1F35A

Crystal structure of murine olfactory marker protein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
162
structure length
162
Chain Sequence
b'AEDGPQKQQLEMPLVLDQDLTQQMRLRVESLKQRGEKKQDGEKLIRPAESVYRLDFIQQQKLQFDHWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPAAIFWRKEDSDAMDWNEADALEFGERLSDLAKIRKVMYFLITFGEGVEPANLKASVVFNQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OLFACTORY MARKER PROTEIN
molecule tags Signaling protein
source organism Mus musculus
publication title The crystal structure of the olfactory marker protein at 2.3 A resolution.
pubmed doi rcsb
total genus 36
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06554 Olfactory_mark Olfactory marker protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.390 Mainly Beta Sandwich Jelly Rolls Olfactory marker 1f35A00
1JODA 1F35A 1ZRIA 1JYTA 1JOBA
chains in the Genus database with same CATH superfamily
2X5IB 3DECA 3E6DA 3PUQA 4SBVA 5A70A 1OH4A 4AFMA 1POV3 5GLZA 2P5BA 5HPOA 5A1FA 2Z79A 5H9QA 2A6VA 4W6YA 5ISLA 1IS5A 3Q8AA 4M4RA 1W0OA 2W1WA 2BNMA 1LOFA 1QU0A 1W2TA 4YG6A 3USUA 3WF1A 3J7MA 2R0FA 3I2HA 4GQ7A 4Y4RA 1OXCA 5F2WA 1ZZCA 3LEKA 3UV9A 1CJDA 1OHFA 3PIJA 4PLOA 4PLMA 3ITQA 4XPVA 3W58A 3KVBA 2Q8EA 3LDKA 4G4FA 3OY8A 5EQUA 5KR7A 1Y9QA 3VDBA 1O4TA 2UY9A 4N43B 1DGRA 1CPNA 4NIGA 4JDMA 3SH4A 2ZX0A 5CBLA 1V00A 3X29B 3PUSA 4F3JA 3VBRB 4FPCA 3IT8A 1RITA 1MS8A 4XMIA 1XU1A 1YO8A 2WBKA 5FUNA 5FZKA 3M1HA 3QOPA 3S30A 3GHNA 3OUJA 1COV2 4IE5A 3CBNA 1J3PA 4IE0A 2XPJA 2J1RA 1NXMA 5IVBA 2BFUS 4JDOA 2JE7A 2QVSB 3JQXA 5KXBA 2FMDA 1AR61 4BISA 5FWJA 1HB1A 2XHNA 1DF0A 3OTFA 4L97A 4MSVA 2VVDA 3RI8A 2ADDA 4S2HA 3I54A 2XB6C 4OHXA 3UGHA 5IK5A 3NV4A 2YYOA 3RGBA 1OFSA 3KD4A 3ZLIA 4CP1A 2D6LX 3VD7A 2X8KA 4QM9A 3C7OA 1WKYA 5FZ1A 1S2KA 3VD4A 2ZZQA 3FN9A 4B7KA 1R091 4AFAA 3VBOC 4AI1A 1YNAA 1DP0A 5FO8B 5HV4A 4DUWA 1LOCA 5A6XA 1W6QB 5JZGB 3B93A 4B4PA 3O0VA 5DG2A 3LWCA 1U0AA 3OPWA 1VBD2 5BXXA 2OA2A 1X8EA 1RUI3 2A3YA 1C28A 3P6BA 1F15A 3ZOIA 1K5MA 3T1MA 1VBA3 1HB3A 2JJ6A 1CZTA 2PHXA 4CDQC 2ORXA 4IERA 3N9PA 2G1MA 2C4XA 4CEWC 4P02B 1NAEA 3IDCB 2R0HA 2R042 3AZVA 1UZWA 4Q4W2 4AHXA 4COUA 1BBT1 1N47A 3HAGA 1S1AA 5FZCA 4CCNA 1G9AA 4CUGA 1J58A 1W2OA 4LKEA 5A33A 3VD5A 5F9TA 3U75A 5C9AA 1OOPC 4GB31 1S0GA 4R9CA 3N9LA 3E5QA 3DYOA 3ZFFB 2E7QA 5SV5A 1XNBA 3AXEA 1V6MA 1S2BA 3ETPA 1SBDA 2CNAA 2ET7A 2JKXA 2HJIA 2R061 2X5IA 4UFKA 4UW5A 5JMOA 1G9CA 1KRIA 3ZXKA 2A75A 5LRRA 4A6OA 4XJ8A 2P3YA 4NIDA 2C5DA 1ZBA1 2XLAA 3O1OA 3L2HA 2A5ZA 3A21A 2F6BA 3EYPA 3WEZA 2D44A 5A6QA 3MV11 3VL8A 4MV2A 4LBKA 2PHUA 4B8EA 1GP4A 5C9AB 4AZZA 1CGPA 3B3QE 4ZHNA 3JBG1 3M70A 5A3UA 4Q8KA 3OGSA 2DF7A 1HB4A 4E27A 3PLQA 1ND3A 3PMSA 5J96B 3MF9A 2E31A 1LGNA 4BPZA 4CDQB 5FMOS 1LULA 5ACA1 5JXIA 1ZRIA 3MICA 5K8SA 4KI5M 3WG4A 3ZYPA 3ZPOA 2DUQA 1TE1B 2QQVA 4N8MA 5LK5A 4AG4A 1C57A 3AP7A 4Q4V3 2ZGMA 4K3UA 3HR9A 5FBJA 4HSJA 1XE8A 3AFGA 3D5OA 5CYYA 3VBSA 4QQHA 4ONUA 4MHRA 4AYUA 4FSJA 1SG3A 4I09A 4NAMA 3WF3A 4BLIA 4BK5A 4UXAA 4YW5A 1TNRA 3GDBA 4S2GA 4YWAA 5FZGA 2OYZA 1SLTA 4AEDA 4CDXB 1UYXA 2Y34A 4NJ4A 4H7LA 5FPLA 2ERFA 1YFXA 4YW7A 4Y20B 2JDAA 3H50A 5A7QA 1NYWA 2RDQA 4JX0A 5FJHA 2HWB1 4QPIA 1H9PA 1AR71 1RUE1 1UCXA 2W91A 4GXLA 5LY2A 1JBCA 1W6PA 2LUWA 2Q8OA 5F5IA 1Y43B 3U07A 1BVVA 4YW6A 2ZAAA 2YB7A 1OQ1A 4KWKA 5JVVA 4AQSA 2X10A 2CAVA 1URXA 4FQ4A 4AEMA 1HB2A 4KGQA 5IATA 5K7PA 5F5AA 2DTYA 1ODMA 1OLQA 2VUAA 3AYEA 4LE3A 2RJ2A 4QHZA 3ZIWA 1S55A 2ZGKA 5F5CA 5T5PA 1STMA 2W1UA 3ZYIB 1AR82 1AZDA 5GZEA 4RHV2 4DO0A 4XACA 2Q1ZB 5J98B 3ZM8A 2WNUB 5A1AA 4XXPA 2RS12 3I2GA 2J1AA 1GOFA 1DZQA 2XUEA 3RDIA 1VIWB 5J36A 3I3QA 4K8RB 4WM8A 2JDYA 2QQMA 4L2NA 2QQKA 3K4ZA 4CP0A 1DDLA 5JMCA 2R49A 1VPHA 1GKBA 2BWCA 2WQ8A 1H8VA 4IEYA 3ZXAC 1JHJA 1F9KA 2RR11 3DF0A 5F8PA 2BQPA 1ZM1A 2RM23 4OYUA 1D0HA 1REFA 2WLPA 2X29A 2WZEA 4CDWB 1KFUL 3FL7A 1MEC2 1NZCA 3LKJA 4LUMA 1W99A 3QH7A 4YW1A 4UF0A 1OUXA 4F7ZA 3C7EA 1NCRC 3N3HA 2A70A 3PVNA 3RS6A 4AVAA 3K46A 2WIIB 1J59A 5C33A 4WV8A 3ZIXA 4MGSA 4JQRA 4IGPA 4EN0A 4FI9A 4GH4B 5IFTA 4N53A 3LFMA 3RYRA 3BOPA 4CDWC 1PZ7A 1GMMA 5EJ3A 4C90A 3POSA 4AW7A 2W3JA 3H0OA 3R0RA 1ENXA 3NJXA 2CGNA 1XOYA 1W6PB 4YVWC 2J1TA 5FYCA 2J1UA 1D4M3 1HN1A 3RZHA 1VBB3 1JOBA 3ZXGA 4D6RA 3KSCA 5DZFA 4I3GA 4DS0A 2XDVA 3OBRA 4IEWA 1XNAA 1JUIA 4BOWA 5KXCA 2ZXQA 2HWD1 4FPOB 1K3IA 1JS9A 3KHCA 2WYSA 3IKWA 2VZ1A 3W5MA 2VZSA 1X9TA 4FXKB 1W0PA 2AEZA 2OVUA 4LOTA 3GCWA 4IE7A 2XBO3 5KHKA 4HKWA 1GNZA 2FD8A 2XGXA 2VW2A 1F31A 4D3WA 3SITA 2YU1A 1YI7A 3WHTA 1QDCA 3A23A 4I2OA 3EHKA 4CDQA 1GV9A 5I0TA 1AYM1 4IEUA 2J42A 1SEFA 4HVQA 1DBNA 3LEGA 5GLTA 4ISRA 5KBFA 4HOOA 3HPNA 3HWJA 1KJRA 3VBSC 3TNQA 1S0DA 1SPPB 2XH6A 3AKQA 4UFIA 2C1FA 2JDKA 3ZXEA 4OVEA 4AVBA 3RYKA 5FYMA 1W28A 3S6PA 4N7UA 2VQUA 3WQ0A 2WAOA 1D4VB 2Q0AA 3LZZA 3R4SA 4JGYB 2A7AA 4XUNA 3FLRA 2JIJA 1JN2P 3KT4A 4COWA 2A6WA 1GNYA 1Q8SA 4F83A 3WQ7A 1Z7S1 3NKTA 2VGDA 3M4FA 3RWNA 4NHKA 4KWLA 2VY0A 1N1SA 2ARXA 2EAKA 3AKTA 2IVJA 3EBRA 3MF6A 4Z8BA 1G9FA 1D4M2 1LRHA 2W39A 2YBSA 4Y1ZA 4X6RB 5LCWL 3I59B 3ST7A 3LEIA 4LO6B 4QKFA 1UXXX 4ZS2A 1MPXA 4X8PA 2Y6LA 3HJRA 2R1DA 2WQZC 2CU5A 3JD73 3PTYA 3UKTA 2UWBA 2WO3A 4FOWA 3OJBA 2G4IA 3PJYA 5IJRA 3LPFA 4Q4Y1 1LOGA 3BVCA 1MZFA 1IKPA 3NNGA 3ZFFC 3WW2A 3SH5A 3HN1A 3N9QA 4DB5A 4JGZA 4BB3A 3AMNA 1AL0G 2D3SA 1C1FA 2R041 4FT8A 4LLFA 4FAGA 3O1SA 2R7EB 2CL2A 1UY2A 2W2IA 5CA6A 5CADA 4FFIA 4PLNA 1AYM3 1W2NA 2D6MA 4MXWB 2BWAA 1CR7A 5F6KA 4BE3A 4P9GA 3W5NA 4ZKTB 5FYBA 4FPGA 5JR7B 3CJIC 3NQHA 3AZZA 4N90A 2RMU3 2JXAA 2XR4A 5C8CC 2ZMKA 2DFBA 1FPN1 4UFMA 4ASMB 3AKSA 3KT1A 1FPN2 1WW7A 4MXWA 2DWRA 3T4HB 1PMIA 3T2OA 2VM9A 4CP2A 2F4LA 2XJSA 3K4AA 1OF4A 3VHRA 2W08A 4LLOA 5FY9A 2VR4A 3MIHA 3RMXA 4B1LA 4GAZA 4GJZA 4LBQB 2QKDA 1AL21 1HRI3 3KHBA 1PO23 1O3QA 2LW8A 1PO22 5IVYA 1W6OB 2QCSB 1BXHA 5IK7A 2WUHA 1WMFA 5IVCA 5C5UA 3VD3A 5FMBA 2GC2A 5ANNA 3JD72 1IHMA 2YFUA 5AC93 4LT5A 5C4WB 3ZN5A 1D4M1 2ZMNA 2Y6FA 3EB7A 2JG9A 1AYN2 3QD6A 4NHYA 2W9XA 2WLQA 1SLIA 1H1IA 1H2KA 1LTEA 1PMJX 4CCKA 4YFZA 4FOVA 1O7FA 3KCYA 3GGLA 4O7XA 1DQ0A 4OI4A 4CCLA 4GA9A 1C1LA 1DQ1A 4NHXA 4LO7A 3WG1A 3PNAA 5DZEA 3ZFGC 1JYWA 4D6QA 5IVEA 3HD8B 4TZDA 2YU2A 2WR9A 1POQA 4LO4B 2VNOA 1K42A 4LBNA 2YPDA 1C8M3 1VJ2A 1W8HA 4LQRA 1J1TA 5LASA 4XFAA 5JXJA 4JGYA 4CEYC 4ZONA 4HANA 3ASIA 5JZGC 5BNOB 3HT2A 4OZXA 2JKBA 5C70A 1W9WA 5L36A 1UPSA 1BCXA 4E2GA 5FOBB 4FQZA 2Q4SA 4LPLA 1SLBA 5JXGA 2ZKNA 3AMHA 3RFRA 2D3PA 3J8F2 2ATFA 2RJKA 3RPQA 2Q30A 2V4AA 4QHBA 4HPKB 2QDRA 4RR3B 5ABJC 2ES3A 1N1YA 1XYOA 1BYHA 2AGSA 2WFF1 4QGNA 5K0UA 4EN6B 5AFBA 2ZHNA 2WFF2 1GWLA 3BALA 1Q8QA 1VMFA 5F3EA 3UYJA 1Z0HA 1F2NA 1PVC1 3AJZA 5JCTA 4GIQA 4BIFA 1JMUB 1VAMA 1REEA 4CU8A 5DAXA 4CDXA 1AL23 2DVDA 1RUC2 2VXRA 2BBAA 3GZUC 1PO21 3WP6A 5FXWA 4BQ4A 3CZJA 5C3PA 2CGOA 2WYFA 4LHSA 4C0HA 3TRSB 4CPBD 1WW6A 4FTSA 3MW3A 4HT1T 4A7ZA 3CNAA 3WP5A 2GC3A 1VALA 2E63A 1HRV1 4QQOA 2JDUA 4XAEA 4MGKE 1N3OA 4AI3A 4RQPC 2EXIA 1AR63 1EY2A 3O14A 3VBHA 1JYCA 2GC0A 3UKVA 5JOYA 3ZSLA 1SDWA 4RR3A 4I01A 4P9IA 4Z92B 1UOJA 3VHNA 3CU7A 4HPKA 4AVTA 5BNPA 3BB6A 3ZX7A 4E8DA 2VXJA 3WD5A 2D6PA 4YPJA 4DINB 1UL9A 3C7FA 3KF5A 4MZUA 1KS4A 1NG0A 1PM7A 2NM1A 2X5IC 4QDSA 3VZOA 1R1A1 5B4NA 1NOVA 4XFGA 3K4DA 1HN0A 2BFUL 2R6QA 2WN2A 4UF0B 3NJZA 2EA7A 4QU2A 5KHJA 3ZFEB 2DBNA 1OFNA 3BKZA 1VAKA 2XQRA 2WO7A 3UESA 1JZ6A 1CJPA 2VOTA 4GJYA 4LE4A 1ENQA 1SZBA 1E5HA 2D5HA 3EQEA 2VD7A 4ZU5A 2BJSA 4Y1YA 4YARA 1W05A 1UU6A 3HMYA 3I3EA 1WLCA 3TEWA 2PYTA 3L9JT 1RUJ2 4OCTA 5CKNA 2VQAA 4FAHA 4XC9A 3AYDA 1RVF2 1GANA 2RS13 4K9SA 2ZEZA 3UGGA 4Q0SA 2ZJCA 4FTBA 4JZRA 3CZUA 2RS52 5HBAA 2RE9A 3ENRA 5D8AA 2W68A 1UOGA 4NHLA 5D1IA 4OQ8A 1YEWA 4LO8A 4HG6B 2H6CA 1UY1A 2C26A 1W9YA 2EIEA 1AR91 1UNBA 1W6QA 2W1SA 2Y0OA 3MIFA 1O6UA 1C5IA 4GKXA 4IUGA 4W6WA 3CJIB 3S5QA 4ZZ8A 4AEDC 2A1XA 4BCUA 5HCFA 3J7HA 3UK9A 2IXCA 3GJBA 4IV3C 4HZFA 4C91A 3KQ4B 2N7GA 1X7NA 2RM22 2IVIB 5FLHA 4YZ5A 4TXWA 1GYKA 3VZKA 2W92A 3WDYA 4HKOA 3JB4C 2PHDA 2AACA 2P34A 1PVXA 2AC1A 3GALA 3M3EA 5DZGA 4COYA 3ZVXA 2HLEA 2WNOA 2Y6HA 3I2FA 2B45X 5FZMA 3LQCA 3Q8EA 3VBSB 2D43A 2XJTA 3INAA 3MFAA 2IFWA 4NRMA 3J9SA 2XG3A 2MNGA 1VBD1 2MEV3 1DCSA 3MW4A 2OKXA 4KBZA 3I8TA 3H3UA 3H9AA 4RN5A 2BERA 2ET1A 2L9LA 3FFQA 3OBTA 1MACA 4PT6A 4W6XA 5FXZA 3TAYA 3OGGA 3WUCA 5FY7A 2IFRA 2YBPA 1P8JA 4GWJA 4LR4A 1XQNA 4UFHA 3WNLA 1CPMA 4AF9A 4XQDA 4JCKA 1ZRCA 2ZPXA 4FFGA 1QJZA 4P08A 