2C1FA

The structure of the family 11 xylanase from neocallimastix patriciarum
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
219
structure length
219
Chain Sequence
MKFTVGNGQNQHKGVNDGFSYEIWLDNTGGNGSMTLGSGATFKAEWNAAVNRGNFLARRGLDFGSQKKATDYDYIGLDYAATYKQTASASGNSRLCVYGWFQNRGLNGVPLVEYYIIEDWVDWVPDAQGKMVTIDGAQYKIFQMDHTGPTINGGSETFKQYFSVRQQKRTSGHITVSDHFKEWAKQGWGIGNLYEVALNAEGWQSSGVADVTLLDVYTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIFUNCTIONAL ENDO-1,4-BETA-XYLANASE A
publication title Understanding the Structural Basis for Substrate and Inhibitor Recognition in Eukaryotic Gh11 Xylanases.
pubmed doi rcsb
source organism Neocallimastix patriciarum
molecule tags Hydrolase
total genus 55
structure length 219
sequence length 219
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2005-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2c1fA00
4HKOA 3ZSEA 1OA4A 2F6BA 3AMHA 3AMNA 5K9YA 1XYOA 1XNKA 3WQ7A 4S2HA 3WX5A 3WQ1A 3VZOA 3AKQA 2BVVA 4HKLA 1PVXA 2DFCA 1IGOA 1H0BA 1T6GC 2JEMA 2NLRA 2QZ3A 4H7MA 3WP3A 2BW8A 2B42B 1XNCA 4NPRA 2DCJA 3VZNA 2NQYA 1BK1A 3MF9A 1H4GA 1REDA 1C5IA 1C5HA 1HV0A 1UKRA 3MFAA 1XYPA 3LGRA 2Z79A 3HD8B 1BCXA 1AXKA 1TE1B 2B46X 2C1FA 2VULA 1M4WA 3MFCA 3VGIA 4HK9A 3AKSA 1KS5A 2D97A 1UU4A 4XQDA 3LB9A 1XYNA 1H1AA 3WY6A 3AMMA 2BWAA 3WT3A 4S2GA 1H8VA 3VZMA 1QH6A 2B45X 2JICA 3WXPA 1XNBA 4HK8A 1YNAA 1NLRA 2DFBA 1OLRA 1ENXA 3EXUA 4S2FA 2JENA 3VL8A 3AKRA 4XPVA 4S2DA 1BVVA 3WQ0A 2DCZA 1OLQA 2VGDA 1UU6A 1W2UA 3MF6A 3VHPA 3AKTA 2DCKA 2BWCA 2VG9A 1REFA 5K7PA 3RI9A 4IXLA 5EJ3A 4HKWA 5HXVA 3WR0A 3VL9A 1OA2A 3B7MA 2VUJA 1OA3A 1UU5A 3O7OA 3VZKA 2QZ2A 3VHOA 3WP5A 2DCYA 2D98A 3M4FA 1HIXA 1KS4A 3AMQA 4XQWA 1H4HA 3WP6A 1QH7A 1XNDA 1HV1A 3AMPA 1F5JA 1REEA 3AKPA 3WP4A 3RI8A 3VLBB 3VZJA 1XXNA 3B5LB 4XQ4A 3VHNA 3VZLA
chains in the Genus database with same CATH superfamily
1X9PA 3MW2A 5J48A 2B8MA 1ZVFA 1OA4A 2BQPA 2IXCA 4Y1VA 3ZKYA 4C8DA 4AL9A 4IEUA 3RMXA 4BQ2A 5DAWA 3OGVA 4CEWB 3WQ7A 4NIIA 4CU7A 2PLV2 2DURA 4DS0A 3AKQA 4LOSA 4JVAA 2O8OA 5FK8A 1ULCA 4CXYA 1W8WA 4IEWA 2VMFA 3F2ZA 2A7AA 2VXRA 3WP3A 1NG0A 4I0WB 2E7AA 3E5XA 2WBKA 4NPRA 1LR5A 3TAYA 1W8TA 4LE3A 4TLGA 4PLNA 4NMIA 1UKRA 2ZHMA 3EBRA 1XYPA 4IQPA 4JRLA 1QHDA 5C3OA 5KR7A 3BTYA 3VUOA 4QHZA 3T0BA 1A6CA 2J1EA 3ZN5A 1FNYA 2WS91 5DZFA 5K8SA 1AYM1 1VBB1 2A6WA 1N1TA 2BGOA 1OLME 2YFUA 4W8JA 2CAVA 1VBE2 3FUQA 3ACIA 2WO2A 2WS93 3A7QA 1AYM3 1VBB3 3KF3A 4LE4A 4QPYA 4NPLA 2UURA 4QDQA 2UYAA 2MHFA 5C4WB 4DUXA 1Q5OA 1KFUL 2W0XA 3RDIA 1FPN1 2P2KA 2WNUA 2JDKA 2R32A 2RHPA 2JDZA 2RDQA 1QH6A 4DIQA 1S2EA 1Q8OA 3ZYFA 2YV8A 4QPGA 4DUVA 4OI0A 4YW1A 5BNOC 1BZWA 4AEDC 4QHOA 2D7FA 3RZMA 1XJAA 4RS5A 3QCWA 5DAVA 4C90A 1AVBA 2C6SA 3MIGA 2IC1A 4YGDA 4DRVA 1JZ8A 3O12A 1RVF2 4FOQA 4XFIA 3EJKA 1OH4A 2JENA 1QJZA 4JX0A 3WNPA 4K8RB 5FPAA 3EHKA 2QE3A 3WQ0A 1OLQA 1PMHX 1MZ5A 2EIDA 1JUHA 1H2KA 1WLWA 2WFF2 4LHKA 4XFCA 5FYSA 3MV11 5A3WA 4A45A 2Q8EA 3VDBA 4DXSA 3PJQA 3AKTA 2DCKA 4X6RB 4X8PA 4ZHNA 2ZMKA 2GN7A 1W8UA 2YG0A 1C1LA 2BOIA 3POFA 3ZXDA 5BNPC 2PFWA 1LOGA 2A6YA 2VZUA 3DEMA 2JKXA 4M3CF 4I3PA 2VTFA 5B4NA 5JXIA 1OA3A 2D3RA 4E27A 3M3OA 4LO8A 1MS4A 4K8FA 3ZN6B 4MGTA 1GZ9A 3HPNA 4XILA 3FZ3A 3DXTA 1EPZA 1A8DA 5FUIA 4E2GA 4DY5A 1DIWA 3PUHA 1KS4A 1OOPC 1XPWA 2LUWA 2MEV1 5CISA 2W46A 2R1BA 4LA2A 5A7PA 4XDOA 4JCKA 3V56A 5FMBA 5BUVA 2W5FA 2Y6LA 2VVFA 2BNOA 5C33A 2MEV3 2VZ3A 3ABZA 4ARXA 3RI8A 1UXXX 3K3OA 4A7YA 3G7DA 1PK6C 1JHNA 2HBUA 2PQQA 3AX4A 3SCGA 3KHBA 1IPKA 1ZM1A 4LHNA 3SKJE 1KDKA 1WLCA 4RYDA 2RMU2 1DFQA 4CDWB 4NIGA 4PIYA 3ZOIA 3SMHA 2XGXA 3OG2A 4AGGA 3I49A 2VO5A 5C3RA 3H7JA 2QTWB 3I8TA 4QB2A 4TXWA 1GWLA 4WBBA 1XU2A 4LBQA 2RS33 3EYPA 1IS4A 4PIXA 2BTVC 1WA6X 5BNPB 5L7OC 4IV1B 4UFMA 4YFZA 1UL9A 1MACA 1YEWA 1W28A 5CVRA 3U75A 2RDRA 3MW4A 1E5SA 3EQEA 5JDBA 3CQOA 2Q30A 4LLOA 5FJKA 1BEV3 5A3LA 4LOTA 4DINB 1AXKA 3WW2A 1TMF2 5FFOC 4AI8A 2ZKLA 4IEVA 1G7YA 3LF7A 3N35A 2RS11 3VKLA 4GIQA 3RYRA 1S1AA 4P9YA 2PYTA 2QDNA 1SFPA 1G86A 5ANNA 3HN3A 4HBNA 3ASIA 4OUEA 1WZXA 3Q9OA 3CNAA 1X36A 3OD4A 5F39A 2WNEA 3T2OA 4BQXA 2AH2A 4YVWA 3WDWA 1DYOA 4Z1VA 1MVEA 2R49A 4U36A 4Q4X1 4CUCA 2VCAA 2GNDA 4UW5A 3UYJA 4COYA 1U5IA 1UY3A 1GUIA 2Q1MA 1ENXA 4Q4X3 4QKDA 1SCSA 5BNNC 3VB9A 3D6EA 2ZPXA 2ZGRA 2WN2A 4XBQA 1JU3A 4JZRA 1D4M2 1V0AA 4XCAA 4XFBA 2GSYA 3PUAA 3GXUA 4JTOA 2ZGLA 3H1YA 1VE0A 3IDEA 1GMMA 3APBA 2DBIA 1V00A 2AEZA 4XMIA 3S6PA 3H3ZA 1CAVA 3EB7A 4FOYA 5JOYA 4D7YA 5IK5A 1W6MB 1K5MB 3WUDA 5CAZA 4N9IA 4HPKB 3WD5A 4C91A 1AL21 3I2OA 1JXNA 1V6LA 4CCMA 3RMYA 1C8M2 3VBRA 4XCBA 4RR3B 3SHRA 2ZGTA 1W2TA 2Y6JA 3FE5A 1RGSA 2HWB1 1AL23 1RUI2 1AXZA 4IETA 1ZZ6A 1UOJA 3TBDA 1DBNA 1YXWA 2FCUA 1Z78A 3WNKA 2BERA 3LOIA 5HXMA 2HWB3 2R072 3JXSA 2WR9A 4BHPA 1FOD1 1UXZA 4CXXA 4KBZA 1S0DA 5I8SA 2FDKA 5GALA 3HOBA 1QH7A 2RG4A 3I54A 3OBRA 2DBNA 2Y6HA 4HXCA 4LO5B 5FUPA 3ZX7A 5FY8A 1SCRA 2Y8KA 3TN91 1Y7BA 3C8XA 3CO2A 4YZ1A 1U5YA 4NJ4A 1CPNA 4AR2A 4ASLA 4IE7A 2NP0A 1IOAA 5C5UA 3HBZA 5FTTC 5FYMA 1NOVA 2XOMA 3CHXA 3TN93 2OKXA 4Q26A 1AJKA 2F6BA 5E16A 2JX9A 5FZMA 4IEQA 3AMHA 3LDKA 1ZNPA 4ZY9A 3BVCA 2XQRA 5I8YA 3SEEA 3D82A 3VBHA 3RGBA 