3ZYRA

Structure of the lectin from platypodium elegans in complex with heptasaccharide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
STDSLSFSFINFDRDERNLIFQGDAHTSRNNILQLTRTDSNGAPVRSTVGRILHSAQVRLWEKSTNRVANLQTQFSFFLSSPLSNPADGIAFFIAPPDTTIPSGSAGGLLGLFNPRTALNESANQVLAVEFDTFFAQNSNTWDPNYQHIGIDVNSIRSSKVVRWERREGKTLNVLVTYNPSTRTIDVVATYPDGQRYQLSHVVDLTTILPEWVRVGFSAASGEQFQTHNLESWSFTSTLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords LECTIN
publication title A Lectin from Platypodium Elegans with Unusual Specificity and Affinity for Asymmetric Complex N-Glycans.
pubmed doi rcsb
source organism Platypodium elegans
total genus 59
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zyrA00
2JE7A 3AZYA 1N47A 2E7TA 4UW3A 2GDFA 1BZWA 1DHKB 1Z0HA 2VW1A 4Q1PA 4FOQA 5GJ6A 4XBLA 1I3HA 4YZ2A 2D3PA 2H0BA 1ULFA 1QNYA 1AX2A 2CWMA 3RMXA 2ZGOA 4ATFA 4YG0A 1JUIA 2JDZA 1KJRA 4RA0A 1W6MA 3MEPA 1LOCA 4XIKA 4FOVA 3WDTA 4BMEA 2A6ZA 2A70A 3NWKA 3AYDA 3WG4A 4DRRA 3M3CA 2DVBA 3IPVA 1APNA 1HLCA 1YRZA 3AYCA 3IM0A 4XJUA 4BMBA 3FUOA 5DG2A 3RQ0A 1F31A 1WBLA 3A4UA 2D6MA 5JMCA 1WLWA 4M3CA 1N1TA 2GN7A 3FFZA 1SACA 4FP3A 2ZA9A 1SLBA 1UL9A 3SLIA 1LEMA 1LGBA 2OW4A 2PHRA 2GNBA 1MR5A 1MS9A 3ILNA 4YM0A 4K20A 4YGBA 2ZAAA 4LBOA 4XIOA 2NMNA 2ZHNA 5EXOA 5T55A 2CY6A 3N7MA 1URXA 1NXD1 2NP0A 3WDVA 5KXEA 3ZXLA 1IKPA 4YG3A 1LCLA 2A6VA 4Q27A 2E51A 3SH4A 5T5LA 5GZEA 1N3PA 2OUJA 5E89A 3ZSKA 2YV8A 2D6KA 4UW5A 3I8TA 3RG0A 1UAIA 3W59A 1WW6A 1C1LA 1LECA 2R49A 4H55A 4LBMA 5H9SA 1UPSA 5IK5A 5JVVA 1LU2A 5GZFA 1DQ6A 3RMYA 3VV1A 4BOWA 2CWSA 1JN2P 2D3SA 4YGCA 1IKQA 1AJOA 3WDYA 3D5OA 4YM1A 3WDXA 4PQ9A 2ZHLA 1ULGA 3IN9A 3FLTA 1CPNA 1Q8VA 4JRAA 2NM1A 4Q8KA 4TZDA 1AXYA 2KM2A 5T54A 1LHNA 1SCSA 4RL7A 4XXPA 1V6JA 4P9YA 4DS0A 2VW2A 4ZKTB 3AZVA 3AZWA 1QGLA 3WZ1A 4UW6A 3GNEA 4W65A 2WKKA 1DQ0A 3AP5A 3ATGA 4FPJA 3HR9A 4LBNA 2DUOA 3WHUA 1YI7A 3OPZA 3KM5A 1MZ5A 4I30A 2A75A 3IMNA 1DIWA 1KJLA 2EXHA 1G9BA 5FRAA 1G8WA 3TAYA 3ENRA 1OFSA 1GICA 2NMOA 4BQ1A 4D69A 4GKXA 3ZXJA 4AYUA 5JOWA 5GLVA 1A3KA 2A6YA 4FPCA 1GZWB 4M00A 1CESA 4Y24A 1S0FA 5EYYA 1DQ4A 3AP9A 3UJQA 4TYSA 2GMEA 1H9PA 1S0BA 1DBNA 1SBFA 4XILA 3V0AB 4FPOB 5KXCA 1DQ1A 3OBRA 4YZ3A 4FQZA 3ZYRA 3OY8B 2ZHMA 3SISA 1H30A 2VW0A 5SV8A 1Y7BA 1LHVA 3APBA 1GZCA 1AF9A 1LULA 4XMAA 3WHTA 4LBQD 3AYEA 3N7JA 1HKDA 5KXDA 3POWA 3BOPA 3WG1A 3WUDA 1C4RA 3HN1A 3PVEA 3MW4A 4BLIA 1N3OA 1W6PB 2XG3A 4C1XA 4IQPA 1G9AA 4M01A 1DZQA 3SH3A 1QF3A 1W0PA 1FYUA 5IK7A 3POYA 1VAVA 1YIFA 4WVWA 1CJPA 2YMZA 1DYKA 1PZ8A 4YFWA 2P34A 1QOTA 4Y22A 3T2TA 3ILRA 3SNMA 1IS5A 5E8AA 4XMIA 2XB6C 1FX5A 2YROA 1GSLA 1MS0A 1D2SA 1V6MA 1IS6A 1LODA 4XHBA 2P3IA 2D3RA 2D6NA 5T5JA 3AJZA 4FPFA 1AVBA 2A71A 1F9KA 4PF5A 3AXDA 1NLSA 1D0HA 1ZM1A 3FLRA 4FPHA 4XJ9A 5GALA 3WVJA 3AYAA 2YZ4A 2WT0A 4YW1A 2ZGSA 1KDKA 3IKWA 4Y20A 4BPZA 1CR7A 3M3QA 2SBAA 1VALA 1O4ZA 2ARXA 3ASIA 3VKOA 4Q2FA 3AZXA 2A3YA 1LHUA 5HCBA 5IK8A 5GZDA 1WW4A 2OUHA 1LTEA 2PHTA 3BIWE 4ISQA 2P2KA 4LBQA 1V6OA 1AZDA 1QOOA 3GALA 4PCRA 2AENA 3JUUA 3KQRA 5DUVA 5EWSA 1MS1A 1LESA 2PELA 2ZGPA 3FBYA 1DGLA 1FV2A 1ZA4A 2ARBA 1FNZA 2E6VA 2NYYA 4Y1XA 4FPLA 3RRDA 3ZPYA 4M3CE 1LGNA 2V5YA 1CIWA 1ENQA 1LJ7A 1W6NB 2V73A 3ZXFA 1GV9A 1LOEA 4AGRA 3DUIA 2R1DA 2WLQA 1DFQA 4XOGA 1IS4A 4F83A 2VH9A 5DXDA 1LGCA 1WW7A 4YG6A 2GN3A 4R9CA 4U2AA 5JLVA 2HYKA 4JC1A 4Y26A 1WCSA 1SCRA 1V6IA 3OYWB 3R4SA 2ZKNA 3MPPG 5HCAA 5T50A 2JKBA 2E7QA 1BJQA 2VU9A 5DG1A 3V65A 3WNXA 2BQPA 1WD3A 1GZ9A 4Y1ZA 4BLJA 2ES3A 2EAKA 3OBTA 5CBLA 2RHPA 1LENA 3I4IA 3LSEA 4P9WA 4XJZA 3ZVXA 4DPNA 5KXBA 1MS3A 4DRVA 1IOAA 1O4YA 1VAMA 2DWRA 4ATEA 1G86A 1WD4A 4WV8A 2GMPA 1MS5A 3HMYA 4GXLA 1FATA 5DZGA 2D43A 5GLWA 5T52A 5L73A 4AGGA 2I2SA 5DUWA 2W68A 4Y1YA 1V6KA 4P14A 2W39A 5JOXA 2DVAA 3V64A 1W6QA 1V00A 1UX6A 3N7LA 2NN8A 3T1LA 4NOTA 1ENRA 4Y1VA 5JOYA 1QKQA 3AK0A 3FUQA 5LK5A 3N3HA 2GNMA 1S0IA 3VKNA 1G9CA 1JBCA 2TEPA 3NV3A 1S1AA 4YFZA 5H9PA 4XYXA 2ZGKA 1JHNA 1OQ1A 1Q8SA 4LBJA 3A0KA 4FVVA 1GANA 3AFKA 5IT6A 3PMEA 1UKGA 2DU1A 1Q8PA 1SLAA 2AR6A 2LALA 3AP7A 3B00A 1JYCA 3JU9A 3M2MA 4HANA 2AGSA 2ENRA 5DZFA 4Q26A 4DQAA 1G9DA 1GNZA 2DUQA 1J1TA 3M3EA 3O0VA 1H9WA 2YXSA 1G9FA 2AH2A 2CTVA 4P9XA 4YW2A 2ZBJA 3V0BA 5HCFA 3TB0A 1WUVA 3U4XA 2JD4A 3BODA 4U36A 1SBEA 3FLPA 3M1HA 1W0OA 1VLNA 2ZGTA 3WG3A 1ULDA 2EXJA 1SLLA 3WLUA 4ISRA 1ONAA 2D6LX 1DQ2A 1JW6A 3D4KA 3PVNA 1WBFA 2DU0A 1GKBA 4K1ZA 2ZHKA 1YO8A 1FV3A 2DV9A 1W6OB 1ULCA 3O0WA 1B09A 1LOAA 3V0AA 1F5FA 3B3QE 4YLZA 1CONA 3OJBA 2LTNA 3OY8A 4R9AA 4AGVA 2D6PA 2W08A 1BYHA 5T5PA 1N1VA 3ZSLA 1YXWA 2B7YA 2UU8A 3USUA 2Q5TA 1OKQA 2DURA 4XJ8A 1KQRA 1HDKA 4WVVA 1BXHA 2DTWA 2ZACA 4YW4A 4YZ5A 2PHFA 1A78A 4XHXA 5DZEA 1SLCA 1X50A 5H9QA 3VKFC 3WDUA 2JJ6A 1AJKA 2PHXA 1ENSA 1W6PA 2PHUA 3L2YA 1W6MB 3WG2A 1QDOA 3SITA 2ZMKA 3D6EA 4Q8LA 2GNTA 3AP6A 1UZYA 4PBOA 1DLLA 2YY1A 4FPGA 4XJAA 1XQNA 5IK4A 4XZPA 2ZABA 1Q8OA 4K21A 5GZCA 3QLQA 3IPVB 1YYNA 3AZZA 3MW3A 1I1EA 2G4IA 4YM3A 3VKLA 2UWCA 1GBGA 3C2UA 4GWMA 4LBQB 2UURA 2A6XA 1RIRA 1V6LA 4M3CB 1WLCA 2VY0A 5DUXA 5CA6A 4NO4A 1SBDA 2E53A 1QNWA 1EPWA 2R1BA 1KITA 3H0OA 3OGGA 2JECA 1S0CA 4XBNA 1N1SA 1MZ6A 