2C1FA

The structure of the family 11 xylanase from neocallimastix patriciarum
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
219
structure length
219
Chain Sequence
MKFTVGNGQNQHKGVNDGFSYEIWLDNTGGNGSMTLGSGATFKAEWNAAVNRGNFLARRGLDFGSQKKATDYDYIGLDYAATYKQTASASGNSRLCVYGWFQNRGLNGVPLVEYYIIEDWVDWVPDAQGKMVTIDGAQYKIFQMDHTGPTINGGSETFKQYFSVRQQKRTSGHITVSDHFKEWAKQGWGIGNLYEVALNAEGWQSSGVADVTLLDVYTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIFUNCTIONAL ENDO-1,4-BETA-XYLANASE A
publication title Understanding the Structural Basis for Substrate and Inhibitor Recognition in Eukaryotic Gh11 Xylanases.
pubmed doi rcsb
source organism Neocallimastix patriciarum
molecule tags Hydrolase
total genus 55
structure length 219
sequence length 219
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2005-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2c1fA00
1C5IA 1H8VA 2B42B 4H7MA 3M4FA 2Z79A 1REEA 4HKOA 1QH6A 2VGDA 1OA3A 3AKQA 3AKRA 5K9YA 3WQ7A 3WQ1A 1ENXA 1TE1B 1UKRA 1BVVA 1REFA 4XQ4A 1HV1A 1H0BA 1HV0A 1BCXA 3WQ0A 3AKSA 1XXNA 2C1FA 4XQDA 2DFBA 1KS5A 2JENA 1H4GA 3B7MA 1XYPA 3VLBB 1AXKA 2DCZA 1C5HA 2BWAA 2VG9A 3WY6A 1XNCA 3AMMA 5K7PA 2D98A 3VZKA 4HK8A 4S2GA 3VL9A 1BK1A 5EJ3A 1H1AA 3VZLA 3MF6A 1T6GC 3MFCA 3VZNA 3EXUA 1M4WA 2JEMA 3LGRA 3WR0A 2VUJA 2DCJA 1HIXA 3MF9A 1REDA 3VHNA 3VL8A 1UU5A 3VZMA 4IXLA 3MFAA 1IGOA 1W2UA 2B45X 1F5JA 1OLQA 2BWCA 3VZOA 4S2HA 2BW8A 3RI8A 1NLRA 2QZ2A 4XQWA 3AMNA 2JICA 3B5LB 4HK9A 1H4HA 1PVXA 3HD8B 3VHOA 3WXPA 2DCKA 4HKLA 3RI9A 3AMHA 1QH7A 2D97A 3VHPA 2DFCA 4NPRA 2DCYA 1OLRA 1OA4A 3LB9A 2VULA 1KS4A 3WT3A 2B46X 3WX5A 3VGIA 1XYOA 1XNBA 4S2FA 3WP5A 3ZSEA 3AMPA 1XNDA 2BVVA 4S2DA 4HKWA 2NLRA 1XNKA 5HXVA 3WP6A 2F6BA 1UU4A 3AMQA 1YNAA 3WP4A 4XPVA 2NQYA 3AKPA 3O7OA 3WP3A 2QZ3A 1OA2A 3AKTA 1UU6A 1XYNA 3VZJA
chains in the Genus database with same CATH superfamily
1US2A 1PM7A 3ASIA 4KU7A 4OUSA 2J7MA 4FFGA 3KGLA 5BNPC 4JDOA 4F83A 3GBFA 5LY1A 2WS93 2I2SA 3VD4A 3VB9A 1EV11 2K46A 4HKOA 1QXJA 3ZFEA 2WA4A 2P34A 4NJ4A 4NHKA 1O5UA 3WQ7A 3B00A 2P2KA 5A1FA 5F2SA 1K12A 2VOTA 4CEYB 1W05A 5DUXA 1AR73 4QDRA 3U78A 4N53C 5CKMA 1UO9A 2YDEA 3I59B 3ZFGA 4UW4A 1E5SA 4AFMA 4JKLA 3HT2A 1OVSA 2TNFA 4YVWA 4WBBA 2FBEA 3NV3A 3RJRA 4M4PA 2Q0AA 4BQ2A 2OZJA 3KV4A 4TYSA 4ZZ5A 2VNRA 4D69A 3N9MA 4AHXA 4CEWC 5LY2A 4LULA 1UD1A 2IXHA 2QCSB 2XJTA 5KWRA 1DQ5A 3VBRC 1JZ8A 4QPGB 4IGQA 4A2UA 4LA2A 1KDMA 1VBC2 1WGPA 2VZUA 4MLOA 1QQP3 4GJYA 4IEVA 3LFMA 1BVP1 1W6PA 2WZR1 1PGL1 1POV1 1H8TA 2W1QA 3WNKA 1PMHX 3N9NA 2Q8OA 4AI8A 5K7PA 2D98A 2J22A 2QUOA 2OYZA 3R6SA 2ZGUA 2J1TA 2Q8CA 3VL9A 1SBFA 3ZIXA 3PIGA 2Y38A 2W92A 2VTFA 4DY3A 1QY4A 1MZ5A 1UY3A 4QX5A 3ZPYA 3LGRA 1VB4A 1DQ6A 3M8LA 2BGCA 3GM8A 3THPA 2WC2A 2JDYA 4LKDA 1RIRA 4LMFA 4FPFA 4XYXA 3CKHA 1IKQA 4Q4V3 1YYNA 3BALA 5GJ6A 3ZFFC 5FDBA 5CFDA 3RZLA 2WFF3 2I74A 2CDOA 5A7NA 3FX3A 3VBFA 1HN0A 1UMHA 1W2TA 3OCPA 4LLOA 3T2OA 1TMF2 2XUMA 3LEKA 3W5NA 4MADA 3NVCA 1S0GA 4Y22A 2AUYA 2EXJA 3AB0A 3Q8EA 1LOBA 4NIDA 4TSVA 4Y4YA 2PHUA 2RM22 3I2KA 4CA9A 2E53A 4RQPC 2RS51 3N36A 1EP0A 4A44A 2HBTA 2H0BA 1S2KA 2QQVA 2RHPA 4KWUA 5A3LA 5JI9A 2WNVC 2Z5WA 4KBZA 1XSRA 1LULA 4KH9A 4EN8B 1TNFA 1NZIA 3LE0A 4Q4Y1 3RMXA 4NPRA 4QQPA 1FT9A 5FP9A 1Y43B 2DCYA 2W1UA 4X8NA 3KM5A 5C9AA 1QJEA 3THTA 3U37A 1M06G 2Y0OA 4PI0A 1H6XA 2DDUA 1WCSA 1ZVFA 3J7MA 1AL0G 1JYVA 3RYRA 3MW4A 4LBOA 1ZZCA 5FZBA 5B4NA 4Z92B 2UURA 3NAPB 3Q8CA 4RA0A 3SLIA 2BVVA 3VBOB 2WWUA 3MPBA 1POV0 1YEWA 4OHZA 3W9AA 4CPBD 4FTEA 3ZR6A 4EWDA 1J1LA 3DPRB 2VUCA 2WNEA 2KXLA 3X29B 4GALA 4R9CA 1PVC2 2XUEA 1K5MC 1POQA 3O7OA 2WAOA 2ZMKA 1C57A 1UU6A 3VN4A 3MV11 4UWDA 2WWJA 2K2SA 5L9VA 4E4HA 4CDXA 2W1WA 5FZMA 4QX8A 2ZX3A 1O4ZA 3E6BA 3M4FA 2WO2A 4N43C 2W52A 2Z79A 4QPIC 1FI2A 5ANNA 5IVBA 4HANA 1NA1A 2KM2A 4MZUA 1NXMA 1ZBE2 2XLFA 1BQPA 1W8UA 2R49A 3T30A 4YSFA 3IWZA 1EAH2 2A7AA 4NRPA 3C2UA 5A7WB 1SCSA 2MEV1 4KI5M 4LNVA 3PVBB 5FREA 3UESA 2B4KA 1TME1 2RR11 4XQDA 2WAAA 4IQPA 3K51A 3E6DA 3RYKA 2BJSA 3P1IA 5CYYA 4IEUA 3ETPA 1W9WA 4LIVA 3NL1A 3ZXJA 4XFBA 2JG9C 4XFIA 4GB32 1RVF1 1E5RA 1ZRRA 2JDPA 5JDBA 3ACLA 2Z69A 3OYWA 3USUB 2VG9A 2FZ1A 2VXJA 3WD5A 4CP9A 4IV1A 2BVBA 4BA6A 4XJWA 3UL2A 2WZ8A 3MLKA 4ORFA 2QVSB 2WSUA 4XEZA 3JQXA 1GP4A 2Y6HA 1W3VA 2HBUA 3C7HA 4R4ZA 4Q29A 1W6QB 1CAVA 1EUUA 1MVQA 1WLDA 1VBD3 1Y4WA 2W39A 3IMMA 4IV3B 3ZX7A 3DUIA 4AW7A 1RUG2 2R1BA 2W2IA 3VBUA 1OD5A 4NVPA 4YM0A 1GZ9A 1O91A 1OPMA 1VBE3 1GUIA 2ZS6B 1RUNA 4MGYE 5DZGA 1ZA7A 5IVYA 2A6WA 3S30A 5DN2A 1IGOA 1YUDA 2IVIB 3WHUA 1PZ7A 5BNQA 5FK8A 3U11A 1KXGA 2VE1A 4S2HA 4XIKA 4YRDA 2IC1A 5A7QA 3ZOIA 1N1YA 2FQPA 2RS13 4LXLA 2W9XA 3EBRA 2JG8B 1VBC1 4FOYA 3B5LB 3JQWA 3VHRA 3R4UA 3ZSKA 5T5JA 1W90A 3POFA 4CCLA 1OF4A 3T2TA 2D3PA 5IVVA 1HXS1 3C8XA 5CFCB 3OUJA 1GWLA 1D2QA 3AMHA 5EQUA 3I8TA 1GQPA 1O8PA 2XXZA 2CWSA 5C4WC 2VH9A 3H42B 2VBDA 1D0HA 1MS5A 1OLRA 1YQ8A 2VZRA 3BYWA 3LB9A 4URTA 5FYSA 3GBWA 4XF0A 5JSRA 2R063 1NLSA 1YI9A 4AYUA 4OHXA 1U0AA 4R9AA 3WX5A 1D4M2 4OI1A 4N90A 3W58A 4F8AA 1S0IA 1AX0A 2W0XA 1OKOA 1XNDA 3T08A 4S2DA 3ZKUA 4AL9A 2GNBA 2Y33A 3GYDA 3M3QA 1TMF1 4WM8A 3GGLA 2XJQA 4IGOA 3TEXA 5KHHA 5FY5A 