3ZYRA

Structure of the lectin from platypodium elegans in complex with heptasaccharide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
b'STDSLSFSFINFDRDERNLIFQGDAHTSRNNILQLTRTDSNGAPVRSTVGRILHSAQVRLWEKSTNRVANLQTQFSFFLSSPLSNPADGIAFFIAPPDTTIPSGSAGGLLGLFNPRTALNESANQVLAVEFDTFFAQNSNTWDPNYQHIGIDVNSIRSSKVVRWERREGKTLNVLVTYNPSTRTIDVVATYPDGQRYQLSHVVDLTTILPEWVRVGFSAASGEQFQTHNLESWSFTSTLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LECTIN
publication title A Lectin from Platypodium Elegans with Unusual Specificity and Affinity for Asymmetric Complex N-Glycans.
pubmed doi rcsb
source organism Platypodium elegans
molecule tags Sugar binding protein
total genus 59
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zyrA00
2ZGNA 1FNYA 1OQ1A 1S0CA 1OKQA 2DWRA 5HCFA 3QLQA 5CBLA 1SLLA 4XHXA 1Q8OA 4YG0A 3IMNA 3UJOA 1F31A 2W39A 3HMYA 3U4XA 1AJOA 3SH5A 3ZYPA 1AX2A 4R9CA 4P9XA 4LBLA 3ZPYA 2A6WA 4AGGA 3WLUA 3AP5A 5T55A 4XTMA 1TEIA 4JRAA 2ERFA 2UU8A 4YW3A 3D6EA 4BPZA 1DQ6A 1CIWA 1W6PB 4M01A 5DZGA 4YW4A 2JE7A 2ENRA 2VW1A 1GSLA 1UN1A 1DQ4A 1FYUA 2TEPA 1UPSA 5H9SA 2HYKA 2NM1A 2ZHKA 3POSA 2D6NA 1DHKB 2A6YA 5T5PA 3ZXKA 3ZXEA 4DS0A 2ZGRA 3AZYA 1SFYA 1G9AA 1LEMA 5EXOA 5GLZA 4FPGA 4XJAA 2ZGOA 1W6MB 2ZGLA 3ZYRA 4U2AA 3T1MA 3N36A 1MVQA 4XJ9A 5GZEA 5KXEA 3POYA 3AP6A 1AX0A 4K21A 4Y22B 5GLUA 3KM5A 3SLIA 1CPNA 3T1LA 2ZGTA 4FOYA 1LGNA 4NOTA 1LULA 1N1TA 1W6QA 4AYUA 3MEPA 1YIFA 2G4IA 3WHUA 1KJLA 1W6NA 1HQLA 3WCSA 2DVDA 2NZ9A 1LJ7A 4GXLA 5GZGA 1SACA 4XIKA 1WUVA 1QOSA 3OBTA 1PZ9A 5AVAA 3OJBA 2JJ6A 4WVWA 4YM0A 4XHBA 5E8AA 3AJYA 1MS0A 5GZFA 2D3SA 5LK5A 3AJZA 3M3QA 1LOCA 5EYYA 2E6VA 1MS9A 3AYAA 3JUUA 4PQ9A 2PHRA 1LU2A 3B69A 1GV9A 3TB0A 4RL7A 1UAIA 1DQ5A 1QU0A 2DTYA 2ZBJA 5DG1A 2AENA 2YZ4A 1G9CA 2ARXA 3VUOA 2D3RA 2GNTA 3AFKA 1S1AA 4TZDA 2DVGA 2EXHA 2R0FA 4BMEA 4GWNA 3DGTA 5E88A 1JYIA 1ZM1A 2NYYA 3LSDA 3R4UA 1DFQA 4P9YA 5GLTA 4FP3A 1QF3A 4Y1UA 3B01A 4M3CE 2OUHA 4FPEA 5CNAA 1SLBA 1X50A 2GMEA 3C2UA 1SBFA 1APNA 4LBQD 1WW6A 1S0JA 1ULGA 2ZHMA 4FPFA 5JOXA 4HANA 4Q8LA 4UW3A 1V6NA 1LTEA 2PHWA 4FPLA 1GANA 2DYCA 2DU0A 3H0OA 4UW6A 3WV6A 1W6QB 5IK8A 1H9PA 1PZ8A 3SNMA 1MS4A 2EF6A 2ZHNA 3AZVA 1W6NB 2D6LX 3TAYA 5IT6A 4UW4A 2P3KA 1NXD1 1V6KA 2W68A 2JD4A 3OGGA 4PF5A 5GM0A 4CZSA 4UW5A 4OZXA 4YGBA 1Q8QA 3HR9A 4M3CF 4XXPA 5T52A 1JXNA 4FPJA 3ZSKA 3B3QE 2YXSA 1WW4A 2DUPA 5CA6A 1IKPA 1A8DA 3R4SA 4Y1YA 2JDZA 2UWAA 1VAVA 1KRIA 2E53A 1DYKA 1H9WA 1Z0HA 4XTPA 1LOFA 3O12A 3BIWE 4YM1A 2PHUA 1SCRA 2W08A 4YZ2A 3BODA 2D6KA 4ATFA 1WLDA 3SITA 2WT2A 1GICA 2AH2A 5JOWA 2AUYA 4Y26A 3V0AA 1R1ZA 4YZ3A 2A6XA 5CB7A 3OPZA 4FOWA 1BQPA 3WG4A 4FPHA 3UK9A 5IK7A 2DUOA 2DVFA 4WV8A 5BYNA 1ULCA 3OY8A 2ZZJA 1MVEA 4YW1A 3M1HA 3CNAA 4LBOA 4DRVA 2R1DA 5DZEA 1C1LA 1KDMA 4XMAA 2ZGKA 2GALA 1LOBA 3PVEA 1N1YA 2VY0A 5DUUA 1JOJA 2LTNA 3B00A 2RHPA 4RA0A 3WVJA 3O0VA 4M3CA 1S0GA 4BOWA 1G9FA 1G8WA 4P14A 1Z78A 1JYCA 3N7KA 2Z42A 1A78A 3PMEA 2E51A 1QOOA 2EXJA 4LBMA 2A3WA 1QDOA 1QGLA 3WUCA 4YGDA 1SLCA 1UMZA 5GLWA 3W59A 4YZ5A 5JMCA 1V6OA 3KQRA 1I3HA 3NV2A 1GZWA 2ZGMA 2ZKNA 4ITCA 2AYHA 3N7MA 4R9AA 2JECA 4R9DA 4BLIA 2OW4A 1QMJA 3FLRA 2PHXA 2GNBA 4YLZA 4XE9A 1LCLA 2WSVA 5GJ6A 1RIRA 3WNXA 5T54A 2XG3A 3ZXFA 4CRQA 5F9TA 2ZAAA 1LHVA 4IQPA 4JC1A 3FFZA 2ZGQA 5H9RA 1LGBA 2D6OX 1JUIA 1VAMA 2R49A 3PJQA 4ZXKA 4XYXA 1N47A 2A6VA 4AVTA 3V0AB 4K1YA 1BKZA 3AP4A 1AXYA 5FRAA 5IUQA 3WCRA 4GWMA 2FMDA 2EXIA 3GALA 4FQ4A 4LBQA 2CY6A 3OY8B 3N3HA 1AXKA 4ATEA 1A3KA 4YFZA 2EIGA 1FNZA 4SLIA 3OBRA 2R0HA 4Z8BA 4YM2A 3VKOA 1SLIA 3V0BA 2D6MA 4FPKA 3SH4A 4GKYA 1BXHA 5H9PA 4XILA 4YZ4A 1ULDA 4YG3A 3USUA 4M3CB 1WBFA 4H55A 3LCPA 1CPMA 1WW7A 3FLTA 1W6OA 3POWA 1AZDA 2DVBA 2P2KA 4AGVA 1ULFA 5EYXA 1JBCA 4PBPA 4YGCA 1KJRA 1CONA 2DV9A 4Y20A 3WZ1A 1DGLA 4ZKTB 3A4UA 2C9AA 3AYDA 5FREA 1GZWB 5DUXA 3SISA 1S0FA 2ZA9A 4I30A 3VV1A 3N7JA 1Q8SA 1WBLA 4DQAA 1LHUA 3IPVA 3WG3A 1N3OA 1OFSA 3NWKA 3JU9A 1IOAA 3I8TA 1VIWB 1LHOA 3ATGA 5DXDA 4Y24A 3VKLA 1QNYA 3MW4A 2P34A 4D69A 1MS5A 2B7YA 4XBQA 5T5OA 2ZMKA 2EALA 4XDQA 2VH9A 1S0IA 5GLVA 4AGRA 1SBDA 1JHNA 4LBQB 2GDFA 2CYFA 1ULEA 1IS3A 2CTVA 1F5FA 3WDWA 1V6LA 5T5LA 1G7YA 1LGCA 2CWMA 4M00A 4XIOA 3W58A 4AWDA 5IK4A 2WLQA 1Q8PA 3M3OA 4GKXA 1QKQA 3VKMA 1SLAA 4BM8A 1Q56A 1V6JA 1V6IA 2YY1A 2VW0A 3GNEA 3T2TA 4NO4A 3V0BB 1LEDA 2ZMLA 4XJZA 5SV8A 5JDBA 3USUB 1MZ5A 2E7QA 4P9WA 1GYKA 2PHFA 3AP7A 1HLCA 1ONAA 2C5DA 3AZXA 2A70A 1EPWA 1W6OB 2CL2A 2UWBA 4XXAA 2I2SA 1C57A 1GNHA 4WZFA 2GNDA 4U36A 4Y1XA 4XJWA 1LOEA 1PZ7A 1B09A 2UURA 1GBGA 1WD3A 1G86A 1VLNA 2A5ZA 2WT1A 3N35A 5CAZA 4FPCA 5HCAA 1DQ2A 4Y20B 2CWSA 1DYPA 1KDKA 1YRZA 2D44A 3FBYA 3QCWA 4FPOB 1WD4A 3RS6A 4YGEA 3ILRA 1IS5A 1DBNA 1LHNA 3ZXLA 5JOZA 1W0OA 3AYEA 3IPVB 1GZCA 3WOGA 1O4ZA 2A3YA 4XMIA 4XZPA 2Q5TA 1FV3A 4F83A 4MYEA 1GNZA 3NV4A 3DUIA 3WDYA 4DRRA 2AGSA 3WG2A 3AXEA 2KM2A 4K1ZA 1BJQA 1HKDA 4ISQA 3ZXJA 4AVSA 2ZGSA 4Q27A 2W52A 2DU1A 2WT0A 2AREA 1AJKA 1CR7A 1N3PA 2A3XA 3PVNA 3RSJA 3ILNA 1UX6A 1WLCA 3A0NA 4PBOA 2A6ZA 3Q9OA 2E7TA 3APBA 4DPNA 5EWSA 4FP2A 5F5QA 5T50A 1GLHA 3WDUA 1I1EA 1IS4A 3MW2A 1FATA 4R9BA 2XB6C 1ENRA 4LBNA 2V5YA 1KITA 3FLPA 