1F35A

Crystal structure of murine olfactory marker protein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
162
structure length
162
Chain Sequence
AEDGPQKQQLEMPLVLDQDLTQQMRLRVESLKQRGEKKQDGEKLIRPAESVYRLDFIQQQKLQFDHWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPAAIFWRKEDSDAMDWNEADALEFGERLSDLAKIRKVMYFLITFGEGVEPANLKASVVFNQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the olfactory marker protein at 2.3 A resolution.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords OLFACTORY MARKER PROTEIN
total genus 36
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06554 Olfactory_mark Olfactory marker protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.390 Mainly Beta Sandwich Jelly Rolls Olfactory marker 1f35A00
1JOBA 1JODA 1ZRIA 1F35A 1JYTA
chains in the Genus database with same CATH superfamily
4CDQA 3GJAA 2FCVA 1JI6A 1RUOA 1RXGA 3MF9A 3TEYA 2FMDA 3Q8CA 4QX2A 3WR0A 1SDDB 1UNBA 3CNAA 1EPWA 5IUQA 3V65A 1Q3EA 2W2IA 5HI0A 3FHAA 2VZRA 3UL2A 4QX7A 4M00A 4LUMA 2BV4A 3PVBB 1VPHA 3B9IA 4FFIA 3M3EA 1XE7A 2RM23 4WVMA 5A1LA 2XHKA 2E51A 3OB8A 3AKRA 1S0DA 2ZX0A 5J09A 2DFCA 4FPGA 1FPN2 1QNWA 1UKGA 3HEIA 3POIA 2XLGA 2AACA 4OMDA 4UFJA 3BTAA 4R9CA 4S2FA 1U5XA 3ZIXA 1ZRFA 4YM1A 3N7MA 1DIWA 2EAAA 2VZTA 4QPGA 3SEEA 4OZXA 4FO9A 3UK9A 3RDIA 3AKTA 1TME1 5FKBA 5FJKA 5A70A 2DBIA 4S2GA 5F39A 4GWMA 4CUBA 2VY0A 2HBTA 1QNYA 1XJAA 1ACCA 2BOIA 2DTYA 2X53S 4J1XA 3H0OA 5EHDA 4QB2A 1GKBA 3ROUA 3USUB 1ZREA 4P5YA 2EXHA 3ZSJA 1R1A3 3RYKA 2ZGRA 4LBNA 2C9KA 2MPFA 2VAUA 1PGL2 2XLAA 2ZJCA 1MS0A 1FX5A 3N9OA 3VKOA 4CP0A 1H2MA 5JZGA 3TEWA 3PVNA 4WM8B 5C4WC 1N47A 5JI9A 1APNA 2C1FA 5APAA 3OBRA 4KQ7A 1YFUA 3JBG1 4I01A 2ARCA 1GLHA 3DXUA 1SLIA 4X8PA 2Q1MA 2ZMLA 4CCEA 5EQUA 3GYDA 5IVEA 2Y0OA 2DUOA 1JBCA 1DYOA 3KHCA 1JYCA 4PQ9A 3CU7A 4UW3A 4BISA 4Y5Z0 4ZXEA 4Y20A 3CEWA 1AL22 4G9SB 4MVTA 3I2OA 4N7IA 4EWDA 3KCYA 4WM7A 1CZVA 2OX0A 2Y6KA 5I0UA 3LEKA 5J37A 2A75A 4LBLA 1JHNA 4TN7A 2CSGA 4ET7A 2V4AA 4GKYA 2PTMA 3VZJA 5I93A 1IPJA 1DBNA 3WSOA 2WDBA 4MLOA 4XZUG 5DDJ2 4BLIA 1XE0A 2VCBA 2ZACA 1UXZA 4JKMA 1O4YA 4C90A 4W50A 2XJUA 3LDKA 1SDWA 2JKXA 3G6JB 1OKOA 2NN8A 2R1BA 2XVLA 4E4ZA 2YFZA 3ASIA 4IETA 4IERA 5A3NA 1DGLA 4KBZA 1F31A 4YW6A 1IS3A 3PHMA 2OUJA 1W2TA 5FYZA 4NVPA 5L73A 2WC2A 1ALYA 4ZONA 2DDUA 2V5YA 5LBFA 5LBBA 5A3PA 2VZ1A 3H7JA 4J1WA 1YFYA 1BEV3 1U0AA 2RS12 3B02A 3ZFEB 4B7KA 1VBB3 2VNGA 1GNHA 1AX2A 3JD73 4R4ZA 5F5CA 5HBAA 1LODA 4KGQA 2OW4A 4B29A 5FKCA 2QJVA 3I2FA 5CAZA 3O1UA 1O3SA 3KWVA 2WNVB 1NAEA 2XQRA 3AP5A 3U0ZA 2YDEA 3H3ZA 1STMA 1UMIA 1X82A 5CNAA 2R0HA 5DUUA 2CAUA 1CONA 4CU8A 4UXAA 1ODNA 2CYFA 2JG8B 1BBT2 4A7ZA 2WS91 1RUH1 3OEAA 1WLTA 4E9KA 4UW4A 5JIUA 4CDWA 4AGRA 4QQ2A 3FZ3A 2B4KA 3JXSA 1I3HA 5AFEA 1SEFA 3LEGA 4UBGA 3EHKA 2VL4A 3ABZA 1CAVB 4CZSA 1UY3A 4GMP1 3D4KA 4KWLA 2G9ZA 2XL9A 1WD4A 2GP3A 4OULA 4RQPA 1OD3A 5ACA3 4M01A 3OTFA 1N1YA 4LBKA 1COV3 1ZVFA 3IKWA 3OSDA 1Q8QA 2VW1A 2EALA 3I4IA 4FFGA 3U78A 1IGOA 4KL1A 1HRI3 3TBDA 5C4WA 1AR62 4Z2WA 4BQ4A 3ZLIA 2JD4A 2R16A 3B93A 3M3CA 4K40A 4RGKA 1ZBA3 4R9DA 1OBNA 5ACA1 3RVHA 4IV1B 4Q4V2 2JDYA 4WZCA 2JDUA 5FY9A 5T50A 3UESA 3ZXLA 4CDXB 4UYBA 1LENA 4P5HA 4X6RB 1KXGA 5E88A 2VXRA 4LKSA 3UKVA 2ID4A 1BEV2 1QDOA 2WQZC 2WRAA 4H7LA 5FWEA 1CIYA 3O0VA 2KD7A 4QM8A 1NE6A 3EB7A 1H6XA 1E5IA 2JG9B 4CXXA 4XYXA 2BOJA 2HEWF 2RE9A 4XCAA 5CKQA 3HJRA 4KG0A 4KMQA 1AL0G 5IVFA 1AXKA 5KR7A 1O7FA 4DUWA 3I59A 4MGIE 5GZEA 5DDJ3 2Q8DA 1G9CA 1UMHA 4Y24A 4K1YA 4Y1UA 1ENSA 5FR3A 1PMIA 4IE5A 4LUKA 1Y9QA 4XXPA 3OD0A 1O3TA 3MZHA 3VKFC 3JQXA 1OC1A 4EE2A 1RJ7A 3PVOA 5TSWA 3I2IA 3VZOA 2FDKA 3AC0A 1NLSA 5A7PA 3FWEA 4IV3A 1JH5A 1BYHA 4GULA 3AMPA 4NRQA 3SCFA 1DYPA 4QHBA 3D82A 1AL21 3NV3A 3SCHA 3NNFA 1R091 4CDXA 2D6NA 1UMZA 4GH4C 2DF7A 2HWF3 2LROA 1UU5A 2R7EB 2XKOA 5T52A 2J1AA 3B7MA 4GA9A 1J3RA 2ZHLA 3RZZA 2VC9A 3BPSA 3FLRA 2WT2A 3LSDA 4JKKA 4Q4V3 3I2KA 5K0UA 4BCUA 3DPRC 5BNNB 1TQ5A 1UF2C 3ZFFA 4QT6A 1G9AA 1WMFA 5JOZA 1QXRA 2JICA 4R9BA 3T4VA 4M4PA 4A3ZA 1FAYA 4GH4A 4XJAA 1W9FA 1BBT3 2ARAA 4Q0UA 2CL2A 3HBKA 3K4AA 1RUE1 5A32A 4E2GA 4YW2A 3MFCA 2JKBA 4CDUB 3CJIA 4A45A 4RD7A 2EXKA 4QX5A 1PX4A 1WD3A 3VHRA 2BU9A 4NUBA 4GJYA 3WT3A 2OYZA 5FZMA 3POWA 4X6QB 1A78A 1JU3A 1Q8OA 2JECA 1UZ0A 1RHI2 3B9CA 4LXLA 3OBZA 1ZZ8A 1YLLA 3T2PA 5L19A 2VNRA 4HN0A 1PM4A 3P3NA 1NA1C 1ZZCA 2I07B 3ZYRA 4A7KA 2VXJA 2Q1FA 3R4UA 1HRI2 1R1A1 1C8M1 3LPGA 1PO11 4IUGA 1HQNA 4UW6A 2WYFA 3AKPA 3OUJA 3VZKA 3ZXEA 1B35B 4I0BA 3GZUC 4IEYA 5FP3A 3VDDC 5AVAA 3BTXA 3PMSA 5DXDA 3T2TA 3S30A 2KA3A 2SLIA 3TOJA 1HXS1 4URAA 1UYPA 1VMFA 4S2DA 1ODMA 3WV6A 3VBRA 3FN9A 4NIIA 2UYBA 4X8NA 2R6QA 3KM5A 2LM3A 4JGZC 3VZMA 1CIWA 1KS4A 2A70A 2W5FA 3B00A 3ILNA 3NSTA 4P9GA 4K21A 2VULA 4GH4B 3S7EA 1PZ7A 2BNNA 1ZZ9A 1ST8A 5LCWL 1H1AA 2R042 3KV9A 4GMP3 3O1VA 3WINE 2P6HA 2RMU2 3QH6A 3OG2A 4XIKA 4L99A 3T3YA 1OH3A 1WKYA 2ZABA 4BMEA 3NV2A 4J6GA 5FY1A 5KHGA 5SV5A 1HB1A 3SLIA 3VV1A 3BUCA 2ZEYA 4CYDA 3SH5A 3M8LA 4P9XA 2VOVA 3NO8A 3EO6A 3WNKA 1VBE1 4Q4Y3 3WG3A 5FY4A 4JCKA 1OUXA 1EUTA 2GZWA 1QOOA 4UFLA 4HPKB 1OOPC 1UY4A 5EFUA 4DNYA 4UBHA 2XJRA 5GJ6A 2FD8A 2VQAA 4N53C 3ZFEA 3FHIB 2WAOA 3FUOA 3J8F2 1LGNA 3NKGA 1RUJ3 1HIXA 4GALA 2FDIA 2YGLA 2ZEXA 4LR4A 1PVXA 1SG3A 2WLPA 2WNVA 3WNOA 1PHMA 2RS32 4DOUA 2E7AA 3AP7A 5C3PA 1FOD1 2A73B 2AUYA 2ZHNA 3L9JT 5CA6A 4A2UA 1ZBE3 1D2QA 3S57A 1AR63 1UZYA 5A7WA 1PO13 1D4VB 4G3YC 4JGYC 5GLVA 5C9AA 5HCHA 2MNGA 4JQRA 2VR4A 3UKNA 1EUUA 3ON7A 3GBWA 4IW3A 2FDHA 2RJLA 1PX3A 2YG0A 4DO0A 4FTSA 1ULEA 4YRDA 5EYYA 1N3OA 2WA3A 3NV1A 1PGW2 2X09A 4A41A 2P3IA 2PLV1 4JGZB 4OI4A 2XBO2 2E6VA 2HWD2 2ZXQA 4JQTA 4LKEA 2WZR1 2RM21 4XCBA 2X05A 1BMV2 3WCRA 1H8TA 1AR93 2VVDA 2WO2A 3AZYA 1YFXA 2WO3A 1LNSA 2XXZA 3IB3A 4JGYA 2QQJA 3ETPA 2J1TA 2ORXA 2YPDA 4AI9A 1C8M3 2WO7A 2PFWA 3ZX7A 3OUHA 3JUUA 3BVCA 5LA9A 2ZCWA 1OUSA 2H0BA 4IV1A 3VBUC 4I2OA 1PNGA 4ES8A 4Q4Y2 1LHNA 1W2UA 1LOFA 4BJ0A 4ARXA 1W06A 2XJQA 3VKLA 1W8HA 4BHPA 4LQRA 1D2SA 2PQQA 3C7EA 3ZMOA 4HVOA 2Y8KA 4OQ9A 3M3QA 3PLQA 4N53B 5C4WB 3U11A 1GFF2 1KS5A 4JRLA 4EZHA 1YJKA 1K5MC 2DCJA 3J7NA 2AGSA 2CHHA 2Q8CA 3A4UA 2GN3A 4HVQA 1AR72 1PO12 5BNPB 4PHZA 2VM9A 4Z8BA 3KVAA 1W0OA 3LF7A 3A0NA 4FTBA 4ORFA 3KD4A 1LTEA 4RHV1 3RWNA 3H8XA 3LCPA 3WY6A 2OUHA 2GN7A 4NHYA 5I8YA 4IGPA 2C24A 2YGMA 3APBA 3AZZA 1X33A 4FI9A 3AFKA 2BVVA 2GP5A 2HYKA 2VGDA 4LHNA 1J59A 2CV6A 5FYSA 4IL7A 1WGPA 3POJA 1PVC2 1V6NA 2XBO3 4XF3A 3HN1A 4XFCA 5KHHA 4IV3B 2YU2A 5FDBA 4PLMA 5J48A 4XFAA 1AR92 3T1MA 5IK8A 4EN8B 2WNUA 2VOKA 1TMF1 4GB31 2VOWA 1DP0A 4ES9A 1R1A2 3WF2A 3VD9A 4Y5TA 5IVVA 3JB8A 5ERLA 4ARYA 4XW3A 1NY72 3HNMA 1O4ZA 4XMAA 1SFPA 3THTA 3OUIA 5A3LA 3OD4A 4I30A 3UV9A 4AQSA 5FPXA 1MS3A 4K8FA 2VTXJ 1H4HA 1SZBA 3WCSA 3OBAA 4CP2A 3KGLA 1ZBE2 2EAKA 4NRMA 3U75A 1MEC1 1AHSA 2VCMA 2XDVA 4I0AA 4U36A 1CQ9A 4J25A 5KHKA 3JU9A 2W1WA 4OYUA 1JOPA 1XC6A 4A4AA 2F4PA 3ZFGA 4P02B 4LITA 3P3PA 2D3RA 2QDRA 3AX4A 4FP3A 3SXWA 5E8AA 1WBLA 2BFUS 2BVBA 5DAXA 1FATA 1XYOA 2BFUL 4URTA 3CDZB 1NXD1 1W8ZA 4W6WA 4CU7A 4YLZA 4IGOA 3LEMA 1W0NA 4YW4A 1C8M2 1OI6A 3C7FA 3NNMA 1WLWA 2ZGKA 4QGNA 5E1RA 3F95A 3VZNA 3ZN4A 4XFIA 5I91A 4FOWA 2WFF2 4QXBA 1PIV3 1PVC3 1VRH1 2VMDA 2YHJA 3CJIB 4XURA 5FK7A 1HN0A 1VBE3 2VQTA 3IMNA 3R0RA 1M4WA 4NN0A 3N3HA 4Y1XA 4EWEA 1RC6A 1UKRA 3P5BA 2ZHKA 5FYMA 1QXJA 3BB6A 3NNGA 1LHWA 4IV3C 1X9PA 3R6SA 1NX9A 4MSVA 4DB5A 4LBQB 5A6QA 3OGJA 1NT0A 2P4EA 5FUPA 3EYPA 2PYTA 2QZ3A 2HWE2 3ACHA 5IVJA 1W9WA 2BGCA 1W8WA 1W03A 4MX3A 4DIQA 5E16A 1UPSA 4RR3A 1HRV2 3MI8A 2BBVA 2C0ZA 5HXMA 4P14A 4PDWA 4JDNA 5FZBA 5JLVA 1SBFA 2BTVC 1H2KA 4KGGA 5FO9B 2PLV3 1X7NA 5FMOL 4ATFA 4LJHA 2RS51 3EQEA 4MOAA 4H3WA 3RI8A 4DY5A 1XOYA 4AG4A 5AFBA 1TE1B 3TN93 4B3NA 1EAH1 1OLRA 4AEMA 1CJDA 1VRH3 3POYA 4BQWA 1JYVA 5BYNA 3VN4A 4E2SA 2Q1ZB 4Y26A 3NMBA 4AFBA 1XNDA 2EIGA 4KNCA 4BK4A 4XJ9A 1AXZA 2PAEA 1RJ8A 2XQXA 1JTZX 1EP0A 4AI2A 1H9WA 1WMEA 3IIAA 5A6ZA 2V5DA 4AEJA 5LEKA 3CZUA 1ZBE1 4B4PA 2IXLA 4QHOA 3UETA 4FPOB 2KR2A 3A0KA 2P17A 2OQ6A 3E5XA 1X50A 2DCZA 1I6XA 2J1RA 2R062 3HN3A 1MPXA 1X9TA 2IFRA 5F3IA 4KH9A 2QTWB 1C1LA 2G9GA 4BM8A 2WWJA 1K5MA 1CAWB 4NAOA 1AR83 4LE3A 4CDQB 5L9VA 4UFIA 5LA1A 1HN1A 4FPYA 4PDWB 1QF3A 3MUY1 3CIHA 4FXGB 4WV8A 4LMFA 4DXSA 2QDNA 1YIFA 5FZHA 2VQUA 4HLTA 4NIHA 2VMFA 2Y6LA 1D4M1 1NZIA 1XYPA 1HRV3 3VHPA 1TZOA 4OQ8A 2J1EA 1LOFC 3T4HB 1GU3A 1TME3 2QCSB 4JRAA 5FZKA 5A7SA 3ZM8A 3D0JA 