3MIDA

Oxidized (cu2+) peptidylglycine alpha-hydroxylating monooxygenase (phm) with bound azide obtained by soaking (100mm nan3)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
311
structure length
311
Chain Sequence
NECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peptidyl-glycine alpha-amidating monooxygenase
publication title Differential Reactivity Between the Two Copper Sites of Peptidylglycine alpha-Hydroxylating Monooxygenase (PHM)
pubmed doi rcsb
source organism Rattus norvegicus
total genus 62
structure length 311
sequence length 311
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 2010-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3midA02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 3midA01
4E4ZA 3MLKA 1PHMA 3MIBA 1YJLA 1PNGA 3MIFA 1YIPA 3MLJA 1YI9A 3MIGA 4R4ZA 1PGSA 3MLLA 3PMSA 3PHMA 3MIEA 4R4XA 3KS7A 1SDWA 1OPMA 1PNFA 3MIDA 4QHBA 3MIHA 3MICA 1YJKA
chains in the Genus database with same CATH superfamily
4WZFA 4X6QB 4XFGA 1Y9QA 2JDUA 2UYBA 4HK8A 2PHWA 4XPVA 3QLQA 1MS9A 2FDGA 5FUNA 1W06A 4JGYC 3NV3A 3JD73 1H9PA 4B3NA 3PTRB 3Q8AA 2FQPA 2GDFA 1EYBA 2BNNA 3HQXA 1YLLA 2ZGQA 4AHYA 3UGHA 4B8EA 1RVF3 2MPFA 2RS32 4QX7A 5F2WA 4AHZA 3NV2A 5A1LA 3LDBA 2DWRA 3EBRA 3E1F1 2JD4A 4RHV3 4GALA 5GALA 5H9PA 3W21A 4D6RA 5A6XA 1W2TA 4Q26A 5F3EA 5T54A 3Q8CA 5DAVA 4DEQA 4QHZA 2PN5A 1X9TA 2ZXQA 4ISQA 1YUDA 3ZFGB 3AZVA 1BJQA 4YGDA 3I3QA 4URAA 5EV7A 2NLRA 1OURA 1PHMA 3EYPA 4I30A 5FQ0B 4LIVA 3WF1A 1HB2A 1N3QA 3DKWA 3MDPA 1AX1A 5FQ0A 2C1FA 3BIEA 5JOZA 5DG2A 1ZYBA 1REEA 2E53A 4XYXA 5FYMA 2YB7A 4QM8A 3IDAA 2YG0A 4CDQA 3OOXA 4Y5SA 3AKSA 4AVTA 3LIHA 4P02B 4DIQA 1PK6B 1SDWA 5DQ0A 3VBRC 3KSCA 3URFA 2QQKA 5BXXA 1Y7BA 1ZBA3 4P08A 4YWAA 2F4LA 3ZKUA 1V9U1 1X8MA 2P3IA 1W8WA 2QDNA 1FNYA 5BNNC 1DYOA 2GAUA 1SFYA 1GKBA 1QDCA 3U07A 1OHFA 3SISA 3VD5A 2VW0A 1AL21 4CU6A 1OH3A 2B7YA 1K5MA 1W2UA 2JDMA 4J6GA 4EN9B 4L8QA 4QM9A 3ZM8A 2WT2A 3J7LA 3I3MA 1D7PM 3Q8BA 3TEWA 4CXWA 1IS6A 4DB5A 1S55A 4UW4A 3WP6A 4PBOA 3H8UA 1DQ6A 1PMJX 5FP7A 5IATA 2VNVA 2A75A 4JX0A 1JBCA 4JKKA 1KFUL 1NYWA 2CDPA 3BTAA 5FPVA 3ZXDA 3POIA 1UXZA 3UKVA 1IOAA 2A71A 2HWD3 5A6YA 3H7JA 4RYDA 4ZY9A 1GANA 1VBB1 4HG6B 5J98B 1EUTA 3VGIA 1URXA 2RDQA 1VE0A 4CU8A 1DGWX 3T0BA 2KA3A 2ARCA 1F5JA 2JXAA 2LS6A 5DUWA 3AXDA 2EIDA 3L2YA 2SBAA 5FMBA 1Q8QA 2EXIA 4EWDA 2AACA 2XVGA 3G7DA 4XFCA 1W9TA 3IT8A 2X5IA 3C7GA 3OG2A 4FSJA 3ZYIB 2DTYA 2RDSA 3D82A 3JXSA 4KU8A 1W9YA 1RUE1 1GP4A 1GZWA 4K20A 1BK1A 1XB9A 1YXWA 2PELA 2DFBA 1OKOA 1J58A 3M1HA 4AGGA 1HB3A 1SPPA 3N9OA 4LE3A 2G9GA 1XJAA 2OW4A 3OY8B 3PIJA 1QOSA 1CJDA 3VBHB 2PLV3 2XLFA 1N3OA 3OUIA 1HRV3 4XC9A 3AYAA 1XNKA 2W92A 4RS5A 5L9BA 2VR4A 2HWE3 3O7OA 4NAMA 4AVSA 3C2UA 4P9GA 2ERFA 5C8CC 1C8M3 2GNMA 1OMIA 2YMZA 4V2WA 3A7QA 3CO2A 2VW1A 5CISA 1RUF1 2LTNA 2WNOA 3OBRA 4IERA 5J96B 2UY8A 4O65A 4CEYB 2ZABA 1QQP1 4FPHA 1E5RA 3BGAA 3ZXAC 2VZTA 1QWRA 5FY4A 1MEC3 2TUNA 4GQ7A 5DN2A 1LOFA 4CDWA 1Z7S3 5A3WA 4M01A 2GN7A 4AQSA 1YCIA 1S1AA 5I0TA 1VAKA 3VD7A 1SBDA 3H3ZA 1B09A 2W1SA 2FD8A 1XE0A 1BVVA 4XIKA 4CDQB 2GU9A 3ITQA 1JZ5A 5FYVA 2CYFA 2BWCA 4XF9A 3LE0A 4IW3A 1DLLA 3MYXA 3B02A 1EAH1 3LEKA 1VBC1 4IV1A 3SITA 4LITA 1WLWA 4ATFA 4Y5TA 2ZA9A 4Q4W3 4YZ4A 3U14A 4E4DX 3H0OA 4Q2FA 2P6CA 4CDXB 2J7MA 4GH4A 4LKSA 5FYHA 3T1MA 1PMIA 4AF9A 3PVNA 1WCUA 1PO23 4Q5OA 2Q8CA 1R1A2 1COV2 2R0HA 2Z42A 3NL1A 3KV6A 1RUC1 1LECA 1N1SA 1ZX5A 2HWB1 3LFIA 3THPA 3B00A 5FYTA 3A0NA 3UYJA 2HWD2 2ZMLA 5CFDB 3U0ZA 1LESA 3RYKA 1QHDA 4KWUA 1ZZ9A 3I2FA 3PVBB 4UI9L 4MGSA 3ZKYA 2D3SA 5LRRA 3R6SA 5IK5A 1B35A 4WM7C 2W3JA 2CGPA 1TE1B 4Q4Y1 4XHXA 3DECA 1BMV1 1NCQC 4ATEA 3K3OA 4MXVA 5FBZA 5AC93 1AXZA 4DUWA 3WNMA 1N47A 1IQAA 5JSOA 5CIRA 1WWYA 5FK7A 4N53C 3TYJA 3J8F3 5LASA 3X29B 4CCNA 3T0AA 1G9CA 3T2OA 5BNPC 3V0BB 3N4MA 2JB8A 2OIIA 2QZ3A 4XXAA 3OSDA 1ZZBA 4YW7A 2WNUA 5FP4A 4QX1A 4EN8B 4DRVA 4Q29A 2DVAA 5EYYA 3HD8B 3RG0A 1HRV2 2DU0A 3QH7A 3GZUC 4CUCA 1Q8VA 2ZGLA 4HN1A 4XDQA 4YGCA 3RMXA 5LCWL 3RZLA 1O4TA 1G9FA 2A3XA 2IFRA 3IPVB 1D4M1 1KFXL 5KXEA 4LBOA 5T52A 3ZXFA 3VBSC 4AVCA 2QQIA 1ASJ1 2UY9A 2W47A 1PNFA 3J26N 3DGTA 4AEDB 4MX3A 5FRAA 4BMEA 3OUHA 4NRPA 3OPZA 5CNAA 4I0BA 1ENRA 1MEC2 2YBKA 4FQ4A 4V2VA 4Y5Z0 1O7FA 1S0CA 1Z7S2 4BLIA 3M70A 4PIXA 5BNQA 1DGLA 3WDUA 5C9AB 1FMD2 1Y3TA 4OHVA 4H55A 3IDCB 3A23A 2W52A 2VZQA 2JG8C 2ZACA 1UX7A 2WQ4A 4GMP0 5DDJ3 4S2GA 1RL3A 3I2IA 2RS11 2VUCA 2VZPA 4QXKA 1PVC3 4BYYA 5HV4A 1H30A 2QQWA 4Q0UA 1U12A 3VZOA 4AHXA 4OCTA 5KXDA 5FZ7A 1W0NA 4R9DA 4TWTA 3B9IA 5K0UA 2RM22 2JG9C 1WW4A 4N90A 4RQPC 4GZ9A 4Q4W2 4YYOA 3WP3A 2H0BA 1DU3D 1A8DA 2JE8A 5JZGC 1OUXA 1Q8SA 3FHQA 3ZR6A 1QXJA 1PO22 3I3DA 1QKQA 1AX2A 5FYZA 3QCWA 2BRTA 2RDNA 4AZZA 2E31A 4K6BA 1OH4A 4ORFA 5KXBA 3NMBA 2RMU1 4TLFA 3NAPC 4KU7A 1A34A 5C5UA 4OHXA 1O59A 1CIYA 1AR93 1TG7A 2VC9A 4QMAA 4UFKA 3VDCA 3AFGA 5CKMA 2Y33A 2JDPA 1NAEA 4ZXEA 3ILNA 3RVHA 3E6CC 1NA1A 1JZ3A 1IG3A 3ILRA 4TN7A 5FYBA 3MO4A 3BALA 3KD4A 4B7EA 5FJHA 1OA3A 4TYSA 5F6KA 5BNOB 3BYWA 3ZFFA 2A6XA 4YG6A 3WLUA 2WJSA 4AW7A 4YZ2A 2C9KA 1LOEA 1YQ5A 4E4HA 3N9NA 3J8F2 5FPBA 1POV0 1ULOA 2SLIA 1WW7A 4LK6A 