5DZFA 1ZA4A 1LHWA 4Q26A 4YZ1A 1CESA 1UZZA 1Y7BA 1YO8A 2WJSA 3ILFA 3V64A 1W0PA 4AVVA 4W65A 3B9CA 2V73A 1NLSA 1DLLA 4FPYA 2WQZC 1O4YA 1J1TA 4Q2FA 2D43A 4YW2A 5H9QA 2GNMA 1CN1A 5DUVA 1LOGA 4YG6A 1U0AA 2D6PA 2ZGUA 1QOTA 4KBBA 5GALA 4XBNA 1DZQA 4Y1ZA 4C1XA 5HCBA 2OUJA 4XJ8A 1DIWA 2P3IA 4TYSA 2JE9A 1C4RA 4GALA 2NN8A 1DQ1A 5JOYA 1FX5A 1YYNA 2ES3A 3BTAA 1S0EA 3R05A 4PCRA 2GN7A 3AP9A 2YV8A 1UZYA 1LOFC 3N7LA 2YROA 1IKQA 1CQ9A 2WKKA 2SBAA 3NV3A 2CNAA 2SLIA 2A75A 3VKNA 2P3JA 1MACA 1S0BA 2A71A 2PHTA 4BQ1A 4FVVA 2D3PA 4WVVA 1FAYA 2GN3A 5KXDA 1G9DA 3INAA 3ASIA 1QNWA 1YXWA 2GMMA 1IS6A 2ZHLA 2ZGPA 3WG1A 3ZSLA 1URXA 1CJPA 5GZDA 3FUQA 3AYCA 1V6MA 3RQ0A 5JLVA 3NV1A 3AX4A 4Q1RA 1G9BA 2PELA 5JVVA 2BQPA 3OYWA 2VUAA 1MS1A 1RITA 2UWCA 1LOAA 3UJQA 3WDTA 3MPPG 1F9KA 1QDCA 3D4KA 1D2SA 1FV2A 1C1FA 3D5OA 3I4IA 2ZABA 1GZ9A 2DVAA 2A7AA 1VALA 1AX1A 3BOPA 5GZCA 1Q8VA 2LALA 2FHRA 3L2YA 4L8QA 5DG2A 2WNEA 4JCKA 1BYHA 2AR6A 1MS3A 1HDKA 5T5JA 3UL2A 3RMYA 3ZSMA 1LECA 1YI7A 2R1BA 4Q8KA 2NMNA 1LENA 1CVNA 3LSEA 4YW5A 5KXCA 2VU9A 3M3EA 1AXZA 3RMXA 3ZSJA 1UKGA 4LBJA 2VW2A 3O0WA 3VKFC 4DFSA 3O0XA 2OVUA 5KXBA 2EAKA 4YFWA 1SLTA 1SBEA 1S0DA 4FOQA 2ZMNA 3M3CA 3WUDA 2D7FA 5E89A 2WSUA 4K20A 1KQRA 1AF9A 1MZ6A 2ARBA 3AZWA 1AVBA 3V65A 3ENRA 5IK5A 3A0KA 2DUQA 4ISRA 4Q1PA 3M2MA 1GKBA 3ZVXA 3IKWA 1JW6A 1WCSA 4HL0A 2H0BA 4FOVA 2EXKA 3AXDA 3AZZA 1WW5A 1MS8A 3SH3A 4YM3A 3WDXA 1H30A 3IM0A 4BMBA 5L73A 1N1VA 1DQ0A 2DTWA 4CTEA 1MR5A 2P37A 4FQZA 3OYWB 3RRDA 4Y1VA 4GA9A 2NMOA 1UL9A 2VXRA 1LESA 1D0HA 1ENQA 4LBKA 4XBLA 1W6PA 2ZACA 2DURA 3WHTA 1V00A 1N3QA 1JN2P 4ASMB 3IN9A 4XOGA 1WLWA 4XJUA 2R16A 3FUOA 2JKBA 1BZWA 3PVOA 1LU1A 3MW3A 1HQWA 3WDVA 4C1WA 1SCSA 4BLJA 1W6MA 2GMPA 1N1SA 3AK0A 1LODA 1XQNA 2YMZA 1RINA 1ENSA 4Y22A 3O5SA 2NP0A 3RG0A 5DUWA 3HN1A
chains in the Genus database with same CATH superfamily
3TN92 3GGLA 1SFNA 4P5HA 3H8XA 5DDJ2 4ES9A 5J36A 5FXWA 2XBO1 2B39A 1Y43B 2OZ6A 1PMJX 3ZR5A 2R32A 2RMU3 4RFRB 5FYYA 5A33A 4CCOA 4JDOA 1Q8OA 4QQ2A 4Q5OA 4PDWA 3E5XA 4CDUB 1R082 3MFCA 2W39A 4E2SA 3HMYA 1X9TA 1HRV2 1L3JA 3RJ2X 3PIJA 3UKTA 1VBD1 4DINB 3LWCA 1XBFA 4AHZA 4P9XA 4QQHA 2A6WA 2D5HA 5JZGC 4BQ4A 5C8CC 2ORZA 1US2A 1XNKA 3U11A 2ERFA 3I2HA 3LDKA 2XL9A 5DAWA 4BPZA 4CCJA 1DQ6A 2VW1A 3JQXA 1UN1A 2BBVA 1DQ4A 1UPSA 5F6KA 4Q0PA 2HYKA 1TG7A 4DXTA 1V9U3 2H6CA 3SEEA 4DS0A 1HIXA 2D6NA 2A6YA 3NKTA 1ZRFA 5A6YA 3AZYA 2Q30A 3RWKX 1G9AA 2ET1A 1LEMA 3LA3A 5EXOA 2VJXA 1FI2A 4FPGA 4LO7A 4EV0A 3ZYRA 4A2UA 2O8OA 3T1MA 3BOWA 3N36A 4HETA 5FPLA 3ZYBA 3NKGA 4XJ9A 5KXEA 1C8M3 1AX0A 3AP6A 3J7HA 3KF3A 4K21A 4QPIC 4Y22B 5B4XA 5HV4A 5F8PA 4KGQA 4NOTA 3MEPA 1CAVB 1JYWA 1RUF1 4IEPA 4UOJA 4JGYC 5IAVA 4GXLA 2ZX0A 1W9FA 1PZ9A 3FBMA 1H4GA 2RS52 4PIZA 3OJBA 5AVAA 2JG9A 1W2UA 3OUIA 1RUE1 3P1IA 1UU6A 3OGVA 3VDDC 4CDQA 5EYYA 3RI9A 2ETEA 4MHRA 2WNUA 3U10A 4PQ9A 3ACGA 2O8QA 2ZEZA 2VOKA 3AB0A 3HNBM 2Q4SA 3ZYJB 2VG9A 4QPGB 4BK4A 2HWB3 2YC2A 1QU0A 2DTYA 2ZBJA 2ZX4A 5DG1A 1AR62 2AENA 2YZ4A 4QM9A 4MADA 1OOPC 1AR83 1E5HA 1ZZ9A 4W6XA 1GQGA 4IV3C 2EXHA 1I9RA 2IXKA 2ZEYA 4GWNA 4K9SA 4META 4XAEA 4LT5A 1ZM1A 3LSDA 3R4UA 5FY4A 1PX4A 4Y1UA 4BU2A 4M3CE 1ODMA 3RNSA 5L19A 2GMEA 3C2UA 3RZMA 1KEXA 2YPDA 1Q3EA 2J1RA 4AAXA 4FPFA 1UYXA 1B35C 2WS93 4HANA 4QGLA 1AL23 2RDQA 5FPZA 2WNVB 4UW3A 4CEYB 5ACA2 3J4UH 3FHQA 2DU0A 4UW6A 3WV6A 1PZ8A 2KR2A 1H1MA 3HJRA 4QMAA 3FC0A 2P3YA 4QX1A 4DXSA 4GH4B 3PUAA 4UW4A 1RUH3 1V6KA 2W68A 4RS5C 4AI2A 4NJ4A 3Q8BA 3T2PA 2VC9A 1K5MB 1KFXL 4OZXA 4HVRA 4A4AA 3VBFA 1Q8QA 2GSYA 4L9BA 2QZ2A 5FIXA 5FLJA 5T52A 2WO3A 2VVFA 2D5FA 5FZLA 4W4ZA 1ND3C 5A7WB 1O8PA 1UZ0A 4RD7A 1VAVA 1WCQA 3I54A 5C9AB 4OMCA 2VMCA 4QDSA 1RXGA 3K2OA 2PA7A 2R7EB 3CDZB 1RXFA 3S30A 4CDXB 1LOFA 4YM1A 1QJY2 1MZEA 4N43C 4YZ2A 1O3SA 3ST7A 3SITA 1RUC2 3M4FA 3CHXA 5DN2A 3FX3A 5K9YA 3VBSB 4Y26A 1R1ZA 2FDFA 4EN6B 4JHZA 3NJYA 3Q8AA 1QQP3 1NYWA 4L11A 4XCAA 4DZGA 1RJ7A 4WV8A 3OY8A 2ZZJA 1MVEA 4H7MA 4CEWC 1EV11 4DRVA 5DZEA 2OA2A 3H8UA 1KDMA 1VBD3 3CJIA 4S2GA 3VBUC 1LOBA 2LS6A 3PVEA 4E4SA 4ZZ8A 5FUPA 2A73B 3B00A 1QY4A 2RHPA 3WVJA 2EIBA 3WW3A 2PXJA 2OQ6A 4M3CA 2W46A 1S0GA 4XFCA 3LAGA 2BWCA 1Z78A 3PL0A 4ZS2A 1A78A 1OLQA 3RWNA 1ALYA 3LDRA 3OD0A 1UF2C 4LBMA 3ZFEC 2A3WA 3WXPA 1QGLA 4YGDA 3ECQA 4Q4V2 5JMCA 1WLTA 2VZ3A 1WCDJ 3KQRA 3OF1A 4COZA 5KC6A 1GZWA 2ZGMA 5D2AA 2AYHA 3N7MA 1PNGA 4R9AA 5FZEA 1S55A 1X9PA 5IVFA 4BLIA 3VDBA 4Y3OA 2BERA 2MNGA 3CKHA 5GJ6A 4ES8A 4EQVA 4A7YA 3DCQA 4X6RB 5FY0A 4MGKE 2RS12 3FFZA 2JG8A 4HLTA 1JUIA 1I6XA 1U5YA 3NAPC 4N8MA 1YLLA 1ACCA 3KT1A 4AVTA 3RYPA 4COYA 2VMHA 3O1PA 4UI9L 1FMD2 2VECA 2J1UA 4E2GA 1H8TA 2CY6A 1RUE3 2PMWB 1AXKA 3PHMA 4HSLA 2ZCWA 4G9SB 5FP9A 4YFZA 2X5IA 4JZRA 2EIGA 4L92A 4UFHA 3OBRA 2DCZA 3I2IA 1R64A 4UFJA 4YM2A 3VKOA 2LROA 2FZ2A 3DN7A 4FBFA 3TRSB 2JDKA 2XUMA 2G1MA 1BXHA 2BFUS 5BXXA 4AFBA 4YZ4A 4YG3A 1CWPA 4MO3M 5SV5A 1U12A 1PO12 3KB5A 3WQBA 5KHHA 1H2MA 1WW7A 4XABA 5A6ZA 4BA6A 1YI9A 3VDDB 5FZHA 1XE8A 4LA3A 3POWA 1VBE2 4D6RA 5LRSA 2P2KA 2RDRA 4A45A 1ULFA 2BV4A 1NCRB 4OUSA 1JBCA 5A3UA 2HKXA 1KJRA 1CONA 1K45A 4DO0A 5J96B 4PDWC 1IPSA 4Y20A 3VL9A 2VD7A 3A4UA 2C9AA 3HQXA 4HG6B 5FQ0B 