1R082 2A3XA 2WFF1 4NAMA 4WBBA 5CADA 3WF3A 5I0RA 4NPRA 2ZGOA 2CTVA 1OLQA 1URXA 2RS11 4ZZ5A 5A6YA 3WDYA 4GB33 4DRVA 1ND3C 5C9AB 2PELA 2WABA 1UO9A 3M1HA 5T54A 3HQXA 1D0GA 5BNOC 2GMMA 4ZU7A 4OVEA 5FZGA 1HJGA 3TNPB 2RDSA 2DBNA 2VTFA 3ATGA 4CCCA 1VRBA 3UJQA 4NPMA 3L2HA 3MV11 3LB9A 5L7OC 4Y22A 5EIYB 1CVNA 5AC91 5BNNA 1QJX1 2X5IA 3B3QE 4K7JA 4MGKE 3D6EA 4AR2A 5BNNC 5LY2A 1MS9A 3OF1A 4HSLA 4PI2A 5DDJ1 1EAH3 5CG8A 4NWVA 4BH9A 2VZQA 3LZZA 4HKWA 3V64A 4EYUA 5FIXA 3I3DA 4COUA 4XQ4A 2WS92 2D5FA 3EMRA 4B4RA 3GZAA 1MQTC 1RUD2 1YFWA 3ME2A 3NAPC 4Q8LA 3WNLA 5KBFA 1F15A 2A6VA 1W8TA 5FK8A 3QBQA 2P3YA 1YEWA 2FMYA 4E27A 1RYYA 3IPVB 3N9LA 2RS52 4AVSA 5I0SA 5FBJA 5K0UB 1XSRA 1DZTA 2FDJA 3KHBA 1CR7A 1P8JA 2JDZA 4GKXA 4META 4N53A 4WVVA 4CP9B 2A3YA 1TMF2 4IDZA 4DZGA 1QJY1 4JV4A 4LK7A 3QOPA 2PHFA 1CGPA 1YI7A 5FQ0A 3AP6A 2OKXA 2BWAA 5C5TA 5JXJA 2CU5A 2R061 1N1TA 1Q5OA 3I3BA 1L7QA 3PUHA 4FPEA 4YGBA 3AKSA 1S2BA 1LHUA 2DCTA 3IDEA 4FPKA 1MZFA 2XJTA 1SBEA 2WZR3 4NHLA 5FZ9A 3VBRB 5FOBB 5ISLA 2X5IB 4MXWB 2B8MA 1RUF2 1DQ0A 5F5AA 5F37A 1W99A 4TTGA 2E53A 2Y38A 2XJVA 1G9FA 3DUIA 3N7JA 4IXLA 4YYOA 1LEDA 1CZSA 1ND2C 1CN1A 2DU1A 2B7YA 3I2HA 4YM3A 5LEJA 4DY3A 3M7AA 3PMEA 5FY0A 5IAVA 3LFMA 1B35C 3VDDB 3U4XA 2GC3A 1VBE2 4R4XA 1V6KA 1OA4A 3NRUA 3WF1A 4RGAA 4O7XA 1RUI2 2YY1A 4I0WB 1OF4A 1SPPA 1MEC3 2AEYA 4BPZA 5FUNA 3RI9A 3WQ7A 3OCPA 4PI0A 3GM8A 1YRZA 1PM7A 1W6QB 4P9JA 2D43A 1FMD3 4IEUA 3E6CC 3QLQA 2RMU3 3J9SA 2HWE3 1RUC3 4HPKA 2D40A 2JDKA 3FL7A 5C3QA 2J1UA 1RUE3 1W04A 2DVAA 4PDWC 5FQ0B 3OY8A 2ZHMA 1DCSA 1OD5A 1UY1A 3BPZA 4K8RB 4CSWA 4JDMA 3T2OA 3ACLA 2WSVA 4HT1T 5IWFA 1YQ6A 2ARXA 3K4ZA 1NCQA 5H9RA 3WNPA 3W5MA 1NA1B 2VBDA 4XACA 3AXDA 1YQ2A 3RFRA 3QACA 3W59A 1K3IA 2TEPA 3GALA 4LBQA 1WLCA 2D44A 4OHWA 5A7WB 3RYRA 3T2QA 2Z42A 2J7MA 3IAPA 4AVAA 2R32A 3THDA 4V2WA 2DWRA 4AHZA 2O8OA 4LKFA 2CGOA 4RR3B 2DCKA 1FPN1 3HAGA 1CX4A 4LIVA 1G8WA 1E5SA 3ENRA 4QX8A 4ZU4A 4EWAA 4OFGA 5FZ8A 3MV01 3VUOA 3C7OA 1DGWX 2WYSA 3GZTB 3RGBA 4P9YA 3QCWA 4L8QA 2VMIA 4Z1VA 1ENRA 1IPKA 1UX6A 3WNXA 4NR1A 3VGIA 1W3VA 4LHKA 5IVCA 5IK7A 2P5BA 2YUEA 2PAKA 2P3KA 1ULFA 5T55A 1CAXA 4UFHA 4H2AA 4LO5B 4B1MA 4Q4X3 1C8NA 3LWCA 3SHRA 3AYCA 1VP6A 2PHXA 5EWSA 5HV0A 1MZ6A 4ZY9A 2DYCA 5CIRA 1JYTA 4XF9A 3VBUB 2PN5A 2B9UA 3I59B 4OI1A 4BU2A 1Z78A 5JSPA 5FYVA 1QDCA 1UPIA 1S2EA 5D8AC 3VBSC 1LU2A 4P08A 4XILA 2WZR2 1Q8SA 3KLSA 1VB2A 2DV9A 2Z2SB 4L0PA 4Y4RA 1FMD1 1BK1A 3JD71 2J22A 4TSVA 1BK0A 5GLWA 1RITA 1UU6A 3RZHA 1V00A 3ETQA 4FOVA 1VBD3 1LKNA 5LATA 5G05L 1J84A 1QQP1 2VUCA 2RDQA 5BNPA 2VZOA 2X10A 3NKTA 5GLTA 1GQHA 1UOJA 1W6MA 2OIIA 4RFT0 4ZPIA 2HWF2 3KS7A 3NJVA 2W08A 2OPKA 4XC9A 2HWC1 1EV12 3LA3A 4UT5A 4RL7A 4UI9L 4A3XA 1ULCA 5IHRA 5SV8A 4PJYA 2DVDA 4FSJA 4XUPA 1KJRA 2DVBA 1ZZ6A 5FP7A 3ORJA 4QPWA 3UGFA 1MS1A 2HWB2 2RS13 1GWMA 3UT0A 4NIDA 3T0DA 1CAWA 2HLEA 4AFDA 2XH6A 2IWGB 2PHLA 3M70A 3WW4A 3SMHA 1JYWA 3T30A 3THCA 2JIGA 5A32B 1RUJ1 2V73A 4I3PA 1JYNA 3SEPA 3BKZA 1BZWA 4Q4X2 4MH0E 1FOD2 4QKFA 4YVWA 5A7NA 3PUAA 3AMQA 1JU4A 2WWSA 4YFZA 3WG2A 4ISQA 5F5IA 3B5LB 1WLDA 2TNFA 2XJSA 1YNAA 4IESA 2CGNA 1NXMA 5FYTA 1GOFA 4LNVA 5LY1A 3NV4A 5FFOC 2EIEA 1LB2A 2JD9A 1VE0A 3WW1A 2P3JA 4H14A 3DXTA 1YHFA 3LD8A 4C1WA 4CUGA 4LLOA 1WW6A 1PGSA 2ET7A 4GWJA 3N35A 4AFCA 4BQ1A 4UWDA 5ACA2 4W4ZA 3CBNA 4LLFA 1RB8G 5H9PA 1W6MB 1GZWB 1JOBA 4JTNA 2JE7A 2ZMKA 1LAJA 2IVIB 1ZRDA 2EVXA 5CBLA 2VOTA 4HXCA 1DLCA 5EPAA 1BXHA 1AVBA 4A6SA 1JZ6A 4QKNA 2ZKNA 1W6PB 4QWNA 4CEYA 1G9DA 3MDPA 5F6LB 3PIJA 1C5HA 2UURA 1G9BA 4AEDC 1IOAA 4QX3A 4AWDA 1V9U1 4BDVB 3POEA 2R073 1X8MA 3AFGA 4KG8A 5F7UA 3HD8B 4UF0A 5K7PA 1X36A 3M2MA 1WW7A 3PDQA 3H8UA 2BPA2 3A7QA 4FT8A 2X5IC 1O91A 2ADEA 3GDBA 5LA0A 3P6BA 5C8CB 4PBPA 5L7OA 4CXYA 1JZ5A 1HRI1 2WSUA 3ZKYA 1K42A 1HV1A 2GAUA 3CO2A 4COWA 1COV1 1R64A 1VB4A 4CTEA 4M0HA 4KU8A 4D7YA 1NLQA 1VMJA 2FQPA 2GNTA 2WN2A 2D5HA 4HSJA 2WFF3 1FOD3 2WNVC 1JMUB 5EJ1B 3PUSA 2AZ5A 4CP9A 4EN7B 1HB4A 2LUWA 3LA2A 5JXGA 1JZ7A 3HMYA 3MHZA 1O3RA 1DGRN 2ZBJA 5KC5A 4SLIA 4DFSA 2VMGA 2Y6HA 5I0TA 2A6ZA 3O5SA 4LOTA 3ZN6A 3I54A 2UWBA 1LGBA 3VBSB 5DPNA 4QAWA 3RJRA 3C2UA 3RWKX 3PVEA 3DYPA 1N1SA 1U12A 3KCXA 1PIV1 1XPWA 4W6XA 5FZOA 3U14A 1LOAA 3WW3A 3ZDSA 1ONAA 3WZ1A 2Y60A 1O5LA 1F4HA 2W1SA 1RUD1 5GZFA 1G6NA 2GH8A 2W3JA 2X29A 2JG8C 4NRPA 3WDTA 1CPNA 2NM1A 3T0BA 1VAMA 1KJLA 2VECA 3PURA 3ZIWA 4BIFA 3A21A 3OY8B 3ACGA 3ZN5A 3OOXA 2W0XA 2AYHA 1RGSA 5FZLA 1ZZ7A 2R49A 3BIWE 1UW8A 1Q8VA 2ZAAA 2I45A 1JZ8A 3WP4A 2CWMA 4AFMA 4NWWA 4AHXA 1TG7A 3FHQA 4JGZA 4L11A 3E6DA 3POBA 1YQCA 3H1MA 4SBVA 2HWD3 5ABJC 1QWRA 3RZKA 3MFAA 3LA7A 2WA4A 1AYM2 4N90A 3ZPYA 3IBMA 2W92A 3ILRA 3W5NA 1D0HA 4IEVA 3E97A 5DUXA 1VJ2A 3RSJA 3ES1A 3RZMA 4MGTA 3BN6A 1LOBA 3O1OA 1AL23 1VBD1 2NQYA 1DF0A 1KDKA 1UN1A 2WZ8A 2XLFA 4TXWA 4BMBA 3AL5A 5IFTA 4Q4W3 2BYVE 1CD3G 1RUF1 4LA3A 4ATEA 4GMP0 3VBSA 1UYZA 1GSLA 2RVAA 2W1UA 1NA1A 1PZ8A 2XL7A 1RTVA 4I02A 2GH2A 2W39A 2QQKA 2VNOA 1US3A 1AR82 1QQP3 2ZGTA 2J1SA 1GMMA 1N3PA 2P34A 4HK9A 5D21A 1PMJX 3O12A 4Y5SA 4JDOA 1MZEA 2CNAA 2VD7A 1CPMA 4M3CB 5GZCA 3ZSMA 2CDPA 1RUH2 2D6LX 4NROA 2P1BA 4Q0PA 1OPMA 5A33B 1BHGA 1T6GC 3RQ0A 3S0MA 1LJ7A 1OSGA 3ZYBA 5D2AA 1W3XA 4AW7A 2EICA 2W9XA 4QQLA 3SITA 1CAVA 2QQIA 1NLRA 4AQTA 5BNOB 2A6WA 3I8TA 1D4M2 4QHZA 5DG2A 5FXVA 2ZGQA 3RZGA 1AR81 1SBDA 2NZ9A 3VHOA 1VBB2 1S0FA 3WG4A 2H6BA 3VBOB 4NPLA 3IT8A 1GR3A 4F7ZA 3ZXDA 3KF5A 2YFUA 4QPYA 3BU0A 1F2NA 1QXPA 2C26A 4HOOA 1C5IA 3RPQA 2GMPA 4B7EA 4N43B 4WVWA 4R9AA 3S5QA 4A6OA 1UU4A 3U07A 1POV3 2ZS6B 2AR6A 3TN91 3GCWA 3ACFA 1KEXA 1AYM3 1V6OA 4QPIB 5FV3A 3W21A 4D6SA 4IE4A 1DFQA 1J58A 5FZ1A 4CEWC 5FY7A 4PBOA 2ZGLA 2WQ4A 2ZGNA 4PF1A 5B2GB 5JCTA 5FMCA 2RR13 1ULGA 2E63A 4AVTA 5FPZA 2TBVA 1K5JA 3AKQA 2XHNA 5LRSA 1ASJ3 5FCCA 4YM0A 3I3QA 5JMCA 1I9RA 1ZNPA 4IE0A 5FY8A 5LBCA 3RJ2X 3LDBA 4A42A 3CQOA 4RYDA 2YB7A 1OH4A 3GGLA 5DAWA 1UY0A 5EJZB 1RMU1 4BK5A 1AR91 1DYKA 3WEZA 1PGL1 3H1YA 3OPTA 3TRSB 1REFA 5LWBA 4CDUC 1XE8A 3NW4A 2BQPA 1UOFA 1TMF3 3G7DA 1HB3A 2WT1A 5A3OA 1JUIA 4WM8C 3ST7A 5CFDC 4TWTA 4R8HA 2KM2A 3GF6A 2QUOA 4FP2A 5T5OA 2IUWA 2VOXA 5CB7A 3CHXA 3I3EA 4L9BA 4GJZA 3IDAA 2IC1A 3K77A 1JYXA 2XUMA 1XXNA 2OZJA 1CZTA 4QM9A 3ZYJB 5CG9A 3ZDVA 4HKOA 4BLJA 5J7MA 4F3JA 1YWKA 3IM0A 2UY8A 3WX5A 4GQ7A 5CEHA 3JCIA 3MPPG 1H4GA 1IZ3A 2RJ2A 3O1TA 4AQ6A 4MXWA 3VD3A 1QQP2 4V1PA 1S0JA 1AXYA 3SKJE 5IFPA 2RR12 4ZS3A 4UF0B 5C3OA 3ZPOA 3T09A 1J3PA 1Y9GA 2YU1A 4FAGA 1AYM1 4OHYA 2OT7A 1IQAA 4I09A 1ASJ2 1REEA 2DCYA 2XVGA 4B8EA 3N9PA 4CCNA 2D97A 1BKZA 4O61A 5JVVA 3N9QA 4CDWC 5J36A 2BRTA 4OHVA 2QVSB 1JXNA 3IAQA 4XAEA 5A7OA 2BNMA 2ZZJA 5JUVA 4QKDA 1SPPB 4IV1C 1W6PA 4IEXA 3NJXA 5KHIA 2C4XA 1QH6A 4GAZA 3JZVA 4O65A 2RV9A 3VKNA 4OMCA 1XNAA 3C7GA 4R52A 3BIEA 4XFBA 3OYWA 4Q1RA 5I8SA 4YARA 4BE3A 2JJ6A 4BQXA 4FOYA 1OPOA 3GHNA 2B45X 1H8TC 4LO7A 4XZPA 1AZDA 1H9PA 1JW6A 1ULOA 2NLRA 3WG1A 2XMLA 2WNOA 4NJ4A 5FO8B 3KF3A 3W20A 1GV9A 3VLBB 5FYYA 2ORZA 3I97A 4XBNA 5FMOS 5LB6A 1OVSA 2OS2A 3POSA 3N36A 1JODA 3DYOA 3VDBA 5J3UA 1QJEA 1WUVA 5LBEA 4AEDA 1W8UA 2AEZA 2F6BA 3WDUA 2Q0AA 3SNMA 4CP1A 1IS6A 1XU2A 3IDBB 4JAAA 2PHUA 2Z5WA 3RYPA 2OQ7A 4E8DA 3FX3A 3MW2A 3BU7A 5JXIA 1ND3A 3H8OA 2W52A 1LHVA 3ZOIA 4QU2A 4XUTA 5IW0A 1C28A 4CU6A 1H6YA 1OQDA 3MIGA 1IS5A 2DURA 2A3WA 3MEPA 4IEOA 3FE5A 3IZOA 4QD2A 4RHV2 2V72A 1UL9A 4I3GA 2JEMA 3QH7A 3KZ4C 2B42B 3ZFEC 4Q2FA 3ZSEA 4P9LA 4D3WA 1VIWB 5FZOB 1IG3A 2X8KA 1OQEA 4OZOA 4CVUA 1ULDA 1UX7A 1GOGA 2D6MA 1FV3A 1LEMA 5CISA 1GICA 2J1VA 1NY71 1WMDA 4KBBA 5I0DA 4NIAA 2E32A 2LALA 1XU1A 4KWKA 3WXPA 4CEWB 1OMIA 5KHJA 5EYXA 4D8MA 3FFZA 5LK7B 5BXXA 4CDWB 1O6UA 1SCRA 2D6OX 1BVVA 4YVWC 4GB32 2VCCA 2E7TA 1DQ5A 2MEV2 4K20A 2V4VA 2XWJB 4E4DX 3WHUA 1TEIA 2B46X 4EN6B 4JHZA 4AGGA 3GZEA 5CFCC 2YPJA 1W6NB 5F32A 1AJOA 2C5DA 4Y22B 4HFSA 2YROA 4LEJA 4XHBA 1V70A 2JDAA 1LESA 4ZKTB 5FJHA 1UWWA 1F9KA 4Q4W1 5FOJB 1JZ4A 2HWE1 5DUVA 1IG0A 5FAXA 1UYYA 1GZ9A 5JI7A 3K4DA 1QHDA 4NHXA 4XTPA 1AUYA 5D1IA 3B01A 3SC7X 2ZA9A 5CFDA 3HT2A 5DAVA 5FPVA 3Q8EA 2YC0A 4LE4A 4QXHA 4RSUA 2O8QA 1MS4A 4QPGC 4D0QA 1HX6A 5EZWA 4Q8KA 3HOBA 3MUZ1 5IYYA 2GU9A 4WVZA 4IQPA 2BDRA 4CA9A 4CCOA 1JYIA 4QX0A 1GP6A 3V0BB 1UD1A 3FLPA 2RS53 1DG6A 3GNEA 3MW3A 1XBFA 4BA6A 3N7KA 1UYXA 5F1RA 1Y3TA 3BCWA 1F8VA 2JDNA 4JC1A 4JTOA 1E57A 1YYNA 2QE3A 3M4FA 1FT9A 1PNFA 2VMCA 4XMIA 3AB0A 1IPSA 4AZZA 3RMXA 2DVGA 4N43A 1W28A 2WJSA 2ZGUA 3SISA 4N9HA 2VE1A 