3ZSJA 3OBRA 1US3A 2XLGA 1JOBA 3WNMA 4Y1ZA 4HBNA 1OFSA 3WP3A 4LTAA 5H9PA 2ERFA 5GZEA 1QHDA 1J3PA 1VBA3 4ASMB 5DG2A 4K9SA 3RSJA 4O7XA 1H8VA 1UZVA 4IEQA 5JXJA 1FNYA 3LFIA 4IEPA 4HETA 1C8M2 1REEA 2Z4FA 2FCVA 1VRH2 2H6BA 3USSA 2ZAHA 3HR9A 2D7FA 1VAKA 1JU4A 5FXXA 3RQ0A 5DDJ2 2J1AA 4DS0A 1S0BA 3NJXA 2WYFA 3PL0A 2ETEA 4LOTA 2VTXJ 5FZ0A 4Y20B 4JKMA 5BNOB 5ANQA 5FPZA 4HG6B 3G6JB 4SLIA 5LASA 4E2QA 3I54A 1KS5A 2ZHNA 4LBQB 4OQ8A 2LROA 4QX0A 4WM7B 3BGAA 1YQCA 3NNMA 1PVC1 4OFGA 3B7MA 4IDZA 2LW8A 4B7EA 3SQOA 5JR7B 2VNOA 1W8TA 4FFHA 4BQ4A 4Z8BA 3T0DA 4FFFA 2EAAA 4EYUA 4LK7A 3QLQA 1W03A 2P6CA 4J1XA 5F7UA 4BJ0A 1FV2A 2VMDA 3ZR5A 2WUHA 3KF5A 4NR1A 2OVUA 4ITCA 1WCDJ 4V2VA 2ZZJA 1DLCA 1GNZA 5E8AA 5JZGB 4CP1A 3IDCB 4COUA 4UFJA 1C1FA 1F5FA 1MACA 1ZBE1 1U5IA 4CDWC 1BLZA 3WW2A 2VMHA 2E7TA 1R1A2 5F2WA 1FV3A 3MPPG 1EAH1 4XHBA 3LIGA 2HEYF 3HNMA 2XQRA 5FZ4A 3VUOA 5L7OC 1SLLA 2VMEA 3B01A 4AAXA 3ZKYA 2W08A 2VC9A 2XR4A 3S5AA 3M1HA 1A6CA 5IWFA 2KA3A 3LEIA 2Q1MA 4RGAA 4XXAA 5F9TA 2OUHA 2B9VA 4HOOA 5H9SA 4XF9A 1X33A 1UXXX 5EJ1B 3PVEA 3SH5A 1X7NA 3WSOA 2R073 4B3NA 2HWB2 4GB31 3SMHA 5L7OA 4BU2A 3JBG3 1X36A 4RR3B 2J1VA 2Z42A 1AXZA 2R7EB 5FPBA 4P9GA 4CDUB 4A6OA 4G4FA 5A7WA 3PUSA 1DFQA 2GSYA 4HFSA 3HNBM 3V64A 3THDA 3VHPA 1F8VA 5C5TA 2ZTNA 2YGLA 5EJZB 5L73A 1WZXA 1NE4A 4QWNA 1RUG1 4Z82A 3N3HA 1V6KA 3NNGA 4YLZA 3TRSB 5DABA 1PK6C 2B46X 5EYXA 4YZ2A 3BUCA 3OF1A 4UFHA 3ILNA 4UOJA 3LD8A 4LUKA 3MW3A 1YQ5A 4ZXKA 3USUA 5K0UB 5A6YA 3VDBA 2ZABA 2NLRA 1QNYA 3NJYA 5GZFA 2XKOA 4HXCA 1CX1A 1PK6A 2PLV2 2VBPA 4XFFA 2JJ6A 2ARAA 1ASJ2 2E7AA 4XURA 1W6QA 4K8RB 1GP5A 2V4AA 5C3OA 4CPBA 4XTPA 1FOD3 5FYTA 2A3YA 2AENA 3C7FA 3U4XA 1JI6A 1YLLA 3F2ZA 3ZSMA 3VZJA 4ES8A 2J1SA 2OT7A 2AR6A 2VUAA 1VAVA 2VL4A 3SKVA 2XJUA 4L8QA 1FNZA 4BH9A 3FFZA 3ES4A 3R4DB 1V6MA 2D3SA 1IS4A 1NCRB 1Y3TA 1RUE1 1KRIA 3Q8AA 1GICA 3IN9A 1D4M1 4IEZA 5FZOB 4YM3A 2JG8A 2BZDA 1BMV2 2JIJA 2VZPA 3MIHA 4BPZA 2BTVC 3A4UA 3ZYRA 1J3QA 4YW6A 4DUXA 2J1UA 2GC3A 1SQ4A 5A3UA 3NQHA 1CN1A 4I30A 5CFCA 4W50A 2CAVA 2YGMA 5LBBA 3CIHA 1GU3A 2GDFA 4BXFA 1BEV2 3C7GA 4FPYA 4M3CB 4JRAA 4Q26A 4GWIA 1H9WA 4LHNA 5LBFA 4GKXA 5I0DA 3POSA 3N7KA 3OPWA 4YVSB 4HSLA 1N1TA 4XJAA 3L2YA 2AREA 2V5YA 2I07B 4P5YA 3WF3A 1C8M1 1I9RA 5GKAC 4D7SA 1VRH1 5DAXA 1BKZA 5LATA 1ND2C 2OXBA 1DZRA 4E4ZA 2OPKA 1W6OB 1HQLA 1QXPA 5DDJ1 3WINE 1V70A 2X53S 4OI0A 1DYPA 2YHJA 3FUOA 3AP7A 3BODA 4CU6A 4ASKA 2B5HA 3O1UA 3GHNA 3CMGA 4GMP3 3UK9A 1YFYA 2B9UA 2R6QA 2W94A 3E97A 4XF1A 2SLIA 2BOIA 3K4DA 5FP3A 4M4RA 3U10A 2QBXA 1GZWB 2EVXA 3S6PA 3FFQA 4G9SB 4D6RA 2RVAA 1MS3A 5AVPA 3Q8BA 4KMQA 4AVVA 1F9KA 3FBMA 4IE6A 1KJRA 2VECA 3H8OA 5EWSA 4Y20A 2XWBB 5BNOA 1MZ6A 1UPIA 3WXPA 1C1LA 1QNWA 5F6LB 1H2NA 2DFCA 2BBVA 4LO6B 4LBQA 3T1MA 1Q8OA 3H0OA 4CU9A 2ZOEB 1R1A1 2K0GA 5T54A 3ZXFA 5E16A 3AVRA 3J26N 5EPAA 2WNUA 2JX9A 3ZSEA 1NG0A 3INAA 4Y3OA 1JYCA 4COYA 5IK4A 5J7MA 1YWKA 4ONUA 3WF1A 1ZZ8A 4HKWA 1MS0A 1QDCA 2VZSA 3MEPA 4FP2A 3ZYIB 1LTEA 5GLUA 1NCQC 3QH6A 1RUJ2 4GD4A 2HWB1 3HQXA 5JZGA 4B1LA 2OPWA 3RZKA 2ARBA 1AYM3 1DGRA 2BNNA 4XILA 3PHMA 1IQDC 2VVFA 2ATFA 3KV9A 2JIGA 5FYYA 4BQXA 2PHTA 1RUF3 1DZQA 4OLLA 2CTVA 4N53B 1AL22 1H1MA 5DUWA 5J37A 4G3YC 2VOVA 3D3AA 2B42B 4FOWA 5DZFA 4EQVA 1NCQA 5IK7A 4CU8A 4J25A 2VU9A 2NYYA 2VZ3A 4XJ8A 4LBNA 4QU2A 1L7LA 1W6PB 3KCXA 2VUDA 3NJVA 4CEWB 4E2SA 1GP6A 1YIPA 1YQ6A 1H8TB 4MVTA 4QT6A 3W21A 3I7DA 4NMIA 1JN2P 3K4ZA 4BE3A 4A4AA 5F37A 3ACHA 2ILMA 1HV1A 5FZEA 2V5DA 3VKFC 4COZA 4RR3A 4ZHNA 1IG0A 5DAVA 1UOJA 3OB8A 2D6LX 1JBCA 4PBOA 4BLIA 5A70A 5JAXA 3JCIA 1N47A 2PLV1 5DG1A 1DQ1A 5GLTA 1ASJ1 2GP3A 3SCHA 1YO8A 1QJU3 5DUVA 4EWAA 3WV6A 4AFDA 4CCJA 2XVKA 3ALQA 3A0KA 1JZ6A 4K40A 2DU1A 2BWAA 1AVBA 1NUKA 3HN1A 2I45A 3CLPA 2YPJA 3K3NA 3ZFFB 2BDRA 4NWVA 4OVEA 4QM8A 3VZKA 5JR2A 4S2GA 3CJIC 5FPXA 2D6KA 1ZM1A 4PT6A 1SZBA 2XBO3 2BFUL 3OD4A 5FBJA 4HVQA 3IDBB 4IE7A 4YFZA 4Q4W3 1PO13 1BMV1 2XL9A 5C9AB 2DCJA 2Y26A 1TQ5A 1ZBA2 3MIDA 3KT7A 2RE9A 3MFAA 5FZLA 4BIOA 3IIIA 5I0SA 1VP6A 2ZGPA 1Q43A 2D6MA 2ZX0A 4Q0QA 1SEFA 5JXGA 4PQ9A 5C3QA 1BEV1 5FTTC 5LBEA 4YG6A 2XPJA 2D40A 2GH8A 4RYDA 3AMNA 4BXSV 5BUVA 1PVXA 1LHVA 1DGRN 2XJPA 1ZNPA 3BU7A 3GF6A 3K75B 4JQTA 2YXSA 5FZOA 4JC1A 3O1TA 3IPVA 4AVSA 3E1F1 4Q4X2 5FBZA 3J4UH 2JDAA 4N7IA 4TXWA 1QIQA 2FDFA 2QJVA 1WLWA 5LEJA 1D7PM 2GU9A 4XFHA 4FPKA 1WW7A 2OZ6A 1ONAA 3DECA 1CIYA 5FZGA 3O0VA 5DPNA 4P5HA 4QD2A 4QPYA 2GC0A 2QDRA 5EP9A 1UPSA 3WP5A 1K5MB 1O8SA 3APBA 2A3XA 1VBB3 1FMD2 1W8HA 2VD7A 1ULOA 2ZXQA 3AVSA 4M01A 1SFNA 2IFRA 1O6UA 4LO4B 4UFLA 2JD4A 1MZFA 4YVSA 5FZ3A 3THCA 4AF9A 1QKQA 2R0HA 3WP6A 4N43B 4AK3A 2Y6KA 5BNNA 1KDKA 1X9PA 1UY2A 2DBIA 2N7GA 4OI2A 2XDVA 4N9IA 3MIFA 1SLBA 2A71A 1SCRA 1W6OA 3O1RA 5LCWL 2BNMA 5CVRA 4DXRA 2D93A 2JKXA 4MOAA 4EN7B 4P9IA 3KCYA 1LESA 4YW3A 3NV4A 3PLQA 2SBAA 4QDQA 4OI4A 3RWNA 4HVRA 1SDWA 2DF7A 3GXUA 1RB8G 2YROA 1IHMA 4ZONA 3OYWB 5K4LA 2PQQA 4NAOA 1I5ZA 4Q0UA 4CP9B 4HSJA 4O65A 5L19A 1JYIA 1W39A 4D7YA 3LAGA 2NP0A 4LHSA 1NLQA 3FBYA 3ZYHA 4E9KA 3BN6A 1GQGA 4Z07A 1CX4A 1V9U2 2JG9B 1NKGA 1REFA 4NRMA 3WF2A 2DVBA 3P6BA 4JZRA 1BCXA 4CVUA 5FJKA 3DXTA 1RUC3 1E57A 2YFZA 4FAGA 2HWE2 4GWMA 3VBUB 