1OPMA

Oxidized (cu2+) peptidylglycine alpha-hydroxylating monooxygenase (phm) with bound substrate
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
310
structure length
310
Chain Sequence
NECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PEPTIDYLGLYCINE ALPHA-HYDROXYLATING MONOOXYGENASE)
publication title Substrate-mediated electron transfer in peptidylglycine alpha-hydroxylating monooxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 70
structure length 310
sequence length 310
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 1999-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1opmA02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 1opmA01
1PHMA 1SDWA 3PHMA 4E4ZA 1OPMA 1YJKA 3MIGA 1PNFA 3MLJA 3MIEA 3MLLA 4R4ZA 4R4XA 1YI9A 3MIHA 3MICA 3KS7A 3MIBA 3PMSA 3MIFA 1YJLA 4QHBA 3MIDA 1YIPA 3MLKA 1PGSA 1PNGA
chains in the Genus database with same CATH superfamily
2GN3A 2WO3A 4BZ4A 1JZ6A 4TLFA 4NOTA 4FPOB 4PQ9A 5KHGA 1SLBA 1HIXA 2BP6A 3IWZA 5HCAA 3VKOA 2QQUA 4IEUA 2PAKA 3LA7A 1ENXA 1ENQA 3HOBA 2RG4A 3W20A 2RMU1 1LODA 3U1XA 1C28A 4MGIE 3NQHA 3BUCA 1AX2A 2GH8A 1RMU1 1T6BX 2VUAA 3C7FA 5JI9A 4KMQA 1G9AA 5LCWL 3D0SA 3PUAA 4XQDA 2GNBA 2RHPA 2F17A 1FNZA 2VVDA 3LIGA 4AHZA 3NV3A 2ZEYA 4CE8A 2X5IC 2XPJA 5F2WA 5DDJ2 3P5BA 4MXVA 3WR0A 1HN0A 3H0OA 4YWAA 1QJFA 3INAA 2NQYA 5FZIA 5LY2A 1ZM1A 5FREA 1ZA7A 2VQTA 4YZ2A 4R4ZA 3FBMA 4NWVA 4FTSA 4XFFA 4N53A 2DVBA 3B7MA 3M3CA 2GC3A 2ZEZA 1ZZBA 5BNPB 3S6PA 1JYCA 5J7MA 2PQSA 1KJLA 5FYHA 2AREA 4BQ1A 2WLQA 3PUSA 2WJSA 4PBOA 4TZDA 5A1AA 4NPRA 1FNYA 2D3PA 1UMIA 5L9RA 1UZVA 2ZGMA 1TME1 3H7YA 4LTAA 2PELA 4YM0A 2ZGOA 4YGDA 3K51A 5A6QA 2VBDA 5F3IA 4H14A 4YLZA 5C9AA 2QQIA 3VHOA 4OHXA 5KXBA 1K5MA 3BIEA 3LOBA 2VCMA 3NNFA 1YXWA 2HWB3 3ZPYA 4CVUA 3C8XA 1YJKA 2D6PA 4GB31 4KWLA 3UGGA 4RHV3 4RGGA 4CZSA 1LOEA 1VRBA 2NM1A 2YDEA 3P3PA 1YHFA 5I0TA 2WFF3 4L8QA 3IDAA 4AK3A 1RUG1 2G9FA 5J48A 4R9BA 1NY71 1AR71 1O6UA 5F2SA 3T1MA 1YO8A 1NCRB 4P9IA 2Y0OA 4IL7A 2I2SA 4IQPA 1O3RA 3AFKA 1SCRA 4COZA 3GZAA 4HVOA 5LW9A 4B1MA 4XJUA 2E63A 1U12A 1OF4A 3RS6A 4XETA 1SFYA 2GSYA 1Z7S3 2VCCA 3PUIA 4Y4YA 2FDJA 2VMHA 5BXXA 4BMBA 2NP0A 4FT8A 3B93A 3T2PA 3H1YA 3VBFB 4HZFA 2OXBA 3V56A 2WBKA 5T55A 1UD1A 4JAAA 1A3KA 1UPIA 2QE3A 1NE6A 3RWNA 2QQJA 5ACA3 1OD5A 5IVEA 3FN9A 5FYSA 4L0PA 4OFGA 2ILMA 4QPIC 3FJSA 3K46A 2ARXA 2A1XA 1C4RA 1NQJA 3BTYA 1G9FA 4GZ9A 4Z82A 3I4IA 2A73B 2KM2A 1I5PA 1QJEA 1D0HA 2LALA 4EWDA 3N35A 1S1AA 3AKTA 2QKDA 3MLKA 1V6NA 5FPBA 4CRQA 1F4HA 3WF4A 1H30A 3IIAA 4AI2A 5FFOC 2VUJA 5I0DA 1B35B 4SLIA 3GZEA 3ZXFA 2FDGA 1UYXA 3GDBA 1NXD1 1MEC1 4K3UA 4MGSA 3UESA 3OPWA 4LBKA 4XHXA 1IS6A 1IKPA 2VNRA 2UY9A 1AR61 2Q8DA 1XPWA 1Y43B 1EUUA 4M3CA 4UFMA 4I30A 4XQ4A 1J84A 2QQMA 3WNPA 3U11A 3UYJA 3NVCA 4GAZA 3R05A 5FZAA 3OUHA 3N7KA 1SFPA 2JKBA 4L11A 2G1MA 5FO7B 5JXGA 3TEXA 2D6LX 1WMEA 1OUXA 1OQEA 3VL9A 1RUD1 1UU6A 1W0NA 2JDMA 1COV1 1XNTA 4I3PA 5FPAA 1ZRCA 1W9FA 4QX8A 2WNUB 4E4ZA 1LGBA 2VOXA 3B69A 3KGLA 3H8XA 1ZREA 1NYWA 1HB4A 1XSQA 1UIKA 2W46A 3HT2A 2WWJA 1R093 3DXUA 4JGZA 4BHPA 4NJ4A 4DIQA 3AZVA 2N7GA 5F7UA 1BHGA 1GLHA 3W9AA 2IFWA 2JECA 4ASLA 5HCBA 1W8ZA 3GGLA 1LTEA 1EUTA 4BQ2A 2EIDA 4LORA 1TMF2 4UI9L 4GKYA 4YG6A 4ZHNA 3I3BA 2VZQA 1DZQA 2ZCWA 4DS0A 1W2AX 1ND2A 5HXMA 3TEYA 5ERLA 3VBRC 3SH5A 4QWNA 5C71A 1W9YA 4W8JA 4NE9A 1CQ9A 4XVHA 2JG9A 2LTNA 1ZBA2 4DUXA 1PO23 1IHMA 1QJX3 1UOGA 3DPRA 3H42B 3OUIA 5EFUA 1MACA 4GJYA 2BFUS 1KJRA 1OFNA 3WD5A 3OPTA 1T2XA 3L2YA 4OMDA 2W1SA 2HWD3 3B02A 3MLJA 1TG7A 2Q8EA 1ULOA 3VBHB 5IVYA 1GANA 5D8AB 3WLUA 1PVC3 4XOGA 1UU4A 3ALQA 1Y7BA 5JI7A 4L99A 4D7TA 1VBD1 3PTRB 4BIOA 3R0RA 3SKJE 4CCNA 1ND3A 3SH4A 4BLJA 4QAWA 4PIZA 3O7OA 3DN7A 3AZWA 4QPWA 1EV13 3M70A 4H7LA 4W50A 5F3CA 2W1QA 1PO11 3MIDA 1RHI2 4IE7A 4OQ8A 3M1HA 3Q8FA 5F32A 5B4NA 1LHWA 1GWMA 5FZ7A 4QB1A 4GJZA 5FYTA 2DF7A 3VUOA 1NCQB 2WA3A 2WWUA 