3AL5A

Crystal structure of human tyw5
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
308
structure length
302
Chain Sequence
b'QHLPVPRLEGVSREQFMQHLYPQRKPLVLEGIDLGPCTSKWTVDYLSQVGGKKEVKIHVQMDFSKNFVYRTLPFDQLVQRAAEKHKEFFVSEDEKYYLRSLGEDPRKDVADIRKQFPLLKGDIKFPEFFKEEQFFSSVFRISSPGLQLWTHYDVMDNLLIQVTGKKRVVLFSPRDAQYLYLKGTKSEVLNIDNPDLAKYPLFSKARRYECSLEAGDVLFIPALWFHNVISEEFGVGVNIFWKHLPSECYDKTDTYGNKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMVLHIQDKAYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing protein C2orf60
molecule tags Unknown function
source organism Homo sapiens
publication title Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
pubmed doi rcsb
total genus 73
structure length 302
sequence length 308
chains with identical sequence B, C, D
ec nomenclature ec 1.14.11.42: tRNA(Phe) (7-(3-amino-3-carboxypropyl)wyosine(37)-C(2))-hydroxylase.
pdb deposition date 2010-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3al5A01
3ZPOA 2OQ7A 3PU8A 5FXWA 3KVAA 5FZ7A 3UYJA 4EYUA 2Q8CA 5CEHA 5F5IA 3K3NA 5FWEA 3AL6A 3DXTA 5FZCA 5E6HA 4D6QA 5IVEA 5FZKA 5A3NA 4BISA 4V2WA 3N9NA 3K3OA 5F3CA 5FYTA 3PUQA 2P5BA 5FZOA 2YU1A 5FZHA 5FY1A 5IW0A 4CCKA 2YBKA 4GAZA 3RVHA 5F3EA 5FY4A 4CCLA 5ISLA 4UF0B 5FZDA 3NJYA 4EZHA 4LXLA 4QXCA 2VD7A 5F39A 5FZEA 3N9OA 5LY1A 2OS2A 5FZGA 3KV4A 5LWBA 5F2WA 5FWJA 4CCOA 4DO0A 5FY5A 3KV9A 2WWUA 3PURA 5FJKA 5A7WB 5F2SA 1VRBA 5IVBA 5IVYA 5FPVA 5FZIA 3U78A 2Q8DA 5FPLA 5FBJA 3AVSA 4Y3OA 5A7NA 4CCNA 5IVJA 3LDBA 4TN7A 4HONA 5FY0A 4CUGA 5FXVA 4LIVA 4XDPA 3PTRB 5FZ6A 5FZFA 5LY2A 4C8DA 2OX0A 3KV6A 5FZ0A 4Y4RA 4QXHA 4V2VA 2GP3A 5FJHA 5FP8A 5FV3A 5A3PA 5FZ1A 4QXBA 5FPUA 4URAA 5A7QA 5FYSA 4GD4A 2YU2A 3DXUA 5FXZA 4GJYA 4LIUA 3U4SA 5FY7A 2WWJA 5FYMA 4EZ4A 5FUNA 5FP7A 2OT7A 2XMLA 5FPBA 4IGOA 5FY9A 2GP5A 4QX8A 5FP3A 5FYIA 5A7SA 3K2OA 3LD8A 5FZ9A 3AVRA 5FZ8A 4HOOA 5LW9A 3PDQA 3KV5A 3N9QA 4LITA 3OPTA 3N9LA 5FZ3A 5ANQA 3OPWA 4Y33A 2XUEA 5FYVA 5FZMA 2XXZA 3AL5A 4NUBA 4D6RA 5FP4A 3N9MA 5F3GA 2YBPA 4CCJA 2OQ6A 4QWNA 4CCMA 5IVCA 5FZOB 4E4HA 4QX7A 5FZAA 5FXXA 4GJZA 4IGQA 4BXFA 2YPDA 4ASKA 4AI9A 4QU1A 4CSWA 5A1LA 4IGPA 4XDOA 4BU2A 5F37A 5IWFA 2XDVA 5IVVA 2W2IA 5FYUA 5FYZA 3PU3A 5FPAA 4AAPA 3PUAA 5K4LA 5FYYA 5FP9A 5A7WA 5A7OA 5A3WA 5A1FA 5KR7A 5FZBA 5FYCA 5F5AA 5FY8A 4D6SA 5A3TA 3ZLIA 3N9PA 5FYBA 5IVFA 5FZLA 2PXJA 5FUPA 5A80A 3KVBA 4UF0A 5FYHA 3PUSA 5F5CA 5F3IA 4DIQA 5F32A 2Q8EA 5FZ4A 5A7PA 2YBSA
chains in the Genus database with same CATH superfamily
5JXHA 4EYUA 2XPJA 5JSPA 4QPGA 4LQRA 2H0BA 2GALA 1SPPB 2VZOA 1I3HA 4RS5A 5FK8A 5C8CB 2HWB3 3NL1A 1RUC1 1RVF3 1VAMA 2VTFA 3E6DA 1NYWA 1UN1A 3BI3A 2DVGA 2KXLA 5IHRA 3C7HA 4PLMA 4KNCA 1W6QB 1AR73 3K3OA 1AX2A 4GALA 4HG6B 5FYTA 3DGTA 4QDRA 1PK6B 3FBMA 1L7RA 1DIWA 1VBD2 1QIQA 1O91A 3BGAA 5FY1A 3LIHA 1LHUA 1JMUB 5E16A 4YW6A 2WNUB 5D8AB 4CCLA 1RUJ1 1VE0A 2VAUA 2JDHA 1VBE1 3NJYA 4LBJA 3U37A 1G7YA 1IKQA 3CJIC 4E8CA 4JGZC 5C3PA 2WSVA 2DVBA 2XJRA 3K51A 4A3ZA 4V1PA 2J1UA 2BWCA 3ZFFB 3MBWA 2Y6GA 1DYOA 4MV2A 3H8RA 3WQ0A 1BHGA 1VRBA 5I0RA 5J37A 4LK7A 5FPVA 4AI8A 5JLVA 1ZZ9A 1C57A 4CDUA 2WSUA 1LNSA 3B3QE 1Y4WA 2WO1A 3FUQA 4Y20B 2VUAA 4LIVA 5KC6A 1YJLA 5FZ6A 5LBBA 2YYOA 1X82A 3ZIWA 4NHXA 2WNVC 3AZZA 1LJ7A 4IE0A 4LBLA 1H2MA 1CX1A 4XACA 4AHYA 3LOBA 2EIDA 5ACA1 3OUJA 5DUXA 2AEZA 2RM21 3ZIXA 5C6CA 1SFPA 2R16A 4BHPA 1Y7BA 3VD4A 1ZRFA 5L19A 3ACLA 2OZ6A 2PFWA 1JYXA 2UY8A 1A78A 1LOCA 1GU3A 2D5HA 3GJAA 3POSA 5FPBA 1XU2A 4XFGA 2PN5A 4HPKB 3M70A 2OZJA 3J8F3 1XNAA 1JOPA 4NWWA 2JIJA 5FZ3A 5LBEA 5JOZA 4UWDA 2N7GA 5EPAA 1IPSA 2XL7A 1R1A1 2VL4A 3AXDA 3M3CA 1W6NB 3FLTA 3MHZA 1WW7A 3PJQA 2XBO1 1UY0A 1HXS3 2ARXA 4NE9A 4D6RA 4AI3A 3GDBA 4ARXA 3BTXA 3MFAA 1WBFA 2BYVE 4HXCA 4MGTA 1JUIA 1W9YA 2QJVA 4JKMA 2XLFA 4LK6A 5K7PA 2KM2A 2YV8A 1BXHA 5T50A 4U2AA 4LKDA 3IB3A 4XJ8A 1ULGA 2PQQA 4AEKA 3QCWA 1JZ5A 1WA4A 1UD1A 4NPMA 3JCIA 2QKDA 5FYUA 2QE3A 3HMYA 4W6XA 3RDIA 4LKSA 4Q1PA 1I5ZA 4M4RA 2ZMNA 4AQ2A 2KD7A 5GZCA 1REFA 2FHRA 3H1WA 2WNVA 1PNFA 2DDUA 5J3UA 5IT6A 1OA2A 1QMJA 1OOPC 3H7JA 4ZKTB 3POBA 3VUOA 3IDCB 2OW4A 4FCAA 3D82A 1UXXX 1ND2A 3TN91 3VKOA 5H9RA 1VMHA 1W8FA 4BZ4A 4YVSA 3NNGA 2QQJA 5FO7B 3PVEA 5FMCA 2GMMA 3JUUA 1NCQB 2ZX3A 2B46X 2ZX1A 1JYTA 4AR2A 3C8XA 1NY71 3IN9A 1ULPA 1UKGA 4KG8A 4Z07A 4LT5A 2VCCA 1RUH1 1PGW2 2QZ3A 1H6YA 1QU0A 2NN8A 3AKSA 5FCCA 5EQUA 3V0AA 1H8TC 3K48A 4RR3B 5CYYA 2JD9A 3WQ1A 1XC6A 3WW3A 4W8JA 2IZWA 1NLRA 4R9AA 4B7KA 2VJXA 1CIWA 4XQWA 2JG8B 1VBA2 2B7YA 2ID4A 1EYBA 3DPRC 4IDZA 4BPZA 4CTEA 3KF5A 2FMYA 2PHDA 1J3QA 4UW3A 1RMU2 5CFCC 3T0BA 2A3WA 2EXIA 2VG9A 3KV9A 4YW7A 3KCCA 4OUSA 3WDTA 4IV3A 4UW6A 1UOJA 3V65A 4EWAA 4IQPA 5GLUA 5K8SA 3VBRC 4A41A 1DGWA 1WCDJ 3RS6A 4BB3A 2ZGTA 3WF1A 5BNNB 3ZFEA 2D40A 1RUJ2 3VZNA 5FXVA 3A7QA 3OGRA 1PO21 4QKFA 3CKHA 5LEJA 2FDHA 1O4ZA 2B4KA 3OGJA 4JC1A 4HK9A 5CG8A 1ENSA 4F8AA 2C1FA 2IXKA 3AP7A 3MF9A 1NG0A 4M3CE 2CHHA 2XQRA 4UYBA 3VBFB 4AFAA 1SCSA 2ZS6B 1LOFA 1Z7S2 5T55A 1JZ4A 4FFHA 1EAH3 2JECA 1H1MA 5LA2A 1W2NA 5CG9A 4UXAA 1LGCA 4CA9A 3ZKYA 1UX6A 2SLIA 3SH5A 2XJSA 2CDOA 3TOJA 4CDXC 4AGRA 1QJX2 4KWJA 4N53A 1OC1A 3W5MA 4LHNA 2OT7A 3ZFGC 5GALA 3WSOA 1S0CA 2GP5A 3AYDA 1GV9A 2UWBA 4XETA 1RL3A 4A4AA 2WBKA 1O5LA 1GOFA 4LORA 3OPTA 4RHV3 2RS31 3CU7A 3N9LA 4OQ9A 3VB9A 1HN1A 4AQSA 1A8DA 1UY4A 2G9FA 1E5HA 4DEQA 5BUVA 2FDKA 2JKXA 1BBT1 1VIWB 5CFDB 3H8OA 3A4UA 3AYCA 4MGIE 2P3YA 1W3VA 4BMEA 1MVQA 3ZMNA 4AYUA 4M0HA 1W8TA 2G1MA 4XFFA 4Q2FA 2EICA 2OQ6A 3TNQA 2A6WA 4Q27A 2ZBJA 4QM9A 3AYEA 1HJGA 3VBHC 3ZSLA 3PL0A 2WQ4A 2GMPA 2YXSA 1G86A 4DZGA 5JR7B 4E2SA 3EJKA 3Q8CA 2MHFA 4ZY9A 2AR6A 1RIRA 1ZZCA 2GH2A 5IVVA 1YCIA 4Q26A 4Y5TA 1I1EA 4WZCA 4AAPA 4Z82A 3S57A 2F4LA 5DUVA 1VAVA 1PO11 1GNHA 1Q8SA 4NIIA 4XTMA 4AFMA 4R4ZA 2WO7A 1IS3A 5A3TA 1HRV2 1DQ6A 3ZLIA 4ZZ8A 2IXLA 4XF1A 4A6OA 2R043 4NJ4A 2PXJA 3T1MA 1ULOA 3FHAA 4UF0A 2YZ4A 4P5YA 4O61A 1NAEA 1CAWA 1W06A 3KT7A 4LBQD 2YBSA 3WW2A 4CU6A 1Y3TA 2HWC2 2E63A 2WJSA 3ETPA 2FZ2A 2GC1A 2VBBA 2VCAA 1AF9A 5BNNC 3CIHA 1EV13 2VY0A 5I0TA 2BV4A 3SCGA 1XBFA 3WG3A 2ATFA 5CKMA 1NLQA 3IMNA 2EA7A 2NM1A 3AMQA 1N3QA 4Q0QA 2QVSB 4YM0A 5FK7A 5ABJC 3WDVA 5FOJB 1DFQA 1LECA 4YGCA 4NRQA 2WYFA 5IW0A 4CCKA 4OYUA 2YBKA 3TN92 1VBA3 1CX4A 5B2GB 5FDBA 1O3RA 3E97A 4W6WA 4ZPIA 4QGMA 4XUTA 2DVAA 2VD7A 2DVFA 3EYPA 4OFGA 4UW4A 3OBZA 2B9VA 2J1EA 1U5XA 2HEWF 4DUWA 4YNIA 3R4DB 5LWBA 2W91A 2PYTA 4LUMA 3MO4A 2ZGUA 1NZIA 2BNOA 2Z42A 3FLPA 1IHMA 3KD4A 3GZTB 1DQ5A 5HCFA 1UXZA 2D98A 2Q8DA 4AVSA 2HWD3 1W0PA 2LUWA 4I09A 1H4GA 1IG0A 1H2KA 1AJOA 3AMMA 5DUUA 3WOGA 5IVJA 2BNMA 3LDBA 5GKAC 2RE9A 2XVKA 3I2IA 4BA6A 4TSVA 4PJYA 1G9DA 3OUIA 1LU2A 4KU7A 4M0NA 2VW1A 2HWE2 4HBNA 4COVA 3CZUA 2WLPA 1CPMA 1MZ5A 1AL23 5FV3A 4HLTA 1K42A 4Q4W3 3LDKA 5HCBA 3ZSMA 2ET1A 3O0WA 5BNQA 2XBO2 5FYSA 2PHUA 4JRLA 2OPKA 4AAXA 3CEWA 4E2GA 4IL7A 1SLBA 3BIEA 2GSYA 5JMOA 2WZEA 2IWGB 1NCRC 1SQ4A 4QX1A 4RGAA 4CP1A 1W8UA 2VOKA 4XZUG 2G9GA 1RB8G 5EJ1B 4QDSA 1QNWA 4HK8A 4ZU4A 1OQ1A 3IPVA 3PUHA 3DN7A 4IEPA 4NPLA 3U4XA 3O0VA 4AEDC 1UYXA 3V64A 4AVVA 4HN1A 1BMV2 1CZSA 4P5HA 4KMQA 4JZRA 4B3NA 3I2GA 4XAAA 4A6SA 2XVLA 3KMHA 5IVCA 4QPIA 2CSGA 3ASIA 1UZYA 1KGYA 4ORFA 3Q8FA 4YZ1A 2A6YA 1G9CA 1ULCA 1SDWA 2RS51 4FFGA 4P9LA 2VMCA 5FBZA 1SBFA 4HSLA 4GB32 3Q8BA 5BNPB 5JI9A 2W1SA 5FPAA 1E5SA 3OY8B 5SV5A 4YFZA 1BBT2 4MUVA 5C4WC 4XABA 4F3JA 2HLEA 1GQPA 2VZUA 4GH4A 1VBB1 1OURA 3I4IA 4AL9A 1Q8PA 5AC92 3F2ZA 4N53B 1QJX3 2ZX0A 2IUWA 4ATFA 5J48A 2VULA 2W52A 1WW5A 3GCXA 4IERA 4ISQA 2WO2A 3KVAA 1BKZA 1V6IA 4DINB 1FPN2 1T2XA 1ND3C 1WW6A 2VMHA 4XEZA 2VCMA 1HQLA 2X05A 3VBFA 5CNAA 1XNBA 4LKFA 1RUI1 4CPBA 4QKDA 1F35A 2JDPA 1IGOA 3GZEA 1L7LA 1Z78A 2W3JA 1V9U1 2QQOA 1RUOA 1CAUA 4RGGA 3UESA 3ZYFA 4SLIA 2PAKA 1BQPA 2FBEA 4NO4A 5GLTA 4H3WA 5CFDC 1ZBE2 2Z2SB 1RUD1 1IQDC 5F39A 2BOJA 4DUXA 2OVUA 1E57A 1POQA 2JG9B 1XSRA 3UKVA 3DYMA 1S0GA 2RS13 3DPRA 4O9GA 1FMD2 2DUQA 3N36A 4LEJA 2X09A 1CJPA 4IEWA 2VZ3A 2WRAA 5C3SA 2MPFA 3NKGA 2TBVA 1W6QA 2VQUA 2ZPXA 4UFHA 1OD5A 3RNSA 1GZCA 4MLOA 2PHFA 2DFCA 2BFUS 1MS3A 3CNAA 4LA3A 4R9CA 5KXCA 1FPN3 4LBNA 3HIFA 1PO22 4K6BA 5FTTC 2R1DA 3VBRA 4O7XA 4CCDA 2RJLA 4XF4A 3WW1A 3X29B 1ZRCA 3D4KA 5KBFA 1G8WA 4JKKA 1FNYA 1I6XA 1WKYA 3LEMA 3SEEA 4R9DA 4C1WA 1AXZA 1U0AA 2VMIA 3GM8A 4ZU7A 3RWNA 4YZ2A 5C9AC 3IKWA 5CISA 2VMFA 3LIGA 4LKEA 4QQ2A 2YPJA 1W9FA 2XOMA 1CAUB 3G7DA 5C3RA 5LZ6A 1DZQA 1HB4A 3KGLA 3POJA 3BOWA 2VW2A 3GHNA 4XUNA 4D0QA 2BP6A 2A70A 1BJQA 3ZXKA 2JG9A 1S0EA 1UL9A 3BPSA 3IDEA 1NCQA 2JG8C 3DPRB 3CLPA 5HBAA 4RQPA 4AHWA 4I3PA 1IKPA 1PZ9A 1FX5A 2V72A 4OHXA 4PIZA 5FYVA 1ZM1A 3VBUC 2R071 1YUDA 5FP4A 5LA1A 1EAH1 2JKBA 5HV4A 1RVF2 1VB4A 5DDJ3 4GJZA 5FUIA 1OBNA 1JU4A 4RN5A 3A21A 3T09A 4I0AA 5F8PA 4YZ5A 1ZVFA 2Q8OA 4IE7A 4YZ3A 3UGGA 4BU2A 1EUUA 3ACGA 4JKLA 4CDQC 2P17A 1RMU3 1QDCA 3PU3A 1AL0G 2D6MA 2H6BA 3PUAA 4Y1XA 5CBLA 4FOVA 3N4MA 3ALQA 2DU0A 1UMHA 5A1FA 4IEXA 4F83A 4N90A 1MS4A 5FZBA 4YW3A 3T4HB 5L7OC 3JZVA 4Q4V1 3ZYRA 5LRSA 2K9ZA 1C3HA 2R30A 4GZ9A 5FYBA 4E4ZA 2FDIA 5J7MA 3DF0A 1U5IA 1XYPA 4MXWA 3GF6A 5JZGB 2V73A 2NYYA 1PGL1 1WBLA 1N3OA 2DWRA 5FXWA 3FUOA 5CEHA 2VQTA 1GQHA 4P9XA 1APNA 1AUYA 3JXSA 3WP6A 3POEA 4PDWC 3V56A 3W9AA 4BQWA 4ZS3A 4BISA 4AXOA 5K9YA 5IAXA 2LRPA 3ZSJA 1GZ9A 4MGKE 4PI2A 4WZFA 3H1YA 3H3LA 1UYPA 3HT1A 2WN2A 2GZWA 4Y22A 4YG0A 