2WNUC 1T6GC 5GKAC 1XNAA 1CVNA 1LEMA 3AC0A 2FCTA 4ZKTB 1RUE1 3N7LA 2RS51 3JD71 3MEPA 1FV2A 2HEVF 4QPWA 5I0UA 4QPGC 1F35A 2VY0A 5ERLA 4J1WA 1JOJA 3ZN4A 3DV8A 2WQ4A 5KXCA 5IUQA 1RUE3 4RS5C 1UMIA 1G6NA 2RS53 3JD73 3VBSA 3LDRA 2X8KA 1D2QA 4MXWA 4BLJA 4M3CE 3P3NA 5AC92 4XUPA 1H1IA 1MZFA 2L9LA 2OQ6A 4GKXA 3O1MA 2W68A 1ULGA 4Y20B 2ZX4A 3VGIA 1DHKB 1X50A 2BDRA 1H6XA 3HIFA 2WZPP 1ZRIA 2I07B 3ATGA 2ZX1A 1RMU2 1W6OA 1OBNA 3I2IA 5JPMB 1UZ0A 3TWIA 4BWOA 4E2QA 1FV3A 4WM7B 2VCBA 3THCA 1BKZA 2X09A 4B1MA 1GZTA 1MVQA 3HBKA 1Z7S1 4A44A 2LROA 3WT3A 2VZVA 3VBUA 3J8F2 3KGZA 2RJLA 3QLQA 3N7MA 1Z7S3 3HAGA 1RL3A 3SH4A 1GZWA 1D0HA 4P9IA 3WW4A 1XE8A 2QQOA 3USSA 5KHHA 1JYCA 1WCKA 4KMQA 1Q56A 3ELNA 5DAQA 3ZFEA 4EN7B 2BP6A 3BIWE 4OFGA 3BU0A 5F3GA 1AR73 2DV9A 3CMGA 2GDFA 2YY1A 3C2UA 1I3HA 3DUIA 2Z4FA 4WM8B 1SPPB 5JVVA 3ZMNA 3RS6A 3WDVA 5I0SA 1LOEA 5JWPA 4FXKB 4K6BA 3AYAA 3FWEA 4Y22B 3LZZA 4NIHA 4DUWA 1WW4A 4A3XA 1W6QB 3H8RA 3UK9A 3MW3A 5KC5A 2PXJA 1CZTA 4CP0A 3QBQA 3N9PA 1OVPA 3WR0A 2B39A 1KEXA 1V6JA 1PO22 2GC3A 1QOTA 4RGGA 3KCYA 3M3IA 3ACLA 1IKQA 2R062 2ZS6B 5C8WA 1CZVA 1VRH1 4LO4B 4V2VA 5L19A 1PIV2 4TSVA 3U07A 5B4XA 3UESA 4WVVA 2XVKA 5HV4A 2KD7A 3RJ2X 2BYVE 4AHXA 3WNOA 4XAAA 4Q27A 3AZYA 4GWJA 3DKQA 1HXS2 4DRRA 1O3TA 1F4AA 2O14A 1H4HA 1OKOA 2CNAA 2DVGA 2RM22 1YC61 3SLIA 1HV1A 2XUEA 4XAEA 3O1VA 4CYDA 1HRI2 1MQTA 3KQRA 5F2SA 2DVBA 4CU8A 2WYFA 3VHNA 2CGOA 5DUWA 1YQ2A 3JB8A 4OI1A 1PGL1 5JSRA 1V6MA 1WMDA 4HKOA 4XVHA 2AREA 3GM8A 4F7ZA 2VMEA 4ZS2A 4EN0A 4EN6B 5F37A 1W0OA 4YNIA 1CZSA 4S2HA 1F9KA 1XE0A 1FAYA 4E9KA 3QACA 1HB3A 5FWEA 2WO1A 3OGJA 5FDBA 4OQ8A 3N9NA 4HVRA 2D6OX 3I2JA 3IAPA 4YVWC 2BW8A 3UGHA 1S0GA 3Q8FA 1RIRA 1UMHA 1YFXA 4WZCA 1J83A 5FOBB 1COV1 2GC2A 1C5IA 4JKMA 4NIAA 1JZ6A 4DPNA 1DU3D 3AP9A 5F6LB 1S2KA 3TEYA 1GOHA 1APNA 3NV1A 2QVSB 3PUSA 3OF1A 4LBQB 3IKWA 4J25A 4OZXA 3U14A 4D6SA 1COV3 3A0NA 2Q5TA 4XEZA 4UFJA 5F3CA 5CNAA 1J3QA 4AYUA 2YPJA 1YFWA 5FXVA 1HDKA 1AYN1 4FFHA 5JOXA 4NHKA 1CIWA 3HVDA 1JOBA 1KDMA 1S2BA 1LTEA 4K20A 3IDBB 4QX2A 2VBPA 5B2GB 4QAWA 1AYN3 2XL9A 1JTZX 5DDJ1 1JOPA 4BH9A 4HVQA 2A73B 3H3UA 1Z0HA 1F4HA 3GYDA 1RXGA 2RJ2A 1SLBA 3SEPA 3VBRC 5KXBA 4CRQA 1HRV2 5HCHA 5IW0A 2UY9A 1DLCA 2BEOA 2DTYA 5FK7A 5C4WA 1GICA 2AGSA 4CE8A 4M0HA 1X8EA 4MLOA 5H9RA 1LGBA 1G9FA 3IZOA 4K21A 3EXUA 4ATFA 3R0RA 4ASMB 4OCTA 3SQOA 1W9SA 4CP2A 1OPMA 2QKDA 3AKRA 5F5QA 4QU2A 2B9VA 5F8PA 4A7KA 2BNMA 1IQDC 2DCZA 2DF7A 5T5PA 3R4SA 2VZQA 1RYYA 3MF6A 1TZOA 4N9HA 4RHV1 4WVZA 2OYZA 3POBA 1V6KA 4BCUA 3LOBA 2VG9A 3E6BA 1CAUB 4M01A 1QMJA 2G9ZA 5IYYA 3P5BA 4XXPA 1OD5A 4HKWA 1WLDA 1W2AX 2W92A 3NSTA 3ZXGA 3RZHA 2B7YA 4FP2A 2XL7A 4GB31 4Y5TA 1EAH1 4KU7A 3T2PA 3B00A 3IPVA 5DZEA 4Y1UA 2BFUL 1FI2A 3D8CA 4FO9A 1SBFA 2WT0A 1A34A 4QPIB 1CAVB 4LK7A 3K46A 4GB33 4UOJA 3VBHC 4URTA 3THPA 2JE9A 4FVVA 1CX1A 1R081 1V6OA 1VALA 5A6YA 3I3BA 2W1UA 4O9GA 1ODNA 1N3OA 1UN1A 1GNYA 1FNZA 4BQ4A 3U78A 1Y3TA 4L8QA 4LULA 1PNGA 1R083 3PJYA 3T3YA 5A6QA 3ZN6A 4UW3A 3ZSKA 5GZGA 2ARBA 4KWUA 3VBSC 4AAPA 1LHNA 1XB9A 2C5DA 5KHKA 2FBEA 3BTZA 3PHMA 4CU6A 5FLHA 1J58A 1NY71 3FFZA 2CU5A 4COVA 2C9KA 2OT7A 3LEIA 4YARA 5A33B 2AUYA 5LB6A 3QD6A 3GBGA 3NKTA 2CGPA 1S0CA 5FYBA 3U0ZA 4BPZA 3NJXA 4LIUA 4LORA 2GMEA 1RUD1 4CCOA 3RZJA 2IXJA 3U4XA 2YMZA 5ACA2 1R1A1 2DFCA 2EXIA 2YXSA 2JD9A 3BOPA 3I2HA 4XJUA 4CCLA 1H0BA 4DXTA 4XUQA 3VBUC 3BOWA 2ZCWA 5FR3A 2B42B 3ETQA 1S0BA 4AVAA 2DCJA 3K3NA 3MI8A 4ZXEA 3WG1A 2PAKA 2BBAA 3ZFFB 1FX5A 3HT2A 1GYKA 1SQ4A 5J7MA 5KHIA 2K9ZA 1XE7A 5L9VA 1ZBE1 4IEOA 3BUCA 3HR9A 1TE1B 1QDCA 4RSUA 3B9IA 1JODA 4TN7A 2WAAA 2ZGNA 4IV1A 4NN0A 5C3SA 2QQIA 2G1MA 2V5YA 4DFSA 1WD4A 2VMDA 1ZBA2 1ZBE3 2JDNA 3AP6A 3KSCA 2GNTA 4FBFA 3UNPA 2W08A 1ZRDA 5GLUA 3WDUA 1RUG1 4DY3A 3A0KA 3M8LA 4MXVA 4BK5A 3UL2A 1Q8QA 2J42A 5F2WA 1OD3A 4XJ8A 4CVUA 1G9BA 3DYMA 3POSA 1DGWA 4XFGA 3WXPA 2VZOA 3CJXA 4N43B 3ZKUA 2FD8A 3D0SA 4IERA 3UJOA 4BIFA 1X7NA 5IJRA 1Y43B 3T30A 2D40A 1EPWA 1W9WA 2WL1A 4PDWB 4D8MA 3AYCA 3DKWA 4NE9A 1J84A 3KV9A 2FDFA 5FKCA 1DQ4A 4QM8A 3W21A 2D43A 4MO3M 2CDPA 2C9AA 4ASKA 2QQLA 2TEPA 3L2YA 4N7UA 4UI9L 3ZR6A 1YI9A 4JHTA 4ONUA 5IVFA 1G9DA 1GSLA 3PIJA 5SV8A 1A8MA 2VZPA 2ZHNA 2R6QA 1GZWB 4GJYA 4DXZA 4NRPA 1MQTC 3LA2A 4AFDA 4CDQB 3ZSMA 5JSPA 2AENA 1GR3A 2V5DA 3O1PA 4TYSA 3GCXA 3I3EA 5T5JA 3C7GA 1RITA 4D7TA 1PO11 1IKPA 5A3TA 2LM3A 1AYM2 1OVSA 1VBB2 3B7MA 3LEMA 4Q1RA 4JGZB 4XFHA 2D5HA 5FYTA 3SC7X 2YYOA 3WUCA 2DWRA 1MS1A 1W6MA 1K5MA 3DGTA 3DECA 3VDAA 2R1DA 3UKNA 3MUY1 4HPKA 3SH5A 3IT8A 3J7HA 4BXFA 5DUUA 2F4PA 1SHWB 4YLZA 5DN2A 4RR3A 4Q4Y2 4MGIE 4XW3A 2JIGA 3KM5A 4QXKA 3GZUC 3ACGA 1O3QA 1MS0A 2YUEA 1OQ1A 4LEJA 4QDSA 4Q8LA 1W05A 3T08A 2OZ6A 1X82A 3M1HA 3DYPA 3VLBB 1XXNA 5GZCA 4Y3OA 5FPLA 2WIIB 3CDZB 1YQ5A 1LENA 3WCSA 3OPZA 3NNLA 4META 3KVAA 3ZPOA 4LJHA 1YYNA 5HV0A 3RWKX 4QXBA 3H8OA 1XOYA 2XJSA 3E97A 4QD2A 1ULFA 3M3QA 4LBJA 1V6NA 1MQTB 4E8CA 1DCSA 1YQCA 2PA7A 2R0FA 2Q1FA 1ZX5A 3RJRA 1UNBA 2UWCA 2Y0OA 4FSJA 2A3XA 2QZ3A 2RR13 2ZTNA 5FZ9A 3O5SA 4B4QA 2OQ7A 2P3JA 4RQPB 1AF9A 1YHFA 5FMOS 1DDLA 5IVEA 1AR81 5E6HA 3TEXA 3CZJA 4CP1A 5AFEA 3BTXA 3Q8CA 1PZ8A 4L0PA 3B94A 4M3CB 2EAKA 3ZIXA 5C4WC 