2C1FA

The structure of the family 11 xylanase from neocallimastix patriciarum
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
219
structure length
219
Chain Sequence
MKFTVGNGQNQHKGVNDGFSYEIWLDNTGGNGSMTLGSGATFKAEWNAAVNRGNFLARRGLDFGSQKKATDYDYIGLDYAATYKQTASASGNSRLCVYGWFQNRGLNGVPLVEYYIIEDWVDWVPDAQGKMVTIDGAQYKIFQMDHTGPTINGGSETFKQYFSVRQQKRTSGHITVSDHFKEWAKQGWGIGNLYEVALNAEGWQSSGVADVTLLDVYTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BIFUNCTIONAL ENDO-1,4-BETA-XYLANASE A
publication title Understanding the Structural Basis for Substrate and Inhibitor Recognition in Eukaryotic Gh11 Xylanases.
pubmed doi rcsb
source organism Neocallimastix patriciarum
total genus 55
structure length 219
sequence length 219
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2005-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2c1fA00
3VL8A 4HKOA 3WP4A 4XQWA 1YNAA 3AKQA 1OA4A 3VGIA 1OA3A 3VL9A 4XQDA 4HKWA 5HXVA 1REEA 3RI9A 1F5JA 1OA2A 1HV0A 2JEMA 1QH6A 1OLQA 3VHPA 3WX5A 1C5IA 3LGRA 3WY6A 3VHOA 1XNKA 2VULA 2D97A 3WQ0A 3HD8B 2F6BA 3AKRA 3AMNA 1BVVA 1KS5A 1C5HA 1XXNA 1HV1A 4HKLA 4S2GA 3O7OA 3MFCA 1XNDA 2JICA 4S2HA 4S2DA 1XNBA 2NLRA 1OLRA 3AKTA 3B5LB 4IXLA 1PVXA 3WP3A 1AXKA 1XYPA 2QZ2A 1XNCA 3VZKA 2B46X 1UU4A 3VZLA 1M4WA 2BVVA 3AMPA 1IGOA 3EXUA 3ZSEA 2D98A 3AMHA 3VLBB 1BCXA 3MF6A 2QZ3A 3VZOA 3WT3A 2JENA 3VZMA 1XYOA 3WQ7A 2B42B 2DCZA 1KS4A 1H0BA 3RI8A 2BWAA 3WQ1A 3AMQA 3M4FA 2BW8A 5K7PA 1H1AA 1H4HA 2DFCA 1REFA 2DCJA 4S2FA 1ENXA 2DCKA 2BWCA 4HK9A 3VZJA 3AKPA 4XPVA 3WXPA 3AKSA 1W2UA 1UU6A 2VUJA 4XQ4A 1T6GC 1BK1A 1QH7A 3AMMA 2Z79A 1REDA 2VG9A 1HIXA 1XYNA 3MF9A 1NLRA 1H8VA 1TE1B 3MFAA 2C1FA 4HK8A 3LB9A 2B45X 1UU5A 5EJ3A 2NQYA 2DCYA 3WR0A 3WP6A 5K9YA 2DFBA 1UKRA 4NPRA 3VZNA 3WP5A 1H4GA 4H7MA 3VHNA 3B7MA 2VGDA
chains in the Genus database with same CATH superfamily
3RVHA 4DNYA 5BNPB 1GYKA 4CPBD 4P9XA 4ASKA 2UY9A 3HQRA 4A44A 3VBSC 4K9SA 1XE8A 3KSCA 4OHZA 4CU7A 5C3QA 3ECQA 3J26N 3KQRA 5CISA 5DUVA 1HQNA 4QPIB 3VKNA 3VD9A 5FO9B 2WS93 5LRSA 3AZYA 4LHSA 5C9AC 3OBAA 2Q1MA 2KD7A 3JQXA 4NMIA 2WFF3 5LA2A 1FX5A 1JZ2A 1WCDJ 1RXGA 2WUHA 1NA1A 3H8RA 1IPSA 1R64A 3HT2A 4FPGA 2FDGA 2HWC1 4UT5A 1DYPA 2ZABA 5E6HA 5KXBA 2OKXA 4JDNA 2GZWA 2B5HA 2JDZA 2ZGNA 2X10A 5I0DA 2OIIA 1F31A 2CV6A 5J98B 1OLME 2C26A 2BGPA 1O7FA 1N47A 2WZ8A 3AP9A 3WG4A 4CCDA 2G4IA 4NRPA 3N7KA 3JBG3 1ODNA 3C7OA 1I5ZA 2VECA 1RUC3 1C4RA 3JZVA 5CFDA 4B29A 1R093 2P6HA 1HXS1 1JOBA 3N9PA 4HKLA 1NLQA 1HB4A 4CDWC 1HRI1 4CXWA 3O1OA 1GNHA 4S2DA 4I3PA 5JMCA 3PMEA 5JZGA 2J7MA 2IFWA 5FZBA 4YG6A 2XVGA 4MGSA 2A73B 3LOIA 4OMCA 1SFYA 4MGZE 4P5HA 4AWDA 4GXLA 3KV6A 2VQ0A 4XUPA 1NY71 3I4IA 4CA9A 1NCQC 1YFXA 1QJFA 2ZAHA 1LU1A 1IGOA 4D7YA 4JTOA 4I3GA 3WUCA 4DRRA 1WD4A 2UWAA 4IDZA 1UMZA 4ZZ5A 5CBLA 1AYM3 2MEV1 1CX4A 1YC61 3ZM8A 3S5AA 3HOBA 4XUQA 3VZMA 5FYBA 3AFGA 5J7MA 5F3EA 2FHRA 3JD71 5FZ6A 2EF6A 4XE9A 2WA4A 4Z92B 1FXZA 4PLNA 2R16A 1KEXA 4P9JA 3RWNA 2RR11 3CMGA 3OPWA 1AX2A 1H2LA 2XDVA 4XFAA 1W9SA 2VNOA 1VAVA 3AZWA 5F5IA 1CAXA 1GZTA 2XBO1 1J59A 1OUXA 2W68A 3QCWA 4WVMB 1GZ9A 5FPUA 3AYEA 2PTMA 3AC0A 4Q4Y1 3NV1A 1OPOA 3ZVXA 2WAOA 1KFUL 1UZ0A 3QLQA 4PT6A 1UOGA 5KHKA 4AGRA 5FZGA 3LB9A 3ZPOA 1VPHA 3WDUA 4AW7A 1VALA 4NRMA 4DIQA 4TTGA 2RDRA 1LOEA 3LF7A 3VUOA 3T2PA 4AE2A 1BZWA 2FMYA 2GH8A 4NHLA 3WUDA 4NAMA 1QQP1 3RSJA 2IVJA 4FAGA 1A34A 3MV11 2AEYA 2E63A 4ISQA 2DF7A 5FTTC 5T5LA 5L9VA 4HKOA 2YMZA 4QX1A 2JDPA 4XQWA 4BIFA 5JOXA 1D4M1 3WINE 1MZ6A 1YJKA 4KH9A 2RS11 4RGKA 5A6YA 5D2AA 1CAVB 4BQ2A 1ZBE3 2R043 1VBC3 2Y0OA 5GKAC 5A32B 1HRI2 4CCNA 1RUE2 1UQXA 1TME1 1TZOA 1RUJ2 1JS9A 1YXWA 1POQA 4ITCA 1QHDA 2RM22 1CX1A 3KV4A 3VHPA 5BY5A 2XHNA 5F32A 5FXXA 3E5QA 4KU7A 1MVEA 1FPN3 1G9FA 1QGLA 2PAEA 4GULA 3U0ZA 4YG0A 1GZWB 1LOFA 1DYOA 3NJYA 4CZSA 3GZUC 1ENRA 4KU8A 1NQJA 4LOTA 1GZCA 5IYYA 4FBFA 2YC4A 1V9U2 1TMF2 4XMIA 1DYKA 4C1XA 1ZZCA 2ATFA 3B3QE 4F3JA 2QFEA 5FZCA 2DYCA 5JXGA 1RB8G 1JOJA 2GAUA 1UMIA 2ERFA 2ZX1A 4K7JA 3WLUA 4JKLA 3EYPA 3R0RA 4Q4X3 5ABJA 3O1VA 3L2YA 1PIV3 3OEAA 4KWKA 1D2QA 3TNPB 2WL1A 4LHKA 2KA3A 1OD5A 2J1VA 5FZAA 1WW4A 1ZZBA 2HWF3 2P6CA 3NKTA 4XIKA 3W9AA 1PVC2 3AXDA 1XNAA 3DV8A 3J7MA 1DGRN 1H30A 2SBAA 3ON7A 2HWB1 2ZMKA 2OA2A 3P1IA 4CEWC 5JPMB 1AUYA 4FFGA 2O8QA 2P5BA 1IG0A 1YFUA 1W3XA 3PUQA 5KBFA 3AP5A 4PQQA 5FBZA 3WG2A 4E8DA 2XMLA 1M06G 3JQWA 1DFQA 2EIEA 4AHYA 1GICA 5F2SA 3O1PA 1DGRA 5J37A 1RUC2 5FP3A 3MPPG 4QT6A 1ZRDA 3OCPA 2EXKA 2XJTA 4LORA 4WM8B 5K0UA 3DXUA 5A32A 3VZJA 4GJZA 3QH6A 4XPVA 5T55A 3NRUA 4BISA 3BCWA 4AVVA 3J8F2 4RQPC 3SMHA 5JDBA 1RGSA 4N9IA 3VD3A 1N1SA 2GNDA 3THTA 1KDMA 1WLCA 2BTVC 2ZEWA 1Q56A 1GQHA 3V64A 5BUVA 5FYZA 2B4KA 2VOXA 5CG8A 1TME2 3C3VA 1RUI2 1H6XA 1GKBA 3MO4A 1AL22 3ZDVA 2L9LA 1NKGA 1BHGA 3MBWA 1X8EA 4QKBA 3POWA 4LBQB 3NW4A 2Y6GA 3ZIXA 4FP2A 5GLWA 1S0CA 4AAXA 4CCKA 2W1SA 5K9YA 1F4HA 2R30A 3T2QA 3WP5A 4A2UA 4C0BA 1US2A 4QQPA 4UBHA 2WNVB 3LDRA 1JHJA 4O9EA 1DZRA 3NJVA 4MZUA 4WBBA 5DG2A 1QWRA 2F4LA 1ZBA1 3NNLA 4KL1A 1W6QA 3NNGA 2K2SA 3DL3A 4AR2A 2ZBJA 4Q5OA 2CAUA 4D0QA 4XQDA 2DTYA 4AVAA 1AR93 3W5MA 4F8AA 3VDDC 4QMAA 2CY6A 5CZKA 3I59A 3VD5A 2JKBA 1UXXX 