3MIDA

Oxidized (cu2+) peptidylglycine alpha-hydroxylating monooxygenase (phm) with bound azide obtained by soaking (100mm nan3)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
311
structure length
311
Chain Sequence
b'NECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-glycine alpha-amidating monooxygenase
molecule tags Oxidoreductase
source organism Rattus norvegicus
publication title Differential Reactivity Between the Two Copper Sites of Peptidylglycine alpha-Hydroxylating Monooxygenase (PHM)
pubmed doi rcsb
total genus 62
structure length 311
sequence length 311
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 2010-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3midA02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 3midA01
4R4XA 3MLLA 1PHMA 1SDWA 4E4ZA 1OPMA 3MIDA 1PNFA 3MIGA 3MIFA 3MICA 1YI9A 3PHMA 1PNGA 3PMSA 1YJKA 4R4ZA 3MIHA 3MLJA 3MIBA 4QHBA 3MLKA 3KS7A 1YIPA 1PGSA 1YJLA 3MIEA
chains in the Genus database with same CATH superfamily
2D3SA 3I8TA 5C4WB 2HH9A 2BOJA 2YBSA 1NAEA 3TEYA 1YXWA 2HJIA 1PIV1 1RYYA 1W2NA 2L9LA 4AVAA 2W68A 2RMU3 5DG2A 2D40A 3WP4A 3WF3A 4NAOA 4A2UA 1OVSA 3CZUA 5FZEA 4IV1B 3RWKX 2HWC1 1Z7S3 1SEFA 3HNMA 4CTEA 4ASMB 1SLTA 2GNTA 2WNVA 1UMHA 4HMZA 1HB1A 4Q8LA 3VD7A 1FMD1 3MFAA 4HKOA 3D6EA 5EZWA 5K0UB 3UGGA 3IIAA 2WT0A 2X09A 3B5LB 3EBRA 1NE4A 4TLGA 4V1PA 1QJEA 4TWTA 4BB3A 1DQ5A 2D3RA 4K8FA 2ATFA 2XWBB 2VOXA 4JVAA 4MADA 3BTZA 3RZLA 1ENRA 2RJLA 1JYWA 5DUVA 1MS4A 3VKMA 1O4ZA 2HWB3 3SLIA 4W4ZA 3WW4A 3ZFFB 2G1MA 4XJUA 2Y6LA 1LODA 3IN9A 2QZ3A 2FCTA 5LB6A 3T1LA 1SLCA 4RGGA 2Y6HA 2B39A 1EV13 1PZ8A 4A45A 3NV4A 3ME2A 3HBKA 1K5MC 2PYTA 3AKSA 2Y6GA 1GYKA 3AKRA 4L8QA 5GLTA 3HN3A 3TRSB 1CWPA 3VV1A 4A42A 3DN7A 3I97A 2QQUA 4Q4X3 3ENRA 5FZKA 5KXDA 5F1RA 3ZFEC 5ABJB 1UO9A 1XXNA 5J09A 2VUJA 5A32B 3GYDA 5LBEA 1I9RA 4XTMA 5C8CA 3J8F3 1ZNPA 3T2QA 2VW2A 3J4UH 1OXCA 1ULOA 2WT2A 4R9AA 4N7IA 4ES9A 5AC91 4L99A 1WCKA 2HWE3 2D6NA 2D97A 4CEYC 4DY5A 3QBQA 1UZVA 2CNAA 1A34A 1X8EA 2XHKA 2Y0IA 2Q1FA 4RR3B 2ZGQA 5LEKA 3JD72 4Y4RA 1YI9A 3ACIA 5A7PA 4LT5A 1CIWA 5I8TA 2JG9B 5FP7A 1H9PA 4A6OA 3VHPA 3AYAA 4LO8A 1C1LA 2DUOA 4RYDA 5C4WA 2X5IA 1W3VA 1BQPA 2EXIA 3OPZA 1QJX3 1X9TA 2H6CA 4LULA 4XF9A 3ZO0B 4CSWA 1VBD3 4NO4A 3VBUA 1UXXX 1ZREA 1SCSA 3SKJE 1DGRN 4Y1YA 4IE7A 1AYM1 3FHIB 2RJ2A 3WD5A 3HR9A 4PDWA 3WG4A 1UZYA 4CCEA 5D8AC 2DV9A 2IVJA 5DUWA 5FREA 2P17A 4YVWA 4CCKA 1FNYA 5JCTA 4IESA 2YPDA 2W08A 5DAWA 3CJXA 4YGBA 2FD8A 4QX2A 4LKFA 4LXLA 3RRDA 1AYM3 1PMHX 4BYYA 4HVOA 1AR71 2E53A 1F2NA 3RJ2X 2VZQA 3S6PA 4C90A 5LBBA 2RDNA 3GHNA 3V0BB 2VTXA 5FXVA 3SC7X 2XL7A 4SLIA 4WZCA 4J1XA 4JDOA 3UETA 5IVVA 3H1YA 2FZ1A 1SMVA 1V00A 3NMBA 1K45A 5FPUA 3FE5A 1Q5OA 5FZ3A 1C4RA 2GN3A 3ZR6A 4P9GA 4B8EA 4YVSB 4HETA 1ND3B 4MX3A 5A3WA 2ZEZA 2FDJA 5LA2A 4D7TA 3EB7A 4BE3A 5BUVA 2RDRA 5C3QA 1MS8A 2ENRA 5I0TA 2WUHA 2OZ6A 1M4WA 1ZVFA 1LESA 3K4DA 5DZGA 5FK8A 3U37A 4CDUC 2ADEA 2NN8A 3B9IA 3IWZA 1DHKB 5FZ0A 1R1ZA 3V65A 4A4AA 5EWSA 5JZGC 3KD4A 1CGPA 1VAKA 3D8CA 1D0HA 5BYNA 5IVFA 5FYYA 2OZJA 3R4UA 5FY0A 1UXZA 2E7QA 3LD8A 2ZGNA 3RMXA 4QGMA 3DPRC 2XJTA 3KT7A 1ZZ8A 2A71A 2C0ZA 4QQPA 5EV7A 1A3KA 1X9PA 1O4YA 3ZFEB 5DZFA 3U10A 2JDMA 3M2MA 1IKQA 1WD3A 3VBUB 5EYYA 4QM8A 1BBT2 1BEV3 5DMYA 5LW9A 1O3TA 1OSGA 1W6QB 3KGLA 2KXLA 4K1ZA 5IAXA 4GH4B 4QKBA 1YIPA 2C26A 1U12A 3AZWA 1N3QA 1V6IA 4FPJA 5L9RA 1XYNA 2FHRA 3K2OA 1IZ3A 4X8NA 2AR6A 2D98A 4Q4V3 1G7YA 1B35B 1KFXL 4QHOA 5FZLA 1HN1A 1QHDA 2ID4A 2VQTA 4L2NA 4MYEA 2VGDA 5JR7B 4N90A 4AEDC 3V0BA 4E4DX 2Q8DA 1JZ6A 3MIFA 1FYUA 1QF3A 4L0PA 5A7NA 1QJU3 3ZMNA 2OPKA 4OLLA 3RZMA 5A7WA 4IE5A 4H55A 1RTVA 4FT8A 5FZAA 4RGKA 3WDUA 5AFEA 2OA2A 2GN7A 1ODMA 1VMJA 3LFIA 5FMBA 5DUUA 3BU0A 3DGTA 3O0VA 3W59A 2V72A 1ST8A 3AYDA 3NNFA 3ZXFA 4URTA 3UT0A 5A32A 5C8CB 1PMJX 3EQEA 1QEXA 2BP6A 1F4HA 3DYMA 1YCIA 4PHZA 3SISA 4YVSC 1LJ7A 3JQXA 3NAPC 5BNNC 5CFCB 1N1SA 1XSRA 2WZ8A 3LEGA 3NJYA 5FPBA 2JJ6A 4TXWA 5EQUA 1CESA 2JG9C 1FAYA 3ECQA 3JBG2 4QPIB 1W3XA 4B1LA 2I74A 4OI4A 4XFIA 3D0JA 2EICA 1ACCA 4FQZA 4K21A 3FHAA 5FXZA 3ZYRA 4HONA 4A3XA 3HMYA 3PJQA 4ZZ5A 3RGBA 4TTGA 2R071 2KR2A 1ZRRA 5FUPA 1RMU3 5F5CA 2CAUA 3B01A 1GNYA 3LAGA 4E4ZA 1K3IA 3BOWA 4HK9A 5JPNB 4ZY9A 1OLMA 1J3QA 2WSVA 1O8SA 4BLJA 1DG6A 1COV3 5IW0A 1VBE1 2RVAA 4QXBA 1H1IA 3DYPA 1GV9A 2XVGA 3RQ0A 3W9AA 1DYKA 3WHUA 5A6YA 2WINB 1MS5A 1O3QA 3AP5A 3NVCA 1O5LA 3WNLA 3FHQA 4KG0A 4RSUA 1W6PA 4YGDA 1S1AA 2KA3A 5C5UA 5CG9A 3TAYA 2QQMA 3GNEA 3IZOA 1OI6A 4G3YC 3TN91 2QQVA 1COV1 3GBWA 2PLV3 3NJZA 3M3IA 2VD7A 4AXOA 3POWA 2E6VA 4MSVA 2VVEA 3POJA 1PM4A 4XHXA 1OQ1A 1PO12 4Z07A 5FBZA 3T2OA 3E5XA 1LRHA 5I91A 1JYCA 3N3HA 5FPXA 3GCWA 1D4M1 2XKPA 4WZFA 3ILRA 1A8DA 1NYWA 1QJY2 2PLV1 2A6WA 1VBB2 2TBVA 2RG4A 2ZGOA 3QD6A 2WJSA 1RXFA 1H8VA 2F4LA 5FJHA 5F9TA 2WN2A 4RA0A 4PF5A 2JICA 1G9CA 2C24A 2AENA 2MEV2 4LE4A 4JDMA 4XUPA 1DGLA 4FSJA 4YGCA 1RUC3 4QPIA 3NW4A 2P6CA 2W52A 1O6UA 4AOCA 4BK5A 1C8M1 5FO8B 2DBNA 5KWRA 4M3CB 4OMDA 5A3TA 4PLNA 3KT4A 2GC2A 4E2QA 4LE3A 4P9IA 4IV3C 4JHZA 1ENQA 3CBNA 1OF3A 2VL4A 5KC5A 2XHNA 2YROA 4NR1A 1WCSA 1KGYA 2VTXJ 3ZLIA 5FYTA 