5HCBA 4XOGA 3N9MA 4EN9B 5IT6A 5FMBA 3ZSLA 5D8AB 1S0BA 1F35A 4BB3A 3C7HA 4CDQC 4LOSA 3WD5A 2R071 3ZYFA 1HJFA 4AGVA 5CYYA 1DQ2A 2Y6FA 4YGCA 4CEYB 1N1VA 1POV0 1UZWA 5FZ4A 4AF9A 3E1F1 1UXXX 2FDFA 4M4RA 2ZX4A 3OPWA 2XGXA 4XABA 1PMHX 2Q30A 3CMGA 2C6SA 3ACIA 3E5QA 3VBFB 4JX0A 3T1LA 1W6OA 3ZFFC 2RR11 2ZMNA 4K9SA 4MGSA 4QB1A 4XUOA 3RRDA 5CFDB 4K3UA 4AI8A 5JMOA 2ZX1A 5FZ6A 3TWIA 3NVCA 1FNYA 3HR9A 2G4IA 3NWKA 1YI9A 2XVKA 5A3WA 1OOPB 1VBC2 1MR5A 2Z4FA 1OQ1A 4PIXA 1IQDC 3FMGA 4E8CA 1W8NA 1RUI3 1Y43B 2RS31 3BTZA 3WW2A 2DUPA 3ALQA 4AE2A 1H1IA 2LW8A 4HK8A 1XRUA 3FLTA 1HW5A 1JUHA 3J7HA 5FPAA 4AVCA 4EJRA 3OGGA 4LTAA 1S4CA 2IXKA 3RMYA 3AL6A 2UU8A 4JKLA 2CDOA 5GLUA 4YG3A 1CESA 1CJPA 3A23A 5FPBA 1BJQA 2HH9A 1RUNA 2JDPA 2NMNA 2ZKLA 2VBPA 2YYOA 1R083 4LBOA 2W94A 1I5PA 2XKPA 1VBB1 1BEV1 4D7TA 3DN7A 4MGZE 2ZEWA 3MYXA 1KD7A 1O4TA 4XJ8A 4DEQA 2L9LA 1T6BX 1NE4A 3F2ZA 4XDOA 5FUIA 3VBFA 3HIFA 3KT4A 1DQ6A 1V6MA 1G7YA 2ZGSA 4YSFA 3WDXA 2YXSA 5DABA 4AVVA 1V6IA 1T2XA 2VNVA 4PQQA 3AZWA 4DPNA 1B35A 4MHUA 4ZU5A 3ZFGB 1UZVA 3ZN6B 3ZR6A 1LOEA 3MLJA 4HL0A 1RUG3 1QJZA 1PO22 4OI2A 1E5HA 2QFEA 1RVF3 2OZ6A 1A34A 1H0BA 3OEBA 4V2VA 4C0HA 1QH7A 2XPJA 2CY6A 1Z7S1 5FLIA 4BXFA 2JG8A 1SFNA 3R4DB 4Q4V1 2CWSA 3BOWA 3CL1A 4Q1PA 4D7SA 2RG4A 2B9VA 2ARBA 1S2KA 1UOBA 2JWPA 5HCAA 5IATA 2BERA 1R093 2BBAA 2XUEA 2VQ0A 1PK6C 4YM2A 3AJYA 4AEKA 4RHV3 2WIIB 5H9QA 1OLMA 1QJX2 1UY2A 2HWC3 5L9BA 2XJPA 3KT7A 3IDCB 5EP9A 4ASLA 1GQGA 4XBQA 5C8WA 4XJUA 5HXVA 5F3CA 3PUQA 3NNLA 5J1XA 3Q8AA 2IXIA 4AXOA 3WQ0A 1YC61 2GNBA 4OLLA 1LR5A 1FPN3 1RUE2 4PIYA 1H30A 2FCUA 1DQ1A 1LCLA 2NPIA 1I1EA 1WCKA 1D7PM 1BQPA 1NZCA 4Q5OA 1MQTA 3NAPA 4QMAA 3LAGA 5JXHA 4AFAA 1KRIA 1RUF3 3LQCA 4W65A 3JB4C 4LHLA 3H9AA 4FPLA 3J8F1 2WL1A 1QKQA 2BNOA 4AQ2A 1OFSA 3T08A 4QDQA 1YIPA 2W1QA 4YGEA 2D6PA 1FXZA 4AEDB 1RIRA 4U2AA 4BQ3A 5C6CA 4Y1ZA 1ASJ1 5G04L 3H42B 5BNQA 3ZYPA 1GNZA 1HLCA 1KDMA 2PQSA 2VZPA 4XF4A 1H2LA 1QOSA 1WCUA 3AK0A 2HWB3 2NMOA 4N8MA 3PU3A 1ND3B 4XXAA 3T0AA 4A44A 3CZJA 5C9AC 2ETEA 4LBJA 4FAHA 5DAQA 3NQHA 5FTTC 2GC1A 2QQNA 3R05A 3K48A 5C3RA 5BNOA 1HB2A 1W6NA 4C1XA 4QXCA 2BP6A 3B69A 2QBXA 1YUDA 5FP8A 4A7YA 1WMXA 3I49A 2GMEA 2QQMA 3AJZA 2QQVA 3O14A 2WO1A 3DECA 1V9U3 2WWUA 5F3GA 1AX1A 5FYUA 4DUXA 2K2SA 4MYEA 1C57A 3TN92 1ZA4A 2BZDA 5JOYA 1JS9A 1ZX5A 4YW5A 1VBA3 2VH9A 4OHZA 4QPIC 4NHMA 2YC2A 1Z7S2 4L97A 4DXRA 1MACA 1GZWA 2ES3A 3MPBA 5ANQA 1EPZA 2PHWA 3I2JA 1HV0A 1AJKA 1W9YA 4K6BA 4L2NA 3V0BA 1NQDA 5T5JA 1LU1A 3DYMA 4IEPA 2Q5TA 3MIBA 2CAVA 5DZFA 2PHTA 3ZFFB 3WHTA 3HT1A 3VDAA 5FZDA 1GP4A 1XYNA 1VMHA 4AL9A 3V0AB 2WR9A 4RGGA 1S0CA 3WF4A 3NJZA 3NL1A 4NE9A 3ZSKA 5LW9A 1RINA 2GALA 3PU8A 1BBT1 2IXCA 4PCRA 5L9RA 5FP9A 3MIFA 4KU7A 5A80A 1VBD2 5KWRA 2HBUA 2Y26A 4XUNA 3TNQA 4BYYA 4CUCA 1W0PA 3N7LA 2JB4A 1NUKA 3AZVA 1J1TA 5GALA 5DAPA 1SLBA 1ZRRA 2N7GA 1VBC3 5FY5A 5T3NA 1BLZA 4HVRA 4E4HA 2JG9C 4AK3A 5A3TA 1EV13 5BNPC 1QJX3 1FYUA 2HYXA 3ZKUA 4MGQA 4DXTA 4YFWA 4LT5A 3C3VA 4CCKA 4TLGA 2OVUA 2W95A 1K45A 5LA2A 4COZA 1TME2 2FDGA 5JPNB 5K8SA 3FBYA 4FFHA 4QDSA 3W58A 3Q8BA 5ANNA 5B4XA 1O3QA 3WUCA 1V9U2 5F2SA 4LBMA 4IE6A 1AR61 5D8AA 3NNJA 2A6YA 2F17A 2AC1A 2BUKA 1VBA2 1HXS3 5FYBA 4YZ2A 5JZGB 3O1RA 4FQZA 3HQRA 4DMIA 3KQRA 2FBEA 4IE7A 2Y6GA 1GP5A 3ZYIB 4MUVA 3VL9A 5M0TA 2QQUA 2AH2A 5C5UA 1LOCA 1WBFA 3MIEA 3ZXGA 1QEXA 4CEWA 1U5ZA 2DFBA 4KWJA 5IK4A 5HV4A 5LZ6A 4EN0A 5FPLA 1MS5A 4PLNA 3BI3A 5JOXA 4Q0QA 2O1QA 3WVJA 3AMHA 5FRAA 4DQAA 1QJU3 2D98A 3EXUA 4YZ1A 4QXKA 3LIHA 2JENA 1W90A 1W2AX 1XNCA 1LGCA 3JD72 3TEXA 5K9YA 5EJ3A 1ZM1A 4MADA 3QD6A 3O7OA 1IKPA 4S2HA 1A3KA 2RDRA 4XPVA 3BTYA 3FFQA 4IEQA 4Q4X1 5KC6A 1RUG2 3BYWA 4NHKA 1OVPA 1QJU1 1TNRA 2VVFA 2ZPXA 2JE8A 4HG6B 3KGZA 4P9WA 4Q29A 5JOWA 3K46A 1YCIA 2D3PA 3K2OA 2NP0A 1B09A 5FMDA 4CCMA 3Q9OA 1PK6B 1ZBA1 2EXJA 5JIAA 2YC4A 5A3UA 4HKLA 3PIGA 4CCDA 5KXCA 1JZ3A 4RS5B 1YQ8A 4TLFA 4TZDA 2NYYA 2PHDA 3S7IA 4Z92B 3D5OA 2IXJA 2VMEA 1CAUB 2GDFA 5FYIA 1GBGA 3U10A 1NCQC 5DZEA 1OT5A 4Q4W2 2W47A 4HN1A 1Z7S3 2XONA 4CE8A 4HBNA 2QZ2A 2ZX2A 3MIHA 3MO4A 2FZ2A 4C91A 3WF0A 5AC93 1LECA 1COV2 4MZUA 5IVYA 3UGHA 2A6XA 1RUG1 4YVSC 4LO6B 3MW4A 4M0NA 2DUQA 2Z79A 3AZXA 2HWB1 2A7AA 1WW5A 2IVJA 3AVSA 3E5UA 4MGYE 4QQPA 5A3MA 3CF6E 1SHWB 4CPBD 3WOGA 3ZMNA 2UYAA 1DGRA 2VUJA 3J26N 2FZ1A 2JB8A 1GZCA 2ERFA 4INDA 2Y64A 4XFGA 4GD4A 2BGOA 2XG3A 4XF1A 4Y1VA 5GKAC 1VBC1 3IN9A 3WNNA 2WNUC 4AHYA 4C8DA 3NJYA 1S0EA 5JR7B 2B39A 4YZ4A 4DEVA 5LRRA 2ADDA 5DG1A 1GANA 1NG0A 1OF3A 3LOIA 2ZX3A 4GXLA 4EQVA 1REDA 2G9FA 3JBG2 4HANA 1ND2A 2D3SA 4M3CF 4COYA 1MEC2 4LORA 3PUIA 1C1FA 2E31A 4QQOA 2G19A 2Y33A 1FMD2 4CCLA 5CFCA 3FBMA 1V6LA 3AMNA 3UNPA 3MIDA 3LEIA 2R30A 3N9NA 5C33A 1HXS2 1VAVA 4XF0A 1CWPA 4XFHA 3V56A 3MBWA 1QGLA 1MZ5A 3N4MA 4FVVA 5FZIA 4BQ5A 3EJKA 3WQBA 4NOTA 1RXFA 2XR4A 2P2KA 5FREA 5DMYA 2QQLA 5ABJB 4ONUA 2VW2A 2ZAHA 3W9AA 4UAPA 1MVEA 4XVHA 1OKQA 2J42A 4XJWA 1QJU2 2SBAA 5E89A 3HVDA 3VBUA 1ZZBA 5L36A 1AYN3 4LK6A 4DS0A 2WBKA 5EV7A 3K75B 1NYWA 1W8OA 1EV11 2LS6A 1MS8A 2UWAA 3HNYM 3INAA 1Q43A 1Q8PA 2WAAA 2ZTNA 4HONA 2W91A 3BALA 3ELNA 5H9SA 4BIOA 1NCRB 5C7GA 1NOVA 2WLQA 2RHPA 2VTXA 1LULA 4QB6A 1VALA 3AYEA 1ZBA2 3J7LA 1KFXL 2E9QA 4AVBA 2RMU1 1UIJA 1RUH3 2ATFA 2WT0A 4XBLA 4QDRA 2LTNA 2VG9A 2WNUB 3PTYA 4Z07A 3KB5A 1MVQA 3VBHA 5CFCB 1LRHA 4D6QA 3PJYA 4LHSA 2W46A 4FPFA 3ZXAC 2H6CA 2O14A 2K46A 3PNAA 4FPCA 2GNMA 4Y1YA 3LOBA 2HEVF 1KGYA 2OA2A 4LPLA 1RUC1 5F9TA 4LULA 4Y3OA 4JVAA 2YZ4A 4JHTA 1OA2A 4CEYC 1RMU3 5AC92 4QKBA 5FLJA 1JN2P 4P00B 4KWUA 3OPZA 4MXVA 3AMMA 1W9SA 1S1AA 3CJXA 3WNMA 2R041 4QPGB 1F5FA 4FOQA 1W6OB 1GUIA 2PHRA 3I3MA 3BGAA 5FZAA 1SMVA 3S5AA 4E4SA 5C70A 2E7QA 2BW8A 2IXHA 1TVGA 3C8XA 2MHFA 3USUA 2I74A 1OOPA 2JIJA 1OXCA 4IGQA 4CCJA 1DZRA 4DXZA 4EROA 4OCTA 1POQA 1RUJ2 1Y7BA 3ITQA 1UQXA 3FC0A 2QQOA 1C4RA 1AYN2 2VBBA 1W8FA 3JBG3 4BOWA 3OYWB 3X29B 4Q0VA 1US2A 1D4M3 1ZA7A 2GC2A 2GSYA 2JDMA 3KT1A 5GZDA 1GQPA 1RVF1 3VBHB 1FNZA 1SQ4A 3WP5A 1AX0A 3AVRA 2VZVA 3AM2A 1RHI1 2CGPA 3H7YA 4B4QA 5FPUA 4B1LA 4EZ4A 4YG6A 2PAMA 2E33A 5CKMA 3H1WA 3U1XA 4CPBA 2AENA 3ZXJA 1DZQA 4JZRA 4XQDA 4XFFA 3WP6A 3LIGA 4CUAA 3VBRC 4XDPA 3MICA 4WM8A 4PLOA 2O0OA 1QIQA 1GYKA 1J3QA 2PMWB 4QQHA 3BODA 1UZZA 1L7RA 3LPFA 1PO23 3VDDA 4CDUA 4LO4B 1FV2A 1RL3A 4OUMA 4AI3A 4XEZA 2WUHA 5GM0A 5BV6A 3KV6A 5E6HA 4QU1A 3O1MA 1HDKA 1YXWA 5DZGA 1RUI1 2RS33 3TAYA 2Y34A 5IVBA 1S0IA 1JHJA 1SCSA 4YVSA 1I5ZA 5A1FA 5F8PA 3RG0A 1WCSA 1W2NA 3B94A 2QQWA 3I7DA 1R092 4Y33A 4HZFA 3FUQA 4WM7B 5IAXA 5KXEA 4ZHNA 1DGWA 1AF9A 2E26A 4ITCA 1X8EA 4UW5A 5DN2A 1KITA 4BQYA 2BJSA 1EY2A 2EIBA 1YO8A 3CJIC 1DLLA 3I2DA 4LA2A 3DKQA 3IMMA 1VAKA 4FCAA 4FFFA 2VUDA 1W39A 5A7QA 4N7UA 4O9GA 1GNYA 1AR73 2VZSA 1VR3A 3VHNA 2ZEZA 3DV8A 2HEYF 2ZZQA 5HPOA 4BWOA 1J83A 2IZWA 1SLLA 4RN5A 4XAAA 4YPJA 3GHMA 3USSA 4OUSA 3LKJA 1RMU2 4RFRB 2VW0A 3S6PA 4ZS2A 1A8DA 1GWLA 2P37A 2QNKA 3DPRA 4UOJA 3O0XA 1HRV1 4FBFA 3GBGA 4YZ5A 2F4LA 5KXBA 1HKDA 3HWJA 3OGRA 5DUWA 1UCXA 1YJLA 1SLTA 2UWCA 2VU9A 5FYHA 1CAUA 1ENXA 1KQRA 3WLUA 5I8TA 3AP4A 2H0VA 4RQPB 1OHFA 5A6XA 2ENRA 3MLKA 1N3QA 1VBA1 3ES4A 2WN3A 2KXLA 3KVBA 3LGRA 4W8JA 5FYCA 3O0WA 1IS4A 4N9IA 4Z82A 1XNKA 2R1DA 4YNIA 3KSCA 5CZKA 1BCXA 3U4SA 1CAXB 4EV0A 1JZ2A 3OJBA 1WZXA 3TB0A 1GOHA 4N43C 5FLHA 2WINB 4ASKA 2IFWA 4UFMA 2BWCA 2G1MA 4ASMB 1R1ZA 1PO21 2VPVA 1F5JA 1C3HA 2WZPP 5DQ0A 2C9AA 5JSOA 1HQWA 5FZ3A 1UAIA 2FHRA 3ECQA 3SCGA 2HJIA 4FPJA 2HKXA 1V0AA 1IKQA 2FCTA 2WKKA 3P1IA 5FZFA 2JG9A 4AYUA 3TEZA 1PZ9A 4C0BA 2JDHA 3MGUA 3AYAA 3DPRB 1OA3A 2OPWA 3M3OA 2VJXA 4K1ZA 5FBZA 5FZEA 4AI0A 4CXWA 5ABJA 2VZUA 1O59A 5EXOA 1ZYBA 4FQ4A 1WA4A 3KV5A 3K51A 1Q56A 1Y9MA 2MEV3 4NMIA 5T5LA 3KMHA 3M3IA 2V09A 3PL0A 4CRQA 1OLME 4HETA 4DRRA 4YVWB 1OURA 1ENQA 2VZ3A 4YZ3A 2RDNA 1PIV2 2EXIA 3IPVA 4FPHA 5BUVA 4H55A 2DU0A 3VBOC 4QGLA 4YW3A 4NIGA 1H8TB 4GZ9A 3AYDA 3KQ4B 4P9IA 3URFA 3CKHA 3V0AA 3VD4A 4H7MA 5F6KA 3D0SA 1QJY2 1WCQA 4YWAA 4GWNA 4Y4YA 1AR71 1S55A 4QX1A 1QMJA 2WZEA 4RQPC 1XNBA 3ZXFA 1W2OA 4F83A 3VB9A 4QPIA 3U37A 3UKTA 5FP4A 4LBQD 1PVC1 5GLZA 3WQ1A 1G86A 4O9EA 5F5QA 3WDVA 1TNFA 3WUDA 3ZXKA 5HCFA 4DUVA 3UJOA 4D94A 3I2GA 3H3UA 4PT6A 4XETA 4AAXA 1RUC2 4XJZA 4YW1A 2WNEA 3L2YA 2EIDA 3CLPA 5FZ0A 5FZCA 3VDCA 4AHWA 2I2SA 1WA6X 2R0FA 5C8CC 3SH4A 3SH3A 2QQPA 4RS5C 5C71A 1KFUL 1W9TA 4NO4A 2PXJA 3VD5A 2VVEA 4AOCA 2BEOA 1ULPA 1VLNA 3DF0A 1J1LA 3OGSA 2AREA 1NKGA 1SFYA 3KCCA 3POFA 5L7OB 5FO7B 