3MIDA

Oxidized (cu2+) peptidylglycine alpha-hydroxylating monooxygenase (phm) with bound azide obtained by soaking (100mm nan3)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
311
structure length
311
Chain Sequence
NECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-glycine alpha-amidating monooxygenase
publication title Differential Reactivity Between the Two Copper Sites of Peptidylglycine alpha-Hydroxylating Monooxygenase (PHM)
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 62
structure length 311
sequence length 311
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 2010-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3midA02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 3midA01
1PGSA 3MIFA 1OPMA 3MLJA 4QHBA 3MLLA 3PMSA 1PNGA 1YJKA 3KS7A 3MIHA 1YI9A 1YIPA 3MICA 3PHMA 4R4ZA 4R4XA 3MIGA 3MIDA 3MLKA 1SDWA 1YJLA 3MIBA 1PNFA 4E4ZA 1PHMA 3MIEA
chains in the Genus database with same CATH superfamily
2X29A 1POV0 1YQ5A 3E6BA 3LA2A 3NAPC 4K7JA 3N7MA 1ZBA2 2VZTA 5FJHA 4CCDA 4CDWA 2ZHMA 3SISA 4CEWA 1AR81 2FDJA 2YC4A 2WNEA 1H0BA 3B7MA 1REFA 4DEQA 5JSRA 3OOXA 4TYSA 3OBAA 1S0FA 5FK7A 5F7UA 2I74A 4I02A 2R32A 4L11A 1RIRA 3PHMA 4QQLA 2V4AA 1OUXA 1NQDA 3HPNA 4Q0PA 5LY1A 1D0GA 5L7OA 3IDBB 4H3WA 4QPGC 3EXUA 1W2AX 1SCRA 1HKDA 2WDBA 5JUVA 1WBFA 3I2OA 2JB4A 4C1WA 3LQCA 3ETQA 4CCKA 3ZPOA 5DUWA 1K5MC 1WLCA 1HRV3 1ZRIA 5L7OB 2OZ6A 1W9WA 2FDIA 1R64A 5FOBB 1HXS2 2A71A 3ZR6A 4P9IA 4NHXA 3B9IA 2QKDA 2W1WA 2XLAA 3T4VA 1RUH2 4QPIB 1DIWA 1NUKA 1QEXA 3WG2A 2Q5TA 4OUSA 1VE0A 1DCSA 1VRBA 2O8OA 1G9CA 4E2QA 5IVVA 3ZFFC 2HWB1 2HKXA 3M1HA 1OA4A 1Q43A 2XJSA 4FFFA 2ZEWA 2BBAA 4PIXA 4S2FA 2VMIA 3FMGA 5B4XA 3H0OA 4F8AA 1AYM3 2NLRA 2TNFA 3GHNA 3PLQA 2VW2A 3USUA 4CUBA 1Y9GA 5CA6A 4DUXA 3K3NA 2B7YA 2G4IA 2P2KA 2WO7A 1TG7A 2D3RA 3U10A 4NHKA 3VDDA 3S0MA 2F6BA 2H6BA 4K1ZA 1W6NB 5FYYA 3USUB 2VNRA 1RUE3 3H3UA 4CTEA 2GC3A 1IPKA 2VCBA 1SZBA 5FR3A 4H7MA 4LE4A 2VMHA 2MEV2 1JBCA 4OQ9A 1GNZA 2ZACA 4G9SB 3LOIA 3FJSA 4PI0A 1W9TA 4FI9A 4R4XA 2IXJA 3MDPA 2WLPA 4OUMA 1OD3A 1TE1B 1V6MA 1XE0A 4F83A 3I59A 3HN3A 1OLRA 2GC1A 4FVVA 3C7HA 1ZBE2 4XMAA 5JVVA 4NIHA 4IV3C 5FZ6A 4LEJA 4XHBA 1O8PA 2WNUC 5DPNA 1NE4A 1UU5A 2Y34A 3IKWA 4HBNA 2NQYA 5FY9A 4QHBA 1V9U2 2IVIB 3ZSMA 3POEA 3UT0A 4Y5Z0 1ZA4A 4GWMA 4XJUA 3WX5A 5F9TA 5DZEA 3OF1A 4XFIA 4PIYA 5FPAA 1VBC3 4HL0A 3JQXA 3LA7A 4HK8A 5CNAA 4E4DX 2IWGB 4MYEA 3LCPA 4P9LA 1NLQA 3GJBA 3UNPA 5C3OA 4ZXEA 4CDQA 3AP5A 4IESA 3I2FA 3AKPA 2CWSA 2VQAA 1BK0A 4HSJA 2OQ7A 1I6XA 2ZEZA 5LRSA 4CPBA 4GQ7A 1A34A 3LSDA 4E27A 1AL23 5T54A 2JDUA 1NZIA 3CJIC 4XJ8A 1RVF1 4XFGA 1YFYA 4Z92B 1L7RA 2VXRA 2XKOA 2HJIA 1JZ2A 2YBKA 2XVKA 5ISLA 4PQQA 2Q8EA 2OW4A 2Q0AA 2RJKA 3SCHA 1W6QB 5A6QA 1HN1A 1DGWA 2VZPA 3HNYM 4L0PA 3HMYA 3TWIA 5BNNA 1D4M1 1YEWA 1VALA 1NA1C 2GSYA 2FD8A 4TSVA 3ZYPA 1RUG2 3KSCA 1XNKA 5LW9A 1ODNA 3HWJA 1QOSA 3I2IA 2R072 2BUKA 4URTA 1W9FA 3VBHB 3BTYA 1YJLA 3IPVA 4XFAA 4P5YA 3ZFGA 2QQUA 1FMD3 2HWC1 1PO22 4RD7A 5BPXA 1RGSA 2WFPA 3SCFA 4GMP0 1KJRA 5C4WA 5BUVA 2EF6A 2FHRA 3IPVB 4NE9A 1S0CA 4XFHA 1CZVA 1QIQA 3S7EA 1AR91 1GANA 3ZFGB 3ACHA 3PMSA 4LA2A 4LBLA 2JEMA 4LBQB 5SV5A 1PZ7A 2E7TA 3WNMA 2CHHA 4I3PA 3T4HB 3O0XA 1MQTC 3ZN6A 3ZXGA 4QGMA 2RVAA 1EY2A 4YM1A 1AL0G 2JDPA 3DPRB 4HETA 1N3QA 3J26N 4YFWA 3VKMA 4DEVA 2CAVA 4AFDA 2JDZA 5C9AC 3GGLA 3INAA 3BODA 2EXKA 5FUPA 3BU7A 4K21A 3MLKA 1E5SA 3FBMA 3NAPA 4CCEA 4PDWA 3WNLA 4ZU7A 2ORZA 5DUUA 2HWF2 2WYSA 2ARBA 3CKHA 3K2OA 3LDBA 2HEVF 5LEKA 1RITA 3UGHA 1VAMA 1OLME 1VLNA 1UPSA 2JX9A 2PA7A 3GHMA 3T1LA 4I0AA 4KWLA 5C70A 4FPHA 1RUI2 2RR13 2YYOA 3M3IA 4LO4B 5LA1A 1LEMA 1CAVB 4R9AA 3SLIA 3WUDA 1PVC2 2A5ZA 2GC2A 4QPGA 4E8DA 4KBZA 5KHJA 4ASMB 1DGWX 3N9MA 5GZCA 5LEJA 2DVFA 4BQ1A 1LKNA 2RS13 1RHI1 3VZNA 2OVUA 3WNXA 5HPOA 2PELA 4GWJA 3GZEA 1RMU3 1R093 2WZEA 2W87A 3UGFA 4CU7A 1RUC1 3RNSA 3FHQA 2B46X 3JU9A 1K5MB 3H42B 2VBDA 4ISRA 4ZONA 4AG4A 3C7GA 4ARXA 2ZKNA 2HYKA 3W21A 1K5JA 3WQBA 4A44A 1KFXL 1WA6X 3LD8A 3POSA 2ZGLA 4IE5A 2NN8A 4K8FA 3ZFFA 3QBQA 2A6WA 4L97A 3TN91 2CL2A 4EN9B 2DF7A 4ORFA 5I0DA 4DB5A 3TNQA 5EXOA 1HRV2 3MICA 5CKNA 2LW8A 2D97A 2XWJB 2VZRA 4OCTA 1ZYBA 1FX5A 5LATA 3ZFFB 5JAXA 3H7JA 4QXCA 1NT0A 1P8JA 1UOGA 2PN5A 3ACLA 4W50A 5CZKA 3KT4A 4LTAA 2QZ2A 4HSLA 3MIEA 5HCBA 1Z7S3 5D8AC 4TTGA 1O4ZA 1IPJA 3M3CA 5F5IA 2YC0A 2NM1A 3ZXAC 1YFWA 2XH6A 3DXUA 4DZGA 4Q4V3 2P6HA 5FY4A 2DUOA 2ID4A 4WBBA 2VUCA 5TSWA 1CESA 4DY5A 5CVRA 4ET7A 1GSLA 1AYM2 2ORXA 1YQ6A 2EALA 4XUOA 1ZZCA 5E1RA 3SC7X 1OFSA 1BQPA 4Z82A 2P3JA 4PF1A 3AP7A 4FPYA 4RQPC 4XF3A 1GZCA 4EWAA 4D6QA 4BA6A 3CBNA 1OXCA 5A7SA 2BFUS 1RUE2 1YO8A 5AVPA 4E9KA 3JD73 2WNVC 1JXNA 4NROA 5FYUA 4Q0SA 5HV0A 1F5FA 1F2NA 2X8KA 5C8CC 1O3QA 4CCLA 5K4LA 4IV3B 5A3NA 1KD7A 3VD7A 1QJY1 2WNUB 3NV3A 4JCKA 2I07B 2VMDA 5IHRA 5FQ0A 4OULA 3GBGA 4K20A 4BZ4A 1X36A 4KG0A 5IK8A 1RL3A 1AZDA 3IDCB 4INDA 4IGQA 2A3WA 5FZHA 3IIAA 4QX3A 2AH2A 5C5TA 1GYKA 4JDMA 4EE2A 4DUVA 3RZHA 3PTRB 2RMU1 2VBBA 2VUDA 5LBBA 2VMCA 3GM8A 4ARYA 4QQHA 3THPA 2E53A 3BN6A 1DYPA 3H8RA 1BVP1 4D69A 1DLLA 1WMXA 2GDFA 3CJIA 4LLOA 2XDVA 2NZ9A 4N9HA 4Q4W1 