2RS33

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 37
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rs3300
5CFDA 1AR91 3TN92 1AYN3 1NCQB 4CDXB 1QJY2 2HWF1 4CDQA 1R091 4CDUB 2RS12 1POV1 1NCQA 4CDXA 5DDJ1 5C9AC 2BFUL 1HXS1 3DPRC 2X5IC 4N43B 4FTEA 3J8F3 1NA1B 1RMU3 1R1A3 2RR12 4RFT0 1NA1A 5BNNA 1VBD3 4WM7C 5BNOB 4Q4W1 2ZTNA 1TME1 3HAGA 3ZFGB 2XPJA 4GH4B 1PGL1 1DDLA 4CDWC 4FTSA 4YVWA 3ZFGA 4CEWC 1AR92 4GH4A 3JB4C 5CFCA 2HWF2 1VRH3 1GFF2 1AR83 4WM8C 1R092 4GMP0 1B35C 5DDJ2 1HXS2 5AC93 1EAH1 1ASJ3 4RR3A 5ACA1 1C8M3 2WZR1 3VBOB 4Y4YA 5D8AA 5ABJC 5C9AB 1RUF3 2X5IB 3VBRB 1BEV1 2HWC1 2HWD3 1K5MB 3VBOA 1E57A 1NOVA 4Q4W2 4LLFA 1ZBE3 1QJY3 1TME2 1RVF1 1EV13 1AL23 2RS13 4YVSB 1PGL2 1OOPB 3JB8A 2ZAHA 1BMV1 2MEV1 2RR13 1EAH2 1F8VA 1MQTB 5ACA2 1B35B 3FBMA 2WZR2 1POV0 1BEV2 1MQTA 1TMF1 2HWC2 4RQPB 5ABJB 1AR93 5BNPC 3VBSB 2WS93 2HWF3 4Q4X1 4RQPA 5AC91 1QJU1 1RVF2 1R093 3CJIB 1RUI1 5L7OC 1POV3 1VBA1 1HXS3 5A32B 3CJIA 2BBVA 1BMV2 1RUH3 1PO21 4GMP1 3VBFA 2MEV2 1ZBE1 3M8LA 5C8CC 1H8TB 1AL21 1CD3G 1TME3 3JD71 1TMF2 1H8TA 4CDQC 1AYM1 1RUG3 4Q4Y3 3VBHC 4Q4X2 5AC92 1NCRA 1QJU2 3NAPC 3ZXAC 1RUI2 1VBA2 1EAH3 3VDDC 5ACA3 2RS51 1PO22 4RS5C 3S6PA 1ND2A 1BEV3 1QJZA 2HWC3 1ZBE2 2WS91 1EV12 1AL22 1F2NA 3JBG1 3ZFFB 1PO11 3JD72 1RVF3 4CDUA 2R071 1RUH1 2GSYA 2PLV1 4N43A 1HQNA 1AYM2 4QPGC 2MEV3 3VBHB 5JZGC 5BNOA 3NAPB 3LOBA 4JGZC 1NY71 2RS52 1AL0G 1TMF3 4IV1C 4CEYC 1RUC1 1RUG1 2WS92 4Q4Y1 5C4WB 1AR61 4RS5B 3JBG2 4IV3C 1PO12 5C4WA 4Q4X3 1V9U1 4NWWA 1QJU3 1RUI3 2R072 1VBA3 1ND3C 1RUH2 2PLV2 1OHFA 3DPRB 1PO23 4GMP3 5C9AA 2X5IA 3VBRA 1K5MA 4WM7B 2RS33 4QPGB 5A33B 5K0UC 1NY72 4WM7A 3JD73 4JGYC 1PIV1 1RUC2 1RUG2 2FZ1A 4N53C 4Q4Y2 4YVSA 1CJDA 4JGZB 4CDWB 1AR62 1OOPA 4CEWB 1AYM3 4IV1B 1M06G 1V9U2 4WM8B 1R081 4QPIC 4EJRA 4PDWC 4SBVA 4WM8A 1B35A 2RS53 1ND3B 3ZFEC 3VBUC 5ABJA 1HRV1 3JBG3 1PO13 3VBSA 4RHV1 4NWVA 1PIV2 2BPA2 2R073 2PLV3 4AEDC 5A32A 4JGYB 1D4M3 4N53B 2RS31 3IDEA 1AR71 2RMU3 1R082 4Q4V3 4FSJA 5CFDC 1RHI1 2RM21 4QPIB 2HWB3 1RUC3 2FZ2A 1NCQC 4CDXC 1AR63 3ZFEB 1HRV2 1RUJ1 5BNPB 4CDUC 2R061 4RHV2 1V9U3 4N43C 1HX6A 1FOD1 5L7OB 1NA1C 5BNNC 1PGW1 5FOJB 2RS32 2BUKA 1AR72 2IZWA 1COV1 2WLPA 5C8CB 4YVWC 1VBE3 3ZFGC 1Z7S1 4GB33 4GH4C 3ZFFA 5CFCC 2RM22 1PIV3 5CFDB 1VAKA 1D4M1 1W39A 1RUJ2 4CDQB 4RR3C 2R062 2RMU1 2VQ0A 4Q4V1 5D8AC 1FOD2 1NG0A 1VB4A 1R083 3VBOC 3VBHA 3VDDB 2HWB1 3NAPA 1IHMA 3VBRC 2WFF3 1MEC1 1PGW2 1K5MC 1VBB3 5BNNB 2HWE1 3VDDA 2XBO1 1BBT1 1QQP3 1COV2 1OPOA 4RS5A 1HRV3 1Z7S2 1VB2A 4YVSC 5GKAC 4RHV3 4Y5Z0 1RUE1 1OOPC 4YVWB 4Z92B 1D4M2 1ZBA1 5CFCB 1FMD1 3DPRA 1X36A 2RMU2 4Q4V2 1VBE1 1AR73 1MQTC 2R041 4GB31 1HRI1 1FPN1 4RR3B 1C8NA 1PVC3 5D8AB 5JZGB 1RUD1 2HWB2 4QPGA 5A33A 1MEC2 1RHI3 2RM23 1VBC1 4RQPC 5JZGA 2HWE2 4BCUA 1QJX1 2XBO2 4CEYB 1BBT2 1WCDJ 3VBSC 1AYN1 4JGZA 4CDWA 4CEWA 1RUJ3 2DF7A 2TBVA 5FMOS 3CJIC 4IV1A 3TN93 4CEYA 2R063 4IV3B 4FTBA 1RUE2 3VBFC 1FOD3 2WFF1 1ZBA2 3J8F1 4IV3A 1VBB1 1FMD2 1RMU1 1R1A1 1QQP1 1ND3A 1VBD1 1VBE2 2R042 1H8TC 1HRI2 1FPN2 4GB32 1COV3 1RUD2 1Z7S3 1VBC2 5K0UB 1NCRC 1QJX2 2Y26A 1AYN2 5K0UA 5FMOL 1VRH1 4JGYA 1AR81 1RB8G 4N53A 1PVC1 1ND2C 2WFF2 1ASJ1 3J8F2 1VBB2 1C8M1 5DDJ3 2ZZQA 3VBFB 4PDWB 1RMU2 1RUF1 1MEC3 1R1A2 1QQP2 2HWD1 1VBD2 2HWE3 4QPIA 2XBO3 4PDWA 1BBT3 3VBUB 3TN91 3ZFFC 1X33A 1QJY1 3ZFEA 4Q4W3 5J96B 5BNPA 1EV11 3VBUA 2RS11 2GH8A 1RUE3 1ZBA3 2BFUS 2QQPA 5L7OA 1FMD3 5BNOC 4AEDB 1NCRB 1VRH2 2WWSA 1AR82 2RR11 1PVC2 5J98B 4AEDA 1SMVA 2R043 1ASJ2 1HRI3 1FPN3 1RHI2 1C8M2 5C8CA 1RUD3 1A6CA 5LK7B 1RUF2 1ND2B 1AUYA 1VBC3 2HWD2 2WZR3 5C4WC 1QJX3
chains in the Genus database with same CATH superfamily
3GBWA 2EXJA 2ZS6B 4FPOB 4NIHA 1OLMA 2E7TA 2HWF1 1LULA 4MGKE 3KV9A 4GKYA 2JG9B 1APNA 1SEFA 1WCQA 1ZVFA 2VW2A 3GZUC 3HR9A 4Y26A 5J37A 1NCQA 4I01A 4XYXA 5DDJ1 4D6RA 2A3WA 4N43B 5C9AC 1SPPB 2VE1A 3J8F3 2GP3A 4CUGA 4ZXKA 3T2OA 1NA1B 4EZHA 1ZM1A 3H8XA 2BV4A 1GZWB 2G9GA 2WT0A 3WG3A 1O7FA 5BNOB 2BDRA 3WQBA 3WQ7A 5FP7A 2IVJA 2DCKA 2XWBB 4NAOA 4HPKA 5FYZA 4BIFA 1GWKA 3AZZA 3GZAA 1GOGA 3TRSB 3HT2A 3LFMA 4XPVA 3W58A 4YVWA 4BQ1A 4FTSA 5EYYA 1OKQA 1AR92 1OVSA 3ZIXA 2FDJA 3JB4C 1F4HA 2BQPA 3HMYA 4I0BA 5A3PA 5A80A 2R32A 1AR83 4LUMA 5A3OA 2P3YA 3ZO0B 2OPWA 4GMP0 4COUA 1WCUA 3WNKA 1IOAA 4HL0A 4OMDA 1HXS2 5AC93 1EAH1 3I2JA 5F37A 4QX2A 3E5XA 1V6OA 2MHFA 5ACA1 1F35A 1LRHA 1O6UA 3HNYM 4P5HA 4IEYA 3SCHA 3ETQA 2BWCA 2X5IB 4ZU4A 2YC0A 4JKLA 2HWC1 3WEZA 1W8FA 1K5MB 1MS4A 3VBOA 1PK6B 4M0HA 3ZYGA 1RIRA 5CBLA 5F6KA 3PNAA 2D5FA 3BCWA 4FPFA 1ZBE3 3BALA 2X05A 4RGAA 4DUVA 4LK7A 1OC1A 5C3RA 2BGCA 2ZGPA 3NV3A 1RVF1 1EV13 1FI2A 5F5IA 1PGL2 4YWAA 3W9AA 5C3SA 4LBJA 4B7KA 3U37A 3SXWA 3SH4A 2P2KA 4M3CF 4XUOA 4AGVA 3UL2A 1VLNA 4YYOA 4MSVA 3SH3A 4R4XA 1H0BA 1LOFC 3AXDA 4FT8A 1J3RA 3PIGA 1DU3D 3RZZA 2DCZA 2XQRA 1QXRA 1F8VA 1W6MA 1U5XA 3LKJA 2PHXA 3PVOA 2UWAA 2BZDA 4XUNA 3AKQA 1BLZA 1MS0A 1BEV2 1MQTA 1TMF1 1UD1A 3MUY1 4F7ZA 3EHKA 2WQ4A 5ABJB 1DQ5A 4Q5OA 2VMFA 1AR93 2WINB 5LK5A 1CZTA 3VHRA 3VBSB 4KI5M 3WNMA 4DQAA 4Z2AA 1UYYA 