3A22A 1SDDB 3G7DA 3LIGA 1S0FA 4LA2A 3SISA 5AC92 2R30A 2XKPA 3N7JA 3BPZA 1Q8SA 1WBLA 4IV3B 1LHUA 3EB7A 4UFMA 2X05A 3WG3A 1SFPA 5CKMA 3NWKA 2MPFA 1IOAA 5FZ8A 3I8TA 3KV5A 2V72A 3ATGA 4XFBA 3HPNA 5FZOA 3ZSEA 2VQ0A 1DGRA 4Q0QA 1CAXA 4B1LA 5F2WA 4RN5A 4AHXA 2ET7A 3MW4A 2MEV1 4D6SA 1QJU3 1MS5A 1VB4A 2B7YA 3LD8A 2ZXQA 5IFPA 2OYZA 2ZAHA 3KGZA 5LWBA 2RS32 1SBDA 5HCHA 2BWAA 4LBQB 2CYFA 2GU9A 2HWE1 1CAWA 4GJZA 2CHHA 4O7XA 4CCNA 5T5LA 1O5UA 1ZBA2 2CWMA 2JDHA 3ZM8A 3PNAA 3KHCA 5FPXA 4GKXA 4CCLA 1QKQA 2Q1MA 1Q56A 2YY1A 3K3NA 3V0BB 2VW0A 3H8RA 4NO4A 4N7UA 2ZMLA 4XJZA 5JDBA 2WZR3 3KD4A 2HEVF 3ZKYA 1JYNA 1K3IA 2B5HA 2W91A 1MQTB 1D4M1 1OSGA 3CIHA 3R4DB 4FFFA 1ND3B 2VUCA 4WZFA 2BNMA 1S2KA 4Y1XA 1JZ5A 1VBC3 3VBRC 4XJWA 2OKXA 1LOEA 5D8AB 3E5UA 1VLNA 2A5ZA 5F5AA 4E8CA 2JG9C 1UY1A 1DQ2A 2C4XA 5JMOA 5KHKA 1DYPA 3FBYA 1GQPA 4INDA 3GZAA 1J58A 1EV13 1PGW1 4CDQC 1IG3A 3RS6A 4YGEA 1DBNA 2CU5A 2WNUC 3LIHA 4EZHA 4AHYA 4F83A 1TZOA 4PI0A 2AGSA 1W2AX 2XJPA 4PLMA 3WW2A 3WG2A 5FP7A 2CGNA 3DYOA 5DAXA 1H0BA 4O9EA 2WYFA 4XUTA 4AF9A 5GKAC 4YVSB 5JSOA 4IL7A 3PVNA 1BK0A 3RSJA 1UX6A 1WLCA 2Y0OA 2Y6HA 4PBOA 1Z7S3 4Q0VA 1ASJ1 1BHGA 1W3XA 5CVRA 1GLHA 3VHOA 1NA1B 1VRH2 5LY1A 1R093 3QOPA 1GWLA 3VBHA 4KNCA 4R9BA 1RUOA 3WP5A 4LBNA 1DGWA 2Z4FA 3ZFEB 1HB1A 2XJQA 2NQYA 5DZFA 4XUNA 4CXYA 1HXS2 1Y4WA 4P9IA 1CESA 1YO8A 4BIFA 1OHFA 3V64A 4A6SA 4AVVA 4K8RB 2YYOA 3B9CA 3DPRC 5F39A 5EIYB 4GMP0 4FPYA 1JZ6A 5BNNA 2WQZC 1O4YA 1RHI3 4R4XA 2Q8DA 4CU6A 1ZZBA 3VZLA 1U0AA 4Q4X2 4BCUA 5KHIA 1ND2A 2HWD3 5FMBA 4RGKA 5GALA 4YSFA 4QT6A 3HN3A 3VBFC 4LKSA 2OUJA 1W8TA 3HQUA 1DIWA 4XJ8A 3IIAA 4XUPA 2BP6A 4TYSA 3VBOB 5I8YA 1AUYA 3WNOA 5JIUA 2DFBA 1DQ1A 2QDNA 2ES3A 1WMEA 3R05A 3AP9A 2YV8A 2JDNA 1LOFC 4LTAA 1NLQA 4GD4A 5FMOL 2YROA 5FK8A 1IKQA 1AR71 4S2DA 1X8MA 4PJYA 2XOMA 3K51A 2SLIA 2WA3A 5A80A 1U5IA 3GM8A 3MYXA 1MACA 3RGBA 5LY2A 4H7LA 5KXDA 2HBTA 1HB2A 2QTWB 3H42B 3INAA 3J8F2 1IPJA 1UU5A 3AVSA 4F8AA 1K42A 1KXGA 1HQNA 1J3RA 3PIGA 3THTA 5BPXA 3ZSLA 3DEMA 1HJFA 1V6MA 5F1RA 3BI3A 1LRHA 3NV1A 1G9BA 3CJIC 2HWF2 2BQPA 3SKJE 5LB6A 1MS1A 4HK8A 2C6SA 1BMV1 2VL4A 4I01A 1FV2A 1HV1A 3GZTB 4PT6A 3FMGA 2ZABA 3NW4A 3N9OA 2DVAA 3BOPA 1VALA 3CL1A 1JU3A 3MDPA 1POV1 2FHRA 2MEV3 1YWKA 2VZ1A 4JCKA 1BYHA 4UWDA 1ZVFA 2VOWA 5CG9A 5F2SA 5F3EA 4MGSA 3WNPA 4QWNA 3K46A 1F4HA 5A7OA 5TSWA 2ADEA 4QPWA 1LECA 5BNPA 1UZWA 1LENA 4QKFA 4TLGA 1CVNA 1OH4A 4FO9A 5KXCA 4EE2A 1XU2A 3OCPA 2PFWA 3RMXA 5JCTA 5K8SA 3O0WA 3VKFC 3O0XA 2OVUA 3PURA 2OXBA 1SLTA 1S0DA 2G9FA 2TUNA 2ZMNA 2D7FA 3P6BA 2WSUA 5E89A 5JSRA 2BGCA 3CJXA 1XSRA 1CZVA 5C4WA 4FTEA 4GB32 3M2MA 3ZVXA 1VJ2A 3NJVA 1QH7A 4HL0A 3LQCA 4UF0B 3F95A 4FFGA 4OUMA 2Q1ZB 3AZZA 4AEDB 1HB3A 3WEZA 1H8TC 5BV6A 4Y5SA 3SEPA 1AR92 2QQMA 3GCWA 3WDXA 3IM0A 3A21A 3PDQA 5C6CA 2R042 2X5IC 3DXTA 1DQ0A 2P37A 4MVTA 2I45A 2C0ZA 3JCIA 4V1PA 2RM21 3VBRB 2FDGA 1UL9A 2KD7A 1LESA 2WR9A 4XF9A 1AYM2 1W6PA 4HONA 4BQXA 2EICA 3ZN5A 1RUJ2 3UKNA 3DL3A 1J3PA 3EQEA 1T2XA 3N9MA 4NIDA 5FY5A 4IUGA 1EUUA 2WQ8A 3KHBA 2R16A 2XVKA 4XJUA 5BNOC 4K6BA 1FPN1 5LBEA 1R1A1 4NPMA 1LU1A 1WZXA 3MW3A 5JPNB 1QJX2 3D82A 3UESA 5LEJA 1COV1 4I2OA 2XQXA 1GOFA 2GH2A 4OMDA 4D8MA 4R52A 3D0JA 5JXHA 4L99A 1YNAA 1PHMA 4D0QA 4QHBA 3JXSA 4S2FA 1W8UA 2WA4A 3WF0A 3IAQA 4MXWB 1PK6B 1WMFA 3MIBA 1HRI1 4AEJA 4BH9A 4CU8A 4EWAA 2WWSA 3KCYA 2DWRA 2EIDA 2VNOA 2JDUA 3MIEA 3QLQA 5CBLA 2BBAA 2Y34A 4ONUA 2YHJA 1JYVA 1OA3A 5FKBA 4BQ3A 3N9QA 2XL7A 3OGRA 3HOBA 5A70A 1W9TA 1JI6A 2VGDA 2ZOEB 3T0AA 1OBNA 3GXUA 3ACLA 1E5SA 1VMJA 4RR3A 1NCQA 5I91A 3U4XA 2RMU1 3DPRB 3SH5A 1SZBA 3M70A 5FY7A 3PUQA 3HNYM 4XF4A 4XTMA 5LA1A 3ZKUA 2ARAA 2UU8A 3JB8A 4XUOA 5FO9B 1AL22 4M0NA 1CIWA 3P5BA 4M01A 4QHOA 4A42A 1RVF2 2HLEA 3AL5A 1RYYA 4JX0A 1S2EA 2VULA 5EPAA 5H9SA 1AR73 2PLV3 1SPPA 3BN6A 3KF5A 3KLSA 4TWTA 5FJKA 2NM1A 5FZ6A 4AFCA 2G9GA 3ZXKA 5DMYA 3PVBB 3KCCA 5A32B 3OOXA 5GLZA 1XOYA 2ZPXA 2Y6GA 4XJAA 3A23A 3WW1A 1W6MB 1EYBA 3ZMOA 1MVQA 5JAXA 1BEV1 3POYA 5GLUA 2UYAA 1CPNA 4CA9A 2ZGTA 4CCDA 4FOYA 1LGNA 3O1MA 1LULA 1W6QA 2K2SA 3WHUA 5FXVA 3J26N 3WQ1A 3WQ0A 1W6NA 1HQLA 1C8M1 1W3VA 5FZFA 5GZGA 1SACA 2MHFA 3ZXAC 1X33A 2PN5A 1X7NA 3LEGA 1PMHX 4HMZA 1WUVA 3OBTA 2AC1A 5L7OB 2JJ6A 3ORJA 2W9XA 1W8ZA 3CJIB 4WVWA 3BCWA 2E33A 2XBO2 2Y6LA 3N9NA 4XHBA 1W2TA 5E8AA 2D3SA 5LK5A 2WQ4A 3AJZA 1W9SA 2RDNA 1YQ5A 3I97A 3M3QA 2K0GA 3LF7A 3HVDA 4OLLA 3ZYIB 2VQAA 4EYUA 3AKPA 4YPJA 1W04A 4X6QB 4LHNA 1XNDA 4Y5TA 2Y8KA 4LOTA 5FZ3A 1X8EA 2PHRA 3VBHC 1VAKA 1XYNA 2WFF3 4NVPA 4BE3A 2W47A 1VBD2 4KGGA 4LO6B 5CU1A 5CISA 1DQ5A 3W9AA 1PGL1 1BVP1 5A7PA 3JBG1 5FYUA 1YJLA 2D3RA 5F32A 4GMP1 4TZDA 1S1AA 2C9KA 2R0FA 4BMEA 3ETPA 2HWB1 3DGTA 2PAMA 4Q0UA 2NYYA 4JV4A 4AOCA 4QKNA 3RI8A 4Z92B 4Y4YA 1AR81 3JQWA 3MLJA 1ND2C 4OHWA 4YYOA 2LM3A 4GJYA 1X50A 1A34A 5C70A 4XW3A 1DZTA 1S0JA 3RYRA 5FK7A 4Q8LA 2QQNA 4IETA 3KWVA 1GANA 2RM23 3ZYFA 5IK8A 1H9PA 3IDCB 3SNMA 5F6LB 3VZMA 3O14A 5FZ1A 1IHMA 3ALQA 1J59A 3MIFA 2YBSA 1RUF2 3MLKA 2EA7A 4N53A 2WLPA 3HR9A 4F7ZA 1R1A3 3I7DA 1V70A 4XXPA 3UKVA 1D0GA 1JXNA 3Q8CA 1WW4A 2DUPA 3LOIA 3K4AA 2W1UA 4IEQA 1IKPA 1A8DA 3R4SA 1XE7A 4B4RA 5I0SA 1KRIA 1RUE2 