2A3WA 4LBKA 4KBBA 5CAZA 1RITA 2ZMLA 2WT1A 5H9RA 1A8DA 3O12A 3N35A 3R05A 2P3JA 2DVDA 2PHWA 3ZYPA 2UWBA 3PJQA 5F5QA 1S0DA 4R9BA 3T1MA 1JOJA 3INAA 1KDMA 1HQLA 3LSDA 2ZGMA 3MW2A 2EXIA 5GLUA 1MS8A 2A5ZA 1HQWA 2GALA 4AVTA 1LOFC 2W52A 1GNHA 1S0EA 2FHRA 2ZGQA 3O5SA 4K1YA 2R0HA 4ITCA 5AVAA 4DFSA 1RINA 3B69A 1QMJA 2AUYA 3A0NA 4L8QA 2AREA 2EXKA 4CZSA 4FPYA 3N7KA 2GMMA 4JCKA 2EIGA 4FPKA 1GYKA 1W6NA 1UMZA 5IUQA 2WJSA 4SLIA 4CTEA 4AVSA 3WOGA 3Q9OA 1DQ5A 4YZ4A 1W6QB 3N36A 1JYIA 1SLIA 5GM0A 2WQZC 3NV2A 2ZMNA 3WCSA 1S0JA 5FREA 3UL2A 2P37A 1Q56A 1FNYA 2D44A 4LBLA 5CB7A 2WSUA 2EALA 1MVEA 1MACA 3LCPA 3OYWA 2CL2A 4YW3A 4AWDA 1AX0A 1PZ9A 2C9AA 2ZZJA 1CN1A 3AXEA 1QDCA 1GLHA 5F9TA 5JOZA 3ZXEA 1N3QA 4PBPA 1UZZA 1S0GA 1LOGA 1V6NA 3AX4A 4FOWA 3ZSMA 2Z42A 1VIWB 4GWNA 2SLIA 4GALA 4BM8A 2A7AA 2C5DA 1SFYA 4XE9A 2DYCA 1BKZA 1N1YA 2A3XA 4FOYA 3DGTA 4M3CF 1JXNA 3QCWA 3AP4A 2WNEA 4OZXA 1MVQA 1C57A 1TEIA 4YM2A 3UK9A 4Z8BA 3V0BB 2DVFA 2OVUA 1LHOA 1LOFA 1UN1A 1FAYA 1AXZA 1R1ZA 2CNAA 3NV1A 2DTYA 3O0XA 5DUUA 2ZGLA 1QOSA 2JE9A 4GKYA 4FP2A 4ZXKA 3B01A 2VUAA 2EF6A 3WV6A 4CRQA 1PZ7A 4YGDA 3UJOA 2WSVA 5JDBA 2DVGA 3VUOA 5BYNA 1AXKA 1QU0A 4XJWA 1CPMA 1CQ9A 4R9DA 2ZGNA 3POSA 5GLZA 4FPEA 3NV4A 2UWAA 1KRIA 1GZWA 5EYXA 1AX1A 4HL0A 4MYEA 3WCRA 1G7YA 4C1WA 1BQPA 3ZSJA 4Y22B 1MS4A 2D6OX 2R0FA 4AVVA 3USUB 3M3OA 1SLTA 3ILFA 2NZ9A 1LOBA 1Z78A 3B9CA 5GZGA 4FQ4A 2CYFA 4XDQA 1C1FA 5E88A 1Q8QA 2WT2A 3CNAA 4Y1UA 1LEDA 1ULEA 4Q1RA 4XBQA 1LHWA 4XTMA 1U0AA 5GLTA 3VKMA 3W58A 3ZXKA 3AJYA 4YGEA 3RSJA 1CVNA 2ZGUA 1WLDA 3WDWA 1LU1A 2GNDA 4GA9A 2D7FA 4Y20B 4ASMB 3WUCA 4YZ1A 1DYPA 2R16A 4XXAA 1WW5A 2ZGRA 2FMDA 5CNAA 3RS6A 1W6OA 2P3KA 2DUPA 2ERFA 1IS3A 3SH5A 2VXRA 4WZFA 3R4UA 5T5OA 4XTPA 2A6WA 2AYHA 4UW4A 3BTAA 3PVOA 4YW5A
chains in the Genus database with same CATH superfamily
1ODMA 4WM8B 4YRDA 1N47A 4FTSA 4UW3A 1Z0HA 2XVLA 2D40A 1C5HA 2XWJB 1IPJA 4QT6A 4JAAA 4N53A 2D3PA 1RUH1 1WKYA 4NE9A 2QDNA 2XGXA 1F8VA 3VL8A 1QJEA 5FXZA 2RS31 1L7LA 3CEWA 2WR9A 3FC0A 3RMXA 4AHXA 1W0NA 4ATFA 5G05L 2DCZA 3BI3A 3OGJA 4YG0A 4COYA 1JUIA 3N4MA 4RA0A 4QDSA 3GCXA 4JX0A 1RUF1 1CAUA 4N43A 4QX5A 4XIKA 2VQUA 3DPRB 4GIQA 2A6ZA 3ST7A 1EAH2 2PHLA 3NMBA 4GMP3 1OD3A 4CCDA 4V2VA 3LDBA 4PI2A 3M3CA 4MGYE 2DVBA 1NQDA 1QJX3 3IM0A 5DPNA 3WQ7A 3VBOA 1QXPA 3FUOA 3GDBA 3TYJA 3OTFA 2W94A 2Y0OA 4LUMA 4S2HA 4GH4B 4QB1A 4QPGB 3A4UA 1WBLA 1P8JA 2D6MA 3J8F2 1WLWA 5FUNA 3GZTB 3FFZA 4E4DX 2B5HA 1SACA 4HVOA 1SLBA 4A45A 5CKNA 3S7IA 2B42B 3TEWA 4WZCA 3H7YA 5FLIA 5C3OA 2NPIA 4YM0A 3ORJA 3BU7A 4YGBA 1DU3D 5T55A 4XCAA 5BNPB 4K6BA 4CDQA 1JZ4A 2ZEXA 2Y26A 2CGOA 3ZXLA 1IKPA 4YG3A 2A6VA 2WN3A 1EAH3 1OI6A 5T5LA 3SH4A 1VAKA 2WLPA 4AQTA 1Z7S2 4I3GA 1W2NA 1OA2A 3KSCA 2D6KA 2R042 3I8TA 3RG0A 4DEVA 1WW6A 1C1LA 1Y43B 1UPSA 1OH3A 2WIIB 4KH9A 4A7KA 2VBPA 4CEWB 3MO4A 2CWSA 1JN2P 2AZ5A 4OMCA 4BU2A 3J8F3 5C8CB 1W39A 2VNRA 3OGRA 2PLV2 4YM1A 3WDXA 4PQ9A 3ZR5A 3VD7A 3MICA 5I91A 1ULGA 4BQYA 1UCXA 3M70A 3TNPB 5I0RA 5KC6A 4LPLA 1Q8VA 2HWC2 2NM1A 2GAUA 2EIDA 4NJ4A 1SCSA 4RL7A 4DS0A 4OHXA 1NT0A 3PVBB 3RVHA 2Y60A 1B35A 4IV1C 3U07A 2UY9A 1QGLA 2WFF1 4ZKTB 3VDBA 4CXYA 3WZ1A 1K5MB 1DDLA 4JQRA 3MIHA 4MSVA 1OKOA 2WKKA 1XYPA 3ATGA 4UT5A 4QQLA 4LIUA 4LBNA 3WP6A 1YI7A 1D2QA 3KM5A 1H1MA 1ND3A 3IMNA 3OPZA 4I30A 1Z7S3 4CU7A 1YHFA 1OFSA 2R043 3WQ1A 5C4WA 4GMP0 4GKXA 3MUZ1 3ZXJA 4AYUA 2ZX2A 2W1WA 1LR5A 1VP6A 2CDOA 1DCSA 1W2AX 4Q0SA 4LO6B 3SEEA 1XC6A 2WNOA 3RGBA 2GMEA 3UYJA 2PLV3 1I5PA 1R64A 2R32A 5JI7A 2IXKA 1DBNA 3V0AB 4M4RA 1Y4WA 3LA3A 1GQPA 1DQ1A 4FPOB 5KXCA 3VDAA 1UU6A 1JYXA 3RFRA 3VGIA 3OY8B 3OD0A 1GWMA 3VHRA 1F4HA 3EJKA 4R4ZA 4XFAA 1EY2A 1CZSA 3VBRA 2W46A 1NCRA 4NIIA 1TG7A 4C0HA 1W3VA 1HXS2 1UD1A 2XJPA 2BWAA 2VOKA 3WW2A 4B7KA 2P4EA 4RN5A 3RI8A 1ZBE2 1FOD1 1NXMA 1YIPA 4A41A 1BK0A 2W9XA 2ORXA 3HN1A 4HSLA 2Y6FA 4IUGA 5D8AB 3OOXA 2QQWA 2BRTA 5F6KA 4BLIA 4CDUB 4HT1T 5JXGA 4MX3A 5E16A 2JENA 2WNVB 4IQPA 4D6SA 4E9KA 1DP0A 1AR62 4UFJA 3LE0A 1ZX5A 3I2OA 3C7EA 1CAWA 1YWKA 2PQSA 4QX8A 5A7OA 3I3EA 3ACLA 2Z4FA 4FTEA 4LKSA 1VAVA 1BHGA 3OSDA 3QACA 1DYKA 1CZVA 1RHI1 1YQ8A 4FFFA 1CX1A 4XMIA 3ES4A 3BIEA 5ACA3 1GSLA 2V4VA 1HXS3 1D2SA 3C7GA 4ZS3A 1PNFA 1O3RA 1LODA 3MV11 1SQ4A 2D3RA 1W9YA 2VCAA 2VMEA 3K51A 5T5JA 5C3QA 1OLRA 3AJZA 1ZBE3 4LKEA 1JYWA 4D8MA 2Q8CA 5I0UA 3RJRA 2VL4A 4YW1A 3VZNA 1PGSA 3H3LA 2ZGSA 1TME2 1CAUB 4BPZA 1CR7A 4E4SA 2SBAA 5FDBA 2JWPA 1Y9GA 1O4ZA 1AR63 4CUBA 5FWJA 2I07B 3ASIA 5IAVA 5EHDA 5ABJA 2HWD2 1FMD1 1ASJ1 2A3YA 1UKRA 2W1UA 4UAPA 4NHXA 3VBOB 4AEJA 5B2GB 5IVEA 1WW4A 2OUHA 1X82A 5C7GA 1LTEA 4Q0PA 1AR82 3DYMA 5HCHA 1OOPA 3BKZA 3GF6A 5K4LA 4LBQA 1IGOA 3TBDA 1AZDA 1OMIA 5KHKA 3LWCA 4OMDA 4Y33A 3JUUA 5DUVA 5EWSA 1MS1A 3HPNA 3TOJA 1C28A 2RDSA 1RGSA 1COV2 1FNZA 4LHLA 4Y1XA 4JKMA 2BGCA 4M3CE 3E6BA 2V5YA 2W47A 1TME3 1D4M2 3AKTA 3BGAA 3JXSA 3ZXFA 1PVXA 4A3ZA 4DO0A 4F83A 1IS4A 4PLMA 5FZFA 2UYAA 2BFUS 5DXDA 4YG6A 1UY4A 1VBA1 2GN3A 3KS7A 4R9CA 3KCYA 4BQ2A 2HWD3 3RYKA 5JWPA 4FFGA 4Q4V2 1WCSA 2RDNA 4C8DA 3NQHA 5LEKA 1RVF3 1AHSA 3ZFFC 1AR83 1CAVA 3JQWA 4IEYA 1PO22 3RJ2X 5JIUA 1BMV1 2BQPA 2WZ8A 3FX3A 5LBBA 1REEA 1XE0A 3WNOA 