3I59B 5IUQA 5T50A 3H8OA 4FPEA 4CEYB 1RUD3 2CV6A 3IMNA 3WOGA 3U07A 3GZUC 1HXS1 4BWOA 4OHYA 3E5UA 4EYUA 2R0HA 3CDZB 3U75A 1OHFA 2VQAA 1TMF1 1WKYA 5I8YA 3LF7A 2CGOA 4FP3A 4YGEA 3AVRA 3C8XA 1NXD1 3POSA 4NMIA 4FTEA 3VZOA 4R52A 5HXVA 4NPMA 5FPVA 1PO22 3R6SA 1LKNA 2R063 3D82A 1DLCA 1S2BA 4OZXA 2R0FA 4WVWA 4XJAA 5FP4A 3ZYHA 1POV3 3BPZA 5FV3A 4B4RA 4WM7C 1NCQA 2UURA 4Z92B 3VKNA 2V4AA 4UI9L 1O59A 2VZ1A 1GWKA 4KWLA 1C8NA 5C33A 1REDA 3MW3A 2WNUB 2Q8EA 2QE3A 5IVYA 4OYUA 2GC0A 4BIFA 2PTMA 3ACFA 3FFZA 3CIHA 5K7PA 1VBE2 2IUWA 2W95A 3THDA 4F83A 1MZEA 4XQWA 5TSWA 4DB5A 1IOAA 1RUJ2 4IXLA 3MF6A 1J59A 2IZWA 1UZWA 3JQWA 1QJZA 1LOGA 5GKAC 3MIDA 2FDFA 2E51A 2JD4A 5A6XA 2NYYA 5EPAA 1IKPA 1GP5A 1XJAA 5GLWA 3PU8A 4LTAA 4Y20B 5A7WB 2OXBA 4AHYA 4JGYC 4DFSA 1NA1C 3O1MA 1D4VB 3CJIC 2HWF3 3N36A 4JRLA 4NHMA 2Z79A 5FWEA 4CZSA 1TZOA 5HCAA 1LU2A 1R1A2 4HSLA 3BVCA 3PHMA 2Q8CA 3RJRA 2VVDA 1SPPB 3MZHA 2FMDA 4DINB 4LO6B 5A70A 3ZYPA 5LWBA 2G9GA 3VBSC 2XUMA 3CJIA 1ASJ3 3RYKA 1SZBA 3AX4A 4I0WB 1BVP1 1RINA 2RS11 2AYHA 1AL21 2ZZJA 4ASLA 1VR3A 2BV4A 1JYIA 4YM3A 5FDBA 5LATA 2HWE2 1UY3A 3JB8A 2JDYA 1YQCA 3WCRA 3CU7A 1MEC2 1AR92 3ABZA 1XOYA 3WQ1A 1POV0 3O1RA 3K3NA 1OD3A 4Y1VA 3WQ0A 3VBFC 3I2DA 1DP0A 1AHSA 5GLVA 5BNPA 3FLRA 3HPNA 5E16A 1AL23 2WABA 5ANNA 3T0DA 4ZU4A 1DGRA 4E4HA 5KXEA 4MLOA 1L7RA 4ZPIA 2GMPA 4OHVA 2DU1A 4GMP1 2PHRA 2VZSA 5JMOA 4PI0A 2Q1MA 3WX5A 1Z7S2 5LASA 1VALA 4FCAA 4DO0A 2OW4A 1TQ5A 1WBLA 2MPFA 3N7MA 3I54A 5LZ6A 1O8PA 3O7OA 1BK1A 2ZOEB 2Z69A 4O7XA 3U0ZA 3MIEA 4XUNA 4H7LA 3LB9A 3NAPA 4WM8B 5BNNA 1NG0A 4YVSA 2XVKA 1JN2P 3DEMA 5FZ8A 2XJQA 3ZXAC 4DUVA 4N53C 3A22A 3VDDB 1PO13 5C5TA 1N1TA 1TE1B 2HWB2 3ORJA 4ZU5A 1O3SA 1ULFA 4K3UA 1A78A 2RDSA 3MV01 4ARYA 5JOZA 1CJDA 5K0UA 3CJIB 3JCIA 1FMD3 1VBB3 1EV12 1XNAA 4Q5OA 1UAIA 3IM0A 3BTAA 4JTNA 4CRQA 2A75A 2P37A 2PA7A 4HBNA 4DRVA 2V73A 4QX0A 1W9TA 1DYOA 4UFJA 3J26N 5KHGA 2Y60A 2MEV3 2Q5TA 2BNOA 5ERLA 1UWWA 2JE8A 1G9AA 4CDWB 3MW4A 4IL7A 3ZKYA 1OQDA 5ANQA 4Y5Z0 5FYCA 4IEZA 5T52A 5BNOC 1FV3A 4YG0A 3KHCA 2RJKA 4Q2FA 4Y33A 3LIHA 2QTWB 1RVF2 2R16A 1VRH1 2EIDA 2FBEA 3APBA 2Z42A 3O1OA 1OLQA 1X36A 2HWD1 2BZDA 4L92A 4XBQA 3M3EA 2W1WA 4JX0A 1H4GA 4UFLA 5FLJA 4I3PA 3JD73 3DCQA 2BEOA 4NROA 4LLOA 4UFMA 2Z2SB 4AVSA 5CA6A 1FOD1 1HRV3 3THTA 4CP9B 4BQ3A 1ZRFA 3MIBA 3UYJA 4OMCA 2RS33 4YW1A 5FZDA 4XZPA 3WDYA 1LULA 3J8F1 3EO6A 3O0XA 4LOTA 2RS12 3ES4A 3VBOC 5FY7A 1XNBA 2GC1A 2PHTA 1AUYA 1NA1B 3LKJA 3BUCA 2CGPA 4CDWC 3RYRA 4M4RA 4MUVA 2HWE1 4OUMA 2QDRA 5H9RA 4S2GA 1W05A 4JGYA 3H3LA 3UNPA 4ZXKA 5GZEA 5SV5A 5FPZA 3OUJA 2WWJA 5JXIA 4OI2A 2NM1A 4C0HA 3IDEA 1VP6A 4RHV2 4ZS3A 2J1RA 4CXXA 2FZ2A 1VLNA 4OHXA 1HJGA 4FXGB 2J42A 1UX6A 3AZVA 1BJQA 1DQ1A 2D7FA 3DL3A 3FL7A 3TNQA 2VJXA 3H3UA 4D69A 1YQ2A 1DF0A 3KWVA 4Q4V2 1UOFA 2P6HA 3KLSA 3IB3A 3ROUA 1JMUB 3KVAA 1AVBA 3N7JA 3N9PA 2BGCA 3IDCB 3VBFB 2OPWA 2EXJA 4M3CA 1K5MA 1CAUA 2GNDA 2RR11 4AFCA 3Q8FA 4AK3A 1MZFA 2W3JA 3HT2A 1SQ4A 2P4EA 1OH4A 3M3QA 4O9EA 1CQ9A 2WYSA 3OBAA 1JYTA 3OYWB 1JUIA 4IGOA 4D7YA 1Q8VA 2LW8A 1W0PA 2SLIA 3GZAA 5JPMB 2K0GA 4CP1A 2D6PA 2JB8A 5FXWA 3SHRA 4JRAA 4XUQA 3LGRA 4ET7A 4M01A 1OUSA 1QMJA 4CUGA 1IPJA 2YV8A 4GB32 4Z82A 3PUAA 4PF1A 3A0NA 2I2SA 4XPVA 4N53A 3R4SA 5HCHA 1XNDA 3ITQA 5CB7A 1LTEA 4CP9A 1SLBA 1DGWA 5IT6A 5DABA 2WWSA 1S0JA 4OHZA 5A1LA 1MEC3 2BFUL 3VZJA 3TB0A 3ZFGA 3EXUA 3VBRC 3WV6A 1APNA 1YFUA 1QQP3 1JZ4A 1Z7S1 4KNCA 1ZM1A 2ZXQA 3VZKA 5F32A 2IFRA 5ACA2 1FX5A 2DU0A 1W8WA 1UD1A 2UY8A 4AI1A 4BQWA 2JKXA 1DFQA 1UQXA 2NMNA 1CPMA 1JBCA 2D43A 2XJPA 1CX1A 2A3WA 1NQJA 2JX9A 3T2PA 3WNXA 3WW1A 1MZ5A 2YYOA 2GSYA 3HAGA 1XB9A 1T2XA 2O0OA 4N7UA 2A5ZA 5DPNA 3ZPOA 1JYXA 1CAXA 2EXHA 1ZZ9A 3HD8B 4LO5B 4JDNA 3MLLA 2DFCA 1GZWA 5EFUA 3PTRB 4I01A 1LGNA 4AW7A 2EIBA 4CCMA 1OMIA 4LMFA 2D44A 4UF0A 2YPJA 2QVSB 4XE9A 4IGQA 2C1FA 2VULA 2YXSA 5CKMA 4CU9A 2VM9A 4FPYA 5C8CC 1EV11 2ZGRA 4N43B 5A6ZA 5F8PA 2B45X 3UKVA 2JB4A 3NNMA 4AGGA 4OHWA 4Y22A 4W65A 3WP6A 1W2OA 5CZKA 2Z5WA 5FYBA 5K8SA 1LHOA 4I0BA 5CU1A 3VB9A 5CFCC 5LK7B 4CDUB 4MH0E 3LCPA 1FMD2 4QHZA 4UFKA 4D6QA 4AEDB 2GH2A 3O1VA 3GZTB 4M3CF 4LBKA 1PZ7A 3CF6E 4K6BA 4JGZB 4JQTA 1NY71 4LNVA 5FLIA 1RHI1 5G04L 2C4XA 2WLQA 4Q4V1 5LA9A 3FFQA 1QJY3 2B42B 2YGMA 4XCBA 1Q3EA 5FYVA 3VUOA 1KDMA 5KHHA 4QX5A 1RUE3 1IPSA 1GU3A 2QCSB 1F15A 1XNCA 3AFGA 1TME3 1W2AX 3C7OA 1UNBA 1RITA 4PIZA 1DBNA 2JDNA 3N9NA 5LBFA 3W21A 2QKDA 3OBZA 2D93A 4R4ZA 5B4NA 2QUOA 1SACA 2XKOA 4NPLA 3X29B 1WLWA 4AFDA 1BZWA 1PX3A 1WCUA 4NIGA 2WNEA 4DXRA 1CAXB 3UJOA 4ZU7A 2ZGLA 4GKXA 3LA2A 2VBBA 4KGQA 1XSQA 4YNIA 3LOIA 4BDVB 3I2KA 4LORA 3VD3A 5K9YA 4HL0A 4FP2A 4PDWB 4OUEA 3WZ1A 1DZQA 3TWIA 2R1BA 5JOXA 2YG0A 1HRI2 4YFWA 1X8MA 4J1WA 1X82A 4AQ2A 4AVTA 1NLQA 2ERFA 5JI7A 1COV2 2DCKA 2DTYA 3HQUA 3Q9OA 4IEQA 3POIA 4RQPB 4ATFA 4LBQD 1W8NA 4RHV3 3VBRB 2HKXA 4P02B 4D6SA 2EF6A 2VZUA 1FT9A 1OVPA 3M8LA 4MXVA 2XWJB 3WDXA 1X7NA 2A6ZA 2QQJA 5JAXA 4BXSV 3L2HA 2Q0AA 3MF9A 3J7MA 2PAKA 2DCTA 3HQRA 1MVQA 4N8MA 1IS6A 1Y9QA 4WVMA 1ZZ6A 3LOBA 4CDXA 4W8JA 2D3PA 3I2GA 4Y1XA 3OSDA 2VNGA 2PHUA 3K3OA 5FO7B 4CVUA 2LRPA 5AVAA 4HXCA 2GDFA 5A3UA 2PHFA 3OUIA 3WG2A 3WW2A 3WDTA 