1VJ2A 1JYIA 3D0SA 4HOOA 1I6XA 4CPBA 4UFJA 1UY3A 4E8CA 5FP3A 1POV3 5DUVA 3VKFC 1QU0A 2YZ4A 3JU9A 4FPYA 1HXS3 2GH2A 1Q5OA 1WW5A 1UYXA 1BMV2 4CU8A 1BQPA 4XBNA 2H0BA 1PO21 2XL9A 4GMP1 3IWZA 5FO7B 3SQOA 2MEV2 3VBFA 4OUEA 2C9AA 4CP9A 3THDA 1U12A 2J7MA 5LB6A 2E32A 1SLAA 2ZGKA 2LROA 4CRQA 3LB9A 3TEWA 1AL21 5FFOC 2VMDA 1CD3G 1H4GA 2V73A 2P6CA 2FD8A 2Y0OA 4CYDA 3RFRA 4B4QA 1AZDA 2XLFA 3KVBA 4XF0A 3IB3A 4XMIA 3RMYA 1GQHA 3IIIA 3Q8EA 3LEMA 2G4IA 2ZMLA 5LBEA 1LHUA 1TG7A 3J7MA 4YW5A 5IVCA 5CIRA 1W2NA 2OXBA 3HBKA 4Q4X2 1X82A 1QJU2 3AB0A 1MS5A 1YHFA 3NV2A 5FZDA 5LA2A 1Q8OA 4XCBA 1RUI2 5CA6A 4A41A 5JSRA 4WBBA 1PHMA 4BE3A 2YU2A 1W2TA 4MO3M 2RS51 1UMZA 4YM1A 3S6PA 1A8MA 1QJZA 1BEV3 1CVNA 3O0WA 3W5MA 1H2NA 3GGLA 3WXPA 4DXSA 4EWEA 4MLOA 2WS91 2VMHA 3RZHA 4UOJA 3KVAA 5L9VA 3MIGA 4L97A 2BP6A 4E2GA 1DG6A 4I3GA 3KMHA 2R071 2XJPA 1RUH1 2YC4A 3M2MA 4KBZA 2DURA 2Q0AA 1S0IA 1C28A 3KQ4B 3OBTA 4FOVA 4ASKA 1AXYA 2XLGA 1HQLA 2RDRA 4QPGC 2E31A 2MEV3 1W6NA 3CKHA 2R1DA 1REFA 1O91A 5JZGC 3QBQA 4XVHA 4DO0A 4RN5A 5BNQA 1G8WA 1U5IA 2D6KA 4HSJA 1W3XA 3M3QA 3RI8A 3R6SA 3ZR6A 2NPIA 2VOKA 3PUSA 2WNEA 4LKEA 2Z4FA 1JUHA 3EYPA 1LU1A 1UF2C 1MPXA 2A6XA 4IETA 4KWJA 3DKWA 4IV3C 1PO12 1WGPA 2PHRA 4Q4X3 1QJU3 1CZSA 2NP0A 1JS9A 2VNVA 2VMGA 4HETA 1RUI3 4NN0A 4QM9A 3BTYA 3DPRB 3GYDA 3WR0A 1CAXA 2DVFA 1IKPA 1W04A 3LWCA 1SG3A 5C9AA 1DYKA 4JVAA 4P9YA 5AVAA 4UFLA 1SLCA 3HEIA 3RWNA 2RS33 2GDFA 4KH9A 4FI9A 4GWJA 3EBRA 3Q8AA 4OHZA 1NY72 3AZYA 3N9QA 3VHOA 5K0UC 1W05A 3VD9A 2FZ1A 2K9ZA 1I5PA 4YVSA 4LE4A 1OH4A 4OCTA 4Q4Y2 3OTFA 1C5HA 3GHMA 1YIPA 2VXRA 1OOPA 3OPTA 5CZKA 1LENA 3IM0A 4FPKA 1DIWA 3ORJA 2VCCA 3PMEA 1YLLA 2JENA 1M06G 3AP4A 4WM8B 5L9RA 1SDWA 2EVXA 4S2HA 1JZ8A 1C1FA 2PTMA 3LCPA 3OF1A 4EJRA 3NNLA 1JZ3A 3KV6A 3OGSA 1QXPA 1OQEA 1JU3A 4PIZA 4MGSA 1RGSA 1YFXA 4GA9A 3FBYA 3RZLA 3OGRA 3K51A 4QKBA 5IWFA 5KC6A 1JZ5A 2EIDA 1XXNA 1EY2A 2Y6KA 1D4VB 4IEZA 1O4ZA 1MS1A 1ZZ8A 3IN9A 4A44A 3I2OA 2A6WA 1PO13 2W87A 2ZHMA 1PIV2 3BIEA 3B69A 3NNGA 5CYYA 1EP0A 4P14A 1GICA 1SBFA 4JGYB 2Z69A 4J25A 4TYSA 2VD7A 2DFCA 2FQPA 4K1YA 1XU1A 2VNGA 4NAMA 2Q1ZB 1CAUA 1MZ6A 1C4RA 3PUHA 4UW5A 5JR2A 2ZGQA 1LKNA 4CU7A 1O3QA 3WP5A 4EN7B 3USUA 4NHMA 1HB3A 4XJAA 3C2UA 2PAMA 3ACLA 1ZREA 5CFDC 2DBNA 4LT5A 3WOGA 4AHXA 3O1OA 2V72A 3FN9A 3AVRA 5F2SA 1GSLA 4QPIB 2HWB3 3OCPA 1W28A 4B4PA 4L99A 5E88A 2DCYA 3ZFEB 1HRV2 4GD4A 3WHUA 3I3EA 1MACA 4OZOA 4CDUC 5A3MA 2I45A 2VPVA 4PLMA 1WBFA 4XIKA 2Q8EA 5BY5A 1HX6A 2LALA 3NV1A 4JQRA 5LBFA 5C6CA 5FJKA 3WNPA 1OLRA 3HQXA 5L7OB 5BNNC 4QDRA 4A7KA 2VUDA 1S0GA 3M3CA 1P8JA 5LZ6A 1NZCA 3K48A 3M1HA 3VBRB 5FOJB 5DUUA 3ZSJA 5A1LA 2BVBA 3MIBA 1AR72 5FZMA 1J83A 2WLQA 3ACIA 3MEPA 1COV1 1IS6A 2V5DA 1LGBA 2WLPA 1FYUA 1SLBA 3ABZA 1VBE3 4WVZA 5C8CB 4CPBD 4D8MA 1VAMA 3HQRA 1LOCA 4NIIA 4LA3A 2YDEA 3AZWA 3J7LA 5A7PA 2PHUA 1UZYA 2EICA 1PIV3 3SNMA 4FFFA 4OHVA 5DUXA 4CP1A 2XXZA 3OD4A 1XQNA 5DN2A 3O1SA 2IFWA 3FMGA 2R062 2VQ0A 4PIYA 3O1MA 3O1VA 4F8AA 4HG6B 4W50A 4NHKA 1V6IA 4CP2A 1XYNA 4MGTA 1REEA 2VTFA 3H0OA 3ZYRA 1S0EA 2WNUC 3TB0A 3NRUA 4O7XA 1TZOA 1W9FA 1ZZBA 1ONAA 4K7JA 2XH6A 1ZRIA 2W1UA 1OPOA 5IYYA 4YGDA 3BTZA 1U5YA 1HRV3 1ULPA 3UT0A 4AL9A 4BLJA 4I2OA 3VZKA 4YVWB 2R16A 4S2GA 1WMXA 1D4M2 2QKDA 2W5FA 4XQDA 1ZBA1 1UO9A 2BJSA 4D3WA 5L9BA 1TNFA 1UU5A 1A34A 2W2IA 2RMU2 1DQ2A 5C8WA 4Q4V2 4DRRA 2E7AA 1XC6A 1K5JA 3H1MA 4BQ5A 2XVGA 5AFBA 4ZS3A 1AR73 4NMIA 1HRI1 4XOGA 3KT1A 4EN9B 5I8YA 5LY2A 3PDQA 1RUD1 2GC3A 4QPGA 3M3OA 5A33A 5A3UA 4HBNA 4P08A 3DL3A 5IUQA 3GCWA 4CCCA 5KWRA 3KWVA 1JYTA 5JZGA 2WZ8A 3INAA 4YLZA 1WCDJ 1CIYA 1AYN1 2GP5A 2DCJA 2R30A 2VJXA 1GUIA 2OVUA 4PIXA 5FRAA 5FMOS 3CJIC 4FOQA 4BZ4A 2R063 3ME2A 1SACA 4AI0A 3POIA 1RUE2 3CIHA 3FZ3A 2WYSA 4UFHA 1R1ZA 2EA7A 4QQOA 4IV3A 2DTWA 3ZYJB 2QQWA 3JCIA 2J1UA 4IEVA 4C8DA 2H0VA 3ACGA 1VBD1 2GNTA 2PAKA 3BU7A 3LA7A 4H14A 4XZUG 5F5CA 4D6QA 1H8TC 1PM4A 1CAWB 1DGWA 1ZA4A 5DQ0A 2P37A 3NNJA 3OBRA 1IS3A 2D6NA 4HLTA 1O3RA 3B5LB 4BU2A 5GZGA 1S0CA 3B02A 1VBC2 4ZU5A 4URTA 1QJX2 1HLCA 2NQYA 2XKPA 3EO6A 2W1QA 1X7NA 5FBJA 4RA0A 5K0UA 3WHTA 5FMOL 4D7SA 5F6LB 2VTXJ 1OD5A 1QMJA 1VRH1 1QEXA 2FCVA 3N9NA 4Q1RA 4QXKA 1N3QA 2BYVE 5GLUA 1OSGA 4YZ3A 3TNQA 4OI1A 2W08A 1ASJ1 1BK0A 2GAUA 2VU9A 2XLAA 2YFUA 4XBLA 1ZZ7A 3KCCA 1US3A 2ZGMA 5FLHA 1C8M1 3MV11 5DDJ3 4JC1A 3VBFB 4BMBA 4X8NA 1RMU2 5GZFA 1UW8A 3BVCA 1R1A2 1QQP2 4DXZA 4Q1PA 1X8MA 4XW3A 4HFSA 2YBKA 3LE0A 1JHJA 3I59A 5HI0A 3VBUB 1XNCA 4IE5A 1XE8A 1UOFA 1HQWA 2JB8A 3L2HA 1X33A 1QJY1 5DAWA 2VOVA 5IVJA 1DZRA 3VB9A 5LCWL 2YV8A 1NQJA 2X8KA 2BWAA 2ZOEB 2F4PA 3LPFA 4WVMA 5JPNB 2W3JA 2GH8A 1RUE3 3PUAA 2ERFA 3N7LA 2K46A 3MZHA 2Y8KA 4L0PA 1Y43B 2DUPA 2WT1A 3K4DA 3I3MA 1KDMA 3DF0A 2WWSA 2FHRA 1W2OA 1DGRA 2RR11 3H8UA 4DINB 2B45X 3FWEA 1PVC2 3AXEA 4DB5A 4MXWA 2DVBA 3PVNA 3MIEA 2A5ZA 3B7MA 2HEVF 4BMEA 2UURA 3L2YA 2QQIA 3OB8A 5BPXA 4UFKA 2WABA 5EPAA 5FUIA 3NV4A 1A6CA 1WBLA 2VVDA 4OLLA 5J36A 1RUF2 5LK7B 1ZRDA 1AUYA 3ALQA 1VBC3 5E1RA 2R0HA 5C4WC 4E8DA 1I9RA 2FDIA 1Z0HA 1QJX3 2CV6A 2GMMA 4IUGA 3ITQA 5FZGA 4XIOA 5CFDA 4AEMA 