1RMU2 3E5XA 2JEMA 1LHWA 5LEJA 5FWEA 2YXSA 3OGVA 2WYFA 2FDKA 3WX5A 1WA6X 1AYN3 2IC1A 2UWBA 2UWCA 3GJBA 4V2WA 5C8WA 5L7OB 4YGDA 3LEKA 4CPBA 5CFCC 5DAVA 5FUPA 2JDUA 1PGL1 1ZRRA 5C3SA 1O59A 2ZGRA 1X9PA 1XBFA 3KM5A 4YZ4A 4RR3A 1E5HA 3RNSA 1DG6A 1YYNA 2EA7A 2JDNA 5FZ7A 4FAHA 4AFAA 1QJU3 1EPWA 1Q43A 2D6PA 4XFBA 2VZOA 5FZMA 4QDQA 4XBNA 4CCEA 1W0PA 5C71A 1HKDA 1RJ8A 4RHV1 4GIQA 1QJY3 2A7AA 4J25A 5FYUA 1W06A 4R9CA 3ZXGA 2RMU3 4D6SA 2NM1A 1UY1A 2R7EB 4UWDA 1XNBA 5C3OA 4B4QA 1F8VA 1WWYA 1RIRA 1ZBE2 2AYHA 2R042 4CU8A 1YQ8A 1OF3A 3O1UA 5A6ZA 2YC2A 4CP9A 2GNTA 4GALA 4CDUC 1G9BA 5J48A 4LITA 2QZ2A 3LSEA 4L8QA 4D3WA 4F7ZA 2ADEA 1ZA7A 3IKWA 1GWKA 2VJXA 2X53S 2ZGPA 3LEGA 1LECA 3POIA 4RGGA 3ILFA 2VBBA 4HPKA 3VBRA 4A6OA 1O4ZA 3PU8A 3E6CC 1KD7A 1FPN2 2X09A 2ZGOA 2P4EA 1JYTA 1RUG1 1Y9GA 4BK5A 2C6SA 2GDFA 3OBTA 1U5XA 3H8UA 3VBUB 1LCLA 4LA2A 4AEDB 2IFRA 2XKOA 1W9TA 2ZKLA 2QVSB 3OUHA 1XYOA 5F5AA 5F8PA 2VTFA 3J7HA 5JSOA 4KBBA 4EN8B 2JDHA 5FO7B 2DBNA 1FT9A 4RA0A 1AR72 2W95A 3JB4C 1FYUA 4QDRA 1QKQA 1AR62 2LW8A 1EV13 1H4HA 1W9FA 3MIGA 4LKDA 3OGRA 2N7GA 4FXGB 4EZHA 3K75B 1U12A 1WZXA 4COYA 1CVNA 4QAWA 1JOPA 1PIV2 2RDNA 4E8CA 1H1MA 1BJQA 5D8AC 4Y24A 1D0GA 4JZRA 4Z07A 3C7FA 4MGQA 1AR82 2RS32 5GZGA 4BLJA 5LA1A 3EHKA 3ZFGA 1HQLA 4CXYA 5BXXA 3BKZA 3FFZA 5DDJ3 1GV9A 1PX4A 4NJ4A 1H8VA 1IZ3A 1PZ8A 5A3TA 1ND2C 2WSUA 3D5OA 4MHRA 2A6XA 1NYWA 1UZZA 4P9WA 5FYYA 5L19A 2R49A 3O1TA 2DU0A 1I5PA 4O9GA 1DHKB 5HV4A 5SV8A 1FV3A 3RYRA 4IE5A 4K40A 4OI1A 3VHNA 3AK0A 3UKTA 3B7MA 2VGDA 4QU2A 1YLLA 3HNBM 4EN9B 5IT6A 1PO13 4K1YA 4EJRA 1UL9A 3UGHA 2QUOA 5FKBA 1QXRA 4P02B 4OQ9A 1BLZA 4WM7A 1OVPA 4QPGC 4LO6B 1F35A 2KM2A 2XLAA 5FMOS 4XFCA 4GB32 4M0HA 1EYBA 4KQ7A 1PM7A 4RYDA 4XF3A 4XURA 4CDQB 2HWD3 5FZ9A 3IAPA 3PUHA 3X29B 1E57A 3OY8A 5F3CA 5E8AA 1S2EA 5ACA3 1V6OA 2WZR2 3N3HA 5JOZA 4C90A 5C33A 4NIHA 4AGVA 1SHWB 4FPKA 4QQOA 4R9BA 2Z69A 4LIUA 3WQ0A 2H6CA 3GM8A 4PCRA 1W8TA 4AQ6A 1LENA 4Q27A 2ZZJA 1W8ZA 3OBRA 3MW3A 3DKWA 4Q0PA 2J1SA 3LDKA 4YVWA 2EXIA 4IV3B 3NAPC 1YRZA 4NPMA 5IUQA 3PTYA 1D2SA 4GWIA 4N43B 3NNFA 4PIYA 1PO23 1COV3 4CU9A 4C0HA 1EAH1 1UX7A 3SEEA 1RHI2 5CFCA 1NCRC 1CAWA 4H7MA 3I2HA 4XEZA 3ZFEC 3VBOB 1DBNA 1F4AA 1FMD1 2A75A 3LCPA 5DUWA 3GHMA 1AYN2 2PN5A 2VMFA 1OD3A 2X5IB 3VLBB 4DQAA 1DGLA 3BVCA 1AF9A 2ZMLA 2VL4A 3M3EA 4YZ2A 2JIGA 4XUNA 1ZRCA 4CSWA 5LZ6A 4LBOA 1FNZA 3OTFA 3WQ7A 1G86A 3LFMA 3H3ZA 1QIQA 1WBFA 2AGSA 1VBD3 1QJZA 1QJU2 4J1XA 3T1LA 1W2OA 4AOCA 4CDUA 1JZ8A 5A6QA 4YM2A 3M4FA 4IERA 5K7PA 3CHXA 2X8KA 1E5RA 5IW0A 5FWJA 5HCFA 2DFCA 2CAVA 3O14A 2NYYA 4AGGA 2GMEA 2RMU2 5DZFA 5F2WA 5FAXA 1MQTC 2J1RA 1RUD2 2R6QA 3AKPA 2XJSA 5FZ8A 1BBT2 3GJAA 4YM1A 4YW4A 3R4SA 2E7QA 4BB3A 1OQDA 4CYDA 1PMIA 3E6BA 1PGW2 3ACHA 1LGBA 3NV4A 1YIPA 1HIXA 4NE9A 1AL0G 1MPXA 2JDMA 4IETA 2WQ8A 5GJ6A 1QJX2 2FDIA 3USUA 2VNGA 4IEUA 1UU5A 2D6NA 5FCCA 2ZGSA 4E4ZA 2DU1A 4D94A 1W6OB 2B7YA 2WAAA 4K21A 3ZPYA 4AAPA 5B2GB 2R063 3PVBB 2DCYA 5FOBB 2NZ9A 5EWSA 3TBDA 2C9AA 1ND3B 4FPYA 4QXCA 1UKRA 2CWMA 1DQ1A 3T30A 5A3UA 2WT2A 2WT0A 2ZGMA 1N1TA 3IIAA 4D8MA 4QPYA 4CEYB 1WMEA 4KGGA 3ZXDA 2IXHA 4Q1PA 1OA4A 4N53C 3UV9A 4CCJA 1PMJX 2R1BA 3RZGA 3BTXA 2Q1ZB 4IV1B 1POV0 1D7PM 1S4CA 3WEZA 3ZN6B 3CJIC 4DO0A 5I91A 1EAH2 2VUCA 1OA2A 3APBA 1VMJA 1I3HA 2ORZA 4YW5A 1O5LA 1Z7S2 2WN2A 3K77A 4FPCA 4ZONA 4XTMA 5G05L 3G7DA 3U07A 1B35C 3NNMA 2ZS6B 4FPHA 3DPRC 3CO2A 2BNNA 2VZQA 2D97A 2E7TA 3EQEA 4CDXB 5H9PA 5FP9A 4IGOA 4QPGA 4OUMA 5FO8B 4BQ5A 2QQMA 1BEV2 1O8SA 1GOGA 3Q8EA 4OHXA 4W8JA 5A7WB 5IFTA 1W0OA 5LBBA 1VBA3 1UF2C 2D6KA 4N7UA 5CU1A 3NSTA 1C28A 2BFUL 4QX2A 3MIDA 4XJ8A 4PDWC 3BODA 4HG6B 1VBE3 4M4RA 4GH4C 4A7ZA 4QQLA 4K6BA 3TB0A 3V56A 3WF2A 2JG9B 3AYAA 1SZBA 1UX6A 1WCUA 1W8NA 3R05A 3GZEA 4A41A 3IMMA 4FSJA 3I3DA 1BMV1 1NUKA 1VE0A 2OPWA 1OSGA 3FJSA 1HRV3 5IVCA 4TWTA 1ZNPA 3GBFA 2XONA 3TEZA 1WCSA 3I54A 3WDTA 1IHMA 5I0TA 3ZSLA 3AMPA 2ZCWA 3EXUA 3SKJE 5ACA2 2D6OX 3VBHB 3D0SA 5C8CC 1R1A2 2BUKA 4Y1YA 3WNNA 3ZN4A 4AYUA 2BOIA 5A7NA 3T4HB 3ZFFC 2PLV2 3WT3A 3RZMA 2HEVF 4URTA 1QDOA 3EJKA 5LWBA 2W87A 1NCRA 1JZ7A 2EIGA 3ASIA 1DLCA 2EIBA 3WF3A 1ULFA 2FD8A 4KI5M 2BP6A 4XUOA 1PO22 1IG3A 1ULGA 1ASJ2 2P34A 4XCAA 4FOYA 4ZU4A 4META 4NR1A 3ZYPA 2DCJA 1WUVA 1C8M3 5D21A 2DCKA 2RS52 3IPVA 3KT1A 3N7LA 3N7MA 1VMHA 2OUJA 3S7IA 3ZYBA 1US3A 4YZ5A 1NA1B 3VKMA 2QNKA 2VUJA 2WNUC 3URFA 1IS6A 2CU5A 2Z79A 4MH0E 4XVHA 1YQ2A 3P3PA 2QQVA 3ACFA 3UESA 1TE1B 3T2OA 1R082 4I30A 2B45X 2FDJA 5FZFA 1O4YA 5A3OA 3IN9A 5ERLA 4LO8A 5EJZB 3S30A 2D43A 3ILRA 4AVSA 4XAEA 1P8JA 2JG8A 5FYMA 2FCTA 5BNPC 5CFDB 2W1UA 1PNGA 2XR4A 1NG0A 1VBD2 5APAA 5FXVA 4ZS3A 2BYVE 4YG3A 1SFNA 2DTWA 3JUUA 3ZN5A 5LB6A 1MS9A 4B7EA 3DCQA 1AX0A 5DAQA 3OGGA 4L92A 3SEPA 4XBQA 4HSJA 5JZGB 2DV9A 5K4LA 3KZ4C 3UT0A 2R0HA 2HWC3 1MACA 1SACA 1TG7A 4Y22A 3ZOIA 5JWPA 4FPFA 2AR6A 1FOD2 4GA9A 5BNOC 1W8WA 1REEA 2ES3A 3ZYHA 1LEDA 3DUIA 2D44A 3A4UA 3K48A 2E32A 4Q4V3 4FP3A 1VBB2 1H2NA 1Y9MA 3RZZA 1WKYA 2XVLA 3B02A 5CKNA 2C9KA 5C4WC 1Z0HA 1IKPA 1HXS3 2HWE3 1D4VB 2QE3A 4N53A 1PM4A 1V6KA 1VR3A 4YFZA 2J1TA 1DGWX 5FYVA 3KQ4B 2G9ZA 3M2MA 4JHTA 4KG8A 4Q0UA 4ZXKA 4RSUA 1K42A 1XXNA 3CIHA 2YYOA 3POFA 