1V6KA 1PIV2 2MNGA 3KS7A 3C7FA 4CDQB 1VBB2 4HZFA 4BLIA 3HVDA 3Q9OA 1ZYBA 1RHI3 2WC2A 3VDCA 3RVHA 1BCXA 1CPNA 4WVZA 2W46A 5FY4A 3O1RA 3NAPA 4ONUA 2JDAA 3WUDA 1UOFA 2C0ZA 3VL9A 3T4VA 3O1OA 3E6CC 2W5FA 4GB31 4Y1UA 3CDZB 1AR83 2DCKA 2A6XA 4LLOA 3SXWA 2YROA 4NHYA 5JPMB 2WFF1 2FD8A 1UY2A 2OYZA 4PLOA 2E7AA 5CADA 4IEUA 1QJY2 1CAVB 2WAAA 1X50A 4ZONA 3L2YA 1GUIA 1JUHA 2WUHA 5A7NA 1DGRA 3O14A 4YW4A 4QT6A 1S2EA 1FATA 5JPNB 2Y0IA 1ASJ1 1WLDA 4KGGA 1KDMA 1AYN1 2ZJCA 4N7IA 5LY2A 2LS6A 2O8OA 4I02A 4XOGA 2VZQA 4BH9A 5C5TA 1ZBA3 3TEZA 1YJKA 3VD3A 3H3UA 5DMYA 1NKGA 4OMDA 3VBHA 2F4PA 2WN3A 2K46A 5FP8A 1ZZBA 3S6PA 4BQ5A 5L36A 2A6VA 2WKKA 2BVVA 2V4VA 3NSTA 3LA2A 1BMV1 4H55A 1Q3EA 3H9AA 2WS93 5GZFA 1HXS1 4W6YA 3ACHA 3LQCA 3W59A 1N1TA 2A5ZA 4BCUA 2EAAA 5I0DA 1R1A3 2BW8A 3CZJA 5FO8B 3ZYGA 2AZ5A 4PQ9A 4PDWA 5T5LA 2WAOA 3MLJA 3J8F1 1NQDA 2CAVA 3U10A 4I2OA 3SHRA 2WLQA 1MEC3 1PM7A 3OBRA 4ITCA 3O1MA 1YRZA 2FZ1A 4LITA 4PIXA 5FREA 4JGZB 4XF0A 1RC6A 5JVVA 3RI8A 4QM8A 3GJBA 2GC0A 3HBZA 4WV8A 2BGCA 2RM23 2XXZA 5F5QA 1B09A 1VRH2 3B69A 5EJ3A 4NUBA 1OUSA 1C8M3 1YI9A 2ZEWA 4UBGA 2D6NA 2DCYA 2OA2A 1R091 4RHV2 4Z8BA 1XNDA 1DU3D 3ELNA 4P9WA 2YC4A 2VBDA 4G3YC 1DBNA 5FXXA 5TSWA 1BK0A 3BCWA 3L2HA 2VC9A 3B01A 1UYYA 4FTBA 4IEZA 5F9TA 4IGPA 4HMZA 4A44A 3POFA 2UU8A 1JBCA 3HPNA 3NV3A 2IC1A 4OMCA 5IWFA 1LAJA 4XBNA 3I2HA 3S7IA 4FPKA 1YFXA 2ZAHA 1KFXL 2R061 3EXUA 4FP3A 3VV1A 1H9PA 3RG0A 4AI1A 1TE1B 3OY8A 3FHIB 5A7OA 3PTYA 3HAGA 4LNVA 4CDXB 3JQWA 5F5AA 1J84A 1VR3A 3LEGA 3I3DA 3N9PA 2RR11 4M3CA 2VOVA 3IT8A 4LBOA 3VBOC 3WF3A 4ES8A 2ZHNA 3MFCA 1W8HA 5F5CA 3S0MA 2C9KA 3I2JA 5F3IA 5EZWA 2HWF2 1W3XA 3KWVA 3DCQA 3IBMA 4PF5A 1C8NA 1VBE3 2FCUA 2Q8CA 2O0OA 1CESA 1RUJ3 2VH9A 4FBFA 3OBTA 2D43A 1GWLA 4IV3C 4EN9B 1CWPA 3LFMA 3ZO0B 5A6YA 2PAEA 2CGPA 4XCAA 3IMMA 1F5JA 1AR71 2VTXJ 2CTVA 5K0UB 1W9WA 3PIGA 1IS6A 4I3GA 4FPYA 4EN7B 3HOBA 3I2FA 4D69A 4COWA 4NIHA 4M4PA 3LKJA 3ACFA 4IEYA 1CZVA 5CA6A 2B8MA 2W68A 2QDRA 4UF0B 3U14A 1BVP1 1MR5A 1LEMA 4BMBA 5CFCB 5FMBA 3V0BB 4FPHA 3BKZA 3WLUA 2YC2A 1YHFA 4Q4X1 1LHNA 3USUB 3WP3A 3I2DA 3BODA 2Z4FA 2ZMKA 2R063 1OD3A 3AZXA 5A7WB 4WVMB 5F2SA 2ZGSA 1W6MA 1W9SA 3J7MA 2PA7A 4CDXA 2XLGA 1BK1A 4D7TA 5FQ0A 4QPGC 4JCKA 3HD8B 5C8CC 4XFCA 5JI7A 4YRDA 4PBOA 2JEMA 5C33A 1A3KA 4KI5M 3VGIA 2PHRA 2D97A 1RINA 5FLIA 4XAEA 5LATA 1JYIA 1PGL2 2GNDA 2W1QA 2ZGPA 3RFRA 3RPQA 2ZHKA 3BTZA 4L11A 5A33A 4YVWC 4CDWB 1IZ3A 4AWDA 2HYKA 2GP3A 4K9SA 3D6EA 4AOCA 4D94A 5KXBA 4HVRA 2I2SA 3WNXA 2P3KA 3ZSKA 4HSJA 5CZKA 1JH5A 3IM0A 5CAZA 4HANA 1WGPA 5L9VA 2E32A 5KHGA 1MEC1 3J7HA 2ZOEB 4UT5A 2Y0OA 4AFDA 4XC9A 3ATGA 3VZOA 1H30A 3M1HA 1QJFA 1GLHA 2WNUA 5D8AA 3BOPA 2J1SA 3C7GA 1GWKA 4NAMA 4LOTA 4NROA 2X5IC 5JWPA 2DUPA 2HEYF 2ZGNA 4X8PA 1ZBA2 1ZZ8A 1YQ8A 2ZGOA 1HX6A 2IXCA 5I93A 1OKOA 3DV8A 1HDKA 1HXS2 1S0BA 2VU9A 2VXJA 2XR4A 3GALA 4XHBA 4YVWA 4FSJA 4IV1B 4BK5A 4ASLA 4QGNA 2C6SA 5JMCA 1HLCA 2O8QA 4B1LA 1UU6A 2UYAA 4MSVA 1AYN3 4PIYA 1YXWA 3KT4A 4E2QA 1SLIA 3J8F2 2R0FA 4ET7A 1S0DA 4MH0E 2EXKA 2X5IB 2WNEA 2P34A 4JVAA 1JYNA 3IIIA 4MGZE 1Q43A 1AR82 1GNYA 1RXGA 3TAYA 3ZYPA 5DZFA 2QQVA 3SISA 2QQPA 5BNPA 1CAXB 5FMOS 3ZX7A 3LFIA 5EYXA 3AZWA 1FOD3 1K12A 4XQ4A 1YC61 2ZACA 4MADA 1NCRB 4D3WA 4GB33 2W47A 4ZZ5A 4P9IA 1RXFA 2J1VA 1OSGA 1QJZA 4Z1VA 3KGZA 3OBAA 5FIXA 2JE7A 4GQ7A 5JR2A 1J3PA 3IAPA 1TMF1 1VP6A 2HWD2 3PUSA 2QCSB 3MLKA 2Q8EA 4Q4X3 4Q0VA 3VKLA 3GHMA 2R32A 4XXPA 2X29A 3DECA 1MQTC 3LCPA 3K3NA 1AR63 5F5IA 2DCZA 4O9EA 1X36A 4E9KA 5A6XA 1W0NA 4QX0A 2BPA2 1NA1A 2XHNA 3DYOA 4FPEA 4XMAA 1Q56A 4M01A 1LEDA 1PGW1 4Q8KA 4L99A 4RFT0 3CF6E 4QAWA 2ET7A 4FPJA 4NAOA 1DQ1A 3HBKA 1R092 3VD7A 3GZUC 3WVJA 1JZ8A 2LROA 3P1IA 2BU9A 4CEWA 5F3EA 2CL2A 5ISLA 1M06G 4N8MA 4A45A 4ASMB 2JX9A 5LBFA 2QQWA 3VBHB 3ETQA 1RUF2 1LENA 4K8RB 3UKNA 5DAPA 4JGZA 4TWTA 3WR0A 2WWUA 5T54A 1BLZA 2VZ1A 4Y1ZA 1G9BA 3ZM8A 5A70A 1EPZA 1ENRA 1ENXA 4A42A 5F7UA 1RTVA 5FPLA 5FBJA 3BTAA 1S2KA 1UPIA 5KHHA 3HNYM 1T6GC 5FY0A 1FXZA 2QQKA 1QHDA 1W8WA 4QMAA 1UZ0A 3TEYA 2R073 1A34A 2FDGA 3GCWA 3ZXDA 2TUNA 4GMP3 1LESA 1UO9A 1V70A 3AJYA 2DCTA 2LM3A 1R093 1SG3A 1DLCA 1XNCA 1PNGA 1C8M1 2KR2A 4JGYB 5FPUA 1VRH1 2BUKA 3UL2A 4GJYA 2YGLA 3ES4A 3J9SA 3T2OA 3WEZA 4WM7B 5FY7A 3MZHA 3LPFA 5LA9A 1B35C 1UWWA 4DFSA 3AFGA 3P6BA 1WWYA 1T6BX 4NHMA 4CUCA 3KQ4B 5DN2A 4OLLA 2ORXA 4GWIA 1R081 1STMA 1W2TA 3FHQA 3K2OA 4J25A 5EWSA 3VZJA 2RMU2 1DHKB 2PLV1 3CJIB 4FO9A 4WVMA 3OPWA 3BUCA 2JB4A 4IUGA 1PO12 1W6NA 3AK0A 5CB7A 4CEWC 1V00A 5H9SA 3TB0A 2JD4A 2EXJA 2CWMA 4HT1T 5DUWA 3N9MA 4QKBA 1SLLA 4XFBA 5K0UA 3U1XA 4AE2A 4L8QA 2VNGA 1D7PM 1QY4A 3VHNA 4AI9A 1OVPA 1ZBA1 2WS92 4RR3C 1YO8A 3UKTA 4EN8B 3WDXA 3ZYIB 4ISRA 2HWF1 5F37A 4YSFA 1AYM3 3HN3A 3NW4A 5BPXA 3VD9A 1M4WA 3I2KA 4DPNA 2HJIA 1O8SA 2VPVA 4LR4A 2Y38A 5LRRA 1HKDA 1F31A 2DURA 3ZFGB 4DXSA 2K0GA 3ZFFA 1DQ0A 1TNFA 2E53A 4L0PA 5FY8A 5I8SA 3VKNA 1RUD3 1WD3A 1KXGA 2RJ2A 1ND3B 4H7LA 4INDA 4KWLA 1NXD1 1E5RA 2QQUA 1CGPA 2HWB2 4M3CB 5FUPA 1AR81 3KVBA 3AMNA 1YYNA 3D3AA 3HQUA 4UFIA 1JS9A 1OOPA 1F4HA 4GWMA 3U75A 1HRI2 2DTYA 3ILFA 1RUI3 4CEYA 3DXTA 4JDNA 5E6HA 5FZKA 1UX7A 5KHIA 3OEAA 3DKQA 1D4M3 2WINB 4FXGB 5HCAA 3N9NA 1AVBA 1K3IA 3ITQA 5I8YA 3PNAA 3U0ZA 1H2NA 4QHZA 4UFJA 3SC7X 3RWKX 1GWMA 4FTEA 2YU1A 1DCSA 1NX9A 4GMP0 4OI0A 2E31A 4LLFA 5DAXA 3FE5A 2ZZQA 1QJX1 3ZSEA 4AQTA 1O3TA 4PF1A 4RSUA 1A8MA 2VO5A 1O3QA 1LODA 4IV1C 1VBB3 2QQMA 2WQ8A 4FQ4A 3TWIA 3VDAA 1H8TA 1J1TA 3I7DA 5FKCA 4CZSA 2WZPP 1LR5A 1YI7A 2HWE1 4K1YA 1UMIA 4Y1VA 2DUOA 4S2HA 4ZXEA 2XKPA 5IVBA 1RUG2 1PZ7A 3KCXA 1CAVA 2UURA 3IAQA 1QXPA 4N9HA 2AEYA 4AQ6A 3T0DA 1QXRA 3AVSA 2WFPA 4YFWA 3WNLA 4CCNA 3U07A 3WP5A 3W5NA 4P14A 1D4VB 5HXMA 1OQEA 2OKXA 1UKRA 2YB7A 1NCQC 3B94A 5A33B 2ES3A 4A2UA 4YVWB 2LTNA 2VR4A 4CDWC 1D2SA 5DDJ1 1EY2A 1OLQA 3WW4A 1OVSA 3E5UA 4MGSA 3T2QA 4AG4A 2E7QA 3QH6A 1JZ7A 2VNVA 4DRRA 2V09A 3S5QA 2X8KA 1XYNA 2BDRA 5DG2A 3THPA 2YU2A 5T5JA 1QOTA 2J1AA 3ZXFA 4HL0A 3U4SA 1SEFA 3HR9A 4QQOA 3T0AA 4NRPA 2NZ9A 2HKXA 2OXBA 2XMLA 5IAVA 2D6LX 4RFRB 5DAVA 2X53S 2ZX2A 1HB3A 2RDSA 4QB1A 2CDPA 4QDQA 5AFEA 4XQDA 2EIBA 4B29A 4DY5A 5A32B 5L9RA 4LO6B 3MPPG 2Z79A 2CNAA 2DCJA 1XRUA 4IV1A 3TRSB 2XGXA 4GH4B 4XFAA 3UJQA 4ZS2A 2XJTA 5JCTA 1WCKA 3AFKA 5D1IA 2A73B 2R1BA 2R6QA 1JN2P 4XDQA 3JD73 4P9GA 5GLZA 4CCMA 4DXTA 4YW2A 2BBVA 1LOBA 2BFUL 2W08A 4BQ2A 4F7ZA 2VMDA 2EIEA 3I3EA 3RRDA 1H4HA 5GM0A 4N7UA 4Z2WA 3E1F1 2WL1A 2EF6A 3P3NA 2NQYA 1OPMA 1CD3G 5FYZA 4XUPA 1FPN1 1ULFA 5K4LA 2VGDA 5FP9A 1MACA 4XMIA 5A3MA 2V5YA 2RM22 2FMDA 3DUIA 3PUIA 5J98B 1IPKA 2XJPA 4D6SA 3O1VA 1HRI3 4EJRA 3OPZA 2XLAA 5I0SA 1US2A 3KB5A 4LBQA 5FYHA 4UFMA 4DIQA 1ZBE1 3ZXJA 4LO4B 1OH3A 1W03A 4X8NA 3ZPOA 1NA1C 3VBSB 4AEMA 1RUD2 2DBIA 1Q8OA 1XE7A 1RUF1 3VZKA 4QU2A 4DXZA 3ILRA 4PCRA 4V2WA 2RS12 3IIAA 3RZZA 4JQRA 3VDDA 1R1A2 4FPCA 1HRV3 1RUF3 2V5DA 2DTWA 2RG4A 3M3OA 5EYYA 4M00A 1C5HA 1WMFA 1IQAA 1OT5A 2JG9C 3OYWA 1ZBE3 2W1UA 1VALA 4FOYA 4QX3A 3WNNA 4QB2A 4LO8A 4C90A 2AUYA 5LK7B 1REEA 2QDNA 2R041 4CEWB 1HRI1 2O1QA 4RQPC 5FMOL 5FZDA 5L73A 1HJFA 2R0HA 2E6VA 3I8TA 1PO13 3N9OA 4LULA 3ZXGA 1JW6A 3OCPA 4L97A 2YFZA 3UT0A 4XFIA 1GQGA 1CZTA 2WNUC 3OUHA 5D8AC 2ZGKA 4BQ3A 4CPBD 3HN1A 2IXHA 4P00B 5FZIA 4YWAA 1ZRRA 2JWPA 2WT0A 3PVNA 1OA4A 4Y3OA 4K3UA 5E8AA 1ZZ7A 1HB1A 4ATEA 1C1FA 3RYKA 2RHPA 1CQ9A 1COV2 2ZZJA 2RS53 1QEXA 1AZDA 3BN6A 3VBSA 3I59A 1KRIA 2ORZA 3LA7A 2PAMA 2VTXA 1BBT3 5FZ0A 1R64A 4JHZA 1ALYA 3WF4A 1R082 3HWJA 4CUBA 2QQLA 2RS33 2UWCA 4WVWA 4LHLA 3SLIA 3VKMA 1V6NA 3KQRA 2E26A 2B39A 4MVTA 2VECA 1JOJA 1BYHA 4OHVA 1PK6A 1YQ2A 1RUE2 2D6OX 1HV0A 1Z7S3 3LDRA 2GC3A 2Y26A 5FUNA 5FP7A 4OUMA 4QQPA 3AP4A 1KS4A 4QX8A 5FP3A 1ZREA 4Q29A 1GSLA 1LTEA 3LZZA 2RVAA 2FCTA 1H6XA 1PMIA 2Q1ZB 4UFLA 2G9ZA 3C2UA 4PHZA 5FZMA 2ILMA 4QPIC 4BE3A 3POGA 5F3GA 1LHWA 2DBNA 4CP9A 3EBRA 1XJAA 5IFTA 1QJY3 3B93A 1ND2C 3ZXEA 3B5LB 4FAGA 3G6JB 3ZPYA 5DAWA 1X33A 5BNOB 3E6BA 3ACIA 4FP2A 2A75A 4XUQA 2FDJA 5F1RA 1W6OB 1YQ5A 4S2GA 1K5JA 1AHSA 4U36A 2WABA 3MEPA 1AR92 4KQ7A 4COYA 1QJEA 2W2IA 2ZEYA 2XKOA 3A0KA 1MQTB 3QLQA 5JDBA 5DZEA 4JTOA 1SCRA 3CL1A 5KC5A 3THCA 2HWE3 5FYYA 5BY5A 1QDOA 1JZ2A 1FV3A 1MPXA 5FKBA 3HQXA 5A3WA 4H7MA 2HEVF 3ZN5A 1PIV3 3ZDVA 1MZ6A 5T3NA 5IK8A 1OQDA 4MX3A 5IVFA 3DYPA 1ULEA 4D7SA 2D3SA 3KHBA 3S7EA 1ODMA 4HFSA 4OHYA 1MS9A 3ENRA 3WNPA 1O6UA 2WR9A 5JZGA 5IFPA 3C3VA 3MUY1 1KJRA 5FZ7A 1OOPB 3EB7A 2D3PA 2ZAAA 3H42B 3PVBB 4B8EA 4BXSV 3ZKUA 1U12A 5AFBA 2WT2A 4LOSA 1VBA1 2Y34A 2CU5A 1IS4A 5HCHA 2ZGMA 2Y8KA 3VDBA 1N1YA 2Y6FA 4MZUA 1SLCA 5I8TA 5JIUA 3FC0A 4CU8A 3Q8EA 4QPYA 1J58A 4RYDA 4EN6B 3U11A 4LUKA 5F3CA 1YQCA 3BALA 4CXXA 3TN93 1RUG1 3PUQA 4GKYA 4CDQA 4NIAA 4Q4Y3 3ABZA 3PLQA 4BOWA 5DG1A 3POYA 4YM3A 1ZRDA 4XJWA 4EZHA 1ST8A 4KGQA 4QXCA 1K5MC 3QH7A 4OZOA 1W28A 1NY72 2OS2A 5IATA 1LRHA 1UF2C 3RZLA 4Z2AA 2EALA 4OCTA 3FZ3A 3R4SA 3U78A 1PGSA 1YIFA 2RR12 4GKXA 3VN4A 2R042 1AJKA 3MW2A 2YC0A 3Q8AA 1WMXA 3AP9A 2P6HA 4RGKA 4EE2A 1B35B 1GP6A 1UNBA 5J96B 1GNZA 1S55A 2OX0A 2XBO3 5T5OA 1HN0A 4C8DA 2XJVA 4DY3A 2GAUA 4LA2A 4CXYA 2XUMA 3KV6A 1XE0A 2P6CA 4Q4W2 2J42A 4UOJA 5HV0A 5L7OB 3J4UH 4HN0A 2PLV3 1H1IA 2YGMA 2VUDA 5D2AA 3RMYA 2ZA9A 3WY6A 1R083 2BGOA 1W8OA 3ZMOA 5A7QA 1W2AX 4JDOA 1F2NA 2I07B 1SACA 2G4IA 5EXOA 1W6PA 3N7MA 2GC2A 1GZTA 4Q1RA 2WIIB 3AKQA 2YDEA 3OGSA 2RDRA 4J1XA 4RHV1 4MOAA 