5FYSA 5KXEA 4KH9A 4B4RA 3QLQA 1YWKA 3ZSJA 1VBC2 2XGXA 1QJEA 2FCTA 1MVEA 1BKZA 5BNPB 1NY72 4MHUA 2IXIA 2ARXA 3CJIB 2VQ0A 4OI1A 2D93A 3AMPA 2DUPA 2LRPA 1SLBA 2RHPA 1OI6A 2VOWA 3SMHA 3RMXA 4H14A 1H9PA 3THTA 1NA1A 3DEMA 3GZAA 2YXSA 1PM4A 2C9AA 2XQXA 1XNAA 1ENSA 2AREA 5B2GB 1GOHA 4Y1YA 5FPZA 2ZZJA 3CNAA 2Y38A 4LXLA 1UL9A 3S6PA 4UW5A 2WL1A 3UKVA 4BXSV 1W6PA 4CP2A 2W5FA 3BTXA 4I01A 5DMYA 4YM0A 5ERLA 4COVA 5CFDA 3WHUA 1TME1 1JI6A 1GZWB 2FCUA 3DECA 4U36A 5FYBA 3NVCA 1H2KA 1VBD1 5FZFA 4LO6B 2IFRA 1MQTA 2Y6FA 3LDRA 1F31A 3A0KA 3PIJA 4AVTA 1HW5A 4QQPA 1D0HA 4M4RA 1G9DA 2IFWA 4XJAA 5IAVA 3UGGA 4AHXA 1RUOA 1LOGA 4DPNA 3ITQA 1FMD2 2X05A 5A3LA 3B9CA 1YI7A 1MQTB 4KWUA 2W68A 5T3NA 4EYUA 2UYBA 5ANNA 4OHVA 1FT9A 4XBQA 1Q8VA 2AC1A 3JXSA 5KXBA 2MHFA 2XUMA 2Z69A 4MX3A 5C9AB 1IQDC 2YBSA 1LHNA 2UU8A 3VD3A 2A6XA 4CPBD 2DDUA 3NRUA 4MXWA 5LASA 3SEPA 4LBMA 1AR63 1UF2C 1MEC3 5IVCA 1QHDA 1VAKA 1F5JA 4S2HA 5FZOA 2YY1A 1WCQA 2KXLA 3OGGA 4DXTA 5C71A 3MLJA 1XYPA 4AI3A 5SV8A 3AVRA 3KCCA 4QDQA 2DYCA 3WP5A 3VD9A 4LBNA 2PHUA 1FAYA 2D5HA 2X5IC 1DGRN 1X9PA 5IK4A 4FAHA 3Q8CA 5FZOB 5BXXA 1IPSA 2SLIA 1B09A 3PVBB 4U2AA 1DP0A 4N7IA 3EMRA 2CTVA 4CUGA 4I3GA 1R1A3 3ZIXA 2C6SA 4GWIA 3C7FA 4AI2A 1Y3TA 4MXVA 3RZLA 1V6KA 4WV8A 3ZMOA 3KCXA 4R9CA 1HRI3 4ATFA 1TMF1 2WFF2 2RR12 4RGKA 3M70A 4YG6A 4FXGB 4I2OA 5IWFA 1JZ4A 4OHXA 1QKQA 1UAIA 1SLTA 2F17A 3CU7A 4AF9A 1XSRA 4QU1A 3EQEA 1FOD1 3KD4A 3F95A 1CZSA 3HN1A 4LULA 3UJQA 3H8OA 2RS12 4V1PA 3R0RA 4UFLA 2F4PA 1W28A 4BB3A 1RMU2 1R092 3O1PA 2QQNA 2J1UA 1W3VA 2AUYA 4WVMA 5FYTA 2P1BA 2EXHA 2QQVA 2B45X 3WSOA 1CIYA 1SLLA 4NR1A 5EWSA 2VM9A 3VB9A 4D7TA 4WVMB 4PT6A 2R30A 4YM2A 2Q8CA 5KHKA 3FLPA 1DF0A 4UFKA 3WP3A 2P3IA 1CD3G 1OFNA 5A33B 5AFBA 4IE4A 4P5HA 3J8F3 1LCLA 2JD4A 2QE3A 5EHDA 4FFGA 4B4QA 5D8AB 1YRZA 1LENA 1OPMA 1W03A 3I3EA 3ACFA 4ZY9A 3ES1A 1H1MA 4TLFA 4AI9A 2ADDA 1OURA 1G6NA 1QJU3 2IXCA 4RQPA 3ZYGA 5BY5A 3MFCA 2R6QA 3KS7A 1QH7A 1X8MA 1Q8SA 5JOXA 1Z7S2 4KQ7A 3I3DA 5GLWA 5A7WA 2WNVA 2A7AA 1URXA 2X10A 2HEWF 2JG9C 3FBYA 1NQJA 3FE5A 4RQPB 3SH4A 3MBWA 3LFIA 3VL9A 4AFCA 1YYNA 4Q4V2 1XPWA 3M3QA 1HV0A 4LNVA 3HT2A 1COV3 4ZS2A 2WNVB 5BNOA 2RM21 4OMDA 5C8CB 1LODA 2VULA 4ZHNA 4LK6A 1QJZA 2YBPA 3WNOA 1YQ2A 4FP2A 1K42A 1SDDB 4UFIA 1B35C 1ZZ7A 3ZDVA 4D3WA 3JD72 4BLJA 1JMUB 1MZ5A 1UU4A 4Y20A 2JE7A 3C7OA 2D6PA 4PBOA 4GJZA 3F2ZA 3K75B 3QCWA 1FPN3 4HANA 1XU2A 4S2DA 2N7GA 3MIGA 2WZPP 1XBFA 2R063 3N35A 1ASJ1 1LECA 2W2IA 4QT6A 4G4FA 1YC61 2PMWB 4COWA 4EWDA 3X29B 1NCRA 1FYUA 3EBRA 2V09A 4R52A 4Q4Y1 5EFUA 2UY9A 3KF5A 4AVCA 3O1TA 1BEV2 1RINA 4C90A 3OCPA 1QXJA 2WZ8A 3H50A 1UQXA 1BMV2 4LBKA 3J4UH 3TRSB 4WZCA 3AXDA 1OKOA 1I5PA 3CLPA 5KXDA 4IETA 1TEIA 1F9KA 1S55A 1UNBA 2PHLA 3AP9A 5F1RA 1OQ1A 2UYAA 1QJX3 1DQ0A 2WWJA 4M3CF 5J98B 4LBOA 3HVDA 5A7QA 4Y3OA 3LFMA 3WD5A 4NJ4A 3SH3A 1YHFA 5FMBA 1Z0HA 4QX1A 4DNYA 2YFZA 4XFCA 3HBZA 5JLVA 3I2GA 3WINE 3I3BA 2BV4A 3NV4A 3SITA 1F8VA 4BWOA 2MNGA 3KF3A 3VKLA 4BQXA 1WMFA 1W2OA 2NP0A 1EPWA 2WT1A 2CGNA 2YMZA 4YGCA 1QJFA 2O8QA 5FZ9A 2W1QA 4Y4RA 1W0OA 1AXYA 1ONAA 4J1WA 1O3TA 3AJZA 5DDJ3 1VJ2A 3H9AA 2WWUA 2OPWA 2O0OA 4LORA 4B8EA 4PHZA 4IEUA 4DQAA 5A1AA 3V64A 3GBWA 5FXWA 3IT8A 1GR3A 3AC0A 1K3IA 1CZTA 4KI5M 2JWPA 3BGAA 4V2WA 3BPSA 5DABA 1WMDA 4B7KA 2UWBA 3ZSKA 4QX5A 4MUVA 3LSEA 1VBA3 1V6OA 1K12A 4AOCA 4BXFA 1BXHA 2WUHA 3I7DA 2YC2A 2WYFA 2X5IA 4C0BA 1NLRA 4YPJA 2I2SA 3IIIA 3WG4A 1I5ZA 5FO8B 3D0JA 2BFUL 2X5IB 3AJYA 1XE7A 2KA3A 1PZ9A 1MEC2 2YU1A 2BOJA 4QQOA 1AR62 3GDBA 4HVRA 3ALQA 3LPGA 4RS5C 3T09A 4A7KA 2BTVC 3WV6A 4YW4A 1WZXA 3M4FA 4FXKB 2C9KA 1LJ7A 1ZRRA 2ILMA 3B93A 2OXBA 4IEVA 1GQPA 1YNAA 2Y60A 3NJXA 1GOFA 4LKEA 3ZKUA 1IS4A 4DUWA 3KCYA 3QD6A 1R1A2 1MR5A 1Y43B 3O1UA 1X9TA 1XNBA 2C24A 4CU8A 3VZLA 1PIV3 3BOPA 4M3CE 5T50A 1HRI2 3WNPA 4A7ZA 2RS33 1SLCA 4I30A 2YDEA 5CADA 1UIJA 3VDCA 4OHYA 1POV1 2ZGNA 3PVNA 3ASIA 4FCAA 4UI9L 1J3RA 5IVYA 1MS9A 4PI2A 3MFAA 1PO21 1N3OA 4J25A 2VMGA 1UMIA 2YFUA 1HQLA 2IXLA 5E88A 3WHTA 1F15A 1CVNA 1OD5A 2WS91 1AR73 3PUSA 5CKMA 2VZ1A 4XACA 3TYJA 4WM7C 4LHSA 5C5UA 2XJVA 3V65A 3VKNA 2BWCA 1ZRCA 3PUIA 4JKLA 4FBFA 1VBE1 4QGLA 3KVAA 2P34A 4UBHA 3VZKA 3AKSA 2Y6KA 3ZXLA 5F5QA 4EN0A 2TBVA 3J8F2 2XLFA 1NG0A 5A3PA 5EIYB 1JYNA 2AYHA 2ZHKA 2HWE3 2JG9B 3RGBA 2WBKA 1Q3EA 2W1SA 2LROA 5IVEA 1U5YA 5HXMA 5JSPA 3T1MA 1BBT2 2EICA 1YIFA 3KMHA 1YQ8A 1QJU2 1I3HA 2ZXQA 2LALA 5T52A 4E4ZA 1B35A 4CCMA 1VB4A 1UY3A 5CG8A 1PMIA 1W2TA 4JKMA 3AFGA 1W9YA 2QZ3A 2NPIA 4Q26A 4FAGA 5CEHA 3LA3A 5KHHA 1ACCA 3TOJA 3WW2A 5GLTA 5IVFA 3WZ1A 1B35B 4AI0A 3NNLA 2OUJA 2ZTNA 1J84A 2RS51 4NHMA 2XJQA 5IATA 3ZN5A 2GH2A 5LBFA 1CQ9A 3UYJA 1GKBA 3UK9A 2WZR1 1OOPC 3H8XA 4CA9A 1JODA 2GMMA 3L2YA 2FMYA 2PTMA 2YG0A 2NYYA 4B29A 2X53S 2G9FA 2KD7A 1JW6A 1AR83 2R1BA 3FC0A 2XPJA 1C1LA 1HIXA 1PO11 3AMQA 3TEZA 1GQGA 1QF3A 3ON7A 3EO6A 2Y6LA 4HVOA 3KLSA 3U37A 1CGPA 3OJBA 4CCOA 4I09A 3VUOA 4KL1A 1DQ6A 1LOFC 5ANQA 3ZXDA 1FPN2 1US3A 5I0UA 4IEQA 4QPIA 3OYWB 2G9ZA 2RG4A 2R062 5I8SA 1ZREA 1UY2A 3VHNA 3LDKA 4M3CB 3E5UA 4UW6A 4YZ5A 2BWAA 3AFKA 1LRHA 4RHV1 3NJYA 4FPFA 5BYNA 3N9QA 4JTNA 4META 5FY7A 5AC91 3J7HA 5K9YA 