5J36A 2DURA 3NQHA 4GB32 1RHI1 1FV3A 1H8TB 1HV1A 2PTMA 1NE4A 4QXBA 3W5NA 1BLZA 1C28A 2CAUA 1LHOA 2C6SA 3HNBM 2Y6FA 3MLJA 4MYEA 3AKPA 4DPNA 1YFWA 3FHAA 3LCPA 2ZX1A 5F37A 1PGSA 3VBUB 2HWF2 1MZEA 2Y64A 1ZBE1 3WDVA 3S5AA 2BYVE 1W6OA 1GWKA 4ASKA 4PT6A 5LW9A 2R061 4AK3A 1CZVA 4YM0A 4AFBA 4F3JA 4QPIB 2NZ9A 3AP4A 4FVVA 2YGMA 4M00A 3K75B 3N9QA 5F9TA 4YGBA 1ND3A 5FZOB 4CDUC 4CCOA 2QKDA 2QTWB 1UOBA 1LGNA 4LOTA 3V64A 1IPSA 1RUD1 1YC61 3OBZA 5FXWA 3LIGA 5FLJA 1A78A 1O6UA 1UZ0A 4YW2A 4HPKA 4XFIA 5A7OA 1SLCA 4A7KA 5CADA 1ND2A 3S7EA 4CEWC 2PHDA 5A3TA 4Y1ZA 4HVRA 1YI9A 2VBDA 4FI9A 1FI2A 3KWVA 2VZOA 2Z2SB 1O91A 2BZDA 3OD0A 4XTMA 1UKRA 2XBO2 3RSJA 4Q4V2 3O12A 4CCDA 5JI9A 2AEYA 3ZFEC 1XXNA 4PHZA 1FPN2 2ZEYA 1S0IA 2DU1A 2YV8A 2IXCA 1UXXX 2O0OA 3ZSLA 1JYXA 5FR3A 2BFUL 1OXCA 4NVPA 3KT4A 1ULPA 4I3PA 1R093 4YG3A 5IVVA 2TNFA 3IMNA 2WLPA 1IHMA 3PIGA 4XAEA 3DPRB 4QXHA 4COYA 2WWJA 4QQLA 4QPGA 4Y1UA 5JAXA 3B7MA 1OFSA 4MXWA 2ARBA 4IE0A 1PO12 3OBAA 5K0UB 5A80A 1OOPC 1XNTA 2Q30A 3LPFA 5C3OA 5JXGA 1NLSA 1UY2A 4GWJA 2A6WA 5IUQA 1AL0G 3LQCA 3IAPA 4Y24A 4Z2WA 4COZA 3AMPA 4XW3A 1LHVA 2AGSA 4L11A 4QGNA 1CESA 4AI3A 4GIQA 1F5FA 3MIHA 5ACA2 3RZGA 2YYOA 1G7YA 3H1YA 2E7TA 3NRUA 5BNNA 4CTEA 3N7LA 3PUHA 4MGZE 1IZ3A 5KHHA 3ZSJA 2R1DA 4Y1XA 4HSLA 1E57A 2DCYA 2WSVA 3IM0A 5C7GA 4S2HA 1D0HA 1OLQA 3WG4A 4YVWC 5EXOA 3N35A 2VCBA 1X36A 2R1BA 4JAAA 4BWOA 1Z0HA 4D8MA 4QHOA 2OQ6A 4UBGA 5A70A 5JR2A 1JYIA 4WVMA 3PNAA 3D3AA 3ZFFB 3ZO0B 3H8XA 3VBOA 3MW3A 1NE6A 2JKBA 2QQNA 4IEOA 2VPVA 3WQBA 4GXLA 3MPPG 4KBBA 4KMQA 2OA2A 3UJOA 1YJKA 2RJLA 1GICA 2FDHA 1H1IA 1QMJA 4XFFA 3OGRA 4IEWA 3ZPOA 4CP1A 1SDDB 4E4ZA 1NOVA 4Y22A 4OUMA 2WZR3 3AJZA 2WAAA 3ALQA 1EV11 5G04L 5CG9A 2BV4A 1YHFA 2RS51 4NRMA 3MFCA 4HVOA 4LLFA 3U37A 5HXVA 5JDBA 1RMU3 4MHUA 1W6OB 5FPZA 2PAKA 2YBPA 1DQ5A 3TEXA 2YY1A 3WG1A 3WW1A 4HSJA 1TEIA 2HBTA 2K0GA 3DYMA 2JICA 4NIDA 4AFDA 2H0VA 1AYM1 2ADEA 5LWBA 3WZ1A 2V4VA 1BKZA 4GKYA 2BJSA 5FMDA 5HCFA 4BQ2A 3QBQA 3NJYA 2ZGOA 4JGYB 4QXCA 1I5PA 3KV4A 4E2GA 4OI0A 4LHLA 2XJSA 3WQ7A 5JXHA 3BUCA 3H3LA 4AQTA 3WNPA 2HBUA 5FYYA 1RTVA 2Z4FA 1R092 3MIBA 2XG3A 5CVRA 5EQUA 4MZUA 1RGSA 1G9BA 1DZRA 4HZFA 4Q4X3 2C26A 5EYXA 1IGOA 3VDDC 3VKOA 4DMIA 1TMF1 5DG1A 1UYPA 1UPSA 4CP9A 1CR7A 3SH3A 4W8JA 3W58A 1AHSA 1RUH1 1VB4A 2W46A 1Z78A 1CAUA 3QD6A 1HRI3 3B01A 4YM2A 3VUOA 3WXPA 2B42B 5EZWA 2D44A 3UGFA 3ZN6A 2OPKA 2ZX3A 1AR71 1WCSA 5JVVA 1PX4A 2YXSA 2W1QA 2WO1A 2RHPA 3AP5A 3CZJA 4YVSC 3IDBB 4OULA 3LOIA 1MQTA 2XLAA 3KQRA 4JGZC 1ALYA 2XJVA 5C3RA 2EALA 2WFF3 1JS9A 1CN1A 2D43A 4OLLA 1HXS2 2VMEA 1ONAA 1NLQA 2ETEA 2XUMA 3ST7A 2UWAA 5IHRA 4H14A 4XF3A 4NIHA 1UL9A 1VBE3 4SLIA 1WD3A 4Q0QA 1QNWA 2JWPA 3VBRB 2WA4A 2IC1A 3PUIA 5L9RA 3VHNA 1VBA3 2ZZQA 1QJX2 3R4UA 5DZFA 2ATFA 1PGL2 1OI6A 3AC0A 3CJIC 4PDWA 4XQWA 4YPJA 5BNNB 5CA6A 4CU7A 2DF7A 2HEVF 2OZJA 3C7HA 3I4IA 4MOAA 1UOJA 4GKXA 4FFIA 2ZGKA 4ZXKA 3KHBA 2JDYA 1CJPA 3HEIA 4PBPA 5FZ6A 1NX9A 3ZYRA 2WRAA 1KS5A 1X33A 4IGQA 2VNOA 4LXLA 4QX2A 1MVEA 2RR11 2PHLA 2VMDA 4IEVA 4I09A 3ZSMA 4BK4A 1NXD1 4IV3A 1OKQA 4C90A 1V0AA 3VL8A 4XUTA 4AVAA 1VMHA 1S2BA 2ZHMA 4XUPA 4ZZ5A 4DNYA 4AHWA 2NYYA 5C4WA 2WZR2 4GA9A 1W9SA 3USUB 4XMIA 1ZREA 3TEZA 1H6YA 1RMU2 4P5YA 1JN2P 1NCQA 2CL2A 4NHMA 4TTGA 2W0XA 5A3LA 4YLZA 2OT7A 5E16A 4B4RA 1FOD1 2J1RA 1QXPA 2HYKA 1YI7A 3AVSA 1GZTA 4PLNA 4JC1A 2HWC1 2Y60A 2AH2A 3K51A 3RZHA 1RUG2 5BNPA 1T6GC 1HDKA 5C8WA 2OVUA 1QJY1 1LOCA 3FL7A 3GZEA 4NHLA 5FUPA 1LCLA 4QX8A 1J1LA 1SACA 1XNBA 2B39A 2VMFA 1GNHA 5IK7A 1H4GA 1V6LA 2LW8A 3AK0A 1NKGA 4QU2A 2J1UA 5L7OC 1U5ZA 2VOTA 5GZEA 3ZFGA 5L36A 3N7JA 4BM8A 5F8PA 5IVFA 3NWKA 4N7IA 4OHZA 4META 4CP2A 1YQCA 4XTPA 3EHKA 2NMNA 4UFHA 5I0UA 4B4QA 1SLBA 1V9U3 4FPCA 4H7LA 5L9VA 5C8CB 5FPUA 2AYHA 2MEV1 3IB3A 3LWCA 1DP0A 1UY3A 1AL23 1YFYA 4IE5A 2DUPA 2HEYF 3ORJA 2JG8A 2Q8DA 1PK6A 1V6KA 1Q3EA 4NR1A 2OS2A 5FZIA 4ES9A 1UD1A 3BOWA 3E5UA 1CAUB 3M3EA 5F32A 1BYHA 3ZN5A 1ULEA 3SQOA 1OLME 4AFMA 5EP9A 1HIXA 3ZN6B 2FZ2A 1VBE2 2E7QA 1H6XA 3GXUA 4ZS3A 4ET7A 4FPFA 1F15A 1UZWA 1VBA2 3GBWA 3T2PA 3H8RA 4GWIA 2XJTA 3NKGA 1W28A 1HN1A 4FOVA 4BQYA 3K46A 1VBB3 2JE9A 5FYIA 2DCJA 2JE7A 3BPZA 3W5MA 2E32A 1CPMA 1W6NB 4HL0A 4K7JA 4C8DA 3LFMA 1RUOA 5FMOL 2GC1A 4G3YC 3K3NA 2GC3A 1WCDJ 3H1WA 2Z5WA 1F4AA 5EPAA 2J1TA 4FCAA 3AMNA 3F95A 4C0BA 4C91A 3PUSA 3R4SA 4CCEA 1RXFA 5I0RA 2UYAA 1PZ8A 5F6LB 3HJRA 2IVJA 2NQYA 4COUA 2PHXA 1NY71 4XEZA 1KEXA 4AGRA 1HQWA 1NCRC 5FZ8A 4Z2AA 1GOFA 4Q8LA 1UU4A 4W6WA 5KXCA 1AJOA 2Y34A 4YNIA 3MICA 2P3YA 4BMBA 2ZKLA 3OEBA 2XUEA 3U4SA 2PQQA 1AF9A 5FY1A 4MSVA 1W39A 5A7SA 1VRH1 2D97A 5LY1A 4WM7B 5K7PA 1VAMA 2KD7A 2ZKNA 1DQ0A 1I9RA 3P5BA 1H1AA 4LBMA 4IGOA 4W65A 3VDAA 1NCQB 2W2IA 4NUBA 5FCCA 3ZXLA 3D5OA 3AYEA 3SCGA 2XPJA 1QQP3 2BQPA 3OY8A 1UYZA 3POJA 3VBHA 2XJPA 2WNEA 1LU1A 3DYPA 5JOWA 3KGZA 1UIKA 1ENQA 2DYCA 2WR9A 4N53B 4YFZA 5AFBA 5GZGA 2D3RA 3TEYA 4CP0A 5BNPB 1CAWB 2DTWA 4RGAA 3VKMA 2JIGA 1LENA 2YC0A 3ATGA 2VY0A 3DCQA 4CDUA 4CXXA 4OHYA 4B1MA 3NNMA 3V56A 3OJBA 3RI8A 4CEYA 4DY5A 4A44A 1JYCA 4XFBA 1OUSA 2ZAAA 1E5HA 4XF1A 2BEOA 5I0DA 5IT6A 5CB7A 3WW4A 1PIV2 4CCMA 3QOPA 1NUKA 4BQ5A 1S4CA 