4DNYA 2W39A 5DPNA 5DXDA 5ABJA 1OH4A 2JG8A 3SH3A 2Y64A 4LE3A 4BM8A 1VRH3 4XUOA 3AVRA 1V0AA 2QFEA 4CDUC 3KV5A 3N9QA 3IDAA 3WXPA 1H1AA 2QBXA 4Y24A 2JDKA 2D6KA 2JB8A 4FVVA 1REDA 2ARAA 5C8WA 4N43C 2D93A 4GMP1 4XZPA 4Y33A 4R9BA 2OUHA 5C70A 4Q0PA 2IXIA 1G9AA 5A1AA 2D6PA 3SKVA 2YBPA 4L2NA 4NRMA 1PVC2 3BU7A 5FZAA 4YGEA 5B4XA 4AVBA 1F4AA 1OLME 1WCSA 1XXNA 3T30A 1L7QA 1SFYA 4BQXA 1PO23 1N1SA 1PK6C 5APAA 3FWEA 3RZGA 2D7FA 3OSDA 2A3YA 1GFF2 1DG6A 3EO6A 1KS5A 4WM8A 2VQAA 1SBDA 3WF0A 2VM9A 4CU9A 2WZ8A 5C9AB 1LHOA 1NXMA 1EV12 3JB8A 5DZGA 3M3QA 4WM7C 5FYCA 4N43A 3ZYBA 1SFNA 3WDWA 1IPJA 2VVEA 5T52A 1AR72 5JAXA 3LSDA 3WV6A 1SZBA 1NOVA 4LE4A 3FN9A 4MXWB 4QQLA 3FL7A 4IE5A 5IVYA 3RZJA 2PHLA 3UYJA 4R52A 5G05L 2C5DA 2ADDA 4COUA 3AL6A 4GA9A 2PHTA 1ZNPA 2ARBA 4PBPA 5FZCA 4UFKA 1GZWA 2GNMA 1FV2A 1QOSA 1RUC3 2UYBA 3MGUA 2HH9A 2DVDA 3TYJA 3ZXAC 1AR61 2QQIA 5FQ0B 1C5IA 3ZFGA 1RUH3 5GLVA 2P5BA 5FZOA 2QUOA 1CR7A 1OLMA 2PTMA 4Y1YA 4K1ZA 4Y20A 4YGBA 5FZHA 5LBCA 1GICA 2PMWB 4FFIA 1JI6A 1KDKA 2CGNA 4QX5A 3BB6A 3ME2A 5DABA 4DEVA 1N1VA 5LB6A 1RUNA 5C5UA 3E5QA 3ST7A 3I3MA 2GU9A 1AR91 1YIPA 2VE1A 3USUA 3N7JA 5J36A 4Q4Y2 3TBDA 3KV4A 3WG2A 4RA0A 5FWJA 1F15A 5C71A 4UI9L 1XU1A 1W39A 5E88A 4YYOA 4C0BA 3N7KA 3NQHA 3VHOA 5CVRA 3UGHA 5FR3A 3WNMA 2WT1A 1VMJA 2GN3A 3FFZA 1RJ8A 2C26A 4BLJA 2I74A 3B9CA 2GNBA 3KCYA 4L92A 4TLGA 2P1BA 5GZGA 1QF3A 3INAA 4KWKA 4CUGA 1AXYA 2ZHMA 2MEV3 4Y5Z0 1TZOA 2JDZA 1FYUA 3VHRA 3MIGA 2VOTA 1ACCA 4W65A 3NAPB 5M0TA 3UNPA 4OUEA 3PMEA 4K20A 4C0HA 4V2VA 2VUCA 3OGVA 2BERA 3ZXLA 3NVCA 2DFBA 5CKNA 4LBKA 4XFHA 4JV4A 3RJRA 1L3JA 1RUE1 1DGLA 2A71A 2CV6A 5CU1A 5FRAA 2XJQA 4BWOA 1MS0A 2P2KA 3L9JT 3OGGA 3AZVA 4QGLA 3NNLA 4XW3A 5IK4A 2WWJA 3AKRA 3A22A 4AW7A 1UZVA 1UAIA 3MLLA 4QXKA 5JSRA 3RZKA 1XYOA 1ND2B 1J83A 1BEV1 3K75B 3LD8A 1IS5A 2BOIA 3PDQA 4QPGB 3I3BA 1WLTA 5FZ8A 5C8CA 3SKJE 5C3OA 2NPIA 3RSJA 1QGLA 4JQTA 4NMIA 1VLNA 4WBBA 1RUE3 3WNKA 3DEMA 1WUVA 5A3UA 4AI2A 2MEV2 1XNTA 4IEQA 2A6ZA 1LKNA 4E4HA 1OI6A 2ENRA 2VZRA 2BQPA 1YFUA 2VXRA 2PHWA 5CIRA 2NP0A 1NE4A 4BQ1A 1TMF2 1H2LA 4BDVB 4XDOA 5FAXA 3H8UA 1X8MA 5LASA 1UZWA 4YG6A 1S0FA 4TYSA 4RD7A 1Y43B 5ANNA 3MF6A 1C8M2 4J6GA 1I9RA 5EIYB 1YFWA 2IXJA 3OF1A 4XHXA 4K8FA 4IV3B 3SNMA 4M3CF 1RGSA 3WZ1A 1DZTA 1EPWA 2WNVB 1O4YA 3KM5A 5KXDA 1GOGA 3IDBB 5FZ4A 1AR93 2GN7A 2OPWA 3KLSA 3T08A 3JU9A 1W04A 1H8VA 2J1TA 3D0JA 3I59B 3PIJA 3AP6A 3W21A 1BVVA 4H14A 4H2AA 1S0JA 1EP0A 1LCLA 2F6BA 1OFNA 2JXAA 4MGYE 2BJSA 5A3NA 4R4XA 3JBG2 4QKNA 3A0NA 1XOYA 3QOPA 4MO3M 3W20A 3AM2A 1O59A 4JAAA 3ZN6B 2F17A 1ZA7A 1V6OA 3TEXA 5JIAA 5JXGA 3T1LA 1WCQA 1KEXA 1QNYA 1EAH2 3NMBA 4KBZA 1JYWA 1DGWX 1TNRA 4OI4A 3H8XA 1V9U2 1RVF1 5AVAA 2XG3A 5C4WA 2HWB1 3VBUB 3I97A 4GAZA 3A23A 4YLZA 2RR13 1GOHA 1DQ4A 1VBD3 5G04L 2C9AA 4AFBA 4LBQB 2BNNA 1VMFA 5CFCA 1YLLA 5IYYA 2WYSA 2VVFA 3OG2A 5FZEA 1MZFA 3HNBM 4MYEA 1A6CA 2CWSA 4DUVA 1V6MA 2X10A 2BBAA 3WX5A 3H3ZA 2BZDA 2GNTA 3ORJA 4BIFA 5I0UA 4JTNA 4CCOA 4DO0A 2GH8A 2ADEA 1V6LA 3UK9A 4AF9A 4I0BA 5SV8A 3VDDB 3O12A 4WVVA 4NHLA 1N3PA 3FX3A 1WZXA 4YG3A 1LGBA 3N35A 4LTAA 4NPRA 4P9YA 2JE8A 1ENQA 4TN7A 4LMFA 3GBGA 2FCVA 1W0OA 3OB8A 4YW5A 4GWJA 4XDPA 2RDNA 5AC93 2DYCA 1LULA 3ZVXA 2ZHLA 1W6OA 3O0XA 4K7JA 3WP4A 2RS52 1WLCA 2SBAA 3GZAA 1HV1A 4QX2A 1OUXA 3SMHA 2EAKA 2Y33A 4WM8B 4IESA 2RMU1 2W1WA 2VZVA 1DYKA 4QD2A 5DAQA 4CP2A 1LOFC 1POV1 4N53C 3NNJA 2VUJA 5FO9B 1UY1A 2P37A 4NWVA 4Q8LA 2DU1A 1VPHA 3WUCA 4CEYC 1DP0A 4CRQA 5C4WB 1QQP1 3RZHA 3VDDC 4NIDA 1JYVA 2XH6A 4IE4A 1PVC1 3KSCA 4OI1A 3LEIA 4NHKA 5GZEA 1UPSA 5H9QA 2WS91 3QBQA 4A7KA 4ZU5A 1C1LA 4HOOA 5LW9A 2E9QA 1UU4A 2Y6KA 3O1UA 3I2OA 1UIJA 1SLTA 3PMSA 4Y26A 4FPFA 4N43B 5CFDA 2VOWA 3VHPA 1R1ZA 1GBGA 2RJKA 2WZR1 4IEOA 2XQXA 2TNFA 3AL5A 3H50A 5E1RA 3ZYJB 1WMDA 2BVBA 1ASJ3 2ZEXA 5FZOB 2VNRA 2BTVC 4AHZA 5FMDA 3LGRA 2B9UA 1QWRA 4IGQA 4BXFA 2Z69A 1JHJA 2XL9A 1ZRIA 3CBNA 1H0BA 2ZTNA 3K4DA 3M4FA 3NNMA 3VKFC 3ZR5A 1VBE2 1VJ2A 3FBYA 5IK7A 1BEV2 1TG7A 2VW0A 2GDFA 2WFF3 3GGLA 1UMZA 1AL22 2IFRA 4CVUA 1FMD1 2PQSA 2H0VA 5JXIA 5EP9A 2EIGA 3AZYA 1K45A 5LA0A 2B45X 1FI2A 4AVAA 3T2PA 5EV7A 4CCCA 1RHI1 1TME2 3IWZA 4XJAA 4BQYA 1CN1A 1GP5A 5FFOC 5F32A 2ZGLA 2VMEA 1Y9MA 1RYYA 3AB0A 4MHRA 3HNMA 1X9PA 1VBC3 1OF3A 4FAHA 4LJHA 5F6LB 2FDFA 5JOXA 1DYPA 4Z92B 2AC1A 1J59A 3B9IA 2OUJA 2VZPA 4ARYA 4DQAA 4Q4Y1 3KZ4C 1VB2A 1MQTA 3JD72 3M3IA 3FMGA 5BXXA 1RUG3 4C91A 5J09A 1WLWA 3SCFA 4Q5OA 4URTA 1CVNA 3F95A 4N9IA 3ZR6A 2CYFA 1D4M2 4P9JA 3LPGA 1QJU1 4AGVA 2VZSA 4E4SA 1NZCA 2ZEZA 3VD5A 3B00A 1SHWB 3HJRA 4Q4V3 1XNKA 2V4AA 4EROA 4GULA 1UOGA 3OEBA 2VBPA 1WCUA 2P3IA 3PHMA 4IW3A 4G9SB 4XXAA 1CIYA 5LY1A 3WDUA 1NUKA 4GIQA 4YGDA 1SLAA 2BGPA 3M7AA 1PMJX 3K4AA 1RUH2 1RMU1 5FY5A 3MIBA 4TXWA 1QH7A 2ZMLA 5FJKA 4LHSA 1FAYA 1PIV1 3MI8A 3B02A 4B4QA 3BU0A 2JDNA 1ND3A 3EQEA 2AH2A 4AK3A 2HBUA 4FXKB 1JYCA 5FPXA 1MS1A 2WWSA 2EXHA 3RZMA 5FZFA 1JU3A 4B7EA 1JZ3A 4FOWA 4CEYB 1UY3A 2Q30A 2B42B 2WFF2 3NAPC 1VAKA 4QXHA 2E7TA 1QJY1 3AYAA 1HB2A 4OI2A 2FQPA 2WQZC 1KITA 4JGYA 3MPBA 5JZGC 3NJXA 4XJUA 5FZ1A 1D0HA 4NN0A 1UZZA 2YHJA 2XONA 3BTYA 2YG0A 2I45A 4GD4A 5FXZA 3O1TA 4RS5C 1AYM2 3C7EA 3AJZA 4KG0A 5A3OA 1JTZX 2W94A 4EZ4A 1XE8A 3MIHA 3APBA 2D3RA 4IGOA 3NWKA 3T2TA 4BYYA 1NT0A 5FYIA 3K77A 4HKWA 1B35A 4D7YA 4DXRA 5A3PA 1UU5A 5AVPA 1Z7S1 3WCSA 1AX1A 1V6JA 1OPOA 1F9KA 1DDLA 2VOXA 2JIGA 5H9PA 1PZ8A 4YM1A 4NIGA 4XTPA 3POIA 5A3LA 4QX7A 2AREA 1DF0A 1TME3 1S0IA 1XB9A 3UJOA 3R05A 2IVIB 3V0BA 2WA4A 2W9XA 2YUEA 1LB2A 3M2MA 2DV9A 3BIWE 1OKQA 1SBEA 2RS11 4R8HA 3SCHA 1HQNA 4IE6A 2WZR2 3THTA 2VMGA 3NKTA 3RYRA 5A7WA 3JBG1 3LOIA 3M3EA 1MEC2 3M8LA 4XVHA 2HWC3 4OHWA 2W87A 4NOTA 3MIEA 1PHMA 5GJ6A 4EQVA 5FZLA 1W90A 2Q4SA 2JENA 2AENA 2IFWA 1K5MA 5JOYA 3KHCA 1V9U3 4FPOB 3VBOB 2P3JA 4S2DA 3VBFC 4G4FA 1LU1A 2AYHA 1AXKA 2VQ0A 3J26N 4QQHA 1N47A 3EHKA 3QD6A 4D6QA 5A32A 2UWAA 3MUZ1 4A7ZA 3RYPA 4OHZA 4E4DX 4CU7A 4FI9A 3ECQA 3CMGA 1OXCA 4UBHA 3ZN6A 4QHBA 3DKWA 5LK5A 1HRV1 1DQ2A 3BVCA 3TEWA 1RJ7A 3VBRB 1O4TA 1UW8A 4K21A 4LBMA 2CY6A 1COV1 1KJLA 5T5PA 1RITA 2P4EA 4JHTA 1XPWA 3CQOA 4UW5A 2Q1FA 4LHKA 2HWC1 3JBG3 4FQZA 2VVDA 1LOEA 1Q8QA 1J3RA 2JDYA 2Q0AA 4EN0A 1QH6A 3IPVB 5JSOA 2K2SA 3ZN4A 5KHJA 1O5UA 1X8EA 3LF7A 2E51A 2JDUA 1H9WA 4AEDB 2G19A 2E33A 4XIOA 5A6QA 4LPLA 3WD5A 4YW1A 1Y9GA 1QQP2 1RHI2 1TME1 2ZCWA 1JODA 2X5IA 3K46A 1FOD2 3ILNA 3N3HA 4BJ0A 3LB9A 1VBC2 2BWAA 2R7EB 3J7NA 4AVTA 4RS5B 1U5ZA 3ZFFC 2ZGQA 1JZ6A 2LALA 3NJVA 2DF7A 2XVGA 2B5HA 3JD71 1RUI2 4P08A 3R0RA 3O1SA 1XSQA 1GP4A 4XBQA 3WQBA 3GNEA 5HXVA 1FNZA 1OMIA 3D0SA 2VZTA 3WNOA 2TEPA 4QB6A 4B1MA 5FYMA 5JUVA 1NQJA 5KXEA 5C7GA 3OJBA 5FY9A 5LEKA 4XILA 2ERFA 2W92A 1JOBA 4HPKA 3OD0A 1S1AA 4X6QB 5D21A 1OA3A 4Q4W1 4AGGA 4E8DA 4MXVA 3CHXA 1AL21 1DGRN 1HIXA 3H7YA 1KFUL 4OVEA 5A6ZA 4FFFA 4QPWA 2XUEA 1ZX5A 3O5SA 3AX4A 1LGNA 2L9LA 3AKPA 4B4RA 5IK5A 3ES1A 3S5AA 4QPIB 5F6KA 3MIFA 2J1RA 2YPDA 4XCBA 3WCRA 2JICA 3GXUA 4HVQA 4CSWA 1S4CA 4I01A 5A1LA 2HWD1 1F8VA 4A3XA 3C7OA 3J7LA 1TEIA 4Q4X2 3RJ2X 3TNPB 3R4UA 4L9BA 4IEVA 1SMVA 3MW3A 4JRAA 2Z5WA 4CUAA 1GYKA 1WD4A 4XE9A 3MIDA 3SQOA 3VLBB 1AX0A 3AKTA 2NMOA 3FLRA 4PDWB 4XIKA 5EHDA 5ERLA 2NMNA 5C3QA 3AMPA 2D44A 3OTFA 2WA3A 1JXNA 2Q1MA 4O65A 4HKOA 1QJU2 1TQ5A 1SPPA 5FWEA 5IVEA 1COV3 4OQ8A 4KBBA 5KHKA 4TTGA 1O3SA 4S2FA 1W9TA 1DLLA 3I3QA 1WMEA 3K4ZA 1PVXA 2AACA 2ETEA 5I91A 1EV11 4LO5B 3AP5A 4COZA 1P8JA 2J22A 4XURA 4Y22B 1MVEA 4CP9B 1LOGA 2O14A 3MYXA 1D4M1 1W99A 4JX0A 1D0GA 4TLFA 4WM7A 2BEOA 3FFQA 1KQRA 4FTSA 5J1XA 1MZEA 1IG3A 1W05A 3H1MA 1UOBA 1ZZ6A 3HEIA 4MG2A 1RUC2 2XWJB 1FMD3 5K0UC 1OF4A 3LWCA 2PELA 3UV9A 3CJIA 3NRUA 3ROUA 1JHNA 3LAGA 3PURA 1FT9A 2HYXA 3VL8A 4A7YA 2WO3A 4CE8A 1WW4A 4CDUB 3LSEA 2HBTA 1WA6X 4HETA 1W2OA 2CAUA 1DZRA 3DL3A 2ZXQA 2A1XA 3OD4A 3NV2A 4D8MA 5ABJB 1F5FA 3N7LA 4XYXA 1AYM1 4AZZA 3PTRB 2HWF3 1YNAA 1Q5OA 2VCBA 3EMRA 3VBUA 4YVSB 1XQNA 4KWUA 2WZR3 5BYNA 2XWBB 3ZOIA 1U5YA 4KU8A 2WDBA 1NA1B 4NVPA 5FJHA 4YPJA 3RI9A 3VBSC 4MHUA 1IOAA 1X7NA 2A3XA 3NJZA 4E27A 1AR62 1ODNA 4QXBA 2ZGRA 1HW5A 2YMZA 3LA3A 4I0WB 2RDQA 3NV4A 3DXUA 3URFA 3SH4A 2C24A 4DMIA 5FPZA 1PVC3 1US3A 4EWEA 3NNFA 4RR3A 1QQP3 1PX3A 4XJZA 1Z0HA 3WG4A 4DRVA 4RL7A 4PT6A 2VNOA 1POV0 2IVJA 3IZOA 1QXJA 3BPZA 3UETA 5EFUA 3BYWA 4I30A 5ANQA 1CONA 1UIKA 1YEWA 3CJXA 2NLRA 1Q8VA 1UCXA 2PLV2 1OHFA 3O7OA 4RQPB 2WNOA 2XJUA 2A7AA 4PQQA 1ONAA 2R072 4J1WA 2QQNA 3CO2A 3VZLA 3WQ7A 4JDMA 3NO8A 5AC91 4FPLA 3S30A 3QACA 4QWNA 1K5MB 2Q5TA 3MV01 2RV9A 1OFSA 2ZABA 2LW8A 4HKLA 3ZDSA 3GBWA 1W8ZA 4ZHNA 4XBLA 3GYDA 1H8TB 2JE9A 3B7MA 5JXJA 1EUTA 1G9FA 4KH9A 4NR1A 1S2BA 2QNKA 3P3PA 3UGFA 1GMMA 4EWDA 2Y6HA 2W95A 3RQ0A 3SEPA 5KR7A 5KWRA 4AEDA 2ZX4A 1W6MB 1YWKA 1W6PB 1VBD1 4BIOA 3WDYA 4Y5SA 3P5BA 2Y6LA 4YVSC 4AI0A 4YM2A 5HPOA 1CAWB 5A7PA 4Q0SA 2OQ7A 3PU8A 3AC0A 4YARA 3VBOA 2UY9A 1NE6A 3ON7A 1GR3A 4AVCA 4CCEA 3KF3A 1QJU3 3AXEA 4EV0A 1GZWB 4FPGA 2ZKLA 5IJRA 2ZKNA 4Q4V2 3I49A 1NLSA 1C4RA 4SBVA 2ARCA 4PLNA 4IETA 1PMHX 5BNPC 1X9TA 5HI0A 3HT2A 5BNOA 2YFUA 3NV1A 2OIIA 4GH4C 5FOBB 2J7MA 5IUQA 4AFCA 5EJZB 2W0XA 3WHTA 4CDWA 4LXLA 1VBC1 4C1XA 1I5PA 3LE0A 2GMEA 3RGBA 1UYZA 4XF9A 1OLRA 5FZGA 3JB4C 1TMF3 5F2WA 3JQXA 5JOWA 5LCWL 2JDMA 5C9AA 4FOQA 1LHVA 1YQ6A 5ACA2 3ZFEC 2H6CA 5GZDA 5L9BA 4HVOA 4ZXKA 1GKBA 3MW4A 2PHXA 4Y4YA 4X6RB 4W4ZA 5E89A 4AEJA 5BNNA 2EVXA 4DS0A 4HONA 1Y9QA 3O1PA 1FOD1 1ZA4A 4K40A 3R6SA 3RMXA 1AYN2 2KA3A 3WG1A 3WT3A 3KT1A 1UQXA 4CXWA 1MS8A 4GXLA 4OZXA 4Y4RA 1O8PA 3W58A 1J1LA 5DDJ2 3LEKA 4Q0UA 1O7FA 1W8NA 2XB6C 1BEV3 4XF3A 3WINE 4URAA 4UAPA 1W2UA 4DB5A 4MGQA 2D5FA 5GLWA 3V0AB 3OOXA 1SDDB 4LIUA 1QKQA 4DOUA 2Y6JA 3USSA 3ZYHA 2R49A 4P02B 3ZFEB 1ASJ2 1D2QA 4TZDA 1URXA 2JJ6A 1CAXA 3HQRA 1YFYA 1TVGA 5A7SA 5FZ9A 5ACA3 4B4PA 3FJSA 2AGSA 5B4NA 4QHOA 1MS5A 3MDPA 4XJ9A 3PVOA 1KD7A 2RS32 5DQ0A 5BNOC 5L7OA 2BRTA 1HQWA 1POV3 3POWA 1CJDA 4KL1A 4XPVA 4BK4A 2QZ2A 3MV11 4AHXA 3WHUA 2RMU3 3PJYA 2MEV1 3OYWB 4CCJA 4IXLA 5BV6A 3SITA 4GWNA 4ASKA 4QU1A 4CYDA 3D5OA 5CKQA 1LOAA 3THDA 3AMHA 5FLJA 1E5IA 2QTWB 2XDVA 4OULA 3WF2A 1QOOA 2R062 4LO7A 3I54A 1G6NA 4CP0A 4W50A 2YY1A 4BQ4A 1NCRA 2Y60A 3H0OA 3GBFA 4WM8C 3MICA 3E5XA 4META 3D8CA 2XHKA 1BZWA 4FT8A 1ULDA 1PX4A 2CGOA 4YZ4A 5A80A 3T3YA 2C4XA 5FLHA 3VZMA 4JGYC 4PI0A 1C28A 4ES9A 1GANA 1PM4A
