2HWF2

A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
253
structure length
253
Chain Sequence
DRIMQITRGDSTISSDDVANAVVGYGVWPHYLTPQDATAINKPTQPDTSSNRFYTLESKHWNGSSKGWWWKLPDALKDMGIFGENMYYHFLGRSGYTVHVQCNASKFHQGTLLVAMIPEHQLASAKHGSVTAGYKLTHPGEAGRDVSQERDASLRQPSDDSWLNFDGTLLGNLLIFPHQFINLRSNNSATLIVPYVNAVPMDSMLRHNNWCLVIIPISPLRSETTSSNIVPITVSISPMCAEFSGARAKNIKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 1A COAT PROTEIN (SUBUNIT VP1)
publication title A comparison of the anti-rhinoviral drug binding pocket in HRV14 and HRV1A.
pubmed doi rcsb
source organism Human rhinovirus 1a
total genus 43
structure length 253
sequence length 253
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hwf200
5JZGA 5JZGB 2PLV3 1EV12 2RM21 1BEV1 4IV3C 1R1A2 1TME3 2RR11 5AC91 2WZR3 3TN91 1WCDJ 3DPRA 1W39A 1AL22 3DPRB 5CFDA 1HRI1 5CFDB 1FMD3 1F2NA 4Q4V1 1RUJ1 4CDQA 4CDQB 1RUG3 2WS91 1QJX1 1NOVA 5C8CA 5C8CB 2RS52 3VBSA 3VBSB 1FPN1 1ND3A 1BEV2 1RHI1 2RM22 1ND3B 2RM23 3JBG1 3ZFFA 3ZFFB 1X33A 2RS32 1HQNA 1RUE1 4JGZA 5BNPA 4JGZB 1AR71 5BNPB 5AC92 2RR13 5AC93 1X36A 3TN93 5FOJB 1HRI2 1C8M1 3VDDA 2WWSA 4Q4V2 3VDDB 1HRI3 1MEC1 1RUJ2 2MEV3 1NCRC 4Q4V3 1RUJ3 2WS92 1QJX2 2WS93 1TMF1 4N43C 2DF7A 1FPN2 1HXS2 1Z7S3 5DDJ2 1FPN3 1VBC1 3JB8A 1RHI3 3JBG2 1NCQC 1PGW1 3VBRC 3JBG3 2R072 4Q4Y3 4QPIC 1RUE3 1FOD2 5K0UC 1B35C 1AR73 2VQ0A 1HRV1 4CEWA 1RUD1 4CEWB 1MEC2 3HAGA 3VBFC 1C8M3 1AR81 1AR61 1RUC2 2R061 1TMF3 1BBT1 2HWE2 1AYM1 4CDUC 1PO21 1VBB1 2PLV1 1VBC2 2X5IC 3ZFEC 1VBC3 2R041 1K5MC 2Y26A 1H8TC 4WM8C 4N53C 4GMP0 1RUF2 1C8NA 1SMVA 1HRV2 1RUD2 1HRV3 2WZR1 3IDEA 1VB4A 1AR83 1RUH3 1VRH2 1AR62 4Y5Z0 3S6PA 1AR63 4CEYC 2R062 1BBT2 1NY71 2R063 1BBT3 1AYM2 3CJIC 2RMU1 4BCUA 1CD3G 1AYM3 1PO22 1QJU3 2PLV2 1PO23 1VBB3 2R042 5D8AC 1NCRA 1NCRB 2FZ1A 2R043 1BMV1 2HWF1 4RR3C 1AYN1 4N43A 4N43B 4CDXC 1PGL1 2BFUS 1TME2 1AL0G 2WZR2 5FMOS 1A6CA 1QQP1 1V9U3 2QQPA 4JGYC 3LOBA 1POV0 4NWVA 1FMD2 1NCQA 1NCQB 1RB8G 1ASJ1 3VBRA 3VBRB 4QPIA 1AUYA 2MEV1 4QPIB 1QJZA 4QPGA 1NY72 1RUG2 4QPGB 5K0UA 1B35A 5K0UB 1B35B 4PDWC 2RMU2 4LLFA 4RS5C 2RMU3 3VBFA 3VBFB 3M8LA 1D4M1 1BMV2 1R081 1Z7S1 1NA1C 1VBE1 2HWF3 4Q4Y1 1PGL2 1AYN3 5A33A 2BPA2 1ND2C 5A33B 5ACA1 4CDUA 2RR12 1QQP2 4CDUB 3TN92 1QJY1 1QQP3 2X5IA 3ZFEA 2X5IB 4NWWA 4RHV1 3ZFEB 4IV1C 1ASJ2 1K5MA 4RFT0 2MEV2 1ASJ3 1H8TA 1K5MB 1H8TB 4WM8A 5C4WC 4WM8B 1EAH1 4N53A 2HWC3 4N53B 2BUKA 1PIV1 3JD71 5BNNC 1IHMA 1R082 1Z7S2 1D4M3 3VBUC 3VBOC 1R083 1RHI2 1PVC1 1COV1 1VBE3 4Q4Y2 4CEYA 4CEYB 1RUE2 4FTBA 5A32A 5A32B 4RQPC 5ACA2 1AR72 3CJIA 3CJIB 5ACA3 1QJY2 4AEDC 1QJY3 5D8AA 4RHV3 1C8M2 5D8AB 1EAH2 1RUH1 4IV3A 4RR3A 4IV3B 4RR3B 1EAH3 2ZTNA 1GFF2 4Z92B 3ZFGC 4CDXA 1VBA1 1OOPC 1RUI1 4CDXB 4WM7C 1TMF2 1PIV2 4JGYA 1PIV3 3JD73 4SBVA 1QJU1 1MQTC 4Q4W1 2ZZQA 4GB31 5L7OC 1PGW2 2FZ2A 1PVC3 1COV3 4EJRA 3NAPC 1POV3 2WFF1 4PDWA 5BNOC 4PDWB 4YVSC 5J98B 4RS5A 4FSJA 1PO11 4RS5B 1VBD1 2BBVA 4Q4X1 5CFCC 1V9U1 1NA1A 3FBMA 3J8F1 1AR82 1NA1B 1RUH2 4GH4C 1HX6A 4JGZC 1VAKA 4Y4YA 1VBA2 1RUI2 1VBA3 1ND2A 1RUI3 4YVWC 1ND2B 2TBVA 2WLPA 1EV11 1QJU2 4IV1A 4Q4W2 4IV1B 1VBB2 4GB32 5LK7B 1R1A1 4Q4W3 4GB33 5C4WA 2GSYA 5C4WB 2WFF3 1AL21 1VBD2 1PO13 1F8VA 1OPOA 1VBD3 4Q4X3 4CDWC 1V9U2 3VBUA 1VB2A 3VBUB 5C9AC 2GH8A 3J8F3 2BFUL 2ZAHA 5FMOL 4RQPA 1E57A 4RQPB 4CEWC 2HWC1 2RS51 4AEDA 4AEDB 1EV13 5GKAC 1M06G 1R1A3 2RS31 4GMP1 2HWF2 3ZFGA 3ZFGB 1OOPA 1OOPB 4WM7A 1AYN2 4WM7B 3ZXAC 1AL23 1RMU1 2IZWA 3VBHC 1MQTA 1MQTB 5L7OA 5L7OB 2HWD1 3NAPA 3NAPB 5BNOA 2HWC2 5BNOB 4YVSA 4YVSB 5ABJC 1HXS1 5DDJ1 2RS53 2RS11 3JB4C 5CFCA 1BEV3 5CFCB 5J96B 2R071 4GH4A 1D4M2 4GH4B 2RS33 1FOD1 4FTSA 1VBE2 4GMP3 1CJDA 4YVWA 1R091 4YVWB 1POV1 5JZGC 1RMU2 1RMU3 2XBO1 1RUC1 4RHV2 1NG0A 1QJX3 2HWD2 2HWD3 4FTEA 2HWE1 1AR91 2RS12 3DPRC 1HXS3 4CDWA 5DDJ3 2RS13 4CDWB 2XPJA 5CFDC 3JD72 5C9AA 4JGYB 5C9AB 2R073 4QPGC 4CDQC 1FOD3 1PVC2 1COV2 1ZBE1 1RUF1 1R092 5C8CC 1R093 1MEC3 2XBO2 1RVF1 1VRH1 3VBSC 2XBO3 1ND3C 1RUC3 1ZBA1 3ZFFC 2HWB1 1OHFA 5BNPC 2HWE3 1AR92 1AR93 3VBHA 3VBHB 3VDDC 1DDLA 1ZBE2 1TME1 1ZBE3 1RUF3 2WFF2 1RUD3 5ABJA 5ABJB 1RVF2 1PO12 1FMD1 1RVF3 4Q4X2 1VRH3 5BNNA 1ZBA2 5BNNB 3VBOA 1ZBA3 3VBOB 1RUG1 2HWB2 3J8F2 2HWB3
chains in the Genus database with same CATH superfamily
4F3JA 3BALA 4FVVA 1DQ5A 4NUBA 4CZSA 1TG7A 4AFDA 2WKKA 1YCIA 2AENA 1CONA 2C26A 5HXMA 4QB6A 1I9RA 3AP4A 1BEV1 4IV3C 3O0WA 4META 3POGA 3KVAA 4Y5TA 1URXA 1UNBA 3H7JA 4KWUA 3H1WA 3NNFA 5AFBA 1V0AA 2CV6A 2WZR3 4RA0A 2VOXA 3A21A 1WCDJ 5FZIA 3SLIA 4AVSA 1OT5A 1AL22 1RL3A 2GNDA 5IFPA 4EWEA 5FP8A 1XU1A 5CFDB 1FMD3 3I4IA 4K20A 1F2NA 3GHMA 4Q4V1 4NHKA 4NRMA 4FPFA 1RUJ1 3CIHA 3BU0A 2QQOA 1UL9A 3RZGA 2ZKNA 2E6VA 2XHKA 4CDQB 2WWUA 3I3EA 4IE6A 1F5FA 1LGBA 1UCXA 3OPTA 3DKWA 3D0SA 1BVVA 4O61A 4RGKA 3TRSB 5C8CA 1HV0A 1CAVA 1IPKA 1T6BX 2VL4A 1US2A 4UW5A 4R8HA 3VBSA 3UESA 4UWDA 1CPMA 2SLIA 3UT0A 1V00A 4KMQA 1UOJA 2BGPA 2WNEA 3CL1A 4R52A 5C3PA 4C0HA 1WW4A 3BTAA 5C6CA 2RS32 1HQNA 1WLCA 3AYCA 4JDNA 3IAQA 4RN5A 1OLQA 3OEAA 4JGZB 2VVFA 1AR71 3B7MA 5AC92 4NHYA 1HN0A 3H3UA 1Q8VA 4PLNA 1X36A 2WYSA 2VZUA 4XFHA 5F3GA 