1OPMA

Oxidized (cu2+) peptidylglycine alpha-hydroxylating monooxygenase (phm) with bound substrate
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
310
structure length
310
Chain Sequence
b'NECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PEPTIDYLGLYCINE ALPHA-HYDROXYLATING MONOOXYGENASE)
publication title Substrate-mediated electron transfer in peptidylglycine alpha-hydroxylating monooxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 70
structure length 310
sequence length 310
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 1999-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1opmA02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 1opmA01
4R4XA 3MIBA 1YI9A 3MICA 4R4ZA 3MLLA 4E4ZA 1PHMA 1YJKA 1YIPA 3KS7A 1YJLA 3MIGA 3MLKA 3MIHA 4QHBA 3MIEA 3PHMA 3MIFA 1PGSA 1PNFA 1SDWA 3MLJA 1OPMA 3PMSA 1PNGA 3MIDA
chains in the Genus database with same CATH superfamily
4E2SA 4NJ4A 4UXAA 4I0WB 2XQRA 1W06A 4IEWA 4OFGA 4YGCA 2Q8DA 3WDWA 3AL6A 4RHV3 4CDXA 2NLRA 2JD4A 3HD8B 3QD6A 4PT6A 3M2MA 4YM0A 1C57A 1SEFA 2XHNA 4PIXA 3LEMA 4AI3A 2VTXJ 1WCQA 1NA1B 4BQ3A 1Y4WA 1V6NA 3ILNA 1VBC1 4LR4A 1KXGA 4Z8BA 1DQ4A 2D6LX 5KHJA 4AR2A 5GM0A 4YW1A 5ISLA 3O1TA 1MVQA 4MGTA 1UNBA 2JKXA 4QKDA 5C33A 1NXMA 2G4IA 3KF5A 3TNPB 3VBRB 4A6OA 3VL9A 1K45A 1ZBA2 2NP0A 1S2BA 1WCSA 4QX7A 1XRUA 4NWVA 4Y1ZA 5DPNA 3WR0A 3MO4A 1JZ4A 4H2AA 4Q26A 1O6UA 1BQPA 1H4HA 3URFA 4YSFA 4FPJA 2ARBA 3CKHA 1ZBE2 3N35A 3ZXGA 4EN9B 3DYMA 4IERA 1V6OA 4WM8A 2BP6A 5JOWA 4ZHNA 3VBSB 3KHBA 4BK5A 1JW6A 1TMF1 4OCTA 1LU1A 3A0NA 1DG6A 1HV0A 2JDUA 2OUJA 2XKOA 4HKOA 4HPKA 4XW3A 5L73A 2DV9A 2CV6A 4M3CF 4CCDA 1UO9A 2RS52 4NHYA 2X29A 2JDZA 2JE7A 5LA1A 2EIBA 3BVCA 4BCUA 1LRHA 3KT1A 4CDUB 2IZWA 2W5FA 5JMCA 1O7FA 1SLBA 2ZX3A 3JBG3 4FOWA 1WLWA 4HANA 4NAMA 2P1BA 3PVEA 3MLLA 1DP0A 3ZFFA 4FTEA 1DGWX 5FYBA 3ALQA 4JAAA 1R082 1PO12 1XYOA 1JYIA 1K5MC 1ZZ7A 1IS4A 4CCJA 5JDBA 4G9SB 4X6RB 1WW5A 1GR3A 5LY2A 1JYWA 4DY5A 1J3RA 4Z07A 1W8HA 2WT1A 2EALA 3VBFB 1D2SA 4PI0A 5CFCB 1VB2A 2BBVA 1VP6A 1EY2A 4S2GA 2R063 5FIXA 5C4WC 1W05A 3SMHA 5A33B 1AYN2 2BTVC 3PNAA 3VBSC 2BOJA 2EAAA 3B00A 2XPJA 3ACIA 1OD5A 3O1UA 5CEHA 2JXAA 5J1XA 1ENQA 3U75A 3ZFGA 2W1WA 2JDKA 3SEPA 5LASA 2R0HA 1MEC2 3WY6A 1I5PA 4RQPA 4LJHA 1W04A 1NE6A 1DGRN 5BNPA 1CPNA 1NCQB 2VZRA 3D82A 2RJKA 4RN5A 3TNQA 4AXOA 4BQWA 2B39A 5CG9A 1RUC3 3SCGA 1RXGA 3H42B 4P08A 1SHWB 1S0DA 4TXWA 4DQAA 4AE2A 5J96B 3Q8EA 4P14A 5LATA 5AVPA 3IZOA 2FZ1A 3R6SA 1H30A 2QCSB 2ET7A 1POV3 2VZOA 1ULDA 5KBFA 4CP9A 3ACFA 1YQCA 4QHOA 1QH7A 3KCXA 3ZYGA 3CO2A 1VRBA 2K0GA 4AHYA 3VBFC 3WOGA 4HVOA 1BLZA 1W6NB 2J1UA 4LIVA 4MO3M 1W6MA 1EAH2 1PNFA 1VBC3 2Z42A 4FVVA 5A6QA 4L8QA 4HL0A 2Q4SA 4L97A 1W9WA 1ZBA1 3ES4A 2CDPA 1X9TA 3MFCA 1U5XA 1DZRA 2DU0A 3SXWA 2RDNA 2H6BA 2E33A 2JB4A 4YG3A 3SC7X 3C2UA 5FYCA 1RUNA 4UF0A 2R7EB 2J22A 1BKZA 5EXOA 2OA2A 3MIBA 4XEZA 3THCA 1ZBE1 3RZLA 1MS4A 1LHOA 4Y22B 3B3QE 1GZCA 1RMU3 2VVEA 5M0TA 1W2NA 4NRMA 4WM7C 4Z82A 3K4ZA 5JZGA 1MS5A 4KWJA 5FXZA 4QPGA 1C1FA 2B45X 3MUY1 3PUAA 3M3EA 1LOCA 4PIYA 4XF4A 4XXAA 3VBHA 4AEDB 5LRSA 4ZXEA 2ZGUA 4QX1A 3LD8A 4QXCA 4PBOA 3WHUA 4BZ4A 1N1VA 4BYYA 2RS51 4KWUA 1LGNA 4XDPA 3I3DA 4FT8A 2GMMA 3L9JT 2CU5A 4OMCA 1WMDA 2DF7A 4M4PA 4N43B 3LOIA 2W1SA 3DEMA 4HKWA 5E16A 4YFZA 1D0GA 2YXSA 4NHXA 3PTRB 2Y33A 3BPZA 4JGYA 3GXUA 1R081 4LLOA 5DUXA 1WBLA 5F2SA 3TOJA 1PO11 4XUPA 2HH9A 3WNXA 4DXTA 2A1XA 1Y3TA 5L9RA 2PHUA 5HPOA 2K9ZA 2YBPA 4HVQA 4FOYA 4UW6A 1I6XA 3OGVA 3QH7A 3DN7A 4LBQA 4XMIA 1O91A 3PL0A 4YZ2A 2NN8A 4AAPA 1VE0A 4JX0A 4DZGA 3QLQA 1JHJA 1ZA7A 1REFA 4CEWA 3VV1A 1R1A2 2PQQA 5FPAA 3CDZB 1JZ7A 3OF1A 1U5IA 1AX1A 2VMEA 5IW0A 4IV1B 2YGMA 3ZFEB 2ZOEB 4BQ2A 2HWE3 1AYN1 3ATGA 4QWNA 1F5FA 1CAWB 3POJA 3M3OA 1J1TA 2DVFA 3V65A 4C1WA 2VH9A 5CNAA 2RM22 3DPRA 3WHTA 4ET7A 2F4PA 1MEC1 2E7QA 4E2QA 3THTA 3LZZA 4LNVA 4IDZA 2CWMA 1V6MA 1MZ6A 3VB9A 3Q8BA 4QHBA 3RJRA 3VZOA 2N7GA 3KV9A 5KHHA 1OOPA 3UGGA 1POV0 1I1EA 1QJEA 1SLIA 5FREA 3R4SA 5DAWA 3WXPA 4AEJA 4YW3A 2WYSA 3FX3A 3O1SA 3AFGA 1X36A 1LHVA 2WO2A 2ZACA 4ZPIA 5F6LB 4UW5A 2QBXA 2VD7A 5F1RA 5I8YA 1YFYA 5GLWA 2ZXQA 4FBFA 2VMHA 1W0OA 1STMA 5CU1A 2ZZQA 3AYDA 1YCIA 3E1F1 2AEYA 2RJ2A 5FY8A 1K3IA 2HLEA 1DQ1A 1PVC3 2ARAA 1EAH1 2B7YA 3J7NA 1JUIA 1WLDA 3CJIA 4GH4C 3HPNA 3J9SA 3IWZA 5FZ7A 2VOKA 4IV1C 5LBEA 4AHXA 2ARXA 4ZS2A 5FPLA 5CG8A 1GOHA 3LA7A 3HNYM 1XB9A 3MIFA 3GNEA 1GSLA 4HZFA 4N53A 4QX3A 1BHGA 2BDRA 3QBQA 4M01A 1SDWA 4RL7A 3PMSA 5ABJA 2GAUA 1LESA 1UX7A 3MBWA 4FOVA 2BWAA 5FMCA 1JYCA 3APBA 3BPSA 5C9AA 5LA0A 4CXWA 1KS4A 1Z78A 3S6PA 1ZBA3 4AVCA 3JQXA 1XPWA 4Z1VA 2QQUA 2R1DA 1UU6A 1HB2A 4G3YC 3CNAA 1A78A 1J1LA 1U5ZA 3WDTA 3POFA 1RGSA 1ND2C 2ZX1A 1ZBE3 2HWD1 4LHLA 5H9QA 2Q5TA 3U1XA 4A3ZA 2XDVA 2A6YA 2VU9A 4NIDA 1O3TA 4Y1YA 3I59B 2WFF2 3LB9A 1MZEA 3J8F3 4M3CE 3INAA 5FYVA 1UZZA 4BXSV 5J09A 1CX4A 1WMFA 3SH4A 4HT1T 3LEIA 1UMZA 4XFAA 5FY4A 5K0UA 5JMOA 5LEKA 3MIHA 2Y6HA 3W59A 3H3LA 4I0AA 1LEDA 4UBHA 5FMDA 1PK6A 3HT1A 1LTEA 3E5QA 2Q1FA 4AG4A 3WNPA 4CDWB 2QQMA 2RS53 5BUVA 3KQ4B 5GZDA 1LEMA 2ZGLA 4MXWB 5B4XA 4LOSA 3BGAA 2AREA 3LCPA 5FLIA 