1OPMA

Oxidized (cu2+) peptidylglycine alpha-hydroxylating monooxygenase (phm) with bound substrate
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
310
structure length
310
Chain Sequence
NECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate-mediated electron transfer in peptidylglycine alpha-hydroxylating monooxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords PROTEIN (PEPTIDYLGLYCINE ALPHA-HYDROXYLATING MONOOXYGENASE)
total genus 70
structure length 310
sequence length 310
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 1999-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1opmA02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 1opmA01
3MLJA 3KS7A 3MIGA 1YJKA 1PHMA 1SDWA 1YJLA 4R4ZA 4R4XA 3PMSA 1YI9A 3MIEA 3MIBA 4E4ZA 3MICA 1PNFA 3PHMA 1PNGA 1PGSA 3MIDA 3MIHA 3MLKA 3MIFA 1OPMA 3MLLA 4QHBA 1YIPA
chains in the Genus database with same CATH superfamily
3WZ1A 2ZGQA 1ZRDA 4H7MA 4DXTA 4CCCA 5KC5A 3KV5A 1CAVB 1UCXA 4BLJA 2V5YA 4FPFA 1HRI2 1QJY1 1SCSA 4RL7A 5EZWA 1K5MB 5EJZB 3SISA 3HR9A 4LBLA 2WR9A 5CKQA 3VBHB 4G4FA 1GNZA 4Q4V1 5FLIA 2BNNA 4WVMA 4EN7B 3WNXA 4FBFA 5C71A 5A3TA 2WNVA 4RR3B 1S2EA 1N1TA 2R32A 5JVVA 2VECA 4O9GA 1SLAA 5B2GB 2PHUA 4HONA 4CCEA 3NNLA 1N3QA 3OBRA 4ATEA 2B4KA 1PGSA 4LBNA 5DAVA 4AFDA 3WDUA 1RB8G 2XVLA 1CONA 3B02A 3P1IA 1LODA 1ZRIA 2AEZA 2VBDA 1O3RA 3K4DA 4GAZA 1AR73 3PVOA 4MGZE 5ANNA 5FV3A 3U75A 3KMHA 3U4XA 3NJXA 4CZSA 5KXEA 1M4WA 4W6XA 4K20A 1K12A 3FLRA 3POYA 4AVCA 4COUA 1OT5A 4F83A 5I8TA 3R0RA 3WP4A 4CUCA 1A34A 4OZOA 2UWBA 1YFUA 4PLOA 1QXPA 3IIAA 4PDWB 1DFQA 3HN3A 3TN93 3E6CC 1ND3A 1OXCA 2VMEA 2I45A 1P8JA 4EWAA 3HT2A 4LT5A 2P3IA 5LBBA 1BEV2 4Q4Y2 2OA2A 5FPBA 1AR72 4FFGA 4RGAA 2AZ5A 2RDSA 5CA6A 3BPZA 5A3PA 4OHYA 1JH5A 1BVVA 4FPYA 4CTEA 1EYBA 1PO13 1COV3 1C3HA 1I5ZA 4MYEA 3L2HA 1YRZA 2E7AA 2YC2A 3PUHA 2JE9A 2HEWF 2SBAA 4K1YA 3T1MA 2P3JA 4W6WA 3AP5A 5A7PA 1ULEA 1LTEA 1XYPA 1NXD1 2WFF3 3J9SA 4IGOA 2FZ1A 1Q8QA 2CU5A 5IAVA 4UW5A 1MS4A 3J7NA 1D4VB 2ZX0A 5FZCA 3N7KA 4TTGA 3FHQA 4FTEA 3AX4A 1MS9A 2YFZA 2RS52 3B93A 3MICA 3OJBA 1UD1A 3POBA 3VDAA 4GJYA 3NW4A 4QDRA 4A6SA 1ZRCA 1NY72 3DCQA 5JUVA 2ZGSA 2D3SA 3LSDA 4CP9A 1ENQA 5A7QA 3WY6A 1DGRN 4KGQA 2DDUA 5FYSA 3U14A 3UETA 4UFIA 1S0IA 4M4RA 3KF3A 3NV4A 1PO11 1FXZA 3AKPA 4PQQA 1OFNA 3AKRA 1G9FA 5HI0A 2R041 5I0TA 2Q4SA 4RQPB 5FXWA 5LCWL 4CP2A 3ZFGB 3AVSA 3ME2A 1YFYA 3PL0A 4LOTA 2CY6A 1X82A 1RUF2 1NCQC 2WFPA 2IFWA 5F3EA 1UYZA 3N9LA 5GLTA 1V9U3 2W92A 1W3VA 5A1LA 4H14A 4Q0QA 5FPUA 3WD5A 3OD0A 4CDQC 4G3YC 1CAWB 4Q4V2 2VH9A 1RUOA 4AVVA 4Y22A 3O1RA 4IEZA 2VCMA 3HNMA 5J48A 5FZ8A 4Q2FA 5IK5A 4W4ZA 2PLV1 1H4GA 5CKMA 3RI8A 3LZZA 2VU9A 3VBRA 3O1TA 4XF3A 4EE2A 5I0RA 4Q4W1 1IS6A 1RUG1 4BIFA 3D6EA 1OPOA 1FNYA 1BJQA 2IVJA 2XVGA 3B01A 1QNWA 2HWD3 4IETA 4COYA 3WP3A 1B35C 1MQTB 3ROUA 5FMOL 2I74A 4NMIA 5I0UA 4AR2A 1YYNA 3IDBB 2VNGA 2XBO1 2Z42A 1SFPA 4DPNA 5LWBA 2OZ6A 1R1ZA 3ZLIA 5JCTA 3JBG2 1YQ6A 5K0UC 2VZSA 2WYSA 4LKEA 2CAVA 2D7FA 2WIIB 3AB0A 5C4WB 1GP6A 4QPGC 2P6HA 5J3UA 3CZJA 2RMU1 3MHZA 4Q0VA 2PN5A 5FPLA 3LPFA 1J83A 4C1XA 4D69A 5IVBA 1PZ8A 2AREA 2F17A 3IPVA 2ZKLA 4FP3A 3LAGA 2XBO3 4OCTA 5FZOB 4B7EA 4WZFA 3WF1A 1YI9A 5LW9A 3I3MA 2D6PA 2XQRA 4FP2A 1JZ6A 2XLFA 4BYYA 3DYMA 5CFCB 1CZTA 4ZPIA 5JPMB 2HWE2 4OQ9A 3GZUC 4YM1A 2D93A 4QX5A 1AZDA 2DURA 2ORZA 2X29A 4HETA 1W8HA 2VMFA 2LM3A 1MZ5A 4NAMA 4XZPA 1RMU1 4PBOA 4DXSA 1ZBA3 3TEWA 4WVZA 4L2NA 4Q0UA 3A23A 1FNZA 4OMCA 2VOXA 2F4PA 1KITA 2D5FA 2OX0A 2ZHNA 1H9WA 4GWMA 3WG3A 3UKVA 3WNLA 1VBC2 1S2BA 1PVC3 1IG0A 3CL1A 2VUCA 3I8TA 4GD4A 1LU1A 2ADDA 2JG9A 3BTXA 4JCKA 2Y34A 4JGYB 4YG3A 5E1RA 3DXUA 1AXZA 1W6OA 4F8AA 3T0DA 2GMEA 3V65A 2YBPA 5HXMA 4GH4B 2Q8EA 3U07A 1DQ6A 5I8YA 1FMD2 5T55A 4JDOA 1K5MA 1PK6C 1HV1A 3I2JA 4JQTA 3ZR5A 4HN1A 1H4HA 1WW5A 4WVMB 1CAWA 1ULFA 5DUUA 4M3CA 4IE6A 2X5IB 3U11A 4CDWB 4XBQA 1PHMA 2ZXQA 5FUPA 5G04L 4AE2A 1JN2P 3ENRA 5C9AA 1RUF1 3Q8FA 2J1SA 3E5QA 5J98B 1XSQA 1SLBA 2CDPA 1CZVA 1ND2A 5DDJ3 1EAH1 3KV9A 2QUOA 1NOVA 5LA0A 1DF0A 1WCKA 5F39A 4Y24A 5A3OA 3VBRC 1FMD3 1KXGA 2D40A 4GWIA 2P4EA 2ZGOA 3TBDA 3AZYA 2C6SA 5C3PA 2KA3A 3ZFGC 4U2AA 3SH4A 5F5IA 5LATA 1PMHX 3JU9A 4U36A 5LA2A 1GZWB 3SITA 5FRAA 3RZMA 5F8PA 2KR2A 2ZPXA 5D8AC 1F15A 1HJFA 2X10A 5DDJ2 3RDIA 4IEYA 5FY7A 1AJOA 2QQPA 5C6CA 3OGRA 1UMZA 4Z2WA 3HEIA 3PMSA 4IXLA 1T6BX 4QMAA 5F37A 3OB8A 4XQ4A 2WWUA 3BN6A 3KT7A 1XRUA 4H7LA 4WM8C 5FXXA 1WCDJ 1WMFA 2BQPA 1G7YA 5DDJ1 2XB6C 4D3WA 3WEZA 5EPAA 2GP5A 2O8OA 3ALQA 4QX1A 3D4KA 4A7YA 1I1EA 3NJYA 3SMHA 3C7OA 5IVVA 3OSDA 2HYXA 1FX5A 1S0EA 2Z5WA 2XQXA 3E6DA 3H3ZA 3AYEA 5HXVA 4CXWA 3RS6A 1QJX3 4QX7A 3T2OA 1W2UA 4QX2A 2O14A 2QQJA 1L7RA 1LAJA 3GALA 1YJLA 1W2NA 2WZPP 4AVSA 2JKBA 1QDOA 3VDCA 4DS0A 4YARA 3OPWA 1RUD3 2B9UA 4P14A 2VZPA 4I02A 2PFWA 4YZ2A 3IDAA 3VBHA 3VBOB 5C4WC 4J1XA 5CBLA 3VL9A 3T4HB 1PIV3 1WMDA 4UBHA 4LHSA 4AGRA 4F3JA 2E63A 5C7GA 5C3QA 3JD73 1Y43B 1C8M2 3LCPA 1JYTA 3IM0A 3I3EA 2NPIA 2JE7A 4ISQA 3PMEA 3THPA 2OPWA 2AYHA 4UXAA 2ID4A 5E88A 2EAKA 1JODA 5HPOA 4QPYA 1SFNA 2GNBA 2RJLA 3IKWA 4SLIA 4XFFA 1SLCA 1HIXA 5H9SA 1J84A 3LQCA 