4IE6A 1OSGA 1EAH3 4CEWA 3VBSB 1VBC3 3RZMA 3VKNA 3UT0A 1GSLA 2ZHNA 4CRQA 3BI3A 2XHKA 1CONA 1QOTA 1AJKA 4YZ5A 3NVCA 2ARXA 2DVGA 1G9DA 3SH4A 2QQMA 2W68A 5M0TA 4WVZA 2O8OA 2Y6KA 3JZVA 1RUC3 2DVDA 4SBVA 3T3YA 2HWB3 1SLLA 2JG8B 5LBCA 5JUVA 2PHTA 5LZ6A 1LHWA 2VZUA 2XGXA 2ZTNA 1CZSA 1WLCA 4K21A 4AQ2A 3HN1A 5F5AA 1O8PA 1YNAA 2HH9A 5LEKA 1OF4A 1YRZA 3GHNA 4BHPA 3LSDA 3LDKA 4OZOA 4CDXA 1RUI1 3AJYA 5LA1A 2X10A 4M3CB 2IXJA 2WLQA 4Q4Y3 5A3UA 2PAEA 4MO3M 1RUNA 2JG9B 4RQPB 3FFQA 1OOPA 5LA0A 1J3PA 2E33A 2WFPA 3L2HA 1HLCA 5FZCA 4QX0A 3WF3A 3AP7A 1EPZA 5JZGB 2VD7A 3MLLA 5CEHA 4P9WA 5CFDA 2IZWA 2RS31 1DDLA 1QF3A 4EN0A 4Y1YA 1TVGA 3GJAA 3LA7A 5LA9A 3I7DA 4Q27A 2EA7A 2LM3A 3LZZA 3NAPB 4NOTA 5GM0A 4R9CA 4OMCA 1OVSA 5SV5A 3O0WA 4LO5B 1KITA 3KMHA 3U11A 5IYYA 4OUEA 2KR2A 2E9QA 2A73B 2G9FA 4Z1VA 1D4M3 1Y9MA 4URTA 3NV1A 1KRIA 4UFMA 1UWWA 1V6OA 4MGQA 2X29A 4LULA 3WQ1A 3V0BA 5F3GA 1S0BA 3RPQA 5A7WA 1QQP2 3HT2A 4XUNA 5CFCC 4WVWA 1VPHA 3SKVA 1MVQA 4BE3A 3JD72 4CA9A 3TWIA 1FXZA 3J7NA 5SV8A 4DXZA 3MF9A 5CZKA 1WCQA 4AEJA 1RVF2 3B93A 4AXOA 5B4NA 5JLVA 2CY6A 2Q5TA 2WUHA 3BCWA 3IPVA 4QKBA 4LUKA 4D3WA 4RHV2 4XUQA 4A2UA 2XKOA 3KT1A 5FZDA 3ZYBA 1UZVA 2YPDA 2NMOA 4DFSA 1YO8A 2R071 2WC2A 3DKQA 4N9IA 2RS13 4A41A 1JZ2A 3AYCA 3VN4A 4AEDA 1R081 4XDPA 1ZZ8A 2A6YA 4NPLA 5FIXA 2GNDA 2HEWF 5C9AA 3POYA 2ZEXA 4CDUB 3VD4A 2QE3A 4DOUA 1BEV3 4YZ3A 1GWLA 2ZGSA 3M3CA 4BJ0A 1LU2A 1PGW1 5HI0A 5B2GB 2BGCA 3D4KA 4IEYA 1ODMA 1XYOA 1JYTA 3WHUA 3IAQA 1F35A 1V6NA 2JENA 2K2SA 3ZXGA 4CCKA 2X05A 2JDKA 3LKJA 4LT5A 4E2QA 4NWVA 2JDZA 5FZ4A 2YDEA 4CEWB 2PFWA 5FY7A 3W9AA 2RMU3 2R30A 4I0AA 3USSA 3N3HA 3NNGA 3JCIA 4K9SA 3RWKX 3TRSB 5I93A 4H7MA 1ZBA2 4D6QA 2J22A 4R8HA 4TZDA 3ZFEB 4XJ9A 3PVOA 5JXIA 1LAJA 2ZBJA 4K3UA 3JB4C 3KCXA 4BISA 1KD7A 1MS0A 2ADDA 1ZVFA 3KCYA 4YW1A 2VULA 2ZX4A 3Q8EA 3LEIA 4LNVA 4Q4Y2 4A4AA 1UN1A 1DQ4A 5GZCA 3LF7A 5C6CA 1WW5A 2QQUA 1H2MA 1RYYA 2WN3A 1OD3A 1L7QA 3AZWA 2DFCA 1JYWA 2VNGA 3SEEA 3NJZA 4NPRA 5FZ3A 3N9LA 5J7MA 4AAPA 4FBFA 3ACHA 4A7ZA 3MHZA 4B4PA 3OUJA 1RHI3 4JGZA 2A7AA 5DAWA 1OOPB 4L2NA 3T2QA 1QJU3 3WT3A 2WN2A 1C1LA 5BNOA 1HB4A 4JTNA 2AUYA 3K48A 5BY5A 4AEMA 3KF5A 2UU8A 1UZYA 2R063 4MGIE 1D4M2 2BBAA 4K8RB 4Q0VA 2JIJA 2HJIA 4D7SA 3GHMA 1O5LA 4JDOA 4QGMA 4WM8C 4XIOA 5JR7B 4M3CE 1H8TA 1NZCA 2WZPP 3CHXA 3VKFC 3N36A 1RUD3 4RFT0 4QB6A 1W9FA 3B94A 4JDNA 5BUVA 1E5IA 2RG4A 2VBPA 4P9IA 3VBUA 4YVWB 1HQNA 1V70A 2P17A 3WCRA 4BB3A 2E6VA 5A3NA 3WG3A 3AL6A 2Q0AA 3LEMA 1XE7A 3JB8A 2WO7A 4HT1T 4QPIA 4JHZA 4RR3C 5ABJC 4DEVA 1I5ZA 2EXKA 1UU6A 5A7WB 2P3KA 3S5QA 5FZOA 4CCJA 2PLV2 3FWEA 1JZ6A 1XU1A 1UCXA 2BOIA 4D0QA 2QJVA 2HWE2 3U1XA 2J42A 3VV1A 5I0SA 1C8M2 4MH0E 1IPKA 1WLTA 2VMHA 3DXUA 3WEZA 5DUUA 1OQEA 3RFRA 1BEV2 2VUJA 4FPEA 3RI9A 3WVJA 5FOBB 4NRQA 4Q1PA 3WNLA 4DUXA 2R49A 5IVCA 2E51A 1R1A1 1COV1 2R16A 1SBEA 3TBDA 1BBT3 1SCSA 4TSVA 3MPBA 3VZKA 1DYPA 1VBD1 5L7OA 4EN6B 3V65A 3KV9A 4FAHA 4BLJA 3PUQA 3AVRA 2VZRA 5DAQA 4AGVA 3DPRA 4PQ9A 2J1EA 2XR4A 5GJ6A 4XETA 3Q9OA 2EIGA 4BPZA 1REFA 1WW6A 4LBKA 4ARYA 3LEGA 1C5IA 3U78A 4CCLA 2JKXA 1DZTA 5FWEA 1UOFA 1QDOA 1AR63 3MV01 1W8NA 4D69A 3P3PA 1W8FA 1IQDC 1L7RA 3KM5A 4XUOA 2DUOA 1LB2A 1JI6A 4HXCA 2XWBB 4ZONA 3VDDB 3WP4A 4QD2A 4CCCA 3ACIA 4BQ3A 3WUDA 2DCKA 5EWSA 1YFXA 2V5DA 2VVDA 4LA2A 4RA0A 1DIWA 3SH5A 1QJU2 4BK5A 4YM3A 1UOGA 1C1FA 4QB1A 3WDTA 5D1IA 5KHGA 3UKTA 4KWLA 3B69A 2QZ2A 4JVAA 5J48A 1O3SA 3BU7A 1U5YA 4YVSB 4JGZB 1XYNA 2FCVA 3GBFA 5FPLA 3FUOA 3TAYA 4V1PA 4FTEA 1ZRFA 2VH9A 3FLPA 4QKNA 3K4AA 5FP3A 3TOJA 5JCTA 1MS3A 5AC92 1TQ5A 2ZGRA 2ZCWA 1EV13 2XQXA 4FPLA 2RS53 1LOGA 4EWEA 4IEXA 3FC0A 1JODA 2CU5A 1FMD1 1GBGA 3CJIB 1O4ZA 4O9GA 2RV9A 5KHIA 2XVKA 1J83A 4NHXA 5ERLA 1OBNA 3ACLA 2XONA 3AZZA 1GFF2 3HR9A 4AYUA 4LPLA 5T5LA 2JX9A 2BFUS 1TZOA 1DGWA 1SCRA 1Y9GA 1BK0A 4XHBA 3RJ2X 2VZ1A 1AUYA 2D98A 1WBFA 4LQRA 2OQ7A 4IEQA 4NIAA 3RZJA 1AVBA 2DDUA 2RM21 1CAVB 4LBJA 4C0HA 3VLBB 1XNCA 4XILA 4N43C 5CBLA 1SEFA 1ACCA 1JXNA 2VW2A 5F3IA 3CNAA 1GNYA 1N1VA 5FO9B 4ZS2A 2WZEA 3KLSA 1ENXA 4LHSA 1TMF3 1BBT2 3JBG1 4JGYA 4FTBA 1CQ9A 1ZZCA 3MEPA 1RUH3 2N7GA 4WVVA 4HKWA 2BP6A 1MS4A 3ZMOA 1CVNA 1OA2A 2OXBA 1SZBA 1OLMA 4HANA 4UFJA 1XSQA 5DDJ2 2XL9A 5FKBA 1DZQA 1AR73 1JZ8A 4FTSA 2VG9A 1MZFA 3MUY1 5F2SA 5E89A 2Y6HA 1QU0A 1PVC2 1PM7A 5FBJA 3UV9A 5CYYA 4ZHNA 3NNFA 5L7OB 2ID4A 5F5IA 5HBAA 3C7EA 2W1WA 4HOOA 4XE9A 1AR62 3WF0A 1YQ2A 1RUJ1 3H42B 3OGVA 2QFEA 4NROA 1KJRA 2QBXA 3JQXA 4UF0B 3CU7A 1QGLA 3ZIWA 1AXYA 4IXLA 1QIQA 3MFAA 2P5BA 4AI9A 4GB31 4QKFA 4GULA 3UESA 3UNPA 5FZLA 4K1YA 2ZPXA 1VALA 5FZEA 2NN8A 4R9AA 2YFZA 4LHNA 3R0RA 5C3PA 2IFWA 2HWF1 3D6EA 4XJ8A 1DGRA 2P1BA 3CQOA 2RR13 1AR92 1GLHA 3K4ZA 4ONUA 4CUAA 4GWNA 3J7MA 3VBRA 1O4YA 4ZU4A 3KHCA 3OEAA 1DG6A 2QDRA 3O1PA 1WUVA 5DAPA 3APBA 3AYDA 4FFGA 3AMMA 1PM4A 2YBSA 3K77A 4IEUA 3EMRA 5A7NA 3AMQA 1ZRDA 1DHKB 4COWA 3PU8A 2ENRA 2LROA 3NJVA 1K5MC 1FOD3 5KHKA 5LRSA 4HVQA 1JZ7A 1O3RA 5JWPA 2RJKA 2WYSA 4X8PA 4XBQA 1CPNA 4AI8A 2HWC3 2XBO1 1IS4A 3ECQA 3ME2A 3N7MA 4Q4V1 2JD9A 3WHTA 3EJKA 3PHMA 4LA3A 5A6QA 4X8NA 1QJY3 2JECA 1FPN1 3OPWA 3USUA 2B5HA 3THCA 1RJ7A 2V4AA 5LBFA 1H2KA 2FZ1A 3W20A 