5FZOB

Crystal structure of the catalytic domain of human jmjd1c
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
343
structure length
338
Chain Sequence
MIPHSWICEKHILWLKDYKNSSNWKLFKECWKQGQPAVVSGVHKKMNISLWKAESISLDFGDHQADLLNCKDSIISNANVKEFWDGFEEVSKRQKETVVLKLKDWPSGEDFKTMMPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLSAYGVVAAKDHDIGTTNLHIEVDDVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords PROBABLE JMJC DOMAIN-CONTAINING HISTONE DEMETHYLATION PROT E
publication title Crystal Structure of the Catalytic Domain of Human Jmjd1C
rcsb
source organism Homo sapiens
total genus 99
structure length 338
sequence length 343
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02373 JmjC JmjC domain, hydroxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fzoB01
4QXBA 3U4SA 5LW9A 3KV4A 5IVEA 5FP8A 2GP3A 5FZDA 5FP3A 5FJHA 2VD7A 4GAZA 5FYVA 2GP5A 2XMLA 5IW0A 4UF0B 5LY1A 5FZIA 3OPTA 3K3OA 3RVHA 2OQ7A 5FZOA 3OPWA 5F39A 4LXLA 4AI9A 4XDOA 5FZ9A 4D6QA 4DIQA 3LD8A 4AAPA 3KV9A 5FYSA 5FV3A 5ANQA 5A7WA 4QX8A 5FZEA 5FUNA 5FP7A 5F37A 4QWNA 5FY1A 3K2OA 2XDVA 3PDQA 3AVRA 3ZPOA 5FZ4A 4CCMA 4E4HA 4EZ4A 2OX0A 5IVJA 4HONA 5FZMA 3AL6A 4URAA 5A7PA 2XXZA 4QX7A 2P5BA 5E6HA 5FZAA 5FUPA 3PURA 5FYTA 3UYJA 5F32A 5F5CA 4D6SA 5IVVA 5A7NA 5FP4A 5FY4A 3LDBA 3N9MA 2W2IA 2YBKA 4GJZA 4LITA 5FZ1A 5IVYA 2OQ6A 3N9QA 4XDPA 2WWUA 4CCKA 3N9NA 5FY9A 3KV5A 5CEHA 5FY8A 5FYCA 5FZ6A 3DXUA 5F5AA 5FYYA 4Y4RA 3PTRB 5FZKA 5F3IA 4EYUA 5FPVA 5A7WB 5A3TA 5FZLA 4UF0A 5FPUA 4GJYA 5FPBA 5FYZA 5A7SA 2Q8DA 5F3CA 3KVBA 3PUAA 3N9PA 5FYUA 4QXHA 2OS2A 5FZHA 4EZHA 2WWJA 3N9LA 5FZGA 5FY7A 3PU8A 5IVCA 4QXCA 4CCJA 5FXZA 3NJYA 4ASKA 4BU2A 5F3GA 5FBJA 5FY5A 5FZ3A 5FWEA 5FYBA 4Y3OA 4CSWA 5A7OA 3AL5A 5A1FA 5FZCA 3K3NA 5A80A 2Q8EA 5A7QA 5FZOB 4V2WA 5FWJA 5FYHA 2YU1A 5FZ7A 3ZLIA 5FY0A 4C8DA 4Y33A 5FXXA 5FYMA 4IGOA 2YU2A 4DO0A 5LWBA 3PUQA 5IVBA 3PUSA 5ISLA 5F5IA 2OT7A 2YBPA 4HOOA 3PU3A 5FZBA 3KVAA 5LY2A 5KR7A 4GD4A 4NUBA 3KV6A 4V2VA 5FZ8A 2PXJA 5FPAA 5FXWA 4CCOA 2Q8CA 4BXFA 5F3EA 5IWFA 5FXVA 4QU1A 4D6RA 3DXTA 4IGQA 5A3WA 4CCNA 5FZFA 5F2WA 2YPDA 4BISA 5IVFA 3U78A 2YBSA 5F2SA 5FYIA 4CCLA 5FP9A 3N9OA 4CUGA 4IGPA 5FPLA 5K4LA 3AVSA 5FZ0A 1VRBA 5A1LA 5A3PA 4TN7A 4LIUA 5A3NA 5FJKA 4LIVA 2XUEA
chains in the Genus database with same CATH superfamily
2EICA 3U4SA 4PF5A 2VZQA 4O9GA 3D6EA 3AXDA 4FPFA 5FP3A 2J7MA 1W2UA 4CP0A 1N1TA 2GP5A 4AFMA 3GYDA 1JMUB 4BE3A 1AYN3 4YM3A 2VVDA 5I8TA 3LEGA 2BPA2 4HN1A 5CG8A 2YV8A 2OQ7A 3LB9A 3OPWA 4ZONA 3ELNA 4RA0A 3AKPA 2VZOA 5KBFA 1UYZA 3MLKA 1NXD1 1RVF1 1YC61 3OJBA 4KU7A 1OQ1A 2LUWA 1FPN1 2B9VA 2PAMA 3POYA 4JQRA 4QX8A 4DMIA 5I93A 2QKDA 2W9XA 4CDXA 4ZZ8A 3ZN5A 1VBE3 1DQ6A 2Z5WA 1BMV1 2FD8A 1WWYA 1AL21 4XFCA 3GBGA 4R52A 2JIJA 1S2EA 3OGGA 2JICA 3ILRA 3CBNA 3IN9A 4XE9A 1FNYA 1GV9A 4GB31 1JUHA 5IAXA 5LA0A 2NPIA 1H1AA 4JKKA 3JB8A 5IVVA 3IDCB 4KBBA 2IXJA 3KWVA 3S0MA 3DCQA 1IS3A 1NZCA 2OQ6A 2A7AA 2QZ3A 1OKOA 4CCKA 3DUIA 4GKXA 2WA4A 3ACGA 3R4UA 1X7NA 1HDKA 3RYRA 5B2GB 5FYYA 1CIYA 3WLUA 4QX3A 3SCGA 1B35B 2BERA 1OSGA 3T0DA 5FZLA 2VXJA 1ENSA 2ARBA 3NNLA 3MV01 1NA1B 3OY8A 1YQ6A 3J8F1 4QQ2A 2VG9A 4JC1A 5DAQA 5FPBA 1G6NA 2Q8DA 1U12A 2V72A 4Z92B 1YXWA 4N53A 4CEWC 1UY1A 3I2IA 2D97A 4Y24A 2F4LA 3CJIB 2FMYA 1GQGA 5BNPC 2VTFA 2XKPA 1IG3A 3W58A 1E5IA 3ZSLA 4RHV3 3RSJA 4ZKTB 1W3VA 2BVVA 2JD9A 4GXLA 4Q4X3 4FSJA 5FZCA 3NL1A 1TME1 4G3YC 1J3PA 4QX1A 1H6YA 3TEYA 1CVNA 1AR92 5JMOA 3IIAA 2ZX4A 2WNUA 4TYSA 3R0RA 2DCJA 3SEPA 4RS5A 5EJ1B 2EIGA 2YU2A 3AZXA 4HT1T 4BCUA 2JECA 3Q8AA 5ISLA 3LOBA 5TSWA 4LNVA 3IT8A 1R1ZA 3T2PA 4IEVA 1REEA 2OVUA 2VY0A 1LODA 1QQP1 2R062 2ZX3A 1XNBA 4MGIE 3RNSA 1L7QA 3OY8B 4BQ1A 2RDRA 3K4DA 4IE7A 5A32A 1Z7S1 2QQJA 3DYOA 3ZFFA 4C91A 3MPBA 3MI8A 4C90A 4ZS2A 2CAVA 1SPPA 2OKXA 3SCFA 1PK6A 1RUI3 4A41A 3CKHA 2Y26A 5IVFA 1G9FA 3BALA 2QQOA 1IKPA 3JCIA 1O4TA 2JEMA 2JDYA 3RRDA 4BMBA 4M4RA 2IFRA 5FPLA 3AVSA 4I09A 2RS13 4JZRA 2K46A 1BLZA 2NMNA 4NIDA 2OXBA 4KGQA 1NY72 2Q1MA 2QQLA 3I8TA 1NE4A 4NE9A 2WZR2 2WNUB 3WDTA 2O1QA 1RMU2 1OKQA 1EPZA 2EIDA 3ZIXA 1M06G 3FUQA 5E8AA 2ADEA 5ACA3 3T2TA 1QH7A 2XMLA 3O1SA 4MG2A 5FMDA 1MEC3 1E57A 1AYM2 1FOD3 4A2UA 4CCEA 1PIV1 3J7NA 2FDKA 4EROA 1JOPA 2E7TA 4TWTA 1ZREA 1JOJA 4UFHA 2G19A 1GZWA 1GWLA 1OI6A 4GWMA 5A32B 2QE3A 5FCCA 1QJZA 2GDFA 5FO8B 3EQEA 1J83A 4QDSA 3BB6A 2DURA 2CDOA 4YW2A 3JBG3 3VBFB 3ZPOA 1OPMA 1DYKA 1O5LA 2HWF1 2J1AA 1RHI2 1Z0HA 2DYCA 3Q8CA 4R9AA 1DFQA 3ZPYA 3H42B 1UZ0A 3NWKA 1OLME 2B5HA 1W2OA 5F32A 3RJRA 3MLJA 3TBDA 3PMEA 3ATGA 1PX4A 4XF9A 4HLTA 2W1UA 3ASIA 5EWSA 1QU0A 2MPFA 5GKAC 4HANA 1PO21 4FPGA 2ID4A 4ONUA 4AYUA 1AVBA 4AZZA 4R4XA 2RS33 4LBJA 3FLTA 4PLMA 4CXYA 1ZM1A 2ARAA 5DDJ1 5FLIA 2BNMA 5KXBA 2XPJA 1RUJ3 2MEV1 3ROUA 3O1PA 2NMOA 1N1SA 1HRI3 2VMCA 4ZZ5A 4Q29A 3CL1A 4K21A 1PZ7A 1UX6A 1Y4WA 2OIIA 2DU1A 5FYZA 4HSJA 5D2AA 1CX4A 4Z8BA 1YFYA 4QB1A 5F3CA 4ATEA 2HBTA 5J48A 1H1IA 2NP0A 1MACA 5FMCA 4H7MA 2AGSA 3S6PA 5J36A 1LOGA 1ZBE3 1OT5A 5A33B 4FPKA 1S55A 3RYKA 4BJ0A 4XJ9A 4CSWA 3H1YA 2WL1A 4BQ5A 1W6OA 2SBAA 2JD4A 2GH8A 5JCTA 4YW4A 2BNOA 1XU2A 2HKXA 2WFF3 5A80A 3ZYHA 1GNHA 4AL9A 4WVMA 5J37A 2RMU1 1PNGA 3ON7A 5L73A 4BIFA 2XR4A 3FFZA 5FY0A 2PHRA 4Q8KA 1JBCA 1H8TA 5LATA 2W1WA 1Q56A 3T0AA 5KR7A 1H9WA 4FFGA 1U5IA 4HFSA 4OHZA 4GD4A 4Y1XA 4E4SA 4JGZC 1W0OA 4OVEA 1E5RA 1GICA 3O1UA 1AR63 1OD3A 1UW8A 3AZWA 2Q8CA 4JV4A 5B4XA 3JU9A 4B4PA 2H6BA 4MYEA 4DZGA 5EYXA 4LA2A 1HB3A 4QXKA 3I2OA 5FZFA 3B7MA 5EZWA 5F2WA 4D7TA 2RS52 5JR2A 1FPN3 1JH5A 1VJ2A 5EV7A 3S7IA 3H8UA 3IM0A 5BNOB 2JG9C 3DPRB 3NAPC 1YI9A 1HN0A 2A73B 2XQRA 5CAZA 4KWKA 1VRBA 1W2TA 1RJ8A 4CRQA 1UXZA 3RZZA 5DG1A 2V09A 2RV9A 5CKQA 4QXBA 1LEMA 5C8CC 1DZTA 1VE0A 1DQ4A 2F4PA 3EJKA 3HAGA 1H8TB 3KT7A 4QU2A 4R4ZA 5DZGA 4B1MA 4CEYC 1G8WA 5LBBA 1YHFA 4E9KA 5ANNA 5JXGA 1QJY3 4PI0A 4IEPA 2GALA 1RUC2 4XPVA 4QX0A 2NM1A 4A6OA 2BGOA 5FZ9A 3N7JA 1H4HA 2Q5TA 2J42A 2HWB1 5C9AC 2JG8C 1YIPA 3P3NA 3BODA 5GM0A 4OUSA 4LULA 3QH7A 3JQXA 2YGLA 1YFWA 2O8QA 2ZA9A 1W6MA 4DINB 4XBLA 5F6LB 4E4HA 2VMIA 4FOYA 4LQRA 5IVJA 4EQVA 4JCKA 3RDIA 1W90A 2CU5A 5T5JA 1IS4A 2VC9A 5FUPA 3WDWA 4CP1A 4HVQA 5LZ6A 4A45A 3UYJA 3HEIA 3C3VA 3VD9A 2VH9A 4GMP1 4RL7A 1W04A 3E6BA 1C8M1 3N9MA 1JYIA 1LR5A 1W06A 4DPNA 1UZYA 1TME3 4XCBA 2NYYA 3KM5A 2JWPA 5FY9A 1IQDC 2GMPA 2PHLA 3AZVA 3L2YA 2XBO2 3KLSA 4Q2FA 5CZKA 5DMYA 1CX1A 2RDQA 3ZXJA 4B4QA 4N9IA 4GIQA 4QDRA 2PLV1 4P08A 4BZ4A 4AI2A 1G9BA 2HWC2 4XEZA 4K1ZA 1XJAA 1AL22 1LHOA 4AVTA 1W6MB 4HL0A 4QHBA 2XLGA 4IEXA 3BOPA 3N9LA 2RDNA 1Z7S3 5FY7A 1N3PA 1W6NB 3MIGA 1NKGA 1PO12 2QQPA 2V73A 2ZGTA 4P9XA 3KF5A 1AR82 4CEWA 2ARXA 5FYBA 4Y3OA 4AI3A 4EWEA 5A6YA 2DFCA 3K3NA 4IEWA 3J9SA 1QJX2 1XNCA 3B9IA 3EXUA 4NPLA 3T08A 3OBRA 1YEWA 4XC9A 2CL2A 4KWUA 5J3UA 4DOUA 2JDKA 4RQPC 2A71A 3WHTA 5C5TA 5KHGA 1V00A 1Q3EA 4JRLA 2PAKA 3J8F2 1Y7BA 3UV9A 4OI1A 4BM8A 2XWJB 5G05L 4CU9A 2KA3A 5IATA 1PIV3 4LUMA 4XQ4A 1RUD1 1NYWA 4M3CF 3GHMA 5APAA 5EYYA 1AJKA 1GQHA 4COZA 4FPEA 4K6BA 1EYBA 1H2LA 4AR2A 2WYSA 1MZ5A 3KCXA 1DF0A 5FMBA 2IXLA 2VULA 1DGWA 3WW2A 2FZ2A 2Y0OA 1UD1A 4I3PA 2YBSA 3R4DB 1DQ2A 4JDMA 4CEWB 3LZZA 4R9CA 1UMZA 2ILMA 5G04L 4AHWA 5BNPB 1W6PB 1VRH1 4PIXA 3CQOA 1SHWB 1SG3A 2WO1A 2HEWF 2W91A 3E6DA 3LWCA 4LMFA 2DUQA 1XBFA 1Y9GA 5D8AC 3TYJA 5A3PA 1EY2A 1CAVA 3O1VA 3UGHA 3V64A 4XURA 5LW9A 1FAYA 3IIIA 3F2ZA 1OLMA 4GWIA 4COUA 1E5SA 4ORFA 2WR9A 1WUVA 3NV2A 2JDAA 4UF0B 5CFCC 3JXSA 5K9YA 1XE0A 2WINB 3FFQA 3LQCA 1LOFA 4GWJA 4DY3A 1LOEA 4XDOA 4RR3C 3WF3A 1IPJA 3BKZA 1V6IA 3LSEA 5HV0A 2MEV3 2V4VA 2VQ0A 3RI9A 1YCIA 5FUNA 4WZFA 5LCWL 1O4YA 5JPNB 2ZGNA 2Y34A 3RWKX 2A6ZA 1ENRA 5M0TA 4LBOA 2G4IA 3D82A 4CCMA 4NIGA 3ZVXA 4HKWA 3OCPA 5FZMA 3X29B 2WN3A 5AFEA 2TNFA 1OQDA 5F9TA 1QJFA 2C9KA 2GU9A 3ZSJA 3HNBM 2VPVA 1NXMA 3TN92 1UMIA 1U5ZA 1US2A 2TUNA 3T1MA 5LEJA 1NQJA 3RI8A 4LUKA 1K12A 3H0OA 4XOGA 1WBLA 2IC1A 4META 1K3IA 3EYPA 1HXS2 4MV2A 3M3IA 3VDAA 3TOJA 3AP5A 2ARCA 3ETQA 4CDXC 3MFAA 3C7HA 2RMU3 2A3YA 3JD72 1T6GC 3WF1A 2WSUA 2A6YA 5E89A 1D2SA 2R1BA 1Q43A 4MSVA 5F3IA 5FZKA 4YSFA 3PLQA 5FPUA 2PHXA 3KD4A 3IPVA 4AFDA 1I1EA 3S7EA 4Q5OA 3LF7A 2XJQA 2BVBA 2HEVF 2IUWA 5A3MA 3UKNA 2OS2A 4WM8C 3VBRC 3AMMA 4QPWA 4CCJA 3KQRA 5GZCA 1FMD1 4XUPA 5FDBA 3LPGA 1LECA 1JUIA 1VBA2 5CKNA 3USUA 3BPZA 3DN7A 5JSOA 1AF9A 3VL8A 2CGNA 2W94A 4NRQA 3AFGA 2FBEA 5A7QA 3R6SA 1AR91 1IOAA 3M3QA 3H3ZA 4MGSA 4XF0A 2PMWB 4I0WB 1RUE1 3E6CC 5D1IA 1K45A 4UWDA 3SLIA 4AE2A 4N53C 2WS93 3PU3A 2R061 5LBFA 4OFGA 4P9WA 4XQDA 1QIQA 2ZHKA 3LKJA 2PXJA 4E27A 4YVSC 4YG3A 1ZBA2 2WQZC 4BXFA 3IPVB 3OOXA 5T5OA 1VBD3 3AK0A 5JXJA 1ZNPA 5T55A 1JN2P 3I3DA 2VMDA 2P3IA 2QQNA 2TEPA 2ZMKA 4D69A 2CGOA 4XTPA 1DQ5A 1I5ZA 2HWB3 4O7XA 4O61A 3D3AA 2Q8OA 5FPXA 2ET7A 2XGXA 4RS5C 2E51A 4TLGA 2RJ2A 1XPWA 1JW6A 3ZYFA 4S2DA 1F35A 2WZR1 2XWBB 2VCMA 4G9SB 1PVXA 5FMOL 1HKDA 4EWAA 5KHIA 4PIYA 3W5NA 1EAH2 1GOGA 3ENRA 4XVHA 2CHHA 3GHNA 1FV3A 3ZFFC 1D4M2 3M2MA 1ULEA 5FO7B 5LY1A 1AYM1 4QHZA 5C8CA 1PK6C 2DTWA 3WOGA 2LRPA 4XABA 3K3OA 4I02A 3LCPA 1OVSA 3KT4A 5FZOA 4BQ2A 1ZRFA 4DFSA 1AL0G 4FPJA 3WNPA 4CEYA 1G9CA 2P3KA 2VCCA 1XE7A 4JGZB 1H9PA 3CDZB 2AZ5A 4BH9A 5F37A 1OQEA 3H3LA 4K8RB 4WM7C 3ZYIB 3K2OA 2HJIA 2VUJA 3AC0A 4HZFA 3WDXA 1K5MC 2YGMA 1WZXA 1RHI1 5JIUA 1LHVA 3GCXA 3POSA 2PA7A 3T2QA 2PHFA 2JG9B 4NPMA 