5DZGA 4YW7A 2WZEA 3R4SA 5FZ7A 4CDUB 1PK6B 3NNMA 2RE9A 2VZRA 3HBKA 1VBC1 3LIHA 4FPJA 4M3CF 4XEZA 1OF3A 1ASJ1 1HDKA 4GKYA 5CEHA 5L9VA 2Q1ZB 3M3IA 2RS13 3O1OA 2J7MA 1CAUA 1BCXA 2XGXA 4COVA 1OVPA 3HD8B 4DUWA 3EB7A 5DQ0A 4XF9A 1DGWA 1QH6A 1QQP2 1MEC3 3MIFA 4PI2A 3NQHA 4XZUG 2HWE1 4IDZA 4BLIA 1ENRA 2HKXA 1J1TA 3O14A 4JVAA 2VCCA 2B42B 3TOJA 1RUJ1 1SPPB 2X09A 5FMDA 2VZQA 1EAH3 3WUDA 2JDUA 4XFAA 3WF0A 1K5JA 4CEWA 4YGCA 4LKFA 3N7JA 4LO8A 3W5MA 4XUNA 4RA0A 3LFMA 4ONUA 1HN1A 5K7PA 4WM7A 5FXZA 3VD9A 1DQ0A 1URXA 4QU1A 2PTMA 1YQ5A 1QXJA 3VHPA 4LIVA 4W6YA 1XU1A 2WNVB 4RR3A 5C3RA 3JB8A 4HKWA 4HPKA 5FYVA 1H2MA 2JX9A 3I3BA 1ZBE3 1C57A 3FFQA 4PI0A 5FZ0A 1V6OA 4UOJA 5IUQA 4HN0A 3G6JB 1NG0A 2FMDA 2QQKA 2GH8A 2UU8A 1IKPA 1XPWA 4CU9A 4CUGA 3HT1A 4NE9A 5SV5A 3WQ7A 4Y5TA 5JI9A 1LECA 1WBFA 3DPRB 4CDXC 5FZIA 3ZSJA 2IFRA 3FZ3A 3RMYA 1MR5A 3SNMA 3RJRA 5FUNA 2WKKA 4DEQA 3M2MA 3TNPB 3N4MA 2QZ3A 1VR3A 1W6PB 2NN8A 3QLQA 4MGTA 4L8QA 1GQGA 5IT6A 3ZO0B 2JECA 1Q8SA 2GH2A 2HWE3 1GANA 1R083 1SACA 2E7QA 2YBKA 4E2QA 1KJLA 3ZYIB 1W04A 3I54A 4UI9L 4K40A 1NXMA 2HWB3 5LB6A 5BNOA 3NV3A 4CCJA 2VD7A 5FZOA 2B5HA 2N7GA 2Y6JA 4NROA 1IPJA 1ZM1A 3MV11 3ZYJB 5SV8A 1W9SA 4P9LA 3J7HA 3NMBA 5B4XA 3KD4A 3K4ZA 4AHWA 5C8CA 2W47A 4OI2A 2XMLA 2QQVA 3T09A 1HB4A 1WW4A 3FBYA 4FTSA 1WA6X 2NMNA 5JI7A 2RDQA 3HN1A 3VDBA 4HL0A 4LBMA 3Q8EA 5CFDA 4B4RA 2XL7A 2XOMA 5JXGA 2EXKA 5HV0A 3LDKA 1K5MC 2DCZA 1VAKA 3HMYA 4TXWA 3K2OA 1EY2A 4Y1ZA 4UWDA 3SEEA 1GZ9A 2JB8A 2YV8A 1S1AA 5FOBB 1NX9A 4FQZA 4XUTA 4GALA 3O0VA 1HLCA 4FAHA 5FQ0A 2JDKA 1XBFA 1EAH2 1RUE3 4AQSA 5IK4A 2HWC1 3IT8A 5CAZA 1YEWA 1J1LA 4LE3A 4WVVA 1PGL1 3RVHA 3P3NA 2YGLA 3ZN6B 2BGOA 2W0XA 1UMIA 2XJVA 2Z69A 1O7FA 2YC4A 1HJGA 1SLLA 3Q8CA 4LR4A 5A6QA 1C8NA 4P5HA 5IFPA 1LOGA 4IE7A 3M70A 4LLOA 3TYJA 4CDQB 5FZ4A 4BJ0A 4MX3A 2R1BA 2KXLA 3M3EA 1MVQA 2C9KA 5LEJA 2MHFA 3B5LB 2DVFA 2ADEA 3BOWA 4LO6B 5FPAA 1D0GA 1AYN1 2JG8A 1R092 3BVCA 4E8CA 2G9ZA 1W06A 3MLLA 1X8MA 4O9EA 1OQEA 4CCMA 4I0AA 5HCAA 1JYNA 1G86A 3DV8A 2WABA 3C7FA 3E97A 1TMF1 3VZJA 4WM7C 3MIGA 1WCUA 4B7KA 4NJ4A 3U1XA 4AW7A 4J25A 3ACHA 5H9QA 1ND3C 4YW1A 4IV1B 1ULOA 1XYOA 4P02B 5LASA 1DG6A 1UKGA 2WUHA 1GLHA 2ZMKA 4IGPA 4JQRA 3I3DA 4P9YA 5F6KA 3H8XA 2Z79A 4PF1A 2VAUA 4Q4X1 5FYZA 3MEPA 5FZHA 5FZBA 2WRAA 1VAVA 4CP9B 4PCRA 3J4UH 3PUSA 1H8TC 3CU7A 5K0UA 4IERA 4IEOA 1RUC3 2OZJA 1RUE1 5JWPA 4N53C 1W2TA 1MQTC 1B35B 1DQ1A 3VHOA 3N9OA 4Q0PA 3DYOA 4LBOA 4YM0A 3ZDSA 2XONA 3E1F1 3I59B 1JUHA 2I07B 2DBNA 3MW2A 4GB33 4FSJA 3TN91 5DUXA 5BNNC 2A6XA 3OGVA 5K8SA 5A7WA 4Y26A 1CVNA 4JAAA 5L73A 4AEDC 1J3PA 4PIZA 1HXS3 1JZ2A 1QMJA 2PQSA 3POFA 1TZOA 2EIDA 4QQPA 1Z7S3 3CF6E 5ABJB 2IXCA 2KM2A 4XUOA 3HBZA 3EMRA 3WNNA 1ONAA 4HT1T 2Q8CA 1JYXA 3WHUA 3MF6A 5DAPA 2W39A 4AI3A 3E5XA 3W5NA 3VB9A 3LF7A 5IVYA 1UOGA 3WDYA 4KBZA 1RITA 1QEXA 3H9AA 5A7NA 1YC61 3W9AA 1IKQA 3OGSA 4Q4W2 5F7UA 1WW7A 4R4ZA 3V0BA 1AL21 1S0FA 4LEJA 3B9CA 4QX0A 3CJIB 2VG9A 1NZIA 2X53S 2DCTA 2WT0A 2RS51 3H8RA 4CA9A 4PLMA 4AK3A 1F4HA 2DYCA 5KHJA 1PM4A 1ENSA 1KQRA 3U37A 4CDQA 3NAPB 3H8UA 4X6RB 4XDQA 2VPVA 3VBSA 2RMU2 4BA6A 1ZZBA 1D4M1 2RVAA 1VBE3 4YG0A 5FPVA 3ZKUA 3WG4A 4E9KA 5KR7A 2IUWA 1OH4A 2WS92 4XC9A 3ACFA 1GFF2 4XUPA 1AVBA 3B7MA 1VBD3 4R8HA 4QXKA 3FC0A 4AGGA 1UY4A 1LB2A 3LA2A 2PLV3 2OUJA 1OKOA 3UJQA 3ZFEB 3I2FA 1V6NA 3RZHA 2ZEXA 1E5HA 3Q8BA 2VQ0A 1Y9QA 3KF5A 1LGNA 2DV9A 3VBFB 3A0NA 4N53B 4XURA 4BK4A 5FR3A 1JHJA 2DCKA 1FPN1 2WC2A 4RS5B 2ZZJA 3AL5A 2WAAA 1RUNA 1BMV2 1S2KA 1LHNA 1NY71 5J36A 5ACA2 1XNAA 3DF0A 3OGGA 1RUG2 1LRHA 2CTVA 4DINB 1RUI3 4XFCA 4XFIA 4COWA 4IEUA 3HPNA 4QM8A 2CGNA 4Z2AA 2E53A 4DNYA 2PA7A 2JEMA 1W2OA 2GU9A 1MZ6A 2P37A 3CNAA 3ZM8A 4N43A 3ZXDA 5EWSA 1ASJ3 1JXNA 3FN9A 2VNVA 4XCAA 2ZBJA 4AAPA 2RS11 1VBD1 3ETPA 3TEXA 4YVSA 2E31A 2JDNA 5IHRA 5J96B 4L99A 5E8AA 2MPFA 5J7MA 3H7JA 1ZRRA 2ZGNA 1LU2A 2R073 2WZR2 3OOXA 4CEYA 1HB1A 2PAKA 5GLZA 1TQ5A 1U5IA 3GCWA 1US3A 4XF1A 3GZTB 3MIDA 1LNSA 2WQ4A 4LHKA 3VBOC 5A70A 5KWRA 2PHWA 1CAXB 5BNNA 1PMJX 4EN9B 3KCXA 4BIOA 4K7JA 3H8OA 1LENA 4BQYA 3M4FA 2VZ1A 3VV1A 1JOJA 4N9IA 4JGYC 4YVWC 1VALA 1WMXA 4B8EA 1BQPA 3WNMA 4DY3A 3RZLA 5FYYA 1ST8A 3LIGA 4GH4C 3LA3A 2C5DA 2VOWA 3HWJA 4HANA 4LUMA 3RQ0A 3USUA 3OYWA 3UGHA 1UW8A 2ZGKA 3OD4A 5JSPA 4LITA 4XCBA 1G6NA 4JC1A 3GZAA 3NNGA 5FTTC 3IWZA 1GKBA 4FXGB 2WNUC 5BNQA 2GSYA 5CYYA 5EXOA 1VRH1 4XAEA 3O0XA 4QX8A 4QQLA 5J1XA 2EA7A 4DZGA 5IK7A 4K9SA 4PDWC 5FZ6A 1HQNA 2B46X 2FMYA 3BPSA 3PTYA 1VB4A 4CVUA 3UV9A 4DXZA 4K6BA 1AYN3 4YPJA 2ZKNA 4AHZA 4B3NA 5F9TA 1JZ4A 3HQUA 4PJYA 3CJXA 4N90A 2A75A 3MW3A 1PM7A 4KU7A 4OI0A 4K21A 1EP0A 1UF2C 2IXLA 1SBFA 2D6MA 4UYBA 5I0SA 1WLDA 1APNA 4NWVA 2R071 4R9AA 3DYPA 1O8SA 3BGAA 5D8AB 2Q30A 2QZ2A 4D6QA 2NM1A 4MG2A 3BOPA 3RJ2X 1KEXA 2ZGTA 5DXDA 5JOYA 5JZGB 2ORXA 2ARCA 1R093 1UIJA 4BB3A 1OA4A 4RQPC 1Q8VA 3RFRA 2D44A 3S30A 3KVAA 2WLQA 3VZKA 4C1WA 5FDBA 1VBA3 4LIUA 3OBAA 1TME1 2VBBA 3POGA 2GNMA 2VNRA 3GJAA 2QTWB 1ZZ9A 2WO7A 4AFCA 1JOBA 2XDVA 4LO4B 2FDFA 2Z2SB 2OW4A 3MFAA 1PO12 1OFSA 2VVFA 4QXCA 4HOOA 3WSOA 3ZYPA 4ZXKA 2VL4A 1V6LA 1HQWA 5LRSA 1PIV2 4IGQA 4MXVA 4YGEA 3WVJA 3C2UA 4HSJA 