4OFGA 4QX8A 2QUOA 5FJKA 1NX9A 4RHV3 2J1EA 4NE9A 1JXNA 3MPPG 3IAPA 4A42A 4RFRB 5DMYA 1QQP1 4RSUA 5IUQA 1L7LA 2DVGA 3FJSA 2FZ1A 4RYDA 1UOBA 1I5PA 4AR2A 1GOGA 2XHKA 1CN1A 2OPWA 3SEPA 1S2EA 1O4YA 5FMCA 3ZSEA 1Z78A 4FCAA 2CWMA 2V73A 3R05A 1G6NA 1R082 3ES1A 3OB8A 2DU0A 5CG9A 1UZ0A 1B35C 2XJRA 1PVC2 1AR93 4QPGA 1W6MB 4JKLA 4M3CB 4WVMB 2ZX2A 4XUQA 4OQ9A 1MEC3 3WV6A 4IEOA 1F5FA 1W03A 5HCBA 4LBJA 4NWWA 2GALA 1SFYA 1DHKB 4QWNA 1O4ZA 1YLLA 5C8CB 2B4KA 3JZVA 4CXWA 2O1QA 3ZDVA 1NE4A 3I2KA 1LOAA 4IEXA 3OEBA 5I8YA 2JENA 4JKKA 3ZSJA 2WT2A 4PDWC 4EZHA 1NQDA 4A7YA 4K1ZA 2QQOA 4AOCA 2P1BA 5J7MA 2XJQA 2XL9A 4NRQA 3NMBA 2XXZA 2B7YA 3KT7A 3BUCA 3POIA 2W1QA 1PGL2 3FBMA 5I93A 1T6GC 2XLGA 1VRH2 1PGL1 3FE5A 3QACA 4AI2A 1OH3A 1KDKA 3WW3A 5CEHA 2NMNA 4PI2A 1OLRA 3NW4A 4O61A 4YVWB 4ARXA 1BEV1 1O91A 1QJU2 2BYVE 3RJ2X 5C71A 3GF6A 1QJY1 2PLV3 1F4AA 3OBAA 1UY3A 2WINB 4I0AA 3ILRA 5BY5A 1TMF1 2VMFA 2ZA9A 4RA0A 3IN9A 4XMAA 1LAJA 3ZYRA 2X53S 2ZX1A 4P9XA 4A7KA 2VMGA 5A3NA 1AVBA 1HV1A 5FTTC 1OOPA 1VBE3 3AYCA 1GFF2 1AR83 2TUNA 3RZZA 4ATFA 1QXPA 1ULPA 2R071 4WM7C 5FPVA 5I0UA 3B9IA 1D0GA 1SCRA 3JB8A 2FCUA 5I0DA 1C8M2 2QQWA 1LECA 2VH9A 5ABJA 1S0IA 3P1IA 1ZZBA 5JLVA 2JDZA 1Y4WA 1H4HA 2XMLA 5CAZA 1RVF1 3O1UA 3H1WA 2QQPA 4CRQA 3SXWA 5A3MA 4K40A 1A8MA 4HK9A 2G9ZA 3BCWA 1IPJA 3WCSA 4DUVA 5BNOA 4DEQA 2LALA 4FFHA 1NA1C 1OQDA 2EICA 3NNMA 3MDPA 2E7AA 5BYNA 3WP3A 1UXZA 4N53C 4R8HA 1PK6A 3ZR6A 1W6MA 4WVMA 2W95A 2Y64A 3BTAA 2VZOA 5E8AA 1ULCA 1J1LA 4U36A 3AJYA 2DURA 3H3LA 1OURA 2P6HA 4XJWA 1YIFA 5E16A 2DU1A 1CWPA 3VV1A 4CZSA 4AGVA 3FC0A 2P3JA 5A7SA 2KXLA 1LNSA 2QDNA 2WWSA 2NN8A 1S0BA 2VUDA 2WO1A 2JD4A 5FZLA 3VBUC 1UF2C 5FYSA 1YFYA 3VBHC 1SBFA 5JDBA 3MIGA 1UY4A 3DN7A 1UYYA 5FZFA 2DVFA 2ID4A 1YCIA 4KWUA 2X09A 4QPGB 4C1WA 5FBZA 1AJOA 4INDA 1UMHA 4DRRA 2YMZA 4BQYA 1O3SA 1QJU3 4EQVA 2PHLA 3PUHA 4Q4Y2 4Q0PA 4H2AA 3W9AA 4E4ZA 4AK3A 1NA1A 3B69A 3WX5A 1X36A 1DYPA 4IQPA 5FZIA 2W52A 1ZZ7A 4DPNA 4ZU4A 4I0WB 3GCXA 1QJX1 5F5QA 3UNPA 3QLQA 4Y4YA 2O0OA 4ES9A 2FCVA 2EXHA 3O7OA 4JGZC 4OI2A 3PUIA 1JH5A 1Q8OA 2AUYA 1E57A 3WSOA 3MBWA 2GH8A 4IESA 1ZBA2 1YQCA 2WFPA 1ASJ2 1NCQA 5JR2A 3D0JA 2ZABA 1H1MA 4HN1A 3UL2A 1RMU1 5I8TA 4Y22A 5BPXA 1QOTA 5CG8A 3ATGA 5FZAA 3JBG3 2JIGA 3ZYBA 3ZXLA 1WD4A 1JOJA 2Z2SB 3OPTA 4JRLA 3POBA 2Y33A 3ALQA 4L92A 4UAPA 4UBHA 1RINA 1MEC1 2WN3A 4MLOA 1JU4A 3LB9A 3ZPYA 1UMIA 4IV3A 4R9DA 3AP6A 2DVAA 2Y6GA 4XF1A 2OXBA 4A6SA 5C3QA 3AVRA 2K9ZA 1XC6A 3EXUA 3M7AA 2J7MA 4NOTA 4Y24A 1UKGA 4LXLA 4XJAA 4CDUB 2LM3A 2NP0A 1BEV3 2EXKA 3J7NA 4NO4A 3EO6A 4B1MA 4FPYA 2ZGQA 2TNFA 4UI9L 1S0JA 1H30A 4GWIA 4Y1XA 1MS1A 3MLLA 2RDNA 3IBMA 1PGW2 2CV6A 4AVCA 2ZX3A 1ND2A 3RYPA 1CQ9A 3TB0A 3JQWA 4PDWA 4XDPA 1UMZA 3GZEA 3VN4A 1PGW1 4BH9A 1JZ7A 5J37A 1FMD2 3MW2A 4YGDA 5JAXA 2DYCA 1DZRA 2A73B 3WCRA 4HKLA 5FK7A 1IOAA 4H7MA 4K7JA 1ENSA 2B46X 2VZTA 1MS9A 1WLWA 2I45A 3TBDA 1EV12 4EZ4A 3FLPA 5HCHA 1J3RA 3ECQA 4XXAA 4ZXEA 1REDA 2DVBA 2HEWF 2JICA 2WZR3 2VNRA 4WZCA 3E6CC 4OHYA 5KC6A 5DUVA 5JZGA 1PX3A 3N9NA 3PTRB 4EWAA 3VDAA 3ZYHA 2PQQA 3H8UA 1SFNA 1AHSA 2E6VA 2RS11 5CFDB 5JIAA 1UYPA 3AP5A 4FXGB 3CQOA 4TN7A 2I07B 1PZ8A 1ULOA 1GUIA 2WT0A 4XJUA 4DXRA 3V0AA 4OI1A 4AI8A 3A7QA 1VBE2 4D94A 4RQPA 4CXXA 5GM0A 5J3UA 1TME3 3IDEA 4QM8A 2RR13 3CL1A 3GZTB 2LTNA 1QXRA 2KD7A 1O5UA 3U11A 5JPMB 3HIFA 3DYMA 4LTAA 4N9HA 1KD7A 1BJQA 3ZYJB 3LFIA 2V09A 3C2UA 4NPMA 1CAXB 4UFJA 2AREA 4UW4A 3SHRA 4NIHA 5DDJ1 5FUPA 4OHVA 3WQ1A 4YZ1A 3KM5A 2WWJA 5I0RA 1A34A 4XHXA 4COZA 3VBUA 2YDEA 2OW4A 1YC61 4ATEA 1JUHA 1AYN1 1LGBA 1W2UA 5T5LA 4TLFA 5H9SA 5LA2A 4CEWB 2Q8CA 1NCRA 1QNYA 1POV0 3KGLA 1ZBE1 4PIZA 5H9PA 5JSPA 4BQXA 1O59A 1KGYA 5FMDA 4QB2A 5FK8A 1UW8A 4BLJA 5IK4A 3C7GA 1OA2A 3WHUA 1HRV3 1XYNA 5F3IA 3CMGA 3H8XA 3D8CA 4Q4X1 1GR3A 5DABA 4AEJA 4E2SA 1VRBA 2YY1A 4LKDA 5DQ0A 3WF0A 3WNPA 5K0UC 1TMF2 2JEMA 3GBGA 1OUSA 4XIKA 2WZR1 5FY8A 2BUKA 4EYUA 4FTEA 1C3HA 3F2ZA 2V4VA 1POV1 1W3XA 3POEA 4DEVA 5D8AC 2XBO1 3T4VA 4TSVA 1QKQA 3E5UA 5FY5A 3LOBA 1U5XA 1WCSA 3ZYGA 1AXZA 4Q4W1 3W59A 4QPIC 5C3OA 2YPJA 4RGAA 1FYUA 3H7JA 5FP8A 2HBUA 4WM7A 5C5TA 4XJZA 3WQBA 1V9U1 2ZOEB 5EPAA 2CAUA 1V9U2 3ME2A 1XB9A 2UY8A 5BNNC 4WVVA 1ND2B 3VBOA 2LROA 3ES4A 3L2YA 4A3XA 2WT1A 4RFT0 4YW3A 3WLUA 2BRTA 1X82A 4RGGA 1X8MA 2R062 1W8WA 3HNBM 5T50A 1XNCA 5L9BA 4HLTA 5L7OA 4UFLA 3OGJA 4R4ZA 3I49A 1V6KA 1ND2C 1VBC3 3AZXA 2HWE3 1TVGA 4XUPA 4QX5A 1FOD1 1AR92 2B9VA 4XE9A 4RS5C 5JOWA 4AGGA 3J7LA 2JX9A 3N7LA 3VKMA 1CAWA 1MS3A 1Z7S3 4CXYA 4IE4A 4Q1RA 4AFDA 4BYYA 4NVPA 2A3XA 4PJYA 5FYZA 2RVAA 2YGLA 3O12A 1WCQA 1XSQA 4IL7A 4NIAA 5FQ0A 1C8NA 1Y3TA 1A78A 1DGWX 1VBB2 4YSFA 2CSGA 2IXHA 3HT1A 4EN7B 5FPAA 1H2LA 3I3BA 4NIIA 1OKOA 4QB6A 5FDBA 1CAUA 1PNGA 3A4UA 4D0QA 4BM8A 3UGFA 2JB4A 2HYXA 1T6BX 1M06G 1QJY3 2PLV1 4PF1A 1H2MA 1H1AA 3QBQA 1O5LA 4Q4Y3 4KQ7A 4YGEA 4FOYA 1PIV1 3T2QA 3UKNA 3ACGA 1MVQA 5FP4A 2Y0IA 1B35A 1HX6A 2WS93 4GMP3 5E89A 2PAKA 5GLVA 1O8PA 5L73A 4EWEA 5FXXA 3GNEA 4P5HA 5EIYB 1GQGA 2JG8B 4OHWA 4XF4A 2PTMA 2GNBA 2VCBA 4OULA 5FP9A 5FY1A 5GALA 1O8SA 1PO11 2UWAA 4F8AA 4FPEA 1CZSA 3IDBB 3I4IA 2JE8A 2G19A 4XUTA 2YC4A 4UW3A 1DQ2A 1LESA 4FO9A 3ZFFA 3GXUA 4LORA 2BPA2 4NAOA 2ZHMA 3T30A 4LBOA 2BBVA 1IPKA 4ISQA 3HEIA 5LRSA 5IAXA 1B09A 4R9BA 3RZJA 4URAA 1R081 3AP9A 2JG8C 2D98A 2OZJA 4RHV1 2YC2A 3I2OA 4CCMA 1ZX5A 5SV8A 4P9JA 1QEXA 4CCEA 1OVPA 1WMDA 2ZGTA 3KVAA 4ITCA 2WWUA 2DCTA 2VO5A 3JXSA 1L7QA 3T1LA 5BNPB 4CU7A 4JRAA 5T55A 1AL22 1RUC3 1COV1 3BPZA 3CKHA 2E7TA 4PQQA 3RZKA 1FV3A 2LRPA 3B9CA 5L7OB 3PMEA 4BXSV 1NKGA 1ZA4A 5HV0A 4GMP0 4M4PA 2RV9A 4RR3C 3U4SA 4SLIA 2R1BA 1LCLA 3FHIB 5J1XA 1YYNA 5B2GB 3K77A 3GYDA 3HBZA 4MGZE 1JYXA 1RIRA 1YI9A 2G9FA 5FZ6A 1LOBA 4BQ2A 1JZ8A 2Q1FA 4B3NA 2UYBA 5AC92 3BIWE 1CX1A 2K2SA 1SPPA 5JI7A 1FMD1 3LA7A 5LBEA 1PHMA 3TN93 2EALA 2UU8A 3ZKYA 4ARYA 5BNOC 3WDXA 2IXIA 2C24A 5BNNA 1UPIA 2ZGUA 3Q8CA 5EV7A 1RUF1 2QQJA 3V65A 1UOFA 2HBTA 2E53A 4MOAA 1V6IA 5LA1A 1W04A 1OC1A 3GM8A 2GDFA 1GLHA 3VZJA 2WZR2 1WD3A 5CNAA 4E8CA 2DCKA 4META 4TLGA 4JDNA 5L19A 5BNNB 2FBEA 3E97A 4Q4X3 5FYTA 2HWD2 3URFA 4WVWA 3AK0A 3KMHA 1TMF3 1WW5A 4KH9A 2HH9A 4YVWA 3UETA 1RUI2 1K45A 2CWSA 4DY5A 3V0AB 2WA4A 2Q8DA 2WZPP 1PVC3 1HIXA 3RZLA 5FO9B 2ZAHA 2VQTA 5FZ7A 3R4UA 2VTXA 1I3HA 4N7IA 1AX2A 5FKCA 4OMDA 1E5RA 1IGOA 2E51A 4K20A 1J3QA 1GZ9A 3FMGA 3K3NA 4XTPA 4EJRA 1T2XA 1Q5OA 5K0UB 1EUUA 5IAVA 1ODNA 1COV3 1QJFA 3HQRA 3LIHA 1D7PM 1LJ7A 2Y26A 4OUSA 3U1XA 5A3PA 4WM8B 5GZGA 5CB7A 3DL3A 5DDJ2 4AXOA 2BTVC 1XYPA 2JECA 1GOHA 4XYXA 1KXGA 3Q9OA 4ZPIA 4XCBA 5ACA3 1JYTA 3KV4A 4O9GA 3T0BA 1V70A 2JG9B 4NHMA 2OQ7A 5IYYA 1VE0A 1WGPA 3T0AA 1CAVA 3JBG2 3LCPA 2VU9A 1E5SA 2OQ6A 2Q1MA 2FHRA 1DG6A 1CONA 2VULA 4WZFA 5F2SA 4CUBA 1CVNA 1G8WA 3WG3A 3O1TA 1Y9GA 1KS5A 1HRI1 2VBPA 3N7KA 3WZ1A 2RHPA 4GKYA 1WMEA 4AHZA 5LW9A 1NLRA 3VKFC 1QMJA 1JYNA 4D69A 2VUJA 4XQ4A 4DXSA 3IMMA 3JU9A 2E26A 1DQ5A 3POFA 4JC1A 1EAH2 4CPBA 3OF1A 1AR73 1RUE3 1NUKA 3PHMA 4KMQA 2P2KA 4Y5TA 4UT5A 4DIQA 1OKQA 2PFWA 2DUPA 4Y26A 1ACCA 5C9AC 2AEYA 3B02A 1NCQC 4G3YC 4YZ2A 4M0NA 5IVVA 3OUIA 3THTA 1RVF3 4Q0QA 1RUI1 3H7YA 3KV6A 4AWDA 2BV4A 5LBCA 1QIQA 3VL9A 4M3CE 1PO12 4IV1B 5C6CA 5C3RA 1BMV2 2HWC3 1VBA1 3MPBA 1BK0A 1CX4A 1WWYA 2DCJA 1WA4A 4YYOA 5FIXA 1RUD1 3ACLA 3LGRA 3SCHA 2PAEA 3P3NA 2EAAA 3DXUA 2VCCA 2VOKA 4Y20A 5K4LA 4CU9A 4ZY9A 1ENRA 2ZHLA 2RMU1 3SKVA 1WMXA 1LOEA 3WW1A 4CEYA 5A32A 2GU9A 5E6HA 1XSRA 4QX3A 4I02A 4KU8A 3AL5A 4NUBA 5IFPA 3CIHA 1LOFC 4PF5A 4YZ4A 3HBKA 1VMJA 5LEKA 1UIKA 4CU6A 3AVSA 2CHHA 4YG3A 4XF9A 1BVP1 4RL7A 2RR12 4YFWA 1GP5A 3BU7A 3NAPB 5CISA 1YRZA 4LHKA 1NZIA 2WA3A 4IETA 1LB2A 4XFBA 3DKWA 2P4EA 2VCAA 1UU5A 3WF4A 4KBBA 2RJLA 5FOJB 5FKBA 2EIDA 1JW6A 1PMHX 3LD8A 3A0NA 1GBGA 2RDSA 4DNYA 1QY4A 1OBNA 2ZZJA 3LOIA 4JVAA 2ZTNA 5F39A 4BMEA 4FOQA 1DLLA 1MZ5A 2P17A 2WNVA 1ND3C 5FZ4A 2OUHA 3S0MA 5IK8A 3N7MA 5BNQA 1OD5A 4LMFA 3K51A 3M8LA 1K5MB 5FZ8A 4RGKA 5AFEA 3VDDC 1O3RA 2OS2A 1F5JA 1VLNA 1ST8A 2WRAA 2VZ3A 3AB0A 3AX4A 4GALA 4H14A 1PIV2 2VZRA 4P9LA 1AR72 1RUE2 4BQ1A 5FPUA 1MQTA 3LDBA 2UURA 3TEYA 1NXD1 1WLDA 5IHRA 4LK7A 2ZMLA 1WCDJ 2GMMA 1UX7A 5HXVA 4KL1A 1GZCA 2UWCA 2WSVA 2VUCA 1R1A3 4HFSA 1JHNA 3J4UH 4Y3OA 1RUD3 1WBLA 2JG8A 4Q27A 3S7IA 3K3OA 2PELA 3T3YA 1SLCA 2D40A 5FPBA 1MZEA 2XUMA 2NQYA 1IKQA 3PL0A 3OD4A 1CIYA 2ZGLA 4ZXKA 5I8SA 3WNMA 1HJGA 1OMIA 3IZOA 4CEWA 5FYYA 2PHRA 3AMPA 1VB2A 1W8UA 1YQ5A 4YM2A 5DG1A 5FXVA 1U12A 4XDOA 