1OPMA

Oxidized (cu2+) peptidylglycine alpha-hydroxylating monooxygenase (phm) with bound substrate
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
310
structure length
310
Chain Sequence
NECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PROTEIN (PEPTIDYLGLYCINE ALPHA-HYDROXYLATING MONOOXYGENASE)
publication title Substrate-mediated electron transfer in peptidylglycine alpha-hydroxylating monooxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 70
structure length 310
sequence length 310
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 1999-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1opmA02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 1opmA01
1PHMA 3MIFA 3MICA 3MLKA 3MIBA 1YI9A 3MLLA 3MIHA 3KS7A 4R4ZA 1YJLA 1YJKA 3PHMA 3MIEA 3MIDA 3PMSA 1PGSA 3MIGA 1SDWA 1OPMA 4E4ZA 1PNGA 1PNFA 4R4XA 4QHBA 1YIPA 3MLJA
chains in the Genus database with same CATH superfamily
1XXNA 1CJDA 4B7KA 1FOD3 1XQNA 2BNOA 4WM8A 3WINE 4C91A 3I4IA 2XJVA 3PNAA 4P9GA 4XJ9A 4A6OA 5FYUA 4AF9A 3W21A 2XWBB 4J1XA 5C3RA 1MS3A 2Y26A 1OA2A 3B02A 2W52A 4SLIA 3ETPA 4XUPA 1MEC2 1VAMA 3PDQA 4RS5A 5FO9B 5I8TA 3VDDA 3LDRA 1UMHA 3KB5A 2RJ2A 4JZRA 3WEZA 4GB31 5EYYA 1KRIA 1COV2 2E51A 1M06G 1UIJA 1ASJ3 2JB4A 3N7LA 3WW3A 5IK8A 1AYM2 4BK4A 3H0OA 4M4PA 3GYDA 1LODA 5FPLA 2MEV1 4WVZA 5JR7B 3AKPA 3LPGA 3ZYIB 4RR3A 1HDKA 3WF0A 5I0RA 4B4PA 2AC1A 4FT8A 5CFCC 1W6NA 4X6RB 1E5IA 4XDQA 1PO12 2D7FA 4BDVB 2CYFA 2YC0A 3DEMA 3KT4A 4YNIA 4CXWA 5FKCA 5I93A 3LOIA 2RS32 5CKMA 3ZKYA 1HV1A 3KVAA 3TEYA 4UW3A 3K4AA 2CNAA 3UGGA 2DTYA 3VDDC 5KXEA 4OFGA 4HZFA 4MHUA 1DCSA 4AAXA 3FN9A 4WV8A 3RVHA 1RJ8A 1XJAA 2BBAA 2WKKA 4L9BA 4N43A 4P00B 3R0RA 2RS12 5FQ0A 3O1OA 3U37A 4GKYA 4FXGB 3IBMA 3DF0A 1XE0A 3U4SA 1O7FA 3J8F2 5A3WA 3G7DA 4MXWA 1W0OA 5A7WA 4JKKA 5FBJA 1HRV3 4YVSA 4ZU5A 3ZFFA 1VBA3 1W6MA 3OY8B 2C5DA 2EIGA 4AI3A 1JMUB 3J7MA 1TMF3 1KGYA 5EFUA 3ZIWA 1VBB2 1VBE1 3GALA 1X8MA 1ZM1A 2B4KA 2ZKLA 4GQ7A 4KI5M 3U11A 1ULCA 2BFUL 1QHDA 1PGW2 4M3CA 3NNGA 5KC5A 1MZEA 1S2BA 1CX1A 4N43C 1LTEA 3VKNA 1OUXA 3WF3A 5JOWA 1WLDA 2PHUA 2P17A 2Q1FA 2VBDA 4NJ4A 4LO4B 1UKRA 4A41A 4GH4A 4ZPIA 3MF9A 4P14A 3QBQA 2WAAA 3H7JA 3ZYPA 3VD5A 5GZGA 4YVSC 5FP7A 3ZFFC 4N90A 5FZKA 4B3NA 3MIBA 1B35A 3VBHA 1OKOA 3AMPA 3MLLA 4Q2FA 2FDKA 1JUIA 1RHI1 3ZFGA 5A6XA 1X8EA 5FPZA 3RYKA 2D6KA 5DDJ3 1JW6A 1YJKA 2BGOA 4CEWC 3D0JA 4YGEA 3OBTA 4W6YA 4DZGA 3WDUA 2HWD3 1ZBA3 3VHRA 4XUQA 2G9FA 4MH0E 4Q4Y1 4XFCA 5FP8A 3PJYA 1UU6A 1RUC2 3BALA 4ZY9A 2V09A 2HWC2 3KMHA 4A44A 4DXRA 4GH4C 4N9HA 3GZEA 1SPPB 1GNHA 1TE1B 3AKQA 3POFA 5DUVA 1GZCA 1RUOA 2FZ2A 2F4PA 5A3TA 1O91A 1VB4A 3H1MA 4FAHA 2IFRA 3VBHC 3EMRA 3SISA 1GNYA 2W1WA 2OUHA 1DIWA 3ZFGC 3K46A 1X50A 3NNMA 5CU1A 3NO8A 1Y9MA 1C5HA 3E6CC 4XTPA 1EUUA 1ZBE2 3CU7A 2CAUA 4DEVA 4DY5A 2I2SA 4YM3A 5KXBA 2YYOA 3CBNA 2ZGRA 1VP6A 2IXCA 5D1IA 4YG6A 1YFXA 4EN7B 2ZGNA 2Y6FA 4LIVA 2R073 1IS6A 2YFUA 3DYMA 5FY8A 4QM8A 4Q0QA 2BVBA 4BH9A 1MZFA 1N1SA 1UD1A 2VW2A 3J4UH 1F31A 2JEMA 2VC9A 4UW6A 5A1AA 2A75A 3MW3A 1UXZA 3ZYHA 2VCBA 5FZBA 4XJAA 1XOYA 4GWMA 4YPJA 1W06A 3JBG1 1CZSA 4W6XA 5A3LA 1XU2A 3UNPA 5C5UA 3ZM8A 1SCRA 5A6QA 3GF6A 4JGZB 5FZLA 2WO1A 3K3OA 3QH6A 3GXUA 4IGQA 1O8SA 1FATA 1EPWA 3MIEA 4CDUC 3DGTA 3AMMA 4M3CF 4OUSA 5J7MA 4Y5SA 3OY8A 4LO8A 1O5UA 1C4RA 5A33B 2OQ7A 2BNMA 2KD7A 4H7LA 4YW2A 5IK7A 1QOSA 5FMOS 4BQXA 2ZX0A 1CIWA 2NP0A 5ACA2 4CU8A 3HNBM 1HRI3 1VRH1 4QX2A 4I0BA 2P34A 5A3OA 4QQ2A 3WNXA 4E8DA 5C71A 2ZCWA 3U07A 2Y38A 4NOTA 1OFSA 4OMCA 1UU4A 2BOIA 4GB33 4NRMA 4CU6A 3N9OA 2OYZA 2Z4FA 4D6QA 4Y1UA 5FZ9A 2MEV3 1D7PM 3RJRA 5L9BA 1K42A 4BCUA 1H2KA 3EJKA 1WW4A 4EN6B 2K9ZA 2W68A 1G9BA 1XNTA 2VW0A 1NA1B 1Q56A 2YXSA 3H1WA 1S0DA 1VAVA 2XMLA 4D7TA 4KQ7A 4S2HA 1RXFA 1NG0A 1QDCA 2VZOA 4V1PA 3WLUA 2G1MA 4KU7A 1C57A 2VM9A 2XLFA 4BISA 1NLSA 3WDVA 4JTNA 4HVQA 2PA7A 2WWSA 2R042 3AXEA 3KGLA 4MZUA 4NUBA 4I01A 4P9IA 3VHPA 2CGPA 1YJLA 3EYPA 4ONUA 3UJQA 1IS3A 4NIHA 3EBRA 3VBRB 3LCPA 3MYXA 5LB6A 4B1MA 1ZRCA 1LOGA 3HBKA 1SPPA 2J1TA 2ADDA 1A8DA 3WR0A 1H1AA 2D6NA 1LHVA 1EV12 3N7KA 1W8NA 2IXJA 5E8AA 5FLHA 5FRAA 4P08A 1HB2A 1GMMA 3HR9A 1MEC1 3B5LB 1OI6A 1NLQA 1VMJA 1Z7S3 3LOBA 1GZTA 1BKZA 1IG3A 1YXWA 1S2EA 2D6PA 3HD8B 1NCRB 3IWZA 1T2XA 1GICA 2QQJA 3MUY1 1R1A2 5F1RA 4EN0A 5JIAA 3TN92 4TSVA 1RUH2 2PAEA 3RS6A 4LNVA 5LASA 1AF9A 1BK1A 2WT1A 4BE3A 1AYM1 2VJXA 1PIV2 3NV2A 4UBHA 3UESA 2X53S 1RVF2 1MS8A 3RI8A 1QJX3 2JDNA 3J9SA 1JZ3A 1I5ZA 2DBNA 3DV8A 2VG9A 1H30A 2QBXA 1VBC3 1PO11 2W3JA 2Y6LA 3LFIA 3R6SA 3WNOA 4AK3A 3MZHA 4K20A 3KLSA 2PHTA 4NAOA 2RS31 3WF4A 2W95A 5FJKA 1QJU1 2VZUA 1KFXL 4IL7A 2J22A 3C7GA 4JGZA 3JB4C 1KJLA 1UPSA 4DNYA 1DQ1A 4IEQA 4Z1VA 4QGNA 2VUCA 1AXYA 5FXWA 1DYKA 1OLQA 3WD5A 3WF1A 2VCAA 4FQZA 4MGQA 4R9AA 3S0MA 4FPFA 2X8KA 3FLPA 1WUVA 2AH2A 2ZMKA 3GM8A 4AHWA 4QPGB 5IAXA 3KHCA 4AL9A 2EIBA 3USUB 3ZXKA 1MVQA 4CP2A 5A33A 2XBO1 3KZ4C 1H1MA 2VZRA 2HWE1 4DXZA 3M7AA 2Z2SB 3I3DA 4LOSA 4HLTA 3J8F1 3BKZA 3R4SA 4Q4Y3 1LHOA 4BXFA 5JZGC 1YIFA 2ZOEB 4PLNA 4Q0UA 1N1VA 3BTYA 1CWPA 4QDQA 2VQAA 1RB8G 4XF9A 4OHWA 1NCQA 2ZTNA 2JDMA 1LGNA 1H8TB 1IKPA 3V0BB 