1KRIA 4Q1PA 5L9BA 3VKMA 1D4VB 3FMGA 2HBTA 1AX2A 1BMV1 4A2UA 3KT1A 3T2TA 2QQKA 5LASA 5IFPA 3O1OA 4M00A 1TNFA 4W50A 3E6CC 1R091 5T52A 4MX3A 3MYXA 2MEV2 1KS5A 4HL0A 3OJBA 4WV8A 4LLFA 3ZSLA 2OVUA 1DZRA 4LIVA 2VQTA 4EQVA 4NOTA 1R093 1TEIA 2WRAA 4Y20A 4BMEA 1GV9A 1OT5A 1Q8VA 2O1QA 4S2GA 3OUHA 2GH8A 3I59B 2JICA 4IE4A 1XNBA 5LRSA 1ULEA 4FT8A 4HG6B 1O7FA 5F3IA 5J96B 1NLRA 5FMDA 4PIZA 4IE5A 4WM7A 4ET7A 3NNJA 2RS32 4KI5M 4YYOA 5JZGB 3OBAA 2ZEZA 2NPIA 1OPOA 2HWD1 2KM2A 2ZGKA 3QH7A 2WSUA 2YC0A 1GQPA 1NYWA 1OXCA 1PVC2 2ORXA 4Y24A 1GLHA 4QKBA 1BEV2 3FBMA 4KNCA 2FCVA 3WEZA 1X8MA 5FLJA 1HB2A 2WINB 4A41A 1VMHA 5BNQA 4EWAA 2VMCA 4WM8A 1SPPA 2ZMLA 4FPJA 1FPN3 4D7SA 5IAXA 4UF0B 3VL9A 5LA0A 4KG8A 1N1YA 4INDA 2G9FA 4Y22A 2VQ0A 3WF2A 4EWEA 3TYJA 1POV1 1NKGA 1W6QA 3Q8AA 1I5ZA 4JV4A 3D3AA 3P6BA 4QQPA 4TZDA 3B01A 2ZAAA 3M4FA 1NT0A 4CUAA 1J1LA 3N3HA 4MG2A 3AMQA 1POV3 3KCCA 2XHNA 1WKYA 4GA9A 2X05A 3IN9A 2MPFA 3JBG1 2YB7A 1QXRA 5L73A 2OUJA 3WP6A 4AI0A 4CA9A 2VZSA 3IPVB 3NJVA 5KC6A 3TNPB 1UY4A 1JYIA 4Q4X2 4YW6A 5F3EA 1LESA 1QJY1 2ZEYA 5KWRA 2X53S 3WP4A 4E4DX 3WOGA 1ALYA 4LBMA 2CTVA 4M4PA 4NUBA 2R16A 4XQ4A 4IV1C 4DQAA 5L36A 1RUJ1 3OY8B 1G9AA 5EIYB 5D21A 2WWSA 2VOTA 4D0QA 1H30A 4OHYA 2JWPA 3AP7A 1WMXA 4LTAA 3VBFA 4P00B 2QNKA 2XWJB 2Y38A 4Y1XA 1P8JA 1GQGA 4CDXB 3LA7A 5FYHA 4LPLA 3KB5A 5FZFA 4XACA 2PHFA 4H2AA 3VKNA 1LHOA 5FZOB 4BK4A 4ES8A 4RN5A 1QF3A 2E51A 1NA1B 1WCDJ 2WZR1 2XLFA 4NIDA 1FMD1 2IXKA 1AL22 1IG3A 1POV0 1RHI1 1REDA 2EXHA 2RJKA 3I3QA 4FPFA 4GWMA 4Y4YA 5E89A 3U37A 2GNBA 2RDNA 4A3ZA 2UU8A 1QWRA 2VOXA 2WZR3 1W8NA 4NWVA 1BCXA 4QXCA 2HEYF 1FMD3 2HWB2 1RHI3 3HNMA 2VZRA 3K77A 1VBD1 5FPVA 3V0AB 1WCUA 4GZ9A 5DXDA 1NX9A 2JB4A 1CAWB 2WDBA 2PLV1 3JB4C 4OZOA 2D97A 1UU4A 3IDCB 1VBD3 4IUGA 1S0IA 1V70A 1NZCA 2Y26A 4YVSB 5CKNA 1S0FA 3I3MA 1NCQB 5LATA 4BMBA 5ANQA 1YQ6A 1OLMA 5LWBA 2VXJA 3TN92 5CG9A 1XNTA 5T3NA 5CKMA 3RYPA 5LZ6A 1OI6A 4IW3A 1IG0A 4Q4W1 4XE9A 3AB0A 3GCWA 4PBOA 4XETA 4W6WA 1DYPA 3N9MA 1DQ5A 2A3YA 3M2MA 4FAGA 4AI2A 3IBMA 2XKPA 4Q4W3 2E63A 4NHYA 1K5MC 1LRHA 1MS8A 2ZZJA 5HCBA 1ST8A 5LRRA 3T1LA 4PF1A 2W1WA 4YM1A 4E4HA 3FLTA 5A3MA 5JXHA 2PHXA 2FDGA 4RR3C 3KWVA 3OEBA 1QOOA 1VBE1 2VCMA 4MGZE 4XPVA 4N53B 5FZ0A 1RUE2 2ZKNA 2RS52 3JD72 2RS13 5FXWA 1W9FA 2XDVA 5I8TA 1YIPA 5EV7A 2QUOA 2HWC1 4B8EA 1GNZA 2VAUA 2ZHLA 5A3UA 1CQ9A 1BLZA 1H9WA 1K45A 2C0ZA 1BYHA 3JQXA 3CBNA 1I1EA 2F17A 4FPCA 2ET1A 2FMDA 3M3EA 3MO4A 2HWC3 2N7GA 1ENSA 2DDUA 3A4UA 5CG8A 1SLLA 1RUF1 2WABA 3KV5A 3IWZA 1D2SA 2BOJA 4SLIA 4AGRA 5FYIA 1MZ6A 3A23A 3E1F1 5KHGA 1ACCA 3ZXJA 3E6DA 4LUMA 5GZEA 3MIFA 4FI9A 1CAUA 1JZ4A 4W4ZA 4Y5Z0 2JE8A 2QQVA 1RUF3 5A7NA 2PAEA 2VC9A 2ZXQA 5T50A 1ASJ1 2WUHA 3DCQA 4HANA 2Q1ZB 2SLIA 3OGSA 1M06G 3RPQA 2WFF1 2HWE1 4MGKE 4QPIA 1ASJ3 1WW5A 4BQYA 2K46A 3VN4A 2ZX0A 3ITQA 2NM1A 3FUOA 2DUQA 5A1FA 1AR72 2EA7A 1J1TA 1ZA4A 1KJRA 5IWFA 2HWE3 5IVVA 4HN0A 1ULPA 2ERFA 4XZUG 4UWDA 4CCDA 1WBLA 2OXBA 2P6HA 2VBBA 1UPIA 4LBLA 4AAXA 3I3DA 2JKBA 4QMAA 3FLPA 4EN9B 3GHNA 4YM2A 4ZZ5A 3WZ1A 1C28A 1CD3G 1VAKA 4YFWA 5A33A 1OF3A 5FOJB 1DGRN 1SACA 5IK4A 1W90A 3C3VA 4XBLA 1HW5A 5C7GA 2LS6A 4K40A 4WM7C 4C0HA 4BQ1A 3C7EA 3ROUA 1FOD3 4XJZA 4AFMA 5IHRA 3MIEA 3I2KA 1IZ3A 2UWAA 3N7KA 4FPHA 4R9AA 3ZFGB 4AEJA 1LULA 4LHSA 2BU9A 3BIEA 2QFEA 1IPSA 1YJKA 4BJ0A 1W0NA 2VULA 2ILMA 2FZ1A 3S5QA 5J09A 2H6BA 1DQ2A 1WA4A 2RMU1 1CWPA 4RA0A 2V72A 4GKYA 2WC2A 3NNGA 1Q8SA 3NKGA 5H9QA 4LA3A 4MV2A 4XTMA 4AI9A 5JXJA 1IS3A 1PHMA 2VTXJ 4R52A 3ZFFA 1QKQA 2J22A 1DQ6A 3PTRB 1W04A 4XXAA 3UJQA 4BB3A 2YBKA 3USUA 2D93A 1H1AA 2C24A 1KGYA 4NRMA 1UY0A 2QQJA 1DGWX 3AL5A 5J3UA 1UY2A 4WM8C 1RUH1 3RZGA 3QOPA 4X8NA 5FZBA 1E5HA 3MPPG 1IPJA 5DG1A 5LBFA 2OX0A 4Y1ZA 4P5YA 4XF4A 2D44A 1RUH3 1AR61 2VMHA 3ZFEB 3K4DA 5FP9A 1TMF1 3WW1A 4V1PA 3ZR5A 2GC0A 3AYEA 3ZIWA 5DQ0A 2GP5A 2PHWA 4N43A 4PCRA 1AR63 3VL8A 2WLPA 1TME2 4ZU7A 3BYWA 1Q3EA 1TMF3 1W2NA 1JMUB 2JG9A 4GQ7A 3WDYA 1WW6A 5FQ0B 1LJ7A 4AE2A 2ZAHA 4PDWA 1RINA 4DEQA 3WDTA 3VHRA 3HN1A 3ILFA 4XJWA 2JG8B 4P9XA 1W6NB 1COV2 4P08A 1AX0A 1WMFA 3AP5A 1PGW2 4AGVA 2VU9A 2DYCA 2J1RA 4B29A 1N1VA 5F5CA 3I2DA 3H8XA 4EYUA 4XUOA 4C0BA 3QH6A 1SLIA 4IXLA 2Q8CA 4E4ZA 5DUXA 4P14A 1OQEA 1ZYBA 2AR6A 2JXAA 4QGNA 1OA2A 5FCCA 3B3QE 2BGCA 4CDQA 1QJU1 3S57A 2VVEA 3VBFC 1IQAA 5ABJB 1AYN2 1DQ1A 1CAXB 1JU4A 5A3OA 1PX3A 4E8DA 3WP5A 1WLTA 2NZ9A 5K0UB 3DYOA 4O65A 1QJU3 4KH9A 4BQWA 5JOZA 1D4M1 1HIXA 5EPAA 4AHZA 3RZZA 5GJ6A 2X5IA 3FLRA 4JGZA 5F5IA 1QY4A 1V6IA 3WINE 2KXLA 1YIFA 4AOCA 3DF0A 1JZ5A 2ZJCA 4QQHA 2E26A 4QXHA 3H0OA 5JAXA 4I09A 1F5JA 1TVGA 4J6GA 4NPMA 4OMCA 3ZVXA 1UIKA 1CN1A 3VZJA 3BKZA 1KD7A 2FMYA 5LA2A 2C4XA 4Q29A 3BI3A 4BOWA 2CYFA 3POWA 1ENQA 4XF0A 3T09A 3W5MA 3O0XA 2ET7A 3ZYGA 5A1AA 1UQXA 4HT1T 4DO0A 1RC6A 1V9U1 1T6BX 3L9JT 4XIOA 1I9RA 2G4IA 4FPYA 2GU9A 1VIWB 3DXUA 3SXWA 4ZZ8A 4X6QB 1QOSA 1V9U3 2P6CA 2QQMA 4FPOB 2HLEA 4FPGA 4M4RA 4CSWA 4XF1A 1VRH3 2D6KA 4YZ4A 4D6QA 3OPWA 1G8WA 2WZ8A 5EXOA 3ECQA 1XNCA 2NQYA 3IMNA 2WQ8A 2Y0IA 4MYEA 4HMZA 5FREA 3SITA 4GB32 3MFAA 3X29B 2HEWF 1VBA1 4QX3A 1UYPA 2MNGA 5I0TA 3UT0A 3D5OA 3VBFB 3HD8B 1JYXA 3E5UA 2E7TA 1BBT1 4FTSA 2K2SA 1K3IA 4ISRA 2C1FA 