2AREA 3L9JT 2VZSA 3WG2A 1G6NA 5A32A 1STMA 1OD5A 5IVBA 3CLPA 3DL3A 3WV6A 1ST8A 1W2NA 2J1SA 4YARA 3GJBA 1NCRB 1VMFA 2DUQA 1RC6A 2QQOA 1OPOA 4OVEA 1YIPA 3B9CA 1PO11 4FOYA 1TME1 5DPNA 5EFUA 1D0GA 4NAOA 4JRLA 1RUH2 2PXJA 5HPOA 4FP3A 5FY5A 2MEV3 3TN93 1N3PA 2ZX0A 4HFSA 2X5IC 5FLIA 4FXKB 1S0DA 4UT5A 4QPYA 4XJWA 2CAVA 5DUXA 4ZU7A 1AR72 2C24A 5JXJA 2VZ3A 2BNMA 3WOGA 2B46X 4YW6A 5ACA1 1BZWA 4HKLA 1M06G 2WABA 5FREA 1AYN1 4FOQA 3RYPA 3D0JA 1HX6A 5LK7B 3ZVXA 4CUGA 2VCMA 3H9AA 3ETQA 4RS5C 4XVHA 5C8CA 3VZMA 4QT6A 3OBTA 2QUOA 4DO0A 2QNKA 1F31A 2Y6GA 4HONA 4S2FA 5FZAA 3HAGA 3BB6A 2GALA 3AX4A 5CKQA 3UJQA 4CXYA 3VD3A 1RINA 3HOBA 3ZDSA 4XFAA 3C7OA 2AENA 3GCWA 5E1RA 4R4XA 1V00A 1ZM1A 5JMCA 3AZXA 1QNYA 4XBLA 2PHFA 1VLNA 4CDWC 1LOFC 2JDAA 1MS5A 2TEPA 1YQ6A 1U5IA 1ULCA 4Z92B 1SLAA 1LULA 4JQRA 4BU2A 4P5HA 2B45X 2PAMA 4B29A 5J3UA 3CDZB 3ZX7A 3FFZA 1O5UA 1W6QB 2O8QA 3ZPYA 1UMZA 3WW2A 3O1VA 2CGNA 1JUIA 4ZU5A 2XJQA 3KVAA 3AP6A 1W6NA 5F5QA 4IE4A 5JOYA 3FX3A 3FN9A 4P9YA 1J1TA 1YYNA 4AEKA 2O14A 3DUIA 1HV0A 1W04A 4QQPA 4IV1C 1W05A 2XL7A 1FAYA 5J09A 3O0XA 4NHYA 2BGPA 2VE1A 2VTFA 2GNBA 4RL7A 5ANQA 3FLTA 1VRH3 4GH4C 1VIWB 3TNPB 1J59A 1F2NA 1QH6A 1AR81 3UKNA 2V72A 3OCPA 4EROA 3SC7X 3PUAA 1NG0A 4Q0PA 2G1MA 3FJSA 5F3CA 2EICA 4PLOA 1S0JA 2WBKA 3RS6A 3ZR5A 1LTEA 2VGDA 4LBNA 5A3MA 3FE5A 4XQDA 4FT8A 4LE4A 2YUEA 1GNZA 4R52A 1CD3G 3POEA 3THTA 4LMFA 2DV9A 2ZS6B 5FP9A 5DZGA 5L19A 4WM7A 4NE9A 4XZUG 5GLZA 5FZ0A 1B35C 1CAXA 2GN3A 3CKHA 5GLVA 4RFRB 4OI2A 2GP3A 3IWZA 1X8EA 4YG0A 2MNGA 1JU3A 2RDRA 3J9SA 2YC4A 4H2AA 4IEZA 1KDKA 4KWJA 3WINE 2HYXA 5L73A 3TN92 2YC2A 3OTFA 5JOXA 2OX0A 2C0ZA 4N53A 4FP2A 4UFIA 2P6HA 1CAWA 2IXLA 3ON7A 2J1AA 5ABJA 5CFCB 4AI2A 4KG8A 4B1LA 4UWDA 1WKYA 4LJHA 2WO2A 2GMEA 5I91A 2WNUC 1GOGA 1HXS1 1WZXA 4PI2A 2Y6JA 1JW6A 2X53S 3ZXEA 1PZ7A 1Q5OA 2GC0A 2VBBA 1FATA 5DABA 4Q4X2 3O1UA 4AVVA 4OI1A 3SNMA 1W8OA 2E7AA 5FXZA 5FPXA 1QJX1 3VBSA 3AL5A 3LAGA 1PGL1 1BXHA 2BWAA 4N9HA 2BPA2 1K3IA 2ZEWA 3D8CA 5T3NA 1QY4A 3ZIXA 4JKLA 3ZLIA 3CF6E 1RUI3 1TNRA 1H4HA 1HRI2 1TNFA 3SHRA 4D7YA 2F4PA 4Y3OA 2R041 2YPJA 3MBWA 3ENRA 2H6BA 2WT0A 3A22A 3M3QA 4XACA 5FFOC 3HNMA 5H9SA 4BXFA 2NP0A 1YJLA 1C3HA 5F39A 3HMYA 3I54A 2LRPA 2RS33 4AR2A 2WSUA 5CKNA 2WFF2 1QJEA 4NPMA 3LOBA 1NQDA 2P2KA 3A4UA 3MW2A 5FZ1A 3FZ3A 3VBFC 2P3JA 1K45A 3WNXA 4JKMA 2Q4SA 1RMU1 2BNOA 1W8HA 4OUSA 1UU5A 2WKKA 4M3CA 2ZAHA 4OQ8A 1POQA 2QQJA 1FX5A 2JG9A 3OPTA 4RQPA 5F7UA 1Y4WA 4A7YA 1ZRCA 1IPJA 3BU0A 5F1RA 2ORZA 1WMEA 3QACA 4L97A 4PJYA 5JZGA 3E5XA 3EQEA 4XBNA 1QJZA 1RUG1 1X9PA 2EIBA 2GC2A 3DYOA 4O61A 4E9KA 3IDEA 1I3HA 1REDA 2BVVA 3CIHA 3P6BA 4KNCA 4W4ZA 1C57A 1UO9A 4OQ9A 4E4SA 4E8DA 1O3QA 1K42A 4EZ4A 3OYWA 1WLDA 2XLGA 1GQPA 4XAAA 2C5DA 3NAPA 1SLTA 5JIUA 3E6DA 1WCKA 2ZMNA 3C8XA 1FT9A 4LTAA 1RUE3 4CPBA 2QVSB 2YHJA 2DBNA 2VJXA 1W3XA 1ENSA 1SBFA 1HN0A 1NA1C 5D8AC 1OQDA 5K4LA 1BVP1 4BQ1A 2B9VA 2R073 3GNEA 4QHBA 4BOWA 1KXGA 2CDOA 2LUWA 4M4PA 2Y6LA 2VOXA 5A1AA 1R083 1DFQA 2R6QA 2ORXA 2RE9A 2ZJCA 1W03A 4LKEA 4LO8A 3NO8A 2VVEA 3PJYA 1WMFA 1DLCA 2EVXA 4WM8B 1CAXB 4CSWA 1RUF3 2XWJB 3MIFA 1I1EA 2PMWB 2GMPA 1W6PB 4C1WA 3MGUA 4GJZA 1PVXA 4R9BA 4IETA 4N8MA 3AM2A 2A1XA 1NZIA 1GMMA 3O1TA 2I45A 3O1MA 4NO4A 1M4WA 4EN7B 4YM1A 2JDHA 2RJ2A 2Y38A 4XJAA 3AZYA 1IKQA 3N7KA 1BCXA 1VBA1 2DBIA 3CJXA 4RR3B 5AFEA 5ABJB 3BVCA 4F83A 1YEWA 4RD7A 1V6JA 1A6CA 4K1ZA 1ND3C 2JB4A 1V9U2 1W99A 4UXAA 2ZEZA 1ULFA 1RUI2 1LRHA 2UWBA 3PVEA 4A6OA 4EZHA 5CU1A 4FOWA 5A33B 1GWMA 1AL22 3GF6A 2W08A 3WW3A 4XABA 3RYRA 1T2XA 3WDWA 2VO5A 3AKQA 4EQVA 1ND2C 1JYNA 1JHNA 4XCBA 2CHHA 5J37A 4QQOA 2XOMA 1E5SA 2VUDA 2I2SA 3VHPA 5JSRA 5FYCA 3ZFEA 3KZ4C 1XU2A 5IK8A 2VTXA 1W8ZA 4O7XA 4UFLA 5T5JA 4M3CF 1LR5A 3I8TA 2WS91 2Q1ZB 2ZGPA 4Z07A 2W1UA 3ILFA 3PDQA 1QJFA 1DQ1A 3IZOA 4L9BA 1VBB2 1LEDA 5GLTA 1PZ9A 4QPGC 1XOYA 3WQ0A 3GYDA 4W6YA 1GV9A 2JEMA 4F7ZA 2ZMKA 2Q1FA 4BA6A 2PYTA 5LBBA 4AWDA 1SG3A 1FV2A 4PCRA 3O1OA 1PMHX 3I3EA 1GZCA 2FMDA 2H6CA 1RUE2 3MW4A 4OHWA 4UOJA 1VMJA 5IVJA 3ZDVA 1UIJA 3M7AA 3D0SA 2QQLA 3OYWB 3MV11 4OYUA 4UBHA 3GGLA 1KDMA 1VR3A 3PMEA 2XMLA 2R072 5FY0A 1H2NA 5GLWA 2XKPA 4Y1VA 4GMP1 1PIV1 1R082 1H2LA 2W91A 2WNVC 3KV5A 5FXXA 3WX5A 3DEMA 2D6OX 4YVWA 4GD4A 5B4XA 5LY2A 2YGLA 1RUF2 4YW5A 3KGLA 2QQVA 1PGW2 2Y0OA 2D6NA 3POBA 1F8VA 4FO9A 1ASJ3 1GP6A 4AOCA 2WWSA 2FDKA 3GCXA 3NNLA 4OI4A 2GNTA 4QAWA 1LODA 2BUKA 3VBOC 1R1A3 1COV3 3IIIA 4CPBD 1JYVA 4KGQA 4RN5A 1VBD3 1JOJA 4M0HA 5JPMB 2NM1A 4YZ1A 2XDVA 2D40A 3I59B 4W6XA 5IAVA 4Y20A 2VCAA 3OGJA 2WL1A 1EUUA 2VMCA 3O5SA 2ARAA 2XJRA 4UW3A 5E88A 3P1IA 3M8LA 4DQAA 4RGKA 3RNSA 2VTXJ 3NV4A 1EAH2 4OMDA 1VBC2 4N43B 5FZGA 4LO7A 5IFPA 2WINB 2CSGA 2IWGB 5KC5A 1MR5A 1J3QA 4QB2A 3RZZA 4ZPIA 4ZKTB 3PJQA 4K40A 1RUC2 5FMCA 4TLGA 3EO6A 1POV1 1U0AA 3RRDA 1DBNA 2HWB2 2V73A 3FMGA 4MG2A 3BN6A 3KT7A 2I07B 2OUHA 5E8AA 2VM9A 3T09A 4CUBA 3JUUA 2AR6A 3E97A 4QDSA 2BU9A 4L92A 3U10A 3PU3A 3VDDA 4CYDA 1T6BX 4UW6A 3AKRA 5FLHA 4AFAA 2ZGNA 4FFFA 3ZYJB 1BMV2 2IVIB 4MUVA 4B7KA 5C3QA 1Q43A 3JD71 1MS8A 5FWJA 2VQUA 3VD9A 4I02A 5IAXA 3F2ZA 3KS7A 5HCBA 3SEPA 4AI0A 1RVF1 4JCKA 1UAIA 2GSYA 4CZSA 1FMD3 2UWCA 