5FOJB 2WWJA 5J09A 1HRI2 4BZ4A 3MW4A 2ZX3A 1MEC1 5GZFA 1NCRC 1MZ5A 4YGCA 4EN6B 5FZ7A 1WBLA 1ZZCA 4LO4B 4BWOA 3AKRA 2HYXA 1QJX2 3USUB 3WQ0A 1IPJA 2WS93 2WZEA 2J1TA 1UW8A 1UZYA 1RITA 4P5YA 1V6MA 2XKOA 4YNIA 1AXYA 1OBNA 4K6BA 1FPN2 2FQPA 2GC2A 4QDRA 3SHRA 4OQ9A 5KBFA 1BJQA 5IVVA 2IWGB 3PVBB 2BJSA 2B45X 2R072 5EFUA 4UF0B 1FOD2 1G9AA 2FCTA 1QJEA 3NV2A 3R4UA 4QKFA 1H6YA 4MXWB 4YFWA 1UKGA 3WNPA 3AZYA 1JZ5A 2YGMA 1QOSA 4GA9A 3U78A 1NZIA 4XFCA 1GP6A 3EO6A 4UBGA 2YUEA 5C71A 5BNQA 5GLVA 2YMZA 1UOGA 5C33A 4BQWA 2G9ZA 1CJPA 4P9XA 4Q8LA 3ZOIA 4XIOA 1H1MA 4KH9A 3LQCA 5FUPA 3N36A 4AI2A 4D7TA 5FY8A 1TMF3 1BBT1 3U0ZA 3RMYA 2C0ZA 3WY6A 3LZZA 2VOTA 4E4SA 2ORXA 1SLCA 1WBFA 4AI3A 3WW1A 1SZBA 2VBDA 1UY2A 4AOCA 1L3JA 1VBC3 2YROA 2XONA 2ZGQA 1K5MC 2NYYA 1H8TC 1PZ7A 3DECA 2ZHMA 2CY6A 3MICA 2WINB 5FZ6A 2Y8KA 3FJSA 5FZFA 2W1SA 4NIGA 2HBUA 4BLJA 4F7ZA 3OYWA 4FQZA 2Q30A 1DZTA 1C8NA 3JCIA 3OOXA 1RUD2 2FMDA 4IESA 2PHWA 2WZR1 1ZM1A 5FO7B 1E5HA 4R9BA 1VB4A 2L9LA 2CGOA 2Y6HA 3LFIA 5FQ0A 1AR62 4Y5Z0 3UL2A 5FUNA 1RC6A 1B09A 1MS9A 1PM7A 1NY71 1XU2A 1EPZA 2R063 3S30A 2ZS6B 4QD2A 1Y9GA 4NJ4A 3L2YA 2A6WA 4HK9A 4O9GA 2W08A 2RMU1 2VMIA 3CJIC 3VKOA 3B93A 4MHRA 2OZJA 5L9BA 3KWVA 4FP3A 2DYCA 3VHNA 1NE6A 5D8AC 3WNNA 2X8KA 2A6XA 3M3OA 2BNMA 2FZ1A 1UY4A 5SV8A 3C7EA 4L11A 3IN9A 1BHGA 3PDQA 2W1WA 1N3OA 2JKXA 1H2MA 4N43A 1JYXA 5A7WB 4BXSV 4CDXC 4INDA 1XPWA 4JAAA 4HG6B 4LBOA 1WA6X 1YWKA 1W6MA 4L97A 1A6CA 1QQP1 3MIDA 4JGYC 1POV0 4NWVA 1KFUL 2JDYA 2VXRA 2P3IA 4DY5A 4IGQA 1ASJ1 2EF6A 3AL6A 4BQ3A 3VBRB 4QXBA 3ROUA 4QPIB 5FZOA 3O1TA 1WA4A 2Y6JA 1RUG2 4QPGB 2CSGA 3RJRA 5K0UB 1HB1A 4F83A 2JX9A 2WT2A 3LDKA 1TNRA 3AC0A 4HSLA 3J4UH 3GYDA 3AZXA 2OZ6A 4LLFA 4PI2A 4RS5C 5FLJA 3VB9A 3WF0A 5LBCA 2FCUA 1HV1A 5T54A 2WR9A 2YG0A 3K48A 1NA1C 4AVAA 1WD4A 2JDPA 2JDHA 1JYNA 1Z78A 4MGKE 1QOOA 4G4FA 5FKCA 2XMLA 1V6NA 1AYN3 2QQIA 4ATFA 5I91A 2BPA2 1ND2C 5A33B 2VVEA 4XABA 4LBQB 5FRAA 4C90A 4ZS2A 4CDUA 4EQVA 2A1XA 1UIJA 1WCQA 1ZZ8A 5DABA 1NKGA 3ZFEA 2X5IB 3C7HA 3H1MA 1EP0A 3MIFA 4NWWA 5FP3A 3WG1A 3FHIB 5JXJA 3MLKA 2B39A 3AMHA 5C4WC 2BOJA 5LRSA 3AX4A 2NM1A 2JB8A 4Q26A 3WDUA 1W8HA 4XQDA 2C5DA 1SFYA 5T3NA 3ZYJB 4E9KA 2HWC3 4K7JA 1SLIA 2JDAA 2W1QA 2BUKA 3C2UA 4YM2A 4BOWA 1XE0A 4DEQA 2JD4A 1IKPA 4YPJA 1RJ7A 1YQ5A 3I49A 1Y3TA 5BNNC 5KXEA 1OF3A 4MGSA 2D3RA 1Z7S2 4IE4A 3VBUC 5FYSA 3VZJA 4M4PA 5A7QA 1COV1 1SQ4A 1VBE3 2ERFA 4CEYA 2VULA 1NQJA 2RE9A 3M1HA 5FCCA 5JPMB 2OA2A 1YIFA 3GZEA 1AR72 4IE0A 5L9VA 3V0AA 1O4YA 3JUUA 4KWKA 4FFIA 5LA9A 4AEDC 1QJY3 3BTZA 4CXXA 4EWDA 1WMEA 1DQ2A 2VXJA 4KI5M 1DHKB 3LSDA 3AXEA 3POYA 1ULGA 3WW3A 2VCCA 4IV3A 4QDSA 3WF4A 1D0HA 1EAH3 2WN3A 5LB6A 4OHZA 4DY3A 3H1YA 1SDDB 4UBHA 5H9SA 1PIV2 3MZHA 1AF9A 1UX6A 5I8TA 3NO8A 4J1WA 3KHCA 2IC1A 3ZYIB 5A3WA 5IK5A 5FYYA 2ZZQA 4BQ1A 5CU1A 5L7OC 1ZRFA 1DYPA 1PVC3 3WT3A 1W03A 1POV3 5KXCA 4UFKA 1HB4A 4K8RB 4ASLA 4HK8A 2BBVA 2VZRA 2QQNA 4JZRA 1UXXX 2OX0A 3GF6A 4QQHA 1GNZA 5CFCC 4IEPA 3T2QA 3MV11 3O1UA 5GLUA 2XJTA 3LEKA 1RUH2 4P9IA 4FI9A 2GNMA 1PK6C 2PHTA 3JZVA 1O59A 5DZGA 1KQRA 1W90A 3VHRA 3T0AA 2EAAA 5EQUA 1RUI2 3ES4A 4A41A 1OLME 1SEFA 1Q5OA 1VBA3 4XAAA 2WNVB 4NAMA 1S0GA 4QGLA 2UY9A 2E7TA 3ORJA 4YVWC 1DP0A 4HKWA 5IVFA 4E8DA 1EV11 2WLPA 2J1SA 3W20A 3MGUA 4Q1RA 4Q4W2 4IV1B 3M70A 1J1LA 4Q1PA 2PAEA 4AI8A 2ID4A 2BGOA 4C91A 1PZ9A 2MHFA 4GB33 3UJQA 4PIYA 1DLCA 3PTRB 1VJ2A 2PA7A 5DAWA 4J25A 2PMWB 1OVSA 3WP4A 1O8PA 1MS1A 3PNAA 1VBD2 3MIBA 1BCXA 5KXDA 4Z82A 3IZOA 4Y1XA 2Q8OA 4Q4X3 1V9U2 1ZVFA 4QX8A 1UWWA 5FLIA 1XBFA 1XXNA 1YFYA 2ES3A 1GWMA 2VW1A 5FPLA 3RG0A 5DUXA 3J8F3 2VMHA 1WLDA 3IMMA 5JI9A 1Y7BA 2QQJA 5LBEA 4YFZA 3LOIA 5FMOL 4FPEA 1ZRRA 4RQPA 3HT1A 4BMBA 4DZGA 4HPKB 2D44A 3CDZB 2H0BA 5DAVA 1Q8SA 2HWC1 3NV4A 4GIQA 2VZOA 4D7YA 4CEWC 1AXZA 5A6YA 2R30A 1ULFA 2ATFA 1SBEA 1LTEA 4FOQA 5FZ0A 4QHOA 2Q0AA 4UYBA 2YDEA 3ENRA 4LXLA 5I0TA 4K9SA 1M06G 4OI0A 4FPLA 4YW7A 1GQHA 1CR7A 4P9WA 3ZFGB 2EXIA 2WDBA 4YZ5A 4XYXA 2ZEXA 4M3CA 2ZGOA 4TN7A 4XFBA 1AL23 3H8XA 2F4PA 2Y6GA 3OGVA 2WNUA 2ADDA 2BQPA 2WA4A 4UW4A 4AVBA 3N7KA 4JRAA 4GKXA 1V6IA 2OVUA 2DBIA 1I1EA 5FZAA 3NAPA 4Y22B 3V0BA 5BNOB 2CHHA 5CBLA 3WXPA 3I7DA 1YQ8A 1HXS1 3E6DA 2D7FA 5DDJ1 5E1RA 2RS11 5LASA 5LA2A 2AC1A 4XJWA 4EV0A 2EIEA 4QDQA 1GOHA 1QU0A 1W8OA 2GNBA 3LA3A 4CVUA 1W6PB 1X8EA 4GH4A 1GANA 3LKJA 2D5FA 2CAUA 2RS33 5JIAA 3ZYBA 2K2SA 1SCSA 3E5QA 4WZCA 3VHPA 1LESA 1M4WA 1H2LA 3CLPA 4K3UA 1MZEA 4XUTA 3WNOA 4WVMB 5KR7A 1GV9A 3SNMA 1R091 4S2DA 2XJSA 1POV1 4JV4A 5DZEA 1RMU2 4JKLA 3OUHA 4Z8BA 1JYWA 4AL9A 4LKDA 4IEUA 4LBQD 4YZ2A 1QF3A 2XR4A 2YC0A 3ECQA 2A3WA 5I0DA 1YNAA 1XYOA 3C7FA 1GR3A 1QJX3 2HWD2 4WV8A 2DCZA 4XVHA 2O1QA 4Y1YA 5C5UA 1UZWA 1Z0HA 2P3JA 1U0AA 4OZOA 5DG2A 1O4TA 3VKMA 4B4QA 2Y33A 3KSCA 1ENRA 5DUWA 2KA3A 4COYA 1EUTA 2VBPA 1L7RA 2XVGA 4Y5SA 5JSPA 1FV3A 4XJ9A 2WRAA 2BWAA 4CDWA 4DFSA 2XPJA 2ET7A 2UU8A 3H8RA 2WSUA 2W2IA 3I2HA 5C9AB 1Q3EA 2R073 1G7YA 2JG9B 2AEYA 1MZ6A 1FOD3 5FYCA 1COV2 1JMUB 5GZGA 1KJLA 1T6GC 4A42A 5C8CC 5ANQA 5C3QA 1MACA 2YPDA 1H2KA 3ILNA 3PUIA 4IETA 4BK4A 4YM1A 1SG3A 1LEDA 1VRH1 2ENRA 4LJHA 3KHBA 4YW1A 3VBSC 3J9SA 1YJKA 5FTTC 3VGIA 3RZMA 