1X36A 2G1MA 2VZSA 5BV6A 4P9GA 3IIIA 3NQHA 4DPNA 2Q0AA 2V4VA 3IB3A 3MI8A 3POEA 4AHWA 1B35A 1CAXB 3KV9A 3KMHA 2JDYA 1QOSA 2ZZQA 4XC9A 1DQ6A 2ID4A 4OI4A 4WZFA 4ZXEA 1W2TA 2FZ2A 1OLRA 4JGZA 2XWJB 4HVRA 1GSLA 1NE6A 1PVXA 4IEZA 3VHRA 4CU6A 4OHYA 1K5MA 1SLCA 2VCAA 3H3LA 3L2HA 3LFIA 3DYPA 4MADA 1Q3EA 1MEC2 4LBMA 3KV5A 5T5OA 4A7KA 2B46X 5KC6A 4AQ2A 3JD73 4M00A 3AXEA 4XXAA 3JCIA 2D98A 3AMHA 3OGJA 4PBOA 5DQ0A 5FZIA 5FY4A 1NZIA 1MS0A 4TSVA 3NJXA 2QZ3A 3TRSB 4AFDA 1YFYA 1XC6A 2YBSA 4MXWA 3UK9A 3PMSA 2Y6HA 2VCBA 1PK6A 2BGOA 3HR9A 2ZACA 2BBVA 4UBGA 5FY5A 4QX8A 3FZ3A 4YZ1A 5LCWL 3O0WA 1RUE1 2XBO3 4AI8A 1H0BA 1RUJ1 3HN3A 1N3OA 4JGYA 4Y4YA 5FZEA 5BNNC 4B4RA 2RM21 4EQVA 3B9CA 2Z42A 1EUTA 2D7FA 2QKDA 2GC0A 4Q4Y3 4YVSA 4O61A 1V6MA 1ENXA 3MUZ1 3ZFFA 2D3SA 3POGA 4ATEA 2BOJA 4BYYA 2CTVA 3SCHA 5FYHA 2ENRA 3KHBA 2GU9A 3PUIA 4XQ4A 1RUF2 1T6GC 3MPBA 3PTRB 3AMMA 2HYKA 3BTAA 5CNAA 4A4AA 3OEBA 1WGPA 1O3SA 1V9U1 1W8UA 3PVNA 1TMF1 2H0BA 4AFCA 1LOGA 4HLTA 2JD9A 5G04L 4E27A 1HB3A 3LWCA 3BYWA 1ZREA 1NLSA 3BN6A 3IM0A 5FIXA 4A45A 3KHCA 2GC2A 4Q4W2 1H9WA 1D4M3 2CYFA 3AZXA 3FLRA 3O1MA 3POSA 5HCAA 2A71A 2RS13 2RV9A 1S1AA 4XUTA 5A3PA 1H4GA 1TQ5A 2EVXA 2PQQA 4FQZA 1ULCA 4FT8A 3VL8A 1PVC1 1RUNA 3P3NA 5FZLA 5LEKA 3BIEA 3PVEA 1X33A 5ABJB 1SBDA 1LKNA 5DXDA 5D1IA 4ZY9A 4Y4RA 1BXHA 1UZVA 2D93A 1CPMA 1JHNA 3RYPA 1W28A 2VM9A 5BYNA 1J1LA 1F5JA 3WHUA 3CNAA 4Q8KA 3CF6E 1XQNA 1LOAA 1CAUA 1RUC1 3MDPA 3N9LA 2QBXA 5FMBA 5FP7A 3KCYA 5FZHA 3OJBA 5KHIA 2HBUA 4OI0A 3GF6A 3SH3A 2XJQA 4LE3A 4XJAA 2WJSA 4JDMA 2PA7A 1ZZ6A 4G4FA 3W5NA 4ASMB 5BNOA 3HNYM 1DU3D 3CU7A 4FFFA 1UPSA 2ZPXA 3J8F1 5J09A 3F2ZA 4XDQA 3ZYJB 2FCUA 1VP6A 4D6RA 2YB7A 3MFCA 5K0UB 4JDOA 4O7XA 2X05A 2F17A 1VRH3 2VUAA 2HEWF 1JUHA 3DEMA 1RUI1 1KFXL 3B00A 4J1WA 4K8FA 5C4WA 4NROA 3MYXA 3WNLA 5JIAA 1H2KA 1AL21 2ZGUA 4L0PA 5F5CA 4UFMA 5FXZA 2IXIA 4AQSA 2ZA9A 3ETPA 2VD7A 1HX6A 3TN92 3I97A 3VBSA 2IVIB 3T09A 4Q4V2 2QQPA 1LEMA 1A8DA 2YBKA 1OFNA 1ZRFA 4YSFA 4UYBA 5KHHA 3O12A 3QOPA 4BZ4A 5C9AA 2HWE2 5EIYB 2CHHA 2RE9A 2R072 3GGLA 3HAGA 1RVF2 2JENA 4QXKA 4GQ7A 4AVBA 1RUOA 4YPJA 2RJKA 3N9NA 2MNGA 3FX3A 2VCMA 3PU3A 2OW4A 1QOOA 1UOBA 1GP4A 4XJUA 3RI8A 1YCIA 4HXCA 4DZGA 1QJEA 1W6QB 4WM8C 1RMU1 4EN6B 4WZCA 1HW5A 4M3CA 4MGKE 1OKQA 1WW6A 2WS92 2Y6KA 5JAXA 3HBZA 5JI9A 4FTSA 1WMFA 1UPIA 1KRIA 1MZ5A 2Q8EA 1I9RA 1QEXA 5EFUA 2EALA 5IVJA 2WFF2 3I59B 4M01A 2OPKA 3GNEA 4OYUA 3R4UA 3C7GA 4LPLA 2JJ6A 1J1TA 5I0SA 1UU6A 1YO8A 4KWLA 4Q8LA 4YZ3A 4CDWA 1RL3A 5FZ3A 1MS3A 4QX5A 4AI1A 2XHKA 5LATA 1NLRA 2OZ6A 5BNNA 1KITA 1W3VA 5JXIA 2W3JA 4HK8A 4J6GA 1AXZA 2ZGTA 2IUWA 1HJGA 1A3KA 3JBG2 1L7QA 2ARXA 4OCTA 4RR3B 2V09A 3WDYA 2RJLA 2OQ6A 1ZBA3 3ZXJA 1UY0A 1NCQA 4GWMA 1R092 2WNVC 1ZBE1 2R041 1LGNA 2QQUA 1OVSA 2WR9A 5EYXA 2VTXJ 1S2KA 4AL9A 4Z2AA 4LULA 4XAAA 4MVTA 4W6XA 5FRAA 1K12A 4EV0A 5B4XA 2GNMA 1LHVA 4BMBA 4Y1UA 3NKGA 2WZPP 4E2SA 3GBWA 1HDKA 1LODA 1T2XA 4LBNA 1K3IA 2FDFA 1FPN1 1NQDA 4IEOA 5FY7A 3WNXA 5I8TA 1J3PA 2E53A 2OT7A 4CP9B 5FP8A 4NHMA 4E9KA 4XMAA 3E5UA 3G6JB 2C5DA 1YQ5A 1V6LA 1A6CA 4QKNA 1DZQA 5LW9A 1CJDA 3VBRB 3FN9A 4HPKB 1L7LA 5A3NA 4QX3A 3RI9A 1UZWA 5FZ4A 1AYM2 4LT5A 3AFKA 2B39A 1OLQA 1TNRA 3WDVA 2Y64A 4IEWA 1UKGA 1AR71 4ZU5A 4BK4A 3ATGA 5FQ0A 3MIFA 1AR61 2PHUA 3HWJA 3ME2A 5L36A 4UFIA 3HBKA 1KXGA 4HVQA 3B9IA 2W1QA 2XL7A 4NIDA 3THCA 4NHKA 4TZDA 2ZAAA 3BALA 3D6EA 5A6XA 3LPGA 1KS5A 2UYAA 1PIV1 3AJZA 5GZCA 4OULA 5DZEA 4LK7A 1O3TA 1AR81 2HWF1 2RS31 4GJYA 5FPAA 4B1MA 3V0BA 1CZVA 4JCKA 3B01A 3KWVA 5A80A 3LEMA 2WLPA 1AHSA 2PAMA 3GYDA 4MGYE 1Y43B 2DVBA 3IAQA 2RHPA 3FWEA 2ZKNA 4ES8A 2ARCA 1RUG3 2PFWA 2BBAA 2W46A 3SH4A 4G9SB 3ZFGB 1BQPA 1CD3G 1XYPA 3QBQA 1UYZA 1VLNA 2J1EA 2OXBA 4LUMA 4NO4A 3HN1A 5EHDA 4ZKTB 1W2AX 3FFQA 2ZX4A 4UF0A 3VBUC 2QQLA 2LUWA 2G19A 2WDBA 1DQ5A 1OFSA 2NMOA 3GDBA 1EUUA 2Q8CA 2VMEA 4YM0A 3CDZB 1A8MA 1ULPA 2LALA 2XOMA 4IESA 5KHGA 4IE6A 4GB31 1OXCA 2VPVA 3H7YA 2YU1A 4CCOA 4C91A 5EQUA 4Q2FA 1W90A 1KDKA 2OQ7A 3K3OA 4NRQA 4UFLA 1GP6A 1VBC2 3OSDA 2UURA 4WM7B 1UMHA 3I2JA 5M0TA 1VRH2 3MUY1 2W92A 3SISA 3TOJA 2C24A 2WZR1 2WZEA 3FUQA 4CRQA 2BJSA 1JYCA 4LEJA 2Z2SB 5JOYA 2EICA 1S0BA 5DG1A 5ANQA 5C7GA 3OY8B 2OUHA 3MLLA 4L99A 1WBLA 1OUSA 3O0XA 4H2AA 1N3PA 3WSOA 4W4ZA 3ZXFA 3ZSKA 1C3HA 4Q0SA 3RJRA 1J3RA 1UY3A 1ZX5A 1UY2A 3A23A 3MEPA 2HJIA 5AFEA 1SLBA 3GBGA 5CEHA 2IWGB 1UN1A 3AX4A 3VDDB 3C7EA 1RHI1 1WLTA 1QY4A 1AR91 4YVWB 3IMNA 3S5QA 2WQ4A 4JC1A 2J1UA 3Q8BA 4PI2A 1GOHA 2H0VA 3S7EA 4DOUA 3VZNA 2A6ZA 4CEWA 3ZYIB 3IBMA 4Q4X2 3H3UA 1WLDA 2YU2A 4HT1T 3AL5A 3HNMA 5CFCB 3KB5A 1JXNA 1AYN1 1CAWB 2DWRA 1X7NA 2G9GA 2WBKA 2HWF2 3VL9A 3K4DA 3UL2A 3VD4A 3M7AA 1K45A 4ATFA 4XJZA 5HPOA 3FLPA 4YW3A 2YGLA 3O1SA 4N7IA 3I2DA 4YLZA 4MXVA 1T6BX 5FZOA 4RS5C 3RQ0A 1QJU1 4Z1VA 5CADA 4Y33A 3I2IA 3RGBA 1W04A 4JRLA 4IUGA 2Y33A 1JBCA 4MGTA 3V0AA 1VB4A 1JYIA 2XJVA 3VN4A 4RQPA 3VDBA 2RMU1 4IV3C 4CDUB 2F6BA 1EY2A 1UD1A 1POV1 1RUD1 2DUOA 5LK7B 1BBT1 1Q8VA 2FCVA 5IWFA 1ENQA 5FY0A 2A1XA 3JXSA 1QDCA 1Q5OA 4CUAA 2MPFA 2TBVA 1PGW1 5GZFA 2ZX0A 3W20A 4IEPA 3D8CA 1XNDA 4UFHA 1LTEA 5ISLA 3VBOC 4X6QB 2PHLA 2Q5TA 3K4ZA 5FYIA 1QJX1 3MIHA 3LQCA 5GLVA 1SDWA 3QD6A 