4BLJA 1VMJA 2PHDA 1JODA 1FT9A 1GQHA 3I4IA 3LSEA 1NZIA 3ZVXA 4LO5B 5KXBA 1MS3A 1VRH1 1IOAA 1POV1 1U12A 1VAMA 2EICA 4NRPA 2Y6JA 5FZIA 3UT0A 1G86A 5KHGA 1COV3 4WV8A 1H8TB 2GMPA 3DXUA 1NA1C 3QH6A 1FATA 1QHDA 2D43A 5GLWA 4GULA 5I8SA 5L73A 3K2OA 5DUWA 1D4M3 1R1A1 1XNTA 2WDBA 2VZSA 4P14A 2Z5WA 1AL21 2Y34A 4AEDB 5CKQA 4MH0E 3WNMA 1TMF1 1W6QA 5LBFA 3GZUC 3N7LA 4Q4V3 4IETA 1ENRA 4FXKB 1QKQA 2DBIA 5L9VA 4BXSV 2JG8B 2QFEA 4AI3A 3N3HA 3PTYA 2GNMA 5CIRA 1G9CA 1JBCA 1PO23 1SPPA 3ELNA 3T0DA 1S1AA 5HXMA 5DDJ1 1AR72 1KGYA 1DZTA 3WQBA 4MV2A 4JVAA 4MLOA 4HMZA 4S2FA 4FVVA 4QX2A 5FPXA 3AFKA 2G9FA 3PMEA 1NE4A 2YU2A 2DU1A 3H8OA 2LALA 5HBAA 2WO7A 3ZDSA 2ENRA 3DXTA 5LWBA 1G9DA 1GNZA 3M3EA 1W2TA 2GC1A 1H9WA 2IFRA 2RR12 1IHMA 1W05A 3V0BA 2JDHA 3UV9A 5HCFA 2RM21 1QWRA 4DUXA 1OVSA 1D7PM 1SBEA 3FLPA 1W0OA 2ZGTA 3MGUA 4W6YA 1ULDA 4IE4A 1RUG1 3CKHA 2D6LX 3KCXA 3ZIWA 3G6JB 2C1FA 4XUTA 4QGMA 2CGPA 2QVSB 1JW6A 3PVNA 2AEZA 4D0QA 3WF0A 2DU0A 1AR73 2XL7A 4NHMA 4RQPC 1VB4A 2RS51 1MQTB 5EIYB 1WMFA 4EV0A 3LKJA 3KHBA 2LTNA 3EO6A 4R9AA 4EN9B 1R081 2WWJA 2W08A 3AMHA 5FYBA 1N1VA 2TBVA 2CGNA 2RR13 2UU8A 4YVWB 2Q5TA 5EZWA 3UGFA 4CUAA 2DURA 3VL9A 4PDWA 2JIGA 3NKTA 1ZRCA 2FDFA 1BCXA 4YW4A 3BTYA 2XBO2 3MBWA 4UBHA 2PHFA 4QMAA 1VBE2 1H8VA 1JU4A 1YFYA 1SLCA 1X50A 2O8QA 5IVJA 5K7PA 3VBFC 4NRQA 1W9TA 1W6PA 2PHUA 2Y6LA 4TTGA 3H8XA 3LEKA 1QDOA 3H1WA 3SITA 2ZMKA 4NVPA 3WG2A 2FZ2A 3RYPA 2RE9A 1UZYA 1DLLA 3DN7A 4FPGA 4XJAA 2N7GA 1ST8A 1T6GC 3EMRA 4XZPA 4QQHA 2ZABA 3SQOA 4C0BA 3VBSB 3IPVB 3THDA 2VMDA 2G4IA 3VKLA 4ZS2A 1GBGA 4LBQB 4LE3A 5I93A 3NNLA 3VZLA 3AKSA 4OI4A 1H0BA 3HT2A 4KL1A 4M3CB 3I7DA 3MI8A 1OF3A 4UF0A 4IE7A 5FZ1A 4AEKA 4UI9L 4XABA 5DUXA 5AC91 2ZJCA 2WZR1 2A73B 2XBO3 5A1FA 1SBDA 3ZFGB 5JZGB 1QNWA 2JDUA 3LF7A 3E6CC 1EPWA 2D98A 1KITA 2R1BA 3H0OA 1VBD1 4RYDA 4XBNA 4XC9A 2JE8A 5F3IA 2A3WA 4XF9A 1BEV3 4ZXEA 3ROUA 4OLLA 3AVSA 3VLBB 3ZYJB 3O1SA 4KBBA 5CAZA 1RITA 2CAVA 2C6SA 3EB7A 3VD5A 2BJSA 4D94A 5DMYA 3CU7A 5FQ0B 5F5QA 1S0DA 3SHRA 4TSVA 4KG8A 3GZEA 5FO9B 4NHYA 3PMSA 1HQLA 3NRUA 4P5HA 5BY5A 5KR7A 1NKGA 1S0EA 4KU8A 1KXGA 4AQ6A 1UYPA 2R0HA 2IXJA 2RJKA 4ITCA 1ALYA 1X8MA 4FXGB 5LW9A 2AUYA 4L8QA 1ZZ8A 2PMWB 3N7KA 2K9ZA 4R52A 3RZHA 1W8UA 1GP6A 5A3WA 4QXBA 4Q4X1 1W6QB 4YZ4A 5F5CA 2RMU1 4AQSA 1JYIA 3LEIA 5C70A 2JG9C 2K0GA 3UKVA 1RUE2 2QQUA 2P3YA 5FREA 5KXEA 2P37A 4LLFA 1FNYA 3W5NA 3IB3A 2EALA 1MVEA 3LCPA 4XCBA 5FMDA 1NCQC 2LUWA 2X10A 4KWKA 1U5YA 2EA7A 3AXEA 1QDCA 3JB8A 5FXWA 4LHSA 4A7YA 5C71A 4Z2WA 5FY7A 3AL5A 4PBPA 1S0GA 4XFHA 1V6NA 2GH8A 1VPHA 4PQQA 4YVSC 5D1IA 3RNSA 1WZXA 3THCA 4GALA 4WBBA 3K46A 2JDNA 3C7OA 4IEUA 4QX1A 4XE9A 1N1YA 1JXNA 1PVC2 1MVQA 1TEIA 2QQLA 2J1VA 4YM2A 5FYZA 4Z8BA 4X8NA 3V0BB 2WA4A 4LT5A 4G3YC 4CE8A 2EIEA 3WW1A 1ZYBA 1PGW1 1S2BA 4S2DA 1QOSA 2GC0A 4FP2A 1X9PA 1V9U2 2EF6A 2G1MA 1QJU1 1W8TA 4YGDA 5CZKA 3CO2A 3I2DA 3GXUA 4K8FA 3VUOA 2VMFA 3OG2A 4IV1B 2B8MA 1NA1A 3OBZA 4ZONA 2UWAA 1HJGA 1D0GA 4AE2A 2ZX0A 3WXPA 5EYXA 5LBEA 1AX1A 2VUCA 4N53C 5K8SA 3LA7A 3LEGA 4XETA 1ENXA 5FYVA 3ZOIA 4MYEA 3AMNA 3WCRA 2FD8A 1BQPA 4WVMA 5FZKA 4Y22B 5J36A 1MS4A 3FJSA 2D6OX 2IFWA 1PVC3 4NIDA 4H7MA 1SLTA 2NZ9A 4N43C 1AYN1 3OCPA 5E88A 3GJBA 5ACA1 1Q8QA 4OHZA 1S4CA 3ZX7A 1ULEA 5GLTA 1V9U3 2D97A 3RSJA 1JTZX 1CVNA 2ZGUA 3AKRA 3ZXGA 3A22A 4EN6B 4FTBA 1J3QA 4CSWA 4ASMB 4Y20B 3NVCA 5KHHA 3WUCA 1DYPA 4COZA 4YZ1A 5CFDA 4DXSA 1NZCA 3MHZA 4W4ZA 4EZHA 3RS6A 1W6OA 1K12A 2P3KA 2Q1MA 5FZGA 5L9RA 3IIIA 4LMFA 4CEYA 1HN0A 5T5OA 4L99A 2WNUC 4ARYA 4UW4A 3BTAA 2IUWA 5HV4A 4N8MA 3ZXDA 4DMIA 1UU5A 3VZOA 1JYTA 4CDQC 2E7TA 5L9BA 1UMHA 1UX7A 1PGL2 3AKQA 4H7LA 4YZ2A 2PAKA 3J9SA 4Q0UA 2JDYA 3FBMA 3H8UA 1QNYA 5ANNA 1RUOA 5FIXA 4P5YA 2I74A 1NX9A 1ASJ2 1KJRA 1XE8A 1W6MA 2YU1A 3O1PA 3SMHA 3VBHC 4BMEA 3W21A 3OPWA 1VRBA 4CYDA 2Y64A 4P9LA 4OI1A 4I01A 2RG4A 3MUY1 3AYDA 4DRRA 1PO11 1GOGA 4NWWA 2VTXA 2QQKA 1HLCA 4XJUA 2BU9A 1B35C 5FP4A 2DFBA 4HETA 3N9MA 1E5IA 2GN7A 3LIGA 3NJVA 4AVCA 4PIYA 1QJY2 1ND3C 4EWDA 5FKCA 1LGBA 3F2ZA 5C4WC 1MEC2 4OI2A 5DAXA 2I45A 4K20A 3R4DB 2ZAAA 1VBA2 2VOWA 2ZHNA 1HJFA 3UNPA 2CY6A 4GB31 1HRV2 5CADA 1XB9A 2MEV2 4CCEA 2CDPA 3WDVA 2Y8KA 4TLFA 3UKNA 4Q27A 3FE5A 2HKXA 2AACA 5L19A 5FY1A 1N3PA 2WINB 5FZBA 2K2SA 4CP9B 2MNGA 3EXUA 4CDWC 5G04L 4UW5A 3W59A 1Q3EA 1UAIA 4QKBA 1LECA 2VQ0A 4LBMA 5H9SA 1PM4A 3VBRC 2RS12 1LU2A 3L9JT 3TN93 1NCRC 5KHIA 1VRH2 4BOWA 4KWJA 3J7LA 5APAA 5KC5A 4YGCA 1AJOA 3X29B 4BWOA 3D5OA 4GD4A 2ZHLA 1QJY3 3MIGA 1WCDJ 1CPNA 1US3A 2WRAA 4Q8KA 2H0VA 4CCNA 2KM2A 2NQYA 1AL22 1MEC3 2YC0A 1H2NA 4GQ7A 4O7XA 3AC0A 4P9YA 5F3GA 2VW2A 3B5LB 4K8RB 4E2SA 2E32A 1HRV3 4UW6A 2MEV3 3K75B 2WO2A 1DQ0A 3KT7A 4X6QB 4QU2A 1MZ5A 1UQXA 1JYNA 1KJLA 1RUC1 1TNRA 5FRAA 1G8WA 2QNKA 5DDJ2 2NMOA 4D69A 1NA1B 4IEVA 4RS5A 2RS13 4Z92B 2J1TA 4M00A 2B9VA 3PHMA 1L7RA 2Y6HA 1S0FA 4Y24A 3IDBB 5FPAA 1OD5A 1QQP1 4QD2A 2Z79A 1T6BX 1SBFA 2XQRA 2YHJA 1C5IA 2W95A 2PQQA 3OBRA 4YZ3A 3ZYRA 4EZ4A 3SISA 3J26N 3EQEA 4GWIA 5SV8A 5LZ6A 3AM2A 2C0ZA 2A1XA 3AL6A 1Y7BA 1LHVA 3APBA 2EAAA 3FFQA 3HN3A 2Z2SB 1VBB1 2HWF2 2OPKA 3OGVA 1SG3A 4HOOA 3Q8EA 4F7ZA 5ABJC 5KXDA 2VTFA 2HBUA 3HBZA 