3ZYGA 4Q0SA 3K3OA 2K0GA 3UYJA 1WWYA 4QGMA 5K4LA 5LASA 2UY9A 3RZJA 3VBHC 4DINB 3PJQA 2XWBB 5JWPA 1DHKB 4LIUA 1XNTA 4BZ4A 2XB6C 1RVF2 3IWZA 4Y20B 1W6QA 2BGPA 1L7LA 4Q26A 5A1AA 3ILFA 5JPMB 2WFPA 1DDLA 5J98B 1S0GA 4E2QA 2TUNA 1R081 1RHI3 4XQWA 2D93A 4XTMA 1W05A 3JQWA 4XDQA 4RS5A 3ZR5A 3WP3A 4XE9A 5C8CA 3RNSA 2PA7A 2EA7A 3OBTA 5FXZA 4MV2A 3HQUA 3SKVA 5GZGA 3DGTA 1H1MA 3LDRA 4YW7A 1NCQB 3DCQA 3HPNA 4WM7C 2HWD1 5F3EA 1UOGA 2VCAA 2HWC2 2P6CA 3KV4A 2YBPA 1E5RA 5J96B 1YQ5A 2HWF1 2ZGMA 4PIZA 1VRH2 1NQJA 4G4FA 2Y6JA 4XHXA 1Z0HA 3E6BA 5LK5A 4KI5M 3K3NA 1PK6A 4GWIA 3AP9A 3D8CA 1POV1 2YV8A 2W68A 3RS6A 2JX9A 3LFIA 2ZGPA 4D6RA 3POGA 4AI1A 1ZRIA 4FXKB 1XSQA 3MF6A 1MQTB 3NAPB 3UGGA 4BXSV 1XB9A 3GXUA 1HQLA 3WDWA 5IK5A 2B5HA 3GCXA 2VUAA 5FXXA 5IJRA 2XOMA 3DEMA 2R043 4RA0A 1U5IA 2VMHA 3H50A 2Z69A 4FTEA 3IIIA 2YBSA 5JZGC 4YVSB 2Q4SA 2R063 4MO3M 1QU0A 4BQ2A 1JOJA 1ND2B 4ISRA 1EYBA 1DU3D 3ZO0B 4AAPA 4MHRA 2A71A 1DQ4A 3HBZA 1QJY3 2ZOEB 1WW4A 2ET1A 2YBKA 4HMZA 1EAH2 3Q8FA 1M06G 1FI2A 4Q27A 4OHXA 2A5ZA 2Q8EA 1WCDJ 2WS93 5BY5A 1GZTA 2GNDA 5JR2A 3SQOA 3VBFC 1AYN1 3EBRA 4Z2AA 5C3SA 5JSRA 3THPA 1K12A 4XIOA 3VL8A 2VO5A 3J8F3 2MEV1 1Y4WA 3J4UH 3PTRB 3H8RA 1QJFA 3GBFA 1F4AA 1LHOA 1QY4A 3OGVA 4ZZ8A 5FWJA 2DTWA 1H2NA 4LKDA 1GWKA 2QKDA 4F8AA 2WQ8A 4RR3C 1H8VA 3LSEA 3LE0A 1UIKA 3DL3A 3AXEA 1A8MA 2RM22 1BMV1 3GJBA 1OFNA 3O1PA 2XBO1 5BPXA 3TYJA 3ZVXA 3O1SA 2PLV2 5CVRA 4ZXKA 3D3AA 4OI0A 4IEZA 1O5UA 2DVFA 2ILMA 4XUQA 3VBOA 5JDBA 4CU9A 2A1XA 5CU1A 2GC0A 4WVMB 4UFKA 4COVA 5CKNA 4JGYB 4YGDA 5JAXA 5KXDA 4OUEA 2JXAA 1O8PA 1NCRC 1SLAA 2EF6A 3A22A 3MLLA 4M3CA 1V6JA 2YMZA 4TYSA 2W87A 1BVP1 4YG0A 4Q4Y1 4WZFA 5F2WA 1XQNA 4W6YA 5A33A 1ZRCA 4IEWA 4L92A 5B4NA 1A6CA 1RUD3 1CX1A 5FZ7A 1SACA 3R4SA 1L3JA 1SLCA 5K0UC 5T5PA 3RZLA 3FJSA 2D6KA 2LRPA 4GIQA 1QOTA 2Y0IA 3J7MA 3H3LA 3BOPA 3VD7A 2JE9A 2R072 1O8SA 4CDXC 1LOGA 1NCRA 1U5YA 4M3CE 5FXWA 3HNBM 3DKWA 3ZYHA 3VKMA 2K9ZA 2D7FA 2RJKA 1PGW1 4PF5A 5AVPA 3ZFGC 1IHMA 2Q8OA 2OXBA 4D69A 4MG2A 3VZLA 1K5MB 4LO8A
chains in the Genus database with same CATH topology
1JOBA 1JODA 1ZRIA 1F35A 1JYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOB A;  1JOD A;  1ZRI A;  1F35 A;  1JYT A; 
#chains in the Genus database with same CATH topology
 4CDQ A;  3GJA A;  2FCV A;  1JI6 A;  1RUO A;  1RXG A;  3MF9 A;  3TEY A;  2FMD A;  3Q8C A;  4QX2 A;  3WR0 A;  1SDD B;  1UNB A;  3CNA A;  1EPW A;  5IUQ A;  3V65 A;  1Q3E A;  2W2I A;  5HI0 A;  3FHA A;  2VZR A;  3UL2 A;  4QX7 A;  4M00 A;  4LUM A;  2BV4 A;  3PVB B;  1VPH A;  3B9I A;  4FFI A;  3M3E A;  1XE7 A;  2RM2 3;  4WVM A;  5A1L A;  2XHK A;  2E51 A;  3OB8 A;  3AKR A;  1S0D A;  2ZX0 A;  5J09 A;  2DFC A;  4FPG A;  1FPN 2;  1QNW A;  1UKG A;  3HEI A;  3POI A;  2XLG A;  2AAC A;  4OMD A;  4UFJ A;  3BTA A;  4R9C A;  4S2F A;  1U5X A;  3ZIX A;  1ZRF A;  4YM1 A;  3N7M A;  1DIW A;  2EAA A;  2VZT A;  4QPG A;  3SEE A;  4OZX A;  4FO9 A;  3UK9 A;  3RDI A;  3AKT A;  1TME 1;  5FKB A;  5FJK A;  5A70 A;  2DBI A;  4S2G A;  5F39 A;  4GWM A;  4CUB A;  2VY0 A;  2HBT A;  1QNY A;  1XJA A;  1ACC A;  2BOI A;  2DTY A;  2X53 S;  4J1X A;  3H0O A;  5EHD A;  4QB2 A;  1GKB A;  3ROU A;  3USU B;  1ZRE A;  4P5Y A;  2EXH A;  3ZSJ A;  1R1A 3;  3RYK A;  2ZGR A;  4LBN A;  2C9K A;  2MPF A;  2VAU A;  1PGL 2;  2XLA A;  2ZJC A;  1MS0 A;  1FX5 A;  3N9O A;  3VKO A;  4CP0 A;  1H2M A;  5JZG A;  3TEW A;  3PVN A;  4WM8 B;  5C4W C;  1N47 A;  5JI9 A;  1APN A;  2C1F A;  5APA A;  3OBR A;  4KQ7 A;  1YFU A;  3JBG 1;  4I01 A;  2ARC A;  1GLH A;  3DXU A;  1SLI A;  4X8P A;  2Q1M A;  2ZML A;  4CCE A;  5EQU A;  3GYD A;  5IVE A;  2Y0O A;  2DUO A;  1JBC A;  1DYO A;  3KHC A;  1JYC A;  4PQ9 A;  3CU7 A;  4UW3 A;  4BIS A;  4Y5Z 0;  4ZXE A;  4Y20 A;  3CEW A;  1AL2 2;  4G9S B;  4MVT A;  3I2O A;  4N7I A;  4EWD A;  3KCY A;  4WM7 A;  1CZV A;  2OX0 A;  2Y6K A;  5I0U A;  3LEK A;  5J37 A;  2A75 A;  4LBL A;  1JHN A;  4TN7 A;  2CSG A;  4ET7 A;  2V4A A;  4GKY A;  2PTM A;  3VZJ A;  5I93 A;  1IPJ A;  1DBN A;  3WSO A;  2WDB A;  4MLO A;  4XZU G;  5DDJ 2;  4BLI A;  1XE0 A;  2VCB A;  2ZAC A;  1UXZ A;  4JKM A;  1O4Y A;  4C90 A;  4W50 A;  2XJU A;  3LDK A;  1SDW A;  2JKX A;  3G6J B;  1OKO A;  2NN8 A;  2R1B A;  2XVL A;  4E4Z A;  2YFZ A;  3ASI A;  4IET A;  4IER A;  5A3N A;  1DGL A;  4KBZ A;  1F31 A;  4YW6 A;  1IS3 A;  3PHM A;  2OUJ A;  1W2T A;  5FYZ A;  4NVP A;  5L73 A;  2WC2 A;  1ALY A;  4ZON A;  2DDU A;  2V5Y A;  5LBF A;  5LBB A;  5A3P A;  2VZ1 A;  3H7J A;  4J1W A;  1YFY A;  1BEV 3;  1U0A A;  2RS1 2;  3B02 A;  3ZFE B;  4B7K A;  1VBB 3;  2VNG A;  1GNH A;  1AX2 A;  3JD7 3;  4R4Z A;  5F5C A;  5HBA A;  1LOD A;  4KGQ A;  2OW4 A;  4B29 A;  5FKC A;  2QJV A;  3I2F A;  5CAZ A;  3O1U A;  1O3S A;  3KWV A;  2WNV B;  1NAE A;  2XQR A;  3AP5 A;  3U0Z A;  2YDE A;  3H3Z A;  1STM A;  1UMI A;  1X82 A;  5CNA A;  2R0H A;  5DUU A;  2CAU A;  1CON A;  4CU8 A;  4UXA A;  1ODN A;  2CYF A;  2JG8 B;  1BBT 2;  4A7Z A;  2WS9 1;  1RUH 1;  3OEA A;  1WLT A;  4E9K A;  4UW4 A;  5JIU A;  4CDW A;  4AGR A;  4QQ2 A;  3FZ3 A;  2B4K A;  3JXS A;  1I3H A;  5AFE A;  1SEF A;  3LEG A;  4UBG A;  3EHK A;  2VL4 A;  3ABZ A;  1CAV B;  4CZS A;  1UY3 A;  4GMP 1;  3D4K A;  4KWL A;  2G9Z A;  2XL9 A;  1WD4 A;  2GP3 A;  4OUL A;  4RQP A;  1OD3 A;  5ACA 3;  4M01 A;  3OTF A;  1N1Y A;  4LBK A;  1COV 3;  1ZVF A;  3IKW A;  3OSD A;  1Q8Q A;  2VW1 A;  2EAL A;  3I4I A;  4FFG A;  3U78 A;  1IGO A;  4KL1 A;  1HRI 3;  3TBD A;  5C4W A;  1AR6 2;  4Z2W A;  4BQ4 A;  3ZLI A;  2JD4 A;  2R16 A;  3B93 A;  3M3C A;  4K40 A;  4RGK A;  1ZBA 3;  4R9D A;  1OBN A;  5ACA 1;  3RVH A;  4IV1 B;  4Q4V 2;  2JDY A;  4WZC A;  2JDU A;  5FY9 A;  5T50 A;  3UES A;  3ZXL A;  4CDX B;  4UYB A;  1LEN A;  4P5H A;  4X6R B;  1KXG A;  5E88 A;  2VXR A;  4LKS A;  3UKV A;  2ID4 A;  1BEV 2;  1QDO A;  2WQZ C;  2WRA A;  4H7L A;  5FWE A;  1CIY A;  3O0V A;  2KD7 A;  4QM8 A;  1NE6 A;  3EB7 A;  1H6X A;  1E5I A;  2JG9 B;  4CXX A;  4XYX A;  2BOJ A;  2HEW F;  2RE9 A;  4XCA A;  5CKQ A;  3HJR A;  4KG0 A;  4KMQ A;  1AL0 G;  5IVF A;  1AXK A;  5KR7 A;  1O7F A;  4DUW A;  3I59 A;  4MGI E;  5GZE A;  5DDJ 3;  2Q8D A;  1G9C A;  1UMH A;  4Y24 A;  4K1Y A;  4Y1U A;  1ENS A;  5FR3 A;  1PMI A;  4IE5 A;  4LUK A;  1Y9Q A;  4XXP A;  3OD0 A;  1O3T A;  3MZH A;  3VKF C;  3JQX A;  1OC1 A;  4EE2 A;  1RJ7 A;  3PVO A;  5TSW A;  3I2I A;  3VZO A;  2FDK A;  3AC0 A;  1NLS A;  5A7P A;  3FWE A;  4IV3 A;  1JH5 A;  1BYH A;  4GUL A;  3AMP A;  4NRQ A;  3SCF A;  1DYP A;  4QHB A;  3D82 A;  1AL2 1;  3NV3 A;  3SCH A;  3NNF A;  1R09 1;  4CDX A;  2D6N A;  1UMZ A;  4GH4 C;  2DF7 A;  2HWF 3;  2LRO A;  1UU5 A;  2R7E B;  2XKO A;  5T52 A;  2J1A A;  3B7M A;  4GA9 A;  1J3R A;  2ZHL A;  3RZZ A;  2VC9 A;  3BPS A;  3FLR A;  2WT2 A;  3LSD A;  4JKK A;  4Q4V 3;  3I2K A;  5K0U A;  4BCU A;  3DPR C;  5BNN B;  1TQ5 A;  1UF2 C;  3ZFF A;  4QT6 A;  1G9A A;  1WMF A;  5JOZ A;  1QXR A;  2JIC A;  4R9B A;  3T4V A;  4M4P A;  4A3Z A;  1FAY A;  4GH4 A;  4XJA A;  1W9F A;  1BBT 3;  2ARA A;  4Q0U A;  2CL2 A;  3HBK A;  3K4A A;  1RUE 1;  5A32 A;  4E2G A;  4YW2 A;  3MFC A;  2JKB A;  4CDU B;  3CJI A;  4A45 A;  4RD7 A;  2EXK A;  4QX5 A;  1PX4 A;  1WD3 A;  3VHR A;  2BU9 A;  4NUB A;  4GJY A;  3WT3 A;  2OYZ A;  5FZM A;  3POW A;  4X6Q B;  1A78 A;  1JU3 A;  1Q8O A;  2JEC A;  1UZ0 A;  1RHI 2;  3B9C A;  4LXL A;  3OBZ A;  1ZZ8 A;  1YLL A;  3T2P A;  5L19 A;  2VNR A;  4HN0 A;  1PM4 A;  3P3N A;  1NA1 C;  1ZZC A;  2I07 B;  3ZYR A;  4A7K A;  2VXJ A;  2Q1F A;  3R4U A;  1HRI 2;  1R1A 1;  1C8M 1;  3LPG A;  1PO1 1;  4IUG A;  1HQN A;  4UW6 A;  2WYF A;  3AKP A;  3OUJ A;  3VZK A;  3ZXE A;  1B35 B;  4I0B A;  3GZU C;  4IEY A;  5FP3 A;  3VDD C;  5AVA A;  3BTX A;  3PMS A;  5DXD A;  3T2T A;  3S30 A;  2KA3 A;  2SLI A;  3TOJ A;  1HXS 1;  4URA A;  1UYP A;  1VMF A;  4S2D A;  1ODM A;  3WV6 A;  3VBR A;  3FN9 A;  4NII A;  2UYB A;  4X8N A;  2R6Q A;  3KM5 A;  2LM3 A;  4JGZ C;  3VZM A;  1CIW A;  1KS4 A;  2A70 A;  2W5F A;  3B00 A;  3ILN A;  3NST A;  4P9G A;  4K21 A;  2VUL A;  4GH4 B;  3S7E A;  1PZ7 A;  2BNN A;  1ZZ9 A;  1ST8 A;  5LCW L;  1H1A A;  2R04 2;  3KV9 A;  4GMP 3;  3O1V A;  3WIN E;  2P6H A;  2RMU 2;  3QH6 A;  3OG2 A;  4XIK A;  4L99 A;  3T3Y A;  1OH3 A;  1WKY A;  2ZAB A;  4BME A;  3NV2 A;  4J6G A;  5FY1 A;  5KHG A;  5SV5 A;  1HB1 A;  3SLI A;  3VV1 