3ZYFA 2XKPA 2XMLA 4CDXB 3H0OA 1CAUB 1CVNA 3H8XA 5HCHA 1N3QA 1UOGA 1ZYBA 2BUKA 3WF4A 1FI2A 2VNRA 4YM3A 1R083 3ORJA 1KDMA 3POBA 1PO13 2ERFA 3PURA 1IS6A 5FZGA 1UZ0A 3VZKA 1D7PM 1GP4A 1QOSA 3K51A 3U10A 1XJAA 4IEUA 3N9OA 1R1A1 2HJIA 2VW2A 3B9IA 4Q27A 4Y3OA 2CDOA 4ZU5A 5LRRA 1S2EA 2W95A 3A22A 4Z2WA 1I9RA 1UYYA 5A3UA 1GQGA 1W6QA 5IYYA 4W50A 3JU9A 1SBFA 2JG8B 4SLIA 1AYN3 2QQJA 2RM21 2ZEWA 2XVKA 4GMP0 1MACA 2QQOA 2Q0AA 5H9PA 4YW4A 2D43A 2XJVA 3LF7A 3AZVA 1L3JA 2LUWA 4Q1PA 4XCAA 3KMHA 1MEC3 4K8FA 3WF1A 1AZDA 4PQQA 5KWRA 2QQWA 1UMIA 4J1XA 1FV3A 3N3HA 5J48A 1IPJA 2YROA 1GOGA 4MV2A 4FI9A 3H8OA 1NZCA 4WVWA 5K8SA 4HKLA 1QDCA 4FPOB 2CNAA 5HXVA 2DDUA 3RZJA 5JOYA 3BTYA 1VIWB 1BK1A 2P5BA 2GU9A 3NO8A 3RZZA 3VDBA 2XB6C 3N4MA 2P6CA 2K46A 2C1FA 3PU8A 1AL22 1K5MA 1ACCA 1EAH3 4DXRA 3RZGA 1W3XA 1YRZA 3K2OA 1HIXA 3JB4C 4MSVA 5FLHA 5AFBA 3TYJA 3WP5A 5FAXA 3QH6A 1GOFA 1BVP1 4K40A 1HRI2 4RYDA 1VBE2 4AAXA 1LODA 1H2KA 1YWKA 2Y8KA 4EV0A 4EN7B 2VCBA 2BBAA 3AMQA 4GKXA 5CKQA 3VBSA 4XXPA 3BIEA 1RUE2 5GKAC 1YUDA 4K21A 4UFHA 2WFF1 3QACA 4LO5B 4EZHA 2GNMA 2HWD3 3ZFGB 3U11A 3VUOA 2VW1A 3W5MA 4CDUA 2CYFA 4DIQA 4ATEA 3WDUA 5JVVA 4B4PA 2Y6FA 3NNFA 2HEWF 4OZOA 1HQNA 2GN7A 1XSRA 3FC0A 3H1YA 3HIFA 4ZZ8A 3EBRA 4ZONA 3WP6A 5B4NA 4MXVA 4IE7A 2TNFA 2VOXA 4ZZ5A 4R9CA 2XWJB 4AI8A 4P5HA 1ZZ8A 3LDRA 1IZ3A 1UW8A 3K4AA 4AGRA 2DYCA 4XPVA 2AH2A 4NE9A 3E6CC 3C7FA 3VBFA 3K46A 2ZMLA 4L92A 1ZRDA 2QE3A 2YY1A 5FPBA 1OVSA 3THDA 4EWAA 1XNBA 2WNOA 4PDWC 4QPYA 2HWB2 4Y5Z0 5F5CA 5FLJA 3ZYBA 1QQP2 3EB7A 1AF9A 1R1A3 3PVNA 4GJYA 3USSA 1LJ7A 4D0QA 4D69A 1S2KA 3DKQA 3PDQA 4AOCA 1DCSA 5F3IA 3A4UA 1P8JA 1PMJX 3NJYA 5IK4A 5BNOC 2B4KA 1SBEA 1H2LA 2ATFA 2RR12 2LM3A 1NCQA 1UY0A 2RM23 3MW2A 2ZX4A 1QU0A 2D6MA 1OA2A 3I8TA 4WVVA 3BI3A 4DUVA 4LPLA 3MPBA 5JZGB 2BV4A 4CP1A 2ZGRA 1ZRRA 1G9BA 1LHNA 4QPGB 1Z7S2 3AB0A 2TEPA 4Y4RA 3VBHB 4JKLA 1XNTA 2PXJA 2WC2A 3EYPA 3MDPA 1R1ZA 5F2WA 2OX0A 3VBUC 5DQ0A 5FUNA 1OQDA 2E9QA 4FPYA 4Q0VA 1H1IA 2OZJA 4P5YA 2R6QA 1RUI2 2SLIA 3UETA 2JG9C 4KWKA 3U78A 3HQXA 2WLQA 5HV0A 1SFNA 1S0CA 2BWCA 2RS12 2Z79A 1W6NA 4XYXA 4BLIA 2XWBB 4YZ5A 3ZYIB 3OYWB 4GWJA 3HT2A 5E1RA 4AGVA 1W8WA 3AKQA 1AL21 4MUVA 3ZVXA 1GNYA 3M8LA 2UYAA 4RD7A 2GDFA 1JZ3A 3NL1A 3TEYA 1CWPA 1S0GA 1ENXA 1U0AA 2VL4A 1KD7A 1XYPA 3AX4A 3ETQA 3KQRA 5I0TA 4X8NA 2P3IA 4QX2A 3CZUA 1CAXB 5GLZA 3KF3A 2DCZA 3HMYA 1LNSA 4CEWB 1QJX2 3AZZA 3D0SA 2OXBA 3IDAA 1HRI1 2D3SA 1VBE1 2JIGA 4Q0PA 1TNFA 4Y22A 5IVFA 2RVAA 3VHNA 1KFXL 5DMYA 2ADEA 4QQLA 1B09A 3GCXA 4XUTA 3OTFA 3N9LA 3W9AA 1RUE1 4AEDA 3RYKA 5FO7B 3KGLA 2ORXA 5F3GA 2OIIA 2OS2A 2XL9A 3LPFA 1MPXA 3AYAA 3CJXA 4OVEA 1KRIA 4IEXA 4H7LA 2YPDA 1DDLA 4XZUG 2XJQA 1QGLA 1SLAA 2WFF3 2XGXA 4XC9A 5FUPA 3D8CA 4N43A 5FXXA 2WAOA 2QQIA 1AR92 3HN3A 3N36A 4CXYA 1HN1A 3I2OA 2VO5A 2UY9A 1OOPB 4I02A 3OBAA 1PM7A 1SZBA 2VVFA 2WKKA 3AFKA 1YJLA 2VOVA 3DUIA 1JZ8A 4AZZA 3WQBA 1W6PB 4UFJA 2HEVF 2EIGA 1OPMA 3PUQA 1JH5A 3B01A 4FQZA 4BMBA 2WWSA 1F5JA 3VD9A 4G4FA 3MEPA 4YLZA 3JUUA 1E5IA 2IXHA 1O5UA 5FZDA 4Q1RA 2BRTA 1GICA 4R4XA 1WW7A 2QNKA 4IV1A 2HWB1 4IEVA 3ZFEA 3W5NA 4GWIA 2E51A 4DEVA 1QQP1 4QQPA 3POGA 3KLSA 2R072 4LLFA 3ECQA 2JDNA 2R30A 3FMGA 1FX5A 1US2A 1O8SA 1ST8A 3FN9A 3FLTA 3PIGA 2R0FA 2W52A 5F5IA 3RNSA 4GXLA 4XMAA 1V00A 4DEQA 2H0VA 5FV3A 1SFYA 3TEZA 4DNYA 1SPPB 5C9AB 3TRSB 1RMU2 2E7TA 2AZ5A 3DV8A 1DQ0A 4RGKA 2SBAA 3ZKUA 3N7KA 3SHRA 1QJZA 2RR11 3ON7A 4ZY9A 3WX5A 5JOXA 1YHFA 1QXPA 2W1QA 4UI9L 3I2KA 3RSJA 1ND2A 1LGCA 3LSEA 5EPAA 3FLRA 2RHPA 1Z7S1 1MS3A 3WP4A 2F17A 5GZGA 4RGAA 4OQ8A 3HJRA 4FPCA 2JEMA 2QUOA 2B42B 4DXSA 4I09A 1H6YA 5EP9A 4FPEA 5A32B 3WUCA 1W8TA 4CEYC 3FHIB 3BOPA 3MW3A 5G05L 1RUI1 1PK6B 5KXEA 4K8RB 2W91A 4MGKE 2VNOA 3H3ZA 3POSA 2RS11 2CL2A 1D4VB 2XONA 3N9MA 4LORA 2C9AA 1G6NA 5EQUA 5FZ1A 3DYPA 5A3TA 2CGOA 4AFMA 4YM1A 1HJFA 5FY1A 1DQ2A 4XETA 5K4LA 4LHKA 5FP9A 2WIIB 2VQ0A 3ZXKA 4NPRA 2VCCA 1E5RA 5FY5A 1AL23 3EJKA 2ZGMA 3WW1A 2GC2A 1SQ4A 4QXKA 4XF9A 1EPZA 1QJX1 1D4M2 2D3PA 2HWE2 4IEYA 1JOJA 2VVDA 1CAVA 4CUGA 3WQ7A 5FP4A 1GWKA 3FZ3A 1H8TB 3OPTA 3LWCA 2MHFA 4XQDA 1IS5A 4XUOA 3Q9OA 2NQYA 4XILA 1HRI3 5FYTA 1VBE3 5SV8A 2O8QA 1LAJA 4RSUA 5FZOB 3T08A 3I59A 2FD8A 5E8AA 1GBGA 1R093 1UN1A 2PAEA 1JN2P 3O5SA 3A21A 5SV5A 4XHBA 1RUE3 2FZ2A 1AR82 3HNBM 3OGJA 2DBNA 1H1MA 2HYKA 4BQ4A 4CDWA 1RVF2 2WYFA 1GMMA 4XUQA 1AR91 3RS6A 1PVXA 2ID4A 3IT8A 4ARXA 1DHKB 4MXWA 5D8AC 4QXBA 4CU7A 5EYXA 4AF9A 4JTNA 1LCLA 1POV1 4O9EA 3RMXA 1ND3C 1UOBA 1W2OA 4DB5A 3I7DA 3HQUA 1CAUA 3BOWA 4OLLA 4LBOA 3ZLIA 4JQRA 1H9WA 1RXFA 4MGSA 1GYKA 3WQ1A 2OVUA 3NJXA 3ILFA 1PVC2 3H8RA 4LK7A 2E53A 3NV4A 2GH2A 4AQ2A 3RZKA 2ILMA 2LS6A 1Z0HA 3B9CA 2V72A 2HYXA 4J6GA 3WW4A 1J3PA 2RE9A 2Y6KA 3D0JA 1AX0A 2WZR2 3HEIA 3ZXEA 3RVHA 1H8TC 1UPIA 5LBBA 4NRQA 4L0PA 2R071 3I2HA 1Y7BA 4AQSA 1NLSA 3W20A 4OI4A 1K5MB 1AR62 2XLAA 5I0RA 3R05A 2J1RA 2ADDA 1RHI3 1Y9QA 2HWB3 1WWYA 2JG8A 2QDNA 2W39A 1JYTA 1GQPA 1QQP3 1UY3A 4QXHA 3WCSA 3J7HA 4D6RA 2VZUA 2OZ6A 4AWDA 2GH8A 1RMU1 2VY0A 2FDKA 2PHRA 2P3JA 2YU2A 2XUEA 5LCWL 5C4WB 4GWMA 2FMYA 1HKDA 4YM2A 2GC0A 3RZMA 2AR6A 3IB3A 5IUQA 4LKDA 5KXDA 3J8F2 3GZUC 2RR13 