4DY5A

Crystal structure of salmonella typhimurium plig, a periplasmic lysozyme inhibitor of g-type lysozyme
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
111
structure length
111
Chain Sequence
TGKNVNVEFDKGQNSARYSGVIKGYDYDTYNFQARKGQKVHVSISNEGADTYLFGPGISDSVDLSRYSSELDGNGQYTLPASGKYELKVLQTRNEARKNKAKKYSVNIQIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Gifsy-1 prophage protein
publication title Structural characterization of the PliG lysozyme inhibitor family.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 26
structure length 111
sequence length 111
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04151 PPC Bacterial pre-peptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4dy5A00
4DXZA 5FBZA 1QXPA 3AFGA 4G9SB 4HPKA 2QFEA 3BOWA 4DY5A 1WMDA 4DZGA 1KFXL 1NQJA 2XVGA 3DF0A 3JQXA 4DY3A 2XVLA 4I3GA 1WMFA 5FAXA 2LUWA 3JQWA 5SV5A 1NQDA 1KFUL 4HPKB 1WMEA 2XVKA 2O8OA 1DF0A 1U5IA
chains in the Genus database with same CATH superfamily
2VXRA 4Z2WA 1RUG1 2B9UA 1FXZA 1HW5A 1RINA 1UU4A 5FPBA 2VU9A 1W9WA 2Y38A 4UYBA 4EN7B 1DGRA 3FLTA 3K3OA 4R9BA 2WO1A 3MW4A 5LBEA 4AI8A 2MPFA 4AVBA 1YWKA 1DCSA 4P9YA 3CEWA 3CBNA 4JVAA 4WM7A 5FYMA 5T5JA 4AQ6A 2PELA 1VE0A 3HD8B 4TLGA 4D94A 2XUEA 2ADEA 2VMGA 3HT1A 3UKNA 1JYWA 5JOWA 1QJFA 1YRZA 3ZKUA 3H3ZA 2X53S 4MO3M 4ZHNA 1M06G 1HV0A 1OFNA 2LS6A 4AVAA 2AR6A 3T3YA 2NQYA 2JDNA 5ISLA 5DAXA 1XU1A 5BNQA 4UFJA 1NZCA 4XXPA 2XJUA 2OUHA 4BMBA 1AX0A 5DAQA 5FZKA 1A6CA 1X36A 3IIIA 2HWB1 3MLLA 4XXAA 4XF9A 2ZGLA 5GLZA 4IV3A 1QQP1 1POV0 2B39A 5A33B 4XEZA 2J1EA 3UL2A 1J3PA 4XJAA 1JHJA 1UQXA 3AMMA 1VBA3 3ZXKA 2VZUA 5FR3A 5JOZA 3O1PA 2X09A 2ZHNA 2EAAA 4LQRA 2DTYA 1S0DA 2CDPA 1CX1A 3UYJA 1ZZ6A 1JODA 2IXCA 1R083 4ZU7A 1YI9A 4IUGA 2YUEA 3H8RA 1ODNA 4XF4A 4LO4B 3IWZA 2ZMLA 3PU8A 2WQ4A 1B35B 2Y0IA 2YC4A 3O7OA 4YZ3A 3WF4A 5FWJA 1Q3EA 4YW6A 3RYPA 4XFIA 1HQNA 5DN2A 1UYPA 4A41A 3EQEA 3ZYHA 4Z1VA 1NOVA 1JUHA 2JWPA 2X29A 3PVEA 1VMJA 4I0BA 5BNOA 3OGRA 1UOBA 3IDEA 5K9YA 4YSFA 4WVMA 2X5IC 5C71A 2VJXA 4JC1A 1V6OA 4P9IA 1LECA 2WZR2 1XE8A 3IZOA 3QH6A 1EAH2 4Y1UA 5FZ6A 3SKJE 3VBRA 5C33A 2H6BA 4XDOA 4AI0A 4EZHA 1ST8A 3LEMA 4UW5A 2Z42A 1IOAA 2VZRA 3BU7A 4F83A 3BU0A 2IXJA 3NO8A 3DPRA 2G4IA 4TYSA 2ENRA 3MFCA 2ZXQA 1G9FA 1GP5A 5D21A 3FN9A 2VQUA 5EWSA 3WSOA 1WMDA 2XONA 3H50A 1EPZA 2E31A 3JBG2 3LCPA 1MZFA 3OD0A 4YVWA 4LO7A 4SLIA 3MHZA 4WM8A 3BGAA 3O0VA 1GBGA 1K45A 3KF3A 4XHXA 4AHZA 4YPJA 1XNAA 2V72A 3ZO0B 1DP0A 1D2SA 3I7DA 3IPVB 1MEC3 1QJU3 2OQ7A 3WDXA 1O3TA 5CAZA 3CLPA 2YHJA 4FXGB 4K20A 1ENQA 2PQSA 2RR11 4XDPA 2VUAA 1AYM3 1IZ3A 5JOYA 5EHDA 3LFIA 4BHPA 4DO0A 1T6GC 3CIHA 1SCSA 5CYYA 1RUG2 2W9XA 2Q30A 4U2AA 2E51A 3ZDSA 4BYYA 4PDWB 1HXS1 4IQPA 1GICA 2UWAA 3DECA 1JUIA 1UF2C 3ST7A 3WG2A 1NLSA 5LW9A 3HWJA 3WNLA 3U1XA 5F39A 2CV6A 2JDZA 1OD3A 2D6NA 1PMIA 4HFSA 1AUYA 3OYWA 2P6CA 4M3CB 1GMMA 2QE3A 4MYEA 5E1RA 1UAIA 3ZM8A 2W87A 4HT1T 3N9MA 4JTOA 4UBGA 1CQ9A 3APBA 3PURA 4QGMA 3AL6A 3V56A 4RGAA 1W2AX 4E2QA 1VMFA 4S2HA 3WY6A 1YIPA 2FQPA 5AFBA 1UCXA 5FZ9A 4AL9A 2YG0A 1H0BA 4BXFA 4G4FA 4DEQA 1RITA 3WDVA 1GOHA 4HVQA 3TEYA 1K42A 2O1QA 2WN2A 2WYFA 2VTFA 1W99A 4LORA 5TSWA 1QQP2 1S0IA 4QPGB 2QQPA 2RMU2 4LIVA 1TMF1 3M3CA 4F7ZA 2BWCA 4ZU5A 3ZYRA 4FPOB 1RHI3 3R6SA 4FTSA 4Z2AA 1WCUA 1HX6A 1XYOA 4KG0A 1LHNA 3QD6A 1JOPA 5FZDA 1S2BA 5T5OA 5A3OA 3VD9A 5BXXA 4AYUA 1QHDA 1BJQA 1PVXA 2P2KA 5FZMA 1HN1A 2A6WA 3GCWA 4META 5K0UC 2XUMA 2J1TA 5C3SA 2EIGA 1RVF1 2DVBA 1N1VA 2YDEA 5K4LA 2BBAA 3J8F1 3KQRA 1JW6A 1YJLA 1W9TA 4KGGA 4QDRA 3VBHC 1OA3A 5JWPA 1MR5A 1JZ2A 1POV1 1NCQB 2A6ZA 2GALA 4IETA 5F3IA 3D6EA 4P02B 4NO4A 4YARA 3KZ4C 2WAAA 1L7QA 5KWRA 4Y24A 3WCRA 5G05L 2VMCA 5J36A 1YQCA 4QX7A 2A71A 3AP6A 5ACA1 4GB33 1XYPA 3GCXA 1VRH1 3ILRA 3HBZA 3NVCA 4AI3A 5LA1A 1ZA7A 1VB2A 1OH3A 1AHSA 2ZHMA 4OLLA 4OZXA 3MPBA 4UFMA 1OC1A 1W9SA 1FPN3 5L9RA 1ND2C 3U10A 2JG9B 4RFRB 3QACA 4K6BA 1RXGA 4CE8A 4CCMA 1H6YA 3WHTA 4BK5A 3ZXJA 4A42A 2IUWA 1MQTC 2GH2A 5CADA 1ZA4A 3MW2A 4N9IA 4AHXA 3VD3A 4TSVA 2D97A 2XJPA 4D3WA 1AYN3 2VUCA 1ULDA 3K77A 4D7SA 3LIGA 3U78A 1YIFA 3LKJA 5A3UA 4BISA 2CYFA 4XACA 3VBUB 1AJKA 1X9PA 2R061 2VQ0A 4QB1A 1MVEA 1NE4A 3VL8A 2VTXA 1PNGA 3NAPB 2RR12 5LASA 5F5IA 1WCQA 3GBFA 3IKWA 4OZOA 4UW3A 5FV3A 4Q4W3 5IK4A 4K7JA 1BKZA 5BPXA 2R16A 4A2UA 5A1FA 5K7PA 3IBMA 1QKQA 4MV2A 5C3RA 3O14A 3VL9A 5FY9A 5A7WA 1J1LA 5AC91 4G9SB 1HXS2 1NUKA 1NCRC 4RR3A 3U14A 2GNMA 4KU7A 1EAH3 3J9SA 4EWDA 3OY8B 1X8MA 3EMRA 1QOSA 4S2FA 4AFAA 2HEYF 2P1BA 4E9KA 2JDUA 2UYBA 2QNKA 5JZGC 4L0PA 4YGDA 4QX2A 3VDAA 3AP7A 2Y6GA 2HLEA 4LITA 2E7AA 4PLOA 4RQPC 1JYNA 1RMU1 4XW3A 2H6CA 2Z2SB 4AVSA 5CFCB 2VMIA 3U11A 4EN8B 5CU1A 3FUQA 2A70A 1W9FA 2FZ1A 1OPMA 2VNVA 2XQRA 3E5QA 3HQUA 2VR4A 3N7MA 2FCVA 4DXRA 5J7MA 3BI3A 4IESA 3UKVA 1LOGA 1SBDA 2OZJA 4EROA 1RUJ3 4CEWA 1CPMA 2YFZA 3Q8EA 3UGGA 3RQ0A 3MGUA 5E8AA 2WNVA 4FBFA 4UFIA 1S55A 5JOXA 1UY2A 1E5HA 4YM2A 3LDBA 4FPYA 4BQWA 1VBB1 1W6PB 2W1WA 4I0AA 4AI2A 2ZTNA 2MEV3 5HCFA 2BBVA 4CDWC 3ASIA 1TMF2 3VKNA 2Q1ZB 4CCCA 4P9LA 4LLFA 2DUPA 3S30A 3VN4A 3RWKX 4GWMA 2HWD3 4Q26A 3LSDA 1W6NB 2R32A 2CWMA 4OULA 2Z4FA 1COV3 