3AL5A

Crystal structure of human tyw5
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
308
structure length
302
Chain Sequence
QHLPVPRLEGVSREQFMQHLYPQRKPLVLEGIDLGPCTSKWTVDYLSQVGGKKEVKIHVQMDFSKNFVYRTLPFDQLVQRAAEKHKEFFVSEDEKYYLRSLGEDPRKDVADIRKQFPLLKGDIKFPEFFKEEQFFSSVFRISSPGLQLWTHYDVMDNLLIQVTGKKRVVLFSPRDAQYLYLKGTKSEVLNIDNPDLAKYPLFSKARRYECSLEAGDVLFIPALWFHNVISEEFGVGVNIFWKHLPSECYDKTDTYGNKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMVLHIQDKAYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords JmjC domain-containing protein C2orf60
publication title Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
pubmed doi rcsb
source organism Homo sapiens
total genus 73
structure length 302
sequence length 308
chains with identical sequence B, C, D
ec nomenclature ec 1.14.11.42: tRNA(Phe) (7-(3-amino-3-carboxypropyl)wyosine(37)-C(2))-hydroxylase.
pdb deposition date 2010-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3al5A01
4V2VA 2OT7A 3KV9A 5F5CA 5FZBA 3U4SA 5FZ4A 5FYCA 3PU8A 5FZOA 5FYHA 4DIQA 5FYSA 5A1FA 5FYUA 5FP4A 4QX8A 3KV6A 5FZIA 2Q8DA 4LIUA 5F39A 5F5AA 4QXHA 2GP5A 2Q8CA 5FZHA 4CCNA 5A3PA 5FPUA 3N9QA 5LY2A 5FPBA 5FZDA 5FYTA 4BU2A 4NUBA 5FWEA 4CUGA 4QX7A 4CCKA 3OPWA 5F2WA 5FY1A 4C8DA 5A7NA 5IVVA 3N9MA 5FJHA 3LD8A 2VD7A 5A7PA 5FY7A 3N9OA 5FXWA 2YBSA 3KVBA 2OQ6A 2OX0A 3NJYA 4GD4A 5F32A 4CCLA 5F3GA 4ASKA 5F2SA 5FZEA 1VRBA 5A3WA 2XDVA 5FUNA 5FY0A 5A7OA 5FYYA 5FZKA 5ANQA 4CCOA 2YPDA 4HONA 5FYBA 4Y4RA 5F37A 3N9PA 4HOOA 4BISA 5LW9A 5FZFA 3DXUA 4CCMA 4D6QA 3LDBA 5A7SA 3PU3A 4IGPA 5K4LA 5FPVA 4XDPA 4Y3OA 5FZOB 4GJZA 5A3NA 2XUEA 4GJYA 3KV5A 5IVYA 4UF0A 4IGQA 4QXCA 4DO0A 5ISLA 5FYVA 4EZHA 5LWBA 2YBPA 5FZAA 5F3EA 5A80A 5FY9A 4E4HA 5FP9A 5FP7A 3N9NA 5F5IA 3PDQA 4BXFA 5FPLA 5FY5A 5FZ3A 3K2OA 3PUSA 5IVFA 2YU1A 4LITA 5F3CA 3U78A 4CSWA 5FWJA 3ZLIA 5IWFA 2OS2A 2YBKA 3K3NA 5FJKA 4QWNA 4Y33A 3UYJA 4IGOA 5IVCA 3PUAA 5IVJA 3ZPOA 3AL6A 5FXVA 5FZCA 5FZ7A 2XXZA 5F3IA 5FY8A 3K3OA 5A3TA 2WWUA 5FP3A 4CCJA 2YU2A 5FXZA 4LIVA 2OQ7A 5LY1A 4V2WA 2PXJA 5FZLA 5FUPA 3DXTA 3AVRA 5FZ6A 2Q8EA 4QU1A 5FZ8A 5IVEA 3N9LA 5FPAA 5E6HA 5FZMA 5A7WA 5FZ1A 5FZ0A 4AI9A 2WWJA 3PTRB 4QXBA 5FZ9A 5FYMA 4D6RA 3OPTA 3KVAA 3AVSA 5IVBA 5FP8A 4URAA 5FYIA 5KR7A 4D6SA 2XMLA 4UF0B 5FXXA 3KV4A 5IW0A 5A1LA 4XDOA 5FV3A 5FBJA 2P5BA 2W2IA 3PURA 4LXLA 5FZGA 3PUQA 5A7QA 5A7WB 3RVHA 5FY4A 5FYZA 4GAZA 4AAPA 4EYUA 4EZ4A 4TN7A 2GP3A 5CEHA 3AL5A
chains in the Genus database with same CATH superfamily
3ON7A 3NMBA 3E1F1 3KV9A 4I3PA 3J7NA 5FZBA 2YC4A 1R092 2VZQA 3PU8A 5CVRA 3RYKA 4DQAA 1GQGA 2QQJA 1IS3A 3OBTA 4META 2WZR3 1OA2A 4PBOA 3POJA 2PHTA 1QJEA 2RE9A 3DPRB 2Q8CA 2K2SA 1QNYA 1A3KA 3N9QA 3WHTA 4YG3A 4CCDA 3BU7A 4QHZA 2ZAAA 1NCQC 3T0AA 4JAAA 1QXRA 4YW4A 4RYDA 1YLLA 1LKNA 2WNUA 1HQLA 4GWNA 4Q4Y2 3I3QA 3FX3A 2VU9A 1LGCA 3SKJE 4Z1VA 3FBYA 1H9PA 1N1SA 1MEC2 3AXDA 5JMOA 2ZX0A 1FPN1 5JVVA 4W50A 4AHXA 5EQUA 3WW1A 3FMGA 4CTEA 4GD4A 4Q0PA 5FOJB 4DPNA 4R9DA 2AZ5A 1HKDA 5ERLA 2ZAHA 3DUIA 2JB8A 4XILA 1PVC1 1N3PA 2RS52 2YV8A 2CYFA 5H9QA 3WOGA 3GGLA 4CCCA 5I8TA 3HN3A 3RZLA 1HIXA 4CP9B 4EROA 2VVFA 1OF4A 1ZM1A 5C8CA 1DIWA 2D5FA 4BXSV 5LW9A 3MIFA 4MGTA 2VUAA 2MHFA 3ZFFB 4CCMA 1C5HA 2FHRA 2YPJA 1IQAA 5C3PA 4F8AA 5LA9A 1OI6A 1Y4WA 4R4XA 1DU3D 5A3NA 1UY0A 1MQTB 3RFRA 3IN9A 2DU1A 4I0BA 1IZ3A 2GMMA 4AEDC 1G8WA 3WY6A 4MHRA 2QE3A 5ISLA 3CZUA 3ZXEA 1SFPA 3W59A 1BBT2 2VNOA 1LGNA 3W5MA 5A70A 4I0WB 3OCPA 4F7ZA 4QKBA 1X8MA 1OQ1A 1RVF3 3MW4A 4BLJA 3RJRA 1UOFA 3WHUA 3WDXA 2Y26A 3W20A 5FZ3A 1E5IA 2XLGA 3JUUA 1VB2A 4NRQA 3UYJA 2YBKA 3CO2A 3SITA 3R05A 1PMJX 1QJX2 3NAPC 5C6CA 1WW5A 1S2BA 4JTOA 4RHV3 2D93A 4NIHA 1LOFC 4Z92B 1SLTA 4S2GA 4W4ZA 4QGNA 3PMEA 2E53A 1BJQA 4FPKA 4LIVA 3AZXA 1AR91 2HWE1 1K5JA 1RMU3 1O91A 4XUQA 4RGGA 2XJTA 4QPIC 1KJRA 2Q8EA 4CXXA 1D4M1 1F2NA 1OOPB 4DXZA 5FZ1A 4FI9A 5DDJ3 4L9BA 2XVKA 4WM8B 1QQP1 4QXBA 4YZ2A 4D6RA 5DMYA 4AWDA 3R6SA 2BFUL 1SPPA 1G9CA 4KWLA 3AVSA 2R6QA 4YM0A 3VZJA 4H14A 4URAA 2X5IA 4KWKA 4R4ZA 3V0AB 2LALA 2CTVA 2WFF1 1B35A 1UN1A 1AVBA 2P5BA 5FFOC 1FXZA 1SCRA 3PUQA 4P9IA 5KBFA 3W9AA 2NP0A 1FPN2 2ZGSA 1PO11 3ZFEB 2O8QA 2Q0AA 5JIUA 3AP7A 1BMV1 1RB8G 1JYWA 1MS3A 1PVC2 1EV13 2E7AA 3GHNA 3MDPA 3W5NA 2WKKA 4MGYE 1GWLA 2J1VA 3K4AA 3PTYA 4IV3C 1J84A 1R083 5FZHA 4KG8A 2JIJA 5FKCA 1EUTA 1I5PA 2IXLA 2RVAA 2V4AA 5FPBA 3MFCA 3H8XA 2P1BA 1JXNA 5K8SA 4CEWA 5FLIA 3SH5A 1OUSA 1CX4A 1CN1A 2P4EA 1RUD1 5D8AB 3KHCA 4IERA 1YQCA 5IFPA 1QJY3 2YY1A 1W8OA 4CEYB 2ZGUA 5BPXA 1BK0A 2BJSA 1XSQA 3LDRA 4QX3A 4Z8BA 4L0PA 4LOTA 2WFPA 4BIFA 4D7SA 1PMHX 1UZZA 4EN7B 1TZOA 2XDVA 4A42A 2EIEA 1Q8OA 4YG0A 5A7OA 3SCGA 2UWCA 1W9SA 2YYOA 4ET7A 1RXFA 1AUYA 3LSDA 2HJIA 2WLPA 2C1FA 3CZJA 1ENXA 4MGQA 3WF4A 4NIIA 3WSOA 3NV3A 2WAAA 2YFZA 3KHBA 4XJZA 5FK7A 3SHRA 4DXRA 4CDUA 2RDRA 4EWEA 3T2QA 1UY3A 1AR92 2RMU3 4LMFA 5IAVA 3I2DA 2HWE2 2WZR1 1HB1A 5T5LA 1RUF3 2R49A 5C9AC 4QXCA 3OYWB 1D4M2 1FV2A 1U5IA 4RD7A 1XYNA 5LWBA 1GNYA 3TEZA 3N35A 2YHJA 1N1VA 3U37A 1QQP2 1KXGA 3CEWA 3GZTB 2RS11 2DURA 2EF6A 2VCMA 5FBZA 4YARA 3E5UA 1QKQA 2ZPXA 1S2EA 4Q4W3 4YZ3A 4H3WA 4LEJA 3I2JA 4FAHA 1GOFA 2WFF2 3KCXA 4I02A 4YVSA 2B39A 2Y64A 1CD3G 2JDYA 3PUAA 1RUI1 1W2NA 4MG2A 4AI2A 4ISQA 5KXCA 5FAXA 1K12A 2FD8A 1PO12 2E9QA 1G9FA 3AJYA 1BMV2 2VO5A 1W9WA 5DAPA 2JENA 4JZRA 5FRAA 2FDJA 1QH7A 2QZ3A 2YU2A 2VQAA 3PJQA 4LO6B 3VBHB 1GMMA 3K48A 2VNRA 1GYKA 3N7MA 2DUPA 2PXJA 1UPSA 2JDKA 1RYYA 4V2WA 3JCIA 4XFAA 5EV7A 4Q8KA 2XPJA 5FMCA 2R041 5JIAA 1AYN1 1TQ5A 3SMHA 2WUHA 1UX6A 4MO3M 2X09A 5FZ0A 3OD4A 3PTRB 4DFSA 2QDRA 1ALYA 1DYKA 4YVWA 4ZU5A 2ZZJA 2BNNA 4MGKE 5FMBA 4LKSA 1LOGA 4XUNA 4OQ8A 4NVPA 3WG3A 2MEV1 5GLVA 3U75A 1RUD2 4MLOA 4XF1A 3DGTA 1RVF1 5FYZA 3FLPA 3CKHA 5T5OA 4RR3B 1OBNA 5CEHA 3NKTA 1W6NB 3ZR5A 4M3CF 2Y38A 4N9IA 3AP5A 1OKOA 2J1SA 1OC1A 2FCVA 3ACGA 3GM8A 3KZ4C 1BHGA 4HKWA 4QB6A 3ZFGC 4AOCA 4XC9A 4BQWA 3RMXA 3U11A 1VAMA 3HOBA 3P6BA 3VDCA 5KXEA 5L7OA 4PQ9A 3MPPG 1G9AA 3LEMA 1OD5A 2RR13 3M3CA 1XNTA 5HV4A 2R1DA 3H3ZA 4FOVA 3BOWA 4ZY9A 5KC5A 1DDLA 1RMU1 4UW4A 4Y5Z0 1Z7S1 1JYNA 5ABJC 2WZR2 3OPWA 1U0AA 5IATA 3KT7A 4MOAA 3ZYBA 3WNOA 4NRPA 4AVTA 1GBGA 5FJHA 3UNPA 4AE2A 2VC9A 5A6QA 5HXMA 1L3JA 1EY2A 3DL3A 2BVBA 2JXAA 5J48A 5J1XA 4KGGA 1J83A 4E9KA 2RS12 3A22A 3MIGA 4G9SB 1QIQA 1KEXA 1YQ8A 5FZEA 1X7NA 1ZBA3 3D6EA 4NRMA 4AFAA 2EAAA 3I2OA 1QJU3 1LHNA 1RUI2 4XF9A 1NCQB 3N9PA 2OKXA 2XGXA 2YFUA 4OZOA 3WD5A 1YWKA 5CFDA 5KHGA 4XCBA 3LDBA 2E33A 3VHNA 1I9RA 4QQ2A 4DS0A 3FFQA 1X8EA 4RQPA 2KR2A 3S5QA 3QCWA 5EJ3A 4LBLA 1DZQA 3DN7A 4EE2A 3NRUA 3KV5A 2W47A 4GJYA 1WCSA 2R042 1AYN2 1C4RA 1R081 1SFNA 1W2AX 2JG8C 2WN2A 1OVPA 4XHBA 2JWPA 3SKVA 2A6WA 1WMFA 1A8DA 1W8TA 2VULA 2WQZC 3JD73 1COV3 5KC6A 2ZGRA 5A3UA 4D7YA 2VNGA 1LTEA 4NWVA 1JS9A 2V5YA 4PDWC 4P5YA 5EPAA 1GUIA 2VY0A 2ARCA 5T55A 4QDRA 5FR3A 3MEPA 3UETA 2MEV2 1U5XA 4LK7A 2ZGOA 4LE3A 3WLUA 2EVXA 2PLV3 1QJY1 1RVF2 4W6WA 1VAVA 2R071 1UO9A 1NCRC 4NHKA 1OPOA 2NMOA 3ACFA 3S30A 5C3SA 2HWD1 4AEDB 2JDAA 1PZ8A 1UAIA 3AKQA 5EP9A 3WF2A 1IHMA 1BZWA 4IE4A 5FO7B 1W6PB 1W6MA 1D4VB 2IFWA 2VMGA 1CAWB 2E31A 3EB7A 5DAVA 5FUPA 4KBZA 5IFTA 1YJKA 4JGZC 3VKNA 2ZGPA 3T2PA 4DEQA 2WNVC 5FPAA 5FZMA 4PLNA 5K7PA 2G9FA 3TN93 2RMU1 4XJAA 5FZ9A 4AK3A 2FDGA 1RMU2 1W6QA 3KVAA 3T09A 4AVAA 5JXGA 3EXUA 1Z7S2 1RUF1 3NAPB 4IEVA 4SBVA 4UW3A 4XDQA 1I3HA 1CZVA 1LEMA 1QF3A 1XNBA 3VBOC 1DF0A 2VW0A 2VMFA 4YW6A 5GALA 4BQ3A 3GZEA 4XPVA 4Z07A 5FZGA 5GKAC 4Y5SA 3VKFC 2BW8A 1H6YA 3PL0A 5I0UA 4QPIB 3IDAA 4O61A 3JU9A 3FLTA 3IM0A 5F5CA 1V6IA 5C71A 4NR1A 2GMPA 4M0NA 1UU6A 1I1EA 4JGYA 2SBAA 2GC1A 3OY8B 4CDXB 3A7QA 1V6KA 5FYUA 3ITQA 1PHMA 4CDQC 2YB7A 1AJKA 1XQNA 3NNFA 1W04A 3GZUC 1N3OA 3IPVA 3AYDA 4JX0A 2Q30A 4RFRB 3VZKA 5FLJA 1VLNA 1PMIA 4FXKB 5BXXA 3KQRA 4O7XA 3NVCA 2VOTA 3UJOA 3I97A 1T2XA 1O5UA 1D2QA 1TMF3 1ONAA 4CCKA 1MVQA 1VRH1 5FY1A 2CNAA 2J1AA 2CU5A 4J25A 2JDNA 4QU2A 1BXHA 3SEEA 1R082 4YZ5A 1VBA3 4OUEA 3RMYA 2AC1A 3AX4A 4XUOA 3O12A 5D1IA 3IDBB 4IV3B 4HK8A 3DKQA 1O7FA 3ILNA 2WA3A 2OX0A 1PGL1 2QUOA 1OLRA 4AEMA 2ZGTA 1GV9A 5F2SA 3AP6A 4A41A 1UWWA 3MV11 5A3WA 2OUJA 1WLDA 5HXVA 2CWSA 1F31A 4E8CA 4AI8A 1QJY2 3TBDA 4A6SA 2BP6A 5KHKA 1W06A 2HWC1 2R072 5LEJA 1H30A 3WUCA 3ZSKA 2HWD2 3VBUB 2JX9A 2BERA 1W3XA 4Y1XA 1LOAA 3RRDA 5BNOA 1NQJA 1RXGA 4XDPA 1W8NA 3THDA 1CZTA 4N53B 3BB6A 4OMDA 3OF1A 4P9GA 2AUYA 3BVCA 2RR11 4UF0A 5LRRA 2H6BA 3IZOA 2VOWA 5B4NA 2RMU2 5AFEA 2E7QA 4AEJA 3KB5A 4PIXA 4P5HA 4KI5M 3DF0A 1RUF2 2QQUA 1OF3A 3D0JA 1AX0A 5CFCC 4FPLA 4P9WA 3LPFA 2V09A 5IWFA 1PM4A 3VBSB 4AW7A 3V56A 2AH2A 3C8XA 4YW7A 2NPIA 4N90A 1H2LA 2XXZA 5F3IA 3DPRA 1QY4A 2FCTA 2FCUA 3V0BA 3C3VA 2Z42A 4IEXA 1QJU1 3K77A 4AXOA 2ZX4A 3I49A 1W3VA 1O5LA 1X9PA 5E8AA 4JKKA 1JTZX 1NA1C 2ORZA 3TYJA 5JOXA 5LK7B 4MXWB 5A7WA 1RUE1 1G9BA 4YLZA 4AI9A 2BPA2 2A3WA 1LOCA 2D98A 1KITA 1S1AA 3ZKUA 5FO9B 1XNKA 5CKMA 2BDRA 5FYMA 3MICA 5KHHA 3T0BA 4XBLA 4NE9A 4RFT0 5FYIA 1VRH2 4C1XA 1RUC1 2XMLA 1VBB3 5CU1A 1UD1A 4WM8C 2W92A 2BQPA 1ST8A 2BWCA 2CWMA 2VUJA 4TLGA 4ARXA 4LTAA 2IVIB 3JD71 1D7PM 3RZKA 3M70A 3OEAA 3GCWA 4OFGA 3HPNA 3SEPA 4CP9A 2QQMA 5DUXA 4IW3A 4HSJA 4OHXA 3I3DA 1PGL2 5TSWA 5DAQA 4CXYA 1UYXA 2RM23 3WP3A 3ZFFA 5L36A 3E6BA 4ZXKA 1YQ5A 3A0NA 5FYCA 1GFF2 3TEYA 2VZRA 3ZFEC 1MQTA 1GLHA 2Z5WA 4YFWA 1TME3 3E6CC 4QPGC 4ZPIA 1OQDA 