2RS33

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 37
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rs3300
1ASJ2 1Z7S2 5DDJ2 4CEYA 1AL0G 1NCQB 4GMP3 4CDQA 4N43B 1Z7S3 2IZWA 4RHV3 4CEYC 5A33B 2WS93 4CDQC 1ND3A 1AL22 1HQNA 1VBE3 4FTBA 1C8NA 2BFUS 1ND3C 2MEV3 2RS53 2HWF3 4CEWB 1RMU2 4CDUB 1ZBA2 5CFDB 4LLFA 1F8VA 3HAGA 1NCQA 3VDDB 1ZBA3 2RS31 1B35A 1AR72 1AYN1 1BBT1 1QJY3 1B35C 3JD71 2PLV1 1VBC3 1FOD3 1RUI1 1QJU3 2RS13 1FMD3 5CFDA 4Q4X2 2BBVA 1CJDA 1MQTB 1FPN3 1HXS1 5CFDC 3VBOB 3ZFEB 2R043 1BMV2 1X36A 1PGL1 4FTSA 2TBVA 1NA1B 1BEV1 1C8M2 5BNPB 3JBG3 5K0UA 1D4M3 1RUC2 4QPGB 4Q4Y1 1MEC3 4BCUA 2HWB2 5K0UC 1RUD3 1RHI1 1PO12 3ZFEA 1PVC2 1TMF1 1RVF2 3VBUB 3ZFEC 2WZR1 3ZFGA 1NCRB 4RQPA 1ZBE2 1POV3 3VBHB 5ACA3 2RM22 3ZFGC 3CJIA 4RQPC 4Q4W3 1AYM1 5JZGB 1R092 3VBFB 2BUKA 2RR13 1V9U3 3CJIC 1EV13 1R093 2RMU2 1VBD3 2HWE2 4GMP1 5BNNB 4EJRA 4YVSB 4QPIB 4CDXA 2WS91 4JGZA 1RUJ1 3ZFFC 2ZZQA 3VBHA 4CDXC 4JGZC 3VBSA 2RS51 2HWF1 1RUG1 4WM7B 1AR91 1R083 3VBFA 1OOPB 3VBSC 5BNOB 1ND2B 4AEDB 2XBO2 2HWC2 4N53B 2HWD2 4GH4A 3VBRB 2R072 1QJY1 1VBB2 1TME2 3J8F2 1PGL2 4GH4C 1EAH1 1VBC1 5L7OB 1QJU1 5C9AB 5AC93 1BEV2 4Z92B 5D8AA 1SMVA 1VRH3 2ZAHA 1QQP2 5C4WB 5D8AC 4AEDA 1NY71 1FPN1 1RUE3 3VBRA 1R1A2 1HRI2 2GSYA 2R041 1ASJ3 1QJX2 5DDJ3 1RUH2 4RR3A 4JGYB 5ABJB 1COV2 1PIV1 1AL23 1F2NA 4RR3C 1VBA1 1D4M1 5C8CB 4YVWA 5FMOS 1MEC1 1PGW1 1HRV1 4GB32 1RUD1 4YVWC 1RMU3 2WFF2 4Y5Z0 4N43A 5A33A 1NCQC 1WCDJ 1AR73 4N43C 4JGYA 2VQ0A 1POV1 4CDWB 5ACA1 1RUG2 4Q4V2 4JGYC 4Q4W1 4CEWA 5C8CA 4IV3B 4CDUA 2RR11 1IHMA 1V9U1 2R061 4CEWC 1EV11 4IV1B 4CDUC 3VDDA 1RUF2 4Q4X3 4RS5B 1AR82 1EAH2 3ZXAC 3FBMA 3VDDC 1CD3G 4PDWB 3NAPB 4CDWA 1HX6A 1E57A 1VB2A 4FTEA 4CDWC 1R081 5FMOL 1AR62 1C8M3 1MQTA 1NG0A 1RUC3 3VBOA 1MQTC 2XPJA 2HWB3 3VBOC 1PO21 3TN91 1PO13 3DPRB 1PVC3 5AC91 1RVF3 1NA1A 1VBA2 1VRH1 5BNPA 1K5MB 2FZ1A 1AUYA 4NWWA 1NA1C 1ZBE3 4QPGA 1HRV2 5BNPC 4FSJA 2RM23 2RS32 4QPGC 5A32B 2QQPA 4GMP0 1AYN2 1ASJ1 1BBT2 5GKAC 3JD72 1Z7S1 2PLV2 4RHV1 5DDJ1 3VBUA 2RMU3 2HWE3 1RUI2 1BBT3 1OHFA 3VBUC 1NCRA 1VBE1 1K5MA 1AL21 1NOVA 2MEV1 1NCRC 1RB8G 3VBHC 5JZGA 2R062 2X5IB 1HXS2 5CFCB 5JZGC 1RMU1 3VBFC 1ZBA1 5BNNA 1QJZA 4YVSA 2XBO3 2HWC3 4QPIA 5BNNC 2HWD3 1AR71 2R073 1FOD1 4YVSC 3LOBA 4QPIC 1VBB3 3J8F3 1TME3 1W39A 4NWVA 5FOJB 4WM7A 3JB4C 2RS11 1FMD1 1BEV3 4Q4Y2 4WM8B 1OOPA 5BNOA 2X5IA 4WM7C 1ND2A 1RHI2 1QQP3 1OOPC 4N53A 5BNOC 4Q4X1 1TMF2 1ND2C 4AEDC 1PO22 1X33A 4CEYB 3TN92 4N53C 3VBRC 1R1A3 1TMF3 1HRI3 2WZR2 5L7OA 5C9AA 2ZTNA 1QJX3 1ND3B 2DF7A 5L7OC 5C9AC 1RUH3 1AYM2 3JBG1 5C4WA 1COV3 2GH8A 1C8M1 4RFT0 5C4WC 1RUC1 5J96B 4RHV2 2HWB1 1B35B 2WS92 4GB33 1RUJ2 1PO11 1PVC1 1VBE2 2WFF3 2FZ2A 1RUJ3 1RVF1 3IDEA 2MEV2 5ABJA 1POV0 2RS52 2HWF2 1AR92 5ABJC 1ZBE1 1RUG3 1VAKA 4Q4V3 2RM21 1AR93 5C8CC 1R091 1VBD1 1QJY2 1VBC2 4SBVA 4Y4YA 2RMU1 1FOD2 1OPOA 1H8TB 2HWE1 1QJU2 1RUF3 5LK7B 1AR83 1A6CA 1EAH3 2RS12 1FMD2 2WLPA 2WWSA 4IV3A 1NY72 1FPN2 5K0UB 4IV1A 4IV3C 1AR63 2R042 4RS5A 4IV1C 2XBO1 2HWC1 1H8TA 4PDWA 2HWD1 3NAPA 4RS5C 2R071 1H8TC 1VBB1 1TME1 3J8F1 4PDWC 3NAPC 2BFUL 1PIV2 3JBG2 3ZFGB 4RQPB 1D4M2 1PIV3 1MEC2 1VBA3 3CJIB 1PGW2 3JB8A 1RUD2 1QQP1 1RUE1 1HRV3 2RS33 1DDLA 1R1A1 2BPA2 1HRI1 1AYN3 3DPRA 3ZFFB 4CDXB 5ACA2 1QJX1 3JD73 4JGZB 2PLV3 3S6PA 3DPRC 1RUI3 4Q4W2 1RUH1 2RR12 5J98B 1COV1 1V9U2 1GFF2 3VBSB 1K5MC 1EV12 1M06G 1VBD2 1VB4A 2R063 5A32A 4GB31 4GH4B 1HXS3 3ZFFA 2WFF1 2Y26A 1R082 4Q4V1 5D8AB 5CFCA 4Q4Y3 2X5IC 5CFCC 1RHI3 3M8LA 1RUF1 4CDQB 1AR81 5AC92 1PO23 3TN93 1VRH2 1BMV1 4RR3B 2WZR3 4WM8A 1RUE2 1AYM3 4YVWB 4WM8C 1AR61
chains in the Genus database with same CATH superfamily
3HBKA 1ASJ2 1IQAA 3IT8A 2YDEA 3PTRB 2GNTA 5LK5A 3N7JA 4CEYA 1AL0G 1Q56A 4QT6A 4XACA 4D3WA 4KU8A 4XCAA 5K4LA 5JSOA 4FOYA 4N43B 5JXJA 3ZMNA 4RHV3 3B9IA 5F3GA 1SPPA 2WNUC 2CWMA 2WS93 4IEVA 4AFMA 1HLCA 4OFGA 1YJKA 1W8UA 4P9LA 5A7WA 3D0JA 2VQTA 3IMNA 3I3BA 5FYIA 4FTBA 1ND3C 2WNVC 2WZEA 3NQHA 3AP9A 2OZ6A 4IEUA 4LO6B 4ZXKA 3SXWA 4DO0A 2HWF3 4CEWB 4ASKA 1ZBA2 2YV8A 5FWJA 2DCKA 2WUHA 4LLFA 2VBPA 3NSTA 1W2TA 4W50A 2VOVA 1AJOA 2XL7A 4QD2A 2YMZA 3NV3A 3LQCA 4XTMA 1LAJA 4XMAA 1BBT1 1S0BA 1I6XA 3C7OA 3N7LA 2C9AA 1PMIA 1VBC3 1FOD3 4NHYA 2D6NA 4BIFA 3N9LA 4MLOA 3PVOA 2KA3A 3I49A 2RHPA 3ZIWA 3WINE 2RS13 2GNMA 3WG4A 1FMD3 4D6RA 1UZWA 4LNVA 1SACA 4NR1A 4YW6A 1SFNA 5CFDA 1GOHA 5IVJA 1PHMA 1CJDA 2BBVA 1W9SA 4TXWA 5EXOA 4CCMA 1XE7A 2JDHA 4E2GA 5FP3A 1ZZCA 2QQMA 3ZFEB 2VR4A 1S2EA 2Y8KA 4QX7A 2JIJA 4CP0A 2DU1A 2R6QA 2YPJA 4FTSA 1PGL1 2O0OA 4LA3A 1ZA4A 1NA1B 1VAVA 2JEMA 4OQ9A 4AEKA 5KBFA 4BH9A 5BNPB 4AE2A 3JBG3 3R4SA 4ISRA 1AF9A 1PK6B 1Q8PA 1RUC2 5FZCA 1O4YA 2XONA 4XHXA 5F32A 4AFBA 4XF3A 2ZHNA 4BCUA 5K0UC 2XDVA 4DNYA 3ACLA 4FI9A 2VVDA 2YFUA 4PLNA 5JXIA 2QQNA 2OKXA 4YZ5A 4NE9A 1JYXA 3E5QA 3ZVXA 2A73B 3FFZA 4YGDA 2WZR1 2YC4A 5T5JA 4W6WA 4RQPA 3NV1A 1LEDA 3MFAA 5A7PA 5GZCA 2RM22 2PYTA 3WF2A 2BNMA 3ZR5A 1AYM1 5I0UA 4ZONA 4EROA 3HN1A 5A6QA 2ZEWA 2DCTA 3LKJA 1XYOA 3VBFB 3VHNA 4NIGA 4RGAA 5JCTA 2PELA 3CJIC 3LB9A 