2EXIA 2RG4A 1MS8A 1OOPA 2J1EA 3NAPB 1VPHA 5LRRA 3IAPA 3SXWA 3WXPA 2AACA 3VKFC 3LDBA 1MS5A 4LEJA 3WQ0A 3S57A 2C6SA 4IQPA 3WNXA 1RUF1 1IQAA 1XYOA 5C8CB 3K46A 5DG2A 1QOTA 4OUMA 3J7HA 4QDQA 4UYBA 1BBT2 4YGDA 2ATFA 4JHTA 3USSA 4CEYB 4FQ4A 3DL3A 3ECQA 3HN3A 3I2HA 2HWD2 4F83A 2IXKA 2PTMA 2XVKA 4E2GA 3AKSA 4C0BA 1AXYA 1O8SA 4W65A 4IEUA 1X8EA 1O3QA 2P6HA 3TEZA 5GLTA 2V5DA 1XRUA 5FZHA 1PMHX 1N47A 2JG8B 2WWJA 5F8PA 5FZGA 3MZHA 1RUD3 4BQYA 1QOSA 1O3SA 4YZ4A 5LBCA 1D0GA 2C4XA 3P5BA 1KJLA 3QOPA 3VKNA 4BDVB 1H6XA 4OZXA 1TMF2 5FWEA 1RTVA 4HETA 5A7OA 4IEZA 1OLRA 2YDEA 3UJQA 2BWCA 3C2UA 4IW3A 3RPQA 5LRSA 1RUG3 4Y1ZA 3KMHA 4CUBA 4JDNA 3RZKA 4IEOA 4Q0SA 4U36A 1OHFA 5FXXA 3VKLA 3ZN6A 3ZXAC 3ACLA 3MUZ1 4UFJA 5F5IA 3VDCA 1R093 4IESA 1RIRA 4OI2A 3IAQA 4FPHA 5LK5A 4FAHA 4D94A 1LTEA 5IJRA 5FPAA 1LHUA 3BVCA 3RZHA 2JDHA 3WNLA 1R1A3 5FXVA 1FI2A 2Z79A 3VBOA 1UY2A 2W1QA 1F5FA 2K9ZA 2RS51 3NSTA 2YPDA 1JS9A 1CN1A 1X50A 2HBUA 4BQ4A 1BEV3 2C24A 2EXHA 3UT0A 3J7MA 4H2AA 5GZGA 5C8WA 5CVRA 5KHHA 1DYPA 1H8VA 5H9QA 5A1LA 2ZX2A 4Z1VA 1HJGA 3B00A 4MLOA 5FLHA 4ARXA 5JZGA 3U0ZA 4B8EA 2GZWA 1JZ2A 2BW8A 1GUIA 3AXEA 3KV4A 1HQWA 4QQLA 2RM21 4A7YA 5IK7A 4CUCA 1WA6X 2XJRA 1LOCA 1JTZX 1T2XA 2JB8A 5IW0A 1HB2A 2O0OA 3ZN6B 5J96B 1ZRRA 3NKGA 2WQ8A 3H9AA 3T30A 5C3RA 1RUC1 4K20A 1O8PA 4RQPB 1KITA 1YQCA 3FX3A 1FV2A 2HWE2 3PVBB 4L11A 5T5LA 5C70A 3TRSB 1UYPA 4K1YA 1LKNA 1N3QA 3WHUA 3W21A 3ITQA 5FV3A 1NCRA 1J84A 2VGDA 1VBB2 3VHPA 2TBVA 2XHKA 1W0NA 4OZOA 1H1MA 5CNAA 1UQXA 3GZAA 5A6XA 1QDCA 4Z2AA 1JZ8A 5IT6A 4BIOA 5FY1A 1NCQA 2DWRA 4WV8A 5FZ4A 4MHUA 1ZYBA 4QB2A 1AXZA 2J1UA 2AREA 5JUVA 4NN0A 3UK9A 1I5PA 3I97A 3M3EA 2VOKA 4PCRA 3FHIB 1FYUA 4XMAA 2I07B 5JOZA 1RUNA 3HNYM 2XVGA 4DRRA 3BN6A 4D3WA 3IBMA 1RUH2 5HCAA 2WLPA 2YBKA 2BOJA 2XL9A 1MS0A 2EXKA 3CO2A 2Y38A 4P5HA 4HXCA 1RC6A 3AJZA 4QX2A 2ERFA 1NAEA 5T3NA 3N9NA 2RHPA 1AR93 2XBO1 4INDA 5BXXA 3ZM8A 5CFCB 4U2AA 3O0XA 1OH3A 1S0IA 3OTFA 4Y4RA 4AVVA 3AP6A 4UW4A 1ENQA 1MQTA 3NKTA 1SBDA 4NPRA 3A22A 4RR3B 5I8YA 1ZZ8A 2HWC1 2QTWB 5IUQA 3I3QA 1N1YA 3H8RA 4BQ3A 1W9YA 1W39A 3ZKYA 2GC2A 4XXPA 4A6SA 1PO11 1IHMA 5JPMB 4YM0A 3T2OA 1ENXA 2XUMA 4WM8A 1AR81 3PVEA 1ZZ7A 3SH4A 3VBRA 4AI8A 5L19A 1BVP1 4XUNA 4LK6A 2BQPA 5FY5A 5K7PA 1VB2A 4MGQA 4UFMA 3ZFEA 1DDLA 1AR72 3V0BA 4XJ8A 4CA9A 4Q0QA 1QJX1 3GF6A 3WR0A 4B3NA 4XFAA 3POWA 1XC6A 3I3EA 2ZTNA 3MIDA 3ZN4A 2OA2A 4CDWA 4MH0E 5HXMA 1EUTA 1BVVA 2GNTA 1EV13 5FYMA 3PVNA 5J7MA 1RMU3 5GJ6A 3PUSA 5FR3A 2R1DA 2YBPA 4HOOA 4MXWA 3HN1A 4CDXB 3KV6A 2I74A 3HOBA 4AGRA 3H7YA 3NVCA 2LALA 3T0BA 5BY5A 1UYYA 4BLIA 3FC0A 3BIEA 2VZVA 2D5HA 2Y0IA 1MS1A 2D6MA 3N4MA 4QU1A 2WNEA 1FMD2 4YVSA 4IGQA 2BWAA 5KXCA 1PGL2 1J1LA 1G7YA 1VAVA 5SV8A 1WMXA 1QF3A 2JX9A 4WM8B 2JXAA 3VUOA 3VBRB 1J59A 3ORJA 4RD7A 4LKFA 4LKDA 4FVVA 1WCKA 5K4LA 5SV5A 1NX9A 5HI0A 2DUPA 3ZDVA 1RHI3 1W8NA 4FXGB 5T5PA 2QDNA 2J1RA 1RUE2 4OI4A 3PUHA 5DABA 3RJ2X 3VZNA 2MHFA 5IVEA 1Q8PA 2QZ2A 5JDBA 2GNDA 2G9GA 4QGLA 1Q8VA 1KS5A 1XSRA 1AYN2 3LFIA 1YQ8A 3RVHA 1B09A 4YPJA 3ZYPA 5F39A 4AFAA 2VECA 4N53B 3U07A 2VW2A 3LD8A 3U14A 4COWA 3UGGA 2P4EA 5IFTA 1UIKA 4YG0A 4H55A 2PQQA 4ISRA 1LCLA 3WNOA 4YVSB 4XMIA 1REFA 1SFPA 4AK3A 2BV4A 5AC92 4E8DA 2A70A 1Y3TA 4FFIA 5JOYA 1W2AX 4Q0VA 1VBE2 4DS0A 1O3TA 1GOHA 1F5JA 2DCZA 2CYFA 4DUXA 4HONA 4DY5A 1WW7A 4WM7A 5FZAA 3W59A 1VALA 4J1XA 1MVQA 4NHYA 4X6QB 4YGEA 3TN91 4MGTA 1OH4A 2VM9A 1S2BA 5F5CA 1LOFC 1K5MA 1CZVA 1QWRA 2VXRA 3JB4C 3MDPA 4PQQA 2XLAA 4RS5B 3VHOA 2R7EB 1DZRA 3ZYRA 1UN1A 3TNPB 3HT2A 4PHZA 5GLUA 2W2IA 3VN4A 4LITA 2OW4A 1HXS1 3INAA 3JQWA 4M01A 2JE9A 1A8DA 4SLIA 2RR13 3WNKA 4N43C 1LHWA 3JD71 3GBWA 2KXLA 3ZFFB 1PVC3 3OBAA 3MW3A 3D8CA 4UW3A 1SPPB 5I0RA 1OPOA 1PK6B 4Q27A 4AEDC 1W9FA 4M4PA 1IGOA 3SKJE 5LA1A 4OHVA 4NR1A 5LA2A 4UXAA 2CAUA 3QH6A 2ZPXA 4Q1PA 4GA9A 3WG2A 4A4AA 4QGNA 4ZXEA 2I45A 4S2GA 3RGBA 1I3HA 3WEZA 5T54A 4WM7B 3FJSA 4EE2A 1ZRCA 4XQWA 4EN9B 2JJ6A 4XW3A 2RS53 5CU1A 1VBA1 3WINE 1K5MB 5I0SA 3MF9A 2J22A 3O14A 3ILNA 5EJZB 3V0AA 1RUF2 2Y64A 4AI1A 5K8SA 4Q4X2 1LULA 2WC2A 2P6CA 4DRVA 1CAXA 4COVA 1X8MA 4HK9A 5FYHA 3B69A 1OFSA 1GZWB 4Z2WA 3ZXGA 4LT5A 1COV2 1YNAA 1ZRIA 2QQUA 3I2DA 1ODMA 2ZEYA 4N7UA 2AYHA 2X8KA 1WD4A 1G9DA 4BB3A 3AB0A 1ZBA1 1JYCA 1QNYA 5EFUA 2FDGA 5JR7B 1MVEA 5F3EA 1XNTA 2DCTA 1LGNA 2BDRA 2H0BA 1ZZCA 1WBFA 1DYOA 1RXFA 2PHUA 4LK7A 5FAXA 1ND2A 1YYNA 4CXWA 1FATA 1GP6A 2ENRA 3PMSA 4LO4B 4OUEA 4YW7A 4BISA 1PX3A 3M70A 5BV6A 4LKSA 2BBVA 3ES4A 4H7LA 3ZYBA 1TNFA 3KZ4C 5K0UA 5FQ0A 2WNVA 1QY4A 1IKQA 1HX6A 2KD7A 4Q8LA 4XYXA 4LO7A 5FP9A 3TNQA 2Q30A 3FL7A 3SISA 1V6NA 2BFUL 2VZ3A 4X8PA 1JYWA 1Q8OA 1WGPA 2JENA 2VMHA 3E5XA 3FN9A 5FJKA 1EAH1 2GMEA 1SCSA 4L97A 4XHXA 1BYHA 3MF6A 1CJDA 1ULPA 1D4M1 2WFPA 2VD7A 2GNMA 3HNMA 1X33A 2Y6HA 3I2GA 5ACA2 1FNZA 1GOFA 4CE8A 3KQ4B 3WW3A 3K51A 1A6CA 1UXXX 2ZZQA 3GGLA 4KI5M 4HKLA 2YPJA 4O65A 4AI9A 5CFDC 1YJKA 1RVF3 4ES9A 3GBFA 3R4SA 4AEMA 1H2MA 2ZGLA 4HKOA 1QJU2 1M4WA 2X5IC 2YC2A 3C7EA 2CWSA 2XJPA 1W6OB 1UY0A 3UESA 1NG0A 3V65A 1AL23 5K0UB 3LOIA 2ZGQA 3JBG2 2VZSA 1OA3A 4WVMB 5DZEA 4FTEA 4GB33 2XXZA 3B3QE 1R082 1ZVFA 4CYDA 1ULGA 4A3XA 1C57A 1OUSA 3LIHA 3I2FA 1CD3G 2RM22 3ZOIA 5C71A 2WABA 4QQHA 2R072 1BCXA 4IEQA 3QCWA 4LBMA 1UPIA 1QEXA 4AQTA 4RGAA 3KB5A 1V9U1 1VAKA 3HD8B 1ONAA 3LA3A 2C5DA 3BGAA 3RMYA 3F95A 1US3A 2YC0A 2RS32 2WYFA 1BBT1 3KV5A 2XH6A 1UPSA 4YGBA 3ZDSA 2C0ZA 1YUDA 3MW4A 5FZ6A 2HWD1 1ZX5A 2BP6A 3DYMA 2B8MA 4FOQA 4DB5A 3MO4A 2Q1ZB 1HRI2 3VZKA 3SH3A 3OD4A 4OMDA 3U75A 2B9UA 4H14A 3J8F3 4ASMB 4AXOA 1VLNA 1ULOA 4KQ7A 1OOPC 4COYA 3P6BA 1HLCA 2R042 2PHDA 4P9YA 4A3ZA 1S0DA 1H0BA 1PM7A 1O91A 2Z4FA 4QXCA 4G4FA 1AX1A 1WLCA 3LEKA 5HCHA 1F31A 1ZBE2 1S0BA 1TMF1 4HBNA 3EB7A 4QAWA 2D3RA 4BXSV 2VW1A 2RVAA 3IDEA 4IDZA 4IV3C 1RITA 2YYOA 3CF6E 3N7LA 4JTNA 1ACCA 1DZQA 2DBIA 4LBKA 1C1LA 2E32A 3PUQA 1ASJ2 1YLLA 3ZR5A 4CDQC 3G6JB 4E4DX 4XZUG 4NUBA 1GNYA 1QQP3 5D21A 5DAPA 5C3QA 1YI7A 2IWGB 3PJYA 1AR62 1LNSA 2X09A 3IKWA 3LFMA 4BLJA 4D6RA 1JYNA 2BNNA 4XDQA 5AVAA 3UL2A 4Q4W1 4NVPA 5JI7A 1F9KA 3NMBA 5D8AB 1UY4A 1X36A 4B7EA 1APNA 2DVFA 3ZYJB 1PGW1 4CCLA 2VAUA 3THCA 2Y6KA 4IGPA 1A8MA 3WNMA 2V5YA 5FREA 3ZFGA 4MVTA 4QKBA 1KDMA 1V70A 1YFXA 3J7LA 1ALYA 2EF6A 2VMGA 4QHOA 1HN1A 1QKQA 4YRDA 3TN93 2SLIA 2L9LA 1V0AA 3RZJA 1W8HA 3E5UA 3OSDA 4R8HA 4GAZA 3VBOC 3DECA 5FZIA 2QQMA 4Z82A 4RGGA 2HWE1 1SMVA 1QJY2 2IZWA 4NHMA 3T4HB 5BYNA 1RJ7A 4DQAA 1VBB1 3M1HA 3HBKA 2HYKA 3O0WA 2WZPP 5ANQA 1JHNA 2LM3A 4PIZA 4W6XA 3GJBA 4S2HA 1O5UA 5JZGC 4BK4A 4LBNA 2VOXA 4UFIA 4Y1YA 1GBGA 2HWF3 3NQHA 5C6CA 4Q4Y2 1I9RA 2P34A 4NWWA 2P37A 2VTXA 5A7PA 2P5BA 2WWSA 4WBBA 2D3PA 1KFXL 1OURA 1Q5OA 3FWEA 4QQPA 1RUH1 5CISA 1PO23 1VBA3 1HRV2 1S0GA 3POJA 2VUCA 3LGRA 4GJZA 5DAWA 1QOOA 1NCRC 4IL7A 5E16A 5FZ1A 5DUXA 2UYAA 1VMFA 5DDJ3 3VDDA 2PYTA 3W9AA 1UU6A 3WCSA 1F4HA 4LO6B 4UFLA 4IUGA 2Y6FA 5FY8A 1GZTA 5FYCA 3VV1A 1NCQC 1JZ7A 1K5JA 2YUEA 1WLTA 2QCSB 4N43A 2EALA 4RN5A 4XZPA 1HW5A 4MHRA 1C28A 1O59A 4JTOA 5CIRA 2WO3A 1KXGA 4PDWC 5EPAA 4D7SA 1W8WA 2R30A 5BNQA 4H3WA 1UOBA 1GKBA 4FPLA 3WQBA 4AEDA 4CXXA 4LKEA 1LAJA 4KG0A 2PHTA 2WT0A 5J1XA 4OHXA 2E31A 4EN7B 5J98B 3WX5A 1CAVB 4C1XA 2O14A 4CPBD 3ILFA 1ULDA 3OUHA 3MIHA 4LBQD 1JXNA 1X9TA 3JUUA 3LDKA 4TXWA 5DUUA 3WCRA 3SEEA 3OGJA 4ATFA 1AR71 2A6VA 2K2SA 3NJXA 2YMZA 3RG0A 5H9PA 1MQTC 1O4ZA 2Z2SB 4OI0A 4DNYA 5DPNA 4L2NA 5CBLA 3L2HA 3T1LA 4YZ1A 2BU9A 5FIXA 1LJ7A 5L36A 3H3UA 3SCHA 2W95A 1VBC2 4N43B 4YLZA 1D4M3 4MZUA 4PJYA 4QPIA 4AVCA 2VO5A 4YZ3A 2ET1A 3HQXA 1SQ4A 3AFKA 4I30A 2D98A 1VMHA 4GMP0 4MO3M 4QM8A 4W6WA 4WZCA 3UGFA 3O1MA 1BKZA 2A3WA 3KCYA 4AEDB 2E63A 4FFFA 2CY6A 2AEZA 2ZXQA 3ZFEC 3CEWA 1MR5A 1OD5A 2ZBJA 3HQUA 2D40A 4QQOA 1JYXA 3H8XA 4YM1A 2PHWA 2R6QA 4N90A 4DXTA 2WAAA 1PGL1 1UIJA 4K3UA 4LE3A 4QPGA 4CDWC 3VBUC 1TEIA 1OA2A 4MUVA 5F2SA 3E97A 4BOWA 4NIHA 5C3OA 4HSLA 5F5QA 1NUKA 3B5LB 1DGRN 3BTXA 2DUOA 3WG3A 1ND3A 4MGYE 1ST8A 4OMCA 4AGVA 1QDOA 3LSDA 5FUIA 4DUVA 3HPNA 3KCCA 2VVFA 1W05A 3OF1A 2ZCWA 5LBEA 4B1LA 4YZ2A 3SH5A 1AYN1 4KWJA 2Q0AA 2XQXA 3OBZA 3B01A 3FUOA 4KMQA 5KXEA 4FI9A 4IETA 3MBWA 4DIQA 4AAPA 3ZKUA 3BI3A 3LAGA 2HWD3 1UZZA 5CFDA 2QQWA 2Q4SA 1NQDA 2BYVE 5FZEA 1H2KA 5AC91 4RFT0 3USUB 3AJYA 3U4XA 3ZXDA 2Q1FA 3OBTA 2ZMLA 4M3CE 4Y5Z0 1MS4A 1VBE1 1GQPA 2PQSA 1S4CA 4PI2A 1W9TA 2OX0A 5IK5A 1OVPA 2X5IA 1CIWA 5FMOS 4BMEA 3GZEA 4Q4V2 5HCBA 1AJOA 3AM2A 1XNAA 5LB6A 4BQXA 2VBDA 4D6SA 1HV1A 4GMP3 3UKVA 2R49A 1C8M3 3AKQA 5H9RA 4NAOA 4XILA 5LK7B 5JMCA 2W39A 2Y6JA 1RUOA 1WD3A 2AR6A 3PHMA 3V56A 2X10A 1KD7A 3M8LA 1LGCA 2AENA 1DP0A 3VZOA 4EV0A 3AP9A 4AWDA 4J6GA 5L9VA 3ETPA 5KXDA 1QJEA 1UNBA 3OYWA 4PBPA 3TEWA 4D7YA 5CFDB 2PLV3 2BTVC 3ST7A 5T50A 1RGSA 1CGPA 4RFRB 5JSRA 4FXKB 1GSLA 3THPA 1XNKA 4CU7A 1GR3A 5BNNA 5J09A 3PUAA 2QDRA 1DBNA 4QXHA 3IMNA 2VBPA 3UETA 2X5IB 5IVCA 4L0PA 1SLTA 3TAYA 3NJVA 1Y9MA 5EIYB 4YVWA 3LA7A 1XSQA 2UWAA 2QBXA 1WCDJ 1S1AA 1V9U2 4XJUA 3KT1A 2F6BA 4Q4X1 2GAUA 2WLQA 5ABJA 4UBGA 5FZOB 2WIIB 4FTBA 4DEQA 4BQWA 3FZ3A 2YU1A 4IV3A 1COV1 2VVEA 1CPMA 3BPSA 2BJSA 5LWBA 5IHRA 4GH4C 1J58A 1OBNA 5DUWA 5BPXA 4R9BA 1W2NA 1Q8QA 2VCAA 4CDQA 5A1AA 4IXLA 3WQ7A 1L7RA 2DU0A 1D2QA 1O7FA 1VBD2 2ZZJA 2IXIA 3I7DA 1VMJA 1WA4A 2R32A 4FFHA 3GNEA 5FRAA 1SEFA 1OOPB 2CTVA 4PBOA 2JE7A 3ZYGA 1J1TA 3WP4A 1JOBA 2OPWA 3OB8A 5FYIA 5GZEA 1VRH3 