4XJ8A 2DU1A 4NRPA 4YVSB 1UKRA 3VKLA 3AP6A 2W52A 4EN8B 3RI9A 3O0WA 4XILA 2HWC3 4XIKA 2BJSA 4AOCA 4EQVA 2HWB1 3KV4A 2NQYA 2CSGA 5CNAA 1HRV1 2RDNA 2ZZQA 1GWKA 3O5SA 1Y9GA 2EAAA 1ZZCA 4NAOA 4Y4YA 4D7YA 4FCAA 5JXIA 4LORA 4EWEA 2XPJA 5HBAA 1XQNA 3T30A 4LO7A 1W6QB 3LB9A 1MPXA 1Q43A 1QOSA 2JICA 3AYAA 2AR6A 3P3PA 5FPZA 4CDXA 2BNOA 2R0HA 4M3CB 4FOQA 3WCSA 2Y64A 4UF0A 4NIHA 3SCGA 3L9JT 5K0UB 3WDWA 1AL23 4Y4RA 4YZ3A 5A3MA 2R042 1AR83 3NJVA 5FO8B 3G7DA 2VZVA 5FZKA 2BVVA 3M1HA 4GXLA 4YVWA 2VW2A 3DKWA 1ZREA 1CESA 4JTOA 2DWRA 1OI6A 4Z92B 5F3IA 3C7HA 2DUPA 3H3LA 2LRPA 3WUCA 1H2KA 2Q5TA 5M0TA 1IG3A 5F32A 5AVAA 5LBFA 2TEPA 3EHKA 2B8MA 3ILFA 1POV0 2VC9A 3TNQA 5JOZA 3OGJA 5BNOB 3M7AA 2JG9B 3CZUA 5J37A 2WA3A 2VTFA 2RG4A 4IEXA 3AMNA 3WG1A 4AQ2A 4L92A 4A3ZA 2GP3A 3RZGA 3IDCB 2Y0IA 1XNKA 5A32B 3V64A 2QQOA 1NE6A 4Y33A 5C8WA 1AR81 2HBUA 1QHDA 1U0AA 5T5LA 1ZVFA 4YGBA 2VE1A 3INAA 2X5IA 4CDWA 3T0AA 5IAXA 4NPLA 5CB7A 1V6JA 2P5BA 5LY2A 4D7TA 5AFEA 4Y1YA 1XE8A 4HK9A 1RHI2 4LUKA 1LKNA 3POIA 5K4LA 3CIHA 4ZXEA 4AZZA 1W0OA 1D2SA 2R49A 4C90A 4FPEA 4D7SA 4ZHNA 4EJRA 4RQPA 1PVC2 2ZCWA 4FFIA 5FYIA 2R063 2WQ8A 4YVWB 5HCBA 4ZKTB 1QWRA 3VKFC 3O1MA 4NIGA 1HN0A 1X7NA 3VZLA 4E4ZA 1BBT1 3ZSLA 1VIWB 1AR61 3ETQA 1W9WA 3BODA 1VJ2A 1HX6A 2A6ZA 3NNFA 2V4AA 2W94A 1YFXA 4FPCA 4YVSC 4I2OA 1RUH2 4N7IA 4NWWA 1G8WA 1JUIA 4UFHA 1REDA 2XLAA 2PHTA 4PHZA 4RSUA 3VHRA 3AXEA 4P5YA 3TWIA 5FKCA 1NYWA 4QB6A 1N3PA 1YXWA 1LJ7A 3QD6A 3N9MA 5FZ9A 1DP0A 2G9FA 4Q4W3 3WDTA 3R4UA 2R043 4LXLA 1BK0A 2OQ6A 1VRH2 2VOVA 4GULA 1QQP1 5A80A 1X50A 2ZGLA 1YHFA 5A6YA 3W59A 3MO4A 2R30A 1XNBA 3M3OA 2JJ6A 1O4TA 3SEPA 5DAWA 1GNHA 4V2VA 3I2KA 3BKZA 3WF4A 1DQ5A 2WN2A 5FZAA 3VDDB 4EZ4A 4QQ2A 1UZ0A 1A6CA 1XNCA 3KCCA 5C3OA 4OZXA 3AP7A 5IATA 3K75B 1L3JA 1FAYA 1FYUA 1U12A 2D6OX 4LMFA 4XQDA 5GKAC 5I0DA 1OBNA 3N9NA 2QDRA 4AEDA 3H50A 3GHMA 3MW4A 2HEYF 4EZHA 4MGSA 3F2ZA 2FDHA 3VBHC 2UWCA 3H3UA 1F9KA 1F35A 2OS2A 2JG9C 2W3JA 2WFF2 2XLGA 3MPPG 4WM7B 2A5ZA 4GJZA 4LBQB 3SLIA 1KS5A 1UX6A 3ZR6A 5LBCA 5JLVA 2YHJA 1C1FA 3BIWE 3FMGA 4WM8B 2GNDA 3KSCA 5FZ1A 4I0WB 2WINB 3K3NA 4HVRA 4QXBA 1CQ9A 5DG2A 5JIAA 1GR3A 1FT9A 4CDUA 2JD4A 2VVDA 3H1YA 4UFLA 1Q3EA 1H2LA 1N47A 5FP4A 2P3YA 1HB3A 5GJ6A 3SXWA 3V0AB 1ZA4A 4CCOA 2BOJA 2WSUA 2B7YA 1IOAA 1UZWA 4MXWB 1XB9A 1CD3G 2VMCA 5FIXA 1QDCA 1WCQA 2BGCA 3U78A 4A7KA 2BGPA 1Q5OA 5FYHA 5LEKA 2ZA9A 4NPRA 3PJQA 2EXJA 1S55A 3KV6A 4L11A 3POEA 4NO4A 4TYSA 3CJIC 1J58A 4BZ4A 1G9AA 3OY8A 1HRI3 2AUYA 3FWEA 2H6BA 4YW6A 5KXDA 2BDRA 3VD3A 1BXHA 2ZX1A 2RS32 5DAXA 3ZFGA 3ES1A 2FCUA 1ZZ6A 4AEDB 4LO5B 2W1UA 1TNRA 2H0BA 1RJ8A 1OA2A 4HVOA 3CLPA 3T1LA 5D8AA 4KI5M 2HH9A 1PO23 1RUI2 4CXYA 1A3KA 4CEWC 4N7UA 5B4NA 4P00B 4DB5A 2VOKA 2WT2A 4Z07A 2Y60A 2IXIA 4YZ5A 4IEVA 4I09A 4O61A 3WW3A 4ITCA 4UFMA 3SCFA 4ET7A 1G9DA 5F3GA 4AFMA 4AYUA 1F5FA 4JDNA 4N53A 1W6MA 4RR3C 2DTYA 4P9GA 3KVBA 5FMOS 1GNYA 2W1WA 4QDQA 5HCFA 2PHLA 3AMHA 3ELNA 4RD7A 4OHZA 4KL1A 4LK7A 4PBPA 5J09A 1RUJ2 2GDFA 4A4AA 2Y38A 3AFGA 2UWAA 1COV1 1NA1A 1CN1A 2FBEA 1TE1B 3DUIA 3I2HA 3LDBA 3AJYA 4N8MA 4E27A 1W6NB 4KBBA 4OYUA 4AWDA 1LEDA 1UWWA 3WNOA 1FMD1 1UAIA 1DZQA 3A0KA 3MDPA 2YZ4A 3MIBA 4NOTA 4FFFA 3S0MA 1DGWX 1ZBE2 3HJRA 5EHDA 5C4WA 4QDSA 2IXHA 3LD8A 3ZYFA 5EFUA 1YWKA 1FPN3 1YIPA 1N1YA 3H42B 2VMIA 5FYBA 5T3NA 1D7PM 4NUBA 1NLSA 2Y6GA 3KS7A 3LEGA 4XJUA 3F95A 4CDXB 5C8CB 2GMMA 5FMCA 2OKXA 1WMEA 2CL2A 1W8NA 3NSTA 1PO21 4HG6B 4MZUA 5FP3A 2IVIB 2JDAA 3WV6A 1AR91 3LEMA 4ARYA 3J8F3 1LOFC 3LA7A 4Q5OA 4Q1RA 4XDPA 1AJKA 1HKDA 2HWF2 5ACA3 4KWUA 4B1MA 5FJKA 4HKLA 3SC7X 5JOXA 1VBB1 2D5HA 1N1VA 3WW2A 3MIEA 2V72A 1YQ2A 3OYWB 2H6CA 2JDMA 3UYJA 5CFDC 2BP6A 2RR11 2D3RA 1RINA 3L2YA 5DPNA 1ZBA2 4YW3A 3OPTA 1AX2A 1W99A 2UURA 3DPRC 1NCQA 4NPMA 4OMDA 5FZ3A 1TME2 2EICA 3VBFC 3I2OA 2BV4A 4FOWA 2BUKA 3BCWA 2J1VA 4LJHA 1YLLA 2Q1FA 4XPVA 5FYUA 1OQDA 2HWD2 3AZVA 3EBRA 2CV6A 3PUQA 3WR0A 2VOTA 4AGVA 1CAVA 2R061 4LLFA 4SBVA 4YWAA 2RJ2A 1UYYA 3VBUB 4E2GA 2P34A 5F2WA 1QJZA 2RHPA 3AM2A 2Q8DA 2ZMNA 1QOTA 1AR62 5KXBA 4ISRA 3BU0A 2FDJA 4A3XA 5A7SA 3PIJA 5LBEA 2HWD1 1QNYA 3ILRA 4NIDA 4JHZA 1H6YA 3WNPA 5FMBA 3LPGA 1HB2A 3LWCA 1J59A 3FLTA 1I5PA 2NZ9A 3VZMA 3ZSKA 5T5JA 2D43A 3I7DA 5DZFA 1POV3 5BV6A 2VMGA 1W05A 2VMDA 4KMQA 3N3HA 3IIIA 2WN3A 4BCUA 4XACA 1E57A 2UYBA 3EO6A 2WDBA 4AI0A 2Y6KA 3ZYRA 4P08A 4JRAA 2YPJA 2CDOA 5L9RA 3RRDA 1R64A 5IVEA 4KQ7A 1AL0G 1YI7A 1PGW1 1QF3A 4BOWA 2PLV2 4TSVA 4DIQA 1MVEA 4J6GA 4OQ8A 5A6ZA 4GB31 1KDKA 1LOEA 1QIQA 4JGYA 5FPXA 1US2A 2W46A 2WZR1 1DLCA 2W91A 3VBUA 2VXRA 2ZS6B 1QJU3 2C4XA 1W8FA 1MZEA 4KG8A 4Q27A 1R1A2 4WVWA 3VD7A 1YFWA 4M00A 1IZ3A 2IWGB 1SHWB 3UGGA 5FY4A 2VCAA 2G1MA 4EYUA 1DYOA 5T5PA 2EXIA 3VHNA 1VBE2 4AL9A 1L7QA 2PQQA 4PIXA 5C3SA 4E2SA 2O1QA 2VY0A 4FPLA 4E8DA 4BU2A 4AQ6A 1SQ4A 4H3WA 4NHMA 1QJFA 4AEKA 1W90A 3VLBB 4XMIA 5FY5A 1VBE1 3T2QA 4W8JA 1MS8A 5BNPC 4I3PA 3GGLA 4RGKA 2WBKA 5G05L 1RXFA 5E89A 2VZOA 5A33B 2WO3A 4TN7A 1GZWA 1XOYA 2ZAHA 4PF5A 3B94A 4XDOA 4AI2A 2C9AA 1UY1A 2Y33A 4R52A 1NZCA 1W8UA 2YGMA 4META 3DXTA 4B4PA 1WBLA 2HWB2 3BYWA 3EXUA 4DMIA 1DZRA 3KGZA 1GOGA 3I4IA 5EYXA 1OOPC 3HQRA 2P17A 