2JDMA

Mutant (s22a) of pseudomonas aeruginosa lectin ii (pa-iil) complexed with methyl-a-l-fucopyranoside
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANASGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords FUCOSE-BINDING LECTIN PA-IIL
publication title Engineering of Pa-Iil Lectin from Pseudomonas Aeruginosa - Unravelling the Role of the Specificity Loop for Sugar Preference.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 19
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2jdmA00
2JDHA 2BV4A 4UT5A 1OURA 2CHHA 2JDNA 1OXCA 2BP6A 1OUXA 5A6ZA 5A3OA 2WR9A 3ZDVA 5A70A 1W8HA 2VUDA 4CE8A 2JDYA 2WRAA 2VUCA 5A6XA 5A6YA 4AOCA 2BOJA 2VNVA 1UQXA 5D2AA 1OVSA 2JDUA 1W8FA 1UZVA 1OVPA 2BOIA 5HCHA 2XR4A 2JDKA 1GZTA 2JDPA 1OUSA 2JDMA 3DCQA 5A6QA
chains in the Genus database with same CATH superfamily
1VBB1 5DZFA 3LSDA 5JOZA 3PMEA 1KFUL 4OI1A 5JXJA 1W0NA 1OXCA 1FT9A 4EQVA 2V5YA 4YZ5A 1W6OB 3MICA 4CP9A 1OOPC 4LIUA 3LPFA 2GZWA 2HEWF 3I2KA 1OT5A 1OQ1A 3LFIA 3OBZA 4D0QA 1H8TB 1DU3D 2RM22 3RZLA 4Y22B 3MUY1 2IXLA 1PX3A 2VOVA 5F8PA 4BQ2A 5C9AA 5FOBB 4OZOA 3PJYA 3NW4A 3NV2A 2DVFA 2Y6HA 3WF1A 4ARXA 2R061 4FFIA 1DCSA 4LMFA 5C7GA 1CESA 3VBOB 1OUSA 2P37A 3BOWA 1IG0A 1AXYA 1O7FA 1M4WA 3WG1A 1LGBA 1J1LA 2VW1A 3WF3A 3ZXKA 1OQEA 2J1AA 5C70A 1GP6A 4C1XA 5I93A 5GZDA 3WQ7A 3BCWA 1NOVA 1ZZCA 2DVDA 1K5MA 2PHDA 3NJVA 5FY0A 3HQUA 5J09A 1US2A 1BK0A 1B35B 4QU1A 1ZBA1 5C3PA 3ZYIB 1SLTA 3T2QA 5CA6A 2XG3A 4HKLA 3J26N 3J7MA 4KGQA 1D0HA 3BKZA 4HETA 4NHXA 1T2XA 2VCMA 4AHZA 4JTOA 3J7LA 2GMEA 3DYMA 1QJY2 4FI9A 4L97A 2ARXA 3VBFB 2ID4A 2RS12 2Y6JA 1RUE2 4K7JA 5T5PA 1ALYA 1OLMA 1HRI2 1VBA2 4RR3C 4S2HA 1G9DA 1A8MA 1VAMA 2BWCA 3VDDA 3QH7A 2AREA 4UF0B 3FN9A 4O7XA 2TBVA 4JTNA 2BV4A 2VOTA 4QKFA 3ZX7A 1EV13 1LEDA 1OFNA 2V09A 3JUUA 3ME2A 1XRUA 1W3VA 2DCJA 3WQ0A 1HRV3 1IHMA 2VXJA 3JQXA 1VRH2 1W99A 2BEOA 1SHWB 2LM3A 4IEOA 5CB7A 3SQOA 2RM21 5T3NA 2QQOA 5A7QA 3AP9A 3DL3A 3HN1A 3VL8A 1AL23 2VGDA 3VDDC 1KJLA 5ACA2 2Z79A 1QH7A 2PHTA 3APBA 4XTPA 1A8DA 3VZNA 1DP0A 1LHVA 3JXSA 2QQKA 2DV9A 1RUC2 2VXRA 3PVEA 2R32A 1YFUA 4YZ1A 1OA4A 3MDPA 4XF9A 3RDIA 1QJU3 1F2NA 4P02B 5FYVA 1CWPA 1XXNA 4AHXA 1X8EA 4QGMA 3POGA 5T5OA 2YROA 2WLPA 1Y9MA 2Z69A 1SFNA 2WFF2 3D82A 1W9YA 4IEQA 3RGBA 3SISA 3AM2A 4LKFA 3FMGA 1CX4A 3LPGA 1Q8SA 2B46X 3NRUA 4IL7A 1J58A 4WM7A 4XJAA 1QQP2 1YFYA 3KHBA 1JZ3A 5FPXA 2VCBA 1SCSA 4FPHA 5C8CC 1QJY1 2B4KA 4UYBA 4YM3A 2RG4A 1ZBE1 1UXXX 3CQOA 1RUE1 4P9WA 4AVBA 2JDMA 4BE3A 1VBA1 2VQ0A 4CDQC 1QU0A 1LOGA 2HWB2 5LA1A 1RITA 2JEMA 5FZGA 4META 5E1RA 2B9VA 1NUKA 2P6CA 3KT4A 3RRDA 4K8RB 3ZFFB 3D3AA 5BNNA 4WM7C 4D94A 3N9MA 1VRH1 2YPDA 3VD9A 1EAH2 4Q4W2 2HWC3 1GP5A 4LO7A 4FXGB 5CVRA 2V5DA 2ET7A 4ZU5A 2W92A 3IDBB 2P3KA 3MIDA 4HPKB 3IWZA 3UKNA 4YVWA 3J8F1 4CUGA 3AP4A 2EXKA 2Y64A 4IV1B 2OPWA 3F2ZA 2FDFA 2DFCA 4LKSA 5ACA1 1UL9A 4AR2A 1GOHA 1XC6A 3NNLA 3VBRB 4RS5A 2YU1A 2XDVA 5HCHA 2WO1A 4FFGA 2A1XA 1RUH2 3T4VA 4L9BA 2EXJA 5E16A 4RD7A 2HWE3 4ET7A 1QIQA 1H8TC 3IDAA 1RUC1 2WT1A 4IE6A 2ZAHA 4PLMA 4F8AA 4DXTA 2ARCA 4N9IA 4CYDA 3O1SA 4QPGB 3SXWA 4N53B 3MPBA 4GWMA 5AVAA 1MS3A 3B9IA 1Y43B 4QPYA 2W47A 2WFF1 4IEYA 4RS5C 4GKYA 4NHYA 3M1HA 4NHLA 1FPN2 4YGEA 1UY0A 4DS0A 2CU5A 1E5RA 3MUZ1 3PIJA 1WA6X 2FMDA 4LTAA 4N7UA 3DKQA 2A3YA 3AJYA 2EA7A 2R042 1NQDA 2XXZA 5FZKA 4E2GA 1IQAA 4MYEA 4QDQA 3PVBB 3E6DA 4K6BA 1GBGA 1VBE1 4MGIE 4UFJA 4W6XA 3W21A 2GC3A 5KHJA 5M0TA 4LK7A 1GP4A 3ZXAC 5FZFA 2HWB1 2RVAA 1L7RA 1RL3A 4IQPA 3FHQA 2XLAA 3E97A 3ZFGA 1Q56A 1T6GC 2R30A 3IIIA 3ITQA 3WD5A 2O14A 1NX9A 3GJAA 1OUXA 2W95A 5LBCA 1EYBA 2X5IB 1C8M3 1ULOA 2WWJA 1OLQA 1RC6A 2DURA 3ACHA 3B01A 2VW2A 3VBFC 4LBKA 4LEJA 2K0GA 4QU2A 4BIFA 1S0FA 1QJEA 1PZ7A 3PU8A 3ZPOA 2JENA 3VLBB 3O0VA 3IN9A 1YIFA 2WZEA 1BVVA 4CCCA 1FI2A 4M0NA 1RUI3 3OEAA 2FCVA 3ZSMA 4P9XA 3CZUA 3RYRA 1NZCA 1POV3 2W94A 2QCSB 3LQCA 3TEYA 2EXIA 1GMMA 4LHLA 4RQPB 1MS8A 1LGCA 3Q8FA 3IKWA 5F5IA 2J1UA 3KT7A 4JQTA 2JD9A 1ULEA 3BTXA 2D6LX 2XBO1 5FZEA 3MW2A 4OQ9A 4B7EA 1WW7A 4YW5A 2WNUB 4WZCA 1HN1A 1W8WA 5B4XA 1U0AA 4LITA 2IXCA 4CUAA 3PMSA 3THTA 1OPMA 1APNA 4JGZA 5DQ0A 1DYOA 2ZX1A 1FPN1 4AOCA 1LRHA 4LBJA 3B5LB 1J84A 4CDWB 4RYDA 2X8KA 3WVJA 1TQ5A 1RMU2 4GMP0 5FZOB 4PIYA 4PHZA 4AFCA 4CDUB 3LIHA 4QDSA 3I3BA 2ZGKA 4QX7A 1CGPA 2GSYA 2X29A 3WW1A 4FPFA 5T54A 4BA6A 1TEIA 1XOYA 4AWDA 3NJXA 4N7IA 4W8JA 4B4PA 2RMU2 2PAMA 3S5QA 4UW4A 3R0RA 1V6KA 1V9U2 4P08A 3ZFEA 3N9PA 4Q8KA 1YXWA 1AR92 1WZXA 1JU3A 1W8HA 2XLFA 3T3YA 3HNMA 3TN92 2G9GA 2CSGA 2BNMA 1VP6A 4UW3A 2BOJA 2WS93 3L9JT 4X6QB 4YYOA 4XC9A 1U5XA 1R1A2 1BHGA 5GZCA 5FY7A 1PIV2 4NROA 5FQ0B 2P3JA 3ZN6A 4DINB 1AR82 1DG6A 4LLFA 5JIAA 5CFCA 4V1PA 4HFSA 3ZN5A 1UU4A 3W5MA 3ZFEC 1OA2A 5BNPB 2RS53 1QDOA 4QQOA 3W20A 4I3PA 5I8YA 1LHWA 2E7TA 4B4RA 2ZOEB 4IV1C 4N53A 3OUHA 4M0HA 5IJRA 1POV0 1E5IA 5E6HA 3OGVA 4P5YA 2VMEA 4AFAA 2WAOA 5F3EA 5A3LA 4Z1VA 3WNNA 4Z2AA 5F5CA 3AYEA 1VBC2 3I3EA 3MPPG 5FZ8A 3H0OA 2EF6A 4M3CA 3UGHA 4NAMA 3WP3A 2PHRA 4FAGA 2HYKA 5FP3A 1CVNA 1PO22 3NQHA 4JHZA 1YWKA 4XFGA 1MS1A 1AF9A 1RMU1 3K2OA 4J1WA 4BXFA 1VMFA 1QHDA 4N53C 1OC1A 4GA9A 2HWD2 1VBD2 4AW7A 2VO5A 5A6QA 3VKMA 5BYNA 1NLRA 5IVFA 3IT8A 4TXWA 1P8JA 1XB9A 2UWAA 4BMBA 3V0BB 2HYXA 3NAPB 3LA3A 1HXS2 4CTEA 2B5HA 5FK8A 1V9U1 5I0TA 2ZACA 1W6QA 4K3UA 2PHFA 1AR91 1OH4A 3H7YA 2EAKA 4JRAA 3GCWA 4L92A 4XJ8A 2FCTA 3OB8A 3TN91 5A6XA 2EIDA 3POWA 3H8RA 1WMXA 4Q4V2 1TZOA 4UBHA 2AACA 3UJQA 5I8SA 4CU8A 3LFMA 1R1A1 3FC0A 1PIV1 3MBWA 3PUIA 1AR81 3AFKA 2X5IC 1X82A 3SKJE 2ZEXA 4KBBA 3VBHB 2RDQA 4JKLA 3UL2A 1UY3A 3ZR5A 3RPQA 2BRTA 1UD1A 4JKKA 2GP5A 4RGGA 4D7YA 3AFGA 1VIWB 5FWJA 1JOPA 4A7ZA 3PTYA 4JCKA 2XH6A 2D6MA 3VD4A 4AI8A 5FZHA 4QM9A 5IYYA 4RQPC 1YNAA 4XFBA 1VBC1 4RGKA 1NY72 2VECA 3WDVA 5FOJB 1ENSA 3UESA 3MFCA 4WZFA 1JYXA 1LEMA 3WNKA 3CF6E 1PO21 4JRLA 4LULA 3U14A 2DCYA 4QB6A 1Q8PA 2MNGA 3SH5A 2WNUC 4BYYA 1STMA 1REFA 2HWD1 1AR63 5FDBA 3E1F1 2JDPA 4PF1A 3UJOA 4MH0E 1GFF2 1MEC2 1W9FA 1FMD2 1IQDC 4ZU7A 1POQA 2YDEA 5DAWA 1XE8A 1KDMA 3FZ3A 2ZX2A 5FYYA 4COUA 1HXS1 4N90A 3EBRA 4GB33 3LEMA 4QB2A 4EWDA 5JSOA 4CDUC 1AYN2 4FPLA 4RSUA 3GBWA 2B45X 1CAVB 3M8LA 3ZPYA 5T52A 5A6YA 5IK4A 2OZJA 4MOAA 4R8HA 1J3QA 1ZZBA 3AKSA 1EUTA 1VAVA 4YGDA 4ZXEA 5F9TA 1CZSA 2W3JA 4LKDA 2ZEWA 3I49A 2JE8A 3HQXA 3NKGA 1W3XA 1W2TA 5BPXA 1N1TA 3BPSA 5JMCA 4TLGA 4BQ5A 1O3RA 3VKOA 2K2SA 1LR5A 2O1QA 2C9KA 3VHRA 1XNAA 3WW3A 3ZIXA 1VPHA 3FHIB 1J59A 3MV01 4MO3M 5IT6A 4GD4A 3WLUA 2JDNA 3MLJA 3RWKX 3R4SA 3G6JB 5IK5A 2VU9A 4ITCA 1XE0A 1TMF2 2R073 5JZGB 4OCTA 1H2KA 5FLJA 4AEMA 1GANA 3OY8A 3WDWA 1UYPA 4FOYA 4M01A 4NRPA 4NPRA 3ST7A 5LRSA 5DPNA 3S7IA 5LA0A 1I5ZA 2X09A 3OBTA 1SBDA 1G9FA 3N3HA 4JGYB 2QFEA 3PLQA 4AI9A 2CGOA 2F6BA 4CP1A 3A0NA 3AX4A 2QVSB 2D6NA 5FMOL 1CAWB 1YUDA 4DRRA 5FZAA 2BERA 4BM8A 2QQWA 1MEC1 5JSRA 1RUG3 1COV3 2PELA 1FMD1 2P6HA 4QX1A 2BGPA 3RFRA 5KHGA 1XNCA 2RS13 3CNAA 2XJQA 1HRI3 5K7PA 2BNNA 2QUOA 2ZCWA 4Q4X2 1RVF1 1PVC3 2QQIA 4M3CE 3I59A 2VMFA 3LDKA 1F8VA 4RGAA 2XKOA 1AYN1 2FHRA 4OI2A 4CZSA 2GC1A 2NYYA 3H3UA 4HT1T 1O3SA 3I2FA 4DRVA 1JN2P 4LLOA 2IZWA 5H9SA 3EXUA 1YRZA 4KQ7A 5L7OA 2D43A 3AMMA 1JYCA 1QF3A 1I3HA 4FXKB 3NAPC 4LIVA 4HVQA 2KD7A 1V6IA 2W2IA 4LQRA 1MS0A 1JS9A 3LAGA 4ZONA 3T2PA 4AEDA 3POIA 1YI7A 2BGCA 5GLZA 3FLPA 3N7MA 2V4VA 4NVPA 2UU8A 3JB4C 1V6OA 2NZ9A 4AL9A 2J1VA 2WNVA 2Y34A 4QDRA 3BALA 4ORFA 2E6VA 1JZ6A 4PQQA 4QHBA 1TMF1 4RHV1 4Y4RA 1SLAA 1VALA 2AC1A 5L7OC 4Y20B 5I0RA 5GLTA 3SCFA 4IEUA 3WNMA 5F37A 1IPJA 1ONAA 5ERLA 4P9GA 5F5QA 4L0PA 2VZUA 1E5HA 5KBFA 1MZFA 1QQP3 3D0JA 5FY1A 3MF6A 3AL5A 2VL4A 3GZTB 3VKFC 4EN6B 3RMXA 5AC91 4FTEA 4MGTA 1TME2 4TN7A 1ZZ6A 2VG9A 1XE7A 4JX0A 2CHHA 3OG2A 3BN6A 4XUPA 1OF4A 3ILFA 4Q4X1 4CP0A 3O1RA 5FLHA 2Q1ZB 2UYBA 1XSQA 2WJSA 4QXKA 4F3JA 5J96B 4R9CA 1BCXA 2C4XA 1D7PM 2XL7A 1V00A 1VAKA 3F95A 3POFA 1EAH3 4Q4W3 5GKAC 3V0AB 4YM0A 4LBQB 4NRMA 3PVNA 4CDXB 4PQ9A 1N3QA 4DEQA 4JVAA 2C24A 1WW6A 3E5QA 2GNTA 2IC1A 1BEV2 5E8AA 4DXRA 2QJVA 4N43B 3T1LA 4D69A 1CN1A 1Q5OA 2JJ6A 3SMHA 2XVGA 4KNCA 3KWVA 4GMP1 5D1IA 4YSFA 1RUH3 5IVVA 5KC6A 1QOSA 5IVCA 2PHWA 3I2OA 1GOGA 4XURA 4BH9A 2JE9A 3VBSB 5A6ZA 4COVA 1WCSA 2FMYA 2OYZA 3MW3A 3M7AA 2OZ6A 1C5HA 2I74A 2JG8A 2RR11 5HXMA 1ASJ3 3KGZA 3NVCA 4BU2A 5JI9A 5KR7A 1DF0A 4RN5A 4BOWA 1O5UA 1SFPA 3WHTA 5C71A 2D7FA 1H1IA 4CXXA 3ZYBA 4B3NA 2H6CA 2YUEA 4KWUA 3RMYA 1UY2A 4I02A 5FZ4A 4HVOA 2WA3A 5D8AA 3Q8CA 3FL7A 2R043 3BODA 3M3OA 1LU1A 1WLCA 4B7KA 1DLLA 1K45A 1TME1 3NV3A 3RVHA 2JG8C 1UY4A 3FX3A 4PJYA 2J22A 