1H9WA 3JD73 1QIQA 4HN0A 1Z0HA 4XTPA 4Q29A 5BNOB 2BW8A 5A6QA 1SCRA 1DGWX 4IV1B 3BODA 4URTA 5CKNA 2XJVA 2VPVA 5KHGA 1WLDA 3MIHA 1W8HA 3FFQA 4IEXA 1GICA 4FCAA 4ZS3A 4AL9A 3V0AA 2JDYA 2RR11 1Q43A 3QACA 5J48A 4WVZA 2VCBA 1HX6A 3BYWA 4FOWA 1BQPA 1T6BX 4LHLA 1F5JA 3PTRB 3I2FA 2DUOA 5CADA 5BYNA 4LE3A 1JZ3A 3LGRA 2R6QA 4I3GA 4YW1A 3AL6A 4A7KA 4CU9A 3I3MA 3FHAA 1QQP1 5BNPC 5APAA 1C1LA 4NN0A 5ABJA 3ZDVA 1AL0G 3WP4A 4XMAA 5HBAA 1MEC3 2DCTA 4EWDA 2DF7A 3RVHA 1W28A 4RA0A 3M3IA 3WF3A 2B8MA 4UFKA 1EAH3 1NOVA 2K9ZA 1G8WA 3URFA 3I3BA 3MICA 2AZ5A 5C4WC 2E51A 5FZ9A 5G04L 3IMMA 1QDOA 4JKKA 3WUCA 3GHMA 1A6CA 3U0ZA 3HT1A 4YNIA 1SLCA 1UMZA 2OIIA 2Y6FA 3QD6A 3MUZ1 1UY0A 3NV2A 2R073 2ZKNA 4ITCA 5KR7A 1NQJA 2JECA 3PLQA 4R9DA 5JWPA 4IE5A 2PHXA 4LKDA 5LA2A 1BEV3 1RTVA 2GNBA 1XB9A 4YLZA 1LCLA 4K8FA 1UNBA 2XG3A 2VUDA 3ZXFA 1XXNA 5H9RA 4M0HA 4FAGA 2GC3A 2R49A 1ZREA 3FHIB 5LASA 1EP0A 4K1YA 1SDWA 3AP4A 4B4PA 3ZFFA 4UBGA 1SQ4A 4GWMA 1QWRA 2RJKA 3GALA 3NO8A 4L97A 4FQ4A 4LO5B 4OULA 4CUBA 4L0PA 2XDVA 5LBFA 2PYTA 3ZN6B 3BTYA 4A3ZA 4D94A 1OMIA 3CEWA 4KWLA 4JGZA 1CD3G 4K7JA 1PIV3 2R0HA 4MGZE 3MLLA 2ARCA 4OFGA 1EV12 1UY2A 1KD7A 5H9PA 3ZX7A 1WWYA 5B2GB 1YFXA 3OG2A 2YBPA 2XPJA 3VD4A 4H55A 3LCPA 2FCTA 3FLTA 3JBG3 4CPBA 4GMP3 4EZ4A 5D21A 1GUIA 1LR5A 2DVBA 3E6BA 5EYXA 4E4HA 4YGCA 1UMIA 1WA6X 2QQOA 1DGLA 3I59A 3POIA 3ACFA 4HZFA 4RR3C 4RQPA 4ZKTB 5FREA 4XF3A 3ZFGB 4CP9A 2NPIA 5L9VA 2VBDA 4W6WA 3U14A 4NAOA 4CUGA 1OFSA 3O1UA 2VZPA 4CCKA 1OQEA 3SHRA 5LBBA 1PGSA 1PO21 1S4CA 3VN4A 2RJLA 1YQ6A 3BU7A 4D69A 4LJHA 3CF6E 4CDWB 3ZMNA 4TTGA 4RHV3 4XBQA 1H6YA 1RUNA 3AKQA 2ZMKA 2EALA 1O8SA 2TBVA 1JOBA 1O4TA 2HYXA 3C7FA 3C7HA 3C8XA 1JHNA 1VPHA 1QJU1 2GDFA 5I0UA 1ULEA 1IS3A 2CTVA 3AMMA 3O1SA 4IERA 4Q4Y1 4A44A 2Q8CA 5A3OA 1POQA 1JZ8A 3OPWA 4IEZA 5AVPA 5IK4A 3M3OA 2XWJB 3AKTA 5J7MA 4N9HA 3T2TA 3GNEA 5K7PA 1ZRDA 1LEDA 2P1BA 2QVSB 1GP5A 1L7LA 3USUB 4P9WA 3AP7A 4AVAA 4AG4A 1W6OB 2WNOA 5A1FA 2UWBA 3S5QA 2V4AA 1HJGA 2RR13 4GQ7A 4U36A 2WZR1 1JZ4A 4MOAA 4BISA 1B09A 2UURA 4F3JA 2QQPA 1G86A 3HD8B 1MPXA 3NRUA 3RZHA 2D97A 4FPCA 4W50A 2QZ3A 4P9JA 1YRZA 3W20A 1J3QA 3AC0A 1VBA3 3QCWA 1VBC1 5IJRA 5L9BA 5J09A 1F2NA 2V09A 3POGA 3WP3A 3ILRA 4OYUA 1IS5A 3IPVB 4LUMA 3P3NA 3BALA 1FV3A 3WDYA 5IVYA 4WVMA 3OGSA 3AXEA 4EROA 4YVWA 2WZ8A 1BJQA 4ISQA 3ZXJA 4AVSA 1OA4A 3OB8A 5JXJA 1PNFA 4LQRA 2DU1A 5K0UA 4KMQA 1CR7A 4Z82A 1VR3A 2A6ZA 2E7TA 3APBA 3NNGA 3Q9OA 2LW8A 4NPRA 1XPWA 5HXMA 3CZJA 4XF0A 5T50A 4BQ2A 2JB8A 3WDUA 2AEZA 3LFIA 3MW2A 4KWKA 2C24A 1Z7S1 5JZGB 5C8CB 3E97A 2HWE2 2V5YA 5IVEA 1W05A 1RB8G 3G6JB 1BCXA 4YZ1A 1UZZA 1Y7BA 1R091 5A3LA 3GZUC 1W0PA 3GYDA 2PQSA 5FZMA 1GWMA 4Q2FA 1J1TA 4YW2A 3RPQA 2GNMA 3I2OA 2UY8A 1H2NA 4ZU7A 2D6PA 2V4VA 5LRRA 2VR4A 5CFDA 1QOTA 2OQ7A 1D4M2 2QKDA 3FWEA 4N53C 3CLPA 1RHI1 5FMCA 1ULPA 1YIPA 4HPKA 5HCBA 2P3IA 3E1F1 1XNAA 2EVXA 2JE9A 2WBKA 1NE4A 2HWD1 2YGMA 2NN8A 4TSVA 2ZEWA 1YYNA 3BTAA 3T0BA 4AK3A 2WYSA 1S0EA 1O91A 3ON7A 4QPIB 3PTYA 4WM7A 4FTSA 1PGW2 3MIGA 1UZYA 3MV11 2YGLA 4R4ZA 4N7IA 3SC7X 4WM8C 4AE2A 4JGYB 3K4ZA 3WD5A 4XUQA 3NV3A 2CNAA 4XETA 3H7JA 2A75A 3VKNA 1NAEA 2ZX3A 1AYN3 4ZY9A 2VOXA 1HN0A 4FVVA 1OLME 1FAYA 4WVVA 5FYCA 2N7GA 4OUEA 3ASIA 1CGPA 1QNWA 1YXWA 2GMMA 2ZHLA 2ZGPA 4QB6A 1GOHA 2W1WA 4OI2A 1URXA 1CJPA 5GZDA 3FUQA 3RFRA 2JB4A 1OVSA 3AKSA 1DZRA 4QQPA 5EP9A 5A3NA 1CAUB 3THCA 3CQOA 5ABJC 5CFCA 5JVVA 1UIJA 1ASJ2 1XRUA 2UWCA 1UOFA 2W0XA 3N4MA 2XWBB 1OOPB 1C1FA 1PO23 1YCIA 4PLNA 5IATA 1VE0A 1GZ9A 5I0DA 2A7AA 2Q8EA 5EJ3A 1RUI3 2LALA 4L8QA 5DG2A 1U5XA 1QJY1 1H2LA 2J42A 2WNEA 4LORA 5KHJA 2CAVA 4YW6A 5KWRA 1HDKA 3TN93 4BXSV 4GWJA 3DYPA 4XQWA 5E6HA 5FYIA 1W8WA 3ZIWA 3ABZA 1W2NA 3ZSMA 2VXJA 4E27A 1YHFA 4Q4Y3 1B35B 3LSEA 1PMIA 1UOBA 5E16A 4YW5A 3ETQA 3M3EA 4IGOA 4M4PA 4BDVB 4LBJA 2QFEA 4QPYA 2EAKA 4YFWA 1NCRA 1R083 3WNMA 4NIHA 3HBKA 3NSTA 3M3CA 2JENA 4BJ0A 4XVHA 1KQRA 1UW8A 2VO5A 2ARBA 3LB9A 3AZWA 1LNSA 2VTXJ 3ENRA 4LIUA 3A0KA 2WN3A 4RS5B 4EJRA 3BUCA 3PUIA 4ISRA 1UQXA 3KMHA 3D8CA 3K48A 3IKWA 5FMOS 4QX5A 1DG6A 1AR72 1JW6A 2XH6A 4QXBA 3WF2A 3WX5A 3ZFFC 1OUXA 4CDUA 4LO8A 3H1YA 5HXVA 1XSQA 4QXCA 1UMHA 1MS8A 4PHZA 4D3WA 4O65A 1GP6A 4YM3A 2XQRA 2BVBA 3EBRA 1I5ZA 5LA0A 1VMHA 2AEYA 1N1VA 4RGGA 1YFYA 4CTEA 3N9PA 4COWA 3OYWB 4Y1VA 2WWUA 2VZTA 4GA9A 5ERLA 1GMMA 5A3TA 4N43B 1OLMA 2ZACA 1JMUB 2DURA 3I3DA 5IW0A 3ZO0B 1N3QA 2UY9A 3J9SA 4XC9A 5T3NA 3ZLIA 3N9LA 4BIOA 3I2JA 1BMV2 4E8DA 4Q0SA 3FUOA 3WP6A 1BZWA 3PVOA 3NNFA 4R8HA 1ENXA 4CEWB 1KFUL 4RQPC 2GMPA 2JICA 1CZTA 1N1SA 1REDA 2OS2A 4QAWA 4P08A 3AK0A 2FQPA 3S57A 4NR1A 3VBUB 1RINA 2RS53 3S0MA 4Y22A 3PU3A 4N90A 1WCUA 4Z2AA 2P4EA 3HN1A 3OEAA 3GDBA 2ZGNA 1FNYA 1LB2A 1CAVA 1OQ1A 2CGPA 4HOOA 1W2OA 2X29A 3MFAA 1HB4A 4SBVA 5G05L 3T4HB 2YB7A 2PAEA 3B7MA 1SLLA 4V2VA 4JAAA 1AR63 2OPKA 3UJOA 2E63A 1F31A 1SG3A 4QB1A 2YFZA 3IBMA 5FPVA 1X36A 2HBUA 2BOIA 4R9CA 4RGAA 1JS9A 5FUIA 3AP5A 2ZTNA 3WLUA 5BY5A 1FOD1 4JRAA 3TYJA 4QPGA 2TNFA 3U07A 2GC1A 4CXXA 4OI1A 2ZX2A 5DZGA 3DF0A 2JE7A 1UXZA 4OQ8A 2YU1A 4UFIA 3NAPB 1GSLA 2RM22 2TEPA 4LKFA 4DUXA 4YRDA 1XJAA 2HEYF 2QQLA 2ZHKA 2WRAA 3RZZA 2ZGRA 5DABA 2VM9A 