2WWUA 1AR91 4YVSA 1ZBA2 2X5IC 4IEPA 3WF1A 5CVRA 4BIOA 1UPIA 3IDCB 1W99A 4RHV2 1J84A 2BGOA 2G19A 4AOCA 1N3OA 2XG3A 1OOPC 4PI0A 4C1XA 3WD5A 3HOBA 4M01A 1YFUA 5FZLA 3ZKYA 1DZQA 2Q8OA 4QPYA 3KHCA 5FKBA 1YQCA 1XXNA 4IESA 4C91A 1E57A 1H1IA 5T3NA 1OQDA 2P34A 1RUD2 3T2TA 2YC4A 3IT8A 1IS5A 1UYXA 2ARAA 2XB6C 3ZN4A 5A32B 2YROA 5BNNA 2HWF3 4PLNA 1V6MA 1F35A 1YI9A 2UYBA 4XACA 5FFOC 1IS6A 3ZM8A 4RQPB 2P3IA 2D6NA 1GFF2 1KFUL 2R071 3ZR6A 2IWGB 4LOSA 4B3NA 3LOIA 1ZBA3 4PF5A 1K3IA 3TWIA 4QB2A 1ZM1A 5GALA 1VR3A 2WT0A 2R062 3M4FA 4RHV3 3T08A 4BDVB 4JZRA 1KDKA 3IKWA 4URTA 2O8OA 3M3QA 2RJ2A 5A7SA 4AFAA 1VALA 4TN7A 1HRI2 3W5MA 2FDIA 2QKDA 1H6YA 2VOXA 4Q2FA 5FO7B 2JDPA 3ZXAC 2P17A 3LZZA 1A6CA 2YFZA 3JD72 1LB2A 2QTWB 3ZO0B 1RUD3 1JI6A 3VBFB 2YBPA 4AQ2A 2HWE2 2QQPA 5AC92 4IV3A 2P2KA 3V56A 5IVVA 1J3RA 1V6OA 5C5UA 1OURA 3GALA 3JBG2 2AENA 1E5RA 2VXJA 4E8DA 1VBD2 5J3UA 4OUMA 1PHMA 1R091 2PELA 2ZGPA 5B4XA 1FV2A 1V0AA 2W0XA 3MDPA 2ARBA 4LTAA 4XUQA 2NYYA 1WMDA 1YCIA 4IGQA 3WP4A 3ZPYA 1UY3A 5CFCA 2R063 2WNUA 2VZ3A 1ENQA 1W6NB 2BERA 1ZNPA 4NAOA 4AZZA 1W8NA 3OPTA 5DABA 4UOJA 2BV4A 1HRI3 2E63A 4XOGA 2VH9A 1AYM1 3WF4A 1WW7A 2BVVA 4CDWB 5BUVA 4IGPA 1YJLA 4E4HA 2HYKA 3JD73 4L2NA 1PX4A 1V6IA 1SZBA 2XXZA 2ZKNA 3R4SA 4N9IA 3A21A 2ADEA 5A6YA 5L7OA 2VU9A 1BJQA 1XRUA 2HWE3 1VMFA 5A70A 2ES3A 2EAKA 3GBGA 3JBG3 3THTA 4P9WA 3VBHA 3KV9A 4GAZA 3MIDA 2C24A 4DRVA 2PAEA 4BISA 3CL1A 2WZPP 1W8WA 4DIQA 5LRRA 4Q4X2 3HMYA 3KLSA 4GXLA 5FMCA 4BK5A 4GWJA 5T52A 1VE0A 5CG8A 1X8EA 5FBJA 3LPGA 1WCQA 4Y1YA 1OA3A 2ILMA 3VD9A 5B4NA 2W39A 3KZ4C 4LITA 4AVAA 5JOXA 5JPNB 1RUJ2 1J1LA 2XKPA 2XONA 1UX6A 2IC1A 1UNBA 3J7MA 3O1MA 5FYIA 5JOYA 4EWEA 3FUQA 4L11A 2OIIA 2WQ8A 4K40A 3WT3A 3VBUA 2B39A 1RB8G 2J1UA 4CCOA 2ZGKA 1JHNA 3UGGA 3ZSEA 1DGWX 3I59A 4LBJA 2YYOA 4PDWC 1GANA 1TE1B 3K3NA 3ZYHA 2JG9B 4H3WA 3I2IA 2AR6A 3JU9A 2XVGA 2IXLA 3ZYGA 1RJ7A 1XPWA 1ACCA 2AGSA 4HANA 4HK9A 5DZFA 2VZTA 5SV5A 4CDWA 2HWC3 1NCQB 1J1TA 2ZPXA 1UY1A 3AMMA 3VDDA 5F5AA 2QZ2A 1ND2A 4KGQA 2AH2A 4BH9A 2ZBJA 3QD6A 1MZEA 2BUKA 1O59A 1WUVA 3FMGA 4KNCA 3G7DA 4YVSB 5LB6A 3TB0A 1JOBA 4U36A 4A6OA 3M8LA 1O7FA 1WCUA 2YBKA 1RUJ3 1FPN2 3GZAA 3RZJA 4X6RB 3WLUA 2GP3A 1W9FA 5JXHA 1I5ZA 5E1RA 3SCFA 4RGAA 4JGYC 4MXWB 2Q8DA 3U10A 1GKBA 3R0RA 1YO8A 1FV3A 3O1UA 4OUEA 2HWB2 2J42A 5IFTA 5FZOA 2XHNA 1LOAA 1BVP1 4CCMA 1CONA 1DLCA 1XBFA 4AGVA 2X09A 1H4HA 1OVPA 2D6PA 2VZQA 4L0PA 3M3IA 1KFXL 3U4XA 1YXWA 2LROA 1A34A 4QU1A 3WNLA 1UXXX 4O9GA 3ZYFA 1OKQA 4AI1A 3PNAA 1UYYA 4XJ8A 4IEZA 5LA9A 4D7TA 4BE3A 4N53B 1HDKA 2WQ4A 3S30A 4B1LA 4BB3A 1BXHA 3NSTA 2ZACA 1OUSA 2J7MA 1FPN3 1XOYA 3O1RA 1NG0A 2F4PA 2FMYA 2J1SA 5DAWA 5DZEA 5FY8A 3POEA 3RZZA 3WDUA 1AJKA 5FZAA 2DBNA 2ET7A 4ZU5A 1OC1A 3QH7A 1ENSA 1ULPA 5I8YA 5F1RA 4N43B 3D6EA 3TEXA 4QQPA 3AP6A 2WN2A 4YYOA 4P00B 2HWB3 4HLTA 4PIZA 2YB7A 1Q8OA 1W90A 5GZCA 5FV3A 3QLQA 4YWAA 1YYNA 3AZZA 4ASLA 2X5IA 3B94A 2ZTNA 3HQUA 2DCTA 2R30A 3H1MA 4LK6A 3VD3A 4MHUA 2Y6KA 1C8M1 3I2FA 2YPDA 4O9EA 1JHJA 4BCUA 1WLCA 3RZLA 2CV6A 1HV0A 2VY0A 4LORA 5LA2A 5CA6A 4NO4A 2V4AA 3ZN6A 2WNUB 4YNIA 5C9AA 4HN1A 1WGPA 4GJZA 2X53S 1MZ6A 4AFMA 4CDQB 1RUI1 2XQXA 2H6CA 5A33A 2ZMLA 1O8SA 3UGHA 1JS9A 3N35A 2KD7A 2P3JA 4DY3A 3LPFA 2OPWA 3ZYPA 4QHZA 4BIFA 5C8WA 1BBT1 2XPJA 1KDMA 2ZGMA 1MS8A 4CP2A 2A5ZA 2GC3A 1O5LA 2GALA 3ACIA 4LA2A 4AFDA 4AVTA 4DXZA 4HFSA 3DEMA 1PK6A 4COVA 1GNHA 4K1YA 2FHRA 2ZGQA 3VBHB 5FR3A 5JR2A 5AVPA 3IWZA 2VZPA 1RINA 1OBNA 1UIKA 2VNVA 3D0SA 5EFUA 4LE4A 2XWBB 4XFGA 2PFWA 3A0NA 2AREA 1GNYA 4CZSA 5A7QA 3IAQA 3I2GA 1B35B 2XMLA 4NPLA 2WJSA 4CTEA 3HJRA 2FCUA 2MPFA 3Q9OA 2YFUA 2VMHA 3I97A 1SLIA 2OQ6A 2WQZC 1ND3B 5ANQA 5GM0A 3SKJE 3WCSA 4COWA 3B02A 1NY71 4QGLA 3CJXA 4PJYA 4KGGA 3UL2A 2D44A 2XJUA 4CDXA 2WA3A 5C4WB 2WSUA 3H3ZA 3OYWA 1MACA 4YW3A 2FDHA 2BOIA 1CJDA 5JSPA 1PZ9A 3MLJA 4COUA 1UF2C 4Q29A 1GLHA 3RWNA 1N3QA 1UZZA 1LOGA 4Q4Y2 3BYWA 3CJIC 1VBC2 1VIWB 2SLIA 5K0UC 2F17A 4QPWA 2QQOA 2A7AA 2C5DA 1SFYA 1XNBA 2ARCA 4MGQA 2B45X 4LO7A 1BKZA 5IW0A 5FOJB 5FZ6A 3DGTA 4NPMA 1FXZA 2BZDA 2X29A 5FXVA 3VBRB 2W92A 4OZXA 1NCRB 3WF2A 4QPIC 3T4HB 5CFDC 4IW3A 5F6LB 2VC9A 1R1ZA 5DUUA 2DTYA 4K3UA 1CWPA 2ZGLA 4AW7A 4GKYA 3B01A 2G9GA 2VG9A 3F95A 4CEYC 1PZ7A 3UJOA 2WSVA 1CGPA 5J37A 3HD8B 1TVGA 1CIYA 5BXXA 5BYNA 4XJWA 1KEXA 5BNOC 5FZ0A 3POSA 5FLHA 1PMHX 1SHWB 1XNCA 3NW4A 1PNGA 1EV12 3LB9A 4FPEA 4Y5SA 4A2UA 3BN6A 4XPVA 1CAWB 5FYUA 1M06G 2XKOA 2P6HA 4Q4Y3 1VBC3 4F3JA 4HL0A 1ULOA 1G7YA 4Y5Z0 4Q4W1 3CDZB 3ZSJA 4DOUA 3HNBM 2Y38A 2YGLA 1X36A 5KHJA 1RMU2 3M3OA 4RR3C 5FYHA 2XVKA 3B9CA 1XNAA 2Y0IA 2CYFA 4FQ4A 4QAWA 5A80A 5GZGA 2QQNA 3Q8AA 3U75A 3O7OA 4Y1UA 3P3PA 1LEDA 4P9IA 1UOGA 3PURA 2VR4A 2JB4A 4XFBA 5I0DA 3TEZA 4HZFA 3B7MA 1PIV2 4NN0A 1LU1A 3HNYM 2E9QA 4LKDA 2VCMA 1WW5A 4QKNA 1EV13 4CPBA 2BW8A 2XUMA 5F2WA 3NAPC 2ERFA 1RC6A 2W5FA 2BNNA 2WS92 5ABJB 5IFPA 3VD4A 2X5IB 2XLFA 4WZFA 1UY2A 4GMP1 2YDEA 5HXVA 4CVUA 2TUNA 4YW5A 1OOPB 3WY6A 1QJX1 1WMEA 1BZWA 2GDFA 2VW1A 1RUH2 3IMMA 4FOQA 4XUPA 4JGYA 1W28A 1XJAA 1I3HA 2RS32 2BEOA 4QM9A 2B46X 4BQ5A 2H0BA 1ULFA 4AHZA 3BTZA 1TZOA 1XYOA 1AX2A 4E2GA 2C9KA 5IYYA 3U0ZA 1PIV3 