1R082 1R092 3A4UA 5FKCA 3Q8BA 4XF3A 2RDNA 2ORXA 2E26A 5I8TA 4TTGA 3O1OA 1GYKA 1F31A 2HJIA 1H0BA 3NNJA 1IPSA 1G86A 2K9ZA 2OS2A 1H9PA 2A71A 3FUQA 5FIXA 3MO4A 3C7OA 5D8AC 3CDZB 4XBLA 5E89A 3K75B 1DZTA 4LHNA 5J98B 3WW4A 5C3RA 4HONA 1BBT2 4Z92B 2D6PA 1HN0A 5DUVA 3O0WA 1YCIA 1LENA 1CZTA 2DUPA 2D93A 2JDKA 1BEV1 3O5SA 1ULPA 1CZVA 2A7AA 2CWSA 2VOWA 3WDUA 2GAUA 3USUB 3JD72 2R0HA 1OURA 3SEPA 2YFZA 5FP7A 4HG6B 5FYIA 3ZSJA 2PMWB 3IIAA 4GQ7A 5GLWA 1GZWA 2A6XA 2YGLA 4IE5A 3I4IA 3OPTA 1VLNA 4AGGA 3OD0A 4FT8A 1Z7S1 5FMOS 5JXIA 3FE5A 4MVTA 2ADDA 5A7WB 4FPJA 1DZQA 3JBG2 4OUEA 4UFKA 4XW3A 1JZ4A 1QDCA 1QH6A 1UZYA 1QKQA 3NNMA 3E6BA 5JSPA 4AEJA 2JIJA 1PO12 1AR72 1OPOA 4AVVA 1W90A 4Y3OA 1PX4A 3HIFA 2A73B 2UYAA 5FTTC 4D3WA 1R081 1R091 3WNPA 4NIAA 3I2GA 1QJZA 4IV3B 3T08A 4D7SA 1W8OA 2RMU3 1VB2A 4NWWA 1NA1B 1JOJA 3GDBA 3KV5A 4AEKA 3N36A 4MUVA 3VUOA 5IK7A 3M4FA 4B1MA 3KZ4C 2YFUA 4QKBA 5JAXA 1GU3A 2E53A 1OOPA 4QX0A 4D7TA 4XAAA 1Q3EA 1MVEA 1FV2A 4RFT0 1OKQA 2XWBB 3HT1A 3MFAA 4LOSA 3T30A 4O61A 2ZS6B 1F5FA 2Y8KA 5FWEA 3SCHA 1BKZA 3DXTA 5FXWA 3WG2A 3T0DA 1XYPA 2LRPA 3I2IA 3OYWB 2RJLA 4CEWB 4ZKTB 1H2LA 2ZHMA 3GM8A 4OUMA 3JD71 1LJ7A 5A7OA 3IPVA 2ZGMA 4ASLA 3P3PA 4KWLA 3ES4A 4UW6A 5FFOC 3U11A 1CAXA 2DU0A 1DQ5A 4TWTA 2WNEA 1AXKA 1NXD1 3ZM8A 5A3MA 4L11A 3TRSB 2YMZA 3JBG1 2HLEA 2WDBA 4A2UA 4NIDA 1Q8OA 4MADA 1NYWA 4DPNA 3PDQA 1Y4WA 5FO8B 1REDA 4OHVA 2KXLA 4L99A 4TYSA 4KMQA 2GNMA 2PHUA 5K9YA 3WOGA 1KFXL 1PO11 3GBFA 5DN2A 3VDBA 1AR71 1HB4A 4K20A 2HEVF 1IZ3A 3GZUC 2UY9A 3LEGA 1VBD3 4AFBA 2XJPA 1IS5A 3LA7A 3LF7A 1CAUA 4JAAA 4P9YA 1K5JA 4YZ2A 2HBTA 3DECA 1O4YA 3KSCA 3I3MA 3KQ4B 1DQ2A 3I3QA 3U4SA 4RR3A 5CKNA 5KC5A 1SDDB 4O9EA 1OFSA 4CU9A 4NIGA 4FTBA 5JXGA 4JV4A 2BNOA 4QPIA 4QGLA 3ZSLA 2QBXA 2IVJA 2VZSA 5A32A 2YBKA 5HI0A 4XDQA 2BWAA 3AMHA 4Q4V3 4YFZA 3RYPA 1HJGA 3POJA 3OBRA 5EV7A 1OKOA 4GWNA 2Y26A 2WO2A 4K8FA 1ZBE2 2IXHA 2PFWA 3ILRA 1JYTA 4HANA 4XF1A 1URXA 1N3OA 1AX2A 4ISRA 1LESA 4BK5A 1EY2A 2R1BA 3FLTA 4QPIC 5FMDA 3THCA 1IS4A 1WW5A 1HV0A 1H6YA 2WR9A 5CKMA 4AVTA 4WVVA 2VVEA 3ETPA 4LR4A 5JWPA 1UU6A 5KXEA 5DAXA 4RL7A 2JDYA 4PI2A 5FKBA 1NCQB 4IEWA 4PF5A 3J8F2 2WZR2 1KXGA 4URTA 2ERFA 4AI1A 1H6XA 1RUF1 1UMZA 3SCGA 4CXYA 3NL1A 1OLRA 3QACA 1DIWA 1HB3A 1JU4A 1W39A 2XR4A 4OUSA 1PZ9A 4Z82A 4AQ2A 5K8SA 3V56A 3AZWA 1L3JA 2D5HA 3POEA 5FXXA 2P1BA 2ATFA 1WD3A 3GXUA 4QXBA 5FPLA 1RUJ2 3ELNA 3OGJA 3Q8AA 5C8CA 2WFPA 3ZYGA 4XJ9A 4P00B 3H9AA 4JC1A 3UK9A 4CDQA 1LTEA 3E5XA 1LOBA 2CDOA 2C6SA 2OA2A 3KQRA 1FNYA 3ZYHA 2K46A 4UFLA 5L9RA 5H9RA 1WA4A 5GLVA 5FP8A 4DY5A 1PVXA 5FZCA 1AZDA 3B7MA 1VBE2 5IATA 4IV3C 1PK6A 2B9UA 4F83A 3NNFA 4CEWA 1NA1C 2DVBA 1W8ZA 3FHAA 5T50A 3SEEA 2VVDA 1RUD2 2KA3A 4X8PA 1AUYA 3LOBA 5FYBA 4XJUA 4E4ZA 1W6OA 1FOD3 3KV9A 2ZZJA 1OI6A 2YY1A 4A6SA 1D4M3 1ZRFA 3LD8A 1FXZA 1H8TA 1AYM2 4U2AA 4WVMB 4NIHA 4Y22A 2ZEYA 4WVZA 1PK6C 3O1MA 2YC0A 4CEWC 2DFBA 2WZR1 1R1ZA 1MS4A 3NWKA 4EZHA 3RZKA 3ZKUA 4XHBA 3EQEA 3HOBA 3HNBM 3ZYFA 3OGSA 1BYHA 4FOVA 5F2WA 3POSA 3VBUB 1LHOA 3VBOA 4CPBA 2BVVA 3SC7X 3OD4A 4QM8A 1GWLA 4A4AA 4X8NA 2EALA 5IUQA 1UY1A 3EO6A 3SKVA 2G9FA 5JCTA 4EWEA 2XBO2 1ACCA 1RUJ1 5L73A 1NAEA 5HCAA 1IKPA 5FYZA 5L9BA 4CXWA 1ULFA 5FZIA 3FFQA 3M3CA 2OUJA 5T5LA 1B35A 3W9AA 5IVJA 1YQ8A 4BPZA 5GZEA 4EWAA 3VBOC 5C5UA 5H9PA 2CV6A 2VMCA 3UKTA 3USSA 3AYCA 1W6MB 1KS4A 4JKMA 1QXRA 1LOCA 2YGMA 3N35A 2Q8CA 1UOBA 1S2EA 3VBFA 2FDKA 3AXDA 1KS5A 2WQZC 2VZPA 3NJZA 1I6XA 1QJX3 5BY5A 2A75A 2VAUA 3C7GA 1JBCA 1QY4A 2YPJA 4UF0A 4ZPIA 3ZLIA 3AZYA 4COWA 1B35C 2Y6GA 4EZ4A 1RUD1 1VR3A 1US3A 1PM7A 5JI7A 3RJRA 1SLBA 1YQ5A 3OUIA 1C8NA 2NLRA 2LALA 2PAEA 3UKVA 5A3UA 1CJPA 1AYM1 3NV4A 1UNBA 2FZ2A 3AZVA 4DOUA 2J1TA 5FZLA 3RWNA 3ZXEA 1UAIA 2W68A 3QOPA 5C3QA 1SZBA 1OLME 1MPXA 2BU9A 3K48A 2GP3A 5EPAA 5DDJ2 1AVBA 2HWF3 1C5IA 5CAZA 1W28A 4CCKA 4ATEA 3VZMA 2JDZA 2LUWA 3PHMA 3GZEA 2VR4A 4E2QA 3WQ1A 4LORA 4Q4Y2 5SV8A 4UT5A 1U5IA 1N1SA 2GNDA 2RV9A 3J7HA 2D3RA 3WF0A 3RZZA 2XVLA 3LDBA 4OQ8A 3AYAA 3P5BA 3N9NA 4LBMA 5FPVA 2DBIA 3A21A 3T2OA 2QZ2A 3N7JA 2UY8A 1MQTB 3ACFA 3O1UA 3LCPA 3W5NA 4YGBA 4FPOB 4G3YC 4HOOA 4CRQA 1BJQA 4MXWB 1RHI2 3IMNA 5A1LA 4R52A 1C1LA 3WF2A 3U37A 2D6KA 3R4DB 4Y1VA 4ZXKA 4W4ZA 3M70A 1PNGA 3M3IA 1LOAA 4R4XA 4XCBA 2VZ3A 3ZFFA 4HMZA 2RS33 1O91A 3DF0A 1SLIA 2IXKA 1UOJA 4HPKA 1MZ5A 5LA9A 2WWSA 4XFCA 5HXVA 3H8OA 1O5LA 3OSDA 4GULA 4IV1A 5FLIA 1YC61 5CEHA 5EXOA 1GQPA 1LGNA 4DNYA 5JIUA 5FR3A 4MHUA 3S57A 1RGSA 5EP9A 3S5AA 2WIIB 3N7KA 3VBRA 1O4ZA 5DDJ1 2I45A 2DVGA 3ZFFC 4DZGA 4XFIA 2OQ6A 3JU9A 1JUHA 1H4HA 2D44A 1NCRB 2DU1A 5E88A 2BDRA 1UIKA 2BUKA 4WVWA 2PLV3 4Q4Y1 1J3RA 4Q0UA 2MEV3 4UFHA 1NLSA 5JUVA 4BWOA 3GJBA 2A6ZA 5HCBA 4QPGA 4QX5A 2PTMA 4UFIA 4GJZA 4R9DA 1UZZA 3ZDVA 4QPWA 2WWUA 4JQRA 4UOJA 3VBRC 5F6KA 3VBUC 4PBOA 1O8SA 1A6CA 4YVSB 3U0ZA 1B09A 4QQLA 1U5ZA 2D97A 2OKXA 3WUCA 5J37A 3POBA 3KLSA 1YQCA 3EB7A 2Q5TA 3C2UA 5A1FA 2C26A 1PZ8A 3T4HB 1PNFA 4QPGC 5CZKA 4XABA 1RHI1 3ZSEA 4LXLA 3X29B 1BBT3 3AKRA 4NJ4A 4NHKA 3O1TA 4SLIA 1SLCA 3BYWA 5DUXA 5ABJA 4EN8B 1XNTA 4IE7A 1FYUA 1JTZX 1ULGA 4CCDA 5GZGA 4XACA 2XQRA 1O3QA 2VOXA 2JDAA 1ZZ8A 5DMYA 3H7JA 2X5IA 3FJSA 1VBB3 1UF2C 3GHNA 3OPZA 2JG9B 5FYMA 5A3OA 3TOJA 1G9BA 1CIWA 1W05A 2GDFA 3AMQA 1O59A 1UKGA 2QQMA 2BQPA 4KH9A 2YV8A 3PUQA 4R4ZA 4A3ZA 4HK8A 2ZA9A 3ZIWA 5F3GA 1BLZA 4BQ4A 4DB5A 4E27A 5LK7B 5FZMA 1PGSA 3GNEA 4K1YA 4ES9A 5ABJC 3AVRA 4NMIA 3K4DA 4XUTA 4FQ4A 4FBFA 2BGOA 2N7GA 4Q0QA 2VBDA 3K46A 4RQPA 3ZXJA 3SH3A 2PQSA 3IM0A 2G9ZA 3CJIB 3WNLA 4IEXA 1ZRDA 1C3HA 3FBYA 2R063 2LS6A 5LCWL 3PNAA 4M4PA 3HPNA 3KB5A 4A42A 2WNUA 3D6EA 5FYUA 4C90A 1GNYA 5HPOA 3HAGA 3HWJA 2XHKA 3U10A 1MS5A 4PLNA 1KD7A 2QDNA 3WINE 2RDSA 2VTFA 3PUAA 1UPSA 4DY3A 4CSWA 4GWIA 1JXNA 4Q5OA 5FPUA 3T09A 3UGGA 4H55A 4CDWA 1ZBA3 3QCWA 5FZOA 4B29A 1OQDA 4CDUA 1Y9QA 2X53S 3B00A 3L2HA 4QHOA 5FZ1A 1OA3A 2ZGQA 3MIGA 3RS6A 4OLLA 3AXEA 1HRV2 4HK9A 4M4RA 1MQTC 3BTAA 2NPIA 5G05L 4E2SA 2DCZA 4XDPA 2JICA 4W6YA 3RSJA 4BQXA 4CDWC 1RVF2 1UCXA 3VN4A 3RZGA 3EMRA 1XSRA 3HNYM 4LKEA 1WD4A 5LY1A 1AL22 2GN3A 4R9BA 2C0ZA 4QX3A 1LECA 4Y1ZA 5T5JA 4I09A 1QJFA 5J3UA 3I2HA 2AEZA 4KBZA 5HV4A 4JDNA 1SG3A 2VE1A 4QKDA 5I0UA 2RM23 5FQ0A 2IVIB 2IFRA 3NJYA 3AP6A 4YG0A 5BXXA 4PIXA 1WMDA 1Y7BA 4XFFA 2A6WA 2JKBA 2XJVA 1JODA 2AGSA 3GCXA 4Y5SA 4ES8A 2WNOA 5BNPA 3FFZA 4CEYB 4NOTA 5CIRA 4BQ3A 4NHMA 1V70A 2CWMA 4NO4A 3BI3A 2AR6A 4S2GA 3GBGA 3DYOA 4F7ZA 2VZVA 1F4AA 1Z0HA 1XU1A 4KWJA 3MEPA 4RHV2 3W59A 1OH3A 4Y5TA 3J9SA 4CCEA 2R7EB 2Y6LA 4AG4A 4CE8A 3HJRA 1HB2A 3AVSA 3O12A 2AH2A 1NCRC 3VHNA 2R16A 5BNOB 1G6NA 5LK5A 3WP4A 4P9IA 1ZNPA 2EIBA 5BNPC 1JZ5A 4DO0A 1JHNA 3TYJA 2OUHA 4YZ4A 5FPZA 3M3EA 1FX5A 5K0UB 4QMAA 2YBPA 5CKQA 1LOFA 5IVBA 1EV11 4XBQA 4XYXA 4YVSC 3TEXA 3LKJA 2VH9A 1HRV1 1QJY3 2VMHA 5DUUA 5AC92 1CX1A 1ZBE3 4XBNA 3V0BA 1RUE3 2FZ1A 2HWC2 3DN7A 4HKWA 2VQTA 1VBA3 3NAPA 2FDGA 4NWVA 3LOIA 5FMCA 4Q8LA 4NRQA 5C4WB 2GH8A 2Y0IA 3K3OA 1W8UA 3NNGA 3OUJA 4I30A 1GICA 2QKDA 2PN5A 4OFGA 5DABA 3MW4A 4LJHA 1MVQA 1ND3B 1AL21 5FXVA 3VZKA 4RA0A 4XILA 3WHUA 1W04A 3O7OA 4AI3A 1GV9A 1VRH3 1LOFC 2LW8A 2IXIA 3PUSA 4LHKA 3SH4A 4E8CA 2B8MA 1RXFA 4HXCA 4DFSA 2ARBA 3UT0A 3J8F3 1KITA 4YM1A 3VBHA 5ACA3 3ABZA 3H1YA 3KGLA 3P1IA 3WV6A 4XTMA 1WGPA 1QJU1 4UI9L 3ZVXA 1H2NA 3KVAA 4YWAA 1V0AA 4JHTA 3TEWA 3ON7A 2UWCA 3O14A 1XNBA 1CPNA 4XDOA 1RUC3 4WM8B 2XWJB 1AX0A 3IBMA 4MGZE 2W46A 4DIQA 2W1QA 2G19A 1DFQA 1YLLA 1TVGA 2RR12 3A23A 3VBHC 4FFFA 5FZ0A 2ILMA 2XONA 5JMOA 3WNOA 2WFF3 4G4FA 1S0GA 5F3IA 5JR2A 5LATA 4HBNA 5FUNA 1ODNA 3VDAA 4D6RA 4EROA 5FYCA 2VBPA 1NKGA 4SBVA 4YFWA 1L7QA 4YW4A 2B42B 1JZ8A 1JZ7A 1C8M2 4DMIA 1VBE3 2JXAA 5JVVA 5JDBA 3O1VA 4NIIA 3SNMA 2HWC1 5A3TA 4YNIA 3HN3A 1A3KA 1PMJX 2HWB3 3LIGA 3TAYA 3BUCA 1O4TA 4IDZA 4D6QA 1CAVA 3AP5A 1W03A 3EHKA 1J3PA 1ENQA 1V6MA 1M06G 3BIWE 5CBLA 1GQHA 1K3IA 1W6PB 2V73A 5EJZB 2XHNA 2HWE1 1KJRA 1JMUB 4YRDA 4XOGA 1WCDJ 1EUUA 4LO5B 4L2NA 2PXJA 1YFXA 1K12A 2XUMA 1WMFA 1HLCA 4XFHA 1YYNA 4H2AA 3MLKA 4Y4YA 4OULA 3U78A 5A33B 1JYNA 5CFDB 1N1VA 2W87A 3GHMA 4AHYA 3S7EA 2CNAA 1UX6A 4CVUA 1ZZ7A 4TSVA 5JZGA 1S0EA 2Q1MA 1ZVFA 3KCYA 3ZYPA 1W6NB 3HVDA 2XBO3 3AZXA 3C7EA 5DG1A 5LEJA 2ZZQA 1Z7S2 2W1SA 1C1FA 2MPFA 5C8WA 2VTXA 4YLZA 5EWSA 4MV2A 3DGTA 3S30A 4HSLA 3KVBA 4A44A 1DZRA 2VNVA 4I0BA 4CEYC 3FLRA 4JGYA 4UFMA 2WN3A 1CPMA 1FPN3 4AQ6A 3ZMOA 2OIIA 2ZGOA 1CAWA 2A6VA 2B7YA 3K4AA 2NM1A 1G8WA 4UBGA 5KHKA 2ZGLA 4FFHA 5JZGC 5DAPA 4BLIA 1EPZA 2Q8OA 3WT3A 3TNQA 1W9SA 1LHUA 2H6BA 1C8M1 1S0CA 2ZGPA 1J1TA 4IE4A 5CG8A 2ET1A 