1F35A

Crystal structure of murine olfactory marker protein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
162
structure length
162
Chain Sequence
AEDGPQKQQLEMPLVLDQDLTQQMRLRVESLKQRGEKKQDGEKLIRPAESVYRLDFIQQQKLQFDHWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPAAIFWRKEDSDAMDWNEADALEFGERLSDLAKIRKVMYFLITFGEGVEPANLKASVVFNQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords OLFACTORY MARKER PROTEIN
publication title The crystal structure of the olfactory marker protein at 2.3 A resolution.
pubmed doi rcsb
source organism Mus musculus
total genus 36
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06554 Olfactory_mark Olfactory marker protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.390 Mainly Beta Sandwich Jelly Rolls Olfactory marker 1f35A00
1ZRIA 1F35A 1JODA 1JYTA 1JOBA
chains in the Genus database with same CATH superfamily
2RDNA 1V6MA 5FCCA 4CDWC 5K8SA 3QLQA 4EV0A 2Q5TA 3K46A 5K0UB 1MS4A 5ISLA 3WNPA 3V0BB 1AR63 1RUE2 4PHZA 2NM1A 1X36A 2O14A 2QTWB 4XQDA 3PIGA 1PZ7A 2BRTA 2W94A 4OHXA 3QOPA 3UESA 1NCRB 2CYFA 2DVAA 2D5FA 4AZZA 4DIQA 2WNVB 2W9XA 4XAEA 4C90A 5KHIA 3AZVA 2IXLA 2LS6A 2V4AA 1JZ6A 5FZ8A 2CGNA 3USUB 3AMHA 2J1EA 2ZX4A 2C9KA 2J1RA 4LPLA 2V4VA 4A45A 3NV4A 1CAWA 2ARAA 4Q2FA 3CJIB 1YFYA 2K9ZA 3MW4A 1N3OA 3ZDSA 4PCRA 3N35A 4FI9A 4AR2A 2F4LA 3VZKA 4GWMA 4NIAA 1RUC3 4Q4W1 1JZ8A 1BBT3 3RFRA 4MGSA 2ZX1A 2HWD2 1JZ7A 1XYOA 1MZEA 2JE8A 2BFUS 1NY71 2V09A 1LEMA 5AC91 2ZMNA 1LR5A 4AYUA 1LHWA 5KR7A 1C1LA 5C5TA 4QB1A 4D8MA 5LB6A 2D6NA 4GMP1 4E2SA 4XUQA 2W08A 2R0FA 5FYZA 3SMHA 3B00A 3WP5A 2G9FA 3KSCA 5C4WC 3B93A 2P1BA 3B02A 3W20A 4LBQB 2QZ2A 4ASMB 5IFTA 3ZSLA 4DO0A 5KHJA 3ZIWA 2ZAHA 2BUKA 4LO8A 4BQYA 1PIV3 4K6BA 4I3PA 2WN2A 1WD4A 2WAAA 2ZX0A 4TN7A 3CKHA 3QBQA 1F4HA 1MQTC 3NNFA 4S2DA 1DBNA 4FBFA 1JOJA 2BZDA 5I93A 3WX5A 5SV8A 4IE0A 5LY2A 3OD4A 2P3IA 3S0MA 4Z8BA 4XDQA 3K3OA 1CZVA 2D3RA 2VZPA 2VL4A 3PUIA 3T0AA 4E27A 3LSDA 4M3CF 1UN1A 1W8TA 4HMZA 1YQCA 2ZA9A 3MICA 3VGIA 3N9QA 3NL1A 4K8RB 3WDYA 5I8SA 2JECA 4R9CA 1LECA 2Y6FA 1PZ9A 1QJFA 2LROA 4I02A 5BNNC 2YBKA 1N1SA 3RPQA 3KGZA 1H1AA 5AVAA 5JMCA 1W8ZA 2BGCA 3VBFA 4Y5TA 1E5RA 4DY3A 2B9VA 3C7EA 5DUXA 2GSYA 3BU0A 1KFUL 2DCYA 2ARBA 3APBA 5ERLA 3S57A 3PLQA 4FPJA 4UF0A 4NHKA 2ARXA 3IMNA 1FV2A 4PIZA 4K8FA 3H3LA 3AP6A 4QQ2A 5F5CA 1H0BA 3B3QE 4HK8A 4FXGB 4Q29A 1IOAA 1X50A 3DUIA 4NAMA 1UZVA 3FUQA 4SBVA 1W2AX 5EZWA 2EXHA 4HVQA 1LOEA 3WF1A 4S2GA 5JLVA 3KM5A 1UZYA 1GWLA 1AR62 1DLLA 2VG9A 4W6WA 1NCRC 2LUWA 5A3UA 4NIHA 3OBTA 2DVGA 4RSUA 2YYOA 4URTA 3KCCA 4MGTA 5KHHA 2P3KA 5FZMA 3N4MA 1LU2A 1OC1A 4Y20A 3U0ZA 3I2KA 4ZU4A 1JODA 2MNGA 1H9PA 4GALA 3U11A 2JX9A 3Q8FA 3LA7A 4OHWA 4LHSA 1OKQA 3AJZA 4P9GA 4AGRA 1E5HA 4XHBA 2FZ1A 1G86A 2FHRA 4GH4A 2DF7A 5BV6A 5F3IA 4AEDB 4B1LA 1JYIA 4YGEA 2CSGA 1BQPA 1UYYA 1HJFA 2JG9B 2UYBA 4XXPA 1C5IA 1W6MA 2BU9A 2CTVA 1NZIA 1XYNA 4CDWA 5FWEA 2QE3A 2QQIA 1RUC2 3QCWA 1GYKA 4NR1A 2G19A 4NN0A 1BBT2 1V9U3 1E57A 4CCOA 3I49A 2H0BA 2B39A 5BXXA 3RZMA 3T1MA 3ENRA 1OXCA 3WQ0A 1A3KA 1APNA 1LHUA 1CIYA 1SACA 3PUQA 4QX1A 5I0DA 2EALA 1D0HA 1FYUA 3A23A 3BODA 5FO9B 5FFOC 2TUNA 5HCHA 1PO11 5A33A 2ZGKA 1KITA 1LTEA 2WC2A 3FMGA 3AKRA 4PIYA 5DG1A 3RJRA 1ZYBA 3L2HA 1PVXA 2OVUA 3H9AA 1HN1A 2W5FA 4LK7A 3PJQA 4Q0UA 4KG0A 1Q5OA 3AYDA 2Q8DA 3GM8A 2OKXA 1RUOA 3W5NA 1PIV2 4GMP0 3WCSA 3ZOIA 4RS5B 3LOBA 1IQAA 1T2XA 1STMA 3GJBA 3LIGA 4GWJA 1DQ2A 1NYWA 4EWDA 1K42A 5B4XA 2AR6A 2R1DA 4HFSA 4A2UA 2W2IA 5FDBA 1OI6A 4I01A 1XU1A 3GNEA 2A3WA 2WS93 2PXJA 1O3SA 2PHDA 2A6YA 1QY4A 4JGZB 1QNWA 2JG8B 2Y6LA 3ZPYA 2CV6A 4R4XA 2GNBA 5DAXA 4YVWB 5A3PA 5BNOB 2YC4A 2DWRA 4ZONA 1GBGA 4NO4A 4XBQA 3NJXA 1RL3A 3VBSC 1FMD1 2RM21 3V56A 1WBLA 3WW3A 2XLGA 5LY1A 4XW3A 3U1XA 2IXIA 3VHPA 3O1MA 4XIOA 3RVHA 3HT1A 4HKOA 4XFGA 4OMDA 3JB4C 3RWNA 2KA3A 5K7PA 4AFCA 4S2HA 1AYM1 4ONUA 3AXDA 4G3YC 1VBB3 3OJBA 3WY6A 4LT5A 3WXPA 2WNUA 5FYSA 4COYA 5T54A 2HYXA 3MIBA 4YZ3A 1K45A 1PK6B 5GJ6A 3RJ2X 5JXGA 1DYPA 4HKLA 1XOYA 3GJAA 5F39A 3LIHA 1GNYA 2DCKA 1AL23 2XL9A 3K51A 3WG3A 3AVSA 2VH9A 3MW2A 2P3YA 4GB31 1NY72 2QZ3A 4DOUA 4AEMA 4OLLA 3IPVB 3GDBA 1O8SA 5IVJA 1H4HA 3D3AA 5SV5A 3O1VA 4QB6A 5IK4A 1N3QA 5JI9A 3AB0A 1PO13 3LDRA 5F6KA 2VVFA 5B4NA 1QDCA 2WO3A 3VZJA 4QGNA 2CAUA 2WUHA 2VMIA 3EBRA 1GFF2 2JDYA 3DPRA 5IFPA 4LO4B 3ZM8A 1CAVA 1GU3A 1W3VA 1LOGA 4IEPA 1KS5A 3JU9A 4JX0A 4NJ4A 3ZKYA 4YGCA 1AR73 4RGKA 2FZ2A 2JG9C 1ENXA 2QQWA 5FK7A 1HQNA 4GJYA 1RIRA 2JIJA 5HV0A 4RQPA 5LK7B 2VGDA 3LE0A 2QQVA 1W3XA 3WNXA 1HV1A 2UURA 1WW6A 1RUH1 2A7AA 4XPVA 2PHRA 3FWEA 1LOAA 3KQ4B 3VL9A 2ES3A 3TEZA 2XUMA 3IDAA 2P34A 5GZGA 1GICA 1GWKA 3EB7A 3WHUA 4HSJA 2R49A 3ILRA 1OPMA 4F7ZA 3G6JB 1KJLA 3GZUC 2D43A 2JDNA 4I30A 2OUHA 4P02B 1TE1B 3M3QA 4QXHA 4XAAA 4FO9A 4PJYA 1RB8G 1BVVA 1FMD3 3WR0A 1ZNPA 1LESA 3E6CC 1X33A 1I6XA 5GZFA 3I2GA 4TLGA 3VDDA 1FNZA 1W9YA 2GC0A 2YUEA 4CXXA 2HYKA 4ISRA 1A8DA 1AYM3 1J3PA 4HOOA 2OZ6A 4PLOA 4RS5C 4KI5M 4XVHA 3T2QA 5A3LA 2DCTA 5I8YA 2WZR3 2WFPA 5J3UA 3LOIA 5FP3A 3LCPA 3FLTA 2XR4A 4NWWA 3N9PA 3R6SA 3HWJA 5F5AA 1W9SA 4JTOA 4GB33 5C7GA 2WWSA 5FPVA 3DN7A 2JG8C 2WS92 1LOFA 1TNFA 3PU8A 1UKRA 2QDRA 4XC9A 1GP5A 3DYOA 4LO7A 4YW5A 3H8XA 3NQHA 3B9CA 4MH0E 2VCMA 4XURA 4XQ4A 2YMZA 1QU0A 3HD8B 1D7PM 2ZGNA 4ARXA 5C3QA 3C7HA 1J84A 1GSLA 1POV0 3NJYA 5GKAC 1F15A 2JDUA 4V1PA 5FLHA 3M2MA 3K4AA 4KG8A 2B46X 1UNBA 4UBHA 1VBB2 1PK6C 1UOBA 3ROUA 1V6IA 1QXJA 4OUMA 2OQ7A 1RUH3 5LA1A 2FDIA 1W0PA 3AP7A 1WLTA 1O6UA 4AHZA 4C91A 1QQP3 2Y6HA 2IXHA 5KC6A 4AOCA 1AL22 4OUSA 4BU2A 2VOXA 4YLZA 4E4HA 1ZM1A 4Y1VA 2Q8OA 4GKXA 1QGLA 1UZWA 2YC2A 2GN7A 2YC0A 4O7XA 5IJRA 1T6GC 1BEV1 4FOQA 2E6VA 2VUJA 2WZPP 2A3XA 3POSA 4MYEA 4EN0A 4DEVA 1GKBA 2BGPA 1RUF1 1PO12 5FZBA 3VBSA 2HLEA 5FP9A 4BLIA 2WNEA 4CUAA 1QOTA 3POYA 1PM7A 1S0IA 4Q4X1 5C8WA 2J1VA 3ASIA 1WW4A 2XXZA 3TN91 3ZXFA 3VBHC 2W68A 1IKPA 2EIEA 4QX5A 4ZU7A 1AR72 4LKDA 4PDWA 2QQOA 5KXCA 4Q0VA 1S4CA 1U5ZA 3TBDA 2GNMA 2C24A 3PUSA 1OF4A 3PTYA 4XE9A 4OZXA 1X9PA 3UKNA 3BPSA 3J7NA 1ZA7A 4OHZA 3THCA 3QH6A 1RUJ1 5IK8A 2FDFA 4KL1A 5JVVA 1EV11 4Y26A 2DFBA 3OTFA 3VBUA 4XF4A 1X8EA 2AC1A 1DDLA 1FMD2 1CAWB 3K75B 2XJUA 1OA4A 1QJY1 5CIRA 4HZFA 3NAPC 2CGOA 1W8HA 4XFHA 2WA3A 4IEZA 4RYDA 3IDCB 2WWJA 1AYM2 2ZZQA 1O8PA 3CZJA 4K1YA 4LULA 4W50A 4XFBA 4AI1A 2OA2A 5EQUA 1RJ7A 2ZKLA 2J22A 5ACA3 4Y22A 2WZR2 3ZSJA 1DP0A 5KXBA 1NKGA 3FFZA 2XLAA 4FXKB 5L73A 3UKTA 4IEQA 3WP3A 1ULOA 1GQGA 1UO9A 3WUCA 3RDIA 4B7KA 1LCLA 3BTAA 4JQRA 4QKNA 4TLFA 5CADA 3MEPA 4GB32 4MGIE 5JAXA 3RZKA 3AZYA 4AEJA 2PHFA 5HXVA 1C8M1 1W0OA 1BEV3 2P6CA 5CFCA 1UL9A 4AQTA 1TMF1 2GP5A 3D0JA 4AI9A 4RHV3 3RI8A 4BE3A 1ULPA 3O0XA 1RUF3 1JUIA 2VBBA 4D0QA 2R071 3HBZA 2OUJA 4Q4X3 3VB9A 4JGYB 3TN93 4TZDA 1HQLA 2ZEYA 3O1PA 3WF0A 3J9SA 1UXXX 4QHOA 4CCKA 4Z92B 3SNMA 5JSOA 1REEA 2RS11 3TYJA 5FYBA 5H9PA 5CFDC 4I2OA 2H0VA 1J83A 2MHFA 4NIIA 1ZRDA 4LBJA 3GYDA 2O8QA 1YCIA 1MS5A 2D6OX 1OQEA 5CZKA 1RUH2 2GC2A 1GR3A 4HK9A 2VR4A 4E9KA 1RUJ3 2OYZA 3THDA 1ZA4A 3W21A 3H8OA 1W9WA 5FREA 5JXJA 5LEKA 4CPBA 2YHJA 4ITCA 4XMIA 2E32A 1O5LA 1IPKA 2CL2A 2JD4A 4K40A 2FDJA 4B4PA 3VBFB 2NMOA 2UY9A 2XH6A 4BIFA 1UZ0A 1YXWA 2AZ5A 4JRLA 3VLBB 1XXNA 4ES9A 4AFAA 4LBKA 3LDBA 4ATFA 3RZZA 4UF0B 1SBDA 3D5OA 5DUUA 2LRPA 2BNOA 5GLVA 1IQDC 2NQYA 2YU2A 2VY0A 1EUUA 1VIWB 2E9QA 1JW6A 2YG0A 3JQXA 2FCTA 3D6EA 4P00B 1G8WA 2EIGA 4CCEA 4FAGA 3B9IA 2VTXJ 2PHUA 1MS9A 5E6HA 2JE9A 5J1XA 4EN8B 3WDVA 4C0BA 4NOTA 1SPPA 1YI7A 2VUAA 4QHZA 4AK3A 3PUHA 1EPZA 1IS6A 3RS6A 5CKQA 3LSEA 5JOYA 4TTGA 1I9RA 3BOWA 1CPMA 4FCAA 1R1ZA 1W2NA 1H9WA 4Y20B 3ILNA 2WYSA 4DXRA 1TMF3 1AZDA 1NG0A 3OPWA 3MFAA 3CLPA 1R64A 3GBGA 2X53S 1NOVA 4X8PA 5CU1A 5LA2A 4CCDA 3KCYA 3B01A 3W5MA 1ZBE1 3I2HA 4IV3A 4B1MA 2YPDA 2WAOA 4NROA 2FMDA 3ABZA 2JXAA 4LR4A 4NHMA 4DUVA 4CCLA 1VMHA 2ZGPA 4YGDA 2D7FA 3VBHA 1WW7A 4K7JA 1NXD1 1DFQA 2VOVA 3OBRA 1IPJA 1W6MB 2SBAA 1H1IA 3KT7A 1B35A 1VALA 2RS13 3DEMA 3J26N 1FPN1 3M3EA 5FZHA 5T50A 2AENA 4AGVA 4HBNA 4FVVA 3S7EA 3KWVA 1SHWB 4R52A 1CD3G 3AKQA 5GZDA 5ACA2 2X09A 1SZBA 2G4IA 2LM3A 3D4KA 1UMHA 1HX6A 2WIIB 3S7IA 2VUCA 1JZ3A 4P9LA 5IVEA 1HJGA 4LE3A 1DGRN 3B5LB 3NJVA 4I0AA 2QDNA 5FZ6A 2UWAA 3FLPA 5JR7B 4D7TA 1W9FA 4AQ6A 5FPUA 5A33B 1FOD1 1ENRA 1BEV2 4Y4RA 4D7YA 5I91A 3RG0A 1RVF3 3N9NA 4JCKA 4P14A 3NNMA 5F9TA 2ZCWA 1JHJA 1RUF2 2D44A 4GXLA 1WCKA 5K9YA 2J1AA 5IVFA 3J7LA 4Q4X2 3WLUA 2BOJA 3LEKA 3TN92 3ZR5A 