1SFYA 3EMRA 2PLV1 1W8OA 1VBB1 4AR2A 1VP6A 1UY3A 1FPN2 2ZGOA 4WM8B 1BLZA 1R1A2 2ZGLA 1K12A 5FP3A 1UD1A 5FYTA 2PHDA 4MG2A 1COV2 1OF3A 2WNVA 2ATFA 3KM5A 3T1LA 4BQYA 5A1LA 2BGPA 3OBAA 1IQDC 4AYUA 3DYMA 1LAJA 1YIFA 1KJLA 4FI9A 4Y33A 1REFA 2J1AA 4GH4A 2NZ9A 4HKLA 3WCSA 4XIKA 4YVWC 2C1FA 1M4WA 1HRI2 1K5MA 4CCEA 4GZ9A 5A33B 1QJY3 2QCSB 5K0UC 3VHRA 2JXAA 4KL1A 4PDWB 3T3YA 1H1AA 3SKVA 1RUC3 4C0BA 1LOCA 4K3UA 5A7WA 4NIGA 5A7NA 4IE6A 1WA4A 1QXPA 2P17A 5C9AA 2QQWA 3JB4C 2XJUA 2VOTA 3JUUA 4AXOA 5IYYA 4JQTA 1LU2A 4CDXA 3B69A 2RMU2 2F4PA 4ORFA 4MUVA 1UAIA 5J3UA 1G9CA 1YQ2A 2JIJA 2ARXA 1UO9A 4HKOA 3VUOA 4LMFA 2WFF1 5JSPA 3VBSA 3HIFA 1W06A 1L7QA 4KU7A 5E88A 1JYIA 3W21A 3WT3A 4FP3A 3CMGA 5F3CA 5KC5A 1ZRCA 3B01A 4B7EA 5CFDC 2J22A 4FPEA 3MBWA 2JG8C 2Y38A 1SBFA 1YFWA 2G19A 4ASKA 1WW6A 2BNNA 2DCKA 4LXLA 3I2DA 1NY71 1V9U2 5FBJA 3E5QA 1O7FA 1V6NA 2JDPA 4OCTA 3GBWA 4Q4V3 2GC2A 4A7ZA 4I09A 4WM7C 2VBPA 1BEV2 4P5YA 1JYTA 2EF6A 2ZHNA 3WW4A 2CV6A 3U75A 5IHRA 1OPOA 1GQHA 4DMIA 3OGGA 4PF5A 5C3PA 1X82A 3TNPB 3UGHA 5GM0A 4CCMA 4CZSA 4UW5A 1C8M2 3ZXGA 2B9VA 2JG9B 4YGBA 4LLOA 5C3SA 4FPJA 3ZSKA 3B3QE 2HWC1 2YXSA 3MF9A 2VOVA 4IEWA 4CDQB 1C5HA 2CSGA 5CA6A 5FYMA 4Y1YA 2JDZA 4AQ2A 4HSJA 3WY6A 2WNUB 1DYKA 4CYDA 1NXMA 1TE1B 5CFCC 1O3QA 1FMD3 5FWJA 1O3RA 1GZTA 3O12A 3BB6A 3BIWE 4NRMA 2PHUA 2W08A 2D6KA 3JD71 4KI5M 2XGXA 4ATFA 2F4LA 5JOWA 4H14A 4YZ3A 2A6XA 5CB7A 1XYPA 3OPZA 1PGL2 3NJXA 3JBG2 3WG4A 4FFHA 1ZRRA 2RV9A 1OI6A 5HPOA 2B9UA 4YW7A 1UCXA 1PO13 2HWB2 1ZBE1 2J1VA 3M1HA 5BUVA 3CNAA 4LBOA 4MGYE 4Q4W1 1AR82 3GF6A 1PVXA 5B4NA 2ZGKA 1N1YA 3ACIA 3J7NA 4G4FA 4LO4B 3UYJA 1FOD3 5JXGA 1NCRC 2LTNA 4I0AA 4AI8A 4NRQA 4D7YA 1ZZCA 1J1LA 1MEC1 4BOWA 5AC93 3AMPA 3VDDA 4P14A 3VGIA 4XFFA 3N7KA 3PMEA 2IVJA 2EXJA 4BHPA 4JRLA 2DCJA 2XONA 2WS92 1U5ZA 1EAH1 3T09A 3VBFB 2FZ1A 5FLIA 2DBIA 3W59A 4CDUC 1V6OA 2QQVA 2AACA 1DGRN 1VBB3 3QBQA 5FQ0A 1RUH2 4QU2A 2OW4A 1QMJA 2XXZA 3AFGA 2B42B 2R061 3NJZA 4IV3A 5FFOC 3O7OA 3L2HA 1F15A 4MX3A 2ZEXA 5A7SA 5HV0A 2YUEA 2IXCA 2R071 1RIRA 3ME2A 5EFUA 1TVGA 2QQIA 2ZAAA 4IQPA 4JC1A 1W03A 5FXXA 2ZGQA 4B7KA 2D6OX 1ZBA3 1SHWB 3Q8FA 1W90A 3PJQA 4HBNA 2JD9A 4XZUG 2X09A 4ZXKA 1K5JA 3IB3A 1BKZA 4QU1A 2YC4A 1AXYA 4NPLA 5FRAA 2FMYA 3OBZA 3WCRA 4OVEA 1NQDA 3OTFA 3VL8A 2RR12 4LBQA 2FDIA 1BVVA 4ZU5A 3POJA 2WN2A 3OY8B 2WIIB 2Q8OA 2VE1A 3N3HA 1XE0A 4MHUA 4V2WA 1A3KA 1HV0A 3O1RA 1FNZA 1GP4A 4XFAA 1NZCA 1RUG1 4KG8A 4Z8BA 3THDA 3V0BA 2WAAA 3C7EA 1GU3A 2BVVA 4XEZA 1QQP2 1UU4A 3POBA 4GKYA 5FY1A 3GBFA 2XLGA 1UOJA 4QGMA 4XILA 5HI0A 3BTXA 2IFWA 1PIV1 4M3CB 3KT4A 3IDBB 1OC1A 1ULOA 1MQTA 4UYBA 1OVPA 1ZZ6A 1ND3A 1YQ8A 3ROUA 4QKDA 1TNRA 2BEOA 2L9LA 5D8AA 1CX1A 3MPBA 2PHLA 4PBPA 3PJYA 2VCMA 2DV9A 2Y6KA 5DAVA 5L9RA 1ZRIA 3HWJA 2I74A 1RL3A 5BNNC 3NQHA 3AYDA 1GZWB 3B93A 5FY9A 2ZA9A 1MZFA 3VV1A 3RDIA 5CG8A 2E26A 3UV9A 2X53S 1UYYA 1N3OA 2E31A 4LEJA 3DV8A 3JU9A 1US3A 1Y3TA 1SEFA 1VIWB 3SCFA 3VKLA 5DXDA 3KV9A 4Y24A 2JG8B 4KBZA 3IDEA 3R0RA 1QNYA 4XQDA 3U37A 1ST8A 4FT8A 4URAA 3LOBA 1UKRA 2O1QA 5T5OA 4YVSA 4QX7A 4XFHA 4XDQA 4S2HA 4AGRA 2CDPA 3PUHA 2RDSA 3ITQA 4LNVA 4WM7B 1H8TB 4RHV1 1OD3A 2XUEA 5JR7B 1NUKA 1NA1A 5EZWA 2HWC3 2Y6JA 1LGCA 4QD2A 4M00A 4COVA 2X5IB 4XURA 2E7AA 4O9GA 4AVCA 4AWDA 1Q8PA 4RSUA 4Y4RA 2XVGA 3ZFEA 3AMQA 3VKMA 5CYYA 1SLAA 2W1SA 3GJBA 1V6JA 1V6IA 2WNVC 4CVUA 4IDZA 2VMFA 4IEVA 2BUKA 2E7QA 2B4KA 2X8KA 3AZXA 1ONAA 2A70A 4IEOA 4GH4C 1OD5A 2WUHA 2WL1A 4PI2A 5FYVA 2VZUA 3UGGA 5A6XA 4XFGA 2YC0A 2GNDA 1UXXX 1PZ7A 1K5MC 1GBGA 1WD3A 2WT1A 4B4QA 4EN7B 3M8LA 4LR4A 2IZWA 4NE9A 1BK1A 4DY5A 3TEXA 4AI9A 4CUCA 4Y20B 4ZZ5A 4I02A 2WZPP 3KGLA 3MZHA 3MHZA 2IWGB 3VBOA 1DF0A 1ZBE3 4CCCA 5F3GA 4Q4W3 5FZGA 5A7QA 3ZXLA 1YEWA 2V5DA 5LA9A 3WNNA 1GZCA 3WOGA 5C3QA 2VBBA 3KSCA 1VBA1 2A3YA 4CDXC 1XNTA 2BDRA 2Q5TA 4TXWA 4XZPA 2GP5A 4MYEA 5FZKA 4COUA 3NV4A 5F7UA 2B46X 3DUIA 1IQAA 4MZUA 3I49A 5FZOB 1ODNA 3SQOA 4FSJA 1CAXB 4D7SA 3C7OA 3VBSC 2HWF3 2ZGSA 1PO22 4Q27A 4XFIA 4XQ4A 5C5UA 5IWFA 2D93A 1AJKA 1A8MA 1G6NA 2A3XA 3ILNA 3A0NA 5FPAA 1F35A 4OHVA 5EWSA 4FP2A 5FYBA 4DXZA 4DUVA 3BVCA 1CAWB 5F5QA 5FCCA 5JIAA 1YJKA 1I1EA 2HEWF 4QX8A 1QJFA 1IS4A 1SMVA 1FATA 1QJU2 4OHZA 1ENRA 3RZJA 2R063 1KITA 4JKLA 4PIYA 4Q4Y2 1ZA4A 4Q26A 2WJSA 2GP3A 3LEIA 5JI7A 4W65A 3ZDSA 1UOGA 1DLLA 3GBGA 3F2ZA 4CP1A 1QEXA 2VVDA 4MGTA 2D43A 2GAUA 4BB3A 1LOGA 4NRPA 4YG6A 3LA7A 4J1XA 2VZVA 4KBBA 2Z69A 1CX4A 1DZQA 2VZSA 4QB2A 3VD7A 2VNRA 1DLCA 1RMU1 3SMHA 2WZR2 3WINE 2ORXA 3VZNA 4GB33 1C4RA 3NL1A 5BNQA 5AFEA 5JOYA 5FLHA 4LHKA 1PVC1 1RUG3 3THPA 1VBC2 1C5IA 4JHTA 3POFA 3KVAA 4DEQA 5I8SA 3N7LA 4PIXA 2NLRA 1AR93 1XNBA 2W92A 2Y33A 5JUVA 2R043 4BXFA 4JDMA 1D2QA 4J1WA 4FFIA 4BQ1A 2QQKA 2PHTA 5CZKA 2GN3A 4CSWA 4UF0A 1AYM3 2EAAA 1RUJ3 2IVIB 4LITA 4RFT0 3RYKA 4AEDA 3EHKA 1AYN1 1PM4A 1TQ5A 5J98B 1QH6A 2RJ2A 3KS7A 3RQ0A 4UT5A 1OQDA 4EN0A 3AX4A 4Q1RA 1Q5OA 1TMF1 2BNOA 3VBHB 1Y9MA 3ZXDA 3MO4A 3VBRA 1QJX3 3UJQA 3WDTA 3RZGA 1NCQC 2VCAA 1F9KA 1Z7S2 2ZJCA 5FZAA 3D4KA 1D2SA 2WC2A 2G9ZA 4ZPIA 3R6SA 4C90A 5BNNB 4FXGB 4OI4A 5GZCA 1Q8VA 1R092 4GAZA 2W94A 1EUTA 2AR6A 3B5LB 3H3ZA 3NNMA 5D1IA 1QXRA 4H2AA 2VTXA 