1X9TA 2SLIA 1HW5A 3K46A 2JENA 1AYM3 4MUVA 2WO1A 3ECQA 4CEYB 1VPHA 5EYYA 5AC92 1OA3A 2EXHA 5DUWA 2FDKA 2JG8C 4OUMA 4Z8BA 5KBFA 5F5CA 3LOBA 1D0HA 3ZFEA 4Y20B 3DL3A 3HNYM 5E6HA 1XU2A 5JR7B 5ABJC 5T50A 1BVP1 2P6CA 4JGZC 2EF6A 2W2IA 3QH6A 4BQ2A 3PUIA 4Y5Z0 1CAUB 1U5ZA 1ZBA1 4FPGA 3LSEA 3D0JA 3RNSA 1O91A 3FBMA 1W6MB 2GC0A 3CDZB 3B9IA 3AKQA 2J1EA 4A7ZA 2JXAA 3ZDVA 2YROA 3PVBB 4O65A 4YSFA 3ZVXA 4CP0A 2YMZA 1SPPA 3RG0A 2VTXA 4OFGA 3UT0A 1Y9MA 5FY9A 3AZXA 4Q4Y3 1NA1C 2BPA2 1CPNA 1H30A 2GC3A 3PU3A 4L9BA 4QPWA 4UW6A 5FK7A 3AXDA 4PT6A 1VMFA 4CCNA 4YM3A 4QKNA 4Y1UA 1NAEA 2Y6LA 3VZNA 4XJAA 2QQNA 3IAPA 1BYHA 3GF6A 2DUQA 3ASIA 2ZX2A 4A41A 3OUHA 3GHNA 3ZYBA 1ZZ8A 2PAEA 4HPKB 1JU4A 4LOSA 4XJZA 4CXXA 1XJAA 1W6OB 2VGDA 5FLJA 4QGMA 5FP8A 2VM9A 3THCA 1ZBE1 1QOOA 1UY0A 1G9BA 5I8SA 3VGIA 2R1DA 2ZX4A 4H55A 3N7LA 3ACLA 3NV1A 5FXVA 3SHRA 5H9PA 1UOFA 2WLPA 1AHSA 1TMF3 3ZYGA 2E6VA 2RS53 4KNCA 1W8OA 4P9XA 2A3YA 4Z82A 1O8PA 1CZSA 1POQA 3K3OA 3ATGA 4S2DA 1K45A 1RUD2 3OF1A 4W65A 4AFAA 2ZEYA 4QD2A 2EIEA 1R082 2BVBA 3WP6A 5FAXA 2HWC2 4GMP1 2CAUA 1FATA 1UU6A 3KGLA 1OKQA 4FPHA 2XJUA 3JCIA 2R072 2WZR3 2UY9A 3DKQA 1GQHA 1AX1A 1BHGA 3WNKA 2YBSA 1PZ9A 1TMF2 1I6XA 1RUC1 2XJQA 1GZTA 1PNFA 1REFA 2QE3A 1HXS1 5AC93 5BNPA 1E5IA 4AHXA 5JOWA 1GWMA 1W9YA 2XJRA 1BLZA 2XXZA 3Q8AA 1ZA7A 2ZGRA 4CDUC 3UNPA 5GLUA 2VZUA 3C7GA 4MO3M 3RYRA 3GYDA 2Y6FA 2WNVC 2PXJA 5A3WA 1U5YA 3NJZA 2L9LA 2A6VA 4J1WA 3AMQA 4JDMA 4XHBA 4Q8KA 4EROA 1W8TA 2ATFA 5JPNB 1F2NA 1QJX1 1DGRA 1EUTA 3FUOA 5KHIA 2WA4A 2GC1A 3FE5A 5EQUA 1H1AA 1SEFA 4QPIA 5FBZA 1O4YA 3RMXA 3WW4A 5A6XA 5ISLA 3WX5A 2HWF1 1W6QA 4EV0A 1MS0A 1V6KA 2RS33 1PGL2 5GLVA 1UZVA 4XMAA 5JXHA 1W6NA 3ZFEC 2WT1A 4RHV1 2PHDA 1RHI1 4XFGA 2AACA 3JQWA 4Y5SA 4YW4A 1LHUA 2VO5A 4JGZA 2K2SA 5F6LB 4ES8A 1V9U2 5IJRA 2PYTA 3ITQA 4XOGA 4C0HA 3GCXA 4KH9A 5L7OC 1SLIA 2MNGA 1ZX5A 3PVEA 4WZCA 5EP9A 5A7WB 3RGBA 1UNBA 2JB4A 3JUUA 4EN6B 2J1TA 1OUXA 1RVF1 1XE7A 4R9BA 1GP5A 2QDNA 2D6KA 4XTPA 5CU1A 3BUCA 2XG3A 1UX7A 2PELA 3J8F2 3UESA 4S2GA 5IFTA 2DTWA 1U5XA 2WFF1 3RPQA 1ULCA 1C4RA 1OD5A 2O0OA 5C9AB 3FFZA 4IE0A 4JKKA 4RYDA 5DAQA 4BMBA 5F5QA 1W8ZA 1W2AX 4DFSA 1RVF2 4NRMA 1AF9A 3M3CA 3NKGA 1HRV2 4AFBA 1K42A 2H0VA 2DVGA 3I2IA 1H2NA 4NRQA 2ARAA 2A73B 2PHXA 2CHHA 1WA4A 3D0SA 3EYPA 3W20A 2D98A 1H8TA 1OC1A 3QH7A 3WDVA 4A2UA 4IV1A 5LK5A 4OVEA 2RJKA 2TUNA 2W1QA 2XUEA 4LBKA 5FZLA 4YFZA 4AXOA 1KRIA 3WP5A 2Y6HA 4DUXA 1FV2A 4OI1A 4A6OA 3W58A 1RTVA 1IS3A 1RVF3 4WV8A 1Q8PA 1QJX2 3SH5A 1YIFA 1O3TA 3ZKYA 4C0BA 3OY8B 3JQXA 1JZ5A 1ACCA 2AEYA 1JW6A 5C8CC 4CPBA 3AKSA 1H0BA 2I2SA 1OH3A 2OUHA 2YB7A 4MV2A 4D6RA 5FWJA 1ULPA 3I59A 3OUIA 5AFBA 3OEAA 1OPMA 2DBIA 5FJHA 4I3GA 4CEWB 1GSLA 2CWSA 3MFCA 1EUUA 1RYYA 3ES4A 1F31A 4YNIA 3AKTA 5A32A 4LPLA 4CU7A 1CPMA 2YPDA 1X33A 3GZEA 1UU5A 4AI8A 1V00A 1X8EA 3THDA 4ZU4A 1C8M3 1FOD2 1IPKA 5FY8A 1RUH1 4ARXA 2QNKA 3UK9A 3UKNA 3HNBM 4YRDA 1IPSA 1BKZA 1RUC2 2ZGUA 4XTMA 3ZSEA 1TG7A 2BZDA 3AYDA 3NKTA 4IE4A 2GC2A 4CCLA 1AL22 2BOIA 3R05A 3DEMA 4LQRA 2E32A 3USUB 2UY8A 1EPZA 1PK6A 4UT5A 3RZZA 3PHMA 2ET7A 3JZVA 3CBNA 4IE5A 4MADA 1GZCA 4XW3A 3KM5A 4ZU7A 5T52A 3N36A 4BM8A 3MLKA 4CRQA 3J26N 1PVC1 1RXGA 1FOD3 1E5SA 1CJPA 5JMOA 1GUIA 1VAMA 5A3LA 1O5UA 4XETA 5IVCA 3O1SA 1Y4WA 4DRVA 1N3OA 2XVKA 4YM2A 4ZS3A 3UJOA 1B35A 3VDDA 3DGTA 3ZFFC 3RZJA 4TLFA 1QQP3 2V09A 2Y26A 1KS4A 1SDWA 2RMU3 3OEBA 4KGGA 2LS6A 2VQUA 1VB2A 5A3NA 1GU3A 3H1WA 3GBWA 2MEV1 1H1IA 4LK6A 5A1AA 1SCRA 1RC6A 3WQBA 1AXKA 2XKOA 1J3QA 3ZSMA 4CCKA 3EJKA 2A7AA 4QXHA 1FPN2 3TRSB 2GNTA 1F5JA 4WBBA 3GNEA 4ZS2A 1L7LA 1QH7A 3NO8A 3H7YA 1UN1A 4Y20A 2BWCA 3WG2A 3WCRA 3TEZA 4YGDA 1PX3A 5JIUA 3WF3A 4ASMB 3X29B 1GYKA 1C8M1 1BZWA 1NLQA 2XJTA 4MGQA 5GZDA 2AENA 2D97A 3USSA 2YU1A 3IAQA 3WQ0A 2ILMA 1N1SA 1Q8OA 2YFUA 3ZN5A 4QM9A 2QKDA 1ND2B 4FO9A 3QACA 4IV3C 3A7QA 3TAYA 2XL9A 1V9U1 1LGCA 4HFSA 3PNAA 1WKYA 3K77A 1SG3A 3PDQA 3WF2A 4QU2A 3S57A 5FZEA 2EVXA 1B09A 2QQWA 2VUDA 1XNDA 3S5AA 3VD4A 1QU0A 3PLQA 4N43C 4N9HA 4ZU5A 4ASKA 5JSOA 1TVGA 2XUMA 4BQ4A 4QB1A 3GBGA 1S0CA 2VULA 4MVTA 1FOD1 2XJSA 4IV1C 1DQ4A 1DZTA 1UMHA 1F4AA 5D1IA 4HXCA 2A6YA 2XKPA 1EV13 3FUQA 2Q0AA 1RJ7A 2ZHKA 2W08A 1GQPA 1NLRA 2AH2A 3UKTA 3VBUC 2E33A 1GP4A 1Q56A 2WZ8A 3I97A 4BH9A 2FCVA 2WQZC 2RM22 2VNOA 3KT1A 4P9WA 1CIYA 2NMOA 2VJXA 1M06G 1ODNA 1W39A 4TLGA 1AR93 3AP4A 4CE8A 4I0BA 2GALA 4JKMA 5BY5A 4S2FA 3LEIA 4XQWA 4XYXA 3IPVB 2ZMLA 3A21A 3Q9OA 4GKXA 5FY0A 5BNNB 3ZXFA 3DPRA 4FVVA 1S4CA 1S0JA 2HLEA 2J1RA 1ENXA 1KD7A 1MS3A 4DRRA 1GOFA 2XWJB 2RM23 5H9RA 4INDA 3O12A 1X9PA 4IQPA 5C9AC 2WNUA 1UXZA 5FCCA 4NIAA 4JTNA 2VW0A 1TEIA 3GJBA 4QPIC 4XF0A 2W68A 4Z1VA 1NQJA 2JIGA 3T2TA 2XH6A 3U0ZA 3SH3A 2J1AA 2HYKA 2CNAA 3KCYA 3NAPC 1PMIA 1W0NA 1QJEA 1UY2A 2LUWA 2PMWB 3ZN6A 4JV4A 1XXNA 3ZX7A 4ES9A 4AG4A 2YDEA 3MGUA 2JG8B 4QQHA 1NQDA 5K9YA 2WS93 4M0HA 5L7OA 4E4HA 1JBCA 2BNMA 4GA9A 3RYKA 3P6BA 5FUIA 1I3HA 3HVDA 1JI6A 2D6NA 1SDDB 1WGPA 4UFKA 3S5QA 3J7MA 2DFBA 4IW3A 1I9RA 2YY1A 1DCSA 5DN2A 3THTA 3AZZA 2YUEA 3O1PA 1JTZX 2G19A 4CP1A 4GWNA 2V73A 4RFT0 3O7OA 2CYFA 5L9BA 3JD72 1W0PA 3IN9A 2CGOA 2MEV2 2D6LX 3C7EA 4XABA 4YG6A 