2C1FA

The structure of the family 11 xylanase from neocallimastix patriciarum
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
219
structure length
219
Chain Sequence
MKFTVGNGQNQHKGVNDGFSYEIWLDNTGGNGSMTLGSGATFKAEWNAAVNRGNFLARRGLDFGSQKKATDYDYIGLDYAATYKQTASASGNSRLCVYGWFQNRGLNGVPLVEYYIIEDWVDWVPDAQGKMVTIDGAQYKIFQMDHTGPTINGGSETFKQYFSVRQQKRTSGHITVSDHFKEWAKQGWGIGNLYEVALNAEGWQSSGVADVTLLDVYTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Understanding the Structural Basis for Substrate and Inhibitor Recognition in Eukaryotic Gh11 Xylanases.
pubmed doi rcsb
source organism Neocallimastix patriciarum
molecule tags Hydrolase
molecule keywords BIFUNCTIONAL ENDO-1,4-BETA-XYLANASE A
total genus 55
structure length 219
sequence length 219
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2005-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2c1fA00
3AMMA 1HIXA 1QH6A 1AXKA 1C5IA 4XQ4A 2VUJA 2B46X 3MF6A 3VZMA 3LB9A 3WP6A 2B45X 3WX5A 1IGOA 4XQDA 2JICA 3B7MA 1XNDA 1OLRA 1OLQA 4S2FA 2DFBA 5K9YA 2DCKA 2DCJA 1BK1A 4S2HA 1ENXA 2JEMA 5HXVA 1W2UA 3EXUA 3VZOA 1UU4A 1REDA 2QZ3A 2JENA 1H8VA 2BW8A 3VZNA 1H4HA 2QZ2A 1H4GA 2VGDA 3WT3A 3AMQA 1H1AA 1OA2A 2BWAA 3WR0A 1OA3A 3AMHA 1UKRA 3AMPA 1BCXA 4S2DA 3VHOA 3VL8A 3ZSEA 1XYNA 3AKTA 3VHNA 3WY6A 1YNAA 3MFAA 3WQ1A 1F5JA 3VL9A 1BVVA 4HK9A 1T6GC 3VHPA 2NLRA 3O7OA 2Z79A 2D98A 4S2GA 1XYPA 4HKLA 2DCYA 5EJ3A 3WXPA 2DCZA 3WP3A 4XQWA 1XNBA 2BVVA 2F6BA 4HKOA 3VZJA 2NQYA 2VULA 2BWCA 3AKPA 4HK8A 3MFCA 4NPRA 3WP5A 1NLRA 3LGRA 1XXNA 1HV1A 3WQ7A 1UU6A 1M4WA 1KS4A 3AKSA 3MF9A 2VG9A 1QH7A 3AKQA 1TE1B 5K7PA 2B42B 1REFA 3M4FA 1XNCA 4IXLA 3VLBB 2C1FA 3VZKA 3VZLA 1H0BA 1XNKA 3AMNA 3HD8B 1HV0A 1C5HA 3AKRA 2DFCA 1KS5A 1PVXA 3RI8A 3B5LB 4XPVA 3WP4A 1OA4A 2D97A 4H7MA 3VGIA 1XYOA 3RI9A 1UU5A 3WQ0A 1REEA 4HKWA
chains in the Genus database with same CATH superfamily
1HRV3 4BQ5A 1IG3A 5EYYA 2JIGA 5J3UA 1F9KA 3NNLA 4XCAA 2BVBA 1NCQA 3OG2A 1DF0A 4Y22B 3PU3A 1J3PA 1DGRA 1UYXA 4DUVA 1UAIA 5AC93 3WEZA 5DG2A 1VJ2A 3C7HA 1CVNA 3WG1A 3GBGA 5F3GA 2XBO3 2A3YA 2RS13 4S2FA 4YPJA 3UETA 1J84A 1AR61 1W8HA 1JZ4A 2VOKA 3BIWE 1A78A 4HSLA 3NVCA 4KWUA 2WO7A 4EN9B 2Y26A 2ZMNA 4QXKA 4R9CA 2D5FA 3D8CA 3GZEA 1JUHA 2ARCA 2HWB1 2NYYA 2I2SA 2QVSB 1REDA 1TMF1 2QZ3A 2WA4A 1H8VA 2OA2A 3VZNA 1WMDA 1H4GA 5T50A 4N43B 4A4AA 5FPBA 2VO5A 3ZFGA 2RDSA 4LBQB 1AZDA 5G04L 2LUWA 4MXWB 1UKRA 4CPBA 3WF3A 4GWJA 4FOVA 3T2OA 1WBFA 4Q0SA 4E2GA 1FOD3 3IDBB 2WZPP 3ZMNA 4EWDA 5KXCA 1HJFA 1HW5A 5EWSA 3KWVA 3OJBA 3ZO0B 3VD3A 3OPWA 3BU7A 2VZSA 3OBZA 4WM8A 3V0BB 3RDIA 4GMP1 1PGSA 4CP9B 4GIQA 1OXCA 2FHRA 2FMDA 3ENRA 3ZXAC 4RD7A 4DOUA 2WO3A 3A0NA 1ULGA 3ZM8A 1AYM1 1VBC2 4BLJA 3TRSB 3O1PA 1YFWA 2WIIB 2DUQA 3LEGA 4I02A 5FZEA 3AFKA 3TNPB 3OBTA 3VZJA 3TN91 3O1SA 1OI6A 2NQYA 3FHIB 1XJAA 2BWCA 5FYHA 4FPLA 2J7MA 4UFLA 4NJ4A 3LFMA 4RA0A 5L9BA 1OH4A 4JQTA 2ADDA 4LOTA 4U36A 4XFCA 2PA7A 1LKNA 4HG6B 4AAPA 2XWBB 4FPHA 3N7MA 2CTVA 1RUI2 4QX2A 4YM0A 3DUIA 1VR3A 4B7KA 4DUWA 1RUD2 1VBE2 3MF9A 2V4AA 1UOBA 4J1XA 3WNLA 1D4M1 1NZCA 2HWD3 3ACIA 3GHMA 2FCTA 4LBOA 4URTA 3CJIB 1XNCA 2JD4A 3E5UA 2H6BA 3N7LA 3VLBB 5DAQA 4Y1ZA 1BHGA 3I2IA 2JG9C 4XVHA 5BV6A 4RHV3 5L9RA 3V56A 2VZQA 5J96B 3AMNA 3B9IA 2D5HA 3U4XA 2FCVA 4FI9A 1OOPB 4PLMA 3AKRA 3KS7A 3PMEA 5LBEA 2Z69A 2G9GA 1O4TA 1W06A 1OQ1A 2FDGA 2A6WA 2VBDA 1O5LA 5AFBA 2WAOA 5SV5A 3SXWA 5JOXA 4H7MA 2V09A 3LPGA 4XXAA 1UNBA 3RI9A 4AL9A 5JOZA 3OYWB 5DDJ1 1SBFA 4DEVA 1AL0G 3PUAA 4Y20B 1DZRA 1H8TC 1HIXA 1LOFA 1PIV3 1UD1A 2PN5A 2ZA9A 5CVRA 4W8JA 4A3XA 4XJZA 5IHRA 5LRRA 2MPFA 3NKGA 3AB0A 3WNMA 1STMA 5IK8A 1AX0A 5KHJA 5A7WA 1I9RA 3KMHA 4H55A 4JGZA 2IXKA 4QX1A 4Q4V1 3ZFEC 1X8MA 2JICA 1S55A 2R072 1GOHA 5J1XA 2Y64A 1G9CA 2J42A 4ISRA 1XNDA 2Z2SB 5JR2A 3BOPA 3S30A 1OLRA 1YQ8A 2VOXA 4MADA 3WZ1A 1EV13 3IDEA 4PDWC 5CFDB 1LOGA 3K3OA 2RS33 4LXLA 5L73A 2G1MA 2D6LX 4IEVA 4FPGA 2AENA 1RUE3 5HXVA 1XE0A 4ZS2A 3T09A 4YZ1A 5T5JA 2MHFA 4AF9A 3W58A 3VBHC 1X9TA 2XUMA 5FFOC 4K8RB 3NMBA 2WA3A 2R16A 1R1ZA 5FY5A 3NNFA 1ZZCA 3SC7X 2X5IA 4YW1A 3QACA 3I59B 5FZ0A 3J8F2 5FBJA 1GWLA 3J8F3 4MGQA 1HXS2 1D0HA 3WY6A 3RFRA 3VL9A 3W5NA 2MEV3 4AW7A 4K40A 3T2TA 1GNZA 1YWKA 3MV11 3POGA 4YZ3A 2JDNA 2IXJA 2WQ4A 4O9EA 4LQRA 4UW6A 4BU2A 4GB31 5FKBA 4QB6A 2ZEWA 2JX9A 1VRBA 1BJQA 3FLTA 4L99A 4ZS3A 1OLME 1V6KA 4V2WA 1JI6A 2DCYA 5BNQA 1IZ3A 1BEV1 1NZIA 3MBWA 1RUH2 4A41A 1L7QA 2ZGQA 1HRI3 4KQ7A 3AKPA 4HK8A 3TAYA 4ARYA 2VMGA 3LA2A 4Q4W3 4ASMB 4OI2A 2Q1ZB 5IK4A 4B8EA 5A32B 2D3PA 1MEC3 4QWNA 4LBNA 5DAXA 4LBLA 4LLFA 4NPMA 1UOJA 2PAKA 1F4HA 4IDZA 1UZVA 4BMEA 5EV7A 4LBMA 2C6SA 5KXDA 1BEV3 2WQ8A 4J1WA 2ZGPA 3HIFA 5D1IA 1TNRA 5GM0A 5FWJA 1CN1A 1AR83 1WUVA 1XRUA 4P5HA 1H8TB 4BWOA 3T0DA 5FZHA 4MGZE 3F2ZA 3Q9OA 3FE5A 1D4M2 4UF0B 2EXKA 2WBKA 4V1PA 1JYIA 1W2NA 2Q8OA 3VDDB 3KM5A 3TEWA 3I2HA 2W2IA 2DFCA 1K5MB 3DYMA 4TN7A 1SLLA 4Q29A 1VB2A 4W4ZA 3LA7A 2RV9A 4FPEA 4DEQA 5JXHA 4Y1VA 3IWZA 1QQP2 2NPIA 4OQ9A 4XFGA 2R1BA 4M3CE 5JZGA 1ASJ2 1VP6A 2QQJA 2WDBA 3I2FA 4AFCA 1ZBE3 4QPWA 1WCUA 5KWRA 4A42A 2JXAA 1TG7A 1X9PA 1IPSA 1BLZA 1RUD3 1VBE3 4KU7A 2VMDA 4COZA 1QU0A 4CUAA 4RR3C 1VMHA 5EXOA 