5A33B 5A80A 5LK7B 2WDBA 3HMYA 2ZGRA 2RS31 1V6LA 3OBZA 5T55A 1P8JA 1RXFA 4Q8KA 1RUJ1 3PDQA 4E2GA 1LEMA 2IFWA 1GOFA 1OVPA 1LHWA 1A3KA 2W95A 4P9LA 5GZCA 3VLBB 1U5YA 1SLAA 5FYIA 2DCZA 5FZ7A 4D94A 4ET7A 3RZGA 3Q8FA 4XUNA 2ZX4A 1AL21 2ZX2A 5FPVA 4CSWA 3MIEA 4GH4C 5I93A 2GAUA 2VQTA 1DCSA 1Q3EA 3RNSA 2NPIA 1LHNA 1XU2A 1PIV1 1U5XA 5FY8A 4QQ2A 5M0TA 4YFWA 2K9ZA 1RUH2 3MV01 5BNPA 1TG7A 1CZSA 3PJQA 3MFCA 3H9AA 2WZEA 4R4XA 1CPMA 4CCCA 2WINB 2UYBA 3OUHA 1FPN3 5GLWA 4DXZA 3ZLIA 3L9JT 2E32A 1OOPC 3MF9A 1HIXA 2DUPA 1AYN2 1VR3A 1MQTC 2ZPXA 4N53A 1Z7S3 4GIQA 1UW8A 1RGSA 3RDIA 2XKPA 3HAGA 4PDWC 3MLJA 5KXBA 5C4WB 4AE2A 2RG4A 3OPTA 4CU7A 4DEVA 1NLRA 1R093 3WW3A 3D0SA 1OD3A 1Q8PA 1G7YA 1HXS2 4ASLA 4ATEA 4WM8B 4CEWA 3M70A 4HLTA 3K2OA 1UX7A 1ZRDA 3W59A 5LBCA 3SH3A 4Q27A 5AVAA 3VBRA 4AFCA 3KLSA 5KC6A 3TNQA 4KBBA 4QHBA 2QTWB 3VHOA 2WT1A 2RM23 3W20A 2GN7A 3ZN5A 5DUUA 4BMBA 1YC61 2WZPP 4LIUA 3TAYA 3U07A 1HN1A 4XF4A 3JD71 2A6ZA 5C8WA 4IW3A 5AC92 1QU0A 4LO5B 3AP6A 1LEDA 1NYWA 3ZYGA 5I91A 1DF0A 3SEEA 2FDKA 2OUJA 1NQJA 1R082 4S2FA 1AR72 1ZBA1 2XJVA 2ZKNA 4OHVA 3V0BA 3AX4A 1IPKA 1OURA 1DYKA 2P3IA 4IEWA 5CU1A 1IOAA 4MXVA 4NUBA 1PO21 4XTMA 2YC4A 2WNOA 2CWMA 3N9OA 4ZKTB 1DQ0A 3LDKA 2ARXA 3ZFFA 3J7HA 3CBNA 4E8CA 4Y1XA 4LA3A 4FXKB 3LDBA 4XPVA 4A3XA 1LENA 2PELA 2GMPA 3AXDA 2D44A 4FT8A 1KJLA 3AKTA 5J48A 4QX2A 1OQDA 2FD8A 2Q30A 4Q4X1 1LECA 4Y5TA 2BNOA 4CZSA 4ISRA 4RQPA 2RMU3 2DCTA 4D0QA 3KT1A 2V73A 4JGYC 3ACGA 1VAMA 2ZGKA 5CZKA 2WNVA 1GWMA 2LS6A 1QJX2 2X5IC 2E7QA 2GMMA 4MV2A 4AVCA 4OMDA 5LA0A 1FMD1 4ARYA 4KGQA 2ADEA 2CYFA 4JGYA 4AQ6A 1UYYA 2H0VA 5F3IA 1U12A 4I0BA 2HYXA 3OY8A 3WVJA 4JGZC 1WMXA 2X5IA 2WFF2 4Y1VA 1W2OA 1GNYA 4KNCA 5A3TA 2ZGMA 5C8CC 3B9CA 5IT6A 1DIWA 1AXKA 1OKQA 4CDWB 2B8MA 1H9PA 3M3OA 4QQLA 4DUVA 3ECQA 4W8JA 2R043 5FZKA 3P3PA 3PMEA 1K5MA 3AYEA 3ELNA 5F8PA 1W0NA 4BHPA 5L7OB 2XVLA 1XNCA 1SLIA 1GMMA 3MO4A 4UAPA 2LALA 1J58A 4BOWA 3KVAA 3PUQA 3IDEA 4JX0A 1O3SA 4N43A 4QDSA 5ACA3 1L7RA 4QPIA 2VMFA 2B7YA 3EXUA 3DCQA 3LDRA 1V9U1 3KV5A 5FY1A 3FHIB 4I0AA 2PYTA 2HWE1 3FLPA 4I3GA 4RD7A 4IXLA 2PHLA 3J9SA 5F39A 4HT1T 2GC2A 2JE7A 2YPDA 3JB8A 4XUTA 3UV9A 2BWCA 1S0EA 2O1QA 3ZMNA 2EAKA 4WVVA 5IVFA 4PLNA 2VZOA 3TN93 3T09A 1L7QA 1FX5A 4XQWA 4DRVA 5IVCA 3NRUA 1PK6B 4RS5C 4Q0VA 2VVEA 1HRI3 4QXBA 4CCKA 1KD7A 4YW1A 1FYUA 4EN6B 2JG9A 2EXKA 3I97A 5H9QA 5A33A 3ILFA 3FWEA 4H14A 3TEWA 2BBAA 3N7JA 1RUH1 5HCBA 2D5FA 1J59A 1BBT3 1JMUB 3ABZA 1UZYA 4AGVA 3BTAA 2JE8A 3CDZB 2DVDA 5ABJC 1XYOA 4MHUA 2R30A 2NMOA 1AYN1 1W99A 3FJSA 1H2LA 3FHAA 1WA4A 2VZQA 1Y9QA 4UW5A 1X82A 4LO7A 2FZ2A 1F4HA 2VW2A 4PF1A 2F6BA 1O59A 1UU4A 2VXRA 4J1WA 3AMQA 5L9BA 3WDTA 5LRSA 1W28A 1YNAA 4QHZA 5HBAA 3TBDA 1N3PA 3TOJA 2WLPA 2ZCWA 4D6SA 4YPJA 4AEDC 1AHSA 2G4IA 4PLMA 4Q2FA 4DB5A 5FO8B 1RXGA 2BOJA 2ES3A 2CGPA 5GALA 4MX3A 4CEYC 4YW4A 3O0WA 4JTOA 3MYXA 2ZGLA 3A22A 2Y6JA 1RUE2 3K3OA 4NO4A 1BHGA 4LJHA 4BLJA 3M3CA 1LU1A 5AC91 5C33A 2ZGSA 3ZXKA 1HJGA 3HT1A 1MS9A 2QQKA 1UIJA 1S0CA 2VNVA 3CHXA 3D8CA 1OUXA 4FO9A 1VBD2 1LGNA 3OGVA 1VJ2A 4SBVA 5C4WA 5DZEA 1R081 2YYOA 1AR71 4QKDA 3VD3A 4CDQC 1H0BA 1JUIA 1RHI3 2Q8EA 3ZXAC 5FWEA 4XMAA 1VBE2 4OYUA 3WNXA 3FHQA 4IUGA 4AI3A 1V6NA 2OQ6A 4UW3A 2XHKA 4FPGA 1JUHA 1S1AA 1V6OA 4K3UA 5FZ8A 1AR63 4IGPA 3OTFA 4A6SA 2ZEYA 4L0PA 1LAJA 3KWVA 5FZ1A 1GBGA 2RS12 4M0NA 2YMZA 4EWEA 3KT4A 1UZ0A 3IIAA 2IXLA 1IPSA 3VV1A 3GJAA 1XC6A 3PU8A 1NQDA 3OBTA 2CV6A 3RRDA 4QX3A 3WY6A 2XB6C 1HRV3 5JXHA 3VDDC 5LA2A 1DBNA 4P9WA 4A7ZA 3S0MA 3WDVA 2QQLA 1OLME 3E5QA 3W5MA 1BK1A 1VE0A 1QJX1 1SFYA 1C3HA 3VZLA 5FWJA 2GH2A 2QQUA 3LQCA 2QKDA 2R062 2C26A 1XE0A 2ZHMA 1UMIA 3VDDA 5JI7A 3T1LA 1ALYA 3SCFA 5IHRA 2ZA9A 1OUSA 4XHXA 3VL8A 2YUEA 5JLVA 3UJOA 1PMIA 2BV4A 4Q4V1 1SG3A 4RL7A 3U75A 4B8EA 4UT5A 1G9DA 2V4VA 2WNUB 4ZU7A 2WFF1 4GWNA 2ZACA 1YFWA 3MHZA 1AR93 2EXIA 5IVEA 1BJQA 5FAXA 1UZWA 5HI0A 2R1DA 4QKBA 3KF3A 4E4DX 2X05A 3RI8A 3D6EA 2QZ2A 3AZZA 3S5QA 4CP0A 2Y0IA 1UIKA 3IKWA 4E4SA 2E31A 2E33A 3UT0A 5FXVA 2HWC3 2RV9A 3N7LA 4QB6A 1VRBA 3MDPA 5FYBA 4FPLA 1VBA2 1LGBA 2AEZA 3J8F3 5DAPA 3NAPC 2D97A 3WW1A 3VDAA 1SLCA 2PN5A 4DRRA 1I3HA 3KS7A 5FJHA 5GLVA 3VBOC 5F1RA 3MIGA 1UNBA 4H3WA 3AJZA 4OUEA 1NCQB 4NHXA 4FPEA 3AYDA 2FMDA 3D82A 4IE5A 4CDWA 2QQPA 1WMEA 2BU9A 2PFWA 2WABA 2E26A 1O7FA 1PZ8A 4K21A 1CZVA 4XC9A 1Q56A 4I2OA 2R0FA 4AAPA 5KXDA 1AZDA 3WNLA 1TVGA 3I3DA 2Q8DA 1QMJA 5KHKA 1I1EA 1WCKA 5FY0A 5B2GB 2YC2A 1AR83 2WJSA 1JZ3A 4W6XA 4AR2A 3IAPA 2IXCA 5KHIA 3OGSA 3OJBA 4NHLA 4XACA 4X8PA 5A3WA 3AYCA 1NX9A 1GNHA 2RDSA 4C0BA 2R32A 4M3CF 3KB5A 2YBSA 1CGPA 3ZDVA 3PTYA 1OHFA 4BWOA 5FCCA 2HEVF 3WLUA 2QDNA 4B1MA 1S2EA 1PX4A 2VGDA 4UW6A 4M00A 2PA7A 2ZHKA 1MEC3 3WQ1A 1BYHA 2OA2A 2GP5A 2ZZQA 4XJ9A 2WQ4A 1B09A 3AP9A 2HJIA 4DXSA 3KQ4B 5LA1A 1UKRA 3A23A 1WWYA 2C0ZA 3ZMOA 1LOAA 2JDUA 3ZSLA 2PHXA 3NJZA 5G04L 4WZFA 3HBKA 4CXYA 5I8TA 1QEXA 4FPOB 4RHV3 3FLRA 5FMOL 4BK4A 2C5DA 1A34A 4LT5A 3CJIB 1YXWA 2A73B 1WBFA 4IV3C 2KR2A 3LZZA 2W3JA 1UF2C 5FIXA 2XQXA 5A3MA 1H30A 3S7EA 1CJPA 1E5HA 5FZDA 1RUD2 3RGBA 4C1XA 1RMU3 2VQAA 4ZS3A 5GM0A 5JVVA 3RFRA 4AEKA 1HX6A 2ORZA 3H50A 4LHLA 3BOWA 4QQOA 1W9SA 4HN1A 3IPVB 2ZEXA 4LBLA 