3N7KA 1OH4A 4AI3A 5BNPC 5FZ0A 4JDOA 3WT3A 1SQ4A 5IW0A 4PIXA 5GLUA 3R0RA 4XFIA 5JR2A 1AR61 1YO8A 4N9IA 2ZMLA 4YWAA 2X5IC 1JYCA 1QDOA 2ZACA 3H42B 2PAEA 3I8TA 1T6BX 1OLMA 1S2KA 2PHTA 2WO1A 4N9HA 4FTEA 1A34A 4I3GA 2JD9A 4XOGA 3T0DA 3WW1A 1RUJ2 2XG3A 4RFRB 1Q8SA 2UYAA 4LA2A 5C3PA 4Y4YA 3A0NA 5EPAA 3WNMA 4AQSA 4XF1A 2BYVE 2PLV3 2OXBA 3KQRA 2D6LX 4IEOA 1ZBE3 5FY0A 1ODMA 4HSLA 1N3PA 2JDPA 1YJKA 4GAZA 5D8AA 4QXBA 4YARA 2P37A 4CP9A 3C7OA 1SFPA 1RXGA 3K2OA 1VP6A 2WNUB 4FPEA 4QKDA 4FFFA 4E8DA 5JXIA 1RUC1 1UAIA 2PYTA 3E6BA 1FPN3 1ENQA 1O4YA 2WDBA 3ATGA 4FPOB 2DVBA 3H0OA 5CFDA 5DMYA 5FXZA 4XCAA 4DXSA 1H8TA 1QMJA 1LGNA 5F3GA 5FKBA 1LODA 1DIWA 4LQRA 2NYYA 5FY7A 2W3JA 2Y34A 2RDRA 1IHMA 3CZUA 3M7AA 3MBWA 2P2KA 5A70A 5J48A 2D93A 5F32A 1AXKA 5FYCA 1FOD3 3ZN6A 3PIJA 3OPZA 3TNQA 4XJ9A 1TMF2 1NA1A 2WRAA 4JZRA 3DPRB 2WQ4A 4GH4C 3S5QA 5GZCA 3GGLA 4FFGA 2A73B 4ZZ5A 1DU3D 4NUBA 1CAVB 1HIXA 3ZSMA 1ALYA 2R072 2WN3A 4PBPA 4XEZA 3BIWE 3LDKA 5FMCA 2Q1ZB 4RQPB 1NAEA 4OQ9A 1YQ2A 4EN7B 2BVVA 1GNHA 4MGZE 1YWKA 3JZVA 1W6NB 5A32A 4BQ2A 5FZOB 4AI0A 3FHAA 2RS12 1W06A 2VQUA 4JV4A 5T5LA 1JZ5A 5FY1A 5L9VA 5GM0A 4ASLA 3M3IA 2VNRA 2QNKA 1X9TA 3T09A 3O0WA 3PJYA 4UW6A 2XVGA 5FP4A 4AW7A 4EZHA 1Z0HA 4CP0A 2EXIA 4Y3OA 5FJHA 2WABA 2HEVF 4LITA 5LW9A 4WBBA 5M0TA 1LNSA 1DYOA 2ZX2A 3AYCA 4KGQA 4OUEA 2XONA 3SEPA 1C28A 3IDBB 4XJAA 3U4SA 3VDDB 3UYJA 4P9JA 4G4FA 3I2OA 2BP6A 2VZRA 4LA3A 4D94A 4OCTA 4Q27A 5C9AC 4MVTA 1JOPA 1KS4A 2VVEA 4OMCA 3T2PA 3HNMA 4Q4V1 1FXZA 4GWNA 5JXHA 1O7FA 1S0FA 1GUIA 1GZWA 5J7MA 1KDMA 2VCAA 3PMEA 2DBNA 4FPLA 3VHOA 4IEVA 2P3JA 1G9DA 4CPBD 2AEZA 4LKEA 2ZGMA 3C8XA 2QJVA 5L19A 1UU6A 5T52A 4BDVB 1CAUB 5FZKA 4WM8A 1DGLA 3KV5A 2WNOA 2Y33A 3FFQA 1ZZBA 2EXKA 2XQXA 3WDWA 3LQCA 3NO8A 5H9RA 2IFWA 4ZKTB 3N7MA 2K46A 1LHNA 2HEYF 2RS31 3BTYA 1UMZA 1LJ7A 1ZBE2 3EMRA 2XB6C 3WSOA 2WNUC 5F5QA 4FPGA 2FCUA 4MZUA 1BHGA 2DCZA 3VHNA 2W91A 5CBLA 1O3QA 3OY8A 3ZO0B 4A44A 1O4ZA 5BNPA 4CEWC 3VUOA 2NLRA 3N7JA 4QQPA 5FP7A 4B8EA 5FYHA 4FP2A 1R083 3HNYM 4NHYA 1RUD3 3CQOA 4OYUA 1PX3A 4O61A 3JQWA 4UW3A 1FPN2 1XNAA 1V9U1 1FT9A 5B2GB 4IDZA 2X5IA 1QJEA 3LPFA 2UY8A 1R1A3 1YHFA 2QQJA 2HWB3 2CU5A 3I3QA 1Q56A 4UBGA 1JHNA 4KWJA 1CX4A 4B29A 4Q8KA 5JZGC 3DPRC 5G04L 3VBSB 1FOD2 3TOJA 4DPNA 3TWIA 4WV8A 1C57A 4A42A 3OSDA 4M3CA 2J1TA 2JDMA 1GNZA 4LO6B 1HRV1 4MHRA 2XJTA 4X8NA 4WZFA 1KJRA 4RQPC 4Y5SA 2Y6KA 3NVCA 1JXNA 1EYBA 2GN3A 4Q4V3 4PDWB 1I5PA 1QKQA 2QQLA 5E89A 1DQ1A 4JKLA 4JKMA 4M00A 4QB2A 2A5ZA 2Z4FA 3NNGA 3IT8A 5AFEA 1GOFA 3E5UA 1SLLA 2EIDA 3KHBA 3VKLA 4LBMA 1J59A 2DVFA 4EROA 1GZCA 2WS91 5A3TA 3U75A 4J6GA 4Y5Z0 1KQRA 2VM9A 3DF0A 3OGVA 4BQ4A 1S1AA 1VPHA 1UYPA 3JBG3 1N1YA 1K5MC 4QKFA 1UIKA 1OA2A 2VW0A 3VBUB 4JAAA 4C0HA 5FOBB 2F17A 5LRSA 4LJHA 3VDDC 3RZLA 3RSJA 2UWBA 5JIAA 3LFMA 3ES4A 5DAPA 4J1WA 2RS33 1HQWA 3FC0A 2NZ9A 3AYEA 3KF5A 2PQSA 1UYZA 3ORJA 1CIWA 3A22A 1VBB1 2ZJCA 5A7QA 3WP4A 2RMU1 4BMEA 1MVEA 2ZTNA 5A7WA 4YM3A 4JVAA 4CXYA 3HN3A 2PFWA 4LBNA 1FX5A 4Y22B 3V64A 5A7NA 3R4DB 3ZSKA 4D3WA 1RMU3 2B9UA 2FMYA 4DMIA 1QH7A 1AL21 4O9GA 1VAKA 2BTVC 4TSVA 3B7MA 4Y24A 2BNNA 1LOFC 5IVVA 5HV4A 2RR13 4PI2A 2ZKNA 4YM1A 4AVSA 3D0SA 5KWRA 5CFCB 1W8WA 2BEOA 5KHGA 4COVA 1GP6A 2Q8CA 3PU3A 2GC3A 3I3BA 2WFF1 3QACA 1GOGA 4RGGA 1LHOA 5LRRA 3GZTB 2C9AA 3TAYA 3M1HA 1TNRA 3KLSA 4FQ4A 4IUGA 5DAVA 4E8CA 2VTFA 1HRV3 1U5IA 4BIOA 1AR71 1SEFA 5CISA 3U37A 1UXZA 4H7LA 5A7SA 5C9AA 1J1LA 1BCXA 2AUYA 2ZOEB 2JENA 4Q8LA 1J58A 1LB2A 1LHVA 3VD3A 1D2SA 1DZTA 4D6QA 5LATA 2AREA 5FOJB 5I8TA 2D40A 3RZHA 1R082 2ZX3A 4BOWA 2WSVA 2OPKA 5BPXA 2WT1A 2E31A 4QHBA 4YZ4A 3SCFA 4BWOA 4DZGA 2BVBA 5CVRA 4C1WA 5LBFA 2QQPA 2VMGA 2ZEXA 5IVYA 2HWB2 4CUBA 2W39A 1XNTA 1G7YA 1LKNA 1CONA 3G7DA 1AX0A 4YW2A 4W6YA 4HG6B 3ST7A 4D7SA 5ANQA 3CIHA 2XKOA 4YVSA 2W1SA 3EYPA 1XU2A 3R05A 1Y9QA 1UX7A 4YFWA 4AE2A 2VQ0A 2WA4A 4PDWC 5A1LA 5F3CA 1IG0A 1XBFA 3MUZ1 2RMU3 3WCRA 1HV0A 3LFIA 4PQ9A 5HXMA 2WZR1 3JXSA 1UU4A 4Q4V2 4CU6A 1H30A 2DURA 4CEWA 4XIKA 4BQ3A 2ZGOA 1EPWA 5G05L 4QM9A 5A7PA 1PMJX 1SPPB 1WBFA 4K21A 2H6CA 2R6QA 3GZAA 3DYMA 4Q26A 3CDZB 4NMIA 2Q0AA 4IEUA 4QDRA 3VBUC 4YYOA 2BV4A 3JCIA 4LHKA 3INAA 3WF4A 1KXGA 2DYCA 2MPFA 2R1BA 2Q1FA 1ZREA 4W65A 3MHZA 4BLJA 1VAMA 2C5DA 2WFF3 4UI9L 5APAA 5JZGA 1Y7BA 4IV3B 4MLOA 5FPAA 3I54A 1OFSA 5T3NA 5AVPA 2JDAA 3RWKX 4IGPA 4CCCA 1ZZ8A 3DV8A 2RS32 3W58A 1CJDA 3VBHB 4QDSA 3KZ4C 1DQ6A 4LKFA 4LIUA 1LEDA 2P5BA 3K4ZA 1B35B 3SH5A 2RDSA 3FHIB 3HQRA 3WQ1A 2D6KA 5FY4A 1A8MA 1MS3A 2HBTA 1U12A 2PTMA 1JYTA 1UKGA 3TEXA 2X10A 3A4UA 5LBEA 1QQP1 1SDWA 1PM4A 3T3YA 5T5JA 3MIGA 1V9U2 3VZOA 2D97A 2F6BA 3FLRA 3VZMA 4LUMA 1XB9A 5CFCC 2J1UA 2R0HA 3GCXA 4OI1A 2I2SA 4ORFA 1VMFA 4IV1A 1W6OA 1ODNA 2RR12 1F2NA 1UQXA 4XF3A 4QPGC 2VOWA 4Q1RA 1K5MA 5JOWA 3LEGA 1GWMA 4G9SB 3TEYA 3SKVA 2ETEA 2BJSA 5BNQA 5DZFA 1DGWA 4A7YA 1WLDA 4KBBA 2YGMA 3NAPB 1G9AA 2IWGB 1HRV2 2ZGQA 2DUQA 3AP4A 4XTMA 1OLRA 4YW3A 1D4M1 1I1EA 1YJLA 2ZGRA 3GHMA 4XUNA 4OI4A 2W1UA 1SDDB 3ZFGA 1PNFA 2N7GA 3LAGA 4JC1A 3EXUA 4YZ5A 3W59A 2B7YA 4K1ZA 1W8NA 2ZEZA 5FK8A 4D69A 4A7ZA 4BYYA 1UMIA 3VBRA 4QXCA 5EYYA 1SMVA 5FUNA 4EN9B 2Y0OA 3KV6A 1GANA 3OBZA 4Z2WA 3V65A 2HWF3 1QJU3 2VE1A 4BISA 5IK5A 1SBEA 1WZXA 4YRDA 4AEKA 1L7QA 1Y9MA 2B42B 3DKQA 4S2FA 4BK5A 4CDWB 2NP0A 3ZYBA 1PO23 3HQUA 2IFRA 2P4EA 4CE8A 1NE6A 1JOBA 4WVWA 5D8AB 2R7EB 2IXJA 2Y8KA 4XFCA 5H9QA 4CP9B 5A1FA 1OF3A 4EN6B 1P8JA 2R041 3IAQA 1ZX5A 4RL7A 1C8NA 2JICA 3WDTA 3CBNA 1IKQA 1NUKA 1Y43B 1VBD1 2RJLA 5FPXA 1OA3A 2RMU2 4QGLA 5ACA1 4YM0A 1DQ4A 1LGBA 3LEIA 1HRI3 4IE6A 5CFDB 1OD5A 1H8TB 1UY3A 3K3NA 4WM7A 5FYUA 3LA3A 2HWE3 4LBQA 2Y64A 2O8OA 2QCSB 3AZWA 4Y1UA 2JB8A 2CWSA 1SBFA 4LOTA 3POGA 3KVBA 4L99A 3URFA 5AFBA 4N43C 3C7FA 3RZJA 1MZFA 2BWCA 1U0AA 3MIEA 1NXMA 3ZN6B 2E7TA 3O7OA 4CDQA 3BU7A 4RHV1 3UK9A 3FL7A 4BQXA 4IV3C 1DZRA 1NA1B 5FZIA 3VKMA 2BPA2 3ZXDA 1DQ0A 1C3HA 2WFF2 3V0AA 4PQQA 1ZRFA 3ZXLA 1ND3A 3A0KA 2KM2A 1W8OA 4Q1PA 3T4VA 4DINB 1B35C 2AEYA 3K4DA 5FYTA 2LW8A 2VXRA 4P9YA 3BUCA 1D4M3 1ZZ9A 4NRPA 4NVPA 5A32B 4COWA 1S0GA 5LEJA 4JDMA 4DRVA 4WZCA 3O1SA 3GZEA 3ECQA 4COUA 5FJKA 2BERA 2BW8A 2KXLA 2ZHLA 4BCUA 2VZQA 1H1MA 4R9DA 3WVJA 4BH9A 2VQAA 1W6QA 3WZ1A 2ADEA 3PDQA 4HONA 3KF3A 2ZZJA 4AVCA 1JH5A 1OT5A 4LNVA 5FYIA 3J7HA 3ACGA 2Y38A 4GA9A 3SCGA 4ARYA 4CDUA 4EWAA 1WGPA 4K20A 4LMFA 4AHXA 3NRUA 1NZCA 3CJXA 1Q8PA 5A6XA 2XUEA 4MADA 1K3IA 1F9KA 4JKKA 1ACCA 5EJZB 4O9EA 1U5XA 2Q1MA 4KWUA 4YGBA 3IIAA 2R043 1ENSA 2W92A 2ZGUA 3MLLA 3BB6A 3E97A 1VBE1 1VBD3 5KBFA 5C6CA 3PURA 5F1RA 4XZUG 5F7UA 1ASJ1 1GZWB 1OMIA 1XNDA 3HNBM 2UU8A 5FXWA 2ZABA 2RJ2A 3TRSB 4HETA 2E51A 2XDVA 1C4RA 2R30A 4GKYA 3H7YA 4J1XA 1TVGA 1GQPA 4L2NA 2VMFA 2GALA 4WM8B 1L7RA 2AH2A 3S30A 4HL0A 2D6PA 4CZSA 1V6JA 5DZGA 3CMGA 1R093 3RRDA 1IS3A 2GH2A 3PVBB 1H6YA 1QJU2 3H50A 4QT6A 4UW5A 1ND2C 2CAVA 3RYPA 4QPGA 4YG3A 1ZRCA 3KCXA 1SLIA 1ZRIA 2JE7A 2YBPA 4RGAA 5FUIA 1YFUA 3ZFEA 1RJ8A 5D8AC 4RA0A 3N9OA 5L7OC 1PO22 1W03A 4GZ9A 2E7AA 4YG6A 1V70A 1WCSA 4BQ1A 1IS5A 1UOGA 1UOFA 2Y0IA 3VDAA 2RVAA 2VO5A 3KMHA 4HN1A 4QPIC 4ATEA 1RUI3 4D6SA 1JZ4A 3OY8B 2D3PA 5A1AA 2RG4A 5BNPB 3K48A 1H8TC 1DGWX 2IVIB 1AUYA 2XJSA 4QMAA 4AF9A 4KU7A 2QQMA 1HRI2 1QEXA 2GDFA 2X5IB 3RZGA 4KNCA 4CXWA 2HWE2 1QQP2 1D0GA 3UT0A 2YFZA 5F5IA 1UPSA 2XHKA 5I0TA 3C2UA 1RTVA 3FBYA 1N1TA 3VD7A 2IC1A 3MPPG 5IT6A 1ST8A 4SLIA 4BJ0A 3PMSA 4CA9A 1NA1C 4ET7A 2Y6JA 1OLQA 4B3NA 4BXSV 5HI0A 4TYSA 5LCWL 3VZNA 3AMNA 3AK0A 1JU3A 5DDJ1 1LOCA 2MEV1 3T0BA 1RVF1 1TG7A 1AF9A 2IUWA 5FTTC 1AYN1 1YLLA 1OVSA 3DECA 3I2FA 4M3CB 4NWVA 4AWDA 4W6XA 2TNFA 1QOOA 2WWUA 4CTEA 2EF6A 2RS51 4QX3A 5T5PA 3U78A 5A6QA 3UJOA 2FCVA 3VV1A 1MEC1 2EVXA 5IVCA 2GC1A 1CR7A 5IVBA 1Q43A 1VBE3 2WQZC 3LZZA 4XQWA 1JUHA 1F8VA 1ASJ3 4ZXEA 2JB4A 1D4M2 4IETA 4DEQA 4UWDA 1FI2A 5FYMA 1SLBA 2PHLA 2WT0A 1JMUB 4ZS3A 4INDA 3OGSA 2DFCA 2Z79A 1YFXA 1XJAA 5ABJA 3WW2A 4NHLA 4Y1XA 1V6KA 2OS2A 1ULGA 4MUVA 1PGW2 3MV11 1PNGA 3IWZA 1NCQC 2J42A 3U4XA 4N43A 4RR3A 2CDPA 1Y9GA 5GLZA 2QUOA 5FV3A 2PLV1 1F31A 2BOIA 1OVPA 3DXTA 1MS0A 3BN6A 3BYWA 4Y33A 3D8CA 4HT1T 1SLCA 3QH7A 4GH4B 4HANA 1S2BA 2D3SA 4Z07A 2VECA 3BTXA 4OVEA 2HBUA 2EA7A 1XNBA 1XSRA 2WBKA 5A7WB 2Y26A 5JMOA 1CAXA 3BOPA 4GULA 1DHKB 2R042 3AP5A 1KEXA 3ZXJA 3KT4A 3F2ZA 4XBLA 3NKTA 1VBD2 1VE0A 1E5SA 4MX3A 5T55A 1VR3A 3GF6A 2VW2A 1GLHA 3D82A 3PTRB 3KS7A 3DGTA 4UFIA 4XUTA 1AHSA 3O14A 3MLKA 4WM8C 4FPKA 1S0EA 3NV1A 2D6MA 1DYKA 