1BZWA 3N36A 5LWBA 1MZFA 2AYHA 4JC1A 2HEYF 3CJXA 3I7DA 4L0PA 4OHXA 4XUOA 4YGDA 5F1RA 4EN6B 2PFWA 1GR3A 2VVEA 4L2NA 5FTTC 4ZZ8A 2B8MA 4AEDA 3I4IA 3POYA 2BNNA 3OEAA 5KHHA 4OI1A 4AQTA 3ZYFA 4MG2A 2OPWA 1CZVA 1YQ6A 5ABJB 4ZY9A 1AR82 2IXHA 5FP3A 1EPWA 2KR2A 1WLCA 3PL0A 5FMOL 5KC6A 1GWKA 4IV3B 2JEMA 1SLTA 4N43C 2B9VA 3CJIC 3QD6A 5FK8A 2C9KA 1A34A 3NL1A 4A7KA 5IAXA 4K6BA 4GALA 3A21A 1IS3A 3LD8A 2PHXA 5JZGC 2G19A 2VMCA 4EZ4A 3HVDA 4CEYB 5JXIA 1S0CA 4MGKE 1GLHA 3R0RA 2CSGA 3WDXA 4AEKA 1LJ7A 1OF4A 3D3AA 3ES1A 4QHOA 2HEWF 5E1RA 3ZN5A 4AI3A 3HEIA 1C3HA 3O1UA 1YIFA 4QU2A 1IG0A 1UZWA 4EROA 5IFPA 3C2UA 4GB33 5FCCA 2FDHA 4DFSA 1RUC3 1SZBA 2J22A 1GP6A 3WUDA 4HONA 2WKKA 5FZGA 1QJU2 2HKXA 2Y6HA 1QJX2 4HK9A 1KDKA 3KVAA 3RS6A 4AE2A 4CP2A 4JDNA 3O1TA 1FAYA 1W03A 4IV1B 1QEXA 2KD7A 3AZZA 2D6KA 2FDFA 3WDUA 1E5RA 4MV2A 2HWC3 3RZJA 3DV8A 1ZZ6A 2Q8EA 3VKLA 1RIRA 1U5YA 1KD7A 4HOOA 4MXVA 3RZHA 4XFFA 4ZONA 4Z07A 1UF2C 5T5PA 1U5ZA 2O8QA 2XHKA 3GBWA 1AXZA 1JU3A 1LGNA 4HKOA 2GMPA 5FMDA 4WZFA 3ILNA 4XFBA 2TUNA 3WDYA 1KXGA 1RUI1 1RXGA 4XIKA 3UT0A 5FQ0B 2JG8A 1GKBA 4NHLA 4XBLA 2IVJA 5T54A 2Y34A 3X29B 5FAXA 3OUHA 4IE5A 4KH9A 1NXMA 2XDVA 4A44A 2HWE1 3FJSA 3N3HA 4CSWA 4RR3A 4XF9A 1QOSA 2G9FA 1W6NA 1FNYA 1VBD3 1BKZA 2AEYA 4K1YA 4B4QA 1AR81 3ZFFA 4ZZ5A 5DZEA 3GF6A 3H8UA 3THPA 1IKPA 1XPWA 3UGHA 1YFXA 1QH7A 1UPSA 5IVFA 1TE1B 2ZGLA 1GMMA 3GNEA 3E6CC 2VM9A 2JG9B 3JD72 2J1EA 3HBZA 1K5JA 2ZX1A 3O14A 2DBIA 2QQNA 4TWTA 3K46A 1CX1A 3NV2A 1CD3G 4OHZA 4QXCA 1SMVA 2X53S 1YCIA 4KG0A 5LEJA 5HCHA 4Q4W1 2CHHA 1AR73 2R1DA 5CIRA 5LB6A 4FOWA 1KS5A 1DQ2A 3D6EA 4FP2A 3RPQA 4D6QA 5KHIA 3MLKA 1LB2A 3POEA 3SEEA 5FDBA 5IVCA 2BNOA 4XCBA 5FZ4A 1SPPA 4LO8A 2ZHLA 5C3QA 1MS1A 4LIVA 5FZBA 4AVSA 1BYHA 2DU0A 4DINB 1QH6A 1C5IA 4YW5A 4MX3A 3I2KA 4IE4A 4Y5TA 1N3PA 3EYPA 2F4PA 1TMF3 2VNVA 3O0VA 1DGRN 1OF3A 3H1WA 2WLPA 3GZTB 1UYYA 4BCUA 1C8M3 5A3MA 4IETA 2DVFA 4XQDA 2WYFA 4D7YA 3JB4C 1OBNA 3FZ3A 2FDIA 4XF4A 1FX5A 4WVWA 5DZFA 5J48A 5H9QA 3M70A 1O3RA 1ZRIA 2VQUA 2HBTA 4UW4A 5FYUA 5FZ7A 3WG3A 4R9BA 1JTZX 1WD3A 2P5BA 3K4AA 4Q5OA 5KXEA 2EF6A 4LPLA 4LKFA 1JHNA 3NNMA 4XUQA 4Y20A 4YLZA 3O1RA 2CY6A 3FX3A 1ENXA 2QNKA 3I97A 2V4VA 1QGLA 1W2UA 3T4VA 4DXRA 4XW3A 3ACGA 5ACA3 2RM21 4AVBA 5L19A 3K3NA 4OHWA 3T3YA 5LEKA 5DAWA 4DNYA 4ORFA 3TWIA 3VDDA 2ZBJA 1GZCA 1VBD2 2BZDA 1LHVA 4Q27A 2Z5WA 1OA3A 3U37A 3JU9A 2ET1A 1DQ4A 3LKJA 5FUPA 4MO3M 1LU1A 5G05L 1I5ZA 3ZSEA 3VL8A 1APNA 4FT8A 2YXSA 3EO6A 1NY72 2D6MA 5BNNB 3PUHA 2VVFA 1EAH1 1YIPA 2W95A 2FMYA 4LK7A 5T52A 5TSWA 5C3PA 3WQ1A 2JB8A 1WCQA 1AR71 1UOGA 3PU8A 2B4KA 3K77A 4B1LA 4CDQA 4LKEA 2R063 3SMHA 2W46A 3VHPA 1FOD1 1ENSA 3PVOA 4CCJA 4I2OA 2BBVA 1IPKA 3WLUA 1X33A 1QJEA 3FFQA 1GV9A 4BMBA 3OPTA 1FXZA 2ZTNA 1NA1B 4RR3B 4Z82A 4XYXA 2Y6GA 3MHZA 4EN0A 3WW3A 2AZ5A 2RDNA 4XQWA 1BVP1 1V6LA 1NLQA 2A6VA 3U78A 2JE9A 1WCDJ 5A7WB 4AQ6A 5FREA 2E9QA 2VC9A 5IK5A 1HN0A 4XMAA 4EE2A 1VBD1 1NLRA 1US3A 1QXRA 2OPKA 4QQOA 4QX5A 3WHTA 3KGLA 3GBFA 4A7YA 2QBXA 3AZXA 4E4HA 2WFF3 3BI3A 4FPKA 3H7YA 1PNGA 2WT2A 2H0VA 3POSA 2A5ZA 4N7IA 4YVWA 4YM3A 1DFQA 2PHDA 4W6XA 4CDWC 3ACFA 2WNVA 2HWE2 2QKDA 2K46A 2TEPA 2ZOEB 1AUYA 1K3IA 4QQHA 1UIKA 2C1FA 2HWC1 3BOWA 3RZKA 4MHRA 2VQTA 4WV8A 4MH0E 3KV9A 4XAAA 2VZRA 3KCXA 3VZLA 4W6WA 2DCTA 4D6RA 2YBKA 5C4WC 1H0BA 2CU5A 5FLIA 5F3EA 1MVEA 4LR4A 2PLV1 5FY4A 2XJUA 2WNVB 4N53A 1EAH2 3S57A 1D2SA 1RJ7A 3PIGA 1X50A 3VB9A 4QX3A 3LIGA 2XLGA 2XH6A 1FMD2 2KA3A 1DQ5A 3MYXA 3BTYA 3KVBA 1L7RA 5CU1A 3LOBA 2FD8A 3VBOA 3HAGA 5FXXA 3AP4A 5A6ZA 4D3WA 1OT5A 2HWF2 4C1XA 1S2EA 2HWF3 3JB8A 4MZUA 4FAGA 2UYBA 3N9NA 3VBFA 1R1A1 4JGZB 1W6QB 3RMYA 2E7AA 1V00A 1G9FA 4AZZA 5LA1A 1J3QA 2XVGA 1IQAA 4BLIA 1X36A 4NMIA 1DIWA 1ZBE2 2QFEA 4CCLA 4DMIA 4LT5A 3OYWA 4YW6A 1JOJA 4QB1A 4ZXKA 3RWNA 1VBB1 1NYWA 2BBAA 4Y26A 2Y60A 3ZIXA 2SBAA 2WNUB 3O5SA 5HPOA 1AF9A 3O0XA 2LM3A 2J1AA 3OPZA 4GMP0 2X29A 2RG4A 1AR92 2BTVC 5F9TA 2BW8A 4Q4X1 4OUSA 3WCSA 4BB3A 2VQAA 1ZZBA 5FWEA 1AHSA 2XG3A 4I3PA 3H8RA 4O61A 5F6KA 4WBBA 1UY0A 5CADA 4DO0A 1TVGA 1RUG3 1PGL2 1UO9A 2W3JA 5BNOB 5FYZA 3IZOA 2ZHKA 2ZEZA 4WM7C 4C91A 4WVMA 3AK0A 2HWE3 1V9U3 4FAHA 3MIBA 4YVSC 4BK4A 1F5JA 4J6GA 5FLHA 3ZFGC 1H2MA 4BPZA 5DUWA 1J58A 2W1QA 5I0DA 2LW8A 1OFSA 1E5HA 4XACA 4GZ9A 3AZWA 4CXWA 4PBOA 4PQ9A 5A1AA 2ZX2A 3AYEA 2JG8C 1MQTA 4X8PA 2NZ9A 3L9JT 1JYVA 5CG9A 2VTFA 1GOGA 1JYTA 2RE9A 1LCLA 1VAKA 3OGJA 3RWKX 3MIFA 4PDWA 3SQOA 4Q8LA 1HRI2 1UKGA 3AVRA 3HT2A 1XNTA 4AEDB 4FFGA 1PM4A 3U14A 1RUF2 2XJRA 3I3QA 1RUH3 3VBSA 4LEJA 2W94A 4CUCA 1ND2A 5GZDA 1ZZ9A 3RZZA 1CGPA 4K20A 1H2NA 5DQ0A 1E57A 2OS2A 5L7OB 2R7EB 4K8FA 1Y9GA 2WQZC 3LGRA 5CFCC 4BOWA 2GC2A 1DGWX 2E51A 1NOVA 4HL0A 4L92A 5DG1A 3KHCA 1K45A 1VBB2 4SBVA 2BYVE 5IWFA 4YG3A 1WLWA 1LOCA 2A75A 3IPVB 3SH5A 3UESA 4D0QA 5DMYA 1ACCA 5A80A 2PHWA 1CAWB 4ISQA 2Q8CA 4Y4YA 1ND3B 2PMWB 4AVTA 1KITA 5FZ9A 3HOBA 3LWCA 4OVEA 3HMYA 1Y7BA 2JDKA 3VKFC 1JXNA 4LITA 5JOYA 1W2OA 1KJLA 5JSRA 5IATA 1ND3C 3ZYBA 1CAUB 4AFAA 2QQUA 5FO8B 1FPN3 5CYYA 4XDPA 5FMOS 1CR7A 2V73A 5KR7A 5FZLA 4C0HA 5JSPA 4LNVA 2JG9A 1QJX1 2VW1A 4Z92B 3NW4A 4KU8A 4H7LA 4YFWA 5A33A 2WFF2 2WINB 3QCWA 1K42A 5CBLA 1OA4A 