2WZ8A 1W28A 1H30A 3U11A 4P14A 5DAXA 3ZMOA 5KHKA 2XVLA 3HQRA 4OLLA 4LIVA 1YWKA 5GZDA 4LR4A 1WLWA 4IV3B 5FP8A 5DN2A 2EVXA 3Q9OA 3NNJA 4AFCA 5FLJA 3M3CA 4BK5A 5ACA1 1RUH3 2WT2A 4AEKA 4FQZA 1ND2C 3PL0A 1MEC1 1MZ6A 2D6OX 1OFNA 1PMIA 3PIJA 4CDQB 5AVPA 3UNPA 3HBZA 3WW4A 2FZ1A 3P3PA 5K0UC 4YW6A 2WNVC 1DLLA 1CPNA 4Q4W2 4ASLA 4YW1A 4XFHA 1LU1A 1QJU1 1WCSA 3WSOA 3SMHA 5A6QA 3WUCA 3HVDA 4QWNA 1PGW2 3S5QA 3ZIWA 2WRAA 2DCKA 2ZMNA 4IE0A 3U10A 3JBG1 1HQLA 3VD5A 5FOJB 4LA3A 4P9GA 1UU4A 5HV4A 5E6HA 2AC1A 1C8NA 1R081 4LBLA 4F7ZA 4DUWA 1SDWA 3THDA 3P1IA 2RDSA 3KSCA 4ES8A 3RWNA 4HPKA 2R071 1YJLA 3C7OA 2YC4A 4YFWA 3QD6A 4JRAA 3EO6A 1KS4A 3JZVA 1PM4A 2W08A 4LHLA 5IVYA 2YZ4A 3LEMA 3N9QA 4UAPA 4NRPA 4CDUA 3OGRA 1KRIA 4E2SA 2RS31 4UBHA 1XQNA 4XBNA 2J1SA 1DQ0A 2OUJA 5H9SA 5GLVA 5L7OA 3C7GA 4KGGA 4SBVA 3VBOB 1RUJ1 1MZFA 2G1MA 1TVGA 4EN8B 4CP9A 1ULFA 4D0QA 3WDYA 1HRI1 2LW8A 1OF4A 4YARA 4EYUA 2WSVA 4K40A 2RJKA 4LLOA 4NAMA 4XFGA 3WDVA 5EXOA 1C1FA 1JZ6A 1FT9A 4YW5A 2R041 1ZZ6A 3ZXKA 3Q8BA 3N9PA 3I3BA 2BZDA 4PDWA 1F2NA 4XAAA 5JZGB 3O0VA 1FMD3 5FXZA 2D93A 3EBRA 1ZBE1 4BU2A 3POGA 1DGRA 2XLFA 2UURA 4JHZA 5L9BA 5KHJA 3AP4A 3CJXA 4HPKB 1RB8G 4XIKA 1A34A 3I2KA 2AUYA 4P9LA 1W8UA 2UY8A 4NRMA 5I0UA 2X53S 4MGZE 1HB4A 3GALA 1C5HA 1RUG2 2ZACA 4XUQA 5FWJA 2QFEA 1RYYA 3CU7A 2B45X 2GC3A 2RJLA 1RUE3 1GYKA 1CR7A 3BU0A 3B02A 1NCRB 5FBZA 1ASJ1 3I54A 4IGOA 1N1VA 4DO0A 2B39A 5JAXA 2A1XA 4CP9B 2GN7A 2D7FA 4ISQA 2W3JA 3KVAA 2R063 1RL3A 4FO9A 2C1FA 5IFPA 2XHNA 1R092 2Y8KA 4ZU4A 3BCWA 1NCQB 5C5UA 1UZVA 2Z42A 3NV4A 3OD0A 2WDBA 1AR61 5IK8A 4PF1A 3ZXFA 4UW6A 2N7GA 3OGSA 4TTGA 4CP2A 2BRTA 2QVSB 3KS7A 1UCXA 2HEYF 1R1A2 3AKTA 4PDWB 1SLIA 4F3JA 3DXTA 1PMJX 1UL9A 4CCNA 1CJPA 1B35A 3DKQA 2W92A 4DEVA 2D6LX 5AC93 3HIFA 4KL1A 4XACA 1NA1A 1BEV2 1V6JA 3IWZA 4M3CA 3L9JT 1GWKA 3T3YA 3GXUA 3VBUA 5E88A 1HV0A 2WZR3 4LIUA 2V4AA 3FBMA 1CWPA 3CJIA 2QNKA 2VZ1A 2ES3A 2ZGMA 3O1OA 2JDMA 1MQTB 2CDPA 4QD2A 2LTNA 1TZOA 1Q8SA 1AYM3 1AHSA 4GZ9A 2VNGA 4GWNA 1OLQA 3IDAA 3LE0A 2GMMA 1QJY1 4XHBA 3T09A 1TE1B 2OUHA 2FHRA 3FHQA 4EJRA 1UZWA 5FYSA 3AX4A 1LESA 2X29A 4W50A 2HLEA 4XFFA 3ZFGC 1FXZA 1DIWA 4CCCA 3ZFEB 4FTSA 4ARYA 3WDUA 1IG0A 2B46X 2XDVA 3PDQA 3AVRA 3E1F1 4JX0A 3V0BB 2E7AA 4LHSA 4Q4Y1 3WG4A 2ZKNA 3DV8A 4M3CB 3LEIA 3IMMA 4FOWA 4IE4A 5JWPA 1E5HA 4LO8A 3MEPA 3VBUB 3VBSC 2DTYA 2QQIA 4CDWB 5E1RA 3O12A 2ZABA 5FYTA 3I3MA 2UWBA 1S2KA 3NJZA 4L92A 1HRV1 4MXWB 1AUYA 3U37A 3WY6A 2JDPA 2YFZA 4Y22A 1VR3A 2NQYA 1RUF3 3B94A 1NLQA 4JKMA 3ZSEA 2EIBA 4HVRA 1KDKA 2VMEA 2ZX0A 3WF2A 3G7DA 3I49A 2Y60A 2B4KA 4YM2A 3WW1A 5JOWA 1COV3 5F1RA 1UWWA 2ORZA 4XFBA 4XF3A 2ZGRA 4HN0A 5FK7A 4F8AA 5A3TA 1W03A 2WQ4A 4OULA 3UKTA 3PVOA 2VZUA 5GLWA 4EN0A 2PN5A 4TSVA 4A7ZA 1UKRA 2ADDA 4IERA 2A6WA 3VDDC 4MXVA 4XJZA 2ZX1A 3ABZA 4RGKA 4Y20A 4ZXKA 1IPKA 3I59A 5FZ3A 4B29A 4RSUA 2VOWA 3I2JA 1LOBA 2IFWA 5CYYA 3TEXA 2XONA 1SACA 3VBFA 1W99A 5IK4A 4Y22B 1Y43B 3SNMA 2O8OA 4FBFA 1NZIA 2GC0A 3B9CA 4L99A 3ZLIA 4AOCA 4DXSA 1STMA 2VQUA 5EQUA 1KJRA 4PQ9A 5KC6A 1VBC1 3E5QA 5IVBA 1EV12 3VLBB 2KR2A 5LY2A 5I91A 4Q1RA 4QKNA 3OG2A 3A21A 2DVGA 2YY1A 4OCTA 5FZ8A 4WVVA 1DLCA 1C4RA 4GH4A 4AW7A 5DUVA 3WP5A 5FO9B 4LORA 2EAKA 2GN3A 4N7IA 3MICA 1W0PA 2VBBA 5AFBA 2W47A 4Y5TA 1IPSA 2AH2A 1QJU3 1QHDA 1MPXA 2XB6C 4RHV2 3WF0A 4NOTA 3W5MA 4M0NA 1PHMA 4Y20B 4BPZA 5B4NA 2D44A 3I59B 2R0HA 2G9FA 1H2NA 4EN6B 3GJAA 5HCFA 3MPPG 3AZYA 1JZ4A 2E7QA 4QPIC 4S2FA 4MX3A 3OGVA 3QACA 1R083 5C4WC 1CZSA 1BQPA 1VB4A 2ORXA 2RM23 4Y1VA 5A33A 1GANA 4CTEA 4AHYA 2GP3A 2ZAAA 2R073 5FZDA 2WJSA 4IE5A 4IV1C 3AMNA 3WG1A 1CAUA 5L9RA 1RUC3 1JYTA 3ACIA 3W20A 1ZA7A 1UYXA 4GH4B 4QPGC 4LXLA 4YWAA 3WQ1A 3CZJA 4BYYA 4D6QA 5KWRA 5I0TA 2E9QA 1RUI2 1H4GA 1I6XA 5FP7A 1W8OA 4LOSA 1ND3C 2H0VA 4LTAA 3V0AB 1L3JA 2ZGOA 4MGKE 2PELA 3LA2A 2BFUS 2R043 2RS12 2CNAA 1CAXB 2XJTA 2A75A 3AL6A 4AFBA 4CZSA 4E8CA 4Q4V1 5FOBB 3PURA 4JQTA 3S30A 1YO8A 4GALA 3LIGA 1UY3A 2Z69A 2YB7A 2K0GA 3WNNA 4XF1A 5BNOA 1WW6A 2BBAA 3K48A 4N8MA 2KM2A 1MEC2 1FOD2 3DPRA 3WF4A 1CAUB 1DGLA 2WO2A 1F15A 4Y1UA 2XBO3 2P1BA 2RR12 5C3PA 4L8QA 2Y6LA 1PVC2 1WKYA 3MIBA 1ND2B 4GQ7A 2PFWA 1NE6A 3AMQA 3GZUC 3VL9A 4AVBA 1ASJ3 1UOGA 3VBHC 1KQRA 3AZZA 3VZJA 4A42A 5FPVA 2HWC3 4YG6A 5FQ0B 4B4RA 4KU8A 2WNVB 5A7SA 2NZ9A 1XU1A 2UY9A 1YFUA 3SQOA 1WMDA 3APBA 1IS5A 2ZEWA 3WV6A 2GNBA 3DKWA 2W46A 4DXRA 4AQSA 1PO13 3HJRA 4AQ6A 2JKBA 4P00B 4PLOA 2JDNA 1AR83 1FX5A 1SBFA 4FT8A 4QM9A 1RXGA 2YFUA 4XF4A 5T52A 1QH6A 1POQA 3J4UH 2D3SA 4NHXA 3PUIA 1QGLA 2YXSA 4XIOA 1QJX3 2UU8A 3NNGA 4R9DA 1WCUA 3A23A 3KHCA 3NRUA 4X8NA 1RUJ2 3RZLA 4LE4A 3AYCA 3CNAA 3VKMA 2J1TA 4IE6A 4C8DA 1D0HA 4M0HA 5BNNC 1SZBA 1XE8A 2DBNA 4JGYC 4EWDA 1F8VA 3A0KA 1R64A 2WS91 4YW3A 1SFNA 4DXZA 5F6KA 3ZR6A 4JDOA 1CONA 1UOJA 1MZEA 3K4ZA 4YVWC 4CCOA 4FAGA 1JZ3A 4LLFA 5IWFA 2D6PA 1VBD1 5I8SA 1LB2A 4W4ZA 2C26A 2Y6GA 2W5FA 3N35A 4OQ9A 5ABJC 3TB0A 3WVJA 3MYXA 1OUXA 5GZFA 5C3SA 3M3OA 3POIA 3AKRA 3M7AA 5FKCA 2HYXA 5JXHA 1V6KA 3FHAA 3N9OA 5JIAA 4AG4A 1Z78A 2P2KA 1W8ZA 2WFF2 4Q4Y3 1GLHA 1LRHA 1LENA 3BOWA 2ZOEB 4N9HA 4URTA 1W6NA 3FLRA 5HPOA 1U5YA 2FCTA 1UAIA 3RQ0A 3TWIA 3SKVA 2R0FA 2VZRA 3O7OA 3HWJA 4ITCA 5FYVA 1HRV3 3WP6A 4J25A 1O6UA 5FTTC 5GLZA 5I0DA 1XYPA 3D0JA 3D0SA 4TZDA 1W9SA 1GZ9A 1LU2A 4NJ4A 4GULA 3VDBA 1QMJA 4XETA 4ET7A 2QJVA 1HQNA 1KFUL 1RVF2 1KGYA 2JIGA 1UO9A 2XG3A 1X9PA 1JZ5A 1FPN2 2FCVA 4I0AA 3MGUA 1AX2A 3CIHA 4LJHA 2ZHMA 2VU9A 2VOTA 4UFKA 5CKMA 2CGPA 4UOJA 4KWLA 3MLLA 4NIAA 1XB9A 3IZOA 4EZ4A 1TG7A 2VNRA 3IB3A 1BMV2 4HVOA 1GMMA 1YQ2A 1YRZA 4URAA 4FPCA 5JVVA 2ZHNA 3HMYA 4GB32 4AF9A 5LA9A 5FKBA 1JU3A 4CU8A 2DF7A 3VBSA 5FY4A 1HXS3 2VUAA 1C3HA 3RZMA 1ODNA 2IXCA 3B93A 2WWUA 5BNPA 1W6PA 3DEMA 5LEKA 4AGGA 2ETEA 1WCQA 2A5ZA 2BGPA 3JD73 1UKGA 3BIWE 3U1XA 3OUIA 1JI6A 1WMFA 3GZTB 2PAEA 3PTRB 1WW5A 2OZ6A 5A3UA 3D5OA 1QXJA 1VBC3 3J26N 4BA6A 5JI9A 3MV11 4UF0A 4BHPA 4GJYA 2H6CA 4CU6A 2WZEA 1U0AA 3WUDA 4C1WA 4LOTA 3ZFGB 4OHYA 4W8JA 4Y4YA 4PT6A 1ULCA 2VTXJ 3OUJA 1J3RA 1S0FA 2D43A 1JODA 2ZHLA 3NJYA 2D6KA 4ASKA 4CDUC 4KH9A 5L7OC 5FBJA 3PNAA 1A78A 1GU3A 4K9SA 3VBSB 1CAWA 2GH2A 2B42B 1URXA 4YFZA 3VB9A 3VD3A 1TME2 1RUG1 1W6QA 1U5XA 3HR9A 4V2WA 4GKYA 2DDUA 2EA7A 2IXHA 1OMIA 3A4UA 3LDRA 2RE9A 2X05A 1K42A 1BZWA 4HG6B 1PNFA 4Q0UA 4QT6A 1W9WA 3BTYA 2EXJA 2FMDA 4I0BA 3VZLA 5FZBA 2XKOA 4HK8A 3SHRA 1R091 2VZPA 2VR4A 3H8OA 4OHWA 3A0NA 4V2VA 1ZBA3 4I2OA 1SCRA 2WAOA 2MNGA 4PLNA 1QQP2 1QNWA 5FXWA 5IYYA 3T4VA 5ERLA 3PJQA 1OC1A 1GWMA 1DCSA 3VZMA 2A3XA 1R1A1 1UOFA 1DG6A 1Z7S2 1HIXA 4IEYA 3RZGA 2FDFA 3ES1A 5FPZA 1DHKB 4XJAA 2QQKA 2VUDA 4LO5B 3VD4A 2BEOA 1XYNA 1OA4A 5HBAA 1BEV1 1LHNA 2C9AA 2D6NA 2ZGUA 5F7UA 1OF3A 2B7YA 5DAVA 3MIEA 4Y26A 5A70A 1CAWB 4ZY9A 3VDDB 2P17A 2DFBA 1DU3D 1W8FA 3A7QA 1W6QB 4XCAA 5EP9A 4HMZA 1NLRA 1EAH3 3ACFA 3ZXEA 2XUEA 4Q0PA 4Q4V3 4FOVA 2YG0A 3C8XA 1LEDA 5C33A 3VKOA 3CMGA 5FJHA 1GNZA 3GDBA 2WN2A 3H7JA 3NV1A 3NW4A 3BTZA 3BUCA 4NHKA 3EHKA 5C4WA 3QBQA 2UYBA 4ZU5A 2XJSA 3AP7A 1B35C 3MFCA 2JE8A 1PIV2 2JDUA 3FBYA 4IV1A 3K75B 4QPYA 4J1WA 3KGZA 1NA1C 1G86A 3C7FA 5EHDA 1QXRA 1POV1 2F17A 3OEBA 5A7WA 4CUAA 3POBA 4M00A 1X82A 3CJIC 1DGWX 3WD5A 2ZS6B 2GSYA 1VP6A 3KHBA 4JAAA 2HWF2 4A7KA 5JLVA 1GP5A 1AX0A 4QX7A 4FPOB 5C7GA 2DV9A 2LS6A 5A3OA 1Y9QA 3BYWA 1C5IA 1WMEA 3M4FA 4X6RB 3VGIA 5FP4A 5LASA 4LHKA 3AMHA 4QPIB 1V9U3 5FK8A 1PO22 4XDPA 2DVBA 1OXCA 5C4WB 2QQVA 3POEA 1PZ9A 1BBT3 4FPYA 1REDA 4I3GA 5DDJ2 4D8MA 1GP4A 2VZTA 5CA6A 1TQ5A 4IV1B 3VHNA 5CEHA 2MEV2 4FP2A 1SLCA 4K8FA 4QMAA 5F5AA 2W68A 3VD7A 1SBEA 3ZSMA 4ZHNA 4QPGB 1XOYA 5A7WB 4NO4A 4XXAA 3VBHA 2JKXA 3KVBA 5FYUA 2XOMA 1EPWA 3H1WA 1WW4A 2QUOA 1AZDA 1ND3B 3ACHA 3QLQA 3DGTA 4JGZA 1NOVA 3KF3A 1JHJA 5GALA 1UU5A 1GZCA 1TMF3 3KGLA 4K7JA 4YNIA 4CVUA 1D4VB 4C0HA 1HJFA 3AL5A 2WNUC 3MW2A 1ZZBA 2XL7A 4XUOA 1EP0A 2R16A 4XUTA 4A44A 1V6MA 3GCWA 3Q8FA 4UW5A 1S0JA 2RMU2 3AYEA 1S0EA 3HT1A 3ZX7A 4QKFA 5FZ7A 1NY71 2EIEA 5DQ0A 5IAVA 3PTYA 4QGMA 2OPKA 2W87A 2JG9A 4Y33A 4Z07A 3WP3A 1YQ5A 2I2SA 3NAPA 1EV11 2FQPA 1SFYA 1RMU1 1F4AA 2VMFA 1A3KA 2A6XA 3EMRA 3IDBB 3D4KA 2CWMA 2VW0A 3ZO0B 1G9AA 1JU4A 1SLLA 4JGYA 2AEYA 1V6OA 3S5AA 2WNOA 3RS6A 1BHGA 4KNCA 3K4AA 3VBHB 1VIWB 2DVAA 1UX7A 3BU7A 2WT1A 3H1MA 1ZA4A 3VBFC 2IVIB 4Q4W3 5A3WA 4RHV1 4Y5SA 1N3OA 2WKKA 4B7KA 3RYPA 2NLRA 4CUGA 4NMIA 4UI9L 3GM8A 3SC7X 5A3LA 3AYDA 5JOXA 4AEJA 5C9AA 2JG8A 2VJXA 2EAAA 5HXVA 1MS9A 5A3NA 2VQAA 4ZPIA 5JSPA 2YHJA 1UF2C 4ZU7A 3H50A 4XFIA 2FDIA 3N7MA 3OYWB 3VHRA 1HB1A 2WS92 3BTAA 4MOAA 2Y33A 2ZEZA 3OPTA 2GC1A 2P3YA 2OZJA 2HWE3 4AI0A 5BNNB 1S0CA 3O1RA 4JGYB 2J1VA 2ZKLA 2FCUA 3KV9A 1VBB3 4QKDA 1RUI1 4BWOA 2P3JA 2VOVA 4YVWB 2E53A 2CV6A 2HWB2 4AAXA 3CLPA 4YYOA 1GFF2 1J3QA 3N3HA 5ABJB 2DVDA 2JB4A 2RS11 1MS3A 2BUKA 4AVAA 1W3XA 2VNVA 2YROA 3POFA 5EJ3A 1SLAA 2VL4A 4I01A 4E4ZA 2HH9A 5C9AB 4ZS3A 2ZEXA 3MIFA 2G9ZA 3PIGA 2OYZA 4CPBA 3FLPA 4FP3A 4XJWA 4E2QA 4LBQA 3OPZA 1BXHA 2D5FA 4P9IA 5A7NA 2LROA 3URFA 2W0XA 5DZFA 1C8M2 1BK1A 1FOD1 1V6LA 5FFOC 3NV3A 1POV0 4LPLA 3THTA 2RR11 3MUY1 3WT3A 1AXKA 1CZTA 1UMHA 1YIFA 1D7PM 1PVC1 2ZGSA 3DXUA 4LHNA 4NROA 4P9JA 4TLFA 3UJOA 2W52A 4V1PA 1PGSA 2E33A 4XTMA 4AHXA 3I4IA 1IZ3A 3SITA 1VAMA 1ZZ9A 2WO7A 4JKLA 4QX5A 3ZMNA 2VQTA 2VCBA 1T6BX 2PLV2 5CB7A 1CQ9A 5BUVA 1SLBA 1NT0A 4RQPA 4UT5A 4WVWA 3MHZA 4EZHA 2ZJCA 5BNOC 3NNFA 3DF0A 3PU8A 2JDZA 3DPRC 3DYPA 4O9EA 5JXIA 2BGCA 1SDDB 2WUHA 4MADA 4Q26A 4YGCA 5F3GA 5DXDA 1CESA 1NLSA 3FMGA 4L9BA 1W8TA 3N36A 4LBQB 2XJVA 1AR73 1O3RA 4AHZA 5A1FA 2FDHA 3N7KA 1L7LA 2E26A 4WVZA 1ZRDA 1IS6A 2WBKA 2Q8EA 1H8TC 4P5YA 3NNMA 4OYUA 4W6YA 3AMPA 4FCAA 4NHLA 2CSGA 1XXNA 1BJQA 3ALQA 3CHXA 2UWCA 1WLDA 3K77A 2OT7A 4NWVA 4P02B 2BOIA 2XJUA 5KC5A 1RINA 3ME2A 5CADA 5D8AA 2FDJA 2IVJA 3Q8EA 1PZ8A 3CZUA 4QB6A 3O1TA 4KG8A 4OQ8A 4YZ5A 3NO8A 3LPFA 1JYVA 3R05A 1XNDA 2ZGPA 5A6ZA 3OEAA 4RYDA 2ZGKA 1RUD2 5CFCA 4JVAA 1TNRA 2E6VA 1EUUA 2WA3A 3RFRA 1DQ1A 1P8JA 2ZAHA 1POV3 3RMXA 3U78A 3ZXLA 2DCYA 4XAEA 4AVSA 4KBZA 4RR3A 3O5SA 4NIIA 4CCDA 2VNOA 1BK0A 5CG9A 2WFF1 1KEXA 3ZSKA 4CDUB 2W1SA 1VRH2 3FE5A 3WZ1A 5FZ0A 4XBQA 2NN8A 3AYAA 4AQ2A 5L7OB 1LGBA 1LOAA 2VE1A 4TN7A 1QXPA