4HMZA 1VBD1 2QQOA 2WO3A 3VZNA 3J7NA 5EXOA 3B02A 4K20A 3WG3A 4C8DA 2TEPA 5FLJA 3B93A 1FXZA 2VUJA 1VBE1 1VPHA 3DGTA 4XDOA 3ZXGA 5KXCA 1XJAA 3E6CC 1W2NA 2HWF3 2MPFA 1F4AA 1F5JA 1TNRA 4CCDA 3ZDSA 3SEPA 3WEZA 3DL3A 1W6NB 1RL3A 2RS11 1ZA4A 1SACA 3EYPA 4NIAA 2ZBJA 3NO8A 4BK5A 4XUPA 5IFPA 5F5CA 4YG3A 3U1XA 3UGGA 5BNNB 4HK9A 1H4HA 4WVZA 1DGLA 1JOPA 1HDKA 4LITA 2WT2A 3H1YA 3O0XA 1RITA 1UYXA 4PF5A 4AHZA 4OQ9A 3LA3A 3O12A 3CQOA 4NROA 4IESA 4BYYA 2F17A 4D8MA 4CCMA 1UCXA 3N9PA 3GNEA 3VBHC 2PHWA 4FQZA 2R061 3AC0A 2BPA2 3JU9A 1HB4A 1ND2A 2GZWA 1PZ9A 3T2QA 1MS1A 4Z1VA 5EYYA 1XNAA 4NN0A 4CCNA 1ENRA 1IS5A 3KD4A 4P9XA 5A3OA 5C70A 3WW4A 5FUNA 1VALA 2UY8A 4NRQA 2CL2A 1COV3 5EV7A 4PIZA 5HXVA 4YGDA 1AJOA 1X9TA 1RUOA 3WP4A 2AEYA 3NKGA 4R9DA 1OC1A 2JDKA 4NPMA 3FN9A 1MS4A 2C9AA 1RUJ3 2VQ0A 2Y60A 2ZKLA 1F15A 1VBA1 3EHKA 4YGBA 1X8MA 3Q9OA 4XFGA 4B4PA 4C1WA 3E5UA 5FZFA 4B7KA 1UYPA 2DWRA 4NAMA 1H2MA 1EV13 1ULEA 2RDQA 5JIUA 3AKQA 1CAXB 4P00B 2Q5TA 4B4RA 5J09A 4FXGB 5K9YA 3WNPA 3SC7X 2C6SA 4WM7C 4AQ2A 4A7KA 3V0AB 4FTSA 1TE1B 4W65A 3BI3A 4XQ4A 2W1SA 5BNPB 3WDYA 1OQEA 2RS32 2WN3A 4BDVB 2PTMA 2QNKA 3AFKA 1GLHA 4GH4B 2BRTA 3KHBA 4META 5FMBA 1H1IA 2JENA 1IQAA 5FQ0B 1N1VA 5D8AC 5CNAA 2WWSA 4YWAA 1LOGA 5ERLA 1LOEA 1ULPA 2FDJA 1OF3A 2A3WA 1QOSA 4EE2A 1VMFA 1HB1A 1K5JA 4XIOA 4JDNA 1PIV2 3RMYA 1OOPB 3ZN6B 5JOWA 3OPZA 5J36A 5D8AA 5T5LA 2WZR3 5CKQA 1ND3C 1POV3 1XQNA 5BYNA 3VBSC 3AMMA 5B4XA 4JV4A 3NNFA 2VZ1A 3VBRB 2B39A 5FRAA 4TLGA 4PDWB 1T6GC 2EA7A 2PAKA 3MLLA 1CWPA 5FXZA 3LCPA 5J3UA 5FPAA 2D5HA 3BTYA 5KC5A 1LCLA 3I3MA 3SCGA 5I0RA 4YM2A 2UYAA 1CONA 1JZ7A 4QX7A 5A32A 1REDA 2JE9A 4BQYA 2GC1A 1STMA 3D0JA 5LRRA 1TZOA 4MXWA 5L9RA 3CJXA 2ZJCA 4XFAA 1QXRA 2HEWF 4KU8A 4LPLA 4JHTA 1GOHA 2VOKA 1SBDA 3V0BB 3LPFA 3MGUA 2XJSA 4GWJA 4K8FA 2VY0A 2A70A 1QOOA 2WLQA 4GA9A 3JBG1 3NV2A 1AYM2 1ULDA 3PU3A 2A75A 3BTZA 4CCEA 1HQNA 2RS53 4KG0A 3ZN4A 1W9FA 1RUD1 2QQWA 3JD72 4PIXA 5FYMA 3ME2A 4OHWA 3RI9A 1W8ZA 4LHKA 3POEA 5KR7A 4Q4Y3 2ZAAA 4GQ7A 4Q4X3 5D21A 2MHFA 3CEWA 3KMHA 5K0UC 3FE5A 4QQHA 1OA4A 3JXSA 2UU8A 4XOGA 3RWKX 4RQPB 1UQXA 1GOGA 2EIEA 1JHJA 1KGYA 3CJIA 2OKXA 1C28A 2HKXA 1ODNA 2WNVB 5JMCA 3ZIWA 5DAQA 1PO22 1J84A 2O0OA 1J1TA 1J83A 1GYKA 3KSCA 3BOPA 4CTEA 5KHJA 5J98B 5FUPA 4DMIA 3HJRA 3FLTA 4QB2A 3WUCA 4AFBA 4L99A 4K1YA 2ET7A 4MUVA 4O61A 4YARA 4JGYB 1YIFA 2J1EA 3OOXA 3OY8B 1QJU2 1W6MB 2OW4A 4EN0A 2E9QA 5BPXA 2X5IB 4EZHA 2ZEZA 1OA2A 2HYKA 3I2GA 3OGJA 2WQ8A 4L97A 5E1RA 3RS6A 4YW5A 2J42A 1W8WA 2FHRA 4IETA 5A6QA 4ISQA 3UJQA 4I09A 4QM9A 3UKNA 1OLMA 3RZZA 1LHOA 1JZ4A 2ZGOA 3HIFA 4XUQA 4XW3A 3OGGA 4YW7A 2VCMA 3MUY1 3PVOA 4FBFA 3RZJA 1ODMA 1LOFC 1W6NA 2XBO2 1HKDA 5C8CB 3JZVA 5C3SA 4Y5Z0 1XSQA 4Q4W2 1ZRFA 3MZHA 5ISLA 1PGW1 2MEV3 2WKKA 5F6KA 3SHRA 4KG8A 4L9BA 1VB2A 1TME3 2RR13 3AKSA 4QPIB 5A1AA 4D7TA 2RDRA 3VD5A 2JB8A 4MG2A 2GNDA 2HWE3 4DZGA 4BISA 4AVBA 2XHNA 1T6BX 2BFUS 2GNTA 3H7JA 1GKBA 1UXZA 1QF3A 5FYUA 1RVF3 5IK8A 1NOVA 4QPWA 4BMEA 1G8WA 3ACFA 1SFPA 1MZEA 2VCAA 4HZFA 4AVTA 5C3PA 1NAEA 2A1XA 4P9JA 2CDPA 4LBJA 1FAYA 4HK8A 1IS3A 3QH7A 1RUI2 2UY9A 4HPKA 1JYXA 1X50A 1C4RA 2DU0A 2LM3A 2QQIA 5HCFA 3IDAA 4EV0A 3ZM8A 1LODA 3MICA 5IJRA 4AZZA 1SPPA 2HWD2 5H9RA 3N4MA 4XFCA 3WG4A 4MYEA 4FSJA 2X09A 1DGWA 4GMP1 4RS5B 1LGCA 3A21A 4FAHA 1YFUA 1UU5A 1S0FA 1VBB2 3DYPA 4QGLA 4QGMA 1W2UA 4H7LA 3KZ4C 2VW0A 4LK6A 4WV8A 4YNIA 1OMIA 1N3OA 3I2DA 5FZCA 4BQWA 2A6YA 3EJKA 3PUIA 4JKKA 1H2KA 4A7YA 4OMCA 3RYPA 3LSDA 3R05A 1CAXA 1VBC3 1XNTA 1WW6A 1N1SA 2H6CA 2KD7A 2JDZA 2WYSA 1PMJX 1XU1A 5F3GA 4YW2A 3GZEA 5ABJB 5JOXA 4BB3A 3V0AA 1LKNA 3ZYJB 1HXS3 3ZFEC 2AH2A 2VMGA 3M2MA 3J7LA 1WA6X 2VZVA 1IZ3A 1O3QA 1RJ7A 4GH4A 1JZ2A 3GCXA 5FZHA 1WW4A 1U5ZA 2V72A 2VR4A 4XAEA 5FLHA 1QOTA 2BEOA 5FQ0A 3OD0A 3ZFGC 1QJY2 1I5PA 1LU2A 4AGGA 3CZUA 4LLFA 4YVWC 2TUNA 4AEDB 4LUMA 5AC93 5FOJB 3VKNA 3CL1A 2DBNA 1Y9GA 1XE7A 5HV4A 3L2HA 3WCRA 1RUC2 1R083 2R16A 1OOPA 4XJZA 3ZN6A 3LEMA 3BU0A 2WO1A 3DV8A 1TMF3 1MQTA 5I0UA 1NZCA 3ST7A 4BQ5A 2CU5A 4Y5SA 4CXWA 2YU2A 4PDWA 1AYM1 5FP4A 5CISA 2DVGA 2WR9A 4FOVA 4AWDA 3O1PA 2VOWA 2XGXA 4OULA 1OXCA 1RUF1 5FYVA 3O1SA 5GZGA 3O14A 1H8TC 3QD6A 4GMP0 3JUUA 1EUTA 2WS92 4GAZA 4CDQB 3RZHA 2Q1FA 1JOJA 1OQ1A 3K4AA 5C5UA 2YB7A 4DY5A 5HXMA 4URAA 2GALA 3DYMA 3R0RA 1Q8VA 1ZREA 5IVJA 1CAWB 4EN9B 1HLCA 5SV8A 4LE4A 3TNPB 1YFXA 3BIWE 4BM8A 3NW4A 4MGSA 4YZ4A 3HQRA 4W6WA 5T5OA 3AZWA 1C8NA 4TWTA 5IATA 1DQ4A 1KFUL 1FPN2 1QJX3 2MNGA 5CFDC 4LBKA 1ULFA 1WLTA 1AUYA 1AXYA 1ENSA 5FOBB 3VBFC 3POIA 4C91A 1OPOA 4RFT0 3VDDB 3WZ1A 4CXXA 1Z7S2 1GQHA 5EZWA 5A6ZA 1JYWA 2IWGB 3HEIA 1WMFA 4IL7A 1QJU1 1PVC3 2ZMNA 4XDQA 1QQP2 1UWWA 2EIBA 4Y24A 5E6HA 4ZZ8A 3AP4A 1R092 4CRQA 1KQRA 1JYTA 2DTYA 2IZWA 1QDOA 4BQ3A 3T2PA 1EYBA 4L11A 5HCAA 1LOCA 3BKZA 5JPMB 1WD3A 3HOBA 2OIIA 3T4HB 2AZ5A 5D1IA 3FL7A 3WNNA 1DG6A 5FUIA 2O14A 2WL1A 3O1VA 3PVNA 5C9AC 2FCTA 4JTNA 1HJFA 1E5IA 4P08A 5EJ3A 3RVHA 2XBO1 1ZBE3 4DNYA 2VNGA 4K1ZA 3ZXLA 2ZGNA 4YM1A 2WN2A 2QQJA 3BCWA 4M0HA 4Q4W1 1EAH3 1PO11 4Q4V2 4AI2A 1W6MA 1A8DA 5CA6A 1CPNA 4QB1A 4EROA 4KL1A 2BGOA 4P14A 3OBAA 4AI9A 3T3YA 1R1ZA 4KWJA 2F4LA 4O9GA 3WHTA 3DKWA 2PAMA 1CAUA 5BY5A 3AXEA 