2ZACA 2D3RA 3DKQA 3VZNA 5CFCA 5A3TA 3UT0A 4JKMA 4CCDA 4I0BA 5M0TA 1OOPB 2HWE1 2YZ4A 1FX5A 1U5IA 2NYYA 3G6JB 3TOJA 1OA3A 3NSTA 3NO8A 1X9PA 4OHZA 1TME2 2Y8KA 1RC6A 1JZ2A 1W8NA 1AF9A 4C1XA 1N3QA 3N9OA 1EYBA 5D21A 1IG0A 1UZYA 1OPMA 4UWDA 5ANQA 1UKRA 3V56A 4A4AA 3CLPA 4Z1VA 4CVUA 1PX4A 5AC91 4DZGA 4LBLA 2J22A 1GP6A 4XJ9A 1HRV2 4QDQA 1IPSA 3ZR5A 4PIXA 1Z7S2 2JE9A 2ZGRA 4WM8C 1R092 1UWWA 3S7EA 2PN5A 4Q4V1 1NT0A 2Z42A 1VRH1 3O0XA 2KR2A 4HL0A 1OF3A 1F35A 2PMWB 3JCIA 2CDOA 5FPXA 1SCSA 4R4XA 2WS92 4AI9A 5LK7B 1F8VA 1L7RA 4YVSC 3IIAA 3A0KA 5KHHA 4CP9B 1X50A 5FCCA 1BEV2 1U5ZA 1HV0A 2R16A 2KM2A 1MS0A 3MHZA 4N53B 4LITA 4YRDA 2GP5A 4QXKA 1OSGA 4IEPA 3H42B 2RDRA 5JSRA 4CCCA 2VL4A 2ZGSA 3KLSA 4PI0A 2GC1A 2C9KA 1UU4A 2QJVA 1QOSA 4L8QA 3OCPA 4M0HA 5LEJA 4BJ0A 2WABA 1ZNPA 3D6EA 4XF3A 1GQPA 4PDWB 4XTMA 4LK6A 1QJX2 1XBFA 1ZZ9A 1EUTA 1SLAA 4XFIA 2ZGOA 1WCUA 4X8NA 2VMEA 2R063 3LSEA 1UY0A 5GZFA 4DMIA 4CUCA 2A71A 4HK8A 4NN0A 2W47A 2F4PA 4Q4W3 3VZMA 1LHNA 1UN1A 2HWE2 2VAUA 3C7HA 5GLUA 2HWF3 5K9YA 4TTGA 2D93A 4NPLA 1I1EA 3BN6A 5FZ0A 1QH6A 3I3MA 2XONA 3R6SA 2DFCA 5LBFA 3FLTA 1GNHA 4AHYA 2EVXA 3CEWA 1LENA 5EJ1B 1HRI2 4NROA 4R52A 3CHXA 2W46A 4IV1A 4E4DX 4MADA 1UYZA 5FQ0B 3ZMOA 3NV2A 3MLJA 4XCAA 1L3JA 3ZFEC 3JD71 3NNFA 5DXDA 4CTEA 4V1PA 4HSLA 2H0VA 4FP3A 5C7GA 1RUH2 4QAWA 4A2UA 3AFKA 1CAWB 3J26N 3MO4A 2NMOA 1C5HA 1IG3A 2FMYA 1WA6X 5KXDA 1DQ6A 3CO2A 1D2QA 2EXJA 2LS6A 3POGA 3TEZA 5F37A 3BIEA 2BGPA 5L9RA 4E4SA 4YM0A 1NA1B 2GP3A 5CFCC 4M3CF 3U0ZA 2W94A 3ILFA 4C8DA 1QOOA 2VNVA 3VKNA 3CJIA 1G9DA 2YHJA 3M3IA 4A3ZA 2JDHA 4K6BA 1ND3B 1DYKA 3VLBB 1OA4A 4HONA 3BI3A 1RUNA 2RG4A 3DXTA 1HW5A 1H8TA 1YQ6A 5A7NA 3RMYA 1BQPA 2B42B 1QQP2 3FHAA 1AYM2 1UO9A 3GBWA 2B5HA 3HVDA 3POJA 3BTXA 1RUJ1 1APNA 4AVVA 3WDWA 4D8MA 1W8OA 1HXS3 3E5XA 2CDPA 2BOIA 3AKRA 2VMDA 5JXHA 1IS4A 1W9SA 1YXWA 2ZKLA 3LSDA 2HWF1 4MGIE 4MUVA 3LA3A 2ILMA 3ZXFA 1RTVA 5FYVA 4IGOA 5JWPA 1MZ6A 4Q8LA 4QQ2A 3THDA 4OLLA 4CP9A 1DIWA 4W8JA 3DV8A 5IWFA 3U4XA 1LEMA 2CTVA 1RUG1 2J1VA 3CDZB 3SKJE 3O1PA 4MG2A 2V5DA 2VOVA 4C0BA 1BZWA 1PNFA 2VE1A 3ZFEA 3HNYM 5ACA2 4QKBA 3MFCA 1QH7A 4H3WA 4HXCA 4DUXA 1RHI1 4KWJA 2P3IA 4PBOA 4XZUG 4QXHA 4J6GA 1SFPA 3VHPA 1JZ4A 2FDKA 1SQ4A 3N36A 2FDHA 1UQXA 4CEYB 4W4ZA 2R30A 5DUUA 2JWPA 2WJSA 1LHVA 4I3PA 1H0BA 1QF3A 1PK6C 1RUH3 4LA2A 3WNKA 1HJFA 5F3CA 2ETEA 4Z07A 5KWRA 3B7MA 5B4XA 2ZS6B 2HWB2 2Y38A 1OI6A 4Y5Z0 2UYAA 5JPNB 1HQLA 3PIGA 4B4RA 2GMPA 1XNDA 3VBRA 3IAQA 2WL1A 3KZ4C 5G04L 3PU3A 2J1SA 1ZVFA 2B39A 2Q5TA 3IPVB 4MVTA 1S0CA 4Q4X2 2PHWA 5LBBA 5LZ6A 2CYFA 5FMOL 1VAVA 4QGMA 3M2MA 1ZZ6A 2ZGPA 2CGPA 2O8OA 4EV0A 1R083 1QHDA 1EV13 2D97A 4Q0UA 5BV6A 3BOWA 1BKZA 1J83A 4K8FA 1Q8PA 2W5FA 3M3CA 2O14A 3VBFC 1QQP3 4Y5SA 1FNZA 2GN3A 1IQAA 2H0BA 1AR81 2XVGA 2FZ2A 4W65A 1AXKA 4MGQA 4OUMA 2WNVC 5I0SA 1RJ7A 4P00B 1OT5A 1MQTB 1KQRA 3TEXA 5A3LA 4UOJA 4E4HA 1WCKA 5T5JA 1W06A 4BU2A 4AEKA 1N3PA 3ZN6A 1V6LA 4XF0A 4Z82A 3ZMNA 5IVJA 2WNVB 1H4GA 4ASLA 3I3DA 1CIWA 3ZSKA 2BNOA 4PCRA 2KA3A 5LWBA 1FOD3 4NWVA 1WZXA 5KXEA 2GSYA 4IW3A 4EN9B 3WINE 4H55A 2FDFA 4JV4A 1Q3EA 1WBFA 3Q8FA 5A3OA 4DFSA 1KITA 3NAPA 1AUYA 1GSLA 5CKQA 4L9BA 4UYBA 1NY71 2VBDA 4IV3B 1XXNA 4IGQA 1VB4A 5D2AA 3SQOA 3ON7A 3LIGA 2WNUA 5BUVA 4IDZA 2YV8A 4TWTA 3K2OA 4W50A 2XWBB 4YW4A 2TBVA 1FAYA 4QD2A 1RUOA 1OLME 5FPZA 4LOSA 3ZFGB 5EP9A 3MLKA 1R1A2 4QKNA 4COVA 3H1MA 1EPZA 3IPVA 1FMD3 3TN91 5CVRA 1MS5A 1KEXA 3J8F3 2DTWA 2QTWB 3LA2A 3TN92 3HQUA 4HVOA 3PU8A 3D3AA 3FFZA 2ARCA 2VOXA 1SDDB 4BA6A 4FBFA 1YJLA 1BBT2 4QPIB 4AGRA 3ORJA 5ERLA 2IZWA 4DXZA 5HXMA 5CFCB 4PHZA 5EJZB 2DUOA 4XIOA 2BGCA 2JDMA 2H6BA 1ZA7A 4XBNA 2FDJA 1I9RA 3PURA 5J48A 2YROA 4BXFA 4BWOA 4QB1A 3NJYA 3DGTA 1BLZA 1H9WA 3WDVA 3RQ0A 3VDDA 4LA3A 4OZOA 1VR3A 2E33A 1UIJA 4QGLA 1IZ3A 4BDVB 1RHI3 1SACA 4LHNA 1AR62 4JGZB 1DFQA 1Q8VA 2PXJA 3VKOA 1PGSA 3BU0A 1HKDA 3BYWA 3JUUA 4D7TA 3WR0A 4ZZ5A 4URTA 3V0BA 4LBMA 4QMAA 4UW6A 2XLFA 1OD3A 4P9YA 2GNDA 5H9RA 1YWKA 4A45A 1TG7A 3T2TA 4UBGA 3KV5A 4FPKA 4IE6A 4XETA 1CAVB 1G7YA 3B5LB 1XU2A 1NY72 3W20A 4S2FA 4L99A 4OUEA 2BVVA 3E1F1 4AQ2A 3OPZA 3PJQA 2A3WA 5FZDA 3WW4A 4D6SA 3PVBB 3BPSA 4FPLA 3HN3A 1OPOA 2VZVA 3OG2A 4LEJA 3ZO0B 3HNMA 3LPGA 3KQRA 5FUIA 4BMBA 2FDGA 3ACFA 4O65A 1H8TB 3CF6E 2C6SA 1DLCA 3NKGA 5FYIA 1QXJA 4J1WA 2GZWA 2EF6A 3FUOA 1ZBE3 2PLV2 3NV1A 3R4DB 4P14A 4XUOA 3WY6A 4ET7A 1CD3G 1FNYA 1MS4A 1PK6B 2ENRA 2ORZA 1TQ5A 2XKPA 3N9MA 5LA9A 2YC0A 4Y33A 5CFDC 2R043 1E5IA 1PZ9A 4HBNA 1W3VA 3KCXA 3KV9A 4YLZA 2IXLA 4K21A 4Z2AA 3TYJA 2RS53 3W21A 3K48A 3LF7A 1BMV1 3HOBA 5A7PA 1RJ8A 2P3KA 3SNMA 4AQ6A 1NCRB 1QJX3 5ABJB 2VVEA 1HXS2 2ZX4A 2VMIA 1MR5A 3K75B 4QPWA 5APAA 5FWEA 1WLTA 4CE8A 4B29A 1W0NA 5EWSA 4XZPA 3MIBA 1HQNA 5KC5A 1K5MC 1R64A 2D6OX 3DPRA 2YUEA 4CCJA 2WDBA 2Y60A 2SBAA 2VMCA 2VZUA 1XNKA 5LATA 3IWZA 2XWJB 2MPFA 5F6LB 3T0DA 1X33A 1TEIA 4K1YA 4DRVA 1V9U3 1JYIA 3WDTA 5DUXA 3ILNA 1RUC1 3EJKA 4HETA 1DGLA 3B00A 1RMU3 2WNUC 2PHFA 4QKDA 2VJXA 2XJUA 4AL9A 2EIBA 2ZEYA 2XL7A 2I2SA 2RM21 3SCFA 4CDUC 4JQTA 3DCQA 4ES8A 1FI2A 3NAPC 4U2AA 1W8FA 5DDJ3 1D2SA 4KGGA 4AFBA 4D7YA 4P9WA 2PAMA 1GICA 4LHLA 4LUKA 3UJQA 4FPFA 2F17A 3B94A 3BTZA 5C4WC 3S5AA 5T3NA 4QQPA 3BTYA 2ARBA 4E2QA 3KGZA 1IS6A 4O9EA 2XKOA 2MEV2 3ZXJA 3PVOA 4LKFA 3I2DA 3N7JA 1UD1A 2QZ3A 2DV9A 4Q5OA 1MVEA 1W6NB 1Y9MA 4N43A 2Y6JA 1AX0A 1V0AA 4R9AA 2WS91 4GMP1 5D8AB 5JUVA 1RUF2 1LKNA 2WO2A 4LKSA 1LEDA 1GU3A 2QQNA 4YVSB 4CDXC 3AKPA 4LBQD 3SISA 5DAQA 5GLWA 5C8CA 1NQJA 1PO13 1Y7BA 1RB8G 5F1RA 5FY4A 4ORFA 1SMVA 2MHFA 1EAH3 4QX0A 3OOXA 2FDIA 2GNMA 2ZBJA 3IB3A 3KS7A 2GNTA 3MUY1 2VNGA 4Y1UA 1LR5A 1ZRRA 1SLLA 4QX2A 5EYXA 3ZSMA 4GWNA 2WAAA 4QU1A 1GWMA 3QH6A 4M01A 1NLQA 5FAXA 5GZDA 1RUJ3 1GZWB 2CY6A 1ALYA 3AZWA 1A6CA 1UZVA 2V5YA 5EHDA 4LULA 3AXDA 1GZTA 2WKKA 2FCTA 3APBA 3MUZ1 3U78A 2HWC1 4IEVA 5A1LA 4L11A 3FHQA 4MHUA 4B7EA 1H6YA 1WUVA 5JI9A 1B35B 4XURA 1VBE1 2VCMA 4AE2A 4KU7A 2BP6A 1LU2A 4GULA 5T52A 2QQUA 3POYA 1NLSA 3KB5A 1J84A 5LA0A 2AZ5A 1ZYBA 3PVEA 3WDUA 3MIDA 1JOPA 4LO5B 1DGWA 4Q26A 3DUIA 1W6OA 4J25A 4QPYA 4Q0VA 2BU9A 4BQ3A 3ZYFA 2PHTA 2W0XA 3UJOA 3N35A 3C3VA 3ABZA 4LBQA 5E88A 2K46A 3VBUB 4Z2WA 3VBHB 2XQXA 5FZ3A 1US3A 3E6BA 1QNWA 3WT3A 1S0EA 4AVSA 5I91A 4MXVA 2JG9C 2VW0A 3RVHA 3WNNA 3KF3A 3M3OA 4CA9A 1LODA 1CAXA 1W8TA 1YJKA 3M3QA 4PIYA 5CU1A 3WUDA 5C8WA 2QE3A 2HEYF 3T2PA 4GH4C 4GD4A 5EYYA 2D6NA 1AYN3 5A7WB 2GN7A 4NMIA 1A8DA 1OQEA 5FRAA 5IT6A 2JD9A 3GJAA 3O0WA 1RUF3 1RUH1 2QQLA 3F95A 1JZ3A 2AYHA 4DQAA 1Q43A 2A6YA 4BK4A 1ONAA 3SC7X 1VBB1 2XJVA 4XFCA 2YFZA 4IEQA 4M00A 3ELNA 4AAPA 4QX7A 1EAH1 3RZGA 3NRUA 4KG8A 3DPRC 4YGCA 3AYAA 3DPRB 5CKMA 1VP6A 3G7DA 4V2WA 4AI0A 3FUQA 2HEVF 5AVAA 5G05L 5FZOB 3VBOB 3MYXA 1PIV3 2IUWA 5A6YA 4XW3A 1K5JA 2PQSA 1EV11 3RI9A 2E9QA 4WM7B 2OIIA 2FQPA 1VBA2 3VD9A 1BHGA 1C8M1 2W87A 4PQ9A 3VUOA 3RRDA 3WP4A 1F4HA 2BGOA 1H6XA 1W90A 4V2VA 1V6JA 4QDRA 2R32A 2RS33 4GB32 2RS32 2WSUA 3VZLA 1YUDA 5IVFA 1RUD2 3NV3A 4DOUA 1A3KA 1N1TA 2YG0A 2ZCWA 5CIRA 1QGLA 1V6OA 3GHMA 4YW2A 3V64A 5FYHA 1G9BA 4XFHA 3HQXA 3IMNA 3AMQA 3AC0A 1GWKA 1RMU2 4EWDA 1ASJ1 4KNCA 3VBRC 3MV01 1G86A 5E1RA 2K0GA 3NL1A 3VKLA 5GJ6A 4N43C 1DYOA 4WVZA 1VBC1 3IIIA 2ARAA 3I7DA 4QXCA 1ZREA 3FZ3A 4RS5A 3TWIA 1KDMA 5JOZA 4JTOA 1W9TA 5C4WA 3AZYA 3NWKA 1DU3D 2JB8A 4IV1C 2IXKA 2NZ9A 3SCGA 3H8OA 1ZZ8A 5DUWA 4XVHA 2YXSA 1RHI2 4BZ4A 2OPKA 3OBZA 1FV2A 3QCWA 1RUG3 3IM0A 2VOWA 1CAUB 3ZN4A 4A41A 2P37A 1NCQB 2HWB3 3P3PA 4YGBA 1RL3A 5T54A 3OYWB 5JIUA 2AR6A 5FY0A 3RZMA 1RGSA 2OT7A 2HWD3 4Q4V2 5FLJA 1ULFA 1W9FA 3VDDB 5FYUA 1IS3A 3KCCA 4RQPB 1YFWA 3ZXDA 2XJPA 2HKXA 1QJY2 5HI0A 3NNJA 4XEZA 2BNNA 3A22A 2GAUA 4QPGC 5A80A 1LHUA 4OMCA 3D4KA 2D5FA 4NPRA 2AH2A 3ACIA 1FXZA 1SHWB 5A3WA 1W39A 4I30A 3SMHA 2WZ8A 5FP3A 2RS31 3ETQA 1M4WA 2ZGNA 5A7OA 1OLMA 3FX3A 4RD7A 3S57A 1PM4A 1XE7A 1XJAA 3EMRA 4PBPA 2X05A 1W8ZA 3LE0A 1H2NA 3USSA 2DDUA 2Z69A 1FPN3 4AAXA 3VDCA 5FLIA 1O3TA 2Z5WA 1ULGA 1DGRN 2WC2A 3N4MA 2E32A 3ZFGA 1XNTA 3RSJA 1LU1A 5A6ZA 3OSDA 2OX0A 5FR3A 5HCAA 1RUG2 1XRUA 4YVSA 3WG2A 4ZS3A 2G9GA 1XPWA 1U5YA 2D7FA 4FPJA 2ZEXA 1W6NA 4FPHA 1IQDC 1GZWA 2JDNA 3IDAA 3C8XA 1UAIA 4B4QA 1EPWA 5DN2A 3VHOA 2VG9A 1TME1 4G9SB 1JU3A 4CDUA 1UZZA 3MI8A 4KG0A 2JDPA 1FT9A 2B9UA 1JODA 2OUJA 4BHPA 1ULDA 1VBD3 2MEV1 4QQLA 5AVPA 4DXTA 2GH2A 2QQIA 3RWKX 3MIEA 4XILA 2VZPA 5T5OA 3H3ZA 3TNPB 1LHWA 4QT6A 1K12A 1ZBE2 1YHFA 1I5ZA 4GZ9A 3POWA 5EXOA 5DAVA 3ZDSA 1AX1A 