3TN92 4CA9A 4E4SA 2P17A 3NKGA 4DXRA 4FAGA 2Q30A 4FXGB 1HB2A 2HEWF 3OSDA 4H3WA 4LBMA 2QTWB 4CDXB 4XJUA 4CDQA 2V5YA 1VMFA 1R091 1XE7A 2HH9A 2C5DA 3LA2A 2QQLA 2ZEYA 4HN1A 3UETA 1OQ1A 3WF2A 3RZMA 3N9OA 1N1TA 1QIQA 4AAPA 4IE6A 2CWSA 4O65A 1NYWA 5TSWA 3MIHA 5H9QA 1FXZA 1RMU3 2BOJA 3ZDVA 1R1A3 2FMDA 4Y33A 5BNNA 2QJVA 4WM7C 3MF9A 3U4XA 4Q4W1 1QHDA 2ZTNA 3NJXA 2AACA 5EYXA 1CZVA 1YXWA 3Q9OA 4BQYA 3HPNA 1W9SA 3ZR5A 2PELA 2QDRA 4PI2A 1TME1 3ZFGB 3K77A 4IXLA 3LPGA 4GH4B 4DIQA 2ARAA 4CDWC 2Y6GA 4CEWC 1RTVA 3RJ2X 3T0AA 1ZYBA 3N9PA 4OQ8A 2D40A 2YROA 3PJYA 4LBQA 2UYAA 4LHSA 3FFQA 4OVEA 2JD9A 4ZHNA 1FV3A 4DS0A 2XQXA 4KGGA 4QMAA 3W20A 5FZ3A 1B35C 1H9PA 3CMGA 4E4DX 2P6HA 3H1WA 5DZGA 2YC2A 2YMZA 2W52A 2HBUA 1L7QA 4L2NA 4CXYA 1VE0A 2DUOA 4XQ4A 3O12A 4OI2A 4Y4YA 3OPZA 5C9AB 5IATA 3K3OA 1RUF3 4GALA 5B4NA 1DQ4A 4FFHA 1DQ0A 5EQUA 2VY0A 4MG2A 2PN5A 4Q0QA 3S30A 2WNUA 1HB1A 4FQZA 4C0HA 4D69A 1YI7A 4MX3A 5DG1A 1OVPA 4CUAA 1CQ9A 1PM7A 3LAGA 2XL7A 2IXLA 1AL23 5LRRA 4YVSB 4EN6B 2KXLA 3NL1A 4I0WB 1ENQA 4W65A 1OOPB 3WG2A 3AC0A 2BNNA 3EXUA 3JB8A 4UW3A 5FK8A 4KNCA 3UKVA 5LWBA 2YBSA 3A0KA 3VZLA 2LTNA 3EMRA 4SLIA 1PGSA 4AEJA 1DP0A 4O9EA 1QDOA 2A1XA 2OYZA 4GXLA 2VR4A 2P3KA 4HANA 2VZ3A 4W6YA 4EN0A 1ULOA 4DEQA 1YI9A 2XVLA 3TWIA 3G7DA 2VCBA 2WZR2 4FQ4A 5FQ0B 2BGOA 4EWAA 1G86A 1JUIA 1O3SA 5C3OA 2WSVA 3R4DB 4LO5B 5JLVA 5LEJA 4QKFA 4RQPB 3FLTA 2VAUA 4YZ2A 2ZGNA 3WP3A 5BNPC 5G04L 5SV5A 2YBPA 2WS93 4IGQA 4Z1VA 2E33A 3ILNA 1GKBA 1OFNA 2A6ZA 5FPXA 1WKYA 1VBA1 2VULA 2DVGA 4LIVA 2NZ9A 3CJIA 2BBVA 2W94A 1RUH3 3RNSA 2EIBA 2JB4A 4Z2WA 1CAUB 5T54A 4ORFA 3VD7A 4M4RA 4PI0A 3M8LA 4LOTA 1E5RA 4UFIA 2F6BA 5LBCA 3I49A 3QD6A 4LULA 4AEKA 3KCXA 4K3UA 4A7ZA 4QGMA 4OYUA 5HCFA 1IZ3A 3A7QA 1IG0A 3KM5A 1W6PA 4ES8A 1CR7A 1H8TA 2BERA 3GBFA 1OA3A 5FY1A 1VMHA 4BQXA 1US2A 2WNVC 2ZABA 2ZGLA 3PTRB 3AKPA 2EIEA 1AYM1 2V4VA 1UKGA 2QQUA 3OEBA 3PL0A 5FLJA 5DZFA 4Y4RA 1AXZA 4GZ9A 2JIJA 2AREA 5FYTA 5BV6A 5AC92 3NAPC 2K0GA 4QX3A 4C1XA 1XU2A 5EHDA 1G9FA 5HPOA 4GWNA 4F83A 1GANA 5GJ6A 1LESA 4CUCA 3SITA 3ZMNA 4QU2A 1JXNA 4XQWA 3POSA 4RS5C 5FZKA 1CESA 2ADDA 2XG3A 4XURA 4CCKA 3LFIA 1H2KA 1ZBE2 1KFXL 5HCAA 5JSPA 3CNAA 3DKQA 2P3IA 1EV12 4KWKA 1CWPA 3JBG1 2GU9A 3BOWA 5IK4A 5F3GA 5IK5A 2NYYA 1PMHX 1XSQA 1L3JA 3JD72 1RUNA 1REDA 4NRMA 5BYNA 3R05A 2CL2A 2PLV1 4QQ2A 4FP2A 3VDAA 1HQNA 4XFIA 1QJFA 4UF0A 2ZGOA 3BYWA 4ARXA 5K7PA 1HJFA 1J3PA 3U0ZA 2QBXA 4GKXA 1O8PA 1V0AA 2UU8A 2VZRA 2PFWA 5FZEA 2UWCA 1JW6A 5A7WB 2PHLA 4A6SA 2OT7A 3C7OA 3LOBA 2PHWA 3W59A 3TAYA 3O1RA 4A7YA 1UIKA 1GNZA 5LY1A 1JOJA 1AL0G 1BVVA 2XDVA 3H3UA 2VOXA 1W9TA 2CSGA 4IV1C 5FMBA 1IGOA 1RUG1 3T30A 2CGPA 5IHRA 4I09A 5FK7A 2LW8A 3MPPG 3POYA 4OI4A 2RDQA 2WFPA 5ISLA 5T5OA 3WNXA 5C4WA 5FO9B 4V1PA 1URXA 1SLIA 2V4AA 1KJRA 2DBIA 1Y3TA 2G9ZA 3UKNA 2VQAA 1DLCA 4AVVA 2DU0A 2VQUA 5A70A 1UYZA 3MIDA 4LHKA 2DU1A 4AGGA 2VMCA 1HDKA 1OQDA 5IJRA 2VBDA 2J1AA 4Q8KA 4AZZA 1K3IA 2TEPA 2AUYA 3KGLA 2Z5WA 1RXFA 1GWMA 3HN1A 4KL1A 3VBRA 4HZFA 2OUHA 4CCMA 4EN8B 2EALA 3B9CA 2WO3A 2ZJCA 3ELNA 1W6QA 3IIAA 4QPGB 5A33B 5KHGA 3K75B 3POGA 5DXDA 2ARBA 2JG8C 5I0RA 4WM7A 3JD73 3ETPA 3Q8FA 1RUC2 2X29A 4N53C 1JYWA 1UY2A 2BNOA 1AR62 2OZ6A 1W9YA 2B4KA 2JDYA 1N3OA 5GZEA 3H3LA 1V9U2 3N7KA 4QB2A 2E26A 1H6YA 4LO4B 3O7OA 4LO8A 5F3IA 3CJXA 4BIOA 3RZKA 2DTYA 3KD4A 4PDWC 4LPLA 5FPAA 1B35A 4MV2A 4LKSA 5JSOA 1DZTA 3KLSA 4COYA 2OZJA 5FP8A 4AHWA 4LBQD 3ST7A 4NIDA 2A3XA 1ALYA 2D6LX 3ACFA 2VVEA 2Z79A 1GZ9A 2FDKA 3WW1A 1MVEA 3ZN6A 3AM2A 3LQCA 4G3YC 1NLRA 2VZVA 1IS4A 5FDBA 4RHV1 4NWVA 3NJVA 4BK4A 2W0XA 4IEXA 4M0NA 4LEJA 5FKBA 2ET1A 1YUDA 4JKMA 1TE1B 1C5IA 3D82A 2ZA9A 1SBEA 1UIJA 5F1RA 4CVUA 1VMJA 3IDEA 1RITA 4K40A 1YQ2A 5EZWA 5FY8A 4DPNA 2JE7A 3NVCA 1NUKA 1R082 1XRUA 5FXWA 4FAHA 5FZLA 1N1YA 4B1LA 3FL7A 3J4UH 2D43A 1KITA 5H9SA 2XJTA 4LXLA 3DYPA 1ZZCA 4AF9A 5JR7B 1SDDB 1SLTA 4XBQA 3I59B 2E9QA 1RUC3 3PVBB 2B39A 2SLIA 1GP4A 1CAVA 1AR63 1ODNA 3ZN4A 4QKDA 3GZTB 3THTA 1RUJ1 4WVMB 2RVAA 3C8XA 3LDKA 2A6VA 4XAAA 1V9U3 4N43C 4PT6A 3ZN5A 1FOD1 2RJKA 2RDSA 5LBBA 1W2UA 5I0UA 2CGOA 1D7PM 1T6GC 1Y9MA 3RGBA 1NA1C 3QLQA 5J1XA 4NO4A 4XFFA 2ZBJA 2DWRA 3VD4A 4XCAA 1JYNA 3OG2A 4QQHA 2QNKA 2RS32 4ISQA 4Q0VA 1KS5A 2E7QA 2J1EA 1Q3EA 3I2KA 2XONA 5IVEA 1Z7S1 4R4ZA 4Y20A 3HT1A 3ZFFA 2RM22 3K4AA 4RYDA 3HN3A 2J1VA 4XDQA 3LDBA 3M3IA 1W8UA 3CO2A 5CFDB 2O0OA 3V0AA 3FUQA 3KT4A 4Q0SA 4A45A 1G9CA 3RWKX 2Y6LA 5K8SA 2W46A 3S7EA 4CDQB 2IXIA 2VOTA 4OZXA 5JXHA 3SLIA 1W03A 1WMFA 4ZKTB 4KQ7A 3ILRA 3VL9A 1OBNA 2WNVA 2ZKLA 3SKJE 1NG0A 1PNFA 2PA7A 1R083 3CL1A 4XAEA 3VDDB 1LU2A 1DQ6A 1IHMA 3NAPA 3T1MA 2DFBA 4W6XA 1PGW2 3HNMA 1K5MC 4IESA 5BNNB 5KXEA 4I02A 3ZSMA 4OHXA 2HWE1 4YNIA 4IEOA 4N90A 5JCTA 1OF4A 5IK8A 5KC5A 5FXVA 2XHKA 2D98A 4ONUA 1OPMA 2QCSB 4X6QB 1QWRA 2I07B 1V6JA 2ZEXA 5FZBA 4H55A 5GZDA 1I5ZA 4RS5A 3RZGA 3AFKA 1VB2A 1J59A 3VHPA 4Q0PA 4Y5Z0 4E2SA 3TEYA 4PBOA 4Q29A 4LBQB 1WA4A 3MW4A 4YRDA 3V65A 1FMD1 2W1SA 4AQ2A 2EXIA 4MGQA 5FZFA 3WNLA 2WIIB 1X36A 2VM9A 1WZXA 3LF7A 4J6GA 5JXIA 4QT6A 3RSJA 4AI1A 4K9SA 2R041 3JXSA 3KF3A 