3CL1A 2A1XA 2QQWA 4RQPA 1VBA3 2PHDA 5FY1A 2WWJA 3RNSA 1R082 5FLIA 4DXRA 3OYWB 1BBT3 4OYUA 1JS9A 2TNFA 4M3CA 5CYYA 4YWAA 4Y1YA 5CKQA 1KITA 4Q0QA 1LHUA 2VECA 1STMA 3LB9A 1F31A 1JUIA 1ZZCA 4FQZA 4FOWA 5FZKA 4AK3A 4DMIA 5F9TA 2ZX2A 3AFKA 2B9UA 4FCAA 5D8AB 3CEWA 4JQRA 5DG2A 3KMHA 4EE2A 4PI2A 3M7AA 1MS5A 2XQXA 1EV11 3PURA 3ZPYA 4HSJA 2QCSB 2CDOA 4MH0E 1CR7A 2GNMA 4OUMA 3S7EA 5AC91 5A6ZA 4R8HA 4CZSA 3HT1A 3N36A 4XYXA 1EV13 5G05L 3LFIA 3I59A 2VL4A 4CCNA 1O5LA 3GHMA 4FPLA 4BLIA 4D6RA 4UFLA 1FYUA 1BHGA 4JQTA 4S2DA 1TG7A 4CUBA 1BVVA 1VMFA 3DPRB 4CDUB 4CCEA 3B69A 1W6PA 5JZGA 4QPIC 1O3RA 1PGSA 4Q4V1 1ZA7A 2G9GA 2VOKA 4CXWA 3VHPA 2JB8A 1W3VA 5T5OA 2RVAA 2XVGA 3WSOA 2XJUA 1BVP1 3MIHA 1VMJA 3J8F1 1ZBE2 4OUSA 1W99A 1UYXA 1ENRA 1NUKA 1ZZ8A 4Q4V3 5CFCB 3ZM8A 3GJBA 5DDJ3 2IXHA 1ONAA 4XABA 1VPHA 2WAOA 5FP7A 1OUSA 3KHCA 4K1ZA 1UU5A 1B09A 3LWCA 3O0WA 3FHAA 2QZ2A 4IE6A 1KJLA 1F5FA 3AXDA 4P9JA 4I0BA 3GDBA 4G9SB 3LEGA 4UF0A 1IHMA 4XUTA 2WNVA 1Y9QA 4OVEA 3CZUA 2QBXA 1QGLA 4JTNA 1AHSA 2OZJA 1UZYA 3AJYA 3N9QA 4B4PA 3GNEA 1UOGA 2EIGA 3AMPA 4R4ZA 5C6CA 4Y4RA 4IE0A 3H7YA 2FZ2A 1HLCA 3S30A 4I01A 4P5HA 4YW3A 2ETEA 4BA6A 4XFAA 3FHQA 1H8TB 2IFRA 4RHV3 5E1RA 5LY2A 4AHWA 5DPNA 2ID4A 5LY1A 4F3JA 2BGPA 1J3PA 2R061 1A78A 1PM4A 3PUIA 3ZFFC 2NMNA 2E6VA 2XJQA 2P4EA 1VRBA 1L7LA 3WQBA 4QU1A 1EAH3 1URXA 2P17A 1WGPA 1U0AA 1UY1A 1CESA 4HKLA 4PT6A 2LW8A 3FN9A 3ZYJB 1HXS1 3N7JA 5GLTA 4CU9A 2JJ6A 3OY8A 4HVOA 4QKNA 3L2HA 4H14A 3T0DA 2VBDA 3ST7A 3MHZA 5EQUA 1ODMA 1H4GA 1WWYA 2Y6KA 4IEZA 2XPJA 1OFNA 1U5XA 2XUMA 3POJA 4CDXA 1JN2P 3OOXA 2VW2A 1SLAA 1UMZA 4GMP0 5FZOA 5A7OA 5C70A 1SEFA 1NA1A 2GALA 4N43C 4XDPA 1US2A 1S0EA 1LOCA 3B9CA 1MEC2 2JG9C 4XHBA 3AKSA 3AP4A 2E53A 2VPVA 4PDWC 2DVFA 2GZWA 3O1RA 2O0OA 3BU7A 4IV3B 4I3GA 5IVJA 5AVAA 3WVJA 3VD5A 5GLWA 4AG4A 5C3QA 2A5ZA 1GKBA 2EIBA 3U11A 1RUD3 3RFRA 3V0AA 3VZMA 3O1SA 4FFFA 3VD9A 1CAWA 1R1A3 5TSWA 1ND2B 1SLTA 3LDBA 4UXAA 2FDHA 5APAA 1L7RA 2BV4A 1RUC1 2I45A 3ZYIB 4CDQC 1K12A 4YVSA 4CDWA 5FZDA 3AL6A 1NCQA 5FAXA 2LRPA 4FTBA 5CB7A 3USUB 2HJIA 2RR12 1YRZA 4GH4B 1RUC3 5BY5A 5C8CA 3EMRA 1UYYA 3MLLA 1CIYA 3PTYA 5C3PA 1BQPA 4EN8B 3O1UA 1NXD1 2X5IC 4JGZC 5I0RA 2OPWA 4WVMA 1JHJA 4I30A 4BIOA 1NLSA 2IVJA 3NJYA 1XU1A 2AYHA 2E31A 5KBFA 1X33A 5FY5A 4Q0UA 4MGYE 3VBOB 5BV6A 2W94A 2YGMA 3I4IA 1NCRB 5FZ4A 3WW3A 5JLVA 2VJXA 5IK8A 5FMCA 5DMYA 5FZ6A 5FY0A 1F15A 1RUG3 4N53A 2WKKA 3WNMA 4TWTA 1BMV2 1HRV1 3LSDA 4QKFA 4YRDA 2JG9B 3RRDA 3D4KA 1C4RA 3RWNA 1QJFA 2RDSA 4L11A 5FZ8A 4IGPA 1CONA 1R092 1QQP1 4QT6A 1HRV3 5EHDA 3ILRA 4AVBA 2GN3A 3E5QA 5JR2A 4B3NA 1K5JA 3T4VA 4K3UA 2A3WA 1LOAA 2W52A 3NAPB 1GP6A 2VH9A 5CIRA 1QQP3 3NNFA 3OBTA 5LW9A 1OQDA 3WF3A 3ACHA 1GP4A 1JYNA 4QGMA 1C57A 4UFHA 4XUNA 1DG6A 1N3QA 3PVNA 2GC1A 4PF5A 5LBBA 5FZ7A 3WLUA 2KA3A 2VNGA 3BPSA 1HJFA 2AZ5A 4LT5A 4RQPC 3Q8EA 1QEXA 2WS92 3CJIB 3ENRA 1H2NA 1UZZA 2X5IB 2ARCA 5F6KA 2FHRA 2ADDA 4BXSV 1PO13 2ADEA 2EXKA 5DAPA 5K4LA 4O61A 1J3RA 1HN1A 1JW6A 3LA3A 1PVXA 4LQRA 3WHUA 2EAAA 1SFYA 1Q8PA 4ZU4A 1IGOA 3PVBB 1FPN2 3UKTA 4H7MA 2Z69A 4FXGB 1FXZA 3B93A 5JMOA 3MBWA 4AWDA 3LAGA 4W65A 3MF9A 3PNAA 4FP3A 1SBEA 1W03A 3PIGA 2R041 1T2XA 4KWLA 3PMSA 4QX5A 3LGRA 1RTVA 5DZGA 2Z79A 4JDNA 4COUA 2VTXA 4OHWA 4Y5SA 4MADA 1O8SA 1NQJA 5H9PA 5T5LA 4EZ4A 1S4CA 5C71A 4Y26A 3GF6A 2R043 3INAA 4HN1A 2BJSA 4JGYB 4A6OA 2XMLA 5IFTA 2TUNA 3ZYRA 2J1VA 2F4LA 2WLQA 5EJ1B 5JZGC 1NAEA 2VOWA 2P1BA 3RVHA 3VDCA 3ZFGA 2HH9A 4XURA 3H1WA 4NAOA 4XQDA 3MPBA 4KL1A 5ACA1 3EO6A 3ACFA 3I2FA 3R4DB 1AR91 2CAUA 3NV3A 5F1RA 1ZZBA 2X29A 1GQHA 2BWAA 2A75A 5LEKA 2P34A 2EICA 2FQPA 2VVDA 2Y34A 4NR1A 1SG3A 5FO7B 3WF1A 1YNAA 1AR93 1N3PA 4GALA 4TTGA 3A22A 5J1XA 1QNWA 4EV0A 5C5TA 4LBQD 2EIEA 2CGNA 1AR83 2CHHA 5I93A 1ZZ9A 2XR4A 1B35A 3VD7A 2Z42A 3W9AA 4JDOA 2BNNA 4S2FA 2WNVC 3OB8A 2VR4A 5JXGA 5FPZA 5HCFA 1VBC1 3LD8A 2VNOA 2D6NA 2IFWA 1YFYA 2WZR2 2XJPA 1YO8A 5FP4A 1W8OA 5GZDA 1FMD2 4I02A 3ZXLA 1RHI2 3J7LA 1QXPA 1VBC3 5E88A 1REFA 4ZU5A 5JIAA 1L3JA 4EROA 5FP3A 1H2LA 1UO9A 3H1MA 5FQ0A 2W87A 1LU2A 1QJX1 2XBO1 1O5UA 2ZGPA 3M3CA 1PZ7A 1VBD2 2B5HA 2JG8A 5CFDB 1RUOA 1W6NA 1W6PB 3H42B 1OMIA 3WV6A 2DVDA 3AFGA 1DZTA 2WT2A 3TRSB 1QJX3 2XBO3 3DN7A 1BK0A 5JR7B 2Q8DA 1GWKA 2HWD3 2GMPA 2LTNA 3TNQA 5IVCA 5D2AA 4LK6A 1HQNA 2ES3A 1EY2A 2ARAA 3A21A 4P9WA 5BPXA 2WT1A 2P3KA 3MLKA 4Q4W2 5ABJA 1CAXA 1MS9A 3B02A 4Z8BA 4YW4A 5C9AB 2Y6GA 3CKHA 4CCJA 4UW4A 3IB3A 4CDXC 5K0UA 3GJAA 1YWKA 4MZUA 3PDQA 3O0VA 3LE0A 2PTMA 1YQ8A 2YBSA 5JI7A 1NA1C 1US3A 1WMEA 2GP3A 3NJZA 1YUDA 2WNVB 3URFA 2RS12 3IM0A 4CEYB 5IK7A 2Y6FA 5EP9A 4OHZA 4Z2WA 4GULA 3ZDVA 4I0AA 2YFZA 5SV5A 5FZ1A 3FFQA 2JDYA 5K9YA 5FY9A 3ZYBA 1HQLA 1JYWA 3WX5A 2V09A 3WHTA 5IT6A 4Z92B 2D3SA 2IWGB 3W20A 2BZDA 3R05A 4LKDA 4QQOA 2HWF1 4CP9B 2ZX3A 2VQAA 2YPDA 2HWC2 4ES9A 5I91A 4Q4Y1 2ZMNA 3OGGA 2EF6A 4AXOA 4AHYA 4DZGA 4BISA 3ES4A 4CDWC 4Q0VA 2HWF3 4YVSC 1SMVA 2NN8A 1NCQC 3JBG3 4Q4Y3 5GZFA 2BVBA 4OULA 1RUF2 5FZHA 2VMIA 4QM9A 1GU3A 3RZKA 3MDPA 3NVCA 4Z82A 5C8CC 5JCTA 3OPTA 2GAUA 1QJY3 1XSRA 1OHFA 5LA1A 2OA2A 3H8UA 2J1TA 3JU9A 1ASJ2 5CEHA 4QWNA 2KR2A 1RUJ3 1QNYA 3IMMA 2PHTA 4MGSA 5FRAA 5FZEA 1Y9MA 3GZEA 