1ZM1A 2BP6A 4O61A 1GICA 4OQ8A 1K45A 5FRAA 4A45A 4QXBA 2J1AA 3MIDA 1QOTA 1IKPA 3L9JT 2F4LA 1UZ0A 1H30A 4E4HA 2ARCA 1CAXB 5FFOC 5D2AA 1W6NA 5FP7A 4LJHA 1JTZX 1LOAA 2OX0A 2HWD1 4HKOA 4RHV3 2BGPA 3I97A 4ISQA 5IT6A 1QJX2 1RUF1 2GN3A 4NWWA 1NZCA 4MVTA 2VJXA 5FZ4A 4CDUC 1QDCA 2YV8A 5IVBA 2HWB3 2DCTA 1PNGA 1DLCA 1N47A 1J3QA 1BYHA 1NXD1 3HOBA 4XCAA 5FXZA 1WD4A 3USSA 3ZYFA 1J59A 4AFMA 2JB8A 2XB6C 2C4XA 2HBUA 5FYVA 3NL1A 4XXPA 5JZGC 1XC6A 3MGUA 1H4GA 5ABJC 3A23A 2K0GA 1IKQA 1Y9MA 1Y7BA 4XPVA 4WM8B 2W47A 4FT8A 2BNMA 4GA9A 3RJRA 1MACA 5IK7A 5DDJ2 2VL4A 2ZBJA 3KV6A 3PU8A 4NAMA 4ITCA 3EJKA 1BLZA 4UF0A 5JSOA 3N9LA 1PGL2 2LTNA 3WQ7A 2Y8KA 3GALA 3VBSC 3KT1A 4YZ2A 5JXGA 2DUQA 4N90A 5FZIA 2E26A 3H3LA 1UWWA 2ET7A 5K0UC 4UF0B 2VVFA 1UYZA 1OF4A 3ECQA 2EXJA 4RS5A 3AL5A 3PURA 4A3XA 1GV9A 5A32A 2WT0A 4GB31 1HB4A 4IXLA 4UYBA 4Y1ZA 5F32A 1VBA2 3GYDA 1KRIA 4KBBA 1YIPA 1DQ5A 4NIDA 4NAOA 4RS5B 1WCUA 4GMP1 4BK4A 1Q8QA 3H7YA 5A32B 1AX2A 1FNYA 2A73B 2OZJA 1UKGA 3MIBA 1WGPA 1SACA 1JYCA 4A42A 3G6JB 4CP1A 4YWAA 5BNPC 1SG3A 4ASKA 3VDBA 3RYKA 5KBFA 1W6QA 2VPVA 1SCSA 2VD7A 1RXFA 4XDPA 2G9GA 4HONA 1JOBA 2TUNA 4LIVA 4BYYA 5KC5A 2J7MA 4YG0A 4UT5A 4XUTA 3WNKA 1BJQA 4AWDA 3LOBA 4LT5A 4O9GA 2QDNA 3AL6A 3VBHA 1CPMA 4I0WB 4Q4X1 1JHNA 5DAXA 4X6RB 1H8VA 1RVF3 4QKDA 3RWNA 2WLQA 4NHLA 4NRQA 4C91A 1PIV2 4AGGA 4WM7A 5JMOA 4BQYA 1H2NA 2RS32 2Y6JA 5I91A 1HN0A 2OA2A 1PGW1 5E6HA 1EV11 5G04L 2Q1ZB 4XFBA 3WF1A 4LBQA 2D43A 4WM7B 4Y5TA 3VBFC 1T6GC 3SHRA 4AAXA 1D4M3 3NKTA 4NUBA 4HLTA 1WCSA 3D3AA 3ZM8A 2BDRA 1MS3A 2XLGA 2CV6A 3GZTB 4NOTA 4CCJA 3DPRA 3WY6A 1O4YA 4XZPA 5FMCA 1HV1A 2JIGA 2LUWA 3OGRA 4PLNA 1AR72 1DYKA 1PX3A 2HWC3 1HX6A 4YW7A 2IXKA 3ZFEB 4AQTA 4OZOA 4DS0A 2FDKA 2PQQA 3W58A 1AR93 5L73A 2XMLA 5LY2A 3FFZA 5JI9A 2CSGA 3W20A 2PAMA 3K51A 1W6MB 3ZSLA 4X6QB 1VBB1 4KU7A 3WF0A 1LHUA 3VBUC 3WF3A 1YFUA 2WO3A 5G05L 5H9QA 2XHNA 2HWE2 2ZGTA 1ENXA 4GD4A 2CYFA 5FZMA 1CAVA 1AYN1 4DXSA 3BI3A 1AHSA 3I4IA 1W8OA 3GCXA 5FXXA 3VL8A 3WQ1A 4YZ1A 1QQP1 3C3VA 4XDQA 2DU0A 4FOWA 3FLTA 5GZFA 4AVBA 1OOPB 5A1FA 4CZSA 1X50A 2ATFA 4N53C 4N43C 5A1LA 2WFF1 4Z1VA 3CF6E 1JZ5A 2GN7A 2ZX4A 3RWKX 2GP3A 1LOFA 1GWLA 1K5MA 2IC1A 4NPRA 2YU2A 4I0BA 2JDNA 5F3GA 3C8XA 5JCTA 2PLV1 5A80A 1G8WA 3DUIA 1LAJA 1KXGA 4CXXA 1ENQA 2VH9A 3AMHA 5BV6A 1VRH1 4LO5B 4FTSA 1OA3A 2VZ3A 2TEPA 2JE8A 1L3JA 1LU2A 1J1TA 2FDHA 1AR82 1DQ4A 2ZHLA 5KR7A 3MHZA 1POQA 1RHI3 2SBAA 4LUKA 1FATA 5HXVA 1RUD1 3LGRA 2R1DA 1RUC3 2RE9A 5IK5A 2ZGRA 3M7AA 2QQOA 4K40A 1SDWA 3VHPA 4DRVA 5CFCC 5JMCA 1RUJ1 2P37A 3W5MA 4QDRA 3CJXA 2ZGOA 3TN93 4E2SA 1KDMA 5FY1A 3RFRA 4BJ0A 4IEWA 4OI0A 5DAPA 1GWKA 1QNYA 4CDUB 1BZWA 1V6JA 3ZIWA 1NCQC 2VY0A 2WWSA 5CU1A 4XAEA 2QBXA 5BNQA 1V6LA 2DBNA 2BEOA 4GWNA 4PQ9A 4UWDA 5ABJA 1LULA 1WWYA 3ORJA 4M0NA 2ZGSA 4AW7A 1ZX5A 2VOKA 5JZGB 2AENA 3AB0A 1FXZA 3HIFA 5ABJB 2Y0OA 4Y22B 3WUCA 2HWB2 4CVUA 4RR3C 4IV3A 1N1TA 3IWZA 2IVJA 2FCVA 2WNUA 4QB2A 2ERFA 3M3OA 1CWPA 1ND3C 3SXWA 4IV1C 1OLMA 1O7FA 4CEYC 3FLRA 4JTOA 3MI8A 3HR9A 3PVEA 3VBSB 3P5BA 5LWBA 5FMDA 1UY4A 4YRDA 1IG3A 4IGPA 5K0UB 4UW4A 3ABZA 2DCKA 3FFQA 3J7NA 2C0ZA 4H55A 3R4SA 1NE6A 2D7FA 5EPAA 4LOSA 3K4ZA 2OYZA 2VTXA 3WF4A 2ENRA 2D6OX 5FZ8A 5J3UA 2FQPA 5CKQA 5FDBA 2Q1FA 3OBRA 2PHDA 1QJY3 4HG6B 3RZMA 1C3HA 2CAUA 1OLQA 5BNPA 1MVQA 2ZGMA 4UFJA 3LPFA 5C8WA 5EQUA 2P4EA 3T0DA 1PK6C 2VZVA 5FY0A 1WW7A 4OHZA 2BU9A 5CB7A 3WDTA 2JDAA 1BEV1 2WAOA 4KMQA 1JYTA 1QOOA 2RMU3 3I3MA 3GCWA 2UY8A 4Z8BA 4EZHA 4GH4B 5J48A 4Q4W3 3H1YA 3NJVA 1LOBA 4BQ2A 2QDRA 1D7PM 2XBO1 1HB2A 1AL22 2Z4FA 4BQ5A 5GZEA 3MO4A 3IDAA 4XBLA 5FUNA 5GKAC 1GZWA 4M0HA 3JQWA 1ZRDA 1UZWA 1ZZ8A 2ZAAA 5DAVA 3DYOA 5CG9A 3B94A 2V5DA 1CJPA 3AZWA 4JZRA 5FZLA 1FV2A 3E5XA 3IAPA 3I2HA 4NRMA 1IHMA 5GLUA 2NMOA 3AK0A 3VBFB 4FQ4A 2QQMA 2NMNA 5KWRA 1MS1A 2ZGUA 5KHGA 3O0WA 1YJKA 3AKQA 1KFUL 4Q8LA 4Y33A 1VMJA 4P00B 1SFYA 1R081 2EIEA 2YROA 5C9AA 1Z78A 3W59A 4OUEA 1TME3 4CP9B 2AEYA 1D4M2 1W8WA 2WN3A 1KEXA 1EUTA 2E51A 3FHIB 4EN7B 1VBD3 2D6MA 4C0HA 4D8MA 3RS6A 4XQDA 5FOJB 4B1LA 1CAWB 1RB8G 3GXUA 2XJPA 1XNDA 4MGSA 4AHZA 4OYUA 5FO9B 2XONA 3CMGA 3PUAA 2HWC2 3GF6A 4YVSC 5F6LB 5FIXA 3VBUB 1APNA 2IXHA 3MF9A 4NRPA 1QY4A 3ZPYA 5FPVA 1F35A 2AACA 2QVSB 3OBZA 4K8RB 1AR92 4MHRA 3RPQA 3WDXA 4FSJA 1Q5OA 1RUNA 3CHXA 2GMEA 4QX8A 3N9PA 5JOZA 2E6VA 3A7QA 3B69A 4Q0VA 5LK5A 4YYOA 3OGJA 2ZGPA 3JBG1 4N53B 4N43B 4EZ4A 1GMMA 4AEJA 5ACA1 3FWEA 4A2UA 4BH9A 2YPJA 1OF3A 4ATEA 4N9IA 5KHIA 4YFZA 2Y64A 5JWPA 3S5AA 1A3KA 2ARAA 1SEFA 2WSVA 5FZGA 4LQRA 2Q4SA 1H4HA 1S0DA 4JC1A 4Z07A 4CXYA 3RZJA 4ZU4A 1YCIA 1DDLA 3CDZB 3VBRC 1IS5A 3QH7A 3VN4A 4XQWA 1EAH1 1UYYA 1W0PA 2HH9A 2R041 3NKGA 1OQEA 2A6YA 1MZFA 4RYDA 3LIHA 3B3QE 4XUNA 4QD2A 4ZXKA 1TMF3 1GLHA 2Z2SB 4CCNA 5DUVA 4G3YC 1L7QA 4HKWA 5CFCA 5FYMA 1UOFA 3J7LA 2ZMNA 5A33A 3AZZA 3W9AA 1JN2P 2DFCA 2PAEA 2YGMA 5FWEA 4Q5OA 1FOD3 5D8AA 3RZKA 5CFCB 2XJTA 5J37A 1RHI2 2B42B 2E7QA 3T0AA 1NCQA 1LR5A 3MW3A 4KU8A 4NHYA 2RDNA 4NO4A 1RUC2 3WEZA 2FZ2A 3POIA 3I2KA 4JHZA 4P14A 4EQVA 1NCQB 2W9XA 2VTFA 2RDRA 4P02B 4QHZA 3RQ0A 1ULOA 1W05A 4AHYA 1GP6A 1JYWA 4DFSA 4BMBA 4GAZA 2WO2A 2VGDA 4RR3A 4MLOA 5FTTC 