chains in the Genus database with same CATH topology
4QXBA 3U4SA 5LW9A 3KV4A 5IVEA 5FP8A 2GP3A 5FZDA 5FP3A 5FJHA 2VD7A 4GAZA 5FYVA 2GP5A 2XMLA 5IW0A 4UF0B 5LY1A 5FZIA 3OPTA 3K3OA 3RVHA 2OQ7A 5FZOA 3OPWA 5F39A 4LXLA 4AI9A 4XDOA 5FZ9A 4D6QA 4DIQA 3LD8A 4AAPA 3KV9A 5FYSA 5FV3A 5ANQA 5A7WA 4QX8A 5FZEA 5FUNA 5FP7A 5F37A 4QWNA 5FY1A 3K2OA 2XDVA 3PDQA 3AVRA 3ZPOA 5FZ4A 4CCMA 4E4HA 4EZ4A 2OX0A 5IVJA 4HONA 5FZMA 3AL6A 4URAA 5A7PA 2XXZA 4QX7A 2P5BA 5E6HA 5FZAA 5FUPA 3PURA 5FYTA 3UYJA 5F32A 5F5CA 4D6SA 5IVVA 5A7NA 5FP4A 5FY4A 3LDBA 3N9MA 2W2IA 2YBKA 4GJZA 4LITA 5FZ1A 5IVYA 2OQ6A 3N9QA 4XDPA 2WWUA 4CCKA 3N9NA 5FY9A 3KV5A 5CEHA 5FY8A 5FYCA 5FZ6A 3DXUA 5F5AA 5FYYA 4Y4RA 3PTRB 5FZKA 5F3IA 4EYUA 5FPVA 5A7WB 5A3TA 5FZLA 4UF0A 5FPUA 4GJYA 5FPBA 5FYZA 5A7SA 2Q8DA 5F3CA 3KVBA 3PUAA 3N9PA 5FYUA 4QXHA 2OS2A 5FZHA 4EZHA 2WWJA 3N9LA 5FZGA 5FY7A 3PU8A 5IVCA 4QXCA 4CCJA 5FXZA 3NJYA 4ASKA 4BU2A 5F3GA 5FBJA 5FY5A 5FZ3A 5FWEA 5FYBA 4Y3OA 4CSWA 5A7OA 3AL5A 5A1FA 5FZCA 3K3NA 5A80A 2Q8EA 5A7QA 5FZOB 4V2WA 5FWJA 5FYHA 2YU1A 5FZ7A 3ZLIA 5FY0A 4C8DA 4Y33A 5FXXA 5FYMA 4IGOA 2YU2A 4DO0A 5LWBA 3PUQA 5IVBA 3PUSA 5ISLA 5F5IA 2OT7A 2YBPA 4HOOA 3PU3A 5FZBA 3KVAA 5LY2A 5KR7A 4GD4A 4NUBA 3KV6A 4V2VA 5FZ8A 2PXJA 5FPAA 5FXWA 4CCOA 2Q8CA 4BXFA 5F3EA 5IWFA 5FXVA 4QU1A 4D6RA 3DXTA 4IGQA 5A3WA 4CCNA 5FZFA 5F2WA 2YPDA 4BISA 5IVFA 3U78A 2YBSA 5F2SA 5FYIA 4CCLA 5FP9A 3N9OA 4CUGA 4IGPA 5FPLA 5K4LA 3AVSA 5FZ0A 1VRBA 5A1LA 5A3PA 4TN7A 4LIUA 5A3NA 5FJKA 4LIVA 2XUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QXB A;  3U4S A;  5LW9 A;  3KV4 A;  5IVE A;  5FP8 A;  2GP3 A;  5FZD A;  5FP3 A;  5FJH A;  2VD7 A;  4GAZ A;  5FYV A;  2GP5 A;  2XML A;  5IW0 A;  4UF0 B;  5LY1 A;  5FZI A;  3OPT A;  3K3O A;  3RVH A;  2OQ7 A;  5FZO A;  3OPW A;  5F39 A;  4LXL A;  4AI9 A;  4XDO A;  5FZ9 A;  4D6Q A;  4DIQ A;  3LD8 A;  4AAP A;  3KV9 A;  5FYS A;  5FV3 A;  5ANQ A;  5A7W A;  4QX8 A;  5FZE A;  5FUN A;  5FP7 A;  5F37 A;  4QWN A;  5FY1 A;  3K2O A;  2XDV A;  3PDQ A;  3AVR A;  3ZPO A;  5FZ4 A;  4CCM A;  4E4H A;  4EZ4 A;  2OX0 A;  5IVJ A;  4HON A;  5FZM A;  3AL6 A;  4URA A;  5A7P A;  2XXZ A;  4QX7 A;  2P5B A;  5E6H A;  5FZA A;  5FUP A;  3PUR A;  5FYT A;  3UYJ A;  5F32 A;  5F5C A;  4D6S A;  5IVV A;  5A7N A;  5FP4 A;  5FY4 A;  3LDB A;  3N9M A;  2W2I A;  2YBK A;  4GJZ A;  4LIT A;  5FZ1 A;  5IVY A;  2OQ6 A;  3N9Q A;  4XDP A;  2WWU A;  4CCK A;  3N9N A;  5FY9 A;  3KV5 A;  5CEH A;  5FY8 A;  5FYC A;  5FZ6 A;  3DXU A;  5F5A A;  5FYY A;  4Y4R A;  3PTR B;  5FZK A;  5F3I A;  4EYU A;  5FPV A;  5A7W B;  5A3T A;  5FZL A;  4UF0 A;  5FPU A;  4GJY A;  5FPB A;  5FYZ A;  5A7S A;  2Q8D A;  5F3C A;  3KVB A;  3PUA A;  3N9P A;  5FYU A;  4QXH A;  2OS2 A;  5FZH A;  4EZH A;  2WWJ A;  3N9L A;  5FZG A;  5FY7 A;  3PU8 A;  5IVC A;  4QXC A;  4CCJ A;  5FXZ A;  3NJY A;  4ASK A;  4BU2 A;  5F3G A;  5FBJ A;  5FY5 A;  5FZ3 A;  5FWE A;  5FYB A;  4Y3O A;  4CSW A;  5A7O A;  3AL5 A;  5A1F A;  5FZC A;  3K3N A;  5A80 A;  2Q8E A;  5A7Q A;  5FZO B;  4V2W A;  5FWJ A;  5FYH A;  2YU1 A;  5FZ7 A;  3ZLI A;  5FY0 A;  4C8D A;  4Y33 A;  5FXX A;  5FYM A;  4IGO A;  2YU2 A;  4DO0 A;  5LWB A;  3PUQ A;  5IVB A;  3PUS A;  5ISL A;  5F5I A;  2OT7 A;  2YBP A;  4HOO A;  3PU3 A;  5FZB A;  3KVA A;  5LY2 A;  5KR7 A;  4GD4 A;  4NUB A;  3KV6 A;  4V2V A;  5FZ8 A;  2PXJ A;  5FPA A;  5FXW A;  4CCO A;  2Q8C A;  4BXF A;  5F3E A;  5IWF A;  5FXV A;  4QU1 A;  4D6R A;  3DXT A;  4IGQ A;  5A3W A;  4CCN A;  5FZF A;  5F2W A;  2YPD A;  4BIS A;  5IVF A;  3U78 A;  2YBS A;  5F2S A;  5FYI A;  4CCL A;  5FP9 A;  3N9O A;  4CUG A;  4IGP A;  5FPL A;  5K4L A;  3AVS A;  5FZ0 A;  1VRB A;  5A1L A;  5A3P A;  4TN7 A;  4LIU A;  5A3N A;  5FJK A;  4LIV A;  2XUE A; 
#chains in the Genus database with same CATH topology
 2EIC A;  3U4S A;  4PF5 A;  2VZQ A;  4O9G A;  3D6E A;  3AXD A;  4FPF A;  5FP3 A;  2J7M A;  1W2U A;  4CP0 A;  1N1T A;  2GP5 A;  4AFM A;  3GYD A;  1JMU B;  4BE3 A;  1AYN 3;  4YM3 A;  2VVD A;  5I8T A;  3LEG A;  2BPA 2;  4HN1 A;  5CG8 A;  2YV8 A;  2OQ7 A;  3LB9 A;  3OPW A;  4ZON A;  3ELN A;  4RA0 A;  3AKP A;  2VZO A;  5KBF A;  1UYZ A;  3MLK A;  1NXD 1;  1RVF 1;  1YC6 1;  3OJB A;  4KU7 A;  1OQ1 A;  2LUW A;  1FPN 1;  2B9V A;  2PAM A;  3POY A;  4JQR A;  4QX8 A;  4DMI A;  5I93 A;  2QKD A;  2W9X A;  4CDX A;  4ZZ8 A;  3ZN5 A;  1VBE 3;  1DQ6 A;  2Z5W A;  1BMV 1;  2FD8 A;  1WWY A;  1AL2 1;  4XFC A;  3GBG A;  4R52 A;  2JIJ A;  1S2E A;  3OGG A;  2JIC A;  3ILR A;  3CBN A;  3IN9 A;  4XE9 A;  1FNY A;  1GV9 A;  4GB3 1;  1JUH A;  5IAX A;  5LA0 A;  2NPI A;  1H1A A;  4JKK A;  3JB8 A;  5IVV A;  3IDC B;  4KBB A;  2IXJ A;  3KWV A;  3S0M A;  3DCQ A;  1IS3 A;  1NZC A;  2OQ6 A;  2A7A A;  2QZ3 A;  1OKO A;  4CCK A;  3DUI A;  4GKX A;  2WA4 A;  3ACG A;  3R4U A;  1X7N A;  1HDK A;  3RYR A;  5B2G B;  5FYY A;  1CIY A;  3WLU A;  4QX3 A;  3SCG A;  1B35 B;  2BER A;  1OSG A;  3T0D A;  5FZL A;  2VXJ A;  1ENS A;  2ARB A;  3NNL A;  3MV0 1;  1NA1 B;  3OY8 A;  1YQ6 A;  3J8F 1;  4QQ2 A;  2VG9 A;  4JC1 A;  5DAQ A;  5FPB A;  1G6N A;  2Q8D A;  1U12 A;  2V72 A;  4Z92 B;  1YXW A;  4N53 A;  4CEW C;  1UY1 A;  3I2I A;  2D97 A;  4Y24 A;  2F4L A;  3CJI B;  2FMY A;  1GQG A;  5BNP C;  2VTF A;  2XKP A;  1IG3 A;  3W58 A;  1E5I A;  3ZSL A;  4RHV 3;  3RSJ A;  4ZKT B;  1W3V A;  2BVV A;  2JD9 A;  4GXL A;  4Q4X 3;  4FSJ A;  5FZC A;  3NL1 A;  1TME 1;  4G3Y C;  1J3P A;  4QX1 A;  1H6Y A;  3TEY A;  1CVN A;  1AR9 2;  5JMO A;  3IIA A;  2ZX4 A;  2WNU A;  4TYS A;  3R0R A;  2DCJ A;  3SEP A;  4RS5 A;  5EJ1 B;  2EIG A;  2YU2 A;  3AZX A;  4HT1 T;  4BCU A;  2JEC A;  3Q8A A;  5ISL A;  3LOB A;  5TSW A;  4LNV A;  3IT8 A;  1R1Z A;  3T2P A;  4IEV A;  1REE A;  2OVU A;  2VY0 A;  1LOD A;  1QQP 1;  2R06 2;  2ZX3 A;  1XNB A;  4MGI E;  3RNS A;  1L7Q A;  3OY8 B;  4BQ1 A;  2RDR A;  3K4D A;  4IE7 A;  5A32 A;  1Z7S 1;  2QQJ A;  3DYO A;  3ZFF A;  4C91 A;  3MPB A;  3MI8 A;  4C90 A;  4ZS2 A;  2CAV A;  1SPP A;  2OKX A;  3SCF A;  1PK6 A;  1RUI 3;  4A41 A;  3CKH A;  2Y26 A;  5IVF A;  1G9F A;  3BAL A;  2QQO A;  1IKP A;  3JCI A;  1O4T A;  2JEM A;  2JDY A;  3RRD A;  4BMB A;  4M4R A;  2IFR A;  5FPL A;  3AVS A;  4I09 A;  2RS1 3;  4JZR A;  2K46 A;  1BLZ A;  2NMN A;  4NID A;  2OXB A;  4KGQ A;  1NY7 2;  2Q1M A;  2QQL A;  3I8T A;  1NE4 A;  4NE9 A;  2WZR 2;  2WNU B;  3WDT A;  2O1Q A;  1RMU 2;  1OKQ A;  1EPZ A;  2EID A;  3ZIX A;  1M06 G;  3FUQ A;  5E8A A;  2ADE A;  5ACA 3;  3T2T A;  1QH7 A;  2XML A;  3O1S A;  4MG2 A;  5FMD A;  1MEC 3;  1E57 A;  1AYM 2;  1FOD 3;  4A2U A;  4CCE A;  1PIV 1;  3J7N A;  2FDK A;  4ERO A;  1JOP A;  2E7T A;  4TWT A;  1ZRE A;  1JOJ A;  4UFH A;  2G19 A;  1GZW A;  1GWL A;  1OI6 A;  4GWM A;  5A32 B;  2QE3 A;  5FCC A;  1QJZ A;  2GDF A;  5FO8 B;  3EQE A;  1J83 A;  4QDS A;  3BB6 A;  2DUR A;  2CDO A;  4YW2 A;  3JBG 3;  3VBF B;  3ZPO A;  1OPM A;  1DYK A;  1O5L A;  2HWF 1;  2J1A A;  1RHI 2;  1Z0H A;  2DYC A;  3Q8C A;  4R9A A;  1DFQ A;  3ZPY A;  3H42 B;  1UZ0 A;  3NWK A;  1OLM E;  2B5H A;  1W2O A;  5F32 A;  3RJR A;  3MLJ A;  3TBD A;  3PME A;  3ATG A;  1PX4 A;  4XF9 A;  4HLT A;  2W1U A;  3ASI A;  5EWS A;  1QU0 A;  2MPF A;  5GKA C;  4HAN A;  1PO2 1;  4FPG A;  2ID4 A;  4ONU A;  4AYU A;  1AVB A;  4AZZ A;  4R4X A;  2RS3 3;  4LBJ A;  3FLT A;  4PLM A;  4CXY A;  1ZM1 A;  2ARA A;  5DDJ 1;  5FLI A;  2BNM A;  5KXB A;  2XPJ A;  1RUJ 3;  2MEV 1;  3ROU A;  3O1P A;  2NMO A;  1N1S A;  1HRI 3;  2VMC A;  4ZZ5 A;  4Q29 A;  3CL1 A;  4K21 A;  1PZ7 A;  1UX6 A;  1Y4W A;  2OII A;  2DU1 A;  5FYZ A;  4HSJ A;  5D2A A;  1CX4 A;  4Z8B A;  1YFY A;  4QB1 A;  5F3C A;  4ATE A;  2HBT A;  5J48 A;  1H1I A;  2NP0 A;  1MAC A;  5FMC A;  4H7M A;  2AGS A;  3S6P A;  5J36 A;  1LOG A;  1ZBE 3;  1OT5 A;  5A33 B;  4FPK A;  1S55 A;  3RYK A;  4BJ0 A;  4XJ9 A;  4CSW A;  3H1Y A;  2WL1 A;  4BQ5 A;  1W6O A;  2SBA A;  2JD4 A;  2GH8 A;  5JCT A;  4YW4 A;  2BNO A;  1XU2 A;  2HKX A;  2WFF 3;  5A80 A;  3ZYH A;  1GNH A;  4AL9 A;  4WVM A;  5J37 A;  2RMU 1;  1PNG A;  3ON7 A;  5L73 A;  4BIF A;  2XR4 A;  3FFZ A;  5FY0 A;  2PHR A;  4Q8K A;  1JBC A;  1H8T A;  5LAT A;  2W1W A;  1Q56 A;  3T0A A;  5KR7 A;  1H9W A;  4FFG A;  1U5I A;  4HFS A;  4OHZ A;  4GD4 A;  4Y1X A;  4E4S A;  4JGZ C;  1W0O A;  4OVE A;  1E5R A;  1GIC A;  3O1U A;  1AR6 3;  1OD3 A;  1UW8 A;  3AZW A;  2Q8C A;  4JV4 A;  5B4X A;  3JU9 A;  4B4P A;  2H6B A;  4MYE A;  4DZG A;  5EYX A;  4LA2 A;  1HB3 