2ZKLA 5EJ3A 4MGYE 3VZJA 1LCLA 2Q30A 4CCNA 3RG0A 2E31A 4AI2A 4AE2A 1KQRA 4JGYC 4CP9B 3ES1A 1S2KA 2WS92 2QQLA 1AX1A 4FPYA 1REEA 1SEFA 4DUWA 5J1XA 5K0UC 1LKNA 1RUI1 2G4IA 3CBNA 3TEZA 2GU9A 1IG3A 2Y38A 3T2TA 4H14A 4ZS3A 1POV1 4QGNA 5C9AB 1JYVA 1CQ9A 4CA9A 1QNYA 3ROUA 2GMPA 2X10A 5KXDA 1I5PA 2BBVA 5C4WC 2ZEZA 3OOXA 3WR0A 3ZR6A 1TE1B 1JYWA 1X33A 1ND3C 2O8OA 1QXPA 4K9SA 1LU2A 4KGGA 3MIBA 3LGRA 4AQTA 1VMJA 1L7LA 1YQ6A 2BJSA 2CDPA 2Q8EA 4XIKA 1GZCA 4E9KA 4AVSA 5A3NA 1MACA 5FY8A 1SACA 2OX0A 4XZPA 4AXOA 2DUQA 1OD5A 2BBAA 1KEXA 1K5MB 1AXZA 1S0JA 3K77A 4L8QA 2BZDA 2GH2A 1TNRA 4Y20A 3I54A 1H9WA 3DUIA 3LDRA 4TLFA 3M3QA 5D2AA 1OVSA 2JDUA 3OGGA 4COZA 2BFUL 4ATFA 1NXMA 4PI0A 5GZFA 3J7NA 1T6BX 4WM8C 4XUOA 2DUOA 2P3IA 2RDRA 3JCIA 1RMU3 2ZMLA 3C8XA 5FJKA 4C8DA 4ASKA 3SLIA 1V6JA 2JDHA 2G1MA 4Q2FA 1S0BA 4MLOA 3VD5A 5JR7B 1PMIA 1RTVA 4D6SA 1WUVA 2QQNA 2WABA 3ZN4A 1O8PA 1UMHA 3ETQA 1F4HA 2WYSA 1SQ4A 1WLWA 2WS91 2WN2A 1D0GA 1IPKA 4FPKA 4GJYA 1HQNA 1H1MA 4OHXA 4FQZA 1V9U3 1X36A 2E9QA 3V0AA 1DGWA 1S2BA 4QQHA 4LBQA 3BIEA 5IK8A 1AR93 4CDXA 4LHSA 4URAA 1EP0A 3LA2A 4YARA 3TN93 3WX5A 4QKNA 1V6NA 2A3WA 2XQXA 2RS51 5IAXA 5LY2A 3U4XA 4Y24A 1H30A 4A7YA 1R1A3 4N43A 1ND2B 5JOYA 1PIV3 5FZBA 1YO8A 2VUAA 4BJ0A 4BZ4A 1AR83 1W2AX 2LTNA 4EV0A 2ZMKA 1LB2A 4XQDA 3KHCA 1PGW1 3VBSA 1DQ1A 2ZGUA 2CYFA 5FZ9A 1W8NA 3TNPB 1YJLA 4CDXC 4IGPA 5CADA 2HEYF 2DDUA 5IVEA 1NE4A 4HN0A 1Q43A 4ZZ8A 4N43C 1BQPA 4HZFA 5LBFA 3ECQA 2WINB 4WM7B 4FP3A 5ANQA 5CFDC 1AR62 1WBLA 1YEWA 3OBAA 3H8XA 2VOKA 1VBC3 3Q9OA 1RUF2 4AI0A 4XHXA 4GZ9A 3K51A 5A3WA 2TUNA 3VBSC 5L19A 1VB4A 1PO23 4AK3A 4XIOA 2ZX4A 3AZZA 3TBDA 1UPIA 1LOEA 3POYA 2VUJA 4YPJA 5ANNA 4GB32 4QQ2A 2HWD3 4A3XA 3AKPA 2ZX0A 4YG6A 1GNZA 5BNNB 5H9QA 2UURA 3BVCA 3R6SA 2CGPA 2ZXQA 3OF1A 4CPBD 3WG3A 1GWKA 2VZOA 3R4UA 5F2SA 1HXS3 3K4ZA 1UX7A 3OGRA 1IOAA 4KWKA 4X6RB 3KV4A 4PT6A 3KCXA 1WCKA 4RFRB 4YVWB 4PLOA 4AQSA 3S0MA 2VW0A 1WCQA 4FSJA 4LBLA 3M2MA 1UZVA 1YHFA 3TB0A 5FO9B 3I2DA 5JPMB 2NMNA 2YU2A 4EN9B 4RS5B 2WO3A 4OZXA 2WO7A 3H1MA 5F3CA 5TSWA 1ZRCA 2Z4FA 3RZJA 4QWNA 3USUA 2GC2A 2R072 2OXBA 1RUOA 4XMAA 2CAUA 4XPVA 3ZSKA 4BCUA 1SFYA 3LB9A 3PTRB 3V64A 5C9AC 1XU2A 5FPAA 2WT2A 4FPEA 4UWDA 3AYDA 5EFUA 4C1WA 1F35A 2YZ4A 3RJ2X 4B1LA 1BXHA 4CUCA 2XUEA 2ZKNA 3C7HA 5A7WA 4HN1A 3O1PA 4Y33A 4QX8A 3ZXFA 2JECA 1AR61 4DEVA 1AL0G 1RUG2 1COV2 2XOMA 1QGLA 1ULDA 2XJUA 5FAXA 2IXJA 1RJ8A 5A80A 2XKPA 1K5MC 1ZYBA 4EE2A 3WW2A 5JXHA 1PVC2 4D8MA 3THPA 3THDA 2XB6C 4A41A 1H8VA 4GB31 5CISA 3ZFGB 4IXLA 2E7QA 2Q1FA 3P3NA 5FXZA 5LASA 1MEC3 3VHPA 1K42A 1W2OA 3D0SA 1FMD3 1S4CA 4FO9A 2OPKA 2W5FA 3RZMA 1ENXA 4IV3A 1FATA 4INDA 2DBNA 3DPRB 2AENA 3ZDSA 3MYXA 1NA1A 3RI9A 3FBMA 1RVF3 5FY9A 3BU7A 1UIJA 2ZHLA 4OI4A 1HB1A 1VE0A 1KGYA 3KF3A 4XETA 1AYN3 3HQRA 2WUHA 3LSEA 3N9LA 4MGQA 3VKNA 3IB3A 3ZXLA 2NP0A 4AFMA 2W1UA 1E57A 4WV8A 5DAQA 3OJBA 4B4QA 2WZ8A 1ND2A 1F9KA 4V2VA 5FMBA 3OYWA 2CGNA 4Q1PA 2DTYA 2R071 4YW7A 2QTWB 1OHFA 3AC0A 3OTFA 5FCCA 1LULA 1WW4A 1H1AA 2BFUS 2XJRA 4YG3A 3IAQA 2J42A 3VV1A 3MF9A 2RJ2A 2SBAA 3I7DA 3O0XA 2OW4A 4KG8A 5FJHA 3WG4A 1OSGA 3KS7A 1W2UA 2ORZA 2WLQA 4JGZB 5KHHA 4GKXA 1XYOA 1ND2C 2J1RA 4RHV3 5EZWA 1TMF3 3KM5A 2VM9A 1AHSA 4XEZA 1ZREA 3VD3A 3QH6A 2VBBA 3AJZA 3UGFA 3AB0A 5I0SA 1YJKA 1RUG1 1COV1 2VNRA 4OHWA 2P4EA 3H8UA 2RS11 1XNDA 4XE9A 1HRI1 4ISQA 2GMMA 1W06A 2QQVA 2WL1A 2ZX3A 2VNGA 4BK4A 1PVC1 5ISLA 2BW8A 2RJKA 4HL0A 1OD3A 5LBEA 4XFAA 4ASMB 2W08A 2IUWA 3OPWA 2D40A 1QOOA 2IWGB 1O6UA 5AC93 5EHDA 1IGOA 1DQ4A 2H0BA 1HW5A 3ZFEB 2ENRA 2C9AA 2VQAA 4Q4X3 4E4SA 3SHRA 3MI8A 5CU1A 1ZRIA 2XGXA 3DYPA 5J7MA 1JI6A 5BV6A 1Q8QA 4LBOA 2D98A 3ZN6B 5KXCA 5BNNC 3UYJA 3B02A 5CFCB 1W2NA 3DXUA 4NR1A 3MLLA 4J6GA 5FYTA 1JYIA 1HIXA 2ZHNA 5FK7A 1G7YA 2YC4A 2YHJA 3E5UA 4YVWC 3IDCB 2JX9A 4O65A 1CONA 1CD3G 4MZUA 1O3TA 1X9TA 1ASJ2 2VZQA 2Y6KA 1QMJA 4GMP3 2EAAA 3PL0A 2Z2SB 4J25A 2VZTA 5JPNB 4XAEA 1NCQA 2JB4A 5FO7B 2FBEA 2UWBA 4M3CB 1QQP1 3SITA 2RR13 3MHZA 5FY5A 1HX6A 3A0KA 4IETA 4I0WB 3C3VA 3RYKA 5EIYB 2WYFA 5LRRA 2VC9A 4S2FA 4PCRA 4NPMA 5LA2A 3VB9A 4QQPA 1DGRN 3UETA 5BNQA 1NE6A 3JB8A 3WDXA 1NCQC 2W9XA 3WCRA 1R64A 5JLVA 2R49A 3DEMA 3DPRA 1TME3 4I01A 3VZLA 4YW6A 1EAH1 4Q4W1 1BVP1 1W6QB 4BMEA 4BQ1A 4XXPA 2VUDA 4O9GA 2YXSA 3QBQA 1RIRA 1YI9A 2P3YA 2D5FA 3ZFGC 3BGAA 2R1DA 4DUXA 1SDWA 4IEZA 5IAVA 1DHKB 5B4NA 1RUH1 1DGRA 1Y9GA 3HEIA 4N9HA 3AP7A 3DPRC 2AUYA 3HBKA 1XJAA 4MHRA 1ZZ9A 2Z5WA 4CUBA 2O0OA 2V72A 2NMOA 5BUVA 3EJKA 4FOQA 2QZ3A 4BISA 1BEV3 1UZ0A 1UZWA 2QNKA 4B8EA 3AMNA 1G9AA 2Q0AA 1RB8G 1ASJ1 2MHFA 1X8MA 1XYNA 2A70A 2O8QA 4IEPA 4XJZA 4XZUG 4JZRA 3U75A 3B3QE 3KCCA 4NN0A 4Q29A 2RHPA 4M00A 4W65A 4WVMA 4NUBA 5A7PA 1OBNA 4CCLA 2PA7A 4OYUA 2X05A 3AK0A 4AGVA 1Z7S3 5FPBA 2VMGA 3J4UH 2R041 3ACLA 5FP9A 3IZOA 3VBUA 4E8DA 1QEXA 1Q8VA 2EICA 3FWEA 3OCPA 5LB6A 5SV5A 2D3PA 4Q26A 3CJXA 3ASIA 1UKRA 2OVUA 4JGZC 4Q27A 2RE9A 1H2MA 1NG0A 4COYA 4XQ4A 5KHIA 5JOWA 3KT1A 1ZA7A 4IUGA 5CG9A 1UW8A 2AEYA 4S2DA 5DAVA 1XPWA 5C3SA 1ZRRA 3ACGA 4BXSV 1R083 1R093 1DGWX 2CY6A 1WKYA 1ULCA 2V4AA 2WRAA 4QAWA 1UO9A 1W6MA 1D4VB 1WLTA 4KL1A 1S0DA 2FD8A 2F17A 4Z2WA 2L9LA 1MZ6A 4M3CF 2QDRA 3KMHA 2VPVA 2D3SA 3WDTA 1NZIA 2AZ5A 3WCSA 2ZJCA 4GAZA 2VCAA 4A7KA 4G9SB 2ETEA 3WUDA 1X7NA 2JWPA 1GR3A 4ONUA 3MIEA 3JD73 3I3DA 5A70A 3ORJA 5CFCC 3OY8B 1KDKA 4PBPA 3U07A 1OMIA 4OHZA 2QQPA 1QOTA 2Y33A 3K3NA 2PAKA 2LROA 1UN1A 2VJXA 3MIHA 3VZOA 4DUVA 3JBG3 2CAVA 3H3ZA 2QQUA 3EYPA 1Y3TA 2I2SA 4LOTA 2QQJA 2HH9A 2ZAAA 4LUMA 2DCTA 2ZPXA 5FP4A 2VMIA 4YW1A 4EYUA 3AKQA 4MXVA 2ES3A 2RMU1 1DGLA 1PO13 4P5HA 1AR73 1I9RA 2WC2A 1DYKA 3I59B 4MGKE 5HV0A 3LZZA 3ENRA 5IW0A 2VD7A 4BHPA 3WXPA 2VVFA 3JQWA 3ZO0B 1MQTA 4DXSA 4FP2A 5GJ6A 4GH4B 2I07B 2A6YA 4N8MA 1DDLA 3MIFA 1LODA 4YW3A 2VQUA 1IS3A 1RYYA 4NPLA 5FZ6A 5L7OB 2PYTA 4MXWA 2PQQA 3KD4A 3HD8B 1UU5A 4QXHA 2XMLA 2XJTA 2YB7A 1EV12 4AEDB 1LAJA 4BDVB 4BB3A 1X9PA 4LK6A 4ZHNA 3BTYA 3PURA 2E63A 3ZOIA 3H3LA 2J1EA 1G9CA 4KU7A 2JKXA 2WNVB 5GLUA 3BB6A 5FV3A 5LWBA 4LA3A 3ILNA 4PDWB 4QXCA 4Y26A 4H7LA 4A45A 4EN7B 5ABJB 2Y60A 2YYOA 4E4HA 1A34A 1TNFA 1VJ2A 4A6OA 3RNSA 2IFWA 2YC2A 2VTXJ 4AZZA 3E6CC 3BU0A 3N9QA 4OVEA 3V65A 1UYXA 3ZYRA 1VBD1 2GNBA 3NMBA 5FY4A 1NCRA 1RUF3 2A3XA 3P6BA 3DCQA 2J1SA 5F1RA 1QJU2 2TEPA 3RI8A 1F5JA 3WY6A 4HVRA 4Y1XA 4AVCA 1Z78A 4E4DX 4EN0A 3QLQA 4ZU4A 2VY0A 1SPPB 4GWJA 1JZ2A 2JE7A 2FCUA 3WSOA 5B2GB 3LWCA 3QD6A 4LO6B 3I2JA 5C6CA 1RINA 4GIQA 1C4RA 4YVSA 5F32A 4P9JA 4DXZA 4LO8A 4XCAA 5JOXA 3S6PA 5I0DA 4Q4V1 1PHMA 1X50A 1KRIA 3N9OA 4XVHA 1S0IA 2KM2A 3ACIA 4I0AA 4XJWA 2JD4A 4GALA 3WDYA 1UYZA 3N7LA 4AHWA 1H4GA 1JW6A 3T0AA 3NSTA 2HKXA 4LA2A 2ZGRA 2Z42A 2C5DA 3T1MA 1FOD2 5L9VA 1NLQA 1WWYA 3FUOA 1SLLA 3OEBA 2HBUA 2SLIA 1RXGA 1D4M2 2NN8A 3IDEA 1WMEA 4LPLA 4UAPA 5APAA 1RJ7A 1GZ9A 4KI5M 2OT7A 2JG9A 3WEZA 4YW2A 4IERA 5FUIA 4XF4A 5HBAA 1W0OA 2GN7A 3VL9A 4LNVA 1ZX5A 1NY71 4K40A 1HJFA 2JG8B 3G7DA 1FV3A 2P2KA 3HT2A 4CCOA 4KU8A 4MG2A 1WLDA 2PHXA 3I97A 5IHRA 5A1AA 2BOIA 2HWE2 2ZHKA 3CLPA 2WZR3 5D8AB 3MGUA 2JG9C 1UWWA 3CJIA 4XUQA 5F5AA 3CL1A 4BQYA 3AL6A 5F7UA 3AMPA 1LHNA 3CKHA 4IEVA 3DV8A 2F4LA 2VZRA 4YGCA 4ZS2A 2BP6A 2KR2A 4DQAA 3PJQA 2WA4A 3N4MA 1GSLA 2WKKA 5FRAA 2P17A 3MZHA 3CMGA 1GLHA 2WBKA 1RUJ3 2ARAA 2J7MA 2ADEA 2DYCA 3HR9A 2GALA 4GH4A 2XPJA 2FDHA 1GWMA 1NQJA 5GM0A 4CCJA 3CJIC 1YFWA 4Y1UA 1UQXA 1QJX2 2BTVC 2E33A 2NQYA 3ZKYA 5LW9A 1HDKA 3CIHA 4GXLA 2D6OX 5FBJA 4Z07A 3WP5A 5C3OA 1SMVA 3VDCA 2E32A 2FQPA 1ST8A 4FVVA 5KWRA 4I2OA 1RUNA 2EIGA 4UXAA 1N1YA 5FZDA 1DYPA 1AJOA 4HKOA 1FOD1 4CP2A 4K21A 3T0BA 4CCMA 5DZGA 1D4M1 2DTWA 3JZVA 1WBFA 3WP6A 1SBFA 4GH4C 4JDOA 2BPA2 1IKQA 4IGQA 5D21A 5DXDA 4FAHA 1GZWB 2GC0A 1VMHA 2XJSA 5IWFA 5J48A 4PDWA 1RUD3 5AFBA 2B39A 2A5ZA 2W91A 4OMDA 2XL9A 5CYYA 3WQBA 5LZ6A 3IAPA 1RUI2 2HWF2 5AVPA 4AEDC 5A3PA 2WQ8A 5C5TA 4FTSA 5FZ3A 2JIGA 1BZWA 2VMDA 3KF5A 1AYM3 4I3GA 4QHZA 4R9AA 2ZGSA 1VRBA 2WSVA 4ARYA 4Z8BA 3GYDA 4H3WA 4H7MA 2WNVC 5FZ7A 5IFTA 5HCFA 2ZBJA 1ZM1A 4QT6A 5DUWA 1PM4A 3WNXA 4TZDA 1V6LA 4KG0A 4MSVA 4BIOA 4PDWC 4CU6A 1DLCA 4CEYA 1JUIA 5G04L 1SPPA 1N3PA 4YZ3A 4LBQD 2EIEA 1IS6A 3URFA 1DQ6A 2BVBA 3VGIA 1JHJA 5CNAA 2E51A 2VNOA 4FPCA 4BLJA 1JOBA 4FCAA 4Q0PA 2WZPP 2EXHA 4LE4A 1DQ0A 4LE3A 3ZYJB 4C91A 1FNZA 2WSUA 1CJDA 1WCUA 2E7AA 3GF6A 4Q0SA 5T55A 5BNOA 1ODMA 2W39A 4OI0A 1QJX1 4UW5A 3ZXDA 4XMIA 3IMMA 1HQLA 3L2YA 1OOPB 3PUHA 2DVAA 2P34A 2WT0A 5K0UA 5KXBA 1F15A 2CL2A 1S1AA 1QWRA 4XXAA 1TG7A 2H0VA 3WZ1A 4IE0A 2RS32 1GUIA 4XUNA 4V2WA 5BNOC 3IPVB 5C4WA 1D2QA 1ZA4A 