1I5PA 1UIKA 1UPSA 2W46A 3AJYA 3NQHA 5D1IA 2HWB1 5F39A 5T5JA 4QB1A 3EJKA 2XG3A 1F35A 5TSWA 3KQ4B 2GN7A 1JODA 1JOBA 1LHWA 3OUIA 3POIA 3VDAA 3HOBA 1OQ1A 2BDRA 5JPNB 3TEWA 1BXHA 1SFNA 4QM9A 3HQRA 4YW6A 4CU7A 5C3SA 1H4GA 1BQPA 1ZBE2 1OQDA 1ENSA 4JX0A 1C5HA 1TME1 1F31A 1G9CA 4W65A 5CYYA 3WHUA 4GKYA 4YM0A 1RUD3 5ABJA 1FI2A 1GBGA 4I2OA 3H3ZA 3MPBA 2NMNA 4XF3A 3RJ2X 2EXHA 1LHVA 1QJFA 1ZA4A 4CCMA 1UZ0A 4AR2A 1LB2A 2I45A 3T30A 5BNNA 5F6KA 2DCJA 1ZBA3 1U12A 3VBOB 3UV9A 3MUZ1 2OPKA 4NE9A 2JECA 4P5HA 5F7UA 1OA3A 5EJ3A 1ZZ6A 3AKTA 5JZGA 3BPZA 4O9EA 1UAIA 4PI0A 4Q0QA 3HIFA 1F9KA 5FBJA 1ULPA 4MGZE 2JKBA 3Q8AA 4HT1T 2YBSA 4MGYE 5IFTA 1YXWA 2KD7A 3POJA 1EV12 1V70A 3X29B 1LR5A 3D3AA 2AR6A 5A6XA 3PJYA 4CSWA 1A8DA 3PU3A 4V2WA 5ANNA 4AXOA 2QVSB 4PBOA 2WQ4A 4H7LA 5FZEA 1IZ3A 3I3DA 2BVVA 5AC91 4R9AA 3TN91 5IVCA 2VOKA 3FHQA 1W39A 3DPRB 2W0XA 3WVJA 1W9SA 3AP9A 2TEPA 3IKWA 1ZZ7A 1HRI1 2HKXA 2WQ8A 2F6BA 2VOWA 1W6QB 2ZMLA 4YW4A 3HQXA 1RUG3 3BPSA 1W2NA 1DGLA 1TVGA 1QJX1 2CL2A 1NOVA 4Y1ZA 1S2EA 5FY7A 2D97A 5KXBA 1HN1A 3VD5A 3I3MA 4AFMA 3ZR5A 2JICA 1SLBA 2IXCA 1LEMA 1NYWA 3BU7A 3RDIA 4A7KA 3O5SA 1NE4A 2DVFA 1FPN1 4QKBA 1OSGA 1ND3A 2PELA 2RM22 1MR5A 4TZDA 3O7OA 5CEHA 3ZFFA 2FDKA 3B9CA 4DMIA 1X33A 1W9FA 3WDYA 5HCBA 4CXWA 4CE8A 1UY3A 5BNPB 3DXUA 1O7FA 1R1ZA 2UWBA 1ENQA 4CU6A 4Y20A 5DN2A 5I8YA 1QXPA 4AK3A 2ZPXA 4Y1UA 4GWMA 2ARAA 3GM8A 3HNYM 2VZ3A 5JOZA 3BYWA 4BQ2A 4JQRA 1V6OA 3GCXA 4Q27A 3VDDB 1DBNA 2HEYF 3NJXA 5FV3A 4Q4V3 1CIWA 4QPYA 1LKNA 1RUJ3 1UYZA 3WP3A 5FWEA 1O3TA 1E5SA 3B5LB 4YRDA 3THCA 1OFSA 3OGSA 3Q8BA 3O1PA 4N43C 5A7PA 1WMFA 4DXTA 2YYOA 2WO7A 3GBFA 4JRLA 4Q0SA 4CU8A 1HXS2 1Z7S3 4I01A 3MLLA 5DDJ2 2OIIA 2D6MA 3JB8A 2JE8A 3WDTA 3KCXA 1CAXA 1WLWA 3JBG2 1PGW1 1UO9A 3WNLA 1XNCA 3IPVB 4ONUA 2B4KA 3N7MA 1YI9A 4GWNA 2QQMA 1E5IA 2P1BA 3PIJA 1AR73 4M3CE 4OMDA 3LIHA 2Z79A 1Q56A 1MS0A 4MSVA 5APAA 1SBFA 1OD5A 4CEWA 1RUD1 2XQXA 3HVDA 4BQ5A 3HAGA 3DYMA 4DIQA 2XH6A 2CAVA 1JYVA 1AR81 1PNFA 4KWJA 4MV2A 1WMXA 5FO9B 1S0BA 3DEMA 1AR61 2WA3A 3WHTA 2PHFA 4FPJA 1SPPB 4BM8A 2QCSB 2VUDA 5IK8A 1CQ9A 1DLLA 2BNOA 1DZQA 3OD4A 5A3PA 3L2HA 2PAMA 5A7NA 3TBDA 1C57A 1K12A 2YFUA 2C4XA 5JMOA 4XDQA 1OH3A 1GKBA 4CDUC 4XJ8A 4PT6A 5LZ6A 1OQEA 4UI9L 3ZFEC 4HZFA 1W05A 4HN1A 3WW4A 3FUOA 2QQWA 2V73A 5DAQA 3T09A 4AQTA 4B1MA 3BIEA 1CESA 2Y26A 5HCHA 3A0NA 1TNFA 4JQTA 2ZA9A 2ZEZA 3U75A 2DFBA 2VNVA 3OGGA 4MGIE 4QKDA 1GU3A 2Y0OA 4CTEA 1HRV2 2K9ZA 1S0FA 3LEGA 3QBQA 4J1XA 3W5MA 3CBNA 1XNTA 2R1BA 1VRH2 1RUH3 1HQLA 4X6RB 4RSUA 2HJIA 4LIVA 4XUOA 4A6OA 5E6HA 4CCNA 2NN8A 3KLSA 5DPNA 3UGFA 4YZ1A 5KHGA 4BDVB 4CEYC 4K8FA 3UKNA 5FPAA 4FPOB 2VZPA 1BBT3 4YM3A 4IEWA 2UYAA 4XTPA 1AYM2 2VMDA 4M01A 2OKXA 2LROA 1PO22 3PVEA 2PLV2 2HEWF 2YBKA 2Z4FA 3K2OA 4CP9B 1JYCA 1N1VA 2R042 3DYPA 3NMBA 4X8PA 4ZXEA 4CUCA 4E2GA 1NCRB 1SLAA 3VKFC 5I0RA 2W95A 3LSEA 2CYFA 4U2AA 2XWBB 5E88A 4AGGA 4YYOA 3ZVXA 1XNAA 2EXJA 1W6OA 2XLAA 1TME2 2G1MA 3LIGA 4LE3A 2RHPA 3U14A 5FZLA 1D0GA 2YV8A 5FMOS 3I97A 1V9U3 2ZMKA 1YJLA 2WO1A 3KGLA 1FAYA 2A3XA 3CHXA 1REEA 3NL1A 4GULA 1Y9MA 1NCQA 2QQVA 2D3SA 1X82A 2P6CA 1AX2A 2ARBA 2DDUA 5FR3A 2XB6C 1AUYA 1RYYA 3NJZA 4AQSA 4FAHA 3LCPA 3NKTA 5KC5A 4N7IA 5FJHA 1B35A 4CU9A 3OUJA 1JZ4A 2XL9A 3WV6A 1J1TA 4D8MA 2WLQA 2XQRA 5FYMA 2P34A 3THPA 4NRQA 1FNZA 1LOEA 4OMCA 1ENXA 1GLHA 1ONAA 2RMU3 2XXZA 3PUQA 4RFRB 3ZN6B 3D8CA 2J1AA 3QD6A 3VBFA 4TYSA 4Y24A 3EB7A 3M8LA 1D4M1 1LOCA 2PHXA 1Z7S1 4K40A 3PUSA 3URFA 2YY1A 3GJAA 4XXPA 3N7LA 1K5JA 4B7EA 2VMFA 3GJBA 2GU9A 3LE0A 4IQPA 5F2WA 1PGL2 5D21A 2QDNA 3ZDSA 1LRHA 3ACFA 2ZGSA 4IE7A 4OVEA 4MGQA 4LKFA 3TN92 2Q5TA 3JQXA 4AVTA 4Z2WA 1QQP3 4PJYA 3B94A 2QQKA 3POEA 2W3JA 2JG8B 3N3HA 4HXCA 1ASJ3 1K5MB 1H8TB 4WM8A 5GLZA 3ES1A 1O4ZA 2R32A 3N9NA 4N53A 4AHYA 3WF3A 5LA1A 4NN0A 1PIV1 4MHUA 4W6XA 3JD71 4HKOA 1G86A 1IHMA 1R082 4NIAA 4G3YC 1WMDA 3NSTA 2XJQA 3OJBA 1NUKA 3TAYA 2YBPA 3RYPA 4GD4A 5A70A 4P08A 2IVIB 5A32B 4RQPC 5ACA2 5CVRA 2WUHA 2RJLA 3CJIB 1WCUA 4BQ4A 3PHMA 4EE2A 1W8TA 5EIYB 5T55A 1HLCA 5D8AB 3M3EA 2DCKA 2Y38A 3ZPYA 1RUH1 3EXUA 1DQ6A 4AAXA 4RR3A 4PLMA 5FPUA 1GFF2 3DKQA 2BEOA 3ZN5A 5FXXA 5FPXA 1Q8PA 2A7AA 5LCWL 1RUI1 4CDXB 1H9PA 4CPBD 2AH2A 3FLPA 2NQYA 1O91A 2ZHNA 2QKDA 3KV4A 4FT8A 2WNUC 4B4RA 2JB4A 3KV5A 3T08A 1QOTA 1SLLA 3OY8A 3ETPA 4Q4W1 3ILFA 1N3QA 4S2FA 1BK1A 1PGW2 3WOGA 1COV3 4KU8A 4EJRA 4XMAA 3NAPC 4PQQA 3VZKA 2WFF1 4PDWA 1ODMA 2Y0IA 2LM3A 1Y9QA 1LAJA 4RS5B 1VBD1 5L36A 4XCAA 4NMIA 3RWKX 3APBA 5B4XA 4CCOA 1CZSA 1V9U1 3OBRA 1W9YA 4ORFA 2UWAA 1G6NA 1AR82 1NA1B 1WZXA 2WT0A 4GH4C 2DUPA 1Y43B 2AZ5A 4JGZC 4AEMA 2H6CA 2DU0A 2LS6A 4NOTA 2WN2A 3M7AA 1FX5A 3KF3A 5FPZA 1D4VB 1ND2B 4FPHA 5LWBA 1BLZA 4IGPA 3QH7A 2TBVA 4XC9A 3ST7A 2C24A 1QJU2 1OLRA 2V09A 2YC2A 2XHNA 3AP6A 4P02B 3MIEA 1RXFA 5C4WB 3FX3A 1GOFA 1VIWB 3K46A 1A8MA 1X50A 4HOOA 3PVNA 2VCMA 1OMIA 2ZEWA 3MLJA 3TNQA 4JHZA 5JAXA 4DUXA 3O12A 4CDWC 5I0SA 3S7IA 3ZYFA 5A3LA 3A7QA 5IVJA 2C9KA 2IFWA 1VB2A 2VO5A 1S0DA 2O8OA 3D82A 3VBUB 2GH8A 3GALA 5J48A 1YQ2A 4LHSA 5LBBA 1NAEA 2BFUL 2K0GA 3KMHA 2P4EA 2ZAHA 4URTA 4XIKA 3WG3A 2BOIA 2G4IA 4E2QA 2D6KA 1VALA 4P00B 3ACIA 1JZ6A 1XNBA 