2G9GA 4MGZE 4UOJA 5FP4A 4DRVA 5A6YA 2VMCA 4N8MA 3ENRA 3VHNA 2WLQA 1PGW1 4PLMA 4I02A 5LATA 4ASKA 5T5LA 5D21A 4ZU4A 2GN7A 2ARCA 1VRBA 2A6VA 5IWFA 4CCDA 4ZKTB 4G9SB 3OB8A 4M0NA 2B39A 3PMEA 1LESA 3TB0A 1H4HA 5L73A 5FY9A 4D6RA 3MO4A 1ZYBA 3LGRA 2C24A 2UWCA 1D4VB 4BQWA 2YDEA 4Q0SA 5F3IA 2D5FA 4CCKA 4KH9A 3VHOA 4TXWA 3VDCA 4GIQA 4AE2A 1NCQC 2Q0AA 3WY6A 2DFCA 1X82A 2XL9A 3AC0A 5A3PA 1CPNA 2CDOA 4OZOA 5AVAA 4HK9A 4KBZA 1ALYA 3JBG3 1W9YA 3RZJA 2WFPA 1JYVA 2D3PA 2EF6A 4DOUA 2GP3A 3VBRA 2BGCA 2D6LX 3I97A 1C5IA 2OKXA 4AQTA 2BTVC 1YFWA 2WO3A 4INDA 1XU1A 4KG0A 2GMEA 3WP4A 1NOVA 1D4M2 2CDPA 2JENA 3JD72 4HKWA 1RUC1 1XNDA 3VN4A 1UY3A 5C4WC 5BPXA 2HWC1 4M3CE 3BI3A 1UY4A 1NCRA 1ONAA 2PHWA 4N9IA 4CCEA 3IAPA 4WVWA 4COVA 5EP9A 4PT6A 4CDQB 4BA6A 5FZAA 5E88A 5F6KA 3VD9A 1E5SA 3V0AB 4COWA 3IIIA 1UNBA 1A3KA 4O7XA 5SV8A 4YM1A 4YGCA 5J1XA 1RJ7A 5GZDA 5FOJB 1NQDA 4K6BA 2YU1A 5HCHA 4MOAA 2Y6KA 2D43A 5D2AA 1W2TA 1W2UA 2VL4A 3KQ4B 1D0GA 2VMDA 1ZBE1 5IYYA 4XJUA 2NN8A 5C8CB 1HXS2 1MS0A 3B7MA 1V70A 3S5QA 5HV4A 2WC2A 2DVBA 1QIQA 1VBD2 2GN3A 4NIDA 2WS92 2VZ3A 2GNBA 2ATFA 2HWB1 3E97A 5F5IA 4NWVA 1UW8A 1VR3A 5JSRA 3I2FA 1RIRA 1CAWB 5LBBA 2XDVA 2DF7A 1QH7A 3LEMA 3OPTA 4Q26A 1CVNA 1OQEA 4LO6B 3VZOA 1ODNA 4QPGA 1URXA 2XG3A 3FLRA 4O9GA 3USUA 1DQ6A 1HQNA 5L19A 3MIFA 4V2WA 4QDSA 1U12A 2XJQA 3K75B 3O1UA 3M3EA 1F15A 3NJYA 4K8FA 3H8UA 3B94A 1W39A 4UXAA 1HB4A 2B7YA 1BQPA 3KS7A 4FPGA 1AR62 1DDLA 2AEYA 1K5MC 1US2A 4XBQA 1REDA 5CEHA 5JMOA 3V0BA 1BYHA 4OVEA 2IVIB 1QXJA 2Y60A 3BIWE 3NNFA 4V2VA 2W1UA 3AXDA 5ACA1 1MEC3 2E53A 4XCBA 2R49A 4LUMA 1HJFA 5IVFA 1HQLA 2K0GA 3VKOA 3QCWA 1PK6B 1GP5A 3M3OA 3BYWA 4QPGC 1RITA 2PLV2 2XVGA 3NJXA 3T0AA 1RXGA 3VLBB 2ZMLA 1ND2B 2FQPA 1COV3 4LUKA 3ZSLA 1ZA7A 4UFJA 1KQRA 1AYM3 1D2SA 2AREA 3ZIXA 3SNMA 4AFDA 4DXTA 3ZFEC 2VD7A 3U1XA 5FZ6A 3CHXA 2C0ZA 2QQIA 3FZ3A 3POWA 5BNNC 3H8RA 2O14A 3VBSC 4KBBA 1PO13 2D6MA 1K3IA 3A7QA 3JU9A 4LE4A 3N9QA 2FDIA 1QKQA 4BLIA 2RS33 1R082 3FX3A 5DAQA 4K21A 5BNQA 2ZGOA 2ZX2A 2RDQA 3I3QA 4YW3A 3VBUC 4XJWA 2BP6A 3BGAA 3IIAA 1JZ8A 3F95A 5FZ8A 3WX5A 2RS13 2QNKA 4XHXA 1BMV2 2BGPA 3M4FA 2V4AA 3KGZA 1SQ4A 1FOD1 2C26A 3J8F3 1JYWA 1H4GA 1EV11 4FFGA 4CDQA 4LO7A 1HKDA 3O14A 4YGBA 2QDNA 2GSYA 3V0AA 4CVUA 1AR92 2DBIA 1JN2P 1PX3A 3HQUA 4R9DA 3UKTA 1W99A 2IC1A 1POV1 2W39A 1LU2A 1VBB3 1R1A1 5C8CA 2YBKA 2YZ4A 2LUWA 1J3PA 2VVDA 3I3EA 3TN91 5FYYA 2WWJA 2VW1A 1CONA 5H9QA 4E4HA 3VZMA 5I0DA 4C8DA 3PVBB 5C7GA 2E7TA 1ASJ1 4IW3A 1RVF1 3DXTA 1ZZBA 4FO9A 5J37A 5HXVA 2WQ8A 3AFKA 1I9RA 2HYKA 1AL22 4NR1A 1NLRA 2DURA 1L7LA 3ZKUA 1CAWA 2A5ZA 4ZZ5A 4P5HA 4AFBA 1VIWB 2GU9A 2GMMA 1BZWA 4NN0A 2A6ZA 1YUDA 4H55A 1YQ5A 2VOXA 5FMOL 3H8XA 1BXHA 3KWVA 4ATFA 1I1EA 2WBKA 4EWAA 5JXJA 3CZJA 3TOJA 1NKGA 4HT1T 3DYOA 4XAEA 3RDIA 3HN1A 4L99A 1G86A 1TEIA 4S2DA 5LEJA 1YYNA 4YM0A 5FZGA 5K7PA 2YB7A 4PJYA 1DGWX 4K1YA 4CPBA 2VXJA 3WQ7A 1RTVA 2E26A 3OBZA 4A42A 1QF3A 2VXRA 3KCXA 2VZSA 1RUC3 1W0PA 1T6GC 3KSCA 5LZ6A 2HWC3 2KXLA 3RZLA 5CISA 5ISLA 1U5YA 5LK5A 2ILMA 3AYAA 1HRV1 5T5OA 1W3VA 3FE5A 1PK6A 4AI1A 1RUE2 4AR2A 4DMIA 5FV3A 3TEZA 4H14A 1TMF1 5CG9A 1XC6A 1ND2A 3MIDA 5DG1A 2B8MA 1IG0A 4EZ4A 4MG2A 1SLAA 3EB7A 4OULA 3RNSA 4LLFA 3A4UA 2JE7A 1QQP2 5CFDB 3ZN5A 1RL3A 2VULA 3P3NA 4CYDA 1ZBE3 3WP6A 1UIKA 1UY2A 2Y33A 1H9WA 4Z92B 2TEPA 3DN7A 2ZHMA 2OIIA 3O0XA 1OD3A 1MS9A 2E6VA 3B9CA 3W59A 2O0OA 2XH6A 2ZZJA 4NHYA 5IVBA 3T08A 1CQ9A 1HQWA 3BPZA 2P3JA 4TN7A 4IERA 5F7UA 2PHDA 4GALA 1PMJX 5EZWA 4A7KA 2WFF2 1CAXB 1SBEA 1NY72 1QJEA 4Q1RA 2VTXJ 3VBOB 3IM0A 1FX5A 4AEJA 1CX4A 4MVTA 5DDJ1 1GQGA 1H2MA 3OEAA 2HEYF 4GJZA 2PQQA 5E89A 5K9YA 3FL7A 2SBAA 1J83A 1A6CA 1D4M1 1SEFA 1ZBA1 2WNUB 1LOEA 2Z42A 4QGLA 2RJLA 4CE8A 5AFBA 2XVKA 1GSLA 1UYZA 3RWKX 2XR4A 2VUJA 5FO8B 4YRDA 4UI9L 1KFUL 1YWKA 4FOYA 5IAVA 4UFKA 4E4DX 4K9SA 1DZRA 2HYXA 1HJGA 3OEBA 2B5HA 2ZBJA 1E5HA 3HNYM 4RSUA 5FO7B 2V5DA 2A71A 4IV1C 4ZS3A 5GLUA 2XXZA 1RUF2 3E5QA 5DAXA 2IVJA 1Y3TA 2QDRA 4PIXA 3ECQA 3VL8A 1UN1A 1VLNA 2W1QA 3LQCA 4CDXB 4IUGA 3RPQA 3ES1A 4CP0A 2P2KA 2E32A 2VNGA 4N53B 3E6DA 2QE3A 2WS91 5GZCA 4YFWA 2GC3A 3I3BA 1XSQA 1F35A 3VKMA 4RFRB 4WM7C 3TEWA 1RYYA 5KWRA 1OOPC 4H3WA 4WBBA 1POV0 3LZZA 4D7SA 1LULA 3JUUA 4DIQA 3UL2A 3PTRB 2Q8DA 4HL0A 5I91A 1PGL2 3A21A 4JRLA 2ZX4A 3M3QA 4JCKA 2H6BA 1GOGA 5I0UA 1PZ9A 5A7SA 2R043 2DDUA 2LM3A 4KL1A 5APAA 3KF5A 5FUPA 5FMBA 4Q1PA 2IUWA 4L11A 1YEWA 4LBOA 1UYPA 2BDRA 3B9IA 5EV7A 2ORZA 5FZDA 2VOKA 3THCA 1EV13 1CAVA 1VMHA 4AGVA 5HBAA 2P4EA 3V65A 4XABA 4E8CA 1UPIA 5D8AB 5DPNA 5A70A 1POV3 1HRI1 5FAXA 2EALA 1FV3A 5CFDA 1I6XA 3VL9A 1R1A3 1QU0A 2DVAA 2PLV1 3OF1A 3TN93 1RUH3 1S4CA 1APNA 3ON7A 4XMAA 5EJZB 3K3NA 4CPBD 5FY7A 1UF2C 4YVWA 1PIV3 4X8NA 1XNAA 2GAUA 2R062 1ST8A 2GC1A 1NZIA 1RVF3 4R4XA 4TLGA 5JOZA 3N36A 3VD4A 2Q8CA 1KJRA 4YM2A 5AC92 5H9PA 4PIZA 3AP6A 5GLZA 5FREA 4WM8C 5EJ1B 1FNZA 5CIRA 5C33A 4FTSA 4U36A 3RMYA 1QY4A 2XONA 3ZMNA 3BOPA 1CAXA 1R081 1W6QB 5FK7A 4GWJA 4S2GA 4AVTA 1WGPA 5CA6A 5IVEA 5GM0A 3VBOA 5A3MA 4RGGA 1NQJA 5JLVA 4KGQA 4I2OA 4EYUA 2YC4A 4KWLA 4RS5C 1JYTA 1R1ZA 3B69A 4F3JA 3ZVXA 1VMFA 2W46A 4NMIA 3TRSB 4AI8A 5BV6A 4JVAA 