4NPLA 1C8M1 3TN92 5LK7B 2VMEA 2WA4A 1UMHA 1UN1A 2UURA 1H6XA 2O14A 4MGQA 5EP9A 1BBT1 2A3YA 2UWCA 5DXDA 4IV1A 4CEYA 5A7OA 5C8CA 4RR3B 2OT7A 2CY6A 4BHPA 3THDA 1DYOA 3POWA 5L9RA 3NNFA 2ZGKA 1ND3B 1DGRA 4IV1B 4CEYB 1S0IA 1ZBA1 1ALYA 1JS9A 1OVSA 2G19A 1UO9A 1W06A 4CDXC 1WUVA 4GULA 4YW1A 1XOYA 4AYUA 4NIGA 2B8MA 1KS4A 2GNBA 4IEPA 4W8JA 4UW3A 5DAWA 1J3PA 2XXZA 4LO8A 3A4UA 4B7EA 1G9AA 3LE0A 2ES3A 2RV9A 3WG3A 2K9ZA 1W6OB 2AZ5A 4UFMA 1GZ9A 1VR3A 2J1TA 1US2A 1OUSA 1ZZBA 1ZBA3 2RM23 2EXIA 2VW1A 3FHAA 5FK8A 2D6NA 1PK6A 1PM7A 3K77A 1EPZA 3LF7A 4IEYA 5EV7A 3ZKYA 3ZLIA 4XVHA 3BKZA 3FZ3A 3BALA 3ACGA 5FZDA 2A6VA 2DCZA 4QM9A 1PHMA 1OPOA 1PK6B 1V6IA 5DN2A 2E31A 4E2GA 1S0EA 5C3SA 3LZZA 5D1IA 4CU6A 5C33A 1HXS1 4QDSA 1ENRA 4XF4A 3D8CA 3AYAA 1LOCA 1QJY2 4LLFA 5FYHA 2VW0A 4QX2A 1KDKA 3ROUA 1RUH1 2ZX2A 3VZOA 4PLOA 2BRTA 3DF0A 2VQUA 4CDWC 2Q8OA 4CEWC 1ASJ3 1NLSA 4XC9A 1X8EA 1RC6A 4NPMA 1WLWA 1I1EA 3CQOA 4L9BA 5FZKA 4LITA 3O1SA 2RMU2 3ACIA 2D3PA 3DXTA 5FMOS 5HBAA 4BPZA 4Q4Y3 3R05A 4AFBA 3WP6A 3N36A 5I0SA 3ILRA 2PFWA 2ZJCA 1FV3A 4LBQD 4Q4W2 5FZEA 5AFEA 1W2NA 4HXCA 4TXWA 1DZQA 2PHTA 2Y26A 4Z2WA 1H2MA 3FN9A 5LBEA 1VAVA 1XNCA 2DWRA 3VZJA 4CU9A 1XYOA 3PNAA 5F6KA 1IGOA 2DURA 5T5PA 3PU3A 4M4PA 3B00A 2BZDA 1UX7A 2MEV1 1E5RA 4RGAA 4YLZA 4FOVA 5F39A 4K9SA 3O1VA 4MG2A 1AX1A 1AJKA 3N9NA 4JDOA 5JR7B 4BIFA 1SLAA 3OPZA 4R4ZA 1CAUA 3V0BB 2VTXJ 1GU3A 1W8HA 1UOJA 3HQXA 5CIRA 3ZVXA 4WM8C 1WD3A 2RJ2A 1ZBE1 2W1UA 4E4SA 4QGNA 4XYXA 4YVSA 4YG3A 1CAUB 2I45A 1VP6A 2WIIB 2JIJA 4HN0A 1TME2 4QXKA 1V9U1 2AR6A 4MZUA 4YW5A 3E5QA 3Q8FA 4YVSB 3WDVA 1WW4A 1O8SA 2A3XA 2ETEA 4TWTA 3WCRA 3WDYA 1VBD2 4MGKE 2J1EA 3VDDC 3AM2A 4WVWA 4MGYE 4AVSA 3KHCA 2OQ6A 3NW4A 1CJDA 3POFA 3UKNA 3J7MA 4FTEA 2WJSA 3AZVA 4AR2A 5A3UA 4A4AA 1YI9A 2XQRA 2E63A 1HB3A 2E32A 4KGGA 5DZFA 3WW1A 3Q8EA 4LO7A 4Y24A 3T2PA 3N9OA 3NV1A 2A6ZA 3MEPA 1U12A 1ZNPA 1C4RA 2XL7A 4N7UA 1XB9A 1AX0A 1UCXA 1XU1A 1S2KA 3OD4A 3VBRA 4AZZA 5EJZB 2VG9A 1STMA 1IS3A 2VNVA 3CIHA 3HBKA 3VBRB 1QDOA 3HQRA 4QM8A 4JX0A 5IAXA 2JE9A 4UAPA 1XQNA 1XXNA 5A6YA 3SNMA 4EV0A 1RJ7A 4AVVA 4XBNA 1SMVA 3LEKA 4LK7A 1JZ8A 1RUG1 2J1SA 2P5BA 4BQ4A 5FZ7A 4COZA 4YARA 1S0BA 2R071 3MZHA 5JPMB 3UETA 4XIKA 2XJRA 3PVOA 1LHWA 2UWAA 4LOTA 1SHWB 1TMF2 3OTFA 3ILNA 1IZ3A 3T0BA 1OKQA 1CN1A 1G86A 5E89A 1HJGA 1LGCA 2PHRA 4XJWA 2WKKA 1UIKA 4FPCA 3AZYA 3EYPA 1POV3 4MADA 4QX7A 2VR4A 4LBJA 4YW2A 1CX1A 1O59A 5K8SA 4XF9A 1PO23 4Z2AA 5HCAA 2JG9A 2ZX1A 3E6CC 3BU0A 2CGOA 2VMFA 4HZFA 3T2OA 3V56A 1OVPA 1TNFA 4B4PA 2WS93 5J1XA 5JXJA 2H0VA 4OMCA 3ZFEC 4UXAA 2DTWA 3EHKA 4DO0A 4XUQA 5BNNC 2XWBB 4DINB 3ZYJB 1MS5A 3N3HA 2HWF1 2D3SA 4V2VA 5I93A 1VIWB 4AGRA 4CDXA 1VBE3 3U11A 1UMZA 2WNOA 3N7JA 3HNBM 4IEXA 4BU2A 1D2SA 3ZYRA 3DYMA 5JOYA 2Y6HA 4CDXB 2LS6A 3DCQA 1RUI1 4N8MA 5A3WA 2BVVA 1HLCA 5C4WC 2Q1MA 2D44A 3WDWA 1J83A 4SBVA 4AVAA 1PVC1 2DVDA 4O9EA 1COV2 1PVXA 1G7YA 4JKKA 4QQ2A 4HPKB 1F4AA 1NXMA 3C7EA 4XABA 3I3QA 4Q8KA 1LNSA 2CWMA 3LEGA 3GBFA 2EAAA 4XXAA 3BCWA 3M3EA 4K6BA 3VHRA 4LIUA 2W0XA 2VCCA 4D6RA 2BYVE 1DFQA 1PNFA 2YB7A 4FFIA 2P6CA 1KJLA 5HCFA 2IZWA 2RS53 3OYWA 2RJLA 4L99A 4TN7A 4QU2A 2DVGA 4YZ4A 3ZX7A 2ZAHA 4GXLA 2RM22 5JIAA 1ST8A 4PDWC 4OLLA 2BNNA 1BHGA 4HOOA 4M3CA 3TEYA 2WZR3 4IL7A 1GNHA 1VB2A 5H9SA 4BIOA 4XW3A 1JOPA 5FP8A 2J22A 4RN5A 3L2HA 3FX3A 4CDWB 1W8NA 1HRV1 1OMIA 4CEWB 3VBOC 1PO13 4YSFA 4LHKA 2VNOA 3ME2A 4MV2A 1SBEA 5DG1A 1CAXA 1LB2A 4X8NA 2VXJA 2FBEA 3TB0A 4H2AA 2OPKA 2VCAA 4MGIE 3WQ0A 3OUHA 2GAUA 2P17A 4XAAA 4JQRA 3JB8A 1H8TC 2HYXA 1ASJ2 2JKXA 4NVPA 2EVXA 1L7LA 4S2GA 4M01A 1JU4A 3ES4A 3AKRA 2ZCWA 3HQUA 3D4KA 1F4HA 2XVGA 5FZ0A 3Q8AA 5AC93 1A78A 3SQOA 2JDKA 4Q4Y2 3VKFC 2BVBA 3QOPA 5IVJA 1AYM1 5EJ3A 5F2WA 4Q2FA 4COYA 4A7YA 4GZ9A 4UBGA 1U5ZA 3AYEA 5M0TA 4L2NA 3APBA 4ZS3A 2BPA2 4WM8A 1MPXA 3WVJA 5IYYA 1RXGA 3J9SA 2P3KA 3LWCA 2HWD3 2J1VA 2DTYA 4QKBA 1DHKB 3KVBA 1RUE1 3KT7A 2PAKA 1N1YA 1RUF3 2B9VA 3ZMNA 4XJ9A 3W5NA 3WW4A 4Q29A 1R1ZA 5FCCA 3ZXFA 5J96B 1D4VB 5FP4A 3RRDA 3ZYIB 2WQ8A 5LCWL 1JYXA 3I2JA 3U4XA 1IOAA 2G1MA 5LRRA 3U14A 2FZ1A 2HLEA 3VV1A 1UD1A 4XF1A 3I54A 4COUA 4RL7A 5FZ1A 1EYBA 3P6BA 4XZUG 1JUHA 1ZZ9A 4Q1RA 3VDDB 4Q0UA 1AJOA 2XHKA 4Y1UA 2JDMA 4P08A 3UV9A 2WN2A 4XUPA 5GM0A 4QAWA 2J1RA 4FPEA 3P1IA 4LKFA 2W91A 2JD9A 5F3EA 1MS4A 1OH3A 4CSWA 4GKXA 1Q56A 4E8CA 4EROA 3Q8BA 3ATGA 1VBC1 4IDZA 4JRAA 1REDA 4CUCA 5FYIA 4PF5A 1NY71 2VNGA 2GU9A 2HBTA 2XUEA 2D98A 3I59B 4GB33 1S4CA 1CX4A 2VE1A 2PXJA 5LBCA 3VLBB 4Y4YA 3C2UA 4BCUA 3N7LA 1Y9QA 2D40A 3OEBA 1LTEA 2E7AA 1NKGA 2W92A 2WRAA 4GMP3 4LE3A 2QUOA 4LKDA 4YGEA 4JQTA 4HK9A 1AL21 4GH4C 3OEAA 2ZKLA 1V0AA 4F3JA 3OGVA 1RYYA 4BQWA 1OBNA 1RJ8A 2ZHNA 4TZDA 2ET1A 4OVEA 1V00A 5A6ZA 5DAQA 1TVGA 3TEXA 3HEIA 1ULFA 4BLIA 4IUGA 1UZVA 3MUZ1 2DU1A 2J42A 1YFXA 2A70A 3SKJE 2JG8C 1SQ4A 1GWMA 1GP4A 1CIWA 5EJ1B 1QGLA 3WNNA 4CDQB 4KGQA 1LGNA 2VUJA 2V73A 5FLHA 1NAEA 3JB4C 3MIFA 3U4SA 3PTYA 4YGBA 3VHOA 4D94A 5FPUA 4GKYA 5I0RA 4AGVA 3PDQA 3O0VA 4W65A 2QJVA 3MLLA 5FMOL 2VC9A 4Q4X3 1FMD1 2EIGA 4WVVA 4XCBA 3MW2A 3RSJA 5E16A 4LHNA 3ZFEA 4IEOA 5C7GA 4HN1A 2QQLA 3D82A 5H9PA 5L36A 1I9RA 3ZDSA 3KHBA 1PMHX 2E33A 