2HWE2 1LCLA 5EWSA 4O7XA 3WNLA 2B4KA 4KQ7A 5CU1A 2VQUA 4HETA 1DYKA 3ON7A 3WDXA 2OPKA 2R7EB 2W91A 3OYWA 1PZ9A 4UFKA 4N53C 5FZAA 5A7QA 2XJTA 2IZWA 3MICA 3GGLA 2BBVA 3LSEA 4EJRA 4KGGA 1WUVA 1PX4A 2WWUA 3J26N 5I0DA 3AVRA 4GJZA 2BFUS 2YC2A 3ME2A 3NWKA 3ZXKA 1ZRFA 5D8AA 1UKGA 3LCPA 4HSLA 4GWIA 1ULOA 4BU2A 1LGCA 2I74A 1HX6A 2YGLA 1FOD2 3OUIA 2OW4A 5G04L 3W59A 4NROA 4QDRA 1ZZ7A 4UT5A 4CPBD 5BNOB 1LOBA 3PU8A 4UBHA 4AEDB 3VD4A 1UD1A 2ZABA 3O1TA 3VKFC 1IS6A 2PLV3 3GBWA 2TBVA 3R6SA 4IGQA 2IVIB 4D69A 5C8CB 5K7PA 3WNNA 4MUVA 2VMGA 3HMYA 2ZEXA 4CDUA 3DPRA 4OLLA 5JI9A 1EUTA 4WVMB 3V65A 2V4VA 4LBKA 1KFXL 2ZHKA 2RS31 3KLSA 4ZPIA 3SCFA 5LK7B 3TEWA 5FY7A 2PAMA 2WFPA 1FATA 4JAAA 4XZPA 5T54A 3VZKA 3ZYHA 1UAIA 5A32B 3TB0A 3WG3A 4B4RA 4RD7A 4E4SA 3ZXEA 1LHWA 4R9DA 1PVC1 2D98A 5FKBA 5CFCA 3ILNA 2EALA 2P5BA 5FZLA 5CADA 3THDA 5F32A 4XTPA 1BEV1 3ETPA 4YZ3A 3N4MA 1RUH2 4JKLA 5F7UA 2W1SA 3KS7A 1WCQA 3SNMA 1PVC3 1NE6A 1VBE3 2YU1A 4AQSA 1QDOA 1XBFA 3AKPA 3F95A 3KGLA 4IEPA 3ZDSA 4CTEA 1AJOA 4UYBA 1AR62 2HYKA 3JCIA 4YGEA 4KU8A 3WG4A 1W8FA 4Q5OA 1H9PA 1WW7A 3NMBA 1PMIA 1OOPB 3OBZA 2ORZA 2WO3A 2ATFA 5LA9A 1QU0A 3AMNA 1NXMA 2CY6A 4QHBA 3ZFGC 3HQXA 3IDAA 1DGLA 1OFSA 3AZZA 1RVF1 4D3WA 1ZRRA 4YG0A 3H50A 1MPXA 1H8TA 4L9BA 1Z7S2 3FL7A 2JEMA 1PK6B 2UY8A 4AFCA 4R4XA 3JUUA 4NHXA 1JI6A 1RVF3 2ZOEB 3WF0A 4YW2A 4XF9A 1D7PM 2H0VA 3HQUA 1UCXA 1BK1A 2XHKA 5IVYA 4RL7A 4ZS3A 1JBCA 1OUXA 1LEDA 4H3WA 5A3PA 1QJU2 2WFF3 4MGQA 1S55A 2VW1A 1B35C 5A7SA 1O8PA 2W39A 3CIHA 3LIGA 3MFCA 4GXLA 3U1XA 4B7EA 2Y33A 4AEKA 4WVWA 3N9OA 5GLZA 2JE7A 5J98B 3C7FA 3ZYPA 5L7OB 3ZMOA 2DVAA 1UIJA 3ZFEC 3K51A 5EYXA 4YZ5A 3AYDA 4LHLA 2J7MA 2PN5A 3PU3A 4AVCA 3PVOA 1XYNA 1CX4A 4N90A 4ZONA 2J1UA 5JSOA 1O3SA 4I2OA 3OCPA 4NHLA 1I6XA 4V2WA 5J37A 5JPNB 3ES1A 1GOFA 2W1QA 4ITCA 5FXXA 1UX6A 2P3IA 3PL0A 4LNVA 3RZLA 4FPEA 2A6ZA 4W6YA 4IV3A 2JG8C 2BRTA 4IESA 1V9U2 4DNYA 1N47A 4CPBA 4YGCA 1UZWA 2Q0AA 2RV9A 2UWBA 2XVLA 2YDEA 4FQ4A 1VRH2 2PQSA 3RSJA 4UFIA 3VKOA 3AZXA 2W2IA 3KVBA 3H3LA 2AACA 2X10A 2VCCA 2WYSA 3LQCA 1ND2A 4M0NA 4C1XA 4URAA 1NE4A 1CJDA 1HJGA 3HWJA 4PLMA 1NZIA 1UOFA 5ABJC 2RMU3 3MLJA 3TOJA 4BQ5A 5KXDA 3BPZA 2D3PA 2WJSA 2O8QA 4XBNA 3CU7A 4GH4A 5DAXA 5K0UC 1I5PA 1SZBA 3BCWA 1VBA2 5M0TA 1B35B 1ND3A 5BNNB 1PNFA 3RI9A 1BBT2 2W95A 1PGL2 2IUWA 5FZIA 2H0BA 4KWJA 5HXVA 3HNBM 3GZTB 5AVPA 3LEKA 5A7WB 1DZQA 3AZVA 3LPGA 3VBOA 4QX7A 3V0BB 5LEJA 1NCRA 2Y60A 2A70A 4IEYA 4AQ2A 4FFGA 1W9TA 4PHZA 1HQWA 4OQ9A 1PM7A 1UZVA 2NYYA 5IATA 3NV2A 3I7DA 4FFIA 5FZCA 2K0GA 4H55A 4H7LA 2WNOA 5FYVA 2QQNA 3S7IA 4F83A 3BN6A 5A6XA 3O14A 4GWNA 4MHUA 1WCSA 1OC1A 1YFUA 2VZ1A 4NVPA 4UBGA 4YM0A 4QB6A 4RGAA 1AXYA 1EV12 4Q2FA 2R30A 1SLCA 3AXEA 1PMJX 3RYKA 4DOUA 4YSFA 4AF9A 3NAPA 2DUOA 2PMWB 1E5RA 4E2SA 3KV6A 2XWBB 2EXJA 2FDJA 2WO7A 4XOGA 4R9CA 4QX0A 5FZGA 3SCHA 5FJHA 5EZWA 4DEVA 3CLPA 1H2MA 4D94A 1R1ZA 2A6VA 1DP0A 4GAZA 4OI4A 2XJRA 1UF2C 4JDMA 5A80A 4KBBA 4OMDA 1VAMA 3FBYA 1VB4A 1LKNA 2E7QA 4RFRB 2BVVA 4C1WA 4Q4V2 4AQTA 4XIKA 3CJIA 1E57A 3I97A 1JYVA 3S0MA 3MIBA 5DDJ2 1NLQA 1JH5A 3KV4A 4YG6A 3J7NA 1OF4A 2JIJA 1EYBA 2ENRA 4PQ9A 4G3YC 4K1YA 1JZ2A 1MS3A 1D4M3 5EFUA 3AJZA 4SBVA 1SDWA 1DF0A 2PHUA 2XLGA 1X9TA 1AR71 3BB6A 4N8MA 4A4AA 4L2NA 5BXXA 3VDDA 5D8AC 1C8M1 1H1MA 2WNUB 3P1IA 4Q0PA 3MGUA 2R0HA 1RUI1 4OI2A 2ZEWA 2YBPA 1UX7A 5FO9B 4QPGB 1VLNA 1C8M3 1D0GA 4TLFA 2W3JA 3LFMA 1AL0G 2Z5WA 4K9SA 4IL7A 4RS5B 2R071 1RUI3 2DU0A 2DUPA 4RHV2 5FMOL 3N9LA 4JGYA 4JRAA 4NAMA 3LKJA 1H8VA 4LO7A 3GBFA 1U12A 5LBEA 4KWKA 4LR4A 4CDUC 3DPRC 4B1LA 3LPFA 2AEYA 2WSVA 2D5FA 2R073 3K4AA 4HZFA 4L92A 4JC1A 3IIIA 1EAH2 3GZAA 3K75B 4R9BA 4XF3A 3C7HA 1QIQA 2JDUA 5ISLA 2YZ4A 3FJSA 2SBAA 3T0AA 3NNMA 5JUVA 5F5AA 2G19A 5CFCC 4XHXA 3OSDA 2W9XA 4BDVB 2WN3A 3JZVA 4MHRA 5FYYA 2VGDA 1UU6A 2W47A 1F2NA 5FIXA 2ZZQA 4LO6B 4KG0A 2H6CA 2WA4A 1LNSA 2ZGUA 1LOFA 4MVTA 3KCXA 3TEZA 4QQLA 5CBLA 4PJYA 4QQ2A 2BPA2 4CCKA 1L7QA 1NY72 2VW0A 5HI0A 5L9RA 3KT7A 2DTWA 2HYXA 4HONA 5JIUA 2XH6A 3NL1A 5FPUA 1O91A 2VUJA 1LB2A 4AFBA 2XG3A 4LXLA 1HKDA 4FAHA 2I2SA 1C8NA 5FY4A 5JMCA 4ATEA 1E5IA 2ZACA 1RUD2 1VB2A 2ZGOA 4NHMA 4PQQA 4AVTA 1H8TC 5AC93 1R1A2 4L97A 1S0JA 4YW5A 1RMU1 1TME1 2A71A 4XQWA 4P9GA 1CPMA 5CFDA 5HCAA 4BE3A 1VJ2A 2XXZA 4YG3A 4YM3A 4KGQA 4NO4A 4P9LA 4CEWA 1LAJA 1RMU3 1TME3 1REEA 5LCWL 1PGW1 1RUC2 1W3XA 1W0PA 2CSGA 3UGGA 2D6PA 2QQUA 1RJ7A 3VZLA 4COZA 4XFFA 1W8ZA 5EJZB 2CV6A 5FWJA 3ZSEA 1RB8G 1RUNA 4A6SA 1UW8A 5C9AA 3J8F3 4PI0A 1HB1A 4Y33A 2ZGQA 3U4SA 1XYOA 1XNKA 5CA6A 2ZGMA 3WQ1A 4K7JA 2OS2A 1Q43A 3K48A 1RUG2 3MUZ1 1CJPA 3SH3A 3FX3A 2VNRA 4GMP1 4AFAA 3PUQA 4CEYA 2CWSA 1C3HA 2ZGSA 2GH2A 3NQHA 2VUAA 3OTFA 3ORJA 5FYUA 1KXGA 1OSGA 2WA3A 2OIIA 3K2OA 2ZA9A 4IDZA 1DLLA 3AM2A 4IV3C 3OEAA 3VZNA 5J36A 1SDDB 4GMP3 4LMFA 1GFF2 1YCIA 4XJ9A 1OURA 2ZBJA 1CGPA 3SKVA 4CP9A 1W2OA 2AC1A 2B46X 1VAVA 1F8VA 1QQP2 1U5ZA 4B7KA 4LKEA 1PO21 1ND2C 3OD0A 3AK0A 3BALA 1LODA 3RQ0A 1SBDA 4HK9A 3POGA 3NV4A 1PIV1 1VR3A 4YVWB 1GOGA 5FBJA 4LKSA 1PO23 3H9AA 1GANA 1YLLA 2C26A 5FO8B 3CF6E 3JQWA 4GH4C 2VD7A 2R063 1YI7A 2XONA 3POIA 5FV3A 3GALA 2JDPA 1PIV3 4CUGA 3DL3A 1ND3C 3AMMA 4UW6A 1DQ0A 2DCTA 3SISA 