4N90A 2DFBA 5HXVA 3ZN6A 1V70A 1WW6A 4JTNA 1D7PM 4Q2FA 2Q0AA 2F4LA 2VQTA 5I8SA 4AEMA 5A32A 4L8QA 2AENA 3FMGA 4LA3A 4NROA 2AGSA 4YRDA 5FYZA 4B1MA 1RUI1 4XJ9A 1RVF2 5A3NA 4BPZA 3J8F2 5I0SA 4PBOA 2WL1A 1GWLA 4AFBA 3GALA 5FLHA 3BPSA 2TNFA 4D0QA 5CG9A 5C8CA 1G9DA 2UY9A 4O61A 3D8CA 1US3A 4Z8BA 3D4KA 1C1LA 3OPWA 2B46X 1GSLA 5JMCA 5ACA2 2HWF1 2PHDA 4WM7C 1VRH2 3D5OA 2ZGUA 2W68A 4R9DA 1SHWB 1O8PA 1J84A 1H8TA 4N8MA 1Y3TA 4K21A 4QWNA 1HN0A 3S0MA 2JDPA 4PJYA 2WO2A 2RMU3 4CXXA 4FPFA 4IE5A 2CNAA 4GD4A 2ZGMA 2W0XA 2XB6C 2WT1A 1QXJA 1DLLA 1REFA 2D98A 3WUDA 4RSUA 3CL1A 5HCAA 4NIGA 1Q8VA 4AEDB 1CR7A 1D4M1 1FAYA 4XE9A 4YW3A 1X9TA 3T2PA 1AL0G 1TME3 1VMHA 5LCWL 5F1RA 4IV3C 4MVTA 5CFDB 1E57A 4EWAA 4AQ2A 1X7NA 2BGOA 2HBTA 2R062 2XHNA 3TNQA 4K1ZA 4Y5TA 5I0DA 3VD4A 4UAPA 4O65A 5GLWA 5A33A 1LOAA 1H2NA 3SEEA 5FPXA 1UMIA 5IVJA 2YBPA 1JBCA 1VBD3 1U12A 3MYXA 3PHMA 5JR2A 1G9CA 4OI1A 3ZXLA 1LENA 1KS5A 4DS0A 3AZVA 5AC92 4QKDA 4QXBA 4YG0A 5FZ4A 5JI7A 3ZFGC 4IE7A 5FY1A 3SHRA 4ES9A 4FP3A 4OVEA 5C3QA 1XU2A 2OPWA 3FLPA 1ULFA 4Q4X2 2RS53 1TVGA 3HN1A 1DQ0A 2VW2A 1JOBA 1HB1A 1B35A 3W58A 4N43B 5FYTA 5BNOC 2WC2A 3PUSA 2V73A 4I01A 5FPLA 3KCCA 4GZ9A 3W59A 3ZMOA 2P6HA 1GLHA 4CEYC 1DF0A 4ZS2A 1WLCA 5HI0A 2R073 2ZGTA 4I0WB 1HKDA 2QUOA 3FHQA 4DOUA 1F4AA 3MLJA 1VBA1 1UZWA 5IK7A 4WVMB 2VCBA 1T2XA 3DPRC 3E97A 3KM5A 4E4SA 3H7JA 3VBRB 1VBB2 1XRUA 4MOAA 4RGKA 2R0FA 1UIKA 4JCKA 1R081 2C24A 2PTMA 3LA3A 4OUSA 2QDRA 5EV7A 3ZYIB 3WLUA 4YVWC 3AP9A 3LPFA 4R4XA 4P00B 5FZ1A 1OVPA 5FXVA 1NAEA 4WM8C 3EJKA 2GN3A 2H0VA 4TZDA 2DVDA 4IDZA 3VHPA 2BP6A 5GJ6A 3DKWA 4PT6A 3M2MA 4KU8A 4P9WA 3NWKA 2GC1A 5F3GA 3PVOA 3Q8BA 4AGVA 4B4PA 4J25A 4CYDA 4DQAA 3IPVA 5KHGA 1GQHA 1GP6A 3DXTA 1RUI2 4QX3A 2KR2A 3K3NA 1UPIA 1QOTA 1JZ7A 3ALQA 2JG8B 5GALA 1DZRA 2QBXA 1APNA 2XR4A 2GNDA 2NMOA 4ET7A 3POGA 3SH5A 2JDHA 3WNKA 4BH9A 3N9OA 2PAMA 4PDWA 3VBOB 1QU0A 2HWF2 2EICA 1SBFA 4FPJA 3PNAA 3USUB 3WW4A 3G6JB 1TZOA 2BW8A 3POIA 3ZFEA 1CAXB 1SFYA 3RZZA 5CZKA 1WD3A 4MUVA 4QKFA 3T1MA 1YUDA 1Y4WA 2A6VA 4M3CA 1F31A 2VVFA 2VZTA 2WKKA 4XF1A 3AX4A 2CTVA 1XNCA 3VBSB 1MEC1 1QJU1 2RE9A 3DCQA 4BB3A 4E8DA 4YG3A 5B2GB 1OOPB 4IEUA 5IAXA 3LA7A 2K0GA 2OS2A 2PAKA 1DFQA 5A3LA 4YNIA 2YY1A 1AYM1 5T3NA 1D4M2 1JOJA 4XABA 5EXOA 1Q5OA 4H55A 1PMJX 2XHKA 3F2ZA 1CZSA 2QQNA 4KH9A 3BALA 4GH4C 4HK8A 4HPKB 5D2AA 5A6QA 2VCAA 3D0JA 1DHKB 2Z69A 1JYVA 4LBNA 3BYWA 1KD7A 3TRSB 4C0BA 2DBNA 1C4RA 4B1LA 2Y26A 4Y1XA 3UNPA 2JJ6A 4FPLA 4P9GA 4IGPA 5E88A 1ND3B 3T30A 3ZPYA 3AP4A 1QJY2 2VZSA 2BDRA 4XETA 2XMLA 2ZMKA 2HWC3 2LTNA 2E7QA 1DU3D 1UKGA 1AR93 2BOIA 5FZHA 1CPNA 2ZZQA 3GYDA 1FI2A 5FIXA 1G9BA 2FDGA 1IGOA 1X8EA 4K8FA 4RS5A 2D7FA 3CHXA 4X6QB 1XNKA 3P6BA 4XHBA 2YC0A 2P34A 4NIDA 2WZPP 1DG6A 5BUVA 5BV6A 5L9VA 2VM9A 2J1VA 4KQ7A 4QX8A 1I5ZA 3POFA 5JIAA 1NCQA 2IWGB 4LK7A 3FX3A 5DUVA 3FBMA 1WCKA 5FZOB 1PM4A 2UWCA 4QKNA 5FMOS 4IEXA 1G7YA 1VBA2 4GALA 3RMYA 1RHI1 3FC0A 4LJHA 5IW0A 2GP3A 1HDKA 2FBEA 4GWJA 2I07B 1Q8SA 1R082 3ABZA 3JQXA 1JHNA 2P4EA 4CP1A 2GMMA 3N7JA 2CHHA 2O8QA 1XSQA 5KHKA 4AVCA 4EN0A 2DWRA 5JCTA 1O91A 4OFGA 4LO6B 1CESA 4PBPA 4A7ZA 4CXYA 2XL7A 2AYHA 5FK8A 3MIEA 2E6VA 4QQHA 3ZXDA 5A6ZA 3P1IA 4XILA 1UMZA 4UXAA 3ZSEA 3MIDA 3BCWA 2O0OA 2ZAHA 4Q4X3 5EZWA 3IB3A 5JDBA 2UU8A 4D69A 4KBZA 3CJIA 3VBUA 1D0HA 3RZJA 4URAA 3T0BA 4PCRA 1CGPA 4GB31 4N53C 5IVFA 4ATFA 2E63A 3NAPA 1JYCA 2R043 5GLVA 4FOVA 2OZ6A 1UXZA 4RR3C 4R52A 1BCXA 4PIZA 1POQA 1FMD3 1VAKA 1F5JA 2D40A 1C5IA 3C8XA 4HXCA 3OBZA 1FPN1 5FUPA 2GZWA 4HBNA 4LXLA 2YMZA 4XBLA 1W6OB 2LUWA 3JQWA 1QNWA 1BHGA 1E5RA 1UPSA 1BK1A 5IT6A 3NV1A 3OY8A 4RR3B 1OLMA 1S0EA 5FRAA 4EZ4A 4RA0A 2JE8A 4DIQA 2ZBJA 3VHRA 3A21A 3RG0A 1GU3A 1AYN1 2XKOA 3OPZA 5A80A 4AZZA 4TTGA 1C1FA 3CQOA 1OT5A 3C7FA 1TE1B 2HEWF 3IN9A 4BQ1A 4CEWC 1MEC2 1QJU2 5CFCA 1ULEA 3AZWA 3NJYA 5FLJA 4JGYB 5FYHA 1XE0A 2BFUL 5GZCA 4A7KA 2WNVC 4KL1A 2AC1A 3OJBA 3MDPA 1AYM2 1U0AA 4ATEA 4Q4W1 4IL7A 3NNJA 1W8WA 3PDQA 3UJOA 1QDCA 5FTTC 1GNZA 2QQVA 3VD5A 1XXNA 4C1XA 2IC1A 2Q5TA 5FPUA 1W04A 2HYKA 5FXWA 1DQ4A 1QJEA 1EAH1 1W6PA 4IEQA 1I1EA 1ZREA 3ENRA 3WW3A 4CU8A 3VZNA 1W8NA 1LCLA 3AVRA 3WZ1A 1UZVA 5T5LA 3KT1A 4YZ2A 2XWBB 3PIJA 5FZBA 5IWFA 2R6QA 4F8AA 2DURA 1W0PA 1QIQA 2R1DA 4KG8A 1W6NA 2JD4A 4LUKA 2ZPXA 2IXIA 3J7HA 4PLNA 2D6PA 1RUJ1 4CDXC 1LEMA 5EYYA 2EXIA 2C9KA 4NHLA 1W90A 1K12A 2PHWA 2DVFA 1LODA 3ILNA 5A32B 3ZKYA 5C8CC 3VZKA 3I3QA 5AVAA 3H8XA 1YXWA 2RS33 3IAQA 1ZBA3 4C8DA 2W52A 4AEJA 1MPXA 1J1TA 2DDUA 5DAWA 3KLSA 3KCYA 1CONA 1ZNPA 2FMYA 2MEV1 4W65A 4AFCA 3KD4A 4MX3A 3VKLA 4PIXA 4XFBA 1JZ6A 5FY5A 3TOJA 2BGPA 1RHI2 2XQXA 3DV8A 2W1SA 4YWAA 1EUTA 1OLME 1QGLA 1V6MA 1K5JA 1BYHA 2HWD1 5JXHA 1MACA 4LKEA 3D0SA 4RN5A 3PUIA 5EFUA 1COV1 1H8TB 3QCWA 1BEV2 3BIEA 4AAPA 1EYBA 2RVAA 1O6UA 4JV4A 4L99A 4KWJA 2ET7A 3ZXFA 2VG9A 3RZKA 1OURA 1QJX2 1NXD1 4XF0A 1DQ2A 1V6LA 4NHKA 2J42A 1JZ8A 3AZXA 4TXWA 5DDJ3 5FYVA 1QJY3 4FO9A 3L2HA 4MGZE 4ES8A 4AEDA 3BOPA 4NOTA 4X8PA 4ZONA 1ZRIA 4MGTA 4ISQA 3NV3A 3LDRA 4XJZA 3FJSA 2D3PA 1REDA 3N9LA 4Y1YA 5FBZA 4OYUA 2DUQA 5FPVA 5CFDA 3A0NA 2VVDA 2W47A 4XFAA 5FZFA 3WW1A 5KR7A 3NJVA 4GB32 4OHVA 4QX0A 5FMOL 2W95A 