1EV13 4D0QA 1BCXA 1N1SA 1ULEA 5T5LA 3O12A 3K4DA 4AXOA 1XRUA 1W6MA 3KZ4C 4XETA 5BNNB 5T5JA 2VAUA 4PBPA 3D0SA 4EN6B 1KQRA 5E8AA 4P9YA 1LGBA 3GZUC 1JHJA 2VVEA 3QH6A 1OA2A 2RDQA 2WS92 1H2LA 3HD8B 5AVAA 2CDOA 4A6OA 5A6XA 5CFDC 4AK3A 5HV4A 3BYWA 3BTAA 1LHVA 4AQSA 3RI9A 5C4WB 1OOPA 3NQHA 3KV5A 3D5OA 3DL3A 1VBE2 2B9UA 1O6UA 1LHOA 4YNIA 5K7PA 3OSDA 1V6NA 1H1AA 3IMMA 1BK1A 2YZ4A 3K4AA 3NJZA 4NMIA 4EJRA 3V0AA 3MYXA 1OHFA 2OS2A 3JCIA 1VBB3 2W08A 2BGOA 3ZN6B 1ZVFA 5APAA 1X7NA 1O91A 2RR11 4FPGA 1KS5A 4Y1VA 2K46A 1AYN3 4ONUA 4IGOA 1SLIA 3V0AB 3BB6A 5T5OA 4DIQA 3URFA 1QXRA 3GNEA 3R4UA 3CZUA 4W6WA 3CEWA 4DRRA 3GJAA 4HFSA 3P3PA 1QQP3 2VUAA 3NAPB 1AUYA 4PDWB 3SCGA 1TNRA 5JI7A 4YM3A 4XMIA 4AHWA 2RS11 5I0TA 4A3ZA 2EAKA 3IM0A 5FZBA 1XNTA 3VBOA 3ZR5A 1JZ7A 1ND2C 4J1XA 2ZMLA 1RMU1 1R091 2WFF3 4B1MA 4YZ3A 3WR0A 5F37A 4FPJA 1DGLA 2RS52 4QMAA 3MW4A 3MIHA 3LEMA 3O7OA 3VBOB 2PLV3 5FZCA 1W3XA 4Y26A 1H8TA 2IUWA 2WAAA 2WZR2 4P9GA 4A6SA 2CGPA 5FY8A 5FP3A 4QPGB 1S2EA 1VRH3 4FPKA 4BMEA 5LA9A 3TBDA 4TLGA 3SH5A 3IN9A 4RA0A 1H8TB 4CDUA 2OUHA 1PO12 2BGCA 5DZGA 5GALA 2W94A 2Y6GA 3AKTA 3NSTA 3ILFA 3PJQA 4QB1A 3O1OA 1RUD3 3TEWA 1ZA7A 4JHTA 1J1LA 1W99A 3LB9A 5FJKA 1YQCA 4XEZA 5JZGA 2DV9A 2VOXA 1OH4A 2W3JA 1Z7S1 2BNOA 1CPNA 2K2SA 2Y33A 4Y22A 2BBVA 4XTPA 3CZJA 3WP4A 1W9SA 3WF2A 3E1F1 1RUJ3 2WQZC 4MGZE 4O65A 4QPWA 4RHV2 4ZPIA 2C5DA 3POBA 4AAPA 1QMJA 2OKXA 5AC92 4Q4V1 4BISA 2PQSA 3NO8A 2FDFA 4HT1T 4XIOA 4DY3A 1G9FA 4IERA 4LKSA 2CU5A 5HCHA 4GJYA 2DCYA 3NWKA 2VOTA 1YLLA 2ZPXA 4R9BA 4UFHA 3VBSA 1U5XA 2JICA 1TZOA 2QQIA 2QCSB 2RDSA 3I8TA 5K0UA 1YXWA 2HWD2 1JH5A 3D6EA 4ASLA 3CL1A 1RUF2 3JD71 3HNMA 5A3TA 1VMFA 4IE0A 2WR9A 5GZGA 4JGYC 3AMMA 4QHOA 5DQ0A 1KITA 2L9LA 2VCMA 3WCSA 2DVAA 4BQ3A 1M4WA 3ZYBA 1SFNA 3LEIA 4CE8A 1XYNA 4Y1XA 3UKTA 4ES9A 3T08A 1UZYA 2EIDA 1PZ8A 1VMHA 3MV01 4NIAA 2H6CA 2X09A 5FPLA 4JVAA 1RTVA 1S2BA 4NIIA 2Q30A 4XILA 4KWJA 5GZDA 2Q8DA 4KWKA 4W4ZA 3IZOA 2WQ4A 2VO5A 1Q8OA 5F8PA 3DN7A 1XSQA 4XURA 4DXZA 3ETPA 5FY5A 5BNOC 1O5UA 4AEMA 1O3RA 4IE7A 4GH4A 3T2QA 2VOVA 4JGZC 1BMV1 3H1MA 4B3NA 3R4DB 2XL9A 3VDAA 2W95A 5JPNB 1JOJA 3KQRA 3T3YA 1U5IA 2ZEYA 5C3PA 5FQ0B 4GB32 3KGLA 1UXZA 1S0JA 2JG8A 2ZX0A 5FREA 4D6SA 5J7MA 1O4TA 1BEV3 5B4NA 5CBLA 4NN0A 2GNDA 3RI8A 1SPPA 3E6DA 1GFF2 2V4VA 1ULDA 2JG8B 4JDNA 4W6XA 1VPHA 3AMNA 3T30A 3ELNA 1FNZA 1QU0A 4HKLA 3JUUA 5FLJA 3VBFA 3A0NA 1NYWA 1UOBA 3ENRA 3RJ2X 3U75A 1SPPB 5FZAA 1NX9A 5FYZA 2VQTA 3DKQA 2XBO3 4D7YA 1NCRC 1HQWA 5A3MA 4FP3A 5IFPA 1RVF2 4RFT0 1NOVA 5H9RA 3ZOIA 4CP9A 3OUJA 3RMYA 1GP5A 1JYVA 1W2UA 2WSUA 5EYYA 4OI4A 5GJ6A 5KC6A 5FO7B 1NA1B 1CAWA 4YW6A 1HB1A 5FBZA 2VBPA 4NWVA 3H1WA 3ZN4A 4BE3A 1J58A 2JXAA 3AZXA 2W46A 2ADEA 2DFBA 3IBMA 4K3UA 2YUEA 4Q4X2 4BOWA 1UPIA 2QQJA 2YPDA 4IE6A 5FPXA 2BQPA 3VBUA 3ZXEA 4BK5A 1W8ZA 3S30A 1X82A 3EB7A 3RZZA 1W6PB 2WA3A 4ZU5A 1PGW2 4AQ2A 1EV12 4Q27A 1W8TA 1R083 4PCRA 5IUQA 4Q0QA 5CFDB 2E9QA 1OQDA 5CISA 1G9BA 2B39A 1N1VA 1SBFA 4URAA 4P9JA 1C57A 2PHWA 2JKBA 4FPLA 1AR61 1MEC1 1T2XA 5EZWA 3RYPA 4YVWC 3BUCA 1DZTA 4N43A 3OPWA 3MPPG 4N53A 5J09A 3OBTA 3I2DA 5FBJA 1C28A 4DOUA 2XVLA 1WCKA 3QACA 3ZO0B 3JZVA 5FUIA 1W8UA 1Q8PA 1FI2A 5I8YA 3WXPA 1C5HA 2A1XA 4EWEA 3N7KA 3VZMA 1XE8A 4AEDC 3POJA 1ND2A 1R1A1 2YHJA 1W0NA 1WLDA 4LHLA 2PHFA 1IS6A 1VBB2 4MXWB 4OI2A 1HRI1 2FMDA 5C6CA 5A3OA 3JBG3 1D2QA 3LKJA 1ND2B 1AYN2 4CUAA 5ACA3 5J36A 1W8FA 1PX4A 3Q9OA 3IMNA 1DU3D 3NNJA 3LAGA 1O5LA 5IJRA 2VU9A 1WW6A 4RGGA 1QQP2 1UYXA 2C26A 4UOJA 4MGTA 1ZRFA 5GLVA 1JZ3A 2QQKA 3PIGA 3BIEA 4KNCA 4FOYA 3PMEA 2XOMA 3MF6A 1EAH3 2R043 4QPYA 1H6YA 2W39A 2BW8A 1UW8A 1ULGA 3RDIA 2WC2A 2PLV2 4LA3A 4LR4A 2GNMA 4MO3M 4LUMA 4R8HA 5CAZA 2GP5A 4BM8A 1PMJX 4OHWA 4X8PA 1JZ6A 2JDYA 1VRH2 1LOEA 2ZMKA 2A75A 1QNWA 3FL7A 2VECA 3J8F1 4LMFA 3BPZA 2OIIA 1UKRA 2DVBA 5LB6A 3ST7A 3U78A 4IEZA 1RUD2 4L92A 5LA0A 1C8NA 2FDGA 1ND3A 4IQPA 4EN8B 1QJU1 2XR4A 4CXWA 4PJYA 3O1MA 2WINB 1DZRA 1IQAA 2Y0IA 5HI0A 3NNMA 2R7EB 5JXIA 4OFGA 1RUJ2 4XQ4A 1UYPA 1ULPA 2O1QA 2R0HA 4JGYA 4Q1PA 5FYCA 3I49A 3OG2A 1OT5A 1C8M3 5DUXA 3UESA 3VD4A 3UL2A 4FTBA 1W6OA 3UJOA 3RYRA 1BBT3 1COV1 3HT1A 3AP6A 2EA7A 4D7SA 3CO2A 3AP4A 1MZEA 4JGYB 3KQ4B 2ZZQA 2EIBA 1QXPA 2XJUA 3BIWE 4XTMA 2JENA 1O3SA 4WVZA 2ZS6B 5F2SA 5FKCA 2WABA 3OY8A 3NMBA 3RG0A 3OD0A 3PUHA 1ULCA 2YGLA 3A22A 4CRQA 2PHXA 5A7WB 3IB3A 1DQ2A 2XG3A 5FAXA 1SFPA 1AXZA 4JGZA 2GMPA 1SBDA 1FPN1 1A8MA 3OY8B 5EYXA 1UXXX 1GZTA 3B02A 3S7IA 4BDVB 4XF0A 1C5IA 5FXVA 1DBNA 2R061 2KM2A 2WO1A 4HVQA 2Z79A 2GNTA 5BNOB 3IDEA 4L8QA 4F7ZA 3RZGA 4JGZB 1LESA 1AF9A 2R0FA 5FP9A 4PIZA 4OZXA 4W6YA 2AEZA 3MUY1 3B5LB 4HMZA 2R16A 4DMIA 5A7NA 5A7PA 4ZKTB 2D6KA 4MH0E 5T55A 1YUDA 5I8TA 2JJ6A 1WLTA 5LA2A 3OB8A 4QKFA 4XE9A 4Y20B 1BVVA 5LZ6A 1AVBA 1EUUA 2Z5WA 3M8LA 3ZYHA 1HXS3 2BJSA 1EP0A 2V72A 1ODMA 3DKWA 4XHXA 1OSGA 2DCJA 3ZXJA 3POYA 1RUH3 4GIQA 2CNAA 2HEYF 2P3YA 2PYTA 2QTWB 1QJX1 3E97A 2VVDA 4XOGA 5L7OC 2ZA9A 4GALA 1XJAA 3H3ZA 4P9XA 1TQ5A 1NCRB 4RFRB 4DXRA 4AL9A 2C1FA 2V5YA 4QPIC 3V0BA 5C3QA 5JIUA 1GUIA 5JXHA 3AYCA 2ZX3A 1E5HA 1WMEA 5DG2A 1W39A 4KG8A 3KV4A 1C1FA 3AYDA 3NNGA 2MPFA 4FQZA 4AFAA 1WW5A 1S1AA 