4HKOA 3BPSA 1WGPA 2XH6A 3KCCA 4LLOA 2Y0IA 3PTYA 4TXWA 4YVSA 3U75A 5C71A 2OZ6A 4RHV1 1MPXA 2BVBA 4HK9A 1MQTC 1CZTA 1SHWB 2FCTA 4QDQA 5T55A 5C5TA 4IGPA 3SCFA 1BQPA 1JU4A 1ZBE3 2L9LA 3DXTA 3ELNA 3OB8A 4IESA 2O1QA 1GQHA 2ET7A 2VXRA 2RM23 2DVFA 3CJIA 4E8CA 4MV2A 4BQXA 2WIIB 3E6BA 3NJXA 3PLQA 4PDWC 1WMDA 1JTZX 3GZTB 1ASJ2 2X8KA 1XNDA 3FUQA 3LD8A 1QOOA 4PLMA 1S0EA 1XE8A 3JBG3 4NN0A 5I8TA 5CG8A 1K5MB 2IUWA 3I49A 3C7FA 3P3NA 2VMIA 4KGGA 4AE2A 1VBD2 4MGYE 3M2MA 4IV3C 4P00B 4E2SA 5I8YA 1CAVA 1FNZA 2EF6A 1LJ7A 3HVDA 3UK9A 1ZBA1 1KJLA 3ES1A 1G9AA 4LK7A 3RQ0A 2WT1A 5APAA 4ARXA 5IJRA 5A3OA 2RS12 5C4WC 2YU1A 1OA4A 3I3BA 4FPGA 3CL1A 2FMYA 4LKDA 4BIFA 3H1MA 3K2OA 1LKNA 1X50A 4C1XA 3TNQA 5FZ9A 1Y43B 4KI5M 5BPXA 4FXGB 5IWFA 3ZXKA 4N7UA 1RUJ3 4JTOA 1XQNA 3G6JB 3MIEA 3JU9A 5FY8A 4AFCA 2Z69A 2YROA 5A1FA 4QQ2A 3R4DB 4Y20B 2OKXA 3ZYFA 4MGTA 2HKXA 2VVFA 3KF3A 4KH9A 4WZCA 2YFUA 1CX4A 1UKGA 4GB33 5LB6A 1JH5A 1YFUA 5FZBA 5KBFA 1CIWA 4D6SA 4DZGA 3RDIA 1DCSA 2RMU2 1DGRN 4YFWA 2X5IB 1HKDA 1MZ5A 1V6MA 2HWF3 2HWD1 1LEMA 3ZFGC 5FDBA 2VUAA 1GZWB 2RVAA 1UW8A 3R05A 4EV0A 5FO7B 1Q56A 1ZZ7A 4UF0A 2PA7A 2D5HA 1H8VA 4JZRA 1US3A 1SPPB 3SMHA 3IKWA 3SXWA 1RB8G 1US2A 2GH2A 5LEJA 5LBEA 1ULDA 2W39A 1DYKA 1K5JA 1XC6A 2VQTA 3ZYPA 3WF4A 2IXHA 4RS5B 2EXHA 4J1XA 1ZA4A 3HWJA 4Y33A 4M4RA 1OQ1A 2AC1A 4NJ4A 2FDJA 2VCCA 5HCAA 4DY3A 1SMVA 4NWWA 1ODNA 3ZN4A 2ZGMA 3MLKA 1C8NA 1L7LA 2X09A 4FQZA 4A6SA 2K46A 2BBVA 2TBVA 1PK6C 2VNRA 1RHI2 4KG0A 4LBQA 1BHGA 1NLRA 2XBO3 4Q4V3 4XDOA 5FK8A 5KR7A 2PLV1 3V0AA 1L3JA 3S57A 4E27A 4Q0SA 4A3XA 3AMHA 4U2AA 3VBFA 1FPN3 2JJ6A 5GZDA 1HRV1 3RMYA 3HPNA 1J3RA 4CDWB 4DXRA 5HV0A 2ES3A 2HWE1 1YQ8A 1ZBE2 1C8M1 4DXTA 4Z82A 2R062 5JMOA 1H1MA 4IQPA 1LNSA 5KHJA 2AEZA 2FDIA 1W0OA 1XBFA 2GP5A 1BEV1 1XRUA 5DZEA 3ACFA 5GLUA 2A5ZA 1IS3A 2XVLA 1RUD2 1UY0A 2VOKA 5I8SA 4G4FA 4DINB 4BXSV 2OYZA 4ZZ8A 1PO13 1MEC1 1TME3 3JBG2 3OGSA 3UGGA 3WDXA 4LR4A 1Z7S1 1LOAA 3MF6A 4QX3A 4BQ4A 4FPYA 2LALA 4IV1B 4M0NA 2E26A 1GYKA 2P4EA 3AXEA 3H8OA 4NIIA 3RWNA 3LDRA 2C9AA 2B9UA 2CNAA 2XJUA 3ES4A 5C3SA 1AYM3 4GH4B 4H3WA 4PIZA 3I97A 1RIRA 1NCRA 2A6ZA 3WNOA 3POGA 4I3GA 5D8AA 5EJ1B 3ZYGA 5ACA3 4UYBA 1S0FA 2VECA 1AYN3 1HB1A 5LA2A 3KVBA 1IG0A 1SQ4A 3S0MA 2XHNA 4WBBA 1WD4A 1ZRRA 3OGGA 2PHRA 1RUJ2 2VL4A 4L99A 4UW5A 1RITA 3WR0A 2VOVA 4JDMA 1IKPA 4Q4W1 2YZ4A 3GM8A 3IN9A 5A3PA 1HW5A 3EB7A 1DQ2A 4HLTA 2ZGTA 1B35B 1PO21 4A3ZA 4QWNA 1LOBA 4YGEA 3RGBA 5DAXA 4DS0A 5FYSA 3S30A 1UMHA 3B5LB 4CU9A 4EE2A 1WA4A 1UY1A 1OVPA 4YW3A 1LGBA 4LORA 1QJU1 4UAPA 3T08A 1S2EA 1YIFA 2CTVA 3VBHC 2ZGUA 4XMAA 3HIFA 3WNKA 5EHDA 3I2JA 2CV6A 5FXVA 2ZHKA 3ETPA 3NKTA 3S7IA 3PMSA 4JV4A 5JIAA 4EWAA 2W94A 5T50A 1RJ8A 5D21A 4QDRA 4QU1A 4D94A 5D2AA 2WNUB 3WF2A 3VHOA 2EXJA 3OD4A 4HETA 4BQWA 4Y26A 2J1VA 4CEYC 5AC91 2VAUA 2A70A 2W87A 1AZDA 5FO8B 2FDFA 2Q8OA 4KBZA 4Y4YA 2DCZA 2GZWA 4JHTA 1KS4A 4ASLA 3J7HA 3MUZ1 1O3TA 5EJ3A 3T2TA 3WD5A 2I74A 4MHRA 5BYNA 1UZZA 3J8F1 4MVTA 4J1WA 3K4DA 2Y26A 1VP6A 5TSWA 1A3KA 1SFNA 3PL0A 3WY6A 1W6QA 4ASMB 1AR83 3N9MA 1GP5A 4J25A 3ZMNA 5CAZA 4CDQC 1UNBA 5FYUA 4DUVA 2WQZC 3MI8A 4LO6B 3TB0A 4XZPA 5C33A 5KWRA 3CEWA 1G86A 4LBQB 2EAKA 3O0VA 1YWKA 4X6RB 3V0AB 4S2DA 3BKZA 2V09A 3HN3A 3VBFB 2D3PA 1WA6X 4CDXC 1EV12 2A3YA 1EPWA 1VB2A 2IXKA 2RS52 1N1TA 3O14A 4GAZA 4XXPA 5AVPA 2IXIA 1BBT1 1TME2 2XXZA 5FUIA 4XOGA 2ZOEB 2JDNA 1WMXA 4Z8BA 4LBQD 1OF3A 1UYXA 4QPWA 3U4XA 4R4ZA 4IDZA 3SKJE 3THDA 3UL2A 1W2AX 1AYM2 5DDJ1 5FV3A 2B4KA 5CFDC 3MZHA 4W50A 2A3WA 2NPIA 3J4UH 4IE7A 4P14A 1CX1A 1PVC1 2K9ZA 1IS5A 4LKFA 1R1ZA 3HNYM 4YRDA 1UX6A 1AYN2 5C70A 1K12A 1HXS3 1UPIA 5GKAC 1U5XA 1AR61 1XNAA 3LA3A 4NMIA 2WNVA 3O1SA 2EIEA 2VZVA 3ASIA 2B8MA 2D6PA 3T4HB 3S6PA 3M3OA 1MS1A 1XYPA 3O1RA 1GR3A 1NA1B 5D8AB 2KXLA 1CWPA 1QJX3 3GZAA 4BDVB 4D7TA 3DV8A 3A0KA 3NNJA 1TMF2 5CFCA 3WNNA 1W9WA 1JOBA 1SLIA 2D93A 3QH6A 3VZNA 3ZOIA 4NIGA 3T4VA 5ANNA 1UYYA 2FBEA 1WBLA 3M4FA 4ITCA 3NSTA 2R043 4XJUA 4GJYA 1AR91 3NW4A 1JHJA 3FBMA 5A7PA 1APNA 5FZHA 2PQSA 4AAXA 1DF0A 1W8TA 2QCSB 2YU2A 1N1YA 3VHRA 2WDBA 4HMZA 2D6MA 3CMGA 4IUGA 5FZKA 4AI1A 3Q8FA 1JZ4A 4PF5A 5FJKA 4L0PA 1OFNA 1JOPA 1NXMA 2GH8A 1Q8OA 3WCSA 2R32A 2D6KA 1EP0A 1VAVA 3IMMA 2D5FA 4FPJA 4HN0A 4AEDC 4BH9A 4YSFA 4BIOA 2CWSA 3H7YA 2BW8A 5FTTC 1I6XA 1S2KA 4BCUA 5JPNB 5K9YA 1HJGA 3VL9A 5C9AC 1ND3B 2P37A 5A7QA 1RUG3 2Q8EA 1C4RA 3AP9A 3I2GA 1AR82 1HJFA 4EJRA 1FYUA 3MIDA 4HPKB 5AVAA 2RR12 1ND2B 4DXSA 2BGOA 4I01A 1VJ2A 1W6MA 4XFHA 1LGCA 1JUHA 3BOPA 5EJZB 5H9RA 3AFKA 3RZKA 4P9JA 4NHKA 1VRBA 4MADA 5BV6A 1GU3A 3T1LA 4JRAA 1W0PA 4CE8A 3EXUA 4PF1A 1AX0A 4XF0A 1D4VB 2BTVC 2R0FA 2V5YA 3DN7A 3BODA 1W2OA 4P9XA 5LK5A 4MGKE 3E5QA 3IIAA 5H9QA 4A45A 1F9KA 4XF4A 4ES8A 3LSEA 1CGPA 1UMIA 1FOD2 3WP5A 4ISRA 1X7NA 2GMMA 2WZ8A 2HWC2 1J84A 4IL7A 4QPGB 5FP8A 4AL9A 2XB6C 5G05L 5FY9A 2R7EB 4MXWB 5A6ZA 3ACGA 2DVBA 1QJY2 1GZ9A 1QXRA 3UETA 5T5PA 3VZJA 4FFHA 1V6IA 3H3UA 4JQTA 5JI7A 1OC1A 4CVUA 2BERA 4F8AA 5IVYA 1R091 3HT1A 5BNOC 4LUMA 3T30A 4LBLA 2WO3A 5JSPA 3ABZA 1GQGA 1OT5A 2C4XA 4PQQA 4OZXA 4WM8A 2EAAA 2WAOA 3CZUA 5HCHA 2AZ5A 1HQLA 1ULGA 2UURA 4INDA 1KGYA 2VMGA 1H8TC 1R64A 