3NMBA 1LRHA 3HJRA 5I8YA 2PHRA 3VBFC 1Y4WA 2K46A 1UU4A 3Q8AA 1GFF2 4XFGA 4FQ4A 3ZXLA 3USUB 1UIKA 5FK7A 3OBZA 3ZSEA 3D82A 1PZ7A 1RC6A 2I74A 2SLIA 1SPPA 5GLTA 3VDDA 2J22A 4BA6A 3VV1A 4PIXA 1HN1A 4HOOA 1JUIA 1L7RA 1VAKA 5HCHA 3AP7A 3H7JA 1UYPA 2GN3A 1Q8OA 1G9DA 1BKZA 1KS4A 1S0IA 1IS5A 2GNBA 2PHFA 4IE7A 4QGNA 4U36A 5ANNA 5FYCA 5A3WA 3WW4A 1DF0A 2TNFA 4L97A 3I8TA 4XHXA 1AR92 1Z7S1 1H1AA 1OPMA 2ORXA 4HN0A 3RZLA 1SQ4A 4GMP3 1NT0A 1W99A 4GWJA 4S2FA 3AB0A 5DUXA 5EZWA 2BWCA 1W6NA 1Y9QA 3RFRA 2E9QA 2MHFA 2JECA 2GMPA 3WCSA 4AI3A 1JU4A 5IK8A 1BEV1 1BK1A 3WCRA 3PL0A 2VC9A 4WVVA 2BNMA 2XJUA 3WNPA 4BH9A 5LRRA 3WV6A 3MFAA 5IVVA 1CR7A 4QQHA 1W8FA 4QPGB 1U5IA 1ND3C 2A5ZA 2HBTA 4LHNA 5GZEA 1CESA 1HJFA 4EZ4A 4FFHA 3PVOA 1I6XA 3KLSA 2JB8A 3WW3A 1QJY2 2AC1A 3PURA 5A1FA 4RL7A 4IV1C 2D5FA 4QXBA 1XPWA 2VQUA 3BU7A 1QF3A 2WO1A 3ETQA 2AREA 4YARA 5ACA1 3S6PA 1R1A1 3IDAA 4XF0A 4EN0A 5CAZA 5A3MA 2PLV1 2XLGA 2ZGLA 1JZ4A 2Q8OA 4AFBA 4IE0A 4LKEA 3ACLA 4M3CF 2DDUA 1OQ1A 5LBCA 1W9YA 3QACA 1ULEA 1SLIA 2E33A 4XF1A 5JR7B 5AVAA 3U4XA 5B4NA 3I49A 4LXLA 4CDXC 3LGRA 1RUH3 3H1YA 2BU9A 3INAA 2DVGA 3PUSA 1PO21 2I07B 1ASJ1 1VJ2A 1NCRB 2DVFA 5D8AA 2WNEA 5F37A 1V6JA 2JE7A 2VZ3A 4W65A 5T3NA 4CE8A 3HD8B 2VTXA 3KF3A 2RS51 1ENSA 4QX0A 5DZGA 1EV12 2XH6A 2ZGQA 5A7SA 5AC93 1ND2A 1HV1A 2VY0A 2JG9C 2XUMA 2W1WA 4RS5A 4XOGA 5FZ0A 3ENRA 2JICA 3IPVB 4R52A 3I3MA 1L3JA 4COWA 4LTAA 2PHTA 4LKSA 4UFJA 1R081 2NLRA 4HMZA 1K5JA 2BNOA 2WYSA 3SCGA 5BPXA 4OVEA 2LRPA 5IVEA 5DDJ2 2J1AA 4IXLA 3UJOA 1C1LA 4SLIA 1YWKA 3M3CA 3VB9A 5FOJB 3T1MA 3VDCA 5JXJA 1VBD1 3FC0A 1MZFA 2XWBB 4ZPIA 3OPTA 1ZYBA 1X9TA 2V72A 4LIVA 4NOTA 1VB2A 1FI2A 5DN2A 3R6SA 4YYOA 3UGFA 2JG8B 3VZOA 1GUIA 2E26A 3B94A 3SC7X 4FOQA 5IVYA 3PJQA 5FP4A 4PHZA 5KC5A 1PO12 3OYWB 2W91A 1FOD1 5IAXA 1LAJA 1UXZA 4RN5A 4BHPA 3D4KA 3MW4A 3D3AA 4HONA 1JMUB 2BW8A 4FXKB 3BPSA 4NUBA 3ROUA 3OD0A 3FLTA 1VBB1 4XYXA 5IJRA 4Y22B 1NA1C 2ZHMA 2R32A 4NIGA 2V5YA 3AJYA 1JYVA 2HWD2 2VZUA 3PJYA 2P3YA 3I2KA 5H9SA 1MS1A 3LD8A 3NAPA 1IS3A 2OYZA 3RZHA 5FPZA 2GN7A 3S57A 4EN7B 1QH7A 4Y26A 5J1XA 5A33A 3M3QA 1H8TC 3CEWA 3H0OA 1W6PA 4N53B 4AEJA 1V00A 1OOPC 3GZAA 1XE0A 3H42B 1LHUA 3MW2A 3TAYA 3KCXA 3ZFEA 5CFDC 5J3UA 4QPWA 4YW2A 3POYA 1N1VA 4Y5Z0 2CGPA 2WABA 1DP0A 4A3XA 1CIWA 2VXJA 1FNYA 2Z5WA 4KMQA 1IQAA 1COV2 5GZDA 3K2OA 3BIWE 5JZGC 3SITA 3BOPA 4JQTA 2JB4A 2TEPA 1B35B 1MEC1 5GALA 1MS8A 2EAKA 4AI0A 4DUWA 5HXMA 2DUQA 5FJKA 5EXOA 4XCBA 3LEIA 4JGZB 3HQUA 3IDCB 1K5MB 2LM3A 1J3QA 4GKXA 5IATA 3BI3A 2D3PA 1W05A 1NXMA 2ZHKA 1W6MB 1AX1A 3ELNA 4JKMA 5FV3A 2WC2A 4XHBA 1VBA1 3CL1A 4B7KA 1UIJA 4CXXA 1MQTA 2VQAA 1BYHA 1C5IA 4OZXA 3ZYFA 1XNKA 4MXWB 1KJRA 1VBE1 1PK6B 2WRAA 4M0NA 3BTYA 1GOFA 2YGMA 3A22A 1CPNA 3OYWA 2YFZA 1X82A 1YI9A 2PQSA 5CB7A 2P37A 2GC1A 4JGYB 4MSVA 4QPIC 5JLVA 2D6MA 4COUA 4Z8BA 1HRV1 1OQEA 5LY2A 4NPLA 2W39A 3MIBA 5F6LB 3K3NA 4FOVA 1RUF1 4AFMA 1Q8SA 4COZA 4XJWA 4OHWA 4YVSB 1WW5A 5FXWA 2WO3A 3ZFFB 3WNKA 3JU9A 3OOXA 3T0BA 1S55A 4X8NA 4W6YA 4Y1VA 4FCAA 3BOWA 2Y38A 2VOKA 3CJXA 3M3IA 4BQYA 4Z2WA 3BB6A 5E1RA 5EV7A 4Q4W1 4DRVA 4Y1XA 5HCBA 3C2UA 5DAXA 5FY1A 3RMXA 3U4SA 4BLIA 4I0WB 3OD4A 3VDAA 3VZLA 2JD4A 1LJ7A 3LIHA 4GAZA 4JQRA 1UW8A 3H1WA 4TYSA 1HRI3 5F3GA 2WIIB 3T2TA 2R062 1RUH2 1RXFA 3AZVA 3C8XA 4PQ9A 4D6QA 3UKVA 3CJIA 3HPNA 1CGPA 4QHOA 4HSLA 3FHIB 2YV8A 1UOFA 2RM23 2VW0A 3T0AA 4B8EA 4BQ3A 1OH4A 2YDEA 3OGSA 1W2NA 2FQPA 2VO5A 1JZ5A 5AC92 4XIOA 2ZHLA 5FY8A 3DPRA 3AMQA 3WQ1A 4R9DA 5IK4A 4LJHA 4BM8A 3H8OA 4P9LA 4CTEA 4EROA 3NVCA 5FPVA 3A21A 3AYCA 3BU0A 2MEV3 2ZOEB 1LHNA 1V9U3 4FVVA 4Y20A 3N35A 2WNOA 3AZZA 3FBMA 1W6MA 3V65A 1Y3TA 4LUKA 1LOFC 5FLIA 1J84A 5L73A 2JKXA 4DEVA 3VKLA 4BE3A 4LQRA 4PDWA 1CAUB 4N8MA 4GH4A 5T50A 2Q8DA 2RR13 1REDA 2X29A 5EPAA 5JVVA 4AF9A 5L9BA 3RZKA 3WF4A 1C8NA 1XYNA 1URXA 2D40A 1WCQA 1N1YA 1V6IA 2GALA 1C57A 2ZGKA 4HN1A 5FY9A 1PVC3 5JPNB 1VBA2 5BNOB 5HBAA 1GBGA 1UZYA 5A7PA 3EMRA 3IZOA 3VKFC 4HETA 4EWEA 1JN2P 3KS7A 2D6LX 1VBE2 3WF1A 3MGUA 3UETA 4LO7A 5FMCA 5ABJC 2BFUS 5C8CA 3SLIA 3ZYGA 3N9OA 2VG9A 3TN91 2ZEXA 1IPJA 3FUOA 5C4WB 3N9MA 4Q4V1 1H8TA 3HQXA 1NX9A 4AG4A 1XU2A 1HRV2 2A6VA 3K4AA 1OOPA 2E31A 3OUJA 3POJA 1H2MA 1IOAA 1CN1A 1W8OA 4UAPA 5JSPA 3S0MA 1G9CA 2VZVA 4XDPA 3AM2A 4M3CE 1F5FA 2ZX2A 1XE7A 2HWE1 2R071 1ACCA 3T4VA 1RVF1 2XL9A 1QQP3 1XSQA 4LBQD 5GLZA 3TYJA 3VBSB 3SH5A 3DECA 4LNVA 4IW3A 4EWAA 1CIYA 4CP0A 2LTNA 1KGYA 4UW4A 1JW6A 1VAMA 4XFFA 4A6SA 4ET7A 3M1HA 5C9AB 5AVPA 3J8F3 4NIAA 1SCRA 2VQTA 3FMGA 4GWNA 2IXJA 2WS91 3WW2A 4B1LA 2VMDA 3KCCA 1CWPA 2WNUA 1W9WA 3WHTA 2WFF1 1TME3 3AKRA 1RUI3 5FFOC 2WKKA 4XW3A 4KWUA 5K0UC 2FDHA 1U0AA 1AL23 4M3CB 4DFSA 4D7TA 1SCSA 1C8M2 4RFRB 5I0UA 3AYDA 1YUDA 5C3RA 4I0AA 4P08A 1PHMA 5JXHA 3CLPA 1JYXA 3ZSJA 2ETEA 5F39A 1QNWA 1XRUA 1GU3A 1OBNA 1G7YA 4DEQA 4CUCA 1LULA 5BNPA 4DMIA 5CKMA 2ZMNA 1KJLA 2CDOA 2VCCA 4KNCA 4PJYA 1CJPA 3JBG1 3PDQA 3H9AA 4CDWB 3AKTA 4XZUG 2PXJA 4LR4A 4WVWA 4NVPA 1R091 2QCSB 4QPIA 4XDOA 1UYYA 2IXCA 5KWRA 5BNNB 3EBRA 3TEXA 4H55A 1A78A 2VNVA 2WFPA 3I2OA 2CWSA 1SMVA 1GR3A 1DGWA 1RMU3 1NCQB 2Y34A 1F2NA 2YHJA 3Q8FA 4AZZA 3RMYA 2C0ZA 2GC3A 4KWJA 1O6UA 3ST7A 1DQ0A 