2WNUA 5L36A 4YLZA 2C4XA 1BMV1 3WUCA 4YVWC 3H42B 4RD7A 1MS4A 2LW8A 3NWKA 5IFTA 1GQHA 2ET1A 2O1QA 2XJRA 3NAPA 4NIAA 2YUEA 1QNYA 5E1RA 1C28A 1GUIA 3AB0A 1WLWA 4BQYA 3N9MA 3T2PA 1AR91 4A7ZA 4RR3C 3VDAA 2PYTA 4EE2A 1WCDJ 2AGSA 2OW4A 4XFHA 3BIEA 1ENXA 3KVBA 1RUD2 5T55A 4ES8A 3C7OA 3PVOA 1Z7S1 4M4RA 4Q4W2 2ZACA 1A8MA 3PU3A 4YSFA 4QKFA 4BIFA 1S0CA 1GOHA 4XUNA 4R4ZA 4CDXA 3O1SA 1SMVA 4U2AA 2YROA 1AJKA 3T0BA 1J58A 5FZEA 1MR5A 4N53A 2IZWA 3MFCA 2Q5TA 1UOFA 2F4LA 4XQDA 1S0JA 2I74A 1BJQA 2BUKA 2QQVA 1QJX1 2D93A 2Y0OA 1JHNA 1UY1A 2OT7A 1SG3A 2W1SA 1VALA 2CY6A 3ILNA 5F8PA 4AWDA 3NAPC 3ZSKA 5FXXA 3LWCA 1BVVA 1VBC1 3Q8AA 1JZ4A 2AEZA 3PUSA 4XFGA 5JXIA 2DCKA 2DUQA 3E6BA 4XIKA 5F32A 1TME2 4CCLA 2HBUA 3RMXA 3TNPB 1REFA 2QQKA 4MLOA 4FVVA 1DQ2A 1K5JA 1ULDA 5CB7A 5JXGA 1X9PA 1WKYA 3MUZ1 4D3WA 1QNWA 1W6OB 3CJXA 3WNNA 1GWLA 2PHRA 1F8VA 4LPLA 5F3GA 4XUOA 4ATEA 3MDPA 1NT0A 4MGKE 5CADA 1D4M3 1OH4A 3JD73 3MV11 4NPLA 4IEVA 3AKTA 3UK9A 2WA3A 1LEDA 4LMFA 2ETEA 5D8AA 1FPN2 4YARA 2SLIA 3H3LA 4JDMA 4R8HA 5IVVA 1PMIA 5L7OB 2QQMA 4YZ1A 2FZ1A 3OUJA 4G4FA 5H9RA 2CWSA 1T6BX 3D0SA 3E1F1 5K4LA 3HT1A 4BYYA 5EIYB 3ZN4A 5HCBA 4MO3M 2QKDA 4QQOA 1B35C 1G9CA 1TNFA 1CAUB 3ASIA 2RDSA 4R9BA 4BHPA 2C9KA 3LEIA 4FFIA 4UF0B 1GNZA 5JUVA 1HXS3 4Q4V2 3RZMA 1XPWA 3ES4A 1W3XA 1XRUA 3GBWA 5A7QA 3HQXA 4AHYA 1J1LA 2H0VA 2NMOA 1VBD3 5C8WA 2GC2A 2A6WA 1W6QA 2JXAA 2WS93 3N7JA 2WINB 3PVNA 1WBLA 4JQTA 5EWSA 3OGRA 2VU9A 2XWJB 2E9QA 5FYMA 2JIGA 4QM9A 5D8AC 3S57A 2GC0A 3FMGA 4Y1ZA 1W8ZA 3WXPA 1DGLA 3NKGA 1D2QA 2WFF1 2WL1A 3NJZA 4W50A 3GGLA 2CWMA 3T30A 3VD3A 4AXOA 3ZSJA 3CL1A 2ZJCA 2AZ5A 4OYUA 1CPMA 1GFF2 2WQZC 3ACHA 1JYXA 2VECA 2DCJA 4DUWA 4DRRA 4EN8B 1ACCA 4J6GA 4J1WA 4XF1A 1V00A 3DKQA 2CGOA 3ZSEA 4BXSV 2R0FA 2WO7A 4YZ4A 4ES9A 1AR73 5FP9A 4FAGA 1AR63 2J42A 1G9DA 2DUPA 1BEV2 3HMYA 5F6LB 2WN2A 1A34A 4AEMA 4ET7A 4HKOA 1GWKA 4XFAA 5FBZA 1GU3A 1W03A 3CJIB 4NE9A 1RUF1 4A6SA 2CSGA 4EQVA 3ACFA 4EWDA 4YW7A 2VOWA 1WW5A 3F2ZA 1LOBA 4AG4A 2PLV3 2GH2A 4FTBA 3ACLA 3WDXA 4LR4A 2B42B 4XBNA 1FMD2 1PO22 2KR2A 1C8NA 4LBKA 1JYCA 4Y3OA 4DUVA 3NV3A 2YGMA 2N7GA 3UJOA 2QQPA 3PURA 4AQSA 3L9JT 3WDTA 4L2NA 4Q0VA 2ZX3A 2ZGKA 4QU1A 5FPAA 2RR12 3NV4A 5DN2A 4OHXA 4XACA 3ZLIA 1J3RA 4FPHA 5A7NA 5BNOB 1XYPA 2BBVA 4MV2A 4XVHA 5IW0A 3PU8A 4ZZ8A 2QJVA 1BBT2 1R083 3N9NA 2VMFA 4IEYA 3ZXDA 2O8OA 2YBPA 1PGL1 1W6OA 3JZVA 2VTFA 2VZPA 3P6BA 3WDYA 1YI7A 2QQNA 2HEVF 4HETA 2WSVA 2XLAA 4EJRA 2VMIA 3MV01 4QKNA 4AEKA 5IVYA 3OJBA 2FDJA 1HN0A 5F5CA 3C7HA 4I0WB 3DL3A 5FXZA 2FMYA 4XUTA 2P1BA 5L7OA 3OD4A 2VTXA 2EIEA 4CCNA 4YZ2A 1QH6A 3MIGA 4OUMA 4P02B 2LALA 3AMHA 1UO9A 2Y8KA 1V6JA 3AZYA 3IDCB 4W6WA 1AR93 4BQ3A 1SHWB 3THPA 2OVUA 4BZ4A 2MPFA 4IV3B 5AFEA 1LU1A 1CAUA 2GNMA 3ZN6B 4CUBA 5A3NA 4UF0A 2A1XA 4QXHA 5H9SA 4IDZA 5K0UB 3TEXA 5T50A 3AMNA 4PI0A 3T1LA 2JDUA 2TBVA 4Z07A 4IEZA 1G6NA 3R4UA 4PF5A 5I0SA 3RZGA 1S1AA 2JDPA 2ZZQA 4AQ6A 1COV1 1H2NA 1IS5A 2RS52 4XFFA 5JWPA 4KGGA 1YO8A 1DQ4A 1ULGA 3NNLA 3PVEA 4IE4A 1IHMA 4NHKA 4DINB 4META 3ATGA 3GCWA 1AL23 1XBFA 2W5FA 3J7NA 4G3YC 1WZXA 1QEXA 4PF1A 4CTEA 1BVP1 5FXVA 2J1SA 1JI6A 4LBMA 4LTAA 3SKVA 1GP6A 2WA4A 5J98B 2DCTA 2YV8A 1GLHA 3AP7A 2BJSA 4ZONA 2R16A 2Z79A 2O8QA 3V56A 4E27A 3I8TA 1WCUA 3MICA 4QX3A 4OHZA 4MXVA 2A3WA 4LBLA 4XEZA 4CP9B 4XZUG 4XMIA 2R1DA 4UWDA 4CDWB 4JTOA 1EPZA 3IDBB 2JG9B 4MX3A 1G8WA 1HW5A 3LEGA 4XQ4A 2RS11 5FTTC 3OGGA 5DZEA 2VNRA 1CR7A 1Q8VA 3A23A 3SCGA 3D6EA 1WA6X 1B09A 5FZHA 4AQ2A 3CJIA 5LBEA 5JVVA 3AMQA 4E4ZA 4UT5A 1RUE3 1EP0A 3IPVB 5ANNA 3AZXA 4Q4W1 4LKDA 4D6SA 4FI9A 2IFWA 1V6OA 1VBB1 3RQ0A 3BTAA 3NV1A 4FPYA 3S5AA 2XQRA 4JGZC 2UY8A 5F2SA 1O3TA 4PQQA 2KA3A 3AX4A 3BB6A 3C2UA 1QQP3 1G9FA 1RGSA 4B4QA 3ELNA 3Q8CA 5FZOB 1YI9A 3MBWA 4I3PA 4IE7A 5LA2A 1OLMA 2JDAA 1RINA 4IE0A 3KHBA 4ZXEA 3SCHA 3M8LA 3VZNA 5BNOA 3LE0A 4Q4X2 1NA1A 1TG7A 4XILA 1LGCA 1TNRA 1ZNPA 3WQ1A 2J1RA 4JKLA 4NRQA 5FZ7A 2ES3A 2DU0A 4PDWB 1TME1 4NHXA 2BVVA 2HH9A 3M3CA 4LKEA 4HSJA 4NAMA 3S30A 3AZZA 3NSTA 2ZGUA 3KT7A 5ABJB 1W9TA 4RGKA 1WMFA 2G19A 2WFF3 3ZDVA 2VOVA 2ERFA 4DUXA 3SQOA 1HLCA 1XSRA 1SLLA 2Q8EA 2EAKA 1V6NA 1I5PA 1KS5A 1VAKA 1YQ6A 2VNVA 4CXXA 2RMU2 4QT6A 4GWNA 3WUDA 3VZJA 3T3YA 2C1FA 5ERLA 3AP9A 3Q8BA 5BNOC 2DVGA 1FPN1 4RQPB 4ZXKA 5J3UA 4IV3A 1NA1C 2B46X 3ZN6A 5FYVA 4NWWA 3U0ZA 4IEOA 5CVRA 4NHMA 5K0UA 3SH4A 1N3PA 3LA7A 1MQTB 1O4TA 1PNGA 1K45A 1RUF3 3T2OA 3AJYA 5CZKA 3A0NA 1AZDA 1AYN2 1UZZA 3D8CA 3NJVA 1OUSA 4FPOB 4MGYE 2AENA 2PMWB 4Q4V1 4QB6A 4XETA 5GLTA 1WW6A 3MPPG 4P5YA 3VKFC 4LITA 3VBRC 1GQPA 4L92A 3N9LA 4HVRA 4I0AA 3O1MA 4XE9A 5LRSA 1V6LA 3H7YA 2A6YA 3OG2A 4XF0A 4OI0A 3I7DA 1F4HA 1NCRC 5I0TA 2H0BA 2NM1A 2UYAA 4CP9A 2UU8A 4XDOA 2WSUA 4QQPA 1YIPA 2EXJA 3O1PA 4CDWA 1XNKA 5IK4A 4BJ0A 4Y1XA 2JG9A 4B29A 3WNLA 5C9AB 2HBTA 3GJBA 1N3OA 4YW6A 1JYNA 3O1TA 1OQ1A 5FWJA 2YBSA 1UOJA 3AYCA 4TYSA 5IHRA 1AR72 4Y5Z0 4Q27A 1JOJA 3K2OA 1BEV1 3IPVA 1GV9A 5LY2A 4BLJA 1JODA 3ZXFA 2VVEA 1EAH2 1W8WA 2RDNA 4I30A 1H8TA 3URFA 5A1FA 2XPJA 3POBA 4EV0A 4LT5A 3AZWA 3MI8A 4WZCA 2ET7A 2YPDA 4TLFA 2FDGA 4FFFA 1JOBA 4LULA 5I8YA 3WW1A 4UFIA 3CIHA 3RZZA 3ZXJA 4AAPA 1S2KA 4DPNA 