3I8TA 2P1BA 2MEV1 1LHUA 2PLV1 2XLAA 3WCSA 4ARXA 5AC92 4YM2A 1R1A3 1UOJA 3K2OA 2CV6A 3K3NA 3ZO0B 2WZ8A 3BALA 3S5QA 5CKNA 1TNFA 4NHXA 3MIHA 2ZZJA 4FAGA 4YGEA 1UO9A 2HLEA 3WX5A 4CDWC 2W1WA 5BY5A 5JUVA 1JZ3A 2F6BA 1X82A 3IPVB 4DZGA 4CUCA 2D7FA 1AL22 1ODMA 4H7MA 2VTXJ 3HD8B 3UGHA 3V0AB 5FY5A 4K1ZA 1BEV1 4GULA 1HXS2 1QOOA 3CBNA 5KC5A 4BQ5A 4A44A 1W6PA 1KS5A 2OUHA 5KWRA 3BTAA 3SKVA 1LOFC 1HB1A 4WV8A 4CDUA 5J3UA 2PHFA 4DXZA 4Z2WA 3CJIC 3VBUA 3WNXA 2JB8A 2WS92 5J37A 4JGYB 3EYPA 2PTMA 3DF0A 3ZXJA 4Y20B 1H9WA 3IBMA 1I3HA 1HRV3 1RGSA 4LO6B 2ZPXA 2VXJA 3UV9A 1OD3A 4CTEA 3THCA 5IWFA 1LECA 4FFIA 4PDWC 1NUKA 2QQNA 4Q4W2 1GSLA 5FUNA 1WW7A 2XVLA 1HJFA 1F9KA 2JE7A 2GH2A 3JXSA 1ULGA 4DEVA 4P00B 1US2A 4HPKA 5I0RA 1RUI1 1V9U1 3A7QA 4XUOA 5T5OA 4Y24A 5JOZA 4AEDC 2VE1A 2RS33 3BB6A 1F5JA 1SBFA 2XUMA 2JENA 2UYBA 2WC2A 4YW1A 3D8CA 3M2MA 5FZ6A 5T52A 3AL6A 1VB2A 1NZCA 4EZ4A 4R9DA 4R4XA 3AX4A 1LJ7A 4IE4A 4LUKA 2GC2A 4WM7A 3AP5A 5C4WA 5FV3A 3SNMA 1AXZA 5FYBA 1I1EA 1GQHA 1QQP2 1CD3G 3NMBA 3ZFFC 1W2TA 4ET7A 1OLMA 4JDMA 4A6OA 1DGLA 2NZ9A 3WCRA 1BMV1 3LAGA 4OUMA 4GA9A 2WYFA 2YGLA 4YVSA 1X9PA 2RR11 3NWKA 3R4UA 4N9IA 1PMHX 4OHWA 3ZDSA 2YC0A 4B1LA 3DV8A 5FXZA 2DBNA 2KXLA 3NV2A 1RUF3 3PNAA 1UAIA 1YYNA 1ZZ8A 3TYJA 4I3GA 4RS5C 5BNNA 4QT6A 4CDQA 2HKXA 4RR3C 1X8EA 4FPGA 3I3MA 3VDDC 5JSOA 3AYDA 1P8JA 4NIAA 1GOHA 1RUE3 4J1WA 1X33A 2RM23 4XFAA 3VZLA 4IV1B 3PJQA 5E16A 4DXSA 1FMD2 5C9AB 1SMVA 3JUUA 3SCHA 4KGGA 4QMAA 4UT5A 5DABA 5ABJB 1RVF2 3GNEA 3KSCA 5K0UC 3ZR6A 1A34A 3KV4A 4WVVA 2VVEA 2XJUA 4XBQA 2DCYA 4LE3A 1F35A 5A3WA 3M3IA 1AL0G 2VOKA 4FPCA 3ZR5A 1I5ZA 2FDHA 2FDFA 1WW4A 2Z4FA 2R063 4Y1XA 2Z69A 3NL1A 2YC2A 3D5OA 4LXLA 1GZ9A 2WWSA 1AZDA 1LHOA 1UMHA 2H0VA 3UNPA 5DDJ1 5I0UA 4Q0UA 4UW6A 4AQ2A 1YFXA 4TTGA 4OHZA 4XCAA 3OEBA 4NUBA 3WVJA 2W5FA 4YZ1A 3LPFA 4UWDA 3AJYA 4META 5IJRA 2VZRA 3FC0A 3DYOA 5D21A 4PF5A 5F5IA 4CEYC 1DYPA 3E5QA 5BNOA 5IATA 1D2SA 4QQHA 3ZFEC 4N43C 1YWKA 1BBT3 3V65A 4LULA 1WZXA 2XR4A 4PJYA 1H2MA 5IVVA 2BVVA 2E33A 5LK7B 3U0ZA 3OF1A 3RI8A 3LEGA 2PMWB 1QJY2 2ZHLA 3N9MA 4CDXC 1ZBE3 4QPGA 1JUHA 5I8SA 2FDKA 3ON7A 3H3LA 3O1OA 4I0BA 3TAYA 1W9TA 2VNVA 1R083 4OHYA 4GWNA 2ZGTA 2E7TA 3AM2A 3WW3A 3RMXA 4DINB 2VPVA 3I97A 5CFDC 1CZSA 1OVSA 2YHJA 1NA1B 3EO6A 2JDHA 5M0TA 4OUEA 4QHOA 3ZKYA 2QNKA 1BLZA 5IHRA 2OQ6A 4W4ZA 1DGRN 1QJZA 2VH9A 1D2QA 1WMXA 4AFCA 3GZTB 3BOWA 4ES9A 1WWYA 3OGSA 3AKQA 2VXRA 3QBQA 2HWF3 4AAPA 5JZGA 1B09A 2GAUA 3PJYA 2P37A 4KU7A 1PIV3 1VAMA 3VDCA 2Q0AA 5T5JA 4ASKA 3O1TA 3KCYA 2TUNA 4I2OA 3I49A 3OGRA 1J1LA 3N9QA 3V0BA 3MFCA 2VQ0A 1RUJ3 2ZABA 5IYYA 1O4TA 2QUOA 4FOQA 3W5NA 3ZXAC 2GN7A 2IVIB 3KS7A 4XC9A 5GALA 5G05L 1PVXA 1J59A 3WSOA 3KT1A 1F31A 1POV1 3QLQA 3POSA 5HI0A 3IDEA 2K9ZA 5FP8A 3FE5A 2VU9A 4AL9A 4O7XA 4W6YA 3M7AA 5FZ8A 3WW2A 3M4FA 3T4VA 2P4EA 2K46A 3GHNA 4BXFA 2VOTA 3AP7A 4B29A 1ND2B 2WABA 3FWEA 4GH4B 1SCSA 5IAVA 2EAKA 4XUPA 5FY0A 1XYPA 4W6WA 1D4M3 4XF0A 3TEWA 1YQCA 1FPN2 3CZJA 1AYN2 5FMCA 1CJDA 2C0ZA 3AMPA 3MV01 2CNAA 1H8TA 5A3OA 2R1DA 4DFSA 5F9TA 3S5AA 1IG0A 1SG3A 4XIKA 2JD9A 4Y4RA 3H50A 4Y1VA 1G7YA 3SEEA 2ZGSA 3OG2A 3OGVA 1W6QB 3VDBA 3E1F1 1PK6B 2CWMA 3BN6A 1HDKA 3JU9A 4HK9A 2WUHA 4U2AA 4BU2A 1EAH2 4EWEA 1KD7A 5FP3A 4CCOA 2R16A 3M3QA 3RMYA 1HRI3 1ND3B 2Q30A 5AFBA 4EE2A 3BPSA 3CKHA 3VD4A 4FI9A 2JWPA 1PGL2 2E51A 2JEMA 1MS3A 4QX1A 4AWDA 5FPUA 2VTXA 2LUWA 3MW3A 3U75A 2FD8A 4JRLA 1KFUL 2YU1A 5C8CA 3NAPB 3JBG2 4YVWB 3JD72 4AGVA 2VMDA 1OUSA 3QH7A 4YFZA 2JXAA 3DCQA 5LK5A 3WW1A 2PHUA 1WCQA 2A75A 4IETA 4YM3A 3WZ1A 5FO9B 1W05A 1CAVB 1STMA 1TMF1 4MSVA 4NRPA 5T5LA 2X5IA 4JKLA 4C0BA 4NIDA 4D6QA 4XFBA 1S2KA 1UY4A 5FZ0A 4DB5A 2XBO3 5CKMA 4I0WB 4PI2A 5E1RA 3TN92 2WN3A 1VB4A 1Q8PA 1CX4A 1ZBA1 2HWC3 4X6QB 5F5CA 4XBLA 3RZMA 5CFCC 2OPKA 1RUC3 4UAPA 1DP0A 3VD3A 4Q4X3 5A3UA 1AR92 3DKQA 3HBKA 4OVEA 1VRH2 2GNTA 2Q5TA 2WYSA 2YC4A 4FPEA 4NAMA 2D98A 4CDUB 3KLSA 5GLUA 4CCEA 