A;  3BUC A;  2ZEY A;  4CYD A;  3SH5 A;  3M8L A;  4P9X A;  2VOV A;  3NO8 A;  3EO6 A;  3WNK A;  1VBE 1;  4Q4Y 3;  3WG3 A;  5FY4 A;  4JCK A;  1OUX A;  1EUT A;  2GZW A;  1QOO A;  4UFL A;  4HPK B;  1OOP C;  1UY4 A;  5EFU A;  4DNY A;  4UBH A;  2XJR A;  5GJ6 A;  2FD8 A;  2VQA A;  4N53 C;  3ZFE A;  3FHI B;  2WAO A;  3FUO A;  3J8F 2;  1LGN A;  3NKG A;  1RUJ 3;  1HIX A;  4GAL A;  2FDI A;  2YGL A;  2ZEX A;  4LR4 A;  1PVX A;  1SG3 A;  2WLP A;  2WNV A;  3WNO A;  1PHM A;  2RS3 2;  4DOU A;  2E7A A;  3AP7 A;  5C3P A;  1FOD 1;  2A73 B;  2AUY A;  2ZHN A;  3L9J T;  5CA6 A;  4A2U A;  1ZBE 3;  1D2Q A;  3S57 A;  1AR6 3;  1UZY A;  5A7W A;  1PO1 3;  1D4V B;  4G3Y C;  4JGY C;  5GLV A;  5C9A A;  5HCH A;  2MNG A;  4JQR A;  2VR4 A;  3UKN A;  1EUU A;  3ON7 A;  3GBW A;  4IW3 A;  2FDH A;  2RJL A;  1PX3 A;  2YG0 A;  4DO0 A;  4FTS A;  1ULE A;  4YRD A;  5EYY A;  1N3O A;  2WA3 A;  3NV1 A;  1PGW 2;  2X09 A;  4A41 A;  2P3I A;  2PLV 1;  4JGZ B;  4OI4 A;  2XBO 2;  2E6V A;  2HWD 2;  2ZXQ A;  4JQT A;  4LKE A;  2WZR 1;  2RM2 1;  4XCB A;  2X05 A;  1BMV 2;  3WCR A;  1H8T A;  1AR9 3;  2VVD A;  2WO2 A;  3AZY A;  1YFX A;  2WO3 A;  1LNS A;  2XXZ A;  3IB3 A;  4JGY A;  2QQJ A;  3ETP A;  2J1T A;  2ORX A;  2YPD A;  4AI9 A;  1C8M 3;  2WO7 A;  2PFW A;  3ZX7 A;  3OUH A;  3JUU A;  3BVC A;  5LA9 A;  2ZCW A;  1OUS A;  2H0B A;  4IV1 A;  3VBU C;  4I2O A;  1PNG A;  4ES8 A;  4Q4Y 2;  1LHN A;  1W2U A;  1LOF A;  4BJ0 A;  4ARX A;  1W06 A;  2XJQ A;  3VKL A;  1W8H A;  4BHP A;  4LQR A;  1D2S A;  2PQQ A;  3C7E A;  3ZMO A;  4HVO A;  2Y8K A;  4OQ9 A;  3M3Q A;  3PLQ A;  4N53 B;  5C4W B;  3U11 A;  1GFF 2;  1KS5 A;  4JRL A;  4EZH A;  1YJK A;  1K5M C;  2DCJ A;  3J7N A;  2AGS A;  2CHH A;  2Q8C A;  3A4U A;  2GN3 A;  4HVQ A;  1AR7 2;  1PO1 2;  5BNP B;  4PHZ A;  2VM9 A;  4Z8B A;  3KVA A;  1W0O A;  3LF7 A;  3A0N A;  4FTB A;  4ORF A;  3KD4 A;  1LTE A;  4RHV 1;  3RWN A;  3H8X A;  3LCP A;  3WY6 A;  2OUH A;  2GN7 A;  4NHY A;  5I8Y A;  4IGP A;  2C24 A;  2YGM A;  3APB A;  3AZZ A;  1X33 A;  4FI9 A;  3AFK A;  2BVV A;  2GP5 A;  2HYK A;  2VGD A;  4LHN A;  1J59 A;  2CV6 A;  5FYS A;  4IL7 A;  1WGP A;  3POJ A;  1PVC 2;  1V6N A;  2XBO 3;  4XF3 A;  3HN1 A;  4XFC A;  5KHH A;  4IV3 B;  2YU2 A;  5FDB A;  4PLM A;  5J48 A;  4XFA A;  1AR9 2;  3T1M A;  5IK8 A;  4EN8 B;  2WNU A;  2VOK A;  1TMF 1;  4GB3 1;  2VOW A;  1DP0 A;  4ES9 A;  1R1A 2;  3WF2 A;  3VD9 A;  4Y5T A;  5IVV A;  3JB8 A;  5ERL A;  4ARY A;  4XW3 A;  1NY7 2;  3HNM A;  1O4Z A;  4XMA A;  1SFP A;  3THT A;  3OUI A;  5A3L A;  3OD4 A;  4I30 A;  3UV9 A;  4AQS A;  5FPX A;  1MS3 A;  4K8F A;  2VTX J;  1H4H A;  1SZB A;  3WCS A;  3OBA A;  4CP2 A;  3KGL A;  1ZBE 2;  2EAK A;  4NRM A;  3U75 A;  1MEC 1;  1AHS A;  2VCM A;  2XDV A;  4I0A A;  4U36 A;  1CQ9 A;  4J25 A;  5KHK A;  3JU9 A;  2W1W A;  4OYU A;  1JOP A;  1XC6 A;  4A4A A;  2F4P A;  3ZFG A;  4P02 B;  4LIT A;  3P3P A;  2D3R A;  2QDR A;  3AX4 A;  4FP3 A;  3SXW A;  5E8A A;  1WBL A;  2BFU S;  2BVB A;  5DAX A;  1FAT A;  1XYO A;  2BFU L;  4URT A;  3CDZ B;  1NXD 1;  1W8Z A;  4W6W A;  4CU7 A;  4YLZ A;  4IGO A;  3LEM A;  1W0N A;  4YW4 A;  1C8M 2;  1OI6 A;  3C7F A;  3NNM A;  1WLW A;  2ZGK A;  4QGN A;  5E1R A;  3F95 A;  3VZN A;  3ZN4 A;  4XFI A;  5I91 A;  4FOW A;  2WFF 2;  4QXB A;  1PIV 3;  1PVC 3;  1VRH 1;  2VMD A;  2YHJ A;  3CJI B;  4XUR A;  5FK7 A;  1HN0 A;  1VBE 3;  2VQT A;  3IMN A;  3R0R A;  1M4W A;  4NN0 A;  3N3H A;  4Y1X A;  4EWE A;  1RC6 A;  1UKR A;  3P5B A;  2ZHK A;  5FYM A;  1QXJ A;  3BB6 A;  3NNG A;  1LHW A;  4IV3 C;  1X9P A;  3R6S A;  1NX9 A;  4MSV A;  4DB5 A;  4LBQ B;  5A6Q A;  3OGJ A;  1NT0 A;  2P4E A;  5FUP A;  3EYP A;  2PYT A;  2QZ3 A;  2HWE 2;  3ACH A;  5IVJ A;  1W9W A;  2BGC A;  1W8W A;  1W03 A;  4MX3 A;  4DIQ A;  5E16 A;  1UPS A;  4RR3 A;  1HRV 2;  3MI8 A;  2BBV A;  2C0Z A;  5HXM A;  4P14 A;  4PDW A;  4JDN A;  5FZB A;  5JLV A;  1SBF A;  2BTV C;  1H2K A;  4KGG A;  5FO9 B;  2PLV 3;  1X7N A;  5FMO L;  4ATF A;  4LJH A;  2RS5 1;  3EQE A;  4MOA A;  4H3W A;  3RI8 A;  4DY5 A;  1XOY A;  4AG4 A;  5AFB A;  1TE1 B;  3TN9 3;  4B3N A;  1EAH 1;  1OLR A;  4AEM A;  1CJD A;  1VRH 3;  3POY A;  4BQW A;  1JYV A;  5BYN A;  3VN4 A;  4E2S A;  2Q1Z B;  4Y26 A;  3NMB A;  4AFB A;  1XND A;  2EIG A;  4KNC A;  4BK4 A;  4XJ9 A;  1AXZ A;  2PAE A;  1RJ8 A;  2XQX A;  1JTZ X;  1EP0 A;  4AI2 A;  1H9W A;  1WME A;  3IIA A;  5A6Z A;  2V5D A;  4AEJ A;  5LEK A;  3CZU A;  1ZBE 1;  4B4P A;  2IXL A;  4QHO A;  3UET A;  4FPO B;  2KR2 A;  3A0K A;  2P17 A;  2OQ6 A;  3E5X A;  1X50 A;  2DCZ A;  1I6X A;  2J1R A;  2R06 2;  3HN3 A;  1MPX A;  1X9T A;  2IFR A;  5F3I A;  4KH9 A;  2QTW B;  1C1L A;  2G9G A;  4BM8 A;  2WWJ A;  1K5M A;  1CAW B;  4NAO A;  1AR8 3;  4LE3 A;  4CDQ B;  5L9V A;  4UFI A;  5LA1 A;  1HN1 A;  4FPY A;  4PDW B;  1QF3 A;  3MUY 1;  3CIH A;  4FXG B;  4WV8 A;  4LMF A;  4DXS A;  2QDN A;  1YIF A;  5FZH A;  2VQU A;  4HLT A;  4NIH A;  2VMF A;  2Y6L A;  1D4M 1;  1NZI A;  1XYP A;  1HRV 3;  3VHP A;  1TZO A;  4OQ8 A;  2J1E A;  1LOF C;  3T4H B;  1GU3 A;  1TME 3;  2QCS B;  4JRA A;  5FZK A;  5A7S A;  3ZM8 A;  3D0J A;  1R08 2;  2A3X A;  2WFF 1;  4NAM A;  4WBB A;  5CAD A;  3WF3 A;  5I0R A;  4NPR A;  2ZGO A;  2CTV A;  1OLQ A;  1URX A;  2RS1 1;  4ZZ5 A;  5A6Y A;  3WDY A;  4GB3 3;  4DRV A;  1ND3 C;  5C9A B;  2PEL A;  2WAB A;  1UO9 A;  3M1H A;  5T54 A;  3HQX A;  1D0G A;  5BNO C;  2GMM A;  4ZU7 A;  4OVE A;  5FZG A;  1HJG A;  3TNP B;  2RDS A;  2DBN A;  2VTF A;  3ATG A;  4CCC A;  1VRB A;  3UJQ A;  4NPM A;  3L2H A;  3MV1 1;  3LB9 A;  5L7O C;  4Y22 A;  5EIY B;  1CVN A;  5AC9 1;  5BNN A;  1QJX 1;  2X5I A;  3B3Q E;  4K7J A;  4MGK E;  3D6E A;  4AR2 A;  5BNN C;  5LY2 A;  1MS9 A;  3OF1 A;  4HSL A;  4PI2 A;  5DDJ 1;  1EAH 3;  5CG8 A;  4NWV A;  4BH9 A;  2VZQ A;  3LZZ A;  4HKW A;  3V64 A;  4EYU A;  5FIX A;  3I3D A;  4COU A;  4XQ4 A;  2WS9 2;  2D5F A;  3EMR A;  4B4R A;  3GZA A;  1MQT C;  1RUD 2;  1YFW A;  3ME2 A;  3NAP C;  4Q8L A;  3WNL A;  5KBF A;  1F15 A;  2A6V A;  1W8T A;  5FK8 A;  3QBQ A;  2P3Y A;  1YEW A;  2FMY A;  4E27 A;  1RYY A;  3IPV B;  3N9L A;  2RS5 2;  4AVS A;  5I0S A;  5FBJ A;  5K0U B;  1XSR A;  1DZT A;  2FDJ A;  3KHB A;  1CR7 A;  1P8J A;  2JDZ A;  4GKX A;  4MET A;  4N53 A;  4WVV A;  4CP9 B;  2A3Y A;  1TMF 2;  4IDZ A;  4DZG A;  1QJY 1;  4JV4 A;  4LK7 A;  3QOP A;  2PHF A;  1CGP A;  1YI7 A;  5FQ0 A;  3AP6 A;  2OKX A;  2BWA A;  5C5T A;  5JXJ A;  2CU5 A;  2R06 1;  1N1T A;  1Q5O A;  3I3B A;  1L7Q A;  3PUH A;  4FPE A;  4YGB A;  3AKS A;  1S2B A;  1LHU A;  2DCT A;  3IDE A;  4FPK A;  1MZF A;  2XJT A;  1SBE A;  2WZR 3;  4NHL A;  5FZ9 A;  3VBR B;  5FOB B;  5ISL A;  2X5I B;  4MXW B;  2B8M A;  1RUF 2;  1DQ0 A;  5F5A A;  5F37 A;  1W99 A;  4TTG A;  2E53 A;  2Y38 A;  2XJV A;  1G9F A;  3DUI A;  3N7J A;  4IXL A;  4YYO A;  1LED A;  1CZS A;  1ND2 C;  1CN1 A;  2DU1 A;  2B7Y A;  3I2H A;  4YM3 A;  5LEJ A;  4DY3 A;  3M7A A;  3PME A;  5FY0 A;  5IAV A;  3LFM A;  1B35 C;  3VDD B;  3U4X A;  2GC3 A;  1VBE 2;  4R4X A;  1V6K A;  1OA4 A;  3NRU A;  3WF1 A;  4RGA A;  4O7X A;  1RUI 2;  2YY1 A;  4I0W B;  1OF4 A;  1SPP A;  1MEC 3;  2AEY A;  4BPZ A;  5FUN A;  3RI9 A;  3WQ7 A;  3OCP A;  4PI0 A;  3GM8 A;  1YRZ A;  1PM7 A;  1W6Q B;  4P9J A;  2D43 A;  1FMD 3;  4IEU A;  3E6C C;  3QLQ A;  2RMU 3;  3J9S A;  2HWE 3;  1RUC 3;  4HPK A;  2D40 A;  2JDK A;  3FL7 A;  5C3Q A;  2J1U A;  1RUE 3;  1W04 A;  2DVA A;  4PDW C;  5FQ0 B;  3OY8 A;  2ZHM A;  1DCS A;  1OD5 A;  1UY1 A;  3BPZ A;  4K8R B;  4CSW A;  4JDM A;  3T2O A;  3ACL A;  2WSV A;  4HT1 T;  5IWF A;  1YQ6 A;  2ARX A;  3K4Z A;  1NCQ A;  5H9R A;  3WNP A;  3W5M A;  1NA1 B;  2VBD A;  4XAC A;  3AXD A;  1YQ2 A;  3RFR A;  3QAC A;  3W59 A;  1K3I A;  2TEP A;  3GAL A;  4LBQ A;  1WLC A;  2D44 A;  4OHW A;  5A7W B;  3RYR A;  3T2Q A;  2Z42 A;  2J7M A;  3IAP A;  4AVA A;  2R32 A;  3THD A;  4V2W A;  2DWR A;  4AHZ A;  2O8O A;  4LKF A;  2CGO A;  4RR3 B;  2DCK A;  1FPN 1;  3HAG A;  1CX4 A;  4LIV A;  1G8W A;  1E5S A;  3ENR A;  4QX8 A;  4ZU4 A;  4EWA A;  4OFG A;  5FZ8 A;  3MV0 1;  3VUO A;  3C7O A;  1DGW X;  2WYS A;  3GZT B;  3RGB A;  4P9Y A;  3QCW A;  4L8Q A;  2VMI A;  4Z1V A;  1ENR A;  1IPK A;  1UX6 A;  3WNX A;  4NR1 A;  3VGI A;  1W3V A;  4LHK A;  5IVC A;  5IK7 A;  2P5B A;  2YUE A;  2PAK A;  2P3K A;  1ULF A;  5T55 A;  1CAX A;  