3FL7A 1ULOA 4QB1A 2CGOA 4NAOA 4QX7A 2ARBA 5FREA 3CQOA 4XETA 1RITA 1LU2A 3GALA 5FUNA 3MIEA 2OZJA 3ITQA 3WW1A 3E97A 2PYTA 2HWC2 2BV4A 2XJPA 4B4PA 1AYM1 3LAGA 4JAAA 4LMFA 2HWB3 3U10A 1TEIA 2VZ1A 2VMGA 4ARXA 4AQTA 1Q8QA 4PI0A 3ZO0B 2VVFA 4X6RB 4XTPA 3ILNA 4KG0A 4MYEA 2VE1A 4UW6A 2Z4FA 4OQ8A 1JTZX 2XUEA 3NO8A 3WOGA 4Z82A 3UKNA 3USSA 3WVJA 4OUEA 4QKFA 1WMXA 1XB9A 4K8RB 1YI7A 4IGQA 1YFWA 5FQ0B 5FPBA 1C1FA 1HXS2 4RR3C 3MF9A 2FZ1A 4FI9A 2RDQA 1OLMA 1SLTA 1S0JA 2C1FA 2Y26A 3ZYRA 5FKCA 4H14A 5FYTA 2GP5A 1IPKA 3DGTA 1H6YA 1UAIA 2NN8A 4LHLA 3WQBA 1O3RA 1SBFA 3ZLIA 4MX3A 2W0XA 3WP6A 1NY72 2XG3A 4QDSA 5A1AA 2YBPA 2CDPA 4NPRA 3SKVA 3T08A 3AP6A 3V0BB 3PLQA 4LLOA 4DB5A 5CG9A 2WWJA 4FO9A 2VVDA 2YPJA 5IVBA 1ZZ8A 5DMYA 1MZEA 4R8HA 4YNIA 2MEV2 4YGCA 4E4HA 1CQ9A 2Y6FA 3AKQA 3L9JT 4JVAA 3VBRC 1AR73 2RG4A 1O8PA 1ONAA 2WQZC 3DF0A 1AR63 4CVUA 3I2FA 5J96B 2LROA 2W94A 3JD72 3MLKA 4LE4A 3BPZA 5T5PA 4LA3A 3N9QA 1W0NA 4MV2A 2HH9A 3ALQA 4UF0B 2XJRA 2VZTA 3U1XA 3ABZA 5LBFA 4ZHNA 1OH3A 2RR12 1QH6A 2C4XA 4WVMA 4DY3A 3WG3A 2UYBA 1PMHX 4XJ9A 5DAWA 4BXFA 2ARAA 2AACA 2A6WA 4HANA 3UNPA 3ES4A 1OHFA 4QM8A 1AR83 1VBC1 2RS33 2VULA 4QGMA 1PZ9A 3WDWA 2PHWA 1VRH1 3ACIA 4YGBA 1OT5A 2XBO2 2V5DA 3OUIA 2VMIA 3Q8CA 2VVEA 4K3UA 5F3IA 3CZJA 2R1DA 3KT7A 3RWKX 1UNBA 3ORJA 5LK5A 1UWWA 4Q4Y2 5C5UA 2VR4A 4I2OA 1JH5A 2ZX3A 4OLLA 1XNTA 5TSWA 2A3WA 1LR5A 4FTEA 3E1F1 2JXAA 3ZFGC 4H3WA 1AJKA 2KR2A 4HZFA 2PMWB 5L7OC 1JODA 3OB8A 4QWNA 2P17A 3DKQA 1AJOA 1GNZA 4QHBA 3WP3A 1QQP2 4XF9A 1AXKA 1F9KA 3W59A 1CAVA 1LOBA 5FMOL 5LA9A 2BVBA 3CZUA 3IDBB 3VZKA 5HI0A 3FE5A 1MS5A 5GM0A 2BVVA 1CONA 3I3BA 5T5JA 1HLCA 3LA3A 4RHV3 4GB33 1D4M2 5KXDA 4Q4X1 1RTVA 3OG2A 2RS12 1O5UA 2PELA 3W21A 3MF6A 2VXRA 5H9RA 1GZWA 4L9BA 5I93A 5IHRA 2BRTA 4LOSA 2WZR3 2YG0A 2Q1FA 2IZWA 3GCWA 3WG1A 5CYYA 4IEYA 4CEWB 2B42B 5FR3A 1PX3A 4WM7C 4BJ0A 5FPXA 1S2BA 4LKFA 4BU2A 1JYNA 2BWAA 3J7NA 3KT4A 1MVQA 3NV2A 4ZU7A 2O14A 4DXZA 1DQ2A 1WCKA 1NE4A 4Y3OA 2VAUA 2P3JA 1REFA 4I0BA 1WW7A 4BQXA 2VBDA 3HIFA 2JDKA 3B69A 4X8PA 4BOWA 3BUCA 1QMJA 2HYXA 1AXYA 1X8MA 5FZOB 4UW3A 3WXPA 3DXTA 2VOTA 4AEDC 4BQWA 5IVFA 1NAEA 3MHZA 1VIWB 1RHI3 4D7SA 1S0EA 1G6NA 4L2NA 2XKPA 2AENA 4OFGA 3OPZA 4O65A 3V0AB 1VMFA 2BZDA 4R9AA 4RQPB 4YVWC 2ZHNA 2ET7A 5JIUA 3A0KA 2J42A 3PIJA 5F1RA 2NPIA 2YY1A 3AL6A 4PLOA 4UI9L 2UY8A 1HB1A 2AUYA 5CA6A 2A3XA 4BWOA 2NQYA 1UYXA 4ZZ8A 3FBYA 4TXWA 5KR7A 2WWUA 1JU3A 1ZRIA 4IGPA 1QXJA 1NOVA 2IXLA 4V2VA 1V6NA 4OMDA 2A6YA 3UGGA 2XB6C 1TNFA 3RG0A 3ZR6A 3H8XA 3VD7A 5I8SA 2DVAA 2E51A 2HWB2 4KGQA 3U75A 3ZX7A 3WP4A 1DDLA 2BDRA 1FV2A 1GWMA 3R4DB 5E89A 4YW7A 2YC0A 3C7HA 5FDBA 3GXUA 1LNSA 1V0AA 3LA7A 3EB7A 4LK6A 1OA3A 4P9YA 1AZDA 2W47A 1YIFA 2PHXA 4GD4A 4HKWA 4MO3M 4WM8A 1UOJA 1S0GA 1SLAA 4OUSA 4ASLA 2Y8KA 3CBNA 5FZ1A 5FK8A 2R0FA 4Y1ZA 1POV3 1EP0A 1RUD3 1STMA 5FPLA 5CIRA 1BBT3 1SPPB 3J7LA 5F6KA 4Q0VA 2BQPA 5H9QA 4AVCA 1O3QA 2BERA 4FOWA 2A70A 4NN0A 2QQJA 3VHOA 4PF1A 4UXAA 5FYSA 1HB2A 2VBPA 2AEZA 1UCXA 3B93A 3KVAA 2DUPA 4EE2A 1U5YA 1W8HA 5JMOA 1LB2A 5K8SA 3H1MA 3AMNA 4HFSA 1QJX3 4R4XA 5FUIA 3WNOA 4INDA 1QXPA 2P2KA 4LBQA 1GWLA 2W5FA 4Q29A 1W39A 4CDQC 1RINA 5GLUA 3ZXKA 4S2GA 3LIGA 2O0OA 3LA2A 2EAAA 1ULDA 2CL2A 1W6NB 2QQIA 3N36A 4S2HA 5EJ1B 3RRDA 1FAYA 4SBVA 3TEYA 1QOTA 2HEYF 2WNVA 4Q26A 1Y7BA 4AXOA 4ES9A 3ZSMA 4XF4A 4BQ4A 1B09A 1YQCA 3U11A 4BCUA 5JR2A 4K1ZA 4MGIE 2RVAA 4FPJA 4AHZA 3ZDSA 5KXCA 5JCTA 3HMYA 1QJY1 4DXTA 1ZBA2 2WO7A 5L9RA 3AP4A 1EAH3 2YROA 2OVUA 2EXJA 1GQPA 2JDAA 4MLOA 4N43C 4ISRA 5FBJA 2DVDA 4I09A 4CCLA 1LHOA 1GQGA 1Z7S3 2VU9A 1XSRA 3LSDA 5T54A 3TWIA 5L7OA 1WA4A 5KHJA 2E7AA 2WINB 3FHAA 4QB2A 3HT1A 5FMDA 4AI2A 1FMD3 3SNMA 2CGNA 2IXKA 4I02A 2QQKA 2QJVA 3EO6A 4HVOA 2B9UA 2DBIA 3PUAA 3SCFA 4IEQA 1R1ZA 4N90A 3U37A 4YRDA 1BEV3 1XU1A 1PGL2 1OC1A 2X5IC 2XXZA 3JB8A 2Q4SA 1WD3A 5F5QA 4LLFA 1WLWA 4OZOA 2OX0A 2WLQA 4E2GA 2K9ZA 1BVP1 2KXLA 3TNQA 3KVBA 3LOBA 1MS4A 2E6VA 4QQ2A 1EV11 5C6CA 4I01A 5A7OA 1YEWA 4FPLA 2ZEYA 4GZ9A 5FZDA 3ZXEA 4E4SA 3HEIA 3UYJA 1PNFA 2D5HA 3M3OA 4JTNA 4PIZA 5D8AB 4RHV2 3SXWA 2ZXQA 5A1LA 4YM3A 5JOWA 2GH2A 3Q9OA 4XACA 3RYKA 1V70A 1HN0A 1U5ZA 1W03A 5IK5A 1OKOA 2GP3A 4B3NA 3I2GA 2V73A 3T0DA 4BIOA 2UU8A 4EWDA 1ND2B 2RJ2A 3IT8A 1GNYA 1R1A3 3VBUA 2I45A 4BXSV 3WR0A 1S0DA 5DDJ1 4AEDA 4AK3A 4NHXA 4RS5B 1NXD1 2PLV3 2DFBA 3AVSA 3KD4A 4QB6A 1OMIA 4Y5TA 1ZZ9A 2Y0IA 1LESA 4YFWA 4QD2A 2VH9A 1RUG2 4RD7A 4XXPA 5FLHA 4YW1A 1XOYA 2A3YA 4LBKA 4UFKA 2AH2A 4CCMA 3NWKA 4C8DA 3K51A 4XZPA 5A3LA 1UY4A 2WSVA 1ASJ3 2QQNA 4R4ZA 1H9PA 1F15A 4AEMA 1PO11 1FATA 1DIWA 3I3EA 2RS53 1UO9A 4NWVA 2Y6LA 4OI2A 2VOWA 3I7DA 4NHYA 5EYYA 3SQOA 4UW5A 4QXHA 2H6BA 4E2QA 5KXEA 3H50A 3MICA 3M8LA 4HBNA 2EIDA 2ILMA 2QQWA 2W52A 4CEYC 4WV8A 4Q0QA 4MOAA 3VBFB 2HWD1 2XQXA 1ZA4A 1BVVA 1R083 3LZZA 2RDSA 4URAA 4G3YC 3RPQA 3ACGA 4FPOB 4DINB 4N9HA 4HL0A 2W08A 4V1PA 3ZIWA 4AVTA 5CVRA 4YW6A 4DUXA 1PGSA 1SBEA 1CZTA 2QQOA 4QHZA 5BNQA 3NAPB 3ZKUA 4A7YA 4P00B 5LY1A 4QGLA 1OURA 3LKJA 3E6DA 1DCSA 2QDRA 3B5LB 3W58A 1TVGA 5A33B 1ST8A 1W6PB 5F9TA 1COV1 1OI6A 2JG8C 2YPDA 5JI7A 4AHXA 1VRBA 1FOD3 3ZFEB 4CDQA 5E16A 2HKXA 1BCXA 2W9XA 1RJ7A 3NNJA 2GMMA 