2VCAA 5E8AA 4B4RA 2WO1A 4IE6A 4YPJA 1S2BA 4DRVA 5IFTA 2P3KA 4CU8A 5A33B 4WZFA 1LNSA 1PNGA 3MBWA 4BE3A 2B8MA 2Q4SA 2XUEA 3WG4A 5E89A 2C9KA 4WM8C 5L7OC 1QH7A 3H8OA 5L19A 2RS53 2Y6HA 3AKRA 4GWIA 1RHI1 1GP6A 3MIEA 2WQ8A 3J8F2 3KF3A 5FZOA 5K4LA 2XDVA 4IGPA 2UWCA 2WSUA 4FPLA 1CAUA 2DVFA 4FO9A 5AC91 3ZXEA 1Y3TA 2XWJB 4B7EA 3I2FA 4P9LA 2A3WA 2ZMNA 3T2OA 2JDYA 2YV8A 2Y6FA 3APBA 1SLAA 2YROA 3LFIA 4BLIA 4FOWA 5GZEA 1H1MA 5H9SA 3IAQA 3I3DA 5KHIA 1AL21 2D6MA 2XLGA 4Y5TA 5FLHA 1MQTA 1NLSA 3OJBA 1HXS1 4NHYA 4OUSA 4BCUA 5DAQA 4N8MA 1O59A 4Q4Y2 3VBOB 3UL2A 5C70A 2ZAHA 4XF9A 2WZPP 3KWVA 2WNVB 4F8AA 1C1LA 4DPNA 3LOIA 3PTYA 3UT0A 3ZSEA 5AFEA 4LBNA 4NPLA 3FFZA 2D5HA 3CEWA 4XAAA 4QPIA 1JI6A 2Y64A 2WS91 1G9CA 1FI2A 4ISQA 4M01A 2XVGA 1IS3A 4ZU4A 1UX7A 5CZKA 1OH3A 4IEOA 4Q4W1 4HL0A 4D7YA 4FTBA 2ES3A 1YUDA 5KR7A 3KM5A 4MGKE 3SCGA 4OCTA 1XNDA 3I2GA 1UY0A 3P6BA 3ZSKA 3PL0A 4URAA 3VV1A 2R043 3HN1A 5FYMA 3LWCA 2X05A 3WT3A 2PXJA 3USUB 1Q8SA 2WT0A 4D8MA 2KD7A 1VMHA 4IESA 5GJ6A 4C90A 4NR1A 2J1VA 2R6QA 4Q0VA 2VMEA 3ZLIA 2BJSA 1MS4A 2G9ZA 4Y33A 3VKNA 5C3QA 3KMHA 2YPJA 1UOBA 3RWKX 3BU7A 3NNLA 1DQ4A 3LD8A 2OKXA 3ILFA 2WLPA 2ZKNA 3JZVA 3J7NA 2VG9A 2XONA 4QU2A 1QQP1 3EXUA 1VJ2A 5F6KA 3MO4A 5EZWA 3RRDA 4AFMA 4LT5A 4RQPB 3VHPA 1BVVA 3F95A 5H9RA 4MX3A 2LW8A 1QOSA 1O5UA 2V4VA 2DDUA 2EA7A 1KDMA 5CB7A 1MS0A 2P3YA 5BNOB 5ANNA 4LHNA 3ELNA 1O8SA 2WQZC 4KG8A 1NLQA 1W04A 3FX3A 4GALA 2P6HA 3FUQA 4HBNA 1QXPA 1OQ1A 1LEDA 2HWB2 2KA3A 2BW8A 3KQRA 4J25A 4Q27A 4R52A 1OLRA 2PHTA 2R0FA 1LHVA 4JV4A 3VBRA 1FYUA 2RDQA 5FMOL 4HKWA 4AEKA 4RHV2 5LZ6A 5BNPC 1UF2C 2WFF2 1FOD3 1CJPA 1FMD1 2BGPA 3GJAA 4FPKA 2BWCA 3ZDVA 2JG8B 2A6YA 4QB6A 2CGNA 1RVF1 4UXAA 4YW2A 1TQ5A 4COYA 4EWAA 1SPPA 3ZMOA 1KS4A 1V0AA 4DMIA 4AEMA 3O14A 1AVBA 1UZWA 3N9LA 2BPA2 2J1UA 2H6CA 1WW6A 1YI9A 1Z7S2 3O0VA 4OLLA 5CISA 4Z92B 4C0HA 1ZRFA 1D7PM 1HV0A 4I0AA 5A6ZA 3R4DB 4UF0B 4MADA 1QDCA 1H0BA 5FLJA 1PM4A 1H2KA 4LHKA 4BXSV 3HPNA 2E9QA 4LO5B 4AHYA 1UPSA 4FOVA 4XDPA 5EQUA 3SHRA 5ACA2 1GZTA 3MEPA 2R072 2B7YA 3BPZA 3NNGA 4KQ7A 4O65A 4PLMA 2ARBA 3RJ2X 1NCRC 2OVUA 3PHMA 4AFAA 2B46X 2VZVA 3O5SA 4LBMA 3B5LB 1ZA4A 2A7AA 3T09A 4GMP3 3T08A 5A1LA 4KGQA 2YPDA 3ACHA 1QEXA 5IK4A 4MXWA 3TNQA 2GDFA 1RXGA 4OZOA 3VZNA 2DWRA 1QJY1 1NOVA 4A6SA 3VBFC 1QDOA 3FFQA 4CDWA 5SV5A 2NPIA 3E97A 2WQ4A 1OLME 4MO3M 2DTYA 1U5ZA 2FMDA 3AFGA 5DAXA 3R6SA 2AGSA 4QQOA 1N3QA 4M4PA 4HVRA 5A7WA 4K6BA 3SC7X 5JIAA 1LOFA 2VL4A 4MYEA 4XF4A 1JH5A 2XHKA 1QJU3 2D43A 2EIEA 3IAPA 3CJIA 3KGZA 3SLIA 3UK9A 1WCSA 3C3VA 3NKGA 2XKPA 3BI3A 1NX9A 2BOIA 1DGWA 1W6OA 2HH9A 4X8PA 3GJBA 1LENA 3JB4C 1IG3A 3LA2A 3OYWB 4XYXA 4Q4V3 1B35C 4DRRA 3MHZA 5J1XA 1ALYA 1M06G 2R32A 2VUDA 1ASJ3 5E6HA 1AHSA 1R092 4BPZA 3WF3A 3I2JA 1PZ9A 4IV3B 3T0BA 3RZLA 2F4PA 1WBLA 1RUH3 1ST8A 4LA3A 3T1LA 2A3XA 4Z1VA 1H1AA 2A71A 2P3JA 4MZUA 4UBGA 4QKFA 4Y1UA 3VGIA 4JHZA 2NYYA 4BYYA 5C8CB 4Y26A 2HYKA 2DCKA 4ES8A 2ADEA 2YXSA 1YFYA 1XJAA 5FZHA 3VBSA 2BEOA 1OSGA 2YBPA 1RUNA 4PLNA 5DAWA 5H9QA 2OQ7A 5CEHA 4LK7A 2WNUC 2R073 1PO22 1QJX2 4YM1A 2I45A 1GP4A 4BOWA 2MPFA 5IVCA 1W06A 5FZLA 3NJYA 3CU7A 4BM8A 1L7QA 4IUGA 4M0NA 5A3TA 4FFGA 2VZOA 1WD4A 2QDNA 5FUIA 3ZFFA 4X6RB 4IEZA 3U07A 4LBLA 5FK8A 2HWD2 4LBJA 3Q8AA 2VZTA 1LGCA 1FPN1 1AYN1 1PVC2 5HCHA 2UYAA 2WINB 2ZX1A 2RV9A 3RI9A 4EJRA 2O8QA 1WLDA 1VMJA 1CN1A 5FP7A 1GICA 1POQA 2Y33A 3KF5A 1UYPA 2W87A 3NV4A 4RS5A 4FQ4A 1RJ7A 3GBGA 1EV12 4RR3A 1MVEA 5GZDA 1W6NB 2W95A 4TSVA 1BVP1 3VDDA 4NIGA 1LU2A 1BXHA 1EAH1 4CUGA 1AUYA 1OC1A 5F39A 4YZ5A 3NJZA 3ZSJA 4IEWA 2SLIA 1PGL1 3ZOIA 1OKQA 1YLLA 2VOWA 3CO2A 3VBHC 5D8AC 5FMBA 2CSGA 3MI8A 1F4AA 5FWEA 5K0UA 3ZM8A 4XJZA 5CA6A 1UKGA 1R1A2 3IIIA 4BQXA 1NZIA 2XJRA 4QKBA 4YG3A 3JBG1 3JD71 5FZOB 1J83A 5IUQA 2EALA 5FZ9A 5C3PA 4EN7B 4Y22A 3A0NA 2H0BA 2QBXA 1DCSA 4A3XA 2E31A 1DLLA 5DUWA 1IS5A 2EXKA 1HKDA 1U0AA 4NWWA 2AEZA 2E6VA 1YC61 4XXAA 5LBEA 4CXWA 