5FXZA 1ND2B 1TME1 5T5JA 1RUI1 4QQLA 1BBT1 3SXWA 3UL2A 1JUHA 5I93A 3RMYA 4Q4X1 4LPLA 4Q8KA 1RUD1 3TN91 4BQWA 3I2KA 3UNPA 2VU9A 1RHI2 1AXZA 2CAUA 3ZSJA 5DDJ1 4DFSA 4NHXA 2CDOA 4NIAA 4FOQA 2HWD2 4MXWA 1PK6A 2FCUA 1NE6A 3A7QA 4K20A 3AKRA 2OX0A 3VDCA 1AVBA 4NHKA 2DBNA 4QHZA 1RC6A 1R081 4Q1PA 3NVCA 4NIIA 1GKBA 1HRV1 4HKWA 3HT2A 1WCSA 3OGJA 4X8NA 1F4AA 4AQ6A 4NWVA 2EXKA 1RVF3 2WABA 1WW5A 3KZ4C 3WF1A 3DPRA 1OT5A 1H30A 3GJAA 4EN8B 5I0TA 4BMBA 2PQQA 3MGUA 5FZCA 2DTWA 1MR5A 4FQZA 2IUWA 4IE4A 3RRDA 3T30A 2OZJA 2NMOA 1D0HA 5DAQA 4XBLA 3WHTA 4IGPA 2WAOA 2VAUA 1LKNA 5F5IA 4ASMB 4AI3A 3IN9A 3UETA 1MQTC 1NZIA 1WLWA 2IC1A 3EJKA 3T2QA 3TEYA 2J7MA 3RZLA 2JKBA 5FY8A 5D8AC 5A32A 4XF1A 3TWIA 3JZVA 1FT9A 4WZCA 5C5TA 1O5LA 3FL7A 1W6MA 3MV01 4CXWA 2QUOA 5BNPB 2IXIA 1GOGA 1LODA 1ENSA 2MEV2 3O5SA 5FZDA 3PMSA 3RG0A 2NP0A 4C91A 3H1MA 2XBO3 5DUWA 2Z5WA 1XYOA 4UFLA 2BRTA 4AEKA 4IE0A 1H8VA 3T4VA 5IVVA 1HW5A 1S0CA 4YWAA 2RS51 1OKQA 2ZZQA 4ARXA 5HCFA 4EWEA 5C4WB 4NHYA 2DCYA 4XHXA 5C3RA 5L7OA 1T6GC 4YVSC 2W2IA 4YG0A 2XLFA 3IMNA 4LOSA 4QXKA 4D7TA 4QGNA 5E1RA 2J1SA 3DXUA 2QJVA 4Z07A 1RMU3 1ZZ7A 1AJOA 3ZYPA 1NA1C 3ES1A 3LEMA 1AX2A 1AR61 5FZIA 1POV0 4LBLA 4NHMA 2GH8A 3ZPYA 3ZR6A 4AGGA 5T55A 5C3OA 4LULA 4GWIA 1TEIA 1V0AA 1PVC3 5IVBA 5LCWL 2H6BA 4YW3A 1O59A 3D6EA 1D7PM 5FWEA 1XU1A 1W6PB 4YW4A 3POEA 4MXVA 2ENRA 5LEKA 1DDLA 1NG0A 2QQJA 1FYUA 5FOJB 1J84A 2O0OA 3LDBA 2BU9A 3POSA 1DHKB 5T5PA 3S7EA 3ZXEA 3GZEA 3X29B 5AFBA 2FBEA 3HBZA 1KGYA 3DKWA 5DAPA 2VUJA 3OD4A 4Z1VA 5ACA1 3T2OA 2FDHA 3VBOC 1OURA 2PAKA 4KWUA 4U2AA 4P02B 5GZEA 1RUF3 1TMF3 1W8FA 3SLIA 2P5BA 2XLAA 4P9LA 1M06G 4QX0A 4IEUA 2UYBA 1N1TA 1UWWA 2G4IA 1Y9GA 2DVDA 1LJ7A 1PM7A 4NMIA 1JZ7A 4LIVA 4OHYA 4I0BA 1QOSA 3Q8EA 4UXAA 4HK9A 4YM0A 5GZFA 3AJYA 1MS0A 1TME3 2VTFA 2WZEA 1NCQB 1BBT3 3B94A 2D98A 3CU7A 2E6VA 4RR3B 5CEHA 4HXCA 4FAHA 5EV7A 4AEMA 4OZOA 4Q4X3 1W99A 1MS9A 3AYAA 1RUD3 2WO7A 3GCXA 2WWJA 1H4HA 3WNLA 1RUC1 5BNOA 1GV9A 2JEMA 5DDJ3 5FP8A 5FTTC 3TB0A 3KV6A 4RL7A 2VVEA 4IV1A 1E57A 4D6QA 4N9IA 2GNTA 1FOD2 2HJIA 3LFMA 5FZ7A 3AFKA 2DVGA 1SPPB 4CEYA 3H7YA 4NAMA 5C8WA 4P9YA 1DFQA 5GLTA 4C8DA 3D0SA 1QF3A 1HRV3 2J1EA 5FJHA 4QKBA 2OUHA 4MSVA 5CNAA 1W9YA 3OUJA 4XAAA 1SLBA 4QDQA 5FO8B 3CO2A 4FTBA 4JDNA 1APNA 1JHJA 2FCVA 4LBQD 3FJSA 4O61A 5LATA 1ULGA 2ADDA 3BIEA 1JZ2A 2ZHMA 2PLV2 3KVBA 4L2NA 5FYSA 1VBB2 2Z79A 3AM2A 4HN1A 5JOXA 2FD8A 1LTEA 2PHWA 2Q0AA 3H50A 4FPLA 4MLOA 1RJ8A 2FDKA 2DYCA 3SCGA 3H0OA 2VZRA 1W6QB 3E6CC 3IT8A 1MS4A 2Y60A 3AZVA 5IT6A 1W6NB 2D6LX 4HT1T 3TAYA 4JGZC 2P3KA 1NXD1 4Q4V1 3L9JT 2JD4A 2X10A 5FBZA 1Y9QA 3K77A 1UYPA 3VDAA 2QNKA 4M3CF 2Y26A 2YPJA 4NROA 1CIYA 4AEDC 4AHWA 4OI0A 4JTNA 2UWAA 4DB5A 2P6HA 2E53A 2RS11 4OHXA 4ZXEA 1NKGA 1E5IA 1HN1A 3WR0A 5J1XA 3IDAA 4OQ9A 4WBBA 1WMDA 4BQ5A 4B29A 2WT2A 1FMD1 4IE7A 2AH2A 2AUYA 1J83A 3U1XA 3DECA 4J6GA 5A3WA 5CIRA 2WFF2 4FPHA 3UK9A 5LZ6A 5IK7A 5CKQA 4I3PA 4NWWA 5FAXA 3TEZA 3S5AA 2DVFA 2WFPA 1ULCA 5C33A 3AMHA 1W8NA 2F6BA 2E32A 3ZN6A 3O1OA 2R1DA 5LK7B 2XR4A 2BFUL 3KT7A 3DKQA 3I3EA 1PO11 2GALA 4AVBA 2VY0A 5DUUA 3P3PA 3HEIA 1JOJA 1VBE1 3O0VA 1PK6C 4Y5Z0 1NY72 5FZ4A 2Z2SB 2JIGA 2QE3A 1G9FA 4AFMA 3HQRA 1JYCA 2Z42A 3AVRA 4NHLA 1OA2A 1QOOA 2ZX1A 4P9GA 3UGFA 4AI0A 4AFDA 3O1TA 4B1MA 2VMEA 3LE0A 1W9WA 4N53B 4AW7A 5AC91 5FKCA 2IXHA 5GLWA 4YZ5A 3TEWA 1I3HA 4IXLA 2QBXA 4KWJA 4ZONA 3EXUA 4ET7A 1W0NA 5ACA3 3ZFGA 1AHSA 1NX9A 3FLRA 1YFUA 4J25A 3TNQA 1IG0A 3LPFA 3W5NA 2KXLA 2HWC2 3VZOA 5EJ1B 4XE9A 1OKOA 2WSVA 2XKOA 2XJTA 4KQ7A 4E4ZA 3OEBA 3WNXA 5T54A 4A6OA 4CRQA 5F9TA 1LHVA 1LGBA 4NUBA 1VAMA 4HVOA 1CZSA 4XYXA 2BYVE 1N47A 2A6VA 1W39A 2RS31 1OUSA 3ZPOA 4CDWA 5JR2A 3V0AB 1WCKA 4IESA 3I3QA 2FDJA 4BZ4A 3HNMA 3JD72 5J37A 1ZX5A 5IUQA 4HVQA 1ZBA1 3O1VA 2FMDA 2EXIA 4MGIE 4W8JA 3W5MA 5F3IA 5A1AA 3RJRA 3TOJA 4ATEA 3E6DA 5ABJB 4SLIA 1STMA 4QX2A 1ZBE2 5A3PA 5ISLA 1SLIA 2D6MA 3ZOIA 4B3NA 4FPKA 4Q4W2 1OF4A 1UPIA 5FUNA 3SH4A 4DXRA 5IVCA 2IXJA 1VMFA 1ULDA 3USUA 5A3MA 2ILMA 1WMXA 4FXKB 1WBFA 3VZKA 3CBNA 1CPMA 5KBFA 1W6OA 1ZNPA 2OT7A 3V56A 4QDRA 2BGOA 4E4DX 1AZDA 4AGVA 1IZ3A 3QH6A 4BWOA 1MEC2 5L7OC 2VCCA 2XMLA 1GR3A 1S2BA 1YC61 2BTVC 1NT0A 3IIIA 3WZ1A 4A3XA 2XHKA 4AZZA 1EAH2 3RZKA 5DUXA 2VZQA 5DPNA 4I30A 4DQAA 3IPVA 3UT0A 1GWKA 4E2QA 4JQRA 1PX3A 2K46A 5C71A 4TN7A 2R062 1LHOA 3H8OA 1QHDA 4BK5A 1UZVA 4DOUA 2R072 2P34A 3NMBA 4DEVA 2GC0A 2W5FA 3USSA 2VMIA 4EN9B 3C7GA 2HWE3 4AI1A 5K4LA 3ZFFB 1VRH1 2VH9A 1S0IA 1KS4A 4W6YA 1YQCA 2O14A 2VMGA 5FMDA 2YBKA 1F5FA 3WDWA 1V6LA 2D40A 1G7YA 1HXS1 2J1TA 1WGPA 4CPBD 4JGZB 4XIOA 3W58A 5JZGA 1EPZA 1XNCA 2WLQA 5C8CA 5GLVA 2RS13 4BM8A 1D4M3 5FV3A 4AAPA 4QX3A 1UY4A 3LPGA 5SV8A 5F37A 1RUG2 3ZIXA 1MZ5A 5IVJA 1GYKA 2PHFA 4JVAA 1HLCA 2C5DA 3IZOA 1EPWA 3EO6A 2CL2A 2HH9A 2DDUA 2I2SA 1C57A 3CZUA 4XXAA 1GNHA 4XDOA 2IXLA 1CJDA 1QJEA 1PIV2 5FR3A 3OUHA 5JPMB 3N35A 2F17A 3KCXA 5CAZA 5HCAA 5FP4A 4DY3A 2WO2A 2CWSA 3MF6A 1KDKA 2D44A 3PU8A 2Y64A 4RQPB 3I59B 5L36A 3WQ7A 3MI8A 4FPOB 1C8NA 1WD4A 4CP9B 1LHNA 2E9QA 5JOZA 2WO1A 4QPIA 3BGAA 1W0OA 3AYEA 3MUY1 1O4ZA 1EY2A 3B02A 4XMIA 2QQUA 5EHDA 1H2KA 1GNZA 3BTZA 4PLOA 1GFF2 4DRRA 5IAXA 