3A21A 4GB31 3CF6E 4XF3A 1HB4A 1ULDA 2ET7A 3S5AA 2HWB2 2QQNA 3U10A 1WCSA 3T0DA 1FX5A 1MEC2 3PLQA 1RHI3 2ZX0A 4KWLA 4LBOA 1JI6A 2RM23 3AMPA 1O8SA 5FZCA 1IKQA 4URAA 2CGNA 2XBO2 2XUEA 5I93A 3E1F1 1E5IA 1BBT2 4V2WA 4CEYB 4Q8LA 3VBSC 5K9YA 3FHIB 4MZUA 2H6CA 4RGKA 3BN6A 4P9WA 4FFGA 4QXHA 4XXPA 2ES3A 1DZQA 2WWJA 4IV1A 2I2SA 1ENSA 4FTBA 4K8RB 1K42A 2BOIA 2IVIB 4IW3A 2ZGRA 4OUSA 4MH0E 2WFF1 1E5HA 3J8F1 4AVTA 1VBB1 2VO5A 1UPIA 1HJGA 1HIXA 5LASA 2X53S 4Y1XA 3Q8BA 3I97A 4BQ2A 3N4MA 3W21A 2ZACA 4QAWA 1VBE2 5FZ9A 3U75A 3WDVA 4BK5A 2QQMA 2HLEA 3KZ4C 3AL5A 1FPN2 4QGNA 1GYKA 1W0PA 3AMHA 2ZHNA 1O59A 4AFCA 3O0XA 4HT1T 4AGRA 1S0BA 4CCOA 2KA3A 5JIAA 4Y5SA 1RINA 3NNFA 5FY0A 1GQPA 1H2MA 2CAVA 4BB3A 4QB1A 1POQA 5IAVA 1D2QA 2OQ6A 4PLOA 3R4SA 5KR7A 3U11A 2ILMA 4FPEA 4W8JA 1NLQA 1AR81 3HIFA 3NW4A 2CTVA 2KR2A 4N53A 4CZSA 1T6BX 1ZRRA 5DAQA 3FX3A 1LOFA 3RMXA 1Q56A 5GZCA 3OUJA 4ASLA 3AP9A 2J42A 1MEC3 1J58A 2ZAAA 3POFA 1IQDC 2JDZA 2XBO3 4PDWA 4AI9A 1UX6A 1BBT3 4O61A 3MLLA 4LHLA 3TBDA 3J7NA 1TVGA 3MYXA 5A3TA 5LA1A 4LUKA 4Q4W3 3IDCB 1JZ2A 2P4EA 1W6PB 5J96B 3D3AA 1EV11 3B3QE 3MV01 4M3CB 5BUVA 1UOBA 2J1RA 3I2HA 4IEUA 3AX4A 2JXAA 5C7GA 2BFUS 1ZZ6A 1WMDA 2ZMKA 3MIFA 2OPKA 4AEDB 2XOMA 1EUTA 3ATGA 5EV7A 3UV9A 5SV8A 2ZKNA 1VRBA 2YU1A 4U2AA 1OFSA 4QWNA 3WQ0A 1OKOA 4PJYA 5E6HA 2JDUA 1SMVA 4AVAA 1FPN3 3J26N 4H2AA 1KRIA 4QM8A 1S55A 1XSRA 1YNAA 4TXWA 3PU3A 5JMOA 1NQDA 1MS8A 2EXHA 2HWD2 2DYCA 2Q5TA 4PBPA 5FPZA 3KHCA 4GIQA 3N3HA 2ZHLA 5CEHA 4QHOA 4C1WA 1AR91 1YQ8A 4EWDA 1WWYA 1IPJA 1LECA 2C24A 2WAOA 4XF1A 1NCQB 3WD5A 1A3KA 4FO9A 1RXGA 4CCDA 4DXTA 2GN3A 1C3HA 1S0FA 2RS12 1CIWA 4IQPA 1POV1 2B5HA 4LORA 4NHXA 4LBLA 2BFUL 1HXS1 3DPRC 2XVKA 3OBAA 4AAXA 3H8RA 3VKMA 4LKDA 3OBZA 2CNAA 1SPPA 2XJSA 4IE0A 3DXUA 3OYWA 5A7SA 1Q8SA 1V6LA 4RFT0 4EYUA 1NA1A 3I2GA 2WR9A 2YB7A 3UK9A 1YCIA 5FZIA 4HPKB 5EWSA 1J84A 2JE8A 3POWA 2UY8A 1JU4A 2YHJA 4KG0A 2ENRA 3RRDA 3ACHA 5HXMA 3BTXA 2B7YA 2Q1FA 1GQGA 1U5ZA 1PGL1 3OOXA 4W4ZA 5A1AA 4E27A 1GWLA 4ZPIA 4Z8BA 1NLSA 2Y64A 5FO8B 2HWF2 4XTMA 5T55A 1LR5A 1XYOA 1GFF2 4WM8C 5CKMA 2UWBA 1OF3A 3MFAA 4K1ZA 5DDJ2 4CTEA 3FUOA 2OA2A 5JIUA 5KXBA 1LHVA 3RI9A 2VW1A 3ZSLA 1KEXA 3E5QA 4QQPA 3U07A 3VKLA 3VBOB 5C33A 1BXHA 2J1SA 2AEYA 2JDNA 2QVSB 1BEV1 3AK0A 1SCSA 3H3ZA 1ENRA 1IQAA 2CHHA 2HWD3 1G7YA 2VG9A 4QB6A 2C26A 3V0BA 2QDNA 1E57A 3WT3A 4XFHA 3BB6A 4EE2A 3IPVA 2EF6A 2WA4A 3AVSA 4LLFA 5T5JA 3RQ0A 5KBFA 3RVHA 3DECA 1QY4A 4AYUA 1ACCA 3HWJA 4ZY9A 2Q1MA 1QNWA 2RS13 1X50A 1OA4A 1MR5A 3QH6A 3ZDSA 3ZOIA 4YSFA 4AVBA 1STMA 2ZAHA 1Z78A 3CQOA 5FY9A 1BMV1 2VMEA 4KU7A 1CPMA 2BTVC 1A8DA 3U4SA 4JRLA 1VR3A 2A71A 2MEV1 4J1XA 1W6MB 3B9IA 5I0SA 1IS5A 4XACA 5FBZA 4Y3OA 1EAH2 1SQ4A 3WDTA 4R8HA 4BQWA 1MQTB 3A4UA 1QNYA 3AJYA 5ACA2 1B35B 1K12A 3FBMA 4YFWA 3IBMA 4DFSA 5FXXA 1TEIA 2GC1A 2DVDA 3MLJA 2HWC2 4DNYA 4XUPA 4B29A 2JEMA 3CU7A 3WDYA 3ZN6B 3MDPA 4FFIA 2O1QA 3BGAA 2A6YA 2Y34A 2QQJA 2HWF3 4CU6A 4Q4X1 4ZZ8A 1QJU1 4P00B 1RVF2 2WWUA 3RZJA 1OT5A 3OPWA 3RS6A 1RUI1 4QPWA 5L7OC 5AVPA 1GV9A 3EQEA 2XJQA 5LA0A 2C0ZA 4CP9B 3PHMA 5FYMA 4NOTA 4XUQA 4YFZA 4G9SB 4FPCA 4V2VA 4HVRA 1LOEA 4K6BA 4QX8A 4CCNA 2VZUA 4IEPA 1VALA 1YFYA 3GHNA 4M4PA 4YG0A 5C8CC 3FFZA 3IMMA 3LIGA 1H4HA 1UOGA 2P5BA 5FWEA 1DF0A 5A1FA 3FHQA 4K8FA 1H2LA 1RJ8A 1TMF2 3IDAA 1BK1A 1R64A 5F5QA 1LB2A 3DYOA 1QDCA 1F15A 3KQRA 1GP6A 1RUG3 4XHBA 2YXSA 4DY3A 1HN1A 1WLTA 3VBHC 5EJZB 2HYKA 4B7EA 1YQCA 1Q8QA 4XF9A 1C1LA 5CKQA 5HV4A 1DQ1A 2AR6A 4JCKA 1BHGA 3WG1A 2BNMA 1F31A 1GLHA 1JMUB 4NHLA 1EAH3 2WSUA 3BOPA 4QHBA 2VNRA 3IAQA 2ETEA 5ACA3 4BYYA 1HN0A 2UYBA 2ZHKA 4XTPA 1PO22 5FXZA 4D0QA 4DEVA 5F9TA 4Y1ZA 4QPYA 5FYCA 4CXXA 1JOPA 2B46X 1AF9A 1HW5A 1JTZX 2HWC3 2PHDA 2TNFA 3JQXA 4R9BA 3U78A 3ZIWA 4ATEA 2ZXQA 1GBGA 1X9PA 4BH9A 1JZ7A 5JWPA 2YG0A 4Y22A 4CCJA 4UFMA 1AL22 1F2NA 1H1AA 4N9IA 1PO11 3ZFFB 5C3PA 3CZJA 3DEMA 3MLKA 3H42B 3QCWA 2ZX2A 4KG8A 1CJPA 1RVF3 5FR3A 4CDUA 3AZXA 4ZXEA 2GSYA 4M00A 4OI0A 4XFBA 1W6NB 3SH5A 5DAXA 1UKRA 3MFCA 2DVAA 1V70A 4JAAA 2WC2A 1JODA 3BU0A 4D94A 1GZTA 2BGPA 4FPJA 1V6MA 2JICA 3GCXA 4XJ9A 3B00A 3RPQA 5CAZA 2VUAA 4BQ3A 3NAPB 4ASMB 3WNOA 4JGZC 1NY71 2ID4A 2RS52 1XNDA 5FZ6A 3BKZA 1H9WA 1TMF3 3KCYA 4LTAA 3O1UA 1KQRA 2BW8A 5FZ8A 2WS92 2GN7A 2IXKA 4Q4Y1 2QFEA 3WF3A 2GZWA 4IDZA 4RS5B 2PYTA 2Y6FA 2ZX1A 3ECQA 3S0MA 4S2FA 4NWWA 2QE3A 1MS3A 1ZX5A 3SKVA 1OUXA 1L7RA 2R072 1CAXB 1ND3C 1RUH2 3I3BA 1OHFA 4GWIA 4X8PA 1YJKA 1JZ6A 5LA9A 4P9IA 3IZOA 5FLIA 1PO23 1DGRN 2PMWB 4GMP3 4Q27A 4JDMA 1QH7A 2O8QA 2IFRA 1GNHA 1OUSA 3ZSEA 1QOSA 1WLWA 3JZVA 3UYJA 1IPSA 3WSOA 5A3LA 1FT9A 4BQ4A 5JDBA 5DAPA 1W6OA 4YZ1A 1PIV1 3OJBA 5A7QA 4WZCA 1JH5A 4YG6A 3UGGA 2RDNA 1CJDA 1GU3A 2R7EB 4AQTA 1XNKA 5FV3A 1GZCA 3G6JB 1CGPA 4TLGA 1NXMA 4IV1B 4N7IA 5IK7A 3URFA 5L19A 4UYBA 4KGQA 1OURA 4TN7A 1FNYA 1V6KA 4JTOA 4FOWA 4MGIE 3P3PA 2VXJA 3KV5A 5EJ1B 4COZA 2D3PA 3DUIA 3B01A 4WM8A 5JPMB 1G6NA 2ADEA 4CP0A 1UQXA 2RS53 5JXJA 5T3NA 3PUQA 4PQQA 3PVEA 4QHZA 3VBUC 4AHYA 2BBAA 1UWWA 5IVYA 1O4YA 1UAIA 1HRV1 3AYDA 4COWA 4E9KA 3UNPA 3LZZA 2VZSA 3K3NA 