4COUA 1SLIA 4B7KA 3VD5A 1N1SA 2XL9A 4E2GA 2AACA 1NCQC 1WA4A 2W1UA 1XBFA 1Y9QA 3TN91 4K20A 1CIYA 4LBQA 3UGFA 3X29B 1MQTB 3VD9A 3GM8A 2R49A 3A4UA 2V09A 3FLRA 3ZFEA 3ZXLA 1AR91 5FOJB 4MHRA 1CAXA 4XJWA 2VGDA 1VRH1 3FUOA 1HRV2 4A3ZA 4AI3A 4ISRA 1DFQA 1H4HA 5HPOA 1LESA 1YQ5A 3OY8A 3K4ZA 4LR4A 1UZYA 2XHNA 4OI0A 2AR6A 2WA4A 2DTWA 2XL7A 4LKEA 1UCXA 1JUIA 3MUY1 3WEZA 4CDXA 1J3RA 3BODA 2Y6KA 2RS13 3J4UH 5LB6A 4EN0A 2JDAA 2Z5WA 3I59A 1JOJA 1AYM3 2IXCA 3WG3A 3NRUA 4QKDA 3U37A 1GWLA 3VKMA 5T50A 2JX9A 1H9PA 2WNEA 3WV6A 1OMIA 3GHMA 1FX5A 4FCAA 5FZMA 1WKYA 3CHXA 4AG4A 3J8F1 1H1IA 1OOPB 4IXLA 2RS32 4JGYC 2VMIA 5CFDA 3ECQA 5I93A 3WINE 3RZKA 4E4SA 5C5UA 2ZGRA 2P3IA 2B5HA 1PMIA 1SLTA 2VW2A 4K9SA 5HV4A 2W91A 1KRIA 4XTPA 3DYPA 3N7LA 3KHCA 2EXJA 3HNMA 3VKLA 1JYIA 1A8MA 1S0GA 1Y9MA 4R9CA 3H1MA 3A22A 2YUEA 1OHFA 1VBB3 3A21A 4P9GA 2V5YA 4Q2FA 1DF0A 3O0XA 2XJTA 4LJHA 3MF6A 2V72A 3KT7A 4XEZA 5FPXA 2VJXA 1RUF2 5FTTC 4Q4Y1 2O8OA 4UYBA 2QQLA 1W3XA 3OBZA 5FBZA 4CCKA 5LBFA 3T0AA 2E32A 5AVPA 2W08A 1XXNA 3ENRA 4QHBA 2D6OX 3OGGA 4PT6A 2WZR3 4JRAA 2ZXQA 1UX6A 3OPZA 1H6YA 1RUE2 2FCTA 2VNOA 2RM22 2ZX3A 4CEWA 2D3SA 2YGMA 2PHXA 4LHSA 3BVCA 1RIRA 3J7MA 3POYA 2Y34A 1C8M3 5BNNB 4CUAA 3PMEA 2VO5A 3WUDA 3ZX7A 4CP9B 3DYMA 2OUJA 1C5HA 1XQNA 4PHZA 2GU9A 2R062 2Y60A 3AMQA 3UKVA 2GMPA 4MVTA 1JHJA 2E26A 3A0KA 3LA3A 4L92A 3HQXA 3H3UA 2HEWF 1NAEA 2PHDA 4JHTA 4QQ2A 3HIFA 1OXCA 1NKGA 4CXXA 4IV1C 5C9AC 1UXXX 4H3WA 4XDQA 2BDRA 3K3OA 4AQTA 2ZS6B 4OYUA 5FZGA 5ABJC 4Q8KA 5JPMB 2C26A 2C5DA 4D7SA 1GUIA 3ORJA 4AVTA 3MPPG 4YYOA 3PU3A 1V6JA 3AMMA 4QX7A 4RA0A 3MLLA 1MS8A 3UKTA 1C3HA 3AK0A 5I8YA 1BBT2 4XMIA 3VHNA 4ITCA 4XQWA 1JS9A 3SH3A 2RVAA 2VNGA 2W2IA 4RGKA 1IQDC 3PIJA 3H1WA 2E53A 4LA2A 2TBVA 1NLRA 1ZBE2 2OPWA 3AXDA 4QM9A 4Q29A 3B01A 1XNBA 5FJKA 1QKQA 4YZ3A 1REFA 1R082 5LASA 1HV1A 4AOCA 4BQ3A 4KI5M 2ZMKA 3GBWA 4EN8B 2JDUA 3IKWA 3PU8A 4MXWB 5C7GA 2HWB1 3ZFGA 2VZUA 3OOXA 4XCBA 4N53B 4XXPA 2HJIA 2VW1A 4RHV1 1W8OA 2VECA 4LLFA 2WFF1 1GOGA 3N3HA 2TEPA 1SLCA 4CA9A 1QHDA 5B4XA 5CFCA 1JZ7A 5FKBA 1WLWA 3AB0A 3VZKA 1O8PA 4YSFA 4UOJA 3LFMA 2XJSA 3M3EA 3M8LA 2QVSB 4QPYA 2FZ2A 1N3PA 1GQGA 4LKDA 2HWF2 3POBA 4K40A 2PQQA 4HOOA 1PIV2 2VVFA 1K5MB 2BU9A 2FQPA 1VBA3 4LLOA 2B39A 5FBJA 1Z7S1 4I01A 1RUJ2 3POFA 4LE4A 3OGJA 1EP0A 5FAXA 3UJOA 2WO2A 1W6OB 2FBEA 1BK0A 3IMMA 4L9BA 5FK7A 5JDBA 4FBFA 5JOXA 3I2DA 2A6ZA 2EAAA 1NA1C 3B3QE 1JYXA 1IGOA 3AKPA 5ACA1 1TZOA 2FMYA 2R071 3O1UA 4QX0A 2VTFA 1W3VA 1KITA 1HQWA 3TRSB 2XOMA 3P1IA 1ZZCA 1VBE3 3LF7A 2OYZA 4DXTA 4Y1YA 1WLTA 3BIWE 2NN8A 4XJ9A 3E5XA 3HNYM 2ZX0A 4BISA 1BK1A 5LATA 1VIWB 2YYOA 3VBSB 1NT0A 1JN2P 4ATEA 5T3NA 3VZOA 1PZ8A 2Q1FA 4CCDA 1D4M2 4HFSA 1F5FA 2DBIA 1GNYA 1N1VA 1H2LA 1D4VB 2HWE3 2J1EA 2O1QA 1OT5A 1BZWA 1GYKA 4JTOA 2WN2A 1SDDB 1URXA 1APNA 2YB7A 3WHTA 1W03A 3CNAA 4ASMB 2JE9A 2FCUA 2QQOA 4LO8A 4LUMA 1QNWA 1QXRA 1X8MA 2ARCA 1S0BA 3HVDA 4UFKA 1JZ4A 4H55A 1HX6A 2V4AA 4MGQA 2WDBA 3GF6A 4MUVA 1ND2C 5FZEA 5C8WA 4GH4C 4FSJA 3T2QA 1DLCA 1HRI2 3HWJA 1W9WA 4ONUA 2BUKA 5LRRA 2ATFA 3NJVA 3WOGA 3PURA 1AR83 1J58A 3D4KA 2VAUA 4GWJA 2AEYA 3LDBA 4YW4A 4BMEA 5IK5A 2B9UA 2R1BA 4QDRA 1XB9A 1R091 1JBCA 4M3CB 1M4WA 2ZBJA 2ZHMA 1O91A 5BUVA 1YNAA 1LKNA 1DQ2A 2GC1A 3HN3A 5A70A 1PK6C 2VY0A 1IZ3A 5CAZA 5KXCA 1H8VA 4F3JA 4QXKA 3CMGA 2ZTNA 3HR9A 1FXZA 1W9SA 1XSRA 1ND3C 1LGNA 2ZGUA 3FBYA 3ZYFA 4I02A 2XBO2 4G9SB 5F1RA 1RB8G 4YNIA 1MS5A 1PO21 1QJX1 1RJ8A 2HWC2 4HN0A 4O61A 5C3OA 2DU0A 4JGZB 1H6XA 1RUC2 3NAPC 4Q4X2 3R4SA 4YVWC 3AYCA 5F6LB 1VMFA 2DURA 2WIIB 1FV2A 4AI9A 4Y5Z0 5A7NA 2HWD1 5FYUA 1XE8A 3VN4A 5JXIA 2DUPA 1PVC1 4MLOA 1RXFA 5JSRA 5JPNB 2WT2A 3FHIB 5FWJA 1V70A 2WSVA 4XW3A 5FY9A 4FVVA 3E5UA 2I07B 4Q1RA 1CAXB 3ZYIB 1S0IA 4FTEA 2JG9B 2ZEXA 3DEMA 5FO8B 3IB3A 3DPRB 1UN1A 3OY8B 5FJHA 2RMU3 1HN1A 3ZN6A 1EV11 4V2VA 4CCCA 2RS52 4TLGA 1W6MA 1V6KA 3MFAA 4RSUA 4Z8BA 2IXIA 1CR7A 2W0XA 5LY1A 