1C4RA 1YIPA 1JI6A 1LHOA 1LGCA 1QJU1 5TSWA 1KFXL 1YQ8A 2ZEWA 3SLIA 3MZHA 1CESA 3FWEA 4YM1A 1FATA 3LAGA 1SBEA 4Y1VA 3WOGA 3ZKUA 5DAPA 4XBLA 5L9VA 5DPNA 5FREA 2I74A 1HQWA 1H8TC 2OZ6A 3BGAA 4BIOA 5F7UA 1RYYA 2R072 2QFEA 3Q8BA 3OUHA 2R073 4GWMA 3T08A 3U14A 2VQ0A 4JTNA 4AHWA 1JYVA 2A6XA 4QHOA 1TZOA 2VECA 4GB33 1NE6A 4S2DA 4XDQA 1JZ5A 5L7OC 2WFF3 4XFFA 1XE0A 4BQWA 3DYPA 3FBYA 4HVRA 2HWC2 1RXGA 2A6ZA 5FZHA 1EP0A 2VTXJ 5F3GA 1AXYA 2C9AA 2SLIA 4Q29A 5BNPC 3OYWA 4E9KA 5CFDA 2IWGB 2O8QA 3SH3A 4JAAA 1MQTC 2BVBA 3O1MA 2VMHA 1QWRA 2VZQA 2RMU2 4FP2A 3RG0A 1JTZX 3GZAA 4CUAA 1VMHA 2ZHKA 2VC9A 1BK1A 3U37A 4HMZA 3VGIA 2QNKA 2YBKA 3VBFB 3CJXA 3AMMA 1I6XA 1FOD2 1QJEA 2V72A 3I2JA 4GH4A 3MGUA 4JHTA 3LDRA 5FZEA 3H8RA 4D7SA 3I59A 5GKAC 1DZTA 1ASJ3 5F32A 4RS5B 2BW8A 3WXPA 4CSWA 3THCA 1VRH3 3OEAA 4EE2A 2XOMA 2WNEA 1R1ZA 2P6CA 3OD0A 4ZU7A 4CDWA 1GQHA 2BOJA 2YGMA 3NJVA 3P5BA 5FP7A 2BDRA 5A33B 3I2IA 4EROA 2C0ZA 2VTFA 4YZ3A 5LY1A 2PA7A 5EZWA 2AENA 4A44A 4XABA 3ROUA 1DQ4A 1YQ2A 5JOXA 1V6NA 4IXLA 2Z4FA 1Q56A 4AFCA 4MYEA 4LNVA 2B8MA 2XBO2 4YG0A 2BZDA 4Q1PA 3MEPA 3WNXA 4LJHA 4N9IA 2VVFA 2GMEA 2Y6KA 3OGRA 2BEOA 1QDOA 5A32B 3AL6A 4MGYE 2WQ4A 4XBQA 3VBFA 1S0FA 2XVLA 4JGYC 4XOGA 4Y22B 5FZOA 4NR1A 1TNFA 1W2AX 3V0BB 1WW4A 4EN8B 4ASKA 1HXS1 1UX6A 2DCYA 2VBBA 5IW0A 3T09A 3J8F1 4QXBA 3RJRA 5C3SA 3RNSA 3VB9A 4CYDA 2HWF2 2IXJA 4LIVA 2TEPA 4MX3A 4YM3A 4LIUA 2DCZA 3NNLA 3PUAA 3O1RA 2DBIA 5J09A 2RS51 5EFUA 3WVJA 3I97A 1BBT3 4IEZA 4TYSA 5LB6A 2HYKA 4XQWA 1CZVA 4AEDB 2XVKA 4J1XA 3O5SA 5CZKA 3GBFA 4FVVA 1HDKA 4Q2FA 5A7WA 2VW1A 5FFOC 1N1VA 3U10A 2NLRA 4NRPA 5FV3A 3O1VA 4WBBA 3WF2A 1OVSA 4DY3A 1VBC2 2ADEA 2VPVA 4JHZA 3H1YA 3LEMA 3DEMA 3PDQA 3BODA 1ULEA 2EIGA 4XAAA 4XHBA 4HN0A 1ZBA3 5DAWA 3OGVA 5KHGA 4X6QB 5KHIA 4YNIA 2NPIA 1US2A 4QX1A 4AQTA 1ZRDA 3SEEA 4MH0E 1YFUA 1AJKA 4MGTA 4P5YA 5FO7B 2QZ2A 5GZCA 2IC1A 3OY8B 5FZBA 3D0SA 3ACHA 3NVCA 4FFFA 1S4CA 3AM2A 3ZN6B 1R093 3WNOA 3B01A 4OI0A 4MO3M 5JSOA 1KJLA 4M3CA 1RXFA 3USUB 4CCOA 1HLCA 4BQ5A 4L0PA 2QBXA 3AP4A 3D82A 5FZ9A 3THPA 3KWVA 1ZRFA 2D6KA
chains in the Genus database with same CATH topology
1JODA 1F35A 1ZRIA 1JYTA 1JOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOD A;  1F35 A;  1ZRI A;  1JYT A;  1JOB A; 
#chains in the Genus database with same CATH topology
 2X5I B;  3DEC A;  3E6D A;  3PUQ A;  4SBV A;  5A70 A;  1OH4 A;  4AFM A;  1POV 3;  5GLZ A;  2P5B A;  5HPO A;  5A1F A;  2Z79 A;  5H9Q A;  2A6V A;  4W6Y A;  5ISL A;  1IS5 A;  3Q8A A;  4M4R A;  1W0O A;  2W1W A;  2BNM A;  1LOF A;  1QU0 A;  1W2T A;  4YG6 A;  3USU A;  3WF1 A;  3J7M A;  2R0F A;  3I2H A;  4GQ7 A;  4Y4R A;  1OXC A;  5F2W A;  1ZZC A;  3LEK A;  3UV9 A;  1CJD A;  1OHF A;  3PIJ A;  4PLO A;  4PLM A;  3ITQ A;  4XPV A;  3W58 A;  3KVB A;  2Q8E A;  3LDK A;  4G4F A;  3OY8 A;  5EQU A;  5KR7 A;  1Y9Q A;  3VDB A;  1O4T A;  2UY9 A;  4N43 B;  1DGR A;  1CPN A;  4NIG A;  4JDM A;  3SH4 A;  2ZX0 A;  5CBL A;  1V00 A;  3X29 B;  3PUS A;  4F3J A;  3VBR B;  4FPC A;  3IT8 A;  1RIT A;  1MS8 A;  4XMI A;  1XU1 A;  1YO8 A;  2WBK A;  5FUN A;  5FZK A;  3M1H A;  3QOP A;  3S30 A;  3GHN A;  3OUJ A;  1COV 2;  4IE5 A;  3CBN A;  1J3P A;  4IE0 A;  2XPJ A;  2J1R A;  1NXM A;  5IVB A;  2BFU S;  4JDO A;  2JE7 A;  2QVS B;  3JQX A;  5KXB A;  2FMD A;  1AR6 1;  4BIS A;  5FWJ A;  1HB1 A;  2XHN A;  1DF0 A;  3OTF A;  4L97 A;  4MSV A;  2VVD A;  3RI8 A;  2ADD A;  4S2H A;  3I54 A;  2XB6 C;  4OHX A;  3UGH A;  5IK5 A;  3NV4 A;  2YYO A;  3RGB A;  1OFS A;  3KD4 A;  3ZLI A;  4CP1 A;  2D6L X;  3VD7 A;  2X8K A;  4QM9 A;  3C7O A;  1WKY A;  5FZ1 A;  1S2K A;  3VD4 A;  2ZZQ A;  3FN9 A;  4B7K A;  1R09 1;  4AFA A;  3VBO C;  4AI1 A;  1YNA A;  1DP0 A;  5FO8 B;  5HV4 A;  4DUW A;  1LOC A;  5A6X A;  1W6Q B;  5JZG B;  3B93 A;  4B4P A;  3O0V A;  5DG2 A;  3LWC A;  1U0A A;  3OPW A;  1VBD 2;  5BXX A;  2OA2 A;  1X8E A;  1RUI 3;  2A3Y A;  1C28 A;  3P6B A;  1F15 A;  3ZOI A;  1K5M A;  3T1M A;  1VBA 3;  1HB3 A;  2JJ6 A;  1CZT A;  2PHX A;  4CDQ C;  2ORX A;  4IER A;  3N9P A;  2G1M A;  2C4X A;  4CEW C;  4P02 B;  1NAE A;  3IDC B;  2R0H A;  2R04 2;  3AZV A;  1UZW A;  4Q4W 2;  4AHX A;  4COU A;  1BBT 1;  1N47 A;  3HAG A;  1S1A A;  5FZC A;  4CCN A;  1G9A A;  4CUG A;  1J58 A;  1W2O A;  4LKE A;  5A33 A;  3VD5 A;  5F9T A;  3U75 A;  5C9A A;  1OOP C;  4GB3 1;  1S0G A;  4R9C A;  3N9L A;  3E5Q A;  3DYO A;  3ZFF B;  2E7Q A;  5SV5 A;  1XNB A;  3AXE A;  1V6M A;  1S2B A;  3ETP A;  1SBD A;  2CNA A;  2ET7 A;  2JKX A;  2HJI A;  2R06 1;  2X5I A;  4UFK A;  4UW5 A;  5JMO A;  1G9C A;  1KRI A;  3ZXK A;  2A75 A;  5LRR A;  4A6O A;  4XJ8 A;  2P3Y A;  4NID A;  2C5D A;  1ZBA 1;  2XLA A;  3O1O A;  3L2H A;  2A5Z A;  3A21 A;  2F6B A;  3EYP A;  3WEZ A;  2D44 A;  5A6Q A;  3MV1 1;  3VL8 A;  4MV2 A;  4LBK A;  2PHU A;  4B8E A;  1GP4 A;  5C9A B;  4AZZ A;  1CGP A;  3B3Q E;  4ZHN A;  3JBG 1;  3M70 A;  5A3U A;  4Q8K A;  3OGS A;  2DF7 A;  1HB4 A;  4E27 A;  3PLQ A;  1ND3 A;  3PMS A;  5J96 B;  3MF9 A;  2E31 A;  1LGN A;  4BPZ A;  4CDQ B;  5FMO S;  1LUL A;  5ACA 1;  5JXI A;  1ZRI A;  3MIC A;  5K8S A;  4KI5 M;  3WG4 A;  3ZYP A;  3ZPO A;  2DUQ A;  1TE1 B;  2QQV A;  4N8M A;  5LK5 A;  4AG4 A;  1C57 A;  3AP7 A;  4Q4V 3;  2ZGM A;  4K3U A;  3HR9 A;  5FBJ A;  4HSJ A;  1XE8 A;  3AFG A;  3D5O A;  5CYY A;  3VBS A;  4QQH A;  4ONU A;  4MHR A;  4AYU A;  4FSJ A;  1SG3 A;  4I09 A;  4NAM A;  3WF3 A;  4BLI A;  4BK5 A;  4UXA A;  4YW5 A;  1TNR A;  3GDB A;  4S2G A;  4YWA A;  5FZG A;  2OYZ A;  1SLT A;  4AED A;  4CDX B;  1UYX A;  2Y34 A;  4NJ4 A;  4H7L A;  5FPL A;  2ERF A;  1YFX A;  4YW7 A;  4Y20 B;  2JDA A;  3H50 A;  5A7Q A;  1NYW A;  2RDQ A;  4JX0 A;  5FJH A;  2HWB 1;  4QPI A;  1H9P A;  1AR7 1;  1RUE 1;  1UCX A;  2W91 A;  4GXL A;  5LY2 A;  1JBC A;  1W6P A;  2LUW A;  2Q8O A;  5F5I A;  1Y43 B;  3U07 A;  1BVV A;  4YW6 A;  2ZAA A;  2YB7 A;  1OQ1 A;  4KWK A;  5JVV A;  4AQS A;  2X10 A;  2CAV A;  1URX A;  4FQ4 A;  4AEM A;  1HB2 A;  4KGQ A;  5IAT A;  5K7P A;  5F5A A;  2DTY A;  1ODM A;  1OLQ A;  2VUA A;  3AYE A;  4LE3 A;  2RJ2 A;  4QHZ A;  3ZIW A;  1S55 A;  2ZGK A;  5F5C A;  5T5P A;  1STM A;  2W1U A;  3ZYI B;  1AR8 2;  1AZD A;  5GZE A;  4RHV 2;  4DO0 A;  4XAC A;  2Q1Z B;  5J98 B;  3ZM8 A;  2WNU B;  5A1A A;  4XXP A;  2RS1 2;  3I2G A;  2J1A A;  1GOF A;  1DZQ A;  2XUE A;  3RDI A;  1VIW B;  5J36 A;  3I3Q A;  4K8R B;  4WM8 A;  2JDY A;  2QQM A;  4L2N A;  2QQK A;  3K4Z A;  4CP0 A;  1DDL A;  5JMC A;  2R49 A;  1VPH A;  1GKB A;  2BWC A;  2WQ8 A;  1H8V A;  4IEY A;  3ZXA C;  1JHJ A;  1F9K A;  2RR1 1;  3DF0 A;  5F8P A;  2BQP A;  1ZM1 A;  2RM2 3;  4OYU A;  1D0H A;  1REF A;  2WLP A;  2X29 A;  2WZE A;  4CDW B;  1KFU L;  3FL7 A;  1MEC 2;  1NZC A;  3LKJ A;  4LUM A;  1W99 A;  3QH7 A;  4YW1 A;  4UF0 A;  1OUX A;  4F7Z A;  3C7E A;  1NCR C;  3N3H A;  2A70 A;  3PVN A;  3RS6 A;  4AVA A;  3K46 A;  2WII B;  1J59 A;  5C33 A;  4WV8 A;  3ZIX A;  4MGS A;  4JQR A;  4IGP A;  4EN0 A;  4FI9 A;  4GH4 B;  5IFT A;  4N53 A;  3LFM A;  3RYR A;  3BOP A;  4CDW C;  1PZ7 A;  1GMM A;  5EJ3 A;  4C90 A;  3POS A;  4AW7 A;  2W3J A;  3H0O A;  3R0R A;  1ENX A;  3NJX A;  2CGN A;  1XOY A;  1W6P B;  4YVW C;  2J1T A;  5FYC A;  2J1U A;  1D4M 3;  1HN1 A;  3RZH A;  1VBB 3;  1JOB A;  3ZXG A;  4D6R A;  3KSC A;  5DZF A;  4I3G A;  4DS0 A;  2XDV A;  3OBR A;  4IEW A;  1XNA A;  1JUI A;  4BOW A;  5KXC A;  2ZXQ A;  2HWD 1;  4FPO B;  1K3I A;  1JS9 A;  3KHC A;  2WYS A;  3IKW A;  2VZ1 A;  3W5M A;  2VZS A;  1X9T A;  4FXK B;  1W0P A;  2AEZ A;  2OVU A;  4LOT A;  3GCW A;  4IE7 A;  2XBO 3;  5KHK A;  4HKW A;  1GNZ A;  2FD8 A;  2XGX A;  2VW2 A;  1F31 A;  4D3W A;  3SIT A;  2YU1 A;  1YI7 A;  3WHT A;  1QDC A;  3A23 A;  4I2O A;  3EHK A;  4CDQ A;  1GV9 A;  5I0T A;  1AYM 1;  4IEU A;  2J42 A;  1SEF A;  4HVQ A;  1DBN A;  3LEG A;  5GLT A;  4ISR A;  5KBF A;  4HOO A;  3HPN A;  3HWJ A;  1KJR A;  3VBS C;  3TNQ A;  1S0D A;  1SPP B;  2XH6 A;  3AKQ A;  4UFI A;  2C1F A;  2JDK A;  3ZXE A;  4OVE A;  4AVB A;  3RYK A;  5FYM A;  1W28 A;  3S6P A;  4N7U A;  2VQU A;  3WQ0 A;  2WAO A;  1D4V B;  2Q0A A;  3LZZ A;  3R4S A;  4JGY B;  2A7A A;  4XUN A;  3FLR A;  2JIJ A;  1JN2 P;  3KT4 A;  4COW A;  2A6W A;  1GNY A;  1Q8S A;  4F83 A;  3WQ7 A;  1Z7S 1;  3NKT A;  2VGD A;  3M4F A;  3RWN A;  4NHK A;  4KWL A;  2VY0 A;  1N1S A;  2ARX A;  2EAK A;  3AKT A;  2IVJ A;  3EBR A;  