4N8MA 5FY5A 1HKDA 1S0JA 3ETPA 4C8DA 1W6PA 5CKMA 1LRHA 1OPOA 1SFYA 2VNGA 2WZ8A 4KBZA 1R092 4WVVA 4ZPIA 3AL6A 2MEV3 5DDJ3 1W28A 4AG4A 4KH9A 4RHV2 3NV3A 4CU9A 2D5HA 1JYVA 1AYN3 1BLZA 5C3SA 3M70A 3UGFA 1UPIA 4DXTA 4EQVA 2RS53 4CUCA 3JB8A 1HB3A 3POWA 3MW3A 4K3UA 1MEC3 3RYRA 5C9AB 5LA0A 3IB3A 3PNAA 2G1MA 4CDXC 2VMCA 1PX4A 1ZRRA 2L9LA 3I59A 2YPJA 4XDOA 1UY0A 4LBQD 1RUI2 5EYXA 4YFZA 4QGMA 1DG6A 1BVP1 2ZHNA 2X05A 1XC6A 2SLIA 3NNJA 1US3A 1O5UA 4MHUA 1QJX1 5E88A 2QVSB 2WL1A 1TZOA 4WVZA 3WF3A 3OOXA 2TBVA 3THTA 1CWPA 2W46A 3O1UA 1VRBA 4AVAA 1CVNA 4CP1A 1HLCA 1OUXA 1L3JA 1VJ2A 2VMHA 3PHMA 4V2WA 4ZXKA 5IYYA 1H2LA 2VMDA 4BMBA 3POBA 2CGPA 1AXZA 4R9AA 1ZVFA 3MO4A 1C1FA 3OUJA 2KD7A 3N9MA 5DABA 5E16A 1LAJA 1ND2A 1UOJA 1NX9A 3OUHA 2F4PA 5FMDA 4FFIA 5FXXA 4HVRA 4MXWA 3OEAA 4LEJA 4YVSB 4ZZ8A 5A6ZA 1REDA 1WCDJ 4AAPA 3HIFA 5L7OA 2JWPA 1SCRA 5FY8A 1L7LA 2BQPA 1F4AA 4QPIA 4TWTA 3HT2A 1RHI1 4XTPA 4LLOA 1I5ZA 4CEWB 2ENRA 1VBE2 1SLTA 1ASJ2 1UYXA 4MSVA 4Z82A 1QNYA 1HB2A 2XBO1 1FNYA 4HLTA 2WO7A 4IGOA 1V6NA 1PGSA 1UW8A 2VCCA 3MYXA 3EO6A 4NPRA 4XHXA 3WUDA 5FZAA 4J25A 1QJZA 1K5JA 1FV3A 1S55A 1I3HA 4IE7A 2W95A 2DUOA 3M4FA 1ULDA 5F2SA 4I0BA 4XILA 3WNKA 2PQQA 1JN2P 3C3VA 1ULFA 3O1OA 4QX2A 3ACIA 4COZA 2XVKA 4UFMA 4KU8A 1OBNA 1UY2A 4CU7A 3O1TA 4A6OA 1ULEA 2C0ZA 2B8MA 1YQ8A 2JJ6A 4ZY9A 2WSUA 4AFBA 1MPXA 4YSFA 3BKZA 2NN8A 2DU0A 5J96B 3LGRA 5JCTA 1VRH1 2AYHA 3WDXA 1R081 4U36A 3ZXAC 1RUD1 3LPGA 3O12A 4ES8A 5JI7A 1Z78A 3ALQA 2J7MA 4HPKA 4AQ2A 5C3OA 4ZS2A 1QJX3 2BWAA 1C5HA 4JHZA 1X8MA 1VMJA 4XMAA 5A3NA 1R1A1 3MUY1 4Z1VA 4FQZA 2HWB1 4META 2OW4A 1YC61 4IV1B 1W6OB 4QDQA 4NPLA 1IS4A 1NCQA 4AAXA 2UWCA 5FPZA 1K5MB 1AR83 4P9WA 2PHWA 2QBXA 3IMMA 4RD7A 5J36A 2VZSA 2P17A 2C26A 5DDJ2 5IATA 2MEV2 1RVF2 3CO2A 3U14A 3ZDVA 3GALA 1AYN2 4AL9A 5D1IA 2QQUA 1DGRA 4UFKA 4UFJA 1JS9A 4IERA 4E2GA 3N9LA 2RS52 1Q8QA 2DVDA 2RV9A 4YPJA 3SEEA 1EUTA 1RHI3 1MEC2 1QH6A 2XHNA 4PLMA 3AC0A 3ZYGA 2I07B 3ELNA 3TNPB 3ZFGB 1GMMA 4E4SA 4EJRA 1N1VA 3Q8EA 4XFAA 2VZUA 2XBO3 1RUG3 2XWBB 3J7MA 3VBRB 5FZ1A 2IXKA 1PGL2 5C5UA 5IUQA 4P08A 5EJ1B 3ZXKA 2VBPA 2Z69A 3R4UA 3AZZA 3JBG1 5FMBA 4LORA 4AHYA 3I2IA 3LB9A 5LA9A 1W2OA 1PMIA 2RE9A 2JDZA 2VC9A 4MGKE 5JWPA 1ONAA 2DBIA 4M0HA 4N53A 3OG2A 4CCJA 2CNAA 2R061 1FAYA 4YVSC 2PLV2 3CEWA 1HXS3 1BK1A 1Y3TA 4HKWA 4LIVA 5FZGA 2VJXA 2BFUL 4XXAA 4UOJA 1WMXA 2AACA 2XLFA 3ETQA 1POQA 2VUDA 4DQAA 4FT8A 3M3CA 3JD73 4KQ7A 1UF2C 1VRH3 3Q8CA 2ZPXA 5EV7A 5FZFA 3F95A 2JKBA 3KV4A 4CDXA 4BZ4A 3MF6A 3FE5A 3RI9A 1RMU1 4WM7B 1YEWA 3IKWA 2ZBJA 4XACA 2FD8A 1WW5A 4P9IA 3ZPOA 3L2YA 4CEYC 4Y1ZA 1J3RA 2RR11 1WMEA 4AGGA 3NV2A 1OSGA 4NRQA 3IAPA 4Q4Y1 2Q8EA 3UNPA 4OQ8A 4JGYA 3WINE 1W39A 2PMWB 1W99A 1UD1A 1PVC1 2HH9A 3AKTA 4CDQB 2YFUA 1Q8VA 2DDUA 3EHKA 1WLWA 4YW1A 1UCXA 3DXUA 4XBNA 2QFEA 4QXKA 3UJQA 1DCSA 3WV6A 2XJVA 3OCPA 4HN0A 4DFSA 2Z42A 3POJA 5J09A 3V0AB 2FDKA 3AJYA 5EIYB 4AXOA 2XJRA 1ND3B 4I09A 4LE4A 4BQWA 5A80A 3AYAA 5KHKA 5D21A 4ISQA 3ZFFA 1KD7A 5L9BA 4IGQA 3AMMA 4UT5A 3S5AA 2ZHKA 4MGYE 2VOTA 5JPNB 1BMV2 1WA6X 2W0XA 5DXDA 1OOPC 3HOBA 2VQTA 2VZOA 3LF7A 2DUPA 3J8F1 4P5YA 1QXPA 1W6QB 4CP2A 4L97A 2WR9A 3Q9OA 3WG1A 4CCMA 1QJX2 3WNNA 1HB4A 4IV1C 4UFHA 3SCHA 3MIHA 3A7QA 5LZ6A 3FHQA 2A75A 4CDUB 5T5OA 4DXZA 1XNKA 4K9SA 2DTWA 2A6WA 3BALA 1XPWA 5K0UC 4LLFA 2XWJB 2R063 1G6NA 1AR82 4Q4W3 4XUOA 1RGSA 1IZ3A 1MZ6A 4XDPA 4IESA 5EXOA 4LXLA 1RXFA 1S0BA 2H6BA 3WQBA 1KGYA 4QU2A 3A21A 3VBOA 2Q30A 3LA2A 5AC93 4PI0A 2WNVC 2W52A 2BBVA 4E4ZA 3PL0A 1QWRA 3ZFGC 1CESA 1G9FA 1XNCA 4GMP3 3T30A 2BGOA 3WD5A 3MIDA 3IDEA 4OULA 2PHXA 3VDBA 1RHI2 5GLTA 2VCBA 4JRAA 5FXVA 1FATA 4Q0PA 3RNSA 3VBRC 5IHRA 1YI9A 3DCQA 3DKWA 2XBO2 5FZLA 3O5SA 1RUG2 2ZXQA 3KD4A 4UW4A 3CJIC 3ZYPA 5BUVA 1YQ6A 5IWFA 5C8CA 4Q4Y3 2QQNA 4FSJA 3BVCA 3VKFC 4IE5A 3GBFA 3MPBA 5A3OA 3SISA 2OIIA 4BPZA 1XE7A 2GZWA 1PVC3 1NE4A 2WLQA 5F2WA 5FO8B 2NMNA 2B4KA 1OHFA 4QPGB 5E1RA 2VU9A 2VAUA 3POFA 3WF2A 1G9CA 1O3TA 4BK4A 5JIUA 3ZFEB 4XABA 4A7KA 2WJSA 2EICA 2A1XA 4FPYA 1W05A 1OUSA 2JDHA 3ZN4A 4BB3A 1HXS2 4KWKA 2PELA 5F8PA 5JSRA 1RITA 5DAWA 1W90A 3WQ7A 3H8RA 4CRQA 3P3PA 4FPHA 2YV8A 3WG2A 1G9BA 1W8FA 4NAOA 1E5IA 3JD72 5GALA 3MV01 2RJKA 4WM7C 1CQ9A 2IXCA 1VRH2 2VPVA 1RUD2 4BA6A 1HB1A 3J8F3 4KWLA 2W1WA 5FZEA 3VL8A 2B45X 3POIA 2ZGTA 3P3NA 1R1A2 3ZYJB 3N36A 4QQOA 2XGXA 4BXFA 4CDQC 4AHWA 4A4AA 4FTSA 4ZU5A 3LWCA 4AI8A 2WINB 1ZZ6A 3ZXEA 1F35A 4DS0A 5J98B 4D6RA 3KT1A 2ARCA 3J4UH 5FQ0A 1UZZA 4GIQA 3E5QA 4A3XA 3HAGA 1ND3C 1NLRA 1GQHA 4N90A 2Q4SA 4UYBA 3T1LA 1O59A 4DUWA 5JPMB 1H2NA 3H1WA 3VZLA 1POV1 1H4GA 5HPOA 3CHXA 4XF9A 3R4SA 5FYVA 1VLNA 2EAKA 4R4ZA 5FZ4A 1GOHA 4WVMA 3X29B 1S0DA 1BXHA 1VBA1 4JHTA 1JBCA 3O0VA 3SH3A 5FMOL 5JZGB 4LUKA 1US2A 5FMOS 5FP8A 5C4WA 2WKKA 5ABJB 1J1TA 4YG0A 5DPNA 5FKCA 4B4RA 4CEYA 2VBDA 1XRUA 2E7QA 1CN1A 4FPCA 4CDUC 2HWF1 3I7DA 1QJU1 1WCUA 1WLCA 4CUGA 1WD3A 5H9SA 3ZLIA 2X8KA 1LULA 4N43B 3JBG2 4RR3B 4FFHA 3CF6E 1WKYA 2PAKA 1CZSA 4R9BA 5HBAA 1MQTA 4XF0A 1DLCA 1D2QA 1PO21 3VKOA 1RUNA 1JYXA 1UY4A 4GD4A 4IE4A 4R8HA 4Q0SA 1YYNA 2A3YA 2I45A 4NPMA 2R062 5FBZA 4Q4W2 3OGRA 5F3EA 5FZDA 3Q8AA 3BI3A 3ZSEA 1QHDA 3HBKA 2VZ3A 2XJQA 3OB8A 4GQ7A 4L9BA 4N7IA 2OPWA 2YY1A 2AGSA 1CAXB 4ASKA 5FZ9A 1OKOA 5AC92 1KFXL 3BGAA 3QD6A 3UGHA 5JDBA 2CY6A 1COV1 1HRI1 3HQXA 3N7LA 5BNNA 3OBAA 2E53A 1S0CA 2HWE1 1OOPA 3P1IA 4QD2A 3T4HB 1RMU2 3OYWA 4AFDA 3BPZA 5FLIA 3IM0A 1AXYA 1F5FA 2ORZA 2ZGSA 2FBEA 1LU1A 2YROA 3AP9A 4OFGA 2W1QA 3ZMNA 2O1QA 4AEDC 5CG8A 1W6PB 5CNAA 5FYYA 4FAHA 4Q4Y2 3E6DA 2R16A 1YIPA 5K4LA 1GP4A 1YFWA 3ZN5A 5LBCA 3ZFEC 5CYYA 1PVC2 2ZMKA 1V6LA 1U5YA 1NQDA 4LO5B 5K0UA 4B4QA 3ILFA 5EP9A 1W6NA 3V0BA 2VZTA 4IEYA 5FZOA 1YIFA 2ZGLA 4H2AA 3HPNA 2XQRA 3U07A 2A6ZA 4W4ZA 3CU7A 1POV3 3OD0A 1NCRA 5JSPA 2YB7A 2LTNA 3I59B 1WCQA 1YQ5A 4L11A 4LOSA 5ANNA 1TEIA 2WNVA 4FOVA 5EHDA 3SQOA 3CNAA 4PF1A 3I2JA 5FRAA 1UIJA 1VBA3 2C1FA 5A3MA 1UU5A 1TQ5A 2VZVA 3VDCA 1KRIA 1TME1 3USUA 2RM23 4C1XA 3PVOA 1PGW1 4PF5A 4ZHNA 5FR3A 4A41A 3J8F2 1W2TA 2G9ZA 3ZR6A 1HW5A 3CJIA 4M4PA 3WG4A 5EFUA 3U10A 1VBC1 4CYDA 1F5JA 1UX6A 1OD3A 2QQKA 4YZ2A 5IAVA 4LHLA 2E33A 3NSTA 4GJZA 4L92A 1ZBA1 5FIXA 1ND2B 1WMDA 3H1YA 4BQ5A 4JQTA 5CEHA 3H7JA 5F6LB 3VD4A 3O1RA 4MXWB 5C70A 5L7OB 3AX4A 3I3MA 3UL2A 3ZXGA 1NLSA 2P6HA 3ME2A 4NHXA 1MACA 4QPIB 4JGZC 4W8JA 4MG2A 1XE8A 1CAUA 1GZTA 1OQ1A 3UKVA 4YVWC 5BNOC 1COV3 5D2AA 4NIDA 1LGCA 1OQDA 4BM8A 5ABJC 4MO3M 2A6XA 3PUAA 1OLME 3AVRA 3T08A 4RR3C 3EQEA 1YNAA 1R091 2GMPA 2XVLA 4FP3A 3NKGA 3FZ3A 2ET7A 4H3WA 3WP6A 3HR9A 1IGOA 1BYHA 4EE2A 3AFGA 1SFNA 4OI2A 2CHHA 2GMMA 2VXJA 1EP0A 4MXVA 4QKBA 4QQHA 3SLIA 3T2OA 3MZHA 3ITQA 3ZVXA 5I0SA 2FDGA 1MVQA 1WMFA 5FAXA 2TEPA 2FQPA 2V5DA 1RUI1 3WOGA 4PBOA 1AJKA 1EY2A 4FOWA 4HXCA 5JUVA 1CX1A 2XPJA 2PAMA 4IQPA 3ZYFA 3IBMA 5CG9A 3AM2A 4HPKB 4P9XA 1DZQA 3RMYA 3RQ0A 2PA7A 4RN5A 3LD8A 4XJZA 3MFCA 1X82A 1TME3 4M01A 1CPNA 5DN2A 2Y60A 3AZXA 4LKSA 4QX7A 3DL3A 4PLNA 4Q0QA 3H3UA 4UFLA 1VBC3 5BYNA 2OT7A 4TXWA 1NCQB 4AFMA 3NNLA 2VOKA 4DB5A 2GAUA 3TB0A 1ZBA3 1DF0A 5JOZA 3BIEA 3ACFA 3B69A 1KDKA 3ACHA 3I3DA 3E1F1 3I97A 1PZ8A 2V73A 1XE0A 3S6PA 1O3RA 1W2UA 1Z7S1 5KXDA 1MZ5A 1XQNA 3WDUA 4IW3A 3VD9A 5A3WA 5C33A 5HCFA 2WO2A 2KR2A 2IZWA 3OUIA 4X6RB 4DNYA 2YU1A 5CA6A 3M3OA 4X6QB 3WNLA 4YM2A 3UV9A 4QX0A 4LBOA 1IG3A 4FTBA 3AKPA 2A6VA 5L36A 3BTZA 1VBA2 5IK7A 1HN0A 5FUPA 2RM22 1NLQA 4CU8A 3RMXA 2Y6GA 1AR91 2J1SA 3POEA 3AKSA 1Q3EA 3SC7X 4XUPA 1AX2A 2OX0A 3E5XA 3RGBA 2HWF2 4AEDA 1RC6A 5LWBA 3UETA 4N53B 2JG9A 4NRMA 1O91A 3SHRA 1J3QA 4H14A 5A7OA 5I0RA 4EZ4A 1GV9A 5DAQA 3VD5A 4CVUA 4A6SA 2WZEA 4QAWA 1JI6A 2Z2SB 3MIFA 1W8UA 2ADDA 3AMQA 4IEXA 1V00A 4LBLA 4UXAA 2HWC1 5F37A 1JU4A 4A3ZA 2PN5A 3KB5A 4N7UA 4CDXB 2V72A 4L0PA 2G9GA 1EAH1 2EXJA 1ZZ7A 3KHCA 2VNOA 4M0NA 1WA4A 2A70A 4NE9A 1COV2 3GHNA 4V2VA 4XJ8A 2D98A 4CCNA 1SG3A 1M4WA 1OURA 2ILMA 2NPIA 4E4DX 3DYPA 2R32A 3IIIA 1PHMA 3ZIXA 5TSWA 1REFA 3GXUA 2B5HA 3KV9A 3OGGA 5KXEA 4RS5A 3HN1A 3WEZA 3L9JT 1RUE1 3ES1A 4H55A 3HMYA 4IL7A 4CSWA 1BZWA 4P5HA 4YW4A 1RYYA 1LOBA 5JOXA 2YXSA 5FPBA 1Z7S3 4OZOA 1X7NA 2CWMA 1VB2A 5LASA 2IVJA 5A6YA 2GU9A 1GZ9A 3ZFFB 5FY9A 4LHNA 1CJPA 4IXLA 4EWEA 4JGZA 2JG8A 2V5YA 3ZYRA 1EV13 5FZ3A 3UGGA 4YVWA 1PGL1 5BNOA 1JTZX 1PMHX 3SH4A 4MOAA 3I4IA 2JIGA 3USSA 3LKJA 4EYUA 5EJ3A 4F83A 1S2EA 1TME2 1V0AA 3PVEA 3HVDA 1QJY3 2GP3A 1AR93 2OZJA 1NQJA 3EJKA 4YZ1A 1AL0G 3LEMA 4O65A 3SKJE 4AVBA 3P6BA 