2GC0A 2XBO2 4XJZA 3K46A 3VGIA 1UY0A 1E57A 1WKYA 3M2MA 5DDJ1 1PGL1 1A8DA 2ZGQA 1JU3A 2B5HA 2QFEA 3ZSEA 1E5IA 2MEV3 3K3OA 2KR2A 4RSUA 5FLIA 1JUIA 5FPBA 4AI1A 1PGSA 5FV3A 1A6CA 2W52A 3MPBA 4AQ6A 4YVWA 5JR2A 3OPTA 3WG1A 3IAQA 1QH6A 2DBIA 3P3NA 3AX4A 4JV4A 4ZZ5A 1W04A 3TNPB 1VBA1 2VZSA 3THCA 3SEEA 3OUIA 1ZBE3 5IFTA 5D21A 4YVWB 4CP0A 4Y5SA 4C1XA 4AEKA 1MS8A 2XKPA 1DG6A 3BOWA 2B4KA 5F5CA 1R082 2VZOA 3DV8A 4JRLA 2QNKA 1V9U3 1U0AA 1GNYA 4AEDA 5KXCA 2QQPA 3BTZA 4XFFA 1HDKA 3AVSA 1HQNA 2WT2A 3H8UA 3PJYA 1H1IA 4QXHA 4IW3A 4AI8A 4C8DA 4FFHA 1MS0A 4H7LA 4LPLA 1WCDJ 2JECA 4R9DA 3NV2A 4A41A 5IW0A 4AEDB 4M00A 1W90A 5L9BA 1UX6A 3BVCA 3TAYA 1UU6A 2QQWA 3VKOA 5C3RA 1M06G 4FPOB 5F3CA 2JDHA 2D5FA 1HJFA 3VD5A 4FOQA 5CYYA 5L9VA 1LEDA 2ZABA 3LIGA 3S57A 4ZZ8A 4O7XA 3MV11 1GQHA 2GH8A 3OGSA 4J6GA 1PIV1 1GBGA 1UY1A 1WBLA 3S5QA 3POGA 2RS31 3WW3A 5A70A 1V70A 3JBG2 5ACA2 1AXKA 3WLUA 3FUQA 1JYIA 5JOWA 4CYDA 3HJRA 4AE2A 3KB5A 2ZOEB 4CDQC 3DYPA 4QWNA 3O5SA 3U07A 2ZEXA 2CDPA 3AXEA 4P9WA 3G7DA 2Z42A 4K1YA 1RUG3 2LM3A 1WA4A 3DGTA 3KM5A 2R073 3HAGA 4WZFA 1T6BX 1FOD2 1AR71 1EAH2 2R042 3KWVA 4JAAA 5F5AA 2GZWA 3O1RA 4SLIA 1N3PA 3O14A 1UZZA 4MSVA 4QKNA 1CR7A 2AGSA 1IG0A 1CONA 1ZZ6A 3T2TA 5JDBA 2GALA 3U1XA 2BERA 3KGZA 1OC1A 4YW3A 3VBHC 4PLMA 1X33A 5FKBA 3R6SA 3RVHA 2VZUA 1S0GA 3KV9A 3PL0A 1MZ6A 2HWE1 1QWRA 3U0ZA 5F3IA 3ZFGC 3WDUA 4HPKA 3ZXKA 2H0BA 3B01A 1KGYA 1DQ1A 1H9WA 3SKVA 3PUQA 4MOAA 2HWF3 1GOGA 1REEA 3DPRC 1LU1A 4QB6A 3WOGA 2VZQA 3FUOA 2D6LX 4FO9A 1C8M2 5GLZA 3WT3A 1Y4WA 4CCCA 4ES8A 4YGDA 3K48A 5L19A 4XDOA 2BOIA 1RUI3 4QX0A 5FWJA 2R49A 5FZ3A 3A21A 1PVC3 3N4MA
chains in the Genus database with same CATH topology
2X29A 1POV0 3E6BA 3LA2A 4K7JA 3NAPC 3N7MA 1ZBA2 4CDWA 2ZHMA 3SISA 4CEWA 1AR81 2WNEA 1H0BA 3B7MA 1REFA 5JSRA 4TYSA 1S0FA 2I74A 4I02A 2R32A 4L11A 1RIRA 3PHMA 4QQLA 1NQDA 4Q0PA 1D0GA 5L7OA 3IDBB 4H3WA 4QPGC 3EXUA 1SCRA 1HKDA 1WBFA 4C1WA 3ETQA 5DUWA 1K5MC 1WLCA 1HRV3 5L7OB 2OZ6A 5FOBB 1HXS2 2A71A 4P9IA 3B9IA 2QKDA 2XLAA 1RUH2 4QPIB 1DIWA 3WG2A 2Q5TA 4OUSA 2O8OA 1G9CA 4E2QA 3ZFFC 2HWB1 2HKXA 3M1HA 1OA4A 1Q43A 2XJSA 4PIXA 4S2FA 2VMIA 3FMGA 4F8AA 3H0OA 1AYM3 2NLRA 2TNFA 3GHNA 3PLQA 2VW2A 3USUA 5CA6A 2B7YA 2G4IA 2P2KA 2D3RA 3U10A 4NHKA 3VDDA 3S0MA 2F6BA 2H6BA 4K1ZA 1W6NB 3USUB 2VNRA 1RUE3 3H3UA 4CTEA 2GC3A 1IPKA 4H7MA 4LE4A 2VMHA 2MEV2 1JBCA 1GNZA 2ZACA 4G9SB 3LOIA 3FJSA 4R4XA 2IXJA 3MDPA 2WLPA 4OUMA 1TE1B 1V6MA 4F83A 3I59A 1OLRA 2GC1A 4FVVA 1ZBE2 4XMAA 5JVVA 4IV3C 4LEJA 4XHBA 2WNUC 1NE4A 1UU5A 3IKWA 4HBNA 2NQYA 4QHBA 1V9U2 3ZSMA 4Y5Z0 1ZA4A 4GWMA 4XJUA 3WX5A 5F9TA 5DZEA 3OF1A 4XFIA 4PIYA 1VBC3 4HL0A 3JQXA 3LA7A 4HK8A 5CNAA 4E4DX 2IWGB 4MYEA 3LCPA 4P9LA 4CDQA 3AP5A 4IESA 3AKPA 2CWSA 2VQAA 4HSJA 5LRSA 1I6XA 4GQ7A 3LSDA 1AL23 5T54A 3CJIC 4XJ8A 1RVF1 4XFGA 1YFYA 4Z92B 2VXRA 2XKOA 2HJIA 2XVKA 2OW4A 2Q0AA 2RJKA 3SCHA 1W6QB 1DGWA 3HMYA 3TWIA 5BNNA 1D4M1 1VALA 1NA1C 2GSYA 4TSVA 3ZYPA 1RUG2 3KSCA 1XNKA 3HWJA 1QOSA 2R072 2BUKA 4URTA 3VBHB 1YJLA 3IPVA 4XFAA 3ZFGA 1FMD3 2HWC1 1PO22 4RD7A 5BPXA 1RGSA 2WFPA 3SCFA 4GMP0 1KJRA 5C4WA 5BUVA 2EF6A 2FHRA 3IPVB 4XFHA 1S0CA 3S7EA 3ZFGB 1AR91 1GANA 3PMSA 4LA2A 4LBLA 2JEMA 4LBQB 5SV5A 1PZ7A 2E7TA 4I3PA 3O0XA 1MQTC 3ZN6A 3ZXGA 4QGMA 1EY2A 4YM1A 1AL0G 3DPRB 4HETA 4YFWA 1N3QA 3J26N 3VKMA 2CAVA 4AFDA 2JDZA 5C9AC 3INAA 3BODA 2EXKA 3BU7A 4K21A 3MLKA 3FBMA 3NAPA 4PDWA 5DUUA 2HWF2 2ARBA 2HEVF 5LEKA 1RITA 1VAMA 1VLNA 1UPSA 2JX9A 2PA7A 3GHMA 3T1LA 4I0AA 4KWLA 4FPHA 1RUI2 2RR13 2YYOA 3M3IA 4LO4B 1LEMA 1CAVB 4R9AA 3SLIA 3WUDA 1PVC2 2A5ZA 2GC2A 4QPGA 5KHJA 4ASMB 1DGWX 5GZCA 5LEJA 2DVFA 4BQ1A 1LKNA 2RS13 1RHI1 3VZNA 2OVUA 3WNXA 2PELA 1RMU3 1R093 1RUC1 3RNSA 2B46X 3JU9A 1K5MB 4ISRA 4AG4A 2ZKNA 2HYKA 1KFXL 3POSA 2ZGLA 2NN8A 4K8FA 3ZFFA 3QBQA 2A6WA 4L97A 3TN91 2CL2A 4EN9B 2DF7A 4ORFA 4DB5A 3TNQA 5EXOA 1HRV2 3MICA 2D97A 2XWJB 1ZYBA 1FX5A 3ZFFB 5JAXA 3H7JA 2PN5A 3ACLA 3KT4A 4LTAA 2QZ2A 4HSLA 3MIEA 5HCBA 1Z7S3 5D8AC 1O4ZA 1IPJA 3M3CA 2YC0A 2NM1A 3ZXAC 1YFWA 2XH6A 4DZGA 4Q4V3 2DUOA 4WBBA 5TSWA 4DY5A 1CESA 5CVRA 1GSLA 1AYM2 2EALA 1ZZCA 5E1RA 1OFSA 1BQPA 4Z82A 2P3JA 3AP7A 4FPYA 4RQPC 4XF3A 1GZCA 4EWAA 4BA6A 2BFUS 1RUE2 1YO8A 5AVPA 4E9KA 3JD73 2WNVC 1JXNA 4Q0SA 1F5FA 1F2NA 2X8KA 5C8CC 1O3QA 4IV3B 1KD7A 1QJY1 2WNUB 3NV3A 4JCKA 2I07B 5FQ0A 4OULA 3GBGA 4K20A 4BZ4A 1X36A 4KG0A 5IK8A 1RL3A 1AZDA 3IDCB 4INDA 2A3WA 3IIAA 2AH2A 1GYKA 4JDMA 2RMU1 4QQHA 3THPA 2E53A 1DYPA 1BVP1 4D69A 1DLLA 2GDFA 4LLOA 3CJIA 4N9HA 4Q4W1 2NZ9A 5KXEA 4KH9A 4B4RA 3QLQA 1YWKA 3ZSJA 1VBC2 2XGXA 5BNPB 1MVEA 1BKZA 1NY72 2IXIA 2ARXA 3CJIB 2VQ0A 4OI1A 2D93A 3AMPA 2DUPA 2VOWA 2RHPA 1SLBA 1OI6A 3SMHA 3RMXA 4H14A 1H9PA 3THTA 1NA1A 3GZAA 2YXSA 2C9AA 1ENSA 2AREA 5B2GB 4Y1YA 5FPZA 2ZZJA 3CNAA 2Y38A 3UKVA 1UL9A 3S6PA 4UW5A 2WL1A 4CP2A 1W6PA 4I01A 4YM0A 4COVA 5CFDA 3WHUA 1TME1 1GZWB 4U36A 3NVCA 1H2KA 1VBD1 4LO6B 2IFRA 1MQTA 1F31A 3A0KA 4AVTA 1HW5A 4QQPA 1D0HA 1G9DA 2IFWA 4XJAA 4AHXA 1RUOA 1LOGA 4DPNA 1FMD2 5A3LA 3B9CA 1YI7A 1MQTB 2W68A 5T3NA 2UYBA 4OHVA 1FT9A 4XBQA 1Q8VA 5KXBA 2MHFA 2XUMA 2Z69A 4MX3A 5C9AB 1LHNA 2UU8A 2A6XA 4MXWA 