3I3BA 5FYZA 2JIGA 3I3QA 1RUNA 1ULDA 1P8JA 1G6NA 1GFF2 1YYNA 1PGSA 2BDRA 4S2FA 4XJWA 3S5QA 2FDKA 2VMFA 3C2UA 3C3VA 4CU6A 1ND2A 3HEIA 2HWF2 2JE7A 3O1UA 4YZ3A 4I2OA 2HBTA 1RGSA 3KM5A 4NHLA 5FY4A 3MUY1 1O4TA 2ARAA 1S2EA 2FCUA 4JGYB 4FBFA 2P3IA 1D4M3 2VXJA 3PL0A 1JUHA 2BOIA 5JUVA 3OD0A 1ASJ2 4UW3A 5BNQA 3KCYA 1R091 5A1AA 1H2LA 1V9U2 1K5JA 2FQPA 1UKGA 3A21A 4DXSA 3W5NA 2DFBA 4YW3A 5DAPA 4XIKA 5T5JA 4QWNA 5L7OC 4OCTA 2I45A 3MGUA 2VOKA 4YRDA 2WIIB 4QU1A 4AQTA 1IGOA 2EXKA 4CPBD 1HW5A 3ZFGB 1GZWB 5CAZA 3NQHA 4I02A 4LUKA 1H6XA 1UOJA 5LA0A 3AVSA 3O1TA 1OH3A 1YC61 2R062 1J83A 1YFXA 1URXA 2CU5A 4IQPA 5FZHA 1KJLA 1GR3A 4I0AA 1LOBA 2QZ2A 2ZHLA 3H42B 4EROA 2H6BA 2ZGMA 3WP3A 1YUDA 3H8XA 4DOUA 1HXS3 2QQIA 1PVC2 1QKQA 4AEJA 2BFUS 1SLAA 4JKKA 5C3RA 5DQ0A 5A3PA 5I93A 1VAVA 2JG9A 1RHI2 2A6XA 3H50A 4NHKA 4WVMB 1HB2A 2AZ5A 3LZZA 3KVBA 4QKFA 3PU3A 3P3NA 5C8WA 1JODA 2D6LX 2VXRA 1U5IA 4B3NA 4M0NA 1SLIA 3UKTA 3IPVA 2VMDA 1WCQA 3M3CA 1XPWA 3RSJA 1Y4WA 2WBKA 4PDWC 3UL2A 2VW0A 5FQ0A 3HWJA 3VBSB 4E2GA 4O9GA 3RZJA 2E33A 2FMYA 2QQNA 1LOFA 4B7KA 4BLIA 1YFWA 1ZZBA 1U5ZA 2J1SA 2JG8C 2XDVA 2ZMKA 3I2HA 4P14A 5H9SA 4Y5SA 3VBUC 3ZIWA 2JDZA 1O7FA 3VHOA 4FOQA 3BYWA 1BCXA 4IUGA 3RI9A 2WO1A 4JZRA 1OC1A 1G8WA 5D1IA 1VBC2 4JKLA 1AR91 3O0WA 2UU8A 1Q8QA 2R041 2VG9A 1RMU1 1LOAA 5HCBA 2WQ4A 5T55A 4CCJA 2DVDA 2W0XA 3N35A 4QPGC 2AREA 5GALA 3NRUA 1REFA 4HKWA 5FZMA 3ZYGA 3N7LA 4N43A 5BPXA 1HIXA 2BPA2 3EHKA 4P9JA 3TOJA 2QFEA 1E57A 5FZ9A 1RL3A 3ZPYA 1V0AA 5JMCA 4NIHA 4Y22B 1AR93 3CL1A 4UF0B 5FMDA 1U0AA 4AAXA 3OGSA 2PAEA 4MGKE 3IDAA 4XFHA 4LA3A 1BBT1 4COVA 1LGCA 4FPOB 3K51A 3T4VA 2D6KA 2WYFA 3S0MA 1W2TA 3VGIA 3Q8AA 1KDKA 3G6JB 5KXCA 1FV2A 1PVXA 1XE0A 3C7FA 1ASJ1 2OX0A 4B7EA 2E26A 4ITCA 4CCOA 4CUCA 2PFWA 1PGL2 3RZZA 1H4HA 2RS13 1OKQA 1RUI3 3E97A 4A7KA 5F6KA 4CU8A 2R32A 2GNBA 4R9BA 4Y1ZA 1RUH1 4XXAA 3LPGA 3NV3A 3LDBA 4BQYA 3RI8A 5JWPA 1UYZA 2G4IA 1R081 1CAVB 3ZXGA 4AF9A 5CKNA 3D3AA 1ZBE1 4N43C 1KD7A 4ONUA 1F5FA 5FMCA 1CAUB 2MNGA 1PK6A 1SFPA 4EZHA 4IDZA 3E6BA 1JZ2A 3NL1A 2DVGA 4QXCA 5E88A 5JLVA 1XYPA 3OJBA 3ZXKA 2BNMA 4HLTA 3AKPA 2Y38A 2IXIA 4PI2A 4Q8KA 4YSFA 3TEZA 4INDA 1AJKA 4D94A 3POFA 1UIKA 1GBGA 3VL9A 2BRTA 2WSUA 4CUBA 3BALA 2JENA 2RDQA 4N53B 3VDDC 4HSJA 4N9HA 4AGRA 4MGIE 2P5BA 1ENSA 4Y3OA 3LSEA 1AJOA 4J6GA 3WQBA 5F5AA 3TN92 4Q4W2 1X33A 4LBJA 1JOJA 3EJKA 1BYHA 1QGLA 4XDPA 4GQ7A 1J3RA 2G9ZA 4AVBA 2WR9A 3U78A 3TEWA 1PO11 2PAMA 3AZYA 3D5OA 3BOPA 2E7AA 3M3OA 2RR12 3E6DA 3UGFA 3S57A 2VZVA 4XFAA 2PHXA 5DN2A 5T5OA 4X6RB 1BHGA 1UU6A 2WA4A 2ZHKA 3WINE 5FRAA 1W6MA 2VCBA 4BCUA 5IK5A 2W87A 1QOTA 3H9AA 3WY6A 4GMP0 1RUG3 5CFDA 2J1EA 5L36A 1V9U3 2Q30A 1XU1A 4AVCA 2RS51 3B02A 2DVAA 4CUAA 4URAA 2ARXA 3LEIA 3ACHA 2W1SA 4RR3A 4YZ4A 5EYXA 2BU9A 1OURA 2VR4A 2PHLA 4A41A 5J48A 3FJSA 4Y4YA 4GA9A 2ZEYA 1AR82 3UGHA 4AAPA 1RUG1 1LR5A 3GALA 2YU2A 3KF3A 5FZIA 4Z1VA 4AI9A 1GMMA 3S30A 5AC92 3VZLA 3I2FA 1RIRA 2OQ7A 1W39A 2XG3A 3H1WA 1BLZA 3BI3A 4UW5A 2LTNA 2VMHA 1ZRDA 3AP6A 2WNUA 3JD71 1PK6B 3FLPA 3NWKA 5IFTA 2P2KA 2A6VA 1YWKA 1EP0A 4RN5A 5FZGA 5C7GA 5F5QA 1GZTA 4BZ4A 1CAVA 3B94A 2CHHA 4BK4A 4YLZA 4L97A 1AF9A 3P1IA 2JKBA 1HXS2 1W99A 1UPIA 2Z4FA 1PVC3 1WA4A 2CL2A 2DYCA 3AL6A 4XFBA 3LPFA 2BTVC 3GF6A 1FPN3 4Y26A 1S55A 4OUSA 1S0BA 4R8HA 1NQDA 3L9JT 1BKZA 4KH9A 4BJ0A 1UMIA 5F3CA 3DKQA 2BJSA 1PGW1 1QU0A 1I3HA 5FYHA 2Y33A 1VMHA 2WZR1 1UZ0A 4QD2A 5CEHA 1Y3TA 3IPVB 4XF1A 2P3JA 5FQ0B 2VY0A 4LHKA 2VNOA 2X53S 4AI8A 2XR4A 4EQVA 2IC1A 4CP2A 1UOGA 5FYUA 3VBHA 2W46A 4QKNA 3SEPA 4XURA 3B69A 3WUCA 2DTWA 4COYA 4LBQB 3RVHA 4Z2WA 1ZA4A 2CAVA 1LAJA 1JH5A 4CU7A 1HB4A 1DQ0A 1UY2A 1PHMA 3PMEA 2AEZA 2GC3A 1N47A 2ZEWA 1VJ2A 4U2AA 2LUWA 4AL9A 4AQSA 1S0IA 1ND3A 3F2ZA 3C7HA 4C1XA 1V6MA 4E2SA 3K75B 1XE7A 4KL1A 3USUB 1NY72 2G19A 4MOAA 4PIYA 1KITA 4UAPA 1GWLA 2R49A 4Q4W1 4YVWC 2BBAA 3IAPA 5A80A 4AEKA 1H8TA 4X8PA 5D2AA 4JTOA 3WF1A 3RDIA 3WT3A 5EHDA 3AC0A 4NJ4A 1VB2A 1C28A 5CFDC 1GZ9A 2VOWA 3JUUA 5KHIA 2R7EB 2TUNA 3OEBA 4QX3A 3K4AA 5E8AA 5APAA 1DLLA 4Q4Y3 5ISLA 1N1YA 1ZBE2 4QPWA 4PQ9A 5J98B 2HWC3 2JIJA 1XE8A 1B35C 2VMGA 1RUI2 5L9BA 2W2IA 1Q8OA 3VDBA 3VHNA 2BQPA 2MHFA 1SBFA 1VBD2 3KHBA 1CX4A 4Q4Y1 3KV4A 3EMRA 3ZFGC 2F17A 3ASIA 4ZZ8A 2UWBA 1GUIA 1AYN3 1EPZA 1UF2C 4IEPA 1RUJ1 2Y6JA 1ZX5A 4RD7A 2BWCA 4CEYA 2RHPA 1KS5A 1QWRA 2J7MA 4Q29A 1SBEA 4RS5C 3D4KA 2OQ6A 1C1FA 4GWJA 4PJYA 3SKVA 3HT1A 2XJSA 3F95A 3OGRA 1IS3A 5A33A 1JS9A 1AYN1 2YMZA 3A7QA 2ARCA 4YW7A 5LBCA 5JI9A 4EN6B 4AHWA 2XLGA 1NOVA 3SH5A 2JG8B 5I8SA 2VOVA 1EAH3 4L9BA 4MV2A 3GBFA 4MXWA 2XPJA 1S0FA 3AZZA 4DXTA 2H0BA 2W1QA 2WQZC 1OFSA 1RUF3 3PUIA 1PNGA 4XUOA 1DCSA 3GCXA 2ORXA 2VVFA 1RUE2 5F3GA 4EN7B 1AX2A 5L7OB 2HWB1 3BTYA 4Q0QA 2A3XA 1Q43A 4M3CE 3THCA 2P34A 3DKWA 3KMHA 4GKYA 1SG3A 4FXKB 3MIHA 4GXLA 4GWMA 4GZ9A 2LROA 4LBNA 3PUSA 4D3WA 2RS31 1H0BA 1V6JA 1T6BX 1ND2C 1QIQA 1YIFA 2VOTA 4BHPA 2DF7A 2AH2A 3KQRA 3HJRA 4NVPA 4KWUA 4RS5A 1W8UA 4YW6A 4Q4X1 3MI8A 1H9WA 3ZIXA 2W91A 3T30A 1DU3D 4FOWA 5T5PA 2LALA 4IERA 3I4IA 4KQ7A 3SXWA 2QQLA 2Y26A 2X8KA 1QJX1 2ZAAA 4NAMA 2AUYA 2XBO1 4LJHA 1UL9A 1TME1 4B29A 1K42A 1MQTB 4E9KA 5AC93 1D2SA 