3GALA 3DYOA 4XXPA 1OLQA 2PQSA 1IKPA 4BQ1A 2XJRA 2WA3A 4O9EA 1K45A 2WO7A 4JGZA 2BW8A 4MGIE 3IM0A 2PHRA 4I0WB 5KBFA 5KXEA 1DLLA 4GB33 4R9BA 5JUVA 1LB2A 4RFRB 4CDXC 5J96B 5C8CA 1WMDA 2CGNA 2G19A 1RTVA 2ZHLA 3POBA 1JH5A 1HQWA 4Y4RA 1OI6A 3WUDA 3ZYBA 5F3CA 2W5FA 5FO7B 1NA1C 4XF3A 1QH7A 2RMU2 4C90A 1PM4A 4FFIA 4AI1A 1RUI1 1JU3A 5C7GA 1PX3A 3CF6E 1UYZA 2Q4SA 3G7DA 3WG2A 1G9FA 1DYOA 1RUG3 5LA9A 4A42A 4CP2A 1IPJA 5CIRA 3ATGA 4FPJA 2HWD1 3VGIA 2JDMA 2JB4A 5FPLA 1ZYBA 1VBB1 2L9LA 1BXHA 2O8QA 5HCHA 5EFUA 2P3JA 2VOXA 4AOCA 4ES9A 4V2WA 5F5AA 3OGRA 3QACA 1WKYA 3NNLA 4A45A 1XB9A 5SV5A 3WQBA 3PJYA 4AQSA 2FMYA 5A7OA 2Y6GA 4ZS2A 5T52A 3T0BA 3VKMA 4IV1C 4OUMA 5A7PA 1UY4A 3UNPA 1YCIA 2D43A 5IUQA 1XYNA 3NMBA 4IEYA 1Q8QA 1RC6A 5LWBA 2R042 1L3JA 4RS5A 1B35C 1DP0A 4IE0A 2XL7A 1CD3G 1UKGA 5FMDA 4Z2AA 2XWJB 3S57A 1WW5A 1EPWA 4UF0B 4UBHA 3VBUC 1OA3A 3S7IA 2UWCA 1RUE3 4XETA 1QJY1 3GDBA 5ACA2 1D4M3 4MGQA 2P3KA 2JDNA 1B35A 5FK7A 4Q5OA 1BVVA 3RJ2X 1HV0A 5JOYA 3MUZ1 4AFAA 1AX2A 2V09A 4DUWA 5ABJA 1WCUA 1RUC1 3VDCA 3CO2A 3U0ZA 2FDHA 3PIJA 3POGA 5JSPA 1V00A 2Q1ZB 1IG3A 4R52A 3KHCA 3T4VA 4W6YA 4XCAA 1UN1A 2E63A 1S2BA 2NZ9A 4DINB 2GNMA 4K7JA 5HPOA 2P5BA 1WUVA 1ULCA 4ZU4A 3KV6A 1XYPA 1XBFA 2W46A 3POYA 3TN92 4AI0A 5FZ9A 2J1RA 3A7QA 3OEBA 1C5HA 4U2AA 4D3WA 2YY1A 5D2AA 2BGPA 5LZ6A 4FTBA 2WS91 1AJKA 1LJ7A 4Q1RA 5F5QA 4AEDA 1HRI2 3GCWA 1AF9A 4E8DA 4HVOA 1MR5A 1MPXA 4RN5A 3UYJA 2DV9A 1W06A 4QX1A 3BB6A 3HWJA 3OG2A 1C8M3 3D4KA 2Z2SB 1VRH3 2VQUA 1CESA 1UZZA 2DTWA 3C7OA 4LBQD 4OZXA 4CEYA 4QXHA 1H6YA 3I59A 5DDJ3 1BBT2 3MW2A 4QPGC 1GV9A 2IVJA 2CY6A 1DQ2A 3TEZA 4DO0A 3UGHA 1FPN1 3WR0A 2ADDA 1S55A 4FQ4A 1YQ2A 3LPGA 3CU7A 4IEOA 4XBLA 2VAUA 3P3NA 4WM8C 1ND2B 3WOGA 5A6XA 1Z7S1 5DMYA 4CDQA 1S4CA 1OFNA 2VM9A 2YC0A 3M3EA 4LE3A 2VPVA 4QPGA 1MS8A 5FLIA 4DPNA 5IYYA 1TEIA 4BCUA 2VW1A 4AVAA 3WDWA 1QQP1 3FUQA 5IAXA 1CAWA 3C7EA 1R091 1W9TA 3VBHB 4CUAA 3AYAA 1W8NA 4FI9A 2PAEA 4BZ4A 2JICA 1XE8A 3K48A 4J6GA 3LOBA 3HBZA 3ZYFA 4COVA 2YG0A 2ARCA 3QOPA 5DXDA 3H3UA 3LKJA 4N9HA 4B4QA 4QGNA 4UFKA 5CG8A 4QAWA 2RM21 4NHYA 4E27A 2Y8KA 1OH3A 4A3ZA 1R64A 1W8FA 3EMRA 1VMJA 2YFUA 5GZDA 5IK5A 1ST8A 3N7MA 3I49A 2D6OX 1J3RA 2FDIA 5JOZA 1R1A3 4EZ4A 2CGOA 2JD9A 1ZZ7A 5FY7A 1VIWB 1S0DA 4JRLA 4YG0A 3AZYA 1RHI2 1UOBA 3WNOA 4EJRA 4M3CE 4XUOA 5CG9A 1W3XA 3LA2A 4N8MA 5JXIA 5G05L 1ZZBA 2FDGA 4JVAA 4FOQA 1QJFA 5APAA 4Z2WA 4L92A 1DZTA 4CCOA 2W47A 5C6CA 2VVDA 2NM1A 4K6BA 2EICA 1V6JA 2CHHA 3N9QA 2HWB3 3E5XA 3NNJA 1PGSA 5I8YA 1AR62 3LF7A 4AGRA 5IAVA 3V65A 2E51A 3POWA 3N35A 5FYZA 5F5IA 1MVEA 2BQPA 2EF6A 5T50A 1HRV2 4QMAA 3WCSA 5JWPA 2PMWB 3I3EA 2RMU1 5FO9B 3DPRC 1SDDB 2P1BA 2WT0A 5FMCA 5I8SA 5FKBA 2VCCA 5D8AB 3JB4C 3NAPA 4FPHA 3SISA 1WD4A 4UYBA 5J1XA 3GHMA 1CZTA 3VBOA 4MGTA 1HW5A 3U14A 4CE8A 4UFMA 4TLFA 1RJ8A 1JODA 2UWAA 3DPRA 3WQ0A 1LHUA 4FPCA 1GR3A 3ILRA 3WF4A 1XXNA 2C1FA 1K3IA 1ULGA 5CADA 3V56A 1V0AA 2G9GA 2X8KA 2XH6A 2ET1A 2C24A 4HONA 4DEQA 2CAUA 1ND3B 2PLV3 3ES1A 1V6IA 1QJZA 2W91A 4Q0SA 1AR92 1EPZA 5A32B 1ASJ3 3VBSB 4CUBA 4QKNA 3CZJA 3LA7A 1YJLA 4MXWB 3AZXA 4YYOA 1Z78A 5FYHA 2G1MA 1FATA 2WIIB 2NN8A 4QU1A 1WLCA 1WBLA 1NY72 2FCUA 1X8EA 4XMIA 2R041 2HWC2 3GZAA 5DQ0A 4ZU5A 5CAZA 1UAIA 3J8F2 1D2SA 3ENRA 1G86A 4XVHA 5JIAA 3U4SA 4IE4A 2W68A 1RUD3 2EALA 1PHMA 5FR3A 5ACA1 1HB3A 1O4TA 2RJLA 4N7UA 4Y1YA 3ZVXA 1Y7BA 3ZPOA 1M4WA 3DN7A 2D6PA 3IMNA 1APNA 1XRUA 3O5SA 4PLOA 2YBKA 3H8XA 4P02B 4MHRA 5C71A 5AFEA 3D5OA 2GN3A 4F7ZA 4TN7A 1KITA 1AX1A 2B45X 2R072 4I02A 3VKOA 3ZXDA 2VBBA 2WQZC 4XBQA 4DXTA 2JXAA 3JBG2 3WDUA 3RZMA 1BEV3 3IAQA 4UF0A 3H1MA 4JDMA 1AR82 1OSGA 2IXJA 4QKFA 3TN91 3BTXA 3T0AA 1DGWX 1G9BA 1Q8SA 3AM2A 5EHDA 2RDNA 3H1WA 1HRI1 4XCBA 1UOGA 4WVMB 2CNAA 2EXHA 3B3QE 4IV3A 5FY4A 4YGCA 5CEHA 5FV3A 2DCKA 4HKLA 2JKBA 1GSLA 3MI8A 1DDLA 2OS2A 4QXKA 4XE9A 5F3EA 5JCTA 4NIGA 1BBT1 1NT0A 3GZTB 2JG8C 3TYJA 2AACA 4MO3M 1KS4A 4JQRA 1MEC2 4R8HA 4H55A 1KFXL 1IS6A 2A6XA 2XVGA 1O5LA 2ID4A 2X10A 3AMPA 1UY1A 5CFCC 4OZOA 2XLAA 3SH4A 3WF0A 2LUWA 2VMIA 5AFBA 2YBPA 1OH4A 3IB3A 2G9ZA 2AC1A 1HB2A 1FOD2 1T2XA 3I3QA 4RHV2 4UFIA 2W87A 5GLZA 1BK0A 5E89A 4AHWA 3HN3A 3SITA 2UWBA 2DURA 1UOFA 1SBEA 3AKPA 4JCKA 4MGKE 3LOIA 1Q5OA 4DOUA 4Y1UA 3ROUA 2VCBA 5FY9A 5FFOC 1D4VB 1EY2A 4CUCA 1XOYA 1C5IA 4PI2A 5FKCA 4ARXA 4AQTA 4PIYA 5LK5A 1RMU2 1ZZ6A 3EQEA 4PJYA 5FZ6A 1BZWA 2QQNA 3AZVA 4MSVA 2VZTA 2ZGQA 3P5BA 1F2NA 1O4YA 5FMOS 2DUQA 1PGW2 4TTGA 1JW6A 1YI7A 3KCCA 4P9YA 4C0HA 3BIEA 3IZOA 3VBHA 2DUOA 5FZIA 4XZPA 4LQRA 5C3RA 4HPKB 1W0PA 1RHI1 1ZX5A 2DVFA 4B29A 2ZMLA 4DFSA 1PNFA 5K8SA 4F3JA 1LR5A 1SPPB 3ORJA 1KEXA 2HWF2 2RS33 4OCTA 5BXXA 4D6QA 3ZXEA 1O3TA 4UI9L 4MGZE 1AR61 3NSTA 2XOMA 5BV6A 1DU3D 2P4EA 3QCWA 3DEMA 5F32A 4FCAA 5IW0A 1JTZX 4WVWA 5BNOC 4LR4A 1AL23 1YHFA 3I2FA 4YZ3A 3FMGA 3UKVA 2QQMA 4AEJA 2P37A 1HRV1 5CKNA 2LRPA 4OHYA 1W9YA 2QFEA 1JYNA 3H8RA 2BERA 3I2HA 4UXAA 2LTNA 1G9CA 1PIV3 1ZRCA 4I3PA 1URXA 4GKYA 2C9KA 2WNUC 5FP8A 3MIBA 3CNAA 4W4ZA 4X6QB 4XJUA 4NIHA 1GFF2 5JSOA 3KQRA 5LB6A 3BPZA 4Y33A 2IXIA 4Q1PA 4WM7A 2O8OA 3VZMA 3PTRB 2WSVA 1ZRIA 3ON7A 4PCRA 3N9LA 4KQ7A 3ZFEB 5FXWA 1NE6A 5JZGC 3MBWA 2DYCA 3I2IA 4GJZA 3RPQA 