3MF6 A;  4Z8B A;  1G9F A;  1D4M 2;  1LRH A;  2W39 A;  2YBS A;  4Y1Z A;  4X6R B;  5LCW L;  3I59 B;  3ST7 A;  3LEI A;  4LO6 B;  4QKF A;  1UXX X;  4ZS2 A;  1MPX A;  4X8P A;  2Y6L A;  3HJR A;  2R1D A;  2WQZ C;  2CU5 A;  3JD7 3;  3PTY A;  3UKT A;  2UWB A;  2WO3 A;  4FOW A;  3OJB A;  2G4I A;  3PJY A;  5IJR A;  3LPF A;  4Q4Y 1;  1LOG A;  3BVC A;  1MZF A;  1IKP A;  3NNG A;  3ZFF C;  3WW2 A;  3SH5 A;  3HN1 A;  3N9Q A;  4DB5 A;  4JGZ A;  4BB3 A;  3AMN A;  1AL0 G;  2D3S A;  1C1F A;  2R04 1;  4FT8 A;  4LLF A;  4FAG A;  3O1S A;  2R7E B;  2CL2 A;  1UY2 A;  2W2I A;  5CA6 A;  5CAD A;  4FFI A;  4PLN A;  1AYM 3;  1W2N A;  2D6M A;  4MXW B;  2BWA A;  1CR7 A;  5F6K A;  4BE3 A;  4P9G A;  3W5N A;  4ZKT B;  5FYB A;  4FPG A;  5JR7 B;  3CJI C;  3NQH A;  3AZZ A;  4N90 A;  2RMU 3;  2JXA A;  2XR4 A;  5C8C C;  2ZMK A;  2DFB A;  1FPN 1;  4UFM A;  4ASM B;  3AKS A;  3KT1 A;  1FPN 2;  1WW7 A;  4MXW A;  2DWR A;  3T4H B;  1PMI A;  3T2O A;  2VM9 A;  4CP2 A;  2F4L A;  2XJS A;  3K4A A;  1OF4 A;  3VHR A;  2W08 A;  4LLO A;  5FY9 A;  2VR4 A;  3MIH A;  3RMX A;  4B1L A;  4GAZ A;  4GJZ A;  4LBQ B;  2QKD A;  1AL2 1;  1HRI 3;  3KHB A;  1PO2 3;  1O3Q A;  2LW8 A;  1PO2 2;  5IVY A;  1W6O B;  2QCS B;  1BXH A;  5IK7 A;  2WUH A;  1WMF A;  5IVC A;  5C5U A;  3VD3 A;  5FMB A;  2GC2 A;  5ANN A;  3JD7 2;  1IHM A;  2YFU A;  5AC9 3;  4LT5 A;  5C4W B;  3ZN5 A;  1D4M 1;  2ZMN A;  2Y6F A;  3EB7 A;  2JG9 A;  1AYN 2;  3QD6 A;  4NHY A;  2W9X A;  2WLQ A;  1SLI A;  1H1I A;  1H2K A;  1LTE A;  1PMJ X;  4CCK A;  4YFZ A;  4FOV A;  1O7F A;  3KCY A;  3GGL A;  4O7X A;  1DQ0 A;  4OI4 A;  4CCL A;  4GA9 A;  1C1L A;  1DQ1 A;  4NHX A;  4LO7 A;  3WG1 A;  3PNA A;  5DZE A;  3ZFG C;  1JYW A;  4D6Q A;  5IVE A;  3HD8 B;  4TZD A;  2YU2 A;  2WR9 A;  1POQ A;  4LO4 B;  2VNO A;  1K42 A;  4LBN A;  2YPD A;  1C8M 3;  1VJ2 A;  1W8H A;  4LQR A;  1J1T A;  5LAS A;  4XFA A;  5JXJ A;  4JGY A;  4CEY C;  4ZON A;  4HAN A;  3ASI A;  5JZG C;  5BNO B;  3HT2 A;  4OZX A;  2JKB A;  5C70 A;  1W9W A;  5L36 A;  1UPS A;  1BCX A;  4E2G A;  5FOB B;  4FQZ A;  2Q4S A;  4LPL A;  1SLB A;  5JXG A;  2ZKN A;  3AMH A;  3RFR A;  2D3P A;  3J8F 2;  2ATF A;  2RJK A;  3RPQ A;  2Q30 A;  2V4A A;  4QHB A;  4HPK B;  2QDR A;  4RR3 B;  5ABJ C;  2ES3 A;  1N1Y A;  1XYO A;  1BYH A;  2AGS A;  2WFF 1;  4QGN A;  5K0U A;  4EN6 B;  5AFB A;  2ZHN A;  2WFF 2;  1GWL A;  3BAL A;  1Q8Q A;  1VMF A;  5F3E A;  3UYJ A;  1Z0H A;  1F2N A;  1PVC 1;  3AJZ A;  5JCT A;  4GIQ A;  4BIF A;  1JMU B;  1VAM A;  1REE A;  4CU8 A;  5DAX A;  4CDX A;  1AL2 3;  2DVD A;  1RUC 2;  2VXR A;  2BBA A;  3GZU C;  1PO2 1;  3WP6 A;  5FXW A;  4BQ4 A;  3CZJ A;  5C3P A;  2CGO A;  2WYF A;  4LHS A;  4C0H A;  3TRS B;  4CPB D;  1WW6 A;  4FTS A;  3MW3 A;  4HT1 T;  4A7Z A;  3CNA A;  3WP5 A;  2GC3 A;  1VAL A;  2E63 A;  1HRV 1;  4QQO A;  2JDU A;  4XAE A;  4MGK E;  1N3O A;  4AI3 A;  4RQP C;  2EXI A;  1AR6 3;  1EY2 A;  3O14 A;  3VBH A;  1JYC A;  2GC0 A;  3UKV A;  5JOY A;  3ZSL A;  1SDW A;  4RR3 A;  4I01 A;  4P9I A;  4Z92 B;  1UOJ A;  3VHN A;  3CU7 A;  4HPK A;  4AVT A;  5BNP A;  3BB6 A;  3ZX7 A;  4E8D A;  2VXJ A;  3WD5 A;  2D6P A;  4YPJ A;  4DIN B;  1UL9 A;  3C7F A;  3KF5 A;  4MZU A;  1KS4 A;  1NG0 A;  1PM7 A;  2NM1 A;  2X5I C;  4QDS A;  3VZO A;  1R1A 1;  5B4N A;  1NOV A;  4XFG A;  3K4D A;  1HN0 A;  2BFU L;  2R6Q A;  2WN2 A;  4UF0 B;  3NJZ A;  2EA7 A;  4QU2 A;  5KHJ A;  3ZFE B;  2DBN A;  1OFN A;  3BKZ A;  1VAK A;  2XQR A;  2WO7 A;  3UES A;  1JZ6 A;  1CJP A;  2VOT A;  4GJY A;  4LE4 A;  1ENQ A;  1SZB A;  1E5H A;  2D5H A;  3EQE A;  2VD7 A;  4ZU5 A;  2BJS A;  4Y1Y A;  4YAR A;  1W05 A;  1UU6 A;  3HMY A;  3I3E A;  1WLC A;  3TEW A;  2PYT A;  3L9J T;  1RUJ 2;  4OCT A;  5CKN A;  2VQA A;  4FAH A;  4XC9 A;  3AYD A;  1RVF 2;  1GAN A;  2RS1 3;  4K9S A;  2ZEZ A;  3UGG A;  4Q0S A;  2ZJC A;  4FTB A;  4JZR A;  3CZU A;  2RS5 2;  5HBA A;  2RE9 A;  3ENR A;  5D8A A;  2W68 A;  1UOG A;  4NHL A;  5D1I A;  4OQ8 A;  1YEW A;  4LO8 A;  4HG6 B;  2H6C A;  1UY1 A;  2C26 A;  1W9Y A;  2EIE A;  1AR9 1;  1UNB A;  1W6Q A;  2W1S A;  2Y0O A;  3MIF A;  1O6U A;  1C5I A;  4GKX A;  4IUG A;  4W6W A;  3CJI B;  3S5Q A;  4ZZ8 A;  4AED C;  2A1X A;  4BCU A;  5HCF A;  3J7H A;  3UK9 A;  2IXC A;  3GJB A;  4IV3 C;  4HZF A;  4C91 A;  3KQ4 B;  2N7G A;  1X7N A;  2RM2 2;  2IVI B;  5FLH A;  4YZ5 A;  4TXW A;  1GYK A;  3VZK A;  2W92 A;  3WDY A;  4HKO A;  3JB4 C;  2PHD A;  2AAC A;  2P34 A;  1PVX A;  2AC1 A;  3GAL A;  3M3E A;  5DZG A;  4COY A;  3ZVX A;  2HLE A;  2WNO A;  2Y6H A;  3I2F A;  2B45 X;  5FZM A;  3LQC A;  3Q8E A;  3VBS B;  2D43 A;  2XJT A;  3INA A;  3MFA A;  2IFW A;  4NRM A;  3J9S A;  2XG3 A;  2MNG A;  1VBD 1;  2MEV 3;  1DCS A;  3MW4 A;  2OKX A;  4KBZ A;  3I8T A;  3H3U A;  3H9A A;  4RN5 A;  2BER A;  2ET1 A;  2L9L A;  3FFQ A;  3OBT A;  1MAC A;  4PT6 A;  4W6X A;  5FXZ A;  3TAY A;  3OGG A;  3WUC A;  5FY7 A;  2IFR A;  2YBP A;  1P8J A;  4GWJ A;  4LR4 A;  1XQN A;  4UFH A;  3WNL A;  1CPM A;  4AF9 A;  4XQD A;  4JCK A;  1ZRC A;  2ZPX A;  4FFG A;  1QJZ A;  4P08 A;  4OFG A;  4QX8 A;  2QUO A;  5FJK A;  1NX9 A;  4RHV 3;  2J1E A;  4NE9 A;  1JXN A;  3MPP G;  3IAP A;  4A42 A;  4RFR B;  5DMY A;  1QQP 1;  4RSU A;  5IUQ A;  1L7L A;  2DVG A;  3FJS A;  2FZ1 A;  4RYD A;  1UOB A;  1I5P A;  4AR2 A;  1GOG A;  2XHK A;  1CN1 A;  2OPW A;  3SEP A;  1S2E A;  1O4Y A;  5FMC A;  3ZSE A;  1Z78 A;  4FCA A;  2CWM A;  2V73 A;  3R05 A;  1G6N A;  1R08 2;  3ES1 A;  3OB8 A;  2DU0 A;  5CG9 A;  1UZ0 A;  1B35 C;  2XJR A;  1PVC 2;  1AR9 3;  4QPG A;  1W6M B;  4JKL A;  4M3C B;  4WVM B;  2ZX2 A;  4XUQ A;  4OQ9 A;  1MEC 3;  3WV6 A;  4IEO A;  1F5F A;  1W03 A;  5HCB A;  4LBJ A;  4NWW A;  2GAL A;  1SFY A;  1DHK B;  4QWN A;  1O4Z A;  1YLL A;  5C8C B;  2B4K A;  3JZV A;  4CXW A;  2O1Q A;  3ZDV A;  1NE4 A;  3I2K A;  1LOA A;  4IEX A;  3OEB A;  5I8Y A;  2JEN A;  4JKK A;  3ZSJ A;  2WT2 A;  4PDW C;  4EZH A;  1NQD A;  4A7Y A;  4K1Z A;  2QQO A;  4AOC A;  2P1B A;  5J7M A;  2XJQ A;  2XL9 A;  4NRQ A;  3NMB A;  2XXZ A;  2B7Y A;  3KT7 A;  3BUC A;  3POI A;  2W1Q A;  1PGL 2;  3FBM A;  5I93 A;  1T6G C;  2XLG A;  1VRH 2;  1PGL 1;  3FE5 A;  3QAC A;  4AI2 A;  1OH3 A;  1KDK A;  3WW3 A;  5CEH A;  2NMN A;  4PI2 A;  1OLR A;  3NW4 A;  4O61 A;  4YVW B;  4ARX A;  1BEV 1;  1O91 A;  1QJU 2;  2BYV E;  3RJ2 X;  5C71 A;  3GF6 A;  1QJY 1;  2PLV 3;  1F4A A;  3OBA A;  1UY3 A;  2WIN B;  4I0A A;  3ILR A;  5BY5 A;  1TMF 1;  2VMF A;  2ZA9 A;  4RA0 A;  3IN9 A;  4XMA A;  1LAJ A;  3ZYR A;  2X53 S;  2ZX1 A;  4P9X A;  4A7K A;  2VMG A;  5A3N A;  1AVB A;  1HV1 A;  5FTT C;  1OOP A;  1VBE 3;  3AYC A;  1GFF 2;  1AR8 3;  2TUN A;  3RZZ A;  4ATF A;  1QXP A;  1ULP A;  2R07 1;  4WM7 C;  5FPV A;  5I0U A;  3B9I A;  1D0G A;  1SCR A;  3JB8 A;  2FCU A;  5I0D A;  1C8M 2;  2QQW A;  1LEC A;  2VH9 A;  5ABJ A;  1S0I A;  3P1I A;  1ZZB A;  5JLV A;  2JDZ A;  1Y4W A;  1H4H A;  2XML A;  5CAZ A;  1RVF 1;  3O1U A;  3H1W A;  2QQP A;  4CRQ A;  3SXW A;  5A3M A;  4K40 A;  1A8M A;  4HK9 A;  2G9Z A;  3BCW A;  1IPJ A;  3WCS A;  4DUV A;  5BNO A;  4DEQ A;  2LAL A;  4FFH A;  1NA1 C;  1OQD A;  2EIC A;  3NNM A;  3MDP A;  2E7A A;  5BYN A;  3WP3 A;  1UXZ A;  4N53 C;  4R8H A;  1PK6 A;  3ZR6 A;  1W6M A;  4WVM A;  2W95 A;  2Y64 A;  3BTA A;  2VZO A;  5E8A A;  1ULC A;  1J1L A;  4U36 A;  3AJY A;  2DUR A;  3H3L A;  1OUR A;  2P6H A;  4XJW A;  1YIF A;  5E16 A;  2DU1 A;  1CWP A;  3VV1 A;  4CZS A;  4AGV A;  3FC0 A;  2P3J A;  5A7S A;  2KXL A;  1LNS A;  2QDN A;  2WWS A;  2NN8 A;  1S0B A;  2VUD A;  2WO1 A;  2JD4 A;  5FZL A;  3VBU C;  1UF2 C;  5FYS A;  1YFY A;  3VBH C;  1SBF A;  5JDB A;  3MIG A;  1UY4 A;  3DN7 A;  1UYY A;  5FZF A;  2DVF A;  2ID4 A;  1YCI A;  4KWU A;  2X09 A;  4QPG B;  4C1W A;  5FBZ A;  1AJO A;  4IND A;  1UMH A;  4DRR A;  2YMZ A;  4BQY A;  1O3S A;  1QJU 3;  4EQV A;  2PHL A;  3PUH A;  4Q4Y 2;  4Q0P A;  4H2A A;  3W9A A;  4E4Z A;  4AK3 A;  1NA1 A;  3B69 A;  3WX5 A;  1X36 A;  1DYP A;  4IQP A;  5FZI A;  2W52 A;  1ZZ7 A;  4DPN A;  4ZU4 A;  4I0W B;  3GCX A;  1QJX 1;  5F5Q A;  3UNP A;  3QLQ A;  4Y4Y A;  2O0O A;  4ES9 A;  2FCV A;  2EXH A;  3O7O A;  4JGZ C;  4OI2 A;  3PUI A;  1JH5 A;  1Q8O A;  2AUY A;  1E57 A;  3WSO A;  3MBW A;  2GH8 A;  4IES A;  1ZBA 2;  1YQC A;  2WFP A;  1ASJ 2;  1NCQ A;  5JR2 A;  3D0J A;  2ZAB A;  1H1M A;  4HN1 A;  3UL2 A;  