3Q9OA 1DU3D 4RYDA 1E57A 1JS9A 4OHVA 4QQPA 2NZ9A 4QHBA 4I0BA 3WX5A 3E5UA 3GZUC 4AEDB 1EV13 2Z2SB 3AMNA 2WZPP 5FOBB 1JTZX 1QMJA 5EYXA 1KRIA 1GQPA 2BNNA 4E27A 2J1EA 1GZWA 3ZIWA 3SMHA 4Y1VA 4CCDA 5IW0A 4OULA 1LULA 1PHMA 1J59A 1OOPA 1XNDA 4WM7A 4X8NA 3RVHA 2JDNA 4WVZA 3TOJA 3ACHA 3B00A 3ZXAC 2OPWA 4EN7B 1T2XA 1RMU1 1W6QA 2VNOA 5IHRA 2JDZA 5C70A 3QH6A 2ZHLA 4QX0A 1MQTA 1DGWA 5FREA 3RYKA 4ARXA 3NJYA 2Q1ZB 3A4UA 3FLRA 4LORA 5L7OB 2XLGA 4PHZA 1C1LA 2ADEA 2HWD1 4P9YA 5H9PA 2J22A 5A7SA 3RZKA 4DINB 3CO2A 1W8UA 3MPPG 4YGEA 2VMEA 4IEVA 4YVSA 3JXSA 1W04A 3BVCA 1AX0A 5ABJC 4IE5A 3POSA 2BTVC 4LUKA 1W3XA 2PFWA 5CFCB 2VUAA 1VPHA 1H4HA 2XJUA 1D4M2 1CX4A 1Q8OA 4H7MA 1PK6B 2RVAA 1OF4A 3G6JB 4NIIA 1DFQA 2D40A 2C1FA 2CU5A 1FNYA 1MS5A 1QXJA 2QJVA 3ON7A 4XBLA 1BK0A 3CKHA 4YVWB 3LD8A 4BH9A 2KR2A 5JZGC 1WCKA 3GBWA 5B4NA 3I59A 4BYYA 1O3RA 4EZ4A 3PUHA 5FP7A 3WINE 4JKMA 3W59A 1K45A 2VD7A 3UJOA 3N9OA 3WF1A 3O1MA 1CAWA 1RUC1 5FY4A 1IG3A 5LW9A 3LGRA 1XE7A 4FOWA 3FL7A 4A7YA 2DVGA 1CAUB 2VW2A 1KDMA 2DFCA 5JR2A 5JWPA 2V4VA 2HWE1 2QZ2A 2NPIA 3PURA 4FO9A 1G9FA 4UFHA 3MEPA 4JVAA 1ODNA 4IEZA 5DAPA 4BQYA 1NQDA 1HXS3 4GWJA 2A6VA 2VAUA 5DDJ3 2RS13 1PMHX 4FPYA 3K3NA 3JD72 3S5QA 4QM8A 1XYNA 3KS7A 4QPGC 2PXJA 4YZ4A 5KC6A 4AE2A 3MFCA 2XWJB 1HIXA 1ZBE1 1RUF1 1W2TA 4J6GA 1W0PA 4HN0A 3D5OA 1R093 1XE8A 5CG9A 5A7OA 3RI9A 2XBO2 3RZZA 1UQXA 3RWNA 1UYPA 5F3CA 4C1XA 3UKTA 3VKLA 1ND3C 2W68A 1GSLA 4AFBA 4BB3A 2NMOA 4IW3A 5A1FA 3ZFFC 2PQSA 1DZRA 3F2ZA 4LLOA 2J1RA 4KQ7A 1AR92 2VZTA 4HVRA 1W6NB 3KVBA 2RDNA 3VBHA 3DF0A 1QNYA 1PNGA 2J7MA 3M2MA 2JIJA 4CXYA 4AAPA 4P9LA 3WDVA 4XF0A 5F3EA 3NJVA 1MVQA 2XOMA 4H14A 4XETA 1MPXA 3BGAA 2WFF2 5EWSA 3SITA 3HN1A 2VJXA 5JOYA 4XFAA 3POWA 1RVF2 1HJGA 3BCWA 3PVOA 2QFEA 1FXZA 1JXNA 5K8SA 1VRH3 3LF7A 4OUSA 5F32A 2P3KA 1JN2P 2JE7A 2ARXA 3IAPA 2HWB3 2HYKA 2E32A 3FWEA 4H55A 3TYJA 3E6CC 5JSRA 1BVP1 4COVA 4LPLA 4JDOA 1FYUA 1LHOA 2WQZC 2XLFA 2DTYA 4XF4A 3WQBA 1JZ3A 2PLV3 2DBNA 4CCEA 5CNAA 2PHRA 1HKDA 5J3UA 3ZO0B 5K4LA 3BTXA 2RM21 2FDIA 4XTMA 1RTVA 4TSVA 2IUWA 1H2NA 4PIZA 3EYPA 3DCQA 3VZLA 1XB9A 5HXVA 2XUMA 1TME3 3LAGA 4EWAA 2RR11 2G9GA 1GYKA 5BY5A 3I8TA 4Q0UA 5LEKA 5CFDA 2YFZA 1IPSA 2XJPA 3ZXKA 3SKJE 2ZMNA 1W8FA 1QNWA 4CDQA 1LU2A 1UYXA 4AI1A 2W94A 2ZX2A 3VUOA 2VZSA 2ZCWA 3DYOA 4BJ0A 1JUHA 1GZ9A 1EYBA 5C8CB 2BYVE 1IQDC 1D2QA 4LO5B 5EYYA 1CAVB 2VNGA 3INAA 5A3OA 3BI3A 4LKEA 4LA2A 1JUIA 3Q8EA 4A3ZA 1ZYBA 3VBSB 4L8QA 5FXVA 5JOWA 1RHI1 2VOVA 4RGGA 2ZAAA 2VMGA 3JBG1 2VNRA 2P6HA 1VR3A 2ZX0A 4LUMA 1RUE1 1MVEA 4JGZA 3ZX7A 1O3SA 1AVBA 5CG8A 3M3CA 5AC93 3TN93 1EUUA 3H8OA 1CIYA 3P3NA 2LW8A 4PCRA 4LA3A 5I8SA 1JZ7A 5IVYA 1C8M1 1CZVA 3WQ1A 3LPFA 4MOAA 5FXZA 1HRI3 4DEVA 4ISRA 4C8DA 2HEVF 3C8XA 3MUY1 2ZKLA 4N7UA 2GN3A 4LOSA 3RNSA 2Y64A 3NKGA 2WS92 3IWZA 3USUA 5A6ZA 1I3HA 4NIHA 3I2IA 1MS4A 5FZGA 1ZRCA 1QIQA 1IS6A 2JJ6A 2Q8DA 4NROA 2DWRA 4KBZA 1H0BA 1W9WA 1XQNA 3IBMA 3GDBA 3LDBA 4SLIA 5JDBA 3KD4A 2WIIB 2VW0A 5GLWA 1UPIA 1FPN3 4IXLA 1YC61 4U36A 1NCQC 2FDHA 5F6LB 5J1XA 1J58A 4UF0A 3ZSKA 5BUVA 1J3RA 5C3RA 1B35C 4MXWA 4BU2A 3B69A 1Y4WA 2ZABA 5FZ3A 4FOVA 1HRV1 4KNCA 5EJZB 4YG3A 5CIRA 4LEJA 2RJKA 3VBFC 1ZRIA 3ZKUA 4EN9B 1LNSA 4XAEA 4NHXA 4ES8A 2XVLA 2WFPA 4AGRA 1RUC2 5FMBA 5E8AA 1GWLA 4LQRA 5T50A 1GMMA 4KWLA 2VZ1A 3I2FA 4ZU7A 1TZOA 1OPMA 2R1DA 4QPWA 3T3YA 4B8EA 5BV6A 5HV4A 1RIRA 2O14A 3N35A 1G8WA 2HWE2 4LHLA 3VZNA 4FBFA 2VCAA 4DPNA 1AYM1 1VAMA 1PO21 3TWIA 1VBC2 1VBB1 2DVAA 2PLV1 2PN5A 3A23A 5FZMA 1LOGA 1V6KA 2R041 3AZWA 3FN9A 4XHXA 3T1LA 4YARA 2AACA 4E2SA 4OI4A 1KD7A 2WL1A 2VM9A 3AP5A 4FFFA 1JU3A 4WM8C 5SV5A 2W9XA 4LK6A 3RI8A 2D98A 1W28A 2GAUA 4DUWA 2GMEA 4N53C 4BMEA 2DV9A 1RUF2 4GMP0 1PX3A 3OYWB 4L92A 1SMVA 3RYRA 4BIFA 4I02A 3WCRA 2BWCA 5GZEA 2BU9A 2R49A 1FATA 5FZ8A 1PZ8A 4QT6A 1AR83 2Y60A 2QQUA 5G05L 1WCSA 5FQ0B 5I0UA 1AR63 1Q8QA 4W6YA 3PUAA 2A6YA 4AI9A 5LK5A 3OBTA 2R062 1TEIA 2GMMA 3ABZA 3AFKA 4P9JA 3WLUA 1QHDA 2PYTA 4DQAA 5FP9A 1GWKA 4Z2AA 1CD3G 4W4ZA 3NNMA 1UY0A 1QJU3 3IDCB 4L99A 5JI7A 5IYYA 3ZPOA 2BW8A 2GZWA 3HBZA 4XXAA 1UX7A 4BE3A 4XOGA 2HWF1 1DGWX 4RR3C 5DXDA 3UYJA 4HANA 5A7WA 4N43B 2OYZA 1PGL1 2BFUS 1ZNPA 4UW6A 3SH4A 3OB8A 1AL0G 4Y33A 3PIGA 2VQUA 2YC4A 4QWNA 2QQPA 1W6MB 3N9MA 3LOBA 5GM0A 1P8JA 3E6BA 2QNKA 4UW3A 5IVEA 4M4RA 1HB2A 3OF1A 5FY0A 4D6RA 3I2OA 1RB8G 3VBRA 3PMEA 1JBCA 4QPIA 4B29A 1W2OA 2IXJA 3FMGA 4MXVA 1HW5A 1QJZA 4QPGA 4S2HA 5FZOB 3OD0A 3C7OA 4ZZ8A 5K0UA 3F95A 4LT5A 5DQ0A 4EN8B 3BODA 3RZLA 4R9CA 1DF0A 4PDWC 4O65A 3ZXFA 3MW2A 2B42B 2GNTA 4COUA 1OUXA 2G19A 1KS5A 5FZCA 4TWTA 4XFIA 3V56A 1BMV2 3O1RA 2GMPA 4LE4A 1R081 2N7GA 4S2GA 4Y4RA 3O1OA 1ULEA 5LY1A 1W2AX 2W52A 3KF5A 3M3QA 1REFA 4FXKB 4Z1VA 4JC1A 1J3QA 5A33A 4LBQA 2CWSA 5ACA1 2DCTA 1WUVA 2G9FA 2RR12 3A22A 3WW2A 4CDUB 1VMHA 2QUOA 2XGXA 1H8VA 1ZA7A 3HQUA 3HPNA 1XJAA 2X5IA 2ZEYA 4RHV1 2XVKA 3ZFEB 1ALYA 2GP3A 3BOWA 4P9GA 4ZHNA 3SCFA 5EPAA 4RFT0 2MEV2 4OCTA 1X9TA 2XKPA 5FMDA 5IAXA 1F4HA 2V4AA 3DGTA 2WZ8A 3WNKA 4IEQA 4OHXA 5C7GA 1V6LA 5FZDA 3SEPA 3WSOA 4NR1A 5BYNA 1JW6A 3KM5A 4XHBA 3ASIA 4CCJA 1QEXA 3QCWA 4LITA 1RJ8A 3NRUA 2VMCA 1AJOA 3T1MA 2FBEA 3VBOC 