4DY3A 2MHFA 4Y4RA 1RL3A 1UL9A 3ZR6A 2VPVA 2VZQA 1FPN2 2RMU1 1PZ9A 5FY7A 3WCSA 3EHKA 4MHUA 3SLIA 1UU6A 1NX9A 2OIIA 4L9BA 4AG4A 1Y7BA 3WT3A 1B35C 1R093 4M01A 4YVSB 5AVPA 4Y22B 2OVUA 1FATA 3NQHA 5IJRA 3W9AA 3PJYA 3RVHA 4E2SA 3BODA 2PQQA 3LQCA 5FZEA 3KGZA 4HLTA 1RYYA 1AYN2 4GJYA 4Y5SA 3AB0A 3PVNA 4L2NA 2WUHA 1GYKA 4N43A 3ES1A 1TME1 5C6CA 1OA2A 2V4AA 1WW7A 3HNYM 3VHOA 2H0BA 4W6WA 3NJZA 4FTBA 5FYUA 5L73A 2WQZC 1VBC2 3IDAA 1UY1A 2BVVA 5F7UA 3OBAA 1F2NA 3F95A 5BNNB 1VBD1 1ZRDA 4Q4W2 5FKBA 3H9AA 3KV6A 1N1SA 1MS9A 2WZ8A 3MW3A 3NNGA 5BYNA 3AMQA 2W91A 2YFUA 1S0CA 3HEIA 1N3OA 1GR3A 1YEWA 4Y1VA 1YLLA 5FPZA 4LMFA 1A8DA 4NIIA 4ZPIA 1CN1A 2VUDA 2E7TA 4UW6A 2RS51 3WF3A 3BTZA 2ZGQA 3KS7A 2JX9A 1SFNA 1CZTA 1VPHA 2RJ2A 3K4AA 4J1XA 3VHNA 3WF0A 4FAGA 2WS93 2XPJA 1HB4A 3BPZA 2IVJA 3PUQA 1DQ5A 2GDFA 1GQGA 4B8EA 4XUPA 4BQ5A 1UOJA 2JICA 2IFRA 1S0BA 3ZSKA 4CCLA 5HBAA 2DTWA 3INAA 1QJZA 4QDQA 2JIGA 4NAMA 4YG6A 1RUJ2 2VD7A 4LTAA 4CUAA 4AHYA 3BKZA 4LT5A 2E32A 1HRV3 1J83A 2N7GA 4JGZB 3ZYGA 4I2OA 1ULCA 3UETA 4FT8A 4RHV3 1R64A 4A6OA 4PDWC 4BQYA 2JG8A 5IVYA 1LOEA 2MEV2 3I2GA 4PQ9A 5FP8A 2C6SA 4NIHA 2ATFA 2XG3A 4BLIA 1W06A 4BJ0A 1QF3A 3VBOA 4CPBA 3RSJA 1OLRA 3AFGA 1XYNA 2VZ3A 4M4RA 1ZZ8A 1AX1A 1JMUB 4QT6A 3USUA 3WNOA 4AR2A 2HWD2 5JR7B 3VZLA 2KXLA 1CAXA 2D5HA 1BLZA 4YGEA 1OKQA 1COV2 2PHLA 2GC2A 4M4PA 3ZFEB 4FXKB 1ASJ2 4GKXA 2WNUB 2JXAA 3B02A 3CMGA 3MPPG 2X05A 4PI0A 2Y6LA 3VDCA 1FOD3 5ANQA 1WCDJ 4IXLA 3TN93 1DQ1A 2DCTA 3VBSA 4HKOA 1N1TA 3ZXEA 1OOPA 2SLIA 2WNEA 3R4DB 5T55A 4DINB 1ZZ7A 3OUIA 3SCHA 1WBLA 2QQIA 1GWMA 2VH9A 4IW3A 2A7AA 1MZ5A 4FOQA 5GZEA 5FP4A 2IFWA 4QPGC 1PM7A 1MS4A 3POJA 1UX6A 4HPKA 2EIBA 1C5HA 2WNOA 4UT5A 2EXJA 4FAHA 3MICA 1MZ6A 2XVGA 2WFF3 3QOPA 4KWKA 4U36A 1O4ZA 4YW4A 1H6XA 3E6DA 4CTEA 5LK5A 3OF1A 3RFRA 5LRRA 1RXFA 1HJFA 4NPLA 4BWOA 1ND3A 2R30A 2TUNA 2HBUA 4PIYA 2OW4A 2YBKA 4LLOA 4XMAA 1W0OA 3O1VA 1V6KA 3HIFA 3GJAA 4P5YA 3GXUA 3TEXA 4LKSA 1LGNA 2ZGRA 3KQ4B 4D7TA 3VZJA 2EXKA 3ON7A 5CVRA 2FZ2A 2D6OX 2VCMA 1BEV3 2WLPA 2WLQA 4XAAA 1KDMA 3SITA 1NCQC 1TME2 4HVOA 4LPLA 5DXDA 1QXPA 1QJX3 3KV5A 4RS5B 4Z07A 3ELNA 4NHMA 1BMV1 5LBFA 4CDUB 4LBOA 1WKYA 3K75B 4GMP3 3IDCB 1IQDC 5CBLA 1VBD2 2WBKA 5FZOA 5T50A 1UY0A 2BERA 2YXSA 1Z7S2 2WRAA 1O4TA 4XQ4A 3HJRA 3M1HA 2JG9C 2B8MA 1UU5A 3KF5A 1GFF2 2TBVA 3ITQA 5IFPA 2QTWB 1LESA 4LNVA 4B4RA 1E5IA 1GNHA 2AUYA 4S2GA 3RZGA 2HWC1 1WBFA 2PXJA 2RS52 1GNYA 4IE6A 2WDBA 1AR91 2ZX3A 4Q1RA 4FFFA 3B94A 2HEVF 4NVPA 4LE4A 1UIJA 4BOWA 1HB3A 3NL1A 2ZX2A 2QVSB 4FPEA 4LR4A 3VBUC 5D8AB 3SEPA 2ZZJA 3I2DA 1BQPA 1KITA 1WGPA 5HPOA 4E8CA 3MFAA 3NAPC 2R072 3B69A 4CCKA 4B29A 2LM3A 1ZBE3 1CJDA 2JENA 3DUIA 1XNTA 2XBO3 2R7EB 1LHOA 2C4XA 5DAVA 3CJIB 4LOSA 1W8UA 2VGDA 5SV8A 5F8PA 4Q5OA 1AJOA 3B3QE 1DDLA 5LY1A 1VBC3 3KGLA 1ZM1A 4OMDA 5FZGA 4IV1B 1OLQA 4GWIA 4LA2A 2ORZA 3BB6A 4YW1A 5FMBA 5LZ6A 4LBLA 4LIUA 5FZCA 1XPWA 2ZEYA 1W6OA 2NMNA 1ULPA 2PLV3 4L11A 4Q29A 5F9TA 2B42B 4Y20B 3WG4A 1O59A 2ZA9A 4UOJA 1J59A 1W8HA 2C5DA 4COZA 3GNEA 5FZ7A 2VBPA 4WZCA 5FJKA 2WA3A 5C9AA 4QD2A 5CFCC 3DF0A 1UOFA 4TLFA 5H9PA 4Q4X1 3ZN4A 3O1OA 2XL9A 1QDOA 5I0RA 2CY6A 2WO7A 4M3CF 1Q43A 1VBE3 1XE7A 2AREA 1F35A 3A22A 2BWAA 4QXCA 1CAVA 1L7LA 3POWA 5FP9A 1RUD3 3FUOA 4JGYA 5FO8B 5J09A 1D0GA 1EY2A 4UW4A 3ZR5A 2R041 2ZGOA 1XBFA 2FDHA 1RUH3 1YFXA 2W5FA 1FMD1 3ZYPA 4CPBD 3ZFFB 2D3SA 3WX5A 2YU2A 1OQDA 3RGBA 1YJKA 4DFSA 3H8OA 5JPNB 1OUXA 2VW0A 4XUOA 4Z82A 3TEZA 2A73B 3FLRA 1PVC3 3OGGA 4HN0A 2WWSA 2HJIA 3LD8A 4MGSA 3M3EA 2CAVA 2DVGA 2X10A 3GF6A 5FP7A 3E6BA 4QQLA 5FYIA 4BDVB 3AK0A 1KS4A 4BIFA 2CGPA 2VXJA 2ORXA 4LK6A 1MVQA 5C3PA 4UF0B 4GIQA 2WJSA 4WVWA 3AZYA 3AMHA 5KXEA 1REEA 1SCRA 3WW2A 4AK3A 1RUF2 5LRSA 4W6YA 4FOYA 3ACGA 4AXOA 2YB7A 1ASJ3 3WF1A 4XTPA 3N3HA 1RTVA 3WNNA 3S6PA 2NYYA 1H1AA 3VDDB 4XAEA 1CVNA 2HKXA 2VW1A 5A3PA 3R4UA 3P5BA 1BMV2 5LEJA 3O1TA 1RIRA 3ZYBA 3O1UA 3HOBA 1Y9QA 3I49A 1W3XA 1Y43B 4MXVA 1MZEA 3SNMA 4MHRA 2OUJA 3UKTA 2WO3A 1UD1A 1ALYA 1C28A 3N9PA 4DEVA 2UWBA 4UFKA 2CSGA 3J7LA 3OPTA 3VDBA 1Y9MA 3AC0A 4XFHA 1LHVA 2DCJA 1G9AA 4CCEA 3I54A 5FQ0B 4Y26A 3RI8A 5LA0A 2HWC2 2JIJA 4JDMA 4JKLA 1U5IA 1PHMA 1AR92 4V1PA 1MS0A 1G8WA 2VECA 4BU2A 4EQVA 2V5DA 3UESA 2Q8OA 4AEDC 2QQOA 4IE0A 4COUA 1DIWA 3L2YA 3TAYA 3GHNA 1FV2A 3N7LA 3PVBB 4YFZA 2P37A 4Q4V3 2RS31 1IKQA 3M8LA 1ZBA1 3OCPA 2E9QA 2Y34A 2VZPA 3B9IA 3NMBA 3CKHA 5CFDC 1KRIA 1DYOA 1OH4A 3S7EA 3LPGA 1DYKA 4XQDA 4QU2A 3TNPB 2RHPA 1PGL2 5I0TA 1XJAA 2W1QA 1OHFA 1F8VA 2F6BA 4CUBA 1HRI3 3RS6A 2BPA2 3FL7A 5F5AA 2D5FA 2O8OA 2EALA 3GZUC 4R9AA 1EP0A 3T0AA 1XNBA 3OGSA 1AL23 1HLCA 2DVAA 2WINB 4YZ4A 4DXZA 1KQRA 1H4HA 1Z7S3 4CU9A 2QQKA 4GXLA 3KHCA 3EB7A 4YVSA 2JE9A 4Y22A 3WDYA 4N43C 4HSLA 4LOTA 5DDJ1 5EJ1B 1QJY1 5F32A 3ETPA 2ZAAA 1W03A 4I3GA 3B93A 2VOTA 3PIGA 4FFHA 4CA9A 1F15A 3WP3A 1HQLA 4YM3A 1UYZA 4GWNA 5DPNA 3VZMA 2KA3A 1UYYA 2WZEA 3WR0A 3AKQA 3OBTA 1KGYA 4DMIA 1Q8QA 1NT0A 2ES3A 5L7OB 1DGLA 2R042 2CGOA 5BNNA 5J3UA 1S0GA 3VBRC 1FMD2 2GNTA 5F6KA 5GLTA 1IG3A 2JB4A 2YPDA 4CU6A 3DL3A 4IGOA 3H1MA 3H1YA 4QQOA 4Y3OA 5IATA 2WYSA 1OI6A 3ZPOA 3NNMA 4W8JA 4MGQA 1H9PA 1R091 4AHWA 2A6YA 3OOXA 1E5SA 1GOGA 5KXCA 1H2LA 4BLJA 1SEFA 5CB7A 3ROUA 2QQWA 3MO4A 5KHIA 2XLGA 4JQRA 3E1F1 3HN3A 3T4VA 1RUNA 4AGRA 3ES4A 2PHRA 2B4KA 5A7QA 3EXUA 5IVBA 3MIFA 5LBBA 3P3PA 4FFIA 3NKGA 4XMIA 5KC6A 4UBHA 3WV6A 3R4SA 4CDQA 4A4AA 2ZEZA 2NZ9A 2B5HA 3V0AB 2JG8C 3O12A 4K8RB 3RJRA 3LWCA 4JGZA 1WW4A 3J7NA 3J26N 2BVBA 4O9EA 5C4WB 4GULA 3Q8CA 4IGQA 3VBOC 3WNMA 4P14A 3WNPA 2LRPA 4WVZA 2VQAA 2ZGPA 4YW5A 3W5MA 2E33A 3U75A 2Y60A 2FDKA 1BBT2 1PGSA 1F4HA 2WAOA 2XJRA 3HAGA 5F3CA 1CAUB 5FAXA 1K5MB 3OEBA 3CDZB 3NNLA 3GZEA 4IEWA 3UK9A 2WS91 1SLTA 1UZYA 2J1AA 3TB0A 4QXHA 2XVKA 3OUHA 5J1XA 3BTXA 3VBSC 4ZS3A 4HETA 3T2OA 1WZXA 2DCZA 5JVVA 2ARAA 1OOPC 2WNUA 4KNCA 4QGNA 1VIWB 2JDKA 2LW8A 4QQPA 1HRV1 2VE1A 4UWDA 1NLQA 2KM2A 4I3PA 3MIBA 3KT7A 3QH7A 4MGKE 2VOVA 2RS32 4RHV1 1ZBA2 1RUF3 4Q27A 1CWPA 4OQ9A 3LAGA 2EIDA 2GH8A 1AR73 4XYXA 1WLDA 2ZGSA 1VRBA 4GA9A 5FY4A 3WF2A 3AJZA 4E4HA 2BTVC 4QDSA 1GZ9A 5J96B 2RG4A 3PUAA 5CKQA 3VLBB 1WLWA 3I2JA 1IS4A 3C7HA 1ND3C 1QH7A 1W8OA 1S0FA 4OI2A 4RYDA 4O7XA 1XB9A 1LU1A 5A3MA 2IVIB 4YGBA 5EJZB 1GZWB 4AVVA 3VBFB 2DUOA 1FOD1 2XDVA 3TN91 4LBQB 3LFMA 3K51A 3H0OA 1SLAA 4B3NA 3EYPA 3IIAA 3OUJA 5FCCA 1O4YA 3WP5A 5DDJ2 2PA7A 2V5YA 5CIRA 1CIYA 3LF7A 3K48A 4QHOA 2QZ3A 1TNRA 2GC0A 1W6MB 4OCTA 2VZ1A 5JI9A 3RZMA 2EIEA 3NV4A 1N1YA 5IVCA 3WQ0A 5H9SA 1BVP1 3I2FA 2KD7A 3GGLA 3MUY1 4CDUA 3HR9A 2YC2A 2Q8DA 5BNPB 3RZLA 4J6GA 5F3EA 2YYOA 4BMEA 2WFF1 5LWBA 5FWEA 3KVAA 3AYCA 2HYXA 1YCIA 3BTAA 3I4IA 1OQEA 2EF6A 3BOWA 2YV8A 4NIAA 2WR9A 3OGJA 1R092 1IKPA 3C3VA 2RS13 2WABA 3HNMA 3S7IA 3LOBA 1P8JA 2Y64A 4QGLA 3ZDVA 4RL7A 5CA6A 4XF3A 4YLZA 4GAZA 4XIOA 2PHUA 3VUOA 1BEV1 2WWUA 1OUSA 4D6RA 1EV13 1QJX1 1UY4A 5D8AA 3J4UH 1C57A 2RM23 4NN0A 5GLUA 3ZIWA 3C7OA 1JYTA 4ITCA 4COVA 4GMP1 1SZBA 1V6NA 4NPMA 4ORFA 5ERLA 4FVVA 4OUMA 5FO7B 3VBHA 4MLOA 5A7PA 1WLTA 2D6LX 4XVHA 5B4NA 4LBJA 5E6HA 3H3UA 3DXUA 2LROA 3I3EA 1PO23 3JD73 5FXZA 2OYZA 3WP4A 4C1WA 4COWA 3HQXA 1IQAA 3R05A 4IV1A 4AI1A 4XFFA 3E5XA 4MZUA 4DRVA 3RJ2X 1PGL1 4AQTA 3BUCA 2G19A 3IMNA 3LE0A 5LATA 4Y20A 1CIWA 2WS92 1Q56A 4QX1A 4AEKA 3RYKA 1O3QA 3H1WA 4XIKA 5FP3A 2A3WA 2OPKA 4JGYC 1H1IA 5C9AB 3SCFA 4DUXA 4R8HA 1IG0A 5IVVA 1ZBE1 1H2MA 2J1UA 2XBO1 1HRV2 1SLIA 1NLRA 4FPGA 1LJ7A 2Y6JA 3CZUA 4DY5A 3NW4A 4HANA 1NA1B 2JKBA 4QU1A 5GKAC 1CAVB 4RHV2 4XZUG 1YFWA 5L19A 1YNAA 1VBC1 2VZVA 3PMSA 4BXSV 4INDA 5C7GA 5ANNA 2A6XA 3ZFFA 2E26A 3BIWE 1T6BX 4DB5A 1PIV3 1W05A 4NR1A 4ZKTB 4QHZA 2PLV1 5CEHA 5EQUA 4AI9A 5HCHA 1PZ8A 2VUJA 2GMPA 5DZGA 2ZS6B 2VULA 5GZDA 4AFDA 4A7YA 4ZZ5A 5K8SA 2J1SA 1ODMA 2YROA 3WG1A 3H7YA 1JTZX 3N9NA 2L9LA 4FPHA 1BBT3 4QX5A 4A45A 4E2GA 2ARBA 5DUUA 4XCBA 4UF0A 1FOD2 1VBE1 3TN92 2J22A 3MI8A 1NZIA 3KB5A 5FY8A 1QWRA 2P3YA 3I2HA 2WWJA 4GJZA 2GSYA 4XUNA 2W94A 2P3KA 3AZZA 4TWTA 1QOOA 2XJQA 4PLMA 1O5UA 1PO13 1W6QB 1RUH1 4FQZA 3DYPA 3VV1A 4NWVA 5LA2A 4XOGA 4LUMA 3POEA 2BV4A 3FHAA 3WHUA 5ABJB 2B7YA 5T54A 1AR83 5C5UA 3VDDA 1PVC1 3ZXAC 3HVDA 2Y6KA 2BNOA 3X29B 4DXSA 4LE3A 2QDNA 4PF5A 4D7YA 4JZRA 5FUIA 1IS3A 1OF4A 2WFF2 5KC5A 4HONA 4YGCA 5KBFA 4N7UA 4QPIB 3QLQA 4GQ7A 1W3VA 5H9RA 2X8KA 5JXIA 4WZFA 3TBDA 3Q9OA 1H8TC 4NPRA 2FDFA 4PQQA 4R9CA 1S1AA 4ZXEA 2JB8A 2NPIA 3MV01 3VKFC 5I8YA 3DEMA 1RB8G 1LEDA 3JUUA 3U4XA 1KFXL 1OPOA 1KEXA 4LBMA 3VGIA 1V9U3 1QNYA 2BNMA 2D93A 3GM8A 4Q0SA 4AOCA 2ILMA 4OHXA 1L7RA 2XH6A 4P9XA 3BTYA 1YQ2A 2MNGA 3DGTA 1ASJ1 3WOGA 3KVBA 2E53A 4S2DA 3I3DA 3S57A 5SV5A 2K2SA 3NRUA 5FKCA 4OHWA 3R0RA 5LA9A 1UX7A 1W8FA 1OVSA 3FZ3A 3BVCA 3A4UA 4K1YA 2VMEA 4MXWB 3USSA 1W2NA 3NNFA 5FOJB 1G6NA 2OA2A 1IHMA 3ACFA 3B01A 5DG1A 2LALA 1A34A 2RV9A 4JHTA 1X33A 1C3HA 3K2OA 2DU1A 4XUQA 3M3QA 4YVSC 3HBKA 1JYIA 3MZHA 3CU7A 4EN9B 4BQ4A 4X6RB 4C90A 2BNNA 3B7MA 5A1LA 1RGSA 1BVVA 1LRHA 1N3PA 5CG8A 1L3JA 5E89A 3SH3A 4OQ8A 1LAJA 4Q4V1 3ZSMA 4HN1A 4QPYA 2RDRA 1CD3G 3GDBA 3I3MA 1IS5A 3JB8A 4XZPA 1HV1A 1LTEA 1AR62 2VAUA 4LHSA 4MG2A 1ZBE2 2Y6FA 5BNNC 2XBO2 4BZ4A 4OI0A 1YO8A 5A6YA 5JAXA 5A7SA 5LK7B 2PN5A 3V0BB 3RWNA 1HRI1 5A6XA 4CRQA 3B5LB 5L7OA 2QQUA 3RZHA 5D1IA 2P5BA 2IXKA 4IERA 3SMHA 1AL21 3PTRB 5J48A 1OKOA 2A5ZA 1Z7S1 2B45X 2PLV2 2R49A 2ZX4A 5F5QA 5CKNA 4NE9A 2W08A 3OTFA 1WMEA 4XUTA 4QHBA 1N47A 1ZVFA 1SPPB 1PZ7A 4JKMA 3E5UA 2QJVA 1OQ1A 1C8M2 1PK6A 3ZFGA 4CDQC 1DYPA 4JDNA 2XJVA 2PAEA 1UY3A 5IFTA 1VBE2 3FWEA 5F6LB 3GHMA 4HMZA 4BIOA 3M7AA 1RUD2 1R1A3 4CCOA 4JGZC 2AEYA 4CDQB 1GV9A 1JS9A 1S2EA 5DAPA 3V0AA 1OFSA 1RUH2 4MGYE 2P17A 4YM1A 4EYUA 5A1AA 3AL5A 4M0NA 1S2KA 3AKSA 3HNBM 5KHHA 1F9KA 2R071 4PI2A 5FDBA 4CEYA 1PVC2 2CL2A 3KMHA 5DZEA 5EYXA 5C4WA 4CU7A 2CDOA 1URXA 2ZEWA 3AXEA 3O0XA 4CP9B 1RUE3 3CNAA 1ZYBA 1AVBA 1AXYA 3CF6E 1QMJA 1UWWA 2Q4SA 2X5IB 5FMCA 4FI9A 2JDAA 5L36A 3K4DA 1CAUA 1CZVA 2AZ5A 1K5MA 2PHTA 1BK0A 4LBKA 3OG2A 3ZFEC 4NHYA 5GM0A 2WNUC 1Q8OA 4DUVA 2QFEA 4AE2A 4HL0A 3K46A 4EWEA 5GZGA 1RUC3 3ZOIA 1QY4A 1U5YA 3MF6A 1UOGA 1W9YA 3FE5A 4Q4Y2 2UURA 5DUXA 5GZFA 1FNZA 1GANA 2W3JA 2ARCA 2ZACA 4IEOA 3WINE 2SBAA 4NJ4A 1XC6A 2Z5WA 1UMHA 2FCUA 2NP0A 2YGMA 3JCIA 3P3NA 2I2SA 2VBDA 3NV2A 4P9JA 3OGVA 1LULA 2HWE2 2Y0OA 3N9QA 1MS5A 4C0HA 2G1MA 1ZZCA 3SCGA 2XKPA 3V64A 2XJTA 1US2A 3T2QA 4AWDA 