3KV6A 2HWC2 5FZIA 3WQ0A 3X29B 5JSOA 1ZZCA 3IDCB 4Q0UA 4XUTA 4HPKA 4X6RB 4NUBA 1NE4A 2WR9A 3MLJA 2WSUA 4GKYA 4L11A 3VB9A 2XVLA 1WD4A 2RR12 1ULPA 3ZIXA 1QH6A 2DTYA 4RS5C 1HN0A 1MR5A 4XHXA 4FFIA 4B3NA 3TN91 3N7JA 5A7PA 4INDA 3M1HA 2VTXJ 3ZSJA 2EIGA 4HMZA 1VBD1 3ZFGB 5BNPC 2DBNA 4Y1UA 2W52A 5GLTA 2KD7A 2XHKA 4CVUA 5BV6A 4E4SA 1VBE1 5D8AC 3POIA 5IK8A 5ACA3 1HW5A 3M3OA 2DCZA 5BUVA 5FZKA 2FQPA 2YPDA 3H8OA 4XW3A 3AB0A 5C4WC 5ABJB 1XU1A 3IAPA 5JXHA 1YEWA 1ZZ6A 1OOPA 4H55A 3SISA 2DVBA 2Y33A 4HKOA 5CG8A 1POV3 5C8WA 1DP0A 1BYHA 2KA3A 4WM8A 3ABZA 2VUDA 3MPBA 3RZJA 1QJU2 4Y3OA 4ZXEA 3RDIA 1CAVB 4K8RB 3V0AA 4W6YA 1YJLA 2A6XA 2WN3A 3KQ4B 2Y6HA 1E5SA 2ETEA 5E1RA 3ZMNA 1MZEA 1M4WA 3BN6A 1RUE2 3O14A 5AFBA 5AVAA 1RUNA 3WXPA 4FOWA 4I30A 1RITA 1HQNA 2D3RA 1RHI1 3AJZA 4MX3A 2Q1MA 1HB2A 1S0JA 2L9LA 2PHLA 3ROUA 3J7MA 1JBCA 1RUC2 3ZDVA 2CGNA 1VBA1 2J1RA 2PHXA 3JD72 2DVAA 3ZLIA 1W8ZA 3TEWA 3I54A 4OUSA 4AVBA 4DUWA 3RQ0A 5LBFA 4TZDA 1LESA 4E2QA 2HYXA 2JG8B 3VDBA 1W2UA 2XBO3 1YFYA 2ZX3A 2JKBA 1S0BA 2PLV2 4JDOA 3T4VA 1W99A 2P17A 3HNYM 1KQRA 4IE7A 2VZ1A 4QGMA 3BOPA 1WCDJ 3OTFA 1HJGA 4LHLA 3VBHC 1W6OB 2QNKA 1FNYA 3ACHA 2G9ZA 1UYYA 4PIZA 2W9XA 4AF9A 2D40A 4LHSA 4K9SA 3L2YA 1O3RA 1L7QA 4MADA 4CEYA 1V6OA 3T0DA 1NCRB 1YIFA 4D6SA 5J36A 3CIHA 1DQ2A 2VH9A 4XIKA 5IAXA 1VMHA 2QQWA 4XDOA 4XE9A 4Y1VA 4YPJA 3BIEA 3TN92 1YUDA 5HBAA 3MV01 4FFHA 1R64A 3FN9A 1IS6A 1VBD2 1PM7A 4GMP3 4IUGA 4JGZB 3ZXGA 4U36A 2X8KA 3UESA 1VBE2 3BU0A 2WNVB 3FC0A 3NV2A 1DQ4A 2ZEWA 3OGGA 4QDSA 3AYEA 4RR3C 1H8TA 1ZA4A 4XMIA 3KCYA 1UNBA 1S0CA 1ZZ7A 4YM2A 4LBKA 5FYSA 3ZXAC 3POWA 4I3GA 4GZ9A 4BK4A 3V65A 4Z2AA 4X8NA 1F5JA 3SC7X 3VBOB 2ATFA 1Y9GA 4JCKA 1ASJ3 1T6BX 4S2HA 2X29A 3WCRA 2FDIA 1QNWA 4AQSA 5EXOA 2D6OX 2JD9A 2W46A 2A6YA 2WYFA 3IB3A 4FPCA 2QCSB 2YGMA 1R1A3 3A0KA 5JZGC 2EXKA 2FDFA 1SLCA 1AR83 2F17A 3RZGA 3P3PA 4TTGA 2EICA 1E57A 1FAYA 4Q4X3 3TAYA 2ZMLA 3D3AA 2K9ZA 5FREA 1VE0A 3NQHA 3LEKA 3AMPA 2BGOA 1XPWA 1RHI2 3D82A 4CDQB 1WBFA 5DG1A 5CNAA 5EZWA 1VBA2 2W94A 3ASIA 3WDUA 2PAEA 2LW8A 3VBRB 2HEYF 3JZVA 5ANQA 5JOYA 1TG7A 1JN2P 3O1MA 2BZDA 2IVJA 3LFMA 3U1XA 3VBFB 2XJVA 2E7TA 3JBG3 4BISA 2RM21 4XMAA 3J7HA 2I74A 3AMHA 1KS4A 3KD4A 5LEKA 3ZN4A 4QD2A 2ZGKA 4IL7A 4GJZA 3CHXA 4IDZA 4DY3A 1CESA 2QTWB 2PTMA 4W8JA 3WP4A 3IIAA 4Q0VA 3M3IA 2RS33 2Z69A 4XACA 4ARYA 1UYPA 3ACIA 4H7LA 1W8UA 5I0DA 5FY9A 2QQPA 2FMDA 3AZYA 5FP7A 4XZUG 5JUVA 4QXKA 1W6NA 5JXJA 1AXYA 1X82A 3SCFA 5HI0A 1HRI3 1WA6X 3GCXA 4D3WA 3RSJA 4K6BA 1MS0A 2HBUA 3WP5A 2P3IA 1NKGA 3VHRA 2VCCA 3TB0A 2CDPA 5IYYA 5A6YA 4B4QA 2E32A 5FY8A 3PVBB 4PT6A 1IPSA 5ACA1 1OLME 3AKRA 4LKFA 4YGEA 3VZLA 2WT1A 3KS7A 2OQ7A 3OUHA 1C3HA 1UX7A 3F2ZA 3FHIB 5C33A 5DN2A 3AMQA 2WIIB 5FZ8A 5LBCA 3BTAA 3N9LA 3GF6A 5CFCB 4CPBD 2FZ2A 2WWJA 4C0BA 1JU4A 2ZACA 1F4AA 4FTSA 1H1IA 1MS9A 4HXCA 1ND3C 1KJLA 1ULOA 5HV0A 4HN1A 2EA7A 4PIYA 4R9BA 1Y7BA 5F1RA 2B9VA 4QQHA 3VDAA 1EAH1 3WV6A 3WNLA 2NZ9A 1SBDA 2GNMA 3GALA 4R9AA 4NPLA 5A7QA 1YFUA 3RVHA 3Q8FA 3BCWA 5ANNA 5A32B 3UT0A 1NCQA 4C90A 2DVGA 2GP3A 5GZFA 1V9U3 4AVCA 1LGBA 1NA1B 1NZIA 1SBFA 3ES4A 4B1LA 1RUH3 4XZPA 4IE5A 5FZ4A 5C5UA 1O3SA 3RWKX 1HXS3 1BEV3 2NQYA 1U5ZA 1AX2A 1UCXA 1XJAA 4FPJA 2IWGB 2HEWF 1AXKA 3LEIA 1LULA 3CJXA 3HQRA 2RM22 3MLKA 3ORJA 5C3QA 4CDXC 4ATFA 2PAKA 4Q29A 3B69A 4S2DA 5CIRA 1WLCA 3DKWA 5L9VA 1QDCA 2GC3A 2ZKNA 4ZONA 4D69A 2YROA 3FWEA 4C8DA 4YM3A 4K40A 4YRDA 1UPIA 1W28A 3RJ2X 3H1MA 1IG3A 4V1PA 2DVDA 3PIJA 4KH9A 4UW5A 3RYRA 1JODA 3OUIA 2R1BA 1K45A 3N9OA 1DYPA 2VVDA 1HRV3 3H1YA 4QPGB 2C24A 5FXWA 2UY9A 3VKLA 5IK5A 1J3QA 4UBHA 4AEDA 1ZBE3 3MHZA 4HK9A 5I91A 3GDBA 5LCWL 2NYYA 3WDYA 2CGOA 3M2MA 1W6PA 2B42B 2KXLA 4XF4A 5EHDA 2BWAA 2YZ4A 4A45A 4GMP1 4CCOA 3NO8A 1FOD3 2JE8A 1ZYBA 5G04L 4F3JA 1VMJA 1X9TA 4RS5B 3ZSMA 1R1ZA 5ACA2 2ZOEB 4UI9L 1VAKA 1K5MB 1VMFA 3APBA 3NAPA 4LBQD 3QBQA 3VBUC 3WQ1A 4KNCA 4LKEA 4YW2A 5BNPB 4W65A 1LOFA 4AL9A 4CDWB 1UXXX 3URFA 2D3PA 1CAUA 2VNVA 3AZVA 2JDHA 2XL7A 2XOMA 4JKMA 4N53C 5DAWA 4BYYA 1Z0HA 2Y0OA 3M8LA 4WV8A 3INAA 4JRLA 3ZYHA 1R1A1 2CAVA 3ZXDA 4AQ2A 5C4WB 4QPIA 1T6GC 5F8PA 5JI9A 1L7LA 4BXFA 1SDDB 2ZEYA 3HNBM 3MUY1 4COVA 1EPWA 3P5BA 1MS8A 1EAH2 3B02A 4Y22B 5DUVA 5L9BA 2OS2A 1IG0A 4AI1A 3I7DA 3OY8A 2FDKA 1RUJ3 1QHDA 4PQQA 1K42A 5GLZA 4AI3A 1YI7A 1WCUA 2D6MA 2OXBA 2Q4SA 2ZCWA 3CNAA 3NNMA 3VBSC 4EJRA 1JOPA 1ZX5A 5FXZA 4QB1A 2RJLA 4ITCA 4BK5A 4Q5OA 3JBG1 3Q9OA 1DLCA 3J8F3 2PHUA 1UZVA 3AC0A 4XBNA 1UZ0A 4AQTA 5BNNC 3N7LA 4JKLA 1F8VA 4XAAA 3A4UA 1CIWA 4IV3A 2QZ2A 4HVOA 2VVEA 3EHKA 2SLIA 2K46A 4FPGA 3KV4A 2RS31 4OI0A 1WKYA 2W68A 1V6JA 1ZVFA 3AP4A 3C7OA 5A1LA 5IUQA 4EN0A 4LO7A 1OFSA 2WINB 3H3UA 1H4HA 1VJ2A 4TXWA 1YQ2A 3PVNA 4R52A 4BM8A 2D6LX 5LB6A 1ULFA 1CZSA 2J42A 1ND2C 3AL5A 4M3CB 4B1MA 3B9CA 2BVVA 4AGGA 2K0GA 3HWJA 4Y1YA 2JDMA 3RNSA 3BUCA 3HNMA 1Y3TA 4DIQA 4R9CA 3MBWA 3ZN6B 4BB3A 2PQSA 2Q1FA 4JV4A 4MZUA 5FP4A 4YSFA 1O4ZA 3OG2A 2G4IA 2VBPA 2YC2A 3NNJA 2WL1A 4BCUA 3B9IA 2C5DA 5DZFA 3H0OA 1C1FA 2QKDA 3SCHA 4M00A 1XE7A 3PVEA 2B5HA 1LOBA 3IMNA 4E27A 2VGDA 4OHYA 3EJKA 5C3OA 4LNVA 1FMD3 1OURA 2Y6KA 5B4XA 1LHVA 2VOXA 1GOHA 2R063 4FPOB 4BQ5A 1DGWX 1Q8SA 1LHOA 1PX4A 1R1A2 3ES1A 2A6ZA 2VW1A 5C9AA 2D6KA 4ASKA 3T2OA 4MV2A 4COUA 5JSPA 1OHFA 3VZOA 1YFXA 5JMCA 2VMEA 4RHV1 4XTPA 1IKQA 3H9AA 3LCPA 1F15A 2O0OA 5K9YA 5JZGB 2AEYA 4YGBA 4P9YA 1XU2A 1V9U1 1XOYA 4DXSA 1QJFA 3B93A 4GMP0 4COYA 2XJRA 4MXWA 1RUH1 4K8FA 1NXMA 4QKDA 5CADA 1UOGA 4QQLA 1HXS1 1GP6A 2OPWA 4OUMA 1VIWB 5FPVA 1UY1A 5JR2A 1LR5A 2JG9C 4EWDA 4K20A 1N1YA 1XNAA 4WVMB 5DDJ1 3JBG2 2QDNA 3IBMA 4CU9A 2LROA 3BIWE 4EZHA 2UYBA 2A7AA 2D6NA 1Q56A 1NXD1 2E51A 2JD4A 3B7MA 2CDOA 2XJQA 2XJUA 3LE0A 3N9NA 3PUIA 4FO9A 5FPLA 3GYDA 5E16A 4P08A 4K1YA 2C6SA 5GZEA 3UJQA 2PA7A 2RS32 4XXPA 1JZ4A 4JHTA 2OIIA 4LBQB 2JKXA 4QWNA 3MGUA 4X6QB 4AHWA 4DMIA 5JDBA 3KSCA 3FUQA 5JSRA 4XIOA 1NYWA 1EV11 3NV1A 1W39A 4BZ4A 2ARXA 1ODNA 5L19A 1KRIA 4WBBA 4AI0A 4NAMA 3AZZA 2UU8A 4LLFA 3TOJA 5T54A 3UKNA 3MIBA 3HR9A 3WW3A 2WZ8A 1Y43B 4LA3A 4NMIA 3MF9A 3ZM8A 4DUVA 2V73A 3HQUA 3LKJA 1I5ZA 1EPZA 1W03A 2RG4A 4TWTA 3W21A 1J1TA 1FOD1 4N7IA 3ZXJA 3C7GA 1RC6A 3FJSA 1ZRDA 2ES3A 2ZZQA 2PAMA 4OULA 2PQQA 3L2HA 4KGQA 3ZSLA 2ET1A 2WS93 3TEXA 4YGDA 3ZFGA 2ZGMA 4BWOA 4NO4A 4XAEA 4BOWA 3ETPA 2DV9A 3UV9A 4WM7C 5FXXA 4GXLA 1JYVA 2F4PA 4NHLA 2W2IA 3Q8BA 1FATA 3HVDA 1O4YA 1Q3EA 4N43C 3DYPA 5ABJA 2OA2A 3R4UA 3U10A 1FNZA 2D7FA 4LJHA 3PLQA 1RTVA 4AG4A 3E5QA 2D5HA 2B9UA 4Q27A 4IE0A 4J6GA 1MZ5A 2X5IB 3HQXA 4LO5B 2CL2A 4FP3A 4RHV2 5LA2A 1CAVA 1ND3B 1RUJ1 4GULA 4U2AA 4DY5A 4F83A 2W3JA 1XE8A 5A1FA 4JTNA 1V9U2 3WCSA 1QMJA 2EIDA 3MIDA 4OI1A 1ZRIA 2W87A 3B3QE 1RUH2 2BGPA 3P3NA 2VXRA 4FQ4A 4IV1C 3WQBA 1HXS2 2TBVA 2N7GA 2ADDA 4LHKA 4QX7A 5DAXA 3PVOA 3VLBB 3VKMA 3NJVA 5DDJ2 1GZWB 1JUIA 3WR0A 1O8PA 4FT8A 3N9MA 1ZZ9A 2HLEA 3WDTA 4ZS2A 4JQTA 5FMOS 4IESA 4LR4A 3O1RA 3POBA 4Q4W1 4LE4A 4XUPA 2D43A 2JG8A 3KT1A 3D8CA 1MS5A 4GKXA 3ZYRA 4O9GA 2BNMA 1SHWB 2PFWA 2XL9A 3BODA 2ZEZA 3POYA 1XYOA 2DUQA 1HV1A 3ACLA 4HONA 5FYBA 2AEZA 1E5RA 1WWYA 2Q1ZB 3GBWA 4PDWA 1W6OA 1EV12 1SBEA 3WZ1A 3KWVA 2XJPA 4IEQA 5L9RA 3SH3A 1RUG3 2VMDA 3VBRC 4OZXA 3ZYPA 5T50A 2IC1A 3VBFC 3ZYGA 2EIBA 3OD0A 2A73B 3ZIWA 1JYCA 4UT5A 1NCRA 1FOD2 1PO23 4CE8A 4KWUA 3ZR6A 3VKOA 3THCA 3G7DA 2XR4A 2AGSA 4TYSA 4QM8A 1BLZA 2WYSA 2GDFA 4JGZA 4A44A 3ETQA 4UAPA 1UU4A 1E5HA 1SFYA 1FMD1 2WNVA 3PUSA 2ZX2A 4DOUA 1SMVA 1MS1A 1PX3A 3A23A 1WMEA 3S6PA 4LA2A 3WUDA 3RPQA 1J3RA 2DCYA 3EQEA 3D5OA 3LIHA 4DRRA 2A70A 3VBOA 1NG0A 4LUKA 4XURA 3EMRA 3THPA 4B7KA 4CCJA 3NL1A 1XXNA 3ALQA 5DZEA 1ZZBA 2ZHNA 3BALA 3B00A 5KHIA 4GH4C 1O3TA 4DEVA 1RUJ2 3M3EA 3KM5A 1V6LA 4P9XA 5CKNA 5J37A 3MIHA 3WF3A 4LBMA 5J96B 1JUHA 2QQLA 2PELA 2WNOA 1AR63 1RGSA 2PHWA 4Q4Y3 1X50A 4JRAA 2HWF3 1AL0G 3S7EA 1PZ9A 4CDQA 3GZAA 2IXIA 3H3LA 5DZGA 2LRPA 4B4PA 4ZS3A 5LATA 1CPMA 1DGWA 1Y9MA 1GZCA 4P00B 3VBRA 3PURA 1UZYA 2VMCA 2XUMA 5I0TA 3FFZA 2B45X 5AC93 4Q4W2 2RS53 1ZBA1 3VBFA 4TN7A 3PJYA 4TSVA 4UFJA 3WDVA 1TEIA 4V2VA 5HCBA 4QKFA 5BNNB 2DFCA 4Z82A 1KD7A 2UWBA 3U4SA 5A6XA 3AP9A 1F4HA 1QGLA 2I07B 5J98B 4FCAA 4QPYA 4EQVA 4YZ4A 1CX1A 4JQRA 3J7LA 4UOJA 4QX8A 2Y6JA 5JCTA 3WF0A 2FDHA 1JYTA 1Q8VA 2GP5A 3T3YA 3TRSB 1GNHA 1KFXL 4QHBA 3MI8A 1GR3A 5FYTA 1BBT3 1N47A 1UKGA 1D2SA 2O14A 4IEWA 5LBBA 2J1UA 1HV0A 2DCKA 3VGIA 1COV1 1ND2B 1EYBA 4C0HA 3DEMA 4NHYA 3T1MA 3M3QA 1ZA7A 2VZVA 2WS91 1OD3A 1UY4A 5FDBA 2QVSB 3VL8A 5C3RA 3ILRA 3J9SA 3LB9A 3FLRA 3VD5A 5IK7A 4CCLA 1FMD2 1YRZA 2PLV1 5LA1A 4BE3A 4WZFA 1A6CA 1JOBA 1RJ8A 3D4KA 2X10A 5JLVA 3PUHA 4YYOA 4MH0E 1Q8QA 4XQDA 1J1LA 3ZX7A 4Y4RA 3O1OA 1C1LA 3O0WA 3N4MA 3DXUA 5CFCA 2BU9A 2XKOA 3ME2A 4WVWA 5K4LA 2CAUA 5C5TA 2BTVC 1FX5A 2G19A 2ZJCA 2PN5A 4COWA 1U5YA 2JIGA 5A3OA 1UMZA 4S2FA 5GJ6A 2ZABA 2R32A 3FZ3A 1K5MC 1UKRA 2R16A 1NX9A 3CMGA 3OGRA 4OVEA 1QOTA 4QB2A 3WNMA 4ASLA 1AYM3 1SLIA 4BQ4A 2XWJB 4LHNA 3H8RA 4CDWC 5DQ0A 3B01A 5A32A 1NY71 1ENSA 4GB33 3T08A 1HDKA 1NA1A 1ZZ8A 1AHSA 5FY5A 3UKVA 1FPN3 4J1WA 4PLOA 3ATGA 1PK6C 4CYDA 3ZKYA 2IUWA 1H0BA 5CZKA 4IGOA 2BOJA 2JG9B 2VUCA 1Q43A 1QXJA 1ZBA2 3MYXA 2W39A 2JDPA 1HLCA 3MLLA 1UXZA 3ECQA 5A3TA 4CZSA 3WW2A 2VXJA 3C2UA 1WW4A 4EV0A 2HBTA 1DQ5A 2D97A 2VBDA 5A3LA 3RI8A 1H2NA 5FZ6A 5FPXA 4OLLA 1D0HA 3H8UA 4JC1A 4LQRA 1TMF1 1LJ7A 3AFGA 4FPYA 3ZFEA 3OOXA 2R30A 4QPGA 1PO21 4L8QA 