chains in the Genus database with same CATH topology
3ZPOA 2OQ7A 3PU8A 5FXWA 3KVAA 5FZ7A 3UYJA 4EYUA 2Q8CA 5CEHA 5F5IA 3K3NA 5FWEA 3AL6A 3DXTA 5FZCA 5E6HA 4D6QA 5IVEA 5FZKA 5A3NA 4BISA 4V2WA 3N9NA 3K3OA 5F3CA 5FYTA 3PUQA 2P5BA 5FZOA 2YU1A 5FZHA 5FY1A 5IW0A 4CCKA 2YBKA 4GAZA 3RVHA 5F3EA 5FY4A 4CCLA 5ISLA 4UF0B 5FZDA 3NJYA 4EZHA 4LXLA 4QXCA 2VD7A 5F39A 5FZEA 3N9OA 5LY1A 2OS2A 5FZGA 3KV4A 5LWBA 5F2WA 5FWJA 4CCOA 4DO0A 5FY5A 3KV9A 2WWUA 3PURA 5FJKA 5A7WB 5F2SA 1VRBA 5IVBA 5IVYA 5FPVA 5FZIA 3U78A 2Q8DA 5FPLA 5FBJA 3AVSA 4Y3OA 5A7NA 4CCNA 5IVJA 3LDBA 4TN7A 4HONA 5FY0A 4CUGA 5FXVA 4LIVA 4XDPA 3PTRB 5FZ6A 5FZFA 5LY2A 4C8DA 2OX0A 3KV6A 5FZ0A 4Y4RA 4QXHA 4V2VA 2GP3A 5FJHA 5FP8A 5FV3A 5A3PA 5FZ1A 4QXBA 5FPUA 4URAA 5A7QA 5FYSA 4GD4A 2YU2A 3DXUA 5FXZA 4GJYA 4LIUA 3U4SA 5FY7A 2WWJA 5FYMA 4EZ4A 5FUNA 5FP7A 2OT7A 2XMLA 5FPBA 4IGOA 5FY9A 2GP5A 4QX8A 5FP3A 5FYIA 5A7SA 3K2OA 3LD8A 5FZ9A 3AVRA 5FZ8A 4HOOA 5LW9A 3PDQA 3KV5A 3N9QA 4LITA 3OPTA 3N9LA 5FZ3A 5ANQA 3OPWA 4Y33A 2XUEA 5FYVA 5FZMA 2XXZA 3AL5A 4NUBA 4D6RA 5FP4A 3N9MA 5F3GA 2YBPA 4CCJA 2OQ6A 4QWNA 4CCMA 5IVCA 5FZOB 4E4HA 4QX7A 5FZAA 5FXXA 4GJZA 4IGQA 4BXFA 2YPDA 4ASKA 4AI9A 4QU1A 4CSWA 5A1LA 4IGPA 4XDOA 4BU2A 5F37A 5IWFA 2XDVA 5IVVA 2W2IA 5FYUA 5FYZA 3PU3A 5FPAA 4AAPA 3PUAA 5K4LA 5FYYA 5FP9A 5A7WA 5A7OA 5A3WA 5A1FA 5KR7A 5FZBA 5FYCA 5F5AA 5FY8A 4D6SA 5A3TA 3ZLIA 3N9PA 5FYBA 5IVFA 5FZLA 2PXJA 5FUPA 5A80A 3KVBA 4UF0A 5FYHA 3PUSA 5F5CA 5F3IA 4DIQA 5F32A 2Q8EA 5FZ4A 5A7PA 2YBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZPO A;  2OQ7 A;  3PU8 A;  5FXW A;  3KVA A;  5FZ7 A;  3UYJ A;  4EYU A;  2Q8C A;  5CEH A;  5F5I A;  3K3N A;  5FWE A;  3AL6 A;  3DXT A;  5FZC A;  5E6H A;  4D6Q A;  5IVE A;  5FZK A;  5A3N A;  4BIS A;  4V2W A;  3N9N A;  3K3O A;  5F3C A;  5FYT A;  3PUQ A;  2P5B A;  5FZO A;  2YU1 A;  5FZH A;  5FY1 A;  5IW0 A;  4CCK A;  2YBK A;  4GAZ A;  3RVH A;  5F3E A;  5FY4 A;  4CCL A;  5ISL A;  4UF0 B;  5FZD A;  3NJY A;  4EZH A;  4LXL A;  4QXC A;  2VD7 A;  5F39 A;  5FZE A;  3N9O A;  5LY1 A;  2OS2 A;  5FZG A;  3KV4 A;  5LWB A;  5F2W A;  5FWJ A;  4CCO A;  4DO0 A;  5FY5 A;  3KV9 A;  2WWU A;  3PUR A;  5FJK A;  5A7W B;  5F2S A;  1VRB A;  5IVB A;  5IVY A;  5FPV A;  5FZI A;  3U78 A;  2Q8D A;  5FPL A;  5FBJ A;  3AVS A;  4Y3O A;  5A7N A;  4CCN A;  5IVJ A;  3LDB A;  4TN7 A;  4HON A;  5FY0 A;  4CUG A;  5FXV A;  4LIV A;  4XDP A;  3PTR B;  5FZ6 A;  5FZF A;  5LY2 A;  4C8D A;  2OX0 A;  3KV6 A;  5FZ0 A;  4Y4R A;  4QXH A;  4V2V A;  2GP3 A;  5FJH A;  5FP8 A;  5FV3 A;  5A3P A;  5FZ1 A;  4QXB A;  5FPU A;  4URA A;  5A7Q A;  5FYS A;  4GD4 A;  2YU2 A;  3DXU A;  5FXZ A;  4GJY A;  4LIU A;  3U4S A;  5FY7 A;  2WWJ A;  5FYM A;  4EZ4 A;  5FUN A;  5FP7 A;  2OT7 A;  2XML A;  5FPB A;  4IGO A;  5FY9 A;  2GP5 A;  4QX8 A;  5FP3 A;  5FYI A;  5A7S A;  3K2O A;  3LD8 A;  5FZ9 A;  3AVR A;  5FZ8 A;  4HOO A;  5LW9 A;  3PDQ A;  3KV5 A;  3N9Q A;  4LIT A;  3OPT A;  3N9L A;  5FZ3 A;  5ANQ A;  3OPW A;  4Y33 A;  2XUE A;  5FYV A;  5FZM A;  2XXZ A;  3AL5 A;  4NUB A;  4D6R A;  5FP4 A;  3N9M A;  5F3G A;  2YBP A;  4CCJ A;  2OQ6 A;  4QWN A;  4CCM A;  5IVC A;  5FZO B;  4E4H A;  4QX7 A;  5FZA A;  5FXX A;  4GJZ A;  4IGQ A;  4BXF A;  2YPD A;  4ASK A;  4AI9 A;  4QU1 A;  4CSW A;  5A1L A;  4IGP A;  4XDO A;  4BU2 A;  5F37 A;  5IWF A;  2XDV A;  5IVV A;  2W2I A;  5FYU A;  5FYZ A;  3PU3 A;  5FPA A;  4AAP A;  3PUA A;  5K4L A;  5FYY A;  5FP9 A;  5A7W A;  5A7O A;  5A3W A;  5A1F A;  5KR7 A;  5FZB A;  5FYC A;  5F5A A;  5FY8 A;  4D6S A;  5A3T A;  3ZLI A;  3N9P A;  5FYB A;  5IVF A;  5FZL A;  2PXJ A;  5FUP A;  5A80 A;  3KVB A;  4UF0 A;  5FYH A;  3PUS A;  5F5C A;  5F3I A;  4DIQ A;  5F32 A;  2Q8E A;  5FZ4 A;  5A7P A;  2YBS A; 
#chains in the Genus database with same CATH topology
 5JXH A;  4EYU A;  2XPJ A;  5JSP A;  4QPG A;  4LQR A;  2H0B A;  2GAL A;  1SPP B;  2VZO A;  1I3H A;  4RS5 A;  5FK8 A;  5C8C B;  2HWB 3;  3NL1 A;  1RUC 1;  1RVF 3;  1VAM A;  2VTF A;  3E6D A;  1NYW A;  1UN1 A;  3BI3 A;  2DVG A;  2KXL A;  5IHR A;  3C7H A;  4PLM A;  4KNC A;  1W6Q B;  1AR7 3;  3K3O A;  1AX2 A;  4GAL A;  4HG6 B;  5FYT A;  3DGT A;  4QDR A;  1PK6 B;  3FBM A;  1L7R A;  1DIW A;  1VBD 2;  1QIQ A;  1O91 A;  3BGA A;  5FY1 A;  3LIH A;  1LHU A;  1JMU B;  5E16 A;  4YW6 A;  2WNU B;  5D8A B;  4CCL A;  1RUJ 1;  1VE0 A;  2VAU A;  2JDH A;  1VBE 1;  3NJY A;  4LBJ A;  3U37 A;  1G7Y A;  1IKQ A;  3CJI C;  4E8C A;  4JGZ C;  5C3P A;  2WSV A;  2DVB A;  2XJR A;  3K51 A;  4A3Z A;  4V1P A;  2J1U A;  2BWC A;  3ZFF B;  3MBW A;  2Y6G A;  1DYO A;  4MV2 A;  3H8R A;  3WQ0 A;  1BHG A;  1VRB A;  5I0R A;  5J37 A;  4LK7 A;  5FPV A;  4AI8 A;  5JLV A;  1ZZ9 A;  1C57 A;  4CDU A;  2WSU A;  1LNS A;  3B3Q E;  1Y4W A;  2WO1 A;  3FUQ A;  4Y20 B;  2VUA A;  4LIV A;  5KC6 A;  1YJL A;  5FZ6 A;  5LBB A;  2YYO A;  1X82 A;  3ZIW A;  4NHX A;  2WNV C;  3AZZ A;  1LJ7 A;  4IE0 A;  4LBL A;  1H2M A;  1CX1 A;  4XAC A;  4AHY A;  3LOB A;  2EID A;  5ACA 1;  3OUJ A;  5DUX A;  2AEZ A;  2RM2 1;  3ZIX A;  5C6C A;  1SFP A;  2R16 A;  4BHP A;  1Y7B A;  3VD4 A;  1ZRF A;  5L19 A;  3ACL A;  2OZ6 A;  2PFW A;  1JYX A;  2UY8 A;  1A78 A;  1LOC A;  1GU3 A;  2D5H A;  3GJA A;  3POS A;  5FPB A;  1XU2 A;  4XFG A;  2PN5 A;  4HPK B;  3M70 A;  2OZJ A;  3J8F 3;  1XNA A;  1JOP A;  4NWW A;  2JIJ A;  5FZ3 A;  5LBE A;  5JOZ A;  4UWD A;  2N7G A;  5EPA A;  1IPS A;  2XL7 A;  1R1A 1;  2VL4 A;  3AXD A;  3M3C A;  1W6N B;  3FLT A;  3MHZ A;  1WW7 A;  3PJQ A;  2XBO 1;  1UY0 A;  1HXS 3;  2ARX A;  4NE9 A;  4D6R A;  4AI3 A;  3GDB A;  4ARX A;  3BTX A;  3MFA A;  1WBF A;  2BYV E;  4HXC A;  4MGT A;  1JUI A;  1W9Y A;  2QJV A;  4JKM A;  2XLF A;  4LK6 A;  5K7P A;  2KM2 A;  2YV8 A;  1BXH A;  5T50 A;  4U2A A;  4LKD A;  3IB3 A;  4XJ8 A;  1ULG A;  2PQQ A;  4AEK A;  3QCW A;  1JZ5 A;  1WA4 A;  1UD1 A;  4NPM A;  3JCI A;  2QKD A;  5FYU A;  2QE3 A;  3HMY A;  4W6X A;  3RDI A;  4LKS A;  4Q1P A;  1I5Z A;  4M4R A;  2ZMN A;  4AQ2 A;  2KD7 A;  5GZC A;  1REF A;  2FHR A;  3H1W A;  2WNV A;  1PNF A;  2DDU A;  5J3U A;  5IT6 A;  1OA2 A;  1QMJ A;  1OOP C;  3H7J A;  4ZKT B;  3POB A;  3VUO A;  3IDC B;  2OW4 A;  4FCA A;  3D82 A;  1UXX X;  1ND2 A;  3TN9 1;  3VKO A;  5H9R A;  1VMH A;  1W8F A;  4BZ4 A;  4YVS A;  3NNG A;  2QQJ A;  5FO7 B;  3PVE A;  5FMC A;  2GMM A;  3JUU A;  1NCQ B;  2ZX3 A;  2B46 X;  2ZX1 A;  1JYT A;  4AR2 A;  3C8X A;  1NY7 1;  3IN9 A;  1ULP A;  1UKG A;  4KG8 A;  4Z07 A;  4LT5 A;  2VCC A;  1RUH 1;  1PGW 2;  2QZ3 A;  1H6Y A;  1QU0 A;  2NN8 A;  3AKS A;  5FCC A;  5EQU A;  3V0A A;  1H8T C;  3K48 A;  4RR3 B;  5CYY A;  2JD9 A;  3WQ1 A;  1XC6 A;  3WW3 A;  4W8J A;  2IZW A;  1NLR A;  4R9A A;  4B7K A;  2VJX A;  1CIW A;  4XQW A;  2JG8 B;  1VBA 2;  2B7Y A;  2ID4 A;  1EYB A;  3DPR C;  4IDZ A;  4BPZ A;  4CTE A;  3KF5 A;  2FMY A;  2PHD A;  1J3Q A;  4UW3 A;  1RMU 2;  5CFC C;  3T0B A;  2A3W A;  2EXI A;  2VG9 A;  3KV9 A;  4YW7 A;  3KCC A;  4OUS A;  3WDT A;  4IV3 A;  4UW6 A;  1UOJ A;  3V65 A;  4EWA A;  4IQP A;  5GLU A;  5K8S A;  3VBR C;  4A41 A;  1DGW A;  1WCD J;  3RS6 A;  4BB3 A;  2ZGT A;  3WF1 A;  5BNN B;  3ZFE A;  2D40 A;  1RUJ 2;  3VZN A;  5FXV A;  3A7Q A;  3OGR A;  1PO2 1;  4QKF A;  3CKH A;  5LEJ A;  2FDH A;  1O4Z A;  2B4K A;  3OGJ A;  4JC1 A;  4HK9 A;  5CG8 A;  1ENS A;  4F8A A;  2C1F A;  2IXK A;  3AP7 A;  3MF9 A;  1NG0 A;  4M3C E;  2CHH A;  2XQR A;  4UYB A;  3VBF B;  4AFA A;  1SCS A;  2ZS6 B;  1LOF A;  1Z7S 2;  5T55 A;  1JZ4 A;  4FFH A;  1EAH 3;  2JEC A;  1H1M A;  5LA2 A;  1W2N A;  5CG9 A;  4UXA A;  1LGC A;  4CA9 A;  3ZKY A;  1UX6 A;  2SLI A;  3SH5 A;  2XJS A;  2CDO A;  3TOJ A;  4CDX C;  4AGR A;  1QJX 2;  4KWJ A;  4N53 A;  1OC1 A;  3W5M A;  4LHN A;  2OT7 A;  3ZFG C;  5GAL A;  3WSO A;  1S0C A;  2GP5 A;  3AYD A;  1GV9 A;  2UWB A;  4XET A;  1RL3 A;  4A4A A;  2WBK A;  1O5L A;  1GOF A;  4LOR A;  3OPT A;  4RHV 3;  2RS3 1;  3CU7 A;  3N9L A;  4OQ9 A;  3VB9 A;  1HN1 A;  4AQS A;  1A8D A;  1UY4 A;  2G9F A;  1E5H A;  4DEQ A;  5BUV A;  2FDK A;  2JKX A;  1BBT 1;  1VIW B;  5CFD B;  3H8O A;  3A4U A;  3AYC A;  4MGI E;  2P3Y A;  1W3V A;  4BME A;  1MVQ A;  3ZMN A;  4AYU A;  4M0H A;  1W8T A;  2G1M A;  4XFF A;  4Q2F A;  2EIC A;  2OQ6 A;  3TNQ A;  2A6W A;  4Q27 A;  2ZBJ A;  4QM9 A;  3AYE A;  1HJG A;  3VBH C;  3ZSL A;  3PL0 A;  2WQ4 A;  2GMP A;  2YXS