5LY1A 1UYXA 3MPBA 5D2AA 2NP0A 4DUVA 4LBJA 4MOAA 4FI9A 4MGKE 2B39A 5CG8A 2K0GA 4OUEA 4Q29A 2W9XA 2YG0A 5GZFA 1ALYA 5HV4A 1Z0HA 4BQ3A 5IYYA 1ZYBA 4LBQD 2WWSA 4IEPA 2AGSA 3ZFFB 1GWLA 2ZJCA 4IESA 4HZFA 4QPGA 3U4SA 4AI1A 2E26A 3JD71 5BPXA 3E5UA 3T08A 2QQUA 3ZIWA 1NCQB 1ZNPA 5KHGA 4Y1XA 2HWF3 4LA3A 3ZXKA 5I91A 1OURA 1VMJA 2X8KA 3K4AA 4Q4X3 4QKFA 3AK0A 5FY1A 2FDGA 1AR92 1OHFA 2ZEWA 3AFKA 4AVTA 1LOAA 1O59A 2OT7A 2UYAA 3KLSA 1SFYA 4A42A 2LTNA 5LA1A 2JIJA 4BXSV 4AF9A 1JHNA 5KXCA 3PIGA 1O5LA 2XHNA 1OF4A 3T4VA 3GM8A 5IW0A 2A3WA 1VLNA 5KHHA 1AX0A 3B69A 4JKLA 3TN92 4XE9A 2RDRA 4EN0A 4XVHA 3D8CA 3N9QA 2HEVF 3M8LA 4RHV3 1UPIA 4P9JA 5FO7B 2QJVA 4F7ZA 2R16A 1E5RA 1XNTA 2XWBB 2B45X 4JRLA 2ES3A 5IK8A 1VRH3 2RV9A 4PQ9A 4A45A 4RGGA 2PAMA 4PDWA 1COV2 3CMGA 3DECA 1EPWA 4Q26A 3BTYA 3TEYA 2A1XA 4LHNA 1QJY3 4XBNA 1LCLA 4OHWA 1ZRFA 3NRUA 1IQAA 2XHKA 1LHVA 5GALA 3ZXEA 2YU2A 1OOPA 1V6MA 3FL7A 1CR7A 3AYCA 2BERA 1LOBA 4CU6A 5LA9A 1OMIA 1MEC1 1FI2A 2DVDA 2JD9A 1C1LA 3I2DA 4Y3OA 5FZMA 4RFRB 3WINE 4N43B 1QJU2 1REEA 1A8MA 3UGFA 1Z7S1 3VBOA 1JS9A 3URFA 2ZAAA 1BEV3 5ABJA 3NAPA 3APBA 4G9SB 5JXJA 2P1BA 5FZDA 2EIBA 3EQEA 4NVPA 3VBSB 1JU3A 2VTXJ 4K1ZA 1RUI1 2JKXA 4AI9A 4GWJA 1UZZA 3OPZA 3CO2A 2MEV3 1DIWA 1S0BA 1WLTA 2RM21 3N35A 3VBRB 4YZ4A 1D4M2 4KWKA 1DGLA 5C5UA 3O1VA 4NHLA 3LGRA 2C0ZA 2C24A 4ORFA 1MACA 5CIRA 3ORJA 4Y22B 4FFHA 1VBA2 2JDHA 2IXKA 4QB2A 2P3KA 4TZDA 4OHXA 4Q1PA 1PZ7A 5JDBA 4IV3A 4MLOA 3MZHA 3S6PA 3I49A 4GQ7A 5L19A 5FBJA 2JE8A 3NV2A 4CUAA 1VMHA 4FXKB 1R081 3OCPA 1C5HA 2C1FA 5FFOC 3VKOA 5JZGC 4C8DA 5IVFA 4OI4A 1KFXL 2ZGPA 3KWVA 5EJ3A 1WCSA 5F1RA 2BBVA 3OBZA 4BWOA 3MI8A 1HRV3 2ETEA 3RSJA 4D0QA 1QXRA 5C70A 5GZCA 3MUY1 3D82A 4L97A 4GB32 3T3YA 2ZEZA 4M01A 2DVBA 1OQ1A 1Y3TA 1CWPA 1GV9A 4XXAA 1VBC3 4Q4X2 4HBNA 1OSGA 1PGW2 3NNJA 5FWEA 4CPBD 4BK5A 5JAXA 2DVAA 2E51A 2VVEA 4LKSA 5C33A 4MHRA 3LOIA 3A4UA 4JX0A 4P9IA 1H6XA 4UAPA 3FHAA 2QCSB 4QHBA 1TNFA 2LROA 1CJDA 3V0AA 1QJU1 2DCYA 4QGLA 4FOYA 1RGSA 4QWNA 3SCHA 1JMUB 1FV3A 3PU8A 4BQWA 1TME3 1WZXA 4CUBA 1HRI1 1LHWA 1QJY2 1UU4A 3BALA 4UW3A 5CG9A 1HQLA 3POJA 1H8TB 3QOPA 1W28A 2VCBA 1IS5A 2VQAA 3LDRA 4XIOA 1LOFA 3MF9A 5F3CA 3S7EA 1NCRA 1YNAA 3VUOA 5A33A 2RR12 3OTFA 1RUE2 2QFEA 4GMP0 4LULA 4FT8A 3LE0A 3DN7A 5TSWA 3K48A 1CX4A 2ERFA 3M3QA 1GMMA 1ND3B 2WJSA 1JYIA 1LEMA 2QQLA 2BTVC 3KZ4C 1DHKB 3MIHA 5GZGA 4AHYA 1SBEA 1W6PA 2IZWA 3CHXA 4LKDA 5D21A 4LE4A 3SKJE 1DBNA 4DQAA 4LNVA 3KB5A 3GDBA 5FK8A 5LRRA 1JZ8A 4A44A 2R062 4RS5C 1XYNA 5FYCA 4AEMA 1JZ7A 3ZOIA 3BB6A 4NHKA 1XC6A 5T54A 4HVQA 5ERLA 2GMPA 1YQCA 4E4SA 4MHUA 3VBSC 1S0DA 1GBGA 1SZBA 2WNOA 1AXYA 3ZN4A 1JZ3A 3ZXAC 2VW1A 4ZY9A 2R6QA 4I30A 4XFHA 5KHKA 5AVPA 1V0AA 2OYZA 1O3QA 1DYPA 1VE0A 3RZKA 4ZZ8A 4X8PA 4ATFA 4HLTA 2ARXA 4PIYA 1CIWA 1RHI3 4QX3A 4YLZA 1QY4A 3JXSA 1LESA 3WOGA 2C26A 1O6UA 3S7IA 2X05A 2EALA 1EV11 2Q1MA 3GXUA 4MXWA 3SQOA 3ZXLA 2ZX3A 4QT6A 3CJIA 2A71A 3ZMNA 5GZEA 5BUVA 1A78A 1WW6A 4QAWA 1IQDC 5CVRA 4YYOA 4BHPA 3POWA 2FD8A 4XFBA 4QKBA 1ASJ2 1RL3A 1ULGA 4UW4A 4B1LA 4FPOB 1VBA1 5APAA 2K9ZA 2V5DA 3I3QA 1STMA 1WLCA 3JB4C 3R6SA 1PVXA 1RUF3 3T2PA 3V56A 4DY5A 1CGPA 2BEOA 4K8FA 3ZXJA 4YZ1A 1H1MA 3AJZA 4MH0E 2WSVA 3SKVA 4R9CA 1IGOA 1BBT2 2JDPA 1YO8A 4Q4V3 5FYTA 3N7MA 4XHXA 4K8RB 3ABZA 4UF0B 3WHTA 2DFCA 2FQPA 2A70A 1RIRA 4OULA 1UZYA 2F4LA 3AMPA 4LA2A 4JHTA 4R4XA 2ZGMA 1VBB2 3BU7A 4URTA 5DG1A 4AEJA 1C28A 1H9PA 2ET1A 1VBD2 1YQ8A 4GMP3 2W5FA 4E4DX 1W03A 2QQIA 3E6BA 5FP9A 5T5OA 3V0BB 3HOBA 3ZPOA 3KHBA 4QPGB 4XJ9A 1NCRB 3VDDC 5CADA 3RWKX 3CKHA 4RHV2 1F8VA 5CZKA 1PO22 1NT0A 1WD4A 2BFUL 3NVCA 3MUZ1 3UL2A 3WDXA 4DOUA 4DO0A 1WWYA 4QKDA 4CCDA 1AR82 4YW2A 1OLRA 5FYMA 2Y8KA 3IBMA 2OIIA 1XSRA 4XBLA 3JBG3 1VBB3 2G4IA 2ENRA 1OUSA 2Z4FA 1OOPB 3PURA 3BTAA 3KHCA 4ASLA 3HIFA 2B9VA 2QVSB 3GBFA 2O8QA 2OQ7A 4BE3A 3J8F1 2J1UA 4BISA 4M3CE 2GZWA 3BTZA 2WL1A 1T6GC 4NHYA 4Q0SA 3BIEA 4B4QA 3D5OA 3D3AA 5ANQA 1QGLA 2PHFA 2VQTA 1CAXA 4X6QB 5F5AA 5FREA 4AAXA 5A1FA 3ACGA 5BXXA 4QPIB 2FDIA 4R9DA 2Q8OA 3B3QE 1BEV1 4JZRA 3ILNA 1C5IA 4RS5A 3VKNA 2VR4A 2BW8A 3HAGA 2BU9A 1T2XA 2VMHA 1YCIA 3H0OA 3ZFFA 4COZA 2CGPA 1UO9A 2J22A 2E7TA 4LTAA 4KWJA 1A8DA 4AVBA 2FHRA 4V2WA 2W87A 1D4M3 3VL8A 2WNUB 2OXBA 4D6SA 3JBG1 5JMCA 4AVAA 2JDYA 1WD3A 2ZHLA 4OUSA 3ZPYA 3J7LA 3ZYHA 5L36A 1ND2C 4IV3B 2IXJA 4IUGA 5DUVA 5FLHA 1RUH3 1EV12 5A3UA 3N9PA 2Y0OA 3KQRA 1NUKA 2BBAA 4CU8A 1KFUL 1OLQA 1RUJ3 1LGBA 2DU0A 2YC0A 3MLJA 5FZFA 3KQ4B 1V70A 1HXS2 2VXJA 3PVNA 1UIKA 3IMNA 2DF7A 2VUAA 1MEC2 5DZEA 2YXSA 5EIYB 1KJRA 4YW5A 2WWJA 1W8WA 1LHOA 4S2HA 3W21A 1ULDA 1PIV1 1OLMA 5CFCC 2JWPA 1O3SA 3WQ1A 3IMMA 3O1UA 2J42A 3WXPA 4D8MA 4BDVB 4FOVA 2ZACA 4LBQA 4NIIA 1H8VA 4IL7A 2OPKA 4NN0A 3U10A 1RUD1 5FP7A 4WM8A 2ZOEB 4QQOA 1VP6A 3CQOA 2QQMA 3B00A 1MS1A 2VZ3A 5HCHA 3A22A 5BNOC 3POSA 1IHMA 5FKBA 2BYVE 2GAUA 2RS12 3CEWA 4HMZA 1D2QA 1DLLA 1UOBA 2VBPA 3ON7A 1JYWA 1S0GA 3FJSA 3IDEA 1NCRC 4DEVA 2GN3A 2BFUS 1OVSA 2W95A 3TB0A 1OLME 3NWKA 3VZOA 1ZZ7A 1GOHA 1W3XA 4M0NA 2DCJA 1V6IA 2KD7A 2XR4A 1OD3A 4XXPA 1JOPA 5CKNA 2NYYA 3C3VA 4PLNA 3WLUA 5L7OB 5E16A 5C5TA 5CISA 1W9FA 5I93A 1KDMA 1AYN2 1LOCA 