1LGCA 1GOHA 2WZEA 3CLPA 3NSTA 2BPA2 2R073 1QJEA 2RHPA 3WDWA 3I3DA 3OY8A 4XEZA 2VMIA 2HJIA 3S57A 3I2IA 5JI7A 5A32A 2VZOA 4Q26A 2OKXA 4HVOA 1WLCA 2JKXA 3FE5A 4N53B 5F32A 3USUB 4JKKA 5HBAA 1AR71 3VZOA 4XFCA 3RJRA 4OULA 3AKSA 3OUIA 2W92A 1H6XA 1VAVA 2XJVA 2GMPA 5IVBA 3D0JA 4DUWA 4YGBA 5FMCA 5E89A 4BDVB 5DPNA 4XXAA 3VHNA 1YYNA 1ULGA 3UESA 3ZXLA 2FZ2A 2LUWA 4CDXC 4AI2A 1UY1A 2B42B 2MNGA 1F4AA 4YW4A 2WRAA 1DCSA 1MZFA 2R061 1O3TA 3H50A 4H7LA 3T2TA 1NKGA 3I3QA 5JMCA 2A75A 5FYYA 4IE7A 1WLDA 4NR1A 3IAPA 4JV4A 3WNNA 2WZPP 2ATFA 3HVDA 4IE4A 2JECA 2YPJA 2YGLA 4P9XA 1QGLA 3GJAA 1YEWA 4MUVA 4NRPA 4JHTA 3VZMA 4ET7A 1PMJX 3VV1A 3ZFGC 3GF6A 4O9GA 3AZVA 4CCLA 2D5HA 2G19A 4GB33 2GNMA 4GH4C 4B4RA 5CFCC 2G9FA 5JOXA 3B94A 3PIJA 5DMYA 3F95A 2W9XA 3MPBA 2XJUA 1CPNA 1D4M1 3WW2A 4EV0A 4YW3A 1CONA 1OMIA 5I0DA 1OA2A 5J3UA 1H30A 3C3VA 1LAJA 3AP6A 4RR3C 3V64A 3GDBA 3THCA 2RMU1 2GNBA 4Q4V1 5D8AC 4RFRB 4B8EA 2R49A 4QQLA 2R0FA 1H1MA 2D93A 2WQ8A 1PZ7A 1AJOA 3VBHA 3PURA 4XDOA 2RJ2A 3OYWB 2WFF3 4LIUA 3VLBB 3WCRA 5K4LA 4YGCA 2ARCA 2C9KA 1VBB3 3ROUA 2VL4A 4PQ9A 4F3JA 4A2UA 1UY4A 4TWTA 4AFBA 5EIYB 1QOTA 3WP6A 2WBKA 3I54A 2XHNA 5LW9A 1COV2 2HYXA 3PU8A 5FYSA 1H8VA 1PNGA 1E5SA 2JKBA 1BJQA 3T08A 2VTXA 4YVSC 2VECA 3VGIA 4D7YA 2BU9A 1RUE1 1OOPC 4AE2A 3U1XA 1EPWA 2JDPA 2WAAA 4GJZA 4LQRA 1OI6A 3WY6A 3E6BA 4AFMA 1KS4A 4XILA 3WF0A 2JWPA 3GZEA 1MS9A 2WNOA 4AR2A 3T4HB 1UZWA 4YARA 2Y60A 3UKTA 3R0RA 2R1BA 5JZGB 3P1IA 1Q8VA 3J9SA 3NJYA 5FIXA 3N7JA 2Y6JA 4PCRA 1VBC1 3SC7X 2FCTA 3V0BB 3D6EA 4RQPC 3ENRA 1UX7A 3KS7A 1QJX1 4BCUA 3M70A 4A6OA 3IPVB 3R4UA 4D7TA 1LHNA 5DAVA 5FPVA 4BJ0A 4JGZA 2VUCA 5B4XA 2RG4A 4CDWA 5A6ZA 2CU5A 3Q8CA 4AK3A 5DUWA 2DF7A 5FYVA 4CEWA 5ANNA 1LNSA 1QOOA 2D7FA 5L36A 4XC9A 5FPBA 2D44A 2A73B 4IV3B 3WDXA 1UZVA 1JYVA 1YIFA 3OUHA 2WL1A 1F5FA 1ZBA2 3KT7A 4LK6A 4A3ZA 4UW6A 5HV0A 3WG4A 1RMU1 2LRPA 3EB7A 3D4KA 1R1A1 1QQP1 1NT0A 1IG3A 1ND3A 4AQ6A 4DRVA 5CKNA 1HRI2 2W1WA 1XPWA 1T2XA 2A3YA 1COV3 2ZGTA 3LEGA 4RSUA 3AKTA 1QKQA 3TYJA 1RUD2 2TUNA 4UW4A 2B9UA 1UZ0A 2FBEA 1I3HA 3LA3A 2E6VA 4YW2A 5GLTA 4HN0A 4IEQA 2JE9A 4HONA 5K0UB 1CAWA 3NJZA 4PF5A 2BRTA 1RL3A 1NCRC 2ZMNA 3ZXJA 3UJQA 4PHZA 1YFUA 2VC9A 4UWDA 1C57A 4BOWA 1AYN2 4YM0A 2NLRA 1W99A 3ZXDA 1BKZA 3SEPA 4N7UA 5FY5A 4ISRA 5F2WA 4NE9A 2GMEA 1PVC1 3NO8A 3AYEA 1KJLA 3LGRA 4JDOA 1ND2C 1DGWX 1FV2A 1N1SA 1ZZ9A 3PMSA 4HK9A 2VCMA 5CVRA 2ZCWA 4LBKA 3IDBB 1JZ4A 2O8OA 1RUF1 1ZRFA 1XYPA 1EUUA 4YW1A 1XBFA 5CNAA 2B9VA 1OD3A 1Q8PA 1VBD2 2HBTA 4ATFA 5JOWA 2YPDA 2JG9C 2H6BA 1YQ5A 3TN91 3PTYA 1UN1A 1X9TA 3S5QA 2VNOA 4JQTA 4LKFA 4L92A 4XE9A 4XMAA 1DLLA 1UY0A 4TLFA 5BNPA 4Y5TA 1S4CA 3VBUA 3ON7A 4QKNA 4A42A 3M4FA 3T3YA 2W68A 2QZ3A 2W39A 4NIAA 2WYFA 1NXD1 3B93A 1ZBA3 2QQPA 3KB5A 4DY5A 1MZ5A 4MXWB 5BNOC 3CDZB 1NX9A 1VRH2 5F3EA 3E6CC 2MPFA 4OHWA 1B09A 3EJKA 3WVJA 5AFEA 1G9BA 4ES9A 2D6PA 4TSVA 5HCBA 4NPMA 4A4AA 1ASJ2 1HRI3 1RHI2 1XB9A 2CWMA 3AYCA 3MF6A 1C8M2 2NM1A 3LD8A 3VZNA 1RUD3 5CG9A 4MADA 1UOJA 2YGMA 2PAEA 1QF3A 1JOBA 4LE3A 1S2BA 4KU8A 1PX4A 2LM3A 4Y22B 4AI3A 5D1IA 5A6QA 1AYN3 3WDUA 1S1AA 1QJY2 3RYRA 4XABA 3F2ZA 5I0TA 2XGXA 1S0DA 3POBA 4CDUB 3BPSA 3ZYBA 4MOAA 4CDXA 1G9AA 2PHTA 3O1TA 1BYHA 2X5IC 1PZ8A 4JRAA 4FTEA 5T5PA 3VKNA 4NPRA 2VQTA 2D97A 4WZFA 1PK6C 4FPHA 3T1LA 4IL7A 4HKOA 4YGEA 3VL8A 5C5UA 4NIGA 3AP7A 2RR12 1ULCA 2OIIA 2JDMA 3SMHA 4BM8A 1VBD3 3ZMOA 1Q43A 2HEYF 2Q4SA 4A3XA 2RE9A 4YZ5A 4DUXA 3WP4A 3UGHA 4GWMA 3HAGA 5FP9A 3VD5A 3WV6A 2XPJA 4NRQA 3C7EA 1LHOA 4IEWA 2XJRA 1J1TA 3AMQA 4N8MA 3BUCA 1DDLA 1AX2A 3ZFGA 4L9BA 3TEZA 1LCLA 3T2PA 4GH4A 2LS6A 4NROA 5BXXA 1LOBA 3AMMA 5CFCA 4BA6A 2EAKA 2VZPA 2XMLA 3OEAA 1VRH3 2Q8DA 1VP6A 1R092 2QQVA 1UPSA 1UZZA 1ZNPA 1DHKB 4HMZA 2AZ5A 4LITA 1Y9GA 3HOBA 1BZWA 1YFWA 4Z07A 5JOZA 1DBNA 1ASJ3 1DFQA 4MGYE 3A22A 4RR3A 2JJ6A 4YW7A 1C8M3 2WZR1 5ABJC 5D8AA 2HKXA 4BXFA 2CDPA 2WNUB 4L11A 1SFNA 4ZONA 5FREA 1UXZA 2RV9A 3MHZA 2FDGA 1NOVA 2UY9A 4M3CE 4Q4W2 2K2SA 5T5LA 4Y1VA 5FZ0A 1W6OB 4FXKB 3HNBM 2AC1A 1A78A 4NPLA 1QJY3 1TME2 5IVVA 1KGYA 3DCQA 5FZ4A 3GNEA 3X29B 1AXKA 3AL6A 3SISA 3T4VA 4LO7A 2VGDA 4LNVA 5IFTA 2F4LA 3OGGA 4ITCA 3ZXGA 5FYBA 2Y0IA 1AX1A 2Q8OA 1LJ7A 1XNAA 2RR13 2Z42A 3KV4A 3HBZA 1NE4A 4AVCA 1KD7A 1OLME 2XUMA 4B3NA 1YQ6A 3ZSKA 5B2GB 2NMNA 3BPZA 1POV0 3HQUA 1DYOA 4BLIA 4IGPA 3WF4A 1MVQA 4Z82A 1XNTA 4XUTA 2WDBA 2JDHA 5FZOA 2Y38A 3CBNA 2IC1A 2D3SA 2JG8A 2ZPXA 5FQ0A 4R52A 3BI3A 3PUIA 4ZS2A 3M7AA 4META 5KHKA 4XFAA 1W9WA 1NAEA 3DYMA 5I8TA 5T52A 3BIWE 2BVVA 4YM3A 1JBCA 3H7YA 4RQPA 5A7OA 5AC91 3BTAA 3AP5A 2KD7A 1R093 3CJIB 3MICA 3D8CA 4GQ7A 3OY8B 5GLVA 5I91A 5A32B 5DZEA 3ZXFA 2RJLA 1CX4A 3LIHA 4FBFA 5C5TA 1OH3A 4P9JA 4ZZ5A 1ZBE1 1AVBA 1WA6X 2VBBA 2DUQA 3LEIA 1FAYA 3LSDA 4R9CA 3DXTA 1O5UA 3MBWA 2WO7A 1H8TB 3ZLIA 5KHIA 1M4WA 4P9GA 2VZQA 4KBBA 1TME3 1UMHA 3IMNA 1BCXA 3OD0A 1CN1A 4HXCA 3JD71 4YZ4A 5ANQA 4C90A 3MW2A 3MGUA 1D0HA 5EJ3A 5FUNA 5FZAA 3RYKA 4W6WA 2QQKA 2CY6A 3AYAA 4Y24A 4CDQC 2AGSA 2WJSA 4LBNA 4YPJA 4X6RB 2ZX3A 4Q4Y3 5ERLA 4LA2A 1JYCA 1NCRA 2BEOA 2I74A 1O5LA 1W06A 3ZXAC 