3LEKA 1XBFA 1MS9A 2Y0OA 4IGOA 4QB1A 1BMV2 5GALA 1ND3A 1CAXB 3B69A 5EJ1B 5DG2A 4MGSA 1PGL2 4OMCA 3AKTA 4BQWA 1NT0A 5IFPA 2HWF1 5J36A 3PIGA 2DWRA 3NO8A 5EQUA 2AYHA 2CTVA 1DBNA 1W8FA 3CEWA 4QX2A 5FYSA 4CU7A 2PLV2 3DKWA 3ZXGA 2MEV2 2XLGA 1LNSA 2DCKA 2RS52 1N47A 3CO2A 3HMYA 4XF0A 4NE9A 1UOFA 4J1XA 3NV1A 1MZEA 4XQWA 4HSJA 5DDJ3 3LEIA 3B9CA 1YIPA 3GZAA 4AAXA 5F39A 4HLTA 2XVKA 1CAUB 1PGW2 2W1WA 1CR7A 1SBEA 3B93A 4K1ZA 1GKBA 2BYVE 3KV6A 4LUKA 4Q4Y3 4WM8A 5FREA 2OQ7A 4LBNA 3VD7A 3LE0A 5EYYA 3WF4A 1QNWA 4AF9A 2R0FA 2C1FA 3GALA 4RR3B 1UYYA 5I91A 3RZHA 3B94A 2F4PA 4WBBA 1U5YA 4IESA 4Q0VA 4AFDA 2W0XA 3A7QA 3D8CA 3MV11 4MX3A 2QE3A 2ZTNA 4P14A 4QPIB 5LEKA 1A78A 1U12A 2YBSA 5A32B 3I8TA 1SCRA 4Q1RA 2FDJA 1S55A 2DF7A 1PMHX 1W8TA 4W50A 1GZTA 1AJKA 2JB8A 3ZMNA 4LT5A 5FBZA 2FDIA 1VBB2 4IW3A 5AFEA 1E5SA 2RS31 2Q8DA 3RQ0A 1RHI3 4YM2A 3VDDB 5K4LA 1I1EA 2VCCA 4LO4B 2W52A 4Y1YA 5EYXA 4ZY9A 4AGRA 1BK1A 3D4KA 5LBBA 1BMV1 1GNHA 5FYHA 3BTZA 2WQ4A 3UNPA 2Q4SA 3GGLA 5DZEA 1YQ2A 1XNKA 3PVOA 4Y5Z0 1PGL1 3ATGA 2TNFA 4PIZA 4EJRA 1ENRA 1MR5A 1UXZA 3NKTA 5F6LB 5A7SA 5A7NA 1GOFA 4ZZ5A 1W6PA 4FOWA 4P9LA 1UMIA 4FPGA 3CHXA 3CZJA 1FAYA 3Q8EA 4U36A 2PLV1 1EPWA 4C0HA 2R062 2MEV1 3W58A 2R6QA 1D2SA 3H50A 1HQWA 3BPZA 1OF3A 2VULA 5A33A 5IVYA 5CFDA 1C57A 4JDMA 3H42B 1UOGA 1W9WA 1HV1A 3BOPA 1QXJA 1GQGA 4OHYA 3TWIA 5C8CB 4W6WA 2ZMNA 4NAOA 1W6NA 2PHLA 3UV9A 3H1WA 1HKDA 2P5BA 2Y6FA 4C0BA 4QD2A 3HBZA 1ZBA2 3PU3A 2ZGTA 2EVXA 2YG0A 3CU7A 3INAA 1C28A 2VUCA 4CDQB 1JH5A 1W9TA 2VZ1A 1J83A 2WAAA 4AYUA 3A22A 5C33A 5L36A 3D5OA 3U1XA 1BBT1 2ZGNA 3C7FA 2ZABA 3R05A 5FUPA 1CIYA 4AAPA 1OVPA 3VHOA 3VKLA 4AVAA 3ALQA 1PK6B 1XQNA 1W0PA
chains in the Genus database with same CATH topology
2JDHA 2BV4A 4UT5A 1OURA 2CHHA 2JDNA 1OXCA 2BP6A 1OUXA 5A6ZA 5A3OA 2WR9A 3ZDVA 5A70A 1W8HA 2VUDA 4CE8A 2JDYA 2WRAA 2VUCA 5A6XA 5A6YA 4AOCA 2BOJA 2VNVA 1UQXA 5D2AA 1OVSA 2JDUA 1W8FA 1UZVA 1OVPA 2BOIA 5HCHA 2XR4A 2JDKA 1GZTA 2JDPA 1OUSA 2JDMA 3DCQA 5A6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JDH A;  2BV4 A;  4UT5 A;  1OUR A;  2CHH A;  2JDN A;  1OXC A;  2BP6 A;  1OUX A;  5A6Z A;  5A3O A;  2WR9 A;  3ZDV A;  5A70 A;  1W8H A;  2VUD A;  4CE8 A;  2JDY A;  2WRA A;  2VUC A;  5A6X A;  5A6Y A;  4AOC A;  2BOJ A;  2VNV A;  1UQX A;  5D2A A;  1OVS A;  2JDU A;  1W8F A;  1UZV A;  1OVP A;  2BOI A;  5HCH A;  2XR4 A;  2JDK A;  1GZT A;  2JDP A;  1OUS A;  2JDM A;  3DCQ A;  5A6Q A; 
#chains in the Genus database with same CATH topology
 1VBB 1;  5DZF A;  3LSD A;  5JOZ A;  3PME A;  1KFU L;  4OI1 A;  5JXJ A;  1W0N A;  1OXC A;  1FT9 A;  4EQV A;  2V5Y A;  4YZ5 A;  1W6O B;  3MIC A;  4CP9 A;  1OOP C;  4LIU A;  3LPF A;  2GZW A;  2HEW F;  3I2K A;  1OT5 A;  1OQ1 A;  3LFI A;  3OBZ A;  4D0Q A;  1H8T B;  1DU3 D;  2RM2 2;  3RZL A;  4Y22 B;  3MUY 1;  2IXL A;  1PX3 A;  2VOV A;  5F8P A;  4BQ2 A;  5C9A A;  5FOB B;  4OZO A;  3PJY A;  3NW4 A;  3NV2 A;  2DVF A;  2Y6H A;  3WF1 A;  4ARX A;  2R06 1;  4FFI A;  1DCS A;  4LMF A;  5C7G A;  1CES A;  3VBO B;  1OUS A;  2P37 A;  3BOW A;  1IG0 A;  1AXY A;  1O7F A;  1M4W A;  3WG1 A;  1LGB A;  1J1L A;  2VW1 A;  3WF3 A;  3ZXK A;  1OQE A;  2J1A A;  5C70 A;  1GP6 A;  4C1X A;  5I93 A;  5GZD A;  3WQ7 A;  3BCW A;  1NOV A;  1ZZC A;  2DVD A;  1K5M A;  2PHD A;  3NJV A;  5FY0 A;  3HQU A;  5J09 A;  1US2 A;  1BK0 A;  1B35 B;  4QU1 A;  1ZBA 1;  5C3P A;  3ZYI B;  1SLT A;  3T2Q A;  5CA6 A;  2XG3 A;  4HKL A;  3J26 N;  3J7M A;  4KGQ A;  1D0H A;  3BKZ A;  4HET A;  4NHX A;  1T2X A;  2VCM A;  4AHZ A;  4JTO A;  3J7L A;  2GME A;  3DYM A;  1QJY 2;  4FI9 A;  4L97 A;  2ARX A;  3VBF B;  2ID4 A;  2RS1 2;  2Y6J A;  1RUE 2;  4K7J A;  5T5P A;  1ALY A;  1OLM A;  1HRI 2;  1VBA 2;  4RR3 C;  4S2H A;  1G9D A;  1A8M A;  1VAM A;  2BWC A;  3VDD A;  3QH7 A;  2ARE A;  4UF0 B;  3FN9 A;  4O7X A;  2TBV A;  4JTN A;  2BV4 A;  2VOT A;  4QKF A;  3ZX7 A;  1EV1 3;  1LED A;  1OFN A;  2V09 A;  3JUU A;  3ME2 A;  1XRU A;  1W3V A;  2DCJ A;  3WQ0 A;  1HRV 3;  1IHM A;  2VXJ A;  3JQX A;  1VRH 2;  1W99 A;  2BEO A;  1SHW B;  2LM3 A;  4IEO A;  5CB7 A;  3SQO A;  2RM2 1;  5T3N A;  2QQO A;  5A7Q A;  3AP9 A;  3DL3 A;  3HN1 A;  3VL8 A;  1AL2 3;  2VGD A;  3VDD C;  1KJL A;  5ACA 2;  2Z79 A;  1QH7 A;  2PHT A;  3APB A;  4XTP A;  1A8D A;  3VZN A;  1DP0 A;  1LHV A;  3JXS A;  2QQK A;  2DV9 A;  1RUC 2;  2VXR A;  3PVE A;  2R32 A;  1YFU A;  4YZ1 A;  1OA4 A;  3MDP A;  4XF9 A;  3RDI A;  1QJU 3;  1F2N A;  4P02 B;  5FYV A;  1CWP A;  1XXN A;  4AHX A;  1X8E A;  4QGM A;  3POG A;  5T5O A;  2YRO A;  2WLP A;  1Y9M A;  2Z69 A;  1SFN A;  2WFF 2;  3D82 A;  1W9Y A;  4IEQ A;  3RGB A;  3SIS A;  3AM2 A;  4LKF A;  3FMG A;  1CX4 A;  3LPG A;  1Q8S A;  2B46 X;  3NRU A;  4IL7 A;  1J58 A;  4WM7 A;  4XJA A;  1QQP 2;  1YFY A;  3KHB A;  1JZ3 A;  5FPX A;  2VCB A;  1SCS A;  4FPH A;  5C8C C;  1QJY 1;  2B4K A;  4UYB A;  4YM3 A;  2RG4 A;  1ZBE 1;  1UXX X;  3CQO A;  1RUE 1;  4P9W A;  4AVB A;  2JDM A;  4BE3 A;  1VBA 1;  2VQ0 A;  4CDQ C;  1QU0 A;  1LOG A;  2HWB 2;  5LA1 A;  1RIT A;  2JEM A;  5FZG A;  4MET A;  5E1R A;  2B9V A;  1NUK A;  2P6C A;  3KT4 A;  3RRD A;  4K8R B;  3ZFF B;  3D3A A;  5BNN A;  4WM7 C;  4D94 A;  3N9M A;  1VRH 1;  2YPD A;  3VD9 A;  1EAH 2;  4Q4W 2;  2HWC 3;  1GP5 A;  4LO7 A;  4FXG B;  5CVR A;  2V5D A;  2ET7 A;  4ZU5 A;  2W92 A;  3IDB B;  2P3K A;  3MID A;  4HPK B;  3IWZ A;  3UKN A;  4YVW A;  3J8F 1;  4CUG A;  3AP4 A;  2EXK A;  2Y64 A;  4IV1 B;  2OPW A;  3F2Z A;  2FDF A;  2DFC A;  4LKS A;  5ACA 1;  1UL9 A;  4AR2 A;  1GOH A;  1XC6 A;  3NNL A;  3VBR B;  4RS5 A;  2YU1 A;  2XDV A;  5HCH A;  2WO1 A;  4FFG A;  2A1X A;  1RUH 2;  3T4V A;  4L9B A;  2EXJ A;  5E16 A;  4RD7 A;  2HWE 3;  4ET7 A;  1QIQ A;  1H8T C;  3IDA A;  1RUC 1;  2WT1 A;  4IE6 A;  2ZAH A;  4PLM A;  4F8A A;  4DXT A;  2ARC A;  4N9I A;  4CYD A;  3O1S A;  4QPG B;  3SXW A;  4N53 B;  3MPB A;  4GWM A;  5AVA A;  1MS3 A;  3B9I A;  1Y43 B;  4QPY A;  2W47 A;  2WFF 1;  4IEY A;  4RS5 C;  4GKY A;  4NHY A;  3M1H A;  4NHL A;  1FPN 2;  4YGE A;  1UY0 A;  4DS0 A;  2CU5 A;  1E5R A;  3MUZ 1;  3PIJ A;  1WA6 X;  2FMD A;  4LTA A;  4N7U A;  3DKQ A;  2A3Y A;  3AJY A;  2EA7 A;  2R04 2;  1NQD A;  2XXZ A;  5FZK A;  4E2G A;  1IQA A;  4MYE A;  4QDQ A;  3PVB B;  3E6D A;  4K6B A;  1GBG A;  1VBE 1;  4MGI E;  4UFJ A;  4W6X A;  3W21 A;  2GC3 A;  5KHJ A;  5M0T A;  4LK7 A;  1GP4 A;  3ZXA C;  5FZF A;  2HWB 1;  2RVA A;  1L7R A;  1RL3 A;  4IQP A;  3FHQ A;  2XLA A;  3E97 A;  3ZFG A;  1Q56 A;  1T6G C;  2R30 A;  3III A;  3ITQ A;  3WD5 A;  2O14 A;  1NX9 A;  3GJA A;  1OUX A;  2W95 A;  5LBC A;  1EYB A;  2X5I B;  1C8M 3;  1ULO A;  2WWJ A;  1OLQ A;  1RC6 A;  2DUR A;  3ACH A;  3B01 A;  2VW2 A;  3VBF C;  4LBK A;  4LEJ A;  2K0G A;  4QU2 A;  4BIF A;  1S0F A;  1QJE A;  1PZ7 A;  3PU8 A;  3ZPO A;  2JEN A;  3VLB B;  3O0V A;  3IN9 A;  1YIF A;  2WZE A;  1BVV A;  4CCC A;  1FI2 A;  4M0N A;  1RUI 3;  3OEA A;  2FCV A;  3ZSM A;  4P9X A;  3CZU A;  3RYR A;  1NZC A;  1POV 3;  2W94 A;  2QCS B;  3LQC A;  3TEY A;  2EXI A;  1GMM A;  4LHL A;  4RQP B;  1MS8 A;  1LGC A;  3Q8F A;  3IKW A;  5F5I A;  2J1U A;  3KT7 A;  4JQT A;  2JD9 A;  1ULE A;  3BTX A;  2D6L X;  2XBO 1;  5FZE A;  3MW2 A;  4OQ9 A;  4B7E A;  1WW7 A;  4YW5 A;  2WNU B;  4WZC A;  1HN1 A;  1W8W A;  5B4X A;  1U0A A;  4LIT A;  2IXC A;  4CUA A;  3PMS A;  3THT A;  1OPM A;  1APN A;  4JGZ A;  5DQ0 A;  1DYO A;  2ZX1 A;  1FPN 1;  4AOC A;  1LRH A;  4LBJ A;  3B5L B;  1J84 A;  4CDW B;  4RYD A;  2X8K A;  3WVJ A;  1TQ5 A;  1RMU 2;  4GMP 0;  5FZO B;  4PIY A;  4PHZ A;  4AFC A;  4CDU B;  3LIH A;  4QDS A;  3I3B A;  2ZGK A;  4QX7 A;  1CGP A;  2GSY A;  2X29 A;  3WW1 A;  4FPF A;  5T54 A;  4BA6 A;  1TEI A;  1XOY A;  4AWD A;  3NJX A;  4N7I A;  4W8J A;  4B4P A;  2RMU 2;  2PAM A;  3S5Q A;  4UW4 A;  3R0R A;  1V6K A;  1V9U 2;  4P08 A;  3ZFE A;  3N9P A;  4Q8K A;  1YXW A;  1AR9 2;  1WZX A;  1JU3 A;  1W8H A;  2XLF A;  3T3Y A;  3HNM A;  3TN9 2;  2G9G A;  2CSG A;  2BNM A;  1VP6 A;  4UW3 A;  2BOJ A;  2WS9 3;  3L9J T;  4X6Q B;  4YYO A;  4XC9 A;  1U5X A;  1R1A 2;  1BHG A;  5GZC A;  5FY7 A;  1PIV 2;  4NRO A;  5FQ0 B;  2P3J A;  3ZN6 A;  4DIN B;  1AR8 2;  1DG6 A;  4LLF A;  5JIA A;  5CFC A;  4V1P A;  4HFS A;  3ZN5 A;  1UU4 A;  3W5M A;  3ZFE C;  1OA2 A;  5BNP B;  2RS5 3;  1QDO A;  4QQO A;  3W20 A;  4I3P A;  5I8Y A;  1LHW A;  2E7T A;  4B4R A;  2ZOE B;  4IV1 C;  4N53 A;  3OUH A;  4M0H A;  5IJR A;  1POV 0;  1E5I A;  5E6H A;  3OGV A;  4P5Y