4AW7A 2FCTA 1PO21 2HKXA 3B3QE 1UZVA 3DPRB 2P3IA 2R063 5FIXA 3ZYBA 4CXYA 1UYXA 2VUAA 3DUIA 3ME2A 4KG8A 3POYA 5T54A 1AJOA 1KITA 1OF3A 2RR11 5AC93 2BW8A 4PDWA 5LBCA 2Q8OA 4N7IA 2X29A 5FPBA 5FMCA 3ALQA 2QVSB 2WLPA 1Y7BA 5ABJA 4BQ4A 4LHSA 2CL2A 5CBLA 5C3OA 1H8TC 3EQEA 1WMDA 2JD9A 4AFCA 4IE5A 3ZYJB 3PMSA 4HG6B 5LK7B 2PQSA 2XQXA 2ZEWA 4FOVA 2YGLA 2A3YA 3SH3A 3UKNA 3W9AA 4AOCA 3M70A 2I07B 4OHYA 1WLTA 3WP3A 1OC1A 3SCFA 5J09A 2IXKA 2BU9A 5JCTA 2R041 5ACA3 1JU3A 3GBGA 4P9WA 3U10A 2H6CA 2VE1A 4RQPA 3KM5A 3CDZB 2PN5A 3FC0A 4UYBA 1K12A 3K4DA 3I49A 1O6UA 2ZHKA 3AK0A 3KT1A 1MQTA 4ZS2A 3WW2A 4ISRA 1C1FA 2XUMA 1FXZA 3P1IA 1H8VA 3USSA 5BXXA 2L9LA 1U5IA 1H1IA 1RUD3 3JQWA 2BYVE 3W20A 5FZ4A 5CG8A 2MNGA 2EICA 4W4ZA 2VCCA 4Q4W3 1SFNA 2WO2A 3UV9A 2VMGA 4YFZA 5F5AA 3IMNA 4JX0A 4Y1VA 1RUH1 2D3SA 2RS51 2DVDA 3VV1A 3SITA 3AYDA 3RGBA 4QPWA 1DGRN 3GZUC 1PIV1 1PZ8A 1TQ5A 3JB8A 3P5BA 4D0QA 2NPIA 5FZCA 3T2TA 2VR4A 3I59B 1RUJ2 2D40A 2BQPA 1W8HA 2UURA 3WNPA 2V5YA 1WMEA 4RA0A 4EN9B 1STMA 3SXWA 1HV0A 4CEYB 3FBMA 3G6JB 3ZSMA 3IKWA 1YFYA 4CDQC 1TME3 1SACA 1JZ5A 1H2LA 2PHLA 1EY2A 2JE8A 5C9AA 2ARAA 5FY1A 3W58A 4CP1A 4QPIB 4LHLA 1I3HA 4D94A 2WWUA 3AZVA 3HEIA 4LA3A 4MGSA 5FPUA 1VBE2 5FPVA 2XHNA 4DEQA 2IXHA 2Y6HA 4QHBA 3WG4A 5C8CC 2ZKNA 2Q30A 4OHVA 1AX0A 4ASLA 2BNNA 3C8XA 1QMJA 3NL1A 1IZ3A 3HBZA 4F7ZA 1LNSA 5DAVA 4LHNA 3PUHA 1DG6A 4RN5A 2OZ6A 1DYOA 2XOMA 1XYOA 2LS6A 5EPAA 3N7MA 1FPN3 4QKBA 1R092 3ROUA 3HIFA 3D82A 1R64A 5FZIA 1ZA4A 1V0AA 2GDFA 3B93A 1W90A 5FOBB 4HN0A 1YQ2A 4B8EA 1WBFA 4RFT0 3DPRA 4P9YA 4D69A 3GNEA 1RHI2 3OGJA 4C0HA 4XF3A 3PUIA 1ZVFA 2W08A 4B7EA 3RWNA 3TBDA 4Q4V3 4W65A 4UW5A 1JUHA 4IETA 2YFZA 2A6XA 2AACA 4S2FA 1CZTA 4MUVA 3RJ2X 4IEPA 4PBPA 3O12A 5IUQA 4HSLA 4M0HA 3LIHA 1WCQA 4Q4X1 5KR7A 4P9JA 2WUHA 5KHJA 4AI9A 2YG0A 1OMIA 1RC6A 4Y1YA 3SC7X 1IOAA 4XIOA 1ENSA 5LBFA 4IE6A 3WHUA 5CFCB 4XQWA 4AVCA 1CD3G 5HPOA 4KNCA 3DXUA 1PK6C 3AP4A 1Q3EA 2FMDA 1E5RA 1IQDC 1ND2C 5FYHA 1SDWA 3ZR5A 3HN3A 4CSWA 2RMU1 4COYA 1UOBA 2NQYA 2ZPXA 2W0XA 1LCLA 4RL7A 4QQHA 1ULEA 1MVEA 3MW2A 2PELA 3H8OA 2ZGSA 3JD71 2JKBA 2GZWA 4XBLA 3AVSA 5JI7A 2VH9A 4YW4A 5CYYA 5J48A 1BEV3 3H3UA 4E2SA 3TNQA 4MADA 2OQ6A 3WHTA 3INAA 4TWTA 4FSJA 2Y0IA 3HQRA 1OLME 1OXCA 2Y64A 4KU8A 1SLBA 1ULFA 4PI2A 2WN3A 1AYN1 1DGRA 2NYYA 3Q8EA 3KF3A 3LA3A 4YG0A 1UL9A 5FYBA 3THTA 4A3XA 5HV0A 2C9AA 2B9VA 2UWAA 2J1UA 3IDAA 3PUAA 3I3MA 1CIYA 1FMD3 1HXS1 1PO23 3I59A 4HKLA 3AP5A 4BOWA 1QWRA 4CEYA 1VBD1 1KEXA 2RR13 5LY1A 2ZGTA 4N43B 4TZDA 2J1AA 1V9U2 5JXHA 1O59A 1UY0A 4QPIA 2IXLA 3WNKA 4Q29A 1PVC2 2GH8A 2VMHA 1QGLA 4WVMB 1BBT3 3MIHA 4GAZA 5A7OA 2CAVA 1JOPA 1O3SA 5HI0A 2BZDA 2XHKA 3TYJA 2R7EB 4OI4A 4PIYA 5CNAA 1VRH2 4YVSB 4BWOA 2ZABA 4HONA 3PLQA 3WG3A 4XURA 1BCXA 3ZMOA 2ZAAA 5C70A 1AXZA 4DXSA 3RYRA 2Y6GA 3LKJA 1GBGA 1QXRA 1IKQA 1WW7A 2V4VA 4AVVA 4QXCA 4LORA 4FQ4A 1RUI2 1AR71 4CEWB 2V72A 1LOCA 1AR61 2WAOA 1YQ8A 4D8MA 4I09A 2QFEA 1EAH1 4A2UA 3BU7A 5CAZA 1W28A 1UZ0A 4Q8LA 3X29B 3VB9A 4PHZA 1S0GA 3CZUA 2VOTA 1DLCA 2A70A 5A32B 2EXIA 2ZHLA 5DZFA 2BRTA 5L9VA 1W8OA 1A78A 2A7AA 3N3HA 4GWIA 1EUTA 4RHV2 1IPKA 4MGIE 4A7YA 3HPNA 4IGOA 3ZXEA 1MZ5A 1HB1A 1SBDA 3VBHB 4BQ2A 2RS53 2AYHA 5A6ZA 4WVVA 3PL0A 4JDOA 5ANQA 4NHLA 2BPA2 1QDOA 3GJAA 2FHRA 4M00A 1KD7A 1XNBA 2JDHA 1ZZ9A 2LTNA 4HVOA 4XFIA 5DAWA 4A45A 3AJZA 3NMBA 3I54A 5LA0A 1QJY3 2OS2A 4COUA 5CFCA 4E2QA 2E63A 4XXAA 1O4ZA 2NZ9A 3J26N 4H7MA 4QMAA 5JR2A 2UYBA 4AZZA 3N4MA 5FKBA 4C1XA 5C3QA 4YW5A 5GJ6A 5E6HA 5LRRA 2GP5A 2Q1MA 3JCIA 1AL0G 3FWEA 4CCJA 1CZVA 5CFDC 1ENQA 1LJ7A 5DZGA 4Y4RA 4NO4A 1OFNA 3LPFA 1WCKA 5FLJA 4FOWA 4QB2A 1GOFA 4IXLA 2DCZA 4QDRA 2R32A 4OQ9A 3OGSA 3AL5A 1UYYA 2HWF2 1OURA 1RUG2 1ZRRA 4JC1A 5GLWA 4URAA 1OH3A 2EAAA 2VQUA 4CDUB 2GALA 2QQUA 4XC9A 3UYJA 1Y43B 1N3QA 5JSOA 4Y22B 1SLCA 4XXPA 1JXNA 4HMZA 1QJU2 3QOPA 3ZR6A 1U5ZA 4QXKA 1AUYA 2TNFA 3VBOC 2ZGQA 5I8SA 3OBRA 1UZYA 4QWNA 2UY9A 3ACIA 2W47A 2R30A 2WJSA 5FYIA 4GA9A 5BY5A 2ZGPA 5FY4A 2WNUC 4XW3A 1RUJ1 4Y33A 2XBO2 2B45X 4Q4X3 1AL21 2HWE2 2W87A 4WVMA 3HJRA 1US3A 4YZ3A 1SFYA 1W2AX 4BQ5A 2R0HA 3ILRA 4HPKB 2ZS6B 4HPKA 4NPMA 2XLGA 1UWWA 2B9UA 2JG8B 3K77A 4KWUA 2IXIA 2JWPA 3AYEA 5JIUA 5LCWL 1HIXA 1AXKA 4OI1A 2R6QA 3RI9A 2WZEA 5EXOA 2FCUA 5G05L 1V6MA 1N1YA 5FK8A 5FUIA 5HXMA 2E7AA 2PHXA 4LKFA 2RMU3 4LBJA 4LO5B 4CEWA 4CDXC 4DY3A 1TVGA 4K3UA 1ZZ6A 2W91A 1SDDB 4N53C 4Q0PA 4FTEA 1LR5A 1X7NA 3JXSA 4XJZA 2VMEA 2ARXA 3P3PA 5LW9A 2EA7A 4ZHNA 1D0HA 1R091 5HCFA 4M01A 3TAYA 4QX8A 5A32A 3OPWA 4QAWA 4MHRA 4CA9A 4W8JA 1RUE1 2WYSA 2EVXA 3S7EA 1SFPA 4XTMA 3HOBA 2EXHA 4CCMA 3U14A 3VBFB 1AYN3 4J25A 1EYBA 2VUDA 5FY5A 5F9TA 4N7UA 3BVCA 4R9CA 1LHUA 1QQP1 4CU7A 5BYNA 1OKQA 1Z78A 2F6BA 1W9SA 1OVPA 1FI2A 1DU3D 2HEWF 1UQXA 4GMP0 3OPZA 1JH5A 1OPMA 4DS0A 2R1BA 4FP2A 5M0TA 2W92A 1C1LA 2JECA 2P3KA 2W94A 5J36A 2ADEA 2WQ4A 5AVPA 1ZZ7A 3BTXA 4UFMA 5FZMA 3KCCA 3RSJA 3JQXA 5KHHA 1W8UA 1H6XA 2BOJA 2VZQA 4GD4A 3KD4A 1DGWA 1YNAA 3HAGA 2VY0A 4COZA 1L3JA 1RMU3 1NY71 5FYTA 4C90A 5GLVA 3MPBA 3OSDA 5HCAA 1WA4A 5JAXA 2YU2A 3AVRA 4CDUA 3A22A 2G4IA 4HOOA 3CMGA 3RYPA 1LOFA 1X33A 4BU2A 1JU4A 1PX4A 3ACGA 4GMP3 