1D4VB 1VBC2 1MS1A 1MS8A 4QWNA 5BY5A 1AVBA 3HEIA 5GLWA 3IZOA 4JDNA 2HWD1 3AL5A 4KGGA 1ZBA2 3VN4A 2JEMA 1PK6A 5DUVA 1QIQA 4DY5A 5FZCA 5J37A 2BDRA 2VZ1A 5KC5A 4LK6A 4LTAA 4M3CE 2WQ8A 3MF9A 2XOMA 4I0WB 5LK5A 1XYPA 3VBOB 1WUVA 2EAAA 5FLJA 2VW1A 2HWC3 4XJUA 4MV2A 2ZS6B 4OHVA 1ZZCA 3W9AA 3IPVA 2WYFA 2ID4A 2A71A 1C8M3 1EAH3 3H3ZA 4XFFA 1RINA 4XYXA 5CB7A 5L9RA 2YZ4A 1BJQA 4H7MA 4Z2AA 2GH8A 2XKPA 1CZTA 2EIBA 4FOYA 2FDHA 4QQLA 2VVDA 3AMPA 2R073 5FO7B 4AVTA 5HCAA 2ET1A 5C8CB 1A6CA 2XL7A 2GNTA 4HVOA 3TEWA 5I0UA 2OQ6A 3AXEA 4YW7A 4N53C 3ZYHA 3ON7A 1NT0A 2C6SA 1M06G 2ERFA 2RHPA 2ORXA 1RUE3 4XCBA 2LALA 4M4RA 1QF3A 3FN9A 3I2DA 4F8AA 2E26A 1JYWA 2ZAAA 2I74A 3HJRA 2CDOA 3CL1A 2JKXA 3MGUA 4RFT0 3VKNA 1K12A 1BMV1 1W04A 3ACLA 2BNMA 2XMLA 2Z5WA 2K2SA 4BHPA 4QM8A 4AI2A 4Y1YA 1V6OA 2DU1A 2E63A 4PT6A 1QOSA 2X29A 2HJIA 5FWJA 5LBBA 3PVNA 4Q5OA 3MI8A 4YW6A 2ZEWA 4JGYC 3NWKA 4DRRA 1SLAA 5C71A 4QPYA 4B7EA 1B09A 4OI0A 2GMEA 1N47A 1OH3A 3NAPA 5EWSA 1Y4WA 1AR81 3FX3A 4NIGA 2RDQA 3KGLA 1DQ5A 3FBMA 5FQ0B 5GZEA 2VD7A 4OHYA 2HWD3 2W87A 3THPA 1ULCA 1MR5A 5FZ7A 2K0GA 2XJPA 1UWWA 2WLPA 2YDEA 1H8VA 3H1MA 3ZFFC 3RYKA 1HDKA 2O0OA 1Z7S2 3P5BA 2YBSA 2HKXA 2JDKA 1URXA 5DG2A 4JTNA 4AVVA 3KVAA 1H2MA 5DZEA 3AFKA 5IAXA 2YGLA 3WHTA 4WVMB 2GNDA 1BK0A 3VBFC 1YRZA 5CKNA 3ZMOA 3BCWA 1RUG1 1EV12 1A78A 1XSQA 2DV9A 5C4WB 3ZKUA 3C7GA 2VULA 2VMEA 4CEYB 2ZHMA 1BKZA 3ZYIB 3IN9A 3SITA 2DTYA 1AX1A 3K77A 3VHRA 3GCWA 3NW4A 3FUOA 1QJY2 1AR92 2C4XA 4KMQA 5HCBA 1H2KA 1MQTB 2W47A 3H8UA 3Q8BA 2VTXA 1HXS1 4GWIA 1JYNA 1BBT1 3MLJA 4XETA 3WW4A 1VB4A 4QU1A 4XZPA 1UY1A 5DUWA 3VBOC 3MDPA 1WWYA 3JUUA 3N3HA 1Q8OA 3OEBA 5DQ0A 5E8AA 1VAVA 1SCSA 4XJWA 1H6XA 3NJZA 1CGPA 1AJOA 3JD71 4L8QA 4MGQA 1W9TA 2HWC2 4UAPA 1QXRA 3I3EA 4U2AA 4FPFA 4IEWA 4F3JA 3WNOA 3B94A 5BNNB 5C3RA 3SXWA 3T2TA 3OF1A 4QPWA 3ZX7A 1C8M2 1EAH2 1O4TA 1OFNA 1OOPB 2QKDA 2DCJA 2VNVA 2BBAA 1LENA 1IPSA 2WT2A 3FJSA 3NMBA 3OYWB 4YNIA 4E2QA 5C8CC 5CAZA 1PIV1 2HEWF 1YUDA 3GBWA 3OPTA 1JZ2A 1W0NA 4QX8A 4DUXA 5FBJA 2ATFA 3M8LA 5FPLA 3OGJA 4URAA
chains in the Genus database with same CATH topology
1ZRIA 1F35A 1JODA 1JYTA 1JOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZRI A;  1F35 A;  1JOD A;  1JYT A;  1JOB A; 
#chains in the Genus database with same CATH topology
 2RDN A;  1V6M A;  5FCC A;  4CDW C;  5K8S A;  3QLQ A;  4EV0 A;  2Q5T A;  3K46 A;  5K0U B;  1MS4 A;  5ISL A;  3WNP A;  3V0B B;  1AR6 3;  1RUE 2;  4PHZ A;  2NM1 A;  1X36 A;  2O14 A;  2QTW B;  4XQD A;  3PIG A;  1PZ7 A;  2BRT A;  2W94 A;  4OHX A;  3QOP A;  3UES A;  1NCR B;  2CYF A;  2DVA A;  2D5F A;  4AZZ A;  4DIQ A;  2WNV B;  2W9X A;  4XAE A;  4C90 A;  5KHI A;  3AZV A;  2IXL A;  2LS6 A;  2V4A A;  1JZ6 A;  5FZ8 A;  2CGN A;  3USU B;  3AMH A;  2J1E A;  2ZX4 A;  2C9K A;  2J1R A;  4LPL A;  2V4V A;  4A45 A;  3NV4 A;  1CAW A;  2ARA A;  4Q2F A;  3CJI B;  1YFY A;  2K9Z A;  3MW4 A;  1N3O A;  3ZDS A;  4PCR A;  3N35 A;  4FI9 A;  4AR2 A;  2F4L A;  3VZK A;  4GWM A;  4NIA A;  1RUC 3;  4Q4W 1;  1JZ8 A;  1BBT 3;  3RFR A;  4MGS A;  2ZX1 A;  2HWD 2;  1JZ7 A;  1XYO A;  1MZE A;  2JE8 A;  2BFU S;  1NY7 1;  2V09 A;  1LEM A;  5AC9 1;  2ZMN A;  1LR5 A;  4AYU A;  1LHW A;  5KR7 A;  1C1L A;  5C5T A;  4QB1 A;  4D8M A;  5LB6 A;  2D6N A;  4GMP 1;  4E2S A;  4XUQ A;  2W08 A;  2R0F A;  5FYZ A;  3SMH A;  3B00 A;  3WP5 A;  2G9F A;  3KSC A;  5C4W C;  3B93 A;  2P1B A;  3B02 A;  3W20 A;  4LBQ B;  2QZ2 A;  4ASM B;  5IFT A;  3ZSL A;  4DO0 A;  5KHJ A;  3ZIW A;  2ZAH A;  2BUK A;  4LO8 A;  4BQY A;  1PIV 3;  4K6B A;  4I3P A;  2WN2 A;  1WD4 A;  2WAA A;  2ZX0 A;  4TN7 A;  3CKH A;  3QBQ A;  1F4H A;  1MQT C;  3NNF A;  4S2D A;  1DBN A;  4FBF A;  1JOJ A;  2BZD A;  5I93 A;  3WX5 A;  5SV8 A;  4IE0 A;  5LY2 A;  3OD4 A;  2P3I A;  3S0M A;  4Z8B A;  4XDQ A;  3K3O A;  1CZV A;  2D3R A;  2VZP A;  2VL4 A;  3PUI A;  3T0A A;  4E27 A;  3LSD A;  4M3C F;  1UN1 A;  1W8T A;  4HMZ A;  1YQC A;  2ZA9 A;  3MIC A;  3VGI A;  3N9Q A;  3NL1 A;  4K8R B;  3WDY A;  5I8S A;  2JEC A;  4R9C A;  1LEC A;  2Y6F A;  1PZ9 A;  1QJF A;  2LRO A;  4I02 A;  5BNN C;  2YBK A;  1N1S A;  3RPQ A;  3KGZ A;  1H1A A;  5AVA A;  5JMC A;  1W8Z A;  2BGC A;  3VBF A;  4Y5T A;  1E5R A;  4DY3 A;  2B9V A;  3C7E A;  5DUX A;  2GSY A;  3BU0 A;  1KFU L;  2DCY A;  2ARB A;  3APB A;  5ERL A;  3S57 A;  3PLQ A;  4FPJ A;  4UF0 A;  4NHK A;  2ARX A;  3IMN A;  1FV2 A;  4PIZ A;  4K8F A;  3H3L A;  3AP6 A;  4QQ2 A;  5F5C A;  1H0B A;  3B3Q E;  4HK8 A;  4FXG B;  4Q29 A;  1IOA A;  1X50 A;  3DUI A;  4NAM A;  1UZV A;  3FUQ A;  4SBV A;  1W2A X;  5EZW A;  2EXH A;  4HVQ A;  1LOE A;  3WF1 A;  4S2G A;  5JLV A;  3KM5 A;  1UZY A;  1GWL A;  1AR6 2;  1DLL A;  2VG9 A;  4W6W A;  1NCR C;  2LUW A;  5A3U A;  4NIH A;  3OBT A;  2DVG A;  4RSU A;  2YYO A;  4URT A;  3KCC A;  4MGT A;  5KHH A;  2P3K A;  5FZM A;  3N4M A;  1LU2 A;  1OC1 A;  4Y20 A;  3U0Z A;  3I2K A;  4ZU4 A;  1JOD A;  2MNG A;  1H9P A;  4GAL A;  3U11 A;  2JX9 A;  3Q8F A;  3LA7 A;  4OHW A;  4LHS A;  1OKQ A;  3AJZ A;  4P9G A;  4AGR A;  1E5H A;  4XHB A;  2FZ1 A;  1G86 A;  2FHR A;  4GH4 A;  2DF7 A;  5BV6 A;  5F3I A;  4AED B;  4B1L A;  1JYI A;  4YGE A;  2CSG A;  1BQP A;  1UYY A;  1HJF A;  2JG9 B;  2UYB A;  4XXP A;  1C5I A;  1W6M A;  2BU9 A;  2CTV A;  1NZI A;  1XYN A;  4CDW A;  5FWE A;  2QE3 A;  2QQI A;  1RUC 2;  3QCW A;  1GYK A;  4NR1 A;  2G19 A;  4NN0 A;  1BBT 2;  1V9U 3;  1E57 A;  4CCO A;  3I49 A;  2H0B A;  2B39 A;  5BXX A;  3RZM A;  3T1M A;  3ENR A;  1OXC A;  3WQ0 A;  1A3K A;  1APN A;  1LHU A;  1CIY A;  1SAC A;  3PUQ A;  4QX1 A;  5I0D A;  2EAL A;  1D0H A;  1FYU A;  3A23 A;  3BOD A;  5FO9 B;  5FFO C;  2TUN A;  5HCH A;  1PO1 1;  5A33 A;  2ZGK A;  1KIT A;  1LTE A;  2WC2 A;  3FMG A;  3AKR A;  4PIY A;  5DG1 A;  3RJR A;  1ZYB A;  3L2H A;  1PVX A;  2OVU A;  3H9A A;  1HN1 A;  2W5F A;  4LK7 A;  3PJQ A;  4Q0U A;  4KG0 A;  1Q5O A;  3AYD A;  2Q8D A;  3GM8 A;  2OKX A;  1RUO A;  3W5N A;  1PIV 2;  4GMP 0;  3WCS A;  3ZOI A;  4RS5 B;  3LOB A;  1IQA A;  1T2X A;  1STM A;  3GJB A;  3LIG A;  4GWJ A;  1DQ2 A;  1NYW A;  4EWD A;  1K42 A;  5B4X A;  2AR6 A;  2R1D A;  4HFS A;  4A2U A;  2W2I A;  5FDB A;  1OI6 A;  4I01 A;  1XU1 A;  3GNE A;  2A3W A;  2WS9 3;  2PXJ A;  1O3S A;  2PHD A;  2A6Y A;  1QY4 A;  4JGZ B;  1QNW A;  2JG8 B;  2Y6L A;  3ZPY A;  2CV6 A;  4R4X A;  2GNB A;  5DAX A;  4YVW B;  5A3P A;  5BNO B;  2YC4 A;  2DWR A;  4ZON A;  1GBG A;  4NO4 A;  4XBQ A;  3NJX A;  1RL3 A;  3VBS C;  1FMD 1;  2RM2 1;  3V56 A;  1WBL A;  3WW3 A;  2XLG A;  5LY1 A;  4XW3 A;  3U1X A;  2IXI A;  3VHP A;  3O1M A;  4XIO A;  3RVH A;  3HT1 A;  4HKO A;  4XFG A;  4OMD A;  3JB4 C;  3RWN A;  2KA3 A;  5K7P A;  4AFC A;  4S2H A;  1AYM 1;  4ONU A;  3AXD A;  4G3Y C;  1VBB 3;  3OJB A;  3WY6 A;  4LT5 A;  3WXP A;  2WNU A;  5FYS A;  4COY A;  5T54 A;  2HYX A;  3MIB A;  4YZ3 A;  1K45 A;  1PK6 B;  5GJ6 A;  3RJ2 X;  5JXG A;  1DYP A;  4HKL A;  1XOY A;  3GJA A;  5F39 A;  3LIH A;  1GNY A;  2DCK A;  1AL2 3;  2XL9 A;  3K51 A;  3WG3 A;  3AVS A;  2VH9 A;  3MW2 A;  2P3Y A;  4GB3 1;  1NY7 2;  2QZ3 A;  4DOU A;  4AEM A;  4OLL A;  3IPV B;  3GDB A;  1O8S A;  5IVJ A;  1H4H A;  3D3A A;  5SV5 A;  3O1V A;  4QB6 A;  5IK4 A;  1N3Q A;  5JI9 A;  3AB0 A;  1PO1 3;  3LDR A;  5F6K A;  2VVF A;  5B4N A;  1QDC A;  2WO3 A;  3VZJ A;  4QGN A;  2CAU A;  2WUH A;  2VMI A;  3EBR A;  1GFF 2;  2JDY A;  3DPR A;  5IFP A;  4LO4 B;  3ZM8 A;  1CAV A;  1GU3 A;  1W3V A;  1LOG A;  4IEP A;  1KS5 A;  3JU9 A;  4JX0 A;  4NJ4 A;  3ZKY A;  4YGC A;  1AR7 3;  4RGK A;  2FZ2 A;  2JG9 C;  1ENX A;  2QQW A;  5FK7 A;  1HQN A;  4GJY A;  1RIR A;  2JIJ A;  5HV0 A;  4RQP A;  5LK7 B;  2VGD A;  3LE0 A;  2QQV A;  1W3X A;  3WNX A;  1HV1 A;  2UUR A;  1WW6 A;  1RUH 1;  2A7A A;  4XPV A;  2PHR A;  3FWE A;  1LOA A;  3KQ4 B;  3VL9 A;  2ES3 A;  3TEZ A;  2XUM A;  3IDA A;  2P34 A;  5GZG A;  1GIC A;  1GWK A;  3EB7 A;  3WHU A;  4HSJ A;  2R49 A;  3ILR A;  1OPM A;  4F7Z A;  3G6J B;  1KJL A;  3GZU C;  2D43 A;  2JDN A;  4I30 A;  2OUH A;  4P02 B;  1TE1 B;  3M3Q A;  4QXH A;  4XAA A;  4FO9 A;  4PJY A;  1RB8 G;  1BVV A;  1FMD 3;  3WR0 A;  1ZNP A;  1LES A;  3E6C C;  1X33 A;  1I6X A;  5GZF A;  3I2G A;  4TLG A;  3VDD A;  1FNZ A;  1W9Y A;  2GC0 A;  2YUE A;  4CXX A;  2HYK A;  4ISR A;  1A8D A;  1AYM 3;  1J3P A;  4HOO A;  2OZ6 A;  4PLO A;  4RS5 C;  4KI5 M;  4XVH A;  3T2Q