4UFH A;  4H2A A;  4LO5 B;  4B1M A;  4Q4X 3;  1C8N A;  3LWC A;  3SHR A;  3AYC A;  1VP6 A;  2PHX A;  5EWS A;  5HV0 A;  1MZ6 A;  4ZY9 A;  2DYC A;  5CIR A;  1JYT A;  4XF9 A;  3VBU B;  2PN5 A;  2B9U A;  3I59 B;  4OI1 A;  4BU2 A;  1Z78 A;  5JSP A;  5FYV A;  1QDC A;  1UPI A;  1S2E A;  5D8A C;  3VBS C;  1LU2 A;  4P08 A;  4XIL A;  2WZR 2;  1Q8S A;  3KLS A;  1VB2 A;  2DV9 A;  2Z2S B;  4L0P A;  4Y4R A;  1FMD 1;  1BK1 A;  3JD7 1;  2J22 A;  4TSV A;  1BK0 A;  5GLW A;  1RIT A;  1UU6 A;  3RZH A;  1V00 A;  3ETQ A;  4FOV A;  1VBD 3;  1LKN A;  5LAT A;  5G05 L;  1J84 A;  1QQP 1;  2VUC A;  2RDQ A;  5BNP A;  2VZO A;  2X10 A;  3NKT A;  5GLT A;  1GQH A;  1UOJ A;  1W6M A;  2OII A;  4RFT 0;  4ZPI A;  2HWF 2;  3KS7 A;  3NJV A;  2W08 A;  2OPK A;  4XC9 A;  2HWC 1;  1EV1 2;  3LA3 A;  4UT5 A;  4RL7 A;  4UI9 L;  4A3X A;  1ULC A;  5IHR A;  5SV8 A;  4PJY A;  2DVD A;  4FSJ A;  4XUP A;  1KJR A;  2DVB A;  1ZZ6 A;  5FP7 A;  3ORJ A;  4QPW A;  3UGF A;  1MS1 A;  2HWB 2;  2RS1 3;  1GWM A;  3UT0 A;  4NID A;  3T0D A;  1CAW A;  2HLE A;  4AFD A;  2XH6 A;  2IWG B;  2PHL A;  3M70 A;  3WW4 A;  3SMH A;  1JYW A;  3T30 A;  3THC A;  2JIG A;  5A32 B;  1RUJ 1;  2V73 A;  4I3P A;  1JYN A;  3SEP A;  3BKZ A;  1BZW A;  4Q4X 2;  4MH0 E;  1FOD 2;  4QKF A;  4YVW A;  5A7N A;  3PUA A;  3AMQ A;  1JU4 A;  2WWS A;  4YFZ A;  3WG2 A;  4ISQ A;  5F5I A;  3B5L B;  1WLD A;  2TNF A;  2XJS A;  1YNA A;  4IES A;  2CGN A;  1NXM A;  5FYT A;  1GOF A;  4LNV A;  5LY1 A;  3NV4 A;  5FFO C;  2EIE A;  1LB2 A;  2JD9 A;  1VE0 A;  3WW1 A;  2P3J A;  4H14 A;  3DXT A;  1YHF A;  3LD8 A;  4C1W A;  4CUG A;  4LLO A;  1WW6 A;  1PGS A;  2ET7 A;  4GWJ A;  3N35 A;  4AFC A;  4BQ1 A;  4UWD A;  5ACA 2;  4W4Z A;  3CBN A;  4LLF A;  1RB8 G;  5H9P A;  1W6M B;  1GZW B;  1JOB A;  4JTN A;  2JE7 A;  2ZMK A;  1LAJ A;  2IVI B;  1ZRD A;  2EVX A;  5CBL A;  2VOT A;  4HXC A;  1DLC A;  5EPA A;  1BXH A;  1AVB A;  4A6S A;  1JZ6 A;  4QKN A;  2ZKN A;  1W6P B;  4QWN A;  4CEY A;  1G9D A;  3MDP A;  5F6L B;  3PIJ A;  1C5H A;  2UUR A;  1G9B A;  4AED C;  1IOA A;  4QX3 A;  4AWD A;  1V9U 1;  4BDV B;  3POE A;  2R07 3;  1X8M A;  3AFG A;  4KG8 A;  5F7U A;  3HD8 B;  4UF0 A;  5K7P A;  1X36 A;  3M2M A;  1WW7 A;  3PDQ A;  3H8U A;  2BPA 2;  3A7Q A;  4FT8 A;  2X5I C;  1O91 A;  2ADE A;  3GDB A;  5LA0 A;  3P6B A;  5C8C B;  4PBP A;  5L7O A;  4CXY A;  1JZ5 A;  1HRI 1;  2WSU A;  3ZKY A;  1K42 A;  1HV1 A;  2GAU A;  3CO2 A;  4COW A;  1COV 1;  1R64 A;  1VB4 A;  4CTE A;  4M0H A;  4KU8 A;  4D7Y A;  1NLQ A;  1VMJ A;  2FQP A;  2GNT A;  2WN2 A;  2D5H A;  4HSJ A;  2WFF 3;  1FOD 3;  2WNV C;  1JMU B;  5EJ1 B;  3PUS A;  2AZ5 A;  4CP9 A;  4EN7 B;  1HB4 A;  2LUW A;  3LA2 A;  5JXG A;  1JZ7 A;  3HMY A;  3MHZ A;  1O3R A;  1DGR N;  2ZBJ A;  5KC5 A;  4SLI A;  4DFS A;  2VMG A;  2Y6H A;  5I0T A;  2A6Z A;  3O5S A;  4LOT A;  3ZN6 A;  3I54 A;  2UWB A;  1LGB A;  3VBS B;  5DPN A;  4QAW A;  3RJR A;  3C2U A;  3RWK X;  3PVE A;  3DYP A;  1N1S A;  1U12 A;  3KCX A;  1PIV 1;  1XPW A;  4W6X A;  5FZO A;  3U14 A;  1LOA A;  3WW3 A;  3ZDS A;  1ONA A;  3WZ1 A;  2Y60 A;  1O5L A;  1F4H A;  2W1S A;  1RUD 1;  5GZF A;  1G6N A;  2GH8 A;  2W3J A;  2X29 A;  2JG8 C;  4NRP A;  3WDT A;  1CPN A;  2NM1 A;  3T0B A;  1VAM A;  1KJL A;  2VEC A;  3PUR A;  3ZIW A;  4BIF A;  3A21 A;  3OY8 B;  3ACG A;  3ZN5 A;  3OOX A;  2W0X A;  2AYH A;  1RGS A;  5FZL A;  1ZZ7 A;  2R49 A;  3BIW E;  1UW8 A;  1Q8V A;  2ZAA A;  2I45 A;  1JZ8 A;  3WP4 A;  2CWM A;  4AFM A;  4NWW A;  4AHX A;  1TG7 A;  3FHQ A;  4JGZ A;  4L11 A;  3E6D A;  3POB A;  1YQC A;  3H1M A;  4SBV A;  2HWD 3;  5ABJ C;  1QWR A;  3RZK A;  3MFA A;  3LA7 A;  2WA4 A;  1AYM 2;  4N90 A;  3ZPY A;  3IBM A;  2W92 A;  3ILR A;  3W5N A;  1D0H A;  4IEV A;  3E97 A;  5DUX A;  1VJ2 A;  3RSJ A;  3ES1 A;  3RZM A;  4MGT A;  3BN6 A;  1LOB A;  3O1O A;  1AL2 3;  1VBD 1;  2NQY A;  1DF0 A;  1KDK A;  1UN1 A;  2WZ8 A;  2XLF A;  4TXW A;  4BMB A;  3AL5 A;  5IFT A;  4Q4W 3;  2BYV E;  1CD3 G;  1RUF 1;  4LA3 A;  4ATE A;  4GMP 0;  3VBS A;  1UYZ A;  1GSL A;  2RVA A;  2W1U A;  1NA1 A;  1PZ8 A;  2XL7 A;  1RTV A;  4I02 A;  2GH2 A;  2W39 A;  2QQK A;  2VNO A;  1US3 A;  1AR8 2;  1QQP 3;  2ZGT A;  2J1S A;  1GMM A;  1N3P A;  2P34 A;  4HK9 A;  5D21 A;  1PMJ X;  3O12 A;  4Y5S A;  4JDO A;  1MZE A;  2CNA A;  2VD7 A;  1CPM A;  4M3C B;  5GZC A;  3ZSM A;  2CDP A;  1RUH 2;  2D6L X;  4NRO A;  2P1B A;  4Q0P A;  1OPM A;  5A33 B;  1BHG A;  1T6G C;  3RQ0 A;  3S0M A;  1LJ7 A;  1OSG A;  3ZYB A;  5D2A A;  1W3X A;  4AW7 A;  2EIC A;  2W9X A;  4QQL A;  3SIT A;  1CAV A;  2QQI A;  1NLR A;  4AQT A;  5BNO B;  2A6W A;  3I8T A;  1D4M 2;  4QHZ A;  5DG2 A;  5FXV A;  2ZGQ A;  3RZG A;  1AR8 1;  1SBD A;  2NZ9 A;  3VHO A;  1VBB 2;  1S0F A;  3WG4 A;  2H6B A;  3VBO B;  4NPL A;  3IT8 A;  1GR3 A;  4F7Z A;  3ZXD A;  3KF5 A;  2YFU A;  4QPY A;  3BU0 A;  1F2N A;  1QXP A;  2C26 A;  4HOO A;  1C5I A;  3RPQ A;  2GMP A;  4B7E A;  4N43 B;  4WVW A;  4R9A A;  3S5Q A;  4A6O A;  1UU4 A;  3U07 A;  1POV 3;  2ZS6 B;  2AR6 A;  3TN9 1;  3GCW A;  3ACF A;  1KEX A;  1AYM 3;  1V6O A;  4QPI B;  5FV3 A;  3W21 A;  4D6S A;  4IE4 A;  1DFQ A;  1J58 A;  5FZ1 A;  4CEW C;  5FY7 A;  4PBO A;  2ZGL A;  2WQ4 A;  2ZGN A;  4PF1 A;  5B2G B;  5JCT A;  5FMC A;  2RR1 3;  1ULG A;  2E63 A;  4AVT A;  5FPZ A;  2TBV A;  1K5J A;  3AKQ A;  2XHN A;  5LRS A;  1ASJ 3;  5FCC A;  4YM0 A;  3I3Q A;  5JMC A;  1I9R A;  1ZNP A;  4IE0 A;  5FY8 A;  5LBC A;  3RJ2 X;  3LDB A;  4A42 A;  3CQO A;  4RYD A;  2YB7 A;  1OH4 A;  3GGL A;  5DAW A;  1UY0 A;  5EJZ B;  1RMU 1;  4BK5 A;  1AR9 1;  1DYK A;  3WEZ A;  1PGL 1;  3H1Y A;  3OPT A;  3TRS B;  1REF A;  5LWB A;  4CDU C;  1XE8 A;  3NW4 A;  2BQP A;  1UOF A;  1TMF 3;  3G7D A;  1HB3 A;  2WT1 A;  5A3O A;  1JUI A;  4WM8 C;  3ST7 A;  5CFD C;  4TWT A;  4R8H A;  2KM2 A;  3GF6 A;  2QUO A;  4FP2 A;  5T5O A;  2IUW A;  2VOX A;  5CB7 A;  3CHX A;  3I3E A;  4L9B A;  4GJZ A;  3IDA A;  2IC1 A;  3K77 A;  1JYX A;  2XUM A;  1XXN A;  2OZJ A;  1CZT A;  4QM9 A;  3ZYJ B;  5CG9 A;  3ZDV A;  4HKO A;  4BLJ A;  5J7M A;  4F3J A;  1YWK A;  3IM0 A;  2UY8 A;  3WX5 A;  4GQ7 A;  5CEH A;  3JCI A;  3MPP G;  1H4G A;  1IZ3 A;  2RJ2 A;  3O1T A;  4AQ6 A;  4MXW A;  3VD3 A;  1QQP 2;  4V1P A;  1S0J A;  1AXY A;  3SKJ E;  5IFP A;  2RR1 2;  4ZS3 A;  4UF0 B;  5C3O A;  3ZPO A;  3T09 A;  1J3P A;  1Y9G A;  2YU1 A;  4FAG A;  1AYM 1;  4OHY A;  2OT7 A;  1IQA A;  4I09 A;  1ASJ 2;  1REE A;  2DCY A;  2XVG A;  4B8E A;  3N9P A;  4CCN A;  2D97 A;  1BKZ A;  4O61 A;  5JVV A;  3N9Q A;  4CDW C;  5J36 A;  2BRT A;  4OHV A;  2QVS B;  1JXN A;  3IAQ A;  4XAE A;  5A7O A;  2BNM A;  2ZZJ A;  5JUV A;  4QKD A;  1SPP B;  4IV1 C;  1W6P A;  4IEX A;  3NJX A;  5KHI A;  2C4X A;  1QH6 A;  4GAZ A;  3JZV A;  4O65 A;  2RV9 A;  3VKN A;  4OMC A;  1XNA A;  3C7G A;  4R52 A;  3BIE A;  4XFB A;  3OYW A;  4Q1R A;  5I8S A;  4YAR A;  4BE3 A;  2JJ6 A;  4BQX A;  4FOY A;  1OPO A;  3GHN A;  2B45 X;  1H8T C;  4LO7 A;  4XZP A;  1AZD A;  1H9P A;  1JW6 A;  1ULO A;  2NLR A;  3WG1 A;  2XML A;  2WNO A;  4NJ4 A;  5FO8 B;  3KF3 A;  3W20 A;  1GV9 A;  3VLB B;  5FYY A;  2ORZ A;  3I97 A;  4XBN A;  5FMO S;  5LB6 A;  1OVS A;  2OS2 A;  3POS A;  3N36 A;  1JOD A;  3DYO A;  3VDB A;  5J3U A;  1QJE A;  1WUV A;  5LBE A;  4AED A;  1W8U A;  2AEZ A;  2F6B A;  3WDU A;  2Q0A A;  3SNM A;  4CP1 A;  1IS6 A;  1XU2 A;  3IDB B;  4JAA A;  2PHU A;  2Z5W A;  3RYP A;  2OQ7 A;  4E8D A;  3FX3 A;  3MW2 A;  3BU7 A;  5JXI A;  1ND3 A;  3H8O A;  2W52 A;  1LHV A;  3ZOI A;  4QU2 A;  4XUT A;  5IW0 A;  1C28 A;  4CU6 A;  1H6Y A;  1OQD A;  3MIG A;  1IS5 A;  2DUR A;  2A3W A;  3MEP A;  4IEO A;  3FE5 A;  3IZO A;  4QD2 A;  4RHV 2;  2V72 A;  1UL9 A;  4I3G A;  2JEM A;  3QH7 A;  3KZ4 C;  2B42 B;  3ZFE C;  4Q2F A;  3ZSE A;  4P9L A;  4D3W A;  1VIW B;  5FZO B;  1IG3 A;  2X8K A;  1OQE A;  4OZO A;  4CVU A;  1ULD A;  1UX7 A;  1GOG A;  2D6M A;  1FV3 A;  1LEM A;  5CIS A;  1GIC A;  2J1V A;  1NY7 1;  1WMD A;  4KBB A;  5I0D A;  4NIA A;  2E32 A;  2LAL A;  1XU1 A;  4KWK A;  3WXP A;  4CEW B;  1OMI A;  5KHJ A;  5EYX A;  4D8M A;  3FFZ A;  5LK7 B;  5BXX A;  4CDW B;  1O6U A;  1SCR A;  2D6O X;  1BVV A;  4YVW C;  4GB3 2;  2VCC A;  2E7T A;  1DQ5 A;  2MEV 2;  4K20 A;  2V4V A;  2XWJ B;  4E4D X;  3WHU A;  1TEI A;  2B46 X;  4EN6 B;  4JHZ A;  4AGG A;  3GZE A;  5CFC C;  2YPJ A;  