1RMU 1;  5I8T A;  4Y22 A;  5BPX A;  1QOT A;  5CG8 A;  3ATG A;  5FZA A;  3JBG 3;  2JIG A;  3ZYB A;  3ZXL A;  1WD4 A;  1JOJ A;  2Z2S B;  3OPT A;  4JRL A;  3POB A;  2Y33 A;  3ALQ A;  4L92 A;  4UAP A;  4UBH A;  1RIN A;  1MEC 1;  2WN3 A;  4MLO A;  1JU4 A;  3LB9 A;  3ZPY A;  1UMI A;  4IV3 A;  4R9D A;  3AP6 A;  2DVA A;  2Y6G A;  4XF1 A;  2OXB A;  4A6S A;  5C3Q A;  3AVR A;  2K9Z A;  1XC6 A;  3EXU A;  3M7A A;  2J7M A;  4NOT A;  4Y24 A;  1UKG A;  4LXL A;  4XJA A;  4CDU B;  2LM3 A;  2NP0 A;  1BEV 3;  2EXK A;  3J7N A;  4NO4 A;  3EO6 A;  4B1M A;  4FPY A;  2ZGQ A;  2TNF A;  4UI9 L;  1S0J A;  1H30 A;  4GWI A;  4Y1X A;  1MS1 A;  3MLL A;  2RDN A;  3IBM A;  1PGW 2;  2CV6 A;  4AVC A;  2ZX3 A;  1ND2 A;  3RYP A;  1CQ9 A;  3TB0 A;  3JQW A;  4PDW A;  4XDP A;  1UMZ A;  3GZE A;  3VN4 A;  1PGW 1;  4BH9 A;  1JZ7 A;  5J37 A;  1FMD 2;  3MW2 A;  4YGD A;  5JAX A;  2DYC A;  1DZR A;  2A73 B;  3WCR A;  4HKL A;  5FK7 A;  1IOA A;  4H7M A;  4K7J A;  1ENS A;  2B46 X;  2VZT A;  1MS9 A;  1WLW A;  2I45 A;  3TBD A;  1EV1 2;  4EZ4 A;  3FLP A;  5HCH A;  1J3R A;  3ECQ A;  4XXA A;  4ZXE A;  1RED A;  2DVB A;  2HEW F;  2JIC A;  2WZR 3;  2VNR A;  4WZC A;  3E6C C;  4OHY A;  5KC6 A;  5DUV A;  5JZG A;  1PX3 A;  3N9N A;  3PTR B;  4EWA A;  3VDA A;  3ZYH A;  2PQQ A;  3H8U A;  1SFN A;  1AHS A;  2E6V A;  2RS1 1;  5CFD B;  5JIA A;  1UYP A;  3AP5 A;  4FXG B;  3CQO A;  4TN7 A;  2I07 B;  1PZ8 A;  1ULO A;  1GUI A;  2WT0 A;  4XJU A;  4DXR A;  3V0A A;  4OI1 A;  4AI8 A;  3A7Q A;  1VBE 2;  4D94 A;  4RQP A;  4CXX A;  5GM0 A;  5J3U A;  1TME 3;  3IDE A;  4QM8 A;  2RR1 3;  3CL1 A;  3GZT B;  2LTN A;  1QXR A;  2KD7 A;  1O5U A;  3U11 A;  5JPM B;  3HIF A;  3DYM A;  4LTA A;  4N9H A;  1KD7 A;  1BJQ A;  3ZYJ B;  3LFI A;  2V09 A;  3C2U A;  4NPM A;  1CAX B;  4UFJ A;  2ARE A;  4UW4 A;  3SHR A;  4NIH A;  5DDJ 1;  5FUP A;  4OHV A;  3WQ1 A;  4YZ1 A;  3KM5 A;  2WWJ A;  5I0R A;  1A34 A;  4XHX A;  4COZ A;  3VBU A;  2YDE A;  2OW4 A;  1YC6 1;  4ATE A;  1JUH A;  1AYN 1;  1LGB A;  1W2U A;  5T5L A;  4TLF A;  5H9S A;  5LA2 A;  4CEW B;  2Q8C A;  1NCR A;  1QNY A;  1POV 0;  3KGL A;  1ZBE 1;  4PIZ A;  5H9P A;  5JSP A;  4BQX A;  1O59 A;  1KGY A;  5FMD A;  4QB2 A;  5FK8 A;  1UW8 A;  4BLJ A;  5IK4 A;  3C7G A;  1OA2 A;  3WHU A;  1HRV 3;  1XYN A;  5F3I A;  3CMG A;  3H8X A;  3D8C A;  4Q4X 1;  1GR3 A;  5DAB A;  4AEJ A;  4E2S A;  1VRB A;  2YY1 A;  4LKD A;  5DQ0 A;  3WF0 A;  3WNP A;  5K0U C;  1TMF 2;  2JEM A;  3GBG A;  1OUS A;  4XIK A;  2WZR 1;  5FY8 A;  2BUK A;  4EYU A;  4FTE A;  1C3H A;  3F2Z A;  2V4V A;  1POV 1;  1W3X A;  3POE A;  4DEV A;  5D8A C;  2XBO 1;  3T4V A;  4TSV A;  1QKQ A;  3E5U A;  5FY5 A;  3LOB A;  1U5X A;  1WCS A;  3ZYG A;  1AXZ A;  4Q4W 1;  3W59 A;  4QPI C;  5C3O A;  2YPJ A;  4RGA A;  1FYU A;  3H7J A;  5FP8 A;  2HBU A;  4WM7 A;  5C5T A;  4XJZ A;  3WQB A;  1V9U 1;  2ZOE B;  5EPA A;  2CAU A;  1V9U 2;  3ME2 A;  1XB9 A;  2UY8 A;  5BNN C;  4WVV A;  1ND2 B;  3VBO A;  2LRO A;  3ES4 A;  3L2Y A;  4A3X A;  2WT1 A;  4RFT 0;  4YW3 A;  3WLU A;  2BRT A;  1X82 A;  4RGG A;  1X8M A;  2R06 2;  1W8W A;  3HNB M;  5T50 A;  1XNC A;  5L9B A;  4HLT A;  5L7O A;  4UFL A;  3OGJ A;  4R4Z A;  3I49 A;  1V6K A;  1ND2 C;  1VBC 3;  3AZX A;  2HWE 3;  1TVG A;  4XUP A;  4QX5 A;  1FOD 1;  1AR9 2;  2B9V A;  4XE9 A;  4RS5 C;  5JOW A;  4AGG A;  3J7L A;  2JX9 A;  3N7L A;  3VKM A;  1CAW A;  1MS3 A;  1Z7S 3;  4CXY A;  4IE4 A;  4Q1R A;  4AFD A;  4BYY A;  4NVP A;  2A3X A;  4PJY A;  5FYZ A;  2RVA A;  2YGL A;  3O12 A;  1WCQ A;  1XSQ A;  4IL7 A;  4NIA A;  5FQ0 A;  1C8N A;  1Y3T A;  1A78 A;  1DGW X;  1VBB 2;  4YSF A;  2CSG A;  2IXH A;  3HT1 A;  4EN7 B;  5FPA A;  1H2L A;  3I3B A;  4NII A;  1OKO A;  4QB6 A;  5FDB A;  1CAU A;  1PNG A;  3A4U A;  4D0Q A;  4BM8 A;  3UGF A;  2JB4 A;  2HYX A;  1T6B X;  1M06 G;  1QJY 3;  2PLV 1;  4PF1 A;  1H2M A;  1H1A A;  3QBQ A;  1O5L A;  4Q4Y 3;  4KQ7 A;  4YGE A;  4FOY A;  1PIV 1;  3T2Q A;  3UKN A;  3ACG A;  1MVQ A;  5FP4 A;  2Y0I A;  1B35 A;  1HX6 A;  2WS9 3;  4GMP 3;  5E89 A;  2PAK A;  5GLV A;  1O8P A;  5L73 A;  4EWE A;  5FXX A;  3GNE A;  4P5H A;  5EIY B;  1GQG A;  2JG8 B;  4OHW A;  4XF4 A;  2PTM A;  2GNB A;  2VCB A;  4OUL A;  5FP9 A;  5FY1 A;  5GAL A;  1O8S A;  1PO1 1;  2UWA A;  4F8A A;  4FPE A;  1CZS A;  3IDB B;  3I4I A;  2JE8 A;  2G19 A;  4XUT A;  2YC4 A;  4UW3 A;  1DQ2 A;  1LES A;  4FO9 A;  3ZFF A;  3GXU A;  4LOR A;  2BPA 2;  4NAO A;  2ZHM A;  3T30 A;  4LBO A;  2BBV A;  1IPK A;  4ISQ A;  3HEI A;  5LRS A;  5IAX A;  1B09 A;  4R9B A;  3RZJ A;  4URA A;  1R08 1;  3AP9 A;  2JG8 C;  2D98 A;  2OZJ A;  4RHV 1;  2YC2 A;  3I2O A;  4CCM A;  1ZX5 A;  5SV8 A;  4P9J A;  1QEX A;  4CCE A;  1OVP A;  1WMD A;  2ZGT A;  3KVA A;  4ITC A;  2WWU A;  2DCT A;  2VO5 A;  3JXS A;  1L7Q A;  3T1L A;  5BNP B;  4CU7 A;  4JRA A;  5T55 A;  1AL2 2;  1RUC 3;  1COV 1;  3BPZ A;  3CKH A;  2E7T A;  4PQQ A;  3RZK A;  1FV3 A;  2LRP A;  3B9C A;  5L7O B;  3PME A;  4BXS V;  1NKG A;  1ZA4 A;  5HV0 A;  4GMP 0;  4M4P A;  2RV9 A;  4RR3 C;  3U4S A;  4SLI A;  2R1B A;  1LCL A;  3FHI B;  5J1X A;  1YYN A;  5B2G B;  3K77 A;  3GYD A;  3HBZ A;  4MGZ E;  1JYX A;  1RIR A;  1YI9 A;  2G9F A;  5FZ6 A;  1LOB A;  4BQ2 A;  1JZ8 A;  2Q1F A;  4B3N A;  2UYB A;  5AC9 2;  3BIW E;  1CX1 A;  2K2S A;  1SPP A;  5JI7 A;  1FMD 1;  3LA7 A;  5LBE A;  1PHM A;  3TN9 3;  2EAL A;  2UU8 A;  3ZKY A;  4ARY A;  5BNO C;  3WDX A;  2IXI A;  2C24 A;  5BNN A;  1UPI A;  2ZGU A;  3Q8C A;  5EV7 A;  1RUF 1;  2QQJ A;  3V65 A;  1UOF A;  2HBT A;  2E53 A;  4MOA A;  1V6I A;  5LA1 A;  1W04 A;  1OC1 A;  3GM8 A;  2GDF A;  1GLH A;  3VZJ A;  2WZR 2;  1WD3 A;  5CNA A;  4E8C A;  2DCK A;  4MET A;  4TLG A;  4JDN A;  5L19 A;  5BNN B;  2FBE A;  3E97 A;  4Q4X 3;  5FYT A;  2HWD 2;  3URF A;  4WVW A;  3AK0 A;  3KMH A;  1TMF 3;  1WW5 A;  4KH9 A;  2HH9 A;  4YVW A;  3UET A;  1RUI 2;  1K45 A;  2CWS A;  4DY5 A;  3V0A B;  2WA4 A;  2Q8D A;  2WZP P;  1PVC 3;  1HIX A;  3RZL A;  5FO9 B;  2ZAH A;  2VQT A;  5FZ7 A;  3R4U A;  2VTX A;  1I3H A;  4N7I A;  1AX2 A;  5FKC A;  4OMD A;  1E5R A;  1IGO A;  2E51 A;  4K20 A;  1J3Q A;  1GZ9 A;  3FMG A;  3K3N A;  4XTP A;  4EJR A;  1T2X A;  1Q5O A;  5K0U B;  1EUU A;  5IAV A;  1ODN A;  1COV 3;  1QJF A;  3HQR A;  3LIH A;  1D7P M;  1LJ7 A;  2Y26 A;  4OUS A;  3U1X A;  5A3P A;  4WM8 B;  5GZG A;  5CB7 A;  3DL3 A;  5DDJ 2;  4AXO A;  2BTV C;  1XYP A;  2JEC A;  1GOH A;  4XYX A;  1KXG A;  3Q9O A;  4ZPI A;  4XCB A;  5ACA 3;  1JYT A;  3KV4 A;  4O9G A;  3T0B A;  1V70 A;  2JG9 B;  4NHM A;  2OQ7 A;  5IYY A;  1VE0 A;  1WGP A;  3T0A A;  1CAV A;  3JBG 2;  3LCP A;  2VU9 A;  1E5S A;  2OQ6 A;  2Q1M A;  2FHR A;  1DG6 A;  1CON A;  2VUL A;  4WZF A;  5F2S A;  4CUB A;  1CVN A;  1G8W A;  3WG3 A;  3O1T A;  1Y9G A;  1KS5 A;  1HRI 1;  2VBP A;  3N7K A;  3WZ1 A;  2RHP A;  4GKY A;  1WME A;  4AHZ A;  5LW9 A;  1NLR A;  3VKF C;  1QMJ A;  1JYN A;  4D69 A;  2VUJ A;  4XQ4 A;  4DXS A;  3IMM A;  3JU9 A;  2E26 A;  1DQ5 A;  3POF A;  4JC1 A;  1EAH 2;  4CPB A;  3OF1 A;  1AR7 3;  1RUE 3;  1NUK A;  3PHM A;  4KMQ A;  2P2K A;  4Y5T A;  4UT5 A;  4DIQ A;  1OKQ A;  2PFW A;  2DUP A;  4Y26 A;  1ACC A;  5C9A C;  2AEY A;  3B02 A;  1NCQ C;  4G3Y C;  4YZ2 A;  4M0N A;  5IVV A;  3OUI A;  3THT A;  1RVF 3;  4Q0Q A;  1RUI 1;  3H7Y A;  3KV6 A;  4AWD A;  2BV4 A;  5LBC A;  1QIQ A;  3VL9 A;  4M3C E;  1PO1 2;  4IV1 B;  5C6C A;  5C3R A;  1BMV 2;  2HWC 3;  1VBA 1;  3MPB A;  1BK0 A;  1CX4 A;  1WWY A;  2DCJ A;  1WA4 A;  4YYO A;  5FIX A;  1RUD 1;  3ACL A;  3LGR A;  3SCH A;  2PAE A;  3P3N A;  2EAA A;  3DXU A;  2VCC A;  2VOK A;  4Y20 A;  5K4L A;  4CU9 A;  4ZY9 A;  1ENR A;  2ZHL A;  2RMU 1;  3SKV A;  1WMX A;  1LOE A;  3WW1 A;  4CEY A;  5A32 A;  2GU9 A;  5E6H A;  1XSR A;  4QX3 A;  4I02 A;  4KU8 A;  3AL5 A;  4NUB A;  5IFP A;  3CIH A;  1LOF C;  4PF5 A;  4YZ4 A;  3HBK A;  1VMJ A;  5LEK A;  1UIK A;  4CU6 A;  3AVS A;  2CHH A;  4YG3 A;  4XF9 A;  1BVP 1;  4RL7 A;  2RR1 2;  4YFW A;  1GP5 A;  3BU7 A;  3NAP B;  5CIS A;  1YRZ A;  4LHK A;  1NZI A;  2WA3 A;  4IET A;  1LB2 A;  4XFB A;  3DKW A;  2P4E A;  2VCA A;  1UU5 A;  3WF4 A;  4KBB A;  2RJL A;  5FOJ B;  5FKB A;  2EID A;  1JW6 A;  1PMH X;  3LD8 A;  3A0N A;  1GBG A;  2RDS A;  4DNY A;  1QY4 A;  1OBN A;  2ZZJ A;  3LOI A;  4JVA A;  2ZTN A;  5F39 A;  4BME A;  4FOQ A;  1DLL A;  1MZ5 A;  2P17 A;  