A;  5A3L A;  2DCT A;  5I8Y A;  2WZR 3;  2WFP A;  5J3U A;  3LOI A;  5FP3 A;  3LCP A;  3FLT A;  2XR4 A;  4NWW A;  3N9P A;  3R6S A;  3HWJ A;  5F5A A;  1W9S A;  4JTO A;  4GB3 3;  5C7G A;  2WWS A;  5FPV A;  3DN7 A;  2JG8 C;  2WS9 2;  1LOF A;  1TNF A;  3PU8 A;  1UKR A;  2QDR A;  4XC9 A;  1GP5 A;  3DYO A;  4LO7 A;  4YW5 A;  3H8X A;  3NQH A;  3B9C A;  4MH0 E;  2VCM A;  4XUR A;  4XQ4 A;  2YMZ A;  1QU0 A;  3HD8 B;  1D7P M;  2ZGN A;  4ARX A;  5C3Q A;  3C7H A;  1J84 A;  1GSL A;  1POV 0;  3NJY A;  5GKA C;  1F15 A;  2JDU A;  4V1P A;  5FLH A;  3M2M A;  3K4A A;  4KG8 A;  2B46 X;  1UNB A;  4UBH A;  1VBB 2;  1PK6 C;  1UOB A;  3ROU A;  1V6I A;  1QXJ A;  4OUM A;  2OQ7 A;  1RUH 3;  5LA1 A;  2FDI A;  1W0P A;  3AP7 A;  1WLT A;  1O6U A;  4AHZ A;  4C91 A;  1QQP 3;  2Y6H A;  2IXH A;  5KC6 A;  4AOC A;  1AL2 2;  4OUS A;  4BU2 A;  2VOX A;  4YLZ A;  4E4H A;  1ZM1 A;  4Y1V A;  2Q8O A;  4GKX A;  1QGL A;  1UZW A;  2YC2 A;  2GN7 A;  2YC0 A;  4O7X A;  5IJR A;  1T6G C;  1BEV 1;  4FOQ A;  2E6V A;  2VUJ A;  2WZP P;  2A3X A;  3POS A;  4MYE A;  4EN0 A;  4DEV A;  1GKB A;  2BGP A;  1RUF 1;  1PO1 2;  5FZB A;  3VBS A;  2HLE A;  5FP9 A;  4BLI A;  2WNE A;  4CUA A;  1QOT A;  3POY A;  1PM7 A;  1S0I A;  4Q4X 1;  5C8W A;  2J1V A;  3ASI A;  1WW4 A;  2XXZ A;  3TN9 1;  3ZXF A;  3VBH C;  2W68 A;  1IKP A;  2EIE A;  4QX5 A;  4ZU7 A;  1AR7 2;  4LKD A;  4PDW A;  2QQO A;  5KXC A;  4Q0V A;  1S4C A;  1U5Z A;  3TBD A;  2GNM A;  2C24 A;  3PUS A;  1OF4 A;  3PTY A;  4XE9 A;  4OZX A;  1X9P A;  3UKN A;  3BPS A;  3J7N A;  1ZA7 A;  4OHZ A;  3THC A;  3QH6 A;  1RUJ 1;  5IK8 A;  2FDF A;  4KL1 A;  5JVV A;  1EV1 1;  4Y26 A;  2DFB A;  3OTF A;  3VBU A;  4XF4 A;  1X8E A;  2AC1 A;  1DDL A;  1FMD 2;  1CAW B;  3K75 B;  2XJU A;  1OA4 A;  1QJY 1;  5CIR A;  4HZF A;  3NAP C;  2CGO A;  1W8H A;  4XFH A;  2WA3 A;  4IEZ A;  4RYD A;  3IDC B;  2WWJ A;  1AYM 2;  2ZZQ A;  1O8P A;  3CZJ A;  4K1Y A;  4LUL A;  4W50 A;  4XFB A;  4AI1 A;  2OA2 A;  5EQU A;  1RJ7 A;  2ZKL A;  2J22 A;  5ACA 3;  4Y22 A;  2WZR 2;  3ZSJ A;  1DP0 A;  5KXB A;  1NKG A;  3FFZ A;  2XLA A;  4FXK B;  5L73 A;  3UKT A;  4IEQ A;  3WP3 A;  1ULO A;  1GQG A;  1UO9 A;  3WUC A;  3RDI A;  4B7K A;  1LCL A;  3BTA A;  4JQR A;  4QKN A;  4TLF A;  5CAD A;  3MEP A;  4GB3 2;  4MGI E;  5JAX A;  3RZK A;  3AZY A;  4AEJ A;  2PHF A;  5HXV A;  1C8M 1;  1W0O A;  1BEV 3;  2P6C A;  5CFC A;  1UL9 A;  4AQT A;  1TMF 1;  2GP5 A;  3D0J A;  4AI9 A;  4RHV 3;  3RI8 A;  4BE3 A;  1ULP A;  3O0X A;  1RUF 3;  1JUI A;  2VBB A;  4D0Q A;  2R07 1;  3HBZ A;  2OUJ A;  4Q4X 3;  3VB9 A;  4JGY B;  3TN9 3;  4TZD A;  1HQL A;  2ZEY A;  3O1P A;  3WF0 A;  3J9S A;  1UXX X;  4QHO A;  4CCK A;  4Z92 B;  3SNM A;  5JSO A;  1REE A;  2RS1 1;  3TYJ A;  5FYB A;  5H9P A;  5CFD C;  4I2O A;  2H0V A;  1J83 A;  2MHF A;  4NII A;  1ZRD A;  4LBJ A;  3GYD A;  2O8Q A;  1YCI A;  1MS5 A;  2D6O X;  1OQE A;  5CZK A;  1RUH 2;  2GC2 A;  1GR3 A;  4HK9 A;  2VR4 A;  4E9K A;  1RUJ 3;  2OYZ A;  3THD A;  1ZA4 A;  3W21 A;  3H8O A;  1W9W A;  5FRE A;  5JXJ A;  5LEK A;  4CPB A;  2YHJ A;  4ITC A;  4XMI A;  2E32 A;  1O5L A;  1IPK A;  2CL2 A;  2JD4 A;  4K40 A;  2FDJ A;  4B4P A;  3VBF B;  2NMO A;  2UY9 A;  2XH6 A;  4BIF A;  1UZ0 A;  1YXW A;  2AZ5 A;  4JRL A;  3VLB B;  1XXN A;  4ES9 A;  4AFA A;  4LBK A;  3LDB A;  4ATF A;  3RZZ A;  4UF0 B;  1SBD A;  3D5O A;  5DUU A;  2LRP A;  2BNO A;  5GLV A;  1IQD C;  2NQY A;  2YU2 A;  2VY0 A;  1EUU A;  1VIW B;  2E9Q A;  1JW6 A;  2YG0 A;  3JQX A;  2FCT A;  3D6E A;  4P00 B;  1G8W A;  2EIG A;  4CCE A;  4FAG A;  3B9I A;  2VTX J;  2PHU A;  1MS9 A;  5E6H A;  2JE9 A;  5J1X A;  4EN8 B;  3WDV A;  4C0B A;  4NOT A;  1SPP A;  1YI7 A;  2VUA A;  4QHZ A;  4AK3 A;  3PUH A;  1EPZ A;  1IS6 A;  3RS6 A;  5CKQ A;  3LSE A;  5JOY A;  4TTG A;  1I9R A;  3BOW A;  1CPM A;  4FCA A;  1R1Z A;  1W2N A;  1H9W A;  4Y20 B;  3ILN A;  2WYS A;  4DXR A;  1TMF 3;  1AZD A;  1NG0 A;  3OPW A;  3MFA A;  3CLP A;  1R64 A;  3GBG A;  2X53 S;  1NOV A;  4X8P A;  5CU1 A;  5LA2 A;  4CCD A;  3KCY A;  3B01 A;  3W5M A;  1ZBE 1;  3I2H A;  4IV3 A;  4B1M A;  2YPD A;  2WAO A;  4NRO A;  2FMD A;  3ABZ A;  2JXA A;  4LR4 A;  4NHM A;  4DUV A;  4CCL A;  1VMH A;  2ZGP A;  4YGD A;  2D7F A;  3VBH A;  1WW7 A;  4K7J A;  1NXD 1;  1DFQ A;  2VOV A;  3OBR A;  1IPJ A;  1W6M B;  2SBA A;  1H1I A;  3KT7 A;  1B35 A;  1VAL A;  2RS1 3;  3DEM A;  3J26 N;  1FPN 1;  3M3E A;  5FZH A;  5T50 A;  2AEN A;  4AGV A;  4HBN A;  4FVV A;  3S7E A;  3KWV A;  1SHW B;  4R52 A;  1CD3 G;  3AKQ A;  5GZD A;  5ACA 2;  2X09 A;  1SZB A;  2G4I A;  2LM3 A;  3D4K A;  1UMH A;  1HX6 A;  2WII B;  3S7I A;  2VUC A;  1JZ3 A;  4P9L A;  5IVE A;  1HJG A;  4LE3 A;  1DGR N;  3B5L B;  3NJV A;  4I0A A;  2QDN A;  5FZ6 A;  2UWA A;  3FLP A;  5JR7 B;  4D7T A;  1W9F A;  4AQ6 A;  5FPU A;  5A33 B;  1FOD 1;  1ENR A;  1BEV 2;  4Y4R A;  4D7Y A;  5I91 A;  3RG0 A;  1RVF 3;  3N9N A;  4JCK A;  4P14 A;  3NNM A;  5F9T A;  2ZCW A;  1JHJ A;  1RUF 2;  2D44 A;  4GXL A;  1WCK A;  5K9Y A;  2J1A A;  5IVF A;  3J7L A;  4Q4X 2;  3WLU A;  2BOJ A;  3LEK A;  3TN9 2;  3ZR5 A;  3N7K A;  1OH4 A;  4AI3 A;  5BNP C;  5FZ0 A;  4JDO A;  3WT3 A;  1SQ4 A;  5IW0 A;  4PIX A;  5GLU A;  3R0R A;  4XFI A;  5JR2 A;  1AR6 1;  1YO8 A;  4N9I A;  2ZML A;  4YWA A;  2X5I C;  1JYC A;  1QDO A;  2ZAC A;  3H42 B;  2PAE A;  3I8T A;  1T6B X;  1OLM A;  1S2K A;  2PHT A;  2WO1 A;  4N9H A;  4FTE A;  1A34 A;  4I3G A;  2JD9 A;  4XOG A;  3T0D A;  3WW1 A;  1RUJ 2;  2XG3 A;  4RFR B;  1Q8S A;  2UYA A;  4LA2 A;  5C3P A;  4Y4Y A;  3A0N A;  5EPA A;  3WNM A;  4AQS A;  4XF1 A;  2BYV E;  2PLV 3;  2OXB A;  3KQR A;  2D6L X;  4IEO A;  1ZBE 3;  5FY0 A;  1ODM A;  4HSL A;  1N3P A;  2JDP A;  1YJK A;  4GAZ A;  5D8A A;  4QXB A;  4YAR A;  2P37 A;  4CP9 A;  3C7O A;  1SFP A;  1RXG A;  3K2O A;  1VP6 A;  2WNU B;  4FPE A;  4QKD A;  4FFF A;  4E8D A;  5JXI A;  1RUC 1;  1UAI A;  2PYT A;  3E6B A;  1FPN 3;  1ENQ A;  1O4Y A;  2WDB A;  3ATG A;  4FPO B;  2DVB A;  3H0O A;  5CFD A;  5DMY A;  5FXZ A;  4XCA A;  4DXS A;  1H8T A;  1QMJ A;  1LGN A;  5F3G A;  5FKB A;  1LOD A;  1DIW A;  4LQR A;  2NYY A;  5FY7 A;  2W3J A;  2Y34 A;  2RDR A;  1IHM A;  3CZU A;  3M7A A;  3MBW A;  2P2K A;  5A70 A;  5J48 A;  2D93 A;  5F32 A;  1AXK A;  5FYC A;  1FOD 3;  3ZN6 A;  3PIJ A;  3OPZ A;  3TNQ A;  4XJ9 A;  1TMF 2;  1NA1 A;  2WRA A;  4JZR A;  3DPR B;  2WQ4 A;  4GH4 C;  3S5Q A;  5GZC A;  3GGL A;  4FFG A;  2A73 B;  4ZZ5 A;  1DU3 D;  4NUB A;  1CAV B;  1HIX A;  3ZSM A;  1ALY A;  2R07 2;  2WN3 A;  4PBP A;  4XEZ A;  3BIW E;  3LDK A;  5FMC A;  2Q1Z B;  4RQP B;  1NAE A;  4OQ9 A;  1YQ2 A;  4EN7 B;  2BVV A;  1GNH A;  4MGZ E;  1YWK A;  3JZV A;  1W6N B;  5A32 A;  4BQ2 A;  5FZO B;  4AI0 A;  3FHA A;  2RS1 2;  1W06 A;  2VQU A;  4JV4 A;  5T5L A;  1JZ5 A;  5FY1 A;  5L9V A;  5GM0 A;  4ASL A;  3M3I A;  2VNR A;  2QNK A;  1X9T A;  3T09 A;  3O0W A;  3PJY A;  4UW6 A;  2XVG A;  5FP4 A;  4AW7 A;  4EZH A;  1Z0H A;  4CP0 A;  2EXI A;  4Y3O A;  5FJH A;  2WAB A;  2HEV F;  4LIT A;  5LW9 A;  4WBB A;  5M0T A;  1LNS A;  1DYO A;  2ZX2 A;  3AYC A;  4KGQ A;  4OUE A;  2XON A;  3SEP A;  1C28 A;  3IDB B;  4XJA A;  3U4S A;  3VDD B;  3UYJ A;  4P9J A;  4G4F A;  3I2O A;  2BP6 A;  2VZR A;  4LA3 A;  4D94 A;  4OCT A;  4Q27 A;  5C9A C;  4MVT A;  1JOP A;  1KS4 A;  2VVE A;  4OMC A;  3T2P A;  3HNM A;  4Q4V 1;  1FXZ A;  4GWN A;  5JXH A;  1O7F A;  1S0F A;  1GUI A;  1GZW A;  5J7M A;  1KDM A;  2VCA A;  3PME A;  2DBN A;  4FPL A;  3VHO A;  4IEV A;  2P3J A;  1G9D A;  4CPB D;  2AEZ A;  4LKE A;  2ZGM A;  3C8X A;  2QJV A;  5L19 A;  1UU6 A;  5T52 A;  4BDV B;  1CAU B;  5FZK A;  4WM8 A;  1DGL A;  3KV5 A;  2WNO A;  2Y33 A;  3FFQ A;  1ZZB A;  2EXK A;  2XQX A;  3WDW A;  3LQC A;  3NO8 A;  5H9R A;  2IFW A;  4ZKT B;  3N7M A;  2K46 A;  1LHN A;  2HEY F;  2RS3 1;  3BTY A;  1UMZ A;  1LJ7 A;  1ZBE 2;  3EMR A;  2XB6 C;  3WSO A;  2WNU C;  5F5Q A;  4FPG A;  2FCU A;  4MZU A;  1BHG A;  2DCZ A;  3VHN A;  2W91 A;  5CBL A;  1O3Q A;  3OY8 A;  3ZO0 B;  4A44 A;  1O4Z A;  5BNP A;  4CEW C;  3VUO A;  2NLR A;  3N7J A;  4QQP A;  5FP7 A;  4B8E A;  5FYH A;  4FP2 A;  1R08 3;  3HNY M;  4NHY A;  1RUD 3;  3CQO A;  4OYU A;  1PX3 A;  4O61 A;  3JQW A;  4UW3 A;  1FPN 2;  1XNA A;  1V9U 1;  1FT9 A;  5B2G B;  4IDZ A;  2X5I A;  1QJE A;  3LPF A;  2UY8 A;  1R1A 3;  1YHF A;  2QQJ A;  