4IV1C 4JGYA 1VBE3 4MH0E 3ZYHA 4LHSA 4P00B 4AFAA 2KM2A 3VLBB 4ZHNA 2XVLA 4K1ZA 2H0VA 3J8F1 4DIQA 1HKDA 4H3WA 3T0DA 3MIDA 1ASJ3 2W52A 2YG0A 3WF4A 4CEYC 1IGOA 3I2GA 2WT0A 1ZA7A 2AREA 2XJSA 1JU4A 1H1IA 1N3PA 1QJZA 5EJZB 2YU2A 4DPNA 2HWF1 4LE4A 3H3UA 4IGQA 2RE9A 3LZZA 4LLFA 1JTZX 1CAUA 3PUSA 4MV2A 4GIQA 2XB6C 4UBHA 4DUWA 1NLRA 4RHV2 2VQUA 3B9IA 3FLPA 3NNLA 3LKJA 1LHWA 4KH9A 4PQQA 4XPVA 3K75B 3ILFA 3J7MA 4DNYA 1OOPA 4CE8A 2W3JA 2V73A 4UAPA 1NLSA 2BZDA 5C7GA 2ID4A 5LW9A 4G3YC 5H9QA 2C26A 2WINB 2RS33 1CN1A 2PTMA 3H3LA 3HAGA 4LUKA 5DUVA 4LKEA 2KA3A 2YFUA 2ZGUA 5FPBA 3ELNA 4XBNA 4C1XA 4Y1ZA 4QQOA 5FYHA 3BKZA 3FE5A 1RGSA 1VB2A 4GALA 1B35A 2Y0IA 1IPKA 2YDEA 1FX5A 4QXHA 5FYZA 3ACHA 2JDAA 1D4VB 4PCRA 2GN7A 4ARYA 3C3VA 4CP2A 4GB31 3VHNA 1JYXA 4C0HA 1P8JA 2LUWA 2JE8A 3ZYGA 2JKXA 5ANQA 5I8TA 1CQ9A 4WVMB 2WKKA 4LK6A 1VBA2 4RS5A 2SBAA 4YVWB 2WDBA 1V9U1 1KS5A 2VZOA 4GULA 4CUAA 4JKMA 3VB9A 2P3JA 1S0BA 2A71A 5K0UB 2BOJA 2D3PA 1AR91 3LEKA 3TBDA 1G9DA 2BPA2 1H6XA 3EYPA 3H1WA 2R041 1IS6A 3H9AA 3WG1A 3QH7A 5M0TA 2W1QA 1OFNA 3AYCA 3VD3A 1DU3D 4JTOA 5JLVA 1O3TA 5FDBA 1AYM1 2PELA 1JODA 1RUJ1 3VZJA 3OYWA 2VUAA 1RITA 3M7AA 1LOAA 1POV3 5I0RA 4N43A 4RYDA 3FZ3A 3BU0A 3MPPG 3U78A 3IAPA 1QDCA 3OSDA 2JDMA 2XJRA 2XHNA 3D5OA 3D3AA 3I4IA 4MGQA 5ANNA 5FOBB 1AX1A 3U4SA 5JI9A 3FN9A 1QJX1 2ZS6B 3L2YA 1UX7A 5FZBA 2QDRA 1MS3A 4QPGC 3VHPA 5CFDB 3IWZA 5EQUA 4CU7A 1VRH3 3OPTA 2GZWA 4CEWA 4PF1A 3LA2A 4HPKB 2Q1FA 4Z2WA 1YI7A 2IFRA 2R1BA 2VNVA 2NMNA 4ASLA 1ZZ8A 4E9KA 1HXS3 3VBUA 1C28A 3ZFGC 4TLFA 1RMU2 1TNFA 1UKGA 2B45X 2VNGA 2VW2A 2W87A 3AMNA 5F5CA 3VD5A 2OPWA 2RVAA 4K40A 2VMDA 5KXBA 1REEA 1SBEA 2JX9A 2RG4A 3J7LA 3WUDA 4YARA 1L7RA 1E5RA 1UIKA 1XC6A 2VQTA 3K4DA 1AF9A 1PVC2 3GHNA 1MZ6A 3KV4A 4HFSA 1ZYBA 3ES4A 1OPMA 3V65A 5IK5A 1F8VA 2DUQA 2I07B 4CDWC 1DYOA 2DFCA 1DCSA 2CGOA 2H0BA 4FOVA 1YUDA 4M4RA 5FPUA 3AXDA 5FO7B 3SH3A 2W95A 4IEYA 1WKYA 4X8PA 1VRBA 3NNJA 2WS91 4IW3A 3BPSA 1AL21 4A41A 5L73A 5CFCB 4XCBA 1RVF1 1OLRA 1QXJA 1AYN2 4AQSA 1OH3A 4LBKA 2VXRA 4AQTA 1ENQA 1JOPA 1TMF2 1GNYA 1V00A 1FPN3 3S7IA 1O6UA 3K3OA 1RUH1 1JN2P 3NAPA 4I0WB 3ZN4A 5C9AC 3SCHA 1C3HA 1UYZA 4QM8A 4CP0A 3KQ4B 5LBCA 3WNKA 5JXIA 4KG0A 4XOGA 1COV3 1OXCA 2BJSA 3J8F3 2A1XA 2EIEA 2LRPA 4KU8A 1FXZA 1I5PA 4BYYA 5IFTA 5DQ0A 2P6CA 3VD9A 1HQWA 1JH5A 3S6PA 3WDVA 3WSOA 4C1WA 1SCSA 4WM8A 4XACA 3T08A 4BLJA 2JWPA 1TME2 4B8EA 1HRI3 1RUI2 1XQNA 2YMZA 1BBT2 4ZU4A 4XDPA 2ZKLA 1DP0A 5FZ0A 4LK7A 1RUD2
chains in the Genus database with same CATH topology
3TN92 1SFNA 4P5HA 5DDJ2 4ES9A 5J36A 2XBO1 2B39A 1Y43B 2OZ6A 2R32A 2RMU3 5A33A 4JDOA 1Q8OA 4QQ2A 4PDWA 3E5XA 4CDUB 1R082 3MFCA 2W39A 4E2SA 3HMYA 1HRV2 1L3JA 3RJ2X 3UKTA 1VBD1 4DINB 3LWCA 4AHZA 4P9XA 4QQHA 2A6WA 2D5HA 5JZGC 5C8CC 3U11A 1XNKA 2ERFA 4BPZA 2XL9A 1DQ6A 2VW1A 3JQXA 1UN1A 2BBVA 1DQ4A 1UPSA 5F6KA 4Q0PA 2HYKA 1V9U3 2H6CA 4DS0A 1HIXA 2D6NA 2A6YA 3NKTA 1ZRFA 3AZYA 2Q30A 1G9AA 2ET1A 1LEMA 3LA3A 5EXOA 1FI2A 4FPGA 4LO7A 4EV0A 3ZYRA 4A2UA 2O8OA 3T1MA 3BOWA 3N36A 4HETA 3NKGA 4XJ9A 5KXEA 1C8M3 1AX0A 3AP6A 4K21A 4Y22B 4QPIC 4KGQA 4NOTA 3MEPA 1CAVB 1RUF1 4IEPA 4JGYC 4GXLA 2ZX0A 1PZ9A 3FBMA 1H4GA 2RS52 4PIZA 3OJBA 5AVAA 2JG9A 1W2UA 1RUE1 1UU6A 3VDDC 4CDQA 5EYYA 3RI9A 2ETEA 2WNUA 3U10A 4PQ9A 2O8QA 2VOKA 3AB0A 2Q4SA 3ZYJB 2VG9A 4QPGB 2HWB3 1AR62 1QU0A 2DTYA 2ZBJA 2ZX4A 5DG1A 2AENA 2YZ4A 4QM9A 1OOPC 1AR83 1ZZ9A 4W6XA 1GQGA 4IV3C 2EXHA 1I9RA 2IXKA 4K9SA 4GWNA 4META 4LT5A 1ZM1A 3LSDA 3R4UA 4Y1UA 4M3CE 3RNSA 5L19A 2GMEA 3C2UA 1Q3EA 4FPFA 1B35C 2WS93 4HANA 4QGLA 1AL23 5FPZA 2WNVB 4UW3A 4CEYB 5ACA2 3J4UH 2DU0A 4UW6A 3WV6A 1PZ8A 4QMAA 1H1MA 3FC0A 4GH4B 4UW4A 1RUH3 1V6KA 2W68A 4RS5C 4AI2A 1K5MB 1KFXL 4OZXA 4HVRA 3VBFA 1Q8QA 2GSYA 4L9BA 2QZ2A 5FLJA 5T52A 2VVFA 2D5FA 1ND3C 4RD7A 1VAVA 3I54A 5C9AB 2PA7A 3S30A 4CDXB 1LOFA 4YM1A 1QJY2 1MZEA 4N43C 4YZ2A 1O3SA 3ST7A 3SITA 1RUC2 3M4FA 3FX3A 5K9YA 3VBSB 4Y26A 1R1ZA 4EN6B 1QQP3 1NYWA 4L11A 4DZGA 1RJ7A 4WV8A 3OY8A 2ZZJA 1MVEA 4H7MA 4CEWC 1EV11 4DRVA 5DZEA 2OA2A 3H8UA 1KDMA 1VBD3 3CJIA 4S2GA 3VBUC 1LOBA 3PVEA 4E4SA 2A73B 3B00A 1QY4A 2RHPA 3WVJA 3WW3A 4M3CA 1S0GA 4XFCA 3LAGA 2BWCA 1Z78A 1A78A 1OLQA 3RWNA 1ALYA 3OD0A 4LBMA 1UF2C 3ZFEC 2QQPA 2A3WA 3WXPA 1QGLA 4YGDA 3ECQA 4Q4V2 5JMCA 1WLTA 3KQRA 1WCDJ 3OF1A 4COZA 5KC6A 1GZWA 2ZGMA 2AYHA 3N7MA 1PNGA 4R9AA 1S55A 4BLIA 2MNGA 5GJ6A 4ES8A 4A7YA 4X6RB 4MGKE 2RS12 3FFZA 2JG8A 4HLTA 1JUIA 1I6XA 1U5YA 3NAPC 1YLLA 3KT1A 4AVTA 3RYPA 4COYA 2VMHA 1FMD2 2VECA 4E2GA 1H8TA 2CY6A 1RUE3 1AXKA 3PHMA 4HSLA 2ZCWA 4G9SB 4YFZA 2X5IA 2EIGA 4L92A 3OBRA 2DCZA 4YM2A 3VKOA 2FZ2A 3DN7A 4FBFA 3TRSB 2XUMA 1BXHA 2BFUS 5BXXA 4AFBA 4YZ4A 4YG3A 5SV5A 1U12A 1PO12 3KB5A 5KHHA 1H2MA 1WW7A 4BA6A 1YI9A 3VDDB 1XE8A 4LA3A 3POWA 1VBE2 5LRSA 2P2KA 1ULFA 4OUSA 1NCRB 1JBCA 2HKXA 1KJRA 1CONA 5J96B 4PDWC 4Y20A 3VL9A 3A4UA 2C9AA 3HQXA 5FQ0B 3G7DA 4LA2A 3SISA 1S0FA 5AC92 2R30A 2XKPA 3N7JA 3BPZA 1Q8SA 1WBLA 4IV3B 1LHUA 3WG3A 3NWKA 2MPFA 1IOAA 3I8TA 3ATGA 4XFBA 3ZSEA 2VQ0A 1DGRA 4Q0QA 1CAXA 4AHXA 2ET7A 3MW4A 2MEV1 1QJU3 1MS5A 1VB4A 2B7YA 2OYZA 2ZAHA 3KGZA 2RS32 1SBDA 2BWAA 4LBQB 2CYFA 2GU9A 