1W6N B;  5F32 A;  1AJO A;  2C5D A;  4Y22 B;  4HFS A;  2YRO A;  4LEJ A;  4XHB A;  1V70 A;  2JDA A;  1LES A;  4ZKT B;  5FJH A;  1UWW A;  1F9K A;  4Q4W 1;  5FOJ B;  1JZ4 A;  2HWE 1;  5DUV A;  1IG0 A;  5FAX A;  1UYY A;  1GZ9 A;  5JI7 A;  3K4D A;  1QHD A;  4NHX A;  4XTP A;  1AUY A;  5D1I A;  3B01 A;  3SC7 X;  2ZA9 A;  5CFD A;  3HT2 A;  5DAV A;  5FPV A;  3Q8E A;  2YC0 A;  4LE4 A;  4QXH A;  4RSU A;  2O8Q A;  1MS4 A;  4QPG C;  4D0Q A;  1HX6 A;  5EZW A;  4Q8K A;  3HOB A;  3MUZ 1;  5IYY A;  2GU9 A;  4WVZ A;  4IQP A;  2BDR A;  4CA9 A;  4CCO A;  1JYI A;  4QX0 A;  1GP6 A;  3V0B B;  1UD1 A;  3FLP A;  2RS5 3;  1DG6 A;  3GNE A;  3MW3 A;  1XBF A;  4BA6 A;  3N7K A;  1UYX A;  5F1R A;  1Y3T A;  3BCW A;  1F8V A;  2JDN A;  4JC1 A;  4JTO A;  1E57 A;  1YYN A;  2QE3 A;  3M4F A;  1FT9 A;  1PNF A;  2VMC A;  4XMI A;  3AB0 A;  1IPS A;  4AZZ A;  3RMX A;  2DVG A;  4N43 A;  1W28 A;  2WJS A;  2ZGU A;  3SIS A;  4N9H A;  2VE1 A;  5HCB A;  4XOG A;  3N9M A;  4EN9 B;  5IT6 A;  5FMB A;  3ZSL A;  5D8A B;  1S0B A;  1F35 A;  4BB3 A;  3C7H A;  4CDQ C;  4LOS A;  3WD5 A;  2R07 1;  3ZYF A;  1HJF A;  4AGV A;  5CYY A;  1DQ2 A;  2Y6F A;  4YGC A;  4CEY B;  1N1V A;  1POV 0;  1UZW A;  5FZ4 A;  4AF9 A;  3E1F 1;  1UXX X;  2FDF A;  4M4R A;  2ZX4 A;  3OPW A;  2XGX A;  4XAB A;  1PMH X;  2Q30 A;  3CMG A;  2C6S A;  3ACI A;  3E5Q A;  3VBF B;  4JX0 A;  3T1L A;  1W6O A;  3ZFF C;  2RR1 1;  2ZMN A;  4K9S A;  4MGS A;  4QB1 A;  4XUO A;  3RRD A;  5CFD B;  4K3U A;  4AI8 A;  5JMO A;  2ZX1 A;  5FZ6 A;  3TWI A;  3NVC A;  1FNY A;  3HR9 A;  2G4I A;  3NWK A;  1YI9 A;  2XVK A;  5A3W A;  1OOP B;  1VBC 2;  1MR5 A;  2Z4F A;  1OQ1 A;  4PIX A;  1IQD C;  3FMG A;  4E8C A;  1W8N A;  1RUI 3;  1Y43 B;  2RS3 1;  3BTZ A;  3WW2 A;  2DUP A;  3ALQ A;  4AE2 A;  1H1I A;  2LW8 A;  4HK8 A;  1XRU A;  3FLT A;  1HW5 A;  1JUH A;  3J7H A;  5FPA A;  4AVC A;  4EJR A;  3OGG A;  4LTA A;  1S4C A;  2IXK A;  3RMY A;  3AL6 A;  2UU8 A;  4JKL A;  2CDO A;  5GLU A;  4YG3 A;  1CES A;  1CJP A;  3A23 A;  5FPB A;  1BJQ A;  2HH9 A;  1RUN A;  2JDP A;  2NMN A;  2ZKL A;  2VBP A;  2YYO A;  1R08 3;  4LBO A;  2W94 A;  1I5P A;  2XKP A;  1VBB 1;  1BEV 1;  4D7T A;  3DN7 A;  4MGZ E;  2ZEW A;  3MYX A;  1KD7 A;  1O4T A;  4XJ8 A;  4DEQ A;  2L9L A;  1T6B X;  1NE4 A;  3F2Z A;  4XDO A;  5FUI A;  3VBF A;  3HIF A;  3KT4 A;  1DQ6 A;  1V6M A;  1G7Y A;  2ZGS A;  4YSF A;  3WDX A;  2YXS A;  5DAB A;  4AVV A;  1V6I A;  1T2X A;  2VNV A;  4PQQ A;  3AZW A;  4DPN A;  1B35 A;  4MHU A;  4ZU5 A;  3ZFG B;  1UZV A;  3ZN6 B;  3ZR6 A;  1LOE A;  3MLJ A;  4HL0 A;  1RUG 3;  1QJZ A;  1PO2 2;  4OI2 A;  1E5H A;  2QFE A;  1RVF 3;  2OZ6 A;  1A34 A;  1H0B A;  3OEB A;  4V2V A;  4C0H A;  1QH7 A;  2XPJ A;  2CY6 A;  1Z7S 1;  5FLI A;  4BXF A;  2JG8 A;  1SFN A;  3R4D B;  4Q4V 1;  2CWS A;  3BOW A;  3CL1 A;  4Q1P A;  4D7S A;  2RG4 A;  2B9V A;  2ARB A;  1S2K A;  1UOB A;  2JWP A;  5HCA A;  5IAT A;  2BER A;  1R09 3;  2BBA A;  2XUE A;  2VQ0 A;  1PK6 C;  4YM2 A;  3AJY A;  4AEK A;  4RHV 3;  2WII B;  5H9Q A;  1OLM A;  1QJX 2;  1UY2 A;  2HWC 3;  5L9B A;  2XJP A;  3KT7 A;  3IDC B;  5EP9 A;  4ASL A;  1GQG A;  4XBQ A;  5C8W A;  4XJU A;  5HXV A;  5F3C A;  3PUQ A;  3NNL A;  5J1X A;  3Q8A A;  2IXI A;  4AXO A;  3WQ0 A;  1YC6 1;  2GNB A;  4OLL A;  1LR5 A;  1FPN 3;  1RUE 2;  4PIY A;  1H30 A;  2FCU A;  1DQ1 A;  1LCL A;  2NPI A;  1I1E A;  1WCK A;  1D7P M;  1BQP A;  1NZC A;  4Q5O A;  1MQT A;  3NAP A;  4QMA A;  3LAG A;  5JXH A;  4AFA A;  1KRI A;  1RUF 3;  3LQC A;  4W65 A;  3JB4 C;  4LHL A;  3H9A A;  4FPL A;  3J8F 1;  2WL1 A;  1QKQ A;  2BNO A;  4AQ2 A;  1OFS A;  3T08 A;  4QDQ A;  1YIP A;  2W1Q A;  4YGE A;  2D6P A;  1FXZ A;  4AED B;  1RIR A;  4U2A A;  4BQ3 A;  5C6C A;  4Y1Z A;  1ASJ 1;  5G04 L;  3H42 B;  5BNQ A;  3ZYP A;  1GNZ A;  1HLC A;  1KDM A;  2PQS A;  2VZP A;  4XF4 A;  1H2L A;  1QOS A;  1WCU A;  3AK0 A;  2HWB 3;  2NMO A;  4N8M A;  3PU3 A;  1ND3 B;  4XXA A;  3T0A A;  4A44 A;  3CZJ A;  5C9A C;  2ETE A;  4LBJ A;  4FAH A;  5DAQ A;  3NQH A;  5FTT C;  2GC1 A;  2QQN A;  3R05 A;  3K48 A;  5C3R A;  5BNO A;  1HB2 A;  1W6N A;  4C1X A;  4QXC A;  2BP6 A;  3B69 A;  2QBX A;  1YUD A;  5FP8 A;  4A7Y A;  1WMX A;  3I49 A;  2GME A;  2QQM A;  3AJZ A;  2QQV A;  3O14 A;  2WO1 A;  3DEC A;  1V9U 3;  2WWU A;  5F3G A;  1AX1 A;  5FYU A;  4DUX A;  2K2S A;  4MYE A;  1C57 A;  3TN9 2;  1ZA4 A;  2BZD A;  5JOY A;  1JS9 A;  1ZX5 A;  4YW5 A;  1VBA 3;  2VH9 A;  4OHZ A;  4QPI C;  4NHM A;  2YC2 A;  1Z7S 2;  4L97 A;  4DXR A;  1MAC A;  1GZW A;  2ES3 A;  3MPB A;  5ANQ A;  1EPZ A;  2PHW A;  3I2J A;  1HV0 A;  1AJK A;  1W9Y A;  4K6B A;  4L2N A;  3V0B A;  1NQD A;  5T5J A;  1LU1 A;  3DYM A;  4IEP A;  2Q5T A;  3MIB A;  2CAV A;  5DZF A;  2PHT A;  3ZFF B;  3WHT A;  3HT1 A;  3VDA A;  5FZD A;  1GP4 A;  1XYN A;  1VMH A;  4AL9 A;  3V0A B;  2WR9 A;  4RGG A;  1S0C A;  3WF4 A;  3NJZ A;  3NL1 A;  4NE9 A;  3ZSK A;  5LW9 A;  1RIN A;  2GAL A;  3PU8 A;  1BBT 1;  2IXC A;  4PCR A;  5L9R A;  5FP9 A;  3MIF A;  4KU7 A;  5A80 A;  1VBD 2;  5KWR A;  2HBU A;  2Y26 A;  4XUN A;  3TNQ A;  4BYY A;  4CUC A;  1W0P A;  3N7L A;  2JB4 A;  1NUK A;  3AZV A;  1J1T A;  5GAL A;  5DAP A;  1SLB A;  1ZRR A;  2N7G A;  1VBC 3;  5FY5 A;  5T3N A;  1BLZ A;  4HVR A;  4E4H A;  2JG9 C;  4AK3 A;  5A3T A;  1EV1 3;  5BNP C;  1QJX 3;  1FYU A;  2HYX A;  3ZKU A;  4MGQ A;  4DXT A;  4YFW A;  4LT5 A;  3C3V A;  4CCK A;  4TLG A;  2OVU A;  2W95 A;  1K45 A;  5LA2 A;  4COZ A;  1TME 2;  2FDG A;  5JPN B;  5K8S A;  3FBY A;  4FFH A;  4QDS A;  3W58 A;  3Q8B A;  5ANN A;  5B4X A;  1O3Q A;  3WUC A;  1V9U 2;  5F2S A;  4LBM A;  4IE6 A;  1AR6 1;  5D8A A;  3NNJ A;  2A6Y A;  2F17 A;  2AC1 A;  2BUK A;  1VBA 2;  1HXS 3;  5FYB A;  4YZ2 A;  5JZG B;  3O1R A;  4FQZ A;  3HQR A;  4DMI A;  3KQR A;  2FBE A;  4IE7 A;  2Y6G A;  1GP5 A;  3ZYI B;  4MUV A;  3VL9 A;  5M0T A;  2QQU A;  2AH2 A;  5C5U A;  1LOC A;  1WBF A;  3MIE A;  3ZXG A;  1QEX A;  4CEW A;  1U5Z A;  2DFB A;  4KWJ A;  5IK4 A;  5HV4 A;  5LZ6 A;  4EN0 A;  5FPL A;  1MS5 A;  4PLN A;  3BI3 A;  5JOX A;  4Q0Q A;  2O1Q A;  3WVJ A;  3AMH A;  5FRA A;  4DQA A;  1QJU 3;  2D98 A;  3EXU A;  4YZ1 A;  4QXK A;  3LIH A;  2JEN A;  1W90 A;  1W2A X;  1XNC A;  1LGC A;  3JD7 2;  3TEX A;  5K9Y A;  5EJ3 A;  1ZM1 A;  4MAD A;  3QD6 A;  3O7O A;  1IKP A;  4S2H A;  1A3K A;  2RDR A;  4XPV A;  3BTY A;  3FFQ A;  4IEQ A;  4Q4X 1;  5KC6 A;  1RUG 2;  3BYW A;  4NHK A;  1OVP A;  1QJU 1;  1TNR A;  2VVF A;  2ZPX A;  2JE8 A;  4HG6 B;  3KGZ A;  4P9W A;  4Q29 A;  5JOW A;  3K46 A;  1YCI A;  2D3P A;  3K2O A;  2NP0 A;  1B09 A;  5FMD A;  4CCM A;  3Q9O A;  1PK6 B;  1ZBA 1;  2EXJ A;  5JIA A;  2YC4 A;  5A3U A;  4HKL A;  3PIG A;  4CCD A;  5KXC A;  1JZ3 A;  4RS5 B;  1YQ8 A;  4TLF A;  4TZD A;  2NYY A;  2PHD A;  3S7I A;  4Z92 B;  3D5O A;  2IXJ A;  2VME A;  1CAU B;  2GDF A;  5FYI A;  1GBG A;  3U10 A;  1NCQ C;  5DZE A;  1OT5 A;  4Q4W 2;  2W47 A;  4HN1 A;  1Z7S 3;  2XON A;  4CE8 A;  4HBN A;  2QZ2 A;  2ZX2 A;  3MIH A;  3MO4 A;  2FZ2 A;  4C91 A;  3WF0 A;  5AC9 3;  1LEC A;  1COV 2;  4MZU A;  5IVY A;  3UGH A;  2A6X A;  1RUG 1;  4YVS C;  4LO6 B;  3MW4 A;  4M0N A;  2DUQ A;  2Z79 A;  3AZX A;  2HWB 1;  2A7A A;  1WW5 A;  2IVJ A;  3AVS A;  3E5U A;  4MGY E;  4QQP A;  5A3M A;  3CF6 E;  1SHW B;  4CPB D;  3WOG A;  3ZMN A;  2UYA A;  1DGR A;  2VUJ A;  3J26 N;  2FZ1 A;  2JB8 A;  1GZC A;  2ERF A;  4IND A;  2Y64 A;  4XFG A;  4GD4 A;  2BGO A;  2XG3 A;  4XF1 A;  4Y1V A;  5GKA C;  1VBC 1;  3IN9 A;  3WNN A;  2WNU C;  4AHY A;  4C8D A;  3NJY A;  1S0E A;  5JR7 B;  2B39 A;  4YZ4 A;  4DEV A;  5LRR A;  2ADD A;  5DG1 A;  1GAN A;  1NG0 A;  1OF3 A;  3LOI A;  2ZX3 A;  4GXL A;  4EQV A;  1RED A;  2G9F A;  3JBG 2;  4HAN A;  1ND2 A;  2D3S A;  4M3C F;  4COY A;  1MEC 2;  4LOR A;  3PUI A;  1C1F A;  2E31 A;  4QQO A;  2G19 A;  2Y33 A;  1FMD 2;  4CCL A;  5CFC A;  3FBM A;  1V6L A;  3AMN A;  3UNP A;  3MID A;  3LEI A;  2R30 A;  3N9N A;  5C33 A;  1HXS 2;  1VAV A;  4XF0 A;  1CWP A;  4XFH A;  3V56 A;  3MBW A;  1QGL A;  1MZ5 A;  3N4M A;  4FVV A;  5FZI A;  4BQ5 A;  3EJK A;  3WQB A;  4NOT A;  1RXF A;  2XR4 A;  2P2K A;  5FRE A;  5DMY A;  2QQL A;  5ABJ B;  4ONU A;  2VW2 A;  2ZAH A;  3W9A A;  4UAP A;  1MVE A;  4XVH A;  1OKQ A;  2J42 A;  4XJW A;  1QJU 2;  2SBA A;  5E89 A;  3HVD A;  3VBU A;  1ZZB A;  5L36 A;  1AYN 3;  4LK6 