2WZR3 1ULFA 3B01A 1RUF3 1T2XA 1YEWA 2PLV3 3ZMOA 4FXGB 3WG2A 2VZUA 2GSYA 3AMMA 2BEOA 1PX3A 5KXBA 5IAVA 4JZRA 2BOIA 3NJZA 3O1OA 2RS52 2VE1A 1ND2B 1MR5A 4BQYA 3POBA 1NE4A 2XVLA 3D5OA 2ZHMA 4N90A 1Y43B 5IJRA 4D94A 1RVF1 5GLZA 4OHVA 4OI4A 3C7FA 4DUXA 1MQTC 2B9UA 1EY2A 4P5YA 3R4SA 3LOIA 3FUQA 1AJKA 2VBBA 2EVXA 2DFBA 4RYDA 4XHXA 1VAMA 2DCKA 3ZYIB 4EJRA 2I45A 2XKPA 3TBDA 3C7EA 4S2HA 3ABZA 4W65A 1R64A 2QQOA 3LSEA 1X8EA 4QHBA 4QB2A 4NOTA 1YJLA 2WSUA 1GQHA 3BU0A 1AL22 1DP0A 2OW4A 2WS93 5GZCA 2GN3A 2VGDA 4TLFA 3P3NA 2ENRA 1VAVA 5JDBA 1PZ7A 2BFUS 1J3RA 2GNMA 4OMDA 1CONA 4XBQA 5H9SA 5IVJA 1Y4WA 4Q4X2 2Z4FA 3I3DA 4RGKA 3ZYJB 3EJKA 3T1MA 1ZREA 2CV6A 5A1LA 2R0FA 2ZJCA 5FMCA 5FZ3A 1BMV2 1V6NA 3S5AA 1GU3A 2VJXA 4YVWB 4N8MA 1JU4A 5I93A 5IT6A 5FO7B 1HB3A 1VBC3 2FQPA 1POV3 4KBZA 4QMAA 3FN9A 5F5IA 5FYMA 1NX9A 4CUGA 4JDOA 5HCBA 3BALA 1NA1C 3OSDA 3AL5A 4IGOA 4NVPA 3BGAA 3PDQA 1LHOA 2UWCA 1MEC2 5FPAA 3AP9A 2CGPA 1V6MA 2AUYA 4AYUA 1JW6A 4IGQA 4P9XA 5E16A 4CDWA 4K1ZA 1QDCA 4COUA 5CG8A 1V70A 4FFFA 4KGGA 4NRQA 5HBAA 3H9AA 2QDNA 1JZ6A 3GJBA 2GH2A 2IC1A 4HZFA 3RYPA 3S0MA 3LEIA 3S7IA 3C7GA 4YM2A 1RUJ2 4JAAA 2RMU3 5JCTA 2XQRA 4UFJA 3FUOA 5FY7A 3H8XA 4OUEA 4FO9A 2JJ6A 4GD4A 2X5IC 1BBT2 3NSTA 2UWBA 5A33B 1LNSA 4DY3A 4HLTA 2VW0A 1IHMA 3WD5A 3UGGA 2PLV2 4FPOB 2GP5A 5DXDA 3JD73 2X5IB 2XGXA 4GMP3 3I59A 5T3NA 3WP5A 1FMD3 2OVUA 4IUGA 1UPIA 2EXHA 4HFSA 2DVBA 2WNVC 5KHKA 1ND3A 2GN7A 2Z42A 5GALA 1Q8QA 3VBUB 5BNPA 3BTXA 1EYBA 1SDDB 1AX2A 4Q4V3 3ZLIA 5LBCA 3NAPC 3T2PA 3WP4A 2WN3A 1QNYA 3ZFEA 3OB8A 2RM22 1QOTA 3ALQA 3HR9A 5HXMA 1GANA 3CDZB 3DPRB 1A8MA 2PHLA 5DUXA 4KWKA 2LROA 3UYJA 2VCMA 5FPZA 1S2BA 1FATA 1PK6B 2VXJA 3MIEA 1OURA 1LAJA 1U12A 4AVVA 2ZMLA 2E53A 2B46X 1HDKA 2C4XA 1NY71 2KM2A 1W8NA 2BJSA 2BNMA 4HSJA 5DDJ3 5EIYB 5L7OA 2CL2A 2ZX3A 2EXJA 4R4ZA 2GMEA 3FBYA 4ZU4A 1YI7A 3VBRC 5CKQA 5A3WA 1UY3A 1LTEA 4Y1YA 5FPXA 2GH8A 5HI0A 2WNEA 1WBLA 3KD4A 3WW1A 5C8CA 3ZR5A 2V5YA 5KHGA 2VTXA 2VXRA 2P1BA 1UWWA 2RR11 1BK1A 3IAQA 5A7QA 3O1MA 5HV0A 3I3BA 3JXSA 4YGCA 1G86A 2A3WA 3NNGA 2VUAA 4CU9A 5JOWA 3RSJA 2VOTA 3VBRB 3ZXJA 5JZGB 2R073 2YPDA 4UT5A 2D6PA 1WKYA 4UWDA 1C8M2 3CZJA 4GAZA 3O12A 2HWD1 1D4M3 3R4UA 1YI9A 4M01A 1HLCA 2VW2A 4IV3C 2IVIB 4YVSA 4KMQA 1ENQA 1W9YA 2OUJA 4FQZA 5CKMA 3JQXA 1W0NA 1XYNA 4DXTA 2ZMKA 1POV1 3AP7A 3NQHA 5BNNC 3ZKYA 2W1UA 4CXXA 3BTZA 3KV5A 2ZXQA 1MS9A 4ASLA 4FTBA 4KG8A 1HB2A 1FPN1 4AGVA 4CU6A 4A6OA 2VOVA 4B7EA 4FQ4A 1XYPA 1QJY1 1T6BX 1H2KA 3WCRA 1AX1A 3PHMA 4PQQA 5CFDA 1WLTA 3ACHA 2YGLA 4KWJA 1X82A 4LULA 4NIAA 2YYOA 2FBEA 2ZGMA 4FXKB 1WW4A 1ULDA 3ATGA 5L9VA 3IDAA 1PO23 2PQQA 2VVDA 2VULA 4Y5SA 3KCCA 1W6QA 4RGAA 5CNAA 4E2SA 1IS4A 1W8TA 2H6CA 4YYOA 2VR4A 1LOBA 2EAAA 1RGSA 2CNAA 3DXUA 4FOQA 4OUMA 1MS8A 4WM8C 2WSVA 2ZPXA 4XDOA 3G7DA 2IXLA 2XQXA 1QY4A 1QJZA 1RHI1 3LZZA 1ULEA 1ULPA 3ZFFC 4RQPA 5IVEA 2Q4SA 3AZVA 3B69A 4Q1RA 1YYNA 1W6PA 1XBFA 4BQ2A 1HKDA 4XHBA 2W5FA 5D21A 2H0BA 3NV4A 2ZKLA 3O0WA 1GZTA 2K2SA 1VLNA 3U07A 2RM23 3HPNA 1LODA 2WWUA 2ZX4A 4Q4V2 5J37A 4HANA 3CLPA 5JXGA 1GOFA 1WA4A 1XNKA 2XXZA 3OGRA 3VD4A 3BCWA 3MI8A 4JV4A 1PGW1 3Q8AA 4MHUA 1CAXB 1ZRRA 1NKGA 2YFUA 3A22A 3ORJA 3VUOA 3U10A 3L2HA 1SLCA 4YVWC 2JDHA 5FKCA 5A3UA 1W3XA 2XR4A 5AC91 1KFUL 3ASIA 1QJX3 1W6OA 3THCA 1MS5A 1FPN2 1DLLA 1W6NB 1FOD2 2E33A 3GXUA 4MYEA 3B9CA 3AXEA 1PGL1 1PO12 2NM1A 4ASKA 4Q4Y2 5FZMA 2ETEA 3VZMA 5CFCA 5T5OA 3POIA 2YMZA 3VBSB 2VZVA 2JG8B 2TNFA 3IIAA 1NCQB 1RUC1 2GNTA 4OMCA 4UFKA 4X6QB 3VBFB 4TYSA 3NJVA 1O3QA 2PYTA 3B7MA 1XOYA 3E1F1 4R52A 1YFYA 1PK6A 2WT0A 3E6DA 2GP3A 5FYTA 4AOCA 4Q2FA 1VRH2 4JDMA 3OD4A 2J1SA 1MVQA 2VU9A 4P14A 4AEDC 1MQTB 3DCQA 1E5IA 4PLNA 1Z7S3 5FUNA 1UU4A 2XOMA 5FUIA 1VB4A 4OYUA 4R9DA 2DV9A 4FCAA 1H4HA 1RUH1 3PJQA 3VBHB 1VBA2 3VD9A 1J83A 2VPVA 5FOBB 1JH5A 4W50A 4ONUA 2F17A 4CA9A 1IS6A 1YJKA 1SLIA 3OGVA 3ZFGB 2XPJA 1GYKA 2W1WA 4A2UA 4L11A 4KWLA 4QX0A 3SITA 1XU1A 3ZSLA 1XQNA 4I0AA 2HWD2 1AYN1 1CPMA 4N43A 2VAUA 3MFAA 4HVRA 4LIUA 5FP9A 1Q43A 4MGYE 3C8XA 3SLIA 1BVVA 2XVKA 4Q0UA 1TEIA 3GCWA 3IPVA 3HNBM 3V65A 3E5XA 3P6BA 3O7OA 4LHNA 1V9U1 5FZKA 5JXJA 1J1LA 1POQA 2W39A 1OQDA 3FHAA 3NO8A 3URFA 1HB1A 4XAEA 1W8FA 3SKVA 3SCFA 2ET7A 1YQ5A 3NKTA 1B35B 4AQSA 4HKLA 4P02B 1GICA 3H1YA 2A7AA 4H14A 5ABJA 1PO11 2WNUC 3RJRA 2JDUA 1XNBA 3NJXA 5I0RA 3CBNA 3LAGA 5BPXA 3A7QA 1I5PA 3OTFA 3U4SA 2Q30A 3JQWA 4GH4C 3RMXA 1PIV2 1UZZA 2Y6FA 3IBMA 1WA6X 3UJOA 1PZ8A 1R1A2 1S0DA 3MFCA 1CZSA 3VD5A 4PJYA 2RS31 2DVGA 4LUKA 1KEXA 1LECA 3PIJA 4RGGA 5DPNA 1JZ5A 1AVBA 4LKDA 3LSDA 4PCRA 2YUEA 2C9AA 2DVDA 3CEWA 4QKBA 3NRUA 1SDWA 1LGBA 2HYKA 3W9AA 1W8UA 1PVC2 2J1UA 5LK7B 4JKMA 4E27A 5C70A 3ETPA 3F95A 3MUY1 3IB3A 4QM9A 3N9QA 4PI0A 4GXLA 4CCOA 3SH3A 4AK3A 2VMHA 1W0PA 4CYDA 2GZWA 5ANQA 4LLOA 2R061 1SFYA 4QKDA 4D7SA 1H9WA 3BPZA 2PTMA 1RXFA 4LA2A 1HV0A 4UFMA 4ZU5A 1ZRDA 5F2WA 3FWEA 4BDVB 2XLAA 2ZGSA 1C4RA 5IVYA 5C4WB 3DEMA 3SCGA 1YQCA 3LPFA 1EAH3 1F31A 3JUUA 2JDZA 4QQ2A 2VNRA 3WG4A 1ZZ8A 1C28A 4QDQA 1OVSA 4QGNA 3PUIA 5C9AB 4AI0A 4COVA 5CZKA 1LHNA 3M7AA 1BQPA 1R082 1ALYA 4ET7A 5B2GB 4RHV1 4M0HA 4AI8A 2ZEXA 5AC92 1C1FA 5EFUA 1GFF2 4D8MA 3LB9A 1SBEA 1UMIA 3CHXA 2BERA 