3PTRB 1VRBA 2WYFA 4V1PA 2OVUA 1SBDA 1DYKA 4M4PA 4C91A 4OLLA 1W9TA 2ZABA 1R091 2GN7A 2P2KA 2K46A 4FQ4A 3OBTA 2R7EB 5EJ1B 1J3RA 4BPZA 3LFIA 3WT3A 3C8XA 1AUYA 1YJKA 2A3XA 5FQ0B 3VBFA 4BXFA 2EIGA 2XBO2 3IZOA 1Z78A 5CFDB 3AZWA 2QBXA 2HJIA 2VZTA 4K3UA 4HK8A 3VD5A 4KWLA 2CWMA 4QHZA 3PJYA 1NE4A 1KGYA 1NKGA 2BRTA 4CYDA 3KT4A 1AR71 2X5IC 2PHRA 4CDWC 3VKMA 2HBTA 4BMEA 2FZ2A 4FTBA 3ZXGA 4BQXA 2XJPA 3AC0A 1MS5A 4IEWA 4AQTA 3FHIB 2V4VA 5FOJB 5AC91 4ZONA 2W1SA 4GZ9A 5F2SA 3OUJA 4OHVA 1CX1A 1XE0A 3IB3A 5GM0A 2A6WA 3RYPA 4O7XA 5FZGA 5LK7B 3BI3A 3QBQA 1LULA 5DABA 4RN5A 2LW8A 3H1MA 3K51A 1AR63 1K3IA 4XF4A 5LZ6A 4KG0A 2TBVA 3LKJA 2WS91 4IEQA 2FCTA 1MZFA 3LEKA 1POV1 2VUJA 3AL6A 3OG2A 3QCWA 1AYM1 3PUAA 5JSRA 2AC1A 1UY3A 5A7OA 3WW1A 4XUQA 4D94A 1UQXA 5IWFA 4XJWA 1BK1A 2JDZA 2RS31 2WO2A 1DQ2A 4CSWA 1MQTA 1Z7S2 2WNEA 3AMMA 5EV7A 4W50A 4BQ5A 5GLWA 4X8NA 1R1A3 5JZGA 3FX3A 4NHXA 5DMYA 5CFCA 1BBT3 3ACIA 3MBWA 4Q4Y1 3ST7A 2IC1A 1LR5A 4L0PA 1RMU2 3AP9A 1BMV1 2R0FA 4QHOA 2DUOA 1JYCA 1WLWA 5ACA1 1UXXX 1AYM2 1UOJA 4ZZ5A 3VN4A 1UL9A 4MGYE 2ARBA 2YYOA 1SMVA 4LHLA 1O4ZA 4MSVA 4TWTA 4CEYC 5FO9B 1QKQA 5IVJA 5BNPB 3I2GA 1R1A1 4MGIE 4EWDA 2TNFA 1ODMA 2ZHMA 1WUVA 1X36A 2F6BA 2ZTNA 1PNGA 3MYXA 4Q8LA 2D3PA 4NR1A 2LALA 4UBGA 5KC6A 1RMU3 1DU3D 4GIQA 3HQXA 1G9CA 3RWNA 5JR2A 1HV0A 2WAOA 2RR13 4UFJA 4I01A 3T0BA 1PX4A 3AVRA 4GH4A 5BYNA 3ZMOA 1UYPA 4DXRA 3ZIXA 1Y7BA 1JYVA 3MV01 1UPSA 3R4DB 2BWAA 4BQ1A 1GICA 2NLRA 4XAAA 4FPKA 1NA1B 3P5BA 3FLPA 2E9QA 1YUDA 4JGZB 4B29A 1SLTA 4Y1VA 4QGNA 4URAA 4FAGA 3NL1A 2G9GA 1IS4A 1RUG3 4KU8A 4HSLA 4HKOA 4YFWA 1DDLA 4H2AA
chains in the Genus database with same CATH topology
3WZ1A 2ZGQA 1ZRDA 4H7MA 5KC5A 1CAVB 1UCXA 4BLJA 2V5YA 4FPFA 1HRI2 1QJY1 1SCSA 4RL7A 5EZWA 1K5MB 3SISA 3HR9A 4LBLA 3VBHB 3VDDC 4EN7B 4G4FA 1GNZA 4Q4V1 5FLIA 2BNNA 4WVMA 4FBFA 3WNXA 2WNVA 4RR3B 1N1TA 2R32A 5JVVA 2VECA 4O9GA 1SLAA 5B2GB 2PHUA 3OBRA 1N3QA 4ATEA 1PGSA 4LBNA 4AFDA 1RB8G 3WDUA 2XVLA 1CONA 3B02A 1LODA 1O3RA 1AR73 3PVOA 4MGZE 3KMHA 3U4XA 4CZSA 5KXEA 1M4WA 4W6XA 4K20A 3FLRA 3POYA 4AVCA 4COUA 4F83A 5I8TA 3R0RA 3WP4A 2UWBA 1YFUA 4PLOA 1QXPA 3IIAA 4PDWB 1DFQA 3TN93 3E6CC 1ND3A 2I45A 4EWAA 3HT2A 4LT5A 2P3IA 1BEV2 4Q4Y2 2OA2A 1AR72 4RGAA 2AZ5A 5CA6A 3BPZA 4OHYA 1JH5A 1BVVA 4FPYA 4CTEA 1EYBA 1PO13 1COV3 1C3HA 1I5ZA 4MYEA 3L2HA 1YRZA 2E7AA 2JE9A 2HEWF 2SBAA 4K1YA 3T1MA 2P3JA 4W6WA 3AP5A 1ULEA 1LTEA 1XYPA 1NXD1 2WFF3 3J9SA 2FZ1A 1Q8QA 4UW5A 1MS4A 1D4VB 2ZX0A 3N7KA 4FTEA 3AX4A 1MS9A 2RS52 3B93A 3MICA 3OJBA 1UD1A 3NW4A 1ZRCA 1NY72 2ZGSA 2D3SA 3LSDA 1ENQA 3WY6A 1DGRN 4KGQA 1S0IA 3NV4A 1PO11 1FXZA 3AKPA 1OFNA 3AKRA 1G9FA 5HI0A 2R041 5I0TA 2Q4SA 4RQPB 4CP2A 3ZFGB 3ME2A 1YFYA 2CY6A 1X82A 1RUF2 1NCQC 2WFPA 2IFWA 5GLTA 1V9U3 4H14A 4Q0QA 3WD5A 3OD0A 4CDQC 4G3YC 1CAWB 4Q4V2 2VH9A 1RUOA 4AVVA 4Y22A 4IEZA 5IK5A 5J48A 4Q2FA 2PLV1 1H4GA 3RI8A 3VBRA 3LZZA 2VU9A 4XF3A 5I0RA 4Q4W1 1IS6A 1RUG1 4BIFA 3D6EA 1OPOA 1FNYA 1BJQA 2XVGA 3B01A 1QNWA 2HWD3 4IETA 4COYA 3WP3A 1B35C 1MQTB 3ROUA 5FMOL 2I74A 5I0UA 1YYNA 3IDBB 2VNGA 2XBO1 2Z42A 4DPNA 2OZ6A 1R1ZA 5JCTA 3JBG2 5K0UC 2CAVA 2D7FA 2WIIB 3AB0A 5C4WB 4QPGC 5J3UA 2RMU1 4Q0VA 2PN5A 4C1XA 4D69A 1PZ8A 2AREA 3IPVA 2ZKLA 4FP3A 3LAGA 2XBO3 4B7EA 4WZFA 1YI9A 2D6PA 4FP2A 2XLFA 5CFCB 5JPMB 2HWE2 3GZUC 4YM1A 2D93A 4QX5A 1AZDA 2DURA 2X29A 4HETA 2LM3A 1MZ5A 4XZPA 1RMU1 4PBOA 1ZBA3 4WVZA 4L2NA 4Q0UA 1FNZA 2VOXA 2F4PA 1KITA 2D5FA 2ZHNA 1H9WA 4GWMA 3WG3A 3UKVA 1VBC2 1S2BA 1PVC3 3CL1A 3I8TA 1LU1A 2JG9A 4JCKA 4JGYB 4YG3A 5E1RA 4F8AA 1AXZA 1W6OA 2GMEA 3V65A 4GH4B 5I8YA 3U07A 1DQ6A 1FMD2 5T55A 4JDOA 1K5MA 1PK6C 1HV1A 4HN1A 1H4HA 1WW5A 4WVMB 1CAWA 1ULFA 5DUUA 4M3CA 2X5IB 3U11A 4CDWB 4XBQA 1PHMA 4AE2A 1JN2P 3ENRA 5C9AA 1RUF1 3E5QA 5J98B 1SLBA 1ND2A 5DDJ3 1EAH1 2QUOA 1NOVA 1DF0A 1WCKA 4Y24A 3VBRC 1FMD3 1KXGA 2D40A 2ZGOA 3TBDA 3AZYA 2KA3A 3ZFGC 4U2AA 3SH4A 4U36A 3JU9A 1GZWB 3SITA 5FRAA 2ZPXA 5D8AC 5DDJ2 3RDIA 4IEYA 1AJOA 2QQPA 5C6CA 1UMZA 4Z2WA 3PMSA 4IXLA 4QMAA 4XQ4A 4H7LA 3KT7A 1XRUA 4WM8C 1WCDJ 1WMFA 2BQPA 1G7YA 5DDJ1 2XB6C 4D3WA 2O8OA 3ALQA 3D4KA 4A7YA 1I1EA 3SMHA 1FX5A 1S0EA 2Z5WA 3E6DA 3H3ZA 3AYEA 5HXVA 3RS6A 1QJX3 1W2UA 3GALA 1YJLA 4AVSA 2WZPP 2JKBA 1QDOA 4DS0A 4YARA 1RUD3 2B9UA 4P14A 4I02A 2PFWA 4YZ2A 3VBHA 3VBOB 5C4WC 4J1XA 5CBLA 3VL9A 1PIV3 1WMDA 4UBHA 4AGRA 4F3JA 2E63A 3JD73 1Y43B 1C8M2 3LCPA 3IM0A 2NPIA 2JE7A 4ISQA 3PMEA 3THPA 5E88A 2AYHA 4UXAA 2EAKA 4QPYA 1SFNA 2RJLA 2GNBA 3IKWA 4SLIA 4XFFA 1SLCA 1HIXA 5H9SA 5DZGA 3R4SA 4CDUB 1PK6B 2RE9A 1VBC1 4FPJA 4M3CF 4XEZA 1ASJ1 1HDKA 4GKYA 2Q1ZB 3M3IA 2RS13 1CAUA 1BCXA 2XGXA 4COVA 3HD8B 4XF9A 1DGWA 1QH6A 1QQP2 1MEC3 3MIFA 2HWE1 4BLIA 1ENRA 2HKXA 1J1TA 3O14A 4JVAA 2B42B 3TOJA 1RUJ1 1EAH3 3WUDA 4XFAA 4CEWA 4YGCA 3N7JA 4LO8A 4RA0A 4ONUA 5K7PA 4WM7A 1DQ0A 1URXA 2PTMA 1QXJA 3VHPA 4W6YA 1XU1A 2WNVB 4RR3A 3JB8A 4HKWA 4HPKA 1H2MA 2JX9A 1ZBE3 1C57A 3FFQA 1V6OA 5IUQA 4HN0A 3G6JB 1NG0A 2FMDA 2GH8A 2UU8A 1IKPA 3HT1A 5SV5A 3WQ7A 5JI9A 1LECA 1WBFA 3DPRB 4CDXC 3ZSJA 2IFRA 3FZ3A 3RMYA 1MR5A 3SNMA 3RJRA 2WKKA 3M2MA 3TNPB 3N4MA 2QZ3A 1VR3A 1W6PB 2NN8A 3QLQA 4L8QA 