5IT6A 1RMU3 5FUPA 2VBBA 2VCBA 4CSWA 5BNPA 3WG2A 1WMFA 3I59B 4GWMA 4UW4A 3IN9A 3N9NA 5EJZB 4CDUC 1R1A1 1W39A 3HEIA 1G8WA 4RL7A 1LOCA 3ES1A 4BA6A 3AYAA 3DXTA 4PQQA 1JHNA 1XE0A 4BQYA 3LDRA 4MOAA 5DZEA 5L9VA 2AH2A 2VMCA 2BTVC 2QJVA 4BJ0A 4A7ZA 5CNAA 1JW6A 2BQPA 4XIOA 2Q1MA 2H6BA 1Y9GA 4UFJA 2AENA 2BNOA 3ABZA 1I9RA 3BOPA 4FP2A 3ZYJB 1QMJA 5FXXA 2CY6A 4B3NA 2EIBA 1DQ6A 2QQWA 3WP3A 2UWBA 1NCRA 1TME3 4P5HA 2EICA 3O1PA 2IVJA 3RYRA 5TSWA 5FXWA 4MV2A 4PBPA 2UU8A 1HRV1 1PNFA 3MYXA 1ZVFA 4MG2A 4Y5SA 3FLPA 3PDQA 4GB33 1GFF2 3D0JA 3OUJA 3U10A 3VBFA 2A6WA 2QFEA 1WMDA 3TBDA 4A41A 3VBOC 1CVNA 1W6PB 1RUG3 3WNKA 5FPZA 2WNVC 4CEWB 2R042 4AVSA 1AR73 3ZPOA 2DU1A 4YW7A 3WUCA 3TEZA 3ZSMA 3WDVA 1O5LA 2D97A 5J96B 3Q9OA 4CXYA 3FLTA 3VBUB 4COWA 1LU1A 2GP5A 2GMMA 4QXHA 2RS31 4XACA 4XILA 1BJQA 1S4CA 4XTMA 5FYZA 5IK8A 2VD7A 3WF0A 4JDOA 2ZZQA 1ULPA 1W0PA 3S0MA 4AI0A 1DYOA 1MR5A 3WY6A 1B35A 4HPKB 2BNNA 1WA6X 2ZX2A 4CCJA 2XQRA 3WDXA 3C7HA 3H8UA 2YBSA 2RDRA 4GXLA 1SACA 1ZZ6A 2ZEWA 2BZDA 5F8PA 2JIGA 4LBQD 3CZUA 3CF6E 2VULA 1U5IA 1RUF1 1UY3A 1XNKA 2GC0A 4XHBA 4KNCA 2SBAA 3U78A 1Q3EA 1UXZA 1G9DA 2A5ZA 5K9YA 1XE7A 1I6XA 2J1AA 1K5JA 2JB4A 4WM7B 5C4WB 1ZRRA 3I3EA 1CX1A 1YCIA 3E6CC 2BVBA 4RYDA 5JR7B 5A32A 3AL5A 3C7EA 1RUE1 4XJ8A 3ATGA 1L3JA 2RM21 4QXBA 3ETPA 3SQOA 4D0QA 1FOD2 1MEC3 1GZWA 4RQPC 1NE4A 4YVSB 4WBBA 1S0EA 4TWTA 1FV3A 1AR63 4DUWA 3GALA 2F4LA 3ZFGB 1T6GC 5T54A 4D3WA 5CG8A 1RC6A 4FXGB 5BNOC 1X36A 2HBTA 1UMZA 2W52A 4PF1A 1Z0HA 4IEPA 4XZPA 3OSDA 4Y1ZA 3ZN4A 4AVCA 5FYYA 2BERA 2R061 4CDQB 5IVFA 1OKOA 1S0CA 3WDWA 3J9SA 4TN7A 3ME2A 1G6NA 2EIGA 1RUD3 3S30A 1COV3 2QZ2A 1IKQA 2X29A 2ZACA 3EQEA 3LEIA 4H2AA 4ZY9A 4DOUA 2W39A 5LEJA 1A6CA 1S55A 1Q5OA 2VUCA 5FR3A 4QX2A 2QCSB 4ZU7A 4GMP0 5FQ0A 3K77A 2WAOA 2XJQA 2G9GA 2J1SA 2JG8C 3RQ0A 2O0OA 4JKMA 4QQPA 1S0FA 4QDQA 1WCKA 4YRDA 3N4MA 1RTVA 4S2DA 4CYDA 2EF6A 2ZGPA 3SCFA 4QGMA 1SLLA 1GV9A 5D8AA 1GNHA 1V6MA 1BBT1 3FMGA 4AE2A 3HNBM 4NHKA 2D44A 2GALA 4OMCA 4BIFA 1UW8A 4HKOA 3SISA 1OLQA 4XBNA 5JCTA 1S2EA 3N9OA 4E8DA 1PX4A 1ZBE1 3SXWA 2RJLA 4JVAA 4B4PA 5GKAC 4K21A 1ULDA 4QDSA 2OS2A 4R8HA 1R081 1O7FA 2JJ6A 3QCWA 4K7JA 1ULEA 3CQOA 1UY2A 2Y6JA 4CU9A 4C1XA 4LEJA 2QQPA 1XYNA 5BPXA 1K42A 1Z78A 5IW0A 3RZZA 3RZJA 4Q0PA 1QJU2 1W2UA 4N7UA 3KV5A 3WXPA 1DYKA 2XXZA 1VBD3 2WR9A 3N7JA 3SMHA 1UL9A 2ZA9A 3OD0A 4QPGB 4ZXKA 5A80A 2DCTA 2HWF1 4HSJA 3IPVA 1PIV1 2HYXA 2W3JA 1CZTA 1PO13 4Q4V2 4DY3A 4AQ6A 3AP6A 4KWUA 3LQCA 2BYVE 3BYWA 3KB5A 3LPGA 4U36A 1RUJ1 2DCJA 1ASJ2 2K2SA 2Q8OA 3WG1A 4PI0A 4OI1A 4FP3A 1HQLA 1LB2A 5D1IA 3POEA 2MEV3 2PLV3 4LO4B 1RUH2 2LRPA 1OPOA 1GOFA 4ZZ8A 1WW5A 3S7IA 2ADDA 4EZHA 1OURA 2QZ3A 2HEVF 2ZX4A 1REEA 4LKFA 5IAXA 5KBFA 3MV11 5C5TA 4YG0A 4JGYA 2X8KA 1OA3A 5JZGB 4Y20A 4A7YA 2VMGA 5EP9A 4BH9A 1WBFA 1LHNA 1XU2A 4D69A 2HEYF 1BEV3 2DYCA 4AGRA 3H3ZA 3V0BB 3KT4A 4NIIA 2CGOA 3I2OA 3SEPA 3AZZA 5FMOS 1NQDA 1QU0A 4IGOA 1VBC2 3POWA 4IV3C 4LO7A 4WZCA 5FZDA 1MS9A 2JD4A 3IT8A 5IVJA 4Q8LA 1ZRIA 4XE9A 1D4M1 2UY8A 2BGCA 5DZGA 5FPLA 2JE8A 4C8DA 1GU3A 2J42A 3NV1A 2NMNA 5C8CC 3O1SA 3RFRA 2QQVA 4RFT0 4MGYE 2XKOA 1YQ2A 4F83A 3KVAA 5GLTA 5DG2A 5LWBA 2WAAA 2XJVA 3EBRA 1X9TA 3WNMA 5DZFA 4ZONA 1WGPA 5CBLA 1Q56A 1J3QA 5GZFA 4E8CA 3DL3A 1HJGA 1YIPA 4P9JA 4Q26A 3O0WA 3T3YA 4COVA 4BDVB 2OZJA 1JZ8A 4NRMA 1FAYA 1HRI1 2YMZA 4JQRA 1GNZA 2LM3A 1RUI3 1V9U3 5I91A 5C3SA 3J26N 3LB9A 3THPA 5EWSA 1PMJX 3ZN6B 4A4AA 2CTVA 5H9PA 1H8TB 2XB6C 1W6MB 4M3CF 5EIYB 5HV0A 3VZMA 4CCLA 3ZYHA 1QGLA 2Y6GA 5CKQA 4HG6B 1GBGA 4V2WA 4CUBA 4DY5A 2XG3A 3CL1A 4PDWA 1CAWA 1ZZ7A 2ZJCA 4M0HA 4UBHA 4E9KA 3HQRA 3DKWA 5F3EA 3AMHA 5FRAA 5DG1A 1BKZA 3USSA 1H2NA 4JX0A 2RJ2A 4IV1A 2RR13 5AVAA 2XBO1 5CIRA 1OQDA 2RJKA 5ABJA 2HWC1 2IUWA 3C7OA 3VL8A 1RUOA 4AEDA 1JXNA 4CU6A 1RUC1 3WP4A 2A3YA 4Q4X1 4XURA 4ARYA 4JKKA 1E5HA 1XOYA 2JIJA 2YBKA 2CHHA 2VZ3A 4YW6A 3H9AA 3ZVXA 5JOWA 3RVHA 2VM9A 4NIHA 1VAKA 