5M0TA 3CHXA 4YM2A 1HRI3 5GM0A 4DMIA 3OPWA 4BQXA 5FJKA 2F4PA 2GP5A 1BEV2 3WP5A 3R05A 1PGW2 1CAWB 4HFSA 3O1PA 1E5RA 2JG8A 4K8RB 4UYBA 1JHNA 4LK6A 5BNPB 3WXPA 2C9AA 3ZSEA 1HB3A 2WNOA 1TEIA 4A44A 5J7MA 1AR73 2Y6FA 1C5HA 3MW2A 4XMAA 3K77A 5GJ6A 3ILFA 2EA7A 1VBD1 1W0OA 1W6NB 4XEZA 4JQRA 2ZKNA 3ZFFC 4AI0A 1GOGA 5BXXA 2JDUA 4IE4A 2BGOA 1H6YA 2UYBA 1GZCA 2JE9A 2BGPA 3AYCA 3I7DA 3PVEA 1OBNA 5FPLA 4META 2VQUA 3SNMA 1UY1A 2A6YA 2PQQA 4FPCA 5EXOA 3BN6A 1DDLA 3H8RA 4UT5A 4TZDA 4C1WA 4S2DA 1V6KA 5CADA 2JEMA 4IGPA 4Q1RA 3VBHB 1RVF1 5G05L 5K0UC 4C91A 1YHFA 4XFGA 4DY3A 2XJRA 3K48A 4YYOA 1QDOA 5I0SA 2X10A 1JU3A 4MGZE 2NMOA 4LHLA 5J36A 5FMOS 4RQPA 1JI6A 5FYMA 3CQOA 2YBPA 3RZKA 2Y0OA 4BIOA 4WV8A 4CA9A 4XOGA 4AFMA 1ULEA 4XFCA 3IMMA 3HBZA 4QX8A 1AR63 1HQLA 2ZGUA 1JU4A 4GD4A 5FZ6A 3AP4A 1LGBA 1RC6A 1UCXA 4MHRA 4KWKA 1JYVA 2B7YA 3A4UA 1NE6A 5CYYA 4LKEA 3P5BA 4Q4Y2 1QNYA 3QACA 2J22A 5I0DA 1A8MA 4CDWA 1S0CA 5FFOC 1NCRA 1SHWB 3U4SA 2RE9A 3P6BA 3FX3A 1J1LA 3WNNA 1AR61 5ABJC 5CFCA 5IVEA 1L7LA 5KC6A 2IFWA 5E6HA 5B2GB 3AP7A 1ND2B 1S2KA 2XLFA 2ZGTA 1NLSA 4UBHA 5DG1A 1B09A 5F2WA 1H30A 5C3OA 4XW3A 5IWFA 2QQOA 3T3YA 3W58A 1UOBA 3LSDA 3O14A 4RFRB 1QJX2 3TNPB 4GIQA 3POGA 4KBBA 4XAAA 5FTTC 4FAHA 2ZABA 3BB6A 2YHJA 4A7ZA 5IK7A 1YEWA 4Z8BA 2J1TA 4I30A 1W9YA 1SFYA 2Q1ZB 5T5LA 4BISA 2VH9A 4MZUA 1OF4A 3J7HA 1TMF2 4FFIA 2VECA 1JZ3A 1Q8PA 1RHI3 4XQ4A 5BNOA 3BPSA 4HPKA 3CNAA 4JGZA 4PIXA 1QJY1 2PLV2 4YFZA 3MUZ1 1BEV1 2J1VA 4CDXC 2EAKA 1NCRC 5JXGA 2CWMA 3HN1A 1YQ6A 2A3YA 2JECA 4FPHA 4BMEA 5J37A 3PVBB 4NRMA 1V6LA 1YI7A 1AYM2 3WVJA 4UW4A 5FZ4A 2ZGPA 5L9VA 3MPPG 1Z0HA 5LRRA 5DUXA 1V6OA 2ZJCA 3GM8A 4GB31 4RL7A 3TYJA 5C3PA 5KR7A 1HV1A 3FBYA 3T2TA 1ULPA 2Y8KA 4ISQA 2XQRA 4QX7A 1JXNA 1LOFC 1WW5A 2E63A 3UV9A 1F5JA 1G9DA 4MGSA 1JW6A 5GZFA 4AWDA 1LEMA 1Y43B 3AKTA 1AXKA 2Y34A 3B93A 4BPZA 5GLZA 4P5YA 2W39A 3Q8BA 1KXGA 2QDNA 2X5IC 3FN9A 4CEWB 1S0GA 2UYAA 4U36A 1Q56A 4WVVA 1X50A 4QB1A 3ZMOA 1WBFA 3ACGA 5LRSA 4ASKA 2E31A 4EWAA 3U1XA 2XJVA 1MZ6A 3N9QA 4IV3B 5FYIA 1MS0A 1R082 5C70A 1UN1A 3AMPA 3WF4A 1E5SA 2K9ZA 2ZGKA 1I5PA 3VN4A 2Y64A 2OIIA 3U14A 1SDDB 4W50A 4SBVA 3WDVA 3I3DA 5LK5A 1WMEA 4LHNA 5J1XA 3PURA 1J58A 5C9AC 3RZGA 3V56A 5FP8A 5F5IA 5FZOB 5LA1A 1XRUA 2IXJA 1F8VA 3RS6A 2VNVA 3PVOA 4XBLA 4BMBA 1AR72 1GSLA 2Q4SA 1BBT3 4BQ2A 4ORFA 1VAMA 5CNAA 1UX7A 2JDKA 2RM22 2DVFA 2YGLA 1E5HA 2XONA 3HNBM 4XUTA 3ZYIB 1W9FA 4FFHA 4BOWA 5CISA 5GZCA 2K2SA 2IWGB 5JOYA 1VBE3 1RUH3 1W04A 4FO9A 4YZ2A 4UW6A 1RXGA 3FWEA 3WDWA 1ULGA 4NE9A 5FR3A 3GBGA 2DWRA 5FP9A 1LOCA 1ZBA3 4TYSA 5JSPA 1QJU2 1W6NA 3MYXA 1H8TB 4CXWA 4D7SA 4DUWA 4LBMA 2ET1A 3JXSA 4M0HA 1JOBA 3ZXLA 5A7OA 3VD5A 1RUC1 1YNAA 3OG2A 3VKOA 3TN93 3ZDSA 4FTSA 3ZVXA 2DURA 3NKGA 3OEAA 1J84A 2BNNA 1R093 4GJZA 4N9IA 4ZHNA 2YB7A 5GLUA 2TNFA 4G9SB 5F3EA 2VZPA 3OB8A 5HBAA 2O14A 5FO9B 1AXZA 1FNZA 4XJZA 4CYDA 4DIQA 3RPQA 2DUPA 1OT5A 4XZUG 3WW3A 1AX1A 1IQAA 3FZ3A 4K40A 2YZ4A 4QM9A 1AR62 3A0KA 1RUG2 1W03A 1YQ5A 2BWAA 4KU7A 1RUD1 5AFBA 3M70A 4FPLA 1NCRB 5FY9A 3GXUA 2A1XA 3BCWA 3LFMA 5F37A 1MQTC 4Y20A 4IEXA 3JBG3 3O1SA 5DZEA 4GALA 2VMIA 4XVHA 3DECA 1AX0A 3DPRB 5F7UA 3ZM8A 1DYPA 3E1F1 2D6OX 1K12A 3ZSJA 1C8M3 2J1UA 1KQRA 5EJZB 1CONA 1OA4A 4UFHA 4OI0A 4LO4B 2DVBA 3ES1A 2QQWA 3ST7A 4AEMA 4EWDA 5I0RA 5FZOA 1NLRA 5FUIA 4PLOA 3T0BA 3PUQA 4LHSA 1VB4A 2AC1A 5IHRA 2HWD2 4AI2A 1OOPA 3JBG1 1D2QA 1U5YA 3L2YA 1FI2A 3O12A 4I09A 2P3KA 5BV6A 5FXXA 1V9U1 3VZMA 1HKDA 1V6NA 1FOD2 2V4VA 4BQ4A 1DQ6A 1JOPA 4NIDA 2B8MA 3AL5A 2OUJA 5A1FA 3SITA 1WMFA 3H3ZA 2VE1A 3HIFA 4UBGA 4QPGB 2XUEA 3AJZA 2CY6A 1GQPA 2PMWB 3SMHA 4MG2A 3NNGA 4CEWC 5FKBA 1TMF3 4AGVA 2V5DA 2E32A 2G9FA 5T54A 3PLQA 1UPSA 1W9WA 4XTPA 4QMAA 5CIRA 5BY5A 4FTBA 4AFAA 4COUA 1G9FA 2ZMNA 4ZXEA 2IXLA 3OF1A 4ES8A 4F8AA 3DXTA 3ZN6A 4IETA 4XF4A 1N3PA 5IK8A 3OGJA 3SH4A 4Q0SA 1ZRIA 3K4ZA 3VBFA 1AXYA 5IFPA 1HX6A 2SBAA 3S5AA 1HDKA 2HWF1 2NLRA 1YQ8A 2WQ8A 5CFDB 5EJ1B 5JIUA 3I3EA 1QXPA 5FAXA 1DQ2A 1PVC1 1QXRA 4FI9A 2HEYF 3QCWA 4NHXA 1QOSA 2Y6KA 1JYNA 1WWYA 3AMHA 2TEPA 4NRPA 4QXHA 4IEVA 4CDQA 1XNKA 5GZGA 2WO7A 3K46A 1D7PM 1ND3C 2GAUA 4M4PA 5JVVA 1W28A 4QT6A 3RWNA 1ZA7A 5DXDA 4ZS2A 4XF3A 2ARBA 5HCFA 2ZX3A 1NZCA 2WO2A 5FPAA 2ZS6B 2BBVA 1O3RA 5JIAA 4O61A 2GZWA 3IBMA 3WHTA 5HV0A 5F39A 4XQDA 2R072 3SCHA 2CTVA 1DZTA 1H2KA 1GLHA 3UK9A 4FFFA 4COWA 5JZGB 3MO4A 3V0AA 1RB8G 2VCMA 4OI1A 2DBIA 4TSVA 4IW3A 3SEEA 3ZYJB 3FBMA 1KEXA 1JZ7A 1R083 5L73A 5C9AA 2RS32 4Z2AA 1ZBE3 2BW8A 1OQEA 1EUTA 4L11A 4AHXA 4C8DA 3BKZA 2KD7A 1W8ZA 1QNWA 1MS1A 1F4AA 2HWC2 2W1UA 1SFNA 3AFKA 4FPFA 4FQ4A 1BVVA 4LIUA 1KFUL 4PBPA 4QGLA 2UWCA 3H7JA 3JU9A 4WBBA 3GJAA 2RM21 2FDHA 1A6CA 2WS91 3FLTA 3WNOA 4NUBA 3ZKUA 3ZXDA 3RYPA 5FY5A 3MDPA 1W6PB 1NT0A 4YW4A 4E8CA 1XU2A 4WM7A 5H9QA 3AMNA 1LHUA 1D0GA 4QHBA 2AACA 1AZDA 2YBKA 3NNLA 4XDOA 1VPHA 5HV4A 4XAEA 5FY1A 1SBDA 2RM23 3ELNA 5DAQA 5FCCA 4D8MA 3E6CC 3CO2A 4BA6A 3CLPA 5DDJ3 4K7JA 4QQLA 5FKCA 2B5HA 4UXAA 1CIYA 1UZZA 5IK4A 1ENXA 1PIV3 1REEA 2RMU1 2VCCA 4J25A 1T6GC 4QU2A 2ZAHA 2R6QA 4RR3C 5FZFA 2MEV1 3HQXA 5KBFA 4NWVA 5A3OA 1VBA3 1RUJ3 2PXJA 2NP0A 2OVUA 3NKTA 1RUF2 3KT1A 1L7QA 2N7GA 