A;  4DS0 A;  2WBK A;  5EV7 A;  3K75 B;  1NYW A;  1W8O A;  1EV1 1;  2LS6 A;  1MS8 A;  2UWA A;  3HNY M;  3INA A;  1Q43 A;  1Q8P A;  2WAA A;  2ZTN A;  4HON A;  2W91 A;  3BAL A;  3ELN A;  5H9S A;  4BIO A;  1NCR B;  5C7G A;  1NOV A;  2WLQ A;  2RHP A;  2VTX A;  1LUL A;  4QB6 A;  1VAL A;  3AYE A;  1ZBA 2;  3J7L A;  1KFX L;  2E9Q A;  4AVB A;  2RMU 1;  1UIJ A;  1RUH 3;  2ATF A;  2WT0 A;  4XBL A;  4QDR A;  2LTN A;  2VG9 A;  2WNU B;  3PTY A;  4Z07 A;  3KB5 A;  1MVQ A;  3VBH A;  5CFC B;  1LRH A;  4D6Q A;  3PJY A;  4LHS A;  2W46 A;  4FPF A;  3ZXA C;  2H6C A;  2O14 A;  2K46 A;  3PNA A;  4FPC A;  2GNM A;  4Y1Y A;  3LOB A;  2HEV F;  1KGY A;  2OA2 A;  4LPL A;  1RUC 1;  5F9T A;  4LUL A;  4Y3O A;  4JVA A;  2YZ4 A;  4JHT A;  1OA2 A;  4CEY C;  1RMU 3;  5AC9 2;  4QKB A;  5FLJ A;  1JN2 P;  4P00 B;  4KWU A;  3OPZ A;  4MXV A;  3AMM A;  1W9S A;  1S1A A;  3CJX A;  3WNM A;  2R04 1;  4QPG B;  1F5F A;  4FOQ A;  1W6O B;  1GUI A;  2PHR A;  3I3M A;  3BGA A;  5FZA A;  1SMV A;  3S5A A;  4E4S A;  5C70 A;  2E7Q A;  2BW8 A;  2IXH A;  1TVG A;  3C8X A;  2MHF A;  3USU A;  2I74 A;  1OOP A;  2JIJ A;  1OXC A;  4IGQ A;  4CCJ A;  1DZR A;  4DXZ A;  4ERO A;  4OCT A;  1POQ A;  1RUJ 2;  1Y7B A;  3ITQ A;  1UQX A;  3FC0 A;  2QQO A;  1C4R A;  1AYN 2;  2VBB A;  1W8F A;  3JBG 3;  4BOW A;  3OYW B;  3X29 B;  4Q0V A;  1US2 A;  1D4M 3;  1ZA7 A;  2GC2 A;  2GSY A;  2JDM A;  3KT1 A;  5GZD A;  1GQP A;  1RVF 1;  3VBH B;  1FNZ A;  1SQ4 A;  3WP5 A;  1AX0 A;  3AVR A;  2VZV A;  3AM2 A;  1RHI 1;  2CGP A;  3H7Y A;  4B4Q A;  5FPU A;  4B1L A;  4EZ4 A;  4YG6 A;  2PAM A;  2E33 A;  5CKM A;  3H1W A;  3U1X A;  4CPB A;  2AEN A;  3ZXJ A;  1DZQ A;  4JZR A;  4XQD A;  4XFF A;  3WP6 A;  3LIG A;  4CUA A;  3VBR C;  4XDP A;  3MIC A;  4WM8 A;  4PLO A;  2O0O A;  1QIQ A;  1GYK A;  1J3Q A;  2PMW B;  4QQH A;  3BOD A;  1UZZ A;  1L7R A;  3LPF A;  1PO2 3;  3VDD A;  4CDU A;  4LO4 B;  1FV2 A;  1RL3 A;  4OUM A;  4AI3 A;  4XEZ A;  2WUH A;  5GM0 A;  5BV6 A;  3KV6 A;  5E6H A;  4QU1 A;  3O1M A;  1HDK A;  1YXW A;  5DZG A;  1RUI 1;  2RS3 3;  3TAY A;  2Y34 A;  5IVB A;  1S0I A;  1JHJ A;  1SCS A;  4YVS A;  1I5Z A;  5A1F A;  5F8P A;  3RG0 A;  1WCS A;  1W2N A;  3B94 A;  2QQW A;  3I7D A;  1R09 2;  4Y33 A;  4HZF A;  3FUQ A;  4WM7 B;  5IAX A;  5KXE A;  4ZHN A;  1DGW A;  1AF9 A;  2E26 A;  4ITC A;  1X8E A;  4UW5 A;  5DN2 A;  1KIT A;  4BQY A;  2BJS A;  1EY2 A;  2EIB A;  1YO8 A;  3CJI C;  1DLL A;  3I2D A;  4LA2 A;  3DKQ A;  3IMM A;  1VAK A;  4FCA A;  4FFF A;  2VUD A;  1W39 A;  5A7Q A;  4N7U A;  4O9G A;  1GNY A;  1AR7 3;  2VZS A;  1VR3 A;  3VHN A;  2ZEZ A;  3DV8 A;  2HEY F;  2ZZQ A;  5HPO A;  4BWO A;  1J83 A;  2IZW A;  1SLL A;  4RN5 A;  4XAA A;  4YPJ A;  3GHM A;  3USS A;  4OUS A;  3LKJ A;  1RMU 2;  4RFR B;  2VW0 A;  3S6P A;  4ZS2 A;  1A8D A;  1GWL A;  2P37 A;  2QNK A;  3DPR A;  4UOJ A;  3O0X A;  1HRV 1;  4FBF A;  3GBG A;  4YZ5 A;  2F4L A;  5KXB A;  1HKD A;  3HWJ A;  3OGR A;  5DUW A;  1UCX A;  1YJL A;  1SLT A;  2UWC A;  2VU9 A;  5FYH A;  1CAU A;  1ENX A;  1KQR A;  3WLU A;  5I8T A;  3AP4 A;  2H0V A;  4RQP B;  1OHF A;  5A6X A;  2ENR A;  3MLK A;  1N3Q A;  1VBA 1;  3ES4 A;  2WN3 A;  2KXL A;  3KVB A;  3LGR A;  4W8J A;  5FYC A;  3O0W A;  1IS4 A;  4N9I A;  4Z82 A;  1XNK A;  2R1D A;  4YNI A;  3KSC A;  5CZK A;  1BCX A;  3U4S A;  1CAX B;  4EV0 A;  1JZ2 A;  3OJB A;  1WZX A;  3TB0 A;  1GOH A;  4N43 C;  5FLH A;  2WIN B;  4ASK A;  2IFW A;  4UFM A;  2BWC A;  2G1M A;  4ASM B;  1R1Z A;  1PO2 1;  2VPV A;  1F5J A;  1C3H A;  2WZP P;  5DQ0 A;  2C9A A;  5JSO A;  1HQW A;  5FZ3 A;  1UAI A;  2FHR A;  3ECQ A;  3SCG A;  2HJI A;  4FPJ A;  2HKX A;  1V0A A;  1IKQ A;  2FCT A;  2WKK A;  3P1I A;  5FZF A;  2JG9 A;  4AYU A;  3TEZ A;  1PZ9 A;  4C0B A;  2JDH A;  3MGU A;  3AYA A;  3DPR B;  1OA3 A;  2OPW A;  3M3O A;  2VJX A;  4K1Z A;  5FBZ A;  5FZE A;  4AI0 A;  4CXW A;  5ABJ A;  2VZU A;  1O59 A;  5EXO A;  1ZYB A;  4FQ4 A;  1WA4 A;  3KV5 A;  3K51 A;  1Q56 A;  1Y9M A;  2MEV 3;  4NMI A;  5T5L A;  3KMH A;  3M3I A;  2V09 A;  3PL0 A;  4CRQ A;  1OLM E;  4HET A;  4DRR A;  4YVW B;  1OUR A;  1ENQ A;  2VZ3 A;  4YZ3 A;  2RDN A;  1PIV 2;  2EXI A;  3IPV A;  4FPH A;  5BUV A;  4H55 A;  2DU0 A;  3VBO C;  4QGL A;  4YW3 A;  4NIG A;  1H8T B;  4GZ9 A;  3AYD A;  3KQ4 B;  4P9I A;  3URF A;  3CKH A;  3V0A A;  3VD4 A;  4H7M A;  5F6K A;  3D0S A;  1QJY 2;  1WCQ A;  4YWA A;  4GWN A;  4Y4Y A;  1AR7 1;  1S55 A;  4QX1 A;  1QMJ A;  2WZE A;  4RQP C;  1XNB A;  3ZXF A;  1W2O A;  4F83 A;  3VB9 A;  4QPI A;  3U37 A;  3UKT A;  5FP4 A;  4LBQ D;  1PVC 1;  5GLZ A;  3WQ1 A;  1G86 A;  4O9E A;  5F5Q A;  3WDV A;  1TNF A;  3WUD A;  3ZXK A;  5HCF A;  4DUV A;  3UJO A;  4D94 A;  3I2G A;  3H3U A;  4PT6 A;  4XET A;  4AAX A;  1RUC 2;  4XJZ A;  4YW1 A;  2WNE A;  3L2Y A;  2EID A;  3CLP A;  5FZ0 A;  5FZC A;  3VDC A;  4AHW A;  2I2S A;  1WA6 X;  2R0F A;  5C8C C;  3SH4 A;  3SH3 A;  2QQP A;  4RS5 C;  5C71 A;  1KFU L;  1W9T A;  4NO4 A;  2PXJ A;  3VD5 A;  2VVE A;  4AOC A;  2BEO A;  1ULP A;  1VLN A;  3DF0 A;  1J1L A;  3OGS A;  2ARE A;  1NKG A;  1SFY A;  3KCC A;  3POF A;  5L7O B;  5FO7 B;  3ZYG A;  4Q0S A;  3K3O A;  2K0G A;  3UYJ A;  1WWY A;  4QGM A;  5K4L A;  5LAS A;  2UY9 A;  3RZJ A;  3VBH C;  4DIN B;  3PJQ A;  2XWB B;  5JWP A;  1DHK B;  4LIU A;  1XNT A;  4BZ4 A;  2XB6 C;  1RVF 2;  3IWZ A;  4Y20 B;  1W6Q A;  2BGP A;  1L7L A;  4Q26 A;  5A1A A;  3ILF A;  5JPM B;  2WFP A;  1DDL A;  5J98 B;  1S0G A;  4E2Q A;  2TUN A;  1R08 1;  1RHI 3;  4XQW A;  2D93 A;  4XTM A;  1W05 A;  3JQW A;  4XDQ A;  4RS5 A;  3ZR5 A;  3WP3 A;  4XE9 A;  5C8C A;  3RNS A;  2PA7 A;  2EA7 A;  3OBT A;  5FXZ A;  4MV2 A;  3HQU A;  3SKV A;  5GZG A;  3DGT A;  1H1M A;  3LDR A;  4YW7 A;  1NCQ B;  3DCQ A;  3HPN A;  4WM7 C;  2HWD 1;  5F3E A;  1UOG A;  2VCA A;  2HWC 2;  2P6C A;  3KV4 A;  2YBP A;  1E5R A;  5J96 B;  1YQ5 A;  2HWF 1;  2ZGM A;  4PIZ A;  1VRH 2;  1NQJ A;  4G4F A;  2Y6J A;  4XHX A;  1Z0H A;  3E6B A;  5LK5 A;  4KI5 M;  3K3N A;  1PK6 A;  4GWI A;  3AP9 A;  3D8C A;  1POV 1;  2YV8 A;  2W68 A;  3RS6 A;  2JX9 A;  3LFI A;  2ZGP A;  4D6R A;  3POG A;  4AI1 A;  1ZRI A;  4FXK B;  1XSQ A;  3MF6 A;  1MQT B;  3NAP B;  3UGG A;  4BXS V;  1XB9 A;  3GXU A;  1HQL A;  3WDW A;  5IK5 A;  2B5H A;  3GCX A;  2VUA A;  5FXX A;  5IJR A;  2XOM A;  3DEM A;  2R04 3;  4RA0 A;  1U5I A;  2VMH A;  3H50 A;  2Z69 A;  4FTE A;  3III A;  2YBS A;  5JZG C;  4YVS B;  2Q4S A;  2R06 3;  4MO3 M;  1QU0 A;  4BQ2 A;  1JOJ A;  1ND2 B;  4ISR A;  1EYB A;  1DU3 D;  3ZO0 B;  4AAP A;  4MHR A;  2A71 A;  1DQ4 A;  3HBZ A;  1QJY 3;  2ZOE B;  1WW4 A;  2ET1 A;  2YBK A;  4HMZ A;  1EAH 2;  3Q8F A;  1M06 G;  1FI2 A;  4Q27 A;  4OHX A;  2A5Z A;  2Q8E A;  1WCD J;  2WS9 3;  5BY5 A;  1GZT A;  2GND A;  5JR2 A;  3SQO A;  3VBF C;  1AYN 1;  3EBR A;  4Z2A A;  5C3S A;  5JSR A;  3THP A;  1K12 A;  4XIO A;  3VL8 A;  2VO5 A;  3J8F 3;  2MEV 1;  1Y4W A;  3J4U H;  3PTR B;  3H8R A;  1QJF A;  3GBF A;  1F4A A;  1LHO A;  1QY4 A;  3OGV A;  4ZZ8 A;  5FWJ A;  2DTW A;  1H2N A;  4LKD A;  1GWK A;  2QKD A;  4F8A A;  2WQ8 A;  4RR3 C;  1H8V A;  3LSE A;  3LE0 A;  1UIK A;  3DL3 A;  3AXE A;  1A8M A;  2RM2 2;  1BMV 1;  3GJB A;  1OFN A;  3O1P A;  2XBO 1;  5BPX A;  3TYJ A;  3ZVX A;  3O1S A;  2PLV 2;  5CVR A;  4ZXK A;  3D3A A;  4OI0 A;  4IEZ A;  1O5U A;  2DVF A;  2ILM A;  4XUQ A;  3VBO A;  5JDB A;  4CU9 A;  2A1X A;  5CU1 A;  2GC0 A;  4WVM B;  4UFK A;  4COV A;  5CKN A;  4JGY B;  4YGD A;  5JAX A;  5KXD A;  4OUE A;  2JXA A;  1O8P A;  1NCR C;  1SLA A;  2EF6 A;  3A22 A;  3MLL A;  4M3C A;  1V6J A;  2YMZ A;  4TYS A;  2W87 A;  1BVP 1;  4YG0 A;  4Q4Y 1;  4WZF A;  5F2W A;  1XQN A;  4W6Y A;  5A33 A;  1ZRC A;  4IEW A;  4L92 A;  5B4N A;  1A6C A;  1RUD 3;  1CX1 A;  5FZ7 A;  1SAC A;  3R4S A;  1L3J A;  1SLC A;  5K0U C;  5T5P A;  3RZL A;  3FJS A;  2D6K A;  2LRP A;  4GIQ A;  1QOT A;  2Y0I A;  3J7M A;  3H3L A;  3BOP A;  3VD7 A;  2JE9 A;  2R07 2;  1O8S A;  4CDX C;  1LOG A;  1NCR A;  1U5Y A;  4M3C E;  5FXW A;  3HNB M;  3DKW A;  3ZYH A;  3VKM A;  2K9Z A;  2D7F A;  2RJK A;  1PGW 1;  4PF5 A;  5AVP A;  3ZFG C;  1IHM A;  2Q8O A;  2OXB A;  4D69 A;  4MG2 A;  3VZL A;  1K5M B;  4LO8 A; 
#chains in the Genus database with same CATH homology
 1JOB A;  1JOD A;  1ZRI A;  1F35 A;  1JYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...