3POEA 1VBA2 5DG2A 1J1LA 3VDDC 3ES1A 3WF1A 4Y1UA 5H9RA 2QUOA 3ZPYA 2AEZA 3HD8B 4FPLA 4UT5A 4EZ4A 2YUEA 1YJLA 1VPHA 1ND2A 2VZ1A 4RGGA 2ZGUA 1OLQA 3RDIA 5A3WA 1RYYA 3S7IA 3T0BA 5FZHA 3ZYIB 2PQQA 1XJAA 2GC2A 4KWUA 5IAXA 2PXJA 3WW4A 4EQVA 4AOCA 1LOGA 2JG9A 5FY7A 4UF0B 3ILFA 3P5BA 4QXBA 3WUCA 3ZYHA 4N43A 3N9LA 2WN2A 1AYM2 1F9KA 1NZIA 1UNBA 3H7JA 4XZPA 4QD2A 3K2OA 2VZTA 2WT2A 4JDNA 1PX3A 1TQ5A 3DGTA 2VBPA 1ULFA 4QGLA 1X8EA 1GZWA 3GALA 5J48A 5L73A 3I8TA 3VBHB 2XWJB 2OX0A 3DV8A 5BNOA 4R9DA 2WA3A 5IW0A 4OFGA 4AQSA 1UYPA 5KHHA 5A7WA 4MHRA 3NNMA 2P3JA 3LSEA 4CEYC 3WUDA 1RUC1 2NMOA 4HKWA 5FP4A 3L9JT 1RC6A 5C4WB 3USSA 2YFZA 1AR61 4K20A 4XFGA 4DOUA 1H1IA 3JBG2 1DYPA 2P1BA 3WW3A 4CE8A 1V9U1 2ZGSA 4BWOA 5A3NA 3N9MA 1VBA3 2PQSA 5FUPA 2PLV2 5DABA 1QXJA 4FP3A 3O0VA 4LR4A 4JHZA 4CSWA 3ZXKA 5F3CA 5F39A 3WQ1A 1W6QB 5FPLA 2W91A 2X5IA 2J22A 3I4IA 3D5OA 2FDHA 3FHAA 3H9AA 2ZEZA 1K5MA 2GC0A 4E2QA 1HKDA 4WM7B 1PK6A 3CHXA 4FCAA 1ST8A 2SBAA 3QOPA 3W5NA 4Q0UA 5D2AA 5FZ1A 4OQ9A 5F8PA 1Y7BA 4UI9L 3GBGA 3GM8A 4JZRA 2N7GA 3O14A 4JGYC 5GALA 1MZEA 1RUG2 3APBA 3TOJA 2GNDA 1JN2P 1TNRA 4JGZB 5D21A 4CDWB 4E4HA 3N35A 4CEWB 1AYM3 4QX7A 3RYPA 4LLOA 4LMFA 5FWJA 1I1EA 3ZXEA 2EXKA 3MO4A 4PLNA 4AVSA 3JQWA 1WD3A 4S2DA 1R081 4I30A 4XHXA 5KXCA 3MUZ1 4QPIC 5F5AA 4QX0A 5FMDA 4CCEA 4IERA 4SBVA 3NMBA 2NN8A 2C1FA 2JX9A 5HXVA 1ND3B 4OUMA 5FYUA 1IPKA 3ZFEC 5JXGA 4I3PA 3SCGA 2J1TA 1UMIA 4MYEA 4CXWA 3CEWA 1YO8A 5EFUA 1N47A 4RD7A 5E8AA 1ZA7A 1Y9QA 5ABJA 5FKCA 2DDUA 3VUOA 3JBG3 3VBSA 3ASIA 4ZU7A 1W90A 3WINE 2FCUA 3FLRA 2D6OX 1XOYA 3ZPOA 4HKLA 3P6BA 1AX0A 3IT8A 5J09A 2PLV3 4TTGA 1KXGA 4AEDC 2VVFA 2W47A 3QACA 5LRSA 4BXSV 3U14A 1D4M3 2OUJA 2C4XA 4P9LA 1LOAA 5FCCA 5A6XA 2RS31 3OGJA 3LOIA 3UGFA 3N7MA 1SLLA 4COVA 2JIGA 4P5YA 2RMU3 5CU1A 5JUVA 1SHWB 4Q4V3 5KHJA 3CZUA 3FC0A 4LHNA 1G9DA 2JDKA 4FSJA 1W3VA 4OHYA 2KM2A 1RHI1 2RM21 4BISA 1CAVB 2PHFA 2WKKA 4LO6B 3UJOA 1W8ZA 1CX1A 3KF5A 5LATA 3POJA 1NCQC 3K46A 2DCTA 1UL9A 3AMNA 3O5SA 4CU9A 2EIGA 5BNPB 1W8HA 1WUVA 4RHV2 3IKWA 2E63A 2AENA 2X09A 4D6SA 5IFPA 5A7NA 2IWGB 2JDAA 1W0NA 3A23A 3MI8A 4UXAA 4AFAA 3SCFA 1ZRCA 1PGW1 4FOYA 4K21A 3QH7A 5JOYA 5CG8A 3JUUA 2P34A 2CYFA 2BUKA 3E6DA 4Y20B 3VKOA 5FTTC 1KFUL 1PMIA 2IZWA 1W2AX 1ULEA 1Y4WA 1L7LA 3K4ZA 4YVWC 1AHSA 3V0AB 1W8NA 3WLUA 4NUBA 4P02B 3NKTA 1ENXA 5GM0A 3TEXA 4G4FA 4QDSA 1UU6A 5GLWA 4L8QA 1W8OA 2ZEWA 1VAKA 2E53A 3FJSA 4QDQA 2IXJA 1D2SA 5A6YA 4ARYA 3VZJA 1W39A 3LDRA 2WNVB 1RUJ2 1VIWB 5G05L 5C3QA 5F7UA 1FOD2 3ZX7A 4N9HA 1WD4A 1VB4A 1RUOA 2CAUA 1S2EA 4UBGA 1LODA 1JHNA 3VBOC 2XKOA 4GJYA 4I0AA 2HWB1 3KHBA 3VBRC 3FLPA 4WVWA 1MEC1 2IXCA 2VW0A 2WUHA 4XJZA 3T09A 3N36A 3ZYPA 4M01A 4NVPA 3DN7A 2IXHA 2XBO1 4LOSA 3VDDA 1BBT1 1QH6A 1QQP3 1YC61 1V6NA 2VUJA 4XDPA 4XJ8A 4QXCA 3T2QA 3ZVXA 1BVP1 4MHUA 1Z7S2 1RJ7A 5GLZA 1JYXA 5GKAC 3KGZA 4RHV3 2EAAA 4Q2FA 1WCKA 4Z92B 3OGVA 1S0JA 1SZBA 5EXOA 1GNYA 3ZKUA 4UBHA 3NWKA 3GXUA 4AI8A 1O4TA 2FMYA 5CFCB 3DPRA 5FAXA 5CISA 1LGNA 4YW6A 1F5JA 1SBDA 5FYHA 1UCXA 1VBE1 4H7MA 5C70A 4JX0A 1MQTC 4HVQA 3C7GA 2D6MA 4RR3B 1FPN1 1KDKA 2F17A 4JTNA 2ORXA 2Q8CA 2OW4A 1C8NA 3E5UA 1LEMA 1PVC3 4LJHA 5D8AB 2X10A 4CUBA 5JVVA 3GJBA 3I7DA 3PJQA 1AJKA 2HWE2 4KMQA 5I8SA 2FDFA 2V09A 3AKRA 5H9PA 4GAZA 1EYBA 2W95A 1K45A 2JD4A 2E51A 1RUJ3 2TBVA 2VH9A 5FYIA 2CDOA 3VDCA 2WN3A 1PZ9A 3TN93 3WZ1A 4CEYA 1WMEA 4HSLA 5LEKA 2VOWA 2DV9A 5E16A 1FOD3 3VBFC 3I2FA 4YM2A 1WW4A 1WW7A 4QU1A 2OS2A 4WVVA 4YG3A 5FY4A 2QQOA 3ES4A 1FNZA 3A0NA 3AFGA 4UAPA 1FMD2 3SEEA 4AW7A 3V56A 1HV1A 1SFPA 2WO1A 4MXVA 3E97A 1J3QA 4XJWA 5C71A 5JAXA 1PVXA 2R042 1LEDA 4GB32 4NJ4A 1N1VA 1NE6A 3SHRA 3H8OA 4RL7A 1D0GA 5KXDA 3VDBA 1Z7S3 3KSCA 5FZOB 2VCAA 2JG8B 4B1MA 4MVTA 1WW6A 2Y26A 1LTEA 1U0AA 4GULA 2Z2SB 1LHWA 1GOFA 1FATA 1XE0A 2G1MA 4C91A 2Y6HA 4AG4A 3NQHA 1GMMA 4XETA 5IVFA 4AXOA 4EROA 4JGYA 4C0BA 4DMIA 3ZKYA 3O1PA 1RB8G 5EP9A 3I2DA 4XF4A 3ZYFA 5FJHA 4AWDA 2D3RA 2WFF2 3J8F2 1DGLA 1YRZA 1EPZA 1VBB2 4NHYA 1XNBA 5CB7A 5JI9A 2ARXA 2AYHA 2ZZQA 3RG0A 4E4ZA 4PDWB 3VN4A 4U36A 2C6SA 2HWD1 3J7HA 2XR4A 4J1WA 1YWKA 2HWE3 4QPIA 5FOBB 3LEKA 4IGOA 4INDA 4QX1A 3ZM8A 1HV0A 3ZFFC 2YY1A 2AH2A 2QZ2A 2ZX4A 3H1YA 3WCSA 3ZFEA 2GALA 1W8TA 2A7AA 5T50A 4BHPA 4BPZA 5FZ7A 1W8WA 2L9LA 3C7FA 4AHZA 1N3PA 1GR3A 2RS11 5APAA 3BODA 4AFDA 2B8MA 2IUWA 1GP5A 2OQ7A 2Y33A 5CADA 2ORZA 5J7MA 5HCHA 4M3CA 2WQZC 5L7OA 1SCRA 1OXCA 4OMCA 1SFYA 1UU4A 1FMD3 4WV8A 4TZDA 5IT6A 1NCRB 4Y1YA 3WX5A 1AR82 4FVVA 3THPA 2XB6C 1V00A 4R9AA 3MW3A 5J98B 2R6QA 5FPUA 1W0OA 3HJRA 4MGZE 4AEDA 2R043 4FPGA 4DZGA 3M3EA 1S2KA 2O14A 1UXXX 4PF1A 2YYOA 3C7HA 3TNPB 5C8CA 1ODMA 2ZZJA 1ND2B 3P3NA 4HK8A 2WO2A 2A70A 2WZR3 3AJZA 5M0TA 3VD3A 4QX5A
chains in the Genus database with same CATH topology