4QKDA 4BQ1A 2GH8A 3KCXA 3OYWA 4H14A 5A3MA 3N7KA 1MS3A 1VRH3 2JDPA 3OY8B 2VNRA 4LPLA 3WCSA 5HXMA 1C5IA 1KJRA 2GALA 4CXYA 3RFRA 1VBA1 3OOXA 1LENA 4F7ZA 3DXUA 4AZZA 4HN0A 1CD3G 3VD4A 3WF0A 4JGZC 4MGQA 1R1A3 3ZFFA 4BXFA 1HRV1 1K5MB 2HLEA 4GWIA 5HI0A 5JXHA 5FYSA 2PHDA 4RFT0 1HJFA 2F6BA 5D8AA 2JDAA 3I49A 1C57A 1S0EA 2HYXA 1F35A 2O8OA 4XJ9A 3POEA 3J7LA 3QH7A 3MFCA 1R1A1 2VMCA 4NWWA 5F3IA 5FZ1A 1US3A 4YG6A 1W6OA 4JV4A 3UKNA 1UYYA 2VBPA 1IG0A 5ACA3 2IXHA 4DNYA 4MHUA 2PQSA 2WAAA 1RUOA 2WWUA 2QQPA 2HWD3 1XNTA 5A3NA 2O1QA 3MHZA 5FLHA 5LY2A 2GU9A 1WW6A 2VPVA 2VZRA 2ZHMA 3PDQA 4QPGA 1AL22 2FCVA 4IEWA 1FOD3 1JZ8A 1KRIA 1PK6C 4GAZA 4LLFA 2EALA 2VAUA 1GOHA 3EYPA 3Q8CA 2BVBA 3ZN5A 3ZOIA 3USSA 2WZR3 3DYOA 4B1MA 4OULA 4DEQA 1OOPB 4YZ5A 1J3PA 3VBRA 4C0BA 3MPBA 2IXCA 1J1TA 4LR4A 4JKMA 4LUMA 2A7AA 2CDPA 4CCLA 1F31A 2ZA9A 2XOMA 3PJYA 1MR5A 2QQKA 5FUNA 4P9WA 3T0AA 1YFYA 2WL1A 1HRI1 2ORZA 4FVVA 1GNHA 4S2HA 1LHNA 1UIJA 2QBXA 3ETPA 3IAQA 3QH6A 4RQPC 3DV8A 4DEVA 2C6SA 2ZACA 3KB5A 4CPBA 4FPGA 3LA7A 3B9CA 3QOPA 4W6YA 5I0UA 3IKWA 4DXZA 1HLCA 5IAVA 5KHKA 1NKGA 1NCQC 3MIGA 2IXKA 4CEWA 1BMV2 4IV1A 2ZCWA 5C71A 1CPNA 4W6XA 4MVTA 2WFPA 3ALQA 3TEXA 4Q26A 4XXPA 2ZGSA 5FZBA 1W8FA 3OGGA 2RS52 1BK0A 4R9DA 3URFA 4DZGA 1JHJA 1TVGA 3WF2A 4Y24A 1MEC1 4CDQB 2A73B 4P5HA 4XCAA 1LEDA 1MS9A 3IT8A 3FMGA 3PNAA 5DAXA 1KS4A 1AR81 1QQP1 3KGZA 1XQNA 5C9AB 2JD9A 2PN5A 1CAWA 1RVF3 4LKSA 1NZIA 3W5MA 1GQHA 5L19A 1WZXA 4F3JA 3B7MA 1OA3A 1NCQB 1W8HA 2WFF3 3B00A 2ZHNA 4MGYE 3I3MA 4OZOA 3S7EA 5EIYB 1HRV2 2WN3A 4LBOA 4GH4C 3V0AB 3B3QE 3I2OA 4E4SA 1PM7A 3N9MA 3BIEA 1WMDA 4LBLA 3WG3A 3KSCA 1ALYA 4QGNA 2ZPXA 4K9SA 5SV8A 1YLLA 2WFF1 2ETEA 3SCFA 3AYEA 3ZSLA 1GICA 3C7EA 3HOBA 4P00B 3Q8EA 1OFNA 4QB6A 5BNOB 4RS5B 1MPXA 2RMU2 1RJ7A 4BQ5A 1EAH1 2X29A 5FIXA 4EN0A 4CP0A 1OLME 2AEYA 3C7GA 4LQRA 4LA2A 2OKXA 2EIEA 4HG6B 4JCKA 1OD5A 1W06A 3P3PA 4XBNA 1HQNA 2XQXA 3N4MA 2WA3A 1QH6A 3H0OA 1E5IA 1WMXA 5DAVA 1RUF1 1DQ4A 4FOVA 3VBSA 3VHRA 1IQDC 1UYXA 1O91A 2WNVB 2ZX1A 2CDOA 3I2IA 4IEUA 4QDSA 5L7OA 4BH9A 4HK8A 3JZVA 3IDBB 2WO3A 2W47A 2WT1A 1VBA2 5F2SA 4KWJA 3AJYA 1QY4A 1ZBA2 4EN9B 3WNKA 5JSRA 4V2WA 3GZEA 4CDXB 4XDQA 1N1VA 5D21A 4MGTA 3AKQA 1XBFA 2D5HA 1VRH2 4CDQC 4LKDA 4Y5TA 1LNSA 3KZ4C 1H1MA 1QXJA 4HVQA 2C9KA 1R092 5IJRA 4YVWB 5EJ3A 5JR2A 1QJU1 3SH3A 2XBO3 2P3YA 3IIIA 1DZRA 2YC4A 1UY4A 2ZBJA 1UYPA 2PHWA 3BTXA 2K46A 1W6QA 5JSOA 1POQA 4GB33 1D4M2 1ZZCA 2YUEA 1NUKA 1CN1A 1MACA 5CVRA 3WSOA 2YY1A 4D6RA 5A3LA 4YARA 3J8F2 4AR2A 1IS4A 1CZVA 2FDGA 3JB4C 1DIWA 1RUE1 2YU1A 3D0SA 4KG8A 5EP9A 3SCGA 3SQOA 1WLDA 2A70A 2J1AA 3VL8A 3AM2A 4B4PA 4OQ8A 4EJRA 3ACLA 5A7SA 2UY9A 2XVLA 4E8DA 3CEWA 3OUHA 2VUAA 1C8M2 4BU2A 1QQP2 3VDAA 4ZONA 4RHV1 3RZHA 1FXZA 3ILNA 5KXBA 1O5UA 2OUHA 2VUCA 1W8OA 1WUVA 4AE2A 1UU4A 4NRQA 5CKQA 4O65A 5E1RA 5CBLA 2VTFA 4LO7A 1M06G 2XMLA 4GJYA 5C6CA 1VE0A 2VU9A 3G7DA 1C3HA 4LOSA 4QX1A 1W6MB 3GGLA 1IHMA 1PMIA 4NOTA 4TN7A 4V2VA 2WLPA 2B4KA 3T1MA 4IV3A 4ISRA 1BMV1 1RUH2 1SPPA 4G4FA 4EE2A 4LITA 4GULA 5C4WC 4AEDA 4XF0A 1QJFA 4CDUA 4YW5A 5FY8A 1H1AA 1JTZX 1W8TA 4LK7A 4QPIC 3UESA 3BIWE 4DPNA 4MO3M 3NV2A 3VD9A 1VBC1 4Q1PA 1WGPA 2ZKLA 3NV1A 5F6LB 5JOWA 5JDBA 2BYVE 4YZ1A 3OBRA 4CCDA 1US2A 2O8QA 3LA3A 3NJXA 3PVNA 1WLTA 3QLQA 4AFBA 3I2JA 4NN0A 4FAGA 4AG4A 2OS2A 1EY2A 4Q4X2 2VZOA 1PZ9A 2VBDA 5J3UA 2ZX0A 1CZTA 1VBC3 4EN8B 1UMZA 2BUKA 3HNYM 1ZBA1 2XH6A 4Q0PA 4IEOA 4FOYA 1NX9A 1TME2 3GJBA 2OYZA 1UY0A 3ZFEA 1PX4A 4B4QA 2VC9A 4EV0A 2D5FA 2ILMA 1Q8SA 4MXWB 4KMQA 1PGL1 1IS5A 4XHBA 1IG3A 2E9QA 2ZX2A 2VUDA 1GQGA 1OA2A 2IVIB 4QDRA 4JC1A 2FDIA 2WNUC 2JWPA 3HVDA 2UWAA 1OUXA 3VBOB 4ZKTB 3GDBA 1GKBA 2RV9A 4HPKB 1HV0A 1LU1A 5GZDA 3WUDA 1WW4A 4GWNA 5E89A 4AVVA 5HPOA 2QNKA 1LB2A 3LE0A 1YJLA 1ZRCA 3LWCA 1JZ5A 1STMA 2B9UA 2R30A 4QPYA 3LDKA 1GOFA 2R1DA 1OPMA 2YFZA 1VIWB 3AB0A 2EIGA 4PT6A 3ON7A 3VDCA 2GMMA 3LDRA 3AK0A 2VCAA 3WEZA 4NIAA 4EWEA 2WKKA 1LHWA 3O5SA 3PMSA 3T08A 3KV6A 4XFFA 2WRAA 3KF5A 1MQTA 3USUA 2W94A 1QH7A 3N9OA 2QJVA 3ZXEA 4IEYA 2ZX4A 4IV1C 4M00A 5DDJ2 3MLKA 4OVEA 4UOJA 3CKHA 3OCPA 3BGAA 1QDCA 5A7QA 1GP6A 1LCLA 4GH4A 3OY8A 1VRBA 2ZMLA 4KGGA 1VMFA 3H1MA 3J7NA 3OTFA 2VO5A 3ETQA 4HANA 2XXZA 4I3GA 2D6MA 2GP3A 1EUUA 1W0NA 3KCCA 3MICA 1FATA 2B9VA 2DCZA 2R043 4X6QB 2KM2A 1NXMA 3KV5A 2DUQA 4Y1UA 3H8UA 5KHJA 3KV9A 1BXHA 3V64A 4YPJA 4P08A 1HQWA 3RG0A 4PQQA 3MLJA 1LECA 3R4DB 2R073 1CZSA 3WLUA 2BVVA 3RNSA 3M1HA 3PUHA 3VBOA 3KQ4B 5IYYA 4QXKA 2E7TA 5IVJA 1TNRA 2DDUA 2YDEA 4KU8A 3VBHC 3ZSKA 5A33B 4HT1T 2WS92 3OGVA 1ZYBA 4E27A 1UU5A 4RGAA 3U4XA 4HKLA 3AMQA 3MBWA 2V09A 1LHVA 3MEPA 4YW2A 4PCRA 1LOEA 4H3WA 2NQYA 5FWJA 1SLLA 3ZN6B 5C3SA 3POBA 2WC2A 4IE0A 3RMYA 1WA6X 2GNMA 2VMEA 4Q0VA 3NO8A 4DRRA 1S4CA 3UJQA 4H2AA 4LIVA 2YC2A 3ZYBA 4Q0UA 1HN0A 1WLCA 2HYKA 3CZJA 5ABJA 5B4XA 2WZR2 5JZGA 1G9BA 1CVNA 1Z78A 3VKLA 2I07B 4EZ4A 1V70A 2CGNA 2ES3A 1EPWA 1FPN2 1RUI1 1W9SA 1ULCA 4ARXA 1Y9MA 2VW1A 4CCCA 1GNZA 1ONAA 2JXAA 1PIV2 3ATGA 4XETA 2GMEA 5FZ7A 2HEWF 1H2NA 4HZFA 3LQCA 4GMP3 2ZZQA 4XABA 1GWMA 3GHMA 4KBZA 2WAOA 4XMIA 3W20A 1YO8A 3I59A 2ZTNA 4WM8C 2H0VA 3U11A 2WNVC 4HOOA 1GANA 4A7YA 4AYUA 4QQHA 