2WO1A 4ASLA 3A21A 1EV13 4TTGA 3B7MA 1R093 5DQ0A 3RYRA 2D98A 2ATFA 4GMP1 3M2MA 1QJFA 2QKDA 3QBQA 1J59A 4BQWA 1Q8VA 2NMNA 2V73A 2CL2A 2IXCA 1QIQA 4BLJA 4YVSB 1MS1A 4JGZA 4ZXEA 2ZGMA 4HL0A 5FZEA 3J9SA 3JXSA 4AVAA 4CTEA 2ZPXA 2BGCA 3RS6A 1UD1A 2ZCWA 5F5QA 4QXCA 2RS51 4F8AA 2W87A 1JODA 1UWWA 3P6BA 5EHDA 2XUMA 2XJVA 4AW7A 4DEVA 4FT8A 3VBSC 3H1WA 4MGKE 3NV2A 4DEQA 2E51A 3U10A 2GC0A 1GQHA 3AFKA 5JUVA 1VBB2 3LCPA 3PMEA 4GWMA 3HT2A 4HONA 1YYNA 2BGPA 4XJWA 1BEV2 2GP3A 4V1PA 2DVGA 3SKJE 4M3CB 3HQUA 3H1MA 3IDCB 4P14A 4QKDA 5DZGA 4FP3A 4YGCA 1REEA 1UQXA 2D7FA 4HKWA 1NY71 5TSWA 2RV9A 1SLBA 4LXLA 1FPN1 3FUQA 3VBRA 1VR3A 1XNCA 1J84A 3JQWA 5LBEA 3EB7A 3THPA 3ZLIA 3ZXGA 4EQVA 5JSRA 4HOOA 1UKGA 3HPNA 4FFHA 3EYPA 1S0FA 3T2PA 4RR3A 5FQ0B 5ABJB 5DG1A 2EIEA 1ULOA 1AL23 2VNRA 3B00A 4IEWA 4LBMA 1LESA 1G9DA 1D4M1 2VOWA 3THCA 5C8CB 3ZSEA 4AHYA 2ZBJA 4Q1RA 3EMRA 5LRSA 5FZMA 4GIQA 4B29A 1RUD1 4JC1A 4B7EA 4YVWC 3U4SA 3ILRA 1GQGA 5I93A 2PN5A 3BTYA 3D0SA 2VZTA 2VTFA 2Y6LA 4Y5Z0 1F9KA 3AB0A 3FFQA 4XBLA 1SLLA 4YM2A 1AR73 3G7DA 3ACGA 3POJA 1POV1 4L11A 4TLGA 3VHPA 2X8KA 4CDWB 5ACA1 1UW8A 1J58A 3OUIA 4HZFA 3WF4A 2O8QA 2Z2SB 4H7LA 3O1PA 4IV3B 4P08A 4MO3M 2RR11 4BHPA 1IHMA 1V9U1 1ZM1A 4BXSV 4XCBA 4RGGA 3VDDA 3WW4A 1NUKA 2NZ9A 1EAH2 4RS5B 1A3KA 5JPMB 1CX1A 1CD3G 1HV1A 2CSGA 3WQ7A 1CVNA 1HKDA 1PZ7A 1GSLA 2C9KA 3NAPB 4HG6B 4QB2A 5A7NA 2P4EA 3PVNA 1OC1A 4Q27A 1E57A 1VB2A 2EF6A 2JD9A 2TEPA 3JZVA 1OFSA 4EV0A 3SQOA 4MV2A 3LEKA 5FMOL 1G9BA 3B94A 4NIAA 1OPMA 2A70A 1K42A 5FXXA 5FXZA 1KQRA 4COUA 1UU4A 1AZDA 5FO7B 3WQBA 1NG0A 1JYVA 1Y3TA 3PNAA 3I2OA 4NMIA 4X6QB 4UT5A 3VD9A 5FYBA 4B4QA 3WNKA 4XUNA 1QNWA 2AENA 3WDTA 2HWB3 4KQ7A 4XBNA 4XJ8A 1PO21 2XMLA 1CONA 5FUNA 2XJUA 1PO13 3M3EA 2Y60A 3ACFA 1EUUA 1RVF3 1SDDB 2ZGQA 3OUJA 1VRH1 4P00B 3S7IA 1K5MB 2HBTA 1F5FA 4FPHA 4XW3A 3VKNA 1HRV2 4I3PA 4JHZA 1VJ2A 3FMGA 2YU2A 3MI8A 4MHUA 1WBLA 4YW5A 3VGIA 5C3SA 4QPGC 3IIAA 3SHRA 2VUCA 1JZ2A 5A32B 2QQPA 4GMP0 4CXWA 1BBT2 1DYOA 5LRRA 4AOCA 5GKAC 1D0HA 1Z7S1 2IXHA 1Z0HA 2RMU3 4QDSA 5JR2A 1OQDA 2ZEYA 2ZKNA 4F7ZA 4BWOA 5FUIA 2DUPA 1W8NA 4LLOA 4I0AA 4NAMA 4I09A 4HBNA 3OEBA 1FV2A 1H0BA 2OS2A 4QU1A 4WBBA 3N9MA 3OBRA 4LBLA 2XVGA 2ZOEB 5J37A 3USUB 2IXKA 4TWTA 5C5TA 2X5IB 4O9EA 3MICA 5JI9A 5JZGC 1RMU1 3RZZA 3UT0A 4B4PA 3AZZA 5D21A 1MS8A 5BNNA 1QJZA 2XLAA 1OLRA 2G19A 4LE4A 2ZS6B 2FDKA 4S2GA 3LWCA 3BOPA 3KT1A 3J4UH 1W6PB 4I01A 1EPZA 1VALA 2VH9A 3IIIA 4UW5A 1O6UA 2XJQA 4HETA 4MUVA 4KWUA 4A7KA 2A1XA 3M1HA 4QQ2A 2P3JA 5FPLA 4WM7A 4JRAA 1TE1B 4Q2FA 4AI8A 4KNCA 2J22A 3PVEA 1W8HA 1RYYA 4JCKA 4BDVB 1OOPA 3D4KA 1ND2A 3KQRA 3MPBA 1LOFC 4BMBA 1BKZA 1GNHA 4N53A 5BNOC 5I0TA 1Q8SA 1W03A 1G9CA 3PUQA 1OXCA 1LECA 4CEYB 5G05L 4XJ9A 3TN92 3IB3A 4JDMA 3VBRC 4ZU7A 1TMF3 2BGOA 2AREA 2WZR2 2ZGPA 5C9AA 3KQ4B 5FYHA 1KGYA 4TN7A 1SPPB 4PLOA 1QJX3 3K3NA 1BK0A 5KHKA 1QOTA 2DF7A 4BE3A 4OMDA 4DOUA 5L7OC 3I2FA 2Q8DA 2D3RA 4CUAA 1AYM2 2A75A 4RYDA 1W8TA 3LPGA 3KLSA 3I59A 3TAYA 3SEPA 2ZKLA 4YNIA 1COV3 2VUAA 4YZ3A 2JDZA 1PM7A 3RWKX 4AFCA 1I3HA 1APNA 3AJYA 3R0RA 4RFT0 3KSCA 3A22A 1Z78A 4MOAA 5IVYA 1W6OA 5C4WC 2X53S 5T5LA 4QKBA 4LT5A 3O1UA 5DAVA 3X29B 3ZXLA 5I0SA 4AQSA 1NLRA 3N9QA 2ZMLA 3D82A 4GB33 3PUSA 3VDBA 1VBE2 1RGSA 3MIBA 5FYYA 5GZEA 1RUJ3 3IDEA 4DXRA 2MEV2 4YW4A 1LGNA 1POV0 2RS52 5KC6A 1JZ6A 3A7QA 1UF2C 1KFXL 3POSA 2BVVA 4CCEA 1GV9A 2WQ4A 4Q29A 1POQA 3PUHA 1RUG3 4Q4V3 1AR93 3LFIA 4XAAA 4A45A 1U5YA 2RDSA 5FZAA 1OF3A 4QQLA 4CSWA 3O1TA 4XILA 1LHWA 1XNTA 1JBCA 4L8QA 4B1MA 1VBD1 4M3CF 1DU3D 3H3LA 3ILFA 5A7SA 2ZACA 4P02B 2KD7A 4R9BA 3RZMA 5C6CA 4QDRA 1L7RA 3H8XA 1AR83 4L92A 4H14A 3JU9A 2PHFA 2Q1MA 3K4DA 4IL7A 4XBQA 4C91A 2B39A 1S1AA 1JTZX 1R64A 2VZUA 2WLPA 2XVLA 3GZEA 1OLQA 1NY72 1ZRFA 2VG9A 2W3JA 5EJ1B 2ORXA 2R30A 1FPN2 2YG0A 3ZX7A 5HXMA 1W3XA 2Y6JA 4NPMA 5CVRA 5EJZB 3KV5A 4KH9A 2QE3A 2VC9A 3DN7A 4IV1C 4EYUA 2ZHMA 3UNPA 1REFA 1A34A 3B93A 1UYXA 2HWD1 3MIGA 2R071 4H3WA 4MHRA 5I0DA 1WW5A 1YFUA 2QZ3A 4PDWC 5FMBA 4AEMA 3CZJA 4OUMA 1CGPA 1NE4A 3AYEA 4RQPB 1D4M2 5FJHA 1GZWA 2Z4FA 1LU1A 3LIHA 4D6SA 1QF3A 4LHKA 5T55A 2CNAA 1S0CA 3NNMA 1E5IA 3R6SA 1GZ9A 1RUD2 3NJYA 3USSA 4COYA 4A3ZA 5IK5A 1W0OA 2D6KA 5JAXA 4YYOA 4Y1YA 2ZHKA 5FP8A 1XE0A 3ETPA 1R1A1 2WSUA 4PQ9A 2JICA 2CDPA 5FLIA 3QD6A 3I97A 5JIUA 1S2KA 1AYN3 2J1TA 3DPRA 4LO4B 1OQ1A 5A3NA 5ACA2 1W6NA 4C0BA 4JGZB 1CZTA 4MGZE 3KT4A 4Y22A 2PMWB 1RUH1 2YXSA 3IM0A 5HCAA 1IPKA 2JKXA 2RR12 1V9U2 4EN7B 1DGRN 4A4AA 3LD8A 3AP5A 4CZSA 1W05A 4ZS2A 3KS7A 4IUGA 1U5XA 2VW0A 2R063 1OUSA 4HXCA 1JH5A 1HXS3 4V2VA 4LK6A 3IWZA 5JIAA 3ZFFA 1Q3EA 2WFF1 3NL1A 2W91A 2R0HA 4DUXA 1BZWA 2GAUA 2PHUA 5FLJA 1KEXA 3AKQA 3ZDSA 5FP4A 4QHZA 3GXUA 2UU8A 3VB9A 3B5LB 4AI2A 1R1ZA 3ZYJB 2J1RA 4LO5B 1Q43A 1W99A 4XIKA 5CFCA 3ZN6B 2PAKA 2EIDA 4JKKA 5IK8A 2K46A 2JG8C 1HJFA 1SEFA 1PX4A 3OPTA 4CPBA 4CRQA 3V56A 3M8LA 1BHGA 3VL8A 3FZ3A 3WDVA 2NP0A 1KFUL 1UXZA 4CDQB 1RUOA 4FCAA 1H1MA 1VRH2 5FPBA 4AEJA 4RR3B 4IGQA 4Z82A 1N1TA 4FQZA 1RUE2 1JHJA 4FFFA 5E88A 2BV4A 3MUZ1 4OLLA 4BYYA 1S0EA 1G9AA 4XIOA 3K48A 3DECA 3I4IA 