A;  4QXK A;  3I2O A;  5FZF A;  3B7M A;  5EZW A;  5F2W A;  4D7T A;  2RS5 2;  5JR2 A;  1FPN 3;  1JH5 A;  1VJ2 A;  5EV7 A;  3S7I A;  3H8U A;  3IM0 A;  5BNO B;  2JG9 C;  3DPR B;  3NAP C;  1YI9 A;  1HN0 A;  2A73 B;  2XQR A;  5CAZ A;  4KWK A;  1VRB A;  1W2T A;  1RJ8 A;  4CRQ A;  1UXZ A;  3RZZ A;  5DG1 A;  2V09 A;  2RV9 A;  5CKQ A;  4QXB A;  1LEM A;  5C8C C;  1DZT A;  1VE0 A;  1DQ4 A;  2F4P A;  3EJK A;  3HAG A;  1H8T B;  3KT7 A;  4QU2 A;  4R4Z A;  5DZG A;  4B1M A;  4CEY C;  1G8W A;  5LBB A;  1YHF A;  4E9K A;  5ANN A;  5JXG A;  1QJY 3;  4PI0 A;  4IEP A;  2GAL A;  1RUC 2;  4XPV A;  4QX0 A;  2NM1 A;  4A6O A;  2BGO A;  5FZ9 A;  3N7J A;  1H4H A;  2Q5T A;  2J42 A;  2HWB 1;  5C9A C;  2JG8 C;  1YIP A;  3P3N A;  3BOD A;  5GM0 A;  4OUS A;  4LUL A;  3QH7 A;  3JQX A;  2YGL A;  1YFW A;  2O8Q A;  2ZA9 A;  1W6M A;  4DIN B;  4XBL A;  5F6L B;  4E4H A;  2VMI A;  4FOY A;  4LQR A;  5IVJ A;  4EQV A;  4JCK A;  3RDI A;  1W90 A;  2CU5 A;  5T5J A;  1IS4 A;  2VC9 A;  5FUP A;  3WDW A;  4CP1 A;  4HVQ A;  5LZ6 A;  4A45 A;  3UYJ A;  3HEI A;  3C3V A;  3VD9 A;  2VH9 A;  4GMP 1;  4RL7 A;  1W04 A;  3E6B A;  1C8M 1;  3N9M A;  1JYI A;  1LR5 A;  1W06 A;  4DPN A;  1UZY A;  1TME 3;  4XCB A;  2NYY A;  3KM5 A;  2JWP A;  5FY9 A;  1IQD C;  2GMP A;  2PHL A;  3AZV A;  3L2Y A;  2XBO 2;  3KLS A;  4Q2F A;  5CZK A;  5DMY A;  1CX1 A;  2RDQ A;  3ZXJ A;  4B4Q A;  4N9I A;  4GIQ A;  4QDR A;  2PLV 1;  4P08 A;  4BZ4 A;  4AI2 A;  1G9B A;  2HWC 2;  4XEZ A;  4K1Z A;  1XJA A;  1AL2 2;  1LHO A;  4AVT A;  1W6M B;  4HL0 A;  4QHB A;  2XLG A;  4IEX A;  3BOP A;  3N9L A;  2RDN A;  1Z7S 3;  5FY7 A;  1N3P A;  1W6N B;  3MIG A;  1NKG A;  1PO1 2;  2QQP A;  2V73 A;  2ZGT A;  4P9X A;  3KF5 A;  1AR8 2;  4CEW A;  2ARX A;  5FYB A;  4Y3O A;  4AI3 A;  4EWE A;  5A6Y A;  2DFC A;  3K3N A;  4IEW A;  3J9S A;  1QJX 2;  1XNC A;  3B9I A;  3EXU A;  4NPL A;  3T08 A;  3OBR A;  1YEW A;  4XC9 A;  2CL2 A;  4KWU A;  5J3U A;  4DOU A;  2JDK A;  4RQP C;  2A71 A;  3WHT A;  5C5T A;  5KHG A;  1V00 A;  1Q3E A;  4JRL A;  2PAK A;  3J8F 2;  1Y7B A;  3UV9 A;  4OI1 A;  4BM8 A;  2XWJ B;  5G05 L;  4CU9 A;  2KA3 A;  5IAT A;  1PIV 3;  4LUM A;  4XQ4 A;  1RUD 1;  1NYW A;  4M3C F;  3GHM A;  5APA A;  5EYY A;  1AJK A;  1GQH A;  4COZ A;  4FPE A;  4K6B A;  1EYB A;  1H2L A;  4AR2 A;  2WYS A;  1MZ5 A;  3KCX A;  1DF0 A;  5FMB A;  2IXL A;  2VUL A;  1DGW A;  3WW2 A;  2FZ2 A;  2Y0O A;  1UD1 A;  4I3P A;  2YBS A;  3R4D B;  1DQ2 A;  4JDM A;  4CEW B;  3LZZ A;  4R9C A;  1UMZ A;  2ILM A;  5G04 L;  4AHW A;  5BNP B;  1W6P B;  1VRH 1;  4PIX A;  3CQO A;  1SHW B;  1SG3 A;  2WO1 A;  2HEW F;  2W91 A;  3E6D A;  3LWC A;  4LMF A;  2DUQ A;  1XBF A;  1Y9G A;  5D8A C;  3TYJ A;  5A3P A;  1EY2 A;  1CAV A;  3O1V A;  3UGH A;  3V64 A;  4XUR A;  5LW9 A;  1FAY A;  3III A;  3F2Z A;  1OLM A;  4GWI A;  4COU A;  1E5S A;  4ORF A;  2WR9 A;  1WUV A;  3NV2 A;  2JDA A;  4UF0 B;  5CFC C;  3JXS A;  5K9Y A;  1XE0 A;  2WIN B;  3FFQ A;  3LQC A;  1LOF A;  4GWJ A;  4DY3 A;  1LOE A;  4XDO A;  4RR3 C;  3WF3 A;  1IPJ A;  3BKZ A;  1V6I A;  3LSE A;  5HV0 A;  2MEV 3;  2V4V A;  2VQ0 A;  3RI9 A;  1YCI A;  5FUN A;  4WZF A;  5LCW L;  1O4Y A;  5JPN B;  2ZGN A;  2Y34 A;  3RWK X;  2A6Z A;  1ENR A;  5M0T A;  4LBO A;  2G4I A;  3D82 A;  4CCM A;  4NIG A;  3ZVX A;  4HKW A;  3OCP A;  5FZM A;  3X29 B;  2WN3 A;  5AFE A;  2TNF A;  1OQD A;  5F9T A;  1QJF A;  2C9K A;  2GU9 A;  3ZSJ A;  3HNB M;  2VPV A;  1NXM A;  3TN9 2;  1UMI A;  1U5Z A;  1US2 A;  2TUN A;  3T1M A;  5LEJ A;  1NQJ A;  3RI8 A;  4LUK A;  1K12 A;  3H0O A;  4XOG A;  1WBL A;  2IC1 A;  4MET A;  1K3I A;  3EYP A;  1HXS 2;  4MV2 A;  3M3I A;  3VDA A;  3TOJ A;  3AP5 A;  2ARC A;  3ETQ A;  4CDX C;  3MFA A;  3C7H A;  2RMU 3;  2A3Y A;  3JD7 2;  1T6G C;  3WF1 A;  2WSU A;  2A6Y A;  5E89 A;  1D2S A;  2R1B A;  1Q43 A;  4MSV A;  5F3I A;  5FZK A;  4YSF A;  3PLQ A;  5FPU A;  2PHX A;  3KD4 A;  3IPV A;  4AFD A;  1I1E A;  3S7E A;  4Q5O A;  3LF7 A;  2XJQ A;  2BVB A;  2HEV F;  2IUW A;  5A3M A;  3UKN A;  2OS2 A;  4WM8 C;  3VBR C;  3AMM A;  4QPW A;  4CCJ A;  3KQR A;  5GZC A;  1FMD 1;  4XUP A;  5FDB A;  3LPG A;  1LEC A;  1JUI A;  1VBA 2;  5CKN A;  3USU A;  3BPZ A;  3DN7 A;  5JSO A;  1AF9 A;  3VL8 A;  2CGN A;  2W94 A;  4NRQ A;  3AFG A;  2FBE A;  5A7Q A;  3R6S A;  1AR9 1;  1IOA A;  3M3Q A;  3H3Z A;  4MGS A;  4XF0 A;  2PMW B;  4I0W B;  1RUE 1;  3E6C C;  5D1I A;  1K45 A;  4UWD A;  3SLI A;  4AE2 A;  4N53 C;  2WS9 3;  3PU3 A;  2R06 1;  5LBF A;  4OFG A;  4P9W A;  4XQD A;  1QIQ A;  2ZHK A;  3LKJ A;  2PXJ A;  4E27 A;  4YVS C;  4YG3 A;  1ZBA 2;  2WQZ C;  4BXF A;  3IPV B;  3OOX A;  5T5O A;  1VBD 3;  3AK0 A;  5JXJ A;  1ZNP A;  5T55 A;  1JN2 P;  3I3D A;  2VMD A;  2P3I A;  2QQN A;  2TEP A;  2ZMK A;  4D69 A;  2CGO A;  4XTP A;  1DQ5 A;  1I5Z A;  2HWB 3;  4O7X A;  4O61 A;  3D3A A;  2Q8O A;  5FPX A;  2ET7 A;  2XGX A;  4RS5 C;  2E51 A;  4TLG A;  2RJ2 A;  1XPW A;  1JW6 A;  3ZYF A;  4S2D A;  1F35 A;  2WZR 1;  2XWB B;  2VCM A;  4G9S B;  1PVX A;  5FMO L;  1HKD A;  4EWA A;  5KHI A;  4PIY A;  3W5N A;  1EAH 2;  1GOG A;  3ENR A;  4XVH A;  2CHH A;  3GHN A;  1FV3 A;  3ZFF C;  1D4M 2;  3M2M A;  1ULE A;  5FO7 B;  5LY1 A;  1AYM 1;  4QHZ A;  5C8C A;  1PK6 C;  2DTW A;  3WOG A;  2LRP A;  4XAB A;  3K3O A;  4I02 A;  3LCP A;  1OVS A;  3KT4 A;  5FZO A;  4BQ2 A;  1ZRF A;  4DFS A;  1AL0 G;  4FPJ A;  3WNP A;  4CEY A;  1G9C A;  2P3K A;  2VCC A;  1XE7 A;  4JGZ B;  1H9P A;  3CDZ B;  2AZ5 A;  4BH9 A;  5F37 A;  1OQE A;  3H3L A;  4K8R B;  4WM7 C;  3ZYI B;  3K2O A;  2HJI A;  2VUJ A;  3AC0 A;  4HZF A;  3WDX A;  1K5M C;  2YGM A;  1WZX A;  1RHI 1;  5JIU A;  1LHV A;  3GCX A;  3POS A;  2PA7 A;  3T2Q A;  2PHF A;  2JG9 B;  4NPM A;  2EXI A;  2RG4 A;  1MS8 A;  1OOP A;  2J1E A;  3NAP B;  1VPH A;  5LRR A;  3IAP A;  3SXW A;  3WXP A;  2AAC A;  3VKF C;  3LDB A;  1MS5 A;  4LEJ A;  3WQ0 A;  3S57 A;  2C6S A;  4IQP A;  3WNX A;  1RUF 1;  1IQA A;  1XYO A;  5C8C B;  3K46 A;  5DG2 A;  1QOT A;  4OUM A;  3J7H A;  4QDQ A;  4UYB A;  1BBT 2;  4YGD A;  2ATF A;  4JHT A;  3USS A;  4CEY B;  4FQ4 A;  3DL3 A;  3ECQ A;  3HN3 A;  3I2H A;  2HWD 2;  4F83 A;  2IXK A;  2PTM A;  2XVK A;  4E2G A;  3AKS A;  4C0B A;  1AXY A;  1O8S A;  4W65 A;  4IEU A;  1X8E A;  1O3Q A;  2P6H A;  3TEZ A;  5GLT A;  2V5D A;  1XRU A;  5FZH A;  1PMH X;  1N47 A;  2JG8 B;  2WWJ A;  5F8P A;  5FZG A;  3MZH A;  1RUD 3;  4BQY A;  1QOS A;  1O3S A;  4YZ4 A;  5LBC A;  1D0G A;  2C4X A;  3P5B A;  1KJL A;  3QOP A;  3VKN A;  4BDV B;  1H6X A;  4OZX A;  1TMF 2;  5FWE A;  1RTV A;  4HET A;  5A7O A;  4IEZ A;  1OLR A;  2YDE A;  3UJQ A;  2BWC A;  3C2U A;  4IW3 A;  3RPQ A;  5LRS A;  1RUG 3;  4Y1Z A;  3KMH A;  4CUB A;  4JDN A;  3RZK A;  4IEO A;  4Q0S A;  4U36 A;  1OHF A;  5FXX A;  3VKL A;  3ZN6 A;  3ZXA C;  3ACL A;  3MUZ 1;  4UFJ A;  5F5I A;  3VDC A;  1R09 3;  4IES A;  1RIR A;  4OI2 A;  3IAQ A;  4FPH A;  5LK5 A;  4FAH A;  4D94 A;  1LTE A;  5IJR A;  5FPA A;  1LHU A;  3BVC A;  3RZH A;  2JDH A;  3WNL A;  1R1A 3;  5FXV A;  1FI2 A;  2Z79 A;  3VBO A;  1UY2 A;  2W1Q A;  1F5F A;  2K9Z A;  2RS5 1;  3NST A;  2YPD A;  1JS9 A;  1CN1 A;  1X50 A;  2HBU A;  4BQ4 A;  1BEV 3;  2C24 A;  2EXH A;  3UT0 A;  3J7M A;  4H2A A;  5GZG A;  5C8W A;  5CVR A;  5KHH A;  1DYP A;  1H8V A;  5H9Q A;  5A1L A;  2ZX2 A;  4Z1V A;  1HJG A;  3B00 A;  4MLO A;  5FLH A;  4ARX A;  5JZG A;  3U0Z A;  4B8E A;  2GZW A;  1JZ2 A;  2BW8 A;  1GUI A;  3AXE A;  3KV4 A;  1HQW A;  4QQL A;  2RM2 1;  4A7Y A;  5IK7 A;  4CUC A;  1WA6 X;  2XJR A;  1LOC A;  1JTZ X;  1T2X A;  2JB8 A;  5IW0 A;  1HB2 A;  2O0O A;  3ZN6 B;  5J96 B;  1ZRR A;  3NKG A;  2WQ8 A;  3H9A A;  3T30 A;  5C3R A;  1RUC 1;  4K20 A;  1O8P A;  4RQP B;  1KIT A;  1YQC A;  3FX3 A;  1FV2 A;  2HWE 2;  3PVB B;  4L11 A;  5T5L A;  5C70 A;  3TRS B;  1UYP A;  4K1Y A;  1LKN A;  1N3Q A;  3WHU A;  3W21 A;  3ITQ A;  5FV3 A;  1NCR A;  1J84 A;  2VGD A;  1VBB 2;  3VHP A;  2TBV A;  2XHK A;  1W0N A;  4OZO A;  1H1M A;  5CNA A;  1UQX A;  3GZA A;  5A6X A;  1QDC A;  4Z2A A;  1JZ8 A;  5IT6 A;  4BIO A;  5FY1 A;  1NCQ A;  2DWR A;  4WV8 A;  5FZ4 A;  4MHU A;  1ZYB A;  4QB2 A;  1AXZ A;  2J1U A;  2ARE A;  5JUV A;  4NN0 A;  3UK9 A;  1I5P A;  3I97 A;  3M3E A;  2VOK A;  4PCR A;  3FHI B;  1FYU A;  4XMA A;  2I07 B;  5JOZ A;  1RUN A;  3HNY M;  2XVG A;  4DRR A;  3BN6 A;  4D3W A;  3IBM A;  1RUH 2;  5HCA A;  2WLP A;  2YBK A;  2BOJ A;  2XL9 A;  1MS0 A;  2EXK A;  3CO2 A;  2Y38 A;  4P5H A;  4HXC A;  1RC6 A;  3AJZ A;  4QX2 A;  2ERF A;  1NAE A;  5T3N A;  3N9N A;  2RHP A;  1AR9 3;  2XBO 1;  4IND A;  5BXX A;  3ZM8 A;  5CFC B;  4U2A A;  3O0X A;  1OH3 A;  1S0I A;  3OTF A;  4Y4R A;  4AVV A;  3AP6 A;  4UW4 A;  1ENQ A;  1MQT A;  3NKT A;  1SBD A;  4NPR A;  3A22 A;  4RR3 B;  5I8Y A;  1ZZ8 A;  2HWC 1;  2QTW B;  5IUQ A;  3I3Q A;  1N1Y A;  3H8R A;  4BQ3 A;  1W9Y A;  1W39 A;  3ZKY A;  2GC2 A;  4XXP A;  4A6S A;  1PO1 1;  1IHM A;  5JPM B;  4YM0 A;  3T2O A;  1ENX A;  2XUM A;  4WM8 A;  1AR8 1;  3PVE A;  1ZZ7 A;  3SH4 A;  3VBR A;  4AI8 A;  5L19 A;  1BVP 1;  4XUN A;  4LK6 A;  2BQP A;  5FY5 A;  5K7P A;  1VB2 A;  4MGQ A;  4UFM A;  3ZFE A;  1DDL A;  1AR7 2;  3V0B A;  4XJ8 A;  4CA9 A;  4Q0Q A;  1QJX 1;  3GF6 A;  3WR0 A;  4B3N A;  4XFA A;  