A;  1G86 A;  4DZG A;  5JR7 B;  4E2S A;  3EJK A;  3Q8C A;  2MHF A;  4ZY9 A;  2AR6 A;  1RIR A;  1ZZC A;  2GH2 A;  5IVV A;  1YCI A;  4Q26 A;  4Y5T A;  1I1E A;  4WZC A;  4AAP A;  4Z82 A;  3S57 A;  2F4L A;  5DUV A;  1VAV A;  1PO1 1;  1GNH A;  1Q8S A;  4NII A;  4XTM A;  4AFM A;  4R4Z A;  2WO7 A;  1IS3 A;  5A3T A;  1HRV 2;  1DQ6 A;  3ZLI A;  4ZZ8 A;  2IXL A;  4XF1 A;  4A6O A;  2R04 3;  4NJ4 A;  2PXJ A;  3T1M A;  1ULO A;  3FHA A;  4UF0 A;  2YZ4 A;  4P5Y A;  4O61 A;  1NAE A;  1CAW A;  1W06 A;  3KT7 A;  4LBQ D;  2YBS A;  3WW2 A;  4CU6 A;  1Y3T A;  2HWC 2;  2E63 A;  2WJS A;  3ETP A;  2FZ2 A;  2GC1 A;  2VBB A;  2VCA A;  1AF9 A;  5BNN C;  3CIH A;  1EV1 3;  2VY0 A;  5I0T A;  2BV4 A;  3SCG A;  1XBF A;  3WG3 A;  2ATF A;  5CKM A;  1NLQ A;  3IMN A;  2EA7 A;  2NM1 A;  3AMQ A;  1N3Q A;  4Q0Q A;  2QVS B;  4YM0 A;  5FK7 A;  5ABJ C;  3WDV A;  5FOJ B;  1DFQ A;  1LEC A;  4YGC A;  4NRQ A;  2WYF A;  5IW0 A;  4CCK A;  4OYU A;  2YBK A;  3TN9 2;  1VBA 3;  1CX4 A;  5B2G B;  5FDB A;  1O3R A;  3E97 A;  4W6W A;  4ZPI A;  4QGM A;  4XUT A;  2DVA A;  2VD7 A;  2DVF A;  3EYP A;  4OFG A;  4UW4 A;  3OBZ A;  2B9V A;  2J1E A;  1U5X A;  2HEW F;  4DUW A;  4YNI A;  3R4D B;  5LWB A;  2W91 A;  2PYT A;  4LUM A;  3MO4 A;  2ZGU A;  1NZI A;  2BNO A;  2Z42 A;  3FLP A;  1IHM A;  3KD4 A;  3GZT B;  1DQ5 A;  5HCF A;  1UXZ A;  2D98 A;  2Q8D A;  4AVS A;  2HWD 3;  1W0P A;  2LUW A;  4I09 A;  1H4G A;  1IG0 A;  1H2K A;  1AJO A;  3AMM A;  5DUU A;  3WOG A;  5IVJ A;  2BNM A;  3LDB A;  5GKA C;  2RE9 A;  2XVK A;  3I2I A;  4BA6 A;  4TSV A;  4PJY A;  1G9D A;  3OUI A;  1LU2 A;  4KU7 A;  4M0N A;  2VW1 A;  2HWE 2;  4HBN A;  4COV A;  3CZU A;  2WLP A;  1CPM A;  1MZ5 A;  1AL2 3;  5FV3 A;  4HLT A;  1K42 A;  4Q4W 3;  3LDK A;  5HCB A;  3ZSM A;  2ET1 A;  3O0W A;  5BNQ A;  2XBO 2;  5FYS A;  2PHU A;  4JRL A;  2OPK A;  4AAX A;  3CEW A;  4E2G A;  4IL7 A;  1SLB A;  3BIE A;  2GSY A;  5JMO A;  2WZE A;  2IWG B;  1NCR C;  1SQ4 A;  4QX1 A;  4RGA A;  4CP1 A;  1W8U A;  2VOK A;  4XZU G;  2G9G A;  1RB8 G;  5EJ1 B;  4QDS A;  1QNW A;  4HK8 A;  4ZU4 A;  1OQ1 A;  3IPV A;  3PUH A;  3DN7 A;  4IEP A;  4NPL A;  3U4X A;  3O0V A;  4AED C;  1UYX A;  3V64 A;  4AVV A;  4HN1 A;  1BMV 2;  1CZS A;  4P5H A;  4KMQ A;  4JZR A;  4B3N A;  3I2G A;  4XAA A;  4A6S A;  2XVL A;  3KMH A;  5IVC A;  4QPI A;  2CSG A;  3ASI A;  1UZY A;  1KGY A;  4ORF A;  3Q8F A;  4YZ1 A;  2A6Y A;  1G9C A;  1ULC A;  1SDW A;  2RS5 1;  4FFG A;  4P9L A;  2VMC A;  5FBZ A;  1SBF A;  4HSL A;  4GB3 2;  3Q8B A;  5BNP B;  5JI9 A;  2W1S A;  5FPA A;  1E5S A;  3OY8 B;  5SV5 A;  4YFZ A;  1BBT 2;  4MUV A;  5C4W C;  4XAB A;  4F3J A;  2HLE A;  1GQP A;  2VZU A;  4GH4 A;  1VBB 1;  1OUR A;  3I4I A;  4AL9 A;  1Q8P A;  5AC9 2;  3F2Z A;  4N53 B;  1QJX 3;  2ZX0 A;  2IUW A;  4ATF A;  5J48 A;  2VUL A;  2W52 A;  1WW5 A;  3GCX A;  4IER A;  4ISQ A;  2WO2 A;  3KVA A;  1BKZ A;  1V6I A;  4DIN B;  1FPN 2;  1T2X A;  1ND3 C;  1WW6 A;  2VMH A;  4XEZ A;  2VCM A;  1HQL A;  2X05 A;  3VBF A;  5CNA A;  1XNB A;  4LKF A;  1RUI 1;  4CPB A;  4QKD A;  1F35 A;  2JDP A;  1IGO A;  3GZE A;  1L7L A;  1Z78 A;  2W3J A;  1V9U 1;  2QQO A;  1RUO A;  1CAU A;  4RGG A;  3UES A;  3ZYF A;  4SLI A;  2PAK A;  1BQP A;  2FBE A;  4NO4 A;  5GLT A;  4H3W A;  5CFD C;  1ZBE 2;  2Z2S B;  1RUD 1;  1IQD C;  5F39 A;  2BOJ A;  4DUX A;  2OVU A;  1E57 A;  1POQ A;  2JG9 B;  1XSR A;  3UKV A;  3DYM A;  1S0G A;  2RS1 3;  3DPR A;  4O9G A;  1FMD 2;  2DUQ A;  3N36 A;  4LEJ A;  2X09 A;  1CJP A;  4IEW A;  2VZ3 A;  2WRA A;  5C3S A;  2MPF A;  3NKG A;  2TBV A;  1W6Q A;  2VQU A;  2ZPX A;  4UFH A;  1OD5 A;  3RNS A;  1GZC A;  4MLO A;  2PHF A;  2DFC A;  2BFU S;  1MS3 A;  3CNA A;  4LA3 A;  4R9C A;  5KXC A;  1FPN 3;  4LBN A;  3HIF A;  1PO2 2;  4K6B A;  5FTT C;  2R1D A;  3VBR A;  4O7X A;  4CCD A;  2RJL A;  4XF4 A;  3WW1 A;  3X29 B;  1ZRC A;  3D4K A;  5KBF A;  1G8W A;  4JKK A;  1FNY A;  1I6X A;  1WKY A;  3LEM A;  3SEE A;  4R9D A;  4C1W A;  1AXZ A;  1U0A A;  2VMI A;  3GM8 A;  4ZU7 A;  3RWN A;  4YZ2 A;  5C9A C;  3IKW A;  5CIS A;  2VMF A;  3LIG A;  4LKE A;  4QQ2 A;  2YPJ A;  1W9F A;  2XOM A;  1CAU B;  3G7D A;  5C3R A;  5LZ6 A;  1DZQ A;  1HB4 A;  3KGL A;  3POJ A;  3BOW A;  2VW2 A;  3GHN A;  4XUN A;  4D0Q A;  2BP6 A;  2A70 A;  1BJQ A;  3ZXK A;  2JG9 A;  1S0E A;  1UL9 A;  3BPS A;  3IDE A;  1NCQ A;  2JG8 C;  3DPR B;  3CLP A;  5HBA A;  4RQP A;  4AHW A;  4I3P A;  1IKP A;  1PZ9 A;  1FX5 A;  2V72 A;  4OHX A;  4PIZ A;  5FYV A;  1ZM1 A;  3VBU C;  2R07 1;  1YUD A;  5FP4 A;  5LA1 A;  1EAH 1;  2JKB A;  5HV4 A;  1RVF 2;  1VB4 A;  5DDJ 3;  4GJZ A;  5FUI A;  1OBN A;  1JU4 A;  4RN5 A;  3A21 A;  3T09 A;  4I0A A;  5F8P A;  4YZ5 A;  1ZVF A;  2Q8O A;  4IE7 A;  4YZ3 A;  3UGG A;  4BU2 A;  1EUU A;  3ACG A;  4JKL A;  4CDQ C;  2P17 A;  1RMU 3;  1QDC A;  3PU3 A;  1AL0 G;  2D6M A;  2H6B A;  3PUA A;  4Y1X A;  5CBL A;  4FOV A;  3N4M A;  3ALQ A;  2DU0 A;  1UMH A;  5A1F A;  4IEX A;  4F83 A;  4N90 A;  1MS4 A;  5FZB A;  4YW3 A;  3T4H B;  5L7O C;  3JZV A;  4Q4V 1;  3ZYR A;  5LRS A;  2K9Z A;  1C3H A;  2R30 A;  4GZ9 A;  5FYB A;  4E4Z A;  2FDI A;  5J7M A;  3DF0 A;  1U5I A;  1XYP A;  4MXW A;  3GF6 A;  5JZG B;  2V73 A;  2NYY A;  1PGL 1;  1WBL A;  1N3O A;  2DWR A;  5FXW A;  3FUO A;  5CEH A;  2VQT A;  1GQH A;  4P9X A;  1APN A;  1AUY A;  3JXS A;  3WP6 A;  3POE A;  4PDW C;  3V56 A;  3W9A A;  4BQW A;  4ZS3 A;  4BIS A;  4AXO A;  5K9Y A;  5IAX A;  2LRP A;  3ZSJ A;  1GZ9 A;  4MGK E;  4PI2 A;  4WZF A;  3H1Y A;  3H3L A;  1UYP A;  3HT1 A;  2WN2 A;  2GZW A;  4Y22 A;  4YG0 A;  1V6K A;  1PIV 2;  2MNG A;  3KS7 A;  3C7F A;  4CDQ B;  1VBB 2;  4HZF A;  4BLI A;  3HVD A;  3Q9O A;  1ZYB A;  1RHI 3;  2WC2 A;  3VDC A;  3RVH A;  1BCX A;  1CPN A;  4WVZ A;  2W46 A;  5FY4 A;  3O1R A;  3NAP A;  4ONU A;  2JDA A;  3WUD A;  1UOF A;  2C0Z A;  3VL9 A;  3T4V A;  3O1O A;  3E6C C;  2W5F A;  4GB3 1;  4Y1U A;  3CDZ B;  1AR8 3;  2DCK A;  2A6X A;  4LLO A;  3SXW A;  2YRO A;  4NHY A;  5JPM B;  2WFF 1;  2FD8 A;  1UY2 A;  2OYZ A;  4PLO A;  2E7A A;  5CAD A;  4IEU A;  1QJY 2;  1CAV B;  2WAA A;  1X50 A;  4ZON A;  3L2Y A;  1GUI A;  1JUH A;  2WUH A;  5A7N A;  1DGR A;  3O14 A;  4YW4 A;  4QT6 A;  1S2E A;  1FAT A;  5JPN B;  2Y0I A;  1ASJ 1;  1WLD A;  4KGG A;  1KDM A;  1AYN 1;  2ZJC A;  4N7I A;  5LY2 A;  2LS6 A;  2O8O A;  4I02 A;  4XOG A;  2VZQ A;  4BH9 A;  5C5T A;  1ZBA 3;  3TEZ A;  1YJK A;  3VD3 A;  3H3U A;  5DMY A;  1NKG A;  4OMD A;  3VBH A;  2F4P A;  2WN3 A;  2K46 A;  5FP8 A;  1ZZB A;  3S6P A;  4BQ5 A;  5L36 A;  2A6V A;  2WKK A;  2BVV A;  2V4V A;  3NST A;  3LA2 A;  1BMV 1;  4H55 A;  1Q3E A;  3H9A A;  2WS9 3;  5GZF A;  1HXS 1;  4W6Y A;  3ACH A;  3LQC A;  3W59 A;  1N1T A;  2A5Z A;  4BCU A;  2EAA A;  5I0D A;  1R1A 3;  2BW8 A;  3CZJ A;  5FO8 B;  3ZYG A;  2AZ5 A;  4PQ9 A;  4PDW A;  5T5L A;  2WAO A;  3MLJ A;  3J8F 1;  1NQD A;  2CAV A;  3U10 A;  4I2O A;  3SHR A;  2WLQ A;  1MEC 3;  1PM7 A;  3OBR A;  4ITC A;  3O1M A;  1YRZ A;  2FZ1 A;  4LIT A;  4PIX A;  5FRE A;  4JGZ B;  4XF0 A;  1RC6 A;  5JVV A;  3RI8 A;  4QM8 A;  3GJB A;  2GC0 A;  3HBZ A;  4WV8 A;  2BGC A;  2RM2 3;  2XXZ A;  5F5Q A;  1B09 A;  1VRH 2;  3B69 A;  5EJ3 A;  4NUB A;  1OUS A;  1C8M 3;  1YI9 A;  2ZEW A;  4UBG A;  2D6N A;  2DCY A;  2OA2 A;  1R09 1;  4RHV 2;  4Z8B A;  1XND A;  1DU3 D;  3ELN A;  4P9W A;  2YC4 A;  2VBD A;  4G3Y C;  1DBN A;  5FXX A;  5TSW A;  1BK0 A;  3BCW A;  3L2H A;  2VC9 A;  3B01 A;  1UYY A;  4FTB A;  4IEZ A;  5F9T A;  4IGP A;  4HMZ A;  4A44 A;  3POF A;  2UU8 A;  1JBC A;  3HPN A;  3NV3 A;  2IC1 A;  4OMC A;  5IWF A;  1LAJ A;  4XBN A;  3I2H A;  3S7I A;  4FPK A;  1YFX A;  2ZAH A;  1KFX L;  2R06 1;  3EXU A;  4FP3 A;  3VV1 A;  1H9P A;  3RG0 A;  4AI1 A;  1TE1 B;  3OY8 A;  3FHI B;  5A7O A;  3PTY A;  3HAG A;  4LNV A;  4CDX B;  3JQW A;  5F5A A;  1J84 A;  1VR3 A;  3LEG A;  3I3D A;  3N9P A;  2RR1 1;  4M3C A;  2VOV A;  3IT8 A;  4LBO A;  3VBO C;  3WF3 A;  4ES8 A;  2ZHN A;  3MFC A;  1W8H A;  5F5C A;  3S0M A;  2C9K A;  3I2J A;  5F3I A;  5EZW A;  2HWF 2;  1W3X A;  3KWV A;  3DCQ A;  3IBM A;  4PF5 A;  1C8N A;  1VBE 3;  2FCU A;  2Q8C A;  2O0O A;  1CES A;  1RUJ 3;  2VH9 A;  4FBF A;  3OBT A;  2D43 A;  1GWL A;  4IV3 C;  4EN9 B;  1CWP A;  3LFM A;  3ZO0 B;  5A6Y A;  2PAE A;  2CGP A;  4XCA A;  3IMM A;  1F5J A;  1AR7 1;  2VTX J;  2CTV A;  5K0U B;  1W9W A;  3PIG A;  1IS6 A;  4I3G A;  4FPY A;  4EN7 B;  3HOB A;  3I2F A;  4D69 A;  4COW A;  4NIH A;  4M4P A;  3LKJ A;  3ACF A;  4IEY A;  1CZV A;  5CA6 A;  2B8M A;  2W68 A;  2QDR A;  4UF0 B;  3U14 A;  1BVP 1;  1MR5 A;  1LEM A;  4BMB A;  5CFC B;  5FMB A;  3V0B B;  4FPH A;  3BKZ A;  3WLU A;  2YC2 A;  1YHF A;  4Q4X 1;  1LHN A;  3USU B;  3WP3 A;  3I2D A;  3BOD A;  2Z4F A;  2ZMK A;  2R06 3;  1OD3 A;  3AZX A;  5A7W B;  4WVM B;  5F2S A;  2ZGS A;  1W6M A;  1W9S A;  3J7M A;  2PA7 A;  4CDX A;  2XLG A;  1BK1 A;  4D7T A;  5FQ0 A;  4QPG C;  4JCK A;  3HD8 B;  5C8C C;  4XFC A;  5JI7 A;  4YRD A;  4PBO A;  2JEM A;  5C33 A;  1A3K A;  4KI5 M;  3VGI A;  2PHR A;  2D97 A;  1RIN A;  5FLI A;  4XAE A;  5LAT A;  1JYI A;  1PGL 2;  2GND A;  2W1Q A;  2ZGP A;  3RFR A;  3RPQ A;  2ZHK A;  3BTZ A;  4L11 A;  5A33 A;  4YVW C;  4CDW B;  1IZ3 A;  4AWD A;  2HYK A;  2GP3 A;  4K9S A;  3D6E