5GLTA 3T09A 1FXZA 3K75B 1W8UA 2D6OX 4KNCA 3T4HB 2CAVA 1S0FA 4FFGA 3EO6A 3S7EA 3ZSLA 1Z7S3 4P02B 3RGBA 2JWPA 5LW9A 2C9KA 1V9U2 2XJSA 3VDDC 4CCEA 2KD7A 5FZ4A 3DYOA 1SLTA 5C3PA 2XBO2 4ZXKA 4QDRA 1B35B 4UAPA 1W39A 4IGQA 2JICA 3G6JB 2GNDA 1UYPA 1RUI3 2IVJA 3GDBA 5C5TA 2GNTA 5FWEA 3RWNA 5EJ1B 5JLVA 5F32A 2WFPA 5DAPA 1FMD3 2RS13 4E9KA 1SDDB 4A45A 1XNDA 5G04L 2D44A 2HBUA 2ZBJA 4JKMA 3I2JA 3GYDA 2A73B 1YQ6A 3UESA 5FOJB 3MFAA 2D40A 5L19A 2JKBA 3LA3A 1E5HA 5HV4A 4AW7A 5HI0A 4GIQA 1D4M1 2BZDA 1VAMA 2HWE1 2HWC2 4MGZE 1XE7A 4LMFA 1WW4A 4W8JA 5FYHA 3H8UA 1QJX3 1WMXA 2V09A 1CZTA 2EF6A 4HOOA 3T1LA 3BU0A 1DYKA 2AUYA 1LOFA 4CCKA 3BTZA 5A1FA 1GP5A 4QX8A 1RIRA 4GMP1 4LA2A 1AR81 2JE9A 4TN7A 2WA3A 3ZPYA 4B29A 1PNGA 4XJ8A 1U12A 1RVF1 2O1QA 4AL9A 1B35C 5IT6A 1N47A 3ZXJA 4DRRA 4TZDA 1NOVA 4WM7B 2YFUA 4XAAA 1GV9A 4B1MA 2F4LA 2YFZA 3VD5A 3USUB 5IHRA 1AR93 3S0MA 4P9WA 3VBUA 3ILRA 2Q8EA 2GZWA 3IPVB 1AX2A 3WDVA 4MADA 4EJRA 4ZKTB 4R4ZA 1JXNA 2WT0A 4P9LA 1PVC1 4PLOA 1UL9A 2Y26A 3FL7A 4HFSA 4HSLA 2XR4A 3ZXAC 4BPZA 3B93A 2TBVA 5BY5A 3K4DA 5DG1A 4UFLA 1LR5A 2WZR1 3V0AA 1FAYA 1AXZA 1LKNA 2Z2SB 3M3QA 4LULA 2QQNA 3DGTA 4HG6B 2Q8CA 1IQAA 3OY8A 3I3MA 3OB8A 5CISA 1AR61 1H2NA 3CEWA 3E6BA 5FY0A 4FPHA 3V0BB 3JCIA 2VCMA 5FZHA 4PHZA 2R073 1S0EA 3VBOB 3EQEA 4LBQD 2RDQA 2C5DA 1JUHA 1APNA 1C5HA 1XU2A 1HV1A 1NAEA 3IKWA 5FP8A 5IAVA 2LRPA 4B7KA 4CE8A 1LB2A 3WEZA 1G86A 4IL7A 3DXTA 3PUIA 3R0RA 1QXJA 3J8F1 2QZ3A 3WLUA 2CTVA 1QH6A 2I74A 3H7YA 3I3QA 2HWD2 4KBBA 5C6CA 4YG0A 3IIIA 5IWFA 1VB4A 3M3IA 4YVSC 2RDSA 1PM4A 2OQ7A 4LO8A 4AI2A 2DCKA 5JSRA 4COVA 5IVYA 4N9IA 3ES1A 3P6BA 2XOMA 1H2MA 3DCQA 1ENRA 1QDOA 1V9U1 3PJYA 4XURA 1V6KA 2A5ZA 3GF6A 3OGSA 2XBO1 4X6QB 3AKSA 1GZWB 1AXYA 3ZDVA 2W9XA 3U0ZA 2Z4FA 5FK7A 5CAZA 1AVBA 4RA0A 3OYWA 2JD9A 1CJDA 4BOWA 3RDIA 5DUUA 3RQ0A 2GC1A 4COYA 2PHXA 3AM2A 2VUJA 5FBJA 3T3YA 1PIV2 4AFDA 5C70A 4HN1A 1S4CA 2XH6A 4KG8A 4FAGA 3M7AA 2PQSA 4EROA 1S0IA 3PTYA 4SBVA 1HN0A 1NG0A 4K6BA 3V56A 1HDKA 1CAXA 3VBOC 2VNVA 5EV7A 1OT5A 5A6ZA 2Y60A 3A7QA 3LOBA 3VL8A 2HWC1 5FZ9A 3VD4A 4Q4W3 1SCRA 1BCXA 3IAQA 4GH4B 3I49A 1D4M3 4I0BA 3U4XA 1BK0A 2FQPA 1BEV2 2WZEA 5FTTC 3ZN4A 3UKTA 1UWWA 2CAUA 2NMOA 3FUQA 2YPJA 4OHWA 3I2IA 3NNMA 4JDNA 1FPN2 2P34A 5EYYA 4F83A 5JAXA 3X29B 3NAPC 1KQRA 4GMP3 4Y33A 1AR83 1UAIA 3I54A 1ND2B 2YYOA 5GJ6A 3ZYHA 5JI7A 5LBFA 1S0BA 1Q8QA 1RVF3 3LIGA 3GZAA 4LEJA 1ZZCA 1XQNA 2X09A 1W6PA 3AMHA 2ZEYA 5ANNA 1GUIA 5BNQA 3HAGA 5FWJA 2ZEZA 5D2AA 4CDQC 4QU2A 3AP4A 4OHYA 5JIUA 2ZABA 2FCUA 3FE5A 2A71A 1TQ5A 3JB8A 2ZPXA 5LWBA 1PMHX 3AVSA 3M4FA 5DN2A 4QB2A 2J42A 2CGNA 3PUHA 5CYYA 2BERA 4CU9A 3PUSA 2QTWB 3U07A 4NHKA 3H7JA 4X8PA 2RG4A 3VKMA 1MS9A 5A1LA 1X8MA 1OMIA 2X5IC 4ONUA 1OA4A 1EYBA 2WZR3 3VHRA 3HWJA 4A42A 4KGQA 1ULGA 4CPBA 1X9PA 3AXEA 1K12A 1BBT2 1O4ZA 1SPPA 1CJPA 1AR63 3C7HA 3MIDA 1H8VA 4BQ5A 1WA4A 2ORZA 1CAVB 3PU3A 1ALYA 3NV2A 4YARA 1FNZA 4CYDA 4E2GA 2OQ6A 1C8M1 1LOAA 1VAVA 3ZXDA 5JWPA 4Q0QA 1QWRA 3LQCA 2FDFA 3OD0A 3Q8CA 3JD72 1Q8VA 1YFXA 5GZFA 1YIPA 3ZIWA 2P2KA 4C0BA 1J83A 3D5OA 1HQLA 5A32A 3WT3A 2JENA 4XBLA 1AJKA 4OHXA 5A3OA 4D94A 2VCAA 1RINA 5LA9A 1GP6A 4QDSA 3UL2A 1V9U3 1QHDA 4OQ9A 1NKGA 1N1SA 5CA6A 3LIHA 5CBLA 5J7MA 2OKXA 2XBO3 5EJZB 3ZN5A 4H14A 2IXKA 3PVBB 4QHZA 5FP3A 2YDEA 1PIV1 2I07B 1S0JA 4QQHA 4D7SA 4CU8A 1PGL2 1DGLA 4KH9A 5FFOC 1PGW2 3SH3A 5IK8A 4XF1A 1D2QA 4L2NA 2KR2A 1OUSA 1DBNA 4COZA 4XFIA 4Y5SA 1RUOA 4CSWA 4BM8A 4QGLA 1FNYA 1OLRA 1RUG3 3I2GA 1V70A 1IPKA 2O8OA 3POYA 2VMFA 4QB6A 2O0OA 1T2XA 3KS7A 5L9BA 2PAMA 1E57A 1ZX5A 1XC6A 3PIJA 4IETA 1WLTA 1H8TA 2ZKNA 3LA2A 4IV3B 2J1TA 3MLJA 4QX0A 2A6XA 5ERLA 2HWC3 4KU7A 1OQ1A 4ASLA 1BEV1 2YGLA 2WL1A 2KM2A 3JXSA 4OI1A 5FZOA 4DINB 2BGPA 3VLBB 4XQWA 3DKWA 3WCRA 4AI0A 1L7QA 2V5YA 3RYRA 1ZRFA 5I0SA 1FPN1 3NW4A 3VD3A 4UBGA 3ZR6A 2XUMA 4FXKB 3BODA 3L2HA 1QEXA 2I45A 4IEZA 5FMBA 3SNMA 3ZX7A 4CCNA 4Y5TA 2QZ2A 3ZM8A 2DTYA 3VDCA 5BV6A 1NLQA 4Z92B 2YC4A 5FDBA 2GP3A 4H55A 4Q4X2 4W65A 3ENRA 3T1MA 2JDHA 4XIOA 3CMGA 1GU3A 4PBPA 3H9AA 3H1MA 3WF3A 1LOGA 2EVXA 2VULA 3UGFA 2XJPA 4I2OA 5I0UA 1YO8A 1GQHA 2VZPA 3JQWA 3C3VA 4JV4A 3NNLA 1FOD2 2NMNA 3OUIA 1T6BX 3B5LB 2BNNA 2QVSB 3FFZA 5LA2A 1DIWA 2UU8A 1TEIA 5FZ8A 2ZGSA 1XYNA 2JIJA 1HJGA 4ES8A 3BIWE 4NROA 2IUWA 4IV3C 5L7OB 2ZA9A 1LECA 5GZCA 2Y64A 4PLNA 3I2DA 2WNVC 1NCRB 5JCTA 2QQLA 2VZ3A 3N9QA 1A8MA 4P9JA 5BPXA 5T5LA 1PZ9A 4PF5A 4HSJA 4E27A 5KC5A 1BBT1 2IFWA 4GKYA 4ASMB 2JDAA 3O1RA 4R52A 2R1BA 5CB7A 2CGPA 3GHMA 2ZMKA 1WLCA 4IGPA 1MS0A 1MQTB 4TSVA 1ULFA 4I3PA 5C8CC 3PMEA 5C4WA 1COV2 4C1XA 3ABZA 4PDWB 3MF6A 5AVAA 2IXJA 2UWBA 4LO4B 3NVCA 4UT5A 1M06G 1R092 1VLNA 5LK5A 1RITA 3PJQA 3HNMA 4XJAA 3T2QA 1NUKA 1ZZ6A 3H50A 3JD71 2JDMA 4LKFA 1UY1A 4R8HA 1C8M3 2DWRA 3CBNA 5BNOB 1JYVA 4NHMA 4BHPA 2FDGA 1OF4A 2P37A 4XUNA 2WINB 1CD3G 3TN92 3HR9A 4BDVB 5DZGA 1B35A 1YI7A 2PELA 4YFWA 3WZ1A 3ZXLA 2PFWA 3ZMNA 2J1SA 1OI6A 4P9XA 2D5HA 3IDBB 1NZIA 4WM8C 5IVJA 1R64A 1PGL1 4QX5A 5L7OC 3ACGA 5B2GB 1SLLA 1PGW1 2A7AA 3VBUB 1ODNA 4F7ZA 2ZMNA 1NCRC 1OBNA 1KDKA 4AEMA 1CGPA 1X82A 5IK5A 2W46A 1ZZ9A 1NT0A 1PIV3 5I8TA 4NIIA 4ORFA 1KGYA 2B9UA 1CPMA 