2HWB 3;  2CU5 A;  3I3Q A;  1Q56 A;  4UBG A;  1JHN A;  4KWJ A;  1CX4 A;  4B29 A;  4Q8K A;  5JZG C;  3DPR C;  5G04 L;  3VBS B;  1FOD 2;  3TOJ A;  4DPN A;  3TWI A;  4WV8 A;  1C57 A;  4A42 A;  3OSD A;  4M3C A;  2J1T A;  2JDM A;  1GNZ A;  4LO6 B;  1HRV 1;  4MHR A;  2XJT A;  4X8N A;  4WZF A;  1KJR A;  4RQP C;  4Y5S A;  2Y6K A;  3NVC A;  1JXN A;  1EYB A;  2GN3 A;  4Q4V 3;  4PDW B;  1I5P A;  1QKQ A;  2QQL A;  5E89 A;  1DQ1 A;  4JKL A;  4JKM A;  4M00 A;  4QB2 A;  2A5Z A;  2Z4F A;  3NNG A;  3IT8 A;  5AFE A;  1GOF A;  3E5U A;  1SLL A;  2EID A;  3KHB A;  3VKL A;  4LBM A;  1J59 A;  2DVF A;  4ERO A;  1GZC A;  2WS9 1;  5A3T A;  3U75 A;  4J6G A;  4Y5Z 0;  1KQR A;  2VM9 A;  3DF0 A;  3OGV A;  4BQ4 A;  1S1A A;  1VPH A;  1UYP A;  3JBG 3;  1N1Y A;  1K5M C;  4QKF A;  1UIK A;  1OA2 A;  2VW0 A;  3VBU B;  4JAA A;  4C0H A;  5FOB B;  2F17 A;  5LRS A;  4LJH A;  3VDD C;  3RZL A;  3RSJ A;  2UWB A;  5JIA A;  3LFM A;  3ES4 A;  5DAP A;  4J1W A;  2RS3 3;  1HQW A;  3FC0 A;  2NZ9 A;  3AYE A;  3KF5 A;  2PQS A;  1UYZ A;  3ORJ A;  1CIW A;  3A22 A;  1VBB 1;  2ZJC A;  5A7Q A;  3WP4 A;  2RMU 1;  4BME A;  1MVE A;  2ZTN A;  5A7W A;  4YM3 A;  4JVA A;  4CXY A;  3HN3 A;  2PFW A;  4LBN A;  1FX5 A;  4Y22 B;  3V64 A;  5A7N A;  3R4D B;  3ZSK A;  4D3W A;  1RMU 3;  2B9U A;  2FMY A;  4DMI A;  1QH7 A;  1AL2 1;  4O9G A;  1VAK A;  2BTV C;  4TSV A;  3B7M A;  4Y24 A;  2BNN A;  1LOF C;  5IVV A;  5HV4 A;  2RR1 3;  4PI2 A;  2ZKN A;  4YM1 A;  4AVS A;  3D0S A;  5KWR A;  5CFC B;  1W8W A;  2BEO A;  5KHG A;  4COV A;  1GP6 A;  2Q8C A;  3PU3 A;  2GC3 A;  3I3B A;  2WFF 1;  3QAC A;  1GOG A;  4RGG A;  1LHO A;  5LRR A;  3GZT B;  2C9A A;  3TAY A;  3M1H A;  1TNR A;  3KLS A;  4FQ4 A;  4IUG A;  5DAV A;  4E8C A;  2VTF A;  1HRV 3;  1U5I A;  4BIO A;  1AR7 1;  1SEF A;  5CIS A;  3U37 A;  1UXZ A;  4H7L A;  5A7S A;  5C9A A;  1J1L A;  1BCX A;  2AUY A;  2ZOE B;  2JEN A;  4Q8L A;  1J58 A;  1LB2 A;  1LHV A;  3VD3 A;  1D2S A;  1DZT A;  4D6Q A;  5LAT A;  2ARE A;  5FOJ B;  5I8T A;  2D40 A;  3RZH A;  1R08 2;  2ZX3 A;  4BOW A;  2WSV A;  2OPK A;  5BPX A;  2WT1 A;  2E31 A;  4QHB A;  4YZ4 A;  3SCF A;  4BWO A;  4DZG A;  2BVB A;  5CVR A;  4C1W A;  5LBF A;  2QQP A;  2VMG A;  2ZEX A;  5IVY A;  2HWB 2;  4CUB A;  2W39 A;  1XNT A;  1G7Y A;  1LKN A;  1CON A;  3G7D A;  1AX0 A;  4YW2 A;  4W6Y A;  4HG6 B;  3ST7 A;  4D7S A;  5ANQ A;  3CIH A;  2XKO A;  4YVS A;  2W1S A;  3EYP A;  1XU2 A;  3R05 A;  1Y9Q A;  1UX7 A;  4YFW A;  4AE2 A;  2VQ0 A;  2WA4 A;  4PDW C;  5A1L A;  5F3C A;  1IG0 A;  1XBF A;  3MUZ 1;  2RMU 3;  3WCR A;  1HV0 A;  3LFI A;  4PQ9 A;  5HXM A;  2WZR 1;  3JXS A;  1UU4 A;  4Q4V 2;  4CU6 A;  1H30 A;  2DUR A;  4CEW A;  4XIK A;  4BQ3 A;  2ZGO A;  1EPW A;  5G05 L;  4QM9 A;  5A7P A;  1PMJ X;  1SPP B;  1WBF A;  4K21 A;  2H6C A;  2R6Q A;  3GZA A;  3DYM A;  4Q26 A;  3CDZ B;  4NMI A;  2Q0A A;  4IEU A;  4QDR A;  3VBU C;  4YYO A;  2BV4 A;  3JCI A;  4LHK A;  3INA A;  3WF4 A;  1KXG A;  2DYC A;  2MPF A;  2R1B A;  2Q1F A;  1ZRE A;  4W65 A;  3MHZ A;  4BLJ A;  1VAM A;  2C5D A;  2WFF 3;  4UI9 L;  5APA A;  5JZG A;  1Y7B A;  4IV3 B;  4MLO A;  5FPA A;  3I54 A;  1OFS A;  5T3N A;  5AVP A;  2JDA A;  3RWK X;  4IGP A;  4CCC A;  1ZZ8 A;  3DV8 A;  2RS3 2;  3W58 A;  1CJD A;  3VBH B;  4QDS A;  3KZ4 C;  1DQ6 A;  4LKF A;  4LIU A;  1LED A;  2P5B A;  3K4Z A;  1B35 B;  3SH5 A;  2RDS A;  3FHI B;  3HQR A;  3WQ1 A;  2D6K A;  5FY4 A;  1A8M A;  1MS3 A;  2HBT A;  1U12 A;  2PTM A;  1JYT A;  1UKG A;  3TEX A;  2X10 A;  3A4U A;  5LBE A;  1QQP 1;  1SDW A;  1PM4 A;  3T3Y A;  5T5J A;  3MIG A;  1V9U 2;  3VZO A;  2D97 A;  2F6B A;  3FLR A;  3VZM A;  4LUM A;  1XB9 A;  5CFC C;  2J1U A;  2R0H A;  3GCX A;  4OI1 A;  2I2S A;  4ORF A;  1VMF A;  4IV1 A;  1W6O A;  1ODN A;  2RR1 2;  1F2N A;  1UQX A;  4XF3 A;  4QPG C;  2VOW A;  4Q1R A;  1K5M A;  5JOW A;  3LEG A;  1GWM A;  4G9S B;  3TEY A;  3SKV A;  2ETE A;  2BJS A;  5BNQ A;  5DZF A;  1DGW A;  4A7Y A;  1WLD A;  4KBB A;  2YGM A;  3NAP B;  1G9A A;  2IWG B;  1HRV 2;  2ZGQ A;  2DUQ A;  3AP4 A;  4XTM A;  1OLR A;  4YW3 A;  1D4M 1;  1I1E A;  1YJL A;  2ZGR A;  3GHM A;  4XUN A;  4OI4 A;  2W1U A;  1SDD B;  3ZFG A;  1PNF A;  2N7G A;  3LAG A;  4JC1 A;  3EXU A;  4YZ5 A;  3W59 A;  2B7Y A;  4K1Z A;  1W8N A;  2ZEZ A;  5FK8 A;  4D69 A;  4A7Z A;  4BYY A;  1UMI A;  3VBR A;  4QXC A;  5EYY A;  1SMV A;  5FUN A;  4EN9 B;  2Y0O A;  3KV6 A;  1GAN A;  3OBZ A;  4Z2W A;  3V65 A;  2HWF 3;  1QJU 3;  2VE1 A;  4BIS A;  5IK5 A;  1SBE A;  1WZX A;  4YRD A;  4AEK A;  1L7Q A;  1Y9M A;  2B42 B;  3DKQ A;  4S2F A;  4BK5 A;  4CDW B;  2NP0 A;  3ZYB A;  1PO2 3;  3HQU A;  2IFR A;  2P4E A;  4CE8 A;  1NE6 A;  1JOB A;  4WVW A;  5D8A B;  2R7E B;  2IXJ A;  2Y8K A;  4XFC A;  5H9Q A;  4CP9 B;  5A1F A;  1OF3 A;  4EN6 B;  1P8J A;  2R04 1;  3IAQ A;  1ZX5 A;  4RL7 A;  1C8N A;  2JIC A;  3WDT A;  3CBN A;  1IKQ A;  1NUK A;  1Y43 B;  1VBD 1;  2RJL A;  5FPX A;  1OA3 A;  2RMU 2;  4QGL A;  5ACA 1;  4YM0 A;  1DQ4 A;  1LGB A;  3LEI A;  1HRI 3;  4IE6 A;  5CFD B;  1OD5 A;  1H8T B;  1UY3 A;  3K3N A;  4WM7 A;  5FYU A;  3LA3 A;  2HWE 3;  4LBQ A;  2Y64 A;  2O8O A;  2QCS B;  3AZW A;  4Y1U A;  2JB8 A;  2CWS A;  1SBF A;  4LOT A;  3POG A;  3KVB A;  4L99 A;  3URF A;  5AFB A;  4N43 C;  3C7F A;  3RZJ A;  1MZF A;  2BWC A;  1U0A A;  3MIE A;  1NXM A;  3ZN6 B;  2E7T A;  3O7O A;  4CDQ A;  3BU7 A;  4RHV 1;  3UK9 A;  3FL7 A;  4BQX A;  4IV3 C;  1DZR A;  1NA1 B;  5FZI A;  3VKM A;  2BPA 2;  3ZXD A;  1DQ0 A;  1C3H A;  2WFF 2;  3V0A A;  4PQQ A;  1ZRF A;  3ZXL A;  1ND3 A;  3A0K A;  2KM2 A;  1W8O A;  4Q1P A;  3T4V A;  4DIN B;  1B35 C;  2AEY A;  3K4D A;  5FYT A;  2LW8 A;  2VXR A;  4P9Y A;  3BUC A;  1D4M 3;  1ZZ9 A;  4NRP A;  4NVP A;  5A32 B;  4COW A;  1S0G A;  5LEJ A;  4JDM A;  4DRV A;  4WZC A;  3O1S A;  3GZE A;  3ECQ A;  4COU A;  5FJK A;  2BER A;  2BW8 A;  2KXL A;  2ZHL A;  4BCU A;  2VZQ A;  1H1M A;  4R9D A;  3WVJ A;  4BH9 A;  2VQA A;  1W6Q A;  3WZ1 A;  2ADE A;  3PDQ A;  4HON A;  3KF3 A;  2ZZJ A;  4AVC A;  1JH5 A;  1OT5 A;  4LNV A;  5FYI A;  3J7H A;  3ACG A;  2Y38 A;  4GA9 A;  3SCG A;  4ARY A;  4CDU A;  4EWA A;  1WGP A;  4K20 A;  4LMF A;  4AHX A;  3NRU A;  1NZC A;  3CJX A;  1Q8P A;  5A6X A;  2XUE A;  4MAD A;  1K3I A;  1F9K A;  4JKK A;  1ACC A;  5EJZ B;  4O9E A;  1U5X A;  2Q1M A;  4KWU A;  4YGB A;  3IIA A;  2R04 3;  1ENS A;  2W92 A;  2ZGU A;  3MLL A;  3BB6 A;  3E97 A;  1VBE 1;  1VBD 3;  5KBF A;  5C6C A;  3PUR A;  5F1R A;  4XZU G;  5F7U A;  1ASJ 1;  1GZW B;  1OMI A;  1XND A;  3HNB M;  2UU8 A;  5FXW A;  2ZAB A;  2RJ2 A;  3TRS B;  4HET A;  2E51 A;  2XDV A;  1C4R A;  2R30 A;  4GKY A;  3H7Y A;  4J1X A;  1TVG A;  1GQP A;  4L2N A;  2VMF A;  2GAL A;  4WM8 B;  1L7R A;  2AH2 A;  3S30 A;  4HL0 A;  2D6P A;  4CZS A;  1V6J A;  5DZG A;  3CMG A;  1R09 3;  3RRD A;  1IS3 A;  2GH2 A;  3PVB B;  1H6Y A;  1QJU 2;  3H50 A;  4QT6 A;  4UW5 A;  1ND2 C;  2CAV A;  3RYP A;  4QPG A;  4YG3 A;  1ZRC A;  3KCX A;  1SLI A;  1ZRI A;  2JE7 A;  2YBP A;  4RGA A;  5FUI A;  1YFU A;  3ZFE A;  1RJ8 A;  5D8A C;  4RA0 A;  3N9O A;  5L7O C;  1PO2 2;  1W03 A;  4GZ9 A;  2E7A A;  4YG6 A;  1V70 A;  1WCS A;  4BQ1 A;  1IS5 A;  1UOG A;  1UOF A;  2Y0I A;  3VDA A;  2RVA A;  2VO5 A;  3KMH A;  4HN1 A;  4QPI C;  4ATE A;  1RUI 3;  4D6S A;  1JZ4 A;  3OY8 B;  2D3P A;  5A1A A;  2RG4 A;  5BNP B;  3K48 A;  1H8T C;  1DGW X;  2IVI B;  1AUY A;  2XJS A;  4QMA A;  4AF9 A;  4KU7 A;  2QQM A;  1HRI 2;  1QEX A;  2GDF A;  2X5I B;  3RZG A;  4KNC A;  4CXW A;  2HWE 2;  1QQP 2;  1D0G A;  3UT0 A;  2YFZ A;  5F5I A;  1UPS A;  2XHK A;  5I0T A;  3C2U A;  1RTV A;  3FBY A;  1N1T A;  3VD7 A;  2IC1 A;  3MPP G;  5IT6 A;  1ST8 A;  4SLI A;  4BJ0 A;  3PMS A;  4CA9 A;  1NA1 C;  4ET7 A;  2Y6J A;  1OLQ A;  4B3N A;  4BXS V;  5HI0 A;  4TYS A;  5LCW L;  3VZN A;  3AMN A;  3AK0 A;  1JU3 A;  5DDJ 1;  1LOC A;  2MEV 1;  3T0B A;  1RVF 1;  1TG7 A;  1AF9 A;  2IUW A;  5FTT C;  1AYN 1;  1YLL A;  1OVS A;  3DEC A;  3I2F A;  4M3C B;  4NWV A;  4AWD A;  4W6X A;  2TNF A;  1QOO A;  2WWU A;  4CTE A;  2EF6 A;  2RS5 1;  4QX3 A;  5T5P A;  3U78 A;  5A6Q A;  3UJO A;  2FCV A;  3VV1 A;  1MEC 1;  2EVX A;  5IVC A;  2GC1 A;  1CR7 A;  5IVB A;  1Q43 A;  1VBE 3;  2WQZ C;  3LZZ A;  4XQW A;  1JUH A;  1F8V A;  1ASJ 3;  4ZXE A;  2JB4 A;  1D4M 2;  4IET A;  4DEQ A;  4UWD A;  1FI2 A;  5FYM A;  