3M70A 4XABA 4DS0A 2CNAA 1N3QA 4IEXA 3DYMA 4GMP1 2JWPA 1VBB3 1BK0A 4MUVA 3A7QA 1NZCA 4QM9A 5C70A 3O1RA 5FZKA 2XPJA 4P14A 3PHMA 1GMMA 1ZM1A 4QU1A 5LBEA 2NMNA 5A7QA 4CUBA 1Q8PA 3GZTB 5F7UA 1ODMA 5J36A 2TUNA 2XQRA 3I3QA 2VW1A 2V4AA 2VW2A 4XBLA 2P3IA 4IV3A 3BTZA 4FFIA 2G9FA 1YJLA 4AEKA 2QDNA 3WD5A 1JZ6A 1ZZ7A 1CZSA 4N43A 3RS6A 3VBHC 2VNRA 1GANA 4PBPA 4GKYA 1YHFA 4FPEA 5DABA 4ONUA 2VZRA 3AKSA 1W2UA 3MZHA 3WF0A 1J58A 3MV01 4ORFA 1MQTB 2ADDA 5SV5A 3D0JA 3VBOA 4QKDA 3NL1A 4ARYA 5A70A 3ZXAC 4P5YA 1WMDA 5E88A 3UJQA 1SEFA 2BGCA 2F4PA 3THPA 1MEC3 1KQRA 3CKHA 5FLJA 5EJ3A 4NIIA 1GLHA 1HQWA 2X5IA 3VBFA 3PIGA 3VKOA 2O1QA 3GHNA 2D3RA 1FMD2 2JE9A 4TLGA 4YWAA 1JI6A 3TEWA 1JZ3A 3HVDA 4JGZC 4P9IA 3IWZA 3O0VA 3SHRA 3U78A 2ZJCA 2OS2A 1K5MC 4JKKA 4WVZA 4BQ1A 5JUVA 3KGZA 3ES1A 1YNAA 2I2SA 5EP9A 3N4MA 4DY5A 5JSRA 2R061 1RUH1 4JX0A 3VGIA 4PF5A 1S0FA 2B8MA 1LOCA 4EYUA 2YFUA 4MHUA 1OF4A 5HXVA 4E4DX 2ET1A 5HV0A 3K46A 1QNYA 2O8OA 5DPNA 4AI9A 1IKQA 1DLLA 1HV0A 1PK6C 4FTBA 2Y6JA 5AC91 4M4PA 4XFHA 3CJIB 4CP2A 1X50A 3KF5A 3WY6A 2VMCA 2W2IA 1EPZA 1Z78A 4JGYC 1RUF3 2YUEA 4YGEA 4H7LA 4L11A 4OHVA 4LO5B 1O4TA 3KGLA 4TLFA 3LPFA 2VZPA 1IQDC 5DAPA 3J4UH 4YVSC 3ZMNA 3DPRB 4UOJA 4XILA 2WA3A 4A3ZA 1W6OA 1C5HA 3P5BA 3O5SA 2B9VA 4A42A 5IFPA 1JYWA 2FBEA 4LO4B 4Q4W3 2GSYA 3MLJA 1ND3A 4Q1RA 4Y20B 3O7OA 3P6BA 2Q30A 2NP0A 3FHQA 2ZTNA 1SG3A 2QTWB 1APNA 1GP5A 2ZEZA 3LE0A 2VOVA 4CEYA 5IK7A 1RYYA 5DUUA 3J9SA 4BMEA 4PDWB 5C3PA 1J83A 3RDIA 4GH4B 3DN7A 3RZJA 2PAKA 1DQ4A 2DCTA 4IV1A 1XJAA 3ZN6A 1XNCA 4LBLA 3QH7A 1SDDB 4W50A 2JE8A 1ZVFA 1M4WA 3WNMA 4DXRA 3DYOA 1IS4A 2BPA2 2PHDA 2WO2A 2WWSA 2VUDA 1E5SA 2WT1A 3NJZA 2AZ5A 3A0NA 3AVRA 3WDXA 2DURA 4NWWA 4BPZA 1H1IA 4IE4A 2CSGA 4RGAA 1YQ6A 4DXSA 5C8CB 3RJ2X 4D69A 4JRAA 2P3KA 4RFT0 2DCZA 3T3YA 3BGAA 4CDXA 4CP1A 4KBZA 4ZS2A 3NV3A 1LGCA 1H8TB 2LS6A 4GMP0 4IQPA 4C1WA 5T52A 3GCXA 1QU0A 1OOPB 5A7WA 3ZKYA 4F83A 2YZ4A 1ALYA 5AFBA 4U2AA 1MR5A 4K20A 1D0HA 5IAVA 3ZR5A 4HK9A 2K0GA 3WZ1A 3THDA 5I0RA 5CKQA 1I1EA 4CCCA 2JG9A 1SFPA 2JX9A 1RUE3 1SLLA 2VMHA 2WN3A 4JV4A 2XLFA 3N7JA 1RUJ3 3LDBA 3PNAA 3POBA 4MG2A 4IEVA 4JHZA 5C5TA 2HLEA 5LASA 1C8M1 3U14A 1O91A 4PLMA 2BEOA 2WNUB 4DUVA 4TN7A 2XGXA 1G8WA 2JIJA 2XVKA 3OF1A 3TN93 3ZMOA 4XFIA 5LA0A 1BMV2 3VBHA 2Y60A 1E5IA 4CUGA 1DZTA 4BDVB 4COVA 4LBJA 1AVBA 2P1BA 5FJHA 4Y5SA 2EXHA 3F95A 3IDEA 1G9AA 4IL7A 2R073 4W6WA 1RVF3 1TMF3 2FMDA
chains in the Genus database with same CATH topology
4DNYA 5BNPB 1GYKA 4P9XA 2UY9A 3VBSC 4K9SA 1XE8A 3KSCA 4OHZA 3ECQA 3J26N 3KQRA 5DUVA 1HQNA 4QPIB 3VKNA 5FO9B 2WS93 5LRSA 3AZYA 5C9AC 2Q1MA 3JQXA 2WFF3 1FX5A 1WCDJ 1NA1A 3HT2A 4FPGA 2HWC1 1DYPA 2ZABA 5KXBA 4JDNA 2GZWA 2B5HA 2JDZA 2ZGNA 2OIIA 1F31A 2CV6A 5J98B 1O7FA 1N47A 3AP9A 3WG4A 2G4IA 3N7KA 3JBG3 1I5ZA 2VECA 1RUC3 1C4RA 3JZVA 5CFDA 4B29A 1R093 1HXS1 4HKLA 4CDWC 1HRI1 1GNHA 4S2DA 4I3PA 5JMCA 3PMEA 5JZGA 2IFWA 4YG6A 2XVGA 2A73B 3LOIA 1SFYA 4MGZE 4P5HA 4AWDA 4GXLA 2VQ0A 1NY71 3I4IA 1NCQC 1YFXA 2ZAHA 1LU1A 1IGOA 4D7YA 4JTOA 4I3GA 3WUCA 4DRRA 1WD4A 2UWAA 1UMZA 5CBLA 1AYM3 2MEV1 1CX4A 3VZMA 3AFGA 5J7MA 2FHRA 3JD71 2EF6A 4XE9A 2WA4A 4Z92B 1FXZA 4PLNA 2R16A 3RWNA 4P9JA 2RR11 1AX2A 1H2LA 4XFAA 2VNOA 1VAVA 3AZWA 1CAXA 2XBO1 1J59A 2W68A 3QCWA 4WVMB 1GZ9A 3AYEA 2PTMA 4Q4Y1 3NV1A 1OPOA 3ZVXA 1KFUL 3QLQA 5KHKA 4AGRA 3LB9A 3WDUA 4AW7A 1VALA 1LOEA 3VUOA 4AE2A 1BZWA 2FMYA 2GH8A 4NHLA 3WUDA 1QQP1 3RSJA 4FAGA 5T5LA 2E63A 4ISQA 2DF7A 5FTTC 4HKOA 2YMZA 4XQWA 4BIFA 5JOXA 1D4M1 3WINE 1MZ6A 1YJKA 4KH9A 2RS11 1CAVB 1ZBE3 2R043 1VBC3 2Y0OA 5GKAC 5A32B 1HRI2 1RUE2 1TME1 1RUJ2 1YXWA 4ITCA 1QHDA 2RM22 3VHPA 5BY5A 3E5QA 4KU7A 1MVEA 1FPN3 1G9FA 1QGLA 2PAEA 4GULA 3U0ZA 4YG0A 1GZWB 1LOFA 4CZSA 3GZUC 1ENRA 4KU8A 1NQJA 1GZCA 4FBFA 1V9U2 1TMF2 4XMIA 1DYKA 4C1XA 1ZZCA 2ATFA 3B3QE 4F3JA 2QFEA 2DYCA 1RB8G 1JOJA 2GAUA 2ERFA 2ZX1A 4K7JA 3WLUA 3R0RA 4Q4X3 5ABJA 3L2YA 1PIV3 4KWKA 3TNPB 1D2QA 2WL1A 4LHKA 2KA3A 1OD5A 1WW4A 1ZZBA 2HWF3 3NKTA 4XIKA 3W9AA 1PVC2 3AXDA 3DV8A 1DGRN 1H30A 2SBAA 2HWB1 2ZMKA 2OA2A 4CEWC 5JPMB 1AUYA 2O8QA 1YFUA 5KBFA 3AP5A 5FBZA 3WG2A 1M06G 3JQWA 1DFQA 4AHYA 1GICA 1DGRA 5J37A 1RUC2 3MPPG 4QT6A 1ZRDA 3OCPA 2EXKA 2XJTA 4WM8B 5K0UA 5A32A 3VZJA 3QH6A 4XPVA 5T55A 3BCWA 4AVVA 3J8F2 4RQPC 3SMHA 5JDBA 1RGSA 4N9IA 1N1SA 2GNDA 3THTA 1KDMA 1WLCA 2BTVC 1Q56A 1GQHA 3V64A 5BUVA 2VOXA 5CG8A 1TME2 3C3VA 1RUI2 1GKBA 1AL22 1X8EA 3ZIXA 3POWA 4LBQB 3NW4A 4FP2A 5GLWA 1S0CA 5K9YA 2R30A 3WP5A 4A2UA 4C0BA 4QQPA 4UBHA 2WNVB 4O9EA 4WBBA 5DG2A 1DZRA 4MZUA 1QWRA 1ZBA1 4KL1A 1W6QA 2K2SA 3DL3A 2ZBJA 2CAUA 4XQDA 2DTYA 4AVAA 1AR93 4F8AA 3VDDC 4QMAA 2CY6A 3I59A 2JKBA 1RMU2 3E5XA 2JEMA 1LHWA 5LEJA 2YXSA 3WX5A 2IC1A 1AYN3 2UWBA 2UWCA 5C8WA 5L7OB 4YGDA 5CFCC 1PGL1 1ZRRA 2ZGRA 3KM5A 4YZ4A 4RR3A 3RNSA 1DG6A 1YYNA 2EA7A 4FAHA 4AFAA 1QJU3 1EPWA 1Q43A 2D6PA 4XFBA 4XBNA 1W0PA 1HKDA 1RJ8A 4RHV1 4GIQA 1QJY3 2A7AA 3ZXGA 4R9CA 2RMU3 2NM1A 1XNBA 4B4QA 1F8VA 1ZBE2 1RIRA 2AYHA 2R042 1G9BA 2GNTA 4GALA 4CDUC 5J48A 2QZ2A 3LSEA 4L8QA 4D3WA 4F7ZA 3IKWA 2ZGPA 4AQ2A 2X53S 3VBRA 1LECA 4RGGA 3ILFA 4HPKA 1O4ZA 3E6CC 1KD7A 1FPN2 2ZGOA 1RUG1 2GDFA 3OBTA 1U5XA 