1D4M3 4NRPA 3IIIA 3AKPA 1RHI2 3U10A 5JCTA 2P2KA 2WSVA 4Q4Y2 4B1LA 2VTXA 2WYFA 3RPQA 4CEYB 3DV8A 1OFNA 1RUE2 3UGGA 4FTBA 2PHLA 5HPOA 5FPVA 1QY4A 2A71A 3V0AB 1QJY2 1KEXA 4V2VA 5FO8B 3HN3A 2B5HA 1W06A 1GP4A 1MS3A 3P1IA 4A6SA 2BGCA 1C8M2 3SEEA 3VKNA 4LO8A 4ZU4A 3WDWA 3O0XA 2V72A 4AF9A 4EZHA 1EAH2 4IV3B 2ZTNA 3ZN4A 5FY1A 5FBZA 4GAZA 4Y3OA 4OI1A 1OOPC 2O8QA 5CISA 3H3LA 1J84A 4WM7C 4M00A 2QZ3A 4XFFA 1LJ7A 3I54A 5AVAA 3ACLA 1OUSA 2RG4A 1PIV3 4Q5OA 4XPVA 2P5BA 3JD73 2D6OX 3WG2A 1QJU1 1MQTC 4Z07A 1XYPA 3VD3A 2ZX1A 4BLIA 2FZ2A 1WW5A 2ARCA 5IK7A 3AYEA 1PX4A 5GLTA 4AQ2A 4LULA 1IQAA 2DVBA 3LWCA 1OD3A 4YVSC 5J98B 1GNYA 1F4AA 3MYXA 1PO11 5IJRA 4H3WA 1OKOA 3ZYRA 3P3PA 2VCBA 4XBQA 1HDKA 3WR0A 4A3XA 3FBMA 2DUQA 1ZX5A 3T0BA 4Y4YA 4MGTA 3HJRA 1X7NA 1RXGA 1VBA2 3WCSA 3O0VA 4XF9A 3TEYA 4AEJA 2WNVA 3AYAA 1RUI3 3KV6A 4GWIA 4RD7A 3VDBA 1OI6A 2FCVA 2GH2A 2ZJCA 4XQWA 1W8ZA 5FZ4A 5DMYA 1C4RA 3S57A 3LEMA 4LKSA 3N9LA 1H9WA 4KL1A 4YW2A 3D4KA 4IV1A 2B9VA 1VBB2 4GB32 4XUPA 1R1A1 4Q4W3 3HBKA 5LK7B 2SBAA 4OFGA 4PBPA 4E4DX 2YXSA 4PF5A 5JR7B 1QH7A 3QOPA 4X6QB 5F5CA 3VL8A 5JSOA 2WFF3 2Y6FA 4R9DA 4XQ4A 1O6UA 2YZ4A 4JHTA 4LBNA 1YRZA 1VBD3 1YUDA 3ZXDA 5AFEA 1GOGA 3TNPB 2B46X 1UZZA 1JHNA 2RDRA 2WBKA 5H9QA 1DQ1A 2ZHKA 1ZZBA 2ORZA 1DIWA 2XL7A 3I3BA 4HPKA 3ZXGA 5A1LA 4RQPB 1CPNA 2RS51 3WP5A 2Z5WA 1NX9A 2VPVA 2Y34A 4E8CA 2VECA 5GKAC 2QBXA 3CU7A 1WGPA 4RL7A 4B7KA 4IEYA 4GMP1 4NPLA 3S7EA 2HWF2 3ZFGA 4XUQA 3LEIA 5JMCA 3NNJA 4XFGA 2AGSA 2JENA 3N9PA 4UOJA 3N4MA 4N90A 4M3CB 4NHMA 1H1AA 2I74A 1CX1A 2XJVA 5KHJA 2WNUB 5CKQA 3VBHC 3WZ1A 4D69A 4UXAA 1W0NA 2ZOEB 3K4DA 4QGNA 5FKBA 4ES9A 3U11A 5B2GB 3LA2A 1WW6A 1WWYA 3ZSLA 4OHYA 2UY8A 3B3QE 3GXUA 3H50A 3AL5A 4UAPA 4CRQA 4XF1A 1LECA 1NLRA 3NAPB 4W6WA 4FXGB 4Y22A 5GALA 3O14A 1QXRA 2P3YA 4WVWA 5BNOA 2RDSA 3I3QA 3VD4A 3V0BB 2CWMA 4IEXA 5F3IA 3R6SA 4AW7A 4XZUG 4DXSA 3GCWA 2CDOA 3OSDA 2VG9A 4K1ZA 3ZR6A 4K1YA 4XEZA 5LY2A 1W6PA 4MO3M 2JDMA 4GH4B 1WW7A 4UFIA 1RINA 4AHWA 2D6LX 1REDA 3K3OA 3AP7A 4WVMA 4WVVA 3IIAA 3OCPA 3ZKYA 2VTXJ 1S4CA 5FFOC 4P14A 3ZSEA 1RMU3 3H8UA 2BP6A 4YG0A 2QQLA 2XBO1 3ZDVA 3IB3A 4ZS3A 3RSJA 2GC1A 4UFMA 4LBLA 2W1UA 4RHV2 2WO3A 3OGJA 4HMZA 5JXHA 2Z42A 2XDVA 4AEKA 1ULDA 2OXBA 2A3YA 1OLMA 1IS4A 1U5YA 2HWD3 1UD1A 1W8NA 3FFZA 4Q2FA 1A3KA 2LALA 1AR91 2YPJA 3POFA 4KG8A 4QKNA 1XSRA 4Q0VA 3GHNA 3K4AA 3T0DA 4CDWB 3CQOA 5CFDC 5FJKA 1S2BA 5C9AA 4JGYB 2JG9A 4IDZA 5LBFA 4DB5A 3CJXA 4FFGA 3RS6A 4LNVA 4FCAA 4XE9A 3IM0A 4CDQC 4NPMA 3VN4A 2ETEA 5FYHA 4CCKA 2ZGKA 5F1RA 2ZGMA 4QXHA 2OS2A 5FZHA 1JYIA 3KT7A 5CB7A 1CWPA 4LBJA 1IKQA 2E26A 3FFQA 3MF6A 3OBAA 5A3TA 1RVF1 4OUEA 4UT5A 1AXKA 5IK4A 2WC2A 4QGMA 4XCBA 1RUC3 4YWAA 5T52A 1SDWA 3J7LA 3PTYA 3WDXA 5C5TA 3S0MA 5F2SA 3EMRA 3L9JT 2HWE3 3DL3A 2KXLA 2W47A 3V64A 4BISA 2X05A 4XJZA 5CKNA 1W3VA 2Q1MA 1VMJA 2E33A 4KBBA 2JG8C 1LOFA 5C8WA 2NP0A 4C0BA 5FAXA 1JZ2A 3U4SA 3KT1A 4NPRA 1OVPA 1UOBA 5FYIA 2R7EB 1QDOA 1D7PM 4D3WA 1DDLA 2BBAA 5CA6A 1ZBE3 1RUF3 3WP6A 2VQTA 5JUVA 1IOAA 2XJRA 4QQOA 5AVPA 4GALA 4DO0A 1KXGA 5ABJB 3NW4A 3ZYHA 3JQWA 5A3MA 3TEXA 2DU1A 1PO12 1FMD1 1OXCA 4FPKA 4MG2A 2WT1A 3ZM8A 4PIXA 5FWJA 1ZBA2 3AM2A 3WUCA 4LR4A 2P17A 5BNNB 3NNLA 3VBOA 2A70A 5GJ6A 1JHJA 3OG2A 5KHIA 2MNGA 2O0OA 1CVNA 2WABA 2BVBA 3RGBA 4MLOA 2UURA 4JTOA 5JZGB 5T5OA 1MS8A 1N1YA 4HKLA 4BHPA 1XNKA 2EIDA 2VE1A 3NVCA 3RRDA 4N8MA 2GALA 2E53A 1O5UA 4KU7A 2IFRA 3FHAA 1DYKA 1JZ8A 2FMYA 3E5XA 3ILRA 3LB9A 1R1A2 1RUNA 1AHSA 4MZUA 3T2TA 3LFMA 2D43A 2C9AA 1PMIA 4QX7A 1O3QA 3BUCA 1HB3A 4AGVA 4Q8KA 3HR9A 1ULOA 2Y6LA 3DPRA 5A3UA 1NXD1 1VP6A 2D93A 3GNEA 2Q8EA 4AHZA 3KZ4C 5FDBA 3AMPA 3HEIA 4CA9A 3I2KA 4HBNA 3ZXLA 2WS91 5F5IA 1O5LA 1PGSA 2E63A 1ST8A 4BIOA 1SBDA 3V65A 1YEWA 2MPFA 2RS52 3HMYA 3Q8CA 1BEV2 1U5ZA 3RMXA 1ND3B 5FP4A 2RM23 3MFAA 3OPZA 1VLNA 3UK9A 3ZFFB 1EPWA 5LEJA 5E89A 3AK0A 2OW4A 4COWA 3ZYGA 5BNPA 3NV1A 3WNXA 4BA6A 2YU2A 2RR13 1QDCA 3WQ7A 4Y20B 2JWPA 3LPGA 4NAOA 3VZOA 3THDA 3VDDA 4E4ZA 4W50A 2DVDA 2WWSA 4Q4V2 4DUVA 5J36A 3KB5A 1RUJ2 1APNA 4OUMA 2MEV3 2FDFA 2DTWA 2I07B 4I09A 3SXWA 3CEWA 1HJFA 1NT0A 3EBRA 3KCYA 4CPBA 3VLBB 4AI0A 4OI2A 5DUUA 4CP2A 2EIBA 4ASKA 1YO8A 1QKQA 2CDPA 1YFXA 1TMF1 2IXIA 1LHNA 2E51A 2DF7A 4AYUA 5K7PA 3HT2A 4MUVA 3UETA 1PVXA 3VL9A 4BXFA 1YYNA 1FT9A 1KJRA 4XW3A 1DYOA 3WEZA 3GBGA 3BN6A 2DUOA 4DOUA 1C3HA 4A2UA 1VBC1 1WLTA 5JLVA 2F17A 1F15A 1RHI3 2DURA 2W87A 1CAXB 4QB2A 5HCAA 3RZHA 3IPVA 3VBRC 3JBG3 4Q4Y3 4XDOA 2JD9A 4QPIC 1UMHA 2EALA 5K9YA 4TLFA 4B4PA 1LCLA 5CADA 1RUE3 2ZXQA 3AFGA 1YQ6A 3MO4A 2ILMA 5K0UC 3JU9A 3MF9A 1UKRA 2VUJA 1ULCA 3R4SA 4HLTA 5M0TA 4GXLA 2JIGA 3DXTA 3WF2A 4ET7A 2VQ0A 3DN7A 4L0PA 4CEWB 1MEC2 1C8M3 2PQQA 3AXDA 4HFSA 5FPBA 3TEZA 4CP1A 5A3NA 4Q29A 4L9BA 5J7MA 1N1TA 4CP0A 1SLTA 4MVTA 1SPPA 4TLGA 5I93A 3U1XA 3C7GA 2QTWB 2JEMA 4OHWA 2R061 3D6EA 2IVJA 1LGCA 5T5LA 1QH6A 2ZZJA 1C5IA 4I30A 2E9QA 5F5AA 2WAAA 2X5IC 3SC7X 2EVXA 4OQ8A 2JXAA 2A73B 2VVDA 1F5JA 2VU9A 4XDPA 3USSA 1LHUA 1GNHA 2EIGA 4FOYA 4XILA 1UU4A 5L73A 1STMA 2Y6KA 2E7AA 4R4ZA 1XC6A 4FFHA 3H0OA 5DZFA 1R64A 2V5YA 4DRVA 1HRV3 1QWRA 3HNBM 2WJSA 3IDEA 3OBZA 4Z92B 4CUAA 3FBYA 1UZVA 2R16A 