3GBWA 2EXJA 2ZS6B 4FPOB 2E7TA 2HWF1 1LULA 4MGKE 4GKYA 2JG9B 1APNA 1SEFA 1ZVFA 2VW2A 3HR9A 3GZUC 4Y26A 5J37A 1NCQA 4I01A 4XYXA 5DDJ1 5C9AC 2A3WA 4N43B 3J8F3 4ZXKA 1NA1B 1ZM1A 2WT0A 1GZWB 2G9GA 3WG3A 1O7FA 5BNOB 3WQ7A 2DCKA 2XWBB 4HPKA 4BIFA 3AZZA 3GZAA 3TRSB 3HT2A 3W58A 4XPVA 4BQ1A 4YVWA 4FTSA 5EYYA 1OKQA 1AR92 3ZIXA 3JB4C 2BQPA 3HMYA 4I0BA 3ZO0B 2R32A 1AR83 4LUMA 4COUA 4GMP0 1IOAA 4HL0A 1HXS2 5AC93 1EAH1 3E5XA 1V6OA 2MHFA 5ACA1 1LRHA 4P5HA 4IEYA 3SCHA 3ETQA 2BWCA 2X5IB 4ZU4A 2YC0A 2HWC1 1K5MB 1MS4A 3VBOA 1PK6B 4M0HA 3ZYGA 1RIRA 5CBLA 5F6KA 3PNAA 2D5FA 3BCWA 4FPFA 1ZBE3 3BALA 4RGAA 2BGCA 2ZGPA 3NV3A 1RVF1 1EV13 1FI2A 1PGL2 3W9AA 4LBJA 4B7KA 3SXWA 3SH4A 2P2KA 4M3CF 4AGVA 3UL2A 1VLNA 4YYOA 4MSVA 3SH3A 4R4XA 1H0BA 1LOFC 3AXDA 4FT8A 1J3RA 1DU3D 3RZZA 2DCZA 1QXRA 1F8VA 1W6MA 1U5XA 3LKJA 2PHXA 3PVOA 2UWAA 3AKQA 1MS0A 1BEV2 1MQTA 1TMF1 1UD1A 4F7ZA 3EHKA 2WQ4A 5ABJB 1DQ5A 1AR93 2WINB 5LK5A 3VHRA 4DQAA 3VBSB 1VJ2A 1JYIA 3D0SA 1I6XA 1POV3 5DUVA 3VKFC 1QU0A 2YZ4A 3JU9A 4FPYA 1HXS3 2GH2A 1Q5OA 1WW5A 1BMV2 1BQPA 4XBNA 2H0BA 1PO21 2XL9A 4GMP1 3IWZA 5FO7B 3VBFA 2MEV2 2C9AA 1U12A 1SLAA 2ZGKA 4CRQA 3LB9A 1AL21 5FFOC 1CD3G 1H4GA 2V73A 2Y0OA 4CYDA 4B4QA 1AZDA 2XLFA 4XF0A 3RMYA 4XMIA 1GQHA 2G4IA 2ZMLA 1LHUA 4YW5A 5CIRA 4Q4X2 1X82A 1QJU2 3AB0A 1MS5A 1YHFA 3NV2A 1Q8OA 5CA6A 1RUI2 5JSRA 4WBBA 1PHMA 4BE3A 2RS51 1UMZA 4YM1A 3S6PA 1A8MA 1QJZA 1BEV3 1CVNA 3O0WA 1H2NA 3WXPA 4EWEA 4MLOA 2WS91 2VMHA 3MIGA 4L97A 4E2GA 1DG6A 4I3GA 3KMHA 2R071 2XJPA 1RUH1 3M2MA 2DURA 2Q0AA 1S0IA 1C28A 4FOVA 3OBTA 1AXYA 2XLGA 1HQLA 4QPGC 2MEV3 1W6NA 2R1DA 1REFA 1O91A 5JZGC 3QBQA 5BNQA 1G8WA 1U5IA 2D6KA 4HSJA 3M3QA 3RI8A 3R6SA 2NPIA 2VOKA 2WNEA 1JUHA 1LU1A 1UF2C 2A6XA 4IETA 4KWJA 3DKWA 4IV3C 1PO12 1WGPA 2PHRA 4Q4X3 1QJU3 2NP0A 2VMGA 4HETA 1RUI3 4NN0A 4QM9A 3DPRB 3GYDA 3WR0A 1CAXA 2DVFA 1IKPA 3LWCA 5C9AA 1DYKA 4JVAA 4P9YA 5AVAA 1SLCA 3RWNA 2RS33 2GDFA 4KH9A 4OHZA 3EBRA 5K0UC 1NY72 3AZYA 3VHOA 2FZ1A 2K9ZA 4YVSA 4LE4A 4Q4Y2 3OTFA 1C5HA 3GHMA 1YIPA 2VXRA 1OOPA 1LENA 3IM0A 4FPKA 1DIWA 3PMEA 1YLLA 2JENA 1M06G 3AP4A 4WM8B 1SDWA 2EVXA 4S2HA 1C1FA 2PTMA 3LCPA 3OF1A 4EJRA 1QXPA 1OQEA 4PIZA 1RGSA 1YFXA 4GA9A 3FBYA 3K51A 5KC6A 1XXNA 1EY2A 1D4VB 4IEZA 1O4ZA 1MS1A 1ZZ8A 3IN9A 2A6WA 1PO13 2ZHMA 1PIV2 3B69A 1EP0A 4P14A 1GICA 1SBFA 4JGYB 2Z69A 4TYSA 2DFCA 2FQPA 4K1YA 1XU1A 2VNGA 4UW5A 2Q1ZB 1CAUA 1MZ6A 1C4RA 2ZGQA 1LKNA 1O3QA 3WP5A 4EN7B 3USUA 4NHMA 4XJAA 3C2UA 2PAMA 3ACLA 1ZREA 5CFDC 4LT5A 3WOGA 4AHXA 1GSLA 4QPIB 2HWB3 3OCPA 4B4PA 4L99A 5E88A 2DCYA 3ZFEB 1HRV2 3WHUA 1MACA 4CDUC 5A3MA 2I45A 2VPVA 4PLMA 1WBFA 4XIKA 5BY5A 1HX6A 2LALA 3NV1A 4JQRA 5C6CA 1OLRA 3HQXA 5L7OB 5BNNC 4A7KA 1S0GA 3M3CA 1NZCA 3K48A 3M1HA 5FOJB 5DUUA 3ZSJA 2BVBA 3MIBA 1AR72 2WLQA 3MEPA 1COV1 1IS6A 1LGBA 2WLPA 1FYUA 1SLBA 4WVZA 1VBE3 5C8CB 1VAMA 1LOCA 4LA3A 2YDEA 3AZWA 2PHUA 1UZYA 1PIV3 3SNMA 4OHVA 5DUXA 4CP1A 3OD4A 1XQNA 2IFWA 3FMGA 2R062 2VQ0A 4PIYA 4F8AA 4NHKA 1V6IA 4CP2A 1XYNA 1REEA 3H0OA 3ZYRA 1S0EA 2WNUC 3TB0A 1ZZBA 1ONAA 4K7JA 2XH6A 1OPOA 4YGDA 1U5YA 1HRV3 4I2OA 4BLJA 3VZKA 4YVWB 2R16A 4S2GA 1D4M2 2QKDA 4XQDA 1ZBA1 4D3WA 1TNFA 1UU5A 2RMU2 1DQ2A 5C8WA 4Q4V2 4DRRA 2E7AA 3H1MA 2XVGA 5AFBA 1AR73 1HRI1 4XOGA 3KT1A 4EN9B 5I8YA 1RUD1 2GC3A 4QPGA 3M3OA 5A33A 4HBNA 5IUQA 3DL3A 5KWRA 5JZGA 3INAA 4YLZA 1WCDJ 1AYN1 2DCJA 2R30A 2OVUA 5FRAA 4PIXA 4BZ4A 5FMOS 3CJIC 4FOQA 2R063 3ME2A 1SACA 4AI0A 1RUE2 3FZ3A 1R1ZA 2EA7A 4QQOA 4IV3A 2DTWA 3ZYJB 3JCIA 4IEVA 2H0VA 3LA7A 1VBD1 2GNTA 2PAKA 3BU7A 4H14A 1H8TC 1CAWB 1DGWA 1ZA4A 2P37A 3OBRA 1IS3A 2D6NA 4HLTA 1O3RA 3B5LB 5GZGA 1S0CA 3B02A 1VBC2 4ZU5A 4URTA 1QJX2 2XKPA 2NQYA 1HLCA 3EO6A 1X7NA 4RA0A 5K0UA 3WHTA 5FMOL 4D7SA 5F6LB 1OD5A 1QMJA 1VRH1 4Q1RA 4QXKA 1N3QA 2BYVE 5GLUA 1OSGA 4YZ3A 3TNQA 4OI1A 2W08A 2XLAA 1ASJ1 2GAUA 2VU9A 4XBLA 5FLHA 1ZZ7A 3KCCA 2ZGMA 1C8M1 5DDJ3 4BMBA 4JC1A 3VBFB 4X8NA 1RMU2 5GZFA 1UW8A 1R1A2 1QQP2 4DXZA 4Q1PA 1X8MA 4XW3A 4HFSA 3I59A 3VBUB 1XNCA 1XE8A 1HQWA 3L2HA 1X33A 1QJY1 2VOVA 1DZRA 2YV8A 1NQJA 2X8KA 2BWAA 2ZOEB 2F4PA 4WVMA 5JPNB 2GH8A 1RUE3 2ERFA 3N7LA 3MZHA 1Y43B 2DUPA 2WT1A 1KDMA 3DF0A 2WWSA 2FHRA 1DGRA 2RR11 3H8UA 4DINB 2B45X 3FWEA 1PVC2 3AXEA 4DB5A 4MXWA 2DVBA 3PVNA 3MIEA 2A5ZA 3B7MA 2HEVF 4BMEA 2UURA 3L2YA 5BPXA 5J36A 3NV4A 1A6CA 1WBLA 2VVDA 4OLLA 5LK7B 1RUF2 1ZRDA 1AUYA 3ALQA 1VBC3 5E1RA 2R0HA 5C4WC 1I9RA 1Z0HA 1QJX3 2CV6A 2GMMA 4AEMA 4XIOA 5CFDA 4E4SA 3TN92 2P17A 3NKGA 4FAGA 2Q30A 4FXGB 4H3WA 2HEWF 4LBMA 4CDXB 4XJUA 4CDQA 2V5YA 1XE7A 1R091 2C5DA 3LA2A 4HN1A 1OQ1A 1N1TA 2CWSA 1NYWA 5TSWA 3MIHA 5H9QA 1FXZA 1RMU3 1R1A3 2FMDA 5BNNA 2QJVA 4WM7C 3MF9A 4Q4W1 1QHDA 2ZTNA 5EYXA 1YXWA 3Q9OA 2PELA 2QDRA 1TME1 3ZFGB 4IXLA 4GH4B 4CDWC 4CEWC 1RTVA 3RJ2X 1ZYBA 2D40A 2YROA 3PJYA 4LBQA 2UYAA 4OVEA 3FFQA 1FV3A 4DS0A 4KGGA 4QMAA 1B35C 1H9PA 4E4DX 3H1WA 5DZGA 2YMZA 2W52A 4L2NA 2DUOA 4XQ4A 3O12A 4OI2A 4Y4YA 3OPZA 5C9AB 1RUF3 4GALA 1DQ4A 1DQ0A 2VY0A 2PN5A 4Q0QA 3S30A 2WNUA 4FQZA 4C0HA 4D69A 1YI7A 4MX3A 5DG1A 1CQ9A 1PM7A 3LAGA 2XL7A 2IXLA 1AL23 5LRRA 4YVSB 4EN6B 2KXLA 3NL1A 4I0WB 1ENQA 4W65A 1OOPB 3WG2A 2BNNA 3EXUA 3JB8A 4UW3A 3UKVA 4KNCA 3A0KA 3VZLA 2LTNA 4SLIA 4AEJA 1PGSA 4O9EA 1QDOA 2OYZA 4GXLA 4HANA 2P3KA 4W6YA 4EN0A 1YI9A 2XVLA 3TWIA 3G7DA 5FQ0B 2WZR2 4FQ4A 4EWAA 1G86A 1JUIA 1O3SA 2WSVA 3R4DB 4LO5B 5JLVA 5LEJA 4RQPB 3FLTA 4YZ2A 