2YROA 2RM21 2V4AA 3FHIB 4BZ4A 1HXS3 4HK8A 1XQNA 4UAPA 1HRI1 1HB4A 1AUYA 1PO12 4EZHA 2D6LX 3VBOC 4A42A 5IVBA 1OLRA 1GBGA 1NCRC 4AI1A 2Y64A 2RM23 3WNXA 2QQPA 4AI3A 4DB5A 1HRI3 4Q8KA 4L99A 5H9SA 4XDQA 2UYBA 4PBPA 1JZ7A 3J9SA 2V73A 1Y9GA 1LHVA 2VE1A 3VBRB 5FZ3A 3AVSA 1W2UA 3HEIA 3P3PA 1RXFA 4NWWA 4QX1A 5A1LA 4OHXA 2R042 2BWCA 3NAPC 1OKQA 2GMMA 3IAQA 4JHZA 4LBOA 3NO8A 3HNYM 4U2AA 5IAVA 5EJ3A 4EWDA 4YZ2A 3NW4A 5CZKA 3HJRA 3UV9A 5FYCA 5HBAA 5E8AA 4COWA 2E9QA 3OUJA 5A70A 1HN0A 5BNOA 1O6UA 4AEDA 4ARYA 2P3YA 2PELA 3O7OA 5GM0A 1GWMA 2FDIA 4Q0SA 1XRUA 3OGRA 4HLTA 2E33A 1W9YA 4MOAA 2BUKA 5EYYA 2DCYA 3CJIC 1EUUA 1ND3B 1UPSA 1VP6A 3G6JB 3WCRA 2XLAA 3T4HB 1AR92 4G4FA 2PHRA 2XB6C 2OUHA 4O9EA 1AR82 1XNDA 1XC6A 3D0JA 4YW7A 2JECA 4WZFA 3W58A 5A32A 4N7IA 1C1FA 1OH3A 1Y4WA 2EVXA 4BM8A 3B5LB 1O4ZA 1QJEA 3VBHB 3VDDC 4AEMA 3U10A 5BNPA 3RG0A 1UYZA 4Z07A 1N1SA 3W5NA 3IIAA 3T1MA 4RGKA 1KQRA 3VD3A 1VBC2 3VZOA 3R4UA 3M70A 5FP8A 2IXIA 4AVSA 5DABA 1LECA 3UKVA 3VBSB 3WG2A 4MXWB 4JGYC 2VM9A 2NLRA 3WF4A 1GNHA 2QDRA 4A7ZA 4FOVA 1OOPA 1AX1A 4PLOA 2E32A 3J7MA 4J1XA 5D1IA 4NRQA 1ZRCA 1RJ8A 1UOBA 3LIHA 5KHJA 4AQ6A 3ZSJA 1J59A 1BJQA 2D6MA 1C5HA 1HV0A 3ZXAC 1W6OB 1QJX2 2XBO2 4HFSA 3KZ4C 2Q4SA 3KQ4B 4XJAA 2XKOA 4YPJA 2VUDA 2A6XA 1PK6A 3PVEA 2HWD2 1MR5A 3KD4A 1M4WA 4RFT0 4F8AA 3FC0A 5FUNA 3NRUA 1R64A 3VBUB 5LK5A 2QJVA 2J1AA 2XJVA 5FPBA 2Q8OA 3AZWA 4LKFA 4QB1A 3THTA 1O4TA 4AZZA 3C7OA 5LBCA 4BQ3A 2LALA 1LOFC 2IXLA 2VUCA 3PMEA 1AZDA 3VDDB 3PLQA 4ZXKA 2JDHA 5GLVA 3J4UH 1EP0A 5A3NA 2JDMA 2B45X 2HKXA 3I2GA 3HQRA 2WQZC 2J1SA 1FT9A 1NQDA 5L7OA 2WZEA 1ZREA 1A3KA 2RE9A 4YGBA 2JD4A 3UETA 2DFBA 2DU1A 4ORFA 2NMOA 2CL2A 1GP5A 1TNRA 4XMAA 1LGNA 5KXEA 4P02B 3MV01 3K4ZA 4QGLA 1H6YA 2PHLA 3ZO0B 4LITA 3UGFA 4XC9A 3BODA 4CCCA 4GD4A 4AVVA 1MZEA 5HPOA 1MEC1 2YHJA 1WD3A 2HWF2 3POEA 5CFDC 5DUVA 3JBG2 5AFBA 1GZCA 4CEWC 3ALQA 4QX8A 3T2QA 1MEC3 1QXJA 4HOOA 4BYYA 3MZHA 1QJY2 1LU1A 1ULDA 1W8HA 2P37A 3S5AA 1K42A 4MSVA 1XSQA 5FBZA 4W6XA 4FTEA 5ACA3 1TQ5A 4LUKA 1RUJ2 2VNVA 5C9AC 1JZ3A 3ZXFA 2ARXA 1BXHA 1SFNA 4OHVA 3BGAA 1O4YA 3BTAA 3KT4A 4JKKA 5BYNA 1UWWA 2RR11 3MIDA 3V64A 4IGOA 3VHOA 4IEXA 5BNNA 3KF5A 2YU2A 1O59A 4AW7A 1ZBA1 1G9CA 3ZLIA 4CEYC 1JYTA 2JDAA 4Z2AA 1WBFA 5T55A 1DGRA 5A7WA 2YC4A 5FXZA 3POYA 3VV1A 2VOVA 3V0BA 5FYZA 1ZBA3 2Z2SB 2VZTA 5FPXA 1W39A 3Q8BA 1POQA 1YJLA 4FPKA 4LBNA 1W06A 5JOWA 2CWMA 1IS5A 3WY6A 4ISQA
chains in the Genus database with same CATH topology
3MW2A 5J48A 2B8MA 1ZVFA 1OA4A 2BQPA 2IXCA 4Y1VA 4IEUA 3RMXA 4CEWB 3WQ7A 2PLV2 2DURA 4DS0A 3AKQA 4JVAA 2O8OA 1ULCA 4IEWA 2A7AA 2VXRA 3WP3A 1NG0A 4I0WB 2E7AA 3E5XA 4NPRA 1LR5A 3TAYA 4LE3A 4PLNA 1UKRA 2ZHMA 3EBRA 1XYPA 4IQPA 4JRLA 1QHDA 3VUOA 1A6CA 3ZN5A 1FNYA 2WS91 5DZFA 5K8SA 1AYM1 1VBB1 2A6WA 1N1TA 2CAVA 1VBE2 3FUQA 2WS93 1AYM3 1VBB3 4LE4A 4QPYA 2UURA 2UYAA 2MHFA 5C4WB 1Q5OA 1KFUL 2W0XA 3RDIA 1FPN1 2P2KA 2WNUA 2R32A 2RHPA 2JDZA 1QH6A 1Q8OA 2YV8A 4QPGA 4OI0A 4YW1A 5BNOC 1BZWA 4AEDC 2D7FA 4RS5A 3QCWA 4C90A 1AVBA 3MIGA 4YGDA 2IC1A 4DRVA 3O12A 1RVF2 4FOQA 4XFIA 3EJKA 2JENA 1QJZA 3EHKA 2QE3A 3WQ0A 1OLQA 4LHKA 1MZ5A 1JUHA 1H2KA 1WLWA 2WFF2 4XFCA 3PJQA 3AKTA 2DCKA 4X6RB 4X8PA 2ZMKA 2GN7A 1C1LA 3ZXDA 5BNPC 2PFWA 1LOGA 2A6YA 4M3CF 4I3PA 1OA3A 2D3RA 4E27A 3M3OA 4LO8A 1MS4A 4K8FA 3ZN6B 1GZ9A 4XILA 3FZ3A 4E2GA 1EPZA 1A8DA 4DY5A 1DIWA 1KS4A 1OOPC 2LUWA 2MEV1 2R1BA 4LA2A 4JCKA 3V56A 5BUVA 2VVFA 2BNOA 5C33A 2MEV3 3RI8A 4A7YA 3G7DA 1PK6C 1JHNA 2PQQA 3SCGA 3AX4A 1IPKA 1ZM1A 4LHNA 1KDKA 1WLCA 2RMU2 1DFQA 4PIYA 3SMHA 2XGXA 4AGGA 3H7JA 3I8TA 4WBBA 1XU2A 4LBQA 2RS33 1IS4A 4PIXA 2BTVC 5BNPB 5L7OC 4IV1B 4YFZA 1UL9A 1MACA 5CVRA 3MW4A 5JDBA 3EQEA 2Q30A 4LLOA 1BEV3 5A3LA 4DINB 1AXKA 3WW2A 1TMF2 5FFOC 4AI8A 2ZKLA 4IEVA 1G7YA 3N35A 2RS11 3VKLA 4GIQA 3RYRA 1S1AA 4P9YA 2PYTA 2QDNA 1G86A 4HBNA 3ASIA 3Q9OA 3CNAA 1X36A 3OD4A 2WNEA 2AH2A 4YVWA 3WDWA 4Z1VA 1MVEA 2R49A 4U36A 4Q4X1 2GNDA 4UW5A 4COYA 1U5IA 2Q1MA 1ENXA 4Q4X3 5BNNC 1SCSA 3D6EA 2ZPXA 2ZGRA 4XBQA 1D4M2 4XFBA 2GSYA 4JTOA 2ZGLA 3H1YA 3IDEA 3APBA 1V00A 4XMIA 3S6PA 3H3ZA 1CAVA 4FOYA 5JOYA 4D7YA 5IK5A 1W6MB 1K5MB 3WUDA 5CAZA 4N9IA 4HPKB 3WD5A 4C91A 1AL21 1JXNA 1V6LA 3RMYA 1C8M2 3VBRA 3SHRA 4RR3B 2ZGTA 3FE5A 1RGSA 2HWB1 1AL23 1RUI2 1AXZA 4IETA 1ZZ6A 3TBDA 1DBNA 1YXWA 1Z78A 3LOIA 2HWB3 2R072 4BHPA 1FOD1 1S0DA 5I8SA 5GALA 1QH7A 3I54A 3OBRA 4LO5B 3ZX7A 1SCRA 3TN91 1Y7BA 3CO2A 4YZ1A 1U5YA 1CPNA 4ASLA 2NP0A 1IOAA 3HBZA 5FTTC 1NOVA 3TN93 4Q26A 1AJKA 2F6BA 5E16A 2JX9A 4IEQA 3AMHA 1ZNPA 5I8YA 3D82A 3VBHA 2WNUC 1T6GC 5GKAC 1CVNA 1LEMA 4ZKTB 1RUE1 3N7LA 2RS51 3JD71 3MEPA 1FV2A 2HEVF 5I0UA 4QPGC 2VY0A 4J1WA 1JOJA 3ZN4A 3DV8A 2WQ4A 5KXCA 5IUQA 1RUE3 4RS5C 1G6NA 2RS53 3JD73 3VBSA 4BLJA 2X8KA 1D2QA 4MXWA 5AC92 4M3CE 3P3NA 1H1IA 1MZFA 4GKXA 2W68A 1ULGA 4Y20B 2ZX4A 3VGIA 1DHKB 1X50A 3HIFA 2WZPP 2I07B 3ATGA 2ZX1A 1RMU2 1W6OA 5JPMB 3TWIA 4BWOA 4E2QA 1FV3A 4WM7B 1BKZA 1MVQA 1Z7S1 3WT3A 3VBUA 3J8F2 3KGZA 2RJLA 3QLQA 3N7MA 1Z7S3 3HAGA 1RL3A 3SH4A 1GZWA 1D0HA 4P9IA 3WW4A 1XE8A 3USSA 5KHHA 1JYCA 1WCKA 1Q56A 3ELNA 4EN7B 3BIWE 4OFGA 1AR73 2DV9A 2GDFA 2YY1A 3C2UA 1I3HA 3DUIA 4WM8B 