1RL3A 2J1TA 5HCFA 2RDNA 2QTWB 2X5IB 1WLCA 3RYKA 2CWSA 1VBC3 3BTZA 1MZEA 1JU3A 5I0SA 4K8FA 3VKFC 2EXIA 2RS12 2O14A 3BCWA 3K48A 4BK4A 4W65A 2WNOA 2ZOEB 3QD6A 1DQ5A 1HLCA 1AYM2 1LEMA 1POV0 4LOTA 4UFLA 1MQTC 3KCXA 2RS51 3FHQA 1L7RA 4FQZA 5JIUA 4GQ7A 3WNLA 3D82A 5A3PA 3GZUC 4WVWA 4ZS2A 3BGAA 4NVPA 2ZAAA 4PCRA 4AVAA 2KR2A 1DZTA 4C1WA 4QKNA 5C3RA 1C57A 2WFPA 3JCIA 5FPVA 3N9PA 5FYVA 3T0DA 2X53S 4NAOA 3LE0A 4QU1A 2R30A 5DDJ3 3E6BA 4FPJA 1MS1A 2EXHA 2OZ6A 1O3SA 2A6XA 1CPNA 2ZGLA 4QX5A 1JYWA 1VR3A 5KC6A 1AX1A 4QX3A 3T2TA 4HETA 1FATA 1VBB2 1IPKA 4P02B 1OI6A 4UW5A 2BRTA 5LA2A 2W94A 1OOPC 2J1RA 4E4HA 1CAUB 1NA1A 3DECA 4G3YC 1UYZA 1XC6A 5FZ3A 2UWAA 4GKXA 3OBRA 4OHVA 4BK5A 3ACIA 2IFRA 4AHXA 1ENSA 3OBAA 3ZN5A 2QQKA 2CDOA 4AI1A 3PLQA 3ACFA 2WZR2 2WL1A 1OFSA 1PGW2 2FCVA 1AXKA 4PLOA 2XVKA 2ET7A 1R64A 1W8TA 4J1XA 4LIUA 2BWAA 4CEYA 2DFCA 2BFUL 3IDCB 4XMAA 3ZYRA 1ZYBA 1DIWA 3U4XA 5GLVA 3K4DA 5A32B 1C8M2 3WQBA 1YJLA 1CIWA 4OI2A 4N43A 2XGXA 2WZEA 3ASIA 3AJZA 3B00A 3WP5A 1UYYA 1FT9A 4IE5A 3AYEA 4RN5A 4XUTA 1HW5A 1GZWB 5GLZA 5JXJA 2R041 2XWBB 2YZ4A 4ZPIA 4A42A 1W8WA 3ROUA 2ARAA 1XNCA 3LCPA 1JOPA 4FPHA 2W47A 3PVBB 4QPIB 2ERFA 4TXWA 4XDOA 4A7KA 4D6SA 3ZSLA 5K7PA 3I2IA 4LMFA 4LKSA 5FY1A 4CP0A 4E2SA 1W99A 3POGA 4DUVA 2VQUA 4GH4A 5BNNC 2R7EB 4YFWA 1C8NA 3KHBA 2VZPA 5FQ0B 5EJ3A 1DZRA 2AYHA 2IXLA 1POV3 4IE0A 2BV4A 4KWJA 4NN0A 4QHZA 5FYIA 3UJQA 2P5BA 1VPHA 3OD4A 1V6OA 1UU5A 5JXHA 1MPXA 2DVAA 1MZ5A 3Q8EA 4C91A 2AZ5A 1W6QA 3K4AA 1PK6A 3CDZB 1CWPA 3D6EA 3ETQA 3KV9A 3LSEA 4O9EA 2D6KA 4NROA 2OIIA 4XF3A 3KVBA 4AXOA 1R1ZA 4WVMA 4Z07A 5A3LA 2V5DA 1A78A 1NXMA 4MH0E 1DQ1A 1FOD1 3ZIWA 2VQAA 4XF1A 1ULCA 3ACLA 3U4SA 2Z2SB 3NAPA 4YZ4A 4YVWA 2Y0IA 5A7QA 2PAEA 4HVQA 3H8RA 3JQXA 5F5AA 3NW4A 5DXDA 1GKBA 1YFWA 4NPMA 1TNRA 1MVQA 4BQ4A 1CAVA 3MIGA 2IXKA 4N9HA 1UY1A 1VBA2 5B2GB 1V6IA 2XQXA 3BU0A 2GP3A 3PVEA 1GWKA 3I2KA 3VBRB 1E5SA 4QGLA 3KZ4C 4AFDA 2ZKLA 3ACGA 4N53C 2D93A 4P9YA 3P3NA 1IQAA 3D3AA 4IW3A 5KHJA 3QOPA 3ZYGA 3AZYA 4FPYA 1W2NA 4NMIA 4HT1T 3GBFA 4CPBA 4UW3A 3RG0A 3N36A 1SPPB 5LBCA 1O3QA 4XZUG 2ETEA 4SBVA 1JZ2A 2VZSA 3UETA 2L9LA 1G9BA 3WDYA 1ZZ9A 1TE1B 3EHKA 4LIVA 4MHUA 4AF9A 1VBE2 1MZ6A 1SDWA 1TMF3 4GMP1 1K5MC 4ORFA 4IDZA 1V00A 3AKSA 4D6RA 3OBTA 1OA4A 3PUHA 5IFPA 2VC9A 2XH6A 3AP9A 4P5YA 3JQWA 4A2UA 5DQ0A 2PN5A 1EY2A 5A33A 1ACCA 3VDAA 5GLWA 2NLRA 2BOJA 3VZJA 1W8FA 4L2NA 1VE0A 1ZBA3 3MF9A 2WO7A 2ZGNA 2P2KA 2P17A 4R9AA 4CP1A 2OA2A 3W58A 5FZ4A 3KD4A 3CLPA 1QH6A 2HWE2 4YGCA 4E27A 1O3TA 1SBDA 4NRQA 2BBVA 3POJA 1CZVA 2IC1A 2B4KA 5A7OA 1QJU1 1JTZX 4IEXA 3L9JT 5FYCA 3O1VA 2PHWA 4AQSA 3BTXA 4JTNA 1D0GA 1LOAA 3AZXA 1CPMA 5CYYA 3WNOA 4CDWB 3VBSC 3WDTA 1OPMA 5F37A 1EYBA 3Q8BA 4HANA 1KFXL 4EROA 1SBEA 5JMOA 4Q4V1 1RHI3 1AR82 3GXUA 1WCDJ 1UNBA 2DV9A 2Z42A 1ASJ1 2VOVA 4JZRA 5E88A 3WQ1A 5IK7A 5A7WB 3VBOA 4CCMA 1G86A 3CJXA 2WNVA 5AC93 1CGPA 4AI8A 1RUH1 2CL2A 4XABA 4YW3A 2Q1ZB 2VZ1A 4HK8A 5FCCA 3CJIB 1LCLA 5FIXA 1IPJA 3B9IA 2YFZA 4JDNA 3MGUA 4J6GA 2X09A 1LOBA 2AC1A 1AL23 4XFIA 3SITA 4X8NA 1BQPA 1YQ6A 4AGGA 5JLVA 1DG6A 4PDWB 4WM8A 1CAWB 3I2HA 5FY8A 5L7OA 2XJPA 5SV8A 2YG0A 1HXS3 4P14A 2HBUA 4KG0A 3RGBA 5EYXA 5FP4A 1ULFA 4HXCA 5EJ1B 4UFHA 3W59A 3J7HA 3IMNA 1VBC1 5DPNA 2E7AA 5C6CA 1F15A 3MICA 4DXRA 1YFUA 3EB7A 1PZ7A 4FFHA 4XJAA 3IZOA 1S0JA 3MIBA 3V64A 1OA2A 1V6LA 1W8NA 5DUUA 3USUA 5A6YA 5BV6A 5LRSA 2PFWA 1SZBA 2WS93 4IGQA 4XPVA 4AEDB 4BB3A 5DMYA 2VMFA 3ZIXA 3ZYBA 1QWRA 2RE9A 1IOAA 3AVRA 1XU1A 4OQ9A 1E5RA 4IEQA 4Q4W3 3HBZA 5FY4A 5KHHA 2RMU2 3O12A 1VALA 2J22A 2BNMA 5FP9A 3MPBA 1WD3A 4JGZC 1ENRA 3MDPA 4P9WA 3ZFFB 1AJOA 1RMU2 1PM7A 5CU1A 2A6VA 4IEVA 5LBBA 3NSTA 2VBPA 4RQPA 2CU5A 2C9AA 2JDKA 1O4YA 2G4IA 1AJKA 4HLTA 1N1YA 1YRZA 4L97A 3NJXA 4LBOA 4RFRB 2RDSA 3VD7A 3MUZ1 5FZBA 4LOSA 3LIHA 3LEMA 2IWGB 3ILNA 1JYTA 1DHKB 1ODNA 1N1TA 1U5YA 1UWWA 4RS5B 2JG9C 3G7DA 4INDA 1VLNA 4KWKA 3DPRC 4RR3B 1KDKA 