2JG9B 1I3HA 2OPWA 2PA7A 4ZS3A 3RRDA 1GNHA 1MQTC 4OHVA 1IGOA 2ET1A 1H9PA 2VR4A 3WG1A 4KU8A 1RHI2 2WO3A 5A7OA 4MGIE 4BQYA 3AP7A 2R043 3CLPA 3OY8B 4N7UA 4NPMA 3OUHA 4QM9A 3TBDA 2IXLA 3ZR5A 5A3MA 4PF1A 1WD4A 1JOBA 4M0NA 3J4UH 1UYZA 1BEV3 5FMOS 2E31A 1CR7A 2H6CA 3HN1A 1CONA 5DG2A 3FJSA 5EHDA 5JSPA 4XACA 2G19A 4DRVA 4AVTA 3POWA 4DY3A 1FPN3 5F39A 4BU2A 2PTMA 4Q4X1 4WM7A 3LFIA 1UXXX 1JYXA 3S5QA 2MEV2 3USUA 3ZPOA 1N3PA 1UX6A 3B7MA 4CCMA 3IPVA 4MHUA 2PHDA 5C3OA 5JIAA 2VJXA 3NWKA 1VALA 4HMZA 3EXUA 2PHFA 1F9KA 1FOD1 5AC92 5LBCA 4FTBA 4CCOA 4META 3FBYA 4AVBA 2ENRA 3OPZA 3BU7A 1FMD2 3B94A 1X50A 3NV3A 5A7NA 2WQ8A 4IUGA 4OMDA 1G9DA 2ZGOA 3TB0A 4E4HA 3ZXFA 3CZJA 3UKVA 5FPZA 4GA9A 4OULA 3V0BA 4GALA 2WT2A 3K48A 2WRAA 5FYIA 2VQUA 3VBOA 3VKLA 4BMEA 4P9YA 4FPFA 1NQJA 1QKQA 1WZXA 3ZMOA 1BBT3 1COV1 3SITA 2UY8A 4JCKA 1SACA 4R9AA 3ETPA 5T3NA 4DS0A 1K5JA 1VMFA 1R091 2WN3A 2Y38A 4HLTA 4YYOA 1DYOA 5I93A 5FUIA 4IEOA 4EN0A 4Y20B 4UW3A 4Q2FA 3H1WA 4FPGA 1AXKA 4K3UA 4P00B 5LK7B 4LE3A 1ZM1A 4K20A 2HWF2 4IGOA 2BVVA 2WUHA 4BIOA 2VZSA 3TN91 3JD73 2AEZA 3NAPA 1UKRA 1C4RA 1YQ5A 2V5DA 4OI0A 1UKGA 5H9SA 1GZWA 5T5JA 3RMYA 4CA9A 2WQ4A 1TG7A 1PHMA 4LOTA 3AKPA 4LKSA 4A6SA 1V6JA 5FP7A 1ASJ2 2AYHA 1IHMA 2W92A 4PQ9A 4HVRA 2Y6JA 1PO23 1JOPA 2VZVA 1DLLA 5DAQA 3T2PA 1YFWA 4CEYB 2A3YA 3AXDA 1JYNA 1N3OA 3NQHA 3MHZA 2Q8OA 3I3EA 3KZ4C 1S55A 2JECA 2BW8A 3AMNA 1C8NA 3TAYA 4YPJA 4TTGA 4RFRB 4GH4A 4XJUA 3KV5A 1W6OB 4JRLA 3P3PA 1RHI1 3AKTA 2F6BA 4XHXA 1OLMA 2ZX0A 3ACLA 5FJHA 5C8WA 3KT4A 2ZJCA 1VMHA 2WNUB 1M4WA 3KVAA 4QGMA 1VBB2 1XU1A 2JE8A 4YW6A 1WUVA 4UW4A 2YB7A 3EMRA 3R4UA 1GLHA 4QPIB 4Z2AA 1OURA 4QKBA 2W47A 4TLFA 5CKMA 4DXZA 5A70A 2ES3A 5K7PA 3K3NA 2OPKA 3VKFC 1OD3A 2YMZA 1PMIA 2PAKA 4XDOA 3MV01 1JHNA 2WNEA 2MEV1 2WLPA 2J1AA 4GD4A 4Q4X3 4NR1A 4XBNA 1CIYA 4PLMA 4RGGA 5A6XA 4EQVA 5HCFA 4XCBA 4FFIA 4FSJA 1ZNPA 2VQAA 1JBCA 5AC91 3THPA 3DPRC 1W8NA 2HKXA 2A3WA 2BNMA 5FZ6A 3AC0A 5FO8B 3WG2A 2W1UA 3I97A 1UCXA 1FMD1 5FZKA 4B8EA 5D8AB 3AMMA 1FOD3 3GJBA 5F7UA 3LDKA 2OYZA 3ZO0B 5A3LA 4I3GA 3OPWA 1ND3B 4QM8A 5H9RA 2AGSA 4FO9A 1QJFA 2IFRA 5APAA 1NQDA 1IKPA 2K2SA 5FJKA 4EWDA 4A44A 5C3SA 4QAWA 4M00A 2WNUC 1ULPA 3IMMA 4OZXA 4JHZA 4Q4W2 1GZTA 4D6SA 1UQXA 4FFHA 2KXLA 2DUOA 4MX3A 3KCYA 4A7KA 3GJAA 4QPIC 3FFQA 5DDJ2 4LO6B 2BGCA 2VMIA 5E88A 2RS32 1UMHA 1DGRA 3GCWA 3N9PA 1UXZA 4LT5A 3MIEA 3CJIC 4CCCA 1COV3 5LB6A 2PYTA 3T2OA 4C91A 1Q56A 3WINE 3S7IA 4W6WA 2A75A 4CP2A 1BJQA 5FXVA 1WMEA 4CVUA 5IK7A 4GJZA 1OXCA 2HWF1 1BYHA 2UURA 2WABA 4WV8A 4Y1VA 4BIFA 2PHTA 3KCCA 4AK3A 3KM5A 1HLCA 4YRDA 4YW7A 2WZ8A 1JU4A 2JX9A 3WNNA 1OSGA 3TN93 2YUEA 4JZRA 1QY4A 4HK9A 3IN9A 2WS93 3WD5A 2X8KA 1ASJ1 3E5XA 1TME2 3QCWA 4JHTA 4EN8B 1QOTA 3HBKA 3ZN6A 1QNYA 3NMBA 2VC9A 4FCAA 4YVWC 1EPWA 1ULOA 5FZBA 3VDDB 2GSYA 5FKCA 1VRH2 2VBDA 2WDBA 5K0UC 3ZKYA 2A6ZA 4IESA 3MI8A 1RB8G 3ZSMA 1LULA 3CHXA 5F9TA 4O65A 1CQ9A 5A7QA 1OLQA 4QPWA 4IV3A 4JRAA 3ROUA 1PZ7A 3DECA 1ZVFA 2WNVA 2A3XA 1A34A 4V1PA 2X10A 3O1PA 4S2HA 4DPNA 1WA6X 2WQZC 4AFCA 1VBB1 1US3A 1GFF2 2WBKA 3MW4A 1Q8SA 3ELNA 2VXRA 3OUJA 5E6HA 1DF0A 1CZVA 1JMUB 1OFSA 4YZ4A 5CIRA 5DAVA 3D4KA 2VM9A 5C8CA 4OUMA 2NZ9A 2C24A 2DVAA 5IJRA 1JODA 3MUZ1 1EUTA 5FMOL 2WWUA 4RS5B 1C1LA 4N8MA 2Q30A 5JPNB 2ZHLA 1UOJA 1Y9GA 1ZZBA 2XXZA 3VKOA 4ZU7A 5JXGA 2DU1A 5FZMA 2J7MA 3J26N 4YG6A 3GZTB 4MZUA 1W8OA 3RJ2X 4DUWA 1IQDC 2MEV3 2RMU2 3TWIA 3N7MA 4K9SA 1IS3A 2XL7A 4EYUA 4YW5A 5ACA2 5L9VA 1J59A 4RR3B 1MZ5A 1MVEA 5F37A 1NYWA 1Q43A 5AC93 3NJZA 5FZCA 3AMPA 4CUBA 5A3NA 2NYYA 1O8PA 2Y0OA 3G7DA 2GNBA 3M1HA 1RUG2 5BXXA 4M0HA 5A6YA 3CU7A 3O14A 5L7OA 3UNPA 1NCRA 1RUF2 2XVLA 1UOFA 3ZIXA 4QB1A 1G9FA 5D1IA 1DGWA 4Q4W1 2CHHA 1A6CA 2YHJA 2W94A 3Q8FA 4BH9A 5A7SA 3OEAA 5DAXA 1KS5A 5FY9A 5T55A 1VR3A 5T52A 2D5FA 1XNCA 1MQTA 1NA1C 5DDJ1 1H0BA 2LTNA 4AFAA 4K7JA 5FYZA 1W8FA 2NM1A 2RS31 4PDWA 1IG0A 5EWSA 3SCFA 2YC0A 3AJYA 2VOTA 3WW2A 4HBNA 2VUAA 2ZX2A 1HB1A 4RS5C 4C8DA 1OH3A 3VHPA 4DMIA 2EXHA 5C3RA 5JXIA 4XFCA 2DUPA 4AVAA 4A41A 2OW4A 5A7WA 1FATA 3I4IA 5FQ0A 3DXUA 5CFDB 3MLKA 5KXCA 3O1OA 2Y6LA 3VBRC 1O5LA 1CESA 2P17A 5BNOA 1ZA4A 3KB5A 4JKKA 4MGQA 3OOXA 2DFCA 4JC1A 1W9YA 4XJ9A 3SLIA 5FZLA 3NNJA 2WO1A 4GQ7A 4YGDA 4LA3A 2HWF3 2ZCWA 2EIEA 4RR3C 1OQEA 4QQOA 5JSOA 3C7EA 1DFQA 3Q8AA 3H3UA 5FPXA 4XF3A 3WF2A 1NLRA 4IE4A 2VMCA 1GWLA 1FV2A 1TME1 1W3VA 1YI9A 2JDYA 3AP5A 3J7LA 3N7JA 3MV11 2VZQA 4XFBA 1UD1A 1SG3A 4Q4Y2 1HXS2 1SFPA 3V0AB 5KHIA 3O12A 1W0PA 1ASJ3 2JG9A 4ISQA 4W6XA 2Z69A 1VRH1 1F15A 3LFMA 5DUWA 4UOJA 1YLLA 5A3WA 2AENA 2VG9A 3SKVA 4CDUC 4CZSA 3DF0A 1UU4A 3AP9A 4UFMA 1ZRCA 1N1TA 4XE9A 2NPIA 1HX6A 4XFFA 3FHAA 3KV4A 1VBA2 4MLOA 4P9GA 3WW3A 1X7NA 4COWA 5CFDC 5JPMB 3U37A 5BYNA 2R32A 2C4XA 4TLGA 3OD4A 3W58A 1VBB3 5FKBA 4I30A 2DCTA 1D0HA 5I8SA 1CX1A 1DZQA 4L11A 4LO7A 5I91A 5FBZA 2O14A 5A1AA 4QKFA 2W68A 5DXDA 5CFCC 2FCVA 1XXNA 1UY2A 2DTWA 1C8M2 1YIFA 4A4AA 1UZWA 3NV1A 2D3RA 3AJZA 1CN1A 5KC6A 1RUH2 4E8DA 3GBGA 4NIGA 2HBTA 1EV12 3BN6A 2RMU1 1DU3D 4IW3A 4P9IA 3WDYA 2OUHA 4WBBA 3ZSJA 3VKNA 3E97A 3LDBA 1W99A 3UV9A 3K3OA 1AYM2 3NAPB 3VGIA 5LEJA 3JZVA 3O1VA 2P6HA 5J37A 5ACA1 