A;  2VME A;  4AFA A;  2WAO A;  5F3E A;  5A3L A;  4Z1V A;  3WNN A;  4Z2A A;  5F5C A;  3AYE A;  1VBC 2;  3I3E A;  3MPP G;  5FZ8 A;  3H0O A;  2EF6 A;  4M3C A;  3UGH A;  4NAM A;  3WP3 A;  2PHR A;  4FAG A;  2HYK A;  5FP3 A;  1CVN A;  1PO2 2;  3NQH A;  4JHZ A;  1YWK A;  4XFG A;  1MS1 A;  1AF9 A;  1RMU 1;  3K2O A;  4J1W A;  4BXF A;  1VMF A;  1QHD A;  4N53 C;  1OC1 A;  4GA9 A;  2HWD 2;  1VBD 2;  4AW7 A;  2VO5 A;  5A6Q A;  3VKM A;  5BYN A;  1NLR A;  5IVF A;  3IT8 A;  4TXW A;  1P8J A;  1XB9 A;  2UWA A;  4BMB A;  3V0B B;  2HYX A;  3NAP B;  3LA3 A;  1HXS 2;  4CTE A;  2B5H A;  5FK8 A;  1V9U 1;  5I0T A;  2ZAC A;  1W6Q A;  4K3U A;  2PHF A;  1AR9 1;  1OH4 A;  3H7Y A;  2EAK A;  4JRA A;  3GCW A;  4L92 A;  4XJ8 A;  2FCT A;  3OB8 A;  3TN9 1;  5A6X A;  2EID A;  3POW A;  3H8R A;  1WMX A;  4Q4V 2;  1TZO A;  4UBH A;  2AAC A;  3UJQ A;  5I8S A;  4CU8 A;  3LFM A;  1R1A 1;  3FC0 A;  1PIV 1;  3MBW A;  3PUI A;  1AR8 1;  3AFK A;  2X5I C;  1X82 A;  3SKJ E;  2ZEX A;  4KBB A;  3VBH B;  2RDQ A;  4JKL A;  3UL2 A;  1UY3 A;  3ZR5 A;  3RPQ A;  2BRT A;  1UD1 A;  4JKK A;  2GP5 A;  4RGG A;  4D7Y A;  3AFG A;  1VIW B;  5FWJ A;  1JOP A;  4A7Z A;  3PTY A;  4JCK A;  2XH6 A;  2D6M A;  3VD4 A;  4AI8 A;  5FZH A;  4QM9 A;  5IYY A;  4RQP C;  1YNA A;  4XFB A;  1VBC 1;  4RGK A;  1NY7 2;  2VEC A;  3WDV A;  5FOJ B;  1ENS A;  3UES A;  3MFC A;  4WZF A;  1JYX A;  1LEM A;  3WNK A;  3CF6 E;  1PO2 1;  4JRL A;  4LUL A;  3U14 A;  2DCY A;  4QB6 A;  1Q8P A;  2MNG A;  3SH5 A;  2WNU C;  4BYY A;  1STM A;  1REF A;  2HWD 1;  1AR6 3;  5FDB A;  3E1F 1;  2JDP A;  4PF1 A;  3UJO A;  4MH0 E;  1GFF 2;  1MEC 2;  1W9F A;  1FMD 2;  1IQD C;  4ZU7 A;  1POQ A;  2YDE A;  5DAW A;  1XE8 A;  1KDM A;  3FZ3 A;  2ZX2 A;  5FYY A;  4COU A;  1HXS 1;  4N90 A;  3EBR A;  4GB3 3;  3LEM A;  4QB2 A;  4EWD A;  5JSO A;  4CDU C;  1AYN 2;  4FPL A;  4RSU A;  3GBW A;  2B45 X;  1CAV B;  3M8L A;  3ZPY A;  5T52 A;  5A6Y A;  5IK4 A;  2OZJ A;  4MOA A;  4R8H A;  1J3Q A;  1ZZB A;  3AKS A;  1EUT A;  1VAV A;  4YGD A;  4ZXE A;  5F9T A;  1CZS A;  2W3J A;  4LKD A;  2ZEW A;  3I49 A;  2JE8 A;  3HQX A;  3NKG A;  1W3X A;  1W2T A;  5BPX A;  1N1T A;  3BPS A;  5JMC A;  4TLG A;  4BQ5 A;  1O3R A;  3VKO A;  2K2S A;  1LR5 A;  2O1Q A;  2C9K A;  3VHR A;  1XNA A;  3WW3 A;  3ZIX A;  1VPH A;  3FHI B;  1J59 A;  3MV0 1;  4MO3 M;  5IT6 A;  4GD4 A;  3WLU A;  2JDN A;  3MLJ A;  3RWK X;  3R4S A;  3G6J B;  5IK5 A;  2VU9 A;  4ITC A;  1XE0 A;  1TMF 2;  2R07 3;  5JZG B;  4OCT A;  1H2K A;  5FLJ A;  4AEM A;  1GAN A;  3OY8 A;  3WDW A;  1UYP A;  4FOY A;  4M01 A;  4NRP A;  4NPR A;  3ST7 A;  5LRS A;  5DPN A;  3S7I A;  5LA0 A;  1I5Z A;  2X09 A;  3OBT A;  1SBD A;  1G9F A;  3N3H A;  4JGY B;  2QFE A;  3PLQ A;  4AI9 A;  2CGO A;  2F6B A;  4CP1 A;  3A0N A;  3AX4 A;  2QVS B;  2D6N A;  5FMO L;  1CAW B;  1YUD A;  4DRR A;  5FZA A;  2BER A;  4BM8 A;  2QQW A;  1MEC 1;  5JSR A;  1RUG 3;  1COV 3;  2PEL A;  1FMD 1;  2P6H A;  4QX1 A;  2BGP A;  3RFR A;  5KHG A;  1XNC A;  2RS1 3;  3CNA A;  2XJQ A;  1HRI 3;  5K7P A;  2BNN A;  2QUO A;  2ZCW A;  4Q4X 2;  1RVF 1;  1PVC 3;  2QQI A;  4M3C E;  3I59 A;  2VMF A;  3LDK A;  1F8V A;  4RGA A;  2XKO A;  1AYN 1;  2FHR A;  4OI2 A;  4CZS A;  2GC1 A;  2NYY A;  3H3U A;  4HT1 T;  1O3S A;  3I2F A;  4DRV A;  1JN2 P;  4LLO A;  2IZW A;  5H9S A;  3EXU A;  1YRZ A;  4KQ7 A;  5L7O A;  2D43 A;  3AMM A;  1JYC A;  1QF3 A;  1I3H A;  4FXK B;  3NAP C;  4LIV A;  4HVQ A;  2KD7 A;  1V6I A;  2W2I A;  4LQR A;  1MS0 A;  1JS9 A;  3LAG A;  4ZON A;  3T2P A;  4AED A;  3POI A;  1YI7 A;  2BGC A;  5GLZ A;  3FLP A;  3N7M A;  2V4V A;  4NVP A;  2UU8 A;  3JB4 C;  1V6O A;  2NZ9 A;  4AL9 A;  2J1V A;  2WNV A;  2Y34 A;  4QDR A;  3BAL A;  4ORF A;  2E6V A;  1JZ6 A;  4PQQ A;  4QHB A;  1TMF 1;  4RHV 1;  4Y4R A;  1SLA A;  1VAL A;  2AC1 A;  5L7O C;  4Y20 B;  5I0R A;  5GLT A;  3SCF A;  4IEU A;  3WNM A;  5F37 A;  1IPJ A;  1ONA A;  5ERL A;  4P9G A;  5F5Q A;  4L0P A;  2VZU A;  1E5H A;  5KBF A;  1MZF A;  1QQP 3;  3D0J A;  5FY1 A;  3MF6 A;  3AL5 A;  2VL4 A;  3GZT B;  3VKF C;  4EN6 B;  3RMX A;  5AC9 1;  4FTE A;  4MGT A;  1TME 2;  4TN7 A;  1ZZ6 A;  2VG9 A;  1XE7 A;  4JX0 A;  2CHH A;  3OG2 A;  3BN6 A;  4XUP A;  1OF4 A;  3ILF A;  4Q4X 1;  4CP0 A;  3O1R A;  5FLH A;  2Q1Z B;  2UYB A;  1XSQ A;  2WJS A;  4QXK A;  4F3J A;  5J96 B;  4R9C A;  1BCX A;  2C4X A;  1D7P M;  2XL7 A;  1V00 A;  1VAK A;  3F95 A;  3POF A;  1EAH 3;  4Q4W 3;  5GKA C;  3V0A B;  4YM0 A;  4LBQ B;  4NRM A;  3PVN A;  4CDX B;  4PQ9 A;  1N3Q A;  4DEQ A;  4JVA A;  2C24 A;  1WW6 A;  3E5Q A;  2GNT A;  2IC1 A;  1BEV 2;  5E8A A;  4DXR A;  2QJV A;  4N43 B;  3T1L A;  4D69 A;  1CN1 A;  1Q5O A;  2JJ6 A;  3SMH A;  2XVG A;  4KNC A;  3KWV A;  4GMP 1;  5D1I A;  4YSF A;  1RUH 3;  5IVV A;  5KC6 A;  1QOS A;  5IVC A;  2PHW A;  3I2O A;  1GOG A;  4XUR A;  4BH9 A;  2JE9 A;  3VBS B;  5A6Z A;  4COV A;  1WCS A;  2FMY A;  2OYZ A;  3MW3 A;  3M7A A;  2OZ6 A;  1C5H A;  2I74 A;  2JG8 A;  2RR1 1;  5HXM A;  1ASJ 3;  3KGZ A;  3NVC A;  4BU2 A;  5JI9 A;  5KR7 A;  1DF0 A;  4RN5 A;  4BOW A;  1O5U A;  1SFP A;  3WHT A;  5C71 A;  2D7F A;  1H1I A;  4CXX A;  3ZYB A;  4B3N A;  2H6C A;  2YUE A;  4KWU A;  3RMY A;  1UY2 A;  4I02 A;  5FZ4 A;  4HVO A;  2WA3 A;  5D8A A;  3Q8C A;  3FL7 A;  2R04 3;  3BOD A;  3M3O A;  1LU1 A;  1WLC A;  4B7K A;  1DLL A;  1K45 A;  1TME 1;  3NV3 A;  3RVH A;  2JG8 C;  1UY4 A;  3FX3 A;  4PJY A;  2J22 A;  1R08 2;  1R09 2;  3A4U A;  5FKC A;  3Q8B A;  4XF3 A;  2RDN A;  2ORX A;  2E26 A;  5I8T A;  4TTG A;  3O1O A;  1GYK A;  1F31 A;  2HJI A;  1H0B A;  3NNJ A;  1IPS A;  1G86 A;  2K9Z A;  2OS2 A;  1H9P A;  2A71 A;  3FUQ A;  5FIX A;  3MO4 A;  3C7O A;  5D8A C;  3CDZ B;  4XBL A;  5E89 A;  3K75 B;  1DZT A;  4LHN A;  5J98 B;  3WW4 A;  5C3R A;  4HON A;  1BBT 2;  4Z92 B;  2D6P A;  1HN0 A;  5DUV A;  3O0W A;  1YCI A;  1LEN A;  1CZT A;  2DUP A;  2D93 A;  2JDK A;  1BEV 1;  3O5S A;  1ULP A;  1CZV A;  2A7A A;  2CWS A;  2VOW A;  3WDU A;  2GAU A;  3USU B;  3JD7 2;  2R0H A;  1OUR A;  3SEP A;  2YFZ A;  5FP7 A;  4HG6 B;  5FYI A;  3ZSJ A;  2PMW B;  3IIA A;  4GQ7 A;  5GLW A;  1GZW A;  2A6X A;  2YGL A;  4IE5 A;  3I4I A;  3OPT A;  1VLN A;  4AGG A;  3OD0 A;  4FT8 A;  1Z7S 1;  5FMO S;  5JXI A;  3FE5 A;  4MVT A;  2ADD A;  5A7W B;  4FPJ A;  1DZQ A;  3JBG 2;  4OUE A;  4UFK A;  4XW3 A;  1JZ4 A;  1QDC A;  1QH6 A;  1UZY A;  1QKQ A;  3NNM A;  3E6B A;  5JSP A;  4AEJ A;  2JIJ A;  1PO1 2;  1AR7 2;  1OPO A;  4AVV A;  1W90 A;  4Y3O A;  1PX4 A;  3HIF A;  2A73 B;  2UYA A;  5FTT C;  4D3W A;  1R08 1;  1R09 1;  3WNP A;  4NIA A;  3I2G A;  1QJZ A;  4IV3 B;  3T08 A;  4D7S A;  1W8O A;  2RMU 3;  1VB2 A;  4NWW A;  1NA1 B;  1JOJ A;  3GDB A;  3KV5 A;  4AEK A;  3N36 A;  4MUV A;  3VUO A;  5IK7 A;  3M4F A;  4B1M A;  3KZ4 C;  2YFU A;  4QKB A;  5JAX A;  1GU3 A;  2E53 A;  1OOP A;  4QX0 A;  4D7T A;  4XAA A;  1Q3E A;  1MVE A;  1FV2 A;  4RFT 0;  1OKQ A;  2XWB B;  3HT1 A;  3MFA A;  4LOS A;  3T30 A;  4O61 A;  2ZS6 B;  1F5F A;  2Y8K A;  5FWE A;  3SCH A;  1BKZ A;  3DXT A;  5FXW A;  3WG2 A;  3T0D A;  1XYP A;  2LRP A;  3I2I A;  3OYW B;  2RJL A;  4CEW B;  4ZKT B;  1H2L A;  2ZHM A;  3GM8 A;  4OUM A;  3JD7 1;  1LJ7 A;  5A7O A;  3IPV A;  2ZGM A;  4ASL A;  3P3P A;  4KWL A;  3ES4 A;  4UW6 A;  5FFO C;  3U11 A;  1CAX A;  2DU0 A;  1DQ5 A;  4TWT A;  2WNE A;  1AXK A;  1NXD 1;  3ZM8 A;  5A3M A;  4L11 A;  3TRS B;  2YMZ A;  3JBG 1;  2HLE A;  2WDB A;  4A2U A;  4NID A;  1Q8O A;  4MAD A;  1NYW A;  4DPN A;  3PDQ A;  1Y4W A;  5FO8 B;  1RED A;  4OHV A;  2KXL A;  4L99 A;  4TYS A;  4KMQ A;  2GNM A;  2PHU A;  5K9Y A;  3WOG A;  1KFX L;  1PO1 1;  3GBF A;  5DN2 A;  3VDB A;  1AR7 1;  1HB4 A;  4K20 A;  2HEV F;  1IZ3 A;  3GZU C;  2UY9 A;  3LEG A;  1VBD 3;  4AFB A;  2XJP A;  1IS5 A;  3LA7 A;  3LF7 A;  1CAU A;  4JAA A;  4P9Y A;  1K5J A;  4YZ2 A;  2HBT A;  3DEC A;  1O4Y A;  3KSC A;  3I3M A;  3KQ4 B;  1DQ2 A;  3I3Q A;  3U4S A;  4RR3 A;  5CKN A;  5KC5 A;  1SDD B;  4O9E A;  1OFS A;  4CU9 A;  4NIG A;  4FTB A;  5JXG A;  4JV4 A;  2BNO A;  4QPI A;  4QGL A;  3ZSL A;  2QBX A;  2IVJ A;  2VZS A;  5A32 A;  2YBK A;  5HI0 A;  4XDQ A;  2BWA A;  3AMH A;  4Q4V 3;  4YFZ A;  3RYP A;  1HJG A;  3POJ A;  3OBR A;  5EV7 A;  1OKO A;  4GWN A;  2Y26 A;  2WO2 A;  4K8F A;  1ZBE 2;  2IXH A;  2PFW A;  3ILR A;  1JYT A;  4HAN A;  4XF1 A;  1URX A;  1N3O A;  1AX2 A;  4ISR A;  1LES A;  4BK5 A;  1EY2 A;  2R1B A;  3FLT A;  4QPI C;  5FMD A;  3THC A;  