1GWKA 3IM0A 1FYUA 2D6KA 2FMDA 2WSVA 4H7LA 4JHZA 3S5AA 2A3XA 4LHNA 1A78A 1PX4A 1UN1A 2I45A 2WT0A 4QM9A 4X8NA 5KXBA 4OHYA 4EN6B 3ZXGA 1LGBA 5EIYB 1JZ4A 5F5CA 2P3JA 4EE2A 1O3SA 1GZWA 1UKRA 3POBA 1CAWB 1PGW1 3VBFA 5M0TA 2ZGNA 4IEPA 3VKOA 2B9VA 3RYRA 2WT2A 4LBQA 3O1MA 4CZSA 3ZYJB 3SXWA 4CCNA 4ONUA 4Q4V2 4KMQA 4RS5C 1RUF1 4N9HA 4QXKA 1KJRA 1W6MA 4MADA 4PHZA 2DBIA 3KV4A 1LGCA 3CJXA 4CDUC 3E6CC 4Q8LA 1AR71 3KCXA 5A7OA 4D6SA 4JX0A 4JAAA 2C26A 1G86A 2HWB2 1HRI2 5BNPA 1IPSA 4DZGA 1UZ0A 2VOKA 4PF1A 4GH4A 4EJRA 1WMXA 2Q1MA 4W4ZA 3LEIA 1AL22 4CVUA 4B7KA 1DZQA 2QCSB 4B4QA 1UNBA 4I02A 1NYWA 4NRPA 4LO8A 1YC61 2AEZA 3LOIA 1W2OA 2G9FA 5D8AC 5FMDA 3PUHA 4XPVA 2BEOA 2ZJCA 3Q8AA 2FDJA 3DKQA 2ZHLA 1PX3A 3A23A 4JDOA 3WQ1A 1ZRCA 1LR5A 2ADDA 3I59B 4XFGA 4Y5Z0 3CJIC 3LIHA 4LKFA 4LEJA 3THTA 3SKVA 4Y1ZA 1UW8A 3M3OA 2DV9A 2RDQA 3RDIA 4BA6A 5A70A 2DCYA 5EJ3A 3MBWA 2VOXA 1AR63 3AYDA 4YW7A 5K0UB 4OUEA 4IV1C 2Y8KA 1F5FA 1HB2A 2YGLA 4IEYA 3VBHB 3GZTB 3WQBA 1JI6A 3ORJA 2XOMA 3ATGA 1TQ5A 2RS11 1DBNA 3B00A 3O0WA 4HVRA 1YFUA 4QMAA 1ZRFA 3ZLIA 3K4ZA 1H8VA 1SQ4A 4L97A 1BZWA 1ZX5A 3WDWA 4E4ZA 1MS1A 2JEMA 1EV11 2NN8A 4D6QA 3ZSLA 3I8TA 2NLRA 1ENRA 3RI9A 1Z0HA 2RM21 1ND2B 4B7EA 4ARYA 1FNYA 3B9CA 1C8M3 2PYTA 3KT4A 1AX2A 2C9AA 4LHKA 4HOOA 2TEPA 5CISA 4Q0QA 1PMHX 2FHRA 2R0HA 4OHZA 3L9JT 3ZFFC 1MQTB 3PJQA 1NA1A 1WUVA 4L92A 4F3JA 1H1MA 2A3YA 4MGIE 3JD71 3ZN5A 1LB2A 1PO21 1AZDA 2D6MA 1XSRA 5G04L 5KXDA 1UZZA 1XOYA 2GP5A 1XNDA 4M00A 5A3TA 5FQ0A 2EXHA 4N53A 4QB6A 2OQ6A 3THDA 4CCJA 3ILFA 4XTMA 1X50A 2RJLA 5FPAA 2WZR3 4KWLA 1O5LA 1A3KA 2PHXA 1PNFA 5JSOA 4XJWA 3O1RA 4LO5B 3MUZ1 4ARXA 2ID4A 5FY0A 1PGW2 1OXCA 1NCRB 2DCKA 4YFWA 3ZVXA 4C91A 1UXXX 2BGCA 3IDBB 1GOFA 4FCAA 4SBVA 3VZOA 1YHFA 4Y33A 3JBG3 5F2WA 2VNOA 3OB8A 1J58A 3VDDC 1YI7A 4FPKA 1STMA 1JU3A 1V00A 3H3LA 1W6QA 3T1LA 5JZGB 3KWVA 1YYNA 1OSGA 4Q0UA 5FOBB 1W8TA 4RQPB 2RDSA 4Q4Y3 1AR72 1PIV1 5ABJA 3GJBA 2JE7A 2BOJA 1VB4A 3V65A 3OBRA 2XJSA 1GZCA 2FD8A 4R4ZA 1MS3A 3HT2A 1I9RA 2HWE3 1BXHA 2F17A 3ACHA 2OXBA 4QPIA 4TN7A 1WCSA 4LBQD 4E4DX 3DN7A 5LY2A 1RUG3 4QM8A 1BBT1 3MIGA 3OD4A 5FZ8A 2XLFA 5CKMA 2JKXA 2ZEXA 3I3BA 5LEKA 3LSEA 4NMIA 2VTXJ 4CP2A 3H8UA 5IVEA 2ZKNA 1IPJA 4LULA 4CDWB 4HZFA 5F37A 5IHRA 2VBBA 5A7NA 1LHWA 1KXGA 1PO11 1AXZA 1SG3A 3WUCA 2Y6HA 3OEAA 4AW7A 4BM8A 2PFWA 4Q8KA 3U4SA 2QKDA 1AR81 1RC6A 4P08A 1S4CA 2V4VA 3VD7A 4IE4A 3W21A 5AFEA 4CDXA 2BU9A 2EVXA 2ZX1A 4I09A 4JRLA 3I2OA 1U5XA 3JU9A 1DZTA 1LOFA 1TG7A 3C2UA 4QKBA 4W50A 4MXWA 2Q8CA 5FBJA 3KHBA 4BQXA 1D4VB 5DZFA 4EV0A 2DFCA 3SH4A 3NJXA 1KJLA 1QXRA 4QPWA 2F4PA 2I74A 1WWYA 4QB2A 2HWB3 2RS12 1YQ6A 3VB9A 3JB4C 4JKKA 4I30A 3BN6A 2A1XA 4XCAA 1QQP3 1V9U1 2AH2A 5IK5A 1Q8PA 1GKBA 2C0ZA 3WEZA 1H30A 2Q8EA 2JDYA 4WM7B 1R1ZA 2ZGKA 5L9BA 2GU9A 3POYA 4AF9A 1EV12 2GMEA 2VNGA 1RJ7A 4V2VA 3RNSA 2RM22 3D82A 2IXLA 3JZVA 5J98B 5L7OC 1SLCA 1VJ2A 2XLAA 3WQ7A 1YFYA 3V0BA 3JD72 1PO22 1TEIA 3TWIA 3ACIA 3LGRA 1SACA 3UV9A 2CU5A 3RMXA 5DQ0A 2ET1A 4IV3B 2P3IA 4GMP0 3LDKA 4CSWA 1RJ8A 3AYEA 3PL0A 3U07A 1J3RA 1PK6C 5B4XA 4RGGA 3C7EA 2CGNA 4HSJA 4XBQA 2W1UA 4FOWA 3OSDA 5KHJA 1SPPA 3AXDA 2CAUA 1DQ6A 4NHXA 1DGWX 5IUQA 1SMVA 4Q0VA 4XC9A 2WQ8A 1H9WA 4XQWA 3LB9A 4A3XA 2YBSA 1TNFA 1WMFA 1PK6B 3FBYA 5FYCA 1OF3A 2PHFA 3ZFGB 2GC3A 1H4GA 1ZZ9A 2BZDA 3UGFA 2NM1A 1RMU2 4Q0PA 1DLCA 3UGHA 3U0ZA 4A44A 3GBWA 3ME2A 4K3UA 1B09A 2ZHKA 1ULOA 3MV11 4FSJA 3THCA 3M70A 5C4WC 1IPKA 5FK7A 1JU4A 4D8MA 3IMMA 5BNOB 4H7MA 5H9QA 2G9ZA 5I8TA 5C8WA 3AJYA 1PIV2 3FFZA 3PU3A 1UYXA 1OMIA 1N3QA 3PTYA 3CO2A 2W92A 1W8ZA 3I2IA 3CZJA 2ZMNA 4XJ8A 4CP9A 1K5MC 1WW5A 1H2KA 4CEYB 1V0AA 2RR13 3AKPA 5JLVA 1WA6X 2X5IA 2ZKLA 4K40A 5T52A 4AQSA 2ARXA 1WA4A 3AYAA 4QAWA 1KDKA 3DPRB 1SFPA 1JH5A 4IEZA 3HQRA 1HXS3 4H2AA 4HK9A 5C70A 5J37A 2CWSA 2WN3A 1XQNA 3AFKA 1R1A1 4FQ4A 4YVWB 4UFHA 4CXWA 4DPNA 3T09A 5FZ3A 5JXJA 2RDNA 1PO12 4WM8B 3ZSJA 1SLLA 5DG2A 4JQTA 1QH6A 2BFUS 5FYYA 2XXZA 5FZLA 4FPCA 3SISA 2PMWB 3I2KA 3RRDA 4A3ZA 1AR82 3ZX7A 1Y9GA 2ETEA 1JXNA 4O9GA 3A7QA 3I97A 1UO9A 2QQMA 4GKYA 5DABA 4BQ2A 2VMDA 1RUE1 1WD4A 2BJSA 3ACLA 3AM2A 1ONAA 1FX5A 1GQPA 2AACA 2XGXA 2VZOA 3LZZA 1VR3A 5IAVA 1VALA 4DXTA 5LBCA 5JUVA 5FZIA 4AGGA 4YM0A 1I5PA 3AKTA 1O7FA 1GZTA 2BQPA 5EPAA 2W39A 5JXGA 3VBFC 1JZ5A 5FLIA 4H3WA 2W46A 4WBBA 4YZ1A 1YQ5A 2O14A 5APAA 1LKNA 1V9U2 1RUC1 1SDDB 1IS6A 4UFLA 4V2WA 3UJQA 5C3OA 2GAUA 1CAWA 3AMNA 3M3IA 5DUWA 1SDWA 1TMF3 1W2TA 1AF9A 3IAPA 3OYWB 5BY5A 4KBBA 2UYAA 1D2QA 4LKDA 4LHLA 2QQJA 3IT8A 4WV8A 4YYOA 4WVVA 4FFGA 1LOCA 2VVEA 1W39A 3WXPA 4ASLA 3A0KA 1NXMA 3W5NA 3T2TA 3EBRA 3LA2A 4M0HA 4XJUA 1W28A 1ZRRA 2FCTA 4E27A 5BNPC 1NY71 2UY8A 4HKLA 5I91A 4CCDA 3MIHA 3FHIB 3ETQA 3O5SA 1EPWA 2Z79A 1VAVA 3AMPA 1RVF3 4AFMA 3J8F3 2VCCA 1K3IA 4BK4A 4QPGA 1DGWA 5HV0A 1POV3 1V6IA 4GH4B 4NRQA 4NWWA 1Z78A 4RD7A 3T4HB 3G7DA 4UI9L 1X82A 3T08A 4ZZ8A 3KV9A 1YQ8A 4G3YC 1C8NA 4ASKA 1OA4A 5ACA3 4XBNA 1VRH3 4MSVA 2JDMA 4DUWA 2VY0A 1FV3A 2WSUA 2Y33A 3H42B 5LB6A 1GP4A 2ZX0A 1MS8A 3PMEA 1LHUA 3MF9A 5C5TA 1I6XA 5JPMB 3Q8FA 4J1WA 1JYXA 5FFOC 1JN2P 3I59A 2D3RA 2Q1FA 1ACCA 3AP5A 4A6SA 5IYYA 2J7MA 3TYJA 2G9GA 3ECQA 1HJGA 