5FO9B 1AUYA 2E26A 2BPA2 4QQ2A 3WVJA 4NIHA 5F5AA 3S57A 1NCQC 1OA3A 3MPPG 4L9BA 4JGZB 3V64A 2GMPA 1RUG1 2XLFA 2DCJA 4AHWA 1BVVA 1DZTA 2MPFA 4AI9A 2J1EA 1UZVA 3OJBA 1RUF1 5T50A 2R49A 4OI2A 4DO0A 1W90A 4CDQB 3ZSEA 4CUCA 1UF2C 4C0HA 4XAEA 2VBPA 5HCBA 1W2AX 1XNKA 2BNOA 2XJTA 2ZZJA 4Q0SA 1TMF3 4KL1A 4WVMA 4MH0E 1JS9A 5KHKA 4WVZA 2R042 4H3WA 4R9BA 3J7MA 3KSCA 4GB32 2EXIA 2ZAHA 1OPOA 4D7YA 3M3CA 5DDJ3 1HB3A 2X5IB 4FPLA 1JTZX 4BK4A 2Q1MA 2RS33 1URXA 1QOOA 2E7AA 5FYUA 2WO7A 4MVTA 2LALA 3C8XA 5FYSA 3ZYPA 3GGLA 2D93A 5HBAA 4AI1A 4CPBD 4Y20A 3OGGA 5E89A 5EJ3A 4E4DX 3W21A 3ZDSA 2DVGA 4AQ6A 2G9FA 1QF3A 1RUJ2 4BXFA 1GANA 1OHFA 4CU6A 2ZGQA 2B5HA 2FDHA 1GZ9A 3KVBA 4IEQA 5IATA 2C6SA 1G8WA 4PI2A 2H0BA 1TZOA 2B9VA 1PX3A 1AJOA 2DUQA 1XSQA 4NO4A 1BMV2 3KD4A 2AACA 4JGZC 4CP0A 5FZEA 1LHWA 4LBJA 2FBEA 4HONA 5FYYA 2QFEA 2W87A 2G9GA 4J1WA 4B4RA 4AEDC 4Q4Y1 1HXS1 2P3KA 3GBWA 3WG4A 4CEYA 4KG0A 2YU1A 4PIZA 4XVHA 1TME3 5T5PA 4Q5OA 3HBZA 1WCKA 4BB3A 1GWMA 1L7RA 1W8ZA 2VBBA 4Q4V2 2VOWA 4KBZA 1OLME 2HEYF 1SMVA 4NPLA 1W6OA 1NY72 1TE1B 1VRH3 1YJKA 2ZEXA 4N43C 4FXGB 1VBD2 2VXJA 3B02A 1UPSA 4FQ4A 4IQPA 1PX4A 5J36A 5EFUA 3WNOA 5F3CA 2WNUA 3CIHA 1VBA1 2ZTNA 3PLQA 4Y4YA 4V2VA 4BA6A 3UGHA 1JZ2A 3WNKA 4D6QA 1DQ5A 5J3UA 3EHKA 1REDA 4MHRA 4YGBA 4QPIA 2Q1ZB 5DZEA 4C90A 1RJ8A 4M3CB 4MGYE 3UJOA 1DQ6A 3A0KA 1K42A 1KITA 1MZFA 2P4EA 2PHWA 2W0XA 3KT7A 1RUD2 1YFUA 4BLJA 1X8EA 2A6WA 1BZWA 2YG0A 1I5ZA 5FZ0A 2EXKA 1UIJA 2VPVA 4HN0A 1YNAA 5A7PA 2E6VA 4LBNA 1ZRIA 3ZFEC 1RUH1 2JDPA 1O3SA 5DUVA 2I2SA 2PLV2 1LOBA 1EV11 2VE1A 1G9AA 4FFFA 4PJYA 5FYMA 5KXBA 5BNNB 4WZFA 1AYM1 2IWGB 4INDA 4A3XA 4LTAA 2J1VA 2RMU3 5D8AA 1OFNA 4NIAA 4XQ4A 3S30A 1DYPA 2BEOA 2D98A 1PO22 1ND3A 3NKGA 3SH5A 2DVBA 4DFSA 1EP0A 5ACA3 5FZAA 3GALA 2VW0A 1WCUA 1HB4A 3OBTA 3ZN6B 3MGUA 5HCAA 1XE8A 2ZAAA 3AYEA 4UYBA 5ANQA 4YVWA 4GWNA 2MNGA 3IAPA 1SLCA 4N7IA 3WSOA 2G1MA 3IBMA 4JTOA 1RUF3 3LSDA 2R041 1FYUA 3D3AA 3GHNA 3MIGA 1W9TA 1KJLA 1A3KA 3P3NA 4LBKA 4COUA 4UFKA 1V0AA 2UWAA 4GB31 4CUAA 1HRV2 1LOEA 3RYPA 4F8AA 1ZREA 3T2TA 1Q8PA 4FPKA 2WNVB 3T0BA 2UWCA 2Z5WA 1JZ6A 4AGGA 5FK8A 1E5SA 3AP6A 2WWJA 3UK9A 4NOTA 1CZSA 4OHZA 2VQTA 4LKEA 5AFEA 1SCSA 4Y1XA 1W28A 3CF6E 3IMNA 2YZ4A 1CIWA 2QQKA 1POQA 1RUJ1 1QJU2 5FRAA 4AQTA 3OSDA 5C8CB 1J3QA 5BNNC 3LEGA 4W4ZA 5JR7B 1IKQA 2E32A 1U5YA 3BCWA 4CTEA 3T30A 2D6NA 1IPSA 1F2NA 1QJY2 5FZIA 5HXMA 2DCYA 1BMV1 3HOBA 4I01A 2CSGA 1PGSA 1XOYA 3ASIA 1OKOA 4Q0UA 3WV6A 2VGDA 3VZNA 4JVAA 4V2WA 1HW5A 2VUDA 4URAA 3T0DA 3F2ZA 3NNGA 2VECA 3VDDA 3RI9A 3E6DA 3D6EA 2FDIA 1REEA 4Q4V1 1HXS3 4Q4Y3 2EA7A 5JUVA 2DFBA 3BKZA 2BU9A 1L7LA 1NY71 4WM8B 3N7LA 5T54A 3UJQA 4CDWC 1VBD1 3IDEA 1YYNA 3QOPA 4UWDA 4YW2A 3VZLA 4A2UA 1UYXA 4E4ZA 4E8CA 3BTAA 5L36A 2WSUA 4HETA 5F6KA 1Y43B 4CDXC 4XBQA 2DBIA 1OUXA 1IOAA 4HPKB 4D3WA 1MR5A 1W9SA 2BYVE 2XQXA 4LBLA 3SISA 4MOAA 1F35A 1T6GC 4B3NA 4QT6A 4YWAA 1VBA3 1NA1A 4LE4A 5IVEA 2GC3A 3NSTA 1RUD1 1GKBA 3C7OA 1AHSA 1YEWA 5EZWA 3VZJA 5I0DA 2XJRA 4TWTA 1W2UA 4RS5A 3RWKX 2A6VA 4NAOA 4NMIA 5CVRA 3ZFFB 3WQ0A 1H6XA 1QIQA 4ITCA 3AVRA 5A7WB 4EWEA 2VUCA 1J58A 2PLV1 4NN0A 5FQ0B 1NX9A 1V6IA 3FLPA 4J25A 1O4TA 3VBRA 3WNLA 2FHRA 1UY4A 3LGRA 3HQRA 5GZEA 2JG8C 4DOUA 2ARCA 4A7YA 1RUH3 2YBSA 5IAXA 2RJLA 2WS92 1EV13 2XG3A 5TSWA 2WZPP 1AR72 4RR3A 3ACHA 5GLVA 3RPQA 3CQOA 1KEXA 4UFIA 1PO21 1AYM3 3PVOA 4AVSA 3BTXA 3VZMA 2GP5A 2VTXA 2QJVA 4AEKA 4YZ1A 3OBRA 2IVIB 4YZ3A 2CY6A 5DABA 3KHCA 2BFUS 3DL3A 4U36A 3FHQA 2TUNA 3UKNA 4QGNA 4BJ0A 4ES9A 3P5BA 1QXRA 3O1MA 4EZ4A 5JOZA 1F4HA 2Y0IA 5CADA 1O3RA 1ENSA 1RC6A 2BGOA 5LZ6A 4LITA 4LUKA 4RQPB 3AZXA 3B69A 4H7MA 3LKJA 5BNPB 3N9NA 4RHV2 4XDQA 2C26A 3M70A 1DLCA 1HRV1 3FWEA 4CCLA 4O61A 5IFPA 2YBKA 3MYXA 4NUBA 1QNWA 4XTMA 1ULCA 2ZHNA 4NHLA 2D6PA 2EIDA 2GALA 2FMDA 3ZFFC 1C3HA 4GB33 2VTFA 1C5IA 2X53S 5FOBB 5CFDA 5A3PA 3S5AA 4CXXA 2VZTA 5FCCA 3GM8A 4CP9B 1QMJA 1QJU1 3E5UA 3WUDA 5IVBA 3LEKA 4WZCA 2XLGA 1WGPA 2IXCA 4LQRA 2IC1A 4XJWA 4XOGA 1G9CA 2DVDA 3C7GA 1LGBA 1A8DA 1QJY1 2BOIA 5CFCA 1RUJ3 1OH4A 1W6MB 1O59A 3FBMA 3I3BA 1Y9MA 1FT9A 2ZGPA 4NRPA 4W6YA 3T4VA 5A33A 4B1LA 4BQXA 4BWOA 2WJSA 2YV8A 4ARYA 4IE5A 4F3JA 1WD3A 4YVSA 5JI9A 2ZGNA 2KA3A 3A23A 5IFTA 1LOFC 4ATFA 3PHMA 1IG3A 1HQWA 3ZFGC 4JDOA 4UF0B 1W9FA 3OEBA 1YC61 2VMGA 2L9LA 3UYJA 2X05A 1UU5A 4RQPC 3NRUA 5F5QA 4Y26A 5BNPC 3SCHA 4QMAA 4GAZA 4BE3A 4Q4V3 1YQ8A 4OYUA 2QKDA 3RG0A 1RJ7A 2V73A 5T5OA 5LY1A 5D21A 2A70A 4O9GA 3AK0A 5C3QA 1VBD3 4IE6A 4YVSB 2QQPA 2WR9A 4KGGA 4KMQA 2G9ZA 5FPUA 2XHKA 3U4SA 3JBG2 1OVPA 4LXLA 3GBFA 4WVMB 3SQOA 3FUOA 4IE0A 2ETEA 5A80A 3ME2A 3ZYJB 2ZS6B 1J84A 4AVVA 5F8PA 3T0AA 2E63A 4Y24A 3O0VA 2XVGA 3BUCA 4NVPA 3OG2A 4JGYB 1H1AA 1XBFA 2CWSA 1RUD3 3IDCB 4QDQA 4QD2A 2OT7A 4XZPA 4S2FA 2W2IA 3VN4A 2BJSA 1WW6A 4GULA 4AHZA 1OKQA 3NKTA 4FTSA 4RFT0 4BQ1A 3SEEA 4OUEA 2LW8A 2P3YA 4LBQB 3ZOIA 2R062 2WA4A 1H4GA 2PLV3 4FP3A 2WS91 4KI5M 3WNMA 1O4YA 4FOQA 3ZSKA 1AR71 1OC1A 2WN2A 5DZFA 2Y6GA 5C5UA 1PZ8A 4EN6B 1XNAA 1F31A 3AZYA 3F95A 4PCRA 4B4QA 1JZ5A 4LBMA 4JGZA 5JZGC 3LAGA 4YNIA 2RDRA 4KQ7A 3BALA 1Q8OA 1TNRA 1YXWA 1AL0G 4QPGC 4XIKA 4CDQA 2ZKLA 3VBHC 1LHUA 