1JOJA 5KR7A 2YGLA 2DUOA 2JDZA 2J1EA 1COV2 3H7YA 1MVEA 2W5FA 4JVAA 4NPMA 3WNNA 1DGLA 1NUKA 1V0AA 3O1VA 1APNA 1ULDA 4WVVA 4LO4B 4HT1T 2WS92 3HBKA 5I93A 2C9AA 1W9TA 5FQ0B 2ZXQA 3O1UA 1H9WA 2JDUA 1TNRA 3OBAA 4RS5A 3NNGA 3SH4A 4AFBA 4LT5A 2J22A 5CG9A 3T4HB 4DZGA 4GWIA 3JB4C 3FBMA 2VOKA 1OQEA 5BNPA 4E2SA 2R7EB 1W05A 1F5FA 1WCKA 3LOIA 4OQ9A 4Y26A 3VZMA 5D8AA 5LA0A 3VZNA 1AR93 4CP1A 1XSRA 4WM7B 3T1LA 1C5IA 2ZX1A 1J59A 3H50A 4ISRA 2EAKA 2WLQA 3K4ZA 3VUOA 1D4M3 3HT2A 4XFCA 1UYZA 3BGAA 1NQDA 4N43B 4UW6A 1DQ6A 4XOGA 5C4WA 4Y20B 4FOYA 1CJPA 1QQP3 1ZNPA 4JGYB 1L7RA 1KDMA 2WZEA 5A7NA 2TEPA 4Y22A 4TLFA 1AR61 4C91A 2Q5TA 4QGLA 5GLUA 1YIPA 3IPVB 2HWF1 1O6UA 1NY72 4A7ZA 2HH9A 3KVBA 4Y5TA 2UURA 4PCRA 2DBIA 5FMOL 1B09A 2W1QA 3MW3A 3VD7A 5J7MA 2O8OA 4P9JA 5CYYA 5LK5A 1PO13 2AENA 4IV1B 4UXAA 2B8MA 4O65A 5AC91 3OYWA 4W6XA 5JPNB 1LRHA 3HD8B 2W1WA 4JDNA 4LK6A 4HOOA 4FFGA 4COZA 4A7YA 3N3HA 1XNCA 2WNUC 4ATEA 4XYXA 1JYIA 4Q1PA 4UYBA 1WLWA 1LHUA 1PNFA 4D6QA 4CU8A 2F6BA 1H8VA 1AL23 1I6XA 3KGZA 4AHZA 3MF6A 4XF3A 3N7KA 1QOSA 3O1SA 3DYOA 4AVVA 4FBFA 3KCCA 2W1UA 4B4RA 2C0ZA 3NSTA 1KS5A 3WG1A 3H7JA 4ONUA 1TMF2 1WGPA 1LB2A 1HJFA 2XQXA 5FZAA 1YHFA 4NHMA 1VBB1 5A80A 3K51A 4HFSA 5T3NA 5BNOB 1RUD3 2W1SA 1PO22 2BV4A 3N36A 4QKNA 1MS4A 4M3CA 1W9FA 3QLQA 4LOSA 3VBHA 4BQXA 4CPBA 5C8CC 4Q2FA 2YU1A 3M7AA 5D2AA 4BDVB 2OYZA 5F3CA 3K3NA 2EALA 1YFWA 3ZN6A 3MIEA 3AK0A 3AL6A 4B29A 1UY2A 1US3A 3IWZA 5FZCA 3IDEA 3CJIB 3S0MA 1XE0A 1UMHA 3HN1A 1TME1 2IXKA 4CA9A 5DG2A 1SCSA 4XFFA 2WC2A 2VZOA 1G86A 4HSLA 4XABA 1W8FA 4WZCA 5A1AA 2XLAA 4A3ZA 4GIQA 3DECA 1IQDC 2RV9A 2MNGA 3SNMA 5E6HA 4XVHA 1W8HA 4FXGB 5BNQA 1YCIA 2XHNA 4RR3A 2EXIA 2R0HA 3OPTA 3LQCA 1NLQA 3V0BB 2WJSA 4M01A 1JHJA 5IVBA 3ZVXA 3QD6A 3JXSA 2H0VA 1VR3A 2RS13 1UF2C 3CLPA 1W90A 1J58A 2QJVA 1AYM1 4QDQA 1OA4A 1HB4A 1AR62 4LXLA 5A7WB 4GB31 5JZGA 4E4DX 1C8NA 4GAZA 2HWF2 4GH4B 5CB7A 5HCAA 3POEA 2ZHMA 4FQZA 4NROA 4OYUA 1ULEA 3LWCA 1QWRA 4CUAA 1RUI3 4XBQA 2E26A 2P2KA 3LIGA 2HEVF 1EUUA 1LEDA 1Q5OA 4YW1A 3OB8A 4K1ZA 1ULCA 5FYHA 2P3KA 5AC92 4R8HA 1DQ1A 1POV1 3RZZA 1RINA 4WVMA 2DYCA 3K75B 2XLFA 1W9YA 2ARBA 2X5IC 3KT4A 4UFIA 4QXHA 5GLWA 4BPZA 1VALA 1MZ6A 2R043 3C7FA 1AYN3 1B35C 5LY2A 1OH3A 4FVVA 1KGYA 2HWB3 5A33B 4IETA 3NNLA 1JHNA 2WQ8A 4CUGA 4P9LA 3GJBA 3O0XA 1DHKB 4CCEA 3LF7A 1XB9A 2HYKA 1V70A 3I2IA 1AZDA 3VD4A 1K3IA 3OBRA 3QACA 5CKQA 2R0FA 4BLIA 5G05L 1A34A 4WVZA 5EJZB 4BJ0A 4LBQA 3S7IA 1LHWA 2I45A 3P1IA 4SLIA 1VBB2 2X05A 2MEV3 3KF5A 2GH8A 2ZS6B 5GZGA 4HPKB 1TE1B 4HVRA 3WF1A 1YC61 2Y8KA 1SQ4A 5GM0A 4KU8A 1S0EA 5HCFA 5I0SA 3S5AA 2CV6A 2BUKA 5HCHA 2CGPA 2XBO1 4IEOA 3I3BA 3F95A 4CEWC 4QHOA 1JYXA 1XRUA 2XH6A 2MPFA 1TME2 3LFIA 4X8PA 3AMMA 1CONA 1JI6A 5FZOB 3IIIA 4QX0A 2C26A 1JH5A 4P14A 1GQPA 5JI7A 5JPMB 1O59A 2EXJA 2PMWB 3JQWA 5CISA 5FKBA 4FSJA 1W2TA 1Z7S3 3JQXA 1W0PA 5FYVA 2RHPA 2YBPA 4YWAA 4A2UA 5IT6A 1V6MA 5JOZA 2P37A 4QQOA 4E4HA 1HQWA 1LU1A 3ILFA 3PDQA 2ZA9A 2VQUA 5FUIA 1CAWA 3UK9A 4YNIA 2GSYA 2Y34A 4LBNA 1AYM2 1OMIA 1YYNA 4UFMA 5EYYA 1ND3A 5FJKA 4CDUC 5IVCA 4GB32 3ZPOA 5FXVA 2GNBA 2QBXA 5FZ7A 1NT0A 4EN8B 2C4XA 4EN9B 1QOOA 3BTZA 1WD3A 1GU3A 4MGIE 1FYUA 3USUB 2BEOA 3B94A 1IPJA 1CR7A 1A78A 2JB4A 4GALA 4M4PA 1RL3A 4FP2A 2B7YA 2E63A 1M06G 2PHDA 1ASJ1 3RI9A 1GZWA 3HBZA 4A6OA 3GHMA 4IQPA 4XF0A 5IVEA 1G9DA 1SACA 2WNEA 2CHHA 4PI0A 3KF3A 2C9KA 1AL21 1CAXB 1PK6B 3ENRA 1AR81 3VD9A 4OI4A 1FV3A 2XVGA 4M3CE 4YVSC 4ZHNA 1US2A 3OSDA 4Q4X1 3BTXA 3I3EA 4A3XA 3AKSA 1S0GA 2BOIA 4CDXA 2YMZA 2LM3A 3ST7A 4CP0A 3WDWA 3NV4A 2WAOA 3ZN5A 2GH2A 2P3JA 1XNDA 2QFEA 3Q8EA 1URXA 1IPKA 3Q8AA 2G9GA 1AX1A 3AYAA 1CPNA 4L97A 1DBNA 3ZOIA 5K0UB 4RN5A 1ODMA 1NLRA 2R073 2WDBA 2HWD3 3EO6A 2XB6C 5EIYB 2P34A 4BMBA 2VW2A 2XBO2 1UIKA 4YVWC 2Q8DA 1GWKA 1LU2A 3VHPA 3VD3A 5A3MA 1KDKA 3O7OA 1POV0 5F39A 4CCNA 3IAQA 1PVXA 3FE5A 4XJ9A 5FPUA 3DCQA 2J7MA 3U07A 5FTTC 4BMEA 5F5QA 2P6HA 1WMDA 3U14A 4IXLA 1OPMA 1H8TB 1LAJA 4XFGA 3HMYA 2VMIA 3LZZA 3I59B 3UGHA 3WNXA 1ENQA 3POSA 1SZBA 4OHWA 1DZRA 3VBUA 1KFUL 2XKPA 5KWRA 1HRI1 2WO2A 3VDDB 2YBSA 1D0GA 1VP6A 5F32A 5L7OC 4QPWA 4N53A 1XC6A 1U12A 3O1PA 2VCAA 2GC2A 2WO7A 2PYTA 1JZ7A 3KGLA 1DYOA 3VN4A 2A3XA 4CUBA 1N1TA 3K46A 1Y9QA 4CU6A 4ZKTB 4I2OA 4IE6A 1RJ7A 2ZGQA 1STMA 3LGRA 4IEPA 5A7SA 2IXCA 4YG6A 1MZFA 4LLOA 5JXIA 4IGPA 2VPVA 1HN1A 2DCJA 1NZCA 2AR6A 1PNGA 3MW2A 1BCXA 1GZTA 1ASJ2 3K4DA 5EFUA 3WW4A 4KU7A 3I2FA 3ZYIB 4E8DA 3VBSA 2A71A 2OUHA 3I2GA 3GBFA 4AFDA 1LNSA 2BRTA 1VRH3 1YXWA 1AL22 2LTNA 5FCCA 2HWB1 1AR82 2G1MA 4Y24A 1S4CA 1UQXA 5IJRA 2BNOA 4Q4X2 4XJWA 4XTMA 5BY5A 5IVFA 4FPHA 4LO8A 1LOEA 2JEMA 2WNUB 4NOTA 5BNNA 4QQPA 5CFDC 2RJ2A 4NIAA 3HJRA 3U78A 4CSWA 5CAZA 5FWJA 3C7EA 1MPXA 4YW3A 4RQPC 1H4GA 3AKTA 2VTXA 4OHVA 4AYUA 1REFA 2FMYA 1UW8A 3RZHA 3O1TA 1BEV1 4N8MA 2D44A 1REDA 3LEGA 3L9JT 1SLBA 3CU7A 2ZTNA 2HWC3 2XG3A 4HG6B 4Q4V3 5LY1A 4MUVA 4OI2A 3ELNA 1H6XA 1OSGA 2BYVE 1UIJA 2WSVA 2F4LA 2XJSA 3GJAA 4O9EA 4XFBA 4Y1ZA 1PIV3 1UOJA 3CF6E 3THTA 3ZXKA 1ND2A 5C8CB 3WNKA 1PZ7A 5HPOA 2ZGNA 5KXBA 3S57A 1HB3A 1QJZA 1REEA 4RGKA 3OGVA 4XETA 2JE9A 2PHFA 2GAUA 1CVNA 1OFNA 4FPEA 3I8TA 4FPFA 4OHZA 5JR7B 2VOVA 3M4FA 1H1AA 3MZHA 1HRV1 2CSGA 2DTWA 3JB8A 1WCQA 1ZBE1 1C8M3 1UU5A 3O5SA 1XBFA 2ENRA 2IFRA 1IKPA 2VL4A 3W58A 5B2GB 4EYUA 3BYWA 3R0RA 1HRI2 1YQ6A 4L2NA 4QX1A 2ZHKA 4AR2A 3VV1A 1H1MA 3BPZA 1LECA 4LULA 3MFAA 4H2AA 3ZMOA 4XFHA 2DCTA 2JJ6A 4I0AA 4XJ8A 3J4UH 3FHQA 2WWSA 5H9RA 1O3QA 4YGCA 1CWPA 2W95A 1P8JA 1GICA 4AGRA 2IXJA 3E5XA 5A3PA 3GNEA 1GNZA 3GBGA 3SXWA 3BI3A 1RUE3 5FWEA 4I01A 1GP5A 3ZYJB 4HL0A 3I2KA 5CBLA 4G3YC 5SV5A 5IVVA 3OJBA 5C70A 2ZKLA 4PHZA 1RUC3 1VBC3 2HWB2 2JG9A 4JGYC 2J1TA 5FY7A 1ENRA 4JHZA 3WT3A 4BQYA 1JZ8A 1SPPB 3CBNA 2OQ6A 1H2MA 3POFA 3BPSA 2YC0A 5F3GA 3UKTA 5T52A 4L92A 2WZPP 3IMMA 1VRBA 1SEFA 2RJKA 2ET7A 1B35B 5IK4A 3AM2A 5FLHA 3WNPA 1W0NA 1MACA 2YXSA 4NWWA 1WZXA 2AACA 2QQOA 3H42B 4GWJA 1BEV2 4Z2WA 3IKWA 5FZFA 4PBPA 3UGFA 2GNTA 1NLSA 1WA4A 3PU3A 5CA6A 3I3MA 1DZTA 2VQ0A 3J8F1 5DABA 5DXDA 3PMSA 3NW4A 4EN6B 1ACCA 3FUOA 4MVTA 4PI2A 4IEUA 4DO0A 1F9KA 4QMAA 4NIGA 4HLTA 2TUNA 2WA4A 4BA6A 1J3PA 1AR73 1DG6A 1ULGA 3VHOA 3LOBA 2OZ6A 4PF1A 2P6CA 2GN3A 5FP9A 5FQ0A 4G4FA 2D3SA 2RDNA 5C7GA 2VM9A 4UFHA 4BQ2A 2H6CA 3HIFA 4GWMA 1VBD3 4CEWB 4DNYA 1W2OA 1YNAA 2BBAA 5L73A 3AFKA 1W0OA 1HRV2 2ID4A 5BNOC 4UFLA 1VBE3 3LA2A 1SLLA 4J1XA 2A1XA 4Y33A 1CAUB 1IGOA 1ZBE2 4ZZ8A 3UL2A 1NAEA 3WG4A 2QQIA 4FAGA 4WM7A 1TNFA 2VZUA 2GU9A 5H9PA 1S55A 2VAUA 3GXUA 4KQ7A 3OEBA 2DF7A 2WWUA 2Y0IA 5FP3A 4BHPA 1GANA 4XEZA 3RS6A 2AYHA 1X36A 2Y60A 5AVPA 4N43A 5LASA 2ZGLA 5FZLA 3CJIC 1XYPA 5FOBB 2XONA 3AVRA 1O4TA 1PGSA 4K21A 4Q1RA 4Y20A 1OA3A 1ZRFA 2TNFA 3DV8A 5D21A 5J09A 5F9TA 4PLMA 4QX5A 1QU0A 1YO8A 3MUZ1 1NE6A 2HKXA 2ILMA 3O0VA 4UWDA 3USSA 5FO8B 3AXEA 4CDUB 2QQNA 3I4IA 3LA3A 4XJUA 2R061 2QQKA 3NWKA 5FP8A 4BQ1A 1G6NA 4FTBA 1WW7A 3CQOA 5T5JA 2DDUA 2GZWA 3DPRC 5T5PA 3RG0A 1RHI3 3EYPA 5IW0A 4IV1A 2RDSA 3V64A 1R093 5FMDA 3WQ7A 1ZREA 1SG3A 4MSVA 1W8WA 4XFIA 4YW5A 1V00A 1S0IA 1FT9A 4Q8LA 1ZRRA 2O1QA 2OT7A 3QOPA 2ARAA 2OVUA 5FPZA 1A8MA 3SQOA 2VZ3A 1OUXA 5LBEA 2VTFA 4YVSB 4M0HA 3LPGA 1RIRA 1JZ3A 4QT6A 4E2GA 1WMXA 2ZMNA 1IOAA 5F5AA 4HANA 3BKZA 4LBJA 4Q4V1 3AMNA 4K3UA 5F7UA 4B7EA 4KWJA 3J8F2 4BU2A 3WINE 1MEC3 1BQPA 2WBKA 1PIV1 2XQRA 1HX6A 1GOGA 3CL1A 1Z78A 4RA0A 5F2WA 3A21A 4KMQA 2ZEXA 4A4AA 4MGZE 3ZFFC 2B46X 2GALA 4UBGA 5DUUA 5M0TA 1UZWA 1DQ0A 5KHJA 3LD8A 3UGGA 2VD7A 2D6PA 2H0BA 3FHAA 2A6VA 3PIGA 1MQTC 2Y6GA 4NJ4A 2AREA 4YVWB 1DGRA 3B5LB 2UY8A 4Q0SA 1ZRCA 1UL9A 2VCBA 3CJIA 3LDKA 2V72A 4D8MA 4YM1A 4Q26A 4CXWA 4OCTA 2WT0A 2YDEA 3TNQA 2GC0A 4BH9A 4QX2A 1C8M1 1FI2A 4H7MA 2LUWA 5FY0A 5FYYA 5E89A 4CP2A 2VECA 5JOWA 2JICA 5F37A 3POGA 1DCSA 1F35A 2ORXA 3R4DB 4NAOA 1S2KA 4ES8A 5FIXA 5C9AB 3OBZA 5JAXA 5DUWA 1PGW1 2W08A 5LZ6A 3T30A 2IZWA 4XXAA 4KG0A 3ZXLA 5IVYA 4QAWA 4CUCA 5L7OB 4PJYA 5DPNA 3ZYFA 2X53S 4FOQA 3LSEA 2DWRA 3RZMA 4LORA 4DINB 5I8YA 1EP0A 4GH4A 3NJXA 2GN7A 2VG9A 1QJX3 2ZMKA 5F5IA 4FFFA 3SLIA 4HBNA 2R062 1OOPC 2FZ1A 4D0QA 2Z79A 2OW4A 3U0ZA 3HEIA 4K7JA 3E6DA 3PNAA 2WABA 1VBC1 4NN0A 1JMUB 3WG2A 5APAA 4XQWA 1LCLA 4RGAA 4E4ZA 1DGRN 3TWIA 1LENA 2DFBA 1GSLA 5FK8A 5SV8A 2V5DA 2DVFA 3CDZB 4ES9A 4I09A 4UFKA 2PHRA 1DFQA 1CQ9A 5A33A 2E6VA 5BYNA 2WO1A 4AGVA 4EWAA 1AF9A 3I2HA 4YFZA 3OUJA 4MGSA 1SDWA 4QU1A 3HAGA 2ERFA 2GMEA 4Q0QA 2NMNA 1BVVA 4ZU7A 2BFUS 5CFDB 4XCAA 2B4KA 1QDOA 2WT2A 4AFMA 4Q4V2 1X33A 2ADEA 4RQPB 4AQ6A 1GQHA 1PIV2 2NN8A 2WRAA 3EBRA 3QH7A 1GP4A 4HVQA 1CJDA 2A75A 1PVC3 1AR71 5FV3A 2CY6A 5J3UA 1N3QA 2EXHA 4EZ4A 4AAPA 1WW6A 1SLAA 5I0RA 4ORFA 1OLQA 5IHRA 3NJZA 3VL9A 4AAXA 4ZZ5A 1JZ5A 2JE7A 1OKQA 1C28A 1TVGA 5FZOA 3PHMA 1C8M2 1V6NA 5I8SA 3WVJA 3DYMA 1OXCA 5K0UC 1RUG1 2UWAA 2VZSA 3WP6A 4CEYC 3BTYA 4DUXA 1CIYA 1GKBA 4LIUA 5E88A 4LUMA 4IEZA 1GWMA 1YI9A 4KBBA 1RUOA 4OMCA 4LPLA 4D94A 3E97A 5EJ1B 5FZDA 1PGW2 1W6MB 4P02B 2NM1A 4ASMB 5EWSA 1UMIA 5A6ZA 1OLMA 3OGJA 3C7HA 4XQ4A 1WLTA 2Y6FA 4BIOA 4A7KA 3WEZA 2NLRA 2WO3A 2XWBB 1DLLA 3ZSEA 1QXPA 1H8TC 3ZPYA 1EAH3 1W6QB 1VPHA 2VR4A 3FL7A 4HETA 4HKLA 4MYEA 2Q8OA 4AHYA 3NJYA 3U4XA 5JWPA 1K5MA 3TNPB 4N9HA 2JECA 3USUA 1BKZA 4CRQA 4CU7A 5GZCA 2VQTA 1R091 4Y4YA 2LS6A 5FUNA 3VDDC 1CGPA 4CDWA 1VBC2 1UOBA 2OZJA 3LA7A 2HWE3 2W91A 2VE1A 4AZZA 4C1WA 1S0DA 4N7UA 3RWNA 2Z2SB 1OT5A 1C57A 4FTEA 3KLSA 3RGBA 2FBEA 4NPRA 1CAXA 1JZ2A 1PK6A 4AFCA 2ZHLA 2VJXA 1G7YA 4PF5A 1VB4A 4YZ1A 2Z4FA 4GQ7A 2XUEA 4NHXA 2OPKA 3LAGA 3IT8A 4IGQA 4Q4Y1 2VZTA 2I2SA 3NKGA 4PDWB 2GNDA 1NOVA 2KM2A 1AJOA 2WFF3 4KL1A 4HZFA 3AZWA 5F3EA 1AXZA 1MEC1 1BVP1 2DU0A 5H9SA 4RSUA 3D0SA 4ZU4A 4B8EA 1JU3A 3H1WA 5F6LB 5K0UA 2UYAA 3K2OA 3AYCA 5LRSA 4QM9A 4LITA 2RS51 2RDQA 4RL7A 3OGSA 1AR72 2YUEA 2IXHA 3HT1A 5IVJA 5KXDA 2BBVA 2VZPA 3G6JB 1POQA 3ZDSA 4URTA 3ZXFA 2YG0A 3K3OA 1IS5A 4L99A 4LBOA 2VMHA 3KMHA 4IEYA 2BGCA 3DXTA 4M4RA 3RYPA 1OVSA 1RUG2 1H2KA 5EYXA 4MHUA 3T2TA 4DRVA 2W0XA 4DXTA 4JDMA 1IS4A 1WUVA 3I59A 3WX5A 1BBT1 1JW6A 1LODA 4MXVA 1OH4A 5F6KA 4AVSA 2WQ4A 1GZ9A 2ZBJA 1O8SA 4D7TA 4AEKA 3Q8CA 3VDDA 2A3YA 1WBLA 5GZDA 1QEXA 3ZO0B 4NIDA 3R4SA 4LKDA 4UF0B 4DB5A 4HN0A 1BK1A 2QQVA 1Q8PA 2Y6LA 2A5ZA 3J26N 3QH6A 5FBJA 1JZ6A 3MO4A 2P3YA 1QJX1 1S0FA 3OPZA 4GA9A 5FY4A 2VBBA 2V4VA 3AKPA