4LBMA 1AR63 1UF2C 1MEC3 1QHDA 1VAKA 1F5JA 4S2HA 2YY1A 2KXLA 3OGGA 3MLJA 1XYPA 4AI3A 5SV8A 3KCCA 3WP5A 2DYCA 4LBNA 2PHUA 1FAYA 2D5HA 2X5IC 1DGRN 5IK4A 4FAHA 5BXXA 2SLIA 1B09A 3PVBB 4U2AA 4N7IA 2CTVA 4I3GA 1R1A3 3ZIXA 4AI2A 1Y3TA 4MXVA 1V6KA 4WV8A 3ZMOA 3KCXA 4R9CA 1HRI3 4ATFA 1TMF1 2WFF2 2RR12 3M70A 4YG6A 4FXGB 4I2OA 4OHXA 1QKQA 1UAIA 1SLTA 3CU7A 4AF9A 3EQEA 1FOD1 3KD4A 3HN1A 4LULA 3UJQA 2RS12 4V1PA 3R0RA 2F4PA 1RMU2 1R092 2AUYA 4WVMA 2EXHA 2B45X 1SLLA 4NR1A 5EWSA 4D7TA 4WVMB 2R30A 4YM2A 5KHKA 3FLPA 1DF0A 3WP3A 5A33B 2P3IA 1CD3G 1OFNA 5AFBA 4P5HA 3J8F3 1LCLA 2JD4A 2QE3A 4B4QA 5D8AB 1YRZA 1LENA 1OPMA 3ES1A 1H1MA 4TLFA 1G6NA 1QJU3 2IXCA 4RQPA 3ZYGA 5BY5A 3MFCA 2R6QA 3KS7A 1QH7A 1X8MA 1Q8SA 5JOXA 1Z7S2 4KQ7A 5GLWA 2WNVA 2A7AA 1URXA 2HEWF 2JG9C 3FBYA 1NQJA 3FE5A 4RQPB 3SH4A 4AFCA 3VL9A 1YYNA 4Q4V2 3M3QA 1HV0A 4LNVA 3HT2A 1COV3 5BNOA 2WNVB 2RM21 5C8CB 1LODA 2VULA 1QJZA 4FP2A 1B35C 1ZZ7A 4D3WA 3JD72 4BLJA 1MZ5A 1UU4A 4Y20A 2JE7A 2D6PA 4PBOA 3QCWA 1FPN3 4HANA 1XU2A 4S2DA 2N7GA 3MIGA 2WZPP 2R063 3N35A 1ASJ1 1LECA 4QT6A 4G4FA 4COWA 4EWDA 1NCRA 1FYUA 3EBRA 2V09A 4R52A 4Q4Y1 5EFUA 2UY9A 4AVCA 1BEV2 1RINA 4C90A 3OCPA 1QXJA 3H50A 1BMV2 4LBKA 3J4UH 3TRSB 4WZCA 3AXDA 3CLPA 5KXDA 4IETA 1TEIA 1F9KA 1S55A 2PHLA 3AP9A 5F1RA 1OQ1A 2UYAA 1QJX3 1DQ0A 5J98B 4M3CF 4LBOA 3WD5A 3SH3A 1YHFA 4DNYA 1Z0HA 4XFCA 3HBZA 5JLVA 3WINE 3NV4A 3SITA 1F8VA 4BWOA 2MNGA 3VKLA 1WMFA 2NP0A 1EPWA 2WT1A 2CGNA 2YMZA 4YGCA 2O8QA 1W0OA 1AXYA 1ONAA 4J1WA 1O3TA 3AJZA 5DDJ3 1VJ2A 3H9AA 2O0OA 4B8EA 4DQAA 4IEUA 3V64A 3GBWA 3IT8A 1GR3A 4B7KA 1WMDA 2UWBA 3ZSKA 4QX5A 4MUVA 3LSEA 1VBA3 1V6OA 1BXHA 3I7DA 2X5IA 4C0BA 1NLRA 2I2SA 3WG4A 5FO8B 1I5ZA 3D0JA 2BFUL 2X5IB 3AJYA 1XE7A 2KA3A 1PZ9A 1MEC2 4QQOA 1AR62 4HVRA 3ALQA 4RS5C 4A7KA 2BTVC 3WV6A 4YW4A 3M4FA 4FXKB 1LJ7A 1ZRRA 2ILMA 3B93A 4IEVA 1YNAA 1IS4A 3KCYA 3QD6A 1R1A2 1MR5A 1Y43B 1XNBA 3VZLA 1PIV3 3BOPA 4M3CE 5T50A 1HRI2 4A7ZA 2RS33 1SLCA 4I30A 2YDEA 5CADA 1UIJA 4OHYA 1POV1 2ZGNA 3PVNA 3ASIA 4FCAA 1J3RA 1MS9A 3MFAA 1PO21 1N3OA 2VMGA 1HQLA 2IXLA 5E88A 3WHTA 1CVNA 1OD5A 2WS91 1AR73 4WM7C 2XJVA 3V65A 3VKNA 2BWCA 1ZRCA 4FBFA 1VBE1 4QGLA 4UBHA 2P34A 3VZKA 3AKSA 3ZXLA 5F5QA 4EN0A 2TBVA 3J8F2 2XLFA 1NG0A 2AYHA 2ZHKA 2HWE3 2JG9B 5JSPA 1Q3EA 1U5YA 3T1MA 1BBT2 1YIFA 3KMHA 1QJU2 1I3HA 2LALA 5T52A 4E4ZA 1B35A 1VB4A 5CG8A 1PMIA 3AFGA 2QZ3A 2NPIA 4Q26A 4FAGA 3LA3A 5KHHA 3WW2A 3TOJA 5GLTA 3WZ1A 1B35B 4AI0A 2OUJA 2ZTNA 2RS51 4NHMA 2XJQA 3ZN5A 2GH2A 1CQ9A 1GKBA 3UK9A 2WZR1 1OOPC 2GMMA 3L2YA 2FMYA 2PTMA 2NYYA 4B29A 2X53S 2G9FA 1JW6A 1AR83 2R1BA 3FC0A 2XPJA 1C1LA 1HIXA 1PO11 3AMQA 1GQGA 1QF3A 3EO6A 4HVOA 3KLSA 1CGPA 3OJBA 4I09A 3VUOA 4KL1A 1DQ6A 1LOFC 3ZXDA 1FPN2 5I0UA 4IEQA 4QPIA 3OYWB 5I8SA 2R062 1ZREA 3VHNA 4M3CB 4UW6A 3E5UA 4YZ5A 2BWAA 3AFKA 1LRHA 4RHV1 5BYNA 4FPFA 4JTNA 4META 5AC91 5K9YA 1ZM1A 1GICA 5FRAA 3MIDA 1QOTA 1IKPA 3L9JT 1H30A 1CAXB 5FFOC 1W6NA 1JTZX 1LOAA 2HWD1 4HKOA 4RHV3 5IT6A 4ISQA 1QJX2 1RUF1 2GN3A 4NWWA 1NZCA 4MVTA 4CDUC 1QDCA 2YV8A 2HWB3 2DCTA 1PNGA 1N47A 1J3QA 1BYHA 1NXD1 3USSA 1WD4A 1J59A 4AFMA 2XB6C 3NL1A 4XXPA 5JZGC 3MGUA 1H4GA 5ABJC 2K0GA 1IKQA 1Y7BA 4XPVA 4WM8B 4FT8A 2BNMA 4GA9A 3RJRA 1MACA 5IK7A 5DDJ2 2ZBJA 5JSOA 4ITCA 3EJKA 1PGL2 2LTNA 3WQ7A 3GALA 3VBSC 3KT1A 4YZ2A 2DUQA 4N90A 2ET7A 5K0UC 2VVFA 3ECQA 4RS5A 2EXJA 4A3XA 1GV9A 5A32A 2WT0A 4GB31 4IXLA 4Y1ZA 1VBA2 3GYDA 1KRIA 4KBBA 1YIPA 1DQ5A 4RS5B 4GMP1 1Q8QA 3H7YA 5A32B 1AX2A 1FNYA 2A73B 2OZJA 1UKGA 3MIBA 1WGPA 1SACA 1JYCA 3G6JB 4CP1A 5BNPC 3RYKA 5KBFA 1W6QA 2VPVA 1SCSA 2G9GA 2TUNA 4BYYA 5KC5A 4YG0A 1BJQA 4AWDA 3LOBA 4LT5A 4O9GA 2QDNA 3VBHA 1CPMA 4I0WB 4Q4X1 1JHNA 4X6RB 1H8VA 1RVF3 3RWNA 2WLQA 4NHLA 4C91A 1PIV2 4AGGA 4WM7A 1H2NA 2RS32 5I91A 2OA2A 1PGW1 1EV11 2Q1ZB 4XFBA 4LBQA 2D43A 4WM7B 3VBFC 1T6GC 3SHRA 1D4M3 3NKTA 4HLTA 1WCSA 1MS3A 2XLGA 2CV6A 3GZTB 4NOTA 3DPRA 3WY6A 1O4YA 4XZPA 1HV1A 2LUWA 4PLNA 1AR72 1DYKA 2HWC3 1HX6A 2IXKA 3ZFEB 4AQTA 4DS0A 2PQQA 3W58A 1AR93 5L73A 3FFZA 5JI9A 2PAMA 3K51A 1W6MB 3ZSLA 4X6QB 1VBB1 4KU7A 1LHUA 3VBUC 1YFUA 5H9QA 2ZGTA 2HWE2 1ENXA 2CYFA 1CAVA 1AYN1 1AHSA 3I4IA 3VL8A 3WQ1A 4YZ1A 1QQP1 3C3VA 4XDQA 2DU0A 4FOWA 3FLTA 5GZFA 4AVBA 1OOPB 4CZSA 1X50A 2ATFA 4N53C 4N43C 2WFF1 4Z1VA 3CF6E 2GN7A 2ZX4A 4NPRA 1LOFA 1K5MA 2IC1A 4I0BA 5JCTA 2PLV1 1G8WA 3DUIA 1KXGA 1ENQA 2VH9A 3AMHA 5BV6A 1VRH1 4LO5B 4FTSA 1OA3A 2TEPA 1L3JA 1LU2A 1J1TA 1AR82 1DQ4A 2ZHLA 1RHI3 2SBAA 4LUKA 1FATA 5HXVA 1RUD1 3LGRA 2R1DA 1RUC3 2RE9A 5IK5A 2ZGRA 3M7AA 4K40A 1SDWA 3VHPA 4DRVA 5CFCC 5JMCA 1RUJ1 2P37A 3CJXA 2ZGOA 3TN93 4E2SA 1KDMA 4IEWA 4OI0A 1QNYA 4CDUB 1BZWA 1V6JA 3ZIWA 1NCQC 2VY0A 2WWSA 5CU1A 5BNQA 1V6LA 4PQ9A 2BEOA 4GWNA 5ABJA 1LULA 4M0NA 2ZGSA 4AW7A 1ZX5A 2VOKA 5JZGB 2AENA 3AB0A 1FXZA 3HIFA 5ABJB 2Y0OA 4Y22B 3WUCA 2HWB2 4RR3C 4IV3A 1N1TA 3IWZA 2WNUA 2ERFA 3M3OA 1ND3C 3SXWA 4IV1C 1O7FA 4CEYC 3FLRA 4JTOA 3MI8A 3HR9A 3PVEA 3VBSB 4YRDA 5K0UB 4UW4A 2DCKA 3FFQA 4H55A 2C0ZA 3R4SA 1NE6A 2D7FA 2OYZA 2ENRA 2D6OX 5J3UA 2FQPA 5FDBA 3OBRA 2PHDA 1QJY3 1C3HA 2CAUA 1OLQA 5BNPA 1MVQA 2ZGMA 5C8WA 1PK6C 1WW7A 4OHZA 5CB7A 3WDTA 