1OH3A 2Y8KA 5CEHA 3MW3A 3LIHA 3RYKA 3AM2A 3BIEA 1D7PM 5F5CA 3RRDA 5JVVA 5L36A 3Q8EA 1WW6A 1SCRA 2W47A 1OPOA 3DPRA 3WVJA 1ZYBA 2ZKNA 5L7OC 1EV12 4HXCA 1PM7A 1RUC2 5K4LA 4CDQB 2ZABA 3QOPA 4QAWA 3VKNA 4CCDA 5F5AA 3VZOA 3T0BA 1JN2P 4JGZC 5I8YA 1BBT1 1HN1A 4QPGB 5FK7A 2UURA 1RUE1 1UZ0A 2NMNA 3FMGA 3TN93 1EP0A 3PLQA 3WT3A 2R041 4QPIC 1H1AA 2JDYA 2HYXA 3WR0A 1CAXA 4G9SB 1R092 5LBBA 2DU1A 4JKLA 4BXSV 2VTXJ 5DUVA 5FY0A 5FZAA 4AVCA 2AR6A 2Y33A 3A0KA 3B02A 3VV1A 1H30A 1VBA1 3CJIA 3VHNA 2WUHA 4DXSA 4C0BA 4CUBA 4B4RA 1SG3A 4YSFA 1A3KA 1FYUA 1GZ9A 2RMU2 1L3JA 2LALA 3ZYGA 1V6JA 3EBRA 4MGTA 4WM7B 2VUDA 3AXDA 3QBQA 4YW3A 4WVZA 1QOOA 4S2GA 4RL7A 3T2QA 2ZGNA 3OEBA 1S0EA 2ILMA 1AR93 2YU1A 3KF5A 2O14A 3JD71 4JCKA 3R6SA 1H6XA 3M3OA 4Q1PA 4XJ9A 4DB5A 5EJ3A 1W90A 3LDKA 4HPKA 1VE0A 4JHTA 4A7ZA 2F6BA 3W21A 5IK7A 1JMUB 1Z0HA 1H2LA 1UCXA 4CDWB 3PTYA 4GA9A 2WO1A 5FYSA 3N4MA 4FSJA 4YW4A 3ZXFA 3HWJA 4YFZA 1JS9A 5JMCA 5A3PA 2DURA 5HV4A 3M3CA 1XXNA 1XSRA 2RDQA 2VMEA 1ZA7A 3ZXLA 5FPUA 2CYFA 1E5SA 3CF6E 4FPFA 3THTA 3POJA 1UX6A 1UY2A 4TSVA 5CAZA 1MZEA 4MSVA 4EN8B 1LOAA 2GDFA 1OD5A 5BUVA 4KNCA 1KGYA 2PQSA 3Q8BA 2EAKA 4EV0A 1JOPA 4JGYC 2CDPA 4TLGA 1WW7A 1COV3 4JHZA 3PVBB 2WYSA 3U11A 4F8AA 3H1MA 1QQP3 5FP4A 1LRHA 4RS5B 3MW2A 2Y0OA 4LA3A 4B4PA 4IEOA 4CDUA 4YWAA 1BEV2 3LDBA 5LRSA 2GC0A 2FZ2A 5B4NA 4EWEA 1DQ1A 2WS92 5GLWA 2D3SA 4LO7A 2BPA2 2O0OA 1Z7S2 4F83A 3ZX7A 4LHLA 2VCCA 1M06G 4BQ4A 2WZEA 3GZUC 4LUMA 4YM1A 1RL3A 1GQPA 5FLJA 5F32A 4XF1A 4AHXA 1JYXA 1F15A 1YQ2A 3MZHA 3A23A 2V72A 3MICA 3GDBA 5JI7A 3ACLA 2GALA 4RFT0 1DLCA 2UY9A 4DS0A 3IIIA 5H9PA 1GWMA 3OY8B 1H6YA 1DG6A 1WGPA 2CAVA 2D7FA 3ETQA 4AFDA 1OMIA 4N9IA 3LCPA 4XF0A 1SQ4A 4YNIA 1AR72 1IGOA 3WX5A 1DZQA 2JDMA 4Y24A 5J36A 5F6LB 2JE8A 3USUA 3WQBA 4FFIA 4LJHA 5LW9A 3TEXA 3P3PA 4CP9A 4Y5Z0 3M1HA 2JIJA 3ZDVA 2DCJA 2PAEA 3SKJE 4PF5A 2QE3A 3R05A 4D7TA 3GZAA 3I3MA 1QQP1 5A3TA 4CCNA 3B00A 1SCSA 1H1MA 1XSQA 4XUTA 2FCUA 2YPJA 2WWJA 3GHNA 4AWDA 2E63A 4OFGA 1WMFA 2JWPA 1U5XA 4QM8A 4YG0A 5FXVA 3TNQA 5GLVA 4COWA 3T08A 5C3SA 3Q8CA 1BCXA 2DUPA 4W6YA 3K4DA 2AACA 1NLSA 1RUE2 1W2AX 2D44A 2R042 2ZS6B 2WRAA 5F3IA 4ZPIA 4QQLA 4AR2A 1YRZA 2IUWA 4Q0QA 3VDCA 1RMU3 5JIUA 1G8WA 3R4DB 1T6GC 2DDUA 4IE6A 4OLLA 4P9LA 4V2VA 1UMHA 1FV3A 4NROA 4CEYC 2NLRA 4QQPA 2DYCA 1YLLA 3RVHA 1N1VA 3P1IA 1HQWA 1LEMA 2VBPA 4GJZA 4AI2A 1XE7A 4OCTA 1HRV1 4UFHA 3AL6A 4FTEA 1D2QA 1W8OA 3GGLA 1GUIA 4Y33A 2ZGOA 5FY9A 2P17A 3WXPA 3I8TA 1UZYA 2IFWA 2PELA 4XBNA 4H3WA 2RS32 4BIFA 3USUB 1UQXA 1JOBA 1W3VA 2EICA 4NHKA 1MZ6A 5LA2A 4NIGA 3LEKA 1I3HA 1CX4A 1W39A 2MNGA 4PT6A 3ZSJA 2DVAA 2LRPA 4I09A 1W05A 4NIHA 4CVUA 5JUVA 2W08A 5J09A 2R30A 2CWMA 3WF0A 4Q26A 1OUSA 1QMJA 1PMHX 3M3QA 3LA3A 1B35A 2EALA 2QQVA 2YC2A 2X09A 3H50A 4GKYA 3ECQA 3KV4A 5FZOA 2GNDA 2VG9A 3SHRA 5FYBA 1UL9A 4JGYB 2VUCA 2JE7A 3MV01 1TME3 4F7ZA 2ES3A 2EXIA 2QQLA 4L9BA 1HRV2 5LY1A 1ZA4A 3TEYA 3POWA 4LE4A 3AVSA 3NAPB 5JI9A 2RVAA 4QKNA 4UBGA 1RB8G 1AR63 1LESA 3KCYA 3NWKA 1W2TA 2P3JA 4FTSA 1RUI3 1CJDA 2ZEYA 4X8NA 1ZBA3 1PVXA 1PNFA 2P3YA 2VH9A 5A3OA 4QD2A 1G9DA 3ROUA 4LORA 4Q0VA 5JPMB 4K7JA 5FYYA 2D93A 1UU5A 2VQ0A 4IEYA 3H8OA 1ZM1A 3J4UH 5I0TA 2CWSA 4XQ4A 1AYM2 1YXWA 2VCAA 4Y1XA 4AG4A 3I2OA 4FPCA 1WMXA 3GCXA 4AXOA 3RQ0A 1XE8A 2ARXA 4E2QA 5CA6A 2K9ZA 4QKFA 2W52A 4CCEA 1BXHA 3PJYA 1GZWB 4QX7A 4BYYA 4E4SA 3TOJA 2IZWA 5GZFA 2ZGTA 1L7LA 4IW3A 4HBNA 1RUOA 1O4ZA 2P3KA 3QH7A 4GH4B 4XOGA 5C9AA 4Q4W2 3UV9A 5K9YA 3V0AB 4META 4PLOA 1GNHA 1R091 2Q1MA 3IKWA 2OQ7A 2C24A 3WNOA 3UJQA 2GNBA 1PVC1 3KT7A 4BQ3A 1HRI1 1R093 4QPGC 3POFA 5FJHA 4I01A 1OA2A 4CCKA 3DF0A 3J9SA 3AYCA 2WAAA 3MW4A 2RS53 1PMIA 3LEMA 3P5BA 1YO8A 3C7OA 3KZ4C 3ZPYA 5FZ8A 5EP9A 3HT1A 4P9YA 2P4EA 2Q5TA 1G7YA 4ZXEA 2MEV2 3T0AA 1QDOA 2XBO2 2BGPA 5FXWA 5D8AB 1K5MC 2L9LA 1DQ6A 1X7NA 1W6PB 2E31A 3OD0A 1O59A 5C8CC 4FPYA 3WHUA 2B7YA 5IUQA 5D2AA 4CTEA 1JUIA 1OQEA 1KQRA 2YDEA 1MACA 5BY5A 1Q8VA 2R062 1DYPA 4M4RA 1I6XA 5JMOA 4AQ2A 5C9AC 4AHZA 1JBCA 3AJZA 2W91A 4JKKA 2NP0A 1W04A 5CFDC 5F39A 3U75A 2P6HA 4GWIA 4R8HA 2P6CA 2R071 5JIAA 2WT1A 5AVAA 5LZ6A 2WO2A 1W9FA 1ST8A 2RDRA 4IE7A 5FYIA 5FJKA 1GP4A 4HMZA 3MDPA 1NCQC 2OZJA 3ZDSA 3RZMA 4TXWA 3B3QE 2XJVA 4MGIE 4E8DA 1JYWA 2FZ1A 2HH9A 1TME1 5BNPC 2P34A 1U5IA 4CP0A 1ND2C 2OT7A 1NCRB 3KT4A 3AP6A 1R083 2WNOA 5ACA2 4ATEA 4PIZA 4Z2WA 3RZGA 1REFA 1BK0A 4NWVA 1URXA 4CCMA 5JSOA 4RS5C 4P9GA 2WJSA 4CDQC 1EUUA 1Z7S1 5LY2A 2BV4A 4FOYA 3T30A 3HN3A 3K4ZA 1MS0A 3VHRA 3RG0A 5F7UA 1JZ3A 1SFNA 1QNWA 2WC2A 3CZUA 4MOAA 3HD8B 2VZOA 2F4LA 5EHDA 5IYYA 3WNXA 1D0GA 2ZGRA 2A3XA 2BGOA 4OZXA 2IXCA 4JTOA 4ZHNA 4OI0A 2Q0AA 1PO21 2YROA 3CKHA 1GP5A 3C3VA 3RJ2X 3APBA 2YGMA 1HB4A 3H42B 3VDDC 1G6NA 4BHPA 4YGBA 1V9U2 3RYRA 5IVVA 3SCHA 1JZ7A 5CB7A 3WDVA 1A6CA 4KGQA 2VZ1A 1WCKA 1B35C 3W59A 5A32A 1QJFA 4NHXA 3MIHA 5ACA1 5LASA 1WZXA 5LCWL 2B45X 4XC9A 4YGEA 3DGTA 5I0UA 1SACA 5A6YA 1SFPA 2ORXA 5FZ6A 2EA7A 2YU2A 3IM0A 2BUKA 2A1XA 4XXPA 5D8AC 2OYZA 1NA1A 4D69A 4INDA 2VOWA 5A3NA 1YHFA 3JZVA 4PDWB 2A6YA 2OIIA 4I30A 3FBMA 4CXYA 1O91A 1O7FA 1LU2A 3EB7A 2XL7A 4JTNA 4P9JA 2PHTA 1DYOA 1NT0A 5F8PA 1P8JA 3KSCA 4CCCA 5JWPA 1Y9QA 3EXUA 4QXBA 