3H8UA 3VBUB 1LCLA 4LA2A 4AEDB 2IFRA 2XKOA 2ZKLA 2QVSB 1XYOA 5JSOA 4KBBA 4EN8B 5FO7B 1FT9A 4RA0A 1AR72 3JB4C 1FYUA 1QKQA 1AR62 1EV13 1H4HA 3MIGA 2N7GA 4FXGB 1U12A 4COYA 1CVNA 1PIV2 1H1MA 1BJQA 5D8AC 4Y24A 1D0GA 4Z07A 5GZGA 1AR82 2RS32 4BLJA 3EHKA 3ZFGA 1HQLA 5BXXA 3FFZA 5DDJ3 1GV9A 1H8VA 1IZ3A 1PZ8A 1ND2C 2WSUA 3D5OA 2A6XA 1NYWA 1UZZA 4P9WA 5L19A 2R49A 2DU0A 4O9GA 1DHKB 5SV8A 1FV3A 3RYRA 4K40A 4OI1A 3VHNA 3AK0A 3UKTA 3B7MA 2VGDA 4QU2A 1YLLA 4EN9B 5IT6A 1PO13 4K1YA 4EJRA 1UL9A 2QUOA 1QXRA 4WM7A 4QPGC 4LO6B 2KM2A 2XLAA 5FMOS 4XFCA 4GB32 4M0HA 1EYBA 4KQ7A 1PM7A 4CDQB 4XF3A 2HWD3 3X29B 1E57A 3OY8A 5E8AA 5ACA3 1V6OA 2WZR2 3N3HA 5JOZA 4C90A 5C33A 4AGVA 4FPKA 4QQOA 4R9BA 2Z69A 3WQ0A 2H6CA 4PCRA 4AQ6A 1LENA 4Q27A 2ZZJA 3OBRA 3MW3A 3DKWA 4Q0PA 4YVWA 2EXIA 4IV3B 3NAPC 1YRZA 5IUQA 3PTYA 1D2SA 4N43B 4PIYA 1PO23 1COV3 4C0HA 1EAH1 1RHI2 5CFCA 1NCRC 1CAWA 4H7MA 4XEZA 3ZFEC 3VBOB 1DBNA 1FMD1 2A75A 3LCPA 5DUWA 3GHMA 1AYN2 2PN5A 2X5IB 3VLBB 4DQAA 1DGLA 1AF9A 2ZMLA 3M3EA 4YZ2A 1ZRCA 4LBOA 1FNZA 3OTFA 3WQ7A 1G86A 3H3ZA 2AGSA 1WBFA 1VBD3 1QJZA 1QJU2 4J1XA 3T1LA 4CDUA 4YM2A 3M4FA 4IERA 5K7PA 2X8KA 5HCFA 2DFCA 2CAVA 3O14A 2NYYA 4AGGA 2GMEA 2RMU2 5DZFA 5FAXA 1MQTC 1RUD2 2R6QA 3AKPA 2XJSA 1BBT2 4YM1A 4YW4A 3R4SA 2E7QA 4CYDA 1OQDA 1PMIA 3E6BA 1PGW2 1LGBA 3NV4A 1YIPA 1HIXA 1AL0G 4IETA 5GJ6A 1QJX2 3USUA 2VNGA 4IEUA 1UU5A 2D6NA 5FCCA 2ZGSA 4E4ZA 2DU1A 4D94A 1W6OB 2B7YA 4K21A 3ZPYA 5B2GB 2R063 3PVBB 2DCYA 5FOBB 2NZ9A 5EWSA 3TBDA 2C9AA 1ND3B 4FPYA 1UKRA 2CWMA 1DQ1A 2WT2A 2WT0A 2ZGMA 1N1TA 3IIAA 4QPYA 4CEYB 1WMEA 4KGGA 3ZXDA 2IXHA 4Q1PA 1OA4A 4N53C 3UV9A 2R1BA 2Q1ZB 4IV1B 1POV0 3ZN6B 3CJIC 5I91A 1EAH2 1OA2A 3APBA 1I3HA 4YW5A 1O5LA 1Z7S2 4FPCA 4XTMA 3G7DA 3U07A 1B35C 2ZS6B 4FPHA 3DPRC 3CO2A 2BNNA 2D97A 2E7TA 3EQEA 4CDXB 5H9PA 4QPGA 4OUMA 5FO8B 1BEV2 4OHXA 1W0OA 1VBA3 1UF2C 2D6KA 4N7UA 5CU1A 3NSTA 1C28A 2BFUL 4XJ8A 3MIDA 4PDWC 3BODA 1VBE3 4GH4C 4A7ZA 4QQLA 4K6BA 3TB0A 3V56A 2JG9B 3AYAA 1UX6A 3R05A 4FSJA 1BMV1 1OSGA 3FJSA 1HRV3 4TWTA 1ZNPA 3GBFA 1WCSA 3I54A 3WDTA 1IHMA 5I0TA 3ZSLA 3AMPA 2ZCWA 3EXUA 5ACA2 2D6OX 3VBHB 3D0SA 5C8CC 1R1A2 2BUKA 4Y1YA 3ZN4A 4AYUA 3ZFFC 2PLV2 3WT3A 2HEVF 4URTA 1QDOA 3EJKA 1NCRA 2EIGA 3ASIA 1ULFA 1PO22 1ULGA 2P34A 1ASJ2 4ZU4A 3ZYPA 4FOYA 5KHJA 4META 4NR1A 2DCJA 1WUVA 1C8M3 2DCKA 2RS52 3IPVA 3KT1A 3N7LA 3N7MA 2OUJA 3S7IA 4YZ5A 1NA1B 3VKMA 2QNKA 2VUJA 2WNUC 3URFA 1IS6A 2Z79A 4MH0E 3P3PA 1TE1B 1R082 4I30A 2B45X 1O4YA 3IN9A 4LO8A 3S30A 2D43A 3ILRA 4AVSA 2JG8A 5BNPC 5CFDB 1PNGA 1NG0A 1VBD2 2BYVE 4YG3A 1SFNA 2DTWA 3JUUA 3ZN5A 1MS9A 4B7EA 1AX0A 3OGGA 4L92A 4XBQA 4HSJA 5JZGB 2DV9A 3KZ4C 2R0HA 2HWC3 1MACA 1SACA 4Y22A 5JWPA 4FPFA 2AR6A 1FOD2 4GA9A 5BNOC 1REEA 2ES3A 1LEDA 3DUIA 2D44A 3A4UA 3K48A 4Q4V3 4FP3A 1VBB2 1H2NA 3RZZA 2XVLA 3B02A 5C4WC 1Z0HA 2QE3A 1IKPA 1HXS3 1D4VB 2HWE3 4N53A 1V6KA 4YFZA 1VR3A 1DGWX 3M2MA 4KG8A 4Q0UA 4ZXKA 4RSUA 1XXNA 2YYOA 1X36A 5BV6A 4P9GA 4DPNA 2Q0AA 3MI8A 4AHWA 1B35A 1CAXB 3KMHA 1QOSA 2ZZQA 1DQ6A 4OI4A 4WZFA 2FZ2A 1OLRA 4JGZA 2XWJB 4HVRA 1GSLA 1NE6A 1PVXA 4IEZA 3VHRA 4OHYA 1K5MA 1SLCA 3L2HA 1Q3EA 1MEC2 4LBMA 5T5OA 4A7KA 2B46X 5KC6A 3JD73 4M00A 3AXEA 4XXAA 3JCIA 2D98A 3AMHA 3OGJA 4PBOA 3TRSB 1MS0A 4TSVA 2QZ3A 4AFDA 1YFYA 3UK9A 4MXWA 3PMSA 1PK6A 3HR9A 2ZACA 2BBVA 4UBGA 3FZ3A 4YZ1A 3O0WA 1RUE1 2XBO3 4AI8A 1H0BA 1RUJ1 4JGYA 1N3OA 4Y4YA 5BNNC 4B4RA 2RM21 3B9CA 2Z42A 2D7FA 2QKDA 2GC0A 4Q4Y3 4YVSA 1V6MA 1ENXA 3ZFFA 2D3SA 4ATEA 4BYYA 2CTVA 3SCHA 2ENRA 2GU9A 4XQ4A 1RUF2 1T6GC 3MPBA 3AMMA 2HYKA 3BTAA 5CNAA 1WGPA 1O3SA 1V9U1 3PVNA 1TMF1 2H0BA 4AFCA 1LOGA 4HLTA 4E27A 3LWCA 1ZREA 1NLSA 3IM0A 2GC2A 4Q4W2 1H9WA 1D4M3 2CYFA 3AZXA 3FLRA 3POSA 5HCAA 2A71A 2RS13 1S1AA 1H4GA 1TQ5A 2EVXA 2PQQA 4FQZA 1ULCA 4FT8A 3VL8A 1PVC1 1RUNA 3P3NA 5LEKA 3PVEA 1X33A 5ABJB 1SBDA 1LKNA 5DXDA 5D1IA 1BXHA 2D93A 1CPMA 1JHNA 3RYPA 5BYNA 1J1LA 1F5JA 3WHUA 3CNAA 4Q8KA 3CF6E 1XQNA 1LOAA 1CAUA 1RUC1 3MDPA 3KCYA 3OJBA 5KHIA 4OI0A 3GF6A 3SH3A 2XJQA 4LE3A 4XJAA 2WJSA 4JDMA 2PA7A 1ZZ6A 4G4FA 4ASMB 5BNOA 1DU3D 3CU7A 1UPSA 2ZPXA 3J8F1 5J09A 4XDQA 3ZYJB 1VP6A 3MFCA 5K0UB 4JDOA 1VRH3 2VUAA 2HEWF 1JUHA 4J1WA 1RUI1 1KFXL 3B00A 5C4WA 4K8FA 3MYXA 5JIAA 1H2KA 1AL21 2ZGUA 2IXIA 4AQSA 2ZA9A 1HX6A 3TN92 3VBSA 4Q4V2 2QQPA 1LEMA 1A8DA 1OFNA 1ZRFA 4YSFA 5KHHA 3O12A 3QOPA 4BZ4A 5C9AA 2HWE2 2RE9A 3HAGA 2R072 4QXKA 1RVF2 2JENA 4GQ7A 4AVBA 1RUOA 2RJKA 2MNGA 3FX3A 2OW4A 1QOOA 4XJUA 3RI8A 1YCIA 4DZGA 4WM8C 1W6QB 4EN6B 1RMU1 4WZCA 1HW5A 4M3CA 4MGKE 1OKQA 1WW6A 2WS92 4FTSA 5JAXA 3HBZA 5JI9A 1KRIA 1WMFA 1UPIA 1MZ5A 1I9RA 5EFUA 2EALA 2WFF2 3I59B 4M01A 2OPKA 3GNEA 3R4UA 2JJ6A 1J1TA 5I0SA 1UU6A 1YO8A 4KWLA 4Q8LA 4YZ3A 4CDWA 1RL3A 1MS3A 4QX5A 4AI1A 2XHKA 1NLRA 2OZ6A 5BNNA 1KITA 4HK8A 4J6GA 1AXZA 2ZGTA 1A3KA 3JBG2 4RR3B 2ARXA 3WDYA 2V09A 3ZXJA 2RJLA 1ZBA3 1NCQA 4GWMA 1R092 2WNVC 1ZBE1 2R041 1LGNA 5EYXA 1S2KA 4LULA 4MVTA 4W6XA 5FRAA 4EV0A 2GNMA 1LHVA 4BMBA 4Y1UA 3NKGA 2WZPP 4E2SA 3GBWA 1HDKA 1LODA 4LBNA 1FPN1 1NQDA 4IEOA 3WNXA 5I8TA 1J3PA 2E53A 4E9KA 4NHMA 4XMAA 3E5UA 3G6JB 2C5DA 1V6LA 1A6CA 1DZQA 1CJDA 3VBRB 4HPKB 3RI9A 1AYM2 4LT5A 3AFKA 2B39A 