A;  4AOC A;  4D94 A;  5KXB A;  4HVR A;  2I2S A;  3WNX A;  2P3K A;  3ZSK A;  4HSJ A;  5CZK A;  1JH5 A;  3IM0 A;  5CAZ A;  4HAN A;  1WGP A;  5L9V A;  2E32 A;  5KHG A;  1MEC 1;  3J7H A;  2ZOE B;  4UT5 A;  2Y0O A;  4AFD A;  4XC9 A;  3ATG A;  3VZO A;  1H30 A;  3M1H A;  1QJF A;  1GLH A;  2WNU A;  5D8A A;  3BOP A;  2J1S A;  3C7G A;  1GWK A;  4NAM A;  4LOT A;  4NRO A;  2X5I C;  5JWP A;  2DUP A;  2HEY F;  2ZGN A;  4X8P A;  1ZBA 2;  1ZZ8 A;  1YQ8 A;  2ZGO A;  1HX6 A;  2IXC A;  5I93 A;  1OKO A;  3DV8 A;  1HDK A;  1HXS 2;  1S0B A;  2VU9 A;  2VXJ A;  2XR4 A;  3GAL A;  4XHB A;  4YVW A;  4FSJ A;  4IV1 B;  4BK5 A;  4ASL A;  4QGN A;  2C6S A;  5JMC A;  1HLC A;  2O8Q A;  4B1L A;  1UU6 A;  2UYA A;  4MSV A;  1AYN 3;  4PIY A;  1YXW A;  3KT4 A;  4E2Q A;  1SLI A;  3J8F 2;  2R0F A;  4ET7 A;  1S0D A;  4MH0 E;  2EXK A;  2X5I B;  2WNE A;  2P34 A;  4JVA A;  1JYN A;  3III A;  4MGZ E;  1Q43 A;  1AR8 2;  1GNY A;  1RXG A;  3TAY A;  3ZYP A;  5DZF A;  2QQV A;  3SIS A;  2QQP A;  5BNP A;  1CAX B;  5FMO S;  3ZX7 A;  3LFI A;  5EYX A;  3AZW A;  1FOD 3;  1K12 A;  4XQ4 A;  1YC6 1;  2ZAC A;  4MAD A;  1NCR B;  4D3W A;  4GB3 3;  2W47 A;  4ZZ5 A;  4P9I A;  1RXF A;  2J1V A;  1OSG A;  1QJZ A;  4Z1V A;  3KGZ A;  3OBA A;  5FIX A;  2JE7 A;  4GQ7 A;  5JR2 A;  1J3P A;  3IAP A;  1TMF 1;  1VP6 A;  2HWD 2;  3PUS A;  2QCS B;  3MLK A;  2Q8E A;  4Q4X 3;  4Q0V A;  3VKL A;  3GHM A;  2R32 A;  4XXP A;  2X29 A;  3DEC A;  1MQT C;  3LCP A;  3K3N A;  1AR6 3;  5F5I A;  2DCZ A;  4O9E A;  1X36 A;  4E9K A;  5A6X A;  1W0N A;  4QX0 A;  2BPA 2;  1NA1 A;  2XHN A;  3DYO A;  4FPE A;  4XMA A;  1Q56 A;  4M01 A;  1LED A;  1PGW 1;  4Q8K A;  4L99 A;  4RFT 0;  3CF6 E;  4QAW A;  2ET7 A;  4FPJ A;  4NAO A;  1DQ1 A;  3HBK A;  1R09 2;  3VD7 A;  3GZU C;  3WVJ A;  1JZ8 A;  2LRO A;  3P1I A;  2BU9 A;  4CEW A;  5F3E A;  2CL2 A;  5ISL A;  1M06 G;  4N8M A;  4A45 A;  4ASM B;  2JX9 A;  5LBF A;  2QQW A;  3VBH B;  3ETQ A;  1RUF 2;  1LEN A;  4K8R B;  3UKN A;  5DAP A;  4JGZ A;  4TWT A;  3WR0 A;  2WWU A;  5T54 A;  1BLZ A;  2VZ1 A;  4Y1Z A;  1G9B A;  3ZM8 A;  5A70 A;  1EPZ A;  1ENR A;  1ENX A;  4A42 A;  5F7U A;  1RTV A;  5FPL A;  5FBJ A;  3BTA A;  1S2K A;  1UPI A;  5KHH A;  3HNY M;  1T6G C;  5FY0 A;  1FXZ A;  2QQK A;  1QHD A;  1W8W A;  4QMA A;  1UZ0 A;  3TEY A;  2R07 3;  1A34 A;  2FDG A;  3GCW A;  3ZXD A;  2TUN A;  4GMP 3;  1LES A;  1UO9 A;  1V70 A;  3AJY A;  2DCT A;  2LM3 A;  1R09 3;  1SG3 A;  1DLC A;  1XNC A;  1PNG A;  1C8M 1;  2KR2 A;  4JGY B;  5FPU A;  1VRH 1;  2BUK A;  3UL2 A;  4GJY A;  2YGL A;  3ES4 A;  3J9S A;  3T2O A;  3WEZ A;  4WM7 B;  5FY7 A;  3MZH A;  3LPF A;  5LA9 A;  1B35 C;  1UWW A;  4DFS A;  3AFG A;  3P6B A;  1WWY A;  1T6B X;  4NHM A;  4CUC A;  3KQ4 B;  5DN2 A;  4OLL A;  2ORX A;  4GWI A;  1R08 1;  1STM A;  1W2T A;  3FHQ A;  3K2O A;  4J25 A;  5EWS A;  3VZJ A;  2RMU 2;  1DHK B;  2PLV 1;  3CJI B;  4FO9 A;  4WVM A;  3OPW A;  3BUC A;  2JB4 A;  4IUG A;  1PO1 2;  1W6N A;  3AK0 A;  5CB7 A;  4CEW C;  1V00 A;  5H9S A;  3TB0 A;  2JD4 A;  2EXJ A;  2CWM A;  4HT1 T;  5DUW A;  3N9M A;  4QKB A;  1SLL A;  4XFB A;  5K0U A;  3U1X A;  4AE2 A;  4L8Q A;  2VNG A;  1D7P M;  1QY4 A;  3VHN A;  4AI9 A;  1OVP A;  1ZBA 1;  2WS9 2;  4RR3 C;  1YO8 A;  3UKT A;  4EN8 B;  3WDX A;  3ZYI B;  4ISR A;  2HWF 1;  5F37 A;  4YSF A;  1AYM 3;  3HN3 A;  3NW4 A;  5BPX A;  3VD9 A;  1M4W A;  3I2K A;  4DPN A;  2HJI A;  1O8S A;  2VPV A;  4LR4 A;  2Y38 A;  5LRR A;  1HKD A;  1F31 A;  2DUR A;  3ZFG B;  4DXS A;  2K0G A;  3ZFF A;  1DQ0 A;  1TNF A;  2E53 A;  4L0P A;  5FY8 A;  5I8S A;  3VKN A;  1RUD 3;  1WD3 A;  1KXG A;  2RJ2 A;  1ND3 B;  4H7L A;  4IND A;  4KWL A;  1NXD 1;  1E5R A;  2QQU A;  1CGP A;  2HWB 2;  4M3C B;  5FUP A;  1AR8 1;  3KVB A;  3AMN A;  1YYN A;  3D3A A;  3HQU A;  4UFI A;  1JS9 A;  1OOP A;  1F4H A;  4GWM A;  3U75 A;  1HRI 2;  2DTY A;  3ILF A;  1RUI 3;  4CEY A;  3DXT A;  4JDN A;  5E6H A;  5FZK A;  1UX7 A;  5KHI A;  3OEA A;  3DKQ A;  1D4M 3;  2WIN B;  4FXG B;  5HCA A;  3N9N A;  1AVB A;  1K3I A;  3ITQ A;  5I8Y A;  3PNA A;  3U0Z A;  1H2N A;  4QHZ A;  4UFJ A;  3SC7 X;  3RWK X;  1GWM A;  4FTE A;  2YU1 A;  1DCS A;  1NX9 A;  4GMP 0;  4OI0 A;  2E31 A;  4LLF A;  5DAX A;  3FE5 A;  2ZZQ A;  1QJX 1;  3ZSE A;  4AQT A;  1O3T A;  4PF1 A;  4RSU A;  1A8M A;  2VO5 A;  1O3Q A;  1LOD A;  4IV1 C;  1VBB 3;  2QQM A;  2WQ8 A;  4FQ4 A;  3TWI A;  3VDA A;  1H8T A;  1J1T A;  3I7D A;  5FKC A;  4CZS A;  2WZP P;  1LR5 A;  1YI7 A;  2HWE 1;  4K1Y A;  1UMI A;  4Y1V A;  2DUO A;  4S2H A;  4ZXE A;  2XKP A;  5IVB A;  1RUG 2;  1PZ7 A;  3KCX A;  1CAV A;  2UUR A;  3IAQ A;  1QXP A;  4N9H A;  2AEY A;  4AQ6 A;  3T0D A;  1QXR A;  3AVS A;  2WFP A;  4YFW A;  3WNL A;  4CCN A;  3U07 A;  3WP5 A;  3W5N A;  4P14 A;  1D4V B;  5HXM A;  1OQE A;  2OKX A;  1UKR A;  2YB7 A;  1NCQ C;  3B94 A;  5A33 B;  2ES3 A;  4A2U A;  4YVW B;  2LTN A;  2VR4 A;  4CDW C;  1D2S A;  5DDJ 1;  1EY2 A;  1OLQ A;  3WW4 A;  1OVS A;  3E5U A;  4MGS A;  3T2Q A;  4AG4 A;  2E7Q A;  3QH6 A;  1JZ7 A;  2VNV A;  4DRR A;  2V09 A;  3S5Q A;  2X8K A;  1XYN A;  2BDR A;  5DG2 A;  3THP A;  2YU2 A;  5T5J A;  1QOT A;  2J1A A;  3ZXF A;  4HL0 A;  3U4S A;  1SEF A;  3HR9 A;  4QQO A;  3T0A A;  4NRP A;  2NZ9 A;  2HKX A;  2OXB A;  2XML A;  5IAV A;  2D6L X;  4RFR B;  5DAV A;  2X53 S;  2ZX2 A;  1HB3 A;  2RDS A;  4QB1 A;  2CDP A;  4QDQ A;  5AFE A;  4XQD A;  2EIB A;  4B29 A;  4DY5 A;  5A32 B;  5L9R A;  4LO6 B;  3MPP G;  2Z79 A;  2CNA A;  2DCJ A;  1XRU A;  4IV1 A;  3TRS B;  2XGX A;  4GH4 B;  4XFA A;  3UJQ A;  4ZS2 A;  2XJT A;  5JCT A;  1WCK A;  3AFK A;  5D1I A;  2A73 B;  2R1B A;  2R6Q A;  1JN2 P;  4XDQ A;  3JD7 3;  4P9G A;  5GLZ A;  4CCM A;  4DXT A;  4YW2 A;  2BBV A;  1LOB A;  2BFU L;  2W08 A;  4BQ2 A;  4F7Z A;  2VMD A;  2EIE A;  3I3E A;  3RRD A;  1H4H A;  5GM0 A;  4N7U A;  4Z2W A;  3E1F 1;  2WL1 A;  2EF6 A;  3P3N A;  2NQY A;  1OPM A;  1CD3 G;  5FYZ A;  4XUP A;  1FPN 1;  1ULF A;  5K4L A;  2VGD A;  5FP9 A;  1MAC A;  4XMI A;  5A3M A;  2V5Y A;  2RM2 2;  2FMD A;  3DUI A;  3PUI A;  5J98 B;  1IPK A;  2XJP A;  4D6S A;  3O1V A;  1HRI 3;  4EJR A;  3OPZ A;  2XLA A;  5I0S A;  1US2 A;  3KB5 A;  4LBQ A;  5FYH A;  4UFM A;  4DIQ A;  1ZBE 1;  3ZXJ A;  4LO4 B;  1OH3 A;  1W03 A;  4X8N A;  3ZPO A;  1NA1 C;  3VBS B;  4AEM A;  1RUD 2;  2DBI A;  1Q8O A;  1XE7 A;  1RUF 1;  3VZK A;  4QU2 A;  4DXZ A;  3ILR A;  4PCR A;  4V2W A;  2RS1 2;  3IIA A;  3RZZ A;  4JQR A;  3VDD A;  1R1A 2;  4FPC A;  1HRV 3;  1RUF 3;  2V5D A;  2DTW A;  2RG4 A;  3M3O A;  5EYY A;  4M00 A;  1C5H A;  1WMF A;  1IQA A;  1OT5 A;  2JG9 C;  3OYW A;  1ZBE 3;  2W1U A;  1VAL A;  4FOY A;  4QX3 A;  3WNN A;  4QB2 A;  4LO8 A;  4C90 A;  2AUY A;  5LK7 B;  1REE A;  2QDN A;  2R04 1;  4CEW B;  1HRI 1;  2O1Q A;  4RQP C;  5FMO L;  5FZD A;  5L73 A;  1HJF A;  2R0H A;  2E6V A;  3I8T A;  1PO1 3;  3N9O A;  4LUL A;  3ZXG A;  1JW6 A;  3OCP A;  4L97 A;  2YFZ A;  3UT0 A;  4XFI A;  1GQG A;  1CZT A;  2WNU C;  3OUH A;  5D8A C;  2ZGK A;  4BQ3 A;  4CPB D;  3HN1 A;  2IXH A;  4P00 B;  5FZI A;  4YWA A;  1ZRR A;  2JWP A;  2WT0 A;  3PVN A;  1OA4 A;  4Y3O A;  4K3U A;  5E8A A;  1ZZ7 A;  1HB1 A;  4ATE A;  1C1F A;  3RYK A;  2RHP A;  1CQ9 A;  1COV 2;  2ZZJ A;  2RS5 3;  1QEX A;  1AZD A;  3BN6 A;  3VBS A;  3I59 A;  1KRI A;  2ORZ A;  3LA7 A;  2PAM A;  2VTX A;  1BBT 3;  5FZ0 A;  1R64 A;  4JHZ A;  1ALY A;  3WF4 A;  1R08 2;  3HWJ A;  4CUB A;  2QQL A;  2RS3 3;  2UWC A;  4WVW A;  4LHL A;  3SLI A;  3VKM A;  1V6N A;  3KQR A;  2E26 A;  2B39 A;  4MVT A;  2VEC A;  1JOJ A;  1BYH A;  4OHV A;  1PK6 A;  1YQ2 A;  1RUE 2;  2D6O X;  1HV0 A;  1Z7S 3;  3LDR A;  2GC3 A;  2Y26 A;  5FUN A;  5FP7 A;  4OUM A;  4QQP A;  3AP4 A;  1KS4 A;  4QX8 A;  5FP3 A;  1ZRE A;  4Q29 A;  1GSL A;  1LTE A;  3LZZ A;  2RVA A;  2FCT A;  1H6X A;  1PMI A;  2Q1Z B;  4UFL A;  2G9Z A;  3C2U A;  4PHZ A;  5FZM A;  2ILM A;  4QPI C;  4BE3 A;  3POG A;  5F3G A;  1LHW A;  2DBN A;  4CP9 A;  3EBR A;  1XJA A;  5IFT A;  1QJY 3;  3B93 A;  1ND2 C;  3ZXE A;  3B5L B;  4FAG A;  3G6J B;  3ZPY A;  5DAW A;  1X33 A;  5BNO B;  3E6B A;  3ACI A;  4FP2 A;  2A75 A;  4XUQ A;  2FDJ A;  5F1R A;  1W6O B;  1YQ5 A;  4S2G A;  1K5J A;  1AHS A;  4U36 A;  2WAB A;  3MEP A;  1AR9 2;  4KQ7 A;  4COY A;  1QJE A;  2W2I A;  2ZEY A;  2XKO A;  3A0K A;  1MQT B;  3QLQ A;  5JDB A;  5DZE A;  4JTO A;  1SCR A;  3CL1 A;  5KC5 A;  3THC A;  2HWE 3;  5FYY A;  5BY5 A;  1QDO A;  1JZ2 A;  1FV3 A;  1MPX A;  5FKB A;  3HQX A;  5A3W A;  4H7M A;  2HEV F;  3ZN5 A;  1PIV 3;  3ZDV A;  1MZ6 A;  5T3N A;  5IK8 A;  1OQD A;  4MX3 A;  5IVF A;  3DYP A;  1ULE A;  4D7S A;  2D3S A;  3KHB A;  3S7E A;  1ODM A;  4HFS A;  4OHY A;  1MS9 A;  3ENR A;  3WNP A;  1O6U A;  2WR9 A;  5JZG A;  5IFP A;  3C3V A;  3MUY 1;  1KJR A;  5FZ7 A;  1OOP B;  3EB7 A;  2D3P A;  2ZAA A;  3H42 B;  3PVB B;  4B8E A;  4BXS V;  3ZKU A;  1U12 A;  5AFB A;  2WT2 A;  4LOS A;  1VBA 1;  2Y34 A;  2CU5 A;  1IS4 A;  5HCH A;  2ZGM A;  2Y8K A;  3VDB A;  1N1Y A;  2Y6F A;  4MZU A;  1SLC A;  5I8T A;  5JIU A;  3FC0 A;  4CU8 A;  3Q8E A;  4QPY A;  1J58 A;  4RYD A;  4EN6 B;  3U11 A;  4LUK A;  5F3C A;  1YQC A;  3BAL A;  4CXX A;  3TN9 3;  1RUG 1;  3PUQ A;  4GKY A;  4CDQ A;  4NIA A;  4Q4Y 3;  3ABZ A;  3PLQ A;  4BOW A;  5DG1 