5A1AA 1W90A 1XQNA 3L2HA 1Z7S2 1WMXA 2ADDA 4IERA 5FR3A 1NCQB 4HMZA 1EPWA 1N1VA 3SNMA 2WNUA 2W1WA 5IVEA 3C8XA 3H8UA 1JXNA 3LFMA 1ST8A 5E6HA 1ZX5A 3OPZA 4YZ1A 5FYUA 2AUYA 2VBBA 3K77A 2J42A 1ND3A 2WNVA 4KBBA 4LULA 3GCXA 2O1QA 2XQRA 5AVPA 1XOYA 4CCJA 3ATGA 3ACHA 3VDCA 2BFUS 5JPNB 3NVCA 5FP7A 2VOXA 4LBNA 2IFRA 3MW4A 1HIXA 1RMU2 3ALQA 4LKEA 2Z5WA 5DAWA 4QX8A 5IVBA 4FO9A 3O1OA 1MS9A 3F2ZA 4NRQA 4XTPA 1OA2A 2F17A 2ZGSA 5F5AA 3VDDB 1ZBA3 3M3CA 3BIEA 1JYCA 3L9JT 4GA9A 1QJY3 1CZSA 1WMEA 1B35C 1QXRA 3JD71 2UYBA 1P8JA 4XVHA 4IEQA 3N9NA 1RUI1 1QJU3 2WJSA 4HSLA 1D2SA 4BK5A 3J7NA 1J83A 2NM1A 3TEXA 1XE8A 1UNBA 5CG8A 2ARCA 2WFPA 5BV6A 2EXIA 1URXA 3AKSA 5A3WA 1A8DA 3DKWA 1H2MA 3KD4A 5F2SA 4YM1A 3RDIA 4XQ4A 3K2OA 1WD4A 5A1FA 4AAXA 1EY2A 1XNKA 3VZNA 1UMHA 5DPNA 3WLUA 3TNPB 2E26A 2R043 2WR9A 4QKNA 4M0HA 1W2UA 2W1SA 1X36A 3AZVA 1IGOA 3DYOA 4DY3A 1VLNA 5A3MA 3HEIA 2HYKA 5C70A 1JYNA 2PHXA 4QXBA 2BYVE 4B7KA 4OHZA 1BEV1 2BP6A 5I8YA 5L19A 1XNAA 5K0UA 1ZRIA 2VUJA 2Y6HA 3U37A 1O5LA 3N35A 3SEEA 1KXGA 4Y24A 1WLDA 5L9RA 1MEC3 5F6LB 3TEZA 2W39A 3HMYA 4W6YA 2WWUA 4U2AA 2OQ6A 1DQ1A 1MZFA 1QWRA 3EBRA 2P2KA 3RMXA 2JDMA 4RA0A 5C33A 2QQOA 1IS6A 5GM0A 3ZFEC 3RWNA 2Y6GA 4DIQA 3KWVA 3RJ2X 5FCCA 5FBJA 4CU7A 4KG8A 4XF9A 2XLGA 2JG9C 3POFA 3VBHB 1XB9A 2WO2A 4BQ2A 2VNOA 5D1IA 1US2A 3SCFA 3VKOA 3ZFGC 3CJIA 3ZIXA 4Q4W3 4TLFA 5EZWA 3VZOA 4XF1A 3WG2A 1DYPA 5FZIA 4FPJA 2BWCA 2C0ZA 5FTTC 3RZKA 2YZ4A 3AP7A 4NIDA 2R49A 3GBWA 2DVAA 5FZ9A 5BNNB 2ZEXA 4L9BA 3BUCA 3ZXKA 5KXEA 4QMAA 3ZR6A 1OMIA 2WS91 3LPFA 1OQEA 3AL6A 4Y1ZA 3ZFFC 2ZZQA 1LHNA 1ULFA 1CQ9A 1UOJA 3HVDA 5DUXA 4LR4A 3GGLA 3ETQA 2VZOA 5K9YA 3VBSA 3IAQA 2HWF1 3BOWA 3OF1A 4WM7B 1W9FA 2VE1A 4XHBA 1V6KA 3WNOA 2DVFA 1VE0A 5LCWL 1OOPB 4LQRA 5E16A 2CGPA 1RIRA 3PL0A 1ND2B 3ST7A 1DZRA 3KCCA 4K3UA 4BQXA 3AXEA 4N53B 3QH6A 2HWD2 2XJTA 3O1RA 3ZYIB 2R072 2PHTA 2QQUA 3LIGA 1UIKA 4H55A 2GZWA 1DP0A 1QMJA 1ZNPA 4KL1A 4Z07A 5JXHA 4GH4C 1EAH1 1OBNA 1V0AA 1VBC1 4OI1A 4DXZA 4XJZA 2HBUA 2UURA 5J48A 4LKDA 5C9AB 2JB8A 1NXD1 2EVXA 2GC1A 2GC2A 4DUWA 1GANA 3IDAA 3ZKYA 3BTXA 1SMVA 2ZAHA 2VCBA 3I59B 4LBQA 5D8AC 4IEZA 4AEDA 1O5UA 3A0KA 3WP5A 5LASA 1W6OB 1R1A2 2GSYA 3BTZA 2WQ8A 1U5IA 4NAOA 5DDJ3 1DYKA 3H42B 1TZOA 4OYUA 4YGEA 3T2OA 3LF7A 1RUH2 4COVA 1MS5A 4JGYB 1ODNA 1Y9GA 3M70A 2OA2A 1F2NA 2QZ2A 3HNBM 3T30A 2D5HA 4YVWA 3K4AA 2TNFA 1HRV1 5FIXA 5FK8A 5FXWA 2GMPA 4XF4A 4CU9A 5I91A 2WFF2 4L2NA 2Y33A 2JB4A 4PIYA 4DS0A 1HN0A 4GJZA 2I45A 3A23A 3POBA 4JTOA 1FAYA 4HKOA 1UN1A 2ZX2A 1KRIA 1GWMA 4LJHA 3DYMA 1NLQA 3MV01 4I02A 2QVSB 4JAAA 1W9YA 2ZGOA 1VMJA 2IXIA 2E53A 1DLCA 1O3SA 2HEVF 3O1VA 2B9VA 3PJQA 1OI6A 1EV11 4WZCA 4CDUC 4AGRA 3GBFA 3B02A 4AHWA 4Q4X3 2K2SA 4A6OA 3KV9A 2FDHA 4W8JA 4FVVA 4OHXA 3VHOA 3URFA 4XFFA 5FPZA 1U5ZA 4UOJA 1V00A 1W28A 2YU1A 2KXLA 4LOSA 4PLMA 4X6RB 3P5BA 1XXNA 1YQ5A 2VBDA 4CDWC 3WR0A 1QY4A 5EYXA 2SLIA 3UGFA 1JOPA 2XVKA 1BYHA 1V6OA 1LOCA 4E2SA 1YCIA 2BU9A 1JW6A 1C8M3 2OX0A 3SITA 4OI2A 1JZ5A 3VV1A 3VZMA 5CISA 2WAOA 3RI9A 3LZZA 1MQTC 4U36A 4XC9A 2XPJA 4K9SA 3POWA 2GNBA 3VBOC 4MH0E 1C5IA 2BNOA 4YGBA 3TN91 3DPRB 1PVC3 1XRUA 3LGRA 5LBFA 3T09A 3CO2A 1IQDC 1VBA2 1NLSA 3QOPA 4Y22B 1S0GA 5A7QA 1V6LA 2RG4A 1VIWB 1AUYA 4PJYA 5LA9A 1ZBE3 4QPGA 5CA6A 4A7YA 3WUCA 4ZZ5A 1ZRCA 4Q0UA 3WD5A 3IKWA 1KS5A 3N9PA 3GJAA 3U07A 5A1LA 2MPFA 3KGLA 5APAA 1LGBA 3GJBA 1W9WA 3P1IA 4YG6A 1O3TA 3WCRA 3JD72 4NPRA 3I2DA 1QGLA 2OZJA 2HWE3 1RUI2 5IUQA 5IVVA 1BBT3 1LOAA 3D8CA 4QX3A 5EPAA 3VBUC 4AVTA 1VBE1 4UAPA 3WDUA 1ENRA 1AL21 2VECA 2MEV1 3LEMA 1H6XA 4YZ4A 3RZGA 1NCRC 4YW3A 3ZXDA 2OT7A 4H2AA 4DUVA 3WG1A 1Q8QA 3KT7A 5JZGA 3VD5A 1JUIA 3OD4A 4PBPA 3RSJA 3GM8A 1CAXA 2D97A 5CFCB 3N36A 4AFDA 4L97A 2AEZA 4FPEA 3LEGA 2QBXA 2YBKA 3DKQA 4Y1VA 4K1YA 2XBO3 2HWC3 4BPZA 2D6LX 2YFZA 1LGCA 1UPSA 1AR71 1YEWA 5F1RA 1GLHA 3MYXA 5GALA 5L9BA 3LOBA 4BZ4A 4QPIC 2R32A 3J8F3 1TME3 2IXLA 3NNFA 4GJYA 1UYPA 1W39A 2FCTA 2LROA 2O14A 4LKSA 4NWVA 3VDAA 3CEWA 5FBZA 4PIXA 4BA6A 4R52A 1LKNA 1F15A 1BCXA 1I5ZA 3KHBA 3IZOA 4RSUA 1LOFA 5JI7A 5BNOA 1WCUA 4G3YC 1ZZ6A 1TQ5A 3FHIB 1QQP3 4MVTA 3MBWA 3RMYA 1I5PA 4AEDC 4O9GA 3BU7A 4QWNA 4JDOA 2C26A 2PHRA 2WNUB 4Q5OA 1H9WA 1JOJA 1HRI3 2WQZC 5L7OA 1OSGA 2ZTNA 1ND3B 2B8MA 2WNVB 1UU5A 4DINB 1HB3A 2BERA 2BOIA 2DUOA 1GBGA 4CA9A 2Y64A 1H2KA 4RL7A 4QHBA 5C4WA 3C7EA 3WW3A 4F83A 4NOTA 4OHWA 2CYFA 1XYPA 1H9PA 5FMDA 2J1SA 4JKMA 3QLQA 4OZXA 4DMIA 5FZ0A 4RHV2 5FP9A 4JHTA 1CX4A 1QDOA 2HWB1 4HKLA 3W20A 2Y34A 4MZUA 2WS92 4FOQA 2DCZA 1QU0A 3RZHA 2VVEA 1IKPA 1PO11 4AVSA 1PNGA 3THDA 4UFIA 1L7LA 1BXHA 2A7AA 4BM8A 1RVF1 2PHLA 1LCLA 1XSRA 1W2OA 4P5YA 1QH7A 1FNYA 2WZPP 3ZPYA 5CAZA 2HWF2 4XUOA 1O59A 1IKQA 3I3DA 4P9GA 1VAKA 5GLVA 1NZCA 4MYEA 4CP9A 3POEA 2WIIB 4FP2A 3HT1A 4XOGA 5CEHA 2D40A 2N7GA 5LATA 5DZFA 1GP5A 3ITQA 4AVVA 2QFEA 3K4ZA 1VBC2 3MPPG 2RMU1 1FOD2 5T3NA 1H8TB 4E9KA 5T50A 1RUF3 1QNYA 2R16A 2DYCA 3MDPA 5CYYA 4AI9A 1A6CA 1K3IA 4IE5A 3CL1A 5KHIA 5HV0A 2NMOA 2QNKA 3CLPA 1W9TA 1WGPA 2RS12 1FMD2 2W1QA 2Y38A 5KHGA 1WCSA 1TNFA 2XUEA 2BDRA 4FXGB 4OULA 4YZ2A 