1RUF2 1WLTA 5HI0A 1VBE3 1Y9QA 3S5QA 4E4ZA 3AVRA 4OHVA 2JDZA 4JKKA 4MVTA 2XJQA 3WDTA 1NLRA 2QQVA 4FOVA 5C6CA 5J98B 5JXIA 3BOWA 2VNOA 3K48A 5FXXA 2VBBA 3ZYIB 4AVBA 2WS93 3NWKA 1M4WA 3AMQA 4BA6A 1EAH1 5KBFA 4ZHNA 1YRZA 2IZWA 2W1QA 4BMBA 2ZZQA 5A3UA 1CAVB 2Q1ZB 1LNSA 2YC2A 3ZKUA 1R092 1I6XA 2J22A 3RQ0A 1F31A 4B4RA 1RUH3 5LCWL 5JMCA 4XF0A 3ZMOA 3PJYA 1N1TA 4FP3A 2RS33 3J8F1 3D82A 3JCIA 3SLIA 3W9AA 2PHRA 1DF0A 5A7WA 4AFCA 3CHXA 1DGWA 1MS9A 2ATFA 1AYM2 3ILNA 4RS5C 3O1OA 1CAXA 1RUF3 3HWJA 4LBOA 4XIOA 3FN9A 2ZAHA 4K9SA 3N7MA 3UKTA 2HLEA 2NP0A 5A3TA 4MGSA 5FYTA 3RZMA 1DG6A 4ONUA 2IXCA 3GHMA 4JGZC 4XEZA 3T2PA 2OUJA 3ZFFB 3E6DA 3ZSKA 4LO4B 2YV8A 2VECA 2R49A 3E5UA 5IK5A 1CD3G 2XUEA 4JDMA 3WW3A 5JVVA 1Z7S1 2WABA 5GZFA 1K5MC 4HG6B 1Y3TA 1DQ6A 1SPPB 1S2EA 2R041 3PLQA 4XQWA 5FYCA 3RMYA 4B8EA 2D3SA 2VZRA 1IKQA 3KWVA 5TSWA 3CMGA 4OUSA 5FAXA 1RJ8A 3OEBA 4CPBD 5IVCA 3IN9A 3FLTA 4FFIA 3KT1A 3MIBA 3WQ0A 2PLV1 1AXYA 2WFF2 2YBSA 5T54A 1LHNA 1W04A 3D0JA 1V6JA 4XXPA 2HWC1 5JXJA 1JU3A 5FY5A 2VMCA 4YPJA 4L9BA 3AP5A 4FPJA 3HR9A 1J59A 2DUOA 2VZUA 4CRQA 2A75A 1DIWA 1G9BA 1YUDA 3TAYA 2DCYA 1QJFA 1GICA 1RUE3 2VE1A 4BQ1A 4DB5A 4Z82A 5JOWA 4QXHA 2VZOA 3H3UA 1YNAA 5BNNC 1E5SA 2QZ3A 2BPA2 1YQ6A 3AP9A 4TYSA 5IVYA 1O3TA 1GWLA 1H9PA 4Y5TA 4QHOA 4DINB 4KQ7A 4UXAA 2XJRA 4XVHA 5CEHA 2RVAA 4LJHA 1YFWA 2ZHMA 1H30A 2VW0A 2WFF3 3HEIA 4NIGA 4EN8B 2DCKA 4BZ4A 1AF9A 1O8PA 3WHTA 3SXWA 4QHBA 1FOD2 1W9SA 2VNGA 3N7JA 4PDWB 4OCTA 1HKDA 3POWA 4D3WA 1HXS1 1H6XA 3CJIA 1U5IA 2PTMA 1L3JA 1KS5A 2GH2A 2IVJA 4IXLA 4UYBA 5K0UA 4EJRA 5A6ZA 5EP9A 2D5HA 3MW4A 2H6BA 1ZBE1 2XLAA 3MLLA 3OBAA 4QM8A 1W6PB 3RI9A 1GOFA 4IV3C 1UZVA 1G9AA 4QPIA 4BXFA 3BUCA 4IE0A 3SH3A 1QF3A 1SEFA 3SKVA 1W0PA 1RHI2 1AR61 1FYUA 4XFIA 3POYA 4YSFA 1OUXA 3VZJA 4C90A 1PZ8A 1SMVA 2X8KA 2HH9A 3LD8A 3BB6A 4MGZE 1QOTA 4YFWA 5CFCC 4CUCA 4JGYB 5FK7A 1FX5A 1HB2A 5BNOA 2WO3A 5FJKA 4NWVA 1MS0A 3DCQA 1CX4A 4GJYA 1FOD3 4UF0B 5LA1A 2JXAA 5JIAA 1LKNA 3PUHA 2ZEWA 1OFNA 3KV5A 3MFCA 1XU1A 2F4LA 1NLSA 1D0HA 1UOFA 2RDQA 3P6BA 3WVJA 2YZ4A 5L7OC 4N9HA 1IG0A 1YQ5A 4CCJA 2J1AA 2VTXJ 3DV8A 1FMD2 2ARXA 4O61A 4RR3A 1TME1 1RHI3 1YEWA 3ON7A 3K77A 1OHFA 4LQRA 5C3PA 2VUDA 5GZDA 3T0AA 2HWD1 3KVBA 4XF1A 3BIWE 4HK8A 4WM8A 4JKLA 1RVF1 3ZYBA 1AR81 3ETPA 4J6GA 4WM7C 3KQRA 1LESA 3FBYA 3SC7X 1DGLA 2LW8A 2BWCA 1ZA4A 1CAXB 3NAPA 3BPSA 2E6VA 3RRDA 5FK8A 3VBUC 3CZJA 1LGNA 5EV7A 1ZRIA 1LJ7A 4FI9A 1COV1 1S2KA 2VCCA 1GV9A 3MFAA 4DEQA 1K42A 1FMD3 2WLQA 1ASJ3 1DFQA 1QJZA 1TNFA 4Y3OA 1GOHA 3DPRA 5L36A 1LGCA 1BLZA 1D4M1 4L97A 4U2AA 4MGTA 3KGLA 5ERLA 4FAGA 4JC1A 4Y26A 1BMV2 1SCRA 3GBWA 5T50A 1FI2A 1NUKA 2JKBA 3U14A 3VDDC 1ND2C 2E7QA 4Q4V1 5DG1A 3WNXA 3I3QA 4EN7B 3FHIB 5CYYA 4OULA 1SFNA 4QPGA 3RYRA 1GZ9A 1T2XA 4Y1ZA 3TRSB 3OBTA 2WL1A 5BV6A 2RHPA 3KT4A 1O3SA 4OI0A 2BOJA 2VJXA 4IE5A 1PO21 2GC2A 4XJZA 2PA7A 3KF3A 2DWRA 2VM9A 4AK3A 1WD4A 4CUGA 3TNQA 1R1A2 3NO8A 4BHPA 4CCKA 5DZGA 5BNPA 2I2SA 3KCCA 1VBA3 2W68A 1UY0A 5AFEA 1H2MA 1TMF2 1V6KA 4Z2AA 4L92A 5FOBB 2DFCA 2VQAA 2KA3A 2KXLA 3DYOA 3K4ZA 4XQDA 4Z07A 1V00A 3ZLIA 4OFGA 5A6QA 3AFGA 4NOTA 3K4AA 5F3CA 3WEZA 3VKNA 4EROA 4CEWA 5A1LA 3PL0A 4BQWA 4YFZA 3RZGA 2HJIA 1OQ1A 1VRH3 4WVZA 1POV3 4JV4A 5C8CA 4PIXA 5DN2A 1STMA 2QQIA 4UFKA 2FCTA 3SEPA 1AR71 4CXXA 2LM3A 3POJA 3AP7A 4MZUA 1JUHA 3B00A 4UBGA 1JYCA 3M2MA 2QQJA 4JDNA 1UMIA 3HAGA 4JGZA 4Q26A 4QQOA 4WVMB 2ZXQA 3PU8A 4XF3A 1R1A3 2RM22 1AL23 3ITQA 5E6HA 3O1TA 2CTVA 4YW2A 3UETA 4AL9A 1K5MA 1TMF3 3CJIB 1UW8A 2JD4A 1RUG2 4LA3A 2RR11 1TQ5A 5K0UB 1AUYA 5LY1A 3WG3A 3H42B 4V2WA 2EXJA 1SLLA 4ISRA 1ONAA 4QDRA 2R7EB 5DDJ3 5FPLA 1IG3A 4QPIB 3I3MA 3D4KA 5CFDB 1WBFA 3NNGA 2RS52 5FTTC 3MV01 1J58A 4K1ZA 4LK7A 2DV9A 2JDAA 1UZ0A 4Q4W2 1W6OB 1ULCA 5A3MA 3ZMNA 2WWSA 4RD7A 1R082 5D21A 4ASKA 5JUVA 1LRHA 3V0AA 4CEYB 5FZ3A 1F5FA 1U5XA 2VQTA 4YLZA 3OJBA 4D6QA 3OY8A 5C9AC 5LATA 1BYHA 5BNOB 3POIA 2RM23 3ZSLA 3ACHA 5F37A 5F8PA 1W2UA 4LO8A 3T3YA 3USUA 4HPKA 4A42A 4HKLA 1RUG3 5A3OA 2JDKA 3BVCA 3I54A 2WAOA 2DTWA 3N9OA 4N7IA 4NUBA 4XDPA 3WNKA 2ZKLA 5F32A 1RUNA 3M7AA 4KBZA 5D8AA 3VKFC 3RPQA 2JJ6A 3VN4A 2XBO1 1ZZ6A 5EJ3A 1LAJA 3L2YA 1W6MB 4NIAA 4RR3B 1PK6C 2WNVA 4KI5M 4LOTA 2RS53 5A7NA 2Q8EA 2XL9A 5JCTA 4R8HA 2AEYA 2XJSA 2YY1A 1XQNA 3U4SA 1BEV1 5A3PA 5FUPA 2DF7A 1R083 4I02A 3H1YA 5FMBA 3MW3A 2FCVA 5JSOA 3MPBA 4PHZA 4E2QA 4XUOA 3PIGA 1MPXA 2BDRA 2L9LA 4XAAA 1RIRA 4Y4YA 2WZR2 4DUWA 1Y9MA 2IXHA 2VVEA 3NAPB 4Q5OA 1HW5A 4W6WA 5FZ9A 3ZDVA 2HEVF 2WO1A 4Z1VA 3OUIA 4CDXC 2V5DA 2DCJA 3PTRB 4ET7A 2ZCWA 2O14A 2JECA 1WCKA 4BYYA 1N1SA 1ZRRA 3ZPOA 4LBKA 1BVVA 1K45A 3NNJA 2WT1A 4D7YA 2D5FA 2E7AA 1NE6A 2DVDA 2LS6A 3PJQA 3JZVA 4AI2A 1OPOA 3DL3A 4R9BA 1JOJA 3INAA 5GLUA 1XSQA 2VOTA 3B9IA 3N9QA 4B4QA 3MIEA 1HQWA 2VD7A 4EQVA 3PUSA 3Q8BA 3O5SA 5AC93 2VPVA 2WZR3 5AVAA 4IL7A 3B69A 1QMJA 3WR0A 4I0WB 1VBD3 3HT1A 4FSJA 3PIJA 3KD4A 3AB0A 1JH5A 4FPYA 4FPKA 2GSYA 1UMZA 2RMU2 5IUQA 1F2NA 2OT7A 5FPZA 5FY9A 3WOGA 5C3SA 3NL1A 2Y33A 3NV2A 2ZMNA 3T4VA 1S0JA 2QDRA 3HIFA 4WM7A 4XAEA 2HBTA 2GZWA 1Q56A 5HPOA 4AI8A 4RS5B 2CL2A 3D8CA 2BBVA 1RUE1 1AX0A 2C9AA 3NJYA 5IVFA 2ZZJA 1HB4A 5FCCA 