4ORFA 5DUUA 2E31A 5EQUA 5CKQA 2XJTA 1E57A 4JKMA 1EAH3 4Y22A 3O0WA 4A4AA 2XB6C 5JZGB 1YRZA 3VUOA 1S0IA 2HWB2 1QOTA 1ZRFA 1PHMA 3BOWA 3WZ1A 3L2YA 2RDRA 5FFOC 2LRPA 4LBQB 1C8M2 2FCVA 1X36A 3PIGA 1J3QA 4XHBA 3D5OA 5T3NA 4DQAA 1JBCA 1N1TA 1OBNA 3CLPA 1O3QA 3H1YA 1UCXA 1NZCA 2BEOA 4GZ9A 1AR82 2EIDA 3D3AA 3ZXAC 3PJQA 5IFPA 1YHFA 2PFWA 2ENRA 1XE8A 1LOFC 1DYPA 1W05A 2QQLA 2W2IA 3ILFA 2JG8A 4O65A 4QKDA 1V9U1 4Y20B 5A3UA 2RM22 2D98A 4X6QB 5BNPB 3KV5A 1PNFA 2WR9A 1LAJA 5DXDA 1PVC1 1O8PA 4OUEA 3MW4A 3T4VA 4GJYA 3SHRA 1DQ0A 4X8PA 1GANA 5K8SA 4AI2A 1ODMA 3WOGA 4E2GA 3MLKA 1NCQB 4QXBA 1UAIA 4AVBA 3WF2A 4QU2A 3WQ0A 1CGPA 1JTZX 3H50A 2XKPA 1OQDA 4HXCA 3SMHA 1AVBA 3MFAA 3J7LA 1H6YA 3V64A 2ZA9A 2KM2A 3HNMA 1V6IA 4H2AA 2WZR2 1IPSA 1RUI1 2QQOA 4LXLA 3WV6A 3ZYFA 4Z2AA 1P8JA 1NYWA 4LE3A 1Q43A 2VNOA 3WCSA 5TSWA 1DFQA 1MACA 3CEWA 3R4DB 4CCOA 2JD4A 2JG8C 2QZ3A 5DG2A 1JHJA 4UFLA 3IT8A 3KV9A 1S0BA 2RE9A 4CRQA 5C4WB 4NRPA 4MSVA 4ISQA 1IS4A 4ITCA 3VBFA 4F83A 1UZWA 3VGIA 1YQCA 4XOGA 1NE6A 1QJFA 4L8QA 4RHV1 3VZLA 2K46A 2CTVA 1REEA 3WDWA 1J1TA 4IESA 5B4NA 1LENA 2VBBA 3EHKA 3POGA 4Z2WA 4BQ1A 4IEUA 3LD8A 2RHPA 3I2JA 3PIJA 5LA9A 4JV4A 2R061 2WNVB 2OX0A 2OA2A 1ZX5A 2WABA 3GHMA 4LIUA 2DV9A 4Y26A 1CJPA 2WT0A 3T4HB 1RUJ3 3PHMA 3KV6A 5AC91 1FT9A 3CNAA 1FOD2 1LEMA 4YYOA 5DABA 1GZWB 1QJY2 3POJA 1WCSA 3IMMA 5L7OC 2JKXA 4UW4A 3AKSA 2PHFA 3I2IA 5LA1A 2FBEA 5FUNA 3VBFC 2JICA 2Z69A 2J7MA 2VZ1A 4AVSA 1RUNA 5FYCA 1HN1A 3FUQA 4P9XA 3OOXA 4O9EA 1GZ9A 1VBE3 4AFMA 3Q8FA 3WT3A 2RJKA 1SLTA 1WD4A 5F3EA 5FZ3A 4F8AA 4YZ5A 3ZDSA 4LK6A 4BMBA 3DECA 3NKTA 2XUEA 1UKGA 2HWF1 3UETA 5KC6A 1RUG1 1ASJ2 2HLEA 2ZEZA 3LSDA 3MF6A 4D7YA 5IT6A 3BU0A 3BUCA 5JZGA 5EHDA 5FPXA 2WNOA 2CU5A 1Y4WA 1R093 2ORXA 1KXGA 2DYCA 1K5MB 4LBQA 5EJ3A 1RUD1 2GNDA 2X5IB 3H3ZA 3ZO0B 2FD8A 2VQTA 4LA2A 2ZEYA 4QGMA 4ARXA 3OBAA 2Y6JA 4HBNA 4QPYA 1YCIA 2ARBA 2QTWB 1GP4A 4LLOA 1RHI3 1HX6A 2RVAA 2XKOA 4XZPA 1OSGA 3FFQA 1SCSA 2DWRA 3H9AA 2X10A 2ZGLA 1ZRIA 2BWAA 1O3RA 4FXKB 1BLZA 4Y20A 5A7PA 4HK8A 1NXD1 3SH5A 5BNPA 5IATA 3ETQA 1G7YA 5IJRA 2NMNA 1JZ2A 4Y5TA 2P5BA 4WZFA 4XF4A 1KS4A 3TWIA 3LFMA 1AHSA 3ZFEB 1LECA 5FYSA 2JIJA 3NQHA 4NIIA 5C3PA 3BCWA 3LA2A 5BUVA 2JDKA 3CJIC 4HFSA 5FLIA 5BNNB 3VBSB 1HRV2 4HN1A 1DBNA 1VBA2 4CCCA 1S0FA 1TMF2 1JZ7A 2VBPA 3K4ZA 3ZX7A 3VBUB 5FYZA 3FUOA 4AGRA 2UWBA 3OGVA 2OPKA 3SEEA 5KBFA 2OUJA 3Q9OA 4OI2A 5C3SA 1UX7A 3NVCA 3RFRA 2X05A 5BNPC 5C4WA 3QH7A 3KCYA 3FBYA 5C5TA 1Z0HA 4FPLA 4MGTA 3VZKA 4FPJA 4JRAA 2VQ0A 1XE7A 5FY0A 1NUKA 3IZOA 3POSA 2J1VA 1DP0A 4JGYB 3U4XA 4AGGA 4URTA 2XJSA 4L97A 4UAPA 3T2QA 4RYDA 2D44A 3FLTA 2MHFA 2WNVA 1QOOA 1W2NA 3QACA 2FDFA 3CKHA 2ZAHA 3SKJE 1F4AA 3ZYRA 4FPKA 5DDJ2 3APBA 1NXMA 1DF0A 1L7QA 3OUIA 1UU5A 1GZWA 3OUHA 5C6CA 1DHKB 2A73B 3AM2A 2VZTA 2ZX1A 3M2MA 2HWD2 4FBFA 5IVCA 1ZBA2 2ZHNA 4XFBA 3NW4A 1PM4A 4Y24A 1V9U3 3NRUA 1AX2A 2OPWA 1OHFA 4TTGA 1PVC3 1W6PB 4IV3C 4JQRA 4QQLA 4K7JA 1WWYA 3FHQA 3EXUA 4CUCA 3W5NA 3LEKA 5DUWA 4C1WA 5K0UC 1FNYA 1VRH3 4NPRA 1FV2A 3LDBA 3POIA 4KWJA 5L9RA 4AFAA 5FDBA 5JOXA 2WZ8A 1MZ6A 3O0VA 1KDMA 1RMU2 2WNVC 4IEXA 5T5JA 4GULA 1JYIA 1Y9QA 4LHKA 1DLLA 1UXXX 3SEPA 4QX1A 2G9ZA 1RUI3 5FMDA 4BPZA 1ZRDA 1K5MA 4LOTA 1UOGA 1H0BA 3HWJA 2X5IA 1Y9GA 2CV6A 2C6SA 2R072 2XJPA 1CN1A 4K8RB 2LROA 3A0KA 1FAYA 2GMPA 1F5FA 1F5JA 4XDPA 3CQOA 2VAUA 2WDBA 2DVFA 3WVJA 3WG2A 1C8M1 1XYNA 4KMQA 4EWEA 2ID4A 2BFUS 4RHV3 3ST7A 4DB5A 4YG3A 3DKWA 2Q1ZB 1M4WA 1NX9A 4QD2A 5FZOA 3THDA 4CDWC 3MGUA 1Q8SA 1W2OA 1IPJA 2E7QA 2JG9C 1ND3B 1AR81 1PMHX 3N9PA 1FMD1 2JJ6A 4JHZA 3ZFEA 1Q8PA 5LWBA 4KWKA 4LBNA 1LHWA 1S55A 1WLCA 3T09A 3NNJA 4A3ZA 5KXCA 1IGOA 1LOAA 5BNNA 2RM21 1VPHA 4LBQD 3VKLA 3VBSA 3WW4A 2VCMA 2X5IC 5F2WA 1Q5OA 2PTMA 5DAPA 1MPXA 4XJ8A 1W8TA 1YFUA 2VVFA 4Q5OA 5GKAC 1BBT1 5CKNA 2XVLA 3RRDA 4BB3A 3VBUA 1GKBA 4RGAA 3B01A 1HRI2 1O5LA 2BWCA 3ITQA 3T0DA 1FYUA 2DU1A 5JMCA 4O61A 5JI9A 2JB8A 2PAMA 4YW1A 4E9KA 4Y4YA 2QZ2A 3AKRA 5KHKA 2WZR1 1YC61 2D5HA 3L2HA 4UBGA 4GB32 5A80A 2HWF3 1ZZCA 2CGNA 5FZFA 1RUG3 2V73A 4AHZA 1ULPA 3J7HA 5DMYA 2MEV2 5JPMB 2GNTA 4OMDA 2BV4A 4JGYA 4PDWC 5FWEA 2QCSB 1OT5A 3N35A 4FFHA 1LB2A 3EO6A 4IQPA 4NVPA 5ABJC 3CO2A 1QJU3 3FFZA 3LAGA 2F17A 3UKVA 1UMIA 4E4SA 2ZGMA 3WG1A 5JSPA 2JE9A 3AL6A 3MEPA 4IV1B 3O1VA 3IB3A 5A1LA 2DFBA 3MLJA 2XGXA 4PQ9A 3HT2A 3SLIA 2NLRA 4JDNA 5F3CA 3D4KA 2JDZA 5KHGA 2WT2A 1ZREA 2P6HA 4XPVA 3UT0A 3K51A 2XBO3 3ZXLA 4RQPC 4AEDB 1W6PA 1LRHA 2HWE3 4YGDA 5LEKA 2RG4A 3C3VA 1QJY1 4MYEA 5F39A 1U5XA 1Q8QA 3OYWB 4PBOA 5T5PA 3PUQA 3W5MA 2Q4SA 5FJHA 1MQTC 2VZVA 4JGYC 4I3GA 1ZZ8A 3O7OA 4BMEA 3BPSA 4WM7B 5JOYA 5DUXA 3VD7A 2ZEXA 3ABZA 2K2SA 1OOPB 1Z7S2 1XB9A 1XNCA 4Z8BA 5IVJA 4OQ8A 1DZTA 4IGPA 3GBFA 1SLIA 1X9TA 1CESA 1PM7A 4FPEA 4CZSA 1W04A 1JS9A 2WNEA 4YWAA 1KDKA 2QUOA 2D97A 1UX6A 2DTWA 3BN6A 4BM8A 4BIOA 1F9KA 4Z82A 3ZPOA 2I45A 2YPJA 1QJX2 1GYKA 1ENRA 2J1EA 3PTYA 3LB9A 5IK5A 3T1MA 1OLRA 3WSOA 2YHJA 4K1ZA 3I2DA 3UGHA 1QJZA 1VBC2 2YY1A 4EZHA 1SZBA 2YMZA 4B1LA 4C0BA 3O1RA 1PZ7A 4GKXA 1LKNA 4ARYA 1ND3A 5B4XA 5C9AC 3I2OA 3KV4A 3RZKA 1PGSA 3OCPA 1J84A 1PVXA 2OZJA 1OVSA 1Q8OA 1ULOA 4XAAA 4BK5A 2Y34A 