5DDJ1 3NAPB 5BNNB 4Q27A 3J9SA 2Q8OA 4JHTA 2XLAA 5FBJA 3ZX7A 5IVCA 4LBQA 4YM1A 4DS0A 5J96B 2BERA 2RS53 1I5ZA 2LM3A 3A23A 4H7MA 3ZR5A 1B35A 1WW7A 3AXEA 5H9PA 2PELA 1RUC2 4P9LA 3LIGA 4CE8A 2HEVF 4FPKA 4QQOA 1W6OB 5T3NA 1VBB1 4BM8A 4XACA 1I1EA 3THPA 3AP9A 1OLRA 5FP3A 3WNMA 2B46X 2ET7A 4UWDA 3VLBB 2W9XA 4AQ6A 5IVBA 2X05A 3MV11 4HN1A 3VDDA 1H8TC 1WCDJ 4R4XA 3WR0A 2R061 2XL9A 2VZ3A 4DQAA 2XJUA 5LCWL 1SDWA 1RMU2 2ADDA 1POV1 3OBTA 4WM8A 4YM0A 3BODA 3BU7A 1RUD2 1YRZA 4TLFA 3DPRA 2EAAA 4A3ZA 1I6XA 2X5IB 4NHYA 1CJPA 2NZ9A 2XGXA 3M7AA 5K4LA 1W90A 4W6WA 1YJKA 3ZYFA 4A6SA 1Y9GA 1AYN2 1H2MA 3LEMA 4FFGA 4QQ2A 4YG3A 5FK7A 5ACA1 1PO23 3AZXA 4XIOA 3OD4A 3ZN4A 2XB6C 3ZXJA 2OT7A 2LS6A 2YC0A 3AXDA 3INAA 3TBDA 3ZDVA 4NPRA 1GP4A 1EYBA 1TG7A 4LEJA 3AMMA 5FMOL 3PIGA 3T4HB 4HVRA 4QAWA 4XYXA 3WNPA 1ODNA 4AI3A 1OKOA 1G86A 5LEJA 1SCRA 1XC6A 2WDBA 5BNPC 1AL0G 1DGWX 2YFUA 2DCYA 5FOBB 4P9YA 1PO21 4K1YA 4WVZA 1EAH2 4OQ9A 4PBOA 3VZNA 5D8AB 2WZEA 3VKFC 3FUQA 3T09A 5JXJA 4R9CA 2W5FA 3E5QA 1FPN1 1R64A 3FC0A 3WQ7A 5IATA 2DCJA 4YWAA 5LY1A 2VQ0A 3M4FA 3PTYA 1CR7A 2R042 2HBUA 2P1BA 3FUOA 1ZZ7A 3NSTA 3POYA 4WM7B 2VZTA 1QOOA 3R0RA 2CWSA 3DF0A 4JAAA 5AVPA 5FZCA 2CSGA 4Q4W3 3WG1A 1U5XA 4QDQA 4XC9A 3PIJA 4IE6A 4ATEA 1F9KA 1WD4A 3NJVA 2NPIA 4K20A 4DUXA 3DUIA 1NA1A 5A6QA 4UFIA 1RJ8A 2W92A 2XBO2 2C5DA 2RR13 4CCNA 1MVEA 1PNFA 2EVXA 5FOJB 2ZEXA 1OOPC 2V5YA 3NNJA 1L3JA 2AGSA 5CG8A 1OPOA 1N3OA 4OFGA 2WZPP 2WS93 4XILA 4NIIA 4D0QA 2WFF2 1UKRA 3S7IA 2CYFA 4P9XA 3LEKA 1Y7BA 1W2UA 1IPKA 3OPTA 1TNFA 3N9LA 4KI5M 4QB2A 1S0DA 3CMGA 3H7YA 2JDHA 4PLMA 4COZA 3KS7A 4AHZA 1XYOA 4XJ8A 3ZSMA 1UW8A 1AR83
chains in the Genus database with same CATH topology
2D3SA 3I8TA 5C4WB 1YXWA 2HJIA 1PIV1 4AVAA 2W68A 2RMU3 5DG2A 2D40A 3WP4A 4A2UA 4IV1B 2HWC1 1Z7S3 1SEFA 4CTEA 4ASMB 1SLTA 2GNTA 2WNVA 4HMZA 4Q8LA 1FMD1 3MFAA 4HKOA 3D6EA 5EZWA 5K0UB 3IIAA 2WT0A 3B5LB 3EBRA 1NE4A 4V1PA 4TWTA 1DQ5A 2D3RA 4K8FA 2ATFA 2XWBB 2VOXA 4JVAA 1ENRA 2RJLA 5DUVA 1MS4A 3VKMA 1O4ZA 2HWB3 3SLIA 3WW4A 3ZFFB 4XJUA 1LODA 3IN9A 2QZ3A 3T1LA 1SLCA 4RGGA 2B39A 1EV13 1PZ8A 3NV4A 3ME2A 1K5MC 2PYTA 3AKSA 1GYKA 3AKRA 4L8QA 5GLTA 3TRSB 3VV1A 3DN7A 4Q4X3 3ENRA 5KXDA 5F1RA 3ZFEC 5ABJB 1XXNA 5J09A 2VUJA 5A32B 3GYDA 5C8CA 1I9RA 4XTMA 3J8F3 1ZNPA 2VW2A 3J4UH 2WT2A 4R9AA 4N7IA 4ES9A 5AC91 4L99A 1WCKA 2HWE3 2D6NA 2D97A 4CEYC 4DY5A 3QBQA 2CNAA 1X8EA 2XHKA 2Y0IA 4RR3B 2ZGQA 5LEKA 3JD72 1YI9A 4LT5A 1CIWA 5I8TA 2JG9B 1H9PA 3VHPA 3AYAA 4LO8A 1C1LA 2DUOA 5C4WA 2X5IA 1BQPA 2EXIA 3OPZA 1QJX3 2H6CA 4LULA 4XF9A 3ZO0B 1VBD3 4NO4A 3VBUA 1ZREA 1SCSA 1DGRN 4Y1YA 1AYM1 3FHIB 3WD5A 3HR9A 4PDWA 3WG4A 1UZYA 5D8AC 2DV9A 5DUWA 5FREA 2P17A 4YVWA 1FNYA 5JCTA 4IESA 2W08A 3CJXA 4YGBA 3RRDA 1AYM3 4BYYA 4HVOA 1AR71 2E53A 1F2NA 3RJ2X 3S6PA 4C90A 3GHNA 3V0BB 2XL7A 4SLIA 4WZCA 4J1XA 4JDOA 3H1YA 2FZ1A 1SMVA 1V00A 3FE5A 1Q5OA 1C4RA 2GN3A 4P9GA 4B8EA 4YVSB 4HETA 1ND3B 4MX3A 4D7TA 5BUVA 4BE3A 1MS8A 2ENRA 5I0TA 2OZ6A 1M4WA 1ZVFA 1LESA 5DZGA 4CDUC 2NN8A 3B9IA 3IWZA 1DHKB 3V65A 1R1ZA 5EWSA 5JZGC 3KD4A 1CGPA 1VAKA 3D8CA 1D0HA 5BYNA 2OZJA 3R4UA 2E7QA 2ZGNA 3RMXA 4QGMA 3DPRC 2XJTA 3KT7A 1ZZ8A 2A71A 2C0ZA 4QQPA 5EV7A 1A3KA 1O4YA 3ZFEB 5DZFA 3U10A 3M2MA 1IKQA 1WD3A 3VBUB 5EYYA 4QM8A 1BBT2 1BEV3 1O3TA 1OSGA 1W6QB 3KGLA 2KXLA 4K1ZA 4GH4B 1YIPA 3AZWA 1U12A 1N3QA 1V6IA 4FPJA 1XYNA 2FHRA 1IZ3A 4X8NA 2AR6A 2D98A 4Q4V3 1G7YA 1B35B 1KFXL 4L2NA 1QHDA 4MYEA 5JR7B 4AEDC 2VGDA 3V0BA 4N90A 4E4DX 3MIFA 1FYUA 1QF3A 3ZMNA 1QJU3 2OPKA 4OLLA 4H55A 1RTVA 4FT8A 3WDUA 5AFEA 2OA2A 2GN7A 5DUUA 3DGTA 3O0VA 3W59A 3AYDA 3ZXFA 4URTA 5A32A 5C8CB 3EQEA 1YCIA 3SISA 4YVSC 1LJ7A 3JQXA 3NAPC 5BNNC 5CFCB 1N1SA 2JJ6A 1CESA 2JG9C 1FAYA 3ECQA 3JBG2 4QPIB 2I74A 4OI4A 4XFIA 3D0JA 4FQZA 4K21A 3ZYRA 4A3XA 3HMYA 3PJQA 2R071 1ZRRA 1RMU3 2CAUA 3B01A 3LAGA 4E4ZA 3BOWA 4HK9A 5JPNB 1J3QA 2WSVA 4BLJA 1DG6A 1COV3 1VBE1 1H1IA 1GV9A 2XVGA 3RQ0A 3W9AA 1DYKA 3WHUA 2WINB 1MS5A 1O3QA 3AP5A 3NVCA 1O5LA 4KG0A 4RSUA 1W6PA 4YGDA 1S1AA 2KA3A 5CG9A 3TAYA 3GNEA 1OI6A 4G3YC 3TN91 1COV1 3GBWA 2PLV3 3NJZA 3M3IA 4AXOA 3POWA 2E6VA 4MSVA 2VVEA 4XHXA 3UKVA 1OQ1A 1PO12 4Z07A 5FBZA 3E5XA 1LRHA 5I91A 1JYCA 3N3HA 5FPXA 1D4M1 2XKPA 4WZFA 3ILRA 1A8DA 1NYWA 2PLV1 1QJY2 2A6WA 1VBB2 2TBVA 2ZGOA 3QD6A 2WJSA 1H8VA 5F9TA 4RA0A 4PF5A 2JICA 1G9CA 4LE4A 2AENA 2MEV2 4JDMA 1DGLA 4FSJA 4YGCA 1RUC3 4QPIA 3NW4A 2W52A 1C8M1 5FO8B 5KWRA 4M3CB 4PLNA 3KT4A 2GC2A 4E2QA 4LE3A 4P9IA 4IV3C 1ENQA 5KC5A 2YROA 4NR1A 1WCSA 3I59B 5IUQA 5T50A 4FPEA 4CEYB 1RUD3 2CV6A 3IMNA 3WOGA 3U07A 3GZUC 1HXS1 4BWOA 4OHYA 3E5UA 2R0HA 1OHFA 2VQAA 1TMF1 5I8YA 2CGOA 4FP3A 4YGEA 4FTEA 3POSA 1NXD1 3VZOA 4R52A 5HXVA 1PO22 3R6SA 3D82A 1LKNA 2R063 4OZXA 1S2BA 4XJAA 2R0FA 4WVWA 1POV3 3BPZA 4B4RA 4WM7C 1NCQA 2UURA 4Z92B 3VKNA 4KWLA 1C8NA 5C33A 1REDA 3MW3A 2WNUB 2QE3A 2GC0A 4BIFA 2PTMA 3FFZA 1VBE2 4F83A 1MZEA 4XQWA 5TSWA 4DB5A 1IOAA 1RUJ2 4IXLA 3MF6A 1J59A 2IZWA 3JQWA 1QJZA 1LOGA 5GKAC 3MIDA 2E51A 2JD4A 2NYYA 1IKPA 5GLWA 4LTAA 4Y20B 4AHYA 4JGYC 4DFSA 1NA1C 1D4VB 3CJIC 2HWF3 3N36A 4JRLA 4NHMA 2Z79A 4CZSA 1LU2A 1R1A2 4HSLA 3PHMA 3RJRA 2VVDA 