1MS1A 4CRQA 4Q8KA 5FPVA 2D6KA 2EICA 3DPRB 4URTA 3ZYRA 3ITQA 4HK8A 2QQVA 4DUXA 5C71A 4N90A 2W3JA 5FR3A 1RUC2 1GNZA 4JQTA 4A7ZA 5JXHA 4JDMA 2D7FA 2VNGA 4LHSA 3MICA 4RHV1 3LPGA 3WF0A 1O3QA 5FXWA 1OF3A 1EUUA 3CL1A 3AL5A 4TYSA 1JI6A 2X5IA 4NWWA 3UT0A 4JGYC 1HRV3 3AKRA 4GZ9A 4S2DA 3RZHA 5CKNA 1W03A 2VMDA 2FCTA 5IVCA 2PHLA 4QU1A 3VDAA 2DURA 2JJ6A 2ZHKA 1VPHA 1LENA 1WCDJ 2B8MA 2BQPA 4QKNA 4XABA 1VBC2 4U2AA 3WDXA 4CEWC 5EIYB 3RFRA 1QJU3 3WG3A 4L99A 1JU3A 1Q5OA 1VMJA 2IXIA 3CJIB 1XE0A 5FY7A 4YGEA 2PMWB 4IEPA 5GALA 5KHGA 1QJY3 1CAWA 1MS8A 2WSVA 3KWVA 4ASKA 2R16A 2YC2A 2AC1A 4XFHA 4N53B 4BISA 1F8VA 1RL3A 4K1YA 5C7GA 1G7YA 5ABJB 3O0XA 4KWLA 3HVDA 5F3EA 3ST7A 3BYWA 3O0WA 3I2FA 2XJUA 3MF9A 3RI8A 3SKJE 3BB6A 2ZGKA 2JB8A 1WBFA 3IIAA 1N1YA 1TVGA 2GMEA 5IVVA 1VAKA 3NJVA 3R4DB 2BVBA 1OOPC 1TMF2 4IXLA 4ZU4A 4EE2A 1VJ2A 2V4AA 4AYUA 2PN5A 4YVWB 3VD7A 3GZEA 5JR2A 5KR7A 3LE0A 3OBZA 4XTPA 2ZGTA 3P1IA 1Q3EA 1V6LA 2V4VA 3JBG1 5FZFA 1RTVA 3TEXA 5K0UB 4MG2A 3VHOA 1S1AA 4M3CA 4Y1UA 4ISRA 1RYYA 2WAAA 1C28A 4R9DA 4Q29A 3MZHA 1F4AA 1UIKA 1UZYA 1X33A 1YQ2A 2RV9A 4HXCA 4LK6A 2D97A 1SBDA 2EAKA 2GN3A 3POIA 4OUSA 1BXHA 5GLUA 1W0NA 2UYBA 4K1ZA 2EXJA 3U14A 1W2TA 2C0ZA 4N53C 3KGZA 2ZHMA 2QDRA 5ABJC 5BNNA 3O7OA 2R061 4D7TA 2Y34A 5FZ3A 4B7EA 5C9AC 5CZKA 3IM0A 1LU2A 4M4RA 1ULEA 4LIUA 4AFBA 3L2YA 2VZ1A 4MYEA 4N9HA 1KJRA 4LUMA 1NE4A 1ONAA 1ODMA 1NXD1 3POEA 1AR73 1W6QB 2FDJA 3K77A 3KV6A 2B46X 4O7XA 5J98B 2W08A 4D8MA 3TEWA 2VAUA 5K9YA 4Q8LA 3AZWA 3AYCA 3WP3A 4XF0A 1KFUL 4E4SA 2BFUL 2LROA 3OCPA 1RUC1 4XFGA 4XJZA 4FAHA 5JXJA 3OGRA 4LHNA 1PK6C 4FP2A 1WKYA
chains in the Genus database with same CATH topology
4E2SA 4UXAA 4I0WB 4IEWA 4OFGA 4YGCA 3WDWA 4RHV3 4CDXA 2NLRA 2JD4A 3HD8B 3QD6A 3M2MA 4YM0A 1C57A 1SEFA 4PIXA 4AI3A 1NA1B 1V6NA 3ILNA 1VBC1 4LR4A 1KXGA 4Z8BA 1DQ4A 2D6LX 5KHJA 5GM0A 4YW1A 1MVQA 5C33A 1NXMA 2G4IA 3TNPB 3VBRB 3VL9A 1ZBA2 2NP0A 1S2BA 1WCSA 4Y1ZA 1XRUA 4NWVA 3WR0A 4Q26A 1BQPA 1H4HA 3URFA 4YSFA 4FPJA 2ARBA 1ZBE2 3N35A 3ZXGA 4EN9B 4WM8A 4IERA 1V6OA 5JOWA 3VBSB 1JW6A 1TMF1 1LU1A 3A0NA 1DG6A 1HV0A 2XKOA 2OUJA 4HKOA 4XW3A 4HPKA 5L73A 2DV9A 2CV6A 4M3CF 2RS52 2X29A 2JDZA 2JE7A 4BCUA 1LRHA 3KT1A 4CDUB 2IZWA 5JMCA 1O7FA 1SLBA 2ZX3A 3JBG3 4FOWA 1WLWA 4HANA 3PVEA 3MLLA 3ZFFA 4FTEA 1DGWX 3ALQA 4JAAA 1R082 1PO12 1XYOA 1JYIA 1K5MC 1ZZ7A 1IS4A 5JDBA 4G9SB 4X6RB 1WW5A 1GR3A 4DY5A 1J3RA 4Z07A 2WT1A 2EALA 3VBFB 1D2SA 2BBVA 5CFCB 1VB2A 1VP6A 1EY2A 4S2GA 2R063 5C4WC 3SMHA 5A33B 1AYN2 2BTVC 3PNAA 3VBSC 2EAAA 3B00A 2XPJA 1OD5A 2JXAA 1ENQA 3ZFGA 2R0HA 1MEC2 3WY6A 4RQPA 1NE6A 1DGRN 5BNPA 1CPNA 1NCQB 3D82A 2RJKA 3TNQA 4AXOA 2B39A 5CG9A 1RUC3 3SCGA 4DQAA 1S0DA 5J96B 4AE2A 4P14A 5AVPA 3R6SA 2FZ1A 1H30A 2QCSB 2ET7A 1POV3 1ULDA 5KBFA 1QH7A 3KCXA 3CO2A 2K0GA 4AHYA 3VBFC 3WOGA 4HVOA 1W6NB 1W6MA 1EAH2 1PNFA 1VBC3 2Z42A 4FVVA 4L8QA 4HL0A 2Q4SA 4L97A 1ZBA1 3ES4A 3MFCA 1U5XA 1DZRA 2DU0A 3SXWA 2H6BA 4YG3A 3C2UA 1RUNA 1BKZA 5EXOA 2OA2A 3MIBA 4XEZA 1ZBE1 1MS4A 1LHOA 4Y22B 3B3QE 1GZCA 1RMU3 2VVEA 4WM7C 4Z82A 5JZGA 1MS5A 4KWJA 4QPGA 1C1FA 2B45X 4XF4A 3M3EA 1LOCA 4PIYA 4XXAA 3VBHA 4AEDB 5LRSA 2ZGUA 4PBOA 3WHUA 4BZ4A 1N1VA 4BYYA 2RS51 1LGNA 4FT8A 2GMMA 3L9JT 1WMDA 2DF7A 4N43B 3LOIA 5E16A 4HKWA 4YFZA 1D0GA 2YXSA 3BPZA 4JGYA 1R081 4LLOA 5DUXA 1WBLA 3TOJA 1PO11 3WNXA 1Y3TA 2PHUA 2K9ZA 4HVQA 4FOYA 4UW6A 1I6XA 3QH7A 3DN7A 4LBQA 4XMIA 1O91A 4YZ2A 2NN8A 4DZGA 3QLQA 4CEWA 1REFA 3VV1A 1R1A2 2PQQA 3OF1A 1U5IA 1AX1A 4IV1B 2YGMA 3ZFEB 2ZOEB 2HWE3 1AYN1 3ATGA 1F5FA 1CAWB 3M3OA 1J1TA 2DVFA 3V65A 4C1WA 2VH9A 5CNAA 2RM22 3DPRA 3WHTA 2F4PA 1MEC1 2E7QA 4E2QA 3THTA 3LZZA 4LNVA 2CWMA 1V6MA 1MZ6A 4QHBA 3RJRA 3VZOA 2N7GA 5KHHA 1OOPA 1POV0 1I1EA 1SLIA 5FREA 3R4SA 3WXPA 4AEJA 4YW3A 3FX3A 3AFGA 1X36A 1LHVA 2ZACA 5F6LB 4UW5A 5F1RA 5I8YA 1YFYA 5GLWA 4FBFA 2VMHA 1W0OA 5CU1A 2ZZQA 3AYDA 1YCIA 5T3NA 1DQ1A 1PVC3 2B7YA 1EAH1 1JUIA 1WLDA 3CJIA 4GH4C 3J9SA 3IWZA 4AHXA 2VOKA 4IV1C 2ARXA 5CG8A 3LA7A 3MIFA 3GNEA 1GSLA 4HZFA 4N53A 4RL7A 3QBQA 4ATEA 4M01A 1SDWA 5ABJA 3PMSA 2GAUA 1LESA 4FOVA 2BWAA 1JYCA 3APBA 5C9AA 1KS4A 1Z78A 3S6PA 1ZBA3 4AVCA 3JQXA 4Z1VA 2R1DA 1UU6A 4G3YC 3CNAA 1A78A 1J1LA 1U5ZA 3WDTA 1RGSA 1ND2C 2ZX1A 1ZBE3 2HWD1 4LHLA 5H9QA 2Q5TA 2A6YA 2VU9A 1O3TA 4Y1YA 3I59B 2WFF2 3LB9A 1MZEA 3J8F3 4M3CE 3INAA 1UZZA 5J09A 1CX4A 1WMFA 3SH4A 4HT1T 4XFAA 1UMZA 5K0UA 5LEKA 3MIHA 3W59A 4I0AA 1LEDA 4UBHA 1PK6A 3HT1A 1LTEA 3E5QA 4AG4A 4CDWB 2RS53 5BUVA 5GZDA 1LEMA 2ZGLA 4MXWB 2AREA 3LCPA 5FLIA 4CDXB 2XKPA 3H0OA 1CAUB 1CVNA 1N3QA 1ZYBA 2BUKA 1FI2A 2VNRA 4YM3A 1R083 1KDMA 1PO13 2ERFA 3VZKA 1IS6A 1QOSA 3K51A 3U10A 4IEUA 1R1A1 2HJIA 2VW2A 3B9IA 4Q27A 4ZU5A 5LRRA 4Z2WA 1I9RA 1GQGA 1W6QA 3JU9A 1SBFA 2JG8B 4SLIA 1AYN3 2RM21 2XVKA 4GMP0 1MACA 2Q0AA 5H9PA 4YW4A 2D43A 2XJVA 3AZVA 1L3JA 2LUWA 4Q1PA 3KMHA 1MEC3 4K8FA 1AZDA 5KWRA 4J1XA 1FV3A 3N3HA 5J48A 1IPJA 2YROA 4MV2A 1NZCA 4WVWA 5K8SA 4HKLA 1QDCA 4FPOB 2CNAA 5HXVA 5JOYA 1VIWB 1BK1A 2GU9A 3NO8A 3RZZA 2XB6C 3N4MA 2C1FA 1AL22 1K5MA 1EAH3 1YRZA 1HIXA 3JB4C 4MSVA 5FLHA 5AFBA 3TYJA 3WP5A 5FAXA 3QH6A 1BVP1 4K40A 1HRI2 1VBE2 1LODA 1H2KA 