1HB4A 5K0UB 1LJ7A 3T1MA 3MIFA 1GP4A 1SBDA 4IV1A 3CU7A 5A3OA 4FPYA 3LAGA 2G4IA 1AR63 4XURA 1Y9MA 2A71A 2ZX0A 1W2AX 3U4XA 3I3QA 2I07B 4RN5A 1PGSA 2W52A 5EV7A 1MZ5A 4PDWA 5GZFA 2W92A 3LOIA 1BQPA 1HQLA 3C3VA 5FKBA 5DUWA 5B4NA 4IE4A 4OUEA 5FXVA 3ZSKA 2BFUL 3AP6A 3JBG2 4X8PA 5FZ6A 1CESA 1BVP1 2PHWA 3ASIA 1N1YA 1W0PA 2W94A 3BN6A 2CGNA 1LEMA 3CJIB 5A7OA 4AXOA 1IPSA 1CAWA 1RITA 3NNGA 4B1LA 1RUE1 2ZX3A 1XSQA 4XABA 5FREA 3EXUA 4BQYA 3LEIA 3HR9A 1NXMA 4HN1A 4LA2A 3B01A 2VXRA 3OGSA 1XJAA 2RS33 1MZ6A 3ZYRA 4A6SA 1GNYA 3OYWA 3ORJA 4FAGA 5JXGA 5IFPA 5F9TA 1DDLA 1G6NA 2Y0OA 3MW3A 4ZY9A 2JDUA 1QJX1 2BNNA 2PLV3 3S6PA 1HDKA 1DGWA 1K12A 4NHKA 2R1DA 5ERLA 4KWLA 1VRBA 4OZOA 2VNVA 3POYA 3ZM8A 1YQ8A 1COV1 3APBA 3HQXA 3IN9A 4ORFA 4QM9A 3VBSB 1EV12 5DN2A 4UWDA 3ZSJA 4OI4A 5FY0A 2JDPA 4QAWA 3N4MA 3ZXFA 3M4FA 4HT1T 3GZUC 2AYHA 4GB31 4KGGA 1UKRA 3T0BA 1DGWX 3O0VA 4D7TA 3FX3A 1UY0A 5A6ZA 1X8EA 1SLAA 1EUTA 3ACIA 3BVCA 2WBKA 2W08A 5I8TA 3WNPA 5K7PA 1V6NA 2EALA 3ME2A 2LS6A 2WYFA 1W06A 1ULPA 2VCAA 2GMMA 1PNFA 1FYUA 3V65A 2ZABA 1V6JA 2A6ZA 3DGTA 4Q4V1 3WEZA 4LBQB 2JG8A 2Y6FA 3AYCA 3EJKA 4FFGA 4Q4Y3 4AG4A 1E5HA 1GNZA 2EXKA 5IW0A 3OCPA 4XETA 4CCNA 1F35A 4E4ZA 2H0VA 1RHI3 4LORA 4WVWA 2IFWA 5I0RA 1O4TA 4TYSA 1AR81 2HH9A 1PO23 1CWPA 2A3YA 2GN7A 2YBSA 5B2GB 3K75B 4AVCA 5A7WB 1MVEA 1XNBA 3FWEA 3WP4A 3THTA 5FY4A 3W5NA 4CU6A 5IATA 3CDZB 4PF1A 4A41A 5IYYA 3DV8A 4YVWB 4WM8C 3PUAA 4HVRA 5FZOA 3WV6A 1W8FA 5IFTA 1N1SA 3RZJA 1FX5A 4HVQA 5A3TA 1TNRA 2Q1ZB 3B3QE 1Z7S3 2IZWA 3TWIA 3LDRA 4MGIE 3WHTA 3UJQA 2HEWF 4KGQA 3ES1A 4CDQC 4Y3OA 5DAPA 1AL22 1HQNA 4CE8A 5FAXA 3RNSA 4CXXA 4NIHA 2P37A 3DXTA 4INDA 3MLJA 1O4ZA 3KVAA 3EHKA 2VJXA 2WNOA 4Q0QA 1X8MA 2UY9A 3NJVA 4CCKA 1DLLA 2Q8OA 5CFDB 1F8VA 1K5JA 3T2TA 1NKGA 1B35A 5FZ3A 4PHZA 1AR72 3E6CC 5C3OA 3AFGA 3HJRA 1AYN1 1JZ7A 4GKXA 3UESA 3WQ1A 3FN9A 2ZJCA 4W4ZA 1LB2A 4MX3A 4FPLA 2ENRA 4QX2A 2GALA 1NQJA 2D6MA 1UU6A 1QOSA 4IGPA 3OGGA 2LW8A 2XOMA 1FT9A 3WZ1A 4Z2WA 2Q8EA 4IESA 1SDWA 1AVBA 4CCDA 3Q8EA 3OGRA 3DCQA 2ZGKA 3PDQA 4UBGA 1LOBA 1ZVFA 3TBDA 1HXS1 2VVFA 5JMCA 3R05A 2ZGNA 2CV6A 1ZZ7A 3I2IA 4LHNA 1IG0A 4PQQA 4JDNA 2B9UA 2VW2A 1BMV2 3H8RA 1X9TA 3CHXA 4QX0A 4NUBA 4E4HA 3PU8A 5IHRA 5CG9A 3WNLA 4LTAA 4J25A 3UL2A 3NRUA 2TBVA 2W5FA 2E32A 3GF6A 2WN2A 3GYDA 4ZS3A 5DG2A 3RYKA 1TEIA 3IAPA 1GWKA 4QPGB 1L7QA 2ZX1A 1YO8A 2P3KA 4EWAA 1OURA 2HWB2 4GQ7A 3AP4A 3LA7A 4B8EA 5LB6A 2Q4SA 4DXTA 1PO12 3ZFEA 5FJKA 2W68A 2ZGUA 5DUUA 3S7EA 3H50A 4FQ4A 4XFAA 3Q9OA 1RVF2 3H7YA 1TVGA 2B42B 2JG9A 3GBGA 4PI2A 4IEPA 2XL9A 1OT5A 3ZFGA 2CWSA 3VLBB 1O7FA 1H6YA 2FCUA 2ORZA 3WF3A 1HN1A 4OCTA 1WZXA 2WC2A 1PMHX 5A3UA 5JZGB 1DFQA 2VM9A 3FL7A 4PI0A 2BUKA 3ZYGA 3ES4A 3J7LA 2HYXA 1CAXB 4COWA 5FY5A 2RMU2 1VBD3 3MEPA 4EJRA 1ZA7A 2AGSA 4JTNA 1GICA 2Y6KA 4EWEA 4D7YA 1SLIA 5HI0A 1KJLA 2BRTA 4A3XA 2W0XA 2VGDA 1GZTA 2UWCA 1WW4A 3BCWA 2D43A 3NJZA 3V64A 3VZKA 4CDXC 1JU4A 5SV8A 5BXXA 1ULGA 3AKPA 1WMDA 2L9LA 3ZPOA 1CIYA 1R083 3VBFA 3WG3A 3OG2A 3FC0A 3N7KA 3IDBB 5BNOB 1SCRA 2XH6A 3ECQA 5FV3A 4EN8B 4GH4A 4YG0A 3VBRB 3NJXA 1UX7A 1QJY1 4DFSA 4URTA 4UFHA 1F31A 1W6QA 3BIWE 4QQPA 1DZTA 1CPNA 1QJU1 3U1XA 2WO3A 1YFWA 4LITA 5L7OB 2LM3A 1DGLA 2QDRA 5AC93 2QUOA 1CR7A 1ENQA 1GP6A 2DBIA 3ELNA 4N90A 5L9VA 4Z92B 1HB1A 1N3OA 4LUMA 5D8AA 5DAXA 2C5DA 2YHJA 2VZVA 3Q8BA 5C4WB 2Z79A 4QU2A 4Y5SA 5FY7A 1DQ4A 4KMQA 2ZGRA 5T54A 1W3VA 2ID4A 3SLIA 4AQ2A 3TEWA 1WMFA 3ILNA 2WNEA 1UYYA 2XJPA 1IZ3A 1DQ5A 1OH4A 1Y7BA 1OF4A 2R041 1ASJ3 1STMA 2WN3A 5CIRA 1ACCA 1GKBA 1QJX2 2LTNA 4EN6B 2VO5A 1JMUB 2QJVA 3FLRA 2V5DA 4W6XA 3KF5A 3WNMA 3TB0A 2K9ZA 2ZX4A 4FPKA 1BJQA 4N9IA 5JWPA 2FDFA 3K46A 2YC2A 5FK7A 1OVSA 1COV2 1OKOA 1S4CA 2YC0A 3CJXA 3B9CA 3ZYPA 1LR5A 1D2QA 1PIV1 4UW4A 1GZCA 3T4VA 1YQ2A 1VBA1 4GKYA 3OGJA 2DURA 3TYJA 1GQPA 5FMOS 5F3IA 1MEC1 4BB3A 4ONUA 4CP9B 3I3EA 3E6BA 3BALA 1PGW1 4CUBA 4K6BA 4GB32 3WOGA 4LBKA 4N7UA 1OD3A 2PQQA 4TSVA 3WT3A 1YFYA 2J1UA 5A33A 4AHXA 1UL9A 4CU8A 4MXWA 1WCDJ 1WWYA 2WDBA 3AKRA 1OLME 1SQ4A 4N43C 3U75A 3NO8A 3WHUA 2GU9A 2VQ0A 1RUG2 5FYSA 1OKQA 3NKTA 4GWIA 4Q4V2 4JGYC 5GJ6A 4E8DA 3CMGA 4Q4W1 2D3PA 5BUVA 5C8CA 4CDUA 3E5UA 2I2SA 3EO6A 1NZIA 1WLCA 4CEWC 2Q8CA 4IV1B 2FDGA 3OD0A 3U11A 4BQ5A 4IDZA 3U78A 1T2XA 3CNAA 3ZXAC 1AR82 3AMHA 5C3RA 3FBMA 5G04L 5FPUA 1PX3A 5A3LA 3FLTA 4PDWB 3DYPA 1AXKA 4CDWA 1U0AA 2HJIA 5FZLA 1HX6A 2DFCA 1SLCA 1C3HA 3E1F1 3PU3A 5F5IA 5GLZA 2Q30A 2AC1A 2D6PA 2WO7A 4Q0PA 5L36A 1GU3A 1B09A 5FZ4A 4D0QA 5F3EA 4FXKB 3BGAA 3QACA 3MO4A 1CAWB 1MQTA 1CIWA 4Q26A 3NNJA 5DABA 2B5HA 2B4KA 1RUC3 3VBOA 1GOFA 4NJ4A 4QPYA 4GAZA 2ETEA 5ANQA 2E9QA 4K7JA 5LZ6A 4P9XA 4NVPA 1GR3A 5FZHA 5JOXA 3EQEA 2UY8A 3OYWB 2FQPA 4COZA 4KWKA 4D7SA 1D0GA 1YWKA 1CAVA 4ISQA 5FUPA 4DQAA 1AJKA 5KXCA 3P3NA 3KVBA 4P9JA 3KHCA 3N7MA 3AYDA 3AL5A 1LNSA 4LKFA 2A6XA 2FZ1A 3JCIA 4AI3A 3RRDA 4CYDA 1NA1C 4Y33A 2YGMA 2VPVA 3O1SA 5BNPC 5EP9A 2XGXA 2RM23 1PK6C 4AI1A 4QHOA 1XPWA 3T0DA 3AZXA 2RDQA 3O7OA 5EJ3A 4WVMA 1AYN2 2QQWA 5ANNA 1UOFA 1KS4A 5DDJ1 1S0IA 4I0BA 4PF5A 4RHV1 3VBUA 4B4RA 2DBNA 4YM3A 1JZ3A 