The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
31
|
sequence length |
140
|
structure length |
140
|
Chain Sequence |
DMSAQAIIRELGLEPHPEGGFYHQTFRDKAGGERGHSTAIYYLLEKGVRSHWHRVTDAVEVWHYYAGAPIALHLSQDGREVQTFTLGPAILEGERPQVIVPANCWQSAESLGDFTLVGCTVSPGFAFSSFVMAEPGWSPG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
hypothetical protein Atu3615
|
publication title |
X-Ray structure of the hypothetical protein Q8U9W0 from Agrobacterium tumefaciens. Northeast Structural Genomics Consortium target AtR55.
rcsb |
source organism |
Agrobacterium tumefaciens str. c58
|
molecule tags |
Structural genomics, unknown function
|
total genus |
31
|
structure length |
140
|
sequence length |
140
|
chains with identical sequence |
B, C, D, E, F, G
|
ec nomenclature | |
pdb deposition date | 2005-05-11 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF06172 | Cupin_5 | Cupin superfamily (DUF985) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Jelly Rolls | Jelly Rolls |