4GXLA 4NROA 2VO5A 3ZOIA 1W9WA 3S6PA 3M3IA 4AI0A 4PCRA 3LF7A 3C7EA 1VJ2A 2AUYA 3I2HA 3ORJA 1VB2A 4UFHA 5EYXA 4Q4Y2 3LIGA 1W9FA 5DQ0A 3RZHA 1WD3A 1VBA1 3HVDA 2ZXQA 4WM8B 5T52A 4HANA 3WNMA 4DFSA 2Z5WA 3DYPA 1CAVB 5GZEA 1LGBA 1WMXA 4JHTA 1H9PA 3KQRA 1AX1A 4JAAA 1ND3C 1W0NA 1YLLA 2XJUA 3I2GA 2IWGB 1DZQA 3IDEA 4LEJA 4QX5A 3DPRC 3UGFA 3BTZA 4RS5B 5J96B 3GDBA 4K40A 3VDDB 1UMZA 4FPCA 3GZTB 3QD6A 4QHZA 4EROA 2WYFA 1QXPA 3BODA 3POEA 2D6OX 1J59A 4LK7A 2EXKA 1LHNA 1S0EA 3AFGA 4YVWB 4AYUA 5GZFA 1SBFA 1TZOA 1OD5A 2E33A 3E5UA 2P37A 2QQWA 2P6CA 3FJSA 5FZ1A 2HWB3 3WP5A 3ZPYA 4XCAA 4IV1A 2WRAA 3OD0A 4OCTA 4RR3B 5GALA 1OPOA 3MHZA 3WCRA 1MS5A 4SBVA 3OTFA 5SV5A 1W6NB 4QHOA 1C8M3 3CF6E 2OXBA 2WZPP 1GWMA 3FHIB 3GCXA 1L7RA 3GZAA 3JBG2 2PXJA 4AHXA 4AEDA 3DCQA 1AR83 2X09A 3E5XA 3ZYGA 3OYWA 1HB3A 2HWD1 3K48A 5KHIA 3IAQA 4CUAA 2XL7A 4FOQA 2RM23 4WM7A 4OLLA 5FZ0A 4NIGA 1C3HA 5FCCA 1OOPA 5FQ0B 3R05A 2DCYA 3NAPB 4OZXA 1U0AA 1POQA 4FCAA 1F2NA 2FDHA 4L0PA 4LKSA 4ZU7A 2CHHA 2W9XA 4MXWB 3FHAA 3GHNA 5A7WB 3I2KA 2YC2A 4R52A 1OA3A 3ZFFB 2D3RA 1W6MB 1RMU1 2TUNA 2VPVA 1IQAA 4FP3A 4LJHA 2BERA 3WQBA 4Q8KA 2A3XA 5E16A 1NAEA 2JDYA 1MS1A 1N47A 1W8FA 2WZR3 3B00A 3M1HA 3QLQA 5F5QA 4AEDC 1JZ6A 1VE0A 4CUGA 5B2GB 4CU9A 1BK0A 5G04L 1BHGA 4GMP1 1NE4A 1OA4A 2R071 4IEWA 4M3CB 4PLOA 3LDKA 3ZXGA 1G9AA 4CEYC 4LQRA 4ASMB 3U75A 2JX9A 1O4YA 2AR6A 4QX0A 3RG0A 2HJIA 4QPIC 5JDBA 3IN9A 3LSEA 4GH4B 2ZMNA 1OF4A 5FR3A 2WIIB 5JPNB 4B4RA 2DUOA 1DQ5A 4DO0A 4XYXA 5KXDA 1GR3A 3VDBA 3S7IA 2PAKA 3U78A 1V6KA 1B35B 4QX7A 2RV9A 5F37A 2P3YA 5FP3A 3C7FA 4AVAA 2VGDA 3ZFGB 4P9LA 3O5SA 4QB1A
chains in the Genus database with same CATH topology
1XXNA 1CJDA 4B7KA 1FOD3 1XQNA 2BNOA 4WM8A 3WINE 4C91A 3I4IA 2XJVA 3PNAA 4P9GA 4XJ9A 4AF9A 2XWBB 4J1XA 1MS3A 2Y26A 1OA2A 3B02A 2W52A 4SLIA 1MEC2 1VAMA 4RS5A 5FO9B 5I8TA 3VDDA 3KB5A 4GB31 5EYYA 1KRIA 1COV2 2E51A 1M06G 1UIJA 1ASJ3 3N7LA 5IK8A 3WW3A 1AYM2 3H0OA 3GYDA 1LODA 2MEV1 4WVZA 5JR7B 3AKPA 3ZYIB 4RR3A 1HDKA 5I0RA 4B4PA 4FT8A 5CFCC 1W6NA 4X6RB 4XDQA 1PO12 2D7FA 2CYFA 2YC0A 3KT4A 4YNIA 5I93A 3LOIA 2RS32 1HV1A 4UW3A 2CNAA 2DTYA 3VDDC 5KXEA 4OFGA 4HZFA 4WV8A 1RJ8A 2WKKA 4L9BA 4N43A 3R0RA 2RS12 5FQ0A 4GKYA 4FXGB 3IBMA 3DF0A 1O7FA 3J8F2 3G7DA 4MXWA 1W0OA 1HRV3 4YVSA 4ZU5A 3ZFFA 1VBA3 1W6MA 3OY8B 2C5DA 2EIGA 4AI3A 1TMF3 5EFUA 3ZIWA 1VBB2 1VBE1 3GALA 1X8MA 1ZM1A 2ZKLA 4GQ7A 3U11A 1ULCA 2BFUL 1QHDA 1PGW2 4M3CA 5KC5A 1MZEA 1S2BA 4N43C 1LTEA 3VKNA 5JOWA 1WLDA 2PHUA 2P17A 4LO4B 1UKRA 4GH4A 3MF9A 4P14A 3QBQA 3H7JA 3ZYPA 5GZGA 4YVSC 3ZFFC 4B3NA 4N90A 3MIBA 1B35A 3VBHA 3AMPA 3MLLA 4Q2FA 1JUIA 1RHI1 3ZFGA 1X8EA 5FPZA 3RYKA 2D6KA 5DDJ3 1JW6A 1YJKA 4CEWC 3D0JA 4YGEA 3OBTA 4W6YA 4DZGA 3WDUA 2HWD3 1ZBA3 3VHRA 2G9FA 4MH0E 4Q4Y1 4XFCA 3PJYA 1UU6A 1RUC2 3BALA 2V09A 2HWC2 3KMHA 4GH4C 4N9HA 1GNHA 1TE1B 3AKQA 5DUVA 1GZCA 1RUOA 2FZ2A 2F4PA 1O91A 1VB4A 3H1MA 4FAHA 2IFRA 3VBHC 3SISA 3ZFGC 2OUHA 1DIWA 1X50A 5CU1A 3NO8A 1C5HA 3E6CC 4XTPA 1ZBE2 3CU7A 2CAUA 4DY5A 2I2SA 4YM3A 5KXBA 2YYOA 2ZGRA 1VP6A 2IXCA 5D1IA 4YG6A 1YFXA 4EN7B 2ZGNA 2R073 1IS6A 4QM8A 4Q0QA 2BVBA 4BH9A 1MZFA 1N1SA 1UD1A 2VW2A 3J4UH 1F31A 2JEMA 4UW6A 2A75A 3MW3A 4XJAA 4GWMA 3JBG1 4W6XA 5A3LA 1XU2A 1SCRA 3GF6A 4JGZB 3QH6A 1FATA 1EPWA 3MIEA 4CDUC 3DGTA 3AMMA 4M3CF 4OUSA 5J7MA 3OY8A 4LO8A 1O5UA 1C4RA 5A33B 2BNMA 4H7LA 5IK7A 4YW2A 1QOSA 5FMOS 2ZX0A 1CIWA 2NP0A 5ACA2 1HRI3 1VRH1 4I0BA 2P34A 4QQ2A 3WNXA 2ZCWA 3U07A 2Y38A 4NOTA 1OFSA 1UU4A 4GB33 2OYZA 4Y1UA 2MEV3 3RJRA 4BCUA 1H2KA 3EJKA 1WW4A 4EN6B 2K9ZA 2W68A 1G9BA 2VW0A 1NA1B 1Q56A 2YXSA 3H1WA 1S0DA 1VAVA 4D7TA 4KQ7A 4S2HA 1NG0A 1QDCA 4V1PA 3WLUA 4KU7A 1C57A 2XLFA 1NLSA 3WDVA 4JTNA 4HVQA 2PA7A 2WWSA 2R042 3AXEA 3KGLA 4MZUA 4P9IA 4I01A 3VHPA 2CGPA 1YJLA 4ONUA 3UJQA 1IS3A 3EBRA 3VBRB 3LCPA 3MYXA 1ZRCA 1LOGA 1A8DA 3WR0A 1H1AA 2D6NA 1LHVA 1EV12 3N7KA 5E8AA 2IXJA 5FLHA 5FRAA 3HR9A 1MEC1 3B5LB 1OI6A 1Z7S3 1BKZA 2D6PA 1YXWA 3HD8B 1NCRB 3IWZA 1GICA 1R1A2 5F1RA 4EN0A 5JIAA 3TN92 4TSVA 1RUH2 2PAEA 3RS6A 4LNVA 1AF9A 1BK1A 2WT1A 4BE3A 1AYM1 1PIV2 3NV2A 4UBHA 2X53S 1RVF2 1MS8A 3RI8A 1QJX3 3J9SA 1I5ZA 3DV8A 2VG9A 1H30A 3MZHA 1VBC3 1PO11 3R6SA 4AK3A 4K20A 3KLSA 2PHTA 2RS31 1QJU1 4IL7A 1KFXL 4JGZA 3JB4C 1KJLA 1UPSA 4DNYA 1DQ1A 4IEQA 4Z1VA 4QGNA 1AXYA 3S0MA 1DYKA 1OLQA 3WD5A 4FQZA 4R9AA 4FPFA 2X8KA 3FLPA 1WUVA 2AH2A 2ZMKA 4AHWA 4QPGB 3ZXKA 3USUB 1MVQA 4CP2A 5A33A 2XBO1 3KZ4C 1H1MA 2HWE1 4DXZA 3M7AA 2Z2SB 4HLTA 3J8F1 3R4SA 4Q4Y3 1LHOA 5JZGC 1YIFA 2ZOEB 4PLNA 4Q0UA 1N1VA 1RB8G 2VQAA 4XF9A 4OHWA 1NCQA 2ZTNA 1LGNA 1H8TB 1IKPA 3V0BB 2G9GA 4MGZE 4DRVA 3ENRA 3VHNA 2WLQA 1PGW1 4PLMA 4I02A 5T5LA 4ZU4A 2GN7A 2A6VA 4ZKTB 4G9SB 4M0NA 2B39A 3PMEA 1LESA 3TB0A 1H4HA 5L73A 1ZYBA 3LGRA 2UWCA 1D4VB 2YDEA 4Q0SA 2D5FA 4KH9A 3VHOA 4GIQA 4AE2A 1NCQC 2Q0AA 3WY6A 2DFCA 2XL9A 1X82A 1CPNA 5AVAA 4HK9A 1ALYA 3JBG3 2WFPA 2D3PA 2EF6A 4DOUA 3VBRA 2BGCA 2D6LX 1C5IA 4AQTA 2BTVC 1YFWA 4INDA 1XU1A 4KG0A 2GMEA 3WP4A 1NOVA 1D4M2 2JENA 3JD72 4HKWA 1RUC1 1XNDA 3VN4A 5C4WC 5BPXA 2HWC1 4M3CE 1NCRA 1ONAA 2PHWA 4N9IA 4WVWA 4COVA 4CDQB 4BA6A 5E88A 5F6KA 3V0AB 4COWA 5SV8A 