chains in the Genus database with same CATH topology
4V2VA 2OT7A 3KV9A 5F5CA 5FZBA 3U4SA 5FZ4A 5FYCA 3PU8A 5FZOA 5FYHA 4DIQA 5FYSA 5A1FA 5FYUA 5FP4A 4QX8A 3KV6A 5FZIA 2Q8DA 4LIUA 5F39A 5F5AA 4QXHA 2GP5A 2Q8CA 5FZHA 4CCNA 5A3PA 5FPUA 3N9QA 5LY2A 5FPBA 5FZDA 5FYTA 4BU2A 4NUBA 5FWEA 4CUGA 4QX7A 4CCKA 3OPWA 5F2WA 5FY1A 4C8DA 5A7NA 5IVVA 3N9MA 5FJHA 3LD8A 2VD7A 5A7PA 5FY7A 3N9OA 5FXWA 2YBSA 3KVBA 2OQ6A 2OX0A 3NJYA 4GD4A 5F32A 4CCLA 5F3GA 4ASKA 5F2SA 5FZEA 1VRBA 5A3WA 2XDVA 5FUNA 5FY0A 5A7OA 5FYYA 5FZKA 5ANQA 4CCOA 2YPDA 4HONA 5FYBA 4Y4RA 5F37A 3N9PA 4HOOA 4BISA 5LW9A 5FZFA 3DXUA 4CCMA 4D6QA 3LDBA 5A7SA 3PU3A 4IGPA 5K4LA 5FPVA 4XDPA 4Y3OA 5FZOB 4GJZA 5A3NA 2XUEA 4GJYA 3KV5A 5IVYA 4UF0A 4IGQA 4QXCA 4DO0A 5ISLA 5FYVA 4EZHA 5LWBA 2YBPA 5FZAA 5F3EA 5A80A 5FY9A 4E4HA 5FP9A 5FP7A 3N9NA 5F5IA 3PDQA 4BXFA 5FPLA 5FY5A 5FZ3A 3K2OA 3PUSA 5IVFA 2YU1A 4LITA 5F3CA 3U78A 4CSWA 5FWJA 3ZLIA 5IWFA 2OS2A 2YBKA 3K3NA 5FJKA 4QWNA 4Y33A 3UYJA 4IGOA 5IVCA 3PUAA 5IVJA 3ZPOA 3AL6A 5FXVA 5FZCA 5FZ7A 2XXZA 5F3IA 5FY8A 3K3OA 5A3TA 2WWUA 5FP3A 4CCJA 2YU2A 5FXZA 4LIVA 2OQ7A 5LY1A 4V2WA 2PXJA 5FZLA 5FUPA 3DXTA 3AVRA 5FZ6A 2Q8EA 4QU1A 5FZ8A 5IVEA 3N9LA 5FPAA 5E6HA 5FZMA 5A7WA 5FZ1A 5FZ0A 4AI9A 2WWJA 3PTRB 4QXBA 5FZ9A 5FYMA 4D6RA 3OPTA 3KVAA 3AVSA 5IVBA 5FP8A 4URAA 5FYIA 5KR7A 4D6SA 2XMLA 4UF0B 5FXXA 3KV4A 5IW0A 5A1LA 4XDOA 5FV3A 5FBJA 2P5BA 2W2IA 3PURA 4LXLA 5FZGA 3PUQA 5A7QA 5A7WB 3RVHA 5FY4A 5FYZA 4GAZA 4AAPA 4EYUA 4EZ4A 4TN7A 2GP3A 5CEHA 3AL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V2V A;  2OT7 A;  3KV9 A;  5F5C A;  5FZB A;  3U4S A;  5FZ4 A;  5FYC A;  3PU8 A;  5FZO A;  5FYH A;  4DIQ A;  5FYS A;  5A1F A;  5FYU A;  5FP4 A;  4QX8 A;  3KV6 A;  5FZI A;  2Q8D A;  4LIU A;  5F39 A;  5F5A A;  4QXH A;  2GP5 A;  2Q8C A;  5FZH A;  4CCN A;  5A3P A;  5FPU A;  3N9Q A;  5LY2 A;  5FPB A;  5FZD A;  5FYT A;  4BU2 A;  4NUB A;  5FWE A;  4CUG A;  4QX7 A;  4CCK A;  3OPW A;  5F2W A;  5FY1 A;  4C8D A;  5A7N A;  5IVV A;  3N9M A;  5FJH A;  3LD8 A;  2VD7 A;  5A7P A;  5FY7 A;  3N9O A;  5FXW A;  2YBS A;  3KVB A;  2OQ6 A;  2OX0 A;  3NJY A;  4GD4 A;  5F32 A;  4CCL A;  5F3G A;  4ASK A;  5F2S A;  5FZE A;  1VRB A;  5A3W A;  2XDV A;  5FUN A;  5FY0 A;  5A7O A;  5FYY A;  5FZK A;  5ANQ A;  4CCO A;  2YPD A;  4HON A;  5FYB A;  4Y4R A;  5F37 A;  3N9P A;  4HOO A;  4BIS A;  5LW9 A;  5FZF A;  3DXU A;  4CCM A;  4D6Q A;  3LDB A;  5A7S A;  3PU3 A;  4IGP A;  5K4L A;  5FPV A;  4XDP A;  4Y3O A;  5FZO B;  4GJZ A;  5A3N A;  2XUE A;  4GJY A;  3KV5 A;  5IVY A;  4UF0 A;  4IGQ A;  4QXC A;  4DO0 A;  5ISL A;  5FYV A;  4EZH A;  5LWB A;  2YBP A;  5FZA A;  5F3E A;  5A80 A;  5FY9 A;  4E4H A;  5FP9 A;  5FP7 A;  3N9N A;  5F5I A;  3PDQ A;  4BXF A;  5FPL A;  5FY5 A;  5FZ3 A;  3K2O A;  3PUS A;  5IVF A;  2YU1 A;  4LIT A;  5F3C A;  3U78 A;  4CSW A;  5FWJ A;  3ZLI A;  5IWF A;  2OS2 A;  2YBK A;  3K3N A;  5FJK A;  4QWN A;  4Y33 A;  3UYJ A;  4IGO A;  5IVC A;  3PUA A;  5IVJ A;  3ZPO A;  3AL6 A;  5FXV A;  5FZC A;  5FZ7 A;  2XXZ A;  5F3I A;  5FY8 A;  3K3O A;  5A3T A;  2WWU A;  5FP3 A;  4CCJ A;  2YU2 A;  5FXZ A;  4LIV A;  2OQ7 A;  5LY1 A;  4V2W A;  2PXJ A;  5FZL A;  5FUP A;  3DXT A;  3AVR A;  5FZ6 A;  2Q8E A;  4QU1 A;  5FZ8 A;  5IVE A;  3N9L A;  5FPA A;  5E6H A;  5FZM A;  5A7W A;  5FZ1 A;  5FZ0 A;  4AI9 A;  2WWJ A;  3PTR B;  4QXB A;  5FZ9 A;  5FYM A;  4D6R A;  3OPT A;  3KVA A;  3AVS A;  5IVB A;  5FP8 A;  4URA A;  5FYI A;  5KR7 A;  4D6S A;  2XML A;  4UF0 B;  5FXX A;  3KV4 A;  5IW0 A;  5A1L A;  4XDO A;  5FV3 A;  5FBJ A;  2P5B A;  2W2I A;  3PUR A;  4LXL A;  5FZG A;  3PUQ A;  5A7Q A;  5A7W B;  3RVH A;  5FY4 A;  5FYZ A;  4GAZ A;  4AAP A;  4EYU A;  4EZ4 A;  4TN7 A;  2GP3 A;  5CEH A;  3AL5 A; 
#chains in the Genus database with same CATH topology
 3ON7 A;  3NMB A;  3E1F 1;  3KV9 A;  4I3P A;  3J7N A;  5FZB A;  2YC4 A;  1R09 2;  2VZQ A;  3PU8 A;  5CVR A;  3RYK A;  4DQA A;  1GQG A;  2QQJ A;  1IS3 A;  3OBT A;  4MET A;  2WZR 3;  1OA2 A;  4PBO A;  3POJ A;  2PHT A;  1QJE A;  2RE9 A;  3DPR B;  2Q8C A;  2K2S A;  1QNY A;  1A3K A;  3N9Q A;  3WHT A;  4YG3 A;  4CCD A;  3BU7 A;  4QHZ A;  2ZAA A;  1NCQ C;  3T0A A;  4JAA A;  1QXR A;  4YW4 A;  4RYD A;  1YLL A;  1LKN A;  2WNU A;  1HQL A;  4GWN A;  4Q4Y 2;  3I3Q A;  3FX3 A;  2VU9 A;  1LGC A;  3SKJ E;  4Z1V A;  3FBY A;  1H9P A;  1N1S A;  1MEC 2;  3AXD A;  5JMO A;  2ZX0 A;  1FPN 1;  5JVV A;  4W50 A;  4AHX A;  5EQU A;  3WW1 A;  3FMG A;  4CTE A;  4GD4 A;  4Q0P A;  5FOJ B;  4DPN A;  4R9D A;  2AZ5 A;  1HKD A;  5ERL A;  2ZAH A;  3DUI A;  2JB8 A;  4XIL A;  1PVC 1;  1N3P A;  2RS5 2;  2YV8 A;  2CYF A;  5H9Q A;  3WOG A;  3GGL A;  4CCC A;  5I8T A;  3HN3 A;  3RZL A;  1HIX A;  4CP9 B;  4ERO A;  2VVF A;  1OF4 A;  1ZM1 A;  5C8C A;  1DIW A;  2D5F A;  4BXS V;  5LW9 A;  3MIF A;  4MGT A;  2VUA A;  2MHF A;  3ZFF B;  4CCM A;  1C5H A;  2FHR A;  2YPJ A;  1IQA A;  5C3P A;  4F8A A;  5LA9 A;  1OI6 A;  1Y4W A;  4R4X A;  1DU3 D;  5A3N A;  1UY0 A;  1MQT B;  3RFR A;  3IN9 A;  2DU1 A;  4I0B A;  1IZ3 A;  2GMM A;  4AED C;  1G8W A;  3WY6 A;  4MHR A;  2QE3 A;  5ISL A;  3CZU A;  3ZXE A;  1SFP A;  3W59 A;  1BBT 2;  2VNO A;  1LGN A;  3W5M A;  5A70 A;  4I0W B;  3OCP A;  4F7Z A;  4QKB A;  1X8M A;  1OQ1 A;  1RVF 3;  3MW4 A;  4BLJ A;  3RJR A;  1UOF A;  3WHU A;  3WDX A;  2Y26 A;  3W20 A;  5FZ3 A;  1E5I A;  2XLG A;  3JUU A;  1VB2 A;  4NRQ A;  3UYJ A;  2YBK A;  3CO2 A;  3SIT A;  3R05 A;  1PMJ X;  1QJX 2;  3NAP C;  5C6C A;  1WW5 A;  1S2B A;  4JTO A;  4RHV 3;  2D93 A;  4NIH A;  1LOF C;  4Z92 B;  1SLT A;  4S2G A;  4W4Z A;  4QGN A;  3PME A;  2E53 A;  1BJQ A;  4FPK A;  4LIV A;  3AZX A;  1AR9 1;  2HWE 1;  1K5J A;  1RMU 3;  1O91 A;  4XUQ A;  4RGG A;  2XJT A;  4QPI C;  1KJR A;  2Q8E A;  4CXX A;  1D4M 1;  1F2N A;  1OOP B;  4DXZ A;  5FZ1 A;  4FI9 A;  5DDJ 3;  4L9B A;  2XVK A;  4WM8 B;  1QQP 1;  4QXB A;  4YZ2 A;  4D6R A;  5DMY A;  4AWD A;  3R6S A;  2BFU L;  1SPP A;  1G9C A;  4KWL A;  3AVS A;  2R6Q A;  4YM0 A;  3VZJ A;  4H14 A;  4URA A;  2X5I A;  4KWK A;  4R4Z A;  3V0A B;  2LAL A;  2CTV A;  2WFF 1;  1B35 A;  1UN1 A;  1AVB A;  2P5B A;  5FFO C;  1FXZ A;  1SCR A;  3PUQ A;  4P9I A;  5KBF A;  3W9A A;  2NP0 A;  1FPN 2;  2ZGS A;  1PO1 1;  3ZFE B;  2O8Q A;  2Q0A A;  5JIU A;  3AP7 A;  1BMV 1;  1RB8 G;  1JYW A;  1MS3 A;  1PVC 2;  1EV1 3;  2E7A A;  3GHN A;  3MDP A;  3W5N A;  2WKK A;  4MGY E;  1GWL A;  2J1V A;  3K4A A;  3PTY A;  4IV3 C;  1J84 A;  1R08 3;  5FZH A;  4KG8 A;  2JIJ A;  5FKC A;  1EUT A;  1I5P A;  2IXL A;  2RVA A;  2V4A A;  5FPB A;  3MFC A;  3H8X A;  2P1B A;  1JXN A;  5K8S A;  4CEW A;  5FLI A;  3SH5 A;  1OUS A;  1CX4 A;  1CN1 A;  2P4E A;  1RUD 1;  5D8A B;  3KHC A;  4IER A;  1YQC A;  5IFP A;  1QJY 3;  2YY1 A;  1W8O A;  4CEY B;  2ZGU A;  5BPX A;  1BK0 A;  2BJS A;  1XSQ A;  3LDR A;  4QX3 A;  4Z8B A;  4L0P A;  4LOT A;  2WFP A;  4BIF A;  4D7S A;  1PMH X;  1UZZ A;  4EN7 B;  1TZO A;  2XDV A;  4A42 A;  2EIE A;  1Q8O A;  4YG0 A;  5A7O A;  3SCG A;  2UWC A;  1W9S A;  2YYO A;  4ET7 A;  1RXF A;  1AUY A;  3LSD A;  2HJI A;  2WLP A;  2C1F A;  3CZJ A;  1ENX A;  4MGQ A;  3WF4 A;  4NII A;  3WSO A;  3NV3 A;  2WAA A;  2YFZ A;  3KHB A;  4XJZ A;  5FK7 A;  3SHR A;  4DXR A;  4CDU A;  2RDR A;  4EWE A;  3T2Q A;  1UY3 A;  1AR9 2;  2RMU 3;  4LMF A;  5IAV A;  3I2D A;  2HWE 2;  2WZR 1;  1HB1 A;  5T5L A;  1RUF 3;  2R49 A;  5C9A C;  4QXC A;  3OYW B;  1D4M 2;  1FV2 A;  1U5I A;  4RD7 A;  1XYN A;  5LWB A;  1GNY A;  3TEZ A;  3N35 A;  2YHJ A;  1N1V A;  3U37 A;  1QQP 2;  1KXG A;  3CEW A;  3GZT B;  2RS1 1;  2DUR A;  2EF6 A;  2VCM A;  5FBZ A;  4YAR A;  3E5U A;  1QKQ A;  2ZPX A;  1S2E A;  4Q4W 3;  4YZ3 A;  4H3W A;  4LEJ A;  3I2J A;  4FAH A;  1GOF A;  2WFF 2;  3KCX A;  4I02 A;  4YVS A;  2B39 A;  2Y64 A;  1CD3 G;  2JDY A;  3PUA A;  1RUI 1;  1W2N A;  4MG2 A;  4AI2 A;  4ISQ A;  5KXC A;  5FAX A;  1K12 A;  2FD8 A;  1PO1 2;  2E9Q A;  1G9F A;  3AJY A;  1BMV 2;  2VO5 A;  1W9W A;  5DAP A;  2JEN A;  4JZR A;  5FRA A;  2FDJ A;  1QH7 A;  2QZ3 A;  2YU2 A;  2VQA A;  3PJQ A;  4LO6 B;  3VBH B;  1GMM A;  3K48 A;  2VNR A;  1GYK A;  3N7M A;  2DUP A;  2PXJ A;  1UPS A;  2JDK A;  1RYY A;  4V2W A;  3JCI A;  4XFA A;  5EV7 A;  4Q8K A;  2XPJ A;  5FMC A;  2R04 1;  5JIA A;  1AYN 1;  1TQ5 A;  3SMH A;  2WUH A;  1UX6 A;  4MO3 M;  2X09 A;  5FZ0 A;  3OD4 A;  