2ZGNA 3WP3A 5BNPC 5SV5A 2WS93 4Z1VA 3ILNA 1GKBA 1OFNA 2A6ZA 5FPXA 1VBA1 2VULA 2DVGA 2NZ9A 3CJIA 2BBVA 1RUH3 3RNSA 4Z2WA 1CAUB 5T54A 4ORFA 3M8LA 2F6BA 3QD6A 4LULA 4AEKA 3KCXA 4K3UA 4A7ZA 4QGMA 5HCFA 1IZ3A 3KM5A 1W6PA 4ES8A 1CR7A 1H8TA 3GBFA 1OA3A 2WNVC 2ZABA 2ZGLA 5FLJA 3AKPA 1AYM1 1UKGA 5DZFA 1AXZA 2AREA 5BV6A 5AC92 3NAPC 2K0GA 4C1XA 1XU2A 1G9FA 4GWNA 4F83A 1GANA 5GJ6A 1LESA 3SITA 3ZMNA 4QU2A 1JXNA 4XQWA 3POSA 4RS5C 1CESA 2XG3A 1H2KA 1ZBE2 1KFXL 5HCAA 5JSPA 3CNAA 2P3IA 1EV12 4KWKA 3JBG1 2GU9A 3BOWA 5IK4A 5IK5A 2NYYA 1L3JA 3JD72 1RUNA 1REDA 5BYNA 3R05A 2CL2A 2PLV1 4QQ2A 4FP2A 1HQNA 4XFIA 2ZGOA 5K7PA 3U0ZA 1J3PA 4GKXA 2UU8A 2PFWA 2UWCA 1JW6A 2PHLA 3LOBA 2PHWA 3W59A 3TAYA 4A7YA 1UIKA 1GNZA 1JOJA 1AL0G 1BVVA 3H3UA 2VOXA 4IV1C 2CGPA 1IGOA 1RUG1 4I09A 3MPPG 3POYA 4OI4A 2WFPA 5T5OA 3WNXA 5C4WA 5FO9B 4V1PA 1URXA 1SLIA 1KJRA 1Y3TA 3UKNA 2VQAA 4AVVA 2DU0A 3MIDA 4LHKA 2DU1A 4AGGA 1HDKA 1OQDA 4Q8KA 2TEPA 2AUYA 3KGLA 2Z5WA 3HN1A 4KL1A 4EN8B 3VBRA 4HZFA 2OUHA 2EALA 3B9CA 3ELNA 2ZJCA 5KHGA 1W6QA 3IIAA 4QPGB 5A33B 5DXDA 2ARBA 2JG8C 5I0RA 4WM7A 3JD73 1RUC2 2X29A 4N53C 2BNOA 1AR62 2OZ6A 1N3OA 5GZEA 1V9U2 3N7KA 4LO4B 3O7OA 4LO8A 3CJXA 4BIOA 2DTYA 3KD4A 4PDWC 1B35A 4MV2A 5JSOA 1DZTA 3KLSA 4COYA 2OZJA 4AHWA 4LBQD 3ST7A 2A3XA 1ALYA 2D6LX 2VVEA 2Z79A 1GZ9A 3WW1A 1MVEA 3ZN6A 3AM2A 4G3YC 1NLRA 1IS4A 5FDBA 4RHV1 4NWVA 2W0XA 4IEXA 4M0NA 4LEJA 2ET1A 1YUDA 1TE1B 1C5IA 3D82A 2ZA9A 1SBEA 1UIJA 5F1RA 3IDEA 1RITA 4K40A 5EZWA 4DPNA 2JE7A 3NVCA 1R082 1XRUA 4FAHA 1N1YA 3J4UH 2D43A 1KITA 5H9SA 2XJTA 4AF9A 1ZZCA 1SLTA 4XBQA 3I59B 2E9QA 1RUC3 3PVBB 2B39A 2SLIA 1CAVA 1AR63 3ZN4A 3GZTB 3THTA 1RUJ1 4WVMB 2A6VA 1V9U3 4N43C 3ZN5A 1FOD1 2RJKA 1W2UA 5I0UA 2CGOA 1T6GC 1NA1C 3QLQA 4NO4A 4XFFA 2ZBJA 2DWRA 4QQHA 2QNKA 2RS32 4ISQA 4Q0VA 1KS5A 2E7QA 1Q3EA 1Z7S1 4R4ZA 4Y20A 3HT1A 3ZFFA 2RM22 4XDQA 3M3IA 3CO2A 3V0AA 5CFDB 2O0OA 3FUQA 3KT4A 4Q0SA 1G9CA 5K8SA 4CDQB 3S7EA 2IXIA 4OZXA 3SLIA 1WMFA 4ZKTB 4KQ7A 3ILRA 3VL9A 2WNVA 2ZKLA 1NG0A 1PNFA 2PA7A 1R083 3CL1A 3VDDB 1LU2A 1DQ6A 1IHMA 3NAPA 3T1MA 2DFBA 4W6XA 1PGW2 4IESA 1K5MC 5BNNB 5KXEA 4I02A 3ZSMA 4OHXA 2HWE1 4YNIA 4IEOA 4N90A 5JCTA 5IK8A 5KC5A 2XHKA 2D98A 4ONUA 1OPMA 2QCSB 4X6QB 1QWRA 2I07B 1V6JA 5GZDA 4H55A 1I5ZA 4RS5A 3AFKA 1VB2A 1J59A 3VHPA 4Q0PA 4Y5Z0 4E2SA 4PBOA 4Q29A 4LBQB 1WA4A 3MW4A 4YRDA 3V65A 1FMD1 4AQ2A 2EXIA 2WIIB 1X36A 4J6GA 4QT6A 3RSJA 4AI1A 4K9SA 2R041 4GB31 3CF6E 4XF3A 1ULDA 2ET7A 2HWB2 3U10A 1WCSA 1FX5A 1MEC2 3PLQA 1RHI3 2ZX0A 4KWLA 4LBOA 2RM23 3AMPA 1IKQA 2CGNA 2XBO2 5I93A 4CEYB 1BBT2 4Q8LA 3VBSC 5K9YA 3FHIB 4MZUA 2H6CA 4P9WA 4XXPA 2ES3A 1DZQA 4IV1A 2I2SA 1ENSA 4FTBA 2ZGRA 4OUSA 4MH0E 2WFF1 3J8F1 4AVTA 1VBB1 1UPIA 1HIXA 2X53S 4Y1XA 3N4MA 2ZACA 1VBE2 3WDVA 3KZ4C 1FPN2 4QGNA 1GYKA 1W0PA 3AMHA 2ZHNA 4AFCA 3O0XA 4HT1T 4AGRA 1S0BA 2KA3A 5JIAA 1RINA 1H2MA 2CAVA 1D2QA 4PLOA 3R4SA 3U11A 2ILMA 4FPEA 1AR81 3HIFA 3NW4A 2CTVA 4CZSA 4N53A 1ZRRA 3FX3A 1LOFA 3RMXA 1Q56A 5GZCA 4ASLA 3AP9A 1MEC3 1J58A 2ZAAA 2JDZA 2XBO3 4PDWA 1UX6A 1BBT3 3MLLA 4LHLA 3TBDA 3MYXA 4LUKA 4Q4W3 3IDCB 5J96B 1W6PB 1EV11 3B3QE 4M3CB 5BUVA 4IEUA 3AX4A 2JXAA 2BFUS 1ZZ6A 1WMDA 2ZMKA 3MIFA 2OPKA 4AEDB 3ATGA 5EV7A 3UV9A 5SV8A 2ZKNA 4U2AA 1OFSA 3WQ0A 4PJYA 4AVAA 1SMVA 1FPN3 3J26N 1KRIA 4QM8A 1S55A 1YNAA 1NQDA 1MS8A 2EXHA 2HWD2 2DYCA 2Q5TA 4PBPA 5FPZA 4GIQA 3N3HA 2ZHLA 4C1WA 4EWDA 1AR91 1IPJA 1LECA 3WD5A 4XF1A 1NCQB 1A3KA 4FO9A 2GN3A 1C3HA 1S0FA 2RS12 1CIWA 4IQPA 1POV1 2B5HA 4LBLA 2BFUL 1HXS1 3DPRC 2XVKA 3VKMA 2CNAA 2XJSA 3OYWA 1Q8SA 1V6LA 4RFT0 1NA1A 3UK9A 1YCIA 4HPKB 5EWSA 3POWA 2UY8A 2YHJA 4KG0A 2ENRA 3RRDA 2B7YA 1GQGA 1U5ZA 1PGL1 4E27A 4Z8BA 1NLSA 5FO8B 2HWF2 4XTMA 5T55A 1LR5A 1XYOA 1GFF2 4WM8C 2UWBA 3MFAA 4K1ZA 5DDJ2 4CTEA 3FUOA 2OA2A 5JIUA 5KXBA 1LHVA 3RI9A 2VW1A 3ZSLA 3U07A 3E5QA 4QQPA 3VKLA 3VBOB 5C33A 1BXHA 2QVSB 3AK0A 1BEV1 3H3ZA 1SCSA 3VBRB 1ENRA 1IQAA 2HWD3 1G7YA 2VG9A 3V0BA 2QDNA 1E57A 3WT3A 4XFHA 3BB6A 3IPVA 2EF6A 2WA4A 5T5JA 4LLFA 3RQ0A 5KBFA 1QY4A 4AYUA 3HWJA 2Q1MA 1QNWA 2RS13 1X50A 1OA4A 1MR5A 3QH6A 3ZDSA 4YSFA 4AVBA 2ZAHA 1Z78A 1BMV1 4KU7A 1CPMA 2BTVC 1A8DA 4JRLA 1VR3A 2A71A 2MEV1 4J1XA 1W6MB 3B9IA 5I0SA 1IS5A 5FBZA 1EAH2 1SQ4A 3WDTA 4R8HA 1MQTB 3A4UA 1QNYA 3AJYA 5ACA2 1B35B 3FBMA 4YFWA 3IBMA 4DFSA 1TEIA 2GC1A 2DVDA 3MLJA 2HWC2 4DNYA 4B29A 2JEMA 3CU7A 3WDYA 3ZN6B 3MDPA 2O1QA 2A6YA 2HWF3 4Q4X1 1QJU1 1RVF2 3RS6A 1RUI1 5L7OC 5AVPA 1GV9A 3EQEA 2XJQA 2C0ZA 3PHMA 4NOTA 4YFZA 4G9SB 4FPCA 4HVRA 1LOEA 4K6BA 4IEPA 1VALA 1YFYA 3GHNA 4YG0A 5C8CC 3FFZA 1H4HA 1DF0A 4K8FA 1H2LA 1RJ8A 1TMF2 5F5QA 1BK1A 1LB2A 1QDCA 3KQRA 1RUG3 4XHBA 2YXSA 4DY3A 1WLTA 3VBHC 2HYKA 4B7EA 1Q8QA 4XF9A 1C1LA 1DQ1A 2AR6A 4JCKA 3WG1A 2BNMA 1F31A 1GLHA 4NHLA 1EAH3 2WSUA 3BOPA 4QHBA 2VNRA 5ACA3 2ETEA 4BYYA 2UYBA 2ZHKA 4XTPA 1PO22 5F9TA 4Y1ZA 4QPYA 2B46X 2HWC3 1AF9A 1HW5A 1JTZX 2PHDA 2TNFA 3JQXA 4R9BA 3ZIWA 4ATEA 4BH9A 1GBGA 5JWPA 4Y22A 1AL22 1F2NA 1H1AA 4N9IA 1PO11 3ZFFB 3MLKA 3QCWA 2ZX2A 4KG8A 1CJPA 1RVF3 4CDUA 3AZXA 2GSYA 4M00A 4OI0A 4XFBA