3POW A;  1XC6 A;  3I3E A;  2ZTN A;  3MID A;  3ZN4 A;  2OA2 A;  4CDW A;  4MH0 E;  5HXM A;  1EUT A;  1BVV A;  2GNT A;  1EV1 3;  5FYM A;  3PVN A;  5J7M A;  1RMU 3;  5GJ6 A;  3PUS A;  5FR3 A;  2R1D A;  2YBP A;  4HOO A;  4MXW A;  3HN1 A;  4CDX B;  3KV6 A;  2I74 A;  3HOB A;  4AGR A;  3H7Y A;  3NVC A;  2LAL A;  3T0B A;  5BY5 A;  1UYY A;  4BLI A;  3FC0 A;  3BIE A;  2VZV A;  2D5H A;  2Y0I A;  1MS1 A;  2D6M A;  3N4M A;  4QU1 A;  2WNE A;  1FMD 2;  4YVS A;  4IGQ A;  2BWA A;  5KXC A;  1PGL 2;  1J1L A;  1G7Y A;  1VAV A;  5SV8 A;  1WMX A;  1QF3 A;  2JX9 A;  4WM8 B;  2JXA A;  3VUO A;  3VBR B;  1J59 A;  3ORJ A;  4RD7 A;  4LKF A;  4LKD A;  4FVV A;  1WCK A;  5K4L A;  5SV5 A;  1NX9 A;  5HI0 A;  2DUP A;  3ZDV A;  1RHI 3;  1W8N A;  4FXG B;  5T5P A;  2QDN A;  2J1R A;  1RUE 2;  4OI4 A;  3PUH A;  5DAB A;  3RJ2 X;  3VZN A;  2MHF A;  5IVE A;  1Q8P A;  2QZ2 A;  5JDB A;  2GND A;  2G9G A;  4QGL A;  1Q8V A;  1KS5 A;  1XSR A;  1AYN 2;  3LFI A;  1YQ8 A;  3RVH A;  1B09 A;  4YPJ A;  3ZYP A;  5F39 A;  4AFA A;  2VEC A;  4N53 B;  3U07 A;  2VW2 A;  3LD8 A;  3U14 A;  4COW A;  3UGG A;  2P4E A;  5IFT A;  1UIK A;  4YG0 A;  4H55 A;  2PQQ A;  4ISR A;  1LCL A;  3WNO A;  4YVS B;  4XMI A;  1REF A;  1SFP A;  4AK3 A;  2BV4 A;  5AC9 2;  4E8D A;  2A70 A;  1Y3T A;  4FFI A;  5JOY A;  1W2A X;  4Q0V A;  1VBE 2;  4DS0 A;  1O3T A;  1GOH A;  1F5J A;  2DCZ A;  2CYF A;  4DUX A;  4HON A;  4DY5 A;  1WW7 A;  4WM7 A;  5FZA A;  3W59 A;  1VAL A;  4J1X A;  1MVQ A;  4NHY A;  4X6Q B;  4YGE A;  3TN9 1;  4MGT A;  1OH4 A;  2VM9 A;  1S2B A;  5F5C A;  1LOF C;  1K5M A;  1CZV A;  1QWR A;  2VXR A;  3JB4 C;  3MDP A;  4PQQ A;  2XLA A;  4RS5 B;  3VHO A;  2R7E B;  1DZR A;  3ZYR A;  1UN1 A;  3TNP B;  3HT2 A;  4PHZ A;  5GLU A;  2W2I A;  3VN4 A;  4LIT A;  2OW4 A;  1HXS 1;  3INA A;  3JQW A;  4M01 A;  2JE9 A;  1A8D A;  4SLI A;  2RR1 3;  3WNK A;  4N43 C;  1LHW A;  3JD7 1;  3GBW A;  2KXL A;  3ZFF B;  1PVC 3;  3OBA A;  3MW3 A;  3D8C A;  4UW3 A;  1SPP B;  5I0R A;  1OPO A;  1PK6 B;  4Q27 A;  4AED C;  1W9F A;  4M4P A;  1IGO A;  3SKJ E;  5LA1 A;  4OHV A;  4NR1 A;  5LA2 A;  4UXA A;  2CAU A;  3QH6 A;  2ZPX A;  4Q1P A;  4GA9 A;  3WG2 A;  4A4A A;  4QGN A;  4ZXE A;  2I45 A;  4S2G A;  3RGB A;  1I3H A;  3WEZ A;  5T54 A;  4WM7 B;  3FJS A;  4EE2 A;  1ZRC A;  4XQW A;  4EN9 B;  2JJ6 A;  4XW3 A;  2RS5 3;  5CU1 A;  1VBA 1;  3WIN E;  1K5M B;  5I0S A;  3MF9 A;  2J22 A;  3O14 A;  3ILN A;  5EJZ B;  3V0A A;  1RUF 2;  2Y64 A;  4AI1 A;  5K8S A;  4Q4X 2;  1LUL A;  2WC2 A;  2P6C A;  4DRV A;  1CAX A;  4COV A;  1X8M A;  4HK9 A;  5FYH A;  3B69 A;  1OFS A;  1GZW B;  4Z2W A;  3ZXG A;  4LT5 A;  1COV 2;  1YNA A;  1ZRI A;  2QQU A;  3I2D A;  1ODM A;  2ZEY A;  4N7U A;  2AYH A;  2X8K A;  1WD4 A;  1G9D A;  4BB3 A;  3AB0 A;  1ZBA 1;  1JYC A;  1QNY A;  5EFU A;  2FDG A;  5JR7 B;  1MVE A;  5F3E A;  1XNT A;  2DCT A;  1LGN A;  2BDR A;  2H0B A;  1ZZC A;  1WBF A;  1DYO A;  1RXF A;  2PHU A;  4LK7 A;  5FAX A;  1ND2 A;  1YYN A;  4CXW A;  1FAT A;  1GP6 A;  2ENR A;  3PMS A;  4LO4 B;  4OUE A;  4YW7 A;  4BIS A;  1PX3 A;  3M70 A;  5BV6 A;  4LKS A;  2BBV A;  3ES4 A;  4H7L A;  3ZYB A;  1TNF A;  3KZ4 C;  5K0U A;  5FQ0 A;  2WNV A;  1QY4 A;  1IKQ A;  1HX6 A;  2KD7 A;  4Q8L A;  4XYX A;  4LO7 A;  5FP9 A;  3TNQ A;  2Q30 A;  3FL7 A;  3SIS A;  1V6N A;  2BFU L;  2VZ3 A;  4X8P A;  1JYW A;  1Q8O A;  1WGP A;  2JEN A;  2VMH A;  3E5X A;  3FN9 A;  5FJK A;  1EAH 1;  2GME A;  1SCS A;  4L97 A;  4XHX A;  1BYH A;  3MF6 A;  1CJD A;  1ULP A;  1D4M 1;  2WFP A;  2VD7 A;  2GNM A;  3HNM A;  1X33 A;  2Y6H A;  3I2G A;  5ACA 2;  1FNZ A;  1GOF A;  4CE8 A;  3KQ4 B;  3WW3 A;  3K51 A;  1A6C A;  1UXX X;  2ZZQ A;  3GGL A;  4KI5 M;  4HKL A;  2YPJ A;  4O65 A;  4AI9 A;  5CFD C;  1YJK A;  1RVF 3;  4ES9 A;  3GBF A;  3R4S A;  4AEM A;  1H2M A;  2ZGL A;  4HKO A;  1QJU 2;  1M4W A;  2X5I C;  2YC2 A;  3C7E A;  2CWS A;  2XJP A;  1W6O B;  1UY0 A;  3UES A;  1NG0 A;  3V65 A;  1AL2 3;  5K0U B;  3LOI A;  2ZGQ A;  3JBG 2;  2VZS A;  1OA3 A;  4WVM B;  5DZE A;  4FTE A;  4GB3 3;  2XXZ A;  3B3Q E;  1R08 2;  1ZVF A;  4CYD A;  1ULG A;  4A3X A;  1C57 A;  1OUS A;  3LIH A;  3I2F A;  1CD3 G;  2RM2 2;  3ZOI A;  5C71 A;  2WAB A;  4QQH A;  2R07 2;  1BCX A;  4IEQ A;  3QCW A;  4LBM A;  1UPI A;  1QEX A;  4AQT A;  4RGA A;  3KB5 A;  1V9U 1;  1VAK A;  3HD8 B;  1ONA A;  3LA3 A;  2C5D A;  3BGA A;  3RMY A;  3F95 A;  1US3 A;  2YC0 A;  2RS3 2;  2WYF A;  1BBT 1;  3KV5 A;  2XH6 A;  1UPS A;  4YGB A;  3ZDS A;  2C0Z A;  1YUD A;  3MW4 A;  5FZ6 A;  2HWD 1;  1ZX5 A;  2BP6 A;  3DYM A;  2B8M A;  4FOQ A;  4DB5 A;  3MO4 A;  2Q1Z B;  1HRI 2;  3VZK A;  3SH3 A;  3OD4 A;  4OMD A;  3U75 A;  2B9U A;  4H14 A;  3J8F 3;  4ASM B;  4AXO A;  1VLN A;  1ULO A;  4KQ7 A;  1OOP C;  4COY A;  3P6B A;  1HLC A;  2R04 2;  2PHD A;  4P9Y A;  4A3Z A;  1S0D A;  1H0B A;  1PM7 A;  1O91 A;  2Z4F A;  4QXC A;  4G4F A;  1AX1 A;  1WLC A;  3LEK A;  5HCH A;  1F31 A;  1ZBE 2;  1S0B A;  1TMF 1;  4HBN A;  3EB7 A;  4QAW A;  2D3R A;  4BXS V;  2VW1 A;  2RVA A;  3IDE A;  4IDZ A;  4IV3 C;  1RIT A;  2YYO A;  3CF6 E;  3N7L A;  4JTN A;  1ACC A;  1DZQ A;  2DBI A;  4LBK A;  1C1L A;  2E32 A;  3PUQ A;  1ASJ 2;  1YLL A;  3ZR5 A;  4CDQ C;  3G6J B;  4E4D X;  4XZU G;  4NUB A;  1GNY A;  1QQP 3;  5D21 A;  5DAP A;  5C3Q A;  1YI7 A;  2IWG B;  3PJY A;  1AR6 2;  1LNS A;  2X09 A;  3IKW A;  3LFM A;  4BLJ A;  4D6R A;  1JYN A;  2BNN A;  4XDQ A;  5AVA A;  3UL2 A;  4Q4W 1;  4NVP A;  5JI7 A;  1F9K A;  3NMB A;  5D8A B;  1UY4 A;  1X36 A;  4B7E A;  1APN A;  2DVF A;  3ZYJ B;  1PGW 1;  4CCL A;  2VAU A;  3THC A;  2Y6K A;  4IGP A;  1A8M A;  3WNM A;  2V5Y A;  5FRE A;  3ZFG A;  4MVT A;  4QKB A;  1KDM A;  1V70 A;  1YFX A;  3J7L A;  1ALY A;  2EF6 A;  2VMG A;  4QHO A;  1HN1 A;  1QKQ A;  4YRD A;  3TN9 3;  2SLI A;  2L9L A;  1V0A A;  3RZJ A;  1W8H A;  3E5U A;  3OSD A;  4R8H A;  4GAZ A;  3VBO C;  3DEC A;  5FZI A;  2QQM A;  4Z82 A;  4RGG A;  2HWE 1;  1SMV A;  1QJY 2;  2IZW A;  4NHM A;  3T4H B;  5BYN A;  1RJ7 A;  4DQA A;  1VBB 1;  3M1H A;  3HBK A;  2HYK A;  3O0W A;  2WZP P;  5ANQ A;  1JHN A;  2LM3 A;  4PIZ A;  4W6X A;  3GJB A;  4S2H A;  1O5U A;  5JZG C;  4BK4 A;  4LBN A;  2VOX A;  4UFI A;  4Y1Y A;  1GBG A;  2HWF 3;  3NQH A;  5C6C A;  4Q4Y 2;  1I9R A;  2P34 A;  4NWW A;  2P37 A;  2VTX A;  5A7P A;  2P5B A;  2WWS A;  4WBB A;  2D3P A;  1KFX L;  1OUR A;  1Q5O A;  3FWE A;  4QQP A;  1RUH 1;  5CIS A;  1PO2 3;  1VBA 3;  1HRV 2;  1S0G A;  3POJ A;  2VUC A;  3LGR A;  4GJZ A;  5DAW A;  1QOO A;  1NCR C;  4IL7 A;  5E16 A;  5FZ1 A;  5DUX A;  2UYA A;  1VMF A;  5DDJ 3;  3VDD A;  2PYT A;  3W9A A;  1UU6 A;  3WCS A;  1F4H A;  4LO6 B;  4UFL A;  4IUG A;  2Y6F A;  5FY8 A;  1GZT A;  5FYC A;  3VV1 A;  1NCQ C;  1JZ7 A;  1K5J A;  2YUE A;  1WLT A;  2QCS B;  4N43 A;  2EAL A;  4RN5 A;  4XZP A;  1HW5 A;  4MHR A;  1C28 A;  1O59 A;  4JTO A;  5CIR A;  2WO3 A;  1KXG A;  4PDW C;  5EPA A;  4D7S A;  1W8W A;  2R30 A;  5BNQ A;  4H3W A;  1UOB A;  1GKB A;  4FPL A;  3WQB A;  4AED A;  4CXX A;  4LKE A;  1LAJ A;  4KG0 A;  2PHT A;  2WT0 A;  5J1X A;  4OHX A;  2E31 A;  4EN7 B;  5J98 B;  3WX5 A;  1CAV B;  4C1X A;  2O14 A;  4CPB D;  3ILF A;  1ULD A;  3OUH A;  3MIH A;  4LBQ D;  1JXN A;  1X9T A;  3JUU A;  3LDK A;  4TXW A;  5DUU A;  3WCR A;  3SEE A;  3OGJ A;  4ATF A;  1AR7 1;  2A6V A;  2K2S A;  3NJX A;  2YMZ A;  3RG0 A;  5H9P A;  1MQT C;  1O4Z A;  2Z2S B;  4OI0 A;  4DNY A;  5DPN A;  4L2N A;  5CBL A;  3L2H A;  3T1L A;  4YZ1 A;  2BU9 A;  5FIX A;  1LJ7 A;  5L36 A;  3H3U A;  3SCH A;  2W95 A;  1VBC 2;  4N43 B;  4YLZ A;  1D4M 3;  4MZU A;  4PJY A;  4QPI A;  4AVC A;  2VO5 A;  4YZ3 A;  2ET1 A;  3HQX A;  1SQ4 A;  3AFK A;  4I30 A;  2D98 A;  1VMH A;  4GMP 0;  4MO3 M;  4QM8 A;  4W6W A;  4WZC A;  3UGF A;  3O1M A;  1BKZ A;  2A3W A;  3KCY A;  4AED B;  2E63 A;  4FFF A;  2CY6 A;  2AEZ A;  2ZXQ A;  3ZFE C;  3CEW A;  1MR5 A;  1OD5 A;  2ZBJ A;  3HQU A;  2D40 A;  4QQO A;  1JYX A;  3H8X A;  4YM1 A;  2PHW A;  2R6Q A;  4N90 A;  4DXT A;  2WAA A;  1PGL 1;  1UIJ A;  4K3U A;  4LE3 A;  4QPG A;  4CDW C;  3VBU C;  1TEI A;  1OA2 A;  4MUV A;  5F2S A;  3E97 A;  4BOW A;  4NIH A;  5C3O A;  4HSL A;  5F5Q A;  1NUK A;  3B5L B;  1DGR N;  3BTX A;  2DUO A;  3WG3 A;  1ND3 A;  4MGY E;  1ST8 A;  4OMC A;  4AGV A;  1QDO A;  3LSD A;  5FUI A;  4DUV A;  3HPN A;  3KCC A;  2VVF A;  1W05 A;  3OF1 A;  2ZCW A;  5LBE A;  4B1L A;  4YZ2 A;  3SH5 A;  1AYN 1;  4KWJ A;  2Q0A A;  2XQX A;  3OBZ A;  3B01 A;  3FUO A;  4KMQ A;  5KXE A;  4FI9 A;  4IET A;  3MBW A;  4DIQ A;  4AAP A;  3ZKU A;  3BI3 A;  3LAG A;  2HWD 3;  1UZZ A;  5CFD A;  2QQW A;  2Q4S A;  1NQD A;  2BYV E;  5FZE A;  1H2K A;  5AC9 1;  4RFT 0;  3USU B;  3AJY A;  3U4X A;  3ZXD A;  2Q1F A;  3OBT A;  2ZML A;  4M3C E;  4Y5Z 0;  1MS4 A;  1VBE 1;  1GQP A;  2PQS A;  1S4C A;  4PI2 A;  1W9T A;  2OX0 A;  5IK5 A;  1OVP A;  2X5I A;  1CIW A;  5FMO S;  4BME A;  3GZE A;  4Q4V 2;  5HCB A;  1AJO A;  3AM2 A;  1XNA A;  5LB6 A;  4BQX A;  2VBD A;  4D6S A;  1HV1 A;  4GMP 3;  3UKV A;  2R49 A;  1C8M 3;  3AKQ A;  5H9R A;  4NAO A;  4XIL A;  5LK7 B;  5JMC A;  2W39 A;  2Y6J A;  1RUO A;  1WD3 A;  2AR6 A;  3PHM A;  3V56 A;  2X10 A;  1KD7 A;  3M8L A;  1LGC A;  2AEN A;  1DP0 A;  3VZO A;  4EV0 