3PTR B;  4DFS A;  2QDR A;  1ALY A;  1DYK A;  4YVW A;  4ZU5 A;  2ZZJ A;  2BNN A;  4MGK E;  5FMB A;  4LKS A;  1LOG A;  4XUN A;  4OQ8 A;  4NVP A;  3WG3 A;  2MEV 1;  5GLV A;  3U75 A;  1RUD 2;  4MLO A;  4XF1 A;  3DGT A;  1RVF 1;  5FYZ A;  3FLP A;  3CKH A;  5T5O A;  4RR3 B;  1OBN A;  5CEH A;  3NKT A;  1W6N B;  3ZR5 A;  4M3C F;  2Y38 A;  4N9I A;  3AP5 A;  1OKO A;  2J1S A;  1OC1 A;  2FCV A;  3ACG A;  3GM8 A;  3KZ4 C;  1BHG A;  4HKW A;  4QB6 A;  3ZFG C;  4AOC A;  4XC9 A;  4BQW A;  3RMX A;  3U11 A;  1VAM A;  3HOB A;  3P6B A;  3VDC A;  5KXE A;  5L7O A;  4PQ9 A;  3MPP G;  1G9A A;  3LEM A;  1OD5 A;  2RR1 3;  3M3C A;  1XNT A;  5HV4 A;  2R1D A;  3H3Z A;  4FOV A;  3BOW A;  4ZY9 A;  5KC5 A;  1DDL A;  1RMU 1;  4UW4 A;  4Y5Z 0;  1Z7S 1;  1JYN A;  5ABJ C;  2WZR 2;  3OPW A;  1U0A A;  5IAT A;  3KT7 A;  4MOA A;  3ZYB A;  3WNO A;  4NRP A;  4AVT A;  1GBG A;  5FJH A;  3UNP A;  4AE2 A;  2VC9 A;  5A6Q A;  5HXM A;  1L3J A;  1EY2 A;  3DL3 A;  2BVB A;  2JXA A;  5J48 A;  5J1X A;  4KGG A;  1J83 A;  4E9K A;  2RS1 2;  3A22 A;  3MIG A;  4G9S B;  1QIQ A;  1KEX A;  1YQ8 A;  5FZE A;  1X7N A;  1ZBA 3;  3D6E A;  4NRM A;  4AFA A;  2EAA A;  3I2O A;  1QJU 3;  1LHN A;  1RUI 2;  4XF9 A;  1NCQ B;  3N9P A;  2OKX A;  2XGX A;  2YFU A;  4OZO A;  3WD5 A;  1YWK A;  5CFD A;  5KHG A;  4XCB A;  3LDB A;  2E33 A;  3VHN A;  1I9R A;  4QQ2 A;  4DS0 A;  3FFQ A;  1X8E A;  4RQP A;  2KR2 A;  3S5Q A;  3QCW A;  5EJ3 A;  4LBL A;  1DZQ A;  3DN7 A;  4EE2 A;  3NRU A;  3KV5 A;  2W47 A;  4GJY A;  1WCS A;  2R04 2;  1AYN 2;  1C4R A;  1R08 1;  1SFN A;  1W2A X;  2JG8 C;  2WN2 A;  1OVP A;  4XHB A;  2JWP A;  3SKV A;  2A6W A;  1WMF A;  1A8D A;  1W8T A;  2VUL A;  2WQZ C;  3JD7 3;  1COV 3;  5KC6 A;  2ZGR A;  5A3U A;  4D7Y A;  2VNG A;  1LTE A;  4NWV A;  1JS9 A;  2V5Y A;  4PDW C;  4P5Y A;  5EPA A;  1GUI A;  2VY0 A;  2ARC A;  5T55 A;  4QDR A;  5FR3 A;  3MEP A;  3UET A;  2MEV 2;  1U5X A;  4LK7 A;  2ZGO A;  4LE3 A;  3WLU A;  2EVX A;  2PLV 3;  1QJY 1;  1RVF 2;  4W6W A;  1VAV A;  2R07 1;  1UO9 A;  1NCR C;  4NHK A;  1OPO A;  2NMO A;  3ACF A;  3S30 A;  5C3S A;  2HWD 1;  4AED B;  2JDA A;  1PZ8 A;  1UAI A;  3AKQ A;  5EP9 A;  3WF2 A;  1IHM A;  1BZW A;  4IE4 A;  5FO7 B;  1W6P B;  1W6M A;  1D4V B;  2IFW A;  2VMG A;  1CAW B;  2E31 A;  3EB7 A;  5DAV A;  5FUP A;  4KBZ A;  5IFT A;  1YJK A;  4JGZ C;  3VKN A;  2ZGP A;  3T2P A;  4DEQ A;  2WNV C;  5FPA A;  5FZM A;  4PLN A;  5K7P A;  2G9F A;  3TN9 3;  2RMU 1;  4XJA A;  5FZ9 A;  4AK3 A;  2FDG A;  1RMU 2;  1W6Q A;  3KVA A;  3T09 A;  4AVA A;  5JXG A;  3EXU A;  1Z7S 2;  1RUF 1;  3NAP B;  4IEV A;  4SBV A;  4UW3 A;  4XDQ A;  1I3H A;  1CZV A;  1LEM A;  1QF3 A;  1XNB A;  3VBO C;  1DF0 A;  2VW0 A;  2VMF A;  4YW6 A;  5GAL A;  4BQ3 A;  3GZE A;  4XPV A;  4Z07 A;  5FZG A;  5GKA C;  4Y5S A;  3VKF C;  2BW8 A;  1H6Y A;  3PL0 A;  5I0U A;  4QPI B;  3IDA A;  4O61 A;  3JU9 A;  3FLT A;  3IM0 A;  5F5C A;  1V6I A;  5C71 A;  4NR1 A;  2GMP A;  4M0N A;  1UU6 A;  1I1E A;  4JGY A;  2SBA A;  2GC1 A;  3OY8 B;  4CDX B;  3A7Q A;  1V6K A;  5FYU A;  3ITQ A;  1PHM A;  4CDQ C;  2YB7 A;  1AJK A;  1XQN A;  3NNF A;  1W04 A;  3GZU C;  1N3O A;  3IPV A;  3AYD A;  4JX0 A;  2Q30 A;  4RFR B;  3VZK A;  5FLJ A;  1VLN A;  1PMI A;  4FXK B;  5BXX A;  3KQR A;  4O7X A;  3NVC A;  2VOT A;  3UJO A;  3I97 A;  1T2X A;  1O5U A;  1D2Q A;  1TMF 3;  1ONA A;  4CCK A;  1MVQ A;  1VRH 1;  5FY1 A;  2CNA A;  2J1A A;  2CU5 A;  4J25 A;  2JDN A;  4QU2 A;  1BXH A;  3SEE A;  1R08 2;  4YZ5 A;  1VBA 3;  4OUE A;  3RMY A;  2AC1 A;  3AX4 A;  4XUO A;  3O12 A;  5D1I A;  3IDB B;  4IV3 B;  4HK8 A;  3DKQ A;  1O7F A;  3ILN A;  2WA3 A;  2OX0 A;  1PGL 1;  2QUO A;  1OLR A;  4AEM A;  2ZGT A;  1GV9 A;  5F2S A;  3AP6 A;  4A41 A;  1UWW A;  3MV1 1;  5A3W A;  2OUJ A;  1WLD A;  5HXV A;  2CWS A;  1F31 A;  4E8C A;  4AI8 A;  1QJY 2;  3TBD A;  4A6S A;  2BP6 A;  5KHK A;  1W06 A;  2HWC 1;  2R07 2;  5LEJ A;  1H30 A;  3WUC A;  3ZSK A;  2HWD 2;  3VBU B;  2JX9 A;  2BER A;  1W3X A;  4Y1X A;  1LOA A;  3RRD A;  5BNO A;  1NQJ A;  1RXG A;  4XDP A;  1W8N A;  3THD A;  1CZT A;  4N53 B;  3BB6 A;  4OMD A;  3OF1 A;  4P9G A;  2AUY A;  3BVC A;  2RR1 1;  4UF0 A;  5LRR A;  2H6B A;  3IZO A;  2VOW A;  5B4N A;  2RMU 2;  5AFE A;  2E7Q A;  4AEJ A;  3KB5 A;  4PIX A;  4P5H A;  4KI5 M;  3DF0 A;  1RUF 2;  2QQU A;  1OF3 A;  3D0J A;  1AX0 A;  5CFC C;  4FPL A;  4P9W A;  3LPF A;  2V09 A;  5IWF A;  1PM4 A;  3VBS B;  4AW7 A;  3V56 A;  2AH2 A;  3C8X A;  4YW7 A;  2NPI A;  4N90 A;  1H2L A;  2XXZ A;  5F3I A;  3DPR A;  1QY4 A;  2FCT A;  2FCU A;  3V0B A;  3C3V A;  2Z42 A;  4IEX A;  1QJU 1;  3K77 A;  4AXO A;  2ZX4 A;  3I49 A;  1W3V A;  1O5L A;  1X9P A;  5E8A A;  4JKK A;  1JTZ X;  1NA1 C;  2ORZ A;  3TYJ A;  5JOX A;  5LK7 B;  4MXW B;  5A7W A;  1RUE 1;  1G9B A;  4YLZ A;  4AI9 A;  2BPA 2;  2A3W A;  1LOC A;  2D98 A;  1KIT A;  1S1A A;  3ZKU A;  5FO9 B;  1XNK A;  5CKM A;  2BDR A;  5FYM A;  3MIC A;  5KHH A;  3T0B A;  4XBL A;  4NE9 A;  4RFT 0;  5FYI A;  1VRH 2;  4C1X A;  1RUC 1;  2XML A;  1VBB 3;  5CU1 A;  1UD1 A;  4WM8 C;  2W92 A;  2BQP A;  1ST8 A;  2BWC A;  2CWM A;  2VUJ A;  4TLG A;  4ARX A;  4LTA A;  2IVI B;  3JD7 1;  1D7P M;  3RZK A;  3M70 A;  3OEA A;  3GCW A;  4OFG A;  3HPN A;  3SEP A;  4CP9 A;  2QQM A;  5DUX A;  4IW3 A;  4HSJ A;  4OHX A;  3I3D A;  1PGL 2;  5TSW A;  5DAQ A;  4CXY A;  1UYX A;  2RM2 3;  3WP3 A;  3ZFF A;  5L36 A;  3E6B A;  4ZXK A;  1YQ5 A;  3A0N A;  5FYC A;  1GFF 2;  3TEY A;  2VZR A;  3ZFE C;  1MQT A;  1GLH A;  2Z5W A;  4YFW A;  1TME 3;  3E6C C;  4QPG C;  4ZPI A;  1OQD A;  3KV6 A;  2HWC 2;  5FZI A;  3WQ0 A;  3X29 B;  5JSO A;  1ZZC A;  3IDC B;  4Q0U A;  4XUT A;  4HPK A;  4X6R B;  4NUB A;  1NE4 A;  2WR9 A;  3MLJ A;  2WSU A;  4GKY A;  4L11 A;  3VB9 A;  2XVL A;  1WD4 A;  2RR1 2;  1ULP A;  3ZIX A;  1QH6 A;  2DTY A;  4RS5 C;  1HN0 A;  1MR5 A;  4XHX A;  4FFI A;  4B3N A;  3TN9 1;  3N7J A;  5A7P A;  4IND A;  3M1H A;  2VTX J;  3ZSJ A;  2EIG A;  4HMZ A;  1VBD 1;  3ZFG B;  5BNP C;  2DBN A;  4Y1U A;  2W52 A;  5GLT A;  2KD7 A;  2XHK A;  4CVU A;  5BV6 A;  4E4S A;  1VBE 1;  5D8A C;  3POI A;  5IK8 A;  5ACA 3;  1HW5 A;  3M3O A;  2DCZ A;  5BUV A;  5FZK A;  2FQP A;  2YPD A;  3H8O A;  4XW3 A;  3AB0 A;  5C4W C;  5ABJ B;  1XU1 A;  3IAP A;  5JXH A;  1YEW A;  1ZZ6 A;  1OOP A;  4H55 A;  3SIS A;  2DVB A;  2Y33 A;  4HKO A;  5CG8 A;  1POV 3;  5C8W A;  1DP0 A;  1BYH A;  2KA3 A;  4WM8 A;  3ABZ A;  2VUD A;  3MPB A;  3RZJ A;  1QJU 2;  4Y3O A;  4ZXE A;  3RDI A;  1CAV B;  4K8R B;  3V0A A;  4W6Y A;  1YJL A;  2A6X A;  2WN3 A;  3KQ4 B;  2Y6H A;  1E5S A;  2ETE A;  5E1R A;  3ZMN A;  1MZE A;  1M4W A;  3BN6 A;  1RUE 2;  3O14 A;  5AFB A;  5AVA A;  1RUN A;  3WXP A;  4FOW A;  4I30 A;  1RIT A;  1HQN A;  2D3R A;  1RHI 1;  3AJZ A;  4MX3 A;  2Q1M A;  1HB2 A;  1S0J A;  2L9L A;  2PHL A;  3ROU A;  3J7M A;  1JBC A;  1RUC 2;  3ZDV A;  2CGN A;  1VBA 1;  2J1R A;  2PHX A;  3JD7 2;  2DVA A;  3ZLI A;  1W8Z A;  3TEW A;  3I54 A;  4OUS A;  4AVB A;  4DUW A;  3RQ0 A;  5LBF A;  4TZD A;  1LES A;  4E2Q A;  2HYX A;  2JG8 B;  3VDB A;  1W2U A;  2XBO 3;  1YFY A;  2ZX3 A;  2JKB A;  1S0B A;  2PLV 2;  4JDO A;  3T4V A;  1W99 A;  2P17 A;  3HNY M;  1KQR A;  4IE7 A;  2VZ1 A;  4QGM A;  3BOP A;  1WCD J;  3OTF A;  1HJG A;  4LHL A;  3VBH C;  1W6O B;  2QNK A;  1FNY A;  3ACH A;  2G9Z A;  1UYY A;  4PIZ A;  2W9X A;  4AF9 A;  2D40 A;  4LHS A;  4K9S A;  3L2Y A;  1O3R A;  1L7Q A;  4MAD A;  4CEY A;  1V6O A;  3T0D A;  1NCR B;  1YIF A;  4D6S A;  5J36 A;  3CIH A;  1DQ2 A;  2VH9 A;  4XIK A;  5IAX A;  1VMH A;  2QQW A;  4XDO A;  4XE9 A;  4Y1V A;  4YPJ A;  3BIE A;  3TN9 2;  1YUD A;  5HBA A;  3MV0 1;  4FFH A;  1R64 A;  3FN9 A;  1IS6 A;  1VBD 2;  1PM7 A;  4GMP 3;  4IUG A;  4JGZ B;  3ZXG A;  4U36 A;  2X8K A;  3UES A;  1VBE 2;  3BU0 A;  2WNV B;  3FC0 A;  3NV2 A;  1DQ4 A;  2ZEW A;  3OGG A;  4QDS A;  3AYE A;  4RR3 C;  1H8T A;  1ZA4 A;  4XMI A;  3KCY A;  1UNB A;  1S0C A;  1ZZ7 A;  4YM2 A;  4LBK A;  5FYS A;  3ZXA C;  3POW A;  4I3G A;  4GZ9 A;  4BK4 A;  3V65 A;  4Z2A A;  4X8N A;  1F5J A;  3SC7 X;  3VBO B;  2ATF A;  1Y9G A;  4JCK A;  1ASJ 3;  1T6B X;  4S2H A;  2X29 A;  3WCR A;  2FDI A;  1QNW A;  4AQS A;  5EXO A;  2D6O X;  2JD9 A;  2W46 A;  2A6Y A;  2WYF A;  3IB3 A;  4FPC A;  2QCS B;  2YGM A;  1R1A 3;  3A0K A;  5JZG C;  2EXK A;  2FDF A;  1SLC A;  1AR8 3;  2F17 A;  3RZG A;  3P3P A;  4TTG A;  2EIC A;  1E57 A;  1FAY A;  4Q4X 3;  3TAY A;  2ZML A;  3D3A A;  2K9Z A;  5FRE A;  1VE0 A;  3NQH A;  3LEK A;  3AMP A;  2BGO A;  1XPW A;  1RHI 2;  3D82 A;  4CDQ B;  1WBF A;  5DG1 A;  5CNA A;  5EZW A;  1VBA 2;  2W94 A;  3ASI A;  3WDU A;  2PAE A;  2LW8 A;  3VBR B;  2HEY F;  3JZV A;  5ANQ A;  5JOY A;  1TG7 A;  1JN2 P;  3O1M A;  2BZD A;  2IVJ A;  3LFM A;  3U1X A;  3VBF B;  2XJV A;  2E7T A;  3JBG 3;  4BIS A;  2RM2 1;  4XMA A;  3J7H A;  2I74 A;  3AMH A;  1KS4 A;  3KD4 A;  5LEK A;  3ZN4 A;  4QD2 A;  2ZGK A;  4IL7 A;  4GJZ A;  3CHX A;  4IDZ A;  4DY3 A;  1CES A;  2QTW B;  2PTM A;  4W8J A;  3WP4 A;  3IIA A;  4Q0V A;  3M3I A;  2RS3 3;  2Z69 A;  4XAC A;  4ARY A;  1UYP A;  3ACI A;  4H7L A;  1W8U A;  5I0D A;  5FY9 A;  2QQP A;  2FMD A;  3AZY A;  5FP7 A;  4XZU G;  5JUV A;  4QXK A;  1W6N A;  5JXJ A;  1AXY A;  1X82 A;  3SCF A;  