3VBFC 5FZDA 1PO22 4YZ5A 5A6QA 2JENA 1N47A 1K5MA 1NQJA 3W5MA 2OX0A 1JODA 1SLBA 5JPNB 4ATFA 1LGCA 4ES9A 1WD4A 3B93A 2ZAAA 4CDUB 3VBOC 1TZOA 1GSLA 2QUOA 2FDJA 1O5UA 2R32A 3AP5A 4ITCA 3B94A 1YFUA 4YVSB 2AEZA 1NG0A 1S0JA 3M2MA 4P9IA 3PURA 2D43A 1IPJA 1W8ZA 1KJRA 3ILFA 1V0AA 4YRDA 3H3UA 1OPMA 4QPGA 3SNMA 1ASJ1 5EZWA 2OQ6A 2Z79A 4PIYA 3ZYHA 5C7GA 2GC1A 2X10A 1S0GA 3JCIA 4RSUA 4CDXB 4JX0A 5LA9A 5K0UC 1W6MB 1NAEA 2B5HA 2VECA 3AFGA 3WP3A 1Q56A 3USSA 3KQ4B 5FPVA 4XFIA 4BK5A 1QJY3 1QJU3 2A73B 2RJKA 2ZZJA 2E6VA 4DRRA 5J98B 4NHMA 5FQ0A 2WS91 4JRAA 4L8QA 4XFAA 2QJVA 3WDWA 2R0HA 3H3ZA 2ARBA 3EQEA 2RS12 3MPPG 1F8VA 4IQPA 3MLLA 2J1RA 5FO9B 1W6MA 3ME2A 3WQ7A 1K12A 1KS4A 3K51A 4A45A 3AKSA 3J7HA 3ZFEB 2RJLA 4WM8B 3V0BA 3VN4A 4N53C 4Z1VA 3KGZA 4NHYA 1UXXX 1XNAA 2A6ZA 4M0NA 3ZYRA 4UAPA 1DCSA 2J1VA 4NAMA 4QU1A 2I74A 4KI5M 4YW7A 4CPBD 1HXS3 1F5FA 1CAVB 1OOPA 4L97A 1OVPA 4N9HA 2R49A 1NE6A 2RR13 2HJIA 4LBKA 2VZ3A 2PAMA 4MXWA 2VNOA 4DPNA 1C5HA 3BYWA 3HNYM 1RUF1 4GWMA 4ARXA 3E5QA 3TYJA 2QQMA 3ZXGA 1VMJA 4E4DX 5C33A 1U0AA 5IVBA 3UNPA 1W99A 2P37A 5EYXA 1AYM3 2VZTA 3E97A 4A6SA 1W9WA 2ZHNA 3WUCA 4K9SA 2VUJA 1JHJA 3MF6A 5EPAA 5LA0A 3VDBA 2BRTA 3AZYA 1PVC3 1VALA 2UWAA 4FPJA 3K48A 1OHFA 1DBNA 2WL1A 3IAPA 4EQVA 1AL23 1RUJ3 1PX4A 4QXHA 1YUDA 5HCAA 2AGSA 2DTWA 2XB6C 4AGGA 1POV0 4J25A 5FY8A 3MEPA 2ARAA 3CQOA 4IESA 4IE0A 2C26A 2XWJB 1ODMA 2EIGA 2OUHA 4QX8A 3L2YA 1N1YA 3WF1A 1ZBA2 4BQ1A 4UW5A 1N3QA 1S1AA 3MGUA 4O65A 4NIIA 2GAUA 3H3LA 4Z2AA 2HWB3 4XILA 2GMMA 3KHBA 5AVPA 4HN0A 5ERLA 4WVMB 5FPLA 3BKZA 2WZ8A 5B4XA 1R081 2BWAA 5FP8A 4AI9A 1Q8PA 4DXZA 3AMHA 2XBO1 1N1TA 2D40A 5GZGA 1CIWA 2A6XA 2YB7A 3T4HB 3FHQA 3BTAA 2O1QA 5C6CA 5FZFA 2DUOA 4FVVA 2V5DA 4E9KA 4XTMA 2WWSA 1JYCA 5E8AA 3VBUC 4NPLA 4R9AA 3ST7A 1AYN3 1NCRA 2QQPA 5JLVA 1B09A 1FT9A 1H9PA 1OC1A 4I0WB 4UOJA 2ORZA 3T1LA 3OBRA 1RUG1 4UI9L 3VBSC 3H0OA 2DBNA 3UK9A 2WZR1 4NN0A 5HCFA 3DPRC 3HNMA 4QDRA 1W28A 2XJPA 2XLFA 3O1VA 5FRAA 4B3NA 4Y4RA 4Y22A 3WW2A 1OKQA 3M8LA 4RFRB 3DKWA 3ELNA 5A7OA 4AVAA 1MEC1 3IDCB 4LKSA 1LOEA 3CO2A 1S0FA 5E6HA 3VKMA 4CDXA 2E26A 1DYKA 3HQRA 3KB5A 4GWNA 3ES4A 4LBQD 3NJYA 1KRIA 2O8OA 3GJAA 4YW2A 5DDJ2 1W6OB 1DHKB 3N9OA 2HWC2 4GULA 4IV1A 5JR7B 1VIWB 4BXFA 3RZLA 4FP3A 2C5DA 3U1XA 2OZ6A 2WFPA 3N35A 4WM7A 1BMV1 2CGOA 4FFHA 4GKXA 2HWF1 2ZX0A 2Y6LA 4Q4Y3 3GM8A 4XEZA 3V0AA 4N53B 3HJRA 3ILRA 1XC6A 4NO4A 5A7SA 4O9GA 4LBQA 2PHUA 3I2DA 3KT1A 5A7NA 1CWPA 2Q1FA 3K75B 5ISLA 5FBZA 5APAA 1RJ8A 1DZTA 1TNFA 1QF3A 2WZR2 4I0BA 3LFIA 2MEV1 3INAA 3UKVA 4G3YC 2W1SA 2QQKA 3QH6A 1G9AA 2DF7A 2Y6JA 3TB0A 3FLPA 4XZUG 4JGYA 5KC5A 3D82A 3ZFFB 2JECA 1PO13 3PNAA 3VGIA 1HX6A 3WQ0A 2GU9A 2HBUA 4RQPB 5C71A 3S5QA 4MGSA 1RUNA 1DGWA 1Y9MA 3CNAA 1JYNA 2PHRA 5A6XA 5FV3A 3LF7A 4QDSA 1RYYA 1XU2A 1ZBE1 2PHFA 1AYN2 1CJPA 2WABA 3N7KA 1MS4A 5I8SA 4LK6A 2WN2A 3N9PA 5CFCB 3DKQA 1OKOA 1O3SA 3AYAA 5LATA 4MUVA 1V6IA 4AI1A 2HLEA 3I49A 1ZRCA 1UMZA 1AJOA 3D0JA 4CU7A 4E8CA 1NQDA 1A8DA 1OLQA 3WV6A 1J1TA 3OCPA 1EPZA 4AEJA 2OXBA 3V64A 1ENRA 2OKXA 3MLJA 2AC1A 2RHPA 3GYDA 4Q4X3 4SLIA 5I0SA 2JDAA 3FLRA 5C4WA 5DUUA 4PIXA 4EN7B 3OOXA 3ZN6B 4H2AA 5CISA 4QPIB 3IMNA 4C1WA 1JZ8A 1PIV1 4C90A 5BNOA 4LOSA 2VCBA 2XKOA 3OUJA 1IQDC 2E32A 3PMSA 4BISA 5LBFA 4CEWB 1W8WA 5AFEA 2LS6A 4MLOA 5BXXA 2EIBA 1KFXL 1MS3A 4O7XA 3WF2A 1YNAA 2YBSA 1I1EA 5BNOC 4HVOA 4QPIA 1TME2 4IGPA 4DIQA 3MO4A 1NXD1 2QQWA 2W9XA 4R4XA 1UY4A 1FMD1 2EIDA 3QLQA 4HETA 3W20A 4AEMA 3DL3A 2IFRA 5K0UB 4LO6B 5FZCA 3VKOA 1AR62 2BU9A 4XJAA 3IT8A 2RR12 1DDLA 4G4FA 4Y3OA 1TMF2 4Y1UA 4JVAA 1UXZA 2HWB2 3AJYA 4QPYA 1CZTA 2DWRA 1KDMA 2ZAHA 1ZZ7A 1PK6C 3ITQA 1UYZA 3EHKA 3OBAA 5H9RA 1RMU1 4BZ4A 2GC3A 4UFIA 5FP7A 2CAUA 4EZHA 1N1SA 1HV1A 1UN1A 2QTWB 3VBOB 4XE9A 1UU6A 1O8SA 5BYNA 3AYDA 5J7MA 5I8TA 3UGFA 4M4PA 1LHWA 3Q8FA 3UL2A 1VMFA 3HBKA 3VD7A 1UOFA 2VNGA 4JRLA 4N7UA 1WCSA 2NMOA 3AKQA 3BODA 1SBDA 3WOGA 5GLUA 3WW4A 2B42B 2XJTA 5EQUA 2B39A 3M4FA 4IEPA 4IXLA 5CKNA 4XUNA 3CU7A 1C57A 5E88A 1CAUA 3VZKA 4RN5A 1IOAA 2Y0IA 2WFF1 4X6RB 1EUTA 1QXJA 1RHI3 1ZX5A 1VBC1 2G9ZA 2ID4A 1LENA 2W92A 1EV11 3TN92 4UW3A 4FBFA 2XONA 2IWGB 5DAPA 2ZGUA 1Q5OA 3BUCA 2JB4A 4BJ0A 1VBA3 3KF3A 1AL21 1HQLA 2VY0A 4IV3A 4IEZA 5C3OA 5A3LA 1RMU2 4UXAA 2J1TA 2D97A 1O6UA 4NE9A 4AAXA 4AFBA 4DY5A 3IN9A 2YY1A 5FXZA 2ATFA 4IEWA 2YG0A 4YZ4A 1AXKA 1C8NA 3OGSA 3PUQA 4HN1A 1VRH3 1GQGA 2D6OX 3THDA 1CIYA 5C8CB 1BBT3 5FR3A 2AREA 3K2OA 4HVQA 4YG6A 5FYCA 3UKTA 1SHWB 1US2A 4CDXC 1JZ2A 4QGMA 2VZPA 1FNZA 2UU8A 1S0BA 1LHUA 4K3UA 2D3RA 2W0XA 2RS11 2RJ2A 5GKAC 1XB9A 2YV8A 3ZXEA 2RMU1 4M3CA 1WWYA 1PGW2 4ZU7A 1F2NA 1W9SA 3NV3A 4WVVA 4Q0PA 4IL7A 1SPPB 4LMFA 1CPNA 1Q3EA 3D4KA 4LHSA 4NRMA 5D8AA 4A3ZA 2JD9A 4Q8KA 5I91A 3J26N 1GNYA 1SEFA 1F4AA 1HJGA 2BP6A 4D6SA 1OFNA 1RC6A 1COV1 2ZZQA 1NCRC 5FY1A 4CDUC 4OHYA 2UYAA 4M3CF 3GALA 4LBJA 2VMIA 3VBUA 3AMQA 3WDTA 5BNPB 1PHMA 3MUZ1 3NAPA 3IMMA 3CL1A 4YARA 3CIHA 3TEZA 3AX4A 4OQ8A 2A71A 1S0IA 1UIJA 2YZ4A 4GJYA 1H8TA 1LOFC 2XHNA 3WNNA 4KBBA 1ZVFA 3JBG2 3OGGA 4DQAA 2HEVF 3VBHA 1C1LA 3EMRA 4BQWA 3MPBA 5FMBA 1D4VB 4CEWC 1CAWA 5A1FA 5C3RA 1Q8SA 3WNKA 3ZXKA 3KLSA 1QIQA 4COYA 4WZCA 3ZKUA 3ZIWA 3ZPOA 