5F9TA 1IPSA 5JOZA 3Q8CA 4M0HA 5FJHA 4W50A 3AX4A 3ZSMA 4W8JA 2Z42A 5FPUA 2Q1FA 4GWNA 4JGZB 2FQPA 2HEWF 4BM8A 2VZ1A 4I2OA 3PUAA 2A3XA 4QKFA 4FBFA 4M3CF 1H8TA 4IDZA 1QIQA 1SFPA 3AP4A 2WNEA 1C57A 1PGW2 5FZCA 2NLRA 4Q4X3 2DVFA 2OVUA 2RMU3 1X7NA 4RFRB 4E27A 1LOFA 3BCWA 2QCSB 2WAAA 3LOBA 1PVC1 1QJU2 3O0XA 4OQ8A 4AEDA 3IZOA 4CU9A 3VZKA 2LRPA 1YC61 4ZXKA 2VUAA 3WV6A 1GQGA 4K7JA 1UWWA 2QBXA 2HEYF 2DVGA 1QH6A 1AXKA 1V9U1 2BYVE 2JG8A 3LDKA 1CQ9A 4R9DA 2ZGNA 4Q0VA 3NV4A 4CP0A 1IPKA 1GZWA 4EWAA 1KRIA 1UO9A 4W6XA 5FPVA 3OGSA 3USSA 4M0NA 3OEAA 3GHNA 4DY5A 4C1WA 1W06A 2PAMA 1AYN2 2MHFA 3U1XA 4DXTA 4EYUA 2ETEA 5DQ0A 4AVVA 3USUB 5ACA2 5JMOA 2QQMA 4HPKB 4CCLA 3ILFA 1I9RA 1Z78A 2KR2A 5BNNB 2YGMA 4XDQA 1C1FA 2PXJA 4NHLA 2W1SA 1QJU3 3K3OA 4BQXA 2WT2A 3CNAA 4FCAA 1BK1A 5M0TA 4XBQA 1OLQA 1LHWA 3W58A 1W2OA 3ZFEC 4AI0A 3AJYA 4YGEA 3BALA 3KQ4B 3WDWA 1ZRDA 1JOPA 1WMXA 4GA9A 3E97A 4AG4A 4RGKA 4UFLA 4J1XA 2R16A 2JIJA 3FZ3A 4XXAA 4FFHA 5FZDA 5FLJA 5FP7A 2ZGRA 3VHPA 2BFUL 4NROA 5CNAA 5A1AA 3S0MA 2DUPA 4KMQA 4QX7A 1IS3A 2J1EA 1MQTA 4UFMA 3SH5A 2ID4A 2VXRA 3A23A 3R4UA 5EPAA 2A6WA 4UFHA 4AR2A 1UXZA 3Q8FA 1AYN3 3GCWA 4RSUA 4MOAA 2BVBA 2E26A 2JE7A 2RJLA 3AZYA 4KWUA 4IV3B 1DHKB 4Q1PA 4TLGA 1XE7A 4YVWA 5GJ6A 3I2KA 4XBLA 1EPZA 5C33A 2FDJA 4JRLA 5I0SA 4XFCA 1OH4A 1GZTA 3T30A 2JICA 5FZHA 4MHRA 1PGL1 5IATA 2BNOA 3U37A 4DNYA 2CWMA 4ZPIA 1OPMA 3K4DA 2ZGOA 5CFCB 2BGPA 4MGIE 4G4FA 3MEPA 4XUNA 1A8MA 1LOCA 3WX5A 3KF5A 2PYTA 4CCCA 1DGRN 2W2IA 1PO12 5FP8A 3HQXA 4I3PA 4XZUG 1F4AA 2A70A 2RDRA 3LFIA 4N90A 5A7PA 1NAEA 1RVF2 3WG4A 3H7JA 4HVRA 3VBSA 3IPVA 1APNA 1POQA 2BBAA 3AYCA 3P3NA 4DZGA 5L7OB 1SDWA 2D93A 4ORFA 1DZRA 2ZX4A 5DG2A 1HIXA 5LASA 1ZRFA 1OT5A 3ALQA 5FMOL 3TN91 4P9JA 5FP9A 4B7EA 1HX6A 4M3CA 1JZ2A 2ZA9A 1UL9A 5D2AA 1LEMA 5A3LA 4BJ0A 2OW4A 5FUIA 2YUEA 5FZ8A 2GNBA 3VZMA 3H8RA 2IXIA 1MR5A 1QJY1 4GB32 4MGKE 3ZFGA 5JZGA 3T09A 5EXOA 5CISA 5LA0A 2CU5A 2NMNA 3DF0A 5BPXA 1MEC1 1URXA 1NXD1 2P5BA 1LCLA 1PO13 4WM7B 2E51A 1QY4A 4IEOA 3HQRA 5GZEA 4MO3M 1HRV1 1HN1A 1PMJX 2MEV1 5E89A 5FQ0A 2VZVA 3J7NA 4H55A 1WWYA 3I3DA 1C3HA 2VVFA 2JDMA 3VBUB 3VV1A 4QXKA 3ACGA 2RS11 3I59B 3WDYA 1OXCA 2W87A 3O1VA 3HBKA 3S57A 3I2HA 4XFFA 3LAGA 4JRAA 4TZDA 1QXJA 4B29A 4GB33 4QDQA 4OYUA 3VDDB 3DKWA 1ND2B 1HB1A 3AZVA 3AZWA 2FBEA 1W9WA 1WA6X 3N9NA 4A6SA 3GNEA 1RUC2 1J3PA 4J1WA 4HKWA 4W65A 5FPBA 3WHUA 4AEMA 1ZZ7A 2QJVA 5LEJA 2PN5A 3I2JA 4P9GA 2EXHA 3U11A 3VHOA 2VAUA 3ENRA 4TWTA 3ES1A 2VBDA 3PUQA 5EQUA 1IZ3A 2VGDA 5GKAC 3L2HA 4N7UA 2F6BA 5GLVA 1A3KA 2A6YA 1AL0G 1GZWB 1QQP2 3QBQA 4FPCA 5FMOS 2EVXA 1CESA 1JZ3A 5C5TA 4ZZ5A 1REDA 2OXBA 3CLPA 1DQ4A 5EYYA 1ZZBA 1IQAA 3ECQA 3UJQA 5IAXA 1NLQA 1S0BA 4PF1A 3LDRA 4XF4A 4XILA 5FZOB 2WZEA 4SBVA 5HV0A 3FWEA 4FQZA 2B4KA 2CAUA 4A3XA 3JQXA 1O5UA 2Q4SA 5EJ1B 1VBB2 1DGRA 2XR4A 2IVIB 4YW6A 1GZCA 1LULA 4XMAA 3VDCA 2OZ6A 5J1XA 1AR92 5DAVA 4LBQD 2OYZA 1RUC3 4IE6A 1GUIA 3AYEA 3R6SA 3T2QA 1U5ZA 2HWF1 3EBRA 3ACFA 3BOPA 1XU2A 3WG1A 3WUDA 1C4RA 3CQOA 3PVEA 2VUJA 3ZIXA 1ZVFA 2ORZA 4G9SB 2BP6A 2VCBA 3PUIA 5I0TA 1ZBA1 2JKXA 2O1QA 4WM8C 5FYYA 1F5JA 4IV1A 1QQP3 3WP3A 3QOPA 5F39A 3POFA 4RHV1 4CU6A 1JZ5A 1VMHA 4I0BA 2DDUA 1V70A 3MF9A 3O14A 5CKMA 4FO9A 3UESA 4NIHA 1Q5OA 5IK7A 1YFXA 4H2AA 3IIAA 1YIFA 4JQTA 4QX0A 4WVWA 1CJPA 2YMZA 2YG0A 2J1RA 2HYXA 3E5XA 1EYBA 1VBB3 4Y22A 3NKGA 3ILRA 2B9UA 3SNMA 5E8AA 4B1MA 3EHKA 3WSOA 2R072 4I09A 1RUD1 1RMU3 1AR93 1W8OA 3DPRC 2JEMA 4FAHA 4XHBA 3KGZA 4BQ4A 3LEMA 1W8HA 4FPFA 2C26A 1AVBA 2A71A 1F9KA 4HN0A 5DAPA 4LXLA 3AXDA 3KVAA 4RFT0 3ZN6B 3FLRA 4FPHA 4XJ9A 5FY4A 3BPZA 5C9AB 3AYAA 2Q0AA 1BEV2 3C8XA 4Y20A 1QH7A 4GH4C 4QPGC 4HSJA 5A33B 2CHHA 1RYYA 4QQ2A 2R061 3POGA 3VKOA 1QEXA 3AZXA 1HRI1 3N9PA 4R4XA 1LHUA 3H9AA 5HCBA 5IK8A 3ZFEA 1UU4A 2PHTA 3JD71 5BNQA 5BNPC 4ISQA 4XURA 1E5HA 4JHTA 3OD4A 1PK6B 2VO5A 3RDIA 3OF1A 4IEXA 2R073 2WBKA 4O65A 1QOOA 4PCRA 2HWE1 2GU9A 4EE2A 4I0AA 1O6UA 1H2LA 3JBG1 5J09A 3LFMA 1JZ6A 4FPLA 5LBCA 1CIWA 5FZ7A 2V73A 2OS2A 3H50A 4TXWA 5IWFA 1OSGA 3FHQA 1LOEA 4CEWC 4AGRA 3DUIA 1ZZ9A 2R1DA 4OHWA 5C8CC 2VMGA 5F2SA 4FT8A 4LKFA 1OA4A 1KS4A 4LHKA 3WF3A 5JLVA 4LEJA 4ES8A 4CDXB 1D4VB 1X33A 3LA2A 3OYWB 3MPPG 5HCAA 2W3JA 3V65A 4LR4A 4ARXA 1EP0A 4J25A 1WD3A 5FZEA 4LULA 4E8CA 5CBLA 1R093 4UFIA 4HBNA 4ZZ8A 1LENA 3MF6A 4BK4A 4DPNA 1O4YA 3U78A 4ATEA 1W03A 3LQCA 5CU1A 3S5AA 1MS5A 3KB5A 3IAPA 4AGGA 4IGOA 4PLOA 1AYM3 1NOVA 4Q0QA 1RL3A 4UWDA 4OZOA 4A4AA 2X05A 4LHNA 4LIVA 5LRSA 3DECA 3JB4C 2C4XA 2ZX1A 3PU3A 2DVAA 3FHAA 2ZEZA 3V64A 4CP9A 3I49A 5J7MA 2FDKA 3OUHA 4QWNA 2NN8A 1RXFA 5FZ4A 3T1LA 2XOMA 4Y1VA 1L7QA 3RZKA 3AK0A 5LK5A 1RUJ1 2BNMA 1VB2A 3W20A 1S0IA 3CIHA 1SDDB 2TEPA 3IBMA 4KG0A 3NV3A 1JZ7A 2Q30A 5H9PA 3GBFA 1YJKA 4XYXA 1ZREA 1Q8SA 3PDQA 3A0KA 2WYFA 3URFA 3VHNA 5IT6A 1XYNA 1UKGA 1Q8PA 1SLAA 2G9ZA 1C8NA 4CP1A 4DQAA 1NQJA 3P5BA 3POBA 5D8AC 1H4GA 4CDUC 3THPA 2DUQA 3ZFFA 2Z69A 3O0VA 2RV9A 4LUKA 1REFA 2YXSA 3S7EA 1G9FA 2WNVC 4P9XA 2WC2A 1EUUA 1XSRA 4AFBA 2VVDA 3BODA 1K5JA 4XQ4A 5EJZB 3AMPA 3M1HA 1VLNA 3ME2A 4NPRA 1DYOA 5JR7B 2XJVA 5JAXA 1UYZA 1GR3A 1DQ2A 5CG9A 1O3QA 1UZWA 2K46A 1FPN1 3KV4A 1UIJA 