5HCHA 4MG2A 1U12A 4HPKA 4IEYA 1QXJA 2JX9A 3HQRA 3HD8B 1NCRA 4HSJA 1UYZA 3NMBA 3GHNA 1XC6A 2YPDA 1ALYA 1K5MA 1NOVA 1J3RA 3HN3A 3ZOIA 2R062 2XWBB 1ZZ9A 5FPAA 2JE7A 2RJ2A 3WDYA 3BPSA 3ZMOA 4Z8BA 5CKMA 1FXZA 1HXS2 2A6YA 1DBNA 2JG8B 1LHOA 4Y1UA 4XXAA 5FWEA 3VBFC 3CF6E 3GZTB 3WW2A 4CPBD 2IVJA 3T2QA 4XFBA 2AR6A 1PZ9A 2ZHLA 4IQPA 4QPIA 4K8RB 1LOGA 4BQ1A 3WP3A 3SMHA 5KHJA 3T08A 1FOD1 2ES3A 4YVSC 1VBB3 5HCBA 2ILMA 3KCXA 5FYZA 2PFWA 3MF6A 2C24A 2RDNA 1AX1A 3WXPA 5FOJB 2RS11 1J3PA 1NX9A 1WLWA 4UYBA 2IWGB 1FMD1 1BEV3 4MGTA 1K45A 2VMFA 2DTYA 1H4HA 2QDNA 2X5IA 5LEKA 2I74A 4XPVA 3OBZA 3VD7A 3SH3A 2OIIA 3KMHA 4OHVA 4Q4X1 5FZOB 5A80A 3SCGA 3HIFA 1JOBA 4S2HA 1ULDA 1QKQA 5DUVA 3T4HB 4LHSA 1I1EA 3AZWA 5GLWA 1UOGA 4E27A 2EXJA 1C28A 4C1XA 2P34A 4PBOA 5JSPA 1D4VB 1E5SA 3WX5A 3FJSA 3JBG1 1Y4WA 2FDIA 5CKNA 3MIHA 2AZ5A 2GH8A 3D5OA 2F4LA 1C8M1 3ZXJA 3DF0A 4Q0SA 1HJGA 4IW3A 1LULA 2WL1A 3PVBB 2VTXA 4RFRB 2WZ8A 4DXSA 4CP1A 4W65A 1ZYBA 2DVDA 4WVZA 1JUHA 1B35B 3J7MA 2BVBA 2VW1A 4IETA 4NRPA 4AGGA 2VCCA 1PVC1 2FZ2A 3AJZA 4P9YA 2LALA 4L0PA 5C3PA 1UCXA 1UPIA 3H1YA 3LSEA 4L99A 5J36A 2VUDA 1ONAA 5ABJC 3WF0A 3HWJA 3S30A 5FPXA 1ZBE1 2BQPA 1NT0A 4JKLA 4QDQA 4META 5FLHA 4C8DA 4ZU4A 5C8CC 1R091 3A4UA 3HNMA 2XKPA 4D69A 1QJY2 4BISA 3NNLA 4IEXA 4FOVA 5AVAA 4IGOA 1J1LA 2HWE1 1OPOA 1OA4A 4ITCA 1QJU2 2C1FA 4XDPA 4I0WB 4MADA 3ROUA 1EAH3 1ENXA 4IEOA 5CKQA 3ZXEA 1CJPA 2FBEA 3AZYA 4Z1VA 4I2OA 1DQ2A 1RUNA 2B7YA 3OUHA 2WWSA 1NE6A 1Q5OA 1GZWB 5FZGA 3W59A 1JYIA 2A6VA 2VMDA 2GNDA 3Q8FA 5A6XA 2FMDA 5F7UA 1IG3A 4IV3C 5FYVA 2R042 4JRLA 4KI5M 4QKFA 3MIDA 4YLZA 2GC3A 2XBO1 2HWC1 4V2WA 5AFBA 4DY5A 3ZYFA 1BVVA 3MIEA 4RS5C 5CZKA 3TNQA 4S2FA 4XZPA 1O3QA 2JENA 1H8TC 3J8F1 1TME1 4NHLA 4NPLA 2JG9B 2PQSA 3NAPC 1W6NB 5H9SA 2DV9A 1PIV2 3NW4A 5H9QA 1SFYA 4FFIA 2NN8A 3FHAA 5HPOA 3ZFGB 4F3JA 5IVFA 4HK9A 1JN2P 3TRSB 2V4VA 4QX1A 1JU3A 4AZZA 3PIJA 2D5FA 2DVBA 1MEC2 3P3PA 3MW2A 3CKHA 1PGW2 1XU1A 4AQTA 2JECA 2EAKA 5BNQA 2VZSA 1QQP1 5T52A 1MZEA 3O1MA 3VZLA 1AX2A 1RL3A 1HRV3 4XMIA 5FYMA 4FAHA 5J3UA 2J1AA 4EN9B 5BPXA 5KXBA 4N8MA 5JMOA 3D6EA 4DPNA 4OQ8A 3AMPA 4XJAA 1V6MA 1HRI1 1DG6A 2VMHA 5F5CA 3ZFFB 1VP6A 3ENRA 3OJBA 4YPJA 3WF1A 2CTVA 3OBTA 4Q4W2 1CAUA 3ZSLA 2P17A 2IVIB 1O8PA 1RXFA 5J98B 4AFAA 3J26N 1K5MC 2GMEA 1X82A 2XB6C 3IPVA 4YW7A 3W5MA 3NV4A 4XDOA 3RPQA 4FPFA 5IVCA 1LRHA 1VB4A 5CB7A 3UV9A 4N7IA 2QCSB 2W47A 3RG0A 1JYTA 4GH4B 2ZXQA 1S0JA 1GUIA 2WYSA 4YM0A 4ES9A 1LU2A 2Y26A 2BW8A 4FPGA 1JHNA 1W6QB 2FD8A 4Q1PA 4YW1A 5C8WA 3MFCA 3AXDA 4BOWA 1DIWA 5IWFA 1S55A 4UFMA 4K21A 4G9SB 1ZZBA 4LBQD 4DRVA 4J1WA 2YROA 4AVBA 5D8AB 1HQWA 1JI6A 2RDRA 5FO8B 3I2JA 2D3SA 3ABZA 1MPXA 1SBFA 2BWAA 2MHFA 2RVAA 2ERFA 2Z69A 4QQHA 1DZQA 3WP6A 4NO4A 4G4FA 4N9HA 2X5IC 3CZUA 1RTVA 2YB7A 2GP5A 4IE0A 1RUF1 5E8AA 4R9CA 3V0BA 3C2UA 5FY8A 3TN93 3LA2A 1BMV1 3AM2A 1ZRRA 3MHZA 1T6BX 2WZR3 2X10A 3LDBA 4GALA 4JVAA 2EICA 2H6BA 3OGVA 4AK3A 1AX0A 2YYOA 2O8OA 1QDCA 4WM8A 5EWSA 4K20A 4QB1A 2NLRA 2QQVA 3PUIA 4KBZA 1AYM3 3ZN6A 1SZBA 4GWJA 2XKOA 4XUPA 2WT0A 3WCSA 1AR61 3AC0A 4GULA 4R9AA 4ZKTB 1KITA 5DDJ2 2R0FA 3FHQA 3WDXA 1TG7A 1J3QA 4GMP3 1SLTA 2ET1A 4YRDA 5FZFA 3ZKUA 1A78A 3VKFC 3ZSMA 4CDQA 2VMGA 4CEYC 5A33B 2JDYA 1Y9QA 2WA3A 3MLKA 3GHMA 4MXWB 4IXLA 4PT6A 2D6OX 3I54A 1MS3A 1UMZA 1VBE3 3Q8AA 5FZKA 5LA1A 2OUHA 1C8NA 1X9PA 4HK8A 2MEV3 4LPLA 3BI3A 1WA4A 2RJKA 2RS53 1QH6A 1EYBA 1REDA 3ZYHA 2J7MA 4CDUB 4UBHA 2BBAA 3OOXA 4QGMA 4S2DA 1G8WA 3HAGA 1NCQA 4LMFA 4AF9A 4AHZA 2RS31 4AAPA 4GD4A 4Q0VA 4A42A 4JQRA 2V5YA 4O65A 3BU0A 1WKYA 4Y20A 2JE8A 4ASMB 5KWRA 1WD3A 2EA7A 2PLV1 1UZZA 1DQ0A 1O3RA 5T5PA 2PHDA 2EIGA 3V0AA 2IXJA 4LHLA 1F5JA 5T5OA 3Q8CA 2KR2A 2WSVA 4HFSA 2ZAAA 1C4RA 2NQYA 2VZ3A 4Y1XA 1C1LA 3OEAA 1NAEA 3CIHA 4M0NA 4Q4X2 5E1RA 5FZ7A 4ES8A 5IK4A 3T1LA 1MQTB 3WDWA 3U0ZA 4YWAA 3H8OA 1FPN3 3LA3A 5CFDC 4CCOA 3VBOB 3GDBA 3ZO0B 3WQ0A 4ET7A 2XLFA 4CCCA 4CVUA 3KCYA 2P6HA 3C7GA 2VMIA 1UMIA 2FCVA 5DAQA 2DCJA 3U14A 1CAVB 2VU9A 4HLTA 4K1ZA 2B46X 4XAEA 4AL9A 3SKVA 2Q0AA 1UXXX 1C8M2 2ARAA 4NHXA 3N3HA 2V09A 2R1BA 1D4M3 1Q8OA 1LHVA 1W2NA 2Q5TA 3CQOA 2X05A 4Q4Y1 3KV6A 1A8MA 5LA0A 1AXZA 3I7DA 2R7EB 3RYPA 2PAEA 3I2KA 5BY5A 1SCSA 3IMMA 1RUD3 5HBAA 1RHI1 2E63A 2XR4A 3VKLA 4WVMB 1PVC2 5HCFA 1TMF1 4XFGA 1ULCA 4JZRA 4NIIA 3S57A 1OVPA 3I8TA 4DB5A 3VBUB 3E6DA 4IE7A 4HPKB 1L3JA 1CPMA 3VZJA 1LTEA 1NQDA 1DQ6A 1NCRB 3MGUA 1ZBE2 1POV3 4MGSA 3VD4A 3VN4A 5ACA3 3HOBA 4BK4A 3MZHA 1UZ0A 3FE5A 4Q8KA 2AH2A 2DUQA 2GDFA 4NHMA 4RQPC 1F4HA 4XFCA 3UK9A 2GN3A 1R092 3RQ0A 2P3IA 1NYWA 2DDUA 2RR13 4J6GA 1QOOA 1V9U3 5FZ8A 1UZYA 3AVRA 4CP2A 4BU2A 1UY1A 2HWE2 2JXAA 1RJ7A 4XF0A 2IUWA 2OPKA 2VL4A 1KDMA 2W1UA 4QPIB 3PLQA 4CDXA 5FDBA 4TZDA 1RUJ1 2JDNA 4MGYE 5I8SA 2F4PA 4UFLA 5FY1A 1JZ4A 4AI0A 1RXGA 4KG0A 2UWBA 3VBHA 4ARYA 4JGZC 3LDKA 4RGKA 3L2YA 4D6QA 1XNDA 5M0TA 2V72A 3OY8A 2ZEZA 1RUG1 1ULEA 3LSDA 1AR91 3TOJA 1GMMA 1T6GC 2XWJB 2OVUA 4HANA 1FI2A 3UYJA 1UY3A 3RJRA 1OD5A 5HV4A 1WA6X 5IJRA 4Y4RA 4AEDB 5KC5A 2XBO2 2HWC2 4A44A 5D2AA 1C1FA 4PCRA 2E7QA 2W46A 3T0AA 4A2UA 3AK0A 3C7HA 