4QQLA 3S6PA 3GZAA 1YI7A 5T5PA 3NWKA 2VH9A 3N9QA 3T2OA 1BYHA 2UWCA 4JDMA 1BBT2 4KG0A 1IG0A 2FD8A 2W91A 3K51A 4XJAA 2AUYA 5KWRA 4JTNA 1JU4A 4BCUA 1AYM3 1IS5A 1KS4A 2H0VA 4YW3A 4CP9A 4KGQA 3GZTB 1PO23 2HLEA 3K75B 1VBB3 1BZWA 4JCKA 2D6PA 1NCRA 2LTNA 1SACA 2IXHA 2R043 5FZ9A 3ZMOA 3UNPA 3ELNA 1BMV1 3H7YA 4LIUA 2FHRA 5ERLA 1U5XA 1CZTA 1AYN1 2PAKA 4IERA 1NZCA 4RGAA 4PF1A 2E31A 3MBWA 4W8JA 2AYHA 2IXLA 4GQ7A 2LUWA 3I2JA 5EXOA 1W6OB 5BPXA 1YIPA 2ZGNA 2BERA 2WZR2 2A5ZA 4D6QA 3ZXEA 5EP9A 5L9RA 3P6BA 3VV1A 2A6ZA 2ZBJA 4UFLA 2X09A 4A4AA 1FMD2 1A78A 1NCQB 4XMIA 5LATA 3AZZA 1PM4A 2RDQA 2JDKA 4NHLA 4IL7A 2MEV1 3H9AA 3QLQA 4QAWA 3T4VA 1NY72 1MZFA 1UMZA 2JDUA 1B35B 5JOXA 1UYYA 2OQ6A 2GP5A 4M0NA 2RMU2 4LHKA 2W92A 3ZN6A 1L7LA 1AX1A 2QE3A 4R4XA 1VE0A 2GDFA 4LOTA 4Y26A 1JH5A 4IEOA 3VBFB 4AVVA 1IGOA 4EN0A 3BKZA 3SH5A 2HH9A 3J26N 1DCSA 4ISQA 4UFJA 3ZMNA 1VBE1 2HWF3 1H1IA 4Q4Y1 5JVVA 1OA2A 3M4FA 4AWDA 2WNVC 3KV9A 4C1WA 1G9BA 3I2GA 1QQP2 2Z69A 1LODA 3IT8A 3ZIXA 3E97A 4AHXA 5F8PA 1QJY1 2IXKA 3WD5A 5J37A 4LK7A 1PMJX 3ZSMA 1OA4A 4IV1C 3EQEA 1ASJ2 5BXXA 2JG8A 1K5MA 1H8TA 1OC1A 1UU6A 4BK5A 1KGYA 4WM8B 1EAH1 2YGLA 3J7HA 3FLTA 4XBNA 3FZ3A 4N53B 4N9HA 4ZKTB 2A75A 2OUHA 4LHNA 4A44A 3IDAA 2V5DA 5IUQA 2FDGA 1S55A 1KDKA 3B9IA 3WNMA 1K3IA 1DG6A 2D6NA 4GZ9A 4H2AA 1LU1A 3K4ZA 1ZRDA 1H6XA 5LRRA 1R083 5L19A 5FYZA 2X10A 4O7XA 5CZKA 1PVC1 1UN1A 4ZZ5A 2ZGTA 1KFXL 5GZCA 3DUIA 1S0JA 1NLSA 1S0CA 2VTFA 2W5FA 4Q0PA 2OQ7A 4XJUA 3AMMA 2P37A 1J83A 4WZFA 5A32A 3VD9A 5FY9A 1N47A 1UOFA 3CNAA 3CJIA 2X53S 3W21A 2ZGRA 5ACA3 1K42A 5F9TA 3FC0A 5DUVA 5A80A 3AKSA 3KT4A 5D8AA 4RHV3 4YZ3A 3A0KA 3AMQA 4HSJA 3B01A 3W5NA 2D5HA 5KHKA 1J3PA 1WKYA 2CTVA 4FPCA 4RR3B 2F4LA 1YQCA 4I0WB 4XZPA 2J1VA 4ZONA 3ZFGC 4D94A 5FY5A 4CDXA 1VBA1 3VD7A 5FK7A 4TTGA 1D2SA 3LA7A 4FQ4A 2UYBA 1TMF2 1S2KA 4A45A 3IDBB 4XUNA 4QX2A 4JGYA 1N1SA 4B3NA 4SBVA 1TE1B 4AVCA 1JOJA 3OY8B 4I3GA 4DNYA 4ZPIA 4YG6A 4GB31 3ZYPA 5H9RA 3RFRA 1WD3A 1YHFA 2R6QA 1SCRA 2BRTA 5CKMA 3EHKA 1US3A 3KQRA 4A7ZA 5JIUA 4CUBA 1GP5A 3AZVA 4QX3A 4PQ9A 1GUIA 2Q4SA 2W39A 3MDPA 3R05A 3C3VA 4PDWB 5BNOC 2OT7A 3MW3A 4RS5A 1GZTA 4FSJA 3PLQA 1LGNA 2VQAA 4Q4X1 1G9DA 3H42B 1NA1A 4D0QA 3J8F1 4OLLA 3HD8B 3FE5A 4QHZA 2TUNA 1HX6A 1VAKA 3ETQA 2D3PA 4MX3A 5FZBA 3ZXJA 2VZVA 4MH0E 2ZGLA 1ND2A 2PHDA 3IMNA 4DRRA 5F37A 1GICA 1DQ0A 1RGSA 2FDJA 3VDCA 1S0IA 3RQ0A 5KHHA 4M3CF 2YHJA 4GJZA 4FP2A 2CGPA 3R0RA 2WO2A 1X8MA 5E16A 1I6XA 1H30A 2B9UA 5FYTA 5C3OA 3UGHA 3ACGA 5C4WA 3MIHA 2GSYA 5DAXA 3UKVA 3WUDA 2RV9A 3OEBA 3R4DB 1CGPA 1LENA 1L7QA 1O8SA 4LO7A 2R0HA 3ME2A 2BZDA 3CZUA 1YFUA 1AL21 2HBTA 4QX5A 1PO13 1F8VA 1OPOA 3AJZA 4BQXA 3VBUA 1N3PA 3MV01 4AFCA 4URAA 5C9AC 1XRUA 3OGRA 2JG9C 1UU5A 4ZU5A 4LO6B 5FMCA 4EROA 5ISLA 5IT6A 3RZJA 1ZZ9A 5A6QA 3O1SA 3J7MA 3OTFA 1GZCA 3BIWE 4IUGA 1AZDA 2Q1FA 4DS0A 2GC3A 2BV4A 4AEDA 2JE9A 1NLQA 3KCCA 4TXWA 2K46A 1R1A3 2RS31 3K77A 5FUIA 1W8WA 3PU8A 3P5BA 4CUGA 2YU1A 2Q8CA 3T4HB 3KGZA 4CCLA 1GZWB 5CAZA 3MHZA 3U4XA 3SKVA 1OOPB 3CZJA 4NVPA 1DQ4A 1AYN2 5HCFA 4WM7B 4ASMB 3WG4A 5FYVA 4YGBA 1W99A 2ET1A 4M0HA 4COZA 5EZWA 1BKZA 2IZWA 3NNGA 4BPZA 2AEZA 5IVBA 2B7YA 3PMSA 1YLLA 2ZGUA 1OKQA 1LOFC 4ZXKA 1MQTB 5GZDA 4LMFA 3AVSA 4F8AA 4HL0A 5L7OA 1FV2A 3W58A 3ALQA 2VR4A 2ZACA 2WNOA 3OPWA 3BOPA 3PJQA 4MADA 1JI6A 4AG4A 5FXWA 2NLRA 3CMGA 4QQ2A 3POBA 2HWC2 4LBKA 2I2SA 3U07A 3ZLIA 3ZSJA 5FYBA 4YVSB 3SQOA 1IS3A 4D7SA 1XOYA 1C1FA 1KITA 2RS53 1EY2A 2VY0A 3JB4C 4ATEA 5EHDA 5CFCA 1BEV3 2R0FA 4YW5A 2J42A 2J1UA 1JOPA 4OZXA 5J96B 2OUJA 2R071 4QMAA 3T2PA 5EV7A 1PK6A 1FOD1 1OH4A 3AKQA 4FTSA 1VBE2 4GMP3 1CJDA 1UMIA 4E4HA 1I5ZA 4QU2A 1OURA 3G7DA 2AREA 1NXMA 4YVWA 3LDRA 1JYTA 1S0EA 1XSQA 2QDRA 4CYDA 5JXIA 1CN1A 3I59B 3HNMA 3I2DA 5HI0A 3S5AA 2VGDA 2C6SA 2LRPA 1C28A 4FPGA 4OYUA 1CAWB 2RJ2A 5FLHA 3O1VA 3E1F1 3GGLA 5F5QA 1NG0A 1SHWB 4G9SB 1CAUA 3BTYA 2WAOA 5HV0A 3FUQA 1RUOA 4ZY9A 3Q8FA 4FTEA 4V1PA 2YB7A 3HWJA 3D0JA 1UY1A 3N7JA 4NO4A 5IWFA 1X9PA 2RS12 2H6BA 3DPRC 4HVOA 4DXRA 5FIXA 5HBAA 1ACCA 1QGLA 1SFPA 2VZQA 2VC9A 5IAVA 4EYUA 3J7NA 3M3IA 3AVRA 4HONA 4N9IA 2PHUA 4DXZA 2ZGPA 1W9TA 2E7QA 2X29A 3VHOA 4AZZA 4CCCA 4NIDA 3MIGA 1PVC2 3QACA 1R092 1S1AA 4GJYA 1POQA 1DGRN 5EJ1B 1LOAA 2CGNA 2EA7A 4YSFA 2KM2A 1MEC3 4YGDA 3SCHA 1LOBA 1UXZA 3VZMA 4I0AA 5FZKA 3W9AA 2XBO3 2TNFA 5FYUA 5IATA 1YFWA 1ZBA1 4QXCA 5G04L 4XACA 2CNAA 3B02A 4K21A 4LBMA 3SCGA 1OHFA 2EICA 5FZ1A 5BNPC 4HETA 2VBBA 1W0OA 4WBBA 1DGRA 1AR93 3AYDA 2EAKA 4KGGA 4QU1A 1W6NA 4IGOA 5JXGA 2VUCA 4XURA 2GC0A 1GQGA 3VBHB 3VDDC 1AJKA 1VAVA 3SH3A 3THTA 4D6SA 3BB6A 3ITQA 1W2UA 5FK8A 1A34A 4MYEA 4I3PA 3U37A 1U5IA 4ARYA 4LTAA 1E5RA 3ATGA 4YLZA 5DG1A 4HVQA 4QX1A 1VMFA 1UF2C 5LA0A 3NV3A 4QXKA 3SISA 1ZREA 2EXKA 3MI8A 1Q43A 4JKKA 1RVF3 4PLOA 4Q4X2 4AQ6A 3PL0A 1VRBA 2DCYA 1V6JA 2ZX4A 1TQ5A 4ITCA 5D2AA 3TB0A 2XUEA 4AFAA 1RUG1 2B8MA 2HWB2 3CF6E 3J8F2 4FAGA 3AB0A 5A1AA 4L2NA 2PTMA 1HQWA
chains in the Genus database with same CATH topology