A;  3POY A;  4YM3 A;  1ZRD A;  4XJW A;  4EZH A;  1ST8 A;  4KGQ A;  4QXC A;  1K5M C;  3QH7 A;  4OZO A;  1W28 A;  1NY7 2;  2OS2 A;  5IAT A;  1LRH A;  1UF2 C;  3RZL A;  4Z2A A;  2EAL A;  4OCT A;  3FZ3 A;  3R4S A;  3U78 A;  1PGS A;  1YIF A;  2RR1 2;  4GKX A;  3VN4 A;  2R04 2;  1AJK A;  3MW2 A;  2YC0 A;  3Q8A A;  1WMX A;  3AP9 A;  2P6H A;  4RGK A;  4EE2 A;  1B35 B;  1GP6 A;  1UNB A;  5J96 B;  1GNZ A;  1S55 A;  2OX0 A;  2XBO 3;  5T5O A;  1HN0 A;  4C8D A;  2XJV A;  4DY3 A;  2GAU A;  4LA2 A;  4CXY A;  2XUM A;  3KV6 A;  1XE0 A;  2P6C A;  4Q4W 2;  2J42 A;  4UOJ A;  5HV0 A;  5L7O B;  3J4U H;  4HN0 A;  2PLV 3;  1H1I A;  2YGM A;  2VUD A;  5D2A A;  3RMY A;  2ZA9 A;  3WY6 A;  1R08 3;  2BGO A;  1W8O A;  3ZMO A;  5A7Q A;  1W2A X;  4JDO A;  1F2N A;  2I07 B;  1SAC A;  2G4I A;  5EXO A;  1W6P A;  3N7M A;  2GC2 A;  1GZT A;  4Q1R A;  2WII B;  3AKQ A;  2YDE A;  3OGS A;  2RDR A;  4J1X A;  4RHV 1;  4MOA A;  4DNY A;  2W39 A;  5DPN A;  5DXD A;  5ABJ A;  1OH4 A;  2JG8 A;  3SH3 A;  2Y64 A;  4LE3 A;  4BM8 A;  1VRH 3;  4XUO A;  3AVR A;  1V0A A;  2QFE A;  4CDU C;  3KV5 A;  3N9Q A;  3IDA A;  3WXP A;  1H1A A;  2QBX A;  4Y24 A;  2JDK A;  2D6K A;  2JB8 A;  4FVV A;  1RED A;  2ARA A;  5C8W A;  4N43 C;  2D93 A;  4GMP 1;  4XZP A;  4Y33 A;  4R9B A;  2OUH A;  5C70 A;  4Q0P A;  2IXI A;  1G9A A;  5A1A A;  2D6P A;  3SKV A;  2YBP A;  4L2N A;  4NRM A;  1PVC 2;  3BU7 A;  5FZA A;  4YGE A;  5B4X A;  4AVB A;  1F4A A;  1OLM E;  1WCS A;  1XXN A;  3T30 A;  1L7Q A;  1SFY A;  4BQX A;  1PO2 3;  1N1S A;  1PK6 C;  5APA A;  3FWE A;  3RZG A;  2D7F A;  3OSD A;  2A3Y A;  1GFF 2;  1DG6 A;  3EO6 A;  1KS5 A;  4WM8 A;  2VQA A;  1SBD A;  3WF0 A;  2VM9 A;  4CU9 A;  2WZ8 A;  5C9A B;  1LHO A;  1NXM A;  1EV1 2;  3JB8 A;  5DZG A;  3M3Q A;  4WM7 C;  5FYC A;  4N43 A;  3ZYB A;  1SFN A;  3WDW A;  1IPJ A;  2VVE A;  5T52 A;  1AR7 2;  5JAX A;  3LSD A;  3WV6 A;  1SZB A;  1NOV A;  4LE4 A;  3FN9 A;  4MXW B;  4QQL A;  3FL7 A;  4IE5 A;  5IVY A;  3RZJ A;  2PHL A;  3UYJ A;  4R52 A;  5G05 L;  2C5D A;  2ADD A;  4COU A;  3AL6 A;  4GA9 A;  2PHT A;  1ZNP A;  2ARB A;  4PBP A;  5FZC A;  4UFK A;  1GZW A;  2GNM A;  1FV2 A;  1QOS A;  1RUC 3;  2UYB A;  3MGU A;  2HH9 A;  2DVD A;  3TYJ A;  3ZXA C;  1AR6 1;  2QQI A;  5FQ0 B;  1C5I A;  3ZFG A;  1RUH 3;  5GLV A;  2P5B A;  5FZO A;  2QUO A;  1CR7 A;  1OLM A;  2PTM A;  4Y1Y A;  4K1Z A;  4Y20 A;  4YGB A;  5FZH A;  5LBC A;  1GIC A;  2PMW B;  4FFI A;  1JI6 A;  1KDK A;  2CGN A;  4QX5 A;  3BB6 A;  3ME2 A;  5DAB A;  4DEV A;  1N1V A;  5LB6 A;  1RUN A;  5C5U A;  3E5Q A;  3ST7 A;  3I3M A;  2GU9 A;  1AR9 1;  1YIP A;  2VE1 A;  3USU A;  3N7J A;  5J36 A;  4Q4Y 2;  3TBD A;  3KV4 A;  3WG2 A;  4RA0 A;  5FWJ A;  1F15 A;  5C71 A;  4UI9 L;  1XU1 A;  1W39 A;  5E88 A;  4YYO A;  4C0B A;  3N7K A;  3NQH A;  3VHO A;  5CVR A;  3UGH A;  5FR3 A;  3WNM A;  2WT1 A;  1VMJ A;  2GN3 A;  3FFZ A;  1RJ8 A;  2C26 A;  4BLJ A;  2I74 A;  3B9C A;  2GNB A;  3KCY A;  4L92 A;  4TLG A;  2P1B A;  5GZG A;  1QF3 A;  3INA A;  4KWK A;  4CUG A;  1AXY A;  2ZHM A;  2MEV 3;  4Y5Z 0;  1TZO A;  2JDZ A;  1FYU A;  3VHR A;  3MIG A;  2VOT A;  1ACC A;  4W65 A;  3NAP B;  5M0T A;  3UNP A;  4OUE A;  3PME A;  4K20 A;  4C0H A;  4V2V A;  2VUC A;  3OGV A;  2BER A;  3ZXL A;  3NVC A;  2DFB A;  5CKN A;  4LBK A;  4XFH A;  4JV4 A;  3RJR A;  1L3J A;  1RUE 1;  1DGL A;  2A71 A;  2CV6 A;  5CU1 A;  5FRA A;  2XJQ A;  4BWO A;  1MS0 A;  2P2K A;  3L9J T;  3OGG A;  3AZV A;  4QGL A;  3NNL A;  4XW3 A;  5IK4 A;  2WWJ A;  3AKR A;  3A22 A;  4AW7 A;  1UZV A;  1UAI A;  3MLL A;  4QXK A;  5JSR A;  3RZK A;  1XYO A;  1ND2 B;  1J83 A;  1BEV 1;  3K75 B;  3LD8 A;  1IS5 A;  2BOI A;  3PDQ A;  4QPG B;  3I3B A;  1WLT A;  5FZ8 A;  5C8C A;  3SKJ E;  5C3O A;  2NPI A;  3RSJ A;  1QGL A;  4JQT A;  4NMI A;  1VLN A;  4WBB A;  1RUE 3;  3WNK A;  3DEM A;  1WUV A;  5A3U A;  4AI2 A;  2MEV 2;  1XNT A;  4IEQ A;  2A6Z A;  1LKN A;  4E4H A;  1OI6 A;  2ENR A;  2VZR A;  2BQP A;  1YFU A;  2VXR A;  2PHW A;  5CIR A;  2NP0 A;  1NE4 A;  4BQ1 A;  1TMF 2;  1H2L A;  4BDV B;  4XDO A;  5FAX A;  3H8U A;  1X8M A;  5LAS A;  1UZW A;  4YG6 A;  1S0F A;  4TYS A;  4RD7 A;  1Y43 B;  5ANN A;  3MF6 A;  1C8M 2;  4J6G A;  1I9R A;  5EIY B;  1YFW A;  2IXJ A;  3OF1 A;  4XHX A;  4K8F A;  4IV3 B;  3SNM A;  4M3C F;  1RGS A;  3WZ1 A;  1DZT A;  1EPW A;  2WNV B;  1O4Y A;  3KM5 A;  5KXD A;  1GOG A;  3IDB B;  5FZ4 A;  1AR9 3;  2GN7 A;  2OPW A;  3KLS A;  3T08 A;  3JU9 A;  1W04 A;  1H8V A;  2J1T A;  3D0J A;  3I59 B;  3PIJ A;  3AP6 A;  3W21 A;  1BVV A;  4H14 A;  4H2A A;  1S0J A;  1EP0 A;  1LCL A;  2F6B A;  1OFN A;  2JXA A;  4MGY E;  2BJS A;  5A3N A;  4R4X A;  3JBG 2;  4QKN A;  3A0N A;  1XOY A;  3QOP A;  4MO3 M;  3W20 A;  3AM2 A;  1O59 A;  4JAA A;  3ZN6 B;  2F17 A;  1ZA7 A;  1V6O A;  3TEX A;  5JIA A;  5JXG A;  3T1L A;  1WCQ A;  1KEX A;  1QNY A;  1EAH 2;  3NMB A;  4KBZ A;  1JYW A;  1DGW X;  1TNR A;  4OI4 A;  3H8X A;  1V9U 2;  1RVF 1;  5AVA A;  2XG3 A;  5C4W A;  2HWB 1;  3VBU B;  3I97 A;  4GAZ A;  3A23 A;  4YLZ A;  2RR1 3;  1GOH A;  1DQ4 A;  1VBD 3;  5G04 L;  2C9A A;  4AFB A;  4LBQ B;  2BNN A;  1VMF A;  5CFC A;  1YLL A;  5IYY A;  2WYS A;  2VVF A;  3OG2 A;  5FZE A;  1MZF A;  3HNB M;  4MYE A;  1A6C A;  2CWS A;  4DUV A;  1V6M A;  2X10 A;  2BBA A;  3WX5 A;  3H3Z A;  2BZD A;  2GNT A;  3ORJ A;  4BIF A;  5I0U A;  4JTN A;  4CCO A;  4DO0 A;  2GH8 A;  2ADE A;  1V6L A;  3UK9 A;  4AF9 A;  4I0B A;  5SV8 A;  3VDD B;  3O12 A;  4WVV A;  4NHL A;  1N3P A;  3FX3 A;  1WZX A;  4YG3 A;  1LGB A;  3N35 A;  4LTA A;  4NPR A;  4P9Y A;  2JE8 A;  1ENQ A;  4TN7 A;  4LMF A;  3GBG A;  2FCV A;  1W0O A;  3OB8 A;  4YW5 A;  4GWJ A;  4XDP A;  2RDN A;  5AC9 3;  2DYC A;  1LUL A;  3ZVX A;  2ZHL A;  1W6O A;  3O0X A;  4K7J A;  3WP4 A;  2RS5 2;  1WLC A;  2SBA A;  3GZA A;  1HV1 A;  4QX2 A;  1OUX A;  3SMH A;  2EAK A;  2Y33 A;  4WM8 B;  4IES A;  2RMU 1;  2W1W A;  2VZV A;  1DYK A;  4QD2 A;  5DAQ A;  4CP2 A;  1LOF C;  1POV 1;  4N53 C;  3NNJ A;  2VUJ A;  5FO9 B;  1UY1 A;  2P37 A;  4NWV A;  4Q8L A;  2DU1 A;  1VPH A;  3WUC A;  4CEY C;  1DP0 A;  4CRQ A;  5C4W B;  1QQP 1;  3RZH A;  3VDD C;  4NID A;  1JYV A;  2XH6 A;  4IE4 A;  1PVC 1;  3KSC A;  4OI1 A;  3LEI A;  4NHK A;  5GZE A;  1UPS A;  5H9Q A;  2WS9 1;  3QBQ A;  4A7K A;  4ZU5 A;  1C1L A;  4HOO A;  5LW9 A;  2E9Q A;  1UU4 A;  2Y6K A;  3O1U A;  3I2O A;  1UIJ A;  1SLT A;  3PMS A;  4Y26 A;  4FPF A;  4N43 B;  5CFD A;  2VOW A;  3VHP A;  1R1Z A;  1GBG A;  2RJK A;  2WZR 1;  4IEO A;  2XQX A;  2TNF A;  3AL5 A;  3H50 A;  5E1R A;  3ZYJ B;  1WMD A;  2BVB A;  1ASJ 3;  2ZEX A;  5FZO B;  2VNR A;  2BTV C;  4AHZ A;  5FMD A;  3LGR A;  2B9U A;  1QWR A;  4IGQ A;  4BXF A;  2Z69 A;  1JHJ A;  2XL9 A;  1ZRI A;  3CBN A;  1H0B A;  2ZTN A;  3K4D A;  3M4F A;  3NNM A;  3VKF C;  3ZR5 A;  1VBE 2;  1VJ2 A;  3FBY A;  5IK7 A;  1BEV 2;  1TG7 A;  2VW0 A;  2GDF A;  2WFF 3;  3GGL A;  1UMZ A;  1AL2 2;  2IFR A;  4CVU A;  1FMD 1;  2PQS A;  2H0V A;  5JXI A;  5EP9 A;  2EIG A;  3AZY A;  1K45 A;  5LA0 A;  2B45 X;  1FI2 A;  4AVA A;  3T2P A;  5EV7 A;  4CCC A;  1RHI 1;  1TME 2;  3IWZ A;  4XJA A;  4BQY A;  1CN1 A;  1GP5 A;  5FFO C;  5F32 A;  2ZGL A;  2VME A;  1Y9M A;  1RYY A;  3AB0 A;  4MHR A;  3HNM A;  1X9P A;  1VBC 3;  1OF3 A;  4FAH A;  4LJH A;  5F6L B;  2FDF A;  5JOX A;  1DYP A;  4Z92 B;  2AC1 A;  1J59 A;  3B9I A;  2OUJ A;  2VZP A;  4ARY A;  4DQA A;  4Q4Y 1;  3KZ4 C;  1VB2 A;  1MQT A;  3JD7 2;  3M3I A;  3FMG A;  5BXX A;  1RUG 3;  4C91 A;  5J09 A;  1WLW A;  3SCF A;  4Q5O A;  4URT A;  1CVN A;  3F95 A;  4N9I A;  3ZR6 A;  2CYF A;  1D4M 2;  4P9J A;  3LPG A;  1QJU 1;  4AGV A;  2VZS A;  4E4S A;  1NZC A;  2ZEZ A;  3VD5 A;  3B00 A;  1SHW B;  3HJR A;  4Q4V 3;  1XNK A;  2V4A A;  4ERO A;  4GUL A;  1UOG A;  3OEB A;  2VBP A;  1WCU A;  2P3I A;  3PHM A;  4IW3 A;  4G9S B;  4XXA A;  1CIY A;  5LY1 A;  3WDU A;  1NUK A;  4GIQ A;  4YGD A;  1SLA A;  2BGP A;  3M7A A;  1PMJ X;  3K4A A;  1RUH 2;  1RMU 1;  5FY5 A;  3MIB A;  4TXW A;  1QH7 A;  2ZML A;  5FJK A;  4LHS A;  1FAY A;  1PIV 1;  3MI8 A;  3B02 A;  4B4Q A;  3BU0 A;  2JDN A;  1ND3 A;  3EQE A;  2AH2 A;  4AK3 A;  2HBU A;  4FXK B;  1JYC A;  5FPX A;  1MS1 A;  2WWS A;  2EXH A;  3RZM A;  5FZF A;  1JU3 A;  4B7E A;  1JZ3 A;  4FOW A;  4CEY B;  1UY3 A;  2Q30 A;  2B42 B;  2WFF 2;  3NAP C;  1VAK A;  4QXH A;  2E7T A;  1QJY 1;  3AYA A;  1HB2 A;  4OI2 A;  2FQP A;  2WQZ C;  1KIT A;  4JGY A;  3MPB A;  5JZG C;  3NJX A;  4XJU A;  5FZ1 A;  1D0H A;  4NN0 A;  1UZZ A;  2YHJ A;  2XON A;  3BTY A;  2YG0 A;  2I45 A;  4GD4 A;  5FXZ A;  3O1T A;  4RS5 C;  1AYM 2;  3C7E A;  3AJZ A;  4KG0 A;  5A3O A;  1JTZ X;  2W94 A;  4EZ4 A;  1XE8 A;  3MIH A;  3APB A;  2D3R A;  4IGO A;  3NWK A;  3T2T A;  4BYY A;  1NT0 A;  5FYI A;  3K77 A;  4HKW A;  1B35 A;  4D7Y A;  4DXR A;  5A3P A;  1UU5 A;  5AVP A;  1Z7S 1;  3WCS A;  1AX1 A;  1V6J A;  1OPO A;  1F9K A;  1DDL A;  2VOX A;  2JIG A;  5H9P A;  1PZ8 A;  4YM1 A;  4NIG A;  4XTP A;  3POI A;  5A3L A;  4QX7 A;  2ARE A;  1DF0 A;  1TME 3;  1S0I A;  1XB9 A;  3UJO A;  3R05 A;  2IVI B;  3V0B A;  2WA4 A;  2W9X A;  2YUE A;  1LB2 A;  3M2M A;  2DV9 A;  3BIW E;  1OKQ A;  1SBE A;  2RS1 1;  4R8H A;  3SCH A;  1HQN A;  4IE6 A;  2WZR 2;  3THT A;  2VMG A;  3NKT