1IS4 A;  1WW5 A;  1HV0 A;  1H6Y A;  2WR9 A;  5CKM A;  4AVT A;  4WVV A;  2VVE A;  3ETP A;  4LR4 A;  5JWP A;  1UU6 A;  5KXE A;  5DAX A;  4RL7 A;  2JDY A;  4PI2 A;  5FKB A;  1NCQ B;  4IEW A;  4PF5 A;  3J8F 2;  2WZR 2;  1KXG A;  4URT A;  2ERF A;  4AI1 A;  1H6X A;  1RUF 1;  1UMZ A;  3SCG A;  4CXY A;  3NL1 A;  1OLR A;  3QAC A;  1DIW A;  1HB3 A;  1JU4 A;  1W39 A;  2XR4 A;  4OUS A;  1PZ9 A;  4Z82 A;  4AQ2 A;  5K8S A;  3V56 A;  3AZW A;  1L3J A;  2D5H A;  3POE A;  5FXX A;  2P1B A;  2ATF A;  1WD3 A;  3GXU A;  4QXB A;  5FPL A;  1RUJ 2;  3ELN A;  3OGJ A;  3Q8A A;  5C8C A;  2WFP A;  3ZYG A;  4XJ9 A;  4P00 B;  3H9A A;  4JC1 A;  3UK9 A;  4CDQ A;  1LTE A;  3E5X A;  1LOB A;  2CDO A;  2C6S A;  2OA2 A;  3KQR A;  1FNY A;  3ZYH A;  2K46 A;  4UFL A;  5L9R A;  5H9R A;  1WA4 A;  5GLV A;  5FP8 A;  4DY5 A;  1PVX A;  5FZC A;  1AZD A;  3B7M A;  1VBE 2;  5IAT A;  4IV3 C;  1PK6 A;  2B9U A;  4F83 A;  3NNF A;  4CEW A;  1NA1 C;  2DVB A;  1W8Z A;  3FHA A;  5T50 A;  3SEE A;  2VVD A;  1RUD 2;  2KA3 A;  4X8P A;  1AUY A;  3LOB A;  5FYB A;  4XJU A;  4E4Z A;  1W6O A;  1FOD 3;  3KV9 A;  2ZZJ A;  1OI6 A;  2YY1 A;  4A6S A;  1D4M 3;  1ZRF A;  3LD8 A;  1FXZ A;  1H8T A;  1AYM 2;  4U2A A;  4WVM B;  4NIH A;  4Y22 A;  2ZEY A;  4WVZ A;  1PK6 C;  3O1M A;  2YC0 A;  4CEW C;  2DFB A;  2WZR 1;  1R1Z A;  1MS4 A;  3NWK A;  4EZH A;  3RZK A;  3ZKU A;  4XHB A;  3EQE A;  3HOB A;  3HNB M;  3ZYF A;  3OGS A;  1BYH A;  4FOV A;  5F2W A;  3POS A;  3VBU B;  1LHO A;  3VBO A;  4CPB A;  2BVV A;  3SC7 X;  3OD4 A;  4QM8 A;  1GWL A;  4A4A A;  4X8N A;  2EAL A;  5IUQ A;  1UY1 A;  3EO6 A;  3SKV A;  2G9F A;  5JCT A;  4EWE A;  2XBO 2;  1ACC A;  1RUJ 1;  5L73 A;  1NAE A;  5HCA A;  1IKP A;  5FYZ A;  5L9B A;  4CXW A;  1ULF A;  5FZI A;  3FFQ A;  3M3C A;  2OUJ A;  5T5L A;  1B35 A;  3W9A A;  5IVJ A;  1YQ8 A;  4BPZ A;  5GZE A;  4EWA A;  3VBO C;  5C5U A;  5H9P A;  2CV6 A;  2VMC A;  3UKT A;  3USS A;  3AYC A;  1W6M B;  1KS4 A;  4JKM A;  1QXR A;  1LOC A;  2YGM A;  3N35 A;  2Q8C A;  1UOB A;  1S2E A;  3VBF A;  2FDK A;  3AXD A;  1KS5 A;  2WQZ C;  2VZP A;  3NJZ A;  1I6X A;  1QJX 3;  5BY5 A;  2A75 A;  2VAU A;  3C7G A;  1JBC A;  1QY4 A;  2YPJ A;  4UF0 A;  4ZPI A;  3ZLI A;  3AZY A;  4COW A;  1B35 C;  2Y6G A;  4EZ4 A;  1RUD 1;  1VR3 A;  1US3 A;  1PM7 A;  5JI7 A;  3RJR A;  1SLB A;  1YQ5 A;  3OUI A;  1C8N A;  2NLR A;  2LAL A;  2PAE A;  3UKV A;  5A3U A;  1CJP A;  1AYM 1;  3NV4 A;  1UNB A;  2FZ2 A;  3AZV A;  4DOU A;  2J1T A;  5FZL A;  3RWN A;  3ZXE A;  1UAI A;  2W68 A;  3QOP A;  5C3Q A;  1SZB A;  1OLM E;  1MPX A;  2BU9 A;  3K48 A;  2GP3 A;  5EPA A;  5DDJ 2;  1AVB A;  2HWF 3;  1C5I A;  5CAZ A;  1W28 A;  4CCK A;  4ATE A;  3VZM A;  2JDZ A;  2LUW A;  3PHM A;  3GZE A;  2VR4 A;  4E2Q A;  3WQ1 A;  4LOR A;  4Q4Y 2;  5SV8 A;  4UT5 A;  1U5I A;  1N1S A;  2GND A;  2RV9 A;  3J7H A;  2D3R A;  3WF0 A;  3RZZ A;  2XVL A;  3LDB A;  4OQ8 A;  3AYA A;  3P5B A;  3N9N A;  4LBM A;  5FPV A;  2DBI A;  3A21 A;  3T2O A;  2QZ2 A;  3N7J A;  2UY8 A;  1MQT B;  3ACF A;  3O1U A;  3LCP A;  3W5N A;  4YGB A;  4FPO B;  4G3Y C;  4HOO A;  4CRQ A;  1BJQ A;  4MXW B;  1RHI 2;  3IMN A;  5A1L A;  4R52 A;  1C1L A;  3WF2 A;  3U37 A;  2D6K A;  3R4D B;  4Y1V A;  4ZXK A;  4W4Z A;  3M70 A;  1PNG A;  3M3I A;  1LOA A;  4R4X A;  4XCB A;  2VZ3 A;  3ZFF A;  4HMZ A;  2RS3 3;  1O91 A;  3DF0 A;  1SLI A;  2IXK A;  1UOJ A;  4HPK A;  1MZ5 A;  5LA9 A;  2WWS A;  4XFC A;  5HXV A;  3H8O A;  1O5L A;  3OSD A;  4GUL A;  4IV1 A;  5FLI A;  1YC6 1;  5CEH A;  5EXO A;  1GQP A;  1LGN A;  4DNY A;  5JIU A;  5FR3 A;  4MHU A;  3S57 A;  1RGS A;  5EP9 A;  3S5A A;  2WII B;  3N7K A;  3VBR A;  1O4Z A;  5DDJ 1;  2I45 A;  2DVG A;  3ZFF C;  4DZG A;  4XFI A;  2OQ6 A;  3JU9 A;  1JUH A;  1H4H A;  2D44 A;  1NCR B;  2DU1 A;  5E88 A;  2BDR A;  1UIK A;  2BUK A;  4WVW A;  2PLV 3;  4Q4Y 1;  1J3R A;  4Q0U A;  2MEV 3;  4UFH A;  1NLS A;  5JUV A;  4BWO A;  3GJB A;  2A6Z A;  5HCB A;  4QPG A;  4QX5 A;  2PTM A;  4UFI A;  4GJZ A;  4R9D A;  1UZZ A;  3ZDV A;  4QPW A;  2WWU A;  4JQR A;  4UOJ A;  3VBR C;  5F6K A;  3VBU C;  4PBO A;  1O8S A;  1A6C A;  4YVS B;  3U0Z A;  1B09 A;  4QQL A;  1U5Z A;  2D97 A;  2OKX A;  3WUC A;  5J37 A;  3POB A;  3KLS A;  1YQC A;  3EB7 A;  2Q5T A;  3C2U A;  5A1F A;  2C26 A;  1PZ8 A;  3T4H B;  1PNF A;  4QPG C;  5CZK A;  4XAB A;  1RHI 1;  3ZSE A;  4LXL A;  3X29 B;  1BBT 3;  3AKR A;  4NJ4 A;  4NHK A;  3O1T A;  4SLI A;  1SLC A;  3BYW A;  5DUX A;  5ABJ A;  4EN8 B;  1XNT A;  4IE7 A;  1FYU A;  1JTZ X;  1ULG A;  4CCD A;  5GZG A;  4XAC A;  2XQR A;  1O3Q A;  2VOX A;  2JDA A;  1ZZ8 A;  5DMY A;  3H7J A;  2X5I A;  3FJS A;  1VBB 3;  1UF2 C;  3GHN A;  3OPZ A;  2JG9 B;  5FYM A;  5A3O A;  3TOJ A;  1G9B A;  1CIW A;  1W05 A;  2GDF A;  3AMQ A;  1O59 A;  1UKG A;  2QQM A;  2BQP A;  4KH9 A;  2YV8 A;  3PUQ A;  4R4Z A;  4A3Z A;  4HK8 A;  2ZA9 A;  3ZIW A;  5F3G A;  1BLZ A;  4BQ4 A;  4DB5 A;  4E27 A;  5LK7 B;  5FZM A;  1PGS A;  3GNE A;  4K1Y A;  4ES9 A;  5ABJ C;  3AVR A;  4NMI A;  3K4D A;  4XUT A;  4FQ4 A;  4FBF A;  2BGO A;  2N7G A;  4Q0Q A;  2VBD A;  3K46 A;  4RQP A;  3ZXJ A;  3SH3 A;  2PQS A;  3IM0 A;  2G9Z A;  3CJI B;  3WNL A;  4IEX A;  1ZRD A;  1C3H A;  3FBY A;  2R06 3;  2LS6 A;  5LCW L;  3PNA A;  4M4P A;  3HPN A;  3KB5 A;  4A42 A;  2WNU A;  3D6E A;  5FYU A;  4C90 A;  1GNY A;  5HPO A;  3HAG A;  3HWJ A;  2XHK A;  3U10 A;  1MS5 A;  4PLN A;  1KD7 A;  2QDN A;  3WIN E;  2RDS A;  2VTF A;  3PUA A;  1UPS A;  4DY3 A;  4CSW A;  4GWI A;  1JXN A;  4Q5O A;  5FPU A;  3T09 A;  3UGG A;  4H55 A;  4CDW A;  1ZBA 3;  3QCW A;  5FZO A;  4B29 A;  1OQD A;  4CDU A;  1Y9Q A;  2X53 S;  3B00 A;  3L2H A;  4QHO A;  5FZ1 A;  1OA3 A;  2ZGQ A;  3MIG A;  3RS6 A;  4OLL A;  3AXE A;  1HRV 2;  4HK9 A;  4M4R A;  1MQT C;  3BTA A;  2NPI A;  5G05 L;  4E2S A;  2DCZ A;  4XDP A;  2JIC A;  4W6Y A;  3RSJ A;  4BQX A;  4CDW C;  1RVF 2;  1UCX A;  3VN4 A;  3RZG A;  3EMR A;  1XSR A;  3HNY M;  4LKE A;  1WD4 A;  5LY1 A;  1AL2 2;  2GN3 A;  4R9B A;  2C0Z A;  4QX3 A;  1LEC A;  4Y1Z A;  5T5J A;  4I09 A;  1QJF A;  5J3U A;  3I2H A;  2AEZ A;  4KBZ A;  5HV4 A;  4JDN A;  1SG3 A;  2VE1 A;  4QKD A;  5I0U A;  2RM2 3;  5FQ0 A;  2IVI B;  2IFR A;  3NJY A;  3AP6 A;  4YG0 A;  5BXX A;  4PIX A;  1WMD A;  1Y7B A;  4XFF A;  2A6W A;  2JKB A;  2XJV A;  1JOD A;  2AGS A;  3GCX A;  4Y5S A;  4ES8 A;  2WNO A;  5BNP A;  3FFZ A;  4CEY B;  4NOT A;  5CIR A;  4BQ3 A;  4NHM A;  1V70 A;  2CWM A;  4NO4 A;  3BI3 A;  2AR6 A;  4S2G A;  3GBG A;  3DYO A;  4F7Z A;  2VZV A;  1F4A A;  1Z0H A;  1XU1 A;  4KWJ A;  3MEP A;  4RHV 2;  3W59 A;  1OH3 A;  4Y5T A;  3J9S A;  4CCE A;  2R7E B;  2Y6L A;  4AG4 A;  4CE8 A;  3HJR A;  1HB2 A;  3AVS A;  3O12 A;  2AH2 A;  1NCR C;  3VHN A;  2R16 A;  5BNO B;  1G6N A;  5LK5 A;  3WP4 A;  4P9I A;  1ZNP A;  2EIB A;  5BNP C;  1JZ5 A;  4DO0 A;  1JHN A;  3TYJ A;  2OUH A;  4YZ4 A;  5FPZ A;  3M3E A;  1FX5 A;  5K0U B;  4QMA A;  2YBP A;  5CKQ A;  1LOF A;  5IVB A;  1EV1 1;  4XBQ A;  4XYX A;  4YVS C;  3TEX A;  3LKJ A;  2VH9 A;  1HRV 1;  1QJY 3;  2VMH A;  5DUU A;  5AC9 2;  1CX1 A;  1ZBE 3;  4XBN A;  3V0B A;  1RUE 3;  2FZ1 A;  2HWC 2;  3DN7 A;  4HKW A;  2VQT A;  1VBA 3;  3NAP A;  2FDG A;  4NWV A;  3LOI A;  5FMC A;  4Q8L A;  4NRQ A;  5C4W B;  2GH8 A;  2Y0I A;  3K3O A;  1W8U A;  3NNG A;  3OUJ A;  4I30 A;  1GIC A;  2QKD A;  2PN5 A;  4OFG A;  5DAB A;  3MW4 A;  4LJH A;  1MVQ A;  1ND3 B;  1AL2 1;  5FXV A;  3VZK A;  4RA0 A;  4XIL A;  3WHU A;  1W04 A;  3O7O A;  4AI3 A;  1GV9 A;  1VRH 3;  1LOF C;  2LW8 A;  2IXI A;  3PUS A;  4LHK A;  3SH4 A;  4E8C A;  2B8M A;  1RXF A;  4HXC A;  4DFS A;  2ARB A;  3UT0 A;  3J8F 3;  1KIT A;  4YM1 A;  3VBH A;  5ACA 3;  3ABZ A;  3H1Y A;  3KGL A;  3P1I A;  3WV6 A;  4XTM A;  1WGP A;  1QJU 1;  4UI9 L;  3ZVX A;  1H2N A;  3KVA A;  4YWA A;  1V0A A;  4JHT A;  3TEW A;  3ON7 A;  2UWC A;  3O14 A;  1XNB A;  1CPN A;  4XDO A;  1RUC 3;  4WM8 B;  2XWJ B;  1AX0 A;  3IBM A;  4MGZ E;  2W46 A;  4DIQ A;  2W1Q A;  2G19 A;  1DFQ A;  1YLL A;  1TVG A;  2RR1 2;  3A23 A;  3VBH C;  4FFF A;  5FZ0 A;  2ILM A;  2XON A;  5JMO A;  3WNO A;  2WFF 3;  4G4F A;  1S0G A;  5F3I A;  5JR2 A;  5LAT A;  4HBN A;  5FUN A;  1ODN A;  3VDA A;  4D6R A;  4ERO A;  5FYC A;  2VBP A;  1NKG A;  4SBV A;  4YFW A;  1L7Q A;  4YW4 A;  2B42 B;  1JZ8 A;  1JZ7 A;  1C8M 2;  4DMI A;  1VBE 3;  2JXA A;  5JVV A;  5JDB A;  3O1V A;  4NII A;  3SNM A;  2HWC 1;  5A3T A;  4YNI A;  3HN3 A;  1A3K A;  1PMJ X;  2HWB 3;  3LIG A;  3TAY A;  3BUC A;  1O4T A;  4IDZ A;  4D6Q A;  1CAV A;  3AP5 A;  1W03 A;  3EHK A;  1J3P A;  1ENQ A;  1V6M A;  1M06 G;  3BIW E;  5CBL A;  1GQH A;  1K3I A;  1W6P B;  2V73 A;  5EJZ B;  2XHN A;  2HWE 1;  1KJR A;  1JMU B;  4YRD A;  4XOG A;  1WCD J;  1EUU A;  4LO5 B;  4L2N A;  2PXJ A;  1YFX A;  1K12 A;  2XUM A;  1WMF A;  1HLC A;  4XFH A;  1YYN A;  4H2A A;  3MLK A;  4Y4Y A;  4OUL A;  3U78 A;  5A33 B;  1JYN A;  5CFD B;  1N1V A;  2W87 A;  3GHM A;  4AHY A;  3S7E A;  2CNA A;  1UX6 A;  4CVU A;  1ZZ7 A;  4TSV A;  5JZG A;  1S0E A;  2Q1M A;  1ZVF A;  3KCY A;  3ZYP A;  1W6N B;  3HVD A;  2XBO 3;  3AZX A;  3C7E A;  5DG1 A;  5LEJ A;  2ZZQ A;  1Z7S 2;  2W1S A;  1C1F A;  2MPF A;  5C8W A;  2VTX A;  4YLZ A;  5EWS A;  4MV2 A;  3DGT A;  3S30 A;  4HSL A;  3KVB A;  4A44 A;  1DZR A;  2VNV A;  4I0B A;  4CEY C;  3FLR A;  4JGY A;  4UFM A;  2WN3 A;  1CPM A;  1FPN 3;  4AQ6 A;  3ZMO A;  2OII A;  2ZGO A;  1CAW A;  2A6V A;  2B7Y A;  3K4A A;  2NM1 A;  1G8W A;  4UBG A;  5KHK A;  2ZGL A;  4FFH A;  5JZG C;  5DAP A;  4BLI A;  1EPZ A;  2Q8O A;  3WT3 A;  3TNQ A;  1W9S A;  1LHU A;  2H6B A;  1C8M 1;  1S0C A;  2ZGP A;  1J1T A;  4IE4 A;  5CG8 A;  2ET1 A;  2ZKL A;  5EJ3 A;  4MGY E;  3VZJ A;  1LCL A;  2Q30 A;  4CCN A;  3RG0 A;  2E31 A;  4AI2 A;  4AE2 A;  1KQR A;  4JGY C;  4CP9 B;  3ES1 A;  1S2K A;  2WS9 2;  2QQL A;  1AX1 A;  4FPY A;  1REE A;  1SEF A;  4DUW A;  5J1X A;  5K0U C;  1LKN A;  1RUI 1;  2G4I A;  3CBN A;  3TEZ A;  2GU9 A;  1IG3 A;  2Y38 A;  3T2T A;  4H14 A;  4ZS3 A;  1POV 1;  4QGN A;  5C9A B;  1JYV A;  1CQ9 A;  4CA9 A;  1QNY A;  3ROU A;  2GMP A;  2X10 A;  5KXD A;  1I5P A;  2BBV A;  5C4W C;  2ZEZ A;  3OOX A;  3WR0 A;  3ZR6 A;  1TE1 B;  1JYW A;  1X33 A;  1ND3 C;  2O8O A;  1QXP A;  4K9S A;  1LU2 A;  4KGG A;  3MIB A;  3LGR A;  4AQT A;  1VMJ A;  1L7L A;  1YQ6 A;  2BJS A;  2CDP A;  2Q8E A;  4XIK A;  1GZC A;  4E9K A;  4AVS A;  5A3N A;  1MAC A;  5FY8 A;  1SAC A;  2OX0 A;  4XZP A;  4AXO A;  2DUQ A;  1OD5 A;  2BBA A;  1KEX A;  1K5M B;  1AXZ A;  1S0J A;  3K77 A;  4L8Q A;  2BZD A;  2GH2 A;  1TNR A;  4Y20 A;  3I54 A;  1H9W A;  3DUI A;  3LDR A;  4TLF A;  3M3Q A;  5D2A A;  1OVS A;  2JDU A;  3OGG A;  4COZ A;  2BFU L;  4ATF A;  1NXM A;  4PI0 A;  5GZF A;  3J7N A;  1T6B X;  4WM8 C;  4XUO A;  2DUO A;  2P3I A;  2RDR A;  3JCI A;  1RMU 3;  2ZML A;  3C8X A;  5FJK A;  4C8D A;  4ASK A;  3SLI A;  1V6J A;  2JDH A;  2G1M A;  4Q2F A;  1S0B A;  4MLO A;  3VD5 A;  5JR7 B;  1PMI A;  1RTV A;  4D6S A;  1WUV A;  2QQN A;  2WAB A;  3ZN4 A;  1O8P A;  1UMH A;  3ETQ A;  1F4H A;  2WYS A;  1SQ4 A;  1WLW A;  2WS9 1;  2WN2 A;  1D0G A;  1IPK A;  4FPK A;  4GJY A;  1HQN A;  1H1M A;  4OHX A;  4FQZ A;  1V9U 3;  1X36 A;  2E9Q A;  3V0A A;  1DGW A;  1S2B A;  4QQH A;  4LBQ A;  3BIE A;  5IK8 A;  1AR9 3;  4CDX A;  4LHS A;  4URA A;  1EP0 A;  3LA2 A;  4YAR A;  3TN9 3;  3WX5 A;  4QKN A;  1V6N A;  2A3W A;  2XQX A;  2RS5 1;  5IAX A;  5LY2 A;  3U4X A;  4Y24 A;  1H30 A;  4A7Y A;  1R1A 3;  4N43 A;  1ND2 B;  5JOY A;  1PIV 3;  5FZB A;  1YO8 A;  2VUA A;  4BJ0 A;  4BZ4 A;  1AR8 3;  1W2A X;  2LTN A;  4EV0 A;  2ZMK A;  1LB2 A;  4XQD A;  3KHC A;  1PGW 1;  3VBS A;  1DQ1 A;  2ZGU A;  2CYF A;  5FZ9 A;  1W8N A;  3TNP B;  1YJL A;  4CDX C;  4IGP A;  5CAD A;  2HEY F;  2DDU A;  5IVE A;  1NE4 A;  4HN0 A;  1Q43 A;  4ZZ8 A;  4N43 C;  1BQP A;  4HZF A;  5LBF A;  3ECQ A;  2WIN B;  4WM7 B;  4FP3 A;  5ANQ A;  5CFD C;  1AR6 2;  1WBL A;  1YEW A;  3OBA A;  3H8X A;  2VOK A;  1VBC 3;  3Q9O A;  1RUF 2;  4AI0 A;  4XHX A;  4GZ9 A;  3K51 A;  5A3W A;  2TUN A;  3VBS C;  5L19 A;  1VB4 A;  1PO2 3;  4AK3 A;  4XIO A;  2ZX4 A;  3AZZ A;  3TBD A;  1UPI A;  1LOE A;  3POY A;  2VUJ A;  4YPJ A;  5ANN A;  4GB3 2;  4QQ2 A;  2HWD 3;  4A3X A;  3AKP A;  2ZX0 A;  4YG6 A;  1GNZ A;  5BNN B;  5H9Q A;  2UUR A;  3BVC A;  3R6S A;  2CGP A;  2ZXQ A;  3OF1 A;  4CPB D;  3WG3 A;  1GWK A;  2VZO A;  3R4U A;  5F2S A;  1HXS 3;  3K4Z A;  1UX7 A;  3OGR A;  1IOA A;  4KWK A;  4X6R B;  3KV4 A;  4PT6 A;  3KCX A;  1WCK A;  4RFR B;  4YVW B;  4PLO A;  4AQS A;  3S0M A;  2VW0 A;  1WCQ A;  4FSJ A;  4LBL A;  3M2M A;  1UZV A;  1YHF A;  3TB0 A;  5FO9 B;  3I2D A;  5JPM B;  2NMN A;  2YU2 A;  4EN9 B;  4RS5 B;  2WO3 A;  4OZX A;  2WO7 A;  3H1M A;  5F3C A;  5TSW A;  1ZRC A;  2Z4F A;  3RZJ A;  4QWN A;  3USU A;  2GC2 A;  2R07 2;  2OXB A;  1RUO A;  4XMA A;  2CAU A;  4XPV A;  3ZSK A;  4BCU A;  1SFY A;  3LB9 A;  3PTR B;  3V64 A;  5C9A C;  1XU2 A;  5FPA A;  2WT2 A;  4FPE A;  4UWD A;  3AYD A;  5EFU A;  4C1W A;  1F35 A;  2YZ4 A;  3RJ2 X;  4B1L A;  1BXH A;  4CUC A;  2XUE A;  2ZKN A;  3C7H A;  5A7W A;  4HN1 A;  3O1P A;  4Y33 A;  4QX8 A;  3ZXF A;  2JEC A;  1AR6 1;  4DEV A;  1AL0 G;  1RUG 2;  1COV 2;  2XOM A;  1QGL A;  1ULD A;  2XJU A;  5FAX A;  2IXJ A;  1RJ8 A;  5A80 A;  2XKP A;  1K5M C;  1ZYB A;  4EE2 A;  3WW2 A;  5JXH A;  1PVC 2;  4D8M A;  3THP A;  3THD A;  2XB6 C;  4A41 A;  1H8V A;  4GB3 1;  5CIS A;  3ZFG B;  4IXL A;  2E7Q A;  2Q1F A;  3P3N A;  5FXZ A;  5LAS A;  1MEC 3;  3VHP A;  1K42 A;  1W2O A;  3D0S A;  1FMD 3;  1S4C A;  4FO9 A;  2OPK A;  2W5F A;  3RZM A;  1ENX A;  4IV3 A;  1FAT A;  4IND A;  2DBN A;  3DPR B;  2AEN A;  3ZDS A;  3MYX A;  1NA1 A;  3RI9 A;  3FBM A;  1RVF 3;  5FY9 A;  3BU7 A;  1UIJ A;  2ZHL A;  4OI4 A;  1HB1 A;  1VE0 A;  1KGY A;  3KF3 A;  4XET A;  1AYN 3;  3HQR A;  2WUH A;  3LSE A;  3N9L A;  4MGQ A;  3VKN A;  3IB3 A;  3ZXL A;  2NP0 A;  4AFM A;  2W1U A;  1E57 A;  4WV8 A;  5DAQ A;  3OJB A;  4B4Q A;  2WZ8 A;  1ND2 A;  1F9K A;  4V2V A;  5FMB A;  3OYW A;  2CGN A;  4Q1P A;  2DTY A;  2R07 1;  4YW7 A;  2QTW B;  1OHF A;  3AC0 A;  3OTF A;  5FCC A;  1LUL A;  1WW4 A;  1H1A A;  2BFU S;  2XJR A;  4YG3 A;  3IAQ A;  2J42 A;  3VV1 A;  3MF9 A;  2RJ2 A;  2SBA A;  3I7D A;  3O0X A;  2OW4 A;  4KG8 A;  5FJH A;  3WG4 A;  1OSG A;  3KS7 A;  1W2U A;  2ORZ A;  2WLQ A;  4JGZ B;  5KHH A;  4GKX A;  1XYO A;  1ND2 C;  2J1R A;  4RHV 3;  5EZW A;  1TMF 3;  3KM5 A;  2VM9 A;  1AHS A;  4XEZ A;  1ZRE A;  3VD3 A;  3QH6 A;  2VBB A;  3AJZ A;  3UGF A;  3AB0 A;  5I0S A;  1YJK A;  1RUG 1;  1COV 1;  2VNR A;  4OHW A;  2P4E A;  3H8U A;  2RS1 1;  1XND A;  4XE9 A;  1HRI 1;  4ISQ A;  2GMM A;  1W06 A;  2QQV A;  2WL1 A;  2ZX3 A;  2VNG A;  4BK4 A;  1PVC 1;  5ISL A;  2BW8 A;  2RJK A;  4HL0 A;  1OD3 A;  5LBE A;  4XFA A;  4ASM B;  2W08 A;  2IUW A;  3OPW A;  2D40 A;  1QOO A;  2IWG B;  1O6U A;  5AC9 3;  5EHD A;  1IGO A;  1DQ4 A;  2H0B A;  1HW5 A;  3ZFE B;  2ENR A;  2C9A A;  2VQA A;  4Q4X 3;  4E4S A;  3SHR A;  3MI8 A;  5CU1 A;  1ZRI A;  2XGX A;  3DYP A;  5J7M A;  1JI6 A;  5BV6 A;  1Q8Q A;  4LBO A;  2D98 A;  3ZN6 B;  5KXC A;  5BNN C;  3UYJ A;  3B02 A;  5CFC B;  1W2N A;  3DXU A;  4NR1 A;  3MLL A;  4J6G A;  5FYT A;  1JYI A;  1HIX A;  2ZHN A;  5FK7 A;  1G7Y A;  2YC4 A;  2YHJ A;  3E5U A;  4YVW C;  3IDC B;  2JX9 A;  4O65 A;  1CON A;  1CD3 G;  4MZU A;  1O3T A;  1X9T A;  1ASJ 2;  2VZQ A;  2Y6K A;  1QMJ A;  4GMP 3;  2EAA A;  3PL0 A;  2Z2S B;  4J25 A;  2VZT A;  5JPN B;  4XAE A;  1NCQ A;  2JB4 A;  5FO7 B;  2FBE A;  2UWB A;  4M3C B;  1QQP 1;  3SIT A;  2RR1 3;  3MHZ A;  5FY5 A;  1HX6 A;  3A0K A;  4IET A;  4I0W B;  3C3V A;  3RYK A;  5EIY B;  2WYF A;  5LRR A;  2VC9 A;  4S2F A;  4PCR A;  4NPM A;  5LA2 A;  3VB9 A;  4QQP A;  1DGR N;  3UET A;  5BNQ A;  1NE6 A;  3JB8 A;  3WDX A;  1NCQ C;  2W9X A;  3WCR A;  1R64 A;  5JLV A;  2R49 A;  3DEM A;  3DPR A;  1TME 3;  4I01 A;  3VZL A;  4YW6 A;  1EAH 1;  4Q4W 1;  1BVP 1;  1W6Q B;  4BME A;  4BQ1 A;  4XXP A;  2VUD A;  4O9G A;  2YXS A;  3QBQ A;  1RIR A;  1YI9 A;  2P3Y A;  2D5F A;  3ZFG C;  3BGA A;  2R1D A;  4DUX A;  1SDW A;  4IEZ A;  5IAV A;  1DHK B;  5B4N A;  1RUH 1;  1DGR A;  1Y9G A;  3HEI A;  4N9H A;  3AP7 A;  3DPR C;  2AUY A;  3HBK A;  1XJA A;  4MHR A;  1ZZ9 A;  2Z5W A;  4CUB A;  2O0O A;  2V72 A;  2NMO A;  5BUV A;  3EJK A;  4FOQ A;  2QZ3 A;  4BIS A;  1BEV 3;  1UZ0 A;  1UZW A;  2QNK A;  4B8E A;  3AMN A;  1G9A A;  2Q0A A;  1RB8 G;  1ASJ 1;  2MHF A;  1X8M A;  1XYN A;  2A70 A;  2O8Q A;  4IEP A;  4XJZ A;  4XZU G;  4JZR A;  3U75 A;  3B3Q E;  3KCC A;  4NN0 A;  4Q29 A;  2RHP A;  4M00 A;  4W65 A;  4WVM A;  4NUB A;  5A7P A;  1OBN A;  4CCL A;  2PA7 A;  4OYU A;  2X05 A;  3AK0 A;  4AGV A;  1Z7S 3;  5FPB A;  2VMG A;  3J4U H;  2R04 1;  3ACL A;  5FP9 A;  3IZO A;  3VBU A;  4E8D A;  1QEX A;  1Q8V A;  2EIC A;  3FWE A;  3OCP A;  5LB6 A;  5SV5 A;  2D3P A;  4Q26 A;  3CJX A;  3ASI A;  