4F3JA 3BALA 4FVVA 1DQ5A 4CZSA 4AFDA 2WKKA 1YCIA 2AENA 1CONA 1I9RA 3AP4A 1BEV1 4IV3C 3O0WA 4META 1URXA 3H7JA 3H1WA 5AFBA 2CV6A 2WZR3 4RA0A 2VOXA 4AVSA 1WCDJ 3SLIA 1AL22 1RL3A 2GNDA 4EWEA 1XU1A 5CFDB 1FMD3 3I4IA 4K20A 1F2NA 3GHMA 4Q4V1 4NHKA 4FPFA 1RUJ1 1UL9A 2ZKNA 2E6VA 2XHKA 4CDQB 1F5FA 1LGBA 1UCXA 3DKWA 3D0SA 1BVVA 3TRSB 5C8CA 1HV0A 1CAVA 1IPKA 4UW5A 4R8HA 3VBSA 1CPMA 2SLIA 1V00A 3CL1A 2WNEA 4R52A 4C0HA 1WW4A 3BTAA 5C6CA 2RS32 1HQNA 1WLCA 3AYCA 4JDNA 1OLQA 4JGZB 2VVFA 1AR71 3B7MA 5AC92 3H3UA 1Q8VA 4PLNA 1X36A 4XFHA 5FOJB 5J09A 1HRI2 4BZ4A 3MW4A 2ZX3A 1MEC1 5GZFA 1NCRC 1MZ5A 4YGCA 4EN6B 1WBLA 1ZZCA 4LO4B 4BWOA 3AKRA 1QJX2 3USUB 3WQ0A 1IPJA 2WS93 1UW8A 1UZYA 1RITA 1V6MA 2XKOA 4YNIA 1AXYA 4K6BA 1FPN2 2FQPA 2GC2A 3SHRA 5KBFA 1BJQA 2IWGB 3PVBB 2R072 2B45X 5EFUA 1G9AA 1FOD2 3NV2A 3R4UA 4MXWB 4YFWA 1UKGA 3AZYA 2YGMA 1QOSA 4GA9A 4XFCA 3EO6A 4UBGA 2YUEA 5BNQA 5GLVA 2YMZA 5C33A 1CJPA 4P9XA 4Q8LA 4XIOA 1H1MA 4KH9A 3N36A 4AI2A 4D7TA 1TMF3 1BBT1 3U0ZA 3RMYA 2C0ZA 3WY6A 3LZZA 4E4SA 1SLCA 1WBFA 4AI3A 3WW1A 1L3JA 1VBC3 2YROA 2ZGQA 1K5MC 2NYYA 1H8TC 1PZ7A 2ZHMA 2CY6A 3MICA 2WINB 3FJSA 4BLJA 4F7ZA 3OYWA 4FQZA 2Q30A 1DZTA 1C8NA 3JCIA 1RUD2 2FMDA 4IESA 2PHWA 2WZR1 1ZM1A 5FO7B 4R9BA 1VB4A 2CGOA 5FQ0A 1AR62 4Y5Z0 3UL2A 1RC6A 1B09A 1MS9A 1PM7A 1NY71 1XU2A 1EPZA 2R063 3S30A 2ZS6B 4QD2A 4O9GA 3L2YA 2A6WA 4HK9A 2W08A 2RMU1 2VMIA 3CJIC 3VKOA 3B93A 2OZJA 4FP3A 2DYCA 3VHNA 1NE6A 5D8AC 2X8KA 2A6XA 3M3OA 2BNMA 2FZ1A 5SV8A 4L11A 3IN9A 1N3OA 1H2MA 4N43A 4CDXC 4INDA 4JAAA 4LBOA 1YWKA 1W6MA 4L97A 1A6CA 1QQP1 3MIDA 4JGYC 1POV0 4NWVA 1KFUL 2VXRA 2P3IA 4DY5A 1ASJ1 2EF6A 3VBRB 3ROUA 4QPIB 1WA4A 1RUG2 4QPGB 3RJRA 5K0UB 4F83A 2JX9A 2WT2A 1TNRA 4HSLA 3J4UH 3GYDA 3AZXA 2OZ6A 4LLFA 4RS5C 5FLJA 1HV1A 5T54A 3K48A 1NA1C 4AVAA 1WD4A 1Z78A 4MGKE 1QOOA 4G4FA 1V6NA 1AYN3 4ATFA 5I91A 2BPA2 1ND2C 5A33B 2VVEA 4LBQB 5FRAA 4C90A 4CDUA 1UIJA 1ZZ8A 3ZFEA 2X5IB 3H1MA 3MIFA 1EP0A 4NWWA 3WG1A 3FHIB 3MLKA 2B39A 3AMHA 5C4WC 5LRSA 3AX4A 2NM1A 4Q26A 3WDUA 4XQDA 2C5DA 1SFYA 5T3NA 3ZYJB 4E9KA 2HWC3 4K7JA 1SLIA 2BUKA 3C2UA 4YM2A 4BOWA 2JD4A 1IKPA 1RJ7A 1Y3TA 5BNNC 5KXEA 2D3RA 1Z7S2 3VBUC 3VZJA 1COV1 1SQ4A 1VBE3 2ERFA 4CEYA 2VULA 1NQJA 2RE9A 3M1HA 5FCCA 5JPMB 2OA2A 1YIFA 1AR72 3V0AA 1O4YA 3JUUA 4KWKA 4AEDC 1QJY3 4EWDA 1WMEA 1DQ2A 1DHKB 3LSDA 3AXEA 3POYA 1ULGA 3WW3A 4IV3A 1D0HA 1EAH3 4OHZA 4DY3A 3H1YA 4UBHA 5H9SA 1PIV2 3MZHA 1AF9A 1UX6A 5I8TA 3NO8A 4J1WA 2IC1A 3ZYIB 5IK5A 2ZZQA 4BQ1A 5CU1A 5L7OC 1ZRFA 1DYPA 1PVC3 3WT3A 1POV3 5KXCA 4ASLA 4HK8A 2BBVA 3GF6A 4QQHA 1GNZA 5CFCC 4IEPA 5GLUA 2XJTA 1RUH2 4P9IA 2PHTA 2GNMA 1PK6C 3JZVA 5DZGA 1KQRA 3VHRA 2EAAA 1RUI2 3ES4A 1SEFA 1Q5OA 1VBA3 2WNVB 4QGLA 1S0GA 4YVWC 2UY9A 2E7TA 4HKWA 1EV11 2WLPA 3MGUA 4Q1RA 4Q4W2 4IV1B 3M70A 1J1LA 4Q1PA 2PAEA 4AI8A 4C91A 1PZ9A 2MHFA 4GB33 3UJQA 4PIYA 1VJ2A 2PA7A 3WP4A 1MS1A 3PNAA 1VBD2 3MIBA 1BCXA 5KXDA 4Z82A 4Y1XA 2Q8OA 4Q4X3 1V9U2 1ZVFA 5FLIA 1XXNA 1YFYA 2ES3A 2VW1A 3RG0A 5DUXA 3J8F3 2VMHA 1WLDA 5JI9A 1Y7BA 4YFZA 3LOIA 5FMOL 4FPEA 1ZRRA 4RQPA 3HT1A 4BMBA 4DZGA 4HPKB 2D44A 4CEWC 2H0BA 4D7YA 1Q8SA 2HWC1 3NV4A 4GIQA 1AXZA 2R30A 1ULFA 2ATFA 1SBEA 1LTEA 4FOQA 5I0TA 2Q0AA 4OI0A 2YDEA 3ENRA 4K9SA 1M06G 4FPLA 1GQHA 1CR7A 4P9WA 3ZFGB 2EXIA 4YZ5A 4XYXA 4M3CA 4XFBA 2ZGOA 1AL23 2F4PA 2WNUA 2BQPA 2WA4A 4UW4A 4AVBA 3N7KA 4JRAA 4GKXA 1V6IA 2OVUA 1I1EA 3NAPA 4Y22B 3V0BA 5BNOB 5CBLA 3WXPA 3I7DA 3E6DA 1HXS1 5E1RA 2D7FA 5DDJ1 2RS11 4EV0A 4XJWA 1QU0A 3LA3A 2GNBA 1W6PB 1X8EA 4GH4A 1GANA 3LKJA 2D5FA 2RS33 2CAUA 5JIAA 2K2SA 1SCSA 3E5QA 4WZCA 3VHPA 1LESA 1M4WA 1H2LA 3CLPA 4K3UA 1MZEA 4WVMB 1GV9A 3SNMA 1R091 4S2DA 2XJSA 1POV1 4JV4A 5DZEA 1RMU2 4Z8BA 4IEUA 4LBQD 4YZ2A 1QF3A 3ECQA 2YC0A 2A3WA 1YNAA 1XYOA 1GR3A 1QJX3 2HWD2 4WV8A 2DCZA 2O1QA 4Y1YA 1Z0HA 2P3JA 1U0AA 5DG2A 1O4TA 3VKMA 4B4QA 3KSCA 5DUWA 1ENRA 2KA3A 4COYA 2XVGA 5JSPA 1FV3A 4XJ9A 2BWAA 4CDWA 4DFSA 2XPJA 2ET7A 2UU8A 2WSUA 5C9AB 1Q3EA 2R073 1G7YA 2JG9B 1MZ6A 1FOD3 1COV2 5GZGA 1KJLA 1T6GC 5C8CC 1MACA 1H2KA 3ILNA 4IETA 4YM1A 1LEDA 1VRH1 2ENRA 4YW1A 3VBSC 3J9SA 1YJKA 5FTTC 3VGIA 3AJYA 1UIKA 1UPSA 5D1IA 2HWB1 5T5JA 3EJKA 2XG3A 5TSWA 2GN7A 1LHWA 1OQ1A 5JPNB 1BXHA 1SFNA 4QM9A 1H4GA 1BQPA 1ZBE2 1OQDA 1ENSA 1C5HA 1TME1 1F31A 1G9CA 4W65A 3WHUA 4GKYA 4YM0A 1RUD3 5ABJA 1FI2A 1GBGA 4I2OA 3H3ZA 3MPBA 2NMNA 4XF3A 3RJ2X 2EXHA 1LHVA 1ZA4A 1LB2A 2I45A 5BNNA 5F6KA 2DCJA 1ZBA3 1U12A 3VBOB 3UV9A 2OPKA 2JECA 4P5HA 1OA3A 5EJ3A 1ZZ6A 3AKTA 5JZGA 3BPZA 4O9EA 1UAIA 4Q0QA 3HIFA 1F9KA 4MGZE 2JKBA 4MGYE 4HT1T 1YXWA 1EV12 1V70A 3X29B 1LR5A 2AR6A 3PJYA 1A8DA 4AXOA 2QVSB 4PBOA 2WQ4A 4H7LA 1IZ3A 2BVVA 5AC91 4R9AA 3TN91 2VOKA 1W39A 3DPRB 2W0XA 3WVJA 3AP9A 3IKWA 2TEPA 1ZZ7A 1HRI1 2HKXA 2F6BA 2VOWA 1W6QB 2ZMLA 4YW4A 3HQXA 1RUG3 1DGLA 1QJX1 2CL2A 1NOVA 4Y1ZA 2D97A 5KXBA 4AFMA 2JICA 1SLBA 2IXCA 1LEMA 1NYWA 3BU7A 3RDIA 4A7KA 3O5SA 1NE4A 2DVFA 1FPN1 1OSGA 1ND3A 2PELA 2RM22 1MR5A 4TZDA 3O7OA 3ZFFA 3B9CA 4DMIA 1X33A 3WDYA 5HCBA 5BNPB 1O7FA 1R1ZA 2UWBA 1ENQA 4Y20A 1QXPA 4AK3A 2ZPXA 4Y1UA 4GWMA 5JOZA 4JQRA 1V6OA 4Q27A 3VDDB 1DBNA 2HEYF 4Q4V3 1CIWA 4QPYA 1LKNA 1RUJ3 3WP3A 1O3TA 3B5LB 4YRDA 1OFSA 4N43C 1WMFA 2YYOA 3GBFA 4JRLA 4Q0SA 1HXS2 1Z7S3 4I01A 3MLLA 5DDJ2 2OIIA 2D6MA 3JB8A 3WDTA 3KCXA 1CAXA 1WLWA 3JBG2 1PGW1 