5FO9B 1CJPA 2FDIA 5K0UA 3AVSA 2JECA 1W2UA 4AVTA 1SBEA 4AAXA 4ZU4A 5E16A 3W20A 4CP0A 4CUCA 1NKGA 2WIIB 2R063 3URFA 4ZY9A 2YPJA 3N4MA 3M4FA 3GZAA 4OMCA 2DYCA 4FTEA 4ISRA 4M3CE 2JG9A 2VNRA 1A8MA 2QZ2A 5AC93 5C9AC 3D3AA 4MH0E 1NQDA 2D44A 3O1SA 1FT9A 3POSA 4FP2A 4H14A 4N7IA 3ZMNA 3PLQA 3WP6A 4ASMB 1R1A2 1ND2A 4BE3A 2ZABA 5F2SA 4BQ3A 3TEWA 1NA1C 5FUNA 2BYVE 2WA4A 5DMYA 2OX0A 3GBGA 3DYMA 5I0UA 1AR61 4DRRA 1RUOA 3MLKA 1MQTA 4NUBA 1HIXA 3WD5A 1RMU3 1NE6A 2C1FA 1JZ3A 3LEGA 3S5QA 4NAOA 3WG3A 1RUE2 4XFCA 2OKXA 1NQJA 1OD5A 3UT0A 3RPQA 3NSTA 2DF7A 3T0DA 2XVLA 3ZIXA 3WDTA 2GN7A 1U5ZA 3J7MA 3WDUA 2IZWA 4N53B 5CNAA 5HV4A 4YZ5A 5A7WB 4NRMA 3JXSA 1S0JA 1I3HA 2A75A 3ZYFA 1VBB3 5JMOA 2ZOEB 1VP6A 2HH9A 1LOBA 5FJHA 5T5PA 3VKMA 1RUC2 1CX4A 2VOWA 3QBQA 1C8M1 1HQWA 1NCRA 1V6JA 1O8SA 2V09A 1ENSA 1ENXA 2XWJB 4KGQA 3N36A 5JSPA 5ABJC 1LNSA 1RUD1 2W2IA 2ERFA 4Z92B 2JD9A 5JZGA 4COYA 1VAMA 3SQOA 3N35A 4XURA 2BUKA 2VO5A 1NY72 4RQPA 1GUIA 5FZAA 4QQ2A 4CEWB 1DGRN 1QEXA 2EAKA 1O3RA 4OI4A 4QPIC 1OBNA 1RUI3 4KWUA 1KFUL 2WNVB 2RJKA 2WZR1 2YZ4A 4XDQA 3FFQA 4W6XA 4YW2A 2YU1A 3EO6A 1EUUA 4KI5M 4P5HA 2VC9A 2VMFA 3LEKA 2DU0A 3NKTA 3WVJA 4BCUA 2D43A 2ZCWA 4CUGA 2GNBA 1W0NA 3KSCA 2J1RA 4HG6B 4IEVA 3WNXA 2EA7A 1J3QA 2HWF3 1SLBA 5A3WA 4RFT0 4Y4YA 5FREA 3THPA 3N7KA 5JIUA 4CDWA 3DYOA 3JBG1 3SC7X 5FZ0A 5HCBA 1VLNA 4Q1PA 4DNYA 3MEPA 2OT7A 4HKWA 2K9ZA 4URTA 3U37A 5FYSA 2R1BA 1AXKA 2VL4A 4ZXKA 3ZN6B 3HPNA 4Q4Y1 1ZZBA 2BRTA 2K46A 1LOFC 2WFPA 3HMYA 4JRAA 5I93A 1LU2A 4K9SA 5IK8A 1ULGA 2VMHA 1M4WA 5FYBA 2QQLA 3C7GA 3AKRA 5EP9A 2IXHA 2HWE1 4CDXB 5FXXA 5HXMA 5JSRA 1D4M3 1NG0A 5C8CB
chains in the Genus database with same CATH topology
2VXRA 4Z2WA 1RUG1 2B9UA 1FXZA 1HW5A 1RINA 1UU4A 2VU9A 2Y38A 4EN7B 1DGRA 3FLTA 4R9BA 3MW4A 4AI8A 2MPFA 1YWKA 4P9YA 3CEWA 4JVAA 4WM7A 5T5JA 4AQ6A 2PELA 3HD8B 4D94A 2VMGA 3HT1A 3UKNA 5JOWA 1YRZA 3H3ZA 2X53S 1M06G 1HV0A 1OFNA 4AVAA 2AR6A 2NQYA 1XU1A 5BNQA 1NZCA 4XXPA 2XJUA 2OUHA 4BMBA 1AX0A 1A6CA 1X36A 2HWB1 3MLLA 4XXAA 4XF9A 2ZGLA 5GLZA 4IV3A 1QQP1 1POV0 2B39A 5A33B 4XEZA 3UL2A 1J3PA 4XJAA 3AMMA 1VBA3 3ZXKA 5JOZA 2ZHNA 2EAAA 2DTYA 1S0DA 1ZZ6A 2IXCA 1R083 4ZU7A 1YI9A 2YUEA 4XF4A 4LO4B 3IWZA 2ZMLA 2WQ4A 1B35B 2Y0IA 3O7OA 4YZ3A 1Q3EA 3RYPA 4XFIA 1HQNA 3EQEA 4Z1VA 1NOVA 1JUHA 2X29A 3PVEA 4I0BA 5BNOA 3IDEA 5K9YA 4YSFA 4WVMA 2X5IC 4JC1A 1V6OA 4P9IA 1LECA 2WZR2 1XE8A 3VBRA 3QH6A 1EAH2 4Y1UA 5C33A 2H6BA 4AI0A 4UW5A 2Z42A 1IOAA 3BU7A 4F83A 2IXJA 3NO8A 3DPRA 2G4IA 4TYSA 2ENRA 3MFCA 1G9FA 5EWSA 1WMDA 3H50A 1EPZA 3JBG2 3LCPA 3OD0A 1MZFA 4YVWA 4LO7A 4SLIA 4WM8A 3O0VA 1GBGA 4XHXA 4AHZA 3ZO0B 3IPVB 1D2SA 3I7DA 1MEC3 1QJU3 3WDXA 1O3TA 5CAZA 3CLPA 2YHJA 4FXGB 4K20A 1ENQA 2RR11 2VUAA 1AYM3 1IZ3A 5JOYA 4BHPA 1T6GC 1SCSA 1RUG2 2Q30A 4U2AA 2E51A 3ZDSA 4BYYA 4PDWB 1HXS1 4IQPA 1GICA 2UWAA 1JUIA 1UF2C 3ST7A 3WG2A 1NLSA 3HWJA 2CV6A 2JDZA 2D6NA 1PMIA 4HFSA 1AUYA 3OYWA 4MYEA 4M3CB 2QE3A 5E1RA 1UAIA 4HT1T 4JTOA 4UBGA 1CQ9A 3APBA 4QGMA 3V56A 4RGAA 4E2QA 4S2HA 3WY6A 1YIPA 2FQPA 5AFBA 1UCXA 1H0BA 4G4FA 1RITA 3WDVA 4HVQA 2O1QA 5TSWA 1QQP2 1S0IA 4QPGB 2QQPA 2RMU2 1TMF1 3M3CA 4F7ZA 2BWCA 4ZU5A 3ZYRA 4FPOB 1RHI3 3R6SA 4FTSA 1HX6A 1XYOA 4KG0A 1LHNA 3QD6A 1S2BA 5T5OA 5BXXA 4AYUA 1QHDA 1BJQA 1PVXA 2P2KA 2A6WA 4META 5K0UC 2XUMA 2EIGA 1RVF1 2DVBA 1N1VA 2YDEA 3J8F1 3KQRA 1JW6A 1YJLA 3VBHC 4KGGA 1OA3A 5JWPA 1MR5A 1POV1 1NCQB 2A6ZA 2GALA 4IETA 3D6EA 4NO4A 4YARA 3KZ4C 5KWRA 4Y24A 3WCRA 5J36A 2A71A 3AP6A 5ACA1 4GB33 1XYPA 1VRH1 3ILRA 3HBZA 3NVCA 4AI3A 1VB2A 1AHSA 2ZHMA 4OLLA 4OZXA 3MPBA 1FPN3 1ND2C 3U10A 2JG9B 3QACA 4K6BA 3WHTA 3ZXJA 1MQTC 2GH2A 5CADA 1ZA4A 3MW2A 4N9IA 4AHXA 4TSVA 2D97A 2XJPA 4D3WA 1AYN3 1ULDA 4D7SA 1YIFA 3LKJA 2CYFA 3VBUB 1AJKA 2R061 2VQ0A 1MVEA 1NE4A 3VL8A 1PNGA 3NAPB 2RR12 3GBFA 3IKWA 4UW3A 4Q4W3 5IK4A 4K7JA 1BKZA 5BPXA 2R16A 4A2UA 5K7PA 3IBMA 1QKQA 4MV2A 3O14A 3VL9A 5AC91 1J1LA 4G9SB 1HXS2 4RR3A 1NCRC 2GNMA 4KU7A 1EAH3 3J9SA 4EWDA 3OY8B 1X8MA 1QOSA 4S2FA 4AFAA 2HEYF 4E9KA 2UYBA 2QNKA 5JZGC 4YGDA 3AP7A 4PLOA 2E7AA 4RQPC 1RMU1 4XW3A 2H6CA 2Z2SB 4AVSA 5CFCB 2VMIA 3U11A 4EN8B 5CU1A 3FUQA 2A70A 2FZ1A 4AVBA 1OPMA 3E5QA 3N7MA 5J7MA 4IESA 3UKVA 1LOGA 1SBDA 2OZJA 4EROA 1RUJ3 4CEWA 1CPMA 3RQ0A 3MGUA 5E8AA 2WNVA 4FBFA 5JOXA 1S55A 4YM2A 4FPYA 1VBB1 1W6PB 4I0AA 4AI2A 2ZTNA 2MEV3 5HCFA 2BBVA 4CDWC 3ASIA 1TMF2 3VKNA 2Q1ZB 4P9LA 4LLFA 2DUPA 3S30A 3VN4A 4GWMA 2HWD3 4Q26A 3LSDA 1W6NB 2R32A 2CWMA 4OULA 1COV3 4N90A 2DFBA 5HXVA 3ZN6A 1V70A 1WW6A 4JTNA 4Q2FA 5I8SA 2Q0AA 4AEMA 5A32A 4L8QA 2AENA 3FMGA 4LA3A 4YRDA 2AGSA 1RUI1 4XJ9A 1RVF2 4BPZA 3J8F2 5I0SA 4PBOA 2WL1A 4AFBA 3GALA 5FLHA 2TNFA 5CG9A 5C8CA 1G9DA 2UY9A 3D8CA 4Z8BA 3D4KA 1C1LA 2B46X 1GSLA 5JMCA 5ACA2 2HWF1 2PHDA 4WM7C 1VRH2 3D5OA 2ZGUA 2W68A 4R9DA 1H8TA 1Y3TA 4K21A 3S0MA 4PJYA 2RMU3 4FPFA 2CNAA 2ZGMA 2W0XA 2XB6C 2WT1A 1QXJA 1DLLA 1REFA 2D98A 3WUDA 4RSUA 3CL1A 5HCAA 1Q8VA 4AEDB 1CR7A 1D4M1 1FAYA 4XE9A 4YW3A 1AL0G 1TME3 5F1RA 4IV3C 4MVTA 5CFDB 1E57A 4EWAA 4AQ2A 1X7NA 2R062 3TNQA 4K1ZA 5GLWA 5A33A 1LOAA 1H2NA 5FPXA 1G9CA 1JBCA 1VBD3 1U12A 3MYXA 3PHMA 4OI1A 3ZXLA 1LENA 1KS5A 4DS0A 