5HI0 A;  1HRI 3;  1WA6 X;  3GCX A;  4D3W A;  3RSJ A;  4K6B A;  1MS0 A;  2HBU A;  3WP5 A;  2P3I A;  1NKG A;  3VHR A;  2VCC A;  3TB0 A;  2CDP A;  5IYY A;  5A6Y A;  4B4Q A;  2E32 A;  5FY8 A;  3PVB B;  4PT6 A;  1IPS A;  5ACA 1;  1OLM E;  3AKR A;  4LKF A;  4YGE A;  3VZL A;  2WT1 A;  3KS7 A;  2OQ7 A;  3OUH A;  1C3H A;  1UX7 A;  3F2Z A;  3FHI B;  5C33 A;  5DN2 A;  3AMQ A;  2WII B;  5FZ8 A;  5LBC A;  3BTA A;  3N9L A;  3GF6 A;  5CFC B;  4CPB D;  2FZ2 A;  2WWJ A;  4C0B A;  1JU4 A;  2ZAC A;  1F4A A;  4FTS A;  1H1I A;  1MS9 A;  4HXC A;  1ND3 C;  1KJL A;  1ULO A;  5HV0 A;  4HN1 A;  2EA7 A;  4PIY A;  4R9B A;  1Y7B A;  5F1R A;  2B9V A;  4QQH A;  3VDA A;  1EAH 1;  3WV6 A;  3WNL A;  2NZ9 A;  1SBD A;  2GNM A;  3GAL A;  4R9A A;  4NPL A;  5A7Q A;  1YFU A;  3RVH A;  3Q8F A;  3BCW A;  5ANN A;  5A32 B;  3UT0 A;  1NCQ A;  4C90 A;  2DVG A;  2GP3 A;  5GZF A;  1V9U 3;  4AVC A;  1LGB A;  1NA1 B;  1NZI A;  1SBF A;  3ES4 A;  4B1L A;  1RUH 3;  4XZP A;  4IE5 A;  5FZ4 A;  5C5U A;  1O3S A;  3RWK X;  1HXS 3;  1BEV 3;  2NQY A;  1U5Z A;  1AX2 A;  1UCX A;  1XJA A;  4FPJ A;  2IWG B;  2HEW F;  1AXK A;  3LEI A;  1LUL A;  3CJX A;  3HQR A;  2RM2 2;  3MLK A;  3ORJ A;  5C3Q A;  4CDX C;  4ATF A;  2PAK A;  4Q29 A;  3B69 A;  4S2D A;  5CIR A;  1WLC A;  3DKW A;  5L9V A;  1QDC A;  2GC3 A;  2ZKN A;  4ZON A;  4D69 A;  2YRO A;  3FWE A;  4C8D A;  4YM3 A;  4K40 A;  4YRD A;  1UPI A;  1W28 A;  3RJ2 X;  3H1M A;  1IG3 A;  4V1P A;  2DVD A;  3PIJ A;  4KH9 A;  4UW5 A;  3RYR A;  1JOD A;  3OUI A;  2R1B A;  1K45 A;  3N9O A;  1DYP A;  2VVD A;  1HRV 3;  3H1Y A;  4QPG B;  2C24 A;  5FXW A;  2UY9 A;  3VKL A;  5IK5 A;  1J3Q A;  4UBH A;  4AED A;  1ZBE 3;  3MHZ A;  4HK9 A;  5I91 A;  3GDB A;  5LCW L;  2NYY A;  3WDY A;  2CGO A;  3M2M A;  1W6P A;  2B42 B;  2KXL A;  4XF4 A;  5EHD A;  2BWA A;  2YZ4 A;  4A45 A;  4GMP 1;  4CCO A;  3NO8 A;  1FOD 3;  2JE8 A;  1ZYB A;  5G04 L;  4F3J A;  1VMJ A;  1X9T A;  4RS5 B;  3ZSM A;  1R1Z A;  5ACA 2;  2ZOE B;  4UI9 L;  1VAK A;  1K5M B;  1VMF A;  3APB A;  3NAP A;  4LBQ D;  3QBQ A;  3VBU C;  3WQ1 A;  4KNC A;  4LKE A;  4YW2 A;  5BNP B;  4W65 A;  1LOF A;  4AL9 A;  4CDW B;  1UXX X;  3URF A;  2D3P A;  1CAU A;  2VNV A;  3AZV A;  2JDH A;  2XL7 A;  2XOM A;  4JKM A;  4N53 C;  5DAW A;  4BYY A;  1Z0H A;  2Y0O A;  3M8L A;  4WV8 A;  3INA A;  4JRL A;  3ZYH A;  1R1A 1;  2CAV A;  3ZXD A;  4AQ2 A;  5C4W B;  4QPI A;  1T6G C;  5F8P A;  5JI9 A;  1L7L A;  4BXF A;  1SDD B;  2ZEY A;  3HNB M;  3MUY 1;  4COV A;  1EPW A;  3P5B A;  1MS8 A;  1EAH 2;  3B02 A;  4Y22 B;  5DUV A;  5L9B A;  2OS2 A;  1IG0 A;  4AI1 A;  3I7D A;  3OY8 A;  2FDK A;  1RUJ 3;  1QHD A;  4PQQ A;  1K42 A;  5GLZ A;  4AI3 A;  1YI7 A;  1WCU A;  2D6M A;  2OXB A;  2Q4S A;  2ZCW A;  3CNA A;  3NNM A;  3VBS C;  4EJR A;  1JOP A;  1ZX5 A;  5FXZ A;  4QB1 A;  2RJL A;  4ITC A;  4BK5 A;  4Q5O A;  3JBG 1;  3Q9O A;  1DLC A;  3J8F 3;  2PHU A;  1UZV A;  3AC0 A;  4XBN A;  1UZ0 A;  4AQT A;  5BNN C;  3N7L A;  4JKL A;  1F8V A;  4XAA A;  3A4U A;  1CIW A;  4IV3 A;  2QZ2 A;  4HVO A;  2VVE A;  3EHK A;  2SLI A;  2K46 A;  4FPG A;  3KV4 A;  2RS3 1;  4OI0 A;  1WKY A;  2W68 A;  1V6J A;  1ZVF A;  3AP4 A;  3C7O A;  5A1L A;  5IUQ A;  4EN0 A;  4LO7 A;  1OFS A;  2WIN B;  3H3U A;  1H4H A;  1VJ2 A;  4TXW A;  1YQ2 A;  3PVN A;  4R52 A;  4BM8 A;  2D6L X;  5LB6 A;  1ULF A;  1CZS A;  2J42 A;  1ND2 C;  3AL5 A;  4M3C B;  4B1M A;  3B9C A;  2BVV A;  4AGG A;  2K0G A;  3HWJ A;  4Y1Y A;  2JDM A;  3RNS A;  3BUC A;  3HNM A;  1Y3T A;  4DIQ A;  4R9C A;  3MBW A;  3ZN6 B;  4BB3 A;  2PQS A;  2Q1F A;  4JV4 A;  4MZU A;  5FP4 A;  4YSF A;  1O4Z A;  3OG2 A;  2G4I A;  2VBP A;  2YC2 A;  3NNJ A;  2WL1 A;  4BCU A;  3B9I A;  2C5D A;  5DZF A;  3H0O A;  1C1F A;  2QKD A;  3SCH A;  4M00 A;  1XE7 A;  3PVE A;  2B5H A;  1LOB A;  3IMN A;  4E27 A;  2VGD A;  4OHY A;  3EJK A;  5C3O A;  4LNV A;  1FMD 3;  1OUR A;  2Y6K A;  5B4X A;  1LHV A;  2VOX A;  1GOH A;  2R06 3;  4FPO B;  4BQ5 A;  1DGW X;  1Q8S A;  1LHO A;  1PX4 A;  1R1A 2;  3ES1 A;  2A6Z A;  2VW1 A;  5C9A A;  2D6K A;  4ASK A;  3T2O A;  4MV2 A;  4COU A;  5JSP A;  1OHF A;  3VZO A;  1YFX A;  5JMC A;  2VME A;  4RHV 1;  4XTP A;  1IKQ A;  3H9A A;  3LCP A;  1F15 A;  2O0O A;  5K9Y A;  5JZG B;  2AEY A;  4YGB A;  4P9Y A;  1XU2 A;  1V9U 1;  1XOY A;  4DXS A;  1QJF A;  3B93 A;  4GMP 0;  4COY A;  2XJR A;  4MXW A;  1RUH 1;  4K8F A;  1NXM A;  4QKD A;  5CAD A;  1UOG A;  4QQL A;  1HXS 1;  1GP6 A;  2OPW A;  4OUM A;  1VIW B;  5FPV A;  1UY1 A;  5JR2 A;  1LR5 A;  2JG9 C;  4EWD A;  4K20 A;  1N1Y A;  1XNA A;  4WVM B;  5DDJ 1;  3JBG 2;  2QDN A;  3IBM A;  4CU9 A;  2LRO A;  3BIW E;  4EZH A;  2UYB A;  2A7A A;  2D6N A;  1Q56 A;  1NXD 1;  2E51 A;  2JD4 A;  3B7M A;  2CDO A;  2XJQ A;  2XJU A;  3LE0 A;  3N9N A;  3PUI A;  4FO9 A;  5FPL A;  3GYD A;  5E16 A;  4P08 A;  4K1Y A;  2C6S A;  5GZE A;  3UJQ A;  2PA7 A;  2RS3 2;  4XXP A;  1JZ4 A;  4JHT A;  2OII A;  4LBQ B;  2JKX A;  4QWN A;  3MGU A;  4X6Q B;  4AHW A;  4DMI A;  5JDB A;  3KSC A;  3FUQ A;  5JSR A;  4XIO A;  1NYW A;  1EV1 1;  3NV1 A;  1W39 A;  4BZ4 A;  2ARX A;  1ODN A;  5L19 A;  1KRI A;  4WBB A;  4AI0 A;  4NAM A;  3AZZ A;  2UU8 A;  4LLF A;  3TOJ A;  5T54 A;  3UKN A;  3MIB A;  3HR9 A;  3WW3 A;  2WZ8 A;  1Y43 B;  4LA3 A;  4NMI A;  3MF9 A;  3ZM8 A;  4DUV A;  2V73 A;  3HQU A;  3LKJ A;  1I5Z A;  1EPZ A;  1W03 A;  2RG4 A;  4TWT A;  3W21 A;  1J1T A;  1FOD 1;  4N7I A;  3ZXJ A;  3C7G A;  1RC6 A;  3FJS A;  1ZRD A;  2ES3 A;  2ZZQ A;  2PAM A;  4OUL A;  2PQQ A;  3L2H A;  4KGQ A;  3ZSL A;  2ET1 A;  2WS9 3;  3TEX A;  4YGD A;  3ZFG A;  2ZGM A;  4BWO A;  4NO4 A;  4XAE A;  4BOW A;  3ETP A;  2DV9 A;  3UV9 A;  4WM7 C;  5FXX A;  4GXL A;  1JYV A;  2F4P A;  4NHL A;  2W2I A;  3Q8B A;  1FAT A;  3HVD A;  1O4Y A;  1Q3E A;  4N43 C;  3DYP A;  5ABJ A;  2OA2 A;  3R4U A;  3U10 A;  1FNZ A;  2D7F A;  4LJH A;  3PLQ A;  1RTV A;  4AG4 A;  3E5Q A;  2D5H A;  2B9U A;  4Q27 A;  4IE0 A;  4J6G A;  1MZ5 A;  2X5I B;  3HQX A;  4LO5 B;  2CL2 A;  4FP3 A;  4RHV 2;  5LA2 A;  1CAV A;  1ND3 B;  1RUJ 1;  4GUL A;  4U2A A;  4DY5 A;  4F83 A;  2W3J A;  1XE8 A;  5A1F A;  4JTN A;  1V9U 2;  3WCS A;  1QMJ A;  2EID A;  3MID A;  4OI1 A;  1ZRI A;  2W87 A;  3B3Q E;  1RUH 2;  2BGP A;  3P3N A;  2VXR A;  4FQ4 A;  4IV1 C;  3WQB A;  1HXS 2;  2TBV A;  2N7G A;  2ADD A;  4LHK A;  4QX7 A;  5DAX A;  3PVO A;  3VLB B;  3VKM A;  3NJV A;  5DDJ 2;  1GZW B;  1JUI A;  3WR0 A;  1O8P A;  4FT8 A;  3N9M A;  1ZZ9 A;  2HLE A;  3WDT A;  4ZS2 A;  4JQT A;  5FMO S;  4IES A;  4LR4 A;  3O1R A;  3POB A;  4Q4W 1;  4LE4 A;  4XUP A;  2D43 A;  2JG8 A;  3KT1 A;  3D8C A;  1MS5 A;  4GKX A;  3ZYR A;  4O9G A;  2BNM A;  1SHW B;  2PFW A;  2XL9 A;  3BOD A;  2ZEZ A;  3POY A;  1XYO A;  2DUQ A;  1HV1 A;  3ACL A;  4HON A;  5FYB A;  2AEZ A;  1E5R A;  1WWY A;  2Q1Z B;  3GBW A;  4PDW A;  1W6O A;  1EV1 2;  1SBE A;  3WZ1 A;  3KWV A;  2XJP A;  4IEQ A;  5L9R A;  3SH3 A;  1RUG 3;  2VMD A;  3VBR C;  4OZX A;  3ZYP A;  5T50 A;  2IC1 A;  3VBF C;  3ZYG A;  2EIB A;  3OD0 A;  2A73 B;  3ZIW A;  1JYC A;  4UT5 A;  1NCR A;  1FOD 2;  1PO2 3;  4CE8 A;  4KWU A;  3ZR6 A;  3VKO A;  3THC A;  3G7D A;  2XR4 A;  2AGS A;  4TYS A;  4QM8 A;  1BLZ A;  2WYS A;  2GDF A;  4JGZ A;  4A44 A;  3ETQ A;  4UAP A;  1UU4 A;  1E5H A;  1SFY A;  1FMD 1;  2WNV A;  3PUS A;  2ZX2 A;  4DOU A;  1SMV A;  1MS1 A;  1PX3 A;  3A23 A;  1WME A;  3S6P A;  4LA2 A;  3WUD A;  3RPQ A;  1J3R A;  2DCY A;  3EQE A;  3D5O A;  3LIH A;  4DRR A;  2A70 A;  3VBO A;  1NG0 A;  4LUK A;  4XUR A;  3EMR A;  3THP A;  4B7K A;  4CCJ A;  3NL1 A;  1XXN A;  3ALQ A;  5DZE A;  1ZZB A;  2ZHN A;  3BAL A;  3B00 A;  5KHI A;  4GH4 C;  1O3T A;  4DEV A;  1RUJ 2;  3M3E A;  3KM5 A;  1V6L A;  4P9X A;  5CKN A;  5J37 A;  3MIH A;  3WF3 A;  4LBM A;  5J96 B;  1JUH A;  2QQL A;  2PEL A;  2WNO A;  1AR6 3;  1RGS A;  2PHW A;  4Q4Y 3;  1X50 A;  4JRA A;  2HWF 3;  1AL0 G;  3S7E A;  1PZ9 A;  4CDQ A;  3GZA A;  2IXI A;  3H3L A;  5DZG A;  2LRP A;  4B4P A;  4ZS3 A;  5LAT A;  1CPM A;  1DGW A;  1Y9M A;  1GZC A;  4P00 B;  3VBR A;  3PUR A;  1UZY A;  2VMC A;  2XUM A;  5I0T A;  3FFZ A;  2B45 X;  5AC9 3;  4Q4W 2;  2RS5 3;  1ZBA 1;  3VBF A;  4TN7 A;  3PJY A;  4TSV A;  4UFJ A;  3WDV A;  1TEI A;  4V2V A;  5HCB A;  4QKF A;  5BNN B;  2DFC A;  4Z82 A;  1KD7 A;  2UWB A;  3U4S A;  5A6X A;  3AP9 A;  1F4H A;  1QGL A;  2I07 B;  5J98 B;  4FCA A;  4QPY A;  4EQV A;  4YZ4 A;  1CX1 A;  4JQR A;  3J7L A;  4UOJ A;  4QX8 A;  2Y6J A;  5JCT A;  3WF0 A;  2FDH A;  1JYT A;  1Q8V A;  2GP5 A;  3T3Y A;  3TRS B;  1GNH A;  1KFX L;  4QHB A;  3MI8 A;  1GR3 A;  5FYT A;  1BBT 3;  1N47 A;  1UKG A;  1D2S A;  2O14 A;  4IEW A;  5LBB A;  2J1U A;  1HV0 A;  2DCK A;  3VGI A;  1COV 1;  1ND2 B;  1EYB A;  4C0H A;  3DEM A;  4NHY A;  3T1M A;  3M3Q A;  1ZA7 A;  2VZV A;  2WS9 1;  1OD3 A;  1UY4 A;  5FDB A;  2QVS B;  3VL8 A;  5C3R A;  3ILR A;  3J9S A;  3LB9 A;  3FLR A;  3VD5 A;  5IK7 A;  4CCL A;  1FMD 2;  1YRZ A;  2PLV 1;  5LA1 A;  4BE3 A;  4WZF A;  1A6C A;  1JOB A;  1RJ8 A;  3D4K A;  2X10 A;  5JLV A;  3PUH A;  4YYO A;  4MH0 E;  1Q8Q A;  4XQD A;  1J1L A;  3ZX7 A;  4Y4R A;  3O1O A;  1C1L A;  3O0W A;  3N4M A;  3DXU A;  5CFC A;  2BU9 A;  2XKO A;  3ME2 A;  4WVW A;  5K4L A;  2CAU A;  5C5T A;  2BTV C;  