4F7ZA 3VDDB 1QQP3 2OT7A 5ISLA 4LK6A 5DN2A 1ONAA 4NHLA 3WW4A 4GD4A 2D40A 3M3OA 4ZS3A 3WF2A 2Y38A 5GM0A 3LGRA 3T30A 2JG8A 5KHKA 5K0UB 3TNPB 4LHLA 4JC1A 2I74A 2P6CA 4P9XA 1TME2 2DVDA 5L9BA 4S2HA 2R0HA 3WHUA 3JB8A 4Y22B 4QGNA 1UZ0A 2ENRA 2ZGKA 4D94A 3HMYA 2Y26A 3EMRA 4K8RB 1YQ8A 5DUVA 3UKNA 2Z79A 1W8UA 5EV7A 2WRAA 4TYSA 2LROA 4GB32 5L73A 1KQRA 2C6SA 4KU8A 4UF0A 3LDKA 4Y3OA 5F5QA 3WQ7A 1FMD3 2RS11 1QF3A 5DUXA 4XFHA 1US3A 1RUG2 5FXVA 3H7JA 4EN9B 4S2FA 1NY72 1RVF3 3I7DA 4G4FA 1AR72 3HQUA 1AYM1 4HKLA 4IERA 4LBQB 3WNNA 4CEYB 1KEXA 1CONA 4LITA 2OX0A 5EXOA 1Q8VA 5T5PA 3ZFEB 1CESA 4N43B 3FZ3A 2AUYA 5FY7A 3GCXA 1OBNA 1QIQA 2A70A 3ST7A 3MZHA 1UQXA 5J09A 4B8EA 2DUQA 4BWOA 4FPFA 4ZXEA 4CDXB 3HAGA 2ZHNA 1K45A 1PGSA 1JODA 2X10A 3NO8A 4OZXA 3ZXGA 4JQTA 1TEIA 1GQPA 4AEJA 4HMZA 3AP4A 4CEWC 1SQ4A 1JU4A 3PVNA 3DUIA 1QNYA 1VBB1 1JMUB 1O4ZA 4ZKTB 5LA9A 5FZKA 3ZMNA 2P34A 3VBUC 3AXEA 4AR2A 5CFDB 4QB2A 2DUOA 3IM0A 1DBNA 1J1TA 1XRUA 3ZYPA 4DNYA 3MW4A 1UZZA 1TVGA 2WT1A 1Q8OA 1QY4A 1EPWA 2Q8CA 4S2GA 3THTA 1OH4A 4FFFA 1QJY3 4NHMA 2JICA 1H4GA 2JDPA 4MGTA 1RYYA 4BQWA 3POIA 5D2AA 4AW7A 4QM8A 3BKZA 2WZR1 4W6XA 2CDPA 1J3PA 1KXGA 1PGW1 3OYWA 2DVGA 4I09A 4FXKB 1JYVA 2NMOA 3F2ZA 1YIFA 3LZZA 1AF9A 1MEC2 1X7NA 4KL1A 4KH9A 2XMLA 3TWIA 3I3QA 3RDIA 4FAHA 1PHMA 1Y4WA 3FHAA 2V73A 3MW2A 1AR62 1GR3A 4IV3A 4M4RA 3GCWA 1C8M1 4WVMB 5LEKA 1XNAA 3ZKUA 4YARA 2CYFA 2CGPA 1SEFA 5KXEA 4URTA 1LULA 1WCUA 1ZX5A 4WM7C 3G6JB 3NNJA 5C4WC 3O1MA 3RNSA 2B45X 1YEWA 3CIHA 1KGYA 1RUD2 1COV2 1VP6A 4ZU5A 4QD2A 4DEQA 1W0OA 2ID4A 3PMSA 3PVOA 5FKCA 4YVSC 2ZMLA 2K0GA 3MIFA 3KV6A 2W92A 2IXHA 2E7QA 4AVVA 3ZFGC 5JSPA 3KQ4B 3HJRA 1EPZA 1IPSA 1U5XA 4E2QA 5CG9A 1S0DA 4MGZE 3S57A 2GNDA 4EN6B 2JDZA 4JCKA 4CDQC 4N90A 1DGRA 1OVPA 3LKJA 3O1RA 5L36A 3AMNA 4Q0QA 2JDNA 4A45A 4AYUA 5A3MA 3RPQA 3I54A 5GZGA 1C5IA 3ZXDA 2MHFA 5J98B 1W6NA 1LRHA 2GMEA 2BBAA 1DU3D 1UOFA 2YU2A 4Q5OA 5GZCA 2PHRA 5FMDA 5ANQA 2C4XA 1WUVA 3WF1A 5K8SA 1FPN3 5EYYA 1AYN3 2J7MA 5APAA 1HB3A 4YW5A 2CAVA 3URFA 4O9GA 5FZFA 4HN1A 5A3NA 1Q8QA 1DGWX 1GP5A 3B9CA 3RZHA 1VBD2 5A1FA 4FOYA 4YGBA 1RINA 1REDA 4Q1PA 5G04L 5FZCA 2PA7A 3RYPA 1LOGA 4AHWA 2YY1A 2ZHKA 4AAXA 4ZZ5A 3DGTA 1JZ5A 4M3CE 2G19A 2D5FA 4XFGA 4XUQA 2WNUA 5FLIA 2DFBA 5HXVA 2C24A 5J36A 1PO12 5A7SA 3FL7A 5F3GA 5EHDA 1VBA1 5CADA 1EAH3 2LS6A 3N7MA 1LAJA 2PYTA 5IVBA 2VW0A 3TB0A 2W9XA 2ORXA 2B42B 1W28A 2MEV2 2PLV2 3RJRA 3ZXKA 1IS4A 5EPAA 4KBBA 3W21A 5CFCB 4QQLA 1HB2A 3IDBB 3LSDA 3AVSA 3C2UA 4LQRA 1W8HA 3JBG3 3JD73 4QXCA 3TOJA 3VLBB 5BNQA 4ATFA 1AXYA 3B94A 2JKXA 2ZGQA 4QPGC 5I8TA 2PAMA 2FZ1A 3Q8CA 5FZ1A 4Q0SA 1GZCA 1VBE1 5KXDA 3AC0A 1AX0A 1X50A 2PHLA 1BEV2 3OTFA 5DAVA 5JOYA 3KCCA 1C1FA 1LR5A 2YFUA 3T4HB 2OW4A 3GYDA 2WKKA 4RD7A 4CP2A 2ET1A 3PUQA 1N3OA 2DCZA 3ITQA 4RGAA 3S7EA 4DO0A 4AFBA 3TN93 3VBHA 2IZWA 2W68A 4WM8B 5L7OB 4PIXA 3THDA 4CU7A 1SHWB 1Q43A 1RITA 3VB9A 5BYNA 4WVZA 2GNMA 1N47A 2HWE1 4AZZA 4EQVA 5HBAA 1AR93 1A8DA 2XLFA 3K75B 1OOPA 4Z2AA 1DDLA 3ILRA 1VRH3 1HQNA 4LNVA 5JZGC 3RZGA 2C1FA 1K3IA 1F2NA 1GMMA 3LEKA 2FDIA 4GIQA 1JYNA 4LPLA 5CVRA 1NG0A 3RSJA 5LA1A 4HSLA 1YI7A 4IEYA 2IXJA 4EV0A 4E4DX 4DQAA 1NCQA 1ZNPA 3OB8A 4P08A 5JVVA 1RUI2 1V9U2 1DQ0A 4NO4A 3WQ0A 5C33A 4AVBA 1UKRA 1UIJA 4EYUA 3HT1A 2CAUA 1AR81 1OF3A 2TNFA 2Y6LA 2D3RA 3W5MA 3J8F3 4OI4A 4M00A 4CPBD 1L7LA 5A6XA 2QDRA 4OULA 1BCXA 3A23A 3L2HA 3QACA 1QXJA 1F8VA 3V0AA 1SFNA 4V1PA 5JAXA 5DAPA 3J7LA 2EVXA 5FDBA 2B9VA 2ORZA 2Y8KA 1BYHA 1W90A 2FHRA 3OEAA 4B4QA 3C7GA 3ES4A 5JR2A 5FOBB 2MNGA 1ZRDA 1BMV2 5JMCA 1JOBA 4N7IA 2RR12 1VAVA 3E6DA 3VHRA 1K12A 4PIYA 4KBZA 4K1YA 1PX3A 3WP6A 1XYOA 1H8TC 3PIGA 1E57A 2VR4A 3WDUA 4Q4Y3 2GZWA 4HONA 4CP9A 3OCPA 4UFIA 3NKTA 5LA0A 3U14A 2BGOA 1QOTA 2UURA 5A7PA 4XAEA 1E5IA 1W2OA 1MZFA 3NNMA 5JWPA 4XUNA 4XFCA 3QH6A 3EJKA 2D6NA
chains in the Genus database with same CATH topology