1AR91 1COV2 3LEGA 4U36A 3ZYPA 1Z0HA 5TSWA 3VD9A 4NHMA 4JAAA 5A3PA 3AP5A 3UGFA 4HN0A 1NY71 5A1LA 3ZFGB 1MQTB 4ZPIA 5DAWA 3HD8B 2HWC1 2VJXA 4YVWB 3H7YA 3ZO0B 5L36A 4GULA 1CQ9A 3AK0A 5CB7A 2AYHA 3J8F1 3HVDA 2WFPA 3OSDA 1UL9A 4KWLA 5LEKA 3AL5A 1CVNA 4XZUG 3FZ3A 2ORXA 4AEMA 3JD73 4X6RB 1DHKB 1EV12 3H3ZA 1ND3A 3I4IA 4PQQA 2ZGTA 3VBSA 4A41A 1OBNA 1QWRA 5E88A 2A5ZA 3FC0A 4RR3C 4NE9A 2Y6FA 3DXUA 4LBMA 5A7SA 3SXWA 3LWCA 1SMVA 4XBNA 2CSGA 1ZBA3 2OQ7A 3EO6A 4CDUC 4XAAA 3DF0A 5IFTA 2R071 1LNSA 1ENQA 2ENRA 2PHFA 4GZ9A 4WZCA 1PO23 1XNKA 1F31A 4PHZA 1AR81 1RUF2 3SKJE 4CDUA 5HV0A 1W04A 4RGKA 2NQYA 2IXKA 1W0OA 4COWA 4XDPA 4LEJA 5LW9A 3TEYA 1I6XA 3WG1A 3NV1A 5CFDB 4H7MA 3VBFB 3B94A 2WZR2 3GJBA 3H8UA 4IERA 3O1MA 1PGL2 2P6HA 1N3QA 3I3BA 4Y22B 4CYDA 3F95A 3SNMA 1QH6A 1OT5A 1NXD1 2PXJA 2YV8A 3B9IA 1S0JA 3AKRA 2OX0A 4I01A 3TB0A 3DKQA 1MEC1 3HQUA 5JMOA 1A78A 1CIWA 3A0NA 5K0UA 2BUKA 2JWPA 4INDA 3WDXA 1ENXA 2BP6A 4ATFA 4LKEA 3PMSA 1FMD3 1PNGA 3VKLA 3K46A 1UX6A 3K77A 5FYCA 1YRZA 5T5PA 1G6NA 1RINA 4WVMA 2DFBA 2RJ2A 1CR7A 2A6VA 2C4XA 1FOD1 1H4GA 2YZ4A 3ETQA 4MH0E 1NCRC 4RHV1 3TWIA 4NIIA 4AG4A 2IUWA 4FVVA 1A8MA 3OEAA 4YZ5A 4UBGA 2Y6LA 3KVBA 1SLTA 1CAUB 3AJYA 3R4SA 5CBLA 4NWWA 4Q0PA 4XABA 3PNAA 2WRAA 4FP3A 2E6VA 2JECA 2XONA 2VMCA 4JGZB 4RSUA 2AGSA 4DIQA 2RS52 4YZ1A 4L2NA 5KHGA 2RJKA 2EIDA 3H3LA 1NCRA 4HL0A 1VLNA 4Q8LA 3UETA 2EIGA 2Y64A 2ZX1A 3PUHA 1LRHA 1RMU1 2TBVA 4QHOA 3IT8A 2XG3A 3POJA 1VMHA 1O3RA 1CJDA 4IEXA 4Q4Y2 2GMEA 1PO12 4AXOA 1H1AA 4TZDA 3MF6A 4PBPA 1JHNA 3HNYM 4JHZA 3BPSA 1GZCA 4V1PA 3EB7A 1V9U3 2JEMA 1UMZA 1RUI3 1GWKA 4YVSC 4CDXB 1LOFA 2XMLA 1F35A 3VHNA 4BIFA 4AHYA 2DVAA 4QXCA 3HPNA 5BNNC 3KGZA 3LSEA 2D6NA 5T3NA 4M3CA 2HWD3 2HWF1 4KGGA 2D3RA 2VO5A 2JDHA 4ZXEA 1NA1B 3VZOA 3I2JA 1ZZ9A 3PURA 1W2AX 1JXNA 2P17A 2VTXA 5A3NA 4KWKA 2F4PA 5FZAA 4Y26A 4LKSA 1ACCA 3NWKA 1SHWB 3BVCA 4CUGA 3NKTA 3QBQA 2HH9A 3B69A 3IBMA 3I2OA 1W8OA 2NMNA 3OUIA 2QE3A 3VD7A 1G9AA 2YU1A 5FPUA 1JS9A 3GBGA 1RUH3 4H2AA 3C3VA 1GZTA 2P3YA 4RGGA 2VULA 3WT3A 4YGEA 4LOSA 3M3IA 4LO8A 1XNBA 3M7AA 4ZY9A 4IV1B 1YJKA 3RG0A 1AYN3 1WCQA 1XPWA 1QJY3 2MEV2 2HLEA 3AFGA 1Y9MA 1GZWA 4NOTA 1TME2 2RR12 4DQAA 3PUAA 1B35B 1COV1 1GANA 2BYVE 4GXLA 1CAVB 3AL6A 3URFA 2X29A 2Y34A 3UKTA 2ZEWA 1D0GA 4NPLA 5JPNB 1QGLA 4LORA 5I0TA 1K42A 3O1OA 1UY0A 2PHDA 2G9FA 2QZ3A 3ITQA 4LKFA 1RVF2 5FP7A 1RYYA 3GZUC 3ACIA 3LIHA 2WBKA 5EIYB 1JZ5A
chains in the Genus database with same CATH topology
1PM7A 3ASIA 4KU7A 4OUSA 5BNPC 3KGLA 4JDOA 4F83A 3GBFA 2WS93 2I2SA 3ZFEA 1EV11 4HKOA 1QXJA 2WA4A 2P34A 4NHKA 1O5UA 3WQ7A 3B00A 2P2KA 4CEYB 5DUXA 1AR73 4N53C 3I59B 2YDEA 3ZFGA 4UW4A 4AFMA 3HT2A 4YVWA 2TNFA 4WBBA 2FBEA 3NV3A 3RJRA 2Q0AA 2OZJA 4TYSA 2VNRA 4D69A 4AHXA 4CEWC 4LULA 1UD1A 2IXHA 2QCSB 2XJTA 5KWRA 1DQ5A 3VBRC 4QPGB 4A2UA 4LA2A 1KDMA 1VBC2 1WGPA 4MLOA 1QQP3 4IEVA 1BVP1 1W6PA 2WZR1 1PGL1 1POV1 1H8TA 2Q8OA 4AI8A 5K7PA 2D98A 3R6SA 2QUOA 2OYZA 4OI0A 2ZGUA 3VL9A 1SBFA 3ZIXA 2Y38A 4DY3A 1QY4A 1MZ5A 4QX5A 3ZPYA 3LGRA 1VB4A 1DQ6A 3M8LA 2BGCA 3THPA 2WC2A 1RIRA 4XYXA 4FPFA 1IKQA 4Q4V3 1YYNA 3BALA 5GJ6A 3ZFFC 5FDBA 5CFDA 2WFF3 2I74A 3FX3A 3VBFA 3OCPA 4LLOA 1TMF2 2XUMA 3NVCA 1S0GA 4Y22A 2AUYA 2EXJA 3AB0A 1LOBA 4TSVA 4Y4YA 2PHUA 2RM22 2E53A 4RQPC 2RS51 3N36A 1EP0A 2H0BA 1S2KA 5A3LA 2RHPA 5JI9A 2WNVC 2Z5WA 1LULA 4KH9A 4EN8B 1TNFA 4Q4Y1 3RMXA 4NPRA 4QQPA 1FT9A 1Y43B 2DCYA 4X8NA 3KM5A 5C9AA 3THTA 1M06G 2Y0OA 1WCSA 1ZVFA 1AL0G 3RYRA 3MW4A 4LBOA 1ZZCA 4Z92B 2UURA 3NAPB 4RA0A 3SLIA 2BVVA 3VBOB 3MPBA 3W9AA 1POV0 4FTEA 4OHZA 4EWDA 1J1LA 3DPRB 2WNEA 2KXLA 3X29B 4GALA 4R9CA 1PVC2 1K5MC 3O7OA 2ZMKA 1C57A 1UU6A 3VN4A 2K2SA 4CDXA 2ZX3A 1O4ZA 3E6BA 3M4FA 4N43C 2W52A 2Z79A 4QPIC 1FI2A 4HANA 1NA1A 2KM2A 4MZUA 1NXMA 1ZBE2 2XLFA 1BQPA 2R49A 4YSFA 3IWZA 1EAH2 2A7AA 3C2UA 1SCSA 2MEV1 4LNVA 3PVBB 5FREA 1TME1 2RR11 4XQDA 4IQPA 3K51A 3E6DA 3RYKA 4IEUA 3NL1A 3ZXJA 4XFBA 2JG9C 4XFIA 4GB32 1RVF1 1ZRRA 5JDBA 3ACLA 2Z69A 3OYWA 3USUB 2VG9A 2FZ1A 3WD5A 4IV1A 2BVBA 4BA6A 4XJWA 3UL2A 3MLKA 4ORFA 2QVSB 2WSUA 4XEZA 3JQXA 4R4ZA 4Q29A 1W6QB 1CAVA 1MVQA 4IV3B 1WLDA 1VBD3 3ZX7A 2W39A 5KBFA 4AW7A 3DUIA 1RUG2 2R1BA 3VBUA 1OD5A 4NVPA 4YM0A 1GZ9A 1O91A 1OPMA 1VBE3 2ZS6B 1RUNA 4MGYE 5DZGA 2A6WA 3S30A 1IGOA 1YUDA 3WHUA 1PZ7A 5BNQA 3U11A 1KXGA 4XIKA 4S2HA 4YRDA 2IC1A 1N1YA 2FQPA 2RS13 3EBRA 2JG8B 1VBC1 4FOYA 3B5LB 3JQWA 3VHRA 3R4UA 3ZSKA 5T5JA 3T2TA 2D3PA 1HXS1 5CFCB 1D2QA 3AMHA 3I8TA 5C4WC 2CWSA 2VH9A 1D0HA 1MS5A 1OLRA 4URTA 3LB9A 5C8WA 3GBWA 4XF0A 5JSRA 2R063 1NLSA 1YI9A 4AYUA 4OHXA 1U0AA 4R9AA 3WX5A 1D4M2 4OI1A 4N90A 3W58A 4F8AA 1S0IA 1AX0A 2W0XA 1XNDA 4S2DA 2GNBA 3GYDA 3M3QA 1TMF1 4WM8A 2XJQA 5KHHA 3ZSJA 3OBRA 2XLGA 4Y1ZA 4HBNA 1OFSA 3WP3A 4LTAA 5H9PA 2ERFA 5GZEA 1QHDA 1J3PA 1VBA3 4ASMB 5DG2A 4K9SA 3RSJA 1H8VA 4IEQA 1FNYA 4IEPA 4HETA 1C8M2 1REEA 1VRH2 2H6BA 3USSA 2ZAHA 3HR9A 2D7FA 1VAKA 3RQ0A 5DDJ2 4DS0A 1S0BA 2ETEA 4Y20B 5BNOB 5FPZA 3G6JB 4SLIA 4E2QA 3I54A 1KS5A 2ZHNA 4LBQB 4WM7B 1PVC1 4OFGA 3B7MA 4B7EA 5JR7B 2VNOA 4Z8BA 2EAAA 3QLQA 4J1XA 1FV2A 4NR1A 2OVUA 4ITCA 1WCDJ 2ZZJA 1GNZA 5E8AA 5JZGB 4CP1A 3IDCB 4COUA 1C1FA 1F5FA 