1YWKA 4EV0A 4EN7B 3AMQA 4GKXA 3VBSA 4XXPA 1RUE2 5GKAC 1YUDA 4K21A 2WFF1 3QACA 4LO5B 2GNMA 2HWD3 3ZFGB 3U11A 3VUOA 2VW1A 4CDUA 2CYFA 3WDUA 5JVVA 4B4PA 2HEWF 1HQNA 2GN7A 3FC0A 3H1YA 3HIFA 3EBRA 3WP6A 4MXVA 2TNFA 2VOXA 4R9CA 2XWJB 4AI8A 4P5HA 1ZZ8A 1IZ3A 1UW8A 4AGRA 2DYCA 4XPVA 2AH2A 3E6CC 3VBFA 2ZMLA 4L92A 1ZRDA 2QE3A 2YY1A 4EWAA 1XNBA 4PDWC 4QPYA 4Y5Z0 2HWB2 5FLJA 3V0AB 1QQP2 1AF9A 1R1A3 3PVNA 3USSA 1LJ7A 4D69A 1S2KA 3A4UA 5IK4A 5BNOC 1SBEA 1H2LA 2ATFA 2RR12 2LM3A 1NCQA 2RM23 3MW2A 2ZX4A 1QU0A 2D6MA 1OA2A 3I8TA 4WVVA 3MPBA 5JZGB 4CP1A 2ZGRA 1ZRRA 1G9BA 1LHNA 4QPGB 1Z7S2 3AB0A 2TEPA 3VBHB 2WC2A 3MDPA 1R1ZA 3VBUC 1OQDA 2E9QA 4FPYA 4Q0VA 1H1IA 2OZJA 2R6QA 1RUI2 2SLIA 2JG9C 4KWKA 3HQXA 2WLQA 1SFNA 1S0CA 2BWCA 2RS12 2Z79A 1W6NA 4XYXA 4BLIA 2XWBB 4YZ5A 3ZYIB 3OYWB 3HT2A 5E1RA 4AGVA 4MUVA 3AKQA 1AL21 3ZVXA 3M8LA 2UYAA 4RD7A 2GDFA 3NL1A 1S0GA 1ENXA 1U0AA 1KD7A 1XYPA 3AX4A 3ETQA 3KQRA 5I0TA 4X8NA 2P3IA 1CAXB 5GLZA 2DCZA 3HMYA 4CEWB 1QJX2 3AZZA 3D0SA 3WX5A 4BA6A 1HRI1 2D3SA 1VBE1 4Q0PA 1TNFA 4Y22A 3VHNA 1KFXL 4QQLA 1B09A 3OTFA 3W9AA 1RUE1 4AEDA 3RYKA 5FO7B 3KGLA 2OIIA 2XL9A 3AYAA 3CJXA 4OVEA 1KRIA 4IEXA 4H7LA 1DDLA 2XJQA 1QGLA 1SLAA 2WFF3 2XGXA 3D8CA 4N43A 1AR92 3N36A 2UY9A 1OOPB 4I02A 1PM7A 3AFKA 2VVFA 2WKKA 1YJLA 2VOVA 3DUIA 1W6PB 2HEVF 2EIGA 1OPMA 1JH5A 3B01A 4FQZA 4BMBA 2WWSA 1F5JA 4G4FA 3MEPA 4YLZA 3JUUA 2IXHA 1O5UA 4Q1RA 1GICA 4R4XA 1WW7A 2QNKA 4IV1A 2HWB1 4IEVA 3ZFEA 2E51A 1QQP1 4QQPA 3KLSA 2R072 4LLFA 3ECQA 2R30A 3FMGA 1FX5A 3FLTA 2R0FA 2W52A 3RNSA 4GXLA 4XMAA 1V00A 2H0VA 1SFYA 4DNYA 5C9AB 3TRSB 1RMU2 2E7TA 2AZ5A 3DV8A 1DQ0A 2SBAA 3N7KA 3SHRA 1QJZA 2RR11 5JOXA 1YHFA 1QXPA 3RSJA 1ND2A 1LGCA 3LSEA 3FLRA 2RHPA 1Z7S1 1MS3A 3WP4A 5GZGA 4RGAA 4FPCA 2JEMA 2QUOA 2B42B 4I09A 4FPEA 5A32B 3WUCA 4CEYC 3FHIB 3BOPA 3MW3A 1RUI1 1PK6B 5KXEA 4MGKE 2VNOA 3H3ZA 3POSA 2RS11 2CL2A 1D4VB 2C9AA 1G6NA 2CGOA 4AFMA 4YM1A 1DQ2A 4XETA 4LHKA 2WIIB 2VQ0A 3ZXKA 4NPRA 1AL23 3EJKA 2ZGMA 3WW1A 2GC2A 1SQ4A 4QXKA 4XF9A 1EPZA 1QJX1 1D4M2 2D3PA 2HWE2 4IEYA 1JOJA 2VVDA 1CAVA 3WQ7A 3FZ3A 1H8TB 3LWCA 2MHFA 4XQDA 1IS5A 3Q9OA 2NQYA 4XILA 1HRI3 5SV8A 1VBE3 2O8QA 4RSUA 3I59A 5E8AA 1GBGA 1R093 1UN1A 2PAEA 1JN2P 3O5SA 5SV5A 4XHBA 1RUE3 2FZ2A 1AR82 3OGJA 1H1MA 2HYKA 4CDWA 1RVF2 1AR91 3RS6A 1PVXA 3IT8A 1DHKB 4MXWA 5D8AC 5EYXA 4AF9A 4JTNA 1LCLA 1POV1 4O9EA 3RMXA 1ND3C 4DB5A 3I7DA 1CAUA 3BOWA 4OLLA 4LBOA 4JQRA 1H9WA 1GYKA 3WQ1A 2OVUA 3ILFA 1PVC2 2E53A 3NV4A 2GH2A 4AQ2A 2ILMA 3B9CA 1Z0HA 4J6GA 3WW4A 1J3PA 2RE9A 3D0JA 1AX0A 2WZR2 3ZXEA 1H8TC 1UPIA 2R071 1Y7BA 4AQSA 1NLSA 4OI4A 1K5MB 1AR62 2XLAA 5I0RA 3R05A 2JG8A 1RHI3 1Y9QA 2HWB3 2QDNA 2W39A 1QQP3 3WCSA 4AWDA 2OZ6A 2GH8A 1RMU1 2VY0A 2PHRA 2P3JA 5C4WB 4GWMA 2FMYA 1HKDA 4YM2A 2GC0A 2AR6A 5IUQA 5KXDA 3J8F2 3GZUC 2RR13 5GLTA 1FXZA 2D6OX 4KNCA 2CAVA 1S0FA 3EO6A 3S7EA 3ZSLA 1Z7S3 1V9U2 2XJSA 3VDDC 1SLTA 2XBO2 4ZXKA 1B35B 1W39A 2JICA 3G6JB 2GNDA 1RUI3 2GNTA 3RWNA 5JLVA 2WFPA 1FMD3 2RS13 4E9KA 1XNDA 2D44A 2ZBJA 3GYDA 2A73B 5FOJB 3MFAA 2D40A 5L19A 2JKBA 3LA3A 4AW7A 5HI0A 4GIQA 1D4M1 2HWE1 1VAMA 2HWC2 4MGZE 1XE7A 1WW4A 3H8UA 1QJX3 2V09A 2EF6A 3T1LA 1DYKA 2AUYA 1LOFA 1RIRA 4GMP1 4LA2A 1AR81 2JE9A 2WA3A 3ZPYA 4B29A 1PNGA 4XJ8A 1U12A 1RVF1 2O1QA 1B35C 5IT6A 1N47A 3ZXJA 4DRRA 4TZDA 1NOVA 4WM7B 1GV9A 3USUB 1AR93 3S0MA 4P9WA 3VBUA 3ILRA 2GZWA 3IPVB 1AX2A 3WDVA 4EJRA 4ZKTB 4R4ZA 1JXNA 2WT0A 4P9LA 1PVC1 4PLOA 1UL9A 2Y26A 4HFSA 4HSLA 3ZXAC 4BPZA 3B93A 2TBVA 5BY5A 5DG1A 1LR5A 2WZR1 3V0AA 1FAYA 1AXZA 1LKNA 2Z2SB 3M3QA 4LULA 3DGTA 1IQAA 3OY8A 1AR61 1H2NA 3CEWA 3E6BA 3V0BB 4FPHA 3JCIA 2R073 1S0EA 3VBOB 3EQEA 4LBQD 2C5DA 1JUHA 1APNA 1C5HA 1XU2A 1HV1A 3IKWA 1LB2A 4B7KA 1G86A 4IL7A 3R0RA 1QXJA 3J8F1 2QZ3A 3WLUA 2CTVA 1QH6A 2I74A 3H7YA 4KBBA 2HWD2 5C6CA 4YG0A 1VB4A 3M3IA 4YVSC 4LO8A 4AI2A 2DCKA 5JSRA 4COVA 4N9IA 3ES1A 1H2MA 3PJYA 1ENRA 1QDOA 1V9U1 1V6KA 2A5ZA 3GF6A 2XBO1 4X6QB 3AKSA 1GZWB 1AXYA 3U0ZA 5CAZA 1AVBA 4RA0A 3OYWA 4BOWA 1CJDA 3RDIA 5DUUA 3RQ0A 2GC1A 4COYA 2PHXA 3AM2A 2VUJA 1PIV2 4AFDA 4HN1A 2XH6A 4KG8A 4FAGA 3M7AA 4EROA 1S0IA 3PTYA 4SBVA 1NG0A 4K6BA 3V56A 1HDKA 1CAXA 3VBOC 5EV7A 3LOBA 3VL8A 2HWC1 4Q4W3 1SCRA 1BCXA 4GH4B 1D4M3 4I0BA 3U4XA 2FQPA 1BEV2 5FTTC 3ZN4A 3UKTA 2CAUA 2NMOA 3FUQA 2YPJA 4OHWA 4JDNA 1FPN2 2P34A 5EYYA 4F83A 5JAXA 3X29B 3NAPC 1KQRA 4GMP3 1AR83 1UAIA 3I54A 1ND2B 2YYOA 5GJ6A 5JI7A 1S0BA 1Q8QA 1RVF3 3GZAA 4LEJA 1ZZCA 1XQNA 1W6PA 3AMHA 5BNQA 3HAGA 4CDQC 4QU2A 3AP4A 4OHYA 5JIUA 2ZABA 3FE5A 2A71A 1TQ5A 3JB8A 2ZPXA 3M4FA 2CGNA 3U07A 4NHKA 3H7JA 4X8PA 3VKMA 1MS9A 1X8MA 1OMIA 2X5IC 4ONUA 1OA4A 1EYBA 2WZR3 3VHRA 3HWJA 4KGQA 1ULGA 3AXEA 1BBT2 1O4ZA 1CJPA 1AR63 3MIDA 1H8VA 1WA4A 1CAVB 1ALYA 3NV2A 4YARA 1FNZA 4CYDA 4E2GA 1C8M1 1LOAA 1VAVA 3ZXDA 5JWPA 4Q0QA 1QWRA 3OD0A 4C0BA 3JD72 1Q8VA 1YFXA 5GZFA 1YIPA 3ZIWA 2P2KA 5KHGA 3D5OA 5A32A 1HQLA 3WT3A 2JENA 4XBLA 1AJKA 4OHXA 4D94A 1RINA 3UL2A 1V9U3 1QHDA 5CA6A 5CBLA 1N1SA 5J7MA 2XBO3 3ZN5A 4H14A 2IXKA 3PVBB 4D7SA 2YDEA 1PIV1 2I07B 1S0JA 4QQHA 1PGL2 1DGLA 4KH9A 5FFOC 1PGW2 3SH3A 5IK8A 4XF1A 1D2QA 4L2NA 1RUOA 1DBNA 4COZA 