1RITA 1WLDA 1H1IA 1VRH1 2QCSB 3BVCA 2D98A 3KQRA 4IEXA 2WNUA 2YC4A 4XTPA 4B1MA 4I3GA 4XUPA 5F3CA 2ERFA 5EJ1B 2WR9A 2RS51 2X8KA 2DCZA 3I2JA 4IERA 1LEDA 1AR91 1Q8OA 4QGLA 2BVVA 4XDQA 4F3JA 5SV8A 1LR5A 4NR1A 1COV2 1GZWA 3BN6A 3MIDA 4DRVA 2EIEA 2JDPA 4HPKB 4BA6A 5GZEA 1MZ5A 5A7PA 2ZGKA 3N7JA 3LE0A 2BQPA 4LHKA 2YC0A 1DGLA 2LTNA 3DXTA 3PTRB 5ANNA 3JBG1 2XL9A 3PVNA 4LO5B 5FZ1A 4YZ2A 2P2KA 4CZSA 3M3EA 3NV1A 1ODNA 3FL7A 1ULCA 4P08A 4NAOA 4PI2A 4C8DA 2R043 4CP1A 1RINA 1RVF3 4LE3A 4PF1A 4XJWA 3AC0A 2N7GA 4CE8A 5DABA 5GJ6A 4BM8A 1FI2A 1ONAA 3PUSA 1OLMA 1CAVA 1RUD1 1VBE1 4XFHA 3OF1A 1NUKA 4UBHA 1ZNPA 2YFZA 4UF0A 1LULA 2KXLA 5DN2A 5FYVA 3A4UA 3I3EA 3DN7A 1FV2A 1F35A 4XETA 4GQ7A 2E7TA 2QDRA 1N3OA 2CDOA 2ZACA 4CU8A 1OOPC 1UY1A 1PMJX 2X05A 4E4ZA 4XJ8A 2Q8DA 1O3TA 3RI8A 3B5LB 1ZRFA 3WF4A 2XJQA 1C8M1 2I07B 1ZBA1 3J7MA 3NNJA 1S2KA 5F5QA 2TBVA 2Y6KA 3SH4A 1GBGA 5FOJB 1O8PA 4GB32 4OULA 1REEA 4HKWA 4M3CB 4XPVA 1OD3A 1YC61 2JKBA 1S4CA 4BE3A 4ES8A 2CGNA 5LK5A 3KV6A 4XABA 3DECA 5M0TA 1V6OA 2Y38A 3MIGA 2QQIA 2YHJA 3WP6A 5F37A 5T5LA 1TQ5A 5IW0A 3OY8A 4NIDA 2R6QA 2E7QA 4HT1T 2XJSA 1VBB3 2YBPA 1Z78A 4XMIA 3ZR6A 4PBPA 2NN8A 1QWRA 3DYPA 2G4IA 4NWWA 4CRQA 4IEQA 1RUJ1 4QT6A 3N9MA 1RUG2 2WLQA 1QJY2 1HQNA 1VPHA 1W9TA 3HQXA 5K0UA 4XZPA 2JKXA 2XMLA 3ZOIA 4EYUA 3UKNA 3H7JA 1PZ9A 5DZGA 4IEUA 2QZ2A 3DYOA 3I54A 5FZIA 3WNPA 4TTGA 1UYPA 4IV1C 4RHV2 5BNNA 2W68A 5KBFA 5DAVA 3AMPA 4RQPC 4S2DA 2VD7A 4JQRA 4UYBA 4XURA 1RHI2 3RNSA 3S7EA 3VHOA 3U0ZA 4AGRA 1RVF2 5C5TA 2VL4A 3ZN6A 3AKTA 5A70A 1MPXA 3WSOA 3S6PA 4P00B 5T55A 3N9LA 4LO4B 2ADEA 5C8WA 5IFTA 1QXPA 4BIOA 4AHYA 2SLIA 3J8F1 3FFZA 3LDRA 2A70A 4K21A 2XUEA 5FZOB 4Z8BA 4URAA 1HXS1 2ZCWA 2BFUL 3WINE 5EJZB 1WW5A 4GH4A 1J59A 3BB6A 2PXJA 3PVEA 5JAXA 4EWAA 2IXIA 4XJUA 1CESA 3CMGA 5ABJC 3HQUA 2BGCA 4BH9A 2BDRA 3BPSA 1IKQA 1AXYA 4NPRA 4OZOA 2P3IA 3JBG3 1SLAA 1Y3TA 4P9WA 4PHZA 3RGBA 4B29A 3J7LA 5K8SA 3ZVXA 3J7NA 1RTVA 4M00A 1CQ9A 3E6BA 1O4YA 4U2AA 1M4WA 5GLTA 3LQCA 1UW8A 4Q4Y1 2D6NA 5C5UA 1DQ0A 5FIXA 1QJU1 4MVTA 1R1A3 3M3IA 3SEPA 5F2SA 2W87A 3ZSMA 5K7PA 2FDKA 1IS5A 4TZDA 1QHDA 1QKQA 2AH2A 4XF3A 1WMEA 4XIOA 4DZGA 1OUXA 1DU3D 1ULOA 3G6JB 3ON7A 3I2GA 2K0GA 1W0OA 3ZXDA 3SISA 1G9BA 4RS5A 4AFMA 4CEWA 1ASJ3 3ZN4A 3D0SA 1OSGA 2UY8A 4NUBA 3ZSKA 4BQXA 4CEYA 2VMFA 4LTAA 4NRPA 3VBRA 1UX7A 3VDAA 2C0ZA 3OUIA 4QHZA 3HN1A 4ZKTB 4AHWA 3ZYPA 4KL1A 1XYOA 3FC0A 2DTYA 2BOJA 5E89A
chains in the Genus database with same CATH topology
1HRV3 5EYYA 5J3UA 1F9KA 2BVBA 1NCQA 1DF0A 4Y22B 1J3PA 1DGRA 1UAIA 5AC93 5DG2A 1VJ2A 1CVNA 3WG1A 3GBGA 2XBO3 2A3YA 2RS13 4S2FA 1AR61 2VOKA 3BIWE 1A78A 4HSLA 3NVCA 4EN9B 2Y26A 2ZMNA 4QXKA 4R9CA 2D5FA 3D8CA 1JUHA 2HWB1 2NYYA 2I2SA 2QVSB 1REDA 1TMF1 2QZ3A 2WA4A 1H8VA 2OA2A 3VZNA 1WMDA 1H4GA 5T50A 4N43B 3ZFGA 4LBQB 1AZDA 2LUWA 4MXWB 1UKRA 4FOVA 1WBFA 4Q0SA 4E2GA 1FOD3 3IDBB 2WZPP 3ZMNA 4EWDA 5KXCA 1HW5A 5EWSA 3OJBA 3ZO0B 3BU7A 4WM8A 3V0BB 3RDIA 4GMP1 1PGSA 4GIQA 2FHRA 2FMDA 3ENRA 3ZXAC 4RD7A 4DOUA 3A0NA 1ULGA 1AYM1 1VBC2 4BLJA 3TRSB 1YFWA 2WIIB 2DUQA 4I02A 3AFKA 3TNPB 3OBTA 3VZJA 3TN91 1OI6A 2NQYA 3FHIB 2BWCA 4FPLA 4RA0A 4U36A 4XFCA 2PA7A 1LKNA 2XWBB 4FPHA 3N7MA 2CTVA 1RUI2 4YM0A 3DUIA 1VR3A 4B7KA 1RUD2 1VBE2 3MF9A 4J1XA 1D4M1 1NZCA 2HWD3 3GHMA 4LBOA 4URTA 3CJIB 1XNCA 2JD4A 3E5UA 2H6BA 3N7LA 3VLBB 4Y1ZA 2JG9C 5BV6A 4RHV3 3V56A 5J96B 3AMNA 3B9IA 2D5HA 3U4XA 1OOPB 4PLMA 3AKRA 3KS7A 3PMEA 2Z69A 2G9GA 1O4TA 1OQ1A 2A6WA 1O5LA 5AFBA 3SXWA 5SV5A 5JOXA 4H7MA 2V09A 4XXAA 3RI9A 5JOZA 3OYWB 5DDJ1 1SBFA 1AL0G 4Y20B 1DZRA 1H8TC 1HIXA 1LOFA 1PIV3 1UD1A 2PN5A 2ZA9A 5CVRA 4A3XA 4XJZA 5LRRA 2MPFA 3NKGA 3AB0A 5IK8A 1AX0A 5KHJA 1I9RA 3KMHA 4H55A 4JGZA 2IXKA 4Q4V1 3ZFEC 1X8MA 2JICA 1S55A 2R072 1G9CA 4ISRA 1XNDA 2Z2SB 3BOPA 3S30A 1OLRA 2VOXA 3WZ1A 1EV13 3IDEA 4PDWC 5CFDB 1LOGA 2RS33 5L73A 2D6LX 4IEVA 4FPGA 2AENA 1RUE3 5HXVA 4YZ1A 5T5JA 2MHFA 4AF9A 3W58A 3VBHC 2XUMA 5FFOC 2WA3A 2R16A 1R1ZA 1ZZCA 2X5IA 4YW1A 3QACA 3I59B 3J8F2 3J8F3 1HXS2 1D0HA 3WY6A 3VL9A 2MEV3 4AW7A 4K40A 3T2TA 1GNZA 1YWKA 4YZ3A 2IXJA 2WQ4A 4O9EA 4UW6A 4GB31 2JX9A 1BJQA 3FLTA 4L99A 1V6KA 2DCYA 5BNQA 1IZ3A 1BEV1 1RUH2 2ZGQA 1HRI3 4KQ7A 3AKPA 4HK8A 3TAYA 2VMGA 3LA2A 4Q4W3 4ASMB 4OI2A 2Q1ZB 5IK4A 4B8EA 5A32B 2D3PA 1MEC3 4LBNA 4LBLA 4LLFA 2PAKA 4BMEA 5EV7A 4LBMA 5KXDA 1BEV3 4J1WA 2ZGPA 3HIFA 5D1IA 1TNRA 5GM0A 1CN1A 1AR83 1WUVA 1XRUA 4P5HA 1H8TB 4BWOA 4MGZE 3Q9OA 3FE5A 1D4M2 2EXKA 4V1PA 1JYIA 2Q8OA 3VDDB 3KM5A 2DFCA 1K5MB 1SLLA 4Q29A 1VB2A 3LA7A 4FPEA 4Y1VA 3IWZA 1QQP2 2NPIA 4XFGA 2R1BA 4M3CE 5JZGA 1ASJ2 1VP6A 4AFCA 1ZBE3 5KWRA 2JXAA 4COZA 1RUD3 1VBE3 4KU7A 1QU0A 4RR3C 5EXOA 1BZWA 3N36A 1MZFA 2AYHA 4JC1A 2HEYF 3CJXA 3I7DA 4OHXA 4YGDA 5F1RA 4EN6B 2PFWA 1GR3A 2VVEA 4L2NA 5FTTC 2B8MA 4AEDA 3I4IA 3POYA 2BNNA 4OI1A 5KHHA 4AQTA 5ABJB 1AR82 2IXHA 5KC6A 1EPWA 1WLCA 5FMOL 4IV3B 2JEMA 1SLTA 4N43C 3CJIC 3QD6A 3NL1A 4A7KA 4K6BA 4GALA 1IS3A 5JZGC 2PHXA 4CEYB 1S0CA 4MGKE 1GLHA 3R0RA 4AEKA 3WDXA 1LJ7A 3ZN5A 3ES1A 5E1RA 2HEWF 4AI3A 1C3HA 1YIFA 4QU2A 4EROA 3C2UA 4GB33 5FCCA 4DFSA 1RUC3 3WUDA 3WHTA 2WKKA 3RS6A 1QJU2 2HKXA 4HK9A 1QJX2 4CP2A 1KDKA 4AE2A 4JDNA 