3E1F1 2ADDA 2CSGA 2ZHKA 3DKQA 4OVEA 3O0WA 1B09A 3GJAA 1HB3A 5FYSA 3T2OA 2VMIA 4MXVA 3B3QE 3ETQA 4PT6A 2HWB1 3BTXA 3C7FA 4QGNA 4QB6A 2BTVC 3FL7A 5T5PA 4B4PA 1XNDA 3J4UH 2B7YA 2ZS6B 1QXRA 4LNVA 3WP5A 1ODNA 1O91A 3GYDA 4X8PA 1S55A 1KQRA 2XJTA 3NJZA 1OF4A 2FZ1A 4WVVA 5LY2A 1RXGA 4BQ3A 2OKXA 4JDOA 3HVDA 3BU0A 3VBOC 1GMMA 1A78A 4XHXA 4YZ5A 4MG2A 2UY8A 5J96B 5H9QA 3OUJA 2PHXA 3MIFA 5K9YA 3OB8A 2WFPA 4ZU4A 4OQ9A 2XH6A 4Q8LA 4NRMA 2GNTA 4PBOA 4A44A 4AAXA 2ET1A 3ABZA 5IK4A 1IQDC 1OQEA 3ZFEB 2OQ7A 4K21A 1MZFA 1I1EA 1C8M2 4YW7A 4YM3A 2UWCA 2OA2A 2E33A 3C2UA 4GWMA 4IEWA 2UURA 4NAMA 4MADA 3WW4A 1XNKA 2A6XA 5FYMA 3KV6A 5A32A 1V6LA 2XHKA 4URAA 3AKPA 1PM7A 3SCGA 4RQPA 4D6RA 5F7UA 5AFBA 1YLLA 5JSRA 1RTVA 3CZUA 1UOJA 3T0BA 5A7WB 1X9TA 3EYPA 5KWRA 2E53A 1RUI2 3D3AA 3GGLA 4QKDA 2V72A 3OGGA 4QX3A 1S0CA 4QXCA 3IDAA 1BBT2 3WNPA 4RGGA 4MUVA 5ISLA 5H9RA 1A8DA 3O12A 4META 3R05A 3P1IA 4ES9A 2TNFA 2P6CA 2PHWA 1ZA7A 2UWBA 4OHYA 3T1MA 4ZY9A 3TN92 2OX0A 1H8TC 2R6QA 1C8M3 1JMUB 1PX3A 1O4TA 2EXIA 3LSDA 3MW2A 5FBZA 5FY0A 1VJ2A 4AHYA 4D7SA 3VBFA 4IEQA 1LOFC 2W52A 5JPMB 3J7HA 1UOBA 3SCHA 2FDGA 3NNMA 4GH4A 1GU3A 2OZJA 3C7HA 4AEDC 4DFSA 2ZEYA 5IHRA 3MYXA 2YPJA 4NMIA 5FP3A 5LK7B 2EXKA 3I3BA 1RUI3 2WYSA 5DAQA 2GMMA 2JG8C 2EIGA 2WUHA 3CF6E 4JCKA 4P02B 2XLGA 1GYKA 2EIBA 1W6NA 4ZU7A 4SLIA 2VULA 4AVSA 4LLOA 4F8AA 1NY72 1BBT3 4AHWA 4S2GA 4AAPA 1DQ5A 3N36A 2W91A 4H14A 3GM8A 4Y4RA 4AF9A 4EN0A 4LBLA 2ZOEB 4JHZA 5CB7A 1PMIA 4AWDA 4DUVA 2GP5A 1GP4A 2ZX3A 2P1BA 4HONA 1EUTA 4INDA 1CN1A 3NNFA 2XDVA 4V1PA 3B93A 5JI9A 3ZXEA 5FWEA 1YQ2A 2QUOA 1GP5A 4FOWA 5I8TA 1H2KA 4NHKA 4KWLA 5FZMA 4AXOA 4Q4Y1 2DYCA 2JD9A 3CBNA 4FOYA 5IJRA 3E5QA 1US2A 1VBC1 4M4PA 3NJXA 2JX9A 3QCWA 2VOVA 3WNNA 5J48A 1W3XA 1JYVA 3UK9A 1J83A 4DXRA 4JTOA 1Q43A 1LHOA 1UN1A 3HNMA 1FAYA 1AXZA 2CNAA 3NV1A 1GWKA 2JE9A 5IVBA 1MQTC 1W8ZA 4JTNA 5JDBA 3A7QA 2O0OA 4HKOA 5FO8B 1QU0A 4XDOA 1CPMA 1KD7A 5GLZA 4CU8A 1H1AA 2QE3A 4CA9A 4YVWC 1W8FA 2Y6GA 2E31A 4HXCA 5A6XA 4AI9A 1G6NA 1EV11 4NR1A 2JG9A 3MZHA 1ZZCA 3DYPA 3S6PA 1JZ8A 5C3RA 4HVQA 4GZ9A 1NCQA 2R0FA 1CZTA 4KU7A 3RWKX 1LOBA 3WINE 3ZN5A 3C3VA 2V09A 1HQNA 1RMU1 3N9LA 3LIHA 4Q1RA 3ZXKA 4XTMA 1U0AA 3IDEA 1NYWA 3VKMA 3VBSC 4P08A 1WLDA 2GNDA 3KMHA 3VB9A 5A3NA 2D7FA 4CDUA 1HV1A 4CXWA 1PIV1 4MXWA 4IERA 5F3EA 1F15A 1VBE1 4A7ZA 2FMDA 5F5IA 1OLMA 3LGRA 4Q4W3 2AC1A 4XW3A 1WA4A 4YARA 4XTPA 2AYHA 1QJX2 3ZFGC 3MLKA 1OLME 5JZGC 2WS91 1POV0 3PVOA 3TEYA 2JB8A
chains in the Genus database with same CATH topology
4WM8B 4YRDA 1N47A 4FTSA 4UW3A 1Z0HA 2XVLA 2D40A 1C5HA 2XWJB 1IPJA 4QT6A 4JAAA 4N53A 2D3PA 1RUH1 2QDNA 2XGXA 1F8VA 3VL8A 2RS31 3CEWA 3FC0A 3RMXA 4AHXA 4ATFA 2DCZA 3OGJA 4YG0A 4COYA 1JUIA 3N4MA 4RA0A 4XIKA 4N43A 1RUF1 1CAUA 4QX5A 3DPRB 4GIQA 2A6ZA 3ST7A 1EAH2 2PHLA 4GMP3 3M3CA 4MGYE 2DVBA 1NQDA 1QJX3 3IM0A 3WQ7A 3VBOA 1QXPA 3FUOA 3TYJA 3OTFA 2Y0OA 4LUMA 4S2HA 4GH4B 4QPGB 3A4UA 1WBLA 3J8F2 2D6MA 1WLWA 3GZTB 3FFZA 4E4DX 2B5HA 1SACA 4HVOA 1SLBA 3S7IA 2B42B 4WZCA 3H7YA 5FLIA 2NPIA 4YM0A 3BU7A 4YGBA 1DU3D 5T55A 5BNPB 4K6BA 4CDQA 2Y26A 2CGOA 3ZXLA 1IKPA 4YG3A 2A6VA 1EAH3 1OI6A 5T5LA 3SH4A 1VAKA 2WLPA 4AQTA 1Z7S2 4I3GA 1OA2A 3KSCA 2D6KA 2R042 3I8TA 3RG0A 1WW6A 1C1LA 1Y43B 1UPSA 2WIIB 4A7KA 4KH9A 4CEWB 2CWSA 1JN2P 2AZ5A 3J8F3 5C8CB 1W39A 2VNRA 2PLV2 4YM1A 3WDXA 4PQ9A 3MICA 5I91A 1ULGA 5I0RA 1UCXA 3M70A 3TNPB 5KC6A 1Q8VA 2HWC2 2NM1A 2GAUA 1SCSA 4RL7A 4DS0A 4OHXA 3PVBB 4IV1C 1B35A 3U07A 4ZKTB 2UY9A 1QGLA 2WFF1 1DDLA 3WZ1A 1K5MB 4JQRA 3MIHA 4MSVA 2WKKA 1XYPA 3ATGA 4QQLA 3WP6A 4LBNA 1YI7A 1D2QA 3KM5A 1H1MA 1ND3A 3IMNA 3OPZA 4I30A 1Z7S3 1YHFA 1OFSA 2R043 3WQ1A 5C4WA 4GMP0 4GKXA 3ZXJA 4AYUA 2ZX2A 1LR5A 1VP6A 4Q0SA 4LO6B 2GMEA 2PLV3 2R32A 5JI7A 2IXKA 1DBNA 3V0AB 4FPOB 3LA3A 5KXCA 1DQ1A 1UU6A 3VGIA 3OY8B 3OD0A 3VHRA 3EJKA 4R4ZA 4XFAA 3VBRA 1EY2A 1NCRA 4C0HA 1HXS2 1UD1A 2XJPA 2BWAA 2VOKA 3WW2A 4B7KA 3RI8A 1ZBE2 1FOD1 1NXMA 1YIPA 3HN1A 4HSLA 5D8AB 5F6KA 4BLIA 4CDUB 4HT1T 4MX3A 5E16A 2JENA 2WNVB 4IQPA 4E9KA 1AR62 1ZX5A 1CAWA 1YWKA 3ACLA 4FTEA 1VAVA 3QACA 1DYKA 1RHI1 4XMIA 3ES4A 5ACA3 1GSLA 1HXS3 1D2SA 1PNFA 1O3RA 1LODA 5T5JA 1SQ4A 2D3RA 3K51A 1OLRA 3AJZA 1ZBE3 3RJRA 5I0UA 3VZNA 4YW1A 1PGSA 2ZGSA 1TME2 1CAUB 4BPZA 1CR7A 4E4SA 2SBAA 5FDBA 1O4ZA 1AR63 2I07B 3ASIA 5ABJA 2HWD2 1FMD1 1ASJ1 2A3YA 1UKRA 5B2GB 4AEJA 3VBOB 1WW4A 2OUHA 1X82A 1LTEA 4Q0PA 1AR82 1OOPA 3GF6A 4LBQA 1IGOA 3TBDA 1AZDA 1OMIA 5KHKA 3LWCA 3JUUA 5DUVA 5EWSA 1MS1A 3TOJA 1C28A 1RGSA 1COV2 1FNZA 4LHLA 4Y1XA 2BGCA 4M3CE 3E6BA 2V5YA 1TME3 1D4M2 3AKTA 3ZXFA 1PVXA 4F83A 1IS4A 4PLMA 2UYAA 2BFUS 5DXDA 4YG6A 1VBA1 2GN3A 3KS7A 4R9CA 3KCYA 2HWD3 3RYKA 5JWPA 4Q4V2 1WCSA 5LEKA 1RVF3 1AHSA 3ZFFC 1AR83 1CAVA 3JQWA 4IEYA 1PO22 3RJ2X 5JIUA 1BMV1 2BQPA 3FX3A 1REEA 4BLJA 2PHDA 1FT9A 1GQHA 3I4IA 3LSEA 3ZVXA 4LO5B 5KXBA 1MS3A 1VRH1 1IOAA 1POV1 1U12A 1VAMA 5KHGA 1G86A 1COV3 4WV8A 1H8TB 2GMPA 1NA1C 3QH6A 1FATA 1QHDA 2D43A 5GLWA 4GULA 5I8SA 5L73A 5DUWA 1D4M3 1R1A1 4P14A 2Z5WA 1AL21 4AEDB 4MH0E 1TMF1 1W6QA 3GZUC 3N7LA 4Q4V3 4IETA 1ENRA 4FXKB 1QKQA 2JG8B 2QFEA 4AI3A 3N3HA 3PTYA 2GNMA 5CIRA 1G9CA 1JBCA 