1PM4A 1YQCA 1OH3A 5IAXA 2JE9A 1UAIA 3J8F2 4XDQA 1TME2 2E7TA 4URAA 3O0XA 4NN0A 1PGL2 2WLQA 5CNAA 5KHHA 1LENA 3E5XA 1AXYA 1YC61 1ZREA 4XQDA 4EZHA 1VPHA 1YFXA 4XYXA 2VZQA 1Y43B 1VRH3 5JOWA 1QQP2 1ODMA 4XXPA 1H2NA 1DGRA 2ADEA 1H1IA 2W9XA 3H9AA 1RUE3 1IPJA 1W6MA 3SH5A 2G9ZA 2VQUA 1HRI2 1WLTA 3WNXA 1SFPA 2A3XA 4UF0A 5GLUA 4KWJA 2ZMKA 2AEYA 4AR2A 3BKZA 3FBYA 2ZA9A 2X09A 2CGOA 1OFNA 1V70A 4NROA 1PZ8A 1YNAA 4P9WA 2A5ZA 5CU1A 4AYUA 5EQUA 4XEZA 4RR3C 5F2WA 4BXFA 5F8PA 2D93A 1UY4A 4OMCA 3AMMA 1ZZ8A 5IAVA 5ISLA 1YIFA 1RMU3 3BTAA 2VZRA 2HEYF 3UKVA 4J1XA 4OI0A 1XU2A 4N43A 2C6SA 1NCQC 2OW4A 3AYAA 3MV11 4QGNA 1S2BA 4SLIA 5C7GA 3KZ4C 2LRPA 4JGYA 2OUJA 5H9RA 4UFJA 2F6BA 1HB2A 3D3AA 4EE2A 2IC1A 1KDKA 2YGLA 1J1TA 4CEWA 3BB6A 4Y26A 3G6JB 3PURA 1YHFA 1RINA 3FLPA 1WUVA 3J7HA 1PVXA 4LIUA 2R061 3PHMA 2P3YA 3M3OA 4KU7A 4MGQA 4YFWA 4EWDA 3PIGA 4CUGA 1E5RA 1RUF2 2NPIA 3KB5A 1IS4A 5LW9A 3AX4A 3VDDC 4FPOB 4LE3A 4Z2AA 4A7ZA 2VY0A 3OBAA 4LK7A 1XYNA 5LBCA 1UZVA 2JJ6A 3UGHA 4FTEA 1SBEA 5C71A 1JS9A 2ET7A 2KM2A 2A3WA 3C7FA 1R081 3M3QA 4R4ZA 4D8MA 3N9OA 1AR62 1YIPA 4QXHA 3OSDA 1X50A 4C1WA 3TEYA 1HV0A 4I30A 2YUEA 2DCYA 4B3NA 2DU0A 4E2QA 1JYWA 1YRZA 4ZPIA 2MNGA 4R9DA 5AFEA 1H30A 2XJSA 4C90A 4JV4A 4OHYA 2JWPA 2JKBA 2XG3A 5FYTA 2E6VA 2BJSA 1DF0A 3OB8A 4QM8A 5AC91 2WABA 3WVJA 5F3CA 4R8HA 1N3QA 1NA1A 4UI9L 2RE9A 3RZLA 3F95A 5FMCA 1CAUB 5BNPA 4CCLA 3VD3A 1YUDA 1PK6A 4NWWA 3R4DB 4C0HA 4CXYA 3ON7A 2AACA 2BTVC 4FSJA 3IPVB 4D94A 4O61A 2RS32 4LEJA 1XBFA 1JZ8A 4XFHA 4YG3A 2EXHA 2P6CA 3W58A 4E4SA 3LE0A 1ASJ1 2VD7A 2A6WA 2PLV2 1DHKB 4NRMA 1ZRDA 1OUXA 3PJYA 1W8WA 2PXJA 4GZ9A 4MXVA 4DZGA 4BLIA 2WKKA 1OHFA 1IS5A 2VNGA 2X29A 5J7MA 2VZ1A 1UX6A 4QGLA 4XUTA 4O7XA 3V0BB 2ARXA 3ZN4A 1WW7A 1MR5A 2TUNA 1RB8G 3VBHC 5F37A 4WV8A 3VHRA 3H3ZA 5CADA 5FOBB 3UJOA 3MLLA 2NYYA 5A3PA 2D44A 1ZBA1 2G1MA 4K40A 2YY1A 4LUKA 5B4XA 5LY2A 3UETA 4BMEA 2XJRA 5IK7A 3O5SA 2V4AA 4YVSA 4LO8A 4P9IA 5BNNC 1WCQA 1VAMA 2PA7A 3I3MA 4BQ4A 2HWD3 1H4GA 3DEMA 5F39A 3W21A 2R073 2VAUA 4M01A 4Q8LA 3T3YA 2QQLA 2E31A 3POIA 1RJ8A 1LHUA 5FZDA 5LEJA 1VMHA 3JB4C 3RI8A 3KF3A 5JDBA 2DWRA 3K3OA 4Q4Y2 4WM8B 1G9FA 2EAAA 3AVSA 1W8ZA 4WM7C 3WUDA 3DUIA 1KD7A 2BZDA 1QHDA 1RHI2 2FHRA 3B69A 4H7MA 4LBOA 1OOPC 3VKMA 1H1AA 4K8FA 1OLMA 1RC6A 4LOTA 1TMF2 1ND2C 4YFZA 3PTYA 1PO22 1X33A 2VTXJ 2QQKA 1C5HA 2XHNA 4N53C 4RD7A 1S0DA 5EIYB 5DXDA 4XQWA 5DMYA 4M4RA 1R1A3 1UOBA 3A0NA 4HVOA 5LWBA 3AMQA 1SHWB 4E4DX 5C9AC 4M3CA 1RUH3 4M00A 1YJLA 2W95A 2WT2A 5GZGA 2VULA 3S5QA 3GNEA 2VXJA 2QQIA 4M4PA 2PTMA 3W9AA 1RUC1 3H7JA 2ZGLA 4DRRA 3WW1A 5J96B 5LY1A 3SISA 2EIBA 1FATA 2FMYA 4LBJA 3SH4A 3RGBA 3K51A 5SV5A 3VUOA 1RUJ2 4JX0A 2UWAA 3CBNA 3KGZA 5HXVA 2CHHA 4FBFA 2WFF3 4Y20B 4FPCA 5FQ0A 5ABJA 1X7NA 4GXLA 4X8NA 1WW6A 4ATEA 1W0NA 5FO9B 5K8SA 4Y5TA 5J1XA 1AR92 3O14A 3UGGA 2B45X 1WCKA 3V0AB 3PMSA 3OPWA 4OVEA 2RM21 5FZ1A 3S0MA 3I2HA 5FKCA 3QCWA 3H0OA 5EFUA 3RFRA 5JR7B 4LO7A 4M3CE 5KXDA 4ARXA 4OUSA 1GYKA 2XHKA 2ZZJA 1FV3A 1V6IA 2OXBA 4P5HA 3NWKA 3IBMA 4WZFA 4SBVA 4Y4YA 2VMCA 2SBAA 3QH7A 2VQAA 4QPWA 3BODA 2HLEA 2E7AA 5FYCA 1DCSA 2CU5A 4UW3A 5LK7B 4EZ4A 4I3GA 5FFOC 2WT1A 2QQJA 4E8CA 1MS4A 3JQXA 3ZDVA 1QJEA 2OPWA 3DXUA 2FDJA 5A70A 3RVHA 4IV3A 3ZYBA 5FPVA 3GALA 4BJ0A 3M3IA 5A6YA 1QXPA 1G7YA 1H2LA 3VL9A 3WNNA 2H0BA 2ARBA 3HBZA 1YI7A 4RS5A 3S5AA 2P5BA 2DFBA 5KR7A 2VOTA 2XXZA 1I9RA 1H8TA 3E97A 4LIVA 5E89A 4ZZ8A 3NAPA 1CN1A 3I2GA 3KV4A 2WA4A 4MSVA 1MACA 3BYWA 2BOJA 3UKTA 1LODA 2Y0IA 5LA2A 1VBB1 2ZMNA 5JOZA 5GLTA 3UKNA 1C57A 2VZPA 3WSOA 5EYYA 4UXAA 3INAA 2JIGA 3AMNA 1MS0A 5GZDA 1H8VA 5DZEA 1PIV3 4FOWA 1FNZA 1N3PA 1VBA3 3JB8A 4GWNA 4AQ6A 1OA3A 3H3UA 4AWDA 4ATFA 1EP0A 3M7AA 5JLVA 2WRAA 2GH2A 3R4UA 1O91A 4XE9A 1PMJX 3GCWA 3NKGA 4QXKA 4EN0A 2ZGTA 2LUWA 2BPA2 3ZN5A 1US3A 4CDXB 2BEOA 1O8SA 3JD73 4R4XA 1BK1A 1F4AA 3DPRC 1RUI3 4XJUA 4QQOA 1GWLA 1N47A 2J1VA 3AKTA 3OY8B 1GFF2 1AHSA 2DTWA 1YQ6A 2WAAA 4QB6A 1M06G 1UY2A 4UFKA 5FRAA 1VBD2 2CY6A 2RJLA 3HNYM 2XQXA 1G86A 3SC7X 4YARA 1SG3A 5A32A 1VMFA 3GZAA 2CAVA 3WY6A 5L73A 2CDOA 2WINB 2P1BA 4XUQA 2C4XA 4PIZA 3KM5A 3MF9A 3BPZA 5C3QA 2K0GA 2W2IA 4AGVA 4YSFA 2Q1FA 5F6KA 3SCHA 5LBBA 4IE6A 2QTWB 4UW6A 1YLLA 3O12A 1GOGA 1YXWA 2G9GA 1M4WA 2CAUA 1R082 4XFIA 1UIJA 2OQ7A 4BIOA 1ENSA 1QEXA 2YBPA 3OTFA 3FUOA 4HN0A 4JQTA 5FY9A 5CBLA 5J09A 3USUA 1IS3A 2OYZA 4CUCA 5C5UA 2JDAA 2WWJA 1WBFA 2JD4A 4XZUG 1YI9A 3JUUA 5CFCC 1MVQA 1W6MB 2VMEA 2G9FA 1IOAA 4ZU5A 4UF0B 4WVVA 5BYNA 3MUY1 2HKXA 5AC92 1W6PA 1LOEA 5FZBA 1HW5A 2PAMA 1W8OA 3POGA 4QX5A 4BQ3A 1KJRA 1D7PM 2VCMA 3O0WA 5IT6A 4YW2A 5JOYA 4ZHNA 2JDKA 2UYAA 1CZVA 2J1EA 2VOKA 2E33A 5H9PA 5JVVA 2Z42A 1BLZA 3DL3A 2H6CA 1W04A 1UO9A
chains in the Genus database with same CATH topology