4XFIA 4BM8A 4QGLA 1FNYA 1OLRA 1RUG3 1V70A 1IPKA 2O8OA 3POYA 2O0OA 3KS7A 2PAMA 1E57A 1ZX5A 4IETA 1WLTA 1H8TA 2ZKNA 3LA2A 4IV3B 3MLJA 2A6XA 2HWC3 4KU7A 1OQ1A 4ASLA 1BEV1 2YGLA 2WL1A 2KM2A 4OI1A 4DINB 3VLBB 4XQWA 3DKWA 3WCRA 4AI0A 1ZRFA 2V5YA 3RYRA 5I0SA 1FPN1 3NW4A 4UBGA 2XUMA 4FXKB 3BODA 3L2HA 2I45A 4IEZA 3SNMA 3ZX7A 2QZ2A 2DTYA 5BV6A 4Z92B 5FDBA 4Q4X2 4H55A 4W65A 3ENRA 3T1MA 4XIOA 4PBPA 3H9AA 3H1MA 1LOGA 2EVXA 2VULA 4I2OA 2XJPA 5I0UA 1YO8A 1GQHA 3JQWA 3C3VA 4JV4A 1FOD2 2NMNA 3B5LB 2BNNA 2QVSB 3FFZA 1DIWA 2UU8A 1TEIA 2ZGSA 1XYNA 4ES8A 3BIWE 4IV3C 5L7OB 2ZA9A 1LECA 5GZCA 4PLNA 3I2DA 2WNVC 1NCRB 5JCTA 5BPXA 1A8MA 4P9JA 5T5LA 1PZ9A 4PF5A 4HSJA 4E27A 5KC5A 1BBT1 2IFWA 4GKYA 4ASMB 4R52A 2R1BA 5CB7A 2CGPA 3GHMA 2ZMKA 1WLCA 1MS0A 1MQTB 4TSVA 1ULFA 4I3PA 5C8CC 3PMEA 5C4WA 1COV2 4C1XA 4PDWB 3MF6A 5AVAA 2IXJA 2UWBA 4LO4B 3NVCA 1M06G 1R092 1VLNA 5LK5A 1RITA 3PJQA 4XJAA 3H50A 1ZZ6A 3JD71 4R8HA 1C8M3 2DWRA 5BNOB 4NHMA 4BHPA 2P37A 3TN92 2WINB 1CD3G 3HR9A 5DZGA 1B35A 1YI7A 2PELA 4YFWA 3WZ1A 3ZXLA 2PFWA 3ZMNA 1OI6A 4P9XA 2D5HA 3IDBB 4WM8C 1PGL1 4QX5A 5L7OC 5B2GB 1SLLA 1PGW1 2A7AA 3VBUB 4F7ZA 2ZMNA 1NCRC 1KDKA 4AEMA 1CGPA 1X82A 5IK5A 1ZZ9A 1PIV3 5I8TA 4ORFA 2B9UA 2JG9B 1CPMA 2PA7A 1I3HA 3RRDA 1GNHA 1MQTC 4OHVA 1IGOA 2ET1A 1H9PA 3WG1A 4KU8A 1RHI2 4MGIE 3AP7A 2R043 3CLPA 3OY8B 4N7UA 4QM9A 3TBDA 2IXLA 5A3MA 1WD4A 4M0NA 3J4UH 5FMOS 1BEV3 1CR7A 2H6CA 3HN1A 1CONA 5DG2A 3FJSA 5JSPA 4DRVA 4AVTA 3POWA 4DY3A 1FPN3 2PTMA 4Q4X1 4WM7A 2MEV2 3USUA 1N3PA 1UX6A 3B7MA 3IPVA 2PHDA 5JIAA 3NWKA 4HMZA 1VALA 3EXUA 2PHFA 1F9KA 1FOD1 5AC92 4FTBA 4META 3FBYA 4AVBA 2ENRA 3OPZA 3BU7A 1FMD2 3B94A 1X50A 3NV3A 1G9DA 2ZGOA 3TB0A 3ZXFA 3UKVA 5FPZA 4GA9A 4OULA 3V0BA 4GALA 2WT2A 3K48A 3VBOA 3VKLA 4BMEA 4P9YA 4FPFA 1NQJA 1QKQA 3ZMOA 1BBT3 1COV1 3SITA 2UY8A 4JCKA 1SACA 4R9AA 4DS0A 4HLTA 1R091 4YYOA 2Y38A 5I93A 4IEOA 4EN0A 4Y20B 4UW3A 4Q2FA 3H1WA 4FPGA 1AXKA 4K3UA 5LK7B 4LE3A 1ZM1A 4K20A 2HWF2 2BVVA 4BIOA 3TN91 3JD73 3NAPA 1UKRA 1C4RA 4OI0A 1UKGA 5H9SA 1GZWA 5T5JA 3RMYA 2WQ4A 1PHMA 3AKPA 1V6JA 1ASJ2 2AYHA 1IHMA 4PQ9A 4HVRA 1PO23 1DLLA 4CEYB 1YFWA 2A3YA 3AXDA 1N3OA 2Q8OA 3KZ4C 1S55A 2JECA 2BW8A 3AMNA 1C8NA 3TAYA 4GH4A 4XJUA 1W6OB 4JRLA 3P3PA 1RHI1 3AKTA 2F6BA 4XHXA 2ZX0A 3ACLA 5C8WA 3KT4A 2ZJCA 4QGMA 2WNUB 1M4WA 1VBB2 1XU1A 1WUVA 4UW4A 3R4UA 1GLHA 4QPIB 4DXZA 4TLFA 2ES3A 5K7PA 2OPKA 3VKFC 2YMZA 1PMIA 2PAKA 1JHNA 2WNEA 2MEV1 2WLPA 4Q4X3 4NR1A 4XBNA 4RGGA 4PLMA 5HCFA 4FSJA 1ZNPA 2VQAA 1JBCA 5AC91 3THPA 3DPRC 2HKXA 2A3WA 2BNMA 5FO8B 3WG2A 1UCXA 1FMD1 4B8EA 5D8AB 3AMMA 1FOD3 2OYZA 3ZO0B 5A3LA 4I3GA 5H9RA 1ND3B 4QM8A 2AGSA 4FO9A 2IFRA 1NQDA 1IKPA 2K2SA 4EWDA 4M00A 2WNUC 4OZXA 4Q4W2 2KXLA 2DUOA 4MX3A 3KCYA 4A7KA 4QPIC 3FFQA 5DDJ2 4LO6B 2BGCA 2VMIA 5E88A 2RS32 1DGRA 4LT5A 3MIEA 3CJIC 1COV3 2PYTA 4C91A 1Q56A 3WINE 3S7IA 4W6WA 2A75A 4CP2A 1BJQA 1WMEA 5IK7A 2HWF1 2UURA 1BYHA 4WV8A 4Y1VA 4BIFA 2PHTA 3KCCA 4AK3A 3KM5A 1HLCA 4YRDA 2JX9A 1OSGA 3TN93 2YUEA 1QY4A 4HK9A 3IN9A 2WS93 3WD5A 2X8KA 1ASJ1 3E5XA 1TME2 3QCWA 4EN8B 1QOTA 3ZN6A 1QNYA 4FCAA 4YVWC 1EPWA 3VDDB 2GSYA 1VRH2 5K0UC 2A6ZA 4IESA 3MI8A 1RB8G 3ZSMA 1LULA 5F9TA 1CQ9A 1OLQA 4IV3A 4JRAA 3ROUA 1PZ7A 1ZVFA 2WNVA 2A3XA 4V1PA 4S2HA 4DPNA 4AFCA 2WQZC 1VBB1 1GFF2 3MW4A 1Q8SA 3ELNA 2VXRA 1DF0A 1OFSA 4YZ4A 5CIRA 3D4KA 5C8CA 4OUMA 2NZ9A 2DVAA 5FMOL 4RS5B 1C1LA 2Q30A 5JPNB 2ZHLA 4ZU7A 1ZZBA 3VKOA 2DU1A 3J26N 4YG6A 3GZTB 4MZUA 3RJ2X 2MEV3 2RMU2 3TWIA 3N7MA 4K9SA 1IS3A 2XL7A 4YW5A 5ACA2 1J59A 4RR3B 1MZ5A 1MVEA 1NYWA 1Q43A 5AC93 3NJZA 3AMPA 2NYYA 2Y0OA 3G7DA 3M1HA 2GNBA 5L7OA 1RUG2 5BXXA 4M0HA 3CU7A 3O14A 1NCRA 1RUF2 2XVLA 3ZIXA 1G9FA 5D1IA 1DGWA 4Q4W1 2YHJA 1A6CA 4BH9A 5T55A 1KS5A 1VR3A 5T52A 2D5FA 1XNCA 1MQTA 1NA1C 5DDJ1 1H0BA 2LTNA 4AFAA 4K7JA 2NM1A 2RS31 4PDWA 5EWSA 3SCFA 2YC0A 3AJYA 3WW2A 4HBNA 2VUAA 2ZX2A 4RS5C 3VHPA 4DMIA 2EXHA 4XFCA 2DUPA 4AVAA 2OW4A 1FATA 3I4IA 5FQ0A 5CFDB 3MLKA 5KXCA 3VBRC 1O5LA 1CESA 2P17A 5BNOA 1ZA4A 3KB5A 2DFCA 4JC1A 4XJ9A 3SLIA 4YGDA 4GQ7A 4LA3A 2HWF3 2ZCWA 4RR3C 1OQEA 4QQOA 5JSOA 1DFQA 3H3UA 5FPXA 4XF3A 1NLRA 1TME1 1FV2A 1YI9A 3AP5A 3N7JA 4YVSB 4XFBA 1UD1A 4Q4Y2 1HXS2 5KHIA 3O12A 1W0PA 1ASJ3 2JG9A 4ISQA 4W6XA 2Z69A 1VRH1 5DUWA 1YLLA 2AENA 2VG9A 4CDUC 4CZSA 3DF0A 1UU4A 3AP9A 1ZRCA 1N1TA 4XE9A 2NPIA 1HX6A 4XFFA 4MLOA 1VBA2 4P9GA 3WW3A 1X7NA 4COWA 5CFDC 5JPMB 5BYNA 2R32A 3OD4A 3W58A 1VBB3 4I30A 2DCTA 1D0HA 5I8SA 1DZQA 4L11A 4LO7A 5I91A 5FBZA 2W68A 5DXDA 5CFCC 1XXNA 1YIFA 1C8M2 2DTWA 3NV1A 2D3RA 3AJZA 1CN1A 5KC6A 1RUH2 3GBGA 1EV12 2RMU1 1DU3D 3WDYA 4P9IA 3ZSJA 2OUHA 4WBBA 3VKNA 3E97A 3UV9A 1AYM2 3NAPB 3VGIA 5LEJA 3JZVA 5J37A 5ACA1 5FO9B 1AUYA 2BPA2 4QQ2A 3WVJA 1NCQC 1OA3A 3MPPG 4L9BA 4JGZB 3V64A 2GMPA 1RUG1 2XLFA 2DCJA 4AHWA 1BVVA 1DZTA 2MPFA 3OJBA 1RUF1 5T50A 2R49A 4OI2A 4CDQB 3ZSEA 1UF2C 4C0HA 5HCBA 2BNOA 1XNKA 2XJTA 4Q0SA 2ZZJA 1TMF3 4KL1A 4WVMA 4MH0E 5KHKA 4WVZA 2R042 4H3WA 4R9BA 3KSCA 4GB32 2EXIA 2ZAHA 1OPOA 4D7YA 3M3CA 5DDJ3 2X5IB 4FPLA 1JTZX 2Q1MA 2RS33 1URXA 1QOOA 2E7AA 4MVTA 2LALA 3ZYPA 2D93A 5HBAA 4AI1A 4Y20A 3OGGA 5E89A 5EJ3A 4E4D