3MZHA 2FMDA 4DINB 4LO6B 3ZYPA 2G9GA 3VBSC 2XUMA 3CJIA 1ASJ3 3RYKA 3AX4A 4I0WB 1BVP1 1RINA 2RS11 2AYHA 1AL21 2ZZJA 4ASLA 1VR3A 1JYIA 4YM3A 5FDBA 2HWE2 3JB8A 3WCRA 3CU7A 1MEC2 1AR92 3WQ1A 1POV0 3WQ0A 4Y1VA 5BNPA 3VBFC 3I2DA 5GLVA 1AHSA 3FLRA 5E16A 1AL23 4ZU4A 1DGRA 5KXEA 4MLOA 2GMPA 4OHVA 2DU1A 4GMP1 2PHRA 2Q1MA 3WX5A 1Z7S2 1VALA 4FCAA 2OW4A 1TQ5A 1WBLA 2MPFA 3N7MA 3I54A 3O7OA 1BK1A 2ZOEB 2Z69A 3U0ZA 3MIEA 4H7LA 3LB9A 3NAPA 4WM8B 5BNNA 1NG0A 4YVSA 2XVKA 1JN2P 2XJQA 3ZXAC 4N53C 3VDDB 1PO13 1N1TA 1TE1B 2HWB2 4ZU5A 1O3SA 1ULFA 4K3UA 1A78A 5JOZA 1CJDA 5K0UA 3CJIB 3JCIA 1FMD3 1VBB3 1EV12 1UAIA 3IM0A 3BTAA 4JTNA 4CRQA 2A75A 2P37A 2PA7A 4HBNA 4DRVA 2V73A 5KHGA 3J26N 2MEV3 2Q5TA 2BNOA 1G9AA 4CDWB 3MW4A 4IL7A 1OQDA 4Y5Z0 4IEZA 5T52A 5BNOC 1FV3A 4YG0A 2RJKA 4Q2FA 1RVF2 2R16A 1VRH1 2FBEA 3APBA 2Z42A 1OLQA 1X36A 2HWD1 4L92A 4XBQA 3M3EA 1H4GA 5FLJA 4I3PA 3JD73 2BEOA 4LLOA 2Z2SB 4AVSA 5CA6A 1FOD1 1HRV3 3THTA 1ZRFA 3MIBA 2RS33 4YW1A 4XZPA 3WDYA 1LULA 3J8F1 3EO6A 3O0XA 3VBOC 2RS12 3ES4A 1XNBA 2GC1A 2PHTA 1AUYA 1NA1B 3LKJA 2CGPA 4CDWC 3RYRA 4MUVA 2HWE1 4OUMA 2QDRA 5H9RA 4S2GA 4JGYA 4ZXKA 5GZEA 5SV5A 5FPZA 4OI2A 2NM1A 4C0HA 3IDEA 1VP6A 4RHV2 2FZ2A 1VLNA 4OHXA 4FXGB 3AZVA 1UX6A 1BJQA 1DQ1A 2D7FA 3DL3A 3TNQA 3H3UA 4D69A 1DF0A 4Q4V2 3KLSA 3ROUA 1AVBA 3N7JA 2BGCA 3IDCB 3VBFB 2EXJA 4M3CA 1K5MA 1CAUA 2GNDA 2RR11 4AFCA 4AK3A 1MZFA 3HT2A 1SQ4A 3M3QA 4O9EA 1CQ9A 3OYWB 1JUIA 4D7YA 1Q8VA 1W0PA 2SLIA 3GZAA 5JPMB 2K0GA 4CP1A 2D6PA 3SHRA 4JRAA 3LGRA 4M01A 1QMJA 1IPJA 2YV8A 4GB32 4Z82A 3A0NA 2I2SA 4XPVA 4N53A 3R4SA 1XNDA 5CB7A 1LTEA 1SLBA 1DGWA 5IT6A 2WWSA 1S0JA 4OHZA 1MEC3 2BFUL 3VZJA 3TB0A 3ZFGA 3EXUA 3VBRC 3WV6A 1APNA 1YFUA 1QQP3 1Z7S1 4KNCA 1ZM1A 3VZKA 2IFRA 5ACA2 1FX5A 2DU0A 1UD1A 2UY8A 4AI1A 1DFQA 2NMNA 1CPMA 1JBCA 2D43A 2XJPA 2A3WA 1NQJA 2JX9A 3WW1A 3WNXA 1MZ5A 2YYOA 2GSYA 3HAGA 2O0OA 4N7UA 2A5ZA 1CAXA 2EXHA 1ZZ9A 3HD8B 4LO5B 4JDNA 3MLLA 2DFCA 1GZWA 5EFUA 4I01A 1LGNA 4AW7A 1OMIA 2D44A 2YPJA 2QVSB 4XE9A 2C1FA 2VULA 2YXSA 5C8CC 4FPYA 1EV11 2ZGRA 4N43B 2B45X 4AGGA 4OHWA 4Y22A 4W65A 3WP6A 2Z5WA 5K8SA 1LHOA 4I0BA 5CU1A 5CFCC 5LK7B 4CDUB 4MH0E 3LCPA 1FMD2 4AEDB 2GH2A 3GZTB 4M3CF 4LBKA 1PZ7A 3CF6E 4K6BA 4JGZB 4LNVA 1NY71 5FLIA 1RHI1 4Q4V1 2WLQA 3FFQA 1QJY3 2B42B 2YGMA 1Q3EA 3VUOA 1KDMA 5KHHA 4QX5A 1RUE3 2QCSB 1XNCA 3AFGA 1TME3 1RITA 4PIZA 1DBNA 2QKDA 2D93A 4R4ZA 2QUOA 1SACA 2XKOA 3X29B 1WLWA 4AFDA 1BZWA 2WNEA 1CAXB 3UJOA 4ZU7A 2ZGLA 4GKXA 3LA2A 4KGQA 4YNIA 3LOIA 5K9YA 4HL0A 4FP2A 4PDWB 3WZ1A 1DZQA 3TWIA 2R1BA 5JOXA 1HRI2 4YFWA 1X8MA 4J1WA 1X82A 4AQ2A 4AVTA 2ERFA 5JI7A 1COV2 2DCKA 2DTYA 3Q9OA 4IEQA 4RQPB 4ATFA 4LBQD 3VBRB 4RHV3 2HKXA 2EF6A 1FT9A 3M8LA 4MXVA 2XWJB 3WDXA 1X7NA 2A6ZA 5JAXA 3L2HA 2Q0AA 3MF9A 2PAKA 2DCTA 1MVQA 1IS6A 1Y9QA 4WVMA 1ZZ6A 3LOBA 4CDXA 2D3PA 4Y1XA 2VNGA 2PHUA 5FO7B 5AVAA 2GDFA 2PHFA 3WG2A 3WW2A 3WDTA 1RUNA 1ULDA 4S2FA 1G6NA 1GFF2 1YYNA 1PGSA 4XJWA 3C2UA 3C3VA 1ND2A 2HWF2 2JE7A 4YZ3A 4I2OA 1RGSA 3KM5A 4NHLA 1O4TA 4JGYB 4FBFA 2P3IA 1D4M3 1JUHA 3OD0A 1ASJ2 4UW3A 5BNQA 3KCYA 1R091 1H2LA 1V9U2 2FQPA 1UKGA 2DFBA 4YW3A 4XIKA 5T5JA 5L7OC 2I45A 3MGUA 2VOKA 4YRDA 2WIIB 4AQTA 1IGOA 2EXKA 1HW5A 3ZFGB 1GZWB 5CAZA 4I02A 4LUKA 2R062 1YFXA 1URXA 4IQPA 1KJLA 1GR3A 4I0AA 1LOBA 2QZ2A 2ZHLA 4EROA 2H6BA 2ZGMA 3WP3A 1YUDA 4DOUA 1HXS3 1PVC2 1QKQA 4AEJA 2BFUS 1SLAA 5I93A 1VAVA 2JG9A 1RHI2 2A6XA 3H50A 4NHKA 4WVMB 2AZ5A 3LZZA 3P3NA 5C8WA 2D6LX 2VXRA 1U5IA 4B3NA 4M0NA 1SLIA 3UKTA 3IPVA 3M3CA 3RSJA 4PDWC 3UL2A 5FQ0A 2VW0A 3HWJA 3VBSB 4E2GA 4O9GA 2FMYA 1LOFA 4B7KA 4BLIA 1YFWA 1ZZBA 1U5ZA 2JG8C 2ZMKA 5H9SA 4P14A 3VBUC 3ZIWA 2JDZA 1O7FA 3VHOA 4FOQA 1BCXA 3RI9A 5D1IA 1G8WA 1VBC2 1AR91 3O0WA 2UU8A 1Q8QA 2R041 2VG9A 1RMU1 1LOAA 5HCBA 2WQ4A 5T55A 2DVDA 2W0XA 3N35A 4QPGC 2AREA 5GALA 1REFA 4HKWA 3ZYGA 2BPA2 3N7LA 4N43A 5BPXA 1HIXA 3EHKA 4P9JA 3TOJA 2QFEA 1E57A 3ZPYA 1RL3A 5JMCA 4Y22B 1AR93 3CL1A 1U0AA 2PAEA 4MGKE 4XFHA 4LA3A 1BBT1 4COVA 1LGCA 4FPOB 3K51A 2D6KA 3S0MA 3VGIA 1KDKA 3G6JB 5KXCA 1FV2A 1PVXA 1ASJ1 4B7EA 4ITCA 1PGL2 2PFWA 3RZZA 1H4HA 2RS13 1OKQA 1RUI3 3E97A 4A7KA 5F6KA 2R32A 2GNBA 4R9BA 4Y1ZA 1RUH1 4XXAA 3NV3A 3RI8A 5JWPA 2G4IA 1R081 1CAVB 3ZXGA 4AF9A 4N43C 1ZBE1 1KD7A 4ONUA 1F5FA 1CAUB 1PK6A 2MNGA 3E6BA 3NL1A 2DVGA 5E88A 5JLVA 1XYPA 3OJBA 3ZXKA 2BNMA 4HLTA 3AKPA 2Y38A 2IXIA 4Q8KA 4YSFA 4INDA 1AJKA 4D94A 1UIKA 1GBGA 3VL9A 2WSUA 3BALA 2JENA 4N53B 3VDDC 4HSJA 4N9HA 4AGRA 4MGIE 1ENSA 3LSEA 1AJOA 4J6GA 3TN92 4Q4W2 1X33A 4LBJA 1JOJA 3EJKA 1BYHA 1QGLA 4GQ7A 1J3RA 4AVBA 1PO11 2PAMA 3AZYA 3D5OA 3BOPA 2E7AA 3M3OA 2RR12 3E6DA 4XFAA 2PHXA 5T5OA 4X6RB 1UU6A 2WA4A 2ZHKA 3WINE 5FRAA 1W6MA 4BCUA 5IK5A 1QOTA 3H9AA 3WY6A 4GMP0 1RUG3 5CFDA 5L36A 1V9U3 2Q30A 1XU1A 4AVCA 2RS51 3B02A 2DVAA 2ARXA 4RR3A 4YZ4A 5EYXA 2PHLA 5J48A 3FJSA 4Y4YA 4GA9A 1AR82 1RUG1 1LR5A 3GALA 4Z1VA 3S30A 5AC92 3VZLA 1RIRA 3H1WA 1W39A 2XG3A 4UW5A 2LTNA 2VMHA 1ZRDA 3AP6A 2WNUA 3JD71 1PK6B 3FLPA 3NWKA 2P2KA 2A6VA 1YWKA 1EP0A 5F5QA 4BZ4A 1CAVA 3B94A 4YLZA 4L97A 1AF9A 2JKBA 1HXS2 4CDUA 1UPIA 5HCAA 1PVC3 1WA4A 2CL2A 2DYCA 4XFBA 2BTVC 3GF6A 1FPN3 4Y26A 