1GQGA 5IT6A 3ZO0B 2JECA 1Q8SA 2GH2A 2HWE3 1GANA 1R083 1SACA 2E7QA 4E2QA 1KJLA 3ZYIB 3I54A 4K40A 1NXMA 2HWB3 5BNOA 3NV3A 2B5HA 2N7GA 3ZYJB 1IPJA 1ZM1A 5SV8A 4P9LA 3KD4A 4AHWA 5C8CA 4OI2A 4FTSA 3FBYA 1WW4A 2NMNA 5JI7A 3HN1A 4HL0A 4LBMA 5CFDA 4B4RA 2XL7A 2EXKA 1K5MC 2DCZA 1VAKA 3HMYA 4Y1ZA 1EY2A 1GZ9A 2YV8A 1S1AA 5FOBB 4FQZA 4GALA 3O0VA 1HLCA 4FAHA 5FQ0A 5IK4A 4AQSA 1EAH2 1RUE3 2HWC1 3IT8A 1J1LA 4LE3A 4WVVA 1PGL1 3P3NA 2YGLA 3ZN6B 2W0XA 2XJVA 3VBOC 2Z69A 1O7FA 4LR4A 1SLLA 1C8NA 4P5HA 1LOGA 3TYJA 3M70A 4LLOA 4CDQB 4MX3A 2R1BA 2KXLA 3M3EA 1MVQA 5LEJA 2MHFA 3B5LB 2DVFA 4LO6B 3BOWA 1D0GA 1AYN1 2JG8A 1R092 3MLLA 1X8MA 4O9EA 1OQEA 5HCAA 4I0AA 1G86A 3DV8A 3E97A 1TMF1 3VZJA 4WM7C 3MIGA 4B7KA 4AW7A 5H9QA 1ND3C 4YW1A 4IV1B 1XYOA 1DG6A 1UKGA 4JQRA 1GLHA 2ZMKA 4P9YA 5F6KA 2Z79A 4Q4X1 3MEPA 1VAVA 4PCRA 3J4UH 1H8TC 3CU7A 5K0UA 4IERA 4IEOA 1RUC3 2OZJA 1RUE1 5JWPA 4N53C 1B35B 1MQTC 1DQ1A 3VHOA 4Q0PA 4YM0A 4LBOA 3ZDSA 3I59B 1JUHA 2I07B 3MW2A 4GB33 4FSJA 3TN91 5DUXA 5BNNC 2A6XA 5K8SA 4Y26A 1CVNA 4JAAA 5L73A 4AEDC 1J3PA 4PIZA 1HXS3 1QMJA 4QQPA 1Z7S3 3CF6E 5ABJB 2IXCA 2KM2A 3HBZA 1ONAA 4HT1T 3WHUA 3MF6A 2W39A 4AI3A 3E5XA 3WDYA 1RITA 3H9AA 3W9AA 1IKQA 4Q4W2 1WW7A 4R4ZA 3V0BA 1AL21 1S0FA 4LEJA 3B9CA 3CJIB 2VG9A 2X53S 2DCTA 2WT0A 2RS51 4PLMA 4AK3A 2DYCA 5KHJA 4CDQA 1ENSA 1KQRA 3NAPB 3H8UA 4X6RB 4XDQA 2VPVA 3VBSA 2RMU2 4BA6A 1ZZBA 1D4M1 4YG0A 1VBE3 4E9KA 3WG4A 2WS92 1GFF2 1AVBA 3B7MA 1VBD3 4R8HA 4QXKA 3FC0A 4AGGA 1LB2A 3LA2A 2PLV3 2OUJA 3UJQA 3ZFEB 1V6NA 2VQ0A 1Y9QA 1LGNA 2DV9A 3VBFB 3A0NA 4N53B 2DCKA 1FPN1 2WC2A 4RS5B 2ZZJA 1RUNA 1BMV2 1S2KA 1LHNA 1NY71 5J36A 5ACA2 3DF0A 3OGGA 1RUG2 1LRHA 2CTVA 4DINB 1RUI3 4XFCA 4XFIA 4COWA 4IEUA 4QM8A 2CGNA 2E53A 4DNYA 2PA7A 2JEMA 2GU9A 1MZ6A 2P37A 3CNAA 4N43A 3ZXDA 5EWSA 1ASJ3 1JXNA 2ZBJA 2RS11 1VBD1 4YVSA 5J96B 4L99A 5E8AA 2MPFA 5J7MA 3H7JA 1ZRRA 2ZGNA 1LU2A 2R073 2WZR2 4CEYA 2PAKA 5GLZA 1TQ5A 1U5IA 4XF1A 3GZTB 3MIDA 2WQ4A 4LHKA 5KWRA 2PHWA 1CAXB 5BNNA 4EN9B 3KCXA 4BIOA 4K7JA 1LENA 3M4FA 3VV1A 1JOJA 4N9IA 4JGYC 4YVWC 1VALA 4B8EA 1BQPA 4DY3A 4GH4C 3LA3A 2C5DA 2VOWA 3HWJA 4HANA 4LUMA 3RQ0A 3USUA 3OYWA 1UW8A 2ZGKA 3OD4A 5JSPA 1G6NA 4JC1A 3GZAA 5FTTC 3IWZA 1GKBA 4FXGB 2WNUC 5BNQA 2GSYA 5EXOA 1VRH1 3O0XA 4QQLA 2EA7A 5IK7A 4K9SA 4PDWC 1HQNA 2B46X 2FMYA 3PTYA 1VB4A 3UV9A 4DXZA 4K6BA 1AYN3 4AHZA 2ZKNA 4B3NA 5F9TA 4PJYA 3CJXA 4N90A 2A75A 3MW3A 1PM7A 4KU7A 4OI0A 4K21A 1EP0A 1UF2C 2IXLA 1SBFA 2D6MA 5I0SA 1WLDA 1APNA 4NWVA 2R071 4R9AA 5D8AB 2Q30A 2QZ2A 2NM1A 3BOPA 3RJ2X 2ZGTA 5JOYA 5DXDA 5JZGB 1R093 1UIJA 1OA4A 4RQPC 1Q8VA 2D44A 3S30A 3VZKA 2WLQA 5FDBA 4C1WA 1VBA3 1TME1 2GNMA 2VNRA 1ZZ9A 4AFCA 4LO4B 2Z2SB 2OW4A 3MFAA 1PO12 1OFSA 2VVFA 3ZYPA 4ZXKA 5LRSA 1V6LA 1HQWA 1PIV2 4MXVA 4YGEA 3WVJA 3C2UA 4HSJA 4XJ8A 2DU1A 4YVSB 1UKRA 3VKLA 3AP6A 2W52A 4EN8B 3RI9A 3O0WA 4XILA 2HWC3 4XIKA 2HWB1 2NQYA 5CNAA 1HRV1 2ZZQA 3O5SA 2EAAA 1ZZCA 4Y4YA 4D7YA 4FCAA 4EWEA 2XPJA 5HBAA 1XQNA 4LO7A 1W6QB 3LB9A 1Q43A 1QOSA 3AYAA 2JICA 3P3PA 2AR6A 5FPZA 4CDXA 2BNOA 2R0HA 4M3CB 4FOQA 3WCSA 3SCGA 3L9JT 5K0UB 3WDWA 1AL23 4YZ3A 5A3MA 2R042 1AR83 5FO8B 3G7DA 2BVVA 3M1HA 4GXLA 4YVWA 2VW2A 3DKWA 1ZREA 1CESA 4JTOA 2DWRA 1OI6A 4Z92B 2DUPA 3WUCA 1H2KA 2Q5TA 5AVAA 2TEPA 3EHKA 2B8MA 3ILFA 1POV0 3TNQA 5JOZA 3OGJA 5BNOB 3M7AA 2JG9B 5J37A 2WA3A 4IEXA 3AMNA 3WG1A 4AQ2A 4L92A 3IDCB 2Y0IA 1XNKA 5A32B 3V64A 1NE6A 5C8WA 1AR81 1QHDA 1U0AA 5T5LA 1ZVFA 4YGBA 3INAA 2X5IA 4CDWA 5CB7A 1V6JA 4D7TA 5AFEA 4Y1YA 1XE8A 4HK9A 1RHI2 4LUKA 1LKNA 1W0OA 1D2SA 2R49A 4C90A 4FPEA 4D7SA 4EJRA 4RQPA 1PVC2 2ZCWA 4ZKTB 2R063 5HCBA 4YVWB 1QWRA 3VKFC 1X7NA 3VZLA 4E4ZA 1BBT1 3ZSLA 1VIWB 1AR61 3ETQA 3BODA 1VJ2A 1HX6A 2A6ZA 4FPCA 1YFXA 4YVSC 4I2OA 1RUH2 4N7IA 4NWWA 1G8WA 1JUIA 1REDA 2XLAA 2PHTA 4RSUA 3VHRA 3AXEA 3TWIA 1NYWA 1N3PA 1YXWA 1LJ7A 3QD6A 4Q4W3 2G9FA 3WDTA 3R4UA 2R043 2VOVA 1VRH2 4GULA 1QQP1 1X50A 2ZGLA 1YHFA 3W59A 2R30A 1XNBA 3M3OA 2JJ6A 1O4TA 1GNHA 1DQ5A 3VDDB 4QQ2A 1A6CA 1XNCA 3KCCA 4OZXA 3AP7A 1L3JA 1FAYA 1FYUA 1U12A 2D6OX 4XQDA 5GKAC 2QDRA 4AEDA 3H50A 3GHMA 3MW4A 2HEYF 3VBHC 2UWCA 3H3UA 1F9KA 2JG9C 2WFF2 2XLGA 4WM7B 3MPPG 3SLIA 2A5ZA 4LBQB 5JLVA 1KS5A 1UX6A 2YHJA 1C1FA 3BIWE 3FMGA 4WM8B 2GNDA 3KSCA 4I0WB 2WINB 4HVRA 1CQ9A 5DG2A 5JIAA 1GR3A 1FT9A 4CDUA 2JD4A 2VVDA 3H1YA 1Q3EA 1H2LA 1N47A 5GJ6A 3SXWA 3V0AB 1ZA4A 2WSUA 2B7YA 1IOAA 4MXWB 1CD3G 1QDCA 2BGCA 4A7KA 1Q5OA 5LEKA 2ZA9A 4NPRA 3PJQA 2EXJA 1S55A 4L11A 4NO4A 4TYSA 3CJIC 1J58A 4BZ4A 1G9AA 3OY8A 1HRI3 2AUYA 3FWEA 2H6BA 5KXDA 1BXHA 2ZX1A 2RS32 3ZFGA 3ES1A 1ZZ6A 4AEDB 4LO5B 1TNRA 2H0BA 1RJ8A 1OA2A 4HVOA 3CLPA 3T1LA 5D8AA 1PO23 1RUI2 1A3KA 4CEWC 4N7UA 4DB5A 2VOKA 2WT2A 4Z07A 2IXIA 4YZ5A 4IEVA 4I09A 3WW3A 4ITCA 3SCFA 1G9DA 4AFMA 4AYUA 1F5FA 4JDNA 4N53A 1W6MA 4RR3C 2DTYA 4P9GA 5FMOS 5HCFA 2PHLA 3AMHA 3ELNA 4RD7A 4OHZA 4KL1A 5J09A 4PBPA 1RUJ2 2GDFA 3AFGA 2Y38A 2UWAA 1COV1 1NA1A 1CN1A 2FBEA 1TE1B 3DUIA 3AJYA 4E27A 1W6NB 4KBBA 4AWDA 1LEDA 1FMD1 1UAIA 1DZQA 3A0KA 3MDPA 2YZ4A 3MIBA 4NOTA 3S0MA 1DGWX 1ZBE2 5C4WA 2IXHA 5EFUA 1YWKA 1FPN3 1YIPA 1N1YA 5T3NA 2VMIA 1NLSA 3KS7A 