1SLB A;  2PHL A;  2WT0 A;  1JMU B;  4ZS3 A;  4IND A;  3OGS A;  2DFC A;  2Z79 A;  1YFX A;  1XJA A;  5ABJ A;  3WW2 A;  4NHL A;  4Y1X A;  1V6K A;  2OS2 A;  1ULG A;  4MUV A;  1PGW 2;  3MV1 1;  1PNG A;  3IWZ A;  1NCQ C;  2J42 A;  3U4X A;  4N43 A;  4RR3 A;  2CDP A;  1Y9G A;  5GLZ A;  2QUO A;  5FV3 A;  2PLV 1;  1F31 A;  2BOI A;  1OVP A;  3DXT A;  1MS0 A;  3BN6 A;  3BYW A;  4Y33 A;  3D8C A;  4HT1 T;  1SLC A;  3QH7 A;  4GH4 B;  4HAN A;  1S2B A;  2D3S A;  4Z07 A;  2VEC A;  3BTX A;  4OVE A;  2HBU A;  2EA7 A;  1XNB A;  1XSR A;  2WBK A;  5A7W B;  2Y26 A;  5JMO A;  1CAX A;  3BOP A;  4GUL A;  1DHK B;  2R04 2;  3AP5 A;  1KEX A;  3ZXJ A;  3KT4 A;  3F2Z A;  4XBL A;  3NKT A;  1VBD 2;  1VE0 A;  1E5S A;  4MX3 A;  5T55 A;  1VR3 A;  3GF6 A;  2VW2 A;  1GLH A;  3D82 A;  3PTR B;  3KS7 A;  3DGT A;  4UFI A;  4XUT A;  1AHS A;  3O14 A;  3MLK A;  4WM8 C;  4FPK A;  1S0E A;  3NV1 A;  2D6M A;  1DYK A;  4N8M A;  5FY5 A;  1HKD A;  1S0J A;  3ETP A;  4C8D A;  1W6P A;  5CKM A;  1LRH A;  1OPO A;  1SFY A;  2VNG A;  2WZ8 A;  4KBZ A;  1R09 2;  4WVV A;  4ZPI A;  3AL6 A;  2MEV 3;  5DDJ 3;  1W28 A;  4AG4 A;  4KH9 A;  4RHV 2;  3NV3 A;  4CU9 A;  2D5H A;  1JYV A;  1AYN 3;  1BLZ A;  5C3S A;  3M70 A;  3UGF A;  1UPI A;  4DXT A;  4EQV A;  2RS5 3;  4CUC A;  3JB8 A;  1HB3 A;  3POW A;  3MW3 A;  4K3U A;  1MEC 3;  3RYR A;  5C9A B;  5LA0 A;  3IB3 A;  3PNA A;  2G1M A;  4CDX C;  2VMC A;  1PX4 A;  1ZRR A;  2L9L A;  3I59 A;  2YPJ A;  4XDO A;  1UY0 A;  4LBQ D;  1RUI 2;  5EYX A;  4YFZ A;  4QGM A;  1DG6 A;  1BVP 1;  2ZHN A;  2X05 A;  1XC6 A;  2SLI A;  3NNJ A;  1US3 A;  1O5U A;  4MHU A;  1QJX 1;  5E88 A;  2QVS B;  2WL1 A;  1TZO A;  4WVZ A;  3WF3 A;  3OOX A;  2TBV A;  3THT A;  1CWP A;  2W46 A;  3O1U A;  1VRB A;  4AVA A;  1CVN A;  4CP1 A;  1HLC A;  1OUX A;  1L3J A;  1VJ2 A;  2VMH A;  3PHM A;  4V2W A;  4ZXK A;  5IYY A;  1H2L A;  2VMD A;  4BMB A;  3POB A;  2CGP A;  1AXZ A;  4R9A A;  1ZVF A;  3MO4 A;  1C1F A;  3OUJ A;  2KD7 A;  3N9M A;  5DAB A;  5E16 A;  1LAJ A;  1ND2 A;  1UOJ A;  1NX9 A;  3OUH A;  2F4P A;  5FMD A;  4FFI A;  5FXX A;  4HVR A;  4MXW A;  3OEA A;  4LEJ A;  4YVS B;  4ZZ8 A;  5A6Z A;  1RED A;  1WCD J;  4AAP A;  3HIF A;  5L7O A;  2JWP A;  1SCR A;  5FY8 A;  1L7L A;  2BQP A;  1F4A A;  4QPI A;  4TWT A;  3HT2 A;  1RHI 1;  4XTP A;  4LLO A;  1I5Z A;  4CEW B;  2ENR A;  1VBE 2;  1SLT A;  1ASJ 2;  1UYX A;  4MSV A;  4Z82 A;  1QNY A;  1HB2 A;  2XBO 1;  1FNY A;  4HLT A;  2WO7 A;  4IGO A;  1V6N A;  1PGS A;  1UW8 A;  2VCC A;  3MYX A;  3EO6 A;  4NPR A;  4XHX A;  3WUD A;  5FZA A;  4J25 A;  1QJZ A;  1K5J A;  1FV3 A;  1S55 A;  1I3H A;  4IE7 A;  2W95 A;  2DUO A;  3M4F A;  1ULD A;  5F2S A;  4I0B A;  4XIL A;  3WNK A;  2PQQ A;  1JN2 P;  3C3V A;  1ULF A;  3O1O A;  4QX2 A;  3ACI A;  4COZ A;  2XVK A;  4UFM A;  4KU8 A;  1OBN A;  1UY2 A;  4CU7 A;  3O1T A;  4A6O A;  1ULE A;  2C0Z A;  2B8M A;  1YQ8 A;  2JJ6 A;  4ZY9 A;  2WSU A;  4AFB A;  1MPX A;  4YSF A;  3BKZ A;  2NN8 A;  2DU0 A;  5J96 B;  3LGR A;  5JCT A;  1VRH 1;  2AYH A;  3WDX A;  1R08 1;  4U36 A;  3ZXA C;  1RUD 1;  3LPG A;  3O12 A;  4ES8 A;  5JI7 A;  1Z78 A;  3ALQ A;  2J7M A;  4HPK A;  4AQ2 A;  5C3O A;  4ZS2 A;  1QJX 3;  2BWA A;  1C5H A;  4JHZ A;  1X8M A;  1VMJ A;  4XMA A;  5A3N A;  1R1A 1;  3MUY 1;  4Z1V A;  4FQZ A;  2HWB 1;  4MET A;  2OW4 A;  1YC6 1;  4IV1 B;  1W6O B;  4QDQ A;  4NPL A;  1IS4 A;  1NCQ A;  4AAX A;  2UWC A;  5FPZ A;  1K5M B;  1AR8 3;  4P9W A;  2PHW A;  2QBX A;  3IMM A;  4RD7 A;  5J36 A;  2VZS A;  2P17 A;  2C26 A;  5DDJ 2;  5IAT A;  2MEV 2;  1RVF 2;  3CO2 A;  3U14 A;  3ZDV A;  3GAL A;  1AYN 2;  4AL9 A;  5D1I A;  2QQU A;  1DGR A;  4UFK A;  4UFJ A;  1JS9 A;  4IER A;  4E2G A;  3N9L A;  2RS5 2;  1Q8Q A;  2DVD A;  2RV9 A;  4YPJ A;  3SEE A;  1EUT A;  1RHI 3;  1MEC 2;  1QH6 A;  2XHN A;  4PLM A;  3AC0 A;  3ZYG A;  2I07 B;  3ELN A;  3TNP B;  3ZFG B;  1GMM A;  4E4S A;  4EJR A;  1N1V A;  3Q8E A;  4XFA A;  2VZU A;  2XBO 3;  1RUG 3;  2XWB B;  3J7M A;  3VBR B;  5FZ1 A;  2IXK A;  1PGL 2;  5C5U A;  5IUQ A;  4P08 A;  5EJ1 B;  3ZXK A;  2VBP A;  2Z69 A;  3R4U A;  3AZZ A;  3JBG 1;  5FMB A;  4LOR A;  4AHY A;  3I2I A;  3LB9 A;  5LA9 A;  1W2O A;  1PMI A;  2RE9 A;  2JDZ A;  2VC9 A;  4MGK E;  5JWP A;  1ONA A;  2DBI A;  4M0H A;  4N53 A;  3OG2 A;  4CCJ A;  2CNA A;  2R06 1;  1FAY A;  4YVS C;  2PLV 2;  3CEW A;  1HXS 3;  1BK1 A;  1Y3T A;  4HKW A;  4LIV A;  5FZG A;  2VJX A;  2BFU L;  4XXA A;  4UOJ A;  1WMX A;  2AAC A;  2XLF A;  3ETQ A;  1POQ A;  2VUD A;  4DQA A;  4FT8 A;  3M3C A;  3JD7 3;  4KQ7 A;  1UF2 C;  1VRH 3;  3Q8C A;  2ZPX A;  5EV7 A;  5FZF A;  3F95 A;  2JKB A;  3KV4 A;  4CDX A;  4BZ4 A;  3MF6 A;  3FE5 A;  3RI9 A;  1RMU 1;  4WM7 B;  1YEW A;  3IKW A;  2ZBJ A;  4XAC A;  2FD8 A;  1WW5 A;  4P9I A;  3ZPO A;  3L2Y A;  4CEY C;  4Y1Z A;  1J3R A;  2RR1 1;  1WME A;  4AGG A;  3NV2 A;  1OSG A;  4NRQ A;  3IAP A;  4Q4Y 1;  2Q8E A;  3UNP A;  4OQ8 A;  4JGY A;  3WIN E;  1W39 A;  2PMW B;  1W99 A;  1UD1 A;  1PVC 1;  2HH9 A;  3AKT A;  4CDQ B;  2YFU A;  1Q8V A;  2DDU A;  3EHK A;  1WLW A;  4YW1 A;  1UCX A;  3DXU A;  4XBN A;  2QFE A;  4QXK A;  3UJQ A;  1DCS A;  3WV6 A;  2XJV A;  3OCP A;  4HN0 A;  4DFS A;  2Z42 A;  3POJ A;  5J09 A;  3V0A B;  2FDK A;  3AJY A;  5EIY B;  4AXO A;  2XJR A;  1ND3 B;  4I09 A;  4LE4 A;  4BQW A;  5A80 A;  3AYA A;  5KHK A;  5D21 A;  4ISQ A;  3ZFF A;  1KD7 A;  5L9B A;  4IGQ A;  3AMM A;  4UT5 A;  3S5A A;  2ZHK A;  4MGY E;  2VOT A;  5JPN B;  1BMV 2;  1WA6 X;  2W0X A;  5DXD A;  1OOP C;  3HOB A;  2VQT A;  2VZO A;  3LF7 A;  2DUP A;  3J8F 1;  4P5Y A;  1QXP A;  1W6Q B;  4CP2 A;  4L97 A;  2WR9 A;  3Q9O A;  3WG1 A;  4CCM A;  1QJX 2;  3WNN A;  1HB4 A;  4IV1 C;  4UFH A;  3SCH A;  3MIH A;  3A7Q A;  5LZ6 A;  3FHQ A;  2A75 A;  4CDU B;  5T5O A;  4DXZ A;  1XNK A;  4K9S A;  2DTW A;  2A6W A;  3BAL A;  1XPW A;  5K0U C;  4LLF A;  2XWJ B;  2R06 3;  1G6N A;  1AR8 2;  4Q4W 3;  4XUO A;  1RGS A;  1IZ3 A;  1MZ6 A;  4XDP A;  4IES A;  5EXO A;  4LXL A;  1RXF A;  1S0B A;  2H6B A;  3WQB A;  1KGY A;  4QU2 A;  3A21 A;  3VBO A;  2Q30 A;  3LA2 A;  5AC9 3;  4PI0 A;  2WNV C;  2W52 A;  2BBV A;  4E4Z A;  3PL0 A;  1QWR A;  3ZFG C;  1CES A;  1G9F A;  1XNC A;  4GMP 3;  3T30 A;  2BGO A;  3WD5 A;  3MID A;  3IDE A;  4OUL A;  2PHX A;  3VDB A;  1RHI 2;  5GLT A;  2VCB A;  4JRA A;  5FXV A;  1FAT A;  4Q0P A;  3RNS A;  3VBR C;  5IHR A;  1YI9 A;  3DCQ A;  3DKW A;  2XBO 2;  5FZL A;  3O5S A;  1RUG 2;  2ZXQ A;  3KD4 A;  4UW4 A;  3CJI C;  3ZYP A;  5BUV A;  1YQ6 A;  5IWF A;  5C8C A;  4Q4Y 3;  2QQN A;  4FSJ A;  3BVC A;  3VKF C;  4IE5 A;  3GBF A;  3MPB A;  5A3O A;  3SIS A;  2OII A;  4BPZ A;  1XE7 A;  2GZW A;  1PVC 3;  1NE4 A;  2WLQ A;  5F2W A;  5FO8 B;  2NMN A;  2B4K A;  1OHF A;  4QPG B;  5E1R A;  2VU9 A;  2VAU A;  3POF A;  3WF2 A;  1G9C A;  1O3T A;  4BK4 A;  5JIU A;  3ZFE B;  4XAB A;  4A7K A;  2WJS A;  2EIC A;  2A1X A;  4FPY A;  1W05 A;  1OUS A;  2JDH A;  3ZN4 A;  4BB3 A;  1HXS 2;  4KWK A;  2PEL A;  5F8P A;  5JSR A;  1RIT A;  5DAW A;  1W90 A;  3WQ7 A;  3H8R A;  4CRQ A;  3P3P A;  4FPH A;  2YV8 A;  3WG2 A;  1G9B A;  1W8F A;  4NAO A;  1E5I A;  3JD7 2;  5GAL A;  3MV0 1;  2RJK A;  4WM7 C;  1CQ9 A;  2IXC A;  1VRH 2;  2VPV A;  1RUD 2;  4BA6 A;  1HB1 A;  3J8F 3;  4KWL A;  2W1W A;  5FZE A;  3VL8 A;  2B45 X;  3POI A;  2ZGT A;  3P3N A;  1R1A 2;  3ZYJ B;  3N36 A;  4QQO A;  2XGX A;  4BXF A;  4CDQ C;  4AHW A;  4A4A A;  4FTS A;  4ZU5 A;  3LWC A;  4AI8 A;  2WIN B;  1ZZ6 A;  3ZXE A;  1F35 A;  4DS0 A;  5J98 B;  4D6R A;  3KT1 A;  2ARC A;  3J4U H;  5FQ0 A;  1UZZ A;  4GIQ A;  3E5Q A;  4A3X A;  3HAG A;  1ND3 C;  1NLR A;  1GQH A;  4N90 A;  2Q4S A;  4UYB A;  3T1L A;  1O59 A;  4DUW A;  5JPM B;  1H2N A;  3H1W A;  3VZL A;  1POV 1;  1H4G A;  5HPO A;  3CHX A;  4XF9 A;  3R4S A;  5FYV A;  1VLN A;  2EAK A;  4R4Z A;  5FZ4 A;  1GOH A;  4WVM A;  3X29 B;  1S0D A;  1BXH A;  1VBA 1;  4JHT A;  1JBC A;  3O0V A;  3SH3 A;  5FMO L;  5JZG B;  4LUK A;  1US2 A;  5FMO S;  5FP8 A;  5C4W A;  2WKK A;  5ABJ B;  1J1T A;  4YG0 A;  5DPN A;  5FKC A;  4B4R A;  4CEY A;  2VBD A;  1XRU A;  2E7Q A;  1CN1 A;  4FPC A;  4CDU C;  2HWF 1;  3I7D A;  1QJU 1;  1WCU A;  1WLC A;  4CUG A;  1WD3 A;  5H9S A;  3ZLI A;  2X8K A;  1LUL A;  4N43 B;  3JBG 2;  4RR3 B;  4FFH A;  3CF6 E;  1WKY A;  2PAK A;  1CZS A;  4R9B A;  5HBA A;  1MQT A;  