3AZVA 5AC92 4YG0A 5JI7A 3ZFGC 3SHRA 4ES9A 4FP3A 4OVEA 1XU2A 3FLPA 1ULFA 4Q4X2 2RS53 3HN1A 1DQ0A 2VW2A 1B35A 3W58A 4N43B 5BNOC 2WC2A 2V73A 4I01A 3KCCA 3W59A 3ZMOA 4CEYC 1GLHA 1DF0A 1WLCA 5HI0A 2R073 2ZGTA 4I0WB 1HKDA 2QUOA 4DOUA 3MLJA 1VBA1 5IK7A 4WVMB 3E97A 3DPRC 3KM5A 4E4SA 3H7JA 3VBRB 1VBB2 1XRUA 2R0FA 1UIKA 4JCKA 1R081 2PTMA 3LA3A 4OUSA 2QDRA 5EV7A 3ZYIB 3WLUA 4YVWC 3AP9A 4R4XA 4WM8C 3EJKA 2GN3A 2H0VA 4TZDA 2DVDA 3VHPA 5GJ6A 3DKWA 3M2MA 4KU8A 4P9WA 3NWKA 2GC1A 3PVOA 4AGVA 4B4PA 4CYDA 4DQAA 5KHGA 3IPVA 1GQHA 1RUI2 1UPIA 1QOTA 3ALQA 2JG8B 5GALA 1DZRA 1APNA 2GNDA 2NMOA 3SH5A 4BH9A 2PAMA 4PDWA 3VBOB 1QU0A 2HWF2 4FPJA 1SBFA 3PNAA 3USUB 3WW4A 3G6JB 2BW8A 3ZFEA 1CAXB 1SFYA 3RZZA 1WD3A 4MUVA 3T1MA 1YUDA 4M3CA 2A6VA 1F31A 2VVFA 2WKKA 4XF1A 3AX4A 2CTVA 1XNCA 3VBSB 1MEC1 1QJU1 2RE9A 5B2GB 4YG3A 1OOPB 4IEUA 3LA7A 2K0GA 2PAKA 1DFQA 5A3LA 4YNIA 2YY1A 1AYM1 5T3NA 1D4M2 1JOJA 5EXOA 1Q5OA 4H55A 2XHKA 4KH9A 3BALA 4GH4C 4HK8A 4HPKB 3D0JA 1DHKB 2Z69A 4LBNA 1KD7A 3TRSB 4C0BA 1C4RA 2Y26A 4Y1XA 2JJ6A 4FPLA 4P9GA 5E88A 3ZPYA 1ND3B 3AP4A 1QJY2 4XETA 2ZMKA 2HWC3 2LTNA 2E7QA 1DU3D 1UKGA 1AR93 1CPNA 2ZZQA 3GYDA 1FI2A 1G9BA 1IGOA 1X8EA 4K8FA 4RS5A 2D7FA 4X6QB 1XNKA 4XHBA 2YC0A 2P34A 2WZPP 1DG6A 5BUVA 5BV6A 4KQ7A 5JIAA 1I5ZA 1NCQA 2IWGB 3FX3A 5DUVA 3FBMA 1WCKA 2UWCA 5FMOS 4IEXA 1G7YA 1VBA2 4GALA 3RMYA 1RHI1 3FC0A 1HDKA 2FBEA 2I07B 1Q8SA 1R082 3JQXA 1JHNA 4CP1A 2GMMA 3N7JA 2O8QA 5KHKA 4AVCA 4EN0A 2DWRA 5JCTA 1O91A 4OFGA 4LO6B 1CESA 4PBPA 4A7ZA 2XL7A 2AYHA 3MIEA 2E6VA 4QQHA 3ZXDA 4XILA 1UMZA 4UXAA 3ZSEA 3MIDA 3BCWA 2O0OA 2ZAHA 4Q4X3 5EZWA 5JDBA 2UU8A 4D69A 3CJIA 3VBUA 1D0HA 4PCRA 1CGPA 4GB31 4N53C 4ATFA 2E63A 3NAPA 1JYCA 2R043 5GLVA 4FOVA 2OZ6A 4RR3C 4R52A 1BCXA 4PIZA 1FMD3 1VAKA 1F5JA 2D40A 1C5IA 1FPN1 2GZWA 4HBNA 2YMZA 4XBLA 1W6OB 2LUWA 3JQWA 1QNWA 1UPSA 1BK1A 5IT6A 3NV1A 3OY8A 4RR3B 1S0EA 5FRAA 4RA0A 2ZBJA 3VHRA 3RG0A 1AYN1 2XKOA 3OPZA 1C1FA 1TE1B 2HEWF 3IN9A 4CEWC 1MEC2 1QJU2 5CFCA 1ULEA 3AZWA 5FLJA 4JGYB 2BFUL 5GZCA 4A7KA 2WNVC 4KL1A 3OJBA 3MDPA 1AYM2 1U0AA 4ATEA 4Q4W1 4IL7A 3UJOA 1QDCA 5FTTC 1GNZA 4C1XA 1XXNA 2IC1A 2Q5TA 2HYKA 1DQ4A 1ZREA 1EAH1 1W6PA 4IEQA 1I1EA 3ENRA 3WW3A 3VZNA 1LCLA 3WZ1A 5T5LA 3KT1A 4YZ2A 2XWBB 2R6QA 4F8AA 2DURA 1W0PA 4KG8A 2R1DA 1W6NA 2JD4A 4LUKA 2ZPXA 2IXIA 4PLNA 2D6PA 1RUJ1 4CDXC 1LEMA 5EYYA 2EXIA 4NHLA 2PHWA 3ILNA 2DVFA 1LODA 5A32B 5C8CC 3VZKA 5AVAA 1YXWA 2RS33 1ZBA3 2W52A 4AEJA 1J1TA 3KLSA 3KCYA 1CONA 1ZNPA 2FMYA 2MEV1 4W65A 4AFCA 3KD4A 4MX3A 3VKLA 4PIXA 4XFBA 3TOJA 1RHI2 3DV8A 1QGLA 1V6MA 2HWD1 1BYHA 1MACA 3D0SA 5EFUA 1COV1 1H8TB 3QCWA 1BEV2 1EYBA 4JV4A 4L99A 4KWJA 2ET7A 3ZXFA 2VG9A 1QJX2 1NXD1 4XF0A 1DQ2A 1V6LA 4NHKA 3AZXA 5DDJ3 1QJY3 4FO9A 3L2HA 4MGZE 4ES8A 4AEDA 3BOPA 4NOTA 4X8PA 4ISQA 3NV3A 4XJZA 3FJSA 2D3PA 1REDA 4Y1YA 5FBZA 2DUQA 5CFDA 3A0NA 2VVDA 4XFAA 3WW1A 4GB32 4OHVA 5FMOL 4DY3A 2MHFA 1RL3A 1UL9A 2VPVA 1FPN2 2RMU1 1PZ9A 3WCSA 3EHKA 3SLIA 1UU6A 2OIIA 4L9BA 4AG4A 1Y7BA 3WT3A 1B35C 1R093 4M01A 4YVSB 5AVPA 4Y22B 2OVUA 1FATA 3W9AA 3PJYA 4E2SA 3BODA 2PQQA 3KGZA 4HLTA 1AYN2 3AB0A 3PVNA 4L2NA 1GYKA 4N43A 3ES1A 1TME1 5C6CA 1OA2A 1WW7A 3VHOA 2H0BA 4W6WA 3NJZA 4FTBA 5L73A 2WQZC 1VBC2 2BVVA 1F2NA 5BNNB 1VBD1 1ZRDA 4Q4W2 3H9AA 1N1SA 1MS9A 3MW3A 5BYNA 3AMQA 1S0CA 1N3OA 1GR3A 4Y1VA 1YLLA 5FPZA 1A8DA 1CN1A 2E7TA 4UW6A 2RS51 2ZGQA 3KS7A 2JX9A 1SFNA 4FAGA 3VHNA 4J1XA 2WS93 2XPJA 4B8EA 3BPZA 1DQ5A 2GDFA 1GQGA 2JICA 2IFRA 1S0BA 3ZSKA 5HBAA 2DTWA 3INAA 1QJZA 4YG6A 1RUJ2 4LTAA 4AHYA 4LT5A 1HRV3 2N7GA 4JGZB 3ZYGA 4I2OA 1ULCA 4FT8A 4RHV3 4PDWC 2JG8A 1LOEA 2MEV2 4PQ9A 2ATFA 2XG3A 4BLIA 1QF3A 3VBOA 3RSJA 1OLRA 3AFGA 1XYNA 1ZZ8A 1AX1A 3USUA 4QT6A 2HWD2 3VZLA 2KXLA 1CAXA 2D5HA 4YGEA 1OKQA 1COV2 2PHLA 2GC2A 3ZFEB 4FXKB 1ASJ2 4GKXA 2WNUB 2JXAA 3B02A 3MPPG 1FOD3 1WCDJ 4IXLA 3TN93 1DQ1A 2DCTA 3VBSA 4HKOA 1N1TA 3ZXEA 1OOPA 2SLIA 2WNEA 3R4DB 5T55A 4DINB 1ZZ7A 3SCHA 1WBLA 2VH9A 2A7AA 1MZ5A 4FOQA 5GZEA 2IFWA 4QPGC 1PM7A 1MS4A 1UX6A 4HPKA 1C5HA 2EXJA 4FAHA 3MICA 1MZ6A 2XVGA 2WFF3 3QOPA 4KWKA 4U36A 1O4ZA 4YW4A 4CTEA 3E6DA 5LK5A 3OF1A 5LRRA 4BWOA 1ND3A 2R30A 2TUNA 4PIYA 2OW4A 4LLOA 4XMAA 1W0OA 1V6KA 3HIFA 1LGNA 2ZGRA 4D7TA 3VZJA 2EXKA 5CVRA 2FZ2A 2D6OX 1BEV3 2WLPA 2WLQA 3SITA 1KDMA 1NCQC 1TME2 4HVOA 5DXDA 1QXPA 1QJX3 4RS5B 4Z07A 3ELNA 4NHMA 1BMV1 4CDUB 4LBOA 4GMP3 3IDCB 5CBLA 1VBD2 5T50A 2YXSA 1Z7S2 4XQ4A 1O4TA 3M1HA 2JG9C 2B8MA 1UU5A 1GFF2 2TBVA 1LESA 4LNVA 4B4RA 1GNHA 2AUYA 4S2GA 1WBFA 2HWC1 2RS52 4Q1RA 2ZX3A 1AR91 3B94A 2HEVF 4NVPA 4LE4A 1UIJA 4BOWA 3NL1A 2ZX2A 2QVSB 4FPEA 4LR4A 3VBUC 5D8AB 2ZZJA 3I2DA 1BQPA 1KITA 1WGPA 3MFAA 3NAPC 2R072 3B69A 1PGL1 4B29A 2LM3A 1ZBE3 1CJDA 2JENA 3DUIA 2XBO3 1LHOA 3CJIB 2VGDA 5SV8A 1AJOA 3B3QE 1DDLA 1VBC3 3KGLA 1ZM1A 4IV1B 1OLQA 4LA2A 4YW1A 3BB6A 4LBLA 1W6OA 2NMNA 2PLV3 4L11A 4Q29A 5F9TA 2B42B 4Y20B 3WG4A 2ZA9A 1J59A 2C5DA 4COZA 3GNEA 4WZCA 2WA3A 5C9AA 4QD2A 5CFCC 3DF0A 4TLFA 5H9PA 4Q4X1 3ZN4A 2XL9A 1QDOA 5I0RA 2CY6A 4M3CF 1Q43A 1VBE3 1XE7A 2AREA 2BWAA 1CAVA 3POWA 1RUD3 3FUOA 4JGYA 5FO8B 5J09A 1D0GA 1EY2A 4UW4A 2R041 2ZGOA 1RUH3 1YFXA 1FMD1 