1FAYA 4IV1B 3AZZA 2D6KA 3WDUA 4MV2A 2HWC3 3DV8A 1ZZ6A 3VKLA 1RIRA 1U5YA 1KD7A 4MXVA 4XFFA 4Z07A 1UF2C 5T5PA 1U5ZA 2O8QA 2XHKA 3GBWA 1AXZA 1LGNA 4HKOA 2GMPA 4WZFA 3ILNA 4XFBA 2TUNA 3WDYA 1KXGA 1RUI1 4XIKA 5FQ0B 2JG8A 1GKBA 4NHLA 4XBLA 5T54A 3X29B 5FAXA 4KH9A 1NXMA 2HWE1 3FJSA 3N3HA 4RR3A 4XF9A 1QOSA 1W6NA 1FNYA 1VBD3 1BKZA 2G9FA 4K1YA 4B4QA 1AR81 3ZFFA 5DZEA 3GF6A 3H8UA 3THPA 1IKPA 1YFXA 1QH7A 1UPSA 1TE1B 2ZGLA 3GNEA 3E6CC 2JG9B 3JD72 3HBZA 2ZX1A 3O14A 4TWTA 3NV2A 1CD3G 4OHZA 1SMVA 2X53S 1YCIA 4KG0A 5LEJA 4Q4W1 1AR73 2R1DA 5CIRA 4FOWA 1KS5A 1DQ2A 3D6EA 4FP2A 3RPQA 5KHIA 1LB2A 3MLKA 5FDBA 2BNOA 4LO8A 2ZHLA 1MS1A 4AVSA 1BYHA 2DU0A 4DINB 1QH6A 1C5IA 4YW5A 4MX3A 1N3PA 2F4PA 1TMF3 3O0VA 1DGRN 3H1WA 2WLPA 3GZTB 4BCUA 1C8M3 5A3MA 4IETA 2DVFA 4XQDA 4D7YA 3JB4C 3FZ3A 4XF4A 1FX5A 4WVWA 5DZFA 5J48A 5H9QA 3M70A 1O3RA 4UW4A 3WG3A 4R9BA 1JTZX 1WD3A 5KXEA 2EF6A 4Y20A 1JHNA 4YLZA 2CY6A 3FX3A 1ENXA 2QNKA 1QGLA 1W2UA 4XW3A 5ACA3 2RM21 4AVBA 5L19A 4OHWA 5LEKA 4DNYA 4ORFA 3TWIA 3VDDA 2ZBJA 1GZCA 1VBD2 4Q27A 1LHVA 2Z5WA 1OA3A 3JU9A 2ET1A 1DQ4A 3LKJA 1LU1A 1I5ZA 3ZSEA 3VL8A 1APNA 4FT8A 2YXSA 3EO6A 1NY72 2D6MA 5BNNB 2VVFA 1EAH1 1YIPA 2FMYA 5TSWA 5T52A 3WQ1A 1AR71 4CDQA 4I2OA 2R063 3SMHA 3VHPA 1FOD1 1ENSA 3PVOA 2BBVA 1IPKA 3WLUA 1X33A 3FFQA 1GV9A 4BMBA 1FXZA 2ZTNA 1NA1B 4RR3B 4Z82A 4XYXA 4EN0A 3WW3A 2AZ5A 4XQWA 1BVP1 1V6LA 2A6VA 2JE9A 1WCDJ 4AQ6A 5FREA 2E9QA 5IK5A 4XMAA 1VBD1 1NLRA 2OPKA 1QXRA 4QQOA 4QX5A 3KGLA 3GBFA 4A7YA 3AZXA 2WFF3 4FPKA 3H7YA 1PNGA 2WT2A 2H0VA 3POSA 2A5ZA 4N7IA 4YVWA 4YM3A 1DFQA 2PHDA 4W6XA 4CDWC 2WNVA 2HWE2 2QKDA 2TEPA 2ZOEB 1AUYA 4QQHA 1UIKA 2C1FA 2HWC1 3BOWA 4WV8A 4MH0E 3KCXA 3VZLA 4W6WA 2DCTA 5C4WC 1H0BA 5FLIA 1MVEA 4LR4A 2PLV1 2XJUA 2WNVB 4N53A 1EAH2 1D2SA 1RJ7A 1X50A 2XLGA 2XH6A 1FMD2 2KA3A 1DQ5A 3MYXA 5CU1A 3LOBA 3VBOA 3HAGA 3AP4A 4D3WA 2HWF2 4C1XA 2HWF3 4MZUA 3JB8A 4FAGA 2UYBA 3VBFA 1R1A1 4JGZB 1W6QB 3RMYA 2E7AA 1V00A 1G9FA 1J3QA 2XVGA 1IQAA 4BLIA 1X36A 4LT5A 1DIWA 1ZBE2 2QFEA 4DMIA 3OYWA 1JOJA 4ZXKA 3RWNA 1VBB1 1NYWA 4Y26A 3ZIXA 2SBAA 2WNUB 3O5SA 1AF9A 3O0XA 2LM3A 4GMP0 3OPZA 2X29A 1AR92 2BTVC 5F9TA 2BW8A 4Q4X1 4OUSA 3WCSA 2VQAA 1ZZBA 1AHSA 2XG3A 4I3PA 5F6KA 4WBBA 5CADA 1PGL2 1RUG3 5BNOB 2ZHKA 4WM7C 4C91A 4WVMA 3AK0A 2HWE3 1V9U3 4FAHA 3MIBA 4YVSC 1F5JA 4J6GA 5FLHA 3ZFGC 1H2MA 4BPZA 5DUWA 1J58A 1OFSA 3AZWA 4PBOA 4PQ9A 2ZX2A 3AYEA 2JG8C 1MQTA 4X8PA 2NZ9A 3L9JT 5CG9A 2RE9A 1LCLA 1VAKA 3OGJA 3MIFA 4PDWA 4Q8LA 1HRI2 1UKGA 3HT2A 4AEDB 1RUF2 2XJRA 1RUH3 3VBSA 4LEJA 1ND2A 5GZDA 1ZZ9A 3RZZA 1CGPA 4K20A 1H2NA 1E57A 5L7OB 4K8FA 2WQZC 3LGRA 5CFCC 4BOWA 2GC2A 1DGWX 2E51A 1NOVA 4HL0A 4L92A 5DG1A 1VBB2 4SBVA 2BYVE 4YG3A 1WLWA 1LOCA 2A75A 3IPVB 3SH5A 2PHWA 1CAWB 4ISQA 4Y4YA 1ND3B 4AVTA 1KITA 4OVEA 3LWCA 3HMYA 1Y7BA 3VKFC 1JXNA 5JOYA 1KJLA 5JSRA 1ND3C 1CAUB 4AFAA 5FO8B 1FPN3 5FMOS 1CR7A 2V73A 4C0HA 5JSPA 4LNVA 2JG9A 1QJX1 2VW1A 4Z92B 3NW4A 4KU8A 4H7LA 4YFWA 5A33A 2WFF2 2WINB 3QCWA 5CBLA 1OA4A 2WZR3 1ULFA 3B01A 1RUF3 2PLV3 3ZMOA 4FXGB 3WG2A 2GSYA 3AMMA 2BEOA 5KXBA 3NJZA 2RS52 1ND2B 1MR5A 1NE4A 3D5OA 2XVLA 2ZHMA 4N90A 1Y43B 4D94A 1RVF1 5GLZA 4OHVA 4OI4A 1MQTC 2B9UA 1EY2A 3R4SA 3LOIA 3FUQA 1AJKA 4XHXA 2EVXA 2DFBA 1VAMA 2DCKA 3ZYIB 4EJRA 2I45A 2XKPA 3TBDA 4S2HA 4W65A 3LSEA 4QHBA 1X8EA 4NOTA 1YJLA 2WSUA 1GQHA 1AL22 5GZCA 2OW4A 2WS93 2GN3A 2VGDA 4TLFA 3P3NA 2ENRA 1VAVA 5JDBA 1PZ7A 2BFUS 1J3RA 2GNMA 1CONA 4XBQA 5H9SA 4Q4X2 3ZYJB 3EJKA 3T1MA 1ZREA 2CV6A 2R0FA 2ZJCA 1BMV2 1V6NA 4YVWB 5I93A 5IT6A 5FO7B 1VBC3 2FQPA 4QMAA 1POV3 4JDOA 5HCBA 3BALA 1NA1C 4NVPA 1LHOA 2UWCA 1MEC2 3AP9A 2CGPA 1V6MA 2AUYA 4AYUA 1JW6A 5E16A 4P9XA 4CDWA 4K1ZA 1QDCA 4COUA 1V70A 4KGGA 5HBAA 3H9AA 2QDNA 2GH2A 2IC1A 4HZFA 3RYPA 3S0MA 3S7IA 4YM2A 1RUJ2 4JAAA 2RMU3 5JCTA 3FUOA 4FO9A 2JJ6A 2X5IC 1BBT2 3NSTA 2UWBA 5A33B 4DY3A 4HLTA 2VW0A 1IHMA 3WD5A 2PLV2 4FPOB 5DXDA 3JD73 2X5IB 2XGXA 4GMP3 3I59A 5T3NA 1FMD3 2OVUA 1UPIA 2EXHA 4HFSA 2DVBA 2WNVC 5KHKA 1ND3A 2Z42A 2GN7A 5GALA 1Q8QA 3VBUB 5BNPA 1EYBA 1AX2A 4Q4V3 3NAPC 3WP4A 1QNYA 2RM22 1QOTA 3ALQA 3HR9A 1GANA 3DPRB 1A8MA 2PHLA 5DUXA 4KWKA 5FPZA 1S2BA 1FATA 1PK6B 3MIEA 1U12A 4AVVA 2ZMLA 2E53A 2B46X 1HDKA 2KM2A 1NY71 2BNMA 4HSJA 5DDJ3 5L7OA 2CL2A 2ZX3A 2EXJA 4R4ZA 2GMEA 3FBYA 4ZU4A 1YI7A 3VBRC 1LTEA 4Y1YA 5FPXA 2GH8A 5HI0A 2WNEA 1WBLA 3KD4A 3WW1A 5C8CA 2V5YA 5KHGA 2VXRA 2RR11 1BK1A 4YGCA 1G86A 2A3WA 2VUAA 5JOWA 3RSJA 3VBRB 3ZXJA 5JZGB 2R073 2D6PA 1C8M2 3O12A 2HWD1 1D4M3 3R4UA 1YI9A 4M01A 1HLCA 2VW2A 4IV3C 4YVSA 1ENQA 4FQZA 2OUJA 3JQXA 1XYNA 2ZMKA 1POV1 3AP7A 5BNNC 1MS9A 4ASLA 4FTBA 4KG8A 1FPN1 4AGVA 2VOVA 4B7EA 4FQ4A 1XYPA 1QJY1 1H2KA 3WCRA 1AX1A 3PHMA 5CFDA 1WLTA 2YGLA 4KWJA 1X82A 4LULA 2YYOA 2FBEA 2ZGMA 4FXKB 1WW4A 1ULDA 3ATGA 1PO23 2PQQA 2VVDA 2VULA 5CNAA 3KCCA 1W6QA 4RGAA 4E2SA 1IS4A 2H6CA 4YYOA 4FOQA 1LOBA 2EAAA 1RGSA 2CNAA 4OUMA 4WM8C 4C1WA 1MS8A 3WP5A 2WSVA 2ZPXA 3G7DA 2IXLA 3ZFFC 1QY4A 1QJZA 1RHI1 3LZZA 1ULEA 3ZX7A 4RQPA 2Q4SA 3AZVA 3B69A 4Q1RA 1YYNA 1W6PA 1HKDA 4XHBA 2H0BA 3NV4A 2ZKLA 3O0WA 2K2SA 1VLNA 3U07A 2RM23 1LODA 2ZX4A 4Q4V2 4HANA 3CLPA 1WA4A 1XNKA 3BCWA 3MI8A 4JV4A 1PGW1 