5JVVA 3ZMNA 3RS6A 3WDVA 5I0SA 1LOEA 5JWPA 4FXKB 4K6BA 3AYAA 3FWEA 4Y22B 3LZZA 1WW4A 4A3XA 1W6QB 3UK9A 3MW3A 5KC5A 4CP0A 3QBQA 3WR0A 2B39A 1V6JA 1PO22 1QOTA 2GC3A 4RGGA 3KCYA 3M3IA 3ACLA 1IKQA 2R062 2ZS6B 5C8WA 1VRH1 4LO4B 5L19A 1PIV2 4TSVA 3U07A 4WVVA 2XVKA 3RJ2X 2BYVE 4AHXA 4Q27A 3AZYA 1O3TA 1HXS2 4DRRA 1H4HA 2DVGA 2CNAA 2RM22 3SLIA 1HV1A 4CYDA 1HRI2 1MQTA 3KQRA 2DVBA 3VHNA 2CGOA 5DUWA 3JB8A 4OI1A 1PGL1 5JSRA 1V6MA 1WMDA 4HKOA 2AREA 4F7ZA 4EN0A 4EN6B 1W0OA 4YNIA 4S2HA 1F9KA 1FAYA 4E9KA 3QACA 3OGJA 5FDBA 4HVRA 2D6OX 4YVWC 2BW8A 1S0GA 1RIRA 1YFXA 4WZCA 5FOBB 1COV1 2GC2A 1C5IA 4DPNA 1DU3D 3AP9A 5F6LB 1S2KA 3NV1A 1APNA 2QVSB 3OF1A 4LBQB 3IKWA 4OZXA 1COV3 3A0NA 2Q5TA 4XEZA 5CNAA 1J3QA 4AYUA 2YPJA 1YFWA 1HDKA 1AYN1 5JOXA 4NHKA 1CIWA 1KDMA 1S2BA 1LTEA 4K20A 3IDBB 5B2GB 1AYN3 2XL9A 1JTZX 5DDJ1 4BH9A 4HVQA 2A73B 3H3UA 1Z0HA 3GYDA 1SLBA 3VBRC 5KXBA 4CRQA 1HRV2 2UY9A 2BEOA 2DTYA 5C4WA 1GICA 2AGSA 4M0HA 1X8EA 4MLOA 5H9RA 1LGBA 1G9FA 4K21A 3EXUA 4ATFA 3R0RA 4ASMB 4CP2A 1OPMA 2QKDA 3AKRA 5F5QA 4QU2A 4A7KA 2BNMA 2DCZA 2DF7A 5T5PA 3R4SA 3MF6A 4N9HA 4RHV1 4WVZA 2OYZA 1V6KA 4BCUA 3LOBA 2VG9A 3E6BA 1CAUB 4M01A 1QMJA 4XXPA 1OD5A 4HKWA 1WLDA 3ZXGA 3NSTA 2B7YA 4FP2A 2XL7A 4GB31 1EAH1 4KU7A 3B00A 3IPVA 5DZEA 4Y1UA 2BFUL 1FI2A 3D8CA 4FO9A 1SBFA 2WT0A 4QPIB 1CAVB 3VBHC 4GB33 4URTA 3THPA 2JE9A 4FVVA 1R081 1V6OA 1VALA 4O9GA 1N3OA 1UN1A 1FNZA 1Y3TA 4L8QA 4LULA 1PNGA 1R083 3PJYA 3ZN6A 4UW3A 3ZSKA 5GZGA 2ARBA 3VBSC 1LHNA 2C5DA 5KHKA 2FBEA 3PHMA 5FLHA 1J58A 1NY71 3FFZA 4COVA 5A33B 4YARA 2AUYA 3QD6A 3GBGA 3NKTA 2CGPA 1S0CA 3U0ZA 4BPZA 2GMEA 1RUD1 2IXJA 3U4XA 2YMZA 5ACA2 1R1A1 2DFCA 2EXIA 2YXSA 3BOPA 4XJUA 1H0BA 3VBUC 3BOWA 2ZCWA 2B42B 3ETQA 1S0BA 4AVAA 2DCJA 3MI8A 3WG1A 2PAKA 3ZFFB 1FX5A 3HT2A 1GYKA 1SQ4A 5J7MA 5KHIA 2K9ZA 1XE7A 1ZBE1 4IEOA 3HR9A 1TE1B 1QDCA 4RSUA 3B9IA 4NN0A 2ZGNA 4IV1A 2V5YA 4DFSA 1WD4A 1ZBA2 1ZBE3 3AP6A 3KSCA 2GNTA 4FBFA 1ZRDA 2W08A 5GLUA 3WDUA 1RUG1 4DY3A 3A0KA 3M8LA 4MXVA 3UL2A 1Q8QA 1G9BA 4XJ8A 3POSA 1DGWA 4XFGA 3WXPA 3CJXA 4N43B 3D0SA 4IERA 3UJOA 4BIFA 1X7NA 1Y43B 2D40A 1EPWA 2WL1A 4PDWB 3AYCA 3DKWA 1DQ4A 4QM8A 2D43A 2C9AA 2TEPA 3L2YA 4N7UA 1YI9A 4ONUA 1G9DA 1GSLA 5SV8A 1A8MA 2ZHNA 2R6QA 1GZWB 4DXZA 1MQTC 3LA2A 4AFDA 4CDQB 3ZSMA 5JSPA 2AENA 1GR3A 4TYSA 5T5JA 4D7TA 1RITA 1PO11 1IKPA 2LM3A 1AYM2 1VBB2 3B7MA 4Q1RA 4XFHA 4JGZB 2D5HA 2YYOA 3WUCA 2DWRA 1MS1A 1W6MA 1K5MA 3DGTA 2R1DA 3UKNA 3SH5A 4HPKA 3IT8A 5DUUA 2F4PA 4YLZA 4RR3A 4Q4Y2 4MGIE 4XW3A 3KM5A 4QXKA 3GZUC 1O3QA 1MS0A 2YUEA 1OQ1A 4LEJA 4Q8LA 2OZ6A 1X82A 3M1HA 3VLBB 1XXNA 5GZCA 2WIIB 1LENA 3WCSA 3OPZA 4META 1YYNA 3E97A 2XJSA 4QD2A 1ULFA 3M3QA 4LBJA 1V6NA 1MQTB 2PA7A 2R0FA 1ZX5A 3RJRA 2UWCA 2Y0OA 4FSJA 2A3XA 2QZ3A 2RR13 2ZTNA 3O5SA 4B4QA 2P3JA 4RQPB 1AF9A 1YHFA 5FMOS 1DDLA 1AR81 4CP1A 5AFEA 1PZ8A 3B94A 4M3CB 2EAKA 3ZIXA 5C4WC 1KRIA 4Q1PA 1D4VB 3FMGA 1AX2A 1BMV1 4A2UA 3KT1A 3T2TA 4M00A 1TNFA 3E6CC 1R091 5T52A 4MX3A 3MYXA 2MEV2 1KS5A 4HL0A 3OJBA 4WV8A 4LLFA 3ZSLA 2OVUA 1DZRA 4NOTA 1R093 1TEIA 4Y20A 4BMEA 1GV9A 1Q8VA 2O1QA 4S2GA 2GH8A 3I59B 2JICA 1XNBA 5LRSA 1ULEA 4FT8A 1O7FA 5J96B 1NLRA 4PIZA 4WM7A 2RS32 4YYOA 5JZGB 2NPIA 1OPOA 2HWD1 2KM2A 2ZGKA 3QH7A 2WSUA 2YC0A 1NYWA 1PVC2 4Y24A 1GLHA 1BEV2 3FBMA 4KNCA 1X8MA 5FLJA 2WINB 5BNQA 4EWAA 4WM8A 2ZMLA 4FPJA 1FPN3 4D7SA 3VL9A 4KG8A 1N1YA 4INDA 2G9FA 4Y22A 2VQ0A 4EWEA 3TYJA 1POV1 1W6QA 1I5ZA 4JV4A 4QQPA 4TZDA 3B01A 2ZAAA 3M4FA 1J1LA 3N3HA 3AMQA 1POV3 3KCCA 4GA9A 3IN9A 2MPFA 3JBG1 3WP6A 1QXRA 5L73A 2OUJA 4AI0A 3IPVB 5KC6A 1JYIA 3TNPB 4Q4X2 1LESA 1QJY1 5KWRA 2X53S 3WP4A 4E4DX 3WOGA 1ALYA 4LBMA 2CTVA 4XQ4A 2R16A 4IV1C 4DQAA 5L36A 1RUJ1 3OY8B 1G9AA 2WWSA 1H30A 4OHYA 3AP7A 4LTAA 3VBFA 2QNKA 2XWJB 2Y38A 4Y1XA 1GQGA 4CDXB 3LA7A 3KB5A 3VKNA 2PHFA 1LHOA 4ES8A 1QF3A 2E51A 1NA1B 1WCDJ 2XLFA 2WZR1 1FMD1 2IXKA 1AL22 1POV0 1RHI1 1REDA 2EXHA 2RJKA 4FPFA 4GWMA 4Y4YA 5E89A 2GNBA 2UU8A 1QWRA 2VOXA 2WZR3 4NWVA 1BCXA 2HEYF 1FMD3 2HWB2 1RHI3 1VBD1 3V0AB 5DXDA 1CAWB 2PLV1 3JB4C 2D97A 1UU4A 3IDCB 1VBD3 4CDWB 1S0IA 1V70A 1NZCA 2Y26A 4YVSB 1S0FA 1NCQB 4BMBA 3TN92 5CG9A 5T3NA 3RYPA 1OI6A 4Q4W1 4XE9A 3AB0A 4PBOA 4XETA 4W6WA 1DYPA 1DQ5A 2A3YA 3M2MA 4FAGA 4AI2A 3IBMA 2XKPA 4Q4W3 2E63A 1K5MC 1LRHA 1MS8A 2ZZJA 5HCBA 5LRRA 3T1LA 4YM1A 3FLTA 5A3MA 2PHXA 4RR3C 1QOOA 1VBE1 4MGZE 4XPVA 4N53B 1RUE2 2ZKNA 2RS52 3JD72 2RS13 5I8TA 1YIPA 5EV7A 2QUOA 2HWC1 4B8EA 1GNZA 2ZHLA 1CQ9A 1H9WA 2C0ZA 3JQXA 1BYHA 1I1EA 4FPCA 2ET1A 2FMDA 3M3EA 2HWC3 2N7GA 1ENSA 3A4UA 5CG8A 1SLLA 1RUF1 3IWZA 1D2SA 4AGRA 4SLIA 1MZ6A 5KHGA 3ZXJA 3E6DA 4LUMA 5GZEA 3MIFA 1CAUA 4Y5Z0 1RUF3 2PAEA 5T50A 1ASJ1 4HANA 2Q1ZB 2SLIA 1M06G 3RPQA 2WFF1 2HWE1 4MGKE 4QPIA 1ASJ3 1WW5A 3VN4A 2ZX0A 2NM1A 3FUOA 2DUQA 1AR72 2EA7A 1J1TA 1ZA4A 1KJRA 2HWE3 4HN0A 2ERFA 1WBLA 1UPIA 4LBLA 2JKBA 4QMAA 3FLPA 4EN9B 3GHNA 4YM2A 3WZ1A 1C28A 1CD3G 1VAKA 4YFWA 5A33A 5FOJB 1DGRN 1SACA 5IK4A 3C3VA 4XBLA 1HW5A 4K40A 4WM7C 4C0HA 4BQ1A 3ROUA 4AFMA 1FOD3 4XJZA 3MIEA 1IZ3A 2UWAA 3N7KA 4FPHA 4R9AA 3ZFGB 4AEJA 1LULA 2QFEA 1YJKA 2VULA 2ILMA 2FZ1A 5J09A 2H6BA 1DQ2A 1WA4A 2RMU1 4RA0A 4GKYA 2WC2A 1Q8SA 3NKGA 