1OLQA 1TNRA 3WDVA 4IEWA 1UKGA 1AR71 4ZU5A 3ATGA 5FQ0A 3MIFA 1AR61 2PHUA 3HWJA 3ME2A 1KXGA 4HVQA 3B9IA 2XL7A 4NHKA 4TZDA 2ZAAA 3BALA 3D6EA 1KS5A 2UYAA 1PIV1 3AJZA 5GZCA 4OULA 5DZEA 1O3TA 1AR81 2HWF1 2RS31 3V0BA 4JCKA 3B01A 2WLPA 1AHSA 2PAMA 3GYDA 4MGYE 1Y43B 2DVBA 2RHPA 3FWEA 2ZKNA 4ES8A 1RUG3 2PFWA 3SH4A 4G9SB 3ZFGB 1BQPA 1CD3G 1XYPA 3QBQA 1VLNA 4LUMA 4NO4A 3HN1A 4ZKTB 3FFQA 2ZX4A 3VBUC 2LUWA 1DQ5A 1OFSA 2NMOA 4YM0A 1A8MA 2LALA 4IESA 5KHGA 4GB31 2VPVA 3H7YA 4C91A 4Q2FA 1KDKA 1VBC2 2UURA 4WM7B 1VRH2 3SISA 3TOJA 4CRQA 2WZR1 3FUQA 1JYCA 4LEJA 2Z2SB 5JOYA 1S0BA 5DG1A 3OY8B 2OUHA 3MLLA 4L99A 1WBLA 3O0XA 1N3PA 3ZXFA 3ZSKA 1C3HA 4Q0SA 3RJRA 1J3RA 1ZX5A 3MEPA 2HJIA 5AFEA 1SLBA 3GBGA 2IWGB 1UN1A 3AX4A 3VDDB 1RHI1 1WLTA 1QY4A 1AR91 4YVWB 3IMNA 2WQ4A 4JC1A 3S7EA 4DOUA 2H0VA 3VZNA 2A6ZA 4CEWA 3ZYIB 3IBMA 4Q4X2 3H3UA 1WLDA 4HT1T 5CFCB 3KB5A 1JXNA 1AYN1 1CAWB 2DWRA 1X7NA 2G9GA 2HWF2 3VL9A 3UL2A 3M7AA 4ATFA 4XJZA 3FLPA 4YW3A 2YGLA 4N7IA 3I2DA 4YLZA 4MXVA 4RS5C 3RQ0A 1QJU1 4Z1VA 5CADA 4JRLA 1JBCA 3V0AA 1VB4A 1JYIA 2XJVA 3VN4A 4RQPA 2RMU1 4IV3C 4CDUB 2F6BA 1EY2A 1UD1A 1POV1 1RUD1 2DUOA 5LK7B 1BBT1 1Q8VA 1ENQA 1QDCA 1Q5OA 2MPFA 2TBVA 1PGW1 5GZFA 2ZX0A 4IEPA 3D8CA 1XNDA 1LTEA 3VBOC 4X6QB 2PHLA 2Q5TA 1QJX1 3MIHA 5GLVA 1SDWA 3QD6A 1LRHA 5I8YA 2PHRA 3VBFC 1UU4A 4XFGA 1GFF2 4FQ4A 3ZXLA 3USUB 1UIKA 3ZSEA 3D82A 1PZ7A 1RC6A 2I74A 2SLIA 5GLTA 4BA6A 3VDDA 3VV1A 4PIXA 1JUIA 1VAKA 3AP7A 3H7JA 2GN3A 1Q8OA 1G9DA 1BKZA 1KS4A 1S0IA 1IS5A 2GNBA 2PHFA 4QGNA 4U36A 3WW4A 1DF0A 2TNFA 4L97A 3I8TA 4XHXA 1AR92 1Z7S1 1H1AA 1OPMA 4HN0A 1SQ4A 4GMP3 4S2FA 5DUXA 3AB0A 5EZWA 2BWCA 1W6NA 1Y9QA 2E9QA 2MHFA 2JECA 2GMPA 3WCSA 4AI3A 5IK8A 1BEV1 1BK1A 3WCRA 4WVVA 2BNMA 2XJUA 4BH9A 5LRRA 3WV6A 3MFAA 1CR7A 4QQHA 4QPGB 1U5IA 1ND3C 2A5ZA 4LHNA 5GZEA 1CESA 3PVOA 1I6XA 3KLSA 3WW3A 1QJY2 4RL7A 4IV1C 2D5FA 3BU7A 3ETQA 4YARA 1QF3A 2AREA 5ACA1 3S6PA 1R1A1 4XF0A 4EN0A 5CAZA 5A3MA 2XLGA 2PLV1 2ZGLA 2Q8OA 4AFBA 3ACLA 4M3CF 1OQ1A 3QACA 1ULEA 1SLIA 4XF1A 5JR7B 5AVAA 3U4XA 4CDXC 3LGRA 1RUH3 3H1YA 3INAA 2DVGA 1PO21 2I07B 1ASJ1 1VJ2A 1NCRB 2DVFA 5D8AA 2WNEA 1V6JA 2JE7A 4W65A 5T3NA 3HD8B 2RS51 1ENSA 5DZGA 1EV12 2XH6A 2ZGQA 5AC93 1ND2A 1HV1A 2VY0A 2JG9C 2XUMA 4RS5A 4XOGA 3ENRA 2JICA 3IPVB 4R52A 1L3JA 4COWA 4LTAA 2PHTA 1R081 2NLRA 4HMZA 2BNOA 3SCGA 5BPXA 4OVEA 5DDJ2 4IXLA 3UJOA 1C1LA 4SLIA 1YWKA 3M3CA 5FOJB 3T1MA 1VBD1 3FC0A 1MZFA 2XWBB 1ZYBA 4NOTA 1VB2A 1FI2A 3R6SA 4YYOA 2JG8B 3VZOA 3B94A 4FOQA 3PJQA 5KC5A 1PO12 3OYWB 1FOD1 4BHPA 3D4KA 3MW4A 2BW8A 4FXKB 3ROUA 3OD0A 3FLTA 1VBB1 4XYXA 4Y22B 1NA1C 2ZHMA 2R32A 2V5YA 3AJYA 2HWD2 3PJYA 5H9SA 1MS1A 3NAPA 1IS3A 2OYZA 5FPZA 2GN7A 4EN7B 1QH7A 4Y26A 5A33A 3M3QA 1H8TC 3CEWA 3H0OA 1W6PA 4N53B 4AEJA 1V00A 1OOPC 3GZAA 3MW2A 3TAYA 1LHUA 3ZFEA 5CFDC 3KCXA 5J3UA 4YW2A 3POYA 1N1VA 4Y5Z0 2CGPA 4A3XA 1CIWA 1FNYA 2Z5WA 1IQAA 1COV2 5GZDA 3BIWE 5JZGC 3SITA 3BOPA 2TEPA 1B35B 1MEC1 5GALA 1MS8A 2EAKA 4AI0A 2DUQA 5EXOA 4JGZB 3IDCB 1K5MB 2LM3A 1J3QA 4GKXA 2D3PA 1NXMA 2ZHKA 1W6MB 1AX1A 3ELNA 2WC2A 4XHBA 1VBA1 3CL1A 4B7KA 1UIJA 1MQTA 2VQAA 1BYHA 1C5IA 4OZXA 1XNKA 4MXWB 1KJRA 1VBE1 1PK6B 4M0NA 2YGMA 1CPNA 3OYWA 1X82A 1YI9A 5CB7A 2P37A 2GC1A 4JGYB 4MSVA 4QPIC 5JLVA 2D6MA 4COUA 4Z8BA 1HRV1 1OQEA 2W39A 3MIBA 5F6LB 4AFMA 4FOVA 1RUF1 1Q8SA 4COZA 4XJWA 4OHWA 4YVSB 1WW5A 3ZFFB 3JU9A 1S55A 4X8NA 4W6YA 4Y1VA 4FCAA 3BOWA 2Y38A 2VOKA 3CJXA 3M3IA 4Z2WA 3BB6A 5E1RA 5EV7A 4Q4W1 4DRVA 4Y1XA 5HCBA 3C2UA 3RMXA 4BLIA 4I0WB 3OD4A 3VZLA 2JD4A 1LJ7A 4JQRA 1UW8A 3H1WA 4TYSA 1HRI3 2WIIB 3T2TA 2R062 1RUH2 3AZVA 4PQ9A 3UKVA 3CJIA 1CGPA 4HSLA 3FHIB 2YV8A 2RM23 2VW0A 4B8EA 2YDEA 2FQPA 5AC92 4XIOA 2ZHLA 3DPRA 3AMQA 3WQ1A 4R9DA 5IK4A 4BM8A 4P9LA 4CTEA 3NVCA 3AYCA 2MEV3 2ZOEB 1LHNA 1V9U3 4FVVA 4Y20A 3N35A 3AZZA 3FBMA 1W6MA 3V65A 1Y3TA 4LUKA 1LOFC 5FLIA 5L73A 3VKLA 4BE3A 4PDWA 1CAUB 4GH4A 5T50A 2RR13 1REDA 2X29A 5JVVA 4AF9A 1C8NA 1XYNA 1URXA 2D40A 1N1YA 1V6IA 2GALA 1C57A 2ZGKA 4HN1A 1PVC3 5JPNB 1VBA2 5BNOB 5HBAA 1GBGA 1UZYA 3VKFC 4HETA 4EWEA 1JN2P 3KS7A 2D6LX 1VBE2 3MGUA 4LO7A 5ABJC 2BFUS 5C8CA 3SLIA 3ZYGA 2VG9A 3TN91 1IPJA 3FUOA 5C4WB 4Q4V1 1H8TA 3HQXA 4AG4A 1XU2A 1HRV2 2A6VA 1OOPA 5JSPA 3S0MA 1H2MA 1IOAA 1CN1A 1G9CA 3AM2A 4M3CE 1F5FA 2ZX2A 1XE7A 2HWE1 2R071 1RVF1 2XL9A 1QQP3 4LBQD 5GLZA 3TYJA 3VBSB 3SH5A 4LNVA 4EWAA 4CP0A 2LTNA 4UW4A 1JW6A 1VAMA 4XFFA 3M1HA 5C9AB 5AVPA 3J8F3 1SCRA 3FMGA 4GWNA 2IXJA 2WS91 3WW2A 3KCCA 2WNUA 3WHTA 2WFF1 1TME3 3AKRA 1RUI3 5FFOC 2WKKA 4XW3A 5K0UC 1U0AA 1AL23 4M3CB 4DFSA 4D7TA 1SCSA 1C8M2 5I0UA 3AYDA 1YUDA 4I0AA 1PHMA 3CLPA 3ZSJA 2ETEA 1QNWA 1XRUA 1G7YA 1LULA 5BNPA 4DMIA 2ZMNA 1KJLA 4KNCA 4PJYA 1CJPA 3JBG1 3H9AA 4CDWB 3AKTA 4LR4A 4WVWA 4NVPA 1R091 2QCSB 4QPIA 2IXCA 5KWRA 5BNNB 3EBRA 4H55A 1A78A 2WFPA 2CWSA 1SMVA 1GR3A 1DGWA 1RMU3 1NCQB 1F2NA 2YHJA 3RMYA 2C0ZA 2GC3A 4KWJA 3ST7A 1DQ0A 2CGOA 5FREA 2ARBA 4XETA 1RITA 1LU2A 3GALA 3MIEA 2OZJA 3WW1A 3E97A 2PYTA 2HWC2 2XJPA 4B4PA 1AYM1 3LAGA 4JAAA 2HWB3 3U10A 1TEIA 2VMGA 4AQTA 1Q8QA 3ZO0B 2VVFA 4X6RB 4XTPA 3ILNA 4KG0A 4MYEA 4UW6A 1JTZX 3NO8A 3WOGA 4Z82A 3UKNA 3USSA 3WVJA 1YI7A 1YFW<