1PO23 3ELNA 1S1AA 5DDJ1 1AR72 1DZTA 4MV2A 4JVAA 4MLOA 4HMZA 4S2FA 4FVVA 5FPXA 3AFKA 2G9FA 3PMEA 1NE4A 2DU1A 2LALA 5HBAA 3ZDSA 2ENRA 1G9DA 1GNZA 3M3EA 2GC1A 1H9WA 2IFRA 2RR12 1IHMA 3V0BA 3UV9A 5HCFA 2RM21 1QWRA 1SBEA 3FLPA 1W0OA 2ZGTA 3MGUA 4W6YA 1ULDA 1RUG1 2D6LX 3KCXA 3ZIWA 3G6JB 2C1FA 4QGMA 2CGPA 2QVSB 1JW6A 3PVNA 2DU0A 1AR73 2XL7A 4NHMA 4RQPC 1VB4A 2RS51 1MQTB 1WMFA 4EV0A 3LKJA 2LTNA 3EO6A 4R9AA 4EN9B 1R081 2W08A 3AMHA 1N1VA 2TBVA 2CGNA 2RR13 2UU8A 4YVWB 2Q5TA 5EZWA 2DURA 3VL9A 4PDWA 1ZRCA 3NKTA 1BCXA 4YW4A 2XBO2 4UBHA 2PHFA 4QMAA 1VBE2 1H8VA 1YFYA 1SLCA 1X50A 2O8QA 5K7PA 3VBFC 1W6PA 2PHUA 3WG2A 1QDOA 3H1WA 3SITA 2ZMKA 4NVPA 2FZ2A 3RYPA 2RE9A 1UZYA 1DLLA 3DN7A 4FPGA 4XJAA 2N7GA 4XZPA 1T6GC 4QQHA 2ZABA 4C0BA 3VBSB 3IPVB 2G4IA 3VKLA 1GBGA 4LBQB 4LE3A 5I93A 3VZLA 3AKSA 4OI4A 1H0BA 3HT2A 4KL1A 4M3CB 3I7DA 3MI8A 4AEKA 5DUXA 5AC91 2ZJCA 2WZR1 2A73B 2XBO3 1SBDA 3ZFGB 5JZGB 1QNWA 3E6CC 1EPWA 2D98A 1KITA 2R1BA 3H0OA 1VBD1 4XBNA 2A3WA 4XF9A 1BEV3 3ROUA 3VLBB 4OLLA 3ZYJB 4KBBA 5CAZA 1RITA 2CAVA 4D94A 3CU7A 5FQ0B 5F5QA 1S0DA 3SHRA 4TSVA 4KG8A 5FO9B 3PMSA 1HQLA 4P5HA 5BY5A 1S0EA 4KU8A 1KXGA 4AQ6A 2R0HA 2IXJA 2RJKA 4ITCA 1ALYA 1X8MA 4FXGB 2AUYA 4L8QA 1ZZ8A 3N7KA 2K9ZA 4R52A 4Q4X1 1W6QB 4YZ4A 4AQSA 2RMU1 1JYIA 2JG9C 2K0GA 3UKVA 1RUE2 5FREA 5KXEA 2P37A 4LLFA 1FNYA 2EALA 1MVEA 3LCPA 1NCQC 2LUWA 4KWKA 1U5YA 2EA7A 3AXEA 1QDCA 3JB8A 4A7YA 4Z2WA 4PBPA 1S0GA 4XFHA 1V6NA 2GH8A 4YVSC 3RNSA 5D1IA 4GALA 4WBBA 4IEUA 4XE9A 1N1YA 1JXNA 1PVC2 1MVQA 1TEIA 4YM2A 4Z8BA 3V0BB 4X8NA 4LT5A 2WA4A 4G3YC 3WW1A 1ZYBA 1PGW1 1S2BA 4S2DA 1QOSA 2GC0A 4FP2A 1V9U2 2EF6A 1QJU1 4YGDA 3CO2A 3I2DA 4K8FA 3VUOA 4IV1B 2B8MA 1NA1A 2UWAA 1D0GA 4AE2A 2ZX0A 3WXPA 5EYXA 1AX1A 4N53C 5K8SA 3LA7A 4XETA 1ENXA 4MYEA 3AMNA 3WCRA 1BQPA 4WVMA 4Y22B 5J36A 1MS4A 3FJSA 2D6OX 2IFWA 1PVC3 4H7MA 1SLTA 2NZ9A 4N43C 1AYN1 3OCPA 5E88A 5ACA1 1Q8QA 4OHZA 3ZX7A 1ULEA 5GLTA 1V9U3 2D97A 3RSJA 1JTZX 1CVNA 2ZGUA 3AKRA 3ZXGA 4EN6B 4FTBA 1J3QA 4ASMB 4Y20B 3NVCA 5KHHA 3WUCA 1DYPA 4COZA 4YZ1A 5CFDA 1NZCA 3RS6A 1W6OA 2P3KA 2Q1MA 4CEYA 5T5OA 4L99A 2WNUC 4UW4A 3BTAA 3ZXDA 4DMIA 1UU5A 3VZOA 4CDQC 2E7TA 1PGL2 3AKQA 4H7LA 4YZ2A 2PAKA 3J9SA 4Q0UA 3FBMA 3H8UA 1QNYA 1RUOA 2I74A 1ASJ2 1KJRA 1XE8A 1W6MA 3SMHA 3VBHC 4BMEA 4CYDA 4P9LA 4OI1A 4I01A 3AYDA 4DRRA 1PO11 4NWWA 1HLCA 4XJUA 1B35C 2DFBA 4HETA 2GN7A 4AVCA 4PIYA 1QJY2 1ND3C 4EWDA 1LGBA 5C4WC 1MEC2 4OI2A 2I45A 4K20A 3R4DB 2ZAAA 1VBA2 2VOWA 2ZHNA 2CY6A 4GB31 1HRV2 5CADA 2MEV2 3WDVA 4TLFA 3UKNA 4Q27A 3FE5A 2HKXA 5L19A 1N3PA 2WINB 2K2SA 2MNGA 3EXUA 4CDWC 4UW5A 3W59A 1Q3EA 1UAIA 5H9SA 1LECA 2VQ0A 4LBMA 3VBRC 2RS12 1LU2A 3L9JT 3TN93 1NCRC 5KHIA 1VRH2 4BOWA 4KWJA 5KC5A 4YGCA 1AJOA 3X29B 4BWOA 3D5OA 2ZHLA 1QJY3 3MIGA 1WCDJ 1CPNA 4Q8KA 2H0VA 2KM2A 2NQYA 1AL22 1MEC3 2YC0A 1H2NA 4GQ7A 3ZFFB 4P9YA 2VW2A 3B5LB 1HRV3 4UW6A 2MEV3 1DQ0A 3KT7A 4X6QB 4QU2A 1MZ5A 1KJLA 1RUC1 1TNRA 5FRAA 1G8WA 2QNKA 5DDJ2 2NMOA 4D69A 1NA1B 4IEVA 4RS5A 2RS13 4Z92B 4M00A 3PHMA 4Y24A 1S0FA 3IDBB 1OD5A 1QQP1 4QD2A 2Z79A 1SBFA 2YHJA 1C5IA 3OBRA 2PQQA 4YZ3A 3ZYRA 3SISA 3J26N 3EQEA 5SV8A 3AM2A 2C0ZA 1Y7BA 1LHVA 3APBA 2EAAA 3FFQA 2Z2SB 1VBB1 2HWF2 2OPKA 4F7ZA 5ABJC 5KXDA 3HBZA 4YVSA 1AR91 1ZBA2 2X5IC 4IEPA 5CVRA 4BIOA 1UPIA 3IDCB 4RHV2 1N3OA 2XG3A 1OOPC 4C1XA 3WD5A 4M01A 1YFUA 1DZQA 2Q8OA 4QPYA 4IESA 1XXNA 4C91A 1E57A 1H1IA 5T3NA 1OQDA 2P34A 1RUD2 3T2TA 3IT8A 1IS5A 3ZN4A 2XB6C 5A32B 2YROA 5BNNA 2HWF3 4PLNA 1V6MA 5FFOC 1YI9A 2UYBA 1IS6A 4RQPB 2P3IA 2D6NA 1GFF2 1KFUL 2R071 2IWGB 4B3NA 3LOIA 1ZBA3 4PF5A 3TWIA 1ZM1A 5GALA 1VR3A 2WT0A 2R062 3M4FA 4RHV3 1KDKA 3IKWA 4URTA 2O8OA 3M3QA 4AFAA 1VALA 1HRI2 2QKDA 2VOXA 4Q2FA 5FO7B 3ZXAC 2P17A 3LZZA 1A6CA 3JD72 1LB2A 3ZO0B 1RUD3 4AQ2A 3VBFB 2HWE2 2QQPA 5AC92 4IV3A 2P2KA 3V56A 1J3RA 1V6OA 3GALA 3JBG2 2AENA 1VBD2 5J3UA 4OUMA 1PHMA 1R091 2PELA 2ZGPA 1FV2A 3MDPA 2W0XA 2ARBA 4LTAA 2NYYA 1WMDA 1YCIA 3ZPYA 3WP4A 5CFCA 2WNUA 2R063 1ENQA 1W6NB 1ZNPA 1HRI3 2E63A 4XOGA 2VH9A 1AYM1 1WW7A 2BVVA 5BUVA 1YJLA 2HYKA 3JD73 4L2NA 3R4SA 1V6IA 4N9IA 2ZKNA 5L7OA 2VU9A 1BJQA 1XRUA 2HWE3 2ES3A 2EAKA 3GBGA 3JBG3 3THTA 4P9WA 3VBHA 3MIDA 4DRVA 2PAEA 3CL1A 2WZPP 5LRRA 4Q4X2 3HMYA 3KLSA 4GXLA 5T52A 5CG8A 1X8EA 4Y1YA 1OA3A 2ILMA 2W39A 3KZ4C 4AVAA 5JOXA 5JPNB 1RUJ2 1J1LA 2XKPA 1UX6A 2IC1A 5JOYA 4EWEA 3FUQA 4L11A 2OIIA 4K40A 3VBUA 2B39A 1RB8G 2ZGKA 1JHNA 3ZSEA 1DGWX 3I59A 4LBJA 2YYOA 4PDWC 1GANA 1TE1B 2JG9B 4H3WA 2AR6A 3JU9A 2XVGA 2IXLA 3ZYGA 1RJ7A 4HANA 5DZFA 2AGSA 4HK9A 5SV5A 4CDWA 2HWC3 1NCQB 1J1TA 2ZPXA 3AMMA 3VDDA 2QZ2A 1ND2A 4KGQA 2AH2A 4BH9A 2ZBJA 3QD6A 1MZEA 2BUKA 3FMGA 1WUVA 4YVSB 4KNCA 3G7DA 3TB0A 3U4XA 4U36A 3M8LA 1O7FA 1RUJ3 1FPN2 3GZAA 4X6RB 3WLUA 1I5ZA 5E1RA 3SCFA 4RGAA 4JGYC 4MXWB 3U10A 1GKBA 3R0RA 1YO8A 1FV3A 2HWB2 1LOAA 1BVP1 1CONA 4AGVA 1H4HA 2D6PA 3M3IA 1KFXL 1YXWA 4AI1A 4O9GA 1OKQA 3PNAA 4XJ8A 4IEZA 4BE3A 4N53B 1HDKA 2WQ4A 3S30A 1BXHA 3NSTA 2ZACA 1FPN3 1NG0A 2F4PA 2FMYA 5DZEA 3RZZA 3WDUA 1AJKA 2ET7A 4ZU5A 3QH7A 1ENSA 5I8YA 5F1RA 4N43B 3D6EA 4QQPA 3AP6A 2HWB3 4HLTA 4PIZA 1Q8OA 5GZCA 3QLQA 1YYNA 3AZZA 4ASLA 2X5IA