1FX5 A;  2G19 A;  2ZJC A;  2PN5 A;  4COW A;  1U5Y A;  2JIG A;  5A3O A;  1UMZ A;  4S2F A;  5GJ6 A;  2ZAB A;  2R32 A;  3FZ3 A;  1K5M C;  1UKR A;  2R16 A;  1NX9 A;  3CMG A;  3OGR A;  4OVE A;  1QOT A;  4QB2 A;  3WNM A;  4ASL A;  1AYM 3;  1SLI A;  4BQ4 A;  2XWJ B;  4LHN A;  3H8R A;  4CDW C;  5DQ0 A;  3B01 A;  5A32 A;  1NY7 1;  1ENS A;  4GB3 3;  3T08 A;  1HDK A;  1NA1 A;  1ZZ8 A;  1AHS A;  5FY5 A;  3UKV A;  1FPN 3;  4J1W A;  4PLO A;  3ATG A;  1PK6 C;  4CYD A;  3ZKY A;  2IUW A;  1H0B A;  5CZK A;  4IGO A;  2BOJ A;  2JG9 B;  2VUC A;  1Q43 A;  1QXJ A;  1ZBA 2;  3MYX A;  2W39 A;  2JDP A;  1HLC A;  3MLL A;  1UXZ A;  3ECQ A;  5A3T A;  4CZS A;  3WW2 A;  2VXJ A;  3C2U A;  1WW4 A;  4EV0 A;  2HBT A;  1DQ5 A;  2D97 A;  2VBD A;  5A3L A;  3RI8 A;  1H2N A;  5FZ6 A;  5FPX A;  4OLL A;  1D0H A;  3H8U A;  4JC1 A;  4LQR A;  1TMF 1;  1LJ7 A;  3AFG A;  4FPY A;  3ZFE A;  3OOX A;  2R30 A;  4QPG A;  1PO2 1;  4L8Q A;  1JOJ A;  5KR7 A;  2YGL A;  2DUO A;  2JDZ A;  2J1E A;  1COV 2;  3H7Y A;  1MVE A;  2W5F A;  4JVA A;  4NPM A;  3WNN A;  1DGL A;  1NUK A;  1V0A A;  3O1V A;  1APN A;  1ULD A;  4WVV A;  4LO4 B;  4HT1 T;  2WS9 2;  3HBK A;  5I93 A;  2C9A A;  1W9T A;  5FQ0 B;  2ZXQ A;  3O1U A;  1H9W A;  2JDU A;  1TNR A;  3OBA A;  4RS5 A;  3NNG A;  3SH4 A;  4AFB A;  4LT5 A;  2J22 A;  5CG9 A;  3T4H B;  4DZG A;  4GWI A;  3JB4 C;  3FBM A;  2VOK A;  1OQE A;  5BNP A;  4E2S A;  2R7E B;  1W05 A;  1F5F A;  1WCK A;  3LOI A;  4OQ9 A;  4Y26 A;  3VZM A;  5D8A A;  5LA0 A;  3VZN A;  1AR9 3;  4CP1 A;  1XSR A;  4WM7 B;  3T1L A;  1C5I A;  2ZX1 A;  1J59 A;  3H50 A;  4ISR A;  2EAK A;  2WLQ A;  3K4Z A;  3VUO A;  1D4M 3;  3HT2 A;  4XFC A;  1UYZ A;  3BGA A;  1NQD A;  4N43 B;  4UW6 A;  1DQ6 A;  4XOG A;  5C4W A;  4Y20 B;  4FOY A;  1CJP A;  1QQP 3;  1ZNP A;  4JGY B;  1L7R A;  1KDM A;  2WZE A;  5A7N A;  2TEP A;  4Y22 A;  4TLF A;  1AR6 1;  4C91 A;  2Q5T A;  4QGL A;  5GLU A;  1YIP A;  3IPV B;  2HWF 1;  1O6U A;  1NY7 2;  4A7Z A;  2HH9 A;  3KVB A;  4Y5T A;  2UUR A;  4PCR A;  2DBI A;  5FMO L;  1B09 A;  2W1Q A;  3MW3 A;  3VD7 A;  5J7M A;  2O8O A;  4P9J A;  5CYY A;  5LK5 A;  1PO1 3;  2AEN A;  4IV1 B;  4UXA A;  2B8M A;  4O65 A;  5AC9 1;  3OYW A;  4W6X A;  5JPN B;  1LRH A;  3HD8 B;  2W1W A;  4JDN A;  4LK6 A;  4HOO A;  4FFG A;  4COZ A;  4A7Y A;  3N3H A;  1XNC A;  2WNU C;  4ATE A;  4XYX A;  1JYI A;  4Q1P A;  4UYB A;  1WLW A;  1LHU A;  1PNF A;  4D6Q A;  4CU8 A;  2F6B A;  1H8V A;  1AL2 3;  1I6X A;  3KGZ A;  4AHZ A;  3MF6 A;  4XF3 A;  3N7K A;  1QOS A;  3O1S A;  3DYO A;  4AVV A;  4FBF A;  3KCC A;  2W1U A;  4B4R A;  2C0Z A;  3NST A;  1KS5 A;  3WG1 A;  3H7J A;  4ONU A;  1TMF 2;  1WGP A;  1LB2 A;  1HJF A;  2XQX A;  5FZA A;  1YHF A;  4NHM A;  1VBB 1;  5A80 A;  3K51 A;  4HFS A;  5T3N A;  5BNO B;  1RUD 3;  2W1S A;  1PO2 2;  2BV4 A;  3N36 A;  4QKN A;  1MS4 A;  4M3C A;  1W9F A;  3QLQ A;  4LOS A;  3VBH A;  4BQX A;  4CPB A;  5C8C C;  4Q2F A;  2YU1 A;  3M7A A;  5D2A A;  4BDV B;  2OYZ A;  5F3C A;  3K3N A;  2EAL A;  1YFW A;  3ZN6 A;  3MIE A;  3AK0 A;  3AL6 A;  4B29 A;  1UY2 A;  1US3 A;  3IWZ A;  5FZC A;  3IDE A;  3CJI B;  3S0M A;  1XE0 A;  1UMH A;  3HN1 A;  1TME 1;  2IXK A;  4CA9 A;  5DG2 A;  1SCS A;  4XFF A;  2WC2 A;  2VZO A;  1G86 A;  4HSL A;  4XAB A;  1W8F A;  4WZC A;  5A1A A;  2XLA A;  4A3Z A;  4GIQ A;  3DEC A;  1IQD C;  2RV9 A;  2MNG A;  3SNM A;  5E6H A;  4XVH A;  1W8H A;  4FXG B;  5BNQ A;  1YCI A;  2XHN A;  4RR3 A;  2EXI A;  2R0H A;  3OPT A;  3LQC A;  1NLQ A;  3V0B B;  2WJS A;  4M01 A;  1JHJ A;  5IVB A;  3ZVX A;  3QD6 A;  3JXS A;  2H0V A;  1VR3 A;  2RS1 3;  1UF2 C;  3CLP A;  1W90 A;  1J58 A;  2QJV A;  1AYM 1;  4QDQ A;  1OA4 A;  1HB4 A;  1AR6 2;  4LXL A;  5A7W B;  4GB3 1;  5JZG A;  4E4D X;  1C8N A;  4GAZ A;  2HWF 2;  4GH4 B;  5CB7 A;  5HCA A;  3POE A;  2ZHM A;  4FQZ A;  4NRO A;  4OYU A;  1ULE A;  3LWC A;  1QWR A;  4CUA A;  1RUI 3;  4XBQ A;  2E26 A;  2P2K A;  3LIG A;  2HEV F;  1EUU A;  1LED A;  1Q5O A;  4YW1 A;  3OB8 A;  4K1Z A;  1ULC A;  5FYH A;  2P3K A;  5AC9 2;  4R8H A;  1DQ1 A;  1POV 1;  3RZZ A;  1RIN A;  4WVM A;  2DYC A;  3K75 B;  2XLF A;  1W9Y A;  2ARB A;  2X5I C;  3KT4 A;  4UFI A;  4QXH A;  5GLW A;  4BPZ A;  1VAL A;  1MZ6 A;  2R04 3;  3C7F A;  1AYN 3;  1B35 C;  5LY2 A;  1OH3 A;  4FVV A;  1KGY A;  2HWB 3;  5A33 B;  4IET A;  3NNL A;  1JHN A;  2WQ8 A;  4CUG A;  4P9L A;  3GJB A;  3O0X A;  1DHK B;  4CCE A;  3LF7 A;  1XB9 A;  2HYK A;  1V70 A;  3I2I A;  1AZD A;  3VD4 A;  1K3I A;  3OBR A;  3QAC A;  5CKQ A;  2R0F A;  4BLI A;  5G05 L;  1A34 A;  4WVZ A;  5EJZ B;  4BJ0 A;  4LBQ A;  3S7I A;  1LHW A;  2I45 A;  3P1I A;  4SLI A;  1VBB 2;  2X05 A;  2MEV 3;  3KF5 A;  2GH8 A;  2ZS6 B;  5GZG A;  4HPK B;  1TE1 B;  4HVR A;  3WF1 A;  1YC6 1;  2Y8K A;  1SQ4 A;  5GM0 A;  4KU8 A;  1S0E A;  5HCF A;  5I0S A;  3S5A A;  2CV6 A;  2BUK A;  5HCH A;  2CGP A;  2XBO 1;  4IEO A;  3I3B A;  3F95 A;  4CEW C;  4QHO A;  1JYX A;  1XRU A;  2XH6 A;  2MPF A;  1TME 2;  3LFI A;  4X8P A;  3AMM A;  1CON A;  1JI6 A;  5FZO B;  3III A;  4QX0 A;  2C26 A;  1JH5 A;  4P14 A;  1GQP A;  5JI7 A;  5JPM B;  1O59 A;  2EXJ A;  2PMW B;  3JQW A;  5CIS A;  5FKB A;  4FSJ A;  1W2T A;  1Z7S 3;  3JQX A;  1W0P A;  5FYV A;  2RHP A;  2YBP A;  4YWA A;  4A2U A;  5IT6 A;  1V6M A;  5JOZ A;  2P37 A;  4QQO A;  4E4H A;  1HQW A;  1LU1 A;  3ILF A;  3PDQ A;  2ZA9 A;  2VQU A;  5FUI A;  1CAW A;  3UK9 A;  4YNI A;  2GSY A;  2Y34 A;  4LBN A;  1AYM 2;  1OMI A;  1YYN A;  4UFM A;  5EYY A;  1ND3 A;  5FJK A;  4CDU C;  5IVC A;  4GB3 2;  3ZPO A;  5FXV A;  2GNB A;  2QBX A;  5FZ7 A;  1NT0 A;  4EN8 B;  2C4X A;  4EN9 B;  1QOO A;  3BTZ A;  1WD3 A;  1GU3 A;  4MGI E;  1FYU A;  3USU B;  2BEO A;  3B94 A;  1IPJ A;  1CR7 A;  1A78 A;  2JB4 A;  4GAL A;  4M4P A;  1RL3 A;  4FP2 A;  2B7Y A;  2E63 A;  1M06 G;  2PHD A;  1ASJ 1;  3RI9 A;  1GZW A;  3HBZ A;  4A6O A;  3GHM A;  4IQP A;  4XF0 A;  5IVE A;  1G9D A;  1SAC A;  2WNE A;  2CHH A;  4PI0 A;  3KF3 A;  2C9K A;  1AL2 1;  1CAX B;  1PK6 B;  3ENR A;  1AR8 1;  3VD9 A;  4OI4 A;  1FV3 A;  2XVG A;  4M3C E;  4YVS C;  4ZHN A;  1US2 A;  3OSD A;  4Q4X 1;  3BTX A;  3I3E A;  4A3X A;  3AKS A;  1S0G A;  2BOI A;  4CDX A;  2YMZ A;  2LM3 A;  3ST7 A;  4CP0 A;  3WDW A;  3NV4 A;  2WAO A;  3ZN5 A;  2GH2 A;  2P3J A;  1XND A;  2QFE A;  3Q8E A;  1URX A;  1IPK A;  3Q8A A;  2G9G A;  1AX1 A;  3AYA A;  1CPN A;  4L97 A;  1DBN A;  3ZOI A;  5K0U B;  4RN5 A;  1ODM A;  1NLR A;  2R07 3;  2WDB A;  2HWD 3;  3EO6 A;  2XB6 C;  5EIY B;  2P34 A;  4BMB A;  2VW2 A;  2XBO 2;  1UIK A;  4YVW C;  2Q8D A;  1GWK A;  1LU2 A;  3VHP A;  3VD3 A;  5A3M A;  1KDK A;  3O7O A;  1POV 0;  5F39 A;  4CCN A;  3IAQ A;  1PVX A;  3FE5 A;  4XJ9 A;  5FPU A;  3DCQ A;  2J7M A;  3U07 A;  5FTT C;  4BME A;  5F5Q A;  2P6H A;  1WMD A;  3U14 A;  4IXL A;  1OPM A;  1H8T B;  1LAJ A;  4XFG A;  3HMY A;  2VMI A;  3LZZ A;  3I59 B;  3UGH A;  3WNX A;  1ENQ A;  3POS A;  1SZB A;  4OHW A;  1DZR A;  3VBU A;  1KFU L;  2XKP A;  5KWR A;  1HRI 1;  2WO2 A;  3VDD B;  2YBS A;  1D0G A;  1VP6 A;  5F32 A;  5L7O C;  4QPW A;  4N53 A;  1XC6 A;  1U12 A;  3O1P A;  2VCA A;  2GC2 A;  2WO7 A;  2PYT A;  1JZ7 A;  3KGL A;  1DYO A;  3VN4 A;  2A3X A;  4CUB A;  1N1T A;  3K46 A;  1Y9Q A;  4CU6 A;  4ZKT B;  4I2O A;  4IE6 A;  1RJ7 A;  2ZGQ A;  1STM A;  3LGR A;  4IEP A;  5A7S A;  2IXC A;  4YG6 A;  1MZF A;  4LLO A;  5JXI A;  4IGP A;  2VPV A;  1HN1 A;  2DCJ A;  1NZC A;  2AR6 A;  1PNG A;  3MW2 A;  1BCX A;  1GZT A;  1ASJ 2;  3K4D A;  5EFU A;  3WW4 A;  4KU7 A;  3I2F A;  3ZYI B;  4E8D A;  3VBS A;  2A71 A;  2OUH A;  3I2G A;  3GBF A;  4AFD A;  1LNS A;  2BRT A;  1VRH 3;  1YXW A;  1AL2 2;  2LTN A;  5FCC A;  2HWB 1;  1AR8 2;  2G1M A;  4Y24 A;  1S4C A;  1UQX A;  5IJR A;  2BNO A;  4Q4X 2;  4XJW A;  4XTM A;  5BY5 A;  5IVF A;  4FPH A;  4LO8 A;  1LOE A;  2JEM A;  2WNU B;  4NOT A;  5BNN A;  4QQP A;  5CFD C;  2RJ2 A;  4NIA A;  3HJR A;  3U78 A;  4CSW A;  5CAZ A;  5FWJ A;  3C7E A;  1MPX A;  4YW3 A;  4RQP C;  1H4G A;  3AKT A;  2VTX A;  4OHV A;  4AYU A;  1REF A;  2FMY A;  1UW8 A;  3RZH A;  3O1T A;  1BEV 1;  4N8M A;  2D44 A;  1RED A;  3LEG A;  3L9J T;  1SLB A;  3CU7 A;  2ZTN A;  2HWC 3;  2XG3 A;  4HG6 B;  4Q4V 3;  5LY1 A;  4MUV A;  4OI2 A;  3ELN A;  1H6X A;  1OSG A;  2BYV E;  1UIJ A;  2WSV A;  2F4L A;  2XJS A;  3GJA A;  4O9E A;  4XFB A;  4Y1Z A;  1PIV 3;  1UOJ A;  3CF6 E;  3THT A;  3ZXK A;  1ND2 A;  5C8C B;  3WNK A;  1PZ7 A;  5HPO A;  2ZGN A;  5KXB A;  3S57 A;  1HB3 A;  1QJZ A;  1REE A;  4RGK A;  3OGV A;  4XET A;  2JE9 A;  2PHF A;  2GAU A;  1CVN A;  1OFN A;  4FPE A;  3I8T A;  4FPF A;  4OHZ A;  5JR7 B;  2VOV A;  3M4F A;  1H1A A;  3MZH A;  1HRV 1;  2CSG A;  2DTW A;  3JB8 A;  1WCQ A;  1ZBE 1;  1C8M 3;  1UU5 A;  3O5S A;  1XBF A;  2ENR A;  2IFR A;  1IKP A;  2VL4 A;  3W58 A;  5B2G B;  4EYU A;  3BYW A;  3R0R A;  1HRI 2;  1YQ6 A;  4L2N A;  4QX1 A;  2ZHK A;  4AR2 A;  3VV1 A;  1H1M A;  3BPZ A;  1LEC A;  4LUL A;  3MFA A;  4H2A A;  3ZMO A;  4XFH A;  2DCT A;  2JJ6 A;  4I0A A;  4XJ8 A;  3J4U H;  3FHQ A;  2WWS A;  5H9R A;  1O3Q A;  4YGC A;  1CWP A;  2W95 A;  1P8J A;  1GIC A;  4AGR A;  2IXJ A;  3E5X A;  5A3P A;  3GNE A;  1GNZ A;  3GBG A;  3SXW A;  3BI3 A;  1RUE 3;  5FWE A;  4I01 A;  1GP5 A;  3ZYJ B;  4HL0 A;  