2WNV A;  1ND3 C;  5FZ4 A;  2OUH A;  3S0M A;  5IK8 A;  3N7M A;  5BNQ A;  1OD5 A;  4LMF A;  3K51 A;  3M8L A;  1K5M B;  5FZ8 A;  4RGK A;  5AFE A;  3VDD C;  1O3R A;  2OS2 A;  1F5J A;  1VLN A;  1ST8 A;  2WRA A;  2VZ3 A;  3AB0 A;  3AX4 A;  4GAL A;  4H14 A;  1PIV 2;  2VZR A;  4P9L A;  1AR7 2;  1RUE 2;  4BQ1 A;  5FPU A;  1MQT A;  3LDB A;  2UUR A;  3TEY A;  1NXD 1;  1WLD A;  5IHR A;  4LK7 A;  2ZML A;  1WCD J;  2GMM A;  1UX7 A;  5HXV A;  4KL1 A;  1GZC A;  2UWC A;  2WSV A;  2VUC A;  1R1A 3;  4HFS A;  1JHN A;  3J4U H;  4Y3O A;  1RUD 3;  1WBL A;  2JG8 A;  4Q27 A;  3S7I A;  3K3O A;  2PEL A;  3T3Y A;  1SLC A;  2D40 A;  5FPB A;  1MZE A;  2XUM A;  2NQY A;  1IKQ A;  3PL0 A;  3OD4 A;  1CIY A;  2ZGL A;  4ZXK A;  5I8S A;  3WNM A;  1HJG A;  1OMI A;  3IZO A;  4CEW A;  5FYY A;  2PHR A;  3AMP A;  1VB2 A;  1W8U A;  1YQ5 A;  4YM2 A;  5DG1 A;  5FXV A;  1U12 A;  4XDO A;  2ZAC A;  2D3R A;  3DKQ A;  3VZN A;  5CFC A;  5A3T A;  3UT0 A;  4JKM A;  4CCD A;  4I0B A;  5M0T A;  1OOP B;  2HWE 1;  2YZ4 A;  1FX5 A;  1U5I A;  2NYY A;  3G6J B;  3TOJ A;  1OA3 A;  3NST A;  3NO8 A;  1X9P A;  4OHZ A;  1TME 2;  2Y8K A;  1RC6 A;  1JZ2 A;  1W8N A;  1AF9 A;  4C1X A;  1N3Q A;  3N9O A;  1EYB A;  5D21 A;  1IG0 A;  1UZY A;  1OPM A;  4UWD A;  5ANQ A;  1UKR A;  3V56 A;  4A4A A;  3CLP A;  4Z1V A;  4CVU A;  1PX4 A;  5AC9 1;  4DZG A;  4LBL A;  2J22 A;  1GP6 A;  4XJ9 A;  1HRV 2;  4QDQ A;  1IPS A;  3ZR5 A;  4PIX A;  1Z7S 2;  2JE9 A;  2ZGR A;  4WM8 C;  1R09 2;  1UWW A;  3S7E A;  2PN5 A;  4Q4V 1;  1NT0 A;  2Z42 A;  1VRH 1;  3O0X A;  2KR2 A;  4HL0 A;  1OF3 A;  1F35 A;  2PMW B;  3JCI A;  2CDO A;  5FPX A;  1SCS A;  4R4X A;  2WS9 2;  4AI9 A;  5LK7 B;  1F8V A;  1L7R A;  4YVS C;  3IIA A;  3A0K A;  5KHH A;  4CP9 B;  1X50 A;  5FCC A;  1BEV 2;  1U5Z A;  1HV0 A;  2R16 A;  2KM2 A;  1MS0 A;  3MHZ A;  4N53 B;  4LIT A;  4YRD A;  2GP5 A;  4QXK A;  1OSG A;  4IEP A;  3H42 B;  2RDR A;  5JSR A;  4CCC A;  2VL4 A;  2ZGS A;  3KLS A;  4PI0 A;  2GC1 A;  2C9K A;  1UU4 A;  2QJV A;  1QOS A;  4L8Q A;  3OCP A;  4M0H A;  5LEJ A;  4BJ0 A;  2WAB A;  1ZNP A;  3D6E A;  4XF3 A;  1GQP A;  4PDW B;  4XTM A;  4LK6 A;  1QJX 2;  1XBF A;  1ZZ9 A;  1EUT A;  1SLA A;  4XFI A;  2ZGO A;  1WCU A;  4X8N A;  2VME A;  2R06 3;  3LSE A;  1UY0 A;  5GZF A;  4DMI A;  4CUC A;  2A71 A;  4HK8 A;  4NN0 A;  2W47 A;  2F4P A;  4Q4W 3;  3VZM A;  1LHN A;  1UN1 A;  2HWE 2;  2VAU A;  3C7H A;  5GLU A;  2HWF 3;  5K9Y A;  4TTG A;  2D93 A;  4NPL A;  1I1E A;  3BN6 A;  5FZ0 A;  1QH6 A;  3I3M A;  2XON A;  3R6S A;  2DFC A;  5LBF A;  3FLT A;  1GNH A;  4AHY A;  2EVX A;  3CEW A;  1LEN A;  5EJ1 B;  1HRI 2;  4NRO A;  4R52 A;  3CHX A;  2W46 A;  4IV1 A;  4E4D X;  4MAD A;  1UYZ A;  5FQ0 B;  3ZMO A;  3NV2 A;  3MLJ A;  4XCA A;  1L3J A;  3ZFE C;  3JD7 1;  3NNF A;  5DXD A;  4CTE A;  4V1P A;  4HSL A;  2H0V A;  4FP3 A;  5C7G A;  1RUH 2;  4QAW A;  4A2U A;  3AFK A;  1CAW B;  3J26 N;  3MO4 A;  2NMO A;  1C5H A;  1IG3 A;  2FMY A;  1WA6 X;  5KXD A;  1DQ6 A;  3CO2 A;  1D2Q A;  2EXJ A;  2LS6 A;  3POG A;  3TEZ A;  5F37 A;  3BIE A;  2BGP A;  5L9R A;  4E4S A;  4YM0 A;  1NA1 B;  2GP3 A;  5CFC C;  4M3C F;  3U0Z A;  2W94 A;  3ILF A;  4C8D A;  1QOO A;  2VNV A;  3VKN A;  3CJI A;  1G9D A;  2YHJ A;  3M3I A;  4A3Z A;  2JDH A;  4K6B A;  1ND3 B;  1DYK A;  3VLB B;  1OA4 A;  4HON A;  3BI3 A;  1RUN A;  2RG4 A;  3DXT A;  1HW5 A;  1H8T A;  1YQ6 A;  5A7N A;  3RMY A;  1BQP A;  2B42 B;  1QQP 2;  3FHA A;  1AYM 2;  1UO9 A;  3GBW A;  2B5H A;  3HVD A;  3POJ A;  3BTX A;  1RUJ 1;  1APN A;  4AVV A;  3WDW A;  4D8M A;  1W8O A;  1HXS 3;  3E5X A;  2CDP A;  2BOI A;  3AKR A;  2VMD A;  5JXH A;  1IS4 A;  1W9S A;  1YXW A;  2ZKL A;  3LSD A;  2HWF 1;  4MGI E;  4MUV A;  3LA3 A;  2ILM A;  3ZXF A;  1RTV A;  5FYV A;  4IGO A;  5JWP A;  1MZ6 A;  4Q8L A;  4QQ2 A;  3THD A;  4OLL A;  4CP9 A;  1DIW A;  4W8J A;  3DV8 A;  5IWF A;  3U4X A;  1LEM A;  2CTV A;  1RUG 1;  2J1V A;  3CDZ B;  3SKJ E;  3O1P A;  4MG2 A;  2V5D A;  2VOV A;  4C0B A;  1BZW A;  1PNF A;  2VE1 A;  3ZFE A;  3HNY M;  5ACA 2;  4QKB A;  3MFC A;  1QH7 A;  4H3W A;  4HXC A;  4DUX A;  1RHI 1;  4KWJ A;  2P3I A;  4PBO A;  4XZU G;  4QXH A;  4J6G A;  1SFP A;  3VHP A;  1JZ4 A;  2FDK A;  1SQ4 A;  3N36 A;  2FDH A;  1UQX A;  4CEY B;  4W4Z A;  2R30 A;  5DUU A;  2JWP A;  2WJS A;  1LHV A;  4I3P A;  1H0B A;  1QF3 A;  1PK6 C;  1RUH 3;  4LA2 A;  3WNK A;  1HJF A;  5F3C A;  2ETE A;  4Z07 A;  5KWR A;  3B7M A;  5B4X A;  2ZS6 B;  2HWB 2;  2Y38 A;  1OI6 A;  4Y5Z 0;  2UYA A;  5JPN B;  1HQL A;  3PIG A;  4B4R A;  2GMP A;  1XND A;  3VBR A;  3IAQ A;  2WL1 A;  3KZ4 C;  5G04 L;  3PU3 A;  2J1S A;  1ZVF A;  2B39 A;  2Q5T A;  3IPV B;  4MVT A;  1S0C A;  4Q4X 2;  2PHW A;  5LBB A;  5LZ6 A;  2CYF A;  5FMO L;  1VAV A;  4QGM A;  3M2M A;  1ZZ6 A;  2ZGP A;  2CGP A;  2O8O A;  4EV0 A;  1R08 3;  1QHD A;  1EV1 3;  2D97 A;  4Q0U A;  5BV6 A;  3BOW A;  1BKZ A;  1J83 A;  4K8F A;  1Q8P A;  2W5F A;  3M3C A;  2O14 A;  3VBF C;  1QQP 3;  4Y5S A;  1FNZ A;  2GN3 A;  1IQA A;  2H0B A;  1AR8 1;  2XVG A;  2FZ2 A;  4W65 A;  1AXK A;  4MGQ A;  4OUM A;  2WNV C;  5I0S A;  1RJ7 A;  4P00 B;  1OT5 A;  1MQT B;  1KQR A;  3TEX A;  5A3L A;  4UOJ A;  4E4H A;  1WCK A;  5T5J A;  1W06 A;  4BU2 A;  4AEK A;  1N3P A;  3ZN6 A;  1V6L A;  4XF0 A;  4Z82 A;  3ZMN A;  5IVJ A;  2WNV B;  1H4G A;  4ASL A;  3I3D A;  1CIW A;  3ZSK A;  2BNO A;  4PCR A;  2KA3 A;  5LWB A;  1FOD 3;  4NWV A;  1WZX A;  5KXE A;  2GSY A;  4IW3 A;  4EN9 B;  3WIN E;  4H55 A;  2FDF A;  4JV4 A;  1Q3E A;  1WBF A;  3Q8F A;  5A3O A;  4DFS A;  1KIT A;  3NAP A;  1AUY A;  1GSL A;  5CKQ A;  4L9B A;  4UYB A;  1NY7 1;  2VBD A;  4IV3 B;  1XXN A;  4IGQ A;  1VB4 A;  5D2A A;  3SQO A;  3ON7 A;  3LIG A;  2WNU A;  5BUV A;  4IDZ A;  2YV8 A;  4TWT A;  3K2O A;  4W50 A;  2XWB B;  4YW4 A;  2TBV A;  1FAY A;  4QD2 A;  1RUO A;  1OLM E;  5FPZ A;  4LOS A;  3ZFG B;  5EP9 A;  3MLK A;  1R1A 2;  4QKN A;  4COV A;  3H1M A;  1EPZ A;  3IPV A;  1FMD 3;  3TN9 1;  5CVR A;  1MS5 A;  1KEX A;  3J8F 3;  2DTW A;  2QTW B;  3LA2 A;  3TN9 2;  3HQU A;  4HVO A;  3PU8 A;  3D3A A;  3FFZ A;  2ARC A;  2VOX A;  1SDD B;  4BA6 A;  4FBF A;  1YJL A;  1BBT 2;  4QPI B;  4AGR A;  3ORJ A;  5ERL A;  2IZW A;  4DXZ A;  5HXM A;  5CFC B;  4PHZ A;  5EJZ B;  2DUO A;  4XIO A;  2BGC A;  2JDM A;  2H6B A;  1ZA7 A;  4XBN A;  2FDJ A;  1I9R A;  3PUR A;  5J48 A;  2YRO A;  4BXF A;  4BWO A;  4QB1 A;  3NJY A;  3DGT A;  1BLZ A;  1H9W A;  3WDV A;  3RQ0 A;  3VDD A;  4LA3 A;  4OZO A;  1VR3 A;  2E33 A;  1UIJ A;  4QGL A;  1IZ3 A;  4BDV B;  1RHI 3;  1SAC A;  4LHN A;  1AR6 2;  4JGZ B;  1DFQ A;  1Q8V A;  2PXJ A;  3VKO A;  1PGS A;  3BU0 A;  1HKD A;  3BYW A;  3JUU A;  4D7T A;  3WR0 A;  4ZZ5 A;  4URT A;  3V0B A;  4LBM A;  4QMA A;  4UW6 A;  2XLF A;  1OD3 A;  4P9Y A;  2GND A;  5H9R A;  1YWK A;  4A45 A;  1TG7 A;  3T2T A;  4UBG A;  3KV5 A;  4FPK A;  4IE6 A;  4XET A;  1CAV B;  1G7Y A;  3B5L B;  1XU2 A;  1NY7 2;  3W20 A;  4S2F A;  4L99 A;  4OUE A;  2BVV A;  3E1F 1;  4AQ2 A;  3OPZ A;  3PJQ A;  2A3W A;  5FZD A;  3WW4 A;  4D6S A;  3PVB B;  3BPS A;  4FPL A;  3HN3 A;  1OPO A;  2VZV A;  3OG2 A;  4LEJ A;  3ZO0 B;  3HNM A;  3LPG A;  3KQR A;  5FUI A;  4BMB A;  2FDG A;  3ACF A;  4O65 A;  1H8T B;  3CF6 E;  2C6S A;  1DLC A;  3NKG A;  5FYI A;  1QXJ A;  4J1W A;  2GZW A;  2EF6 A;  3FUO A;  1ZBE 3;  2PLV 2;  3NV1 A;  3R4D B;  4P14 A;  4XUO A;  3WY6 A;  4ET7 A;  1CD3 G;  1FNY A;  1MS4 A;  1PK6 B;  2ENR A;  2ORZ A;  1TQ5 A;  2XKP A;  3N9M A;  5LA9 A;  2YC0 A;  4Y33 A;  5CFD C;  2R04 3;  1E5I A;  1PZ9 A;  4HBN A;  1W3V A;  3KCX A;  3KV9 A;  4YLZ A;  2IXL A;  4K21 A;  4Z2A A;  3TYJ A;  2RS5 3;  3W21 A;  3K48 A;  3LF7 A;  1BMV 1;  3HOB A;  5A7P A;  1RJ8 A;  2P3K A;  3SNM A;  4AQ6 A;  1NCR B;  1QJX 3;  5ABJ B;  2VVE A;  1HXS 2;  2ZX4 A;  2VMI A;  1MR5 A;  3K75 B;  4QPW A;  5APA A;  5FWE A;  1WLT A;  4CE8 A;  4B29 A;  1W0N A;  5EWS A;  4XZP A;  3MIB A;  1HQN A;  5KC5 A;  1K5M C;  1R64 A;  2D6O X;  3DPR A;  2YUE A;  4CCJ A;  2WDB A;  2Y60 A;  2SBA A;  2VMC A;  2VZU A;  1XNK A;  5LAT A;  3IWZ A;  2XWJ B;  2MPF A;  5F6L B;  3T0D A;  1X33 A;  1TEI A;  4K1Y A;  4DRV A;  1V9U 3;  1JYI A;  3WDT A;  5DUX A;  3ILN A;  1RUC 1;  3EJK A;  4HET A;  1DGL A;  3B00 A;  1RMU 3;  2WNU C;  2PHF A;  4QKD A;  2VJX A;  2XJU A;  4AL9 A;  2EIB A;  2ZEY A;  2XL7 A;  2I2S