A;  3AP9 A;  4AWD A;  4J6G A;  5L9V A;  3ETP A;  5KXD A;  1QJE A;  1UNB A;  3OYW A;  4PBP A;  3TEW A;  4D7Y A;  5CFD B;  2PLV 3;  2BTV C;  3ST7 A;  5T50 A;  1RGS A;  1CGP A;  4RFR B;  5JSR A;  4FXK B;  1GSL A;  3THP A;  1XNK A;  4CU7 A;  1GR3 A;  5BNN A;  5J09 A;  3PUA A;  2QDR A;  1DBN A;  4QXH A;  3IMN A;  2VBP A;  3UET A;  2X5I B;  5IVC A;  4L0P A;  1SLT A;  3TAY A;  3NJV A;  1Y9M A;  5EIY B;  4YVW A;  3LA7 A;  1XSQ A;  2UWA A;  2QBX A;  1WCD J;  1S1A A;  1V9U 2;  4XJU A;  3KT1 A;  2F6B A;  4Q4X 1;  2GAU A;  2WLQ A;  5ABJ A;  4UBG A;  5FZO B;  2WII B;  4FTB A;  4DEQ A;  4BQW A;  3FZ3 A;  2YU1 A;  4IV3 A;  1COV 1;  2VVE A;  1CPM A;  3BPS A;  2BJS A;  5LWB A;  5IHR A;  4GH4 C;  1J58 A;  1OBN A;  5DUW A;  5BPX A;  4R9B A;  1W2N A;  1Q8Q A;  2VCA A;  4CDQ A;  5A1A A;  4IXL A;  3WQ7 A;  1L7R A;  2DU0 A;  1D2Q A;  1O7F A;  1VBD 2;  2ZZJ A;  2IXI A;  3I7D A;  1VMJ A;  1WA4 A;  2R32 A;  4FFH A;  3GNE A;  5FRA A;  1SEF A;  1OOP B;  2CTV A;  4PBO A;  2JE7 A;  3ZYG A;  1J1T A;  3WP4 A;  1JOB A;  2OPW A;  3OB8 A;  5FYI A;  5GZE A;  1VRH 3;  2WZ8 A;  1W28 A;  1H30 A;  3U11 A;  4P14 A;  5DAX A;  3ZMO A;  5KHK A;  2XVL A;  3HQR A;  4OLL A;  4LIV A;  1YWK A;  5GZD A;  4LR4 A;  1WLW A;  4IV3 B;  5FP8 A;  5DN2 A;  2EVX A;  3Q9O A;  3NNJ A;  4AFC A;  5FLJ A;  3M3C A;  4BK5 A;  5ACA 1;  1RUH 3;  2WT2 A;  4AEK A;  4FQZ A;  1ND2 C;  3PL0 A;  1MEC 1;  1MZ6 A;  2D6O X;  1OFN A;  1PMI A;  3PIJ A;  4CDQ B;  5AVP A;  3UNP A;  3HBZ A;  3WW4 A;  2FZ1 A;  3P3P A;  5K0U C;  4YW6 A;  2WNV C;  1DLL A;  1CPN A;  4Q4W 2;  4ASL A;  4YW1 A;  4XFH A;  1LU1 A;  1QJU 1;  1WCS A;  3WSO A;  3SMH A;  5A6Q A;  3WUC A;  3HVD A;  4QWN A;  1PGW 2;  3S5Q A;  3ZIW A;  2WRA A;  2DCK A;  2ZMN A;  4IE0 A;  3U10 A;  3JBG 1;  1HQL A;  3VD5 A;  5FOJ B;  4LA3 A;  4P9G A;  1UU4 A;  5HV4 A;  5E6H A;  2AC1 A;  1C8N A;  1R08 1;  4LBL A;  4F7Z A;  4DUW A;  1SDW A;  3THD A;  3P1I A;  2RDS A;  3KSC A;  4ES8 A;  3RWN A;  4HPK A;  2R07 1;  1YJL A;  3C7O A;  2YC4 A;  4YFW A;  3QD6 A;  4JRA A;  3EO6 A;  1KS4 A;  3JZV A;  1PM4 A;  2W08 A;  4LHL A;  5IVY A;  2YZ4 A;  3LEM A;  3N9Q A;  4UAP A;  4NRP A;  4CDU A;  3OGR A;  1KRI A;  4E2S A;  2RS3 1;  4UBH A;  1XQN A;  4XBN A;  2J1S A;  1DQ0 A;  2OUJ A;  5H9S A;  5GLV A;  5L7O A;  3C7G A;  4KGG A;  4SBV A;  3VBO B;  1RUJ 1;  1MZF A;  2G1M A;  1TVG A;  4EN8 B;  4CP9 A;  1ULF A;  4D0Q A;  3WDY A;  1HRI 1;  2LW8 A;  1OF4 A;  4YAR A;  4EYU A;  2WSV A;  4K40 A;  2RJK A;  4LLO A;  4NAM A;  4XFG A;  3WDV A;  5EXO A;  1C1F A;  1JZ6 A;  1FT9 A;  4YW5 A;  2R04 1;  1ZZ6 A;  3ZXK A;  3Q8B A;  3N9P A;  3I3B A;  2BZD A;  4PDW A;  1F2N A;  4XAA A;  5JZG B;  3O0V A;  1FMD 3;  5FXZ A;  2D93 A;  3EBR A;  1ZBE 1;  4BU2 A;  3POG A;  1DGR A;  2XLF A;  2UUR A;  4JHZ A;  5L9B A;  5KHJ A;  3AP4 A;  3CJX A;  4HPK B;  1RB8 G;  4XIK A;  1A34 A;  3I2K A;  2AUY A;  4P9L A;  1W8U A;  2UY8 A;  4NRM A;  5I0U A;  2X53 S;  4MGZ E;  1HB4 A;  3GAL A;  1C5H A;  1RUG 2;  2ZAC A;  4XUQ A;  5FWJ A;  2QFE A;  1RYY A;  3CU7 A;  2B45 X;  2GC3 A;  2RJL A;  1RUE 3;  1GYK A;  1CR7 A;  3BU0 A;  3B02 A;  1NCR B;  5FBZ A;  1ASJ 1;  3I54 A;  4IGO A;  1N1V A;  4DO0 A;  2B39 A;  5JAX A;  2A1X A;  4CP9 B;  2GN7 A;  2D7F A;  4ISQ A;  2W3J A;  3KVA A;  2R06 3;  1RL3 A;  4FO9 A;  2C1F A;  5IFP A;  2XHN A;  1R09 2;  2Y8K A;  4ZU4 A;  3BCW A;  1NCQ B;  5C5U A;  1UZV A;  2Z42 A;  3NV4 A;  3OD0 A;  2WDB A;  1AR6 1;  5IK8 A;  4PF1 A;  3ZXF A;  4UW6 A;  2N7G A;  3OGS A;  4TTG A;  4CP2 A;  2BRT A;  2QVS B;  3KS7 A;  1UCX A;  2HEY F;  1R1A 2;  3AKT A;  4PDW B;  1SLI A;  4F3J A;  3DXT A;  1PMJ X;  1UL9 A;  4CCN A;  1CJP A;  1B35 A;  3DKQ A;  2W92 A;  4DEV A;  2D6L X;  5AC9 3;  3HIF A;  4KL1 A;  4XAC A;  1NA1 A;  1BEV 2;  1V6J A;  3IWZ A;  4M3C A;  3L9J T;  1GWK A;  3T3Y A;  3GXU A;  3VBU A;  5E88 A;  1HV0 A;  2WZR 3;  4LIU A;  2V4A A;  3FBM A;  1CWP A;  3CJI A;  2QNK A;  2VZ1 A;  2ES3 A;  2ZGM A;  3O1O A;  2JDM A;  1MQT B;  2CDP A;  4QD2 A;  2LTN A;  1TZO A;  1Q8S A;  1AYM 3;  1AHS A;  4GZ9 A;  2VNG A;  4GWN A;  1OLQ A;  3IDA A;  3LE0 A;  2GMM A;  1QJY 1;  4XHB A;  3T09 A;  1TE1 B;  2OUH A;  2FHR A;  3FHQ A;  4EJR A;  1UZW A;  5FYS A;  3AX4 A;  1LES A;  2X29 A;  4W50 A;  2HLE A;  4XFF A;  3ZFG C;  1FXZ A;  1DIW A;  4CCC A;  3ZFE B;  4FTS A;  4ARY A;  3WDU A;  1IG0 A;  2B46 X;  2XDV A;  3PDQ A;  3AVR A;  3E1F 1;  4JX0 A;  3V0B B;  2E7A A;  4LHS A;  4Q4Y 1;  3WG4 A;  2ZKN A;  3DV8 A;  4M3C B;  3LEI A;  3IMM A;  4FOW A;  4IE4 A;  5JWP A;  1E5H A;  4LO8 A;  3MEP A;  3VBU B;  3VBS C;  2DTY A;  2QQI A;  4CDW B;  5E1R A;  3O12 A;  2ZAB A;  5FYT A;  3I3M A;  2UWB A;  1S2K A;  3NJZ A;  4L92 A;  1HRV 1;  4MXW B;  1AUY A;  3U37 A;  3WY6 A;  2JDP A;  2YFZ A;  4Y22 A;  1VR3 A;  2NQY A;  1RUF 3;  3B94 A;  1NLQ A;  4JKM A;  3ZSE A;  2EIB A;  4HVR A;  1KDK A;  2VME A;  2ZX0 A;  3WF2 A;  3G7D A;  3I49 A;  2Y60 A;  2B4K A;  4YM2 A;  3WW1 A;  5JOW A;  1COV 3;  5F1R A;  1UWW A;  2ORZ A;  4XFB A;  4XF3 A;  2ZGR A;  4HN0 A;  5FK7 A;  4F8A A;  5A3T A;  1W03 A;  2WQ4 A;  4OUL A;  3UKT A;  3PVO A;  2VZU A;  5GLW A;  4EN0 A;  2PN5 A;  4TSV A;  4A7Z A;  1UKR A;  2ADD A;  4IER A;  2A6W A;  3VDD C;  4MXV A;  4XJZ A;  2ZX1 A;  3ABZ A;  4RGK A;  4Y20 A;  4ZXK A;  1IPK A;  3I59 A;  5FZ3 A;  4B29 A;  4RSU A;  2VOW A;  3I2J A;  1LOB A;  2IFW A;  5CYY A;  3TEX A;  2XON A;  1SAC A;  3VBF A;  1W99 A;  5IK4 A;  4Y22 B;  1Y43 B;  3SNM A;  2O8O A;  4FBF A;  1NZI A;  2GC0 A;  3B9C A;  4L99 A;  3ZLI A;  4AOC A;  4DXS A;  1STM A;  2VQU A;  5EQU A;  1KJR A;  4PQ9 A;  5KC6 A;  1VBC 1;  3E5Q A;  5IVB A;  1EV1 2;  3VLB B;  2KR2 A;  5LY2 A;  5I91 A;  4Q1R A;  4QKN A;  3OG2 A;  3A21 A;  2DVG A;  2YY1 A;  4OCT A;  5FZ8 A;  4WVV A;  1DLC A;  1C4R A;  4GH4 A;  4AW7 A;  5DUV A;  3WP5 A;  5FO9 B;  4LOR A;  2EAK A;  2GN3 A;  4N7I A;  3MIC A;  1W0P A;  2VBB A;  5AFB A;  2W47 A;  4Y5T A;  1IPS A;  2AH2 A;  1QJU 3;  1QHD A;  1MPX A;  2XB6 C;  4RHV 2;  3WF0 A;  4NOT A;  3W5M A;  4M0N A;  1PHM A;  4Y20 B;  4BPZ A;  5B4N A;  2D44 A;  3I59 B;  2R0H A;  2G9F A;  1H2N A;  4EN6 B;  3GJA A;  5HCF A;  3MPP G;  3AZY A;  1JZ4 A;  2E7Q A;  4QPI C;  4S2F A;  4MX3 A;  3OGV A;  3QAC A;  1R08 3;  5C4W C;  1CZS A;  1BQP A;  1VB4 A;  2ORX A;  2RM2 3;  4Y1V A;  5A33 A;  1GAN A;  4CTE A;  4AHY A;  2GP3 A;  2ZAA A;  2R07 3;  5FZD A;  2WJS A;  4IE5 A;  4IV1 C;  3AMN A;  3WG1 A;  1CAU A;  5L9R A;  1RUC 3;  1JYT A;  3ACI A;  3W20 A;  1ZA7 A;  1UYX A;  4GH4 B;  4QPG C;  4LXL A;  4YWA A;  3WQ1 A;  3CZJ A;  4BYY A;  4D6Q A;  5KWR A;  5I0T A;  2E9Q A;  1RUI 2;  1H4G A;  1I6X A;  5FP7 A;  1W8O A;  4LOS A;  1ND3 C;  2H0V A;  4LTA A;  3V0A B;  1L3J A;  2ZGO A;  4MGK E;  2PEL A;  3LA2 A;  2BFU S;  2R04 3;  2RS1 2;  2CNA A;  1CAX B;  2XJT A;  2A75 A;  3AL6 A;  4AFB A;  4CZS A;  4E8C A;  4Q4V 1;  5FOB B;  3PUR A;  4JQT A;  3S30 A;  1YO8 A;  4GAL A;  3LIG A;  1UY3 A;  2Z69 A;  2YB7 A;  2K0G A;  3WNN A;  4XF1 A;  5BNO A;  1WW6 A;  2BBA A;  3K48 A;  4N8M A;  2KM2 A;  1MEC 2;  1FOD 2;  3DPR A;  3WF4 A;  1CAU B;  1DGL A;  2WO2 A;  1F15 A;  4Y1U A;  2XBO 3;  2P1B A;  2RR1 2;  5C3P A;  4L8Q A;  2Y6L A;  1PVC 2;  1WKY A;  3MIB A;  1ND2 B;  4GQ7 A;  2PFW A;  1NE6 A;  3AMQ A;  3GZU C;  3VL9 A;  4AVB A;  1ASJ 3;  1UOG A;  3VBH C;  1KQR A;  3AZZ A;  3VZJ A;  4A42 A;  5FPV A;  2HWC 3;  4YG6 A;  5FQ0 B;  4B4R A;  4KU8 A;  2WNV B;  5A7S A;  2NZ9 A;  1XU1 A;  2UY9 A;  1YFU A;  3SQO A;  1WMD A;  3APB A;  1IS5 A;  2ZEW A;  3WV6 A;  2GNB A;  3DKW A;  2W46 A;  4DXR A;  4AQS A;  1PO1 3;  3HJR A;  4AQ6 A;  2JKB A;  4P00 B;  4PLO A;  2JDN A;  1AR8 3;  1FX5 A;  1SBF A;  4FT8 A;  4QM9 A;  1RXG A;  2YFU A;  4XF4 A;  5T52 A;  1QH6 A;  1POQ A;  3J4U H;  2D3S A;  4NHX A;  3PUI A;  1QGL A;  2YXS A;  4XIO A;  1QJX 3;  2UU8 A;  3NNG A;  4R9D A;  1WCU A;  3A23 A;  3KHC A;  3NRU A;  4X8N A;  1RUJ 2;  3RZL A;  4LE4 A;  3AYC A;  3CNA A;  3VKM A;  2J1T A;  4IE6 A;  4C8D A;  1D0H A;  4M0H A;  5BNN C;  1SZB A;  1XE8 A;  2DBN A;  4JGY C;  4EWD A;  1F8V A;  3A0K A;  1R64 A;  2WS9 1;  4YW3 A;  1SFN A;  4DXZ A;  5F6K A;  3ZR6 A;  4JDO A;  1CON A;  1UOJ A;  1MZE A;  3K4Z A;  4YVW C;  4CCO A;  4FAG A;  1JZ3 A;  4LLF A;  5IWF A;  2D6P A;  1VBD 1;  5I8S A;  1LB2 A;  4W4Z A;  2C26 A;  2Y6G A;  2W5F A;  3N35 A;  4OQ9 A;  5ABJ C;  3TB0 A;  3WVJ A;  3MYX A;  1OUX A;  5GZF A;  5C3S A;  3M3O A;  3POI A;  3AKR A;  3M7A A;  5FKC A;  2HYX A;  5JXH A;  1V6K A;  3FHA A;  3N9O A;  5JIA A;  4AG4 A;  1Z78 A;  2P2K A;  1W8Z A;  2WFF 2;  4Q4Y 3;  1GLH A;  1LRH A;  1LEN A;  3BOW A;  2ZOE B;  4N9H A;  4URT A;  1W6N A;  3FLR A;  5HPO A;  1U5Y A;  2FCT A;  1UAI A;  3RQ0 A;  3TWI A;  3SKV A;  2R0F A;  2VZR A;  3O7O A;  3HWJ A;  4ITC A;  5FYV A;  1HRV 3;  3WP6 A;  4J25 A;  1O6U A;  5FTT C;  5GLZ A;  5I0D A;  1XYP A;  3D0J A;  3D0S A;  4TZD A;  1W9S A;  1GZ9 A;  1LU2 A;  4NJ4 A;  4GUL A;  3VDB A;  1QMJ A;  4XET A;  4ET7 A;  2QJV A;  1HQN A;  1KFU L;  1RVF 2;  1KGY A;  2JIG A;  1UO9 A;  2XG3 A;  1X9P A;  1JZ5 A;  1FPN 2;  2FCV A;  4I0A A;  3MGU A;  1AX2 A;  3CIH A;  4LJH A;  2ZHM A;  2VU9 A;  2VOT A;  4UFK A;  5CKM A;  2CGP A;  