3I2K A;  5CBL A;  4G3Y C;  5SV5 A;  5IVV A;  3OJB A;  5C70 A;  2ZKL A;  4PHZ A;  1RUC 3;  1VBC 3;  2HWB 2;  2JG9 A;  4JGY C;  2J1T A;  5FY7 A;  1ENR A;  4JHZ A;  3WT3 A;  4BQY A;  1JZ8 A;  1SPP B;  3CBN A;  2OQ6 A;  1H2M A;  3POF A;  3BPS A;  2YC0 A;  5F3G A;  3UKT A;  5T52 A;  4L92 A;  2WZP P;  3IMM A;  1VRB A;  1SEF A;  2RJK A;  2ET7 A;  1B35 B;  5IK4 A;  3AM2 A;  5FLH A;  3WNP A;  1W0N A;  1MAC A;  2YXS A;  4NWW A;  1WZX A;  2AAC A;  2QQO A;  3H42 B;  4GWJ A;  1BEV 2;  4Z2W A;  3IKW A;  5FZF A;  4PBP A;  3UGF A;  2GNT A;  1NLS A;  1WA4 A;  3PU3 A;  5CA6 A;  3I3M A;  1DZT A;  2VQ0 A;  3J8F 1;  5DAB A;  5DXD A;  3PMS A;  3NW4 A;  4EN6 B;  1ACC A;  3FUO A;  4MVT A;  4PI2 A;  4IEU A;  4DO0 A;  1F9K A;  4QMA A;  4NIG A;  4HLT A;  2TUN A;  2WA4 A;  4BA6 A;  1J3P A;  1AR7 3;  1DG6 A;  1ULG A;  3VHO A;  3LOB A;  2OZ6 A;  4PF1 A;  2P6C A;  2GN3 A;  5FP9 A;  5FQ0 A;  4G4F A;  2D3S A;  2RDN A;  5C7G A;  2VM9 A;  4UFH A;  4BQ2 A;  2H6C A;  3HIF A;  4GWM A;  1VBD 3;  4CEW B;  4DNY A;  1W2O A;  1YNA A;  2BBA A;  5L73 A;  3AFK A;  1W0O A;  1HRV 2;  2ID4 A;  5BNO C;  4UFL A;  1VBE 3;  3LA2 A;  1SLL A;  4J1X A;  2A1X A;  4Y33 A;  1CAU B;  1IGO A;  1ZBE 2;  4ZZ8 A;  3UL2 A;  1NAE A;  3WG4 A;  2QQI A;  4FAG A;  4WM7 A;  1TNF A;  2VZU A;  2GU9 A;  5H9P A;  1S55 A;  2VAU A;  3GXU A;  4KQ7 A;  3OEB A;  2DF7 A;  2WWU A;  2Y0I A;  5FP3 A;  4BHP A;  1GAN A;  4XEZ A;  3RS6 A;  2AYH A;  1X36 A;  2Y60 A;  5AVP A;  4N43 A;  5LAS A;  2ZGL A;  5FZL A;  3CJI C;  1XYP A;  5FOB B;  2XON A;  3AVR A;  1O4T A;  1PGS A;  4K21 A;  4Q1R A;  4Y20 A;  1OA3 A;  1ZRF A;  2TNF A;  3DV8 A;  5D21 A;  5J09 A;  5F9T A;  4PLM A;  4QX5 A;  1QU0 A;  1YO8 A;  3MUZ 1;  1NE6 A;  2HKX A;  2ILM A;  3O0V A;  4UWD A;  3USS A;  5FO8 B;  3AXE A;  4CDU B;  2QQN A;  3I4I A;  3LA3 A;  4XJU A;  2R06 1;  2QQK A;  3NWK A;  5FP8 A;  4BQ1 A;  1G6N A;  4FTB A;  1WW7 A;  3CQO A;  5T5J A;  2DDU A;  2GZW A;  3DPR C;  5T5P A;  3RG0 A;  1RHI 3;  3EYP A;  5IW0 A;  4IV1 A;  2RDS A;  3V64 A;  1R09 3;  5FMD A;  3WQ7 A;  1ZRE A;  1SG3 A;  4MSV A;  1W8W A;  4XFI A;  4YW5 A;  1V00 A;  1S0I A;  1FT9 A;  4Q8L A;  1ZRR A;  2O1Q A;  2OT7 A;  3QOP A;  2ARA A;  2OVU A;  5FPZ A;  1A8M A;  3SQO A;  2VZ3 A;  1OUX A;  5LBE A;  2VTF A;  4YVS B;  4M0H A;  3LPG A;  1RIR A;  1JZ3 A;  4QT6 A;  4E2G A;  1WMX A;  2ZMN A;  1IOA A;  5F5A A;  4HAN A;  3BKZ A;  4LBJ A;  4Q4V 1;  3AMN A;  4K3U A;  5F7U A;  4B7E A;  4KWJ A;  3J8F 2;  4BU2 A;  3WIN E;  1MEC 3;  1BQP A;  2WBK A;  1PIV 1;  2XQR A;  1HX6 A;  1GOG A;  3CL1 A;  1Z78 A;  4RA0 A;  5F2W A;  3A21 A;  4KMQ A;  2ZEX A;  4A4A A;  4MGZ E;  3ZFF C;  2B46 X;  2GAL A;  4UBG A;  5DUU A;  5M0T A;  1UZW A;  1DQ0 A;  5KHJ A;  3LD8 A;  3UGG A;  2VD7 A;  2D6P A;  2H0B A;  3FHA A;  2A6V A;  3PIG A;  1MQT C;  2Y6G A;  4NJ4 A;  2ARE A;  4YVW B;  1DGR A;  3B5L B;  2UY8 A;  4Q0S A;  1ZRC A;  1UL9 A;  2VCB A;  3CJI A;  3LDK A;  2V72 A;  4D8M A;  4YM1 A;  4Q26 A;  4CXW A;  4OCT A;  2WT0 A;  2YDE A;  3TNQ A;  2GC0 A;  4BH9 A;  4QX2 A;  1C8M 1;  1FI2 A;  4H7M A;  2LUW A;  5FY0 A;  5FYY A;  5E89 A;  4CP2 A;  2VEC A;  5JOW A;  2JIC A;  5F37 A;  3POG A;  1DCS A;  1F35 A;  2ORX A;  3R4D B;  4NAO A;  1S2K A;  4ES8 A;  5FIX A;  5C9A B;  3OBZ A;  5JAX A;  5DUW A;  1PGW 1;  2W08 A;  5LZ6 A;  3T30 A;  2IZW A;  4XXA A;  4KG0 A;  3ZXL A;  5IVY A;  4QAW A;  4CUC A;  5L7O B;  4PJY A;  5DPN A;  3ZYF A;  2X53 S;  4FOQ A;  3LSE A;  2DWR A;  3RZM A;  4LOR A;  4DIN B;  5I8Y A;  1EP0 A;  4GH4 A;  3NJX A;  2GN7 A;  2VG9 A;  1QJX 3;  2ZMK A;  5F5I A;  4FFF A;  3SLI A;  4HBN A;  2R06 2;  1OOP C;  2FZ1 A;  4D0Q A;  2Z79 A;  2OW4 A;  3U0Z A;  3HEI A;  4K7J A;  3E6D A;  3PNA A;  2WAB A;  1VBC 1;  4NN0 A;  1JMU B;  3WG2 A;  5APA A;  4XQW A;  1LCL A;  4RGA A;  4E4Z A;  1DGR N;  3TWI A;  1LEN A;  2DFB A;  1GSL A;  5FK8 A;  5SV8 A;  2V5D A;  2DVF A;  3CDZ B;  4ES9 A;  4I09 A;  4UFK A;  2PHR A;  1DFQ A;  1CQ9 A;  5A33 A;  2E6V A;  5BYN A;  2WO1 A;  4AGV A;  4EWA A;  1AF9 A;  3I2H A;  4YFZ A;  3OUJ A;  4MGS A;  1SDW A;  4QU1 A;  3HAG A;  2ERF A;  2GME A;  4Q0Q A;  2NMN A;  1BVV A;  4ZU7 A;  2BFU S;  5CFD B;  4XCA A;  2B4K A;  1QDO A;  2WT2 A;  4AFM A;  4Q4V 2;  1X33 A;  2ADE A;  4RQP B;  4AQ6 A;  1GQH A;  1PIV 2;  2NN8 A;  2WRA A;  3EBR A;  3QH7 A;  1GP4 A;  4HVQ A;  1CJD A;  2A75 A;  1PVC 3;  1AR7 1;  5FV3 A;  2CY6 A;  5J3U A;  1N3Q A;  2EXH A;  4EZ4 A;  4AAP A;  1WW6 A;  1SLA A;  5I0R A;  4ORF A;  1OLQ A;  5IHR A;  3NJZ A;  3VL9 A;  4AAX A;  4ZZ5 A;  1JZ5 A;  2JE7 A;  1OKQ A;  1C28 A;  1TVG A;  5FZO A;  3PHM A;  1C8M 2;  1V6N A;  5I8S A;  3WVJ A;  3DYM A;  1OXC A;  5K0U C;  1RUG 1;  2UWA A;  2VZS A;  3WP6 A;  4CEY C;  3BTY A;  4DUX A;  1CIY A;  1GKB A;  4LIU A;  5E88 A;  4LUM A;  4IEZ A;  1GWM A;  1YI9 A;  4KBB A;  1RUO A;  4OMC A;  4LPL A;  4D94 A;  3E97 A;  5EJ1 B;  5FZD A;  1PGW 2;  1W6M B;  4P02 B;  2NM1 A;  4ASM B;  5EWS A;  1UMI A;  5A6Z A;  1OLM A;  3OGJ A;  3C7H A;  4XQ4 A;  1WLT A;  2Y6F A;  4BIO A;  4A7K A;  3WEZ A;  2NLR A;  2WO3 A;  2XWB B;  1DLL A;  3ZSE A;  1QXP A;  1H8T C;  3ZPY A;  1EAH 3;  1W6Q B;  1VPH A;  2VR4 A;  3FL7 A;  4HET A;  4HKL A;  4MYE A;  2Q8O A;  4AHY A;  3NJY A;  3U4X A;  5JWP A;  1K5M A;  3TNP B;  4N9H A;  2JEC A;  3USU A;  1BKZ A;  4CRQ A;  4CU7 A;  5GZC A;  2VQT A;  1R09 1;  4Y4Y A;  2LS6 A;  5FUN A;  3VDD C;  1CGP A;  4CDW A;  1VBC 2;  1UOB A;  2OZJ A;  3LA7 A;  2HWE 3;  2W91 A;  2VE1 A;  4AZZ A;  4C1W A;  1S0D A;  4N7U A;  3RWN A;  2Z2S B;  1OT5 A;  1C57 A;  4FTE A;  3KLS A;  3RGB A;  2FBE A;  4NPR A;  1CAX A;  1JZ2 A;  1PK6 A;  4AFC A;  2ZHL A;  2VJX A;  1G7Y A;  4PF5 A;  1VB4 A;  4YZ1 A;  2Z4F A;  4GQ7 A;  2XUE A;  4NHX A;  2OPK A;  3LAG A;  3IT8 A;  4IGQ A;  4Q4Y 1;  2VZT A;  2I2S A;  3NKG A;  4PDW B;  2GND A;  1NOV A;  2KM2 A;  1AJO A;  2WFF 3;  4KL1 A;  4HZF A;  3AZW A;  5F3E A;  1AXZ A;  1MEC 1;  1BVP 1;  2DU0 A;  5H9S A;  4RSU A;  3D0S A;  4ZU4 A;  4B8E A;  1JU3 A;  3H1W A;  5F6L B;  5K0U A;  2UYA A;  3K2O A;  3AYC A;  5LRS A;  4QM9 A;  4LIT A;  2RS5 1;  2RDQ A;  4RL7 A;  3OGS A;  1AR7 2;  2YUE A;  2IXH A;  3HT1 A;  5IVJ A;  5KXD A;  2BBV A;  2VZP A;  3G6J B;  1POQ A;  3ZDS A;  4URT A;  3ZXF A;  2YG0 A;  3K3O A;  1IS5 A;  4L99 A;  4LBO A;  2VMH A;  3KMH A;  4IEY A;  2BGC A;  3DXT A;  4M4R A;  3RYP A;  1OVS A;  1RUG 2;  1H2K A;  5EYX A;  4MHU A;  3T2T A;  4DRV A;  2W0X A;  4DXT A;  4JDM A;  1IS4 A;  1WUV A;  3I59 A;  3WX5 A;  1BBT 1;  1JW6 A;  1LOD A;  4MXV A;  1OH4 A;  5F6K A;  4AVS A;  2WQ4 A;  1GZ9 A;  2ZBJ A;  1O8S A;  4D7T A;  4AEK A;  3Q8C A;  3VDD A;  2A3Y A;  1WBL A;  5GZD A;  1QEX A;  3ZO0 B;  4NID A;  3R4S A;  4LKD A;  4UF0 B;  4DB5 A;  4HN0 A;  1BK1 A;  2QQV A;  1Q8P A;  2Y6L A;  2A5Z A;  3J26 N;  3QH6 A;  5FBJ A;  1JZ6 A;  3MO4 A;  2P3Y A;  1QJX 1;  1S0F A;  3OPZ A;  4GA9 A;  5FY4 A;  2VBB A;  2V4V A;  3AKP A; 
#chains in the Genus database with same CATH homology
 4V2V A;  2OT7 A;  3KV9 A;  5F5C A;  5FZB A;  3U4S A;  5FZ4 A;  5FYC A;  3PU8 A;  5FZO A;  5FYH A;  4DIQ A;  5FYS A;  5A1F A;  5FYU A;  5FP4 A;  4QX8 A;  3KV6 A;  5FZI A;  2Q8D A;  4LIU A;  5F39 A;  5F5A A;  4QXH A;  2GP5 A;  2Q8C A;  5FZH A;  4CCN A;  5A3P A;  5FPU A;  3N9Q A;  5LY2 A;  5FPB A;  5FZD A;  5FYT A;  4BU2 A;  4NUB A;  5FWE A;  4CUG A;  4QX7 A;  4CCK A;  3OPW A;  5F2W A;  5FY1 A;  4C8D A;  5A7N A;  5IVV A;  3N9M A;  5FJH A;  3LD8 A;  2VD7 A;  5A7P A;  5FY7 A;  3N9O A;  5FXW A;  2YBS A;  3KVB A;  2OQ6 A;  2OX0 A;  3NJY A;  4GD4 A;  5F32 A;  4CCL A;  5F3G A;  4ASK A;  5F2S A;  5FZE A;  1VRB A;  5A3W A;  2XDV A;  5FUN A;  5FY0 A;  5A7O A;  5FYY A;  5FZK A;  5ANQ A;  4CCO A;  2YPD A;  4HON A;  5FYB A;  4Y4R A;  5F37 A;  3N9P A;  4HOO A;  4BIS A;  5LW9 A;  5FZF A;  3DXU A;  4CCM A;  4D6Q A;  3LDB A;  5A7S A;  3PU3 A;  4IGP A;  5K4L A;  5FPV A;  4XDP A;  4Y3O A;  5FZO B;  4GJZ A;  5A3N A;  2XUE A;  4GJY A;  3KV5 A;  5IVY A;  4UF0 A;  4IGQ A;  4QXC A;  4DO0 A;  5ISL A;  5FYV A;  4EZH A;  5LWB A;  2YBP A;  5FZA A;  5F3E A;  5A80 A;  5FY9 A;  4E4H A;  5FP9 A;  5FP7 A;  3N9N A;  5F5I A;  3PDQ A;  4BXF A;  5FPL A;  5FY5 A;  5FZ3 A;  3K2O A;  3PUS A;  5IVF A;  2YU1 A;  4LIT A;  5F3C A;  3U78 A;  4CSW A;  5FWJ A;  3ZLI A;  5IWF A;  2OS2 A;  2YBK A;  3K3N A;  5FJK A;  4QWN A;  4Y33 A;  3UYJ A;  4IGO A;  5IVC A;  3PUA A;  5IVJ A;  3ZPO A;  3AL6 A;  5FXV A;  5FZC A;  5FZ7 A;  2XXZ A;  5F3I A;  5FY8 A;  3K3O A;  5A3T A;  2WWU A;  5FP3 A;  4CCJ A;  2YU2 A;  5FXZ A;  4LIV A;  2OQ7 A;  5LY1 A;  4V2W A;  2PXJ A;  5FZL A;  5FUP A;  3DXT A;  3AVR A;  5FZ6 A;  2Q8E A;  4QU1 A;  5FZ8 A;  5IVE A;  3N9L A;  5FPA A;  5E6H A;  5FZM A;  5A7W A;  5FZ1 A;  5FZ0 A;  4AI9 A;  2WWJ A;  3PTR B;  4QXB A;  5FZ9 A;  5FYM A;  4D6R A;  3OPT A;  3KVA A;  3AVS A;  5IVB A;  5FP8 A;  4URA A;  5FYI A;  5KR7 A;  4D6S A;  2XML A;  4UF0 B;  5FXX A;  3KV4 A;  5IW0 A;  5A1L A;  4XDO A;  5FV3 A;  5FBJ A;  2P5B A;  2W2I A;  3PUR A;  4LXL A;  5FZG A;  3PUQ A;  5A7Q A;  5A7W B;  3RVH A;  5FY4 A;  5FYZ A;  4GAZ A;  4AAP A;  4EYU A;  4EZ4 A;  4TN7 A;  2GP3 A;  5CEH A;  3AL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...