1XNCA 3IPVB 4ONUA 3N7MA 1YI9A 4GWNA 1AR73 4M3CE 2Z79A 1Q56A 1MS0A 4MSVA 1SBFA 1OD5A 4CEWA 1RUD1 3HAGA 2XH6A 2CAVA 1AR81 1PNFA 4KWJA 4MV2A 5FO9B 1S0BA 1AR61 2WA3A 3WHTA 2PHFA 4FPJA 4BM8A 2QCSB 5IK8A 1CQ9A 1DLLA 2BNOA 1DZQA 3OD4A 3L2HA 2PAMA 3TBDA 1C57A 4XDQA 1GKBA 4CDUC 4XJ8A 1OQEA 3ZFEC 4HZFA 4HN1A 3WW4A 3FUOA 2V73A 4AQTA 1CESA 2Y26A 3A0NA 1TNFA 2ZA9A 2DFBA 3OGGA 4MGIE 2Y0OA 4CTEA 1HRV2 2K9ZA 1S0FA 3QBQA 4J1XA 2R1BA 1VRH2 1RUH3 1HQLA 4X6RB 4RSUA 2HJIA 2NN8A 3KLSA 4YZ1A 5KHGA 4CEYC 4K8FA 3UKNA 4FPOB 1BBT3 4YM3A 4IEWA 2UYAA 4XTPA 1AYM2 4M01A 1PO22 3PVEA 2PLV2 2HEWF 1JYCA 1N1VA 2R042 4X8PA 4E2GA 1NCRB 1SLAA 3VKFC 5I0RA 3LSEA 2CYFA 4U2AA 2XWBB 5E88A 4AGGA 4YYOA 3ZVXA 2EXJA 1W6OA 2XLAA 1TME2 4LE3A 2RHPA 1D0GA 2YV8A 5FMOS 1V9U3 2ZMKA 1YJLA 3KGLA 1FAYA 2A3XA 3NL1A 1REEA 4GULA 1NCQA 2D3SA 1X82A 1AX2A 2ARBA 2XB6C 1AUYA 3NJZA 4AQSA 4FAHA 3LCPA 3NKTA 5KC5A 4N7IA 1B35A 2XL9A 3WV6A 1J1TA 2WLQA 2P34A 3THPA 1FNZA 1LOEA 1ENXA 1GLHA 1ONAA 2RMU3 3ZN6B 3D8CA 3VBFA 3QD6A 4TYSA 4Y24A 3M8LA 1D4M1 1LOCA 2PHXA 1Z7S1 4K40A 3URFA 2YY1A 4XXPA 3N7LA 4B7EA 4IQPA 2GU9A 1PGL2 2QDNA 3ZDSA 1LRHA 2ZGSA 4OVEA 3TN92 2Q5TA 3JQXA 4AVTA 4Z2WA 1QQP3 4PJYA 3B94A 2JG8B 3N3HA 1ASJ3 1K5MB 1H8TB 4WM8A 5GLZA 3ES1A 1O4ZA 2R32A 4N53A 4AHYA 4NN0A 1PIV1 4W6XA 3JD71 4HKOA 1G86A 1IHMA 1R082 4G3YC 1WMDA 3NSTA 2XJQA 3OJBA 3TAYA 3RYPA 5A32B 4RQPC 5ACA2 5CVRA 2RJLA 3CJIB 3PHMA 5T55A 1HLCA 5D8AB 3M3EA 2DCKA 2Y38A 3ZPYA 1RUH1 3EXUA 1DQ6A 4RR3A 4PLMA 1GFF2 2BEOA 3ZN5A 5FPXA 1Q8PA 2A7AA 1RUI1 4CDXB 1H9PA 2AH2A 3FLPA 2NQYA 1O91A 2ZHNA 2QKDA 4FT8A 2WNUC 4B4RA 1QOTA 1SLLA 3OY8A 4Q4W1 3ILFA 1N3QA 4S2FA 1BK1A 1PGW2 3WOGA 1COV3 4KU8A 4EJRA 4XMAA 3NAPC 3VZKA 2WFF1 4PDWA 2Y0IA 2LM3A 1Y9QA 4RS5B 1VBD1 5L36A 3APBA 1V9U1 3OBRA 4ORFA 2UWAA 1G6NA 1AR82 1NA1B 4GH4C 2WT0A 4AEMA 2DUPA 1Y43B 2AZ5A 4JGZC 2H6CA 2DU0A 4NOTA 3M7AA 1FX5A 5FPZA 1D4VB 1ND2B 4FPHA 3QH7A 2TBVA 3ST7A 1QJU2 1OLRA 2V09A 3AP6A 3MIEA 5C4WB 3FX3A 1VIWB 1A8MA 1X50A 3PVNA 1OMIA 3MLJA 3TNQA 5JAXA 3O12A 4CDWC 5I0SA 3S7IA 5A3LA 4AGVA 2IFWA 1VB2A 3D82A 1S0DA 2O8OA 3VBUB 5J48A 2GH8A 3GALA 2BFUL 2K0GA 3KMHA 2ZAHA 4XIKA 4URTA 3WG3A 2G4IA 4E2QA 2D6KA 1VALA 1XNBA 3Q9OA 1DU3D 1E57A 4OHVA 4QQPA 2NZ9A 4QHBA 4I0BA 3WX5A 3E5UA 3GZUC 4AEDB 1EV13 2Z2SB 3AMNA 2WZPP 5FOBB 1JTZX 1QMJA 5EYXA 1KRIA 4E27A 2BNNA 1GZWA 3ZIWA 3SMHA 4Y1VA 4OULA 1LULA 1PHMA 1J59A 1OOPA 1XNDA 4WM7A 4X8NA 4WVZA 3TOJA 3B00A 3ZXAC 4EN7B 1RMU1 1W6QA 2VNOA 2JDZA 3QH6A 2ZHLA 1MQTA 1DGWA 5FREA 3RYKA 2Q1ZB 3A4UA 3FLRA 5L7OB 2XLGA 1C1LA 4P9YA 2HWD1 5H9PA 4DINB 3CO2A 3MPPG 4YGEA 4IEVA 4YVSA 1AX0A 5ABJC 3POSA 2BTVC 4LUKA 5CFCB 2PFWA 2VUAA 1H4HA 2XJUA 1D4M2 1CX4A 1Q8OA 4H7MA 1PK6B 3G6JB 1DFQA 2D40A 2C1FA 1FNYA 1MS5A 1QXJA 2QJVA 4XBLA 4YVWB 5JZGC 4BH9A 1WCKA 3GBWA 3I59A 4BYYA 1O3RA 3WINE 3W59A 3UJOA 1CAWA 1RUC1 3LGRA 1XE7A 4FOWA 4A7YA 2VW2A 2DVGA 1CAUB 1KDMA 2DFCA 5JWPA 2HWE1 2QZ2A 2NPIA 4FO9A 1G9FA 3MEPA 4JVAA 4IEZA 1NQDA 1HXS3 2A6VA 5DDJ3 2RS13 4FPYA 3JD72 4QM8A 1XYNA 3KS7A 4QPGC 4YZ4A 5KC6A 4AE2A 3MFCA 2XWJB 1HIXA 1ZBE1 1RUF1 4J6GA 1W0PA 4HN0A 3D5OA 1R093 1XE8A 5CG9A 3RI9A 2XBO2 3RZZA 3RWNA 4C1XA 3UKTA 3VKLA 1ND3C 2W68A 1GSLA 4AFBA 2NMOA 3ZFFC 1DZRA 4LLOA 4KQ7A 1AR92 4HVRA 1W6NB 3VBHA 3DF0A 1QNYA 1PNGA 3M2MA 4P9LA 3WDVA 4XF0A 1MVQA 4H14A 4XETA 2WFF2 5EWSA 3SITA 3HN1A 4XFAA 3POWA 1RVF2 3BCWA 3PVOA 2QFEA 1FXZA 1JXNA 5K8SA 1VRH3 4OUSA 2P3KA 1JN2P 2JE7A 2ARXA 2HYKA 2HWB3 3FWEA 3TYJA 4H55A 3E6CC 5JSRA 1BVP1 4COVA 4JDOA 1FYUA 1LHOA 2WQZC 2XLFA 2DTYA 4XF4A 2PLV3 5CNAA 2PHRA 1HKDA 5J3UA 3ZO0B 2RM21 4XTMA 1RTVA 4TSVA 1H2NA 4PIZA 3VZLA 5HXVA 2XUMA 1TME3 3LAGA 4EWAA 2RR11 2G9GA 1GYKA 5BY5A 3I8TA 4Q0UA 5LEKA 5CFDA 2XJPA 3ZXKA 2ZMNA 1QNWA 4CDQA 1LU2A 4AI1A 2ZX2A 3VUOA 2ZCWA 1JUHA 1GZ9A 1EYBA 5C8CB 2BYVE 1D2QA 4LO5B 5EYYA 1CAVB 2VNGA 3INAA 4LA2A 1JUIA 1ZYBA 3VBSB 4L8QA 5JOWA 1RHI1 2VOVA 4RGGA 2ZAAA 2VMGA 3JBG1 2VNRA 1VR3A 2ZX0A 4LUMA 1RUE1 1MVEA 4JGZA 3ZX7A 1O3SA 1AVBA 5CG8A 3M3CA 5AC93 3TN93 3P3NA 4PCRA 4LA3A 5I8SA 1C8M1 3WQ1A 1HRI3 4ISRA 2HEVF 2ZKLA 4N7UA 2GN3A 3RNSA 3NKGA 2WS92 3IWZA 3USUA 1I3HA 1MS4A 1ZRCA 1IS6A 2JJ6A 2DWRA 1H0BA 1XQNA 3IBMA 4SLIA 5JDBA 3KD4A 2WIIB 2VW0A 5GLWA 1UPIA 1FPN3 4IXLA 4U36A 1NCQC 5F6LB 1J58A 3ZSKA 5BUVA 1J3RA 1B35C 4MXWA 3B69A 2ZABA 4FOVA 1HRV1 4KNCA 4YG3A 5CIRA 4LEJA 2RJKA 3VBFC 4EN9B 4ES8A 2XVLA 2WFPA 4AGRA 1RUC2 5E8AA 5T50A 4KWLA 4ZU7A 1OPMA 2R1DA 4B8EA 5BV6A 1RIRA 3N35A 1G8WA 2HWE2 4LHLA 3VZNA 4FBFA 4DPNA 1AYM1 1VAMA 1PO21 3TWIA 1VBC2 1VBB1 2DVAA 2PLV1 2PN5A 1LOGA 1V6KA 2R041 3AZWA 4XHXA 3T1LA 4YARA 4E2SA 4OI4A 1KD7A 2WL1A 3AP5A 4WM8C 5SV5A 5I8YA 3RI8A 2D98A 2GAUA 2GMEA 4N53C 4BMEA 2DV9A 1RUF2 4GMP0 3OYWB 4L92A 3RYRA 1SMVA 4BIFA 4I02A 3WCRA 2BWCA 5GZEA 2R49A 1FATA 1PZ8A 4QT6A 1AR83 1WCSA 5FQ0B 5I0UA 1AR63 1Q8QA 4W6YA 2A6YA 5LK5A 3OBTA 2R062 1TEIA 2GMMA 3AFKA 4P9JA 3WLUA 1QHDA 2PYTA 4DQAA 1CD3G 1QJU3 3IDCB 4L99A 5JI7A 2BW8A 2GZWA 3HBZA 4XXAA 4BE3A 4XOGA 2HWF1 1DGWX 4RR3C 5DXDA 4HANA 4N43B 2OYZA 1PGL1 2BFUS 1ZNPA 4UW6A 3SH4A 1AL0G 2QQPA 1W6MB 3LOBA 5GM0A 3E6BA 2QNKA 4UW3A 3OF1A 1RB8G 3VBRA 3PMEA 1JBC