4XF0 A;  1DLC A;  1D2Q A;  1PO2 1;  3VKO A;  1RUN A;  1JYX A;  1UY4 A;  4GD4 A;  4IE4 A;  4R8H A;  4Q0S A;  1YYN A;  2A3Y A;  2I45 A;  4NPM A;  2R06 2;  5FBZ A;  4Q4W 2;  3OGR A;  5F3E A;  5FZD A;  3Q8A A;  3BI3 A;  3ZSE A;  1QHD A;  3HBK A;  2VZ3 A;  2XJQ A;  3OB8 A;  4GQ7 A;  4L9B A;  4N7I A;  2OPW A;  2YY1 A;  2AGS A;  1CAX B;  4ASK A;  5FZ9 A;  1OKO A;  5AC9 2;  1KFX L;  3BGA A;  3QD6 A;  3UGH A;  5JDB A;  2CY6 A;  1COV 1;  1HRI 1;  3HQX A;  3N7L A;  5BNN A;  3OBA A;  2E53 A;  1S0C A;  2HWE 1;  1OOP A;  3P1I A;  4QD2 A;  3T4H B;  1RMU 2;  3OYW A;  4AFD A;  3BPZ A;  5FLI A;  3IM0 A;  1AXY A;  1F5F A;  2ORZ A;  2ZGS A;  2FBE A;  1LU1 A;  2YRO A;  3AP9 A;  4OFG A;  2W1Q A;  3ZMN A;  2O1Q A;  4AED C;  5CG8 A;  1W6P B;  5CNA A;  5FYY A;  4FAH A;  4Q4Y 2;  3E6D A;  2R16 A;  1YIP A;  5K4L A;  1GP4 A;  1YFW A;  3ZN5 A;  5LBC A;  3ZFE C;  5CYY A;  1PVC 2;  2ZMK A;  1V6L A;  1U5Y A;  1NQD A;  4LO5 B;  5K0U A;  4B4Q A;  3ILF A;  5EP9 A;  1W6N A;  3V0B A;  2VZT A;  4IEY A;  5FZO A;  1YIF A;  2ZGL A;  4H2A A;  3HPN A;  2XQR A;  3U07 A;  2A6Z A;  4W4Z A;  3CU7 A;  1POV 3;  3OD0 A;  1NCR A;  5JSP A;  2YB7 A;  2LTN A;  3I59 B;  1WCQ A;  1YQ5 A;  4L11 A;  4LOS A;  5ANN A;  1TEI A;  2WNV A;  4FOV A;  5EHD A;  3SQO A;  3CNA A;  4PF1 A;  3I2J A;  5FRA A;  1UIJ A;  1VBA 3;  2C1F A;  5A3M A;  1UU5 A;  1TQ5 A;  2VZV A;  3VDC A;  1KRI A;  1TME 1;  3USU A;  2RM2 3;  4C1X A;  3PVO A;  1PGW 1;  4PF5 A;  4ZHN A;  5FR3 A;  4A41 A;  3J8F 2;  1W2T A;  2G9Z A;  3ZR6 A;  1HW5 A;  3CJI A;  4M4P A;  3WG4 A;  5EFU A;  3U10 A;  1VBC 1;  4CYD A;  1F5J A;  1UX6 A;  1OD3 A;  2QQK A;  4YZ2 A;  5IAV A;  4LHL A;  2E33 A;  3NST A;  4GJZ A;  4L92 A;  1ZBA 1;  5FIX A;  1ND2 B;  1WMD A;  3H1Y A;  4BQ5 A;  4JQT A;  5CEH A;  3H7J A;  5F6L B;  3VD4 A;  3O1R A;  4MXW B;  5C70 A;  5L7O B;  3AX4 A;  3I3M A;  3UL2 A;  3ZXG A;  1NLS A;  2P6H A;  3ME2 A;  4NHX A;  1MAC A;  4QPI B;  4JGZ C;  4W8J A;  4MG2 A;  1XE8 A;  1CAU A;  1GZT A;  1OQ1 A;  3UKV A;  4YVW C;  5BNO C;  1COV 3;  5D2A A;  4NID A;  1LGC A;  1OQD A;  4BM8 A;  5ABJ C;  4MO3 M;  2A6X A;  3PUA A;  1OLM E;  3AVR A;  3T08 A;  4RR3 C;  3EQE A;  1YNA A;  1R09 1;  2GMP A;  2XVL A;  4FP3 A;  3NKG A;  3FZ3 A;  2ET7 A;  4H3W A;  3WP6 A;  3HR9 A;  1IGO A;  1BYH A;  4EE2 A;  3AFG A;  1SFN A;  4OI2 A;  2CHH A;  2GMM A;  2VXJ A;  1EP0 A;  4MXV A;  4QKB A;  4QQH A;  3SLI A;  3T2O A;  3MZH A;  3ITQ A;  3ZVX A;  5I0S A;  2FDG A;  1MVQ A;  1WMF A;  5FAX A;  2TEP A;  2FQP A;  2V5D A;  1RUI 1;  3WOG A;  4PBO A;  1AJK A;  1EY2 A;  4FOW A;  4HXC A;  5JUV A;  1CX1 A;  2XPJ A;  2PAM A;  4IQP A;  3ZYF A;  3IBM A;  5CG9 A;  3AM2 A;  4HPK B;  4P9X A;  1DZQ A;  3RMY A;  3RQ0 A;  2PA7 A;  4RN5 A;  3LD8 A;  4XJZ A;  3MFC A;  1X82 A;  1TME 3;  4M01 A;  1CPN A;  5DN2 A;  2Y60 A;  3AZX A;  4LKS A;  4QX7 A;  3DL3 A;  4PLN A;  4Q0Q A;  3H3U A;  4UFL A;  1VBC 3;  5BYN A;  2OT7 A;  4TXW A;  1NCQ B;  4AFM A;  3NNL A;  2VOK A;  4DB5 A;  2GAU A;  3TB0 A;  1ZBA 3;  1DF0 A;  5JOZ A;  3BIE A;  3ACF A;  3B69 A;  1KDK A;  3ACH A;  3I3D A;  3E1F 1;  3I97 A;  1PZ8 A;  2V73 A;  1XE0 A;  3S6P A;  1O3R A;  1W2U A;  1Z7S 1;  5KXD A;  1MZ5 A;  1XQN A;  3WDU A;  4IW3 A;  3VD9 A;  5A3W A;  5C33 A;  5HCF A;  2WO2 A;  2KR2 A;  2IZW A;  3OUI A;  4X6R B;  4DNY A;  2YU1 A;  5CA6 A;  3M3O A;  4X6Q B;  3WNL A;  4YM2 A;  3UV9 A;  4QX0 A;  4LBO A;  1IG3 A;  4FTB A;  3AKP A;  2A6V A;  5L36 A;  3BTZ A;  1VBA 2;  5IK7 A;  1HN0 A;  5FUP A;  2RM2 2;  1NLQ A;  4CU8 A;  3RMX A;  2Y6G A;  1AR9 1;  2J1S A;  3POE A;  3AKS A;  1Q3E A;  3SC7 X;  4XUP A;  1AX2 A;  2OX0 A;  3E5X A;  3RGB A;  2HWF 2;  4AED A;  1RC6 A;  5LWB A;  3UET A;  4N53 B;  2JG9 A;  4NRM A;  1O91 A;  3SHR A;  1J3Q A;  4H14 A;  5A7O A;  5I0R A;  4EZ4 A;  1GV9 A;  5DAQ A;  3VD5 A;  4CVU A;  4A6S A;  2WZE A;  4QAW A;  1JI6 A;  2Z2S B;  3MIF A;  1W8U A;  2ADD A;  3AMQ A;  4IEX A;  1V00 A;  4LBL A;  4UXA A;  2HWC 1;  5F37 A;  1JU4 A;  4A3Z A;  2PN5 A;  3KB5 A;  4N7U A;  4CDX B;  2V72 A;  4L0P A;  2G9G A;  1EAH 1;  2EXJ A;  1ZZ7 A;  3KHC A;  2VNO A;  4M0N A;  1WA4 A;  2A70 A;  4NE9 A;  1COV 2;  3GHN A;  4V2V A;  4XJ8 A;  2D98 A;  4CCN A;  1SG3 A;  1M4W A;  1OUR A;  2ILM A;  2NPI A;  4E4D X;  3DYP A;  2R32 A;  3III A;  1PHM A;  3ZIX A;  5TSW A;  1REF A;  3GXU A;  2B5H A;  3KV9 A;  3OGG A;  5KXE A;  4RS5 A;  3HN1 A;  3WEZ A;  3L9J T;  1RUE 1;  3ES1 A;  4H55 A;  3HMY A;  4IL7 A;  4CSW A;  1BZW A;  4P5H A;  4YW4 A;  1RYY A;  1LOB A;  5JOX A;  2YXS A;  5FPB A;  1Z7S 3;  4OZO A;  1X7N A;  2CWM A;  1VB2 A;  5LAS A;  2IVJ A;  5A6Y A;  2GU9 A;  1GZ9 A;  3ZFF B;  5FY9 A;  4LHN A;  1CJP A;  4IXL A;  4EWE A;  4JGZ A;  2JG8 A;  2V5Y A;  3ZYR A;  1EV1 3;  5FZ3 A;  3UGG A;  4YVW A;  1PGL 1;  5BNO A;  1JTZ X;  1PMH X;  3SH4 A;  4MOA A;  3I4I A;  2JIG A;  3USS A;  3LKJ A;  4EYU A;  5EJ3 A;  4F83 A;  1S2E A;  1TME 2;  1V0A A;  3PVE A;  3HVD A;  1QJY 3;  2GP3 A;  1AR9 3;  2OZJ A;  1NQJ A;  3EJK A;  4YZ1 A;  1AL0 G;  3LEM A;  4O65 A;  3SKJ E;  4AVB A;  3P6B A;  1D4V B;  1VBC 2;  1MS1 A;  1MS8 A;  4QWN A;  5BY5 A;  1AVB A;  3HEI A;  5GLW A;  3IZO A;  4JDN A;  2HWD 1;  3AL5 A;  4KGG A;  1ZBA 2;  3VN4 A;  2JEM A;  1PK6 A;  5DUV A;  1QIQ A;  4DY5 A;  5FZC A;  5J37 A;  2BDR A;  2VZ1 A;  5KC5 A;  4LK6 A;  4LTA A;  4M3C E;  2WQ8 A;  3MF9 A;  2XOM A;  4I0W B;  5LK5 A;  1XYP A;  3VBO B;  1WUV A;  2EAA A;  5FLJ A;  2VW1 A;  2HWC 3;  4XJU A;  4MV2 A;  2ZS6 B;  4OHV A;  1ZZC A;  3W9A A;  3IPV A;  2WYF A;  2ID4 A;  2A71 A;  1C8M 3;  1EAH 3;  3H3Z A;  4XFF A;  1RIN A;  4XYX A;  5CB7 A;  5L9R A;  2YZ4 A;  1BJQ A;  4H7M A;  4Z2A A;  2GH8 A;  2XKP A;  1CZT A;  2EIB A;  4FOY A;  2FDH A;  4QQL A;  2VVD A;  3AMP A;  2R07 3;  5FO7 B;  4AVT A;  5HCA A;  2ET1 A;  5C8C B;  1A6C A;  2XL7 A;  2GNT A;  4HVO A;  3TEW A;  5I0U A;  2OQ6 A;  3AXE A;  4YW7 A;  4N53 C;  3ZYH A;  3ON7 A;  1NT0 A;  2C6S A;  1M06 G;  2ERF A;  2RHP A;  2ORX A;  1RUE 3;  4XCB A;  2LAL A;  4M4R A;  1QF3 A;  3FN9 A;  3I2D A;  4F8A A;  2E26 A;  1JYW A;  2ZAA A;  2I74 A;  3HJR A;  2CDO A;  3CL1 A;  2JKX A;  3MGU A;  4RFT 0;  3VKN A;  1K12 A;  1BMV 1;  1W04 A;  3ACL A;  2BNM A;  2XML A;  2Z5W A;  2K2S A;  4BHP A;  4QM8 A;  4AI2 A;  4Y1Y A;  1V6O A;  2DU1 A;  2E63 A;  4PT6 A;  1QOS A;  2X29 A;  2HJI A;  5FWJ A;  5LBB A;  3PVN A;  4Q5O A;  3MI8 A;  4YW6 A;  2ZEW A;  4JGY C;  3NWK A;  4DRR A;  1SLA A;  5C71 A;  4QPY A;  4B7E A;  1B09 A;  4OI0 A;  2GME A;  1N47 A;  1OH3 A;  3NAP A;  5EWS A;  1Y4W A;  1AR8 1;  3FX3 A;  4NIG A;  2RDQ A;  3KGL A;  1DQ5 A;  3FBM A;  5FQ0 B;  5GZE A;  2VD7 A;  4OHY A;  2HWD 3;  2W87 A;  3THP A;  1ULC A;  1MR5 A;  5FZ7 A;  2K0G A;  2XJP A;  1UWW A;  2WLP A;  2YDE A;  1H8V A;  3H1M A;  3ZFF C;  3RYK A;  1HDK A;  2O0O A;  1Z7S 2;  3P5B A;  2YBS A;  2HKX A;  2JDK A;  1URX A;  5DG2 A;  4JTN A;  4AVV A;  3KVA A;  1H2M A;  5DZE A;  3AFK A;  5IAX A;  2YGL A;  3WHT A;  4WVM B;  2GND A;  1BK0 A;  3VBF C;  1YRZ A;  5CKN A;  3ZMO A;  3BCW A;  1RUG 1;  1EV1 2;  1A78 A;  1XSQ A;  2DV9 A;  5C4W B;  3ZKU A;  3C7G A;  2VUL A;  2VME A;  4CEY B;  2ZHM A;  1BKZ A;  3ZYI B;  3IN9 A;  3SIT A;  2DTY A;  1AX1 A;  3K77 A;  3VHR A;  3GCW A;  3NW4 A;  3FUO A;  1QJY 2;  1AR9 2;  2C4X A;  4KMQ A;  5HCB A;  1H2K A;  1MQT B;  2W47 A;  3H8U A;  3Q8B A;  2VTX A;  1HXS 1;  4GWI A;  1JYN A;  1BBT 1;  3MLJ A;  4XET A;  3WW4 A;  1VB4 A;  4QU1 A;  4XZP A;  1UY1 A;  5DUW A;  3VBO C;  3MDP A;  1WWY A;  3JUU A;  3N3H A;  1Q8O A;  3OEB A;  5DQ0 A;  5E8A A;  1VAV A;  1SCS A;  4XJW A;  1H6X A;  3NJZ A;  1CGP A;  1AJO A;  3JD7 1;  4L8Q A;  4MGQ A;  1W9T A;  2HWC 2;  4UAP A;  1QXR A;  3I3E A;  4U2A A;  4FPF A;  4IEW A;  4F3J A;  3WNO A;  3B94 A;  5BNN B;  5C3R A;  3SXW A;  3T2T A;  3OF1 A;  4QPW A;  3ZX7 A;  1C8M 2;  1EAH 2;  1O4T A;  1OFN A;  1OOP B;  2QKD A;  2DCJ A;  2VNV A;  2BBA A;  1LEN A;  1IPS A;  2WT2 A;  3FJS A;  3NMB A;  3OYW B;  4YNI A;  4E2Q A;  5C8C C;  5CAZ A;  1PIV 1;  2HEW F;  1YUD A;  3GBW A;  3OPT A;  1JZ2 A;  1W0N A;  4QX8 A;  4DUX A;  5FBJ A;  2ATF A;  3M8L A;  5FPL A;  3OGJ A;  4URA A; 
#chains in the Genus database with same CATH homology
 1ZRI A;  1F35 A;  1JOD A;  1JYT A;  1JOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...