3FLRA 4AG4A 1P8JA 4LHKA 1W6PA 2WNVB 2MEV2 2R042 1H9WA 5FAXA 1C5HA 3VBUC 3M3IA 5FKCA 5FZMA 4Q8KA 1SFPA 1X82A 4O9EA 2MHFA 1RXGA 4RR3A 1OLRA 4QPIC 4WVMB 5IVEA 4RGGA 5DXDA 1PX3A 3VBOB 1NT0A 1W90A 1UQXA 3I2OA 5ISLA 1ZZ6A 3ZSEA 3BTZA 3ZXJA 4Y4RA 4COVA 4AQ6A 2Z79A 3POWA 2D6LX 5A33A 2QQPA 2WS93 1UY4A 3BTYA 2VQAA 4PI0A 5IFTA 4Y22B 3C3VA 2G4IA 2W5FA 5FMOS 1F4HA 3A21A 4XQ4A 1MZ6A 3VKLA 1D2QA 3VDBA 4FPOB 4YW4A 2ZX2A 4FAGA 5KC6A 2PHUA 5F5CA 1LHUA 4A42A 2OPWA 1QH7A 4MLOA 4QX5A 2VU9A 1D2SA 3FBYA 4P9LA 4XURA 3IBMA 3B3QE 2Y8KA 3H50A 1ZNPA 2VOWA 4FPKA 2ILMA 3WDYA 4KQ7A 5J1XA 1ZRIA 2BOJA 5IW0A 2WZR1 1ZA7A 2G9ZA 3DPRC 1NY72 3LGRA 3MIGA 4GWMA 1EY2A 2VQ0A 4LIUA 4RSUA 2W9XA 1GOHA 1W8UA 3GDBA 1H0BA 1W6MB 2ZHLA 3LB9A 2W95A 3I2KA 1A8MA 3POSA 4LEJA 5FOJB 4HBNA 1Q8PA 3PURA 2ET1A 5K0UC 1W3VA 1OPMA 1UF2C 4GMP3 3TN91 1PIV3 5EIYB 2HLEA 3WUCA 2F6BA 3FHIB 3JQWA 3KQ4B 5HXMA 1VRH2 4K8FA 3W59A 4EYUA 4KWKA 2WA3A 3HQRA 3I2HA 4QQHA 1XSRA 2VXJA 2A6VA 4CP9B 2G19A 5LATA 1NQJA 3AKTA 1XPWA 4PIYA 3VB9A 3ZSKA 4AVBA 3I2DA 2FCUA 1S0GA 2CGOA 3AB0A 2Q1MA 3HQUA 2ZZJA 4Q4X1 2WYFA 1O8SA 2D7FA 3N9PA 2FHRA 1QEXA 1MQTB 4XCAA 4WV8A 5FPAA 5IK4A 3BTXA 3SCHA 1JMUB 2DCTA 4I2OA 2E63A 5DMYA 3INAA 1GUIA 4I0WB 1HRI1 2KM2A 2WWUA 4QKDA 3WSOA 4BZ4A 2P34A 3GBGA 3ZFFC 5K8SA 2F17A 5DUVA 3POFA 3ROUA 1PNGA 2CWMA 2BDRA 4PDWB 3VZLA 4U36A 4DRRA 4IEPA 5FZFA 2WFF1 4Q1RA 3HBZA 4OFGA 3OF1A 3I59A 1LHNA 1MACA 3T0DA 4G9SB 4KL1A 4XJZA 5A32B 2OUJA 2WQ8A 5GZFA 4LOSA 4IV3B 2XQRA 3LPGA 3BIWE 1VBE1 3CBNA 3GALA 1POV3 3DF0A 3RJRA 4LO4B 3KB5A 3ZYHA 2WS92 1G8WA 3SLIA 5T5OA 5E6HA 1AXKA 1KQRA 3LA2A 3HBKA 4N43A 4QGLA 5C4WB
chains in the Genus database with same CATH topology
4WZFA 4X6QB 4XFGA 1Y9QA 2UYBA 4HK8A 2PHWA 4XPVA 3QLQA 1MS9A 4JGYC 3NV3A 3JD73 1H9PA 4B3NA 2FQPA 2GDFA 1EYBA 2BNNA 3HQXA 1YLLA 2ZGQA 4AHYA 4B8EA 1RVF3 2MPFA 2RS32 4AHZA 3NV2A 2DWRA 3EBRA 4RHV3 2JD4A 5H9PA 4GALA 5GALA 4Q26A 5T54A 2PN5A 4ISQA 3ZFGB 1YUDA 3AZVA 1BJQA 4YGDA 5EV7A 2NLRA 1PHMA 4I30A 5FQ0B 1N3QA 3DKWA 3MDPA 1AX1A 2C1FA 5JOZA 5DG2A 1ZYBA 1REEA 2E53A 4XYXA 4QM8A 4CDQA 3AKSA 4AVTA 1PK6B 1SDWA 3VBRC 3KSCA 3URFA 5BXXA 1Y7BA 1ZBA3 1V9U1 1X8MA 2QDNA 2P3IA 1FNYA 5BNNC 2GAUA 1SFYA 1GKBA 1QDCA 3U07A 1OHFA 3SISA 2VW0A 1AL21 2B7YA 1K5MA 1W2UA 4J6GA 4EN9B 4L8QA 4QM9A 2WT2A 1IS6A 4DB5A 1S55A 4UW4A 3WP6A 4PBOA 3H8UA 1DQ6A 2A75A 1JBCA 1KFUL 1NYWA 3BTAA 3ZXDA 3UKVA 1IOAA 2A71A 2HWD3 3H7JA 1GANA 1VBB1 5J98B 3VGIA 1URXA 1DGWX 2KA3A 1F5JA 2JXAA 5DUWA 3AXDA 3L2YA 2SBAA 1Q8QA 2EXIA 4EWDA 2XVGA 3G7DA 4XFCA 3IT8A 2X5IA 4FSJA 3ZYIB 2DTYA 3D82A 4KU8A 1RUE1 1GZWA 4K20A 1BK1A 1YXWA 2PELA 2DFBA 1J58A 3M1HA 4AGGA 4LE3A 2G9GA 2OW4A 3OY8B 1QOSA 1CJDA 3VBHB 2PLV3 2XLFA 1N3OA 1HRV3 3AYAA 1XNKA 4RS5A 3O7OA 2HWE3 4AVSA 3C2UA 4P9GA 2ERFA 5C8CC 1C8M3 2GNMA 1OMIA 2YMZA 3CO2A 2VW1A 1RUF1 2LTNA 3OBRA 4IERA 5J96B 2UY8A 4CEYB 2ZABA 1QQP1 4FPHA 3ZXAC 1QWRA 1MEC3 2TUNA 4GQ7A 4CDWA 1LOFA 1Z7S3 4M01A 2GN7A 4AQSA 1YCIA 1S1AA 5I0TA 1VAKA 1SBDA 3H3ZA 1B09A 1BVVA 4XIKA 4CDQB 2GU9A 2CYFA 2BWCA 4XF9A 1DLLA 3MYXA 3B02A 1EAH1 1VBC1 4IV1A 3SITA 1WLWA 4ATFA 2ZA9A 4Q4W3 4YZ4A 4E4DX 3H0OA 4Q2FA 4CDXB 4GH4A 3T1MA 1PMIA 4AF9A 3PVNA 1PO23 1R1A2 1COV2 2R0HA 2Z42A 3NL1A 1RUC1 1LECA 1N1SA 1ZX5A 2HWB1 3THPA 3B00A 3A0NA 2HWD2 2ZMLA 5CFDB 3U0ZA 1LESA 3RYKA 1QHDA 1ZZ9A 3PVBB 2D3SA 5LRRA 3R6SA 5IK5A 1B35A 4WM7C 2CGPA 1TE1B 4Q4Y1 4XHXA 1BMV1 1NCQC 4ATEA 5FBZA 4MXVA 5AC93 1AXZA 1N47A 1IQAA 5JSOA 5CIRA 4N53C 3TYJA 3J8F3 3X29B 1G9CA 5BNPC 3V0BB 3N4MA 4XXAA 2OIIA 2QZ3A 1ZZBA 4EN8B 2WNUA 4DRVA 4Q29A 2DVAA 5EYYA 3HD8B 3RG0A 1HRV2 2DU0A 3QH7A 3GZUC 1Q8VA 2ZGLA 4HN1A 4XDQA 4YGCA 3RMXA 1O4TA 1G9FA 2A3XA 2IFRA 3IPVB 1D4M1 1KFXL 5KXEA 4LBOA 5T52A 3ZXFA 3VBSC 4AVCA 1ASJ1 2UY9A 1PNFA 3J26N 3DGTA 4AEDB 4MX3A 5FRAA 4BMEA 5CNAA 3OPZA 4I0BA 1ENRA 1MEC2 4Y5Z0 4FQ4A 1O7FA 1S0CA 1Z7S2 5BNQA 3M70A 4PIXA 1DGLA 3WDUA 5C9AB 1FMD2 1Y3TA 4OHVA 4H55A 3IDCB 2W52A 2JG8C 2ZACA 2WQ4A 4GMP0 5DDJ3 4S2GA 1RL3A 2RS11 4QXKA 1PVC3 4BYYA 1H30A 4Q0UA 4AHXA 1U12A 3VZOA 5KXDA 4R9DA 4TWTA 3B9IA 5K0UA 2RM22 2JG9C 1WW4A 4N90A 4RQPC 4Q4W2 4YYOA 3WP3A 2H0BA 1DU3D 1A8DA 5JZGC 1Q8SA 1QXJA 1PO22 1QKQA 1AX2A 3QCWA 4K6BA 4ORFA 5KXBA 2RMU1 4TLFA 3NAPC 4KU7A 4OHXA 1AR93 4QMAA 3AFGA 3ILNA 3E6CC 1NA1A 3ILRA 3BALA 3KD4A 4B7EA 1OA3A 4TYSA 5F6KA 5BNOB 3ZFFA 2A6XA 4YG6A 3WLUA 2WJSA 4AW7A 4YZ2A 1LOEA 3J8F2 1POV0 2SLIA 1WW7A 5J36A 2DURA 4GB32 1RHI1 2PTMA 1FV3A 1H8TB 1HV1A 1NE4A 2CAUA 1C28A 1LHOA 4MYEA 3MLJA 3AKPA 4DPNA 1YFWA 3LCPA 2ZX1A 1PGSA 3VBUB 2HWF2 1MZEA 3WDVA 1ZBE1 2BYVE 1W6OA 2R061 4AK3A 4AFBA 4YM0A 4F3JA 4QPIB 2NZ9A 3AP4A 4FVVA 2YGMA 4M00A 5F9TA 4YGBA 1ND3A 4CDUC 2QKDA 1LGNA 3V64A 1RUD1 5FLJA 1A78A 4YW2A 4HPKA 4XFIA 4A7KA 1SLCA 5CADA 1ND2A 3S7EA 4CEWC 2PHDA 4Y1ZA 4HVRA 1YI9A 1FI2A 2Z2SB 1O91A 3OD0A 4XTMA 3RSJA 1UKRA 2XBO2 4Q4V2 3O12A 5JI9A 3ZFEC 1XXNA 1FPN2 1S0IA 2DU1A 2YV8A 2IXCA 2O0OA 3ZSLA 2BFUL 4NVPA 3KT4A 4I3PA 1R093 4YG3A 2TNFA 3IMNA 2WLPA 1IHMA 3DPRB 4COYA 4QQLA 4QPGA 4Y1UA 5JAXA 3B7MA 1OFSA 4MXWA 2ARBA 1PO12 5K0UB 1OOPC 2Q30A 1NLSA 2A6WA 5IUQA 1AL0G 4Y24A 4Z2WA 4COZA 3AMPA 4XW3A 