4UOJ A;  4KWL A;  3MLL A;  4NIA A;  1XB9 A;  3IZO A;  4EZ4 A;  1TG7 A;  2VNR A;  3IB3 A;  1BMV 2;  4HVO A;  1GMM A;  1YQ2 A;  1YRZ A;  4URA A;  4FPC A;  5JVV A;  2ZHN A;  3HMY A;  4GB3 2;  4AF9 A;  5LA9 A;  5FKB A;  1JU3 A;  4CU8 A;  2DF7 A;  3VBS A;  5FY4 A;  1HXS 3;  2VUA A;  1C3H A;  3RZM A;  1ODN A;  2IXC A;  3B93 A;  2WWU A;  5BNP A;  1W6P A;  3DEM A;  5LEK A;  4AGG A;  2ETE A;  1WCQ A;  2A5Z A;  2BGP A;  3JD7 3;  1UKG A;  3BIW E;  3U1X A;  3OUI A;  1JI6 A;  1WMF A;  3GZT B;  2PAE A;  3PTR B;  1WW5 A;  2OZ6 A;  5A3U A;  3D5O A;  1QXJ A;  1VBC 3;  3J26 N;  4BA6 A;  5JI9 A;  3MV1 1;  4UF0 A;  4BHP A;  4GJY A;  2H6C A;  4CU6 A;  2WZE A;  1U0A A;  3WUD A;  4C1W A;  4LOT A;  3ZFG B;  4OHY A;  4W8J A;  4Y4Y A;  4PT6 A;  1ULC A;  2VTX J;  3OUJ A;  1J3R A;  1S0F A;  2D43 A;  1JOD A;  2ZHL A;  3NJY A;  2D6K A;  4ASK A;  4CDU C;  4KH9 A;  5L7O C;  5FBJ A;  3PNA A;  1A78 A;  1GU3 A;  4K9S A;  3VBS B;  1CAW A;  2GH2 A;  2B42 B;  1URX A;  4YFZ A;  3VB9 A;  3VD3 A;  1TME 2;  1RUG 1;  1W6Q A;  1U5X A;  3HR9 A;  4V2W A;  4GKY A;  2DDU A;  2EA7 A;  2IXH A;  1OMI A;  3A4U A;  3LDR A;  2RE9 A;  2X05 A;  1K42 A;  1BZW A;  4HG6 B;  1PNF A;  4Q0U A;  4QT6 A;  1W9W A;  3BTY A;  2EXJ A;  2FMD A;  4I0B A;  3VZL A;  5FZB A;  2XKO A;  4HK8 A;  3SHR A;  1R09 1;  2VZP A;  2VR4 A;  3H8O A;  4OHW A;  3A0N A;  4V2V A;  1ZBA 3;  4I2O A;  1SCR A;  2WAO A;  2MNG A;  4PLN A;  1QQP 2;  1QNW A;  5FXW A;  5IYY A;  3T4V A;  5ERL A;  3PJQ A;  1OC1 A;  1GWM A;  1DCS A;  3VZM A;  2A3X A;  1R1A 1;  1UOF A;  1DG6 A;  1Z7S 2;  1HIX A;  4IEY A;  3RZG A;  2FDF A;  3ES1 A;  5FPZ A;  1DHK B;  4XJA A;  2QQK A;  2VUD A;  4LO5 B;  3VD4 A;  2BEO A;  1XYN A;  1OA4 A;  5HBA A;  1BEV 1;  1LHN A;  2C9A A;  2D6N A;  2ZGU A;  5F7U A;  1OF3 A;  2B7Y A;  5DAV A;  3MIE A;  4Y26 A;  5A70 A;  1CAW B;  4ZY9 A;  3VDD B;  2P17 A;  2DFB A;  1DU3 D;  1W8F A;  3A7Q A;  1W6Q B;  4XCA A;  5EP9 A;  4HMZ A;  1NLR A;  1EAH 3;  3ACF A;  3ZXE A;  2XUE A;  4Q0P A;  4Q4V 3;  4FOV A;  2YG0 A;  3C8X A;  1LED A;  5C33 A;  3VKO A;  3CMG A;  5FJH A;  1GNZ A;  3GDB A;  2WN2 A;  3H7J A;  3NV1 A;  3NW4 A;  3BTZ A;  3BUC A;  4NHK A;  3EHK A;  5C4W A;  3QBQ A;  2UYB A;  4ZU5 A;  2XJS A;  3AP7 A;  1B35 C;  3MFC A;  2JE8 A;  1PIV 2;  2JDU A;  3FBY A;  4IV1 A;  3K75 B;  4QPY A;  4J1W A;  3KGZ A;  1NA1 C;  1G86 A;  3C7F A;  5EHD A;  1QXR A;  1POV 1;  2F17 A;  3OEB A;  5A7W A;  4CUA A;  3POB A;  4M00 A;  1X82 A;  3CJI C;  1DGW X;  3WD5 A;  2ZS6 B;  2GSY A;  1VP6 A;  3KHB A;  4JAA A;  2HWF 2;  4A7K A;  5JLV A;  1GP5 A;  1AX0 A;  4QX7 A;  4FPO B;  5C7G A;  2DV9 A;  2LS6 A;  5A3O A;  1Y9Q A;  3BYW A;  1C5I A;  1WME A;  3M4F A;  4X6R B;  3VGI A;  5FP4 A;  5LAS A;  4LHK A;  3AMH A;  4QPI B;  1V9U 3;  5FK8 A;  1PO2 2;  4XDP A;  2DVB A;  1OXC A;  5C4W B;  2QQV A;  3POE A;  1PZ9 A;  1BBT 3;  4FPY A;  1RED A;  4I3G A;  5DDJ 2;  4D8M A;  1GP4 A;  2VZT A;  5CA6 A;  1TQ5 A;  4IV1 B;  3VHN A;  5CEH A;  2MEV 2;  4FP2 A;  1SLC A;  4K8F A;  4QMA A;  5F5A A;  2W68 A;  3VD7 A;  1SBE A;  3ZSM A;  4ZHN A;  4QPG B;  1XOY A;  5A7W B;  4NO4 A;  4XXA A;  3VBH A;  2JKX A;  3KVB A;  5FYU A;  2XOM A;  1EPW A;  3H1W A;  1WW4 A;  2QUO A;  1AZD A;  1ND3 B;  3ACH A;  3QLQ A;  3DGT A;  4JGZ A;  1NOV A;  3KF3 A;  1JHJ A;  5GAL A;  1UU5 A;  1GZC A;  1TMF 3;  3KGL A;  4K7J A;  4YNI A;  4CVU A;  1D4V B;  4C0H A;  1HJF A;  3AL5 A;  2WNU C;  3MW2 A;  1ZZB A;  2XL7 A;  4XUO A;  1EP0 A;  2R16 A;  4XUT A;  4A44 A;  1V6M A;  3GCW A;  3Q8F A;  4UW5 A;  1S0J A;  2RMU 2;  3AYE A;  1S0E A;  3HT1 A;  3ZX7 A;  4QKF A;  5FZ7 A;  1NY7 1;  2EIE A;  5DQ0 A;  5IAV A;  3PTY A;  4QGM A;  2OPK A;  2W87 A;  2JG9 A;  4Y33 A;  4Z07 A;  3WP3 A;  1YQ5 A;  2I2S A;  3NAP A;  1EV1 1;  2FQP A;  1SFY A;  1RMU 1;  1F4A A;  2VMF A;  1A3K A;  2A6X A;  3EMR A;  3IDB B;  3D4K A;  2CWM A;  2VW0 A;  3ZO0 B;  1G9A A;  1JU4 A;  1SLL A;  4JGY A;  2AEY A;  1V6O A;  3S5A A;  2WNO A;  3RS6 A;  1BHG A;  4KNC A;  3K4A A;  3VBH B;  1VIW B;  2DVA A;  1UX7 A;  3BU7 A;  2WT1 A;  3H1M A;  1ZA4 A;  3VBF C;  2IVI B;  4Q4W 3;  5A3W A;  4RHV 1;  4Y5S A;  1N3O A;  2WKK A;  4B7K A;  3RYP A;  2NLR A;  4CUG A;  4NMI A;  4UI9 L;  3GM8 A;  3SC7 X;  5A3L A;  3AYD A;  5JOX A;  4AEJ A;  5C9A A;  2JG8 A;  2VJX A;  2EAA A;  5HXV A;  1MS9 A;  5A3N A;  2VQA A;  4ZPI A;  5JSP A;  2YHJ A;  1UF2 C;  4ZU7 A;  3H50 A;  4XFI A;  2FDI A;  3N7M A;  3OYW B;  3VHR A;  1HB1 A;  2WS9 2;  3BTA A;  4MOA A;  2Y33 A;  2ZEZ A;  3OPT A;  2GC1 A;  2P3Y A;  2OZJ A;  2HWE 3;  4AI0 A;  5BNN B;  1S0C A;  3O1R A;  4JGY B;  2J1V A;  2ZKL A;  2FCU A;  3KV9 A;  1VBB 3;  4QKD A;  1RUI 1;  4BWO A;  2P3J A;  2VOV A;  4YVW B;  2E53 A;  2CV6 A;  2HWB 2;  4AAX A;  3CLP A;  4YYO A;  1GFF 2;  1J3Q A;  3N3H A;  5ABJ B;  2DVD A;  2JB4 A;  2RS1 1;  1MS3 A;  2BUK A;  4AVA A;  1W3X A;  2VNV A;  2YRO A;  3POF A;  5EJ3 A;  1SLA A;  2VL4 A;  4I01 A;  4E4Z A;  2HH9 A;  5C9A B;  4ZS3 A;  2ZEX A;  3MIF A;  2G9Z A;  3PIG A;  2OYZ A;  4CPB A;  3FLP A;  4FP3 A;  4XJW A;  4E2Q A;  4LBQ A;  3OPZ A;  1BXH A;  2D5F A;  4P9I A;  5A7N A;  2LRO A;  3URF A;  2W0X A;  5DZF A;  1C8M 2;  1BK1 A;  1FOD 1;  1V6L A;  5FFO C;  3NV3 A;  1POV 0;  4LPL A;  3THT A;  2RR1 1;  3MUY 1;  3WT3 A;  1AXK A;  1CZT A;  1UMH A;  1YIF A;  1D7P M;  1PVC 1;  2ZGS A;  3DXU A;  4LHN A;  4NRO A;  4P9J A;  4TLF A;  3UJO A;  2W52 A;  4V1P A;  1PGS A;  2E33 A;  4XTM A;  4AHX A;  3I4I A;  1IZ3 A;  3SIT A;  1VAM A;  1ZZ9 A;  2WO7 A;  4JKL A;  4QX5 A;  3ZMN A;  2VQT A;  2VCB A;  1T6B X;  2PLV 2;  5CB7 A;  1CQ9 A;  5BUV A;  1SLB A;  1NT0 A;  4RQP A;  4UT5 A;  4WVW A;  3MHZ A;  4EZH A;  2ZJC A;  5BNO C;  3NNF A;  3DF0 A;  3PU8 A;  2JDZ A;  3DPR C;  3DYP A;  4O9E A;  5JXI A;  2BGC A;  1SDD B;  2WUH A;  4MAD A;  4Q26 A;  4YGC A;  5F3G A;  5DXD A;  1CES A;  1NLS A;  3FMG A;  4L9B A;  1W8T A;  3N36 A;  4LBQ B;  2XJV A;  1AR7 3;  1O3R A;  4AHZ A;  5A1F A;  2FDH A;  3N7K A;  1L7L A;  2E26 A;  4WVZ A;  1ZRD A;  1IS6 A;  2WBK A;  2Q8E A;  1H8T C;  4P5Y A;  3NNM A;  4OYU A;  4W6Y A;  3AMP A;  4FCA A;  4NHL A;  2CSG A;  1XXN A;  1BJQ A;  3ALQ A;  3CHX A;  2UWC A;  1WLD A;  3K77 A;  2OT7 A;  4NWV A;  4P02 B;  2BOI A;  2XJU A;  5KC5 A;  1RIN A;  3ME2 A;  5CAD A;  5D8A A;  2FDJ A;  2IVJ A;  3Q8E A;  1PZ8 A;  3CZU A;  4QB6 A;  3O1T A;  4KG8 A;  4OQ8 A;  4YZ5 A;  3NO8 A;  3LPF A;  1JYV A;  3R05 A;  1XND A;  2ZGP A;  5A6Z A;  3OEA A;  4RYD A;  2ZGK A;  1RUD 2;  5CFC A;  4JVA A;  1TNR A;  2E6V A;  1EUU A;  2WA3 A;  3RFR A;  1DQ1 A;  1P8J A;  2ZAH A;  1POV 3;  3RMX A;  3U78 A;  3ZXL A;  2DCY A;  4XAE A;  4AVS A;  4KBZ A;  4RR3 A;  3O5S A;  4NII A;  4CCD A;  2VNO A;  1BK0 A;  5CG9 A;  2WFF 1;  1KEX A;  3ZSK A;  4CDU B;  2W1S A;  1VRH 2;  3FE5 A;  3WZ1 A;  5FZ0 A;  4XBQ A;  2NN8 A;  3AYA A;  4AQ2 A;  5L7O B;  1LGB A;  1LOA A;  2VE1 A;  4TN7 A;  1QXP A; 
#chains in the Genus database with same CATH homology
 4QXB A;  3U4S A;  5LW9 A;  3KV4 A;  5IVE A;  5FP8 A;  2GP3 A;  5FZD A;  5FP3 A;  5FJH A;  2VD7 A;  4GAZ A;  5FYV A;  2GP5 A;  2XML A;  5IW0 A;  4UF0 B;  5LY1 A;  5FZI A;  3OPT A;  3K3O A;  3RVH A;  2OQ7 A;  5FZO A;  3OPW A;  5F39 A;  4LXL A;  4AI9 A;  4XDO A;  5FZ9 A;  4D6Q A;  4DIQ A;  3LD8 A;  4AAP A;  3KV9 A;  5FYS A;  5FV3 A;  5ANQ A;  5A7W A;  4QX8 A;  5FZE A;  5FUN A;  5FP7 A;  5F37 A;  4QWN A;  5FY1 A;  3K2O A;  2XDV A;  3PDQ A;  3AVR A;  3ZPO A;  5FZ4 A;  4CCM A;  4E4H A;  4EZ4 A;  2OX0 A;  5IVJ A;  4HON A;  5FZM A;  3AL6 A;  4URA A;  5A7P A;  2XXZ A;  4QX7 A;  2P5B A;  5E6H A;  5FZA A;  5FUP A;  3PUR A;  5FYT A;  3UYJ A;  5F32 A;  5F5C A;  4D6S A;  5IVV A;  5A7N A;  5FP4 A;  5FY4 A;  3LDB A;  3N9M A;  2W2I A;  2YBK A;  4GJZ A;  4LIT A;  5FZ1 A;  5IVY A;  2OQ6 A;  3N9Q A;  4XDP A;  2WWU A;  4CCK A;  3N9N A;  5FY9 A;  3KV5 A;  5CEH A;  5FY8 A;  5FYC A;  5FZ6 A;  3DXU A;  5F5A A;  5FYY A;  4Y4R A;  3PTR B;  5FZK A;  5F3I A;  4EYU A;  5FPV A;  5A7W B;  5A3T A;  5FZL A;  4UF0 A;  5FPU A;  4GJY A;  5FPB A;  5FYZ A;  5A7S A;  2Q8D A;  5F3C A;  3KVB A;  3PUA A;  3N9P A;  5FYU A;  4QXH A;  2OS2 A;  5FZH A;  4EZH A;  2WWJ A;  3N9L A;  5FZG A;  5FY7 A;  3PU8 A;  5IVC A;  4QXC A;  4CCJ A;  5FXZ A;  3NJY A;  4ASK A;  4BU2 A;  5F3G A;  5FBJ A;  5FY5 A;  5FZ3 A;  5FWE A;  5FYB A;  4Y3O A;  4CSW A;  5A7O A;  3AL5 A;  5A1F A;  5FZC A;  3K3N A;  5A80 A;  2Q8E A;  5A7Q A;  5FZO B;  4V2W A;  5FWJ A;  5FYH A;  2YU1 A;  5FZ7 A;  3ZLI A;  5FY0 A;  4C8D A;  4Y33 A;  5FXX A;  5FYM A;  4IGO A;  2YU2 A;  4DO0 A;  5LWB A;  3PUQ A;  5IVB A;  3PUS A;  5ISL A;  5F5I A;  2OT7 A;  2YBP A;  4HOO A;  3PU3 A;  5FZB A;  3KVA A;  5LY2 A;  5KR7 A;  4GD4 A;  4NUB A;  3KV6 A;  4V2V A;  5FZ8 A;  2PXJ A;  5FPA A;  5FXW A;  4CCO A;  2Q8C A;  4BXF A;  5F3E A;  5IWF A;  5FXV A;  4QU1 A;  4D6R A;  3DXT A;  4IGQ A;  5A3W A;  4CCN A;  5FZF A;  5F2W A;  2YPD A;  4BIS A;  5IVF A;  3U78 A;  2YBS A;  5F2S A;  5FYI A;  4CCL A;  5FP9 A;  3N9O A;  4CUG A;  4IGP A;  5FPL A;  5K4L A;  3AVS A;  5FZ0 A;  1VRB A;  5A1L A;  5A3P A;  4TN7 A;  4LIU A;  5A3N A;  5FJK A;  4LIV A;  2XUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...