3ZYPA 3ZFFB 2D3SA 3WX5A 4DFSA 1OQDA 1YJKA 5JPNB 2VW0A 4Z82A 2A73B 3FLRA 1PVC3 3OGGA 4HN0A 2WWSA 2HJIA 3M3EA 2CAVA 2DVGA 3GF6A 3E6BA 4QQLA 3AK0A 1KS4A 4BIFA 2CGPA 1MVQA 4GIQA 2WJSA 4WVWA 3AZYA 3AMHA 5KXEA 1REEA 1SCRA 3WW2A 4AK3A 1RUF2 5LRSA 4W6YA 4FOYA 4AXOA 1ASJ3 4XTPA 3N3HA 1RTVA 3S6PA 2NYYA 1H1AA 3VDDB 1CVNA 2HKXA 2VW1A 1BMV2 3R4UA 5LEJA 1RIRA 1Y9QA 1Y43B 4MXVA 1MZEA 3SNMA 2OUJA 3UKTA 1UD1A 1ALYA 1C28A 2UWBA 4XFHA 1LHVA 2DCJA 1G9AA 3I54A 5FQ0B 4Y26A 3RI8A 2HWC2 4JDMA 1U5IA 1PHMA 1AR92 4V1PA 1MS0A 1G8WA 2VECA 2Q8OA 4AEDC 4COUA 1DIWA 3L2YA 3TAYA 3GHNA 1FV2A 3N7LA 3PVBB 4YFZA 2P37A 4Q4V3 2RS31 1IKQA 3M8LA 1ZBA1 3OCPA 2E9QA 5CFDC 3B9IA 1KRIA 3S7EA 1DYKA 4XQDA 4QU2A 3TNPB 2RHPA 1PGL2 5I0TA 1OHFA 1F8VA 2F6BA 1HRI3 3RS6A 2BPA2 2D5FA 2O8OA 2EALA 3GZUC 4R9AA 1EP0A 1XNBA 1AL23 1HLCA 2DVAA 2WINB 4YZ4A 4DXZA 1KQRA 1H4HA 1Z7S3 4GXLA 4YVSA 2JE9A 4Y22A 3WDYA 4N43C 4HSLA 5DDJ1 1QJY1 2ZAAA 4I3GA 3B93A 3WP3A 1HQLA 4YM3A 4GWNA 3VZMA 2KA3A 3WR0A 3AKQA 3OBTA 4DMIA 1Q8QA 2ES3A 5L7OB 1DGLA 2R042 2CGOA 5BNNA 5J3UA 1S0GA 3VBRC 1FMD2 2GNTA 5F6KA 5GLTA 3DL3A 3H1MA 3H1YA 4QQOA 1OI6A 1H9PA 1R091 4AHWA 2A6YA 5KXCA 1H2LA 4BLJA 1SEFA 5CB7A 3ROUA 5KHIA 2XLGA 4JQRA 1RUNA 4AGRA 3ES4A 2PHRA 3EXUA 3MIFA 3P3PA 3NKGA 4XMIA 5KC6A 4UBHA 3WV6A 3R4SA 4CDQA 2NZ9A 2B5HA 3V0AB 2JG8C 3O12A 3RJRA 3LWCA 4JGZA 1WW4A 3J26N 2BVBA 4O9EA 5C4WB 4GULA 3VBOC 4P14A 4WVZA 2VQAA 2ZGPA 4YW5A 1BBT2 1PGSA 2XJRA 3HAGA 1CAUB 5FAXA 1K5MB 4IEWA 3UK9A 2WS91 1SLTA 1UZYA 3TB0A 2XVKA 3VBSC 4HETA 2DCZA 5JVVA 1OOPC 2WNUA 4KNCA 4QGNA 1VIWB 4QQPA 1HRV1 2KM2A 4I3PA 3MIBA 3KT7A 3QH7A 4MGKE 2VOVA 2RS32 4RHV1 1ZBA2 1RUF3 4Q27A 3LAGA 2GH8A 1AR73 4XYXA 1WLDA 2ZGSA 4GA9A 3AJZA 2BTVC 5J96B 1GZ9A 3VLBB 1WLWA 1IS4A 1ND3C 1QH7A 1S0FA 4OI2A 1LU1A 5A3MA 4YGBA 1GZWB 4AVVA 3VBFB 2DUOA 1FOD1 3TN91 4LBQB 3K51A 3H0OA 1SLAA 4B3NA 3IIAA 5FCCA 1O4YA 3WP5A 5DDJ2 2PA7A 2V5YA 5CIRA 3K48A 2QZ3A 1TNRA 2GC0A 1W6MB 5JI9A 3NV4A 1N1YA 3WQ0A 5H9SA 1BVP1 4CDUA 3HR9A 5BNPB 4J6GA 2YYOA 4BMEA 2WFF1 3AYCA 1YCIA 3BTAA 3I4IA 1OQEA 2EF6A 3BOWA 2YV8A 3OGJA 1R092 1IKPA 3C3VA 2RS13 3S7IA 3LOBA 4QGLA 4RL7A 5CA6A 4XF3A 4YLZA 4XIOA 2PHUA 3VUOA 1BEV1 1EV13 1QJX1 5D8AA 3J4UH 1C57A 2RM23 4NN0A 5GLUA 3ZIWA 4ITCA 4COVA 4GMP1 1V6NA 4ORFA 4FVVA 4OUMA 5FO7B 3VBHA 4MLOA 1WLTA 2D6LX 4LBJA 3H3UA 3JD73 2OYZA 4C1WA 1PO23 3WP4A 3HQXA 1IQAA 3R05A 4IV1A 4AI1A 4XFFA 3E5XA 4MZUA 4DRVA 3RJ2X 4AQTA 3IMNA 4Y20A 1CIWA 2WS92 1Q56A 4AEKA 3RYKA 1O3QA 3H1WA 4XIKA 2A3WA 2OPKA 4JGYC 1H1IA 5C9AB 3SCFA 4R8HA 1ZBE1 1H2MA 2XBO1 4FPGA 1HRV2 1SLIA 1NLRA 1LJ7A 4DY5A 3NW4A 4HANA 2JKBA 1NA1B 5GKAC 1CAVB 4RHV2 1YFWA 5L19A 1YNAA 1VBC1 3PMSA 4INDA 2A6XA 3ZFFA 3BIWE 4DB5A 1PIV3 4NR1A 4ZKTB 2PLV1 1PZ8A 2VUJA 2GMPA 5DZGA 2ZS6B 2VULA 5GZDA 4AFDA 4A7YA 5K8SA 2YROA 3WG1A 3H7YA 1JTZX 4FPHA 1BBT3 4QX5A 4E2GA 2ARBA 5DUUA 1FOD2 1VBE1 3TN92 3MI8A 3KB5A 1QWRA 2GSYA 2P3KA 3AZZA 4TWTA 1QOOA 2XJQA 4PLMA 1O5UA 1PO13 1W6QB 1RUH1 4FQZA 3VV1A 4NWVA 4XOGA 4LUMA 3WHUA 5ABJB 2B7YA 5T54A 1AR83 3VDDA 1PVC1 3ZXAC 2BNOA 3X29B 4LE3A 2QDNA 4PF5A 4D7YA 1IS3A 2WFF2 5KC5A 5KBFA 4YGCA 4N7UA 4QPIB 3QLQA 4GQ7A 5H9RA 2X8KA 4WZFA 3TBDA 3Q9OA 1H8TC 4NPRA 4R9CA 1S1AA 3VKFC 2NPIA 5I8YA 1RB8G 1LEDA 3JUUA 3U4XA 1KFXL 1OPOA 4LBMA 3VGIA 5FQ0A 1V9U3 1QNYA 2BNMA 2D93A 4BQ1A 4Q0SA 5FOJB 2ILMA 4OHXA 2XH6A 4P9XA 2MNGA 3DGTA 1ASJ1 3WOGA 2E53A 4S2DA 5SV5A 2K2SA 4OHWA 3R0RA 3FZ3A 3A4UA 4K1YA 4MXWB 3USSA 1G6NA 2OA2A 1IHMA 3B01A 5DG1A 2LALA 1X33A 1C3HA 2DU1A 3M3QA 4YVSC 1JYIA 3MZHA 3CU7A 4EN9B 4X6RB 2BNNA 3B7MA 1RGSA 1BVVA 1LRHA 1N3PA 5CG8A 1L3JA 5E89A 3SH3A 4Q4V1 3ZSMA 4HN1A 4QPYA 1CD3G 1IS5A 3JB8A 4XZPA 1HV1A 1LTEA 1AR62 1ZBE2 5BNNC 2XBO2 4BZ4A 4OI0A 1YO8A 5JAXA 5LK7B 2PN5A 3V0BB 3RWNA 1HRI1 4CRQA 3B5LB 5L7OA 5D1IA 2IXKA 4IERA 3SMHA 1AL21 5J48A 2A5ZA 1Z7S1 2B45X 2PLV2 2R49A 2ZX4A 5F5QA 2W08A 3OTFA 1WMEA 4QHBA 1N47A 1ZVFA 1PZ7A 3E5UA 2QJVA 1OQ1A 1C8M2 1PK6A 3ZFGA 4CDQC 1DYPA 4JDNA 2XJVA 2PAEA 1VBE2 3FWEA 5F6LB 3GHMA 4HMZA 4BIOA 3M7AA 1RUD2 1R1A3 4JGZC 4CDQB 1GV9A 3V0AA 1OFSA 1RUH2 4MGYE 2P17A 4YM1A 4M0NA 1S2KA 3AKSA 5KHHA 1F9KA 2R071 5FDBA 4CEYA 1PVC2 2CL2A 3KMHA 5DZEA 5EYXA 5C4WA 1URXA 3AXEA 3O0XA 1RUE3 3CNAA 1ZYBA 1AVBA 1AXYA 3CF6E 1QMJA 2Q4SA 2X5IB 5L36A 1CAUA 2AZ5A 1K5MA 2PHTA 4LBKA 3ZFEC 5GM0A 2WNUC 1Q8OA 2QFEA 4AE2A 4HL0A 4EWEA 5GZGA 1RUC3 1QY4A 1U5YA 3MF6A 5DUXA 4Q4Y2 3FE5A 5GZFA 2UURA 1FNZA 1GANA 2ZACA 4IEOA 3WINE 2SBAA 2Z5WA 2NP0A 2YGMA 3JCIA 3P3NA 2I2SA 3NV2A 5JR7B 4P9JA 4COWA 1LULA 2HWE2 2Y0OA 4C0HA 1MS5A 1ZZCA 3SCGA 2XKPA 3V64A 2XJTA 4AWDA 3IM0A 1FYUA 2D6KA 2FMDA 2WSVA 4H7LA 2A3XA 4LHNA 1A78A 1UN1A 2I45A 2WT0A 4QM9A 4X8NA 5KXBA 4OHYA 4EN6B 3ZXGA 1LGBA 2P3JA 1O3SA 1GZWA 1UKRA 1CAWB 1PGW1 3VBFA 2ZGNA 4IEPA 3VKOA 3RYRA 2WT2A 4LBQA 4CZSA 3ZYJB 3SXWA 4ONUA 4Q4V2 4RS5C 1RUF1 4N9HA 4QXKA 1KJRA 1W6MA 4CDUC 1LGCA 3CJXA 3E6CC 4Q8LA 1AR71 3KCXA 4JAAA 1G86A 2HWB2 1HRI2 5BNPA 4DZGA 2VOKA 4GH4A 4EJRA 2Q1MA 1AL22 4B7KA 1DZQA 2QCSB 4B4QA 4I02A 1NYWA 4LO8A 3LOIA 2G9FA 5D8AC 4XPVA 2BEOA 2ZJCA 2ZHLA 4JDOA 3WQ1A 1ZRCA 1LR5A 3I59B 4XFGA 4Y5Z0 3CJIC 3THTA 4LEJA 4BA6A 4Y1ZA