1ASJ2 1IQAA 3IT8A 2YDEA 2GNTA 5LK5A 3N7JA 4CEYA 1AL0G 1Q56A 4QT6A 4D3WA 4KU8A 5JSOA 4FOYA 4N43B 3ZMNA 4RHV3 3B9IA 2WNUC 4IEVA 2CWMA 2WS93 4AFMA 1HLCA 4OFGA 1YJKA 4P9LA 3D0JA 3IMNA 4FTBA 1ND3C 2WNVC 3AP9A 2OZ6A 4IEUA 4LO6B 4ZXKA 3SXWA 2HWF3 4CEWB 1ZBA2 2YV8A 2DCKA 4LLFA 3NSTA 2VOVA 1AJOA 2XL7A 4QD2A 2YMZA 3NV3A 4XTMA 4XMAA 1BBT1 1S0BA 1I6XA 3N7LA 2C9AA 1PMIA 1VBC3 1FOD3 2D6NA 4BIFA 4MLOA 3PVOA 2KA3A 2RHPA 3ZIWA 3WINE 2RS13 2GNMA 3WG4A 1FMD3 4LNVA 1SACA 4NR1A 1SFNA 5CFDA 1PHMA 1CJDA 2BBVA 5EXOA 1XE7A 4E2GA 1ZZCA 3ZFEB 4CP0A 1PGL1 2DU1A 2R6QA 2YPJA 4FTSA 2O0OA 4LA3A 1ZA4A 1NA1B 1VAVA 2JEMA 4AEKA 5KBFA 4BH9A 5BNPB 4AE2A 3JBG3 3R4SA 4ISRA 1AF9A 1PK6B 1Q8PA 1RUC2 1O4YA 4XHXA 4AFBA 4XF3A 2ZHNA 4BCUA 5K0UC 4DNYA 3ACLA 2VVDA 4PLNA 4YZ5A 3E5QA 3ZVXA 2A73B 3FFZA 4YGDA 2WZR1 5T5JA 4W6WA 4RQPA 3NV1A 1LEDA 3MFAA 5GZCA 2RM22 2PYTA 2BNMA 1AYM1 5I0UA 4EROA 3HN1A 2DCTA 3LKJA 1XYOA 3VBFB 3VHNA 4RGAA 5JCTA 2PELA 3CJIC 3LB9A 4ASLA 1EV13 3B7MA 1R093 3RYRA 2D98A 2ATFA 4GMP1 3M2MA 2QKDA 3QBQA 1J59A 1Q8VA 2NMNA 2V73A 2CL2A 2IXCA 4BLJA 4YVSB 1MS1A 4JGZA 2ZGMA 4HL0A 4AVAA 3J9SA 4CTEA 2ZPXA 2BGCA 3RS6A 1UD1A 2ZCWA 5F5QA 2RS51 4F8AA 2XUMA 2XJVA 4AW7A 4FT8A 3VBSC 3H1WA 4MGKE 3NV2A 2E51A 3U10A 2GC0A 1GQHA 3AFKA 1VBB2 3LCPA 3PMEA 4GWMA 3HT2A 1YYNA 4XJWA 1BEV2 4V1PA 2DVGA 4M3CB 3IDCB 3H1MA 4P14A 5DZGA 4FP3A 4YGCA 1REEA 2D7FA 4HKWA 1NY71 5TSWA 1SLBA 1FPN1 3FUQA 3VBRA 1VR3A 1XNCA 3JQWA 3THPA 3ZXGA 5JSRA 1UKGA 1S0FA 4RR3A 5FQ0B 5ABJB 5DG1A 1AL23 2VNRA 3B00A 4IEWA 4LBMA 1LESA 1G9DA 1D4M1 2VOWA 5C8CB 3ZSEA 4AHYA 2ZBJA 4Q1RA 5LRSA 4GIQA 4B29A 1RUD1 4JC1A 4B7EA 4YVWC 5I93A 3ILRA 1GQGA 2PN5A 3D0SA 4Y5Z0 1F9KA 3AB0A 3FFQA 4XBLA 1SLLA 4YM2A 1AR73 3G7DA 1POV1 4L11A 3VHPA 4CDWB 2X8KA 5ACA1 1UW8A 1J58A 4HZFA 2O8QA 2Z2SB 4H7LA 4IV3B 2RR11 4BHPA 1IHMA 1V9U1 1ZM1A 4RGGA 3VDDA 3WW4A 2NZ9A 4RS5B 1EAH2 1A3KA 5JPMB 1CD3G 1HV1A 3WQ7A 1CVNA 1HKDA 1PZ7A 1GSLA 3NAPB 3PVNA 4Q27A 1E57A 1VB2A 2EF6A 3JZVA 2TEPA 1OFSA 4EV0A 4MV2A 5FMOL 1G9BA 3B94A 1OPMA 2A70A 1KQRA 4COUA 1UU4A 1AZDA 5FO7B 1NG0A 1Y3TA 3PNAA 4X6QB 4B4QA 1QNWA 2AENA 3WDTA 2HWB3 4KQ7A 4XBNA 4XJ8A 1PO21 1CONA 2XJUA 1PO13 3M3EA 1RVF3 2ZGQA 1VRH1 3S7IA 1K5MB 1F5FA 4FPHA 4XW3A 3VKNA 1HRV2 4I3PA 1VJ2A 3FMGA 3MI8A 1WBLA 4YW5A 3VGIA 4QPGC 3IIAA 3SHRA 5A32B 2QQPA 4GMP0 1BBT2 5LRRA 5GKAC 1D0HA 1Z7S1 2IXHA 1Z0HA 2RMU3 1OQDA 2ZKNA 4F7ZA 4BWOA 2DUPA 4LLOA 4I0AA 4I09A 4HBNA 1FV2A 1H0BA 4WBBA 3OBRA 4LBLA 2XVGA 2ZOEB 5J37A 3USUB 2IXKA 4TWTA 2X5IB 4O9EA 3MICA 5JI9A 5JZGC 1RMU1 3RZZA 4B4PA 3AZZA 1MS8A 5BNNA 1QJZA 2XLAA 1OLRA 4LE4A 2ZS6B 4S2GA 3LWCA 3BOPA 3KT1A 3J4UH 1W6PB 4I01A 1EPZA 1VALA 2VH9A 4UW5A 2XJQA 4HETA 4MUVA 4A7KA 3M1HA 4QQ2A 2P3JA 4WM7A 4JRAA 1TE1B 4Q2FA 4AI8A 4KNCA 3PVEA 4JCKA 1OOPA 3D4KA 1ND2A 3KQRA 3MPBA 1LOFC 4BMBA 1BKZA 1GNHA 4N53A 5BNOC 5I0TA 1Q8SA 1G9CA 1LECA 4CEYB 3TN92 4XJ9A 4JDMA 3VBRC 4ZU7A 1TMF3 2WZR2 2AREA 2ZGPA 5C9AA 4PLOA 1QJX3 5KHKA 1QOTA 2DF7A 4BE3A 4DOUA 5L7OC 2D3RA 1AYM2 2A75A 3KLSA 3I59A 3TAYA 2ZKLA 4YNIA 1COV3 2VUAA 4YZ3A 2JDZA 1PM7A 4AFCA 1I3HA 1APNA 3AJYA 3R0RA 4RFT0 3KSCA 1Z78A 5C4WC 1W6OA 2X53S 5T5LA 4LT5A 3X29B 3ZXLA 5I0SA 4AQSA 1NLRA 2ZMLA 3D82A 4GB33 1VBE2 1RGSA 3MIBA 5GZEA 1RUJ3 3IDEA 2MEV2 4YW4A 1LGNA 1POV0 2RS52 5KC6A 1UF2C 1KFXL 3POSA 2BVVA 1GV9A 2WQ4A 4Q29A 1RUG3 4Q4V3 1AR93 1U5YA 4QQLA 4XILA 1LHWA 4L8QA 1JBCA 1VBD1 4M3CF 1DU3D 3ILFA 2ZACA 4R9BA 5C6CA 1AR83 4L92A 4H14A 3JU9A 2PHFA 2Q1MA 4IL7A 4XBQA 4C91A 2B39A 1S1AA 1JTZX 2XVLA 2WLPA 1OLQA 1NY72 1ZRFA 2VG9A 2R30A 1FPN2 3ZX7A 5CVRA 4KH9A 2QE3A 4IV1C 3DN7A 2ZHMA 1REFA 3B93A 2HWD1 3MIGA 2R071 4H3WA 1WW5A 1YFUA 2QZ3A 4PDWC 4OUMA 1CGPA 1NE4A 3AYEA 4RQPB 1D4M2 1GZWA 1LU1A 1QF3A 4LHKA 5T55A 2CNAA 1S0CA 3R6SA 1GZ9A 1RUD2 3USSA 4COYA 5IK5A 1W0OA 2D6KA 5JAXA 4YYOA 4Y1YA 2ZHKA 1R1A1 2WSUA 4PQ9A 2JICA 5FLIA 5JIUA 3QD6A 5JOWA 1S2KA 1AYN3 3DPRA 4LO4B 1OQ1A 5ACA2 1W6NA 4C0BA 4JGZB 4MGZE 3KT4A 4Y22A 1RUH1 2YXSA 3IM0A 5HCAA 1IPKA 2RR12 1V9U2 4EN7B 1DGRN 3AP5A 4CZSA 3KS7A 1U5XA 2VW0A 2R063 1JH5A 1HXS3 3IWZA 5JIAA 3ZFFA 1Q3EA 2WFF1 3NL1A 2R0HA 1BZWA 2GAUA 2PHUA 5FLJA 3AKQA 3ZDSA 2UU8A 3B5LB 4AI2A 1R1ZA 3ZYJB 4LO5B 1Q43A 4XIKA 5CFCA 3ZN6B 2PAKA 5IK8A 2JG8C 1SEFA 4CRQA 3V56A 3M8LA 3VL8A 3FZ3A 3WDVA 2NP0A 1KFUL 4CDQB 1RUOA 4FCAA 1H1MA 1VRH2 4AEJA 4RR3B 4Z82A 1N1TA 4FQZA 1RUE2 5E88A 4OLLA 4BYYA 1S0EA 1G9AA 4XIOA 3K48A 3I4IA 1XQNA 3L2HA 1Z7S2 4IERA 1NCQB 4HMZA 1EPWA 1N1VA 3SNMA 2WNUA 3H8UA 1JXNA 1ZX5A 3OPZA 4YZ1A 2AUYA 4KBBA 4LULA 1ND3A 2WNVA 5AVPA 2O1QA 3ATGA 2BFUS 5JPNB 3NVCA 2VOXA 4LBNA 2IFRA 3MW4A 1HIXA 1RMU2 3ALQA 2Z5WA 4FO9A 1MS9A 4XTPA 1OA2A 2ZGSA 3VDDB 1ZBA3 3M3CA 1JYCA 3L9JT 4GA9A 1QJY3 1WMEA 1B35C 1QXRA 3JD71 2UYBA 4IEQA 1RUI1 1QJU3 2WJSA 4HSLA 1D2SA 2NM1A 1XE8A 5CG8A 2WFPA 5BV6A 2EXIA 1URXA 3AKSA 1A8DA 3DKWA 1H2MA 3KD4A 4YM1A 3RDIA 4XQ4A 1WD4A 1EY2A 1XNKA 3VZNA 3WLUA 3TNPB 2R043 4M0HA 1W2UA 1X36A 3AZVA 1IGOA 4DY3A 1VLNA 5A3MA 2HYKA 2PHXA 2BYVE 4B7KA 4OHZA 1BEV1 5I8YA 5L19A 5K0UA 2VUJA 1O5LA 3N35A 1KXGA 4Y24A 1WLDA 1MEC3 5F6LB 2W39A 3HMYA 4W6YA 4U2AA 1DQ1A 1MZFA 1QWRA 3EBRA 2P2KA 3RMXA 4RA0A 5C33A 1IS6A 5GM0A 3ZFEC 3RWNA 3RJ2X 5FCCA 4KG8A 4XF9A 2XLGA 2JG9C 3VBHB 2VNOA 5D1IA 3SCFA 3VKOA 3ZFGC 3CJIA 3ZIXA 4Q4W3 4TLFA 5EZWA 3VZOA 4XF1A 3WG2A 1DYPA 4FPJA 2BWCA 2C0ZA 5FTTC 2YZ4A 3AP7A 2R49A 3GBWA 2DVAA 5BNNB 4L9BA 