A;  3RYR A;  5A7W A;  3JBG 1;  3LOI A;  3M3E A;  1MEC 2;  3M8L A;  4XVH A;  2HWC 3;  4OHW A;  2W87 A;  4NOT A;  3MIE A;  1PHM A;  5GJ6 A;  4EQV A;  5FZL A;  1W90 A;  2Q4S A;  2JEN A;  2AEN A;  2IFW A;  1K5M A;  5JOY A;  3KHC A;  1V9U 3;  4FPO B;  3VBO B;  2P3J A;  4S2D A;  3VBF C;  4G4F A;  1LU1 A;  2AYH A;  1AXK A;  2VQ0 A;  3J26 N;  4QQH A;  1N47 A;  3EHK A;  3QD6 A;  4D6Q A;  5A32 A;  2UWA A;  3MUZ 1;  4A7Z A;  3RYP A;  4OHZ A;  4E4D X;  4CU7 A;  4FI9 A;  3ECQ A;  3CMG A;  1OXC A;  4UBH A;  3ZN6 A;  4QHB A;  3DKW A;  5LK5 A;  1HRV 1;  1DQ2 A;  3BVC A;  3TEW A;  1RJ7 A;  3VBR B;  1O4T A;  1UW8 A;  4K21 A;  4LBM A;  2CY6 A;  1COV 1;  1KJL A;  5T5P A;  1RIT A;  2P4E A;  4JHT A;  1XPW A;  3CQO A;  4UW5 A;  2Q1F A;  4LHK A;  2HWC 1;  3JBG 3;  4FQZ A;  2VVD A;  1LOE A;  1Q8Q A;  1J3R A;  2JDY A;  2Q0A A;  4EN0 A;  1QH6 A;  3IPV B;  5JSO A;  2K2S A;  3ZN4 A;  5KHJ A;  1O5U A;  1X8E A;  3LF7 A;  2E51 A;  2JDU A;  1H9W A;  4AED B;  2G19 A;  2E33 A;  4XIO A;  5A6Q A;  4LPL A;  3WD5 A;  4YW1 A;  1Y9G A;  1QQP 2;  1RHI 2;  1TME 1;  2ZCW A;  1JOD A;  2X5I A;  3K46 A;  1FOD 2;  3ILN A;  3N3H A;  4BJ0 A;  3LB9 A;  1VBC 2;  2BWA A;  2R7E B;  3J7N A;  4AVT A;  4RS5 B;  1U5Z A;  3ZFF C;  2ZGQ A;  1JZ6 A;  2LAL A;  3NJV A;  2DF7 A;  2XVG A;  2B5H A;  3JD7 1;  1RUI 2;  4P08 A;  3R0R A;  3O1S A;  1XSQ A;  1GP4 A;  4XBQ A;  3WQB A;  3GNE A;  5HXV A;  1FNZ A;  1OMI A;  3D0S A;  2VZT A;  3WNO A;  2TEP A;  4QB6 A;  4B1M A;  5FYM A;  5JUV A;  1NQJ A;  5KXE A;  5C7G A;  3OJB A;  5FY9 A;  5LEK A;  4XIL A;  2ERF A;  2W92 A;  1JOB A;  4HPK A;  3OD0 A;  1S1A A;  4X6Q B;  5D21 A;  1OA3 A;  4Q4W 1;  4AGG A;  4E8D A;  4MXV A;  3CHX A;  1AL2 1;  1DGR N;  1HIX A;  3H7Y A;  1KFU L;  4OVE A;  5A6Z A;  4FFF A;  4QPW A;  2XUE A;  1ZX5 A;  3O5S A;  3AX4 A;  1LGN A;  2L9L A;  3AKP A;  4B4R A;  5IK5 A;  3ES1 A;  3S5A A;  4QPI B;  5F6K A;  3MIF A;  2J1R A;  2YPD A;  4XCB A;  3WCR A;  2JIC A;  3GXU A;  4HVQ A;  4CSW A;  1S4C A;  4I01 A;  5A1L A;  2HWD 1;  1F8V A;  4A3X A;  3C7O A;  3J7L A;  1TEI A;  4Q4X 2;  3RJ2 X;  3TNP B;  3R4U A;  4L9B A;  4IEV A;  1SMV A;  3MW3 A;  4JRA A;  2Z5W A;  4CUA A;  1GYK A;  1WD4 A;  4XE9 A;  3MID A;  3SQO A;  3VLB B;  1AX0 A;  3AKT A;  2NMO A;  3FLR A;  4PDW B;  4XIK A;  5EHD A;  5ERL A;  2NMN A;  5C3Q A;  3AMP A;  2D44 A;  3OTF A;  2WA3 A;  1JXN A;  2Q1M A;  4O65 A;  4HKO A;  1QJU 2;  1TQ5 A;  1SPP A;  5FWE A;  5IVE A;  1COV 3;  4OQ8 A;  4KBB A;  5KHK A;  4TTG A;  1O3S A;  4S2F A;  1W9T A;  1DLL A;  3I3Q A;  1WME A;  3K4Z A;  1PVX A;  2AAC A;  2ETE A;  5I91 A;  1EV1 1;  4LO5 B;  3AP5 A;  4COZ A;  1P8J A;  2J22 A;  4XUR A;  4Y22 B;  1MVE A;  4CP9 B;  1LOG A;  2O14 A;  3MYX A;  1D4M 1;  1W99 A;  4JX0 A;  1D0G A;  4TLF A;  4WM7 A;  2BEO A;  3FFQ A;  1KQR A;  4FTS A;  5J1X A;  1MZE A;  1IG3 A;  1W05 A;  3H1M A;  1UOB A;  1ZZ6 A;  3HEI A;  4MG2 A;  1RUC 2;  2XWJ B;  1FMD 3;  5K0U C;  1OF4 A;  3LWC A;  2PEL A;  3UV9 A;  3CJI A;  3NRU A;  3ROU A;  1JHN A;  3LAG A;  3PUR A;  1FT9 A;  2HYX A;  3VL8 A;  4A7Y A;  2WO3 A;  4CE8 A;  1WW4 A;  4CDU B;  3LSE A;  2HBT A;  1WA6 X;  4HET A;  1W2O A;  2CAU A;  1DZR A;  3DL3 A;  2ZXQ A;  2A1X A;  3OD4 A;  3NV2 A;  4D8M A;  5ABJ B;  1F5F A;  3N7L A;  4XYX A;  1AYM 1;  4AZZ A;  3PTR B;  2HWF 3;  1YNA A;  1Q5O A;  2VCB A;  3EMR A;  3VBU A;  4YVS B;  1XQN A;  4KWU A;  2WZR 3;  5BYN A;  2XWB B;  3ZOI A;  1U5Y A;  4KU8 A;  2WDB A;  1NA1 B;  4NVP A;  5FJH A;  4YPJ A;  3RI9 A;  3VBS C;  4MHU A;  1IOA A;  1X7N A;  2A3X A;  3NJZ A;  4E27 A;  1AR6 2;  1ODN A;  4QXB A;  2ZGR A;  1HW5 A;  2YMZ A;  3LA3 A;  4I0W B;  2RDQ A;  3NV4 A;  3DXU A;  3URF A;  3SH4 A;  2C24 A;  4DMI A;  5FPZ A;  1PVC 3;  1US3 A;  4EWE A;  3NNF A;  4RR3 A;  1QQP 3;  1PX3 A;  4XJZ A;  1Z0H A;  3WG4 A;  4DRV A;  4RL7 A;  4PT6 A;  2VNO A;  1POV 0;  2IVJ A;  3IZO A;  1QXJ A;  3BPZ A;  3UET A;  5EFU A;  3BYW A;  4I30 A;  5ANQ A;  1CON A;  1UIK A;  1YEW A;  3CJX A;  2NLR A;  1Q8V A;  1UCX A;  2PLV 2;  1OHF A;  3O7O A;  4RQP B;  2WNO A;  2XJU A;  2A7A A;  4PQQ A;  1ONA A;  2R07 2;  4J1W A;  2QQN A;  3CO2 A;  3VZL A;  3WQ7 A;  4JDM A;  3NO8 A;  5AC9 1;  4FPL A;  3S30 A;  3QAC A;  4QWN A;  1K5M B;  2Q5T A;  3MV0 1;  2RV9 A;  1OFS A;  2ZAB A;  2LW8 A;  4HKL A;  3ZDS A;  3GBW A;  1W8Z A;  4ZHN A;  4XBL A;  3GYD A;  1H8T B;  2JE9 A;  3B7M A;  5JXJ A;  1EUT A;  1G9F A;  4KH9 A;  4NR1 A;  1S2B A;  2QNK A;  3P3P A;  3UGF A;  1GMM A;  4EWD A;  2Y6H A;  2W95 A;  3RQ0 A;  3SEP A;  5KR7 A;  5KWR A;  4AED A;  2ZX4 A;  1W6M B;  1YWK A;  1W6P B;  1VBD 1;  4BIO A;  3WDY A;  4Y5S A;  3P5B A;  2Y6L A;  4YVS C;  4AI0 A;  4YM2 A;  5HPO A;  1CAW B;  5A7P A;  4Q0S A;  2OQ7 A;  3PU8 A;  3AC0 A;  4YAR A;  3VBO A;  2UY9 A;  1NE6 A;  3ON7 A;  1GR3 A;  4AVC A;  4CCE A;  3KF3 A;  1QJU 3;  3AXE A;  4EV0 A;  1GZW B;  4FPG A;  2ZKL A;  5IJR A;  2ZKN A;  4Q4V 2;  3I49 A;  1NLS A;  1C4R A;  4SBV A;  2ARC A;  4PLN A;  4IET A;  1PMH X;  5BNP C;  1X9T A;  5HI0 A;  3HT2 A;  5BNO A;  2YFU A;  3NV1 A;  2OII A;  4GH4 C;  5FOB B;  2J7M A;  5IUQ A;  4AFC A;  5EJZ B;  2W0X A;  3WHT A;  4CDW A;  4LXL A;  1VBC 1;  4C1X A;  1I5P A;  3LE0 A;  2GME A;  3RGB A;  1UYZ A;  4XF9 A;  1OLR A;  5FZG A;  3JB4 C;  1TMF 3;  5F2W A;  3JQX A;  5JOW A;  5LCW L;  2JDM A;  5C9A A;  4FOQ A;  1LHV A;  1YQ6 A;  5ACA 2;  3ZFE C;  2H6C A;  5GZD A;  5L9B A;  4HVO A;  4ZXK A;  1GKB A;  3MW4 A;  2PHX A;  4Y4Y A;  4X6R B;  4W4Z A;  5E89 A;  4AEJ A;  5BNN A;  2EVX A;  4DS0 A;  4HON A;  1Y9Q A;  3O1P A;  1FOD 1;  1ZA4 A;  4K40 A;  3R6S A;  3RMX A;  1AYN 2;  2KA3 A;  3WG1 A;  3WT3 A;  3KT1 A;  1UQX A;  4CXW A;  1MS8 A;  4GXL A;  4OZX A;  4Y4R A;  1O8P A;  3W58 A;  1J1L A;  5DDJ 2;  3LEK A;  4Q0U A;  1O7F A;  1W8N A;  2XB6 C;  1BEV 3;  4XF3 A;  3WIN E;  4URA A;  4UAP A;  1W2U A;  4DB5 A;  4MGQ A;  2D5F A;  5GLW A;  3V0A B;  3OOX A;  1SDD B;  4LIU A;  1QKQ A;  4DOU A;  2Y6J A;  3USS A;  3ZYH A;  2R49 A;  4P02 B;  3ZFE B;  1ASJ 2;  1D2Q A;  4TZD A;  1URX A;  2JJ6 A;  1CAX A;  3HQR A;  1YFY A;  1TVG A;  5A7S A;  5FZ9 A;  5ACA 3;  4B4P A;  3FJS A;  2AGS A;  5B4N A;  4QHO A;  1MS5 A;  3MDP A;  4XJ9 A;  3PVO A;  1KD7 A;  2RS3 2;  5DQ0 A;  5BNO C;  5L7O A;  2BRT A;  1HQW A;  1POV 3;  3POW A;  1CJD A;  4KL1 A;  4XPV A;  4BK4 A;  2QZ2 A;  3MV1 1;  4AHX A;  3WHU A;  2RMU 3;  3PJY A;  2MEV 1;  3OYW B;  4CCJ A;  4IXL A;  5BV6 A;  3SIT A;  4GWN A;  4ASK A;  4QU1 A;  4CYD A;  3D5O A;  5CKQ A;  1LOA A;  3THD A;  3AMH A;  5FLJ A;  1E5I A;  2QTW B;  2XDV A;  4OUL A;  3WF2 A;  1QOO A;  2R06 2;  4LO7 A;  3I54 A;  1G6N A;  4CP0 A;  4W50 A;  2YY1 A;  4BQ4 A;  1NCR A;  2Y60 A;  3H0O A;  3GBF A;  4WM8 C;  3MIC A;  3E5X A;  4MET A;  3D8C A;  2XHK A;  1BZW A;  4FT8 A;  1ULD A;  1PX4 A;  2CGO A;  4YZ4 A;  5A80 A;  3T3Y A;  2C4X A;  5FLH A;  3VZM A;  4JGY C;  4PI0 A;  1C28 A;  4ES9 A;  1GAN A;  1PM4 A; 
#chains in the Genus database with same CATH homology
 3ZPO A;  2OQ7 A;  3PU8 A;  5FXW A;  3KVA A;  5FZ7 A;  3UYJ A;  4EYU A;  2Q8C A;  5CEH A;  5F5I A;  3K3N A;  5FWE A;  3AL6 A;  3DXT A;  5FZC A;  5E6H A;  4D6Q A;  5IVE A;  5FZK A;  5A3N A;  4BIS A;  4V2W A;  3N9N A;  3K3O A;  5F3C A;  5FYT A;  3PUQ A;  2P5B A;  5FZO A;  2YU1 A;  5FZH A;  5FY1 A;  5IW0 A;  4CCK A;  2YBK A;  4GAZ A;  3RVH A;  5F3E A;  5FY4 A;  4CCL A;  5ISL A;  4UF0 B;  5FZD A;  3NJY A;  4EZH A;  4LXL A;  4QXC A;  2VD7 A;  5F39 A;  5FZE A;  3N9O A;  5LY1 A;  2OS2 A;  5FZG A;  3KV4 A;  5LWB A;  5F2W A;  5FWJ A;  4CCO A;  4DO0 A;  5FY5 A;  3KV9 A;  2WWU A;  3PUR A;  5FJK A;  5A7W B;  5F2S A;  1VRB A;  5IVB A;  5IVY A;  5FPV A;  5FZI A;  3U78 A;  2Q8D A;  5FPL A;  5FBJ A;  3AVS A;  4Y3O A;  5A7N A;  4CCN A;  5IVJ A;  3LDB A;  4TN7 A;  4HON A;  5FY0 A;  4CUG A;  5FXV A;  4LIV A;  4XDP A;  3PTR B;  5FZ6 A;  5FZF A;  5LY2 A;  4C8D A;  2OX0 A;  3KV6 A;  5FZ0 A;  4Y4R A;  4QXH A;  4V2V A;  2GP3 A;  5FJH A;  5FP8 A;  5FV3 A;  5A3P A;  5FZ1 A;  4QXB A;  5FPU A;  4URA A;  5A7Q A;  5FYS A;  4GD4 A;  2YU2 A;  3DXU A;  5FXZ A;  4GJY A;  4LIU A;  3U4S A;  5FY7 A;  2WWJ A;  5FYM A;  4EZ4 A;  5FUN A;  5FP7 A;  2OT7 A;  2XML A;  5FPB A;  4IGO A;  5FY9 A;  2GP5 A;  4QX8 A;  5FP3 A;  5FYI A;  5A7S A;  3K2O A;  3LD8 A;  5FZ9 A;  3AVR A;  5FZ8 A;  4HOO A;  5LW9 A;  3PDQ A;  3KV5 A;  3N9Q A;  4LIT A;  3OPT A;  3N9L A;  5FZ3 A;  5ANQ A;  3OPW A;  4Y33 A;  2XUE A;  5FYV A;  5FZM A;  2XXZ A;  3AL5 A;  4NUB A;  4D6R A;  5FP4 A;  3N9M A;  5F3G A;  2YBP A;  4CCJ A;  2OQ6 A;  4QWN A;  4CCM A;  5IVC A;  5FZO B;  4E4H A;  4QX7 A;  5FZA A;  5FXX A;  4GJZ A;  4IGQ A;  4BXF A;  2YPD A;  4ASK A;  4AI9 A;  4QU1 A;  4CSW A;  5A1L A;  4IGP A;  4XDO A;  4BU2 A;  5F37 A;  5IWF A;  2XDV A;  5IVV A;  2W2I A;  5FYU A;  5FYZ A;  3PU3 A;  5FPA A;  4AAP A;  3PUA A;  5K4L A;  5FYY A;  5FP9 A;  5A7W A;  5A7O A;  5A3W A;  5A1F A;  5KR7 A;  5FZB A;  5FYC A;  5F5A A;  5FY8 A;  4D6S A;  5A3T A;  3ZLI A;  3N9P A;  5FYB A;  5IVF A;  5FZL A;  2PXJ A;  5FUP A;  5A80 A;  3KVB A;  4UF0 A;  5FYH A;  3PUS A;  5F5C A;  5F3I A;  4DIQ A;  5F32 A;  2Q8E A;  5FZ4 A;  5A7P A;  2YBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...