1MACA 1ZBE1 1U5IA 4CDWC 3WW2A 2VMHA 2E7TA 1R1A2 1FV3A 3MPPG 1EAH1 4XHBA 2HEYF 3VUOA 5L7OC 1SLLA 3B01A 2W08A 3M1HA 1A6CA 2KA3A 4XXAA 2Q1MA 4RGAA 5F9TA 2OUHA 5H9SA 4XF9A 1X33A 3PVEA 3SH5A 1X7NA 2R073 4B3NA 2HWB2 4GB31 3SMHA 5L7OA 3JBG3 1X36A 4RR3B 2Z42A 1AXZA 4P9GA 4CDUB 4G4FA 1DFQA 2GSYA 4HFSA 3V64A 3VHPA 1F8VA 2ZTNA 2YGLA 5L73A 4YLZA 1NE4A 1RUG1 4Z82A 3N3HA 1V6KA 3TRSB 1PK6C 2B46X 5EYXA 4YZ2A 3OF1A 3ILNA 4LUKA 3MW3A 4ZXKA 3USUA 5K0UB 2ZABA 2NLRA 1QNYA 5GZFA 2XKOA 1PK6A 2PLV2 4XFFA 2JJ6A 1ASJ2 2E7AA 1W6QA 4XTPA 1FOD3 2A3YA 2AENA 3U4XA 1YLLA 3ZSMA 3VZJA 4ES8A 2AR6A 2VUAA 1VAVA 2XJUA 4L8QA 1FNZA 4BH9A 3FFZA 3ES4A 3R4DB 1V6MA 2D3SA 1IS4A 1NCRB 1Y3TA 1RUE1 1KRIA 1GICA 3IN9A 1D4M1 4IEZA 4YM3A 2JG8A 1BMV2 3MIHA 4BPZA 2BTVC 3A4UA 3ZYRA 1J3QA 2GC3A 1SQ4A 1CN1A 4I30A 5CFCA 2CAVA 2YGMA 2GDFA 1BEV2 4FPYA 4M3CB 4JRAA 4Q26A 1H9WA 4LHNA 4GKXA 3POSA 3N7KA 4YVSB 4HSLA 1N1TA 4XJAA 3L2YA 2AREA 2V5YA 2I07B 1C8M1 1I9RA 5GKAC 4D7SA 1VRH1 1BKZA 1ND2C 1DZRA 4E4ZA 2OPKA 1W6OB 1HQLA 1QXPA 5DDJ1 3WINE 1V70A 2X53S 1DYPA 2YHJA 3FUOA 3AP7A 3BODA 2B5HA 3GHNA 4GMP3 3UK9A 1YFYA 2B9UA 2R6QA 3E97A 4XF1A 2SLIA 3U10A 3S6PA 1GZWB 2EVXA 3FFQA 4G9SB 1MS3A 5AVPA 4AVVA 1F9KA 3FBMA 1KJRA 2VECA 5EWSA 4Y20A 2XWBB 5BNOA 1MZ6A 1UPIA 3WXPA 1C1LA 1QNWA 5F6LB 1H2NA 2DFCA 2BBVA 4LO6B 4LBQA 3T1MA 1Q8OA 3H0OA 2ZOEB 1R1A1 2K0GA 5T54A 3ZXFA 5E16A 3J26N 2WNUA 2JX9A 3ZSEA 1NG0A 3INAA 5IK4A 1JYCA 4COYA 5J7MA 1YWKA 4ONUA 1ZZ8A 4HKWA 1MS0A 1QDCA 3MEPA 4FP2A 3ZYIB 1LTEA 5GLUA 1NCQC 3QH6A 1RUJ2 5JZGA 2HWB1 3HQXA 2ARBA 1AYM3 1DGRA 2BNNA 4XILA 3PHMA 2VVFA 2ATFA 2PHTA 1RUF3 1DZQA 4OLLA 2CTVA 4N53B 1AL22 1H1MA 5DUWA 5J37A 4G3YC 2VOVA 2B42B 4FOWA 5DZFA 1NCQA 5IK7A 2VU9A 2NYYA 4XJ8A 4LBNA 4QU2A 1W6PB 3KCXA 4CEWB 4E2SA 1YIPA 1H8TB 4MVTA 4QT6A 3I7DA 1JN2P 4BE3A 2ILMA 1HV1A 3VKFC 4COZA 4RR3A 2D6LX 1JBCA 4PBOA 4BLIA 5JAXA 3JCIA 1N47A 2PLV1 5DG1A 1DQ1A 5GLTA 1ASJ1 3SCHA 1YO8A 1QJU3 5DUVA 4EWAA 3WV6A 4AFDA 2XVKA 3ALQA 3A0KA 4K40A 2DU1A 2BWAA 1AVBA 3HN1A 2I45A 3CLPA 2YPJA 3ZFFB 4NWVA 4OVEA 4QM8A 3VZKA 4S2GA 3CJIC 5FPXA 2D6KA 1ZM1A 2XBO3 2BFUL 3OD4A 4HVQA 3IDBB 4YFZA 4Q4W3 1PO13 1BMV1 2XL9A 5C9AB 2DCJA 2Y26A 1TQ5A 1ZBA2 3MIDA 3KT7A 2RE9A 3MFAA 4BIOA 5I0SA 1VP6A 2ZGPA 1Q43A 2D6MA 2ZX0A 4Q0QA 1SEFA 4PQ9A 1BEV1 5FTTC 4YG6A 2XPJA 2D40A 2GH8A 3AMNA 5BUVA 1PVXA 1LHVA 1DGRN 2XJPA 1ZNPA 3BU7A 3GF6A 2YXSA 4JC1A 3IPVA 4AVSA 4Q4X2 5FBZA 3J4UH 4N7IA 2QJVA 1WLWA 5LEJA 2GU9A 4XFHA 4FPKA 1WW7A 2OZ6A 1ONAA 3O0VA 4P5HA 4QD2A 4QPYA 2GC0A 2QDRA 1UPSA 3WP5A 1K5MB 3APBA 2A3XA 1VBB3 1FMD2 4M01A 1SFNA 2IFRA 4LO4B 2JD4A 1MZFA 4YVSA 4AF9A 1QKQA 2R0HA 3WP6A 4N43B 4AK3A 5BNNA 1KDKA 2N7GA 4OI2A 3MIFA 1SLBA 2A71A 1SCRA 1W6OA 2BNMA 5CVRA 2D93A 4EN7B 4P9IA 3KCYA 1LESA 4YW3A 3NV4A 3PLQA 2SBAA 4OI4A 3RWNA 4HVRA 1SDWA 2DF7A 1RB8G 2YROA 1IHMA 3OYWB 2PQQA 1I5ZA 4Q0UA 4HSJA 5L19A 1JYIA 1W39A 4D7YA 3LAGA 2NP0A 3FBYA 1GQGA 4Z07A 1CX4A 1V9U2 2JG9B 1REFA 2DVBA 1BCXA 4FAGA 1RUC3 1E57A 5A33B 2HWE2 4GWMA 3VBUB 5LK7B 3HMYA 2ZGRA 2RS31 1V6LA 5T55A 4Q8KA 1RUJ1 4E2GA 1LEMA 2IFWA 1LHWA 1A3KA 4P9LA 5GZCA 3VLBB 1U5YA 1SLAA 4D94A 2DCZA 2ZX4A 1AL21 2ZX2A 3MIEA 4GH4C 5I93A 2GAUA 1Q3EA 3RNSA 2NPIA 1LHNA 1XU2A 1PIV1 1U5XA 4QQ2A 4YFWA 2K9ZA 1RUH2 5BNPA 3PJQA 3MFCA 3H9AA 4R4XA 1CPMA 2WINB 2UYBA 4DXZA 1FPN3 5GLWA 3L9JT 1OOPC 3MF9A 1HIXA 2DUPA 1AYN2 1VR3A 1MQTC 2ZPXA 4N53A 1Z7S3 4GIQA 1UW8A 1RGSA 3RDIA 2XKPA 3HAGA 4PDWC 3MLJA 5KXBA 5C4WB 4AE2A 1NLRA 1R093 3WW3A 3D0SA 1Q8PA 1G7YA 1HXS2 4ASLA 4ATEA 4WM8B 4CEWA 3M70A 4HLTA 1ZRDA 3W59A 3SH3A 3VBRA 4Q27A 5AVAA 4AFCA 3KLSA 5KC6A 3TNQA 4KBBA 4QHBA 3VHOA 2WT1A 2RM23 4BMBA 2GN7A 3ZN5A 5DUUA 2WZPP 3TAYA 3U07A 4XF4A 3JD71 2A6ZA 5AC92 1QU0A 4LO5B 3AP6A 1LEDA 1NYWA 3ZYGA 5I91A 1DF0A 2OUJA 1NQJA 1R082 4S2FA 1AR72 1ZBA1 2XJVA 2ZKNA 4OHVA 3V0BA 3AX4A 1IPKA 1DYKA 2P3IA 4IEWA 5CU1A 1IOAA 4MXVA 4XTMA 1PO21 2CWMA 4ZKTB 1DQ0A 2ARXA 3ZFFA 4Y1XA 4LA3A 4FXKB 4XPVA 4A3XA 1LENA 2PELA 2GMPA 3AXDA 2D44A 4FT8A 1KJLA 3AKTA 5J48A 1OQDA 2Q30A 4Q4X1 1LECA 2BNOA 4CZSA 4ISRA 4RQPA 2RMU3 2DCTA 3KT1A 2V73A 4JGYC 1VAMA 2ZGKA 2WNVA 1QJX2 2X5IC 2E7QA 2GMMA 4MV2A 4AVCA 1FMD1 4KGQA 2CYFA 4JGYA 4AQ6A 2H0VA 1U12A 4I0BA 3OY8A 3WVJA 4JGZC 2X5IA 2WFF2 4Y1VA 4KNCA 2ZGMA 5C8CC 3B9CA 5IT6A 1DIWA 1AXKA 1OKQA 4CDWB 2B8MA 1H9PA 3M3OA 4QQLA 3ECQA 2R043 3P3PA 3PMEA 1K5MA 3AYEA 3ELNA 5L7OB 4BHPA 2XVLA 1XNCA 1SLIA 2LALA 1J58A 4BOWA 1O3SA 3IDEA 4N43A 5ACA3 4QPIA 2B7YA 3EXUA 1V9U1 3FHIB 4I0AA 2PYTA 2HWE1 3FLPA 4I3GA 4RD7A 4IXLA 2PHLA 3J9SA 4HT1T 2GC2A 2JE7A 3JB8A 3UV9A 2BWCA 1S0EA 2O1QA 3ZMNA 2EAKA 4WVVA 4PLNA 3TN93 1FX5A 4XQWA 4DRVA 1PK6B 4RS5C 4Q0VA 2VVEA 1HRI3 1KD7A 4YW1A 1FYUA 4EN6B 2JG9A 2EXKA 5H9QA 5A33A 3ILFA 3FWEA 4H14A 3N7JA 1RUH1 5HCBA 2D5FA 1J59A 1BBT3 1UZYA 4AGVA 3BTAA 2DVDA 5ABJC 1XYOA 2R30A 2NMOA 1AYN1 3FJSA 1H2LA 1WA4A 4UW5A 1Y9QA 1X82A 4LO7A 2FZ2A 2VW2A 2F6BA 2VXRA 1UU4A 4J1WA 3AMQA 5LRSA 3WDTA 1YNAA 5HBAA 3TBDA 1N3PA 3TOJA 2WLPA 2ZCWA 5FO8B 4AEDC 1AHSA 2G4IA 4PLMA 4Q2FA 4DB5A 2CGPA 2ES3A 5GALA 4MX3A 4CEYC 4YW4A 3O0WA 4JTOA 3MYXA 2ZGLA 1RUE2 4NO4A 4BLJA 3M3CA 1LU1A 5AC91 5C33A 2ZGSA 3ZXKA 3HT1A 1MS9A 