1CAXB 1ZRRA 3VUOA 3U10A 3L2HA 1SLCA 4YVWC 5AC91 1KFUL 3ASIA 1QJX3 1W6OA 1MS5A 1FPN2 1DLLA 1W6NB 1FOD2 4MYEA 3B9CA 3AXEA 1PGL1 1PO12 2NM1A 4Q4Y2 2ETEA 3VZMA 5CFCA 5T5OA 2YMZA 3VBSB 2JG8B 2TNFA 3IIAA 1NCQB 1RUC1 2GNTA 4X6QB 3VBFB 4TYSA 1O3QA 2PYTA 3B7MA 4R52A 1YFYA 1PK6A 2WT0A 3E6DA 4Q2FA 1VRH2 4JDMA 3OD4A 1MVQA 2VU9A 4P14A 4AEDC 1MQTB 4PLNA 1Z7S3 1UU4A 1VB4A 4R9DA 2DV9A 4FCAA 1H4HA 1RUH1 3PJQA 3VBHB 1VBA2 2VPVA 5FOBB 1JH5A 4ONUA 1IS6A 1YJKA 1SLIA 3ZFGB 2XPJA 1GYKA 4A2UA 4L11A 4KWLA 3SITA 1XU1A 3ZSLA 1XQNA 4I0AA 2HWD2 1AYN1 1CPMA 4N43A 4Z1VA 3MFAA 4HVRA 1Q43A 4MGYE 3SLIA 1BVVA 2XVKA 4Q0UA 1TEIA 3IPVA 3V65A 3E5XA 4LHNA 3O7OA 1DDLA 1V9U1 1J1LA 2W39A 3URFA 1OQDA 3NO8A 3SCFA 2ET7A 3NKTA 1B35B 4AQSA 4HKLA 1GICA 3H1YA 2A7AA 4H14A 5ABJA 1PO11 2WNUC 3RJRA 1XNBA 5I0RA 3LAGA 5BPXA 3OTFA 2Q30A 3JQWA 4GH4C 3RMXA 1PIV2 1UZZA 3IBMA 3UJOA 1PZ8A 1R1A2 1S0DA 3MFCA 4PJYA 2RS31 2DVGA 4LUKA 1LECA 4RGGA 1AVBA 3LSDA 4PCRA 2YUEA 2C9AA 2DVDA 3CEWA 1SDWA 1LGBA 2HYKA 3W9AA 1PVC2 5LK7B 4E27A 4QM9A 4GXLA 3SH3A 4AK3A 2VMHA 1W0PA 4CYDA 2GZWA 4LLOA 2R061 1SFYA 4D7SA 1H9WA 3BPZA 2PTMA 4LA2A 4ZU5A 1HV0A 1ZRDA 3FWEA 2XLAA 2ZGSA 1C4RA 5C4WB 3SCGA 1EAH3 1F31A 3JUUA 2JDZA 4QQ2A 2VNRA 3WG4A 1ZZ8A 1C28A 4QGNA 5C9AB 4AI0A 4COVA 1LHNA 3M7AA 1BQPA 1R082 1ALYA 5B2GB 4RHV1 4M0HA 4AI8A 5AC92 1C1FA 5EFUA 1GFF2 3LB9A 1SBEA 3MW3A 3RYKA 3AM2A 3RRDA 5JVVA 5L36A 1WW6A 1SCRA 1OPOA 3DPRA 3WVJA 1ZYBA 2ZKNA 5L7OC 1EV12 1PM7A 1RUC2 4CDQB 2ZABA 3QOPA 3VKNA 3VZOA 5I8YA 1JN2P 4JGZC 1BBT1 4QPGB 2UURA 1RUE1 2NMNA 3FMGA 3TN93 1EP0A 3PLQA 3WT3A 2R041 4QPIC 1H1AA 3WR0A 1CAXA 4G9SB 1R092 2DU1A 5DUVA 4AVCA 2AR6A 3B02A 3A0KA 3VV1A 1H30A 1VBA1 3CJIA 3VHNA 4C0BA 4B4RA 4YSFA 1A3KA 1FYUA 1GZ9A 2RMU2 1L3JA 2LALA 3ZYGA 1V6JA 3EBRA 4WM7B 3AXDA 3QBQA 4YW3A 4WVZA 1QOOA 4S2GA 4RL7A 2ZGNA 1S0EA 2ILMA 1AR93 4JCKA 3JD71 3R6SA 3M3OA 4Q1PA 4XJ9A 4DB5A 5EJ3A 4HPKA 4A7ZA 2F6BA 5IK7A 1Z0HA 3N4MA 1H2LA 1UCXA 4CDWB 3PTYA 4GA9A 4FSJA 4YW4A 3ZXFA 3HWJA 4YFZA 5JMCA 2DURA 3M3CA 1XXNA 3ZXLA 2CYFA 3THTA 3CF6E 4FPFA 1UX6A 4TSVA 5CAZA 1MZEA 4MSVA 4EN8B 1LOAA 2GDFA 1OD5A 5BUVA 4KNCA 2EAKA 4EV0A 4JGYC 3U11A 1WW7A 1COV3 3PVBB 4F8AA 3H1MA 1QQP3 1LRHA 4RS5B 3MW2A 2Y0OA 4LA3A 4B4PA 4IEOA 4CDUA 1BEV2 5LRSA 2GC0A 2FZ2A 4EWEA 1DQ1A 2WS92 5GLWA 2D3SA 4LO7A 2BPA2 2O0OA 1Z7S2 4F83A 4LHLA 1M06G 3GZUC 4LUMA 4YM1A 1RL3A 5FLJA 4XF1A 4AHXA 3MZHA 3MICA 5JI7A 3ACLA 2GALA 4RFT0 2UY9A 4DS0A 5H9PA 3OY8B 2CAVA 1DG6A 1WGPA 2D7FA 3ETQA 4AFDA 1OMIA 4N9IA 3LCPA 4XF0A 1SQ4A 4YNIA 1AR72 1IGOA 3WX5A 1DZQA 4Y24A 5J36A 5F6LB 3USUA 3P3PA 4Y5Z0 3M1HA 2DCJA 2PAEA 4PF5A 2QE3A 3R05A 4D7TA 3GZAA 1QQP1 3B00A 1SCSA 1H1MA 2YPJA 3GHNA 4AWDA 2E63A 4OFGA 1WMFA 1U5XA 4QM8A 4YG0A 3TNQA 5GLVA 4COWA 1BCXA 2DUPA 4W6YA 1NLSA 1RUE2 2D44A 2R042 2ZS6B 4QQLA 1YRZA 4Q0QA 1RMU3 5JIUA 1G8WA 3R4DB 1T6GC 4P9LA 4OLLA 1FV3A 4CEYC 2NLRA 4QQPA 2DYCA 1YLLA 1N1VA 1HQWA 1LEMA 4AI2A 1XE7A 1HRV1 4FTEA 1D2QA 2ZGOA 2P17A 3WXPA 3I8TA 1UZYA 2IFWA 2PELA 4XBNA 4H3WA 2RS32 4BIFA 3USUB 4NHKA 1MZ6A 1I3HA 1CX4A 1W39A 2MNGA 3ZSJA 2DVAA 4I09A 2W08A 5J09A 2R30A 2CWMA 4Q26A 1QMJA 3M3QA 3LA3A 1B35A 2EALA 3H50A 4GKYA 3ECQA 2GNDA 2VG9A 3SHRA 1UL9A 4JGYB 2JE7A 1TME3 4F7ZA 2ES3A 2EXIA 4L9BA 1HRV2 1ZA4A 3POWA 4LE4A 3NAPB 5JI9A 1RB8G 4UBGA 1AR63 1LESA 3KCYA 3NWKA 2P3JA 4FTSA 1RUI3 1CJDA 4X8NA 1ZBA3 1PVXA 1PNFA 2VH9A 1G9DA 4QD2A 3ROUA 4Q0VA 5JPMB 4K7JA 2D93A 1UU5A 2VQ0A 4IEYA 1ZM1A 3J4UH 5I0TA 2CWSA 4XQ4A 1AYM2 1YXWA 4Y1XA 4AG4A 4FPCA 4AXOA 3RQ0A 1XE8A 2ARXA 4E2QA 5CA6A 2K9ZA 5J37A 2W52A 1BXHA 3PJYA 1GZWB 4E4SA 4BYYA 3TOJA 2IZWA 5GZFA 2ZGTA 4HBNA 1RUOA 1O4ZA 2P3KA 3QH7A 4GH4B 4XOGA 5C9AA 4Q4W2 3UV9A 5K9YA 3V0AB 4META 4PLOA 1GNHA 1R091 2Q1MA 3IKWA 3UJQA 2GNBA 1PVC1 3KT7A 1HRI1 1R093 4QPGC 4I01A 1OA2A 3DF0A 3J9SA 3AYCA 3MW4A 2RS53 1PMIA 1YO8A 3KZ4C 3ZPYA 3HT1A 4P9YA 2Q5TA 1G7YA 2MEV2 1QDOA 2XBO2 5D8AB 1K5MC 1DQ6A 1X7NA 1W6PB 3OD0A 5C8CC 4FPYA 3WHUA 2B7YA 5IUQA 4CTEA 1JUIA 1OQEA 1KQRA 2YDEA 1MACA 5BY5A 1Q8VA 2R062 1DYPA 1I6XA 4AQ2A 5C9AC 4AHZA 1JBCA 3AJZA 2NP0A 5CFDC 5JIAA 4R8HA 2R071 2WT1A 5AVAA 4HMZA 3MDPA 1NCQC 2OZJA 3ZDSA 3B3QE 2XJVA 4MGIE 2FZ1A 1TME1 5BNPC 2P34A 1U5IA 4CP0A 1ND2C 5ACA2 1NCRB 3KT4A 3AP6A 1R083 4ATEA 4PIZA 4Z2WA 1REFA 4NWVA 1URXA 5JSOA 4RS5C 4P9GA 2WJSA 4CDQC 1Z7S1 4FOYA 1MS0A 3VHRA 3RG0A 1SFNA 1QNWA 2WC2A 3HD8B 3WNXA 1D0GA 2ZGRA 2A3XA 4OZXA 2IXCA 4JTOA 4OI0A 2Q0AA 1PO21 2YROA 3C3VA 3RJ2X 3APBA 2YGMA 3VDDC 1G6NA 4BHPA 4YGBA 1V9U2 3RYRA 3SCHA 5CB7A 3WDVA 1A6CA 4KGQA 1WCKA 1B35C 3W59A 5A32A 3MIHA 5ACA1 2B45X 4YGEA 3DGTA 5I0UA 1SACA 2EA7A 3IM0A 4XXPA 2BUKA 5D8AC 2OYZA 1NA1A 4D69A 4INDA 2VOWA 1YHFA 3JZVA 4PDWB 2A6YA 2OIIA 4I30A 3FBMA 1O91A 1O7FA 1LU2A 2XL7A 4JTNA 4P9JA 2PHTA 5JWPA 3KSCA 1Y9QA 3EXUA 3VBFC 1PO22 4YZ5A 2JENA 1N47A 1K5MA 1NQJA 1SLBA 5JPNB 4ATFA 1LGCA 4ES9A 1WD4A 3B93A 2ZAAA 4CDUB 3VBOC 1GSLA 2QUOA 2R32A 1O5UA 3AP5A 4ITCA 3B94A 1YFUA 4YVSB 1NG0A 1S0JA 3M2MA 4P9IA 2D43A 1IPJA 1KJRA 3ILFA 4YRDA 3H3UA 1OPMA 4QPGA 3SNMA 1ASJ1 5EZWA 2Z79A 4PIYA 2GC1A 1S0GA 3JCIA 4RSUA 4CDXB 5K0UC 1W6MB 2B5HA 2VECA 3AFGA 3WP3A 1Q56A 3USSA 4XFIA 1QJY3 1QJU3