5H9QA 4LA3A 4MV2A 4XTMA 1IS3A 1PHMA 4R52A 3ZFFA 1QKQA 1DQ6A 3UJQA 4XXAA 3USUA 2D93A 1H1AA 1DGWX 5J3UA 4WM8C 1RUH1 3QOPA 4X8NA 3MPPG 1IPJA 5DG1A 4Y1ZA 4XF4A 2D44A 1RUH3 1AR61 2VMHA 3ZFEB 1TMF1 3WW1A 4V1PA 2GC0A 3AYEA 3ZIWA 2PHWA 4N43A 4PCRA 1AR63 3VL8A 2WLPA 1TME2 4ZU7A 1Q3EA 1TMF3 2JG9A 4GQ7A 3WDYA 4AE2A 1WW6A 5FQ0B 1LJ7A 2ZAHA 4PDWA 1RINA 3WDTA 3VHRA 3HN1A 3ILFA 4XJWA 2JG8B 4P9XA 1W6NB 1COV2 1AX0A 1WMFA 3AP5A 1PGW2 4AGVA 2VU9A 2DYCA 4B29A 1N1VA 3I2DA 4C0BA 3QH6A 1SLIA 4IXLA 4E4ZA 5DUXA 4P14A 1OQEA 1ZYBA 2AR6A 2JXAA 4QGNA 1OA2A 5FCCA 3B3QE 2BGCA 4CDQA 1QJU1 2VVEA 3VBFC 1IQAA 5ABJB 1AYN2 1DQ1A 1CAXB 3WP5A 1WLTA 2NZ9A 5K0UB 1QJU3 4KH9A 5JOZA 1D4M1 1HIXA 4AHZA 3RZZA 5GJ6A 2X5IA 3FLRA 4JGZA 3WINE 1QY4A 1V6IA 2KXLA 1YIFA 3DF0A 2ZJCA 4QQHA 5JAXA 3H0OA 4I09A 1F5JA 4J6GA 3ZVXA 1UIKA 1CN1A 3VZJA 1KD7A 2FMYA 4Q29A 4BOWA 2CYFA 3POWA 1ENQA 4XF0A 3O0XA 2ET7A 3ZYGA 4HT1T 1RC6A 1V9U1 3L9JT 4XIOA 1I9RA 2G4IA 4FPYA 2GU9A 1VIWB 3SXWA 4X6QB 1QOSA 1V9U3 4FPOB 4FPGA 4XF1A 1VRH3 2D6KA 4YZ4A 1G8WA 5EXOA 3ECQA 1XNCA 2NQYA 3IMNA 2Y0IA 4MYEA 4HMZA 5FREA 3SITA 4GB32 3MFAA 3X29B 2HEWF 1VBA1 2MNGA 3VBFB 5I0TA 3D5OA 3HD8B 3E5UA 2E7TA 1BBT1 4FTSA 2K2SA 4ISRA 2C1FA 3CL1A 4RQPA 1VBA3 2PHDA 3RNSA 1R082 5FLIA 3OYWB 1BBT3 2TNFA 4M3CA 4Y1YA 1KITA 4Q0QA 1LHUA 2VECA 3LB9A 1F31A 1JUIA 1ZZCA 4FQZA 4FOWA 4AK3A 4DMIA 5F9TA 2ZX2A 3AFKA 2B9UA 4FCAA 5D8AB 3CEWA 4JQRA 5DG2A 3KMHA 3M7AA 1MS5A 1EV11 3ZPYA 4HSJA 2QCSB 4MH0E 1CR7A 2GNMA 4OUMA 3S7EA 5AC91 4R8HA 4CZSA 3HT1A 3N36A 4XYXA 1EV13 3I59A 1O5LA 3GHMA 4FPLA 4BLIA 1FYUA 4S2DA 1BVVA 4CDUB 3DPRB 3B69A 1W6PA 5JZGA 4QPIC 1O3RA 1PGSA 4Q4V1 2G9GA 2VOKA 3VHPA 5T5OA 2XVGA 2XJUA 1BVP1 3MIHA 3J8F1 1ZBE2 4OUSA 4Q4V3 1ENRA 1ZZ8A 5CFCB 5DDJ3 2IXHA 1ONAA 4K1ZA 1UU5A 1B09A 3LWCA 3O0WA 2QZ2A 1KJLA 1F5FA 3AXDA 4P9JA 4I0BA 4G9SB 1IHMA 2WNVA 1Y9QA 4OVEA 1QGLA 4JTNA 1AHSA 2OZJA 1UZYA 3AJYA 4B4PA 3GNEA 2EIGA 3AMPA 4R4ZA 5C6CA 3H7YA 2FZ2A 1HLCA 3S30A 4I01A 4P5HA 4YW3A 2ETEA 4BA6A 4XFAA 1H8TB 2IFRA 4RHV3 5E1RA 4AHWA 4F3JA 1J3PA 2R061 1A78A 3ZFFC 2NMNA 2E6VA 2XJQA 1EAH3 1URXA 2P17A 1WGPA 1U0AA 4HKLA 1CESA 3ZYJB 1HXS1 3N7JA 5GLTA 2JJ6A 3OY8A 4HVOA 3L2HA 4H14A 3ST7A 1H4GA 4IEZA 2XPJA 1OFNA 1U5XA 2XUMA 4CDXA 1JN2P 2VW2A 1SLAA 1UMZA 4GMP0 1SEFA 1NA1A 2GALA 4N43C 1S0EA 1LOCA 3B9CA 1MEC2 2JG9C 4XHBA 3AKSA 3AP4A 2E53A 2VPVA 4PDWC 2DVFA 2GZWA 2O0OA 3BU7A 4IV3B 4I3GA 5AVAA 3WVJA 5GLWA 4AG4A 2A5ZA 1GKBA 3U11A 1RUD3 3V0AA 3VZMA 1CAWA 1R1A3 5TSWA 1ND2B 1SLTA 4UXAA 2I45A 1RUC1 3ZYIB 4CDQC 4CDWA 4YVSA 1NCQA 5FAXA 4FTBA 5CB7A 3USUB 2HJIA 2RR12 1YRZA 4GH4B 1RUC3 5BY5A 5C8CA 3MLLA 3PTYA 1BQPA 4EN8B 1NXD1 2X5IC 4JGZC 5I0RA 4WVMA 4I30A 4BIOA 1NLSA 1XU1A 2AYHA 5KBFA 1X33A 4Q0UA 4MGYE 3VBOB 5BV6A 2YGMA 3I4IA 1NCRB 3WW3A 5JLVA 5IK8A 1RUG3 4N53A 2WKKA 1BMV2 4TWTA 1HRV1 3LSDA 4YRDA 2JG9B 3RRDA 3D4KA 1C4RA 3RWNA 4L11A 1CONA 1R092 1QQP1 4QT6A 1HRV3 4AVBA 3ILRA 2GN3A 3E5QA 4B3NA 4K3UA 2A3WA 1LOAA 2W52A 3NAPB 2VH9A 5CIRA 1QQP3 3OBTA 1OQDA 4QGMA 1C57A 1DG6A 1N3QA 3PVNA 2GC1A 4PF5A 3WLUA 2KA3A 2VNGA 2AZ5A 4LT5A 4RQPC 3CJIB 2WS92 3ENRA 1H2NA 1UZZA 2X5IB 5F6KA 2FHRA 1PO13 2EXKA 1J3RA 1JW6A 3LA3A 1PVXA 3WHUA 2EAAA 1SFYA 1Q8PA 4ZU4A 1IGOA 3PVBB 1FPN2 3UKTA 4H7MA 2Z69A 4FXGB 1FXZA 3B93A 4AWDA 3LAGA 4W65A 3MF9A 3PNAA 4FP3A 1SBEA 4KWLA 2R041 5DZGA 3PMSA 4QX5A 3LGRA 1RTVA 4COUA 2Z79A 4JDNA 4OHWA 5H9PA 1NQJA 5T5LA 4Y26A 3GF6A 2R043 3INAA 4HN1A 4JGYB 2TUNA 3ZYRA 2WLQA 5JZGC 2VOWA 3ZFGA 3H1WA 4XQDA 3MPBA 4KL1A 5ACA1 3EO6A 3R4DB 1AR91 2CAUA 3NV3A 5F1RA 1ZZBA 2X29A 1GQHA 2BWAA 2A75A 5LEKA 2P34A 2FQPA 2VVDA 4NR1A 5FO7B 1YNAA 1AR93 1N3PA 4GALA 1QNWA 4EV0A 4LBQD 2CGNA 1AR83 5I93A 1ZZ9A 1B35A 2Z42A 3W9AA 4JDOA 2BNNA 4S2FA 2WNVC 5FPZA 5HCFA 1VBC1 2VNOA 2D6NA 2IFWA 1YFYA 2WZR2 2XJPA 1YO8A 5GZDA 3ZFEA 1FMD2 4I02A 3ZXLA 1RHI2 1QXPA 1VBC3 5E88A 1REFA 4ZU5A 5JIAA 1L3JA 4EROA 1H2LA 3H1MA 5FQ0A 1LU2A 2XBO1 1QJX1 1O5UA 2ZGPA 3M3CA 1PZ7A 1VBD2 2B5HA 2JG8A 5CFDB 1RUOA 1W6NA 1W6PB 1OMIA 3WV6A 2DVDA 3AFGA 1DZTA 2WT2A 3TRSB 1QJX3 2XBO3 3DN7A 5JR7B 2HWD3 2GMPA 2LTNA 3TNQA 1HQNA 2ES3A 1EY2A 5BPXA 4P9WA 2WT1A 2P3KA 3MLKA 4Q4W2 5ABJA 1CAXA 1MS9A 3B02A 4Z8BA 4YW4A 5C9AB 4UW4A 4CDXC 5K0UA 1YWKA 4MZUA 3O0VA 2PTMA 5JI7A 1NA1C 3NJZA 1WMEA 3URFA 1YUDA 2WNVB 2RS12 3IM0A 4CEYB 5IK7A 4Z2WA 4OHZA 4GULA 4I0AA 5SV5A 5K9YA 3FFQA 1HQLA 3WX5A 2V09A 3WHTA 5IT6A 4Z92B 2D3SA 2IWGB 3R05A 4QQOA 2HWF1 2ZX3A 2VQAA 4ES9A 2HWC2 5I91A 4Q4Y1 2ZMNA 3OGGA 2EF6A 4AXOA 4AHYA 3ES4A 4CDWC 4Q0VA 2HWF3 4YVSC 1SMVA 2NN8A 1NCQC 3JBG3 4Q4Y3 5GZFA 2BVBA 4OULA 1RUF2 2VMIA 4QM9A 3MDPA 3NVCA 4Z82A 5C8CC 5JCTA 2GAUA 1QJY3 1OHFA 2OA2A 3H8UA 3JU9A 1ASJ2 1RUJ3 1QNYA 2PHTA 5FRAA 2HWE2 1LCLA 5EWSA 4KQ7A 5CU1A 4HETA 1DYKA 3WDXA 2OPKA 3OYWA 1PZ9A 4N53C 2XJTA 2IZWA 3MICA 2BBVA 3LSEA 4EJRA 4KGGA 1WUVA 3J26N 2BFUS 3ME2A 3NWKA 3ZXKA 1ZRFA 5D8AA 1UKGA 3LCPA 4HSLA 1LGCA 2I74A 1HX6A 2YGLA 1FOD2 2OW4A 3W59A 1ZZ7A 5BNOB 1LOBA 4UBHA 4AEDB 1UD1A 2ZABA 3VKFC 1IS6A 2PLV3 3GBWA 2TBVA 3R6SA 4D69A 5C8CB 5K7PA 4MUVA 2VMGA 3HMYA 4CDUA 3DPRA 4OLLA 5JI9A 4WVMB 3V65A 4LBKA 1KFXL 2ZHKA 2RS31 3KLSA 3SCFA 5LK7B 2PAMA 2WFPA 1FATA