1UIJA 1S0CA 3D8CA 4FO9A 1VBD2 1LGNA 5C4WA 1VJ2A 4SBVA 5DZEA 1R081 2YYOA 1AR71 4CDQC 1H0BA 1JUIA 1RHI3 3ZXAC 4XMAA 1VBE2 3WNXA 4AI3A 1V6NA 4UW3A 2XHKA 4FPGA 1JUHA 1S1AA 1V6OA 4K3UA 1AR63 3OTFA 1GBGA 2RS12 4M0NA 2YMZA 4EWEA 3KT4A 3IIAA 2IXLA 3VV1A 1NQDA 3OBTA 2CV6A 3RRDA 3WY6A 2XB6C 1HRV3 3VDDC 1DBNA 4P9WA 4A7ZA 3S0MA 3WDVA 3E5QA 1BK1A 1QJX1 1SFYA 1C3HA 3VZLA 2GH2A 2QKDA 2R062 2ZHMA 3VDDA 5JI7A 3T1LA 1ALYA 3SCFA 2ZA9A 4XHXA 3VL8A 2YUEA 5JLVA 3UJOA 1PMIA 4Q4V1 4RL7A 4B8EA 1G9DA 2WNUB 4ZU7A 2WFF1 4GWNA 2ZACA 1YFWA 1AR93 2EXIA 1BJQA 5FAXA 5HI0A 2R1DA 4E4DX 3RI8A 3D6EA 2QZ2A 3AZZA 4CP0A 2Y0IA 1UIKA 3IKWA 4E4SA 2HWC3 3N7LA 3MDPA 4FPLA 1VBA2 1LGBA 3J8F3 3NAPC 2D97A 3WW1A 1SLCA 2PN5A 4DRRA 1I3HA 3KS7A 5GLVA 3VBOC 5F1RA 3MIGA 4H3WA 3AJZA 1NCQB 4FPEA 3AYDA 2FMDA 3D82A 4CDWA 2QQPA 1WMEA 2PFWA 1O7FA 1PZ8A 4K21A 1Q56A 4I2OA 2R0FA 5KXDA 1AZDA 1I1EA 5KHKA 1QMJA 1WCKA 5B2GB 1AR83 2WJSA 4W6XA 2IXCA 5KHIA 3OJBA 4NHLA 4X8PA 3AYCA 1GNHA 4C0BA 2R32A 4M3CF 3KB5A 1CGPA 3PTYA 1OHFA 4BWOA 5FCCA 2HEVF 3WLUA 2QDNA 2VGDA 4UW6A 4M00A 2PA7A 2ZHKA 1MEC3 3WQ1A 1BYHA 2OA2A 2ZZQA 4XJ9A 2WQ4A 1B09A 3AP9A 2HJIA 1UKRA 2C0ZA 3ZMOA 1LOAA 3ZSLA 2PHXA 3NJZA 4WZFA 5I8TA 4FPOB 4RHV3 3FLRA 5FMOL 2C5DA 4LT5A 3CJIB 1YXWA 2A73B 1WBFA 4IV3C 3LZZA 1UF2C 5A3MA 1H30A 3S7EA 1CJPA 1RUD2 4C1XA 1RMU3 2VQAA 5GM0A 5JVVA 4AEKA 4E9KA 5KXEA 1HX6A 3H50A 4QQOA 4LHLA 3BOWA 4HN1A 3IPVB 4LBLA 4HMZA 1VBD1 3VZNA 5EXOA 3B02A 4K20A 3WG3A 2TEPA 5FLJA 3B93A 1FXZA 2VUJA 1VBE1 3DGTA 3ZXGA 5KXCA 3E6CC 2HWF3 2MPFA 1F5JA 1TNRA 3ZDSA 3DL3A 1W6NB 1RL3A 2RS11 1ZA4A 1SACA 2ZBJA 3NO8A 4YG3A 5BNNB 4HK9A 1H4HA 4WVZA 1DGLA 1HDKA 2WT2A 3H1YA 3O0XA 1RITA 4PF5A 4AHZA 3LA3A 3O12A 4IESA 4BYYA 1UCXA 3GNEA 3VBHC 2PHWA 4FQZA 2R061 2BPA2 3JU9A 1ND2A 2GZWA 1PZ9A 1MS1A 4Z1VA 5EYYA 4NN0A 1ENRA 1IS5A 3KD4A 4P9XA 3WW4A 1VALA 2UY8A 2CL2A 1COV3 5EV7A 4PIZA 5HXVA 4YGDA 1AJOA 1RUOA 3WP4A 3NKGA 4R9DA 1MS4A 2C9AA 1RUJ3 2VQ0A 2ZKLA 1VBA1 3EHKA 4YGBA 1X8MA 3Q9OA 4XFGA 4B4PA 4C1WA 3E5UA 4B7KA 2DWRA 1H2MA 1EV13 1ULEA 5JIUA 3AKQA 1CAXB 5J09A 2Q5TA 4B4RA 4FXGB 5K9YA 4A7KA 4WM7C 4AQ2A 3V0AB 4FTSA 1TE1B 4W65A 4XQ4A 5BNPB 3WDYA 1OQEA 2RS32 2PTMA 2QNKA 3AFKA 1GLHA 4GH4B 4META 1H1IA 2JENA 1IQAA 5FQ0B 1N1VA 5D8AC 5CNAA 2WWSA 1LOGA 1LOEA 2A3WA 1QOSA 4XIOA 4JDNA 1PIV2 3RMYA 1OOPB 3ZN6B 5JOWA 3OPZA 5J36A 5D8AA 5T5LA 2WZR3 1ND3C 1POV3 1XQNA 5BYNA 3VBSC 3AMMA 4JV4A 3VBRB 2B39A 5FRAA 4PDWB 1T6GC 2EA7A 2PAKA 3MLLA 3LCPA 5J3UA 2D5HA 5KC5A 1LCLA 3SCGA 5I0RA 4YM2A 2UYAA 1CONA 5A32A 1REDA 2JE9A 2GC1A 3D0JA 5LRRA 4MXWA 3CJXA 2ZJCA 4XFAA 1QXRA 2HEWF 4KU8A 2VOKA 1SBDA 3V0BB 3MGUA 2XJSA 4K8FA 2VY0A 2A70A 1QOOA 2WLQA 4GA9A 3JBG1 3NV2A 1AYM2 1ULDA 2A75A 1HQNA 2RS53 4KG0A 3ZN4A 1RUD1 3JD72 4PIXA 3ME2A 4OHWA 3RI9A 4LHKA 4Q4Y3 2ZAAA 4GQ7A 4Q4X3 2MHFA 3CEWA 3KMHA 5K0UC 3FE5A 4QQHA 1OA4A 2UU8A 4XOGA 4RQPB 3CJIA 1C28A 2HKXA 2WNVB 5JMCA 3ZIWA 1PO22 2O0OA 1J1TA 5KHJA 1GYKA 3KSCA 3BOPA 4CTEA 5J98B 4DMIA 3FLTA 3WUCA 4AFBA 4L99A 4K1YA 2ET7A 4MUVA 4YARA 4JGYB 1YIFA 3OY8B 1QJU2 1W6MB 2OW4A 4EN0A 2E9QA 5BPXA 2X5IB 1OA2A 2HYKA 3OGJA 4L97A 5E1RA 3RS6A 4YW5A 2FHRA 4IETA 4ISQA 3UJQA 4I09A 4QM9A 3UKNA 3RZZA 1LHOA 2ZGOA 3HIFA 4XW3A 3OGGA 3PVOA 4FBFA 1W6NA 1LOFC 2XBO2 1HKDA 5C8CB 3JZVA 4Y5Z0 1ZRFA 4Q4W2 3MZHA 1PGW1 2MEV3 2WKKA 5F6KA 3SHRA 4KG8A 4L9BA 1VB2A 1TME3 2RR13 3AKSA 4QPIB 4D7TA 2GNDA 2HWE3 4DZGA 4AVBA 2BFUS 2GNTA 3H7JA 1GKBA 1QF3A 1RVF3 5IK8A 1NOVA 4BMEA 1G8WA 1MZEA 4HZFA 4AVTA 4P9JA 4LBJA 1FAYA 4HK8A 1IS3A 3QH7A 1RUI2 2UY9A 4HPKA 1X50A 1C4RA 2DU0A 2LM3A 5HCFA 4EV0A 1LODA 3MICA 2HWD2 5H9RA 3N4MA 4XFCA 3WG4A 4MYEA 4FSJA 4RS5B 1DGWA 4GMP1 4FAHA 1LGCA 1YFUA 1UU5A 1S0FA 1VBB2 4QGLA 4QGMA 1W2UA 4H7LA 3KZ4C 2VW0A 4WV8A 4YNIA 1OMIA 1N3OA 3I2DA 2A6YA 3EJKA 4A7YA 1H2KA 3RYPA 3LSDA 3R05A 1CAXA 1VBC3 1WW6A 1N1SA 2H6CA 2JDZA 1XU1A 4YW2A 5JOXA 5ABJB 3V0AA 1LKNA 3ZYJB 1HXS3 3ZFEC 2AH2A 2VMGA 3M2MA 1IZ3A 1O3QA 1RJ7A 4GH4A 1WW4A 1U5ZA 5FLHA 1QOTA 2BEOA 5FQ0A 3OD0A 3ZFGC 1QJY2 1LU2A 4AGGA 4LLFA 4YVWC 2TUNA 4AEDB 4LUMA 5AC93 5FOJB 3VKNA 3CL1A 1XE7A 3L2HA 3WCRA 1RUC2 1R083 2R16A 1OOPA 4XJZA 3ZN6A 3DV8A 1TMF3 1MQTA 5I0UA 1NZCA 3ST7A 4PDWA 1AYM1 2DVGA 4FOVA 4AWDA 2VOWA 2XGXA 4OULA 1RUF1 5GZGA 3O14A 1H8TC 3QD6A 4GMP0 3JUUA 2WS92 4CDQB 1JOJA 1OQ1A 4DY5A 2GALA 3R0RA 1Q8VA 1ZREA 1CAWB 4EN9B 1HLCA 5SV8A 4LE4A 3TNPB 1YFXA 3BIWE 4BM8A 3NW4A 4YZ4A 4W6WA 5T5OA 3AZWA 1C8NA 4TWTA 1DQ4A 1KFUL 2MNGA 1FPN2 1QJX3 5CFDC 4LBKA 1ULFA 1WLTA 1AUYA 1AXYA 1ENSA 5FOBB 3VBFC 4C91A 1OPOA 4RFT0 3VDDB 3WZ1A 1Z7S2 1GQHA 5EZWA 2IWGB 1WMFA 4IL7A 1QJU1 1PVC3 2ZMNA 4XDQA 1QQP2 4Y24A 3AP4A 1R092 4CRQA 1KQRA 2DTYA 2IZWA 1QDOA 1EYBA 4L11A 5HCAA 1LOCA 5JPMB 1WD3A 2OIIA 2AZ5A 5D1IA 1DG6A 2WL1A 3PVNA 5C9AC 4JTNA 5EJ3A 2XBO1 1ZBE3 4DNYA 2VNGA 4K1ZA 3ZXLA 2ZGNA 4YM1A 3BCWA 4M0HA 4Q4W1 1EAH3 1PO11 4Q4V2 4AI2A 1W6MA 1A8DA 5CA6A 1CPNA 4EROA 4KL1A 4P14A 1R1ZA 4KWJA 4O9GA 3WHTA 3DKWA 2PAMA 1CAUA 5BY5A 3AXEA 3GALA 4XXPA 1OLQA 1IKPA 4BQ1A 2XJRA 2WA3A 4O9EA 4JGZA 2BW8A 4MGIE 3IM0A 2PHRA 4I0WB 1DLLA 4GB33 4R9BA 1LB2A 4CDXC 5J96B 5C8CA 1WMDA 2CGNA 1RTVA 2ZHLA 1JH5A 1HQWA 1OI6A 3WUDA 5FO7B