1S55A 4OUSA 1S0BA 4R8HA 1NQDA 3L9JT 1BKZA 4KH9A 1PGW1 1QU0A 1I3HA 2WZR1 4QD2A 1Y3TA 3IPVB 4XF1A 2P3JA 5FQ0B 2VY0A 4LHKA 2VNOA 2X53S 4AI8A 2IC1A 4CP2A 3VBHA 3B69A 3WUCA 2DTWA 4COYA 4LBQB 4Z2WA 1ZA4A 2CAVA 1JH5A 1DQ0A 3PMEA 1PHMA 2GC3A 1N47A 1VJ2A 4U2AA 2LUWA 4AQSA 1S0IA 1ND3A 4C1XA 4E2SA 1V6MA 4KL1A 1XE7A 3USUB 1NY72 4PIYA 1KITA 4YVWC 2R49A 4Q4W1 4AEKA 1H8TA 4X8PA 4JTOA 3RDIA 3WT3A 1VB2A 1C28A 5CFDC 1GZ9A 2VOWA 3JUUA 5KHIA 2TUNA 5E8AA 1DLLA 4Q4Y3 1N1YA 1ZBE2 4PQ9A 5J98B 2HWC3 1XE8A 2VMGA 1B35C 1RUI2 1Q8OA 3VHNA 2BQPA 2MHFA 1SBFA 1VBD2 1CX4A 4Q4Y1 3ZFGC 3ASIA 2UWBA 1AYN3 1EPZA 1UF2C 4IEPA 1RUJ1 1ZX5A 4RD7A 2BWCA 4CEYA 2RHPA 1KS5A 1QWRA 4Q29A 1SBEA 4RS5C 3D4KA 1C1FA 4PJYA 3HT1A 2XJSA 1IS3A 5A33A 2YMZA 1AYN1 5JI9A 4EN6B 4AHWA 2XLGA 1NOVA 3SH5A 2JG8B 5I8SA 2VOVA 1EAH3 4L9BA 4MV2A 3GBFA 4MXWA 2XPJA 1S0FA 3AZZA 2H0BA 2WQZC 1OFSA 1RUF3 1PNGA 2VVFA 1RUE2 4EN7B 1AX2A 5L7OB 2HWB1 4Q0QA 2A3XA 1Q43A 4M3CE 2P34A 3DKWA 3KMHA 4GKYA 4GXLA 4FXKB 3MIHA 4GWMA 5K7PA 4LBNA 4D3WA 2RS31 1H0BA 1V6JA 1ND2C 1YIFA 4BHPA 2DF7A 2AH2A 3KQRA 4NVPA 4RS5A 4Q4X1 3MI8A 1H9WA 3ZIXA 1DU3D 4FOWA 5T5PA 2LALA 4IERA 3I4IA 4KQ7A 3SXWA 2Y26A 2X8KA 1QJX1 2ZAAA 2AUYA 2XBO1 1UL9A 1TME1 4B29A 1MQTB 4E9KA 5AC93 1D2SA 4YM2A 1HRI3 5GM0A 4DMIA 2F4PA 1BEV2 3WP5A 3R05A 1PGW2 1CAWB 4HFSA 2JG8A 1JHNA 5BNPB 3WXPA 2C9AA 3ZSEA 1TEIA 5J7MA 1AR73 1C5HA 3MW2A 4XMAA 5GJ6A 3ILFA 2EA7A 1VBD1 1W0OA 1W6NB 4XEZA 4JQRA 2ZKNA 3ZFFC 4AI0A 5BXXA 2UYBA 1GZCA 2JE9A 3AYCA 3I7DA 3PVEA 4META 3SNMA 4FPCA 2A6YA 2PQQA 5EXOA 1DDLA 4TZDA 4C1WA 4S2DA 1V6KA 5CADA 2JEMA 4Q1RA 3VBHB 1RVF1 5K0UC 4C91A 1YHFA 4XFGA 4DY3A 2XJRA 3K48A 4YYOA 1QDOA 5I0SA 4MGZE 2NMOA 4LHLA 5J36A 5FMOS 4RQPA 2Y0OA 4BIOA 4WV8A 4XOGA 4AFMA 1ULEA 4XFCA 3HBZA 1AR63 1HQLA 2ZGUA 3AP4A 1LGBA 1RC6A 1UCXA 4KWKA 2B7YA 3A4UA 1NE6A 4Q4Y2 1QNYA 3QACA 1A8MA 4CDWA 1S0CA 5FFOC 1NCRA 5ABJC 2RE9A 3FX3A 1J1LA 5KC6A 1AR61 5CFCA 2IFWA 5B2GB 3AP7A 1ND2B 1S2KA 2XLFA 2ZGTA 1NLSA 4UBHA 5DG1A 1B09A 1H30A 4XW3A 3W58A 3LSDA 3O14A 1QJX2 3TNPB 4GIQA 4KBBA 5FTTC 2ZABA 3BB6A 2YHJA 4A7ZA 5IK7A 4Z8BA 4I30A 1SFYA 2Q1ZB 5T5LA 2VH9A 4MZUA 1TMF2 2VECA 1Q8PA 1RHI3 4XQ4A 5BNOA 4HPKA 3CNAA 4JGZA 4PIXA 1QJY1 2PLV2 4YFZA 1BEV1 4CDXC 2EAKA 1NCRC 2CWMA 3HN1A 2A3YA 2JECA 4BMEA 4FPHA 5J37A 3PVBB 1V6LA 1YI7A 1AYM2 3WVJA 4UW4A 2ZGPA 3MPPG 1Z0HA 5LRRA 5DUXA 1V6OA 2ZJCA 4GB31 4RL7A 3TYJA 1HV1A 3FBYA 3T2TA 4ISQA 1JXNA 1LOFC 1WW5A 2E63A 3UV9A 1F5JA 1G9DA 5GZFA 1JW6A 4AWDA 1LEMA 1Y43B 3AKTA 1AXKA 3B93A 4BPZA 5GLZA 2W39A 1KXGA 2QDNA 2X5IC 4CEWB 1S0GA 2UYAA 4U36A 1Q56A 4WVVA 1X50A 3ZMOA 1WBFA 5LRSA 4EWAA 2XJVA 1MZ6A 4IV3B 1MS0A 1R082 1UN1A 3AMPA 2K9ZA 2ZGKA 3VN4A 2OIIA 4SBVA 3WDVA 5LK5A 1WMEA 4LHNA 1J58A 5C9AC 3V56A 1XRUA 2IXJA 1F8VA 3RS6A 3PVOA 4XBLA 4BMBA 1AR72 1GSLA 2Q4SA 1BBT3 4ORFA 1VAMA 5CNAA 2RM22 2DVFA 2YGLA 3ZYIB 4BOWA 5GZCA 2K2SA 2IWGB 5JOYA 1VBE3 1RUH3 4FO9A 4YZ2A 4UW6A 3FWEA 3WDWA 1ULGA 3GBGA 2DWRA 5JSPA 1LOCA 1ZBA3 4TYSA 1QJU2 1W6NA 3MYXA 1H8TB 4D7SA 4LBMA 2ET1A 3ZXLA 4M0HA 1RUC1 1YNAA 3VKOA 3TN93 3ZDSA 4FTSA 3ZVXA 2DURA 3NKGA 2BNNA 1R093 4N9IA 5GLUA 2TNFA 4G9SB 5HBAA 5FO9B 1AXZA 1FNZA 4XJZA 4CYDA 3RPQA 2DUPA 3WW3A 1AX1A 1IQAA 3FZ3A 4K40A 2YZ4A 4QM9A 1AR62 3A0KA 1RUG2 2BWAA 4KU7A 1RUD1 5AFBA 3M70A 4FPLA 1NCRB 3BCWA 1MQTC 4Y20A 4IEXA 3JBG3 5DZEA 4GALA 2VMIA 1AX0A 3DPRB 1DYPA 2D6OX 3ZSJA 1C8M3 1KQRA 1CONA 1OA4A 4OI0A 4LO4B 2DVBA 3ES1A 3ST7A 4AEMA 4EWDA 5I0RA 1NLRA 4PLOA 1VB4A 2HWD2 4AI2A 1OOPA 3JBG1 1D2QA 1U5YA 3L2YA 1FI2A 3O12A 4I09A 2P3KA 5BV6A 1V9U1 3VZMA 1HKDA 1V6NA 1FOD2 1DQ6A 2B8MA 2OUJA 3SITA 1WMFA 3H3ZA 3HIFA 4UBGA 4QPGB 3AJZA 2CY6A 3SMHA 4CEWC 4AGVA 1TMF3 2G9FA 5T54A 3PLQA 1UPSA 4XTPA 5CIRA 4QMAA 5BY5A 4FTBA 4AFAA 4COUA 1G9FA 2ZMNA 2IXLA 3OF1A 4ES8A 4F8AA 3ZN6A 4IETA 4XF4A 1N3PA 5IK8A 3OGJA 3SH4A 4Q0SA 3VBFA 1AXYA 1HX6A 2SBAA 1HDKA 2HWF1 2NLRA 5JIUA 5CFDB 1QXPA 5FAXA 1DQ2A 1PVC1 1QXRA 2HEYF 3QCWA 1QOSA 3AMHA 2TEPA 4IEVA 4CDQA 1XNKA 5GZGA 1ND3C 5JVVA 2GAUA 4QT6A 3RWNA 5DXDA 4XF3A 2ARBA 5HCFA 2ZX3A 1NZCA 2BBVA 2ZS6B 1O3RA 5JIAA 2GZWA 3IBMA 3WHTA 4XQDA 2R072 3SCHA 2CTVA 1DZTA 1H2KA 1GLHA 3UK9A 4COWA 5JZGB 3V0AA 1RB8G 4OI1A 4TSVA 3ZYJB 3FBMA 1R083 5L73A 5C9AA 2RS32 1ZBE3 2BW8A 1OQEA 4L11A 4AHXA 1QNWA 1MS1A 3AFKA 2HWC2 4FQ4A 1SFNA 4FPFA 4PBPA 4QGLA 1BVVA 1KFUL 2UWCA 3H7JA 3JU9A 4WBBA 2RM21 1A6CA 2WS91 3FLTA 3ZXDA 3RYPA 3MDPA 1W6PB 4YW4A 1XU2A 4WM7A 5H9QA 3AMNA 1LHUA 1D0GA 4QHBA 1AZDA 3E6CC 1SBDA 2RM23 3ELNA 5FCCA 3CO2A 4BA6A 3CLPA 5DDJ3 4K7JA 4QQLA 2B5HA 4UXAA 1UZZA 5IK4A 1ENXA 1PIV3 1REEA 2RMU1 1T6GC 4QU2A 2ZAHA 2R6QA 4RR3C 2MEV1 3HQXA 5KBFA 4NWVA 1VBA3 1RUJ3 2NP0A 2OVUA 3NKTA 1RUF2 3KT1A 2N7GA 4BQ1A 2GH8A 3KCXA 3OYWA 4H14A 5A3MA 3N7KA 1MS3A 1VRH3 3OY8B 2VNRA 3WCSA 1C5IA 1KJRA 2GALA 1VBA1 1LENA 4F7ZA 4HN0A 1CD3G 4JGZC 3ZFFA 1R1A3 1HRV1 1K5MB 5HI0A 2PHDA 4RFT0 2F6BA 5D8AA 1C57A 1S0EA 2O8OA 4XJ9A 3QH7A 3MFCA 1R1A1 4NWWA 4YG6A 1W6OA 4JV4A 3UKNA 5ACA3 2IXHA 4DNYA 1RUOA 2QQPA 2HWD3 2O1QA 5FLHA 2GU9A 1WW6A 2VPVA 4QPGA 2ZHMA 1AL22 4IEWA 1FOD3 1KRIA 1PK6C 4LLFA 2EALA 2BVBA 3ZN5A 3USSA 2WZR3 4OULA 4YZ5A 1OOPB 1J3PA