1A3KA 4YM1A 4YGCA 1RJ7A 5GZDA 5FOJB 1NQDA 4K6BA 2D43A 1W2UA 1D0GA 1ZBE1 4XJUA 2NN8A 5C8CB 1HXS2 1MS0A 3B7MA 1V70A 2WC2A 2DVBA 1VBD2 2GN3A 2WS92 2GNBA 2ATFA 2HWB1 3E97A 4NWVA 1UW8A 1VR3A 5JSRA 1RIRA 1CAWB 2DF7A 1QH7A 4Q26A 1CVNA 1OQEA 4LO6B 3VZOA 4QPGA 1URXA 2XG3A 3FLRA 4O9GA 3USUA 1DQ6A 1HQNA 5L19A 3MIFA 1U12A 2XJQA 3M3EA 4K8FA 3H8UA 3B94A 1W39A 4UXAA 3KS7A 2B7YA 1BQPA 4FPGA 1AR62 1DDLA 1K5MC 4XBQA 1REDA 3V0BA 1BYHA 4OVEA 1QXJA 3BIWE 3AXDA 5ACA1 1MEC3 2E53A 2R49A 4LUMA 1HQLA 2K0GA 3VKOA 3QCWA 1PK6B 3M3OA 4QPGC 1RITA 2PLV2 2XVGA 3VLBB 2ZMLA 1ND2B 2FQPA 1COV3 4LUKA 3ZSLA 1KQRA 1AYM3 1D2SA 2AREA 3ZIXA 3SNMA 4AFDA 3ZFEC 2C0ZA 3POWA 3FZ3A 5BNNC 3VBSC 4KBBA 1PO13 2D6MA 4LE4A 3JU9A 1QKQA 4BLIA 2RS33 1R082 3FX3A 5BNQA 4K21A 2ZGOA 2ZX2A 3VBUC 4YW3A 4XJWA 3IIAA 3WX5A 2RS13 2QNKA 4XHXA 1BMV2 3M4FA 3KGZA 1SQ4A 1FOD1 3J8F3 1H4GA 1EV11 4CDQA 4LO7A 1HKDA 3O14A 4YGBA 2QDNA 2GSYA 3V0AA 1AR92 1JN2P 4R9DA 3UKTA 2IC1A 1POV1 2W39A 1LU2A 1VBB3 1R1A1 5C8CA 2YZ4A 2LUWA 1J3PA 2VVDA 3TN91 5H9QA 2VW1A 1CONA 3VZMA 3PVBB 2E7TA 1ASJ1 5J37A 1RVF1 1ZZBA 4FO9A 5HXVA 3AFKA 1I9RA 2HYKA 1AL22 4NR1A 1NLRA 2DURA 1CAWA 2A5ZA 4P5HA 4AFBA 1VIWB 2GU9A 2GMMA 1BZWA 4NN0A 2A6ZA 1YUDA 4H55A 2VOXA 5FMOL 1BXHA 4ATFA 1I1EA 4EWAA 3TOJA 4HT1T 3RDIA 3HN1A 4L99A 1G86A 1TEIA 4S2DA 5LEJA 1YYNA 4YM0A 5K7PA 4PJYA 1DGWX 4K1YA 3WQ7A 1RTVA 1QF3A 2VXRA 3KCXA 1RUC3 1W0PA 1T6GC 3KSCA 2HWC3 2KXLA 1U5YA 5LK5A 2ILMA 3AYAA 1HRV1 5T5OA 4AI1A 3FE5A 1PK6A 1RUE2 4DMIA 4H14A 1TMF1 5CG9A 1ND2A 3MIDA 5DG1A 2B8MA 1SLAA 4OULA 3RNSA 4LLFA 3A4UA 2JE7A 1QQP2 5CFDB 3ZN5A 1RL3A 2VULA 3P3NA 4CYDA 1ZBE3 3WP6A 1UIKA 1H9WA 4Z92B 2TEPA 3DN7A 2ZHMA 2OIIA 3O0XA 1MS9A 2E6VA 3B9CA 3W59A 2O0OA 2XH6A 2ZZJA 1CQ9A 1HQWA 3BPZA 2P3JA 4IERA 2PHDA 4GALA 5EZWA 4A7KA 2WFF2 1CAXB 1SBEA 1NY72 4Q1RA 3VBOB 4AEJA 3IM0A 1FX5A 1CX4A 4MVTA 5DDJ1 1GQGA 1H2MA 2HEYF 2PQQA 5E89A 5K9YA 2SBAA 1A6CA 1D4M1 1SEFA 1ZBA1 2WNUB 1LOEA 2Z42A 4QGLA 2RJLA 5AFBA 2XVKA 1GSLA 2VUJA 5FO8B 4YRDA 1KFUL 1YWKA 4FOYA 4E4DX 4K9SA 1DZRA 5ACA3 2B5HA 2ZBJA 4RSUA 5FO7B 4IV1C 2A71A 5GLUA 1RUF2 3E5QA 1Y3TA 2QDRA 4PIXA 3ECQA 3VL8A 1UN1A 1VLNA 4CDXB 3RPQA 3ES1A 4CP0A 2P2KA 2VNGA 4N53B 3E6DA 2QE3A 2WS91 5GZCA 4YFWA 2GC3A 3VKMA 4WM7C 5KWRA 1OOPC 4H3WA 4WBBA 1POV0 3LZZA 4D7SA 1LULA 3JUUA 3UL2A 5I91A 4HL0A 1PGL2 4JRLA 2ZX4A 3M3QA 4JCKA 2H6BA 5I0UA 1PZ9A 2R043 2LM3A 4KL1A 4Q1PA 4L11A 4LBOA 3B9IA 5EV7A 2VOKA 1EV13 1CAVA 4AGVA 5HBAA 3V65A 1UPIA 5D8AB 1POV3 1HRI1 5FAXA 2EALA 1FV3A 5CFDA 1I6XA 3VL9A 1R1A3 1QU0A 2DVAA 2PLV1 3OF1A 3TN93 1RUH3 1APNA 4XMAA 1UF2C 4YVWA 1PIV3 4X8NA 2R062 2GAUA 4R4XA 5JOZA 2GC1A 1ZRFA 1RVF3 3N36A 1KJRA 4YM2A 5AC92 5H9PA 4PIZA 3AP6A 5GLZA 5FREA 4WM8C 4FTSA 1FNZA 5CIRA 5C33A 4U36A 3RMYA 1QY4A 3ZMNA 3BOPA 1CAXA 1R081 1W6QB 4S2GA 4AVTA 1WGPA 5CA6A 5GM0A 3VBOA 5A3MA 4RGGA 1NQJA 5JLVA 4KGQA 4I2OA 4KWLA 4RS5C 1R1ZA 3B69A 4F3JA 3ZVXA 3TRSB 4AI8A 5BV6A 4JVAA 2WNUA 5L36A 4YLZA 1BMV1 3WUCA 4YVWC 4RD7A 1MS4A 3NWKA 1GQHA 2ET1A 2O1QA 2XJRA 3NAPA 2YUEA 1QNYA 5E1RA 1C28A 3AB0A 1WLWA 1AR91 4A7ZA 4RR3C 2PYTA 1WCDJ 2AGSA 2OW4A 4XFHA 1ENXA 1RUD2 5T55A 4ES8A 3PVOA 1Z7S1 4Q4W2 2ZACA 1A8MA 4YSFA 4BIFA 1S0CA 4R4ZA 4CDXA 1SMVA 4U2AA 2YROA 1AJKA 1J58A 1MR5A 4N53A 2IZWA 3MFCA 2Q5TA 4XQDA 1S0JA 2I74A 2Y0OA 1BJQA 2BUKA 1QJX1 2D93A 1JHNA 3ILNA 1VALA 2CY6A 4AWDA 3NAPC 3ZSKA 3LWCA 1BVVA 1VBC1 4XFGA 2DCKA 2DUQA 3E6BA 4XIKA 1TME2 3RMXA 3TNPB 1REFA 4MLOA 4FVVA 1DQ2A 1ULDA 5CB7A 4D3WA 1QNWA 1W6OB 3CJXA 2PHRA 1F8VA 4ATEA 3MDPA 4MGKE 5CADA 1D4M3 3JD73 3UK9A 4IEVA 3AKTA 2WA3A 1LEDA 2ETEA 5D8AA 1FPN2 4YARA 2SLIA 4JDMA 4R8HA 1PMIA 5L7OB 4YZ1A 2FZ1A 4G4FA 5H9RA 2CWSA 3D0SA 4BYYA 3HT1A 3ZN4A 5HCBA 2QKDA 4QQOA 1B35C 1G9CA 1TNFA 1CAUB 3ASIA 4R9BA 4BHPA 1GNZA 1HXS3 4Q4V2 3ES4A 1XRUA 3GBWA 3HQXA 4AHYA 1J1LA 2H0VA 2NMOA 1VBD3 5C8WA 2GC2A 2A6WA 1W6QA 2JXAA 2WS93 3N7JA 2WINB 3PVNA 1WBLA 5EWSA 2VU9A 2XWJB 2E9QA 4QM9A 5D8AC 2GC0A 3FMGA 4Y1ZA 3WXPA 1DGLA 3NKGA 1D2QA 2WFF1 2WL1A 3NJZA 2CWMA 4AXOA 3ZSJA 3CL1A 2ZJCA 2AZ5A 1CPMA 1GFF2 2WQZC 2VECA 2DCJA 4DRRA 4EN8B 4J6GA 4J1WA 4XF1A 1V00A 2CGOA 3ZSEA 2R0FA 4FAGA 4YZ4A 4ES9A 1AR73 1AR63 1G9DA 2DUPA 1BEV2 3HMYA 5F6LB 4AEMA 4HKOA 4XFAA 5FBZA 3CJIB 1RUF1 4EWDA 2VOWA 1WW5A 1LOBA 4AG4A 2PLV3 2GH2A 4FTBA 3ACLA 3WDXA 4LR4A 2B42B 4XBNA 1FMD2 1PO22 4LBKA 1C8NA 1JYCA 2QQPA 3NV3A 2YGMA 2N7GA 3UJOA 4AQSA 3L9JT 3WDTA 4L2NA 4Q0VA 2ZX3A 2ZGKA 2RR12 3NV4A 4OHXA 1J3RA 4FPHA 5BNOB 2BBVA 1XYPA 4MV2A 2QJVA 1BBT2 1R083 4IEYA 3ZXDA 2O8OA 1PGL1 1W6OA 3JZVA 3WDYA 1YI7A 2HEVF 4HETA 2WSVA 2XLAA 4EJRA 2VMIA 4AEKA 3OJBA 4I0WB 3DL3A 2FMYA 5L7OA 3OD4A 4YZ2A 1QH6A 3MIGA 4OUMA 2LALA 3AMHA 3AZYA 1V6JA 3IDCB 4W6WA 1AR93 3THPA 2OVUA 4BZ4A 2MPFA 4IV3B 1LU1A 1CAUA 2GNMA 3ZN6B 5H9SA 5K0UB 5T50A 3AMNA 3T1LA 2TBVA 4Z07A 4IEZA 1G6NA 3R4UA 4PF5A 5I0SA 1S1AA 2ZZQA 4AQ6A 1COV1 1H2NA 1IS5A 2RS52 4XFFA 5JWPA 4KGGA 1YO8A 1DQ4A 1ULGA 3PVEA 1IHMA 4NHKA 4DINB 4META 3ATGA 1AL23 4G3YC 4CTEA 1BVP1 4LBMA 4LTAA 2WA4A 5J98B 2DCTA 2YV8A 1GLHA 3AP7A 2R16A 2Z79A 2O8QA 3V56A 4E27A 3I8TA 3MICA 4OHZA 4MXVA 2A3WA 4LBLA 4XEZA 4XMIA 2R1DA 