1BEV1 1QOOA 2RMU3 2UY8A 4Z8BA 4GH4B 5J48A 4Q4W3 3H1YA 1LOBA 2QDRA 2XBO1 1AL22 5GZEA 4XBLA 5GKAC 1GZWA 4M0HA 3JQWA 1ZRDA 1ZZ8A 2ZAAA 5CG9A 3B94A 1CJPA 3AZWA 1FV2A 3E5XA 1IHMA 5GLUA 2NMOA 3AK0A 3VBFB 4FQ4A 2NMNA 5KWRA 1MS1A 2ZGUA 5KHGA 3O0WA 1YJKA 3AKQA 1KFUL 4Q8LA 1SFYA 1R081 2YROA 5C9AA 1Z78A 3W59A 1TME3 1D4M2 2E51A 3FHIB 4EN7B 1VBD3 2D6MA 4C0HA 3RS6A 4XQDA 5FOJB 1RB8G 1CAWB 2XJPA 1XNDA 4AHZA 5FO9B 2HWC2 3GF6A 4YVSC 5F6LB 3VBUB 1APNA 2IXHA 3MF9A 1QY4A 3ZPYA 2QVSB 3RPQA 1AR92 3WDXA 4FSJA 1Q5OA 1RUNA 2GMEA 5JOZA 2E6VA 3B69A 4Q0VA 5LK5A 4YYOA 3OGJA 2ZGPA 3JBG1 4N53B 4N43B 4AEJA 5ACA1 3FWEA 4A2UA 4BH9A 2YPJA 4ATEA 4N9IA 5KHIA 4YFZA 5JWPA 1A3KA 1SEFA 2WSVA 2Q4SA 1H4HA 1S0DA 4JC1A 4Z07A 1DDLA 4ZU4A 1YCIA 3VBRC 1IS5A 3QH7A 3VN4A 4XQWA 1EAH1 2R041 1W0PA 3NKGA 1OQEA 2A6YA 1MZFA 3B3QE 4QD2A 4ZXKA 1TMF3 1GLHA 2Z2SB 5DUVA 4G3YC 4HKWA 5CFCA 2ZMNA 5A33A 3AZZA 3W9AA 1JN2P 2DFCA 2PAEA 2YGMA 1FOD3 5D8AA 5CFCB 2XJTA 5J37A 1RHI2 2B42B 2E7QA 1NCQA 1LR5A 3MW3A 4KU8A 4NO4A 1RUC2 2FZ2A 4P14A 1NCQB 3RQ0A 4AHYA 4DFSA 4BMBA 2VGDA 4RR3A 4MLOA 5FTTC 3TN92 1C8M1 5LK7B 2WA4A 1UN1A 2UURA 1BBT1 2A3YA 2UWCA 5DXDA 4IV1A 4CEYA 5C8CA 4RR3B 2CY6A 4BHPA 3POWA 2ZGKA 1ND3B 1DGRA 4IV1B 4CEYB 1S0IA 1ZBA1 1ALYA 4CDXC 1WUVA 4GULA 4YW1A 4AYUA 2B8MA 1KS4A 2GNBA 4IEPA 4UW3A 1J3PA 4LO8A 4B7EA 3A4UA 1G9AA 2ES3A 3WG3A 2K9ZA 1W6OB 2AZ5A 1GZ9A 1VR3A 3R05A 1ZZBA 2RM23 4DINB 1ZBA3 4ZU7A 2EXIA 2VW1A 3TYJA 4E27A 2D6NA 1PK6A 1PM7A 4IEYA 1EPZA 5EV7A 3FZ3A 3BALA 2A6VA 2DCZA 4QM9A 1PHMA 1OPOA 1PK6B 1V6IA 4E2GA 1S0EA 3LZZA 5D1IA 5C33A 1HXS1 4XF4A 1ENRA 3D8CA 3AYAA 1LOCA 1QJY2 4LLFA 2VW0A 3ROUA 1KDKA 3VZOA 1RUH1 2ZX2A 4PLOA 3DF0A 4CDWC 2Q8OA 4CEWC 1ASJ3 1NLSA 1X8EA 1RC6A 1WLWA 1I1EA 4L9BA 2RMU2 2D3PA 5FMOS 5HBAA 4BPZA 4Q4Y3 4AFBA 3WP6A 3N36A 5I0SA 3ILRA 2PFWA 2ZJCA 1FV3A 4LBQD 4Q4W2 5AFEA 1DZQA 2PHTA 2Y26A 4Z2WA 1H2MA 1VAVA 1XNCA 2DWRA 3VZJA 1XYOA 3PNAA 5F6KA 1IGOA 2DURA 5T5PA 3B00A 2MEV1 4RGAA 4YLZA 4FOVA 4K9SA 1AX1A 1AJKA 4JDOA 5JR7B 4BIFA 1SLAA 3OPZA 4R4ZA 1CAUA 3V0BB 3HQXA 5CIRA 3ZVXA 4WM8C 1WD3A 1ZBE1 4E4SA 4QGNA 4XYXA 4YVSA 4YG3A 1CAUB 2I45A 1VP6A 2WIIB 4HN0A 1TME2 4QXKA 1V9U1 2AR6A 4MZUA 4YW5A 3E5QA 4YVSB 3WDVA 1WW4A 2ETEA 2A3XA 4TWTA 3WCRA 3WDYA 1VBD2 4MGKE 3VDDC 3AM2A 4WVWA 4MGYE 4AVSA 3NW4A 1CJDA 3UKNA 4FTEA 2WJSA 3AZVA 1YI9A 2E63A 5DZFA 4KGGA 3WW1A 4LO7A 4Y24A 3NV1A 2A6ZA 3MEPA 1U12A 1ZNPA 1C4RA 2XL7A 4N7UA 1AX0A 1UCXA 1XU1A 1S2KA 3OD4A 3VBRA 2VG9A 1IS3A 3VBRB 1QDOA 4QM8A 2JE9A 1XQNA 1XXNA 3SNMA 4EV0A 1RJ7A 4AVVA 4XBNA 1SMVA 1RUG1 4YARA 4COZA 1S0BA 2R071 3MZHA 5JPMB 4XIKA 2XJRA 3PVOA 1LHWA 2UWAA 1TMF2 3OTFA 3ILNA 1IZ3A 1OKQA 1CN1A 1G86A 5E89A 1LGCA 2PHRA 4XJWA 2WKKA 1UIKA 4FPCA 3AZYA 1POV3 4YW2A 4LBJA 5K8SA 4XF9A 1PO23 5HCAA 3E6CC 2JG9A 2ZX1A 2CGOA 4HZFA 3V56A 1TNFA 4B4PA 2WS93 2H0VA 3ZFEC 4UXAA 2DTWA 3EHKA 5BNNC 2XWBB 3ZYJB 1MS5A 3N3HA 2HWF1 2D3SA 5I93A 1VIWB 4AGRA 4CDXA 1VBE3 3U11A 1UMZA 3N7JA 4IEXA 1D2SA 3ZYRA 5JOYA 4CDXB 1RUI1 5C4WC 2BVVA 1HLCA 2Q1MA 2D44A 3WDWA 4SBVA 4AVAA 1PVC1 2DVDA 4O9EA 1COV2 1PVXA 1G7YA 4QQ2A 4HPKB 1NXMA 4Q8KA 2CWMA 3GBFA 2EAAA 4XXAA 3BCWA 3M3EA 4K6BA 3VHRA 2W0XA 2BYVE 1DFQA 1PNFA 5HCFA 1KJLA 2IZWA 2RS53 3OYWA 2RJLA 4L99A 4YZ4A 4QU2A 2DVGA 3ZX7A 2ZAHA 4GXLA 2RM22 5JIAA 4PDWC 4OLLA 2BNNA 4M3CA 2WZR3 4IL7A 1GNHA 1VB2A 5H9SA 4BIOA 4XW3A 3L2HA 3FX3A 4CDWB 4CEWB 1HRV1 1OMIA 3VBOC 1PO13 4YSFA 4LHKA 2VNOA 3ME2A 4MV2A 1SBEA 5DG1A 1CAXA 1LB2A 4X8NA 2FBEA 3TB0A 2OPKA 4MGIE 3WQ0A 2GAUA 2P17A 4JQRA 3JB8A 1H8TC 1ASJ2 4NVPA 2EVXA 4S2GA 4M01A 3ES4A 3AKRA 2ZCWA 3D4KA 2XVGA 5AC93 1A78A 4Q4Y2 3VKFC 2BVBA 3QOPA 1AYM1 5EJ3A 4Q2FA 4COYA 4A7YA 4UBGA 1U5ZA 3AYEA 4L2NA 3APBA 2BPA2 4WM8A 3WVJA 3J9SA 2P3KA 3LWCA 2HWD3 2DTYA 1DHKB 3KT7A 1RUE1 2PAKA 1N1YA 1RUF3 3ZMNA 4XJ9A 3WW4A 4Q29A 1R1ZA 5FCCA 3ZXFA 5J96B 1D4VB 3RRDA 3ZYIB 3U4XA 1IOAA 5LRRA 3VV1A 2FZ1A 1UD1A 4XF1A 3I54A 4COUA 4RL7A 1EYBA 1JUHA 1ZZ9A 4Q1RA 3VDDB 4Q0UA 1AJOA 2XHKA 4Y1UA 3UV9A 5GM0A 4FPEA 1MS4A 4GKXA 1Q56A 4EROA 3ATGA 1VBC1 4JRAA 1REDA 4PF5A 1NY71 2VNGA 2GU9A 2D98A 3I59B 4GB33 1CX4A 3VLBB 4Y4YA 3C2UA 4BCUA 3N7LA 1Y9QA 2D40A 1LTEA 2E7AA 4GMP3 4LE3A 2QUOA 4YGEA 4HK9A 1AL21 4GH4C 4F3JA 2ZKLA 1RJ8A 2ZHNA 4TZDA 2ET1A 4OVEA 1V00A 1ULFA 4BLIA 2DU1A 1YFXA 2A70A 2JG8C 1SQ4A 1CIWA 1QGLA 4CDQB 4KGQA 1LGNA 2VUJA 2V73A 5FLHA 3MIFA 3JB4C 4D94A 3PTYA 4YGBA 3VHOA 4GKYA 5I0RA 4AGVA 3O0VA 4W65A 2QJVA 3MLLA 5FMOL 4Q4X3 1FMD1 2EIGA 4WVVA 3MW2A 3RSJA 5E16A 4LHNA 3ZFEA 4IEOA 4HN1A 3D82A 5H9PA 5L36A 1I9RA 3ZDSA 1EV13 1BCXA 1N1SA 1ULEA 5T5LA 3O12A 4AXOA 1XRUA 1W6MA 3KZ4C 4XETA 5BNNB 5T5JA 4PBPA 3D0SA 4EN6B 1KQRA 5E8AA 4P9YA 1LGBA 3GZUC 2VVEA 3QH6A 1OA2A 2WS92 1H2LA 3HD8B 5AVAA 5CFDC 4AK3A 3BTAA 1LHVA 4AQSA 3RI9A 5C4WB 1OOPA 3D5OA 3DL3A 1VBE2 2B9UA 1LHOA 4YNIA 5K7PA 1V6NA 1H1AA 1BK1A 2YZ4A 3NJZA 4EJRA 3V0AA 3MYXA 1OHFA 3JCIA 1VBB3 2W08A 3ZN6B 1ZVFA 1X7NA 1O91A 2RR11 4FPGA 1KS5A 4Y1VA 1AYN3 4ONUA 3V0AB 1SLIA 3BB6A 5T5OA 3URFA 1QXRA 3GNEA 3R4UA 4W6WA 3CEWA 4DRRA 4HFSA 3P3PA 1QQP3 2VUAA 3NAPB 1AUYA 4PDWB 3SCGA 1TNRA 5JI7A 4YM3A 4XMIA 4AHWA 2RS11 5I0TA 2EAKA 3IM0A