3ZXKA 5KXEA 4QMAA 1OMIA 2WS91 1OQEA 4Y1ZA 3ZFFC 2ZZQA 1LHNA 1ULFA 1CQ9A 5DUXA 4LR4A 3ETQA 5K9YA 3VBSA 3OF1A 2HWF1 3BOWA 4WM7B 4XHBA 2CGPA 1V6KA 2DVFA 1OOPB 5E16A 1RIRA 1ND2B 3ST7A 1DZRA 3KCCA 4K3UA 3AXEA 4N53B 3QH6A 2HWD2 2XJTA 3ZYIB 2R072 2PHTA 4H55A 4KL1A 1UIKA 4Z07A 2GZWA 1QMJA 1ZNPA 4GH4C 1EAH1 4DXZA 1VBC1 4OI1A 4XJZA 2UURA 5J48A 5C9AB 1NXD1 2EVXA 2GC1A 2GC2A 1GANA 1SMVA 2ZAHA 3I59B 4LBQA 5D8AC 4IEZA 4AEDA 1O5UA 3A0KA 3WP5A 1W6OB 1R1A2 2GSYA 1U5IA 5DDJ3 1DYKA 4YGEA 1RUH2 4COVA 1MS5A 4JGYB 3M70A 2OA2A 1F2NA 2QZ2A 2D5HA 4YVWA 2TNFA 1HRV1 2GMPA 4XF4A 5I91A 2WFF2 4L2NA 4PIYA 4DS0A 2I45A 4JTOA 1FAYA 4HKOA 1UN1A 2ZX2A 1KRIA 4I02A 2QVSB 4JAAA 2ZGOA 2IXIA 2E53A 1O3SA 2HEVF 3PJQA 1OI6A 1EV11 4WZCA 4CDUC 4AGRA 3GBFA 3B02A 4AHWA 4Q4X3 2K2SA 4FVVA 4OHXA 3VHOA 3URFA 4XFFA 5FPZA 1U5ZA 1V00A 2KXLA 4PLMA 4X6RB 1XXNA 4CDWC 3WR0A 1QY4A 5EYXA 2SLIA 2XVKA 1BYHA 1V6OA 1LOCA 4E2SA 1YCIA 1JW6A 1C8M3 3SITA 4OI2A 3VV1A 3VZMA 3RI9A 3LZZA 1MQTC 4U36A 2XPJA 4K9SA 3POWA 2GNBA 3VBOC 4MH0E 1C5IA 2BNOA 4YGBA 3TN91 3DPRB 1PVC3 1XRUA 3LGRA 3CO2A 1VBA2 1NLSA 3QOPA 4Y22B 1S0GA 1V6LA 1VIWB 1AUYA 4PJYA 1ZBE3 4QPGA 5CA6A 4A7YA 3WUCA 1ZRCA 4Q0UA 3WD5A 3IKWA 1KS5A 3U07A 2MPFA 3KGLA 1LGBA 4YG6A 1O3TA 3WCRA 3JD72 4NPRA 3I2DA 1QGLA 2OZJA 2HWE3 1RUI2 5IUQA 1BBT3 1LOAA 3D8CA 3VBUC 4AVTA 1VBE1 3WDUA 1ENRA 1AL21 2VECA 2MEV1 4YZ4A 1NCRC 4YW3A 3ZXDA 3WG1A 1Q8QA 3KT7A 5JZGA 1JUIA 3OD4A 4PBPA 3RSJA 1CAXA 2D97A 5CFCB 3N36A 4AFDA 4L97A 4FPEA 4Y1VA 4K1YA 2XBO3 2HWC3 4BPZA 2D6LX 1LGCA 1UPSA 1AR71 5F1RA 1GLHA 3MYXA 5GALA 3LOBA 4BZ4A 4QPIC 2R32A 3J8F3 1TME3 2IXLA 1W39A 5I0RA 3V0BA 4NWVA 4BA6A 3CEWA 5FBZA 4PIXA 4R52A 1LKNA 1I5ZA 1BCXA 4RSUA 1LOFA 5JI7A 5BNOA 4G3YC 1ZZ6A 1TQ5A 3FHIB 1QQP3 4MVTA 3RMYA 4AEDC 4O9GA 3BU7A 4JDOA 2PHRA 2WNUB 1H9WA 1JOJA 1HRI3 2WQZC 5L7OA 1OSGA 2ZTNA 1ND3B 2B8MA 2WNVB 1UU5A 4DINB 2DUOA 1GBGA 1H2KA 4RL7A 4QHBA 5C4WA 3WW3A 4F83A 4NOTA 4OHWA 2CYFA 1XYPA 1H9PA 3QLQA 4OZXA 4DMIA 4RHV2 1CX4A 1QDOA 2HWB1 4HKLA 4MZUA 2WS92 4FOQA 2DCZA 1QU0A 2VVEA 1IKPA 1PO11 4AVSA 1PNGA 1BXHA 2A7AA 4BM8A 1RVF1 2PHLA 1LCLA 2WZPP 1QH7A 1FNYA 5CAZA 2HWF2 1IKQA 4P9GA 1VAKA 5GLVA 1NZCA 4MYEA 2WIIB 4FP2A 3HT1A 4XOGA 2D40A 2N7GA 5DZFA 4AVVA 2QFEA 1VBC2 3MPPG 2RMU1 1FOD2 5T3NA 1H8TB 4E9KA 5T50A 1RUF3 1QNYA 2R16A 2DYCA 3MDPA 5KHIA 1A6CA 3CL1A 2NMOA 2QNKA 3CLPA 1WGPA 2RS12 1FMD2 2Y38A 5KHGA 1WCSA 1TNFA 4FXGB 4OULA 4YZ2A 5K0UB 1LJ7A 3T1MA 3MIFA 1SBDA 4IV1A 3CU7A 4FPYA 3LAGA 2G4IA 1AR63 2A71A 2ZX0A 3U4XA 2I07B 1PGSA 2W52A 5EV7A 1MZ5A 4PDWA 5GZFA 3LOIA 1BQPA 1HQLA 3C3VA 5DUWA 3ZSKA 2BFUL 3AP6A 3JBG2 4X8PA 1CESA 1BVP1 2PHWA 3ASIA 1N1YA 1W0PA 2CGNA 1LEMA 3CJIB 4AXOA 1CAWA 1RITA 1RUE1 2ZX3A 5FREA 3EXUA 3HR9A 1NXMA 4HN1A 4LA2A 3B01A 2VXRA 3ZYRA 2RS33 4AEMA 1MZ6A 1DDLA 3OYWA 4FAGA 5F9TA 1G6NA 2Y0OA 3MW3A 1QJX1 2BNNA 2PLV3 3S6PA 1HDKA 1DGWA 4NHKA 2R1DA 4KWLA 3POYA 1COV1 3APBA 3HQXA 3IN9A 4ORFA 4QM9A 3VBSB 1EV12 3ZSJA 4OI4A 3N4MA 3ZXFA 3M4FA 4HT1T 3GZUC 2AYHA 4GB31 4KGGA 1UKRA 1DGWX 3O0VA 4D7TA 3FX3A 1X8EA 1SLAA 2W08A 5I8TA 5K7PA 1V6NA 2EALA 3ME2A 2GMMA 1PNFA 1FYUA 3V65A 2ZABA 1V6JA 2A6ZA 3DGTA 4Q4V1 4LBQB 2JG8A 3AYCA 3EJKA 4Q4Y3 4AG4A 1GNZA 2EXKA 3OCPA 4XETA 4E4ZA 2H0VA 1RHI3 4WVWA 2IFWA 1O4TA 4TYSA 1AR81 1PO23 2A3YA 2GN7A 5B2GB 4AVCA 1MVEA 1XNBA 3FWEA 3WP4A 3THTA 3DV8A 4YVWB 4WM8C 4HVRA 3WV6A 1N1SA 1FX5A 4HVQA 1TNRA 2Q1ZB 3B3QE 1Z7S3 2IZWA 3TWIA 4MGIE 3WHTA 3UJQA 2HEWF 4KGQA 3ES1A 4CDQC 1AL22 1HQNA 5FAXA 3RNSA 2P37A 4INDA 3MLJA 1O4ZA 3EHKA 4Q0QA 1X8MA 2UY9A 1DLLA 2Q8OA 5CFDB 1F8VA 3T2TA 1B35A 3E6CC 1AR72 3AFGA 1AYN1 4GKXA 3WQ1A 2ZJCA 1LB2A 4MX3A 4FPLA 2ENRA 2GALA 1NQJA 2D6MA 1UU6A 1QOSA 3OGGA 1FT9A 3WZ1A 4Z2WA 4IESA 1SDWA 1AVBA 2ZGKA 4UBGA 1LOBA 1ZVFA 3TBDA 1HXS1 2VVFA 5JMCA 3R05A 2ZGNA 2CV6A 1ZZ7A 4LHNA 4JDNA 2B9UA 2VW2A 1BMV2 5CG9A 4LTAA 3UL2A 2TBVA 3GF6A 3GYDA 5DG2A 3RYKA 1TEIA 4QPGB 2ZX1A 4EWAA 1YO8A 2P3KA 2HWB2 4GQ7A 3AP4A 3LA7A 4B8EA 2Q4SA 1PO12 3ZFEA 2W68A 2ZGUA 5DUUA 3S7EA 3H50A 4FQ4A 4XFAA 3Q9OA 1RVF2 3H7YA 2B42B 2JG9A 3GBGA 4IEPA 2XL9A 3ZFGA 2CWSA 3VLBB 1O7FA 2WC2A 5JZGB 1DFQA 2BUKA 3ZYGA 3ES4A 4COWA 1CAXB 2RMU2 1VBD3 3MEPA 4EJRA 2AGSA 4JTNA 1GICA 4EWEA 4D7YA 1SLIA 5HI0A 1KJLA 4A3XA 2W0XA 2VGDA 2UWCA 1WW4A 3BCWA 2D43A 3NJZA 3V64A 3VZKA 4CDXC 5SV8A 5BXXA 1ULGA 3AKPA 1WMDA 1R083 3VBFA 3WG3A 3FC0A 3N7KA 3IDBB 5BNOB 1SCRA 2XH6A 3ECQA 4EN8B 4GH4A 4YG0A 3VBRB 1QJY1 4DFSA 4URTA 1F31A 1W6QA 3BIWE 4QQPA 1DZTA 1CPNA 1QJU1 5L7OB 1YFWA 2LM3A 1DGLA 2QDRA 5AC93 2QUOA 1CR7A 1ENQA 3ELNA 4N90A 4Z92B 1N3OA 4LUMA 5D8AA 2C5DA 2YHJA 5C4WB 2Z79A 4QU2A 1DQ4A 2ZGRA 5T54A 3SLIA 4AQ2A 1WMFA 3ILNA 2WNEA 2XJPA 1IZ3A 1DQ5A 1Y7BA 2R041 1ASJ3 5CIRA 1GKBA 1QJX2 2LTNA 4EN6B 2QJVA 3FLRA 4W6XA 3TB0A 2K9ZA 2ZX4A 4FPKA 1BJQA 4N9IA 5JWPA 1COV2 2YC0A 3CJXA 3B9CA 1LR5A 1D2QA 1PIV1 4UW4A 1GZCA 1VBA1 4GKYA 3OGJA 2DURA 3TYJA 5FMOS 1MEC1 4ONUA 3E6BA 3BALA 1PGW1 4K6BA 4GB32 3WOGA 4LBKA 4N7UA 2PQQA 4TSVA 3WT3A 1YFYA 5A33A 4AHXA 1UL9A 4MXWA 1WCDJ 3AKRA 1SQ4A 4N43C 3NO8A 3WHUA 2GU9A 2VQ0A 1RUG2