4CDWB 4JTOA 1EPZA 3IDBB 2JG9B 4MX3A 1G8WA 1HW5A 5FTTC 4XQ4A 2RS11 3OGGA 5DZEA 2VNRA 1CR7A 1Q8VA 3SCGA 3D6EA 1B09A 4AQ2A 3CJIA 5JVVA 3AMQA 4E4ZA 1RUE3 1EP0A 3IPVB 3AZXA 4Q4W1 2IFWA 1V6OA 1VBB1 3RQ0A 3BTAA 3NV1A 4FPYA 4JGZC 2UY8A 1O3TA 2KA3A 3AX4A 3BB6A 3C2UA 1QQP3 1G9FA 1RGSA 4B4QA 3ELNA 1YI9A 4I3PA 3VZNA 1RINA 3SCHA 5BNOA 3M8LA 4Q4X2 1NA1A 4XILA 1LGCA 1TNRA 1ZNPA 3WQ1A 2ES3A 2DU0A 4PDWB 1TME1 2BVVA 3M3CA 4HSJA 3S30A 3AZZA 3NSTA 2ZGUA 3KT7A 5ABJB 1WMFA 2WFF3 2VOVA 2ERFA 1HLCA 1SLLA 2EAKA 1V6NA 1KS5A 1VAKA 2RMU2 4QT6A 4GWNA 3WUDA 3VZJA 2C1FA 3AP9A 5BNOC 2DVGA 1FPN1 4RQPB 4ZXKA 5J3UA 4IV3A 1NA1C 2B46X 3ZN6A 4NWWA 3U0ZA 4IEOA 5CVRA 4NHMA 5K0UA 3SH4A 1N3PA 3LA7A 1MQTB 1O4TA 1PNGA 1RUF3 3AJYA 3A0NA 1AZDA 1AYN2 1UZZA 3D8CA 4FPOB 4MGYE 2AENA 5AFEA 4Q4V1 4XETA 5GLTA 1WW6A 3MPPG 3VKFC 3VBRC 4L92A 4HVRA 4I0AA 4XE9A 5LRSA 1V6LA 3H7YA 2A6YA 4XF0A 4OI0A 3I7DA 1NCRC 5I0TA 2H0BA 2NM1A 2UYAA 2UU8A 2WSUA 4QQPA 1YIPA 2EXJA 4CDWA 1XNKA 5IK4A 4Y1XA 2JG9A 4B29A 5C9AB 1N3OA 1OQ1A 3AYCA 4TYSA 1AR72 4Y5Z0 4Q27A 1JOJA 1BEV1 3IPVA 1GV9A 4BLJA 3ZXFA 2VVEA 1EAH2 2XPJA 4I30A 3URFA 1H8TA 4EV0A 4LT5A 3AZWA 3MI8A 4WZCA 2ET7A 4TLFA 4LULA 5I8YA 3WW1A 3RZZA 3ZXJA 1S2KA 4DPNA 4AW7A 1PO21 2HKXA 3B3QE 3DPRB 2P3IA 2R063 3DUIA 2VUAA 3ME2A 5T54A 4KG8A 3POYA 1AJOA 1KITA 2RR11 5AC93 2BW8A 4PDWA 2Q8OA 4N7IA 2X29A 3ALQA 2QVSB 2WLPA 1Y7BA 5ABJA 2CL2A 5CBLA 1H8TC 3EQEA 1WMDA 4AFCA 3ZYJB 3PMSA 5LK7B 3UKNA 4FOVA 3SH3A 2YGLA 2A3YA 3W9AA 3M70A 2I07B 4OHYA 1WLTA 3WP3A 3SCFA 5J09A 2IXKA 5JCTA 2R041 3GBGA 4P9WA 3U10A 2H6CA 4RQPA 3KM5A 2PN5A 3FC0A 2ZHKA 3AK0A 3KT1A 3WW2A 1MQTA 4ISRA 1C1FA 2XUMA 1FXZA 3USSA 1H8VA 5BXXA 1U5IA 1H1IA 1RUD3 3JQWA 2BYVE 5CG8A 2MNGA 4Q4W3 1SFNA 3UV9A 2VMGA 4YFZA 3IMNA 4Y1VA 1RUH1 2D3SA 2RS51 2DVDA 3VV1A 3SITA 3AYDA 1DGRN 3GZUC 1PIV1 1PZ8A 1TQ5A 3JB8A 2NPIA 3T2TA 3I59B 1RUJ2 2D40A 2BQPA 2UURA 2V5YA 1WMEA 4RA0A 4EN9B 3SXWA 1HV0A 4CEYB 3FBMA 3G6JB 3ZSMA 3IKWA 1YFYA 4CDQC 1TME3 1SACA 1H2LA 2PHLA 1EY2A 5C9AA 3W58A 4CP1A 4QPIB 4LHLA 1I3HA 4D94A 3AZVA 4LA3A 1VBE2 2IXHA 4QHBA 5C8CC 3WG4A 2ZKNA 2Q30A 4OHVA 1AX0A 4ASLA 2BNNA 3NL1A 1QMJA 1IZ3A 3HBZA 4F7ZA 4LHNA 1DG6A 2OZ6A 1XYOA 3N7MA 1FPN3 1R092 3ROUA 3HIFA 3D82A 1ZA4A 2GDFA 3B93A 5FOBB 4HN0A 4B8EA 1WBFA 4RFT0 3DPRA 4P9YA 4D69A 3GNEA 1RHI2 3OGJA 4C0HA 4XF3A 1ZVFA 2W08A 4B7EA 3RWNA 3TBDA 4Q4V3 4W65A 4UW5A 1JUHA 4IETA 2A6XA 4S2FA 4MUVA 3RJ2X 4IEPA 4PBPA 3O12A 5IUQA 4HSLA 4M0HA 4Q4X1 4P9JA 5KHJA 1OMIA 1RC6A 4Y1YA 1IOAA 4XIOA 1ENSA 3WHUA 5CFCB 4XQWA 4AVCA 1CD3G 4KNCA 1PK6C 3AP4A 1Q3EA 2FMDA 1ND2C 1SDWA 2RMU1 4COYA 2NQYA 2ZPXA 2W0XA 1LCLA 4RL7A 4QQHA 1ULEA 1MVEA 3MW2A 2PELA 2ZGSA 3JD71 2JKBA 2GZWA 4XBLA 5JI7A 2VH9A 4YW4A 5J48A 1BEV3 3H3UA 4E2SA 3TNQA 3WHTA 3INAA 4TWTA 4FSJA 2Y0IA 4KU8A 1SLBA 1ULFA 1AYN1 1DGRA 2NYYA 4YG0A 3LA3A 3THTA 4A3XA 1UL9A 2C9AA 2UWAA 1FMD3 1PO23 1HXS1 3I59A 4HKLA 3AP5A 4BOWA 1QWRA 4CEYA 1VBD1 2RR13 2ZGTA 4N43B 4TZDA 1V9U2 4QPIA 2IXLA 4Q29A 2VMHA 1PVC2 2GH8A 1QGLA 4WVMB 1BBT3 3MIHA 2CAVA 1O3SA 5HI0A 2XHKA 3TYJA 4OI4A 4PIYA 5CNAA 1VRH2 4YVSB 4BWOA 2ZABA 3PLQA 3WG3A 1BCXA 3ZMOA 2ZAAA 1AXZA 3RYRA 3LKJA 1GBGA 1QXRA 1IKQA 1WW7A 4AVVA 4FQ4A 1RUI2 1AR71 4CEWB 1LOCA 1AR61 4I09A 2QFEA 1EAH1 4A2UA 3BU7A 5CAZA 4Q8LA 3X29B 1S0GA 2A70A 5A32B 2EXIA 2ZHLA 5DZFA 3N3HA 1A78A 2A7AA 4RHV2 4A7YA 1IPKA 4MGIE 3ZXEA 1MZ5A 3VBHB 1SBDA 2RS53 2AYHA 4WVVA 4JDOA 4NHLA 2BPA2 1QDOA 2FHRA 4M00A 1KD7A 1XNBA 2LTNA 1ZZ9A 4HVOA 4XFIA 3AJZA 3I54A 1QJY3 5CFCA 4COUA 4E2QA 2E63A 4XXAA 1O4ZA 2NZ9A 3J26N 4H7MA 4QMAA 2UYBA 3N4MA 4C1XA 4YW5A 5GJ6A 5LRRA 3JCIA 2Q1MA 1AL0G 3FWEA 5CFDC 1ENQA 1LJ7A 5DZGA 4NO4A 1OFNA 1WCKA 5FLJA 4FOWA 4IXLA 2DCZA 2R32A 2HWF2 4JC1A 1RUG2 1ZRRA 5GLWA 2EAAA 4CDUB 2GALA 1Y43B 1N3QA 5JSOA 4Y22B 1SLCA 4XXPA 1JXNA 4HMZA 1QJU2 3QOPA 1U5ZA 4QXKA 1AUYA 2TNFA 3VBOC 2ZGQA 5I8SA 3OBRA 1UZYA 2UY9A 2R30A 2WJSA 4GA9A 5BY5A 2ZGPA 2WNUC 4XW3A 1RUJ1 2XBO2 2B45X 4Q4X3 1AL21 2HWE2 4WVMA 4YZ3A 1SFYA 2R0HA 3ILRA 4HPKB 2ZS6B 2XLGA 2B9UA 2JG8B 2IXIA 3AYEA 5JIUA 1HIXA 1AXKA 4OI1A 2R6QA 3RI9A 5EXOA 1V6MA 1N1YA 2E7AA 2PHXA 2RMU3 4LBJA 4LO5B 4CEWA 4CDXC 4DY3A 4K3UA 1ZZ6A 4N53C 4Q0PA 4FTEA 1LR5A 1X7NA 4XJZA 2ARXA 3P3PA 2EA7A 1D0HA 1R091 5HCFA 4M01A 3TAYA 5A32A 1RUE1 2EVXA 3S7EA 4XTMA 2EXHA 3VBFB 1AYN3 1EYBA 5F9TA 4N7UA 4R9CA 5BYNA 1LHUA 1QQP1 3LOBA 1OKQA 1Z78A 2F6BA 1FI2A 1DU3D 2HEWF 4GMP0 3OPZA 1JH5A 1OPMA 4DS0A 2R1BA 4FP2A 5J36A 1C1LA 2JECA 2P3KA 2WQ4A 5AVPA 1ZZ7A 3KCCA 3RSJA 3JQXA 5KHHA 3KD4A 1DGWA 1YNAA 3HAGA 2VY0A 4COZA 1L3JA 1RMU3 1NY71 4C90A 5GLVA 3MPBA 5HCAA 1WA4A 5JAXA 4CDUA 3RYPA 2G4IA 1LOFA 1X33A 4GMP3 5DUUA 4ORFA 2XJTA 1E57A 4Y22A 1EAH3 3O0WA 2XB6C 5JZGB 1YRZA 3VUOA 1S0IA 2HWB2 1QOTA 1PHMA 3BOWA 3WZ1A 3L2YA 5FFOC 4LBQB 1C8M2 1X36A 1J3QA 4XHBA 3D5OA 5T3NA 4DQAA 1JBCA 1N1TA 3CLPA 1O3QA 3H1YA 1UCXA 1NZCA 2BEOA 1AR82 3ZXAC 3PJQA 1YHFA 2PFWA 2ENRA 1XE8A 1LOFC 1DYPA 4HPKA 3ILFA 2JG8A 4Y20B 1V9U1 2RM22 2D98A 4X6QB 5BNPB 1PNFA 5DXDA 1PVC1 3MW4A 3SHRA 1DQ0A 4X8PA 1GANA 5K8SA 4AI2A 3WOGA 4E2GA 3MLKA 1NCQB 1UAIA 4AVBA 4QU2A 3WQ0A 1CGPA 1JTZX 3H50A 2XKPA 1OQDA