1LHVA 2AGSA 4L11A 4QGNA 1CESA 4AI3A 4GIQA 1F5FA 3MIHA 5ACA2 2YYOA 1G7YA 3H1YA 2E7TA 5BNNA 4CTEA 3N7LA 3ZSJA 4MGZE 1IZ3A 5KHHA 2R1DA 4Y1XA 4HSLA 1E57A 2DCYA 2WSVA 3IM0A 4S2HA 1D0HA 1OLQA 3WG4A 4YVWC 5EXOA 3N35A 1X36A 2R1BA 4JAAA 4BWOA 1Z0HA 4UBGA 1JYIA 4WVMA 3PNAA 3ZFFB 3ZO0B 3VBOA 3MW3A 1NE6A 2JKBA 4IEOA 2VPVA 4GXLA 3MPPG 4KBBA 2OA2A 3UJOA 1YJKA 2RJLA 1GICA 1H1IA 1QMJA 4XFFA 4IEWA 4CP1A 4E4ZA 1NOVA 4Y22A 4OUMA 2WZR3 3AJZA 3ALQA 1EV11 5CG9A 2RS51 1YHFA 3MFCA 4HVOA 4LLFA 5HXVA 1RMU3 1W6OB 5FPZA 2PAKA 1DQ5A 2YY1A 3WG1A 3WW1A 4HSJA 1TEIA 2K0GA 2JICA 4AFDA 2H0VA 1AYM1 3WZ1A 5HCFA 1BKZA 4GKYA 3QBQA 2ZGOA 4JGYB 4E2GA 4OI0A 4LHLA 2XJSA 3WQ7A 4AQTA 1RTVA 3MIBA 1R092 5CVRA 2XG3A 4MZUA 1RGSA 1G9BA 1DZRA 4HZFA 4Q4X3 5EYXA 1IGOA 3VDDC 3VKOA 4DMIA 1TMF1 5DG1A 1UPSA 5JDBA 1CR7A 3SH3A 3W58A 1AHSA 1RUH1 1VB4A 3QD6A 1Z78A 1CAUA 3VHNA 1HRI3 3B01A 4YM2A 3VUOA 3WXPA 2B42B 5EZWA 2D44A 3ZN6A 2OPKA 2ZX3A 1AR71 1WCSA 5JVVA 2YXSA 2RHPA 3AP5A 4YVSC 3IDBB 4OULA 3LOIA 1MQTA 2XLAA 3KQRA 4JGZC 1ALYA 2XJVA 2EALA 2WFF3 1CN1A 2D43A 4OLLA 1HXS2 1ONAA 2ETEA 3ST7A 2XUMA 2UWAA 4H14A 4XF3A 1UL9A 1VBE3 4SLIA 1WD3A 4Q0QA 1QNWA 3VBRB 2WA4A 2IC1A 1VBA3 2ZZQA 1QJX2 3R4UA 5DZFA 2ATFA 1PGL2 1OI6A 3CJIC 4PDWA 5CA6A 4XQWA 5BNNB 2DF7A 2HEVF 2OZJA 3I4IA 4ZXKA 4GKXA 2ZGKA 4PBPA 1CJPA 3ZYRA 1KS5A 1X33A 5A32A 2VNOA 1MVEA 2RR11 2PHLA 4IEVA 3ZSMA 4I09A 1NXD1 4IV3A 1OKQA 4C90A 3VL8A 4AVAA 1S2BA 2ZHMA 4DNYA 4AHWA 2NYYA 5C4WA 2WZR2 4GA9A 3USUB 4XMIA 1ZREA 1RMU2 1JN2P 1NCQA 2CL2A 4NHMA 2W0XA 5A3LA 4YLZA 5E16A 4B4RA 1FOD1 1QXPA 2HYKA 1YI7A 4PLNA 4JC1A 2HWC1 2AH2A 3K51A 1RUG2 5BNPA 1T6GC 1HDKA 5C8WA 2OVUA 1QJY1 1LOCA 4NHLA 1LCLA 1J1LA 1SACA 1XNBA 2B39A 5IK7A 1GNHA 1H4GA 1V6LA 3AK0A 4QU2A 5L7OC 1U5ZA 5GZEA 3ZFGA 5L36A 3N7JA 4BM8A 3NWKA 4N7IA 4OHZA 4META 4CP2A 4XTPA 3EHKA 2NMNA 5I0UA 4B4QA 1SLBA 1V9U3 4FPCA 4H7LA 5C8CB 2AYHA 2MEV1 3LWCA 1AL23 1YFYA 2DUPA 2HEYF 2JG8A 1PK6A 1V6KA 1Q3EA 4NR1A 4ES9A 1UD1A 3BOWA 3E5UA 1CAUB 3M3EA 1BYHA 3ZN5A 1ULEA 4AFMA 1HIXA 3ZN6B 2FZ2A 1VBE2 2E7QA 4FPFA 1VBA2 3GBWA 2XJTA 3NKGA 4FOVA 1VBB3 2JE9A 2DCJA 2JE7A 3BPZA 1CPMA 1W6NB 4HL0A 4K7JA 1RUOA 5FMOL 2GC1A 4G3YC 2GC3A 1WCDJ 3H1WA 2Z5WA 4FCAA 3AMNA 4C0BA 4C91A 3R4SA 5I0RA 2UYAA 1PZ8A 5F6LB 2NQYA 4COUA 2PHXA 1NY71 4XEZA 4AGRA 1HQWA 1NCRC 4Q8LA 1UU4A 4W6WA 5KXCA 1AJOA 4YNIA 3MICA 4BMBA 2ZKLA 2PQQA 1AF9A 4MSVA 1W39A 1VRH1 2D97A 4WM7B 5K7PA 1VAMA 2ZKNA 1DQ0A 1I9RA 4LBMA 1H1AA 4W65A 1NCQB 5FCCA 2XPJA 3ZXLA 3D5OA 3AYEA 3SCGA 1QQP3 2BQPA 3OY8A 3VBHA 2XJPA 2WNEA 1LU1A 5JOWA 3KGZA 1UIKA 1ENQA 2DYCA 4N53B 4YFZA 5GZGA 5AFBA 2D3RA 4CP0A 5BNPB 1CAWB 2DTWA 4RGAA 3VKMA 2YC0A 1LENA 3ATGA 4CDUA 2VY0A 4OHYA 3V56A 3OJBA 3RI8A 4CEYA 4DY5A 1JYCA 4XFBA 2ZAAA 4XF1A 5IT6A 2BEOA 5CB7A 3WW4A 1PIV2 3QOPA 4CEWA 1OSGA 1EAH3 3VBSB 1VBC3 3VKNA 4CRQA 1GSLA 2ZHNA 2XHKA 1CONA 1QOTA 1AJKA 4YZ5A 3NVCA 2ARXA 2DVGA 1G9DA 3SH4A 2W68A 4WVZA 2O8OA 3JZVA 1RUC3 2DVDA 4SBVA 2HWB3 1SLLA 2JG8B 2PHTA 1LHWA 2ZTNA 2XGXA 1WLCA 4K21A 4AQ2A 3HN1A 1YNAA 5LEKA 1YRZA 3GHNA 4BHPA 3LSDA 4CDXA 1RUI1 3AJYA 4M3CB 2IXJA 2WLQA 4Q4Y3 2PAEA 1RUNA 2JG9B 4RQPB 3FFQA 1OOPA 1J3PA 2WFPA 3L2HA 1HLCA 3AP7A 1EPZA 5JZGB 3MLLA 4P9WA 5CFDA 2IZWA 2RS31 1DDLA 1QF3A 4EN0A 4Y1YA 3LA7A 3I7DA 4Q27A 2EA7A 2LM3A 3LZZA 3NAPB 4NOTA 5GM0A 4R9CA 5SV5A 3O0WA 4LO5B 1KITA 3KMHA 3U11A 2E9QA 2A73B 2G9FA 4Z1VA 1D4M3 4URTA 3NV1A 1KRIA 1V6OA 2X29A 4LULA 3WQ1A 3V0BA 1S0BA 3RPQA 1QQP2 3HT2A 5CFCC 4WVWA 1MVQA 4BE3A 3JD72 3TWIA 1FXZA 5SV8A 4DXZA 3MF9A 4AEJA 1RVF2 3B93A 4AXOA 5JLVA 2CY6A 2Q5TA 3IPVA 3BCWA 4LUKA 4D3WA 4RHV2 4A2UA 2XKOA 3KT1A 4DFSA 2NMOA 1YO8A 2R071 2WC2A 4N9IA 2RS13 3AYCA 3VN4A 4AEDA 1R081 1ZZ8A 2A6YA 2GNDA 2HEWF 5C9AA 3POYA 4CDUB 2QE3A 4DOUA 1BEV3 4YZ3A 2ZGSA 3M3CA 1LU2A 1PGW1 5HI0A 5B2GB 2BGCA 3D4KA 4IEYA 1XYOA 3WHUA 2JENA 1V6NA 2K2SA 3ZXGA 3LKJA 4LT5A 4E2QA 4NWVA 2JDZA 4CEWB 2YDEA 2PFWA 3W9AA 2RMU3 2R30A 4I0AA 3USSA 3N3HA 3JCIA 4K9SA 3TRSB 5I93A 4H7MA 1ZBA2 4TZDA 4R8HA 3ZFEB 4XJ9A 3PVOA 2ZBJA 4K3UA 3JB4C 3KCXA 1KD7A 1MS0A 3KCYA 1ZVFA 4YW1A 2VULA 2ZX4A 4LNVA 4Q4Y2 1UN1A 1DQ4A 5GZCA 5C6CA 1WW5A 1H2MA 3AZWA 2DFCA 2VNGA 3NJZA 4NPRA 5J7MA 4FBFA 4A7ZA 4B4PA 4JGZA 1RHI3 2A7AA 1OOPB 4L2NA 1QJU3 3WT3A 1C1LA 5BNOA 4JTNA 2AUYA 3K48A 5BY5A 4AEMA 2UU8A 1UZYA 2R063 4MGIE 1D4M2 4Q0VA 2HJIA 4D7SA 3GHMA 1O5LA 4JDOA 4QGMA 4WM8C 4XIOA 5JR7B 4M3CE 1H8TA 1NZCA 2WZPP 3VKFC 3N36A 1RUD3 4RFT0 3B94A 4JDNA 5BUVA 4P9IA 3VBUA 4YVWB 1HQNA 1V70A 2P17A 3WCRA 2E6VA 3WG3A 2Q0AA 4HT1T 1XE7A 3JB8A 4QPIA 4RR3C 5ABJC 1I5ZA 2EXKA 1UU6A 2P3KA 2PLV2 3FWEA 1XU1A 1UCXA 2QJVA 2HWE2 3VV1A 5I0SA 1C8M2 4MH0E 1IPKA 1WLTA 2VMHA 5DUUA 1OQEA 1BEV2 2VUJA 4FPEA 3RI9A 3WVJA 5FOBB 4Q1PA 2R49A 2E51A 1R1A1 1COV1 2R16A 1SBEA 3TBDA 1BBT3 1SCSA 4TSVA 3MPBA 3VZKA 1DYPA 1VBD1 5L7OA 4EN6B 3V65A 4FAHA 4BLJA 4AGVA 3DPRA 4PQ9A 5GJ6A 4XETA 3Q9OA 2EIGA 4BPZA 1REFA 1WW6A 4LBKA 1C5IA 1DZTA 1QDOA 1AR63 4D69A 3P3PA 3KM5A 2DUOA 1LB2A 3WP4A 2XWBB 3VDDB 4QD2A 3WUDA 2DCKA 5EWSA 1YFXA 2VVDA 4LA2A 4RA0A 1DIWA 3SH5A 1QJU2 4YM3A 1C1FA 3WDTA 5D1IA 5KHGA 3UKTA 4KWLA 3B69A 2QZ2A 4JVAA 5J48A 1O3SA 3BU7A 