1UKR A;  2OVU A;  4JGZ C;  4Q27 A;  2RE9 A;  1H2M A;  1NG0 A;  4COY A;  4XQ4 A;  5KHI A;  5JOW A;  3KT1 A;  1ZA7 A;  4IUG A;  5CG9 A;  1UW8 A;  2AEY A;  4S2D A;  5DAV A;  1XPW A;  5C3S A;  1ZRR A;  3ACG A;  4BXS V;  1R08 3;  1R09 3;  1DGW X;  2CY6 A;  1WKY A;  1ULC A;  2V4A A;  2WRA A;  4QAW A;  1UO9 A;  1W6M A;  1D4V B;  1WLT A;  4KL1 A;  1S0D A;  2FD8 A;  2F17 A;  4Z2W A;  2L9L A;  1MZ6 A;  4M3C F;  2QDR A;  3KMH A;  2VPV A;  2D3S A;  3WDT A;  1NZI A;  2AZ5 A;  3WCS A;  2ZJC A;  4GAZ A;  2VCA A;  4A7K A;  4G9S B;  2ETE A;  3WUD A;  1X7N A;  2JWP A;  1GR3 A;  4ONU A;  3MIE A;  3JD7 3;  3I3D A;  5A70 A;  3ORJ A;  5CFC C;  3OY8 B;  1KDK A;  4PBP A;  3U07 A;  1OMI A;  4OHZ A;  2QQP A;  1QOT A;  2Y33 A;  3K3N A;  2PAK A;  2LRO A;  1UN1 A;  2VJX A;  3MIH A;  3VZO A;  4DUV A;  3JBG 3;  2CAV A;  3H3Z A;  2QQU A;  3EYP A;  1Y3T A;  2I2S A;  4LOT A;  2QQJ A;  2HH9 A;  2ZAA A;  4LUM A;  2DCT A;  2ZPX A;  5FP4 A;  2VMI A;  4YW1 A;  4EYU A;  3AKQ A;  4MXV A;  2ES3 A;  2RMU 1;  1DGL A;  1PO1 3;  4P5H A;  1AR7 3;  1I9R A;  2WC2 A;  1DYK A;  3I59 B;  4MGK E;  5HV0 A;  3LZZ A;  3ENR A;  5IW0 A;  2VD7 A;  4BHP A;  3WXP A;  2VVF A;  3JQW A;  3ZO0 B;  1MQT A;  4DXS A;  4FP2 A;  5GJ6 A;  4GH4 B;  2I07 B;  2A6Y A;  4N8M A;  1DDL A;  3MIF A;  1LOD A;  4YW3 A;  2VQU A;  1IS3 A;  1RYY A;  4NPL A;  5FZ6 A;  5L7O B;  2PYT A;  4MXW A;  2PQQ A;  3KD4 A;  3HD8 B;  1UU5 A;  4QXH A;  2XML A;  2XJT A;  2YB7 A;  1EV1 2;  4AED B;  1LAJ A;  4BDV B;  4BB3 A;  1X9P A;  4LK6 A;  4ZHN A;  3BTY A;  3PUR A;  2E63 A;  3ZOI A;  3H3L A;  2J1E A;  1G9C A;  4KU7 A;  2JKX A;  2WNV B;  5GLU A;  3BB6 A;  5FV3 A;  5LWB A;  4LA3 A;  3ILN A;  4PDW B;  4QXC A;  4Y26 A;  4H7L A;  4A45 A;  4EN7 B;  5ABJ B;  2Y60 A;  2YYO A;  4E4H A;  1A34 A;  1TNF A;  1VJ2 A;  4A6O A;  3RNS A;  2IFW A;  2YC2 A;  2VTX J;  4AZZ A;  3E6C C;  3BU0 A;  3N9Q A;  4OVE A;  3V65 A;  1UYX A;  3ZYR A;  1VBD 1;  2GNB A;  3NMB A;  5FY4 A;  1NCR A;  1RUF 3;  2A3X A;  3P6B A;  3DCQ A;  2J1S A;  5F1R A;  1QJU 2;  2TEP A;  3RI8 A;  1F5J A;  3WY6 A;  4HVR A;  4Y1X A;  4AVC A;  1Z78 A;  4E4D X;  4EN0 A;  3QLQ A;  4ZU4 A;  2VY0 A;  1SPP B;  4GWJ A;  1JZ2 A;  2JE7 A;  2FCU A;  3WSO A;  5B2G B;  3LWC A;  3QD6 A;  4LO6 B;  3I2J A;  5C6C A;  1RIN A;  4GIQ A;  1C4R A;  4YVS A;  5F32 A;  4P9J A;  4DXZ A;  4LO8 A;  4XCA A;  5JOX A;  3S6P A;  5I0D A;  4Q4V 1;  1PHM A;  1X50 A;  1KRI A;  3N9O A;  4XVH A;  1S0I A;  2KM2 A;  3ACI A;  4I0A A;  4XJW A;  2JD4 A;  4GAL A;  3WDY A;  1UYZ A;  3N7L A;  4AHW A;  1H4G A;  1JW6 A;  3T0A A;  3NST A;  2HKX A;  4LA2 A;  2ZGR A;  2Z42 A;  2C5D A;  3T1M A;  1FOD 2;  5L9V A;  1NLQ A;  1WWY A;  3FUO A;  1SLL A;  3OEB A;  2HBU A;  2SLI A;  1RXG A;  1D4M 2;  2NN8 A;  3IDE A;  1WME A;  4LPL A;  4UAP A;  5APA A;  1RJ7 A;  1GZ9 A;  4KI5 M;  2OT7 A;  2JG9 A;  3WEZ A;  4YW2 A;  4IER A;  5FUI A;  4XF4 A;  5HBA A;  1W0O A;  2GN7 A;  3VL9 A;  4LNV A;  1ZX5 A;  1NY7 1;  4K40 A;  1HJF A;  2JG8 B;  3G7D A;  1FV3 A;  2P2K A;  3HT2 A;  4CCO A;  4KU8 A;  4MG2 A;  1WLD A;  2PHX A;  3I97 A;  5IHR A;  5A1A A;  2BOI A;  2HWE 2;  2ZHK A;  3CLP A;  2WZR 3;  5D8A B;  3MGU A;  2JG9 C;  1UWW A;  3CJI A;  4XUQ A;  5F5A A;  3CL1 A;  4BQY A;  3AL6 A;  5F7U A;  3AMP A;  1LHN A;  3CKH A;  4IEV A;  3DV8 A;  2F4L A;  2VZR A;  4YGC A;  4ZS2 A;  2BP6 A;  2KR2 A;  4DQA A;  3PJQ A;  2WA4 A;  3N4M A;  1GSL A;  2WKK A;  5FRA A;  2P17 A;  3MZH A;  3CMG A;  1GLH A;  2WBK A;  1RUJ 3;  2ARA A;  2J7M A;  2ADE A;  2DYC A;  3HR9 A;  2GAL A;  4GH4 A;  2XPJ A;  2FDH A;  1GWM A;  1NQJ A;  5GM0 A;  4CCJ A;  3CJI C;  1YFW A;  4Y1U A;  1UQX A;  1QJX 2;  2BTV C;  2E33 A;  2NQY A;  3ZKY A;  5LW9 A;  1HDK A;  3CIH A;  4GXL A;  2D6O X;  5FBJ A;  4Z07 A;  3WP5 A;  5C3O A;  1SMV A;  3VDC A;  2E32 A;  2FQP A;  1ST8 A;  4FVV A;  5KWR A;  4I2O A;  1RUN A;  2EIG A;  4UXA A;  1N1Y A;  5FZD A;  1DYP A;  1AJO A;  4HKO A;  1FOD 1;  4CP2 A;  4K21 A;  3T0B A;  4CCM A;  5DZG A;  1D4M 1;  2DTW A;  3JZV A;  1WBF A;  3WP6 A;  1SBF A;  4GH4 C;  4JDO A;  2BPA 2;  1IKQ A;  4IGQ A;  5D21 A;  5DXD A;  4FAH A;  1GZW B;  2GC0 A;  1VMH A;  2XJS A;  5IWF A;  5J48 A;  4PDW A;  1RUD 3;  5AFB A;  2B39 A;  2A5Z A;  2W91 A;  4OMD A;  2XL9 A;  5CYY A;  3WQB A;  5LZ6 A;  3IAP A;  1RUI 2;  2HWF 2;  5AVP A;  4AED C;  5A3P A;  2WQ8 A;  5C5T A;  4FTS A;  5FZ3 A;  2JIG A;  1BZW A;  2VMD A;  3KF5 A;  1AYM 3;  4I3G A;  4QHZ A;  4R9A A;  2ZGS A;  1VRB A;  2WSV A;  4ARY A;  4Z8B A;  3GYD A;  4H3W A;  4H7M A;  2WNV C;  5FZ7 A;  5IFT A;  5HCF A;  2ZBJ A;  1ZM1 A;  4QT6 A;  5DUW A;  1PM4 A;  3WNX A;  4TZD A;  1V6L A;  4KG0 A;  4MSV A;  4BIO A;  4PDW C;  4CU6 A;  1DLC A;  4CEY A;  1JUI A;  5G04 L;  1SPP A;  1N3P A;  4YZ3 A;  4LBQ D;  2EIE A;  1IS6 A;  3URF A;  1DQ6 A;  2BVB A;  3VGI A;  1JHJ A;  5CNA A;  2E51 A;  2VNO A;  4FPC A;  4BLJ A;  1JOB A;  4FCA A;  4Q0P A;  2WZP P;  2EXH A;  4LE4 A;  1DQ0 A;  4LE3 A;  3ZYJ B;  4C91 A;  1FNZ A;  2WSU A;  1CJD A;  1WCU A;  2E7A A;  3GF6 A;  4Q0S A;  5T55 A;  5BNO A;  1ODM A;  2W39 A;  4OI0 A;  1QJX 1;  4UW5 A;  3ZXD A;  4XMI A;  3IMM A;  1HQL A;  3L2Y A;  1OOP B;  3PUH A;  2DVA A;  2P34 A;  2WT0 A;  5K0U A;  5KXB A;  1F15 A;  2CL2 A;  1S1A A;  1QWR A;  4XXA A;  1TG7 A;  2H0V A;  3WZ1 A;  4IE0 A;  2RS3 2;  1GUI A;  4XUN A;  4V2W A;  5BNO C;  3IPV B;  5C4W A;  1D2Q A;  1ZA4 A;  3LEK A;  1XBF A;  1MS9 A;  2Y0O A;  4IGO A;  4QB1 A;  1BMV 2;  5GAL A;  1ND3 A;  1CAX B;  3B69 A;  5EJ1 B;  5DG2 A;  4MGS A;  1PGL 2;  4OMC A;  3AKT A;  4BQW A;  1NT0 A;  5IFP A;  2HWF 1;  5J36 A;  3PIG A;  2DWR A;  3NO8 A;  5EQU A;  2AYH A;  2CTV A;  1DBN A;  1W8F A;  3CEW A;  4QX2 A;  5FYS A;  4CU7 A;  2PLV 2;  3DKW A;  3ZXG A;  2MEV 2;  2XLG A;  1LNS A;  2DCK A;  2RS5 2;  1N47 A;  3CO2 A;  3HMY A;  4XF0 A;  4NE9 A;  1UOF A;  4J1X A;  3NV1 A;  1MZE A;  4XQW A;  4HSJ A;  5DDJ 3;  3LEI A;  3B9C A;  1YIP A;  3GZA A;  4AAX A;  5F39 A;  4HLT A;  2XVK A;  1CAU B;  1PGW 2;  2W1W A;  1CR7 A;  1SBE A;  3B93 A;  4K1Z A;  1GKB A;  2BYV E;  3KV6 A;  4LUK A;  4Q4Y 3;  4WM8 A;  5FRE A;  2OQ7 A;  4LBN A;  3VD7 A;  3LE0 A;  5EYY A;  3WF4 A;  1QNW A;  4AF9 A;  2R0F A;  2C1F A;  3GAL A;  4RR3 B;  1UYY A;  5I91 A;  3RZH A;  3B94 A;  2F4P A;  4WBB A;  1U5Y A;  4IES A;  4Q0V A;  4AFD A;  2W0X A;  3A7Q A;  3D8C A;  3MV1 1;  4MX3 A;  2QE3 A;  2ZTN A;  4P14 A;  4QPI B;  5LEK A;  1A78 A;  1U12 A;  2YBS A;  5A32 B;  3I8T A;  1SCR A;  4Q1R A;  2FDJ A;  1S55 A;  2DF7 A;  1PMH X;  1W8T A;  4W50 A;  1GZT A;  1AJK A;  2JB8 A;  3ZMN A;  4LT5 A;  5FBZ A;  2FDI A;  1VBB 2;  4IW3 A;  5AFE A;  1E5S A;  2RS3 1;  2Q8D A;  3RQ0 A;  1RHI 3;  4YM2 A;  3VDD B;  5K4L A;  1I1E A;  2VCC A;  4LO4 B;  2W52 A;  4Y1Y A;  5EYX A;  4ZY9 A;  4AGR A;  1BK1 A;  3D4K A;  5LBB A;  1BMV 1;  1GNH A;  5FYH A;  3BTZ A;  2WQ4 A;  3UNP A;  2Q4S A;  3GGL A;  5DZE A;  1YQ2 A;  1XNK A;  3PVO A;  4Y5Z 0;  1PGL 1;  3ATG A;  2TNF A;  4PIZ A;  4EJR A;  1ENR A;  1MR5 A;  1UXZ A;  3NKT A;  5F6L B;  5A7S A;  5A7N A;  1GOF A;  4ZZ5 A;  1W6P A;  4FOW A;  4P9L A;  1UMI A;  4FPG A;  3CHX A;  3CZJ A;  1FAY A;  3Q8E A;  4U36 A;  2PLV 1;  1EPW A;  4C0H A;  2R06 2;  2MEV 1;  3W58 A;  2R6Q A;  1D2S A;  3H50 A;  1HQW A;  3BPZ A;  1OF3 A;  2VUL A;  5A33 A;  5IVY A;  5CFD A;  1C57 A;  4JDM A;  3H42 B;  1UOG A;  1W9W A;  1HV1 A;  3BOP A;  1QXJ A;  1GQG A;  4OHY A;  3TWI A;  5C8C B;  4W6W A;  2ZMN A;  4NAO A;  1W6N A;  2PHL A;  3UV9 A;  3H1W A;  1HKD A;  2P5B A;  2Y6F A;  4C0B A;  4QD2 A;  3HBZ A;  1ZBA 2;  3PU3 A;  2ZGT A;  2EVX A;  2YG0 A;  3CU7 A;  3INA A;  1C28 A;  2VUC A;  4CDQ B;  1JH5 A;  1W9T A;  2VZ1 A;  1J83 A;  2WAA A;  4AYU A;  3A22 A;  5C33 A;  5L36 A;  3D5O A;  3U1X A;  1BBT 1;  2ZGN A;  3C7F A;  2ZAB A;  3R05 A;  5FUP A;  1CIY A;  4AAP A;  1OVP A;  3VHO A;  3VKL A;  4AVA A;  3ALQ A;  1PK6 B;  1XQN A;  1W0P A; 
#chains in the Genus database with same CATH homology
 2JDH A;  2BV4 A;  4UT5 A;  1OUR A;  2CHH A;  2JDN A;  1OXC A;  2BP6 A;  1OUX A;  5A6Z A;  5A3O A;  2WR9 A;  3ZDV A;  5A70 A;  1W8H A;  2VUD A;  4CE8 A;  2JDY A;  2WRA A;  2VUC A;  5A6X A;  5A6Y A;  4AOC A;  2BOJ A;  2VNV A;  1UQX A;  5D2A A;  1OVS A;  2JDU A;  1W8F A;  1UZV A;  1OVP A;  2BOI A;  5HCH A;  2XR4 A;  2JDK A;  1GZT A;  2JDP A;  1OUS A;  2JDM A;  3DCQ A;  5A6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...