A;  2RM2 1;  3SCF A;  4CDU C;  4JQT A;  3DCQ A;  4ES8 A;  1FI2 A;  3NAP C;  4U2A A;  1W8F A;  5DDJ 3;  1D2S A;  4KGG A;  4AFB A;  4D7Y A;  4P9W A;  2PAM A;  1GIC A;  4LHL A;  4LUK A;  3UJQ A;  4FPF A;  2F17 A;  3B94 A;  3BTZ A;  5C4W C;  3S5A A;  5T3N A;  4QQP A;  3BTY A;  2ARB A;  4E2Q A;  3KGZ A;  1IS6 A;  4O9E A;  2XKO A;  2MEV 2;  3ZXJ A;  3PVO A;  4LKF A;  3I2D A;  3N7J A;  1UD1 A;  2QZ3 A;  2DV9 A;  4Q5O A;  1MVE A;  1W6N B;  1Y9M A;  4N43 A;  2Y6J A;  1AX0 A;  1V0A A;  4R9A A;  2WS9 1;  4GMP 1;  5D8A B;  5JUV A;  1RUF 2;  1LKN A;  2WO2 A;  4LKS A;  1LED A;  1GU3 A;  2QQN A;  4YVS B;  4CDX C;  3AKP A;  4LBQ D;  3SIS A;  5DAQ A;  5GLW A;  5C8C A;  1NQJ A;  1PO1 3;  1Y7B A;  1RB8 G;  5F1R A;  5FY4 A;  4ORF A;  1SMV A;  2MHF A;  1EAH 3;  4QX0 A;  3OOX A;  2FDI A;  2GNM A;  2ZBJ A;  3IB3 A;  3KS7 A;  2GNT A;  3MUY 1;  2VNG A;  4Y1U A;  1LR5 A;  1ZRR A;  1SLL A;  4QX2 A;  5EYX A;  3ZSM A;  4GWN A;  2WAA A;  4QU1 A;  1GWM A;  3QH6 A;  4M01 A;  1NLQ A;  5FAX A;  5GZD A;  1RUJ 3;  1GZW B;  2CY6 A;  1ALY A;  3AZW A;  1A6C A;  1UZV A;  2V5Y A;  5EHD A;  4LUL A;  3AXD A;  1GZT A;  2WKK A;  2FCT A;  3APB A;  3MUZ 1;  3U78 A;  2HWC 1;  4IEV A;  5A1L A;  4L11 A;  3FHQ A;  4MHU A;  4B7E A;  1H6Y A;  1WUV A;  5JI9 A;  1B35 B;  4XUR A;  1VBE 1;  2VCM A;  4AE2 A;  4KU7 A;  2BP6 A;  1LU2 A;  4GUL A;  5T52 A;  2QQU A;  3POY A;  1NLS A;  3KB5 A;  1J84 A;  5LA0 A;  2AZ5 A;  1ZYB A;  3PVE A;  3WDU A;  3MID A;  1JOP A;  4LO5 B;  1DGW A;  4Q26 A;  3DUI A;  1W6O A;  4J25 A;  4QPY A;  4Q0V A;  2BU9 A;  4BQ3 A;  3ZYF A;  2PHT A;  2W0X A;  3UJO A;  3N35 A;  3C3V A;  3ABZ A;  4LBQ A;  5E88 A;  2K46 A;  3VBU B;  4Z2W A;  3VBH B;  2XQX A;  5FZ3 A;  1US3 A;  3E6B A;  1QNW A;  3WT3 A;  1S0E A;  4AVS A;  5I91 A;  4MXV A;  2JG9 C;  2VW0 A;  3RVH A;  3WNN A;  3KF3 A;  3M3O A;  4CA9 A;  1LOD A;  1CAX A;  1W8T A;  1YJK A;  3M3Q A;  4PIY A;  5CU1 A;  3WUD A;  5C8W A;  2QE3 A;  2HEY F;  3T2P A;  4GH4 C;  4GD4 A;  5EYY A;  2D6N A;  1AYN 3;  5A7W B;  2GN7 A;  4NMI A;  1A8D A;  1OQE A;  5FRA A;  5IT6 A;  2JD9 A;  3GJA A;  3O0W A;  1RUF 3;  1RUH 1;  2QQL A;  3F95 A;  1JZ3 A;  2AYH A;  4DQA A;  1Q43 A;  2A6Y A;  4BK4 A;  1ONA A;  3SC7 X;  1VBB 1;  2XJV A;  4XFC A;  2YFZ A;  4IEQ A;  4M00 A;  3ELN A;  4AAP A;  4QX7 A;  1EAH 1;  3RZG A;  3NRU A;  4KG8 A;  3DPR C;  4YGC A;  3AYA A;  3DPR B;  5CKM A;  1VP6 A;  3G7D A;  4V2W A;  4AI0 A;  3FUQ A;  2HEV F;  5AVA A;  5G05 L;  5FZO B;  3VBO B;  3MYX A;  1PIV 3;  2IUW A;  5A6Y A;  4XW3 A;  1K5J A;  2PQS A;  1EV1 1;  3RI9 A;  2E9Q A;  4WM7 B;  2OII A;  2FQP A;  1VBA 2;  3VD9 A;  1BHG A;  1C8M 1;  2W87 A;  4PQ9 A;  3VUO A;  3RRD A;  3WP4 A;  1F4H A;  2BGO A;  1H6X A;  1W90 A;  4V2V A;  1V6J A;  4QDR A;  2R32 A;  2RS3 3;  4GB3 2;  2RS3 2;  2WSU A;  3VZL A;  1YUD A;  5IVF A;  1RUD 2;  3NV3 A;  4DOU A;  1A3K A;  1N1T A;  2YG0 A;  2ZCW A;  5CIR A;  1QGL A;  1V6O A;  3GHM A;  4YW2 A;  3V64 A;  5FYH A;  1G9B A;  4XFH A;  3HQX A;  3IMN A;  3AMQ A;  3AC0 A;  1GWK A;  1RMU 2;  4EWD A;  1ASJ 1;  4KNC A;  3VBR C;  3MV0 1;  1G86 A;  5E1R A;  2K0G A;  3NL1 A;  3VKL A;  5GJ6 A;  4N43 C;  1DYO A;  4WVZ A;  1VBC 1;  3III A;  2ARA A;  3I7D A;  4QXC A;  1ZRE A;  3FZ3 A;  4RS5 A;  3TWI A;  1KDM A;  5JOZ A;  4JTO A;  1W9T A;  5C4W A;  3AZY A;  3NWK A;  1DU3 D;  2JB8 A;  4IV1 C;  2IXK A;  2NZ9 A;  3SCG A;  3H8O A;  1ZZ8 A;  5DUW A;  4XVH A;  2YXS A;  1RHI 2;  4BZ4 A;  2OPK A;  3OBZ A;  1FV2 A;  3QCW A;  1RUG 3;  3IM0 A;  2VOW A;  1CAU B;  3ZN4 A;  4A41 A;  2P37 A;  1NCQ B;  2HWB 3;  3P3P A;  4YGB A;  1RL3 A;  5T54 A;  3OYW B;  5JIU A;  2AR6 A;  5FY0 A;  3RZM A;  1RGS A;  2OT7 A;  2HWD 3;  4Q4V 2;  5FLJ A;  1ULF A;  1W9F A;  3VDD B;  5FYU A;  1IS3 A;  3KCC A;  4RQP B;  1YFW A;  3ZXD A;  2XJP A;  2HKX A;  1QJY 2;  5HI0 A;  3NNJ A;  4XEZ A;  2BNN A;  3A22 A;  2GAU A;  4QPG C;  5A80 A;  1LHU A;  4OMC A;  3D4K A;  2D5F A;  4NPR A;  2AH2 A;  3ACI A;  1FXZ A;  1SHW B;  5A3W A;  1W39 A;  4I30 A;  3SMH A;  2WZ8 A;  5FP3 A;  2RS3 1;  3ETQ A;  1M4W A;  2ZGN A;  5A7O A;  1OLM A;  3FX3 A;  4RD7 A;  3S57 A;  1PM4 A;  1XE7 A;  1XJA A;  3EMR A;  4PBP A;  2X05 A;  1W8Z A;  3LE0 A;  1H2N A;  3USS A;  2DDU A;  2Z69 A;  1FPN 3;  4AAX A;  3VDC A;  5FLI A;  1O3T A;  2Z5W A;  1ULG A;  1DGR N;  2WC2 A;  3N4M A;  2E32 A;  3ZFG A;  1XNT A;  3RSJ A;  1LU1 A;  5A6Z A;  3OSD A;  2OX0 A;  5FR3 A;  5HCA A;  1RUG 2;  1XRU A;  4YVS A;  3WG2 A;  4ZS3 A;  2G9G A;  1XPW A;  1U5Y A;  2D7F A;  4FPJ A;  2ZEX A;  1W6N A;  4FPH A;  1IQD C;  1GZW A;  2JDN A;  3IDA A;  3C8X A;  1UAI A;  4B4Q A;  1EPW A;  5DN2 A;  3VHO A;  2VG9 A;  1TME 1;  4G9S B;  1JU3 A;  4CDU A;  1UZZ A;  3MI8 A;  4KG0 A;  2JDP A;  1FT9 A;  2B9U A;  1JOD A;  2OUJ A;  4BHP A;  1ULD A;  1VBD 3;  2MEV 1;  4QQL A;  5AVP A;  4DXT A;  2GH2 A;  2QQI A;  3RWK X;  3MIE A;  4XIL A;  2VZP A;  5T5O A;  3H3Z A;  3TNP B;  1LHW A;  4QT6 A;  1K12 A;  1ZBE 2;  1YHF A;  1I5Z A;  4GZ9 A;  3POW A;  5EXO A;  5DAV A;  3ZDS A;  1AX1 A;  1C4R A;  1YIP A;  1JI6 A;  1LHO A;  1LGC A;  1QJU 1;  5TSW A;  1KFX L;  1YQ8 A;  2ZEW A;  3SLI A;  3MZH A;  1CES A;  3FWE A;  4YM1 A;  1FAT A;  3LAG A;  1SBE A;  4Y1V A;  3WOG A;  3ZKU A;  5DAP A;  4XBL A;  5L9V A;  5DPN A;  5FRE A;  2I74 A;  1HQW A;  1H8T C;  2OZ6 A;  3BGA A;  4BIO A;  5F7U A;  1RYY A;  2R07 2;  2QFE A;  3Q8B A;  3OUH A;  2R07 3;  4GWM A;  3T08 A;  3U14 A;  2VQ0 A;  4JTN A;  4AHW A;  1JYV A;  2A6X A;  4QHO A;  1TZO A;  2VEC A;  4GB3 3;  1NE6 A;  4S2D A;  4XDQ A;  1JZ5 A;  5L7O C;  2WFF 3;  4XFF A;  1XE0 A;  4BQW A;  3DYP A;  3FBY A;  4HVR A;  2HWC 2;  1RXG A;  2A6Z A;  5FZH A;  1EP0 A;  2VTX J;  5F3G A;  1AXY A;  2C9A A;  2SLI A;  4Q29 A;  5BNP C;  3OYW A;  4E9K A;  5CFD A;  2IWG B;  2O8Q A;  3SH3 A;  4JAA A;  1MQT C;  2BVB A;  3O1M A;  2VMH A;  1QWR A;  2VZQ A;  2RMU 2;  4FP2 A;  3RG0 A;  1JTZ X;  3GZA A;  4CUA A;  1VMH A;  2ZHK A;  2VC9 A;  1BK1 A;  3U37 A;  4HMZ A;  3VGI A;  2QNK A;  2YBK A;  3VBF B;  3CJX A;  3AMM A;  1I6X A;  1FOD 2;  1QJE A;  2V72 A;  3I2J A;  4GH4 A;  3MGU A;  4JHT A;  3LDR A;  5FZE A;  3H8R A;  4D7S A;  3I59 A;  5GKA C;  1DZT A;  1ASJ 3;  5F32 A;  4RS5 B;  2BW8 A;  3WXP A;  4CSW A;  3THC A;  1VRH 3;  3OEA A;  4EE2 A;  2XOM A;  2WNE A;  1R1Z A;  2P6C A;  3OD0 A;  4ZU7 A;  4CDW A;  1GQH A;  2BOJ A;  2YGM A;  3NJV A;  3P5B A;  5FP7 A;  2BDR A;  5A33 B;  3I2I A;  4ERO A;  2C0Z A;  2VTF A;  4YZ3 A;  5LY1 A;  2PA7 A;  5EZW A;  2AEN A;  4A44 A;  4XAB A;  3ROU A;  1DQ4 A;  1YQ2 A;  5JOX A;  1V6N A;  4IXL A;  2Z4F A;  1Q56 A;  4AFC A;  4MYE A;  4LNV A;  2B8M A;  2XBO 2;  4YG0 A;  2BZD A;  4Q1P A;  3MEP A;  3WNX A;  4LJH A;  4N9I A;  2VVF A;  2GME A;  2Y6K A;  3OGR A;  2BEO A;  1QDO A;  5A32 B;  3AL6 A;  4MGY E;  2WQ4 A;  4XBQ A;  3VBF A;  1S0F A;  2XVL A;  4JGY C;  4XOG A;  4Y22 B;  5FZO A;  4NR1 A;  1TNF A;  1W2A X;  3V0B B;  1WW4 A;  4EN8 B;  4ASK A;  1HXS 1;  1UX6 A;  2DCY A;  2VBB A;  5IW0 A;  3T09 A;  3J8F 1;  4QXB A;  3RJR A;  5C3S A;  3RNS A;  3VB9 A;  4CYD A;  2HWF 2;  2IXJ A;  4LIV A;  2TEP A;  4MX3 A;  4YM3 A;  4LIU A;  2DCZ A;  3NNL A;  3PUA A;  3O1R A;  2DBI A;  5J09 A;  2RS5 1;  5EFU A;  3WVJ A;  3I97 A;  1BBT 3;  4IEZ A;  4TYS A;  5LB6 A;  2HYK A;  4XQW A;  1CZV A;  4AED B;  2XVK A;  4J1X A;  3O5S A;  5CZK A;  3GBF A;  4FVV A;  1HDK A;  4Q2F A;  5A7W A;  2VW1 A;  5FFO C;  1N1V A;  3U10 A;  2NLR A;  4NRP A;  5FV3 A;  3O1V A;  4WBB A;  3WF2 A;  1OVS A;  4DY3 A;  1VBC 2;  2ADE A;  2VPV A;  4JHZ A;  3H1Y A;  3LEM A;  3DEM A;  3PDQ A;  3BOD A;  1ULE A;  2EIG A;  4XAA A;  4XHB A;  4HN0 A;  1ZBA 3;  5DAW A;  3OGV A;  5KHG A;  4X6Q B;  5KHI A;  4YNI A;  2NPI A;  1US2 A;  4QX1 A;  4AQT A;  1ZRD A;  3SEE A;  4MH0 E;  1YFU A;  1AJK A;  4MGT A;  4P5Y A;  5FO7 B;  2QZ2 A;  5GZC A;  2IC1 A;  3OY8 B;  5FZB A;  3D0S A;  3ACH A;  3NVC A;  4FFF A;  1S4C A;  3AM2 A;  3ZN6 B;  1R09 3;  3WNO A;  3B01 A;  4OI0 A;  4MO3 M;  5JSO A;  1KJL A;  4M3C A;  1RXF A;  3USU B;  4CCO A;  1HLC A;  4BQ5 A;  4L0P A;  2QBX A;  3AP4 A;  3D82 A;  5FZ9 A;  3THP A;  3KWV A;  1ZRF A;  2D6K A; 
#chains in the Genus database with same CATH homology
 1JOD A;  1F35 A;  1ZRI A;  1JYT A;  1JOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...