1U5YA 4YVSB 4JGZB 1XYNA 3GBFA 3FUOA 3TAYA 4V1PA 4FTEA 1ZRFA 2VH9A 3FLPA 5JCTA 3TOJA 1MS3A 5AC92 1TQ5A 2ZGRA 2ZCWA 1EV13 4FPLA 2RS53 1LOGA 4EWEA 4IEXA 3FC0A 4O9GA 1FMD1 1GBGA 3CJIB 1O4ZA 5KHIA 2XVKA 3ACLA 3AZZA 1GFF2 3HR9A 4AYUA 5T5LA 2JX9A 2BFUS 1DGWA 1SCRA 4XHBA 3RJ2X 1AUYA 2D98A 1WBFA 4IEQA 1AVBA 2RM21 1CAVB 4LBJA 4C0HA 3VLBB 1XNCA 4XILA 4N43C 5CBLA 1SEFA 2VW2A 1JXNA 3CNAA 1N1VA 5FO9B 3KLSA 1ENXA 1TMF3 1BBT2 3JBG1 4JGYA 4FTBA 1CQ9A 1ZZCA 3MEPA 1RUH3 2N7GA 4WVVA 4HKWA 1MS4A 3ZMOA 1CVNA 1OA2A 4HANA 5DDJ2 2XL9A 1DZQA 1AR73 4FTSA 2VG9A 1MZFA 5E89A 1QU0A 1PVC2 1PM7A 3UV9A 5L7OB 5HBAA 1AR62 4XE9A 1RUJ1 2QFEA 1KJRA 3JQXA 3CU7A 1QGLA 3ZIWA 1AXYA 4IXLA 3MFAA 4GB31 4GULA 4K1YA 2ZPXA 1VALA 2NN8A 4R9AA 4LHNA 3R0RA 2IFWA 2HWF1 3D6EA 4XJ8A 1DGRA 2RR13 1AR92 1GLHA 4ONUA 4GWNA 3VBRA 1O4YA 4ZU4A 1DG6A 2QDRA 1WUVA 3APBA 3AYDA 3AMMA 4IEUA 1ZRDA 3AMQA 1DHKB 4COWA 2ENRA 1K5MC 1FOD3 5KHKA 5LRSA 4HVQA 5JWPA 2RJKA 4X8PA 4XBQA 1CPNA 4AI8A 2HWC3 2XBO1 1IS4A 3ECQA 3ME2A 3N7MA 4Q4V1 3WHTA 3EJKA 3PHMA 4LA3A 4X8NA 1QJY3 2JECA 1FPN1 3USUA 2B5HA 1RJ7A 1H2KA 2FZ1A 2AREA 3L9JT 3WG2A 1G6NA 1OD5A 3CLPA 3DL3A 3WV6A 4YARA 1NCRB 2DUQA 1RC6A 1OPOA 4OVEA 1YIPA 3B9CA 1PO11 4FOYA 1TME1 5EFUA 1D0GA 4JRLA 1RUH2 4FP3A 2MEV3 3TN93 1N3PA 2ZX0A 4HFSA 2X5IC 5FLIA 4FXKB 1S0DA 4QPYA 4XJWA 2CAVA 5DUXA 4ZU7A 1AR72 3WOGA 2BNMA 2B46X 5ACA1 1BZWA 4HKLA 1M06G 5FREA 1AYN1 4FOQA 3RYPA 3D0JA 1HX6A 5LK7B 3ZVXA 3H9AA 3ETQA 4RS5C 5C8CA 3VZMA 4QT6A 3OBTA 2QUOA 2QNKA 1F31A 4S2FA 3HAGA 3BB6A 2GALA 3AX4A 3UJQA 1RINA 3ZDSA 4XFAA 2AENA 5E1RA 4R4XA 1V00A 1ZM1A 5JMCA 3AZXA 1QNYA 4XBLA 2PHFA 1VLNA 4CDWC 2TEPA 1LOFC 1MS5A 1U5IA 1ULCA 4Z92B 1SLAA 1LULA 4JQRA 4P5HA 2B45X 2PAMA 4B29A 5J3UA 3ZX7A 3FFZA 1O5UA 1W6QB 2O8QA 3ZPYA 1UMZA 3WW2A 2CGNA 1JUIA 4ZU5A 2XJQA 3AP6A 1W6NA 5F5QA 5JOYA 3FX3A 4P9YA 1J1TA 1YYNA 4AEKA 3DUIA 1HV0A 4QQPA 4IV1C 2XL7A 1FAYA 5J09A 3O0XA 4RL7A 2GNBA 3FLTA 1VRH3 4GH4C 1VIWB 3TNPB 1J59A 1F2NA 1QH6A 1AR81 3UKNA 3OCPA 4EROA 1NG0A 4Q0PA 3FJSA 4PLOA 1S0JA 3RS6A 1LTEA 2VGDA 4LBNA 5A3MA 3FE5A 4XQDA 4FT8A 4LE4A 2YUEA 1GNZA 4R52A 1CD3G 3THTA 2DV9A 2ZS6B 5DZGA 5L19A 4WM7A 5GLZA 1B35C 1CAXA 2GN3A 5GLVA 4OI2A 3IWZA 1X8EA 4YG0A 2MNGA 3J9SA 4IEZA 1KDKA 4KWJA 3WINE 3TN92 5L73A 3OTFA 5JOXA 4N53A 2C0ZA 4FP2A 1CAWA 2IXLA 5ABJA 5CFCB 4AI2A 4KG8A 2GMEA 5I91A 2WNUC 1HXS1 1JW6A 2X53S 3ZXEA 1PZ7A 1Q5OA 2GC0A 1FATA 4Q4X2 4AVVA 4OI1A 3SNMA 2E7AA 5FPXA 1QJX1 3VBSA 3LAGA 1PGL1 1BXHA 2BWAA 4N9HA 2BPA2 3D8CA 5T3NA 1QY4A 3ZIXA 3CF6E 1RUI3 1TNRA 1H4HA 1HRI2 1TNFA 3SHRA 4D7YA 2F4PA 2R041 2YPJA 3ENRA 2H6BA 2WT0A 3M3QA 5FFOC 2NP0A 5H9SA 1YJLA 1C3HA 3HMYA 3I54A 2RS33 2WSUA 2WFF2 3LOBA 1NQDA 2P2KA 3A4UA 3MW2A 3FZ3A 3VBFC 2P3JA 3WNXA 2Q4SA 1RMU1 2BNOA 4OUSA 1UU5A 2WKKA 4M3CA 2ZAHA 1FX5A 2JG9A 4RQPA 1ZRCA 4A7YA 1IPJA 5F1RA 1WMEA 3QACA 4L97A 4PJYA 5JZGA 3E5XA 3EQEA 4XBNA 1QJZA 1RUG1 4E9KA 2GC2A 3IDEA 1I3HA 1REDA 2BVVA 4KNCA 4E4SA 1O3QA 1C57A 3OYWA 1WLDA 2XLGA 2C5DA 3NAPA 1SLTA 5JIUA 3E6DA 1WCKA 2ZMNA 1FT9A 4LTAA 1RUE3 2QVSB 2YHJA 1ENSA 1SBFA 1NA1C 5D8AC 1OQDA 4BQ1A 1BVP1 2R073 3GNEA 4QHBA 4BOWA 1KXGA 2LUWA 2VOXA 1R083 1DFQA 2R6QA 2RE9A 2ZJCA 4LO8A 3NO8A 2VVEA 3PJYA 1WMFA 4WM8B 2EVXA 1CAXB 1RUF3 2XWJB 3MIFA 1I1EA 2GMPA 1W6PB 4C1WA 3MGUA 1PVXA 4R9BA 4IETA 3AM2A 2I45A 4NO4A 1M4WA 4EN7B 4YM1A 2Y38A 4XJAA 3AZYA 1IKQA 3N7KA 1BCXA 1VBA1 4RR3B 3CJXA 5AFEA 5ABJB 4F83A 4RD7A 1V6JA 1A6CA 4K1ZA 1ND3C 1V9U2 4UXAA 1ULFA 1RUI2 1LRHA 2UWBA 3PVEA 5CU1A 4FOWA 5A33B 1AL22 3GF6A 2W08A 3WW3A 3RYRA 3WDWA 3AKQA 1ND2C 1JHNA 5J37A 4QQOA 2I2SA 3VHPA 5JSRA 3ZFEA 3KZ4C 1XU2A 5IK8A 5T5JA 4M3CF 1LR5A 3I8TA 2WS91 2Q1ZB 2ZGPA 4Z07A 3ILFA 1DQ1A 4L9BA 1VBB2 1LEDA 5GLTA 1PZ9A 4QPGC 3WQ0A 3GYDA 4W6YA 1GV9A 2JEMA 4F7ZA 2ZMKA 4BA6A 2PYTA 4AWDA 1FV2A 4PCRA 1GZCA 2FMDA 2H6CA 1RUE2 3MW4A 4OHWA 1UIJA 3M7AA 3D0SA 3OYWB 4UBHA 1KDMA 1VR3A 3PMEA 2R072 1H2NA 5GLWA 2XKPA 4Y1VA 4GMP1 1PIV1 1R082 1H2LA 2WNVC 3WX5A 2D6OX 4YVWA 2YGLA 1RUF2 4YW5A 3KGLA 1PGW2 2Y0OA 2D6NA 1F8VA 4FO9A 1ASJ3 2WWSA 4OI4A 2GNTA 1LODA 2BUKA 3VBOC 1R1A3 1COV3 4KGQA 1VBD3 1JOJA 4M0HA 5JPMB 2NM1A 4YZ1A 3I59B 2D40A 4W6XA 4Y20A 3OGJA 2WL1A 3O5SA 2XJRA 4UW3A 5E88A 4DQAA 3M8LA 3RNSA 3NV4A 1EAH2 1VBC2 4N43B 4LO7A 2WINB 2IWGB 5KC5A 1MR5A 1J3QA 3RZZA 4ZKTB 3PJQA 4K40A 1RUC2 3EO6A 1POV1 1U0AA 3RRDA 1DBNA 2HWB2 2V73A 3FMGA 3KT7A 2I07B 2OUHA 5E8AA 3JUUA 2AR6A 3E97A 3U10A 4L92A 3VDDA 4CYDA 4UW6A 3AKRA 5FLHA 4AFAA 2ZGNA 3ZYJB 1BMV2 4MUVA 4B7KA 1Q43A 3JD71 1MS8A 4I02A 3KS7A 5HCBA 4AI0A 1RVF1 4JCKA 1UAIA 2GSYA 4CZSA 1FMD3 2UWCA 4HKOA 3KCCA 1WGPA 2XH6A 4LLOA 4E2SA 2Y0IA 3PTYA 4YVSA 2OZ6A 4RHV1 2BVBA 4HK9A 1MQTC 5T55A 3SCFA 1BQPA 1ZBE3 4IESA 3ELNA 2O1QA 1GQHA 2ET7A 2VXRA 2RM23 2DVFA 3CJIA 4MV2A 2WIIB 3E6BA 3PLQA 4PDWC 1WMDA 1JTZX 3GZTB 1ASJ2 2X8KA 1XNDA 3FUQA 1QOOA 4PLMA 1S0EA 1XE8A 3JBG3 4NN0A 5I8TA 5CG8A 1K5MB 3P3NA 2VMIA 4KGGA 4AE2A 1VBD2 4MGYE 3M2MA 4IV3C 5I8YA 1CAVA 1FNZA 2EF6A 1LJ7A 3UK9A 1ZBA1 1KJLA 3ES1A 1G9AA 3RQ0A 2WT1A 5C4WC 2RS12 1OA4A 4FPGA 3CL1A 2FMYA 4BIFA 3H1MA 1LKNA 1X50A 4C1XA 3TNQA 1Y43B 5BPXA 4FXGB 3ZXKA 4N7UA 1RUJ3