4XJUA 4CDXB 5C8CB 2GMMA 1WMEA 2CL2A 3NSTA 1PO21 4MZUA 3WV6A 1AR91 3J8F3 1LOFC 3LA7A 4Q1RA 1AJKA 1HKDA 2HWF2 5ACA3 5JOXA 4HKLA 1VBB1 2D5HA 1N1VA 3WW2A 3MIEA 3OYWB 2H6CA 5CFDC 2RR11 2D3RA 1RINA 3L2YA 1ZBA2 4YW3A 1AX2A 2UURA 3DPRC 1NCQA 1TME2 3VBFC 4FOWA 2BUKA 3BCWA 1YLLA 4XPVA 1OQDA 2HWD2 3AZVA 3EBRA 2CV6A 3WR0A 4AGVA 1CAVA 2R061 4LLFA 4SBVA 3VBUB 4E2GA 2P34A 1QJZA 2RHPA 3AM2A 2ZMNA 1QOTA 1AR62 5KXBA 4ISRA 4A3XA 2HWD1 1QNYA 3ILRA 3LWCA 1J59A 3FLTA 2NZ9A 3VZMA 3ZSKA 5T5JA 2D43A 3I7DA 5DZFA 1POV3 5BV6A 2VMGA 3N3HA 4BCUA 1E57A 2UYBA 3EO6A 4AI0A 3ZYRA 4JRAA 2YPJA 3RRDA 4KQ7A 1AL0G 1YI7A 1PGW1 1QF3A 4BOWA 2PLV2 4TSVA 1MVEA 4J6GA 4GB31 1KDKA 1LOEA 4JGYA 5FPXA 2WZR1 3VBUA 2VXRA 2ZS6B 1QJU3 4KG8A 1MZEA 4WVWA 4Q27A 1R1A2 1YFWA 4M00A 1IZ3A 2IWGB 5T5PA 2EXIA 3VHNA 1VBE2 2PQQA 4PIXA 4E2SA 2O1QA 2VY0A 4FPLA 4AQ6A 1SQ4A 4H3WA 4NHMA 4AEKA 3VLBB 4XMIA 1VBE1 1MS8A 5BNPC 4I3PA 5E89A 5A33B 1GZWA 2ZAHA 4PF5A 3B94A 4AI2A 2C9AA 4R52A 1NZCA 2YGMA 4META 4B4PA 1WBLA 2HWB2 3EXUA 4DMIA 1DZRA 3KGZA 3I4IA 5EYXA 1OOPC 2P17A 2SLIA 1HW5A 2JENA 1AYM3 4MUVA 3ECQA 4CEYB 5EYYA 5AC92 1OA3A 2EXHA 5DUWA 2JG8C 4OUMA 4Z8BA 5KBFA 3LOBA 1D0HA 3ZFEA 4Y20B 3DL3A 1XU2A 5JR7B 5ABJC 5T50A 1BVP1 4JGZC 2EF6A 3QH6A 4Y5Z0 1CAUB 1U5ZA 1ZBA1 4FPGA 3LSEA 3D0JA 3RNSA 1O91A 3FBMA 1W6MB 2GC0A 3B9IA 3AKQA 4A7ZA 2JXAA 2YROA 3PVBB 4YSFA 3ZVXA 4CP0A 2YMZA 3RG0A 4OFGA 3AZXA 4Q4Y3 1NA1C 2BPA2 1CPNA 1H30A 2GC3A 4L9BA 4UW6A 3AXDA 4YM3A 4Y1UA 3VZNA 4XJAA 1BYHA 3GF6A 2DUQA 3ASIA 2ZX2A 3GHNA 1ZZ8A 2PAEA 4HPKB 4XJZA 1W6OB 2VGDA 5FLJA 4QGMA 1ZBE1 1QOOA 1G9BA 5I8SA 3VGIA 2R1DA 2ZX4A 4H55A 3N7LA 3ACLA 3NV1A 3SHRA 5H9PA 2WLPA 1AHSA 1TMF3 3ZYGA 2E6VA 2RS53 4KNCA 4P9XA 4Z82A 2A3YA 3ATGA 4S2DA 1RUD2 3OF1A 4W65A 4AFAA 4QD2A 1R082 2BVBA 3WP6A 5FAXA 2HWC2 4GMP1 2CAUA 1FATA 1UU6A 3KGLA 1OKQA 4FPHA 2XJUA 3JCIA 2R072 2WZR3 2UY9A 1GQHA 1AX1A 1PZ9A 1TMF2 1I6XA 1RUC1 2XJQA 1PNFA 1REFA 2QE3A 1HXS1 5AC93 5BNPA 4AHXA 5JOWA 2XJRA 2ZGRA 4CDUC 5GLUA 3RYRA 3GYDA 2WNVC 1U5YA 3NJZA 4J1WA 2A6VA 4JDMA 3AMQA 4XHBA 4Q8KA 4EROA 5JPNB 2ATFA 1F2NA 1QJX1 1DGRA 3FUOA 5KHIA 2WA4A 2GC1A 3FE5A 5FBZA 1H1AA 1SEFA 4QPIA 3RMXA 1O4YA 3WW4A 3WX5A 2HWF1 1W6QA 4EV0A 1MS0A 1V6KA 2RS33 1PGL2 5GLVA 4XMAA 1W6NA 3ZFEC 2WT1A 4RHV1 2PHDA 1RHI1 4XFGA 3JQWA 4YW4A 1LHUA 4JGZA 2K2SA 5F6LB 4ES8A 1V9U2 2PYTA 4XOGA 4C0HA 4KH9A 5L7OC 1SLIA 2MNGA 1ZX5A 3PVEA 4WZCA 4EN6B 3JUUA 1RVF1 1XE7A 4R9BA 4XTPA 2QDNA 2D6KA 5CU1A 2XG3A 2PELA 3J8F2 4S2GA 2DTWA 1U5XA 2WFF1 3RPQA 1ULCA 1C4RA 1OD5A 2O0OA 5C9AB 3FFZA 4BMBA 5F5QA 4DFSA 1RVF2 1AF9A 3M3CA 3NKGA 1HRV2 4AFBA 2H0VA 2DVGA 1H2NA 2PHXA 2A73B 1WA4A 3D0SA 2D98A 1H8TA 3QH7A 3WDVA 4A2UA 4IV1A 5LK5A 4OVEA 2RJKA 2TUNA 4LBKA 4YFZA 4AXOA 1KRIA 3WP5A 1FV2A 4OI1A 3W58A 1RTVA 1IS3A 1RVF3 4WV8A 1Q8PA 1QJX2 3SH5A 1YIFA 1O3TA 4C0BA 3OY8B 3JQXA 1JW6A 5C8CC 3AKSA 1H0BA 2I2SA 2OUHA 4MV2A 3I59A 5AFBA 1OPMA 4I3GA 4CEWB 1GSLA 2CWSA 3MFCA 3ES4A 5A32A 4YNIA 1F31A 3AKTA 1CPMA 1X33A 4AI8A 1UU5A 1V00A 1X8EA 4ZU4A 1C8M3 1FOD2 1IPKA 1RUH1 2QNKA 3UK9A 3UKNA 4YRDA 1BKZA 1RUC2 2ZGUA 4XTMA 3ZSEA 3AYDA 3NKTA 2GC2A 1AL22 3R05A 3USUB 2UY8A 1EPZA 1PK6A 3RZZA 3PHMA 2ET7A 3JZVA 4XW3A 1GZCA 4ZU7A 3KM5A 5T52A 3N36A 4BM8A 3MLKA 4CRQA 3J26N 1PVC1 1FOD3 1CJPA 5A3LA 1VAMA 1O5UA 4XETA 4DRVA 1N3OA 2XVKA 4YM2A 3UJOA 3VDDA 1B35A 3ZFFC 3DGTA 4TLFA 1QQP3 2V09A 2Y26A 1KS4A 1SDWA 2RMU3 4KGGA 1VB2A 3H1WA 3GBWA 2MEV1 1H1IA 1SCRA 1RC6A 1AXKA 2XKOA 1J3QA 3ZSMA 3EJKA 2A7AA 1FPN2 3TRSB 2GNTA 1F5JA 4WBBA 3GNEA 1QH7A 3NO8A 3H7YA 1UN1A 4Y20A 2BWCA 3WG2A 3WCRA 4YGDA 5JIUA 4ASMB 3X29B 1GYKA 1C8M1 1BZWA 2XJTA 5GZDA 3USSA 2AENA 2D97A 3WQ0A 2ILMA 1N1SA 1Q8OA 3ZN5A 4QM9A 2QKDA 1ND2B 4FO9A 3QACA 4IV3C 3TAYA 2XL9A 1V9U1 1LGCA 4HFSA 3PNAA 4DZGA 4QU2A 2EVXA 1B09A 1XNDA 1QU0A 3PLQA 4N43C 4N9HA 4ZU5A 5JSOA 2XUMA 3GBGA 1S0CA 2VULA 4MVTA 2XJSA 1FOD1 4IV1C 1DQ4A 1DZTA 5D1IA 2A6YA 2XKPA 1EV13 3FUQA 2Q0AA 1RJ7A 2ZHKA 2W08A 1NLRA 2AH2A 3UKTA 3VBUC 1Q56A 4BH9A 2WQZC 2RM22 2VNOA 3KT1A 4P9WA 2NMOA 1M06G 1W39A 1AR93 3AP4A 4I0BA 2GALA 5BY5A 4S2FA 4XQWA 4XYXA 3IPVB 2ZMLA 3Q9OA 4GKXA 5BNNB 3ZXFA 3DPRA 4FVVA 1S0JA 1ENXA 1KD7A 1MS3A 4DRRA 2XWJB 2RM23 5H9RA 4INDA 3O12A 4IQPA 5C9AC 2WNUA 5FCCA 4JTNA 2VW0A 1TEIA 4QPIC 4XF0A 2W68A 4Z1VA 1NQJA 3T2TA 2XH6A 3U0ZA 3SH3A 2CNAA 2HYKA 3KCYA 3NAPC 1PMIA 2LUWA 3ZN6A 4ES9A 4JV4A 1XXNA 3ZX7A 4AG4A 2YDEA 3MGUA 2JG8B 4QQHA 1NQDA 5K9YA 2WS93 4M0HA 5L7OA 1JBCA 2BNMA 4GA9A 3RYKA 1I3HA 2D6NA 1WGPA 2DFBA 1I9RA 2YY1A 3THTA 3AZZA 2YUEA 1JTZX 4CP1A 4GWNA 2V73A 4RFT0 3O7OA 2CYFA 3JD72 1W0PA 3IN9A 2CGOA 2MEV2 2D6LX 4YG6A 3MPBA 2NP0A 4LBJA 4MGKE 2B39A 5CG8A 2K0GA 4Q29A 5GZFA 1ALYA 1Z0HA 1ZYBA 4LBQD 2WWSA 4IEPA 2AGSA 3ZFFB 2ZJCA 4IESA 4HZFA 4QPGA 4AI1A 3JD71 5BPXA 3E5UA 3ZIWA 1NCQB 1ZNPA 5KHGA 4Y1XA 2HWF3 4LA3A 3ZXKA 5I91A 2X8KA 4Q4X3 3AK0A 1AR92 1OHFA 3AFKA 4AVTA 1LOAA 2UYAA 3KLSA 1SFYA 2LTNA 4AF9A 1JHNA 5KXCA 1O5LA 2A3WA 1VLNA 5KHHA 1AX0A 3B69A 3TN92 4XE9A 4EN0A 3D8CA 4F7ZA 2HEVF 3M8LA 4RHV3 1UPIA 4P9JA 5FO7B 2QJVA 5CAZA 2R16A 2XWBB 2B45X 4JRLA 2ES3A 5IK8A 1VRH3 4PQ9A 4RGGA 2PAMA 4PDWA 1COV2 1EPWA