2HWE1 1CAWA 5T5LA 1O5UA 1ZBA2 2CWMA 3PNAA 5FPXA 4GKXA 1QKQA 2Q1MA 1Q56A 2YY1A 3V0BB 2VW0A 4NO4A 4N7UA 2ZMLA 4XJZA 5JDBA 2WZR3 3KD4A 2HEVF 2B5HA 1MQTB 1D4M1 1OSGA 3R4DB 1ND3B 4WZFA 2BNMA 1S2KA 4Y1XA 1VBC3 3VBRC 4XJWA 1LOEA 5D8AB 3E5UA 1VLNA 2A5ZA 2JG9C 1DQ2A 5KHKA 1DYPA 3FBYA 4INDA 3GZAA 1J58A 1EV13 1PGW1 4CDQC 3RS6A 4YGEA 1DBNA 2WNUC 4AHYA 4F83A 2AGSA 2XJPA 3WW2A 4PLMA 3WG2A 2CGNA 1H0BA 4O9EA 4AF9A 5GKAC 4YVSB 5JSOA 4IL7A 3PVNA 3RSJA 1UX6A 1WLCA 2Y0OA 4PBOA 1Z7S3 4Q0VA 1ASJ1 5CVRA 1GLHA 3VHOA 1NA1B 1VRH2 1R093 3QOPA 3VBHA 4KNCA 4R9BA 1RUOA 3WP5A 4LBNA 1DGWA 3ZFEB 2XJQA 2NQYA 5DZFA 1HXS2 4P9IA 1CESA 1YO8A 4BIFA 1OHFA 3V64A 4AVVA 2YYOA 3B9CA 3DPRC 4GMP0 4FPYA 5BNNA 2WQZC 1O4YA 1RHI3 4R4XA 1ZZBA 3VZLA 1U0AA 4BCUA 5KHIA 1ND2A 2HWD3 5GALA 4YSFA 4QT6A 3VBFC 2OUJA 4XJ8A 1DIWA 3IIAA 4TYSA 3VBOB 5I8YA 1AUYA 5JIUA 2DFBA 1DQ1A 2QDNA 2ES3A 1WMEA 3R05A 3AP9A 2YV8A 1LOFC 4LTAA 5FMOL 2YROA 1IKQA 1AR71 4S2DA 1X8MA 4PJYA 3K51A 2SLIA 2WA3A 1U5IA 3MYXA 1MACA 4H7LA 5KXDA 3J8F2 3INAA 1IPJA 1UU5A 4F8AA 1KXGA 1HQNA 1J3RA 3THTA 3ZSLA 5BPXA 1V6MA 5F1RA 1LRHA 3NV1A 1G9BA 3CJIC 2HWF2 2BQPA 1MS1A 4HK8A 1BMV1 4I01A 1FV2A 1HV1A 3GZTB 3FMGA 2ZABA 3NW4A 2DVAA 3BOPA 1VALA 3CL1A 3MDPA 1POV1 2FHRA 2MEV3 1YWKA 4JCKA 1BYHA 1ZVFA 2VOWA 5CG9A 5TSWA 5BNPA 1LECA 1LENA 1CVNA 4FO9A 5KXCA 1XU2A 3OCPA 2PFWA 3RMXA 5JCTA 5K8SA 3O0WA 3VKFC 3O0XA 2OVUA 1SLTA 1S0DA 2G9FA 2TUNA 2ZMNA 2D7FA 5E89A 2WSUA 5JSRA 2BGCA 3CJXA 5C4WA 4FTEA 4GB32 3M2MA 3ZVXA 1VJ2A 1QH7A 4HL0A 4OUMA 2Q1ZB 3AZZA 4AEDB 1H8TC 5BV6A 1AR92 3WDXA 3IM0A 5C6CA 2R042 2X5IC 1DQ0A 2P37A 4MVTA 2I45A 2C0ZA 3JCIA 4V1PA 2RM21 3VBRB 1UL9A 1LESA 4XF9A 1AYM2 1W6PA 3ZN5A 1RUJ2 3UKNA 3DL3A 1J3PA 3EQEA 4XJUA 2R16A 2XVKA 5BNOC 4K6BA 1FPN1 1R1A1 1LU1A 3MW3A 5JPNB 1QJX2 3D82A 5LEJA 1COV1 4I2OA 2GH2A 4R52A 3D0JA 4L99A 1YNAA 1PHMA 4QHBA 4S2FA 2WA4A 4MXWB 1PK6B 1WMFA 3MIBA 1HRI1 4AEJA 4BH9A 4EWAA 2WWSA 3KCYA 2DWRA 2VNOA 3QLQA 3MIEA 5CBLA 4ONUA 2YHJA 1OA3A 2XL7A 2ZOEB 2VGDA 3ACLA 4RR3A 1NCQA 5I91A 3U4XA 2RMU1 3DPRB 3SH5A 3M70A 4XF4A 4XTMA 2UU8A 3JB8A 5FO9B 1AL22 4M0NA 1CIWA 4M01A 1RVF2 2VULA 5H9SA 1AR73 2PLV3 3KLSA 4TWTA 4AFCA 2NM1A 2G9GA 3ZXKA 3PVBB 3KCCA 5A32B 5GLZA 2ZPXA 3WW1A 4XJAA 1W6MB 1EYBA 3ZMOA 1MVQA 5JAXA 1BEV1 3POYA 5GLUA 2UYAA 1CPNA 2ZGTA 4FOYA 1LGNA 1LULA 1W6QA 2K2SA 3WHUA 3WQ0A 3J26N 3WQ1A 1W6NA 1HQLA 1C8M1 5GZGA 1SACA 2MHFA 3ZXAC 1X33A 2PN5A 1X7NA 4HMZA 1WUVA 3OBTA 5L7OB 2JJ6A 3CJIB 4WVWA 3BCWA 2XBO2 4XHBA 5E8AA 2D3SA 5LK5A 2WQ4A 3AJZA 4OLLA 3M3QA 2K0GA 3ZYIB 2VQAA 3AKPA 4X6QB 4LHNA 1XNDA 1X8EA 2PHRA 3VBHC 1VAKA 1XYNA 2WFF3 4NVPA 4BE3A 1VBD2 4KGGA 4LO6B 5CU1A 1DQ5A 3W9AA 1PGL1 1BVP1 3JBG1 1YJLA 2D3RA 4GMP1 4TZDA 1S1AA 2R0FA 4BMEA 2HWB1 3DGTA 2PAMA 4Q0UA 2NYYA 4JV4A 3RI8A 4Z92B 4Y4YA 1AR81 3JQWA 3MLJA 1ND2C 4OHWA 4YYOA 2LM3A 1X50A 4XW3A 1DZTA 1S0JA 3RYRA 4Q8LA 4IETA 1GANA 2RM23 5IK8A 1H9PA 3IDCB 3SNMA 5F6LB 3VZMA 3O14A 1IHMA 3ALQA 1J59A 3MIFA 1RUF2 3MLKA 2EA7A 4N53A 2WLPA 3HR9A 4F7ZA 1R1A3 3I7DA 1V70A 4XXPA 3UKVA 1D0GA 1JXNA 1WW4A 2DUPA 3LOIA 4IEQA 1IKPA 1A8DA 3R4SA 1XE7A 4B4RA 5I0SA 1KRIA 1RUE2 1H9WA 3JD73 4HN0A 1Z0HA 4XTPA 4Q29A 5BNOB 2BW8A 1SCRA 1DGWX 4IV1B 3BODA 4URTA 2XJVA 2VPVA 5KHGA 1WLDA 3MIHA 3FFQA 4IEXA 1GICA 4FCAA 3V0AA 2RR11 1Q43A 3QACA 5J48A 4WVZA 1HX6A 4FOWA 1BQPA 4LHLA 1F5JA 2DUOA 5CADA 5BYNA 4LE3A 3LGRA 2R6QA 4I3GA 4YW1A 4A7KA 1QQP1 5BNPC 1C1LA 4NN0A 5ABJA 1AL0G 3WP4A 4XMAA 5HBAA 1MEC3 2DCTA 4EWDA 2DF7A 4RA0A 3M3IA 2B8MA 1EAH3 1NOVA 2K9ZA 1G8WA 3URFA 3MICA 2AZ5A 5C4WC 2E51A 1QDOA 3WUCA 3GHMA 1A6CA 3U0ZA 3HT1A 4YNIA 1SLCA 1UMZA 2OIIA 3QD6A 3NV2A 2R073 2ZKNA 4ITCA 1NQJA 2JECA 3PLQA 4R9DA 5JWPA 2PHXA 1BEV3 1RTVA 2GNBA 4YLZA 1LCLA 4K8FA 2XG3A 3ZXFA 1XXNA 5H9RA 4M0HA 4FAGA 2GC3A 2R49A 1ZREA 3FHIB 1EP0A 4K1YA 1SDWA 3AP4A 4B4PA 3ZFFA 4UBGA 1SQ4A 4GWMA 1QWRA 2RJKA 3GALA 3NO8A 4L97A 4FQ4A 4LO5B 4OULA 2PYTA 3ZN6B 4D94A 1OMIA 3CEWA 4KWLA 4JGZA 1CD3G 4K7JA 1PIV3 2R0HA 4MGZE 3MLLA 4OFGA 1EV12 1KD7A 5H9PA 3ZX7A 5B2GB 1YFXA 2XPJA 4H55A 3LCPA 3FLTA 3JBG3 4GMP3 1LR5A 2DVBA 3E6BA 5EYXA 4YGCA 1DGLA 3I59A 4HZFA 4RQPA 4ZKTB 4RR3C 5FREA 4XF3A 3ZFGB 2NPIA 4W6WA 1OFSA 1OQEA 3SHRA 1PGSA 1PO21 3VN4A 2RJLA 3BU7A 4D69A 3CF6E 4CDWB 4RHV3 4XBQA 1RUNA 3AKQA 2ZMKA 2EALA 2TBVA 5GLVA 1O4TA 1JHNA 1QJU1 2GDFA 5I0UA 1ULEA 1IS3A 2CTVA 3AMMA 4IERA 4Q4Y1 4IEZA 5AVPA 5IK4A 3M3OA 2XWJB 3AKTA 5J7MA 4N9HA 3T2TA 3GNEA 5K7PA 1ZRDA 1LEDA 2QVSB 3USUB 4P9WA 3AP7A 4AVAA 4AG4A 1W6OB 2UWBA 2RR13 4GQ7A 4U36A 2WZR1 1B09A 2UURA 4F3JA 1G86A 3HD8B 2D97A 4FPCA 2QZ3A 4P9JA 1YRZA 3ZMNA 1J3QA 1VBA3 3QCWA 1VBC1 5J09A 1F2NA 2V09A 3WP3A 3ILRA 1IS5A 3IPVB 4LUMA 3P3NA 3BALA 1FV3A 3WDYA 4WVMA 3AXEA 4EROA 4YVWA 1BJQA 4ISQA 3ZXJA 4AVSA 1OA4A 1PNFA 5K0UA 2DU1A 1CR7A 4Z82A 1VR3A 2A6ZA 2E7TA 3APBA 3Q9OA 4NPRA 4XF0A 5T50A 3WDUA 3MW2A 4KWKA 1Z7S1 5JZGB 5C8CB 3E97A 2HWE2 2V5YA 1RB8G 3G6JB 1BCXA 4YZ1A 1UZZA 1Y7BA 1R091 5A3LA 3GZUC 1W0PA 3GYDA 4Q2FA 1J1TA 4YW2A 3RPQA 2GNMA 2UY8A 1H2NA 4ZU7A 2D6PA 5LRRA 5CFDA 1QOTA 2QKDA 1D4M2 3FWEA 4N53C 3CLPA 1RHI1 1YIPA 4HPKA 5HCBA 2P3IA 2EVXA 2JE9A 1NE4A 2HWD1 2YGMA 2NN8A