2GN3A 4BZ4A 4TLFA 4NOTA 4FPOB 4PQ9A 5KHGA 1SLBA 1HIXA 3IWZA 5HCAA 3VKOA 4IEUA 2PAKA 3LA7A 1ENXA 1ENQA 2RMU1 1LODA 1C28A 4MGIE 1AX2A 2GH8A 1RMU1 2VUAA 5JI9A 1G9AA 3D0SA 4XQDA 2GNBA 2RHPA 1FNZA 2VVDA 4AHZA 3NV3A 2X5IC 2XPJA 5DDJ2 4MXVA 3WR0A 3H0OA 3INAA 2NQYA 1ZM1A 5FREA 4YZ2A 4R4ZA 3FBMA 4NWVA 4FTSA 4XFFA 4N53A 2DVBA 3B7MA 3M3CA 2GC3A 1ZZBA 5BNPB 3S6PA 1JYCA 5J7MA 1KJLA 4BQ1A 2AREA 2WLQA 4PBOA 2WJSA 4TZDA 4NPRA 1FNYA 2D3PA 2ZGMA 1TME1 3H7YA 4LTAA 2PELA 4YM0A 2ZGOA 4YGDA 3K51A 4H14A 4YLZA 5C9AA 3VHOA 4OHXA 5KXBA 1K5MA 3LOBA 1YXWA 2HWB3 3ZPYA 1YJKA 2D6PA 4GB31 4KWLA 4RHV3 4RGGA 4CZSA 1LOEA 2NM1A 2YDEA 3P3PA 1YHFA 5I0TA 2WFF3 4L8QA 4AK3A 1RUG1 2G9FA 5J48A 4R9BA 1NY71 1AR71 3T1MA 1YO8A 1NCRB 4P9IA 2Y0OA 4IL7A 2I2SA 4IQPA 1O3RA 3AFKA 1SCRA 4COZA 3GZAA 4HVOA 4XJUA 2E63A 1U12A 3RS6A 4XETA 1SFYA 2GSYA 1Z7S3 4Y4YA 5BXXA 4BMBA 2NP0A 2VMHA 4FT8A 3B93A 3H1YA 3VBFB 4HZFA 3V56A 5T55A 1UD1A 4JAAA 1A3KA 1UPIA 2QE3A 1NE6A 3RWNA 5ACA3 1OD5A 4OFGA 2ILMA 4QPIC 3FJSA 2ARXA 1C4RA 1NQJA 1G9FA 4Z82A 3I4IA 2A73B 2KM2A 1D0HA 2LALA 4EWDA 3N35A 1S1AA 3AKTA 2QKDA 3MLKA 1V6NA 4CRQA 1H30A 3IIAA 4AI2A 5FFOC 2VUJA 1B35B 4SLIA 3ZXFA 1NXD1 1MEC1 4K3UA 4XHXA 4LBKA 1IS6A 1IKPA 2VNRA 2UY9A 1AR61 1Y43B 4M3CA 4XQ4A 4I30A 3U11A 3NVCA 3R05A 3N7KA 2JKBA 4L11A 5FO7B 2D6LX 1WMEA 1OQEA 3VL9A 1RUD1 1UU6A 1COV1 4I3PA 1ZRCA 2WNUB 4E4ZA 1LGBA 2VOXA 3B69A 3KGLA 1ZREA 1NYWA 3HT2A 4BHPA 1UIKA 1R093 4JGZA 3AZVA 2N7GA 1GLHA 3W9AA 2IFWA 2JECA 4ASLA 5HCBA 1LTEA 4YG6A 1TMF2 4GKYA 2ZCWA 1DZQA 4DS0A 1ND2A 3VBRC 3SH5A 1CQ9A 2JG9A 2LTNA 1ZBA2 1PO23 1IHMA 1QJX3 3DPRA 5EFUA 1MACA 2BFUS 1KJRA 1OFNA 3WD5A 3L2YA 2HWD3 3B02A 3MLJA 3VBHB 3WLUA 1GANA 5D8AB 1PVC3 4XOGA 1UU4A 3ALQA 1Y7BA 5JI7A 4L99A 4D7TA 1VBD1 4BIOA 3R0RA 1ND3A 3SH4A 4BLJA 4PIZA 3O7OA 3DN7A 3AZWA 1EV13 3M70A 4H7LA 1PO11 3MIDA 1RHI2 3M1HA 1LHWA 2DF7A 3VUOA 1NCQB 2WA3A 3I8TA 2MEV1 1LHUA 2PLV1 2XLAA 3WCSA 5AC92 4YM2A 1R1A3 2CV6A 3ZO0B 3BALA 1TNFA 3MIHA 2ZZJA 4FAGA 4YGEA 3WX5A 4CDWC 5BY5A 2F6BA 1X82A 3IPVB 4DZGA 2D7FA 1AL22 4H7MA 3V0AB 3HD8B 4K1ZA 1BEV1 4GULA 1HXS2 1QOOA 5KC5A 1W6PA 1KS5A 2OUHA 5KWRA 3BTAA 1LOFC 4WV8A 4CDUA 5J3UA 2PHFA 4Z2WA 3CJIC 3VBUA 3WNXA 2WS92 5J37A 4JGYB 2PTMA 3DF0A 3ZXJA 4Y20B 1H9WA 3IBMA 1I3HA 1HRV3 1RGSA 4LO6B 2ZPXA 3UV9A 4CTEA 1LECA 4PDWC 4Q4W2 1GSLA 1WW7A 2XVLA 1F9KA 2JE7A 2GH2A 1ULGA 4HPKA 5I0RA 1RUI1 1V9U1 5T5OA 4Y24A 5JOZA 4AEDC 2RS33 3BB6A 1F5JA 1SBFA 2XUMA 2JENA 2UYBA 2WC2A 4YW1A 3D8CA 3M2MA 5T52A 1VB2A 1NZCA 4R9DA 4R4XA 3AX4A 1LJ7A 4WM7A 4LUKA 2GC2A 5C4WA 3AP5A 3SNMA 1AXZA 1I1EA 1GQHA 1QQP2 1CD3G 3ZFFC 4JDMA 1DGLA 2NZ9A 3WCRA 1BMV1 3LAGA 4OUMA 4GA9A 2YGLA 4YVSA 2RR11 3NWKA 4N9IA 3R4UA 4OHWA 3ZDSA 2YC0A 3DV8A 2KXLA 3NV2A 1RUF3 3PNAA 1UAIA 1YYNA 1ZZ8A 3TYJA 4I3GA 4RS5C 5BNNA 4QT6A 4CDQA 2HKXA 4RR3C 1X8EA 4FPGA 3VDDC 5JSOA 3AYDA 1RUE3 4J1WA 1X33A 2RM23 4XFAA 3VZLA 4IV1B 3PJQA 5E16A 1FMD2 5C9AB 1SMVA 3JUUA 3SCHA 4KGGA 4QMAA 5ABJB 1RVF2 3GNEA 3KSCA 5K0UC 4WVVA 2VVEA 2XJUA 4XBQA 2DCYA 4LE3A 3M3IA 1AL0G 2VOKA 4FPCA 1I5ZA 1WW4A 2R063 4Y1XA 2Z69A 3NL1A 3D5OA 1GZ9A 2WWSA 1AZDA 1LHOA 2H0VA 5DDJ1 5I0UA 4Q0UA 4UW6A 4AQ2A 1YFXA 4OHZA 3WVJA 4YZ1A 3AJYA 4META 3FC0A 4CEYC 4PF5A 1DYPA 3E5QA 5BNOA 1D2SA 4QQHA 3ZFEC 4N43C 1YWKA 1BBT3 3V65A 4LULA 4PJYA 1H2MA 2BVVA 5LK7B 3U0ZA 3OF1A 3RI8A 1QJY2 2ZHLA 4CDXC 1ZBE3 4QPGA 1JUHA 5I8SA 4I0BA 3TAYA 1R083 4OHYA 4GWNA 2ZGTA 2E7TA 3AM2A 3WW3A 3RMXA 4DINB 2VPVA 5CFDC 2YHJA 1NA1B 3EO6A 2QNKA 1DGRN 1QJZA 2VH9A 1D2QA 4AFCA 3GZTB 3BOWA 4ES9A 3AKQA 2VXRA 3QBQA 2HWF3 5JZGA 1B09A 2GAUA 3PJYA 2P37A 4KU7A 1PIV3 1VAMA 2Q0AA 5T5JA 3KCYA 2TUNA 4I2OA 1J1LA 3V0BA 3MFCA 2VQ0A 1RUJ3 2ZABA 1O4TA 2QUOA 4FOQA 3ZXAC 2GN7A 3KS7A 5GALA 1PVXA 1J59A 3KT1A 1F31A 1POV1 3QLQA 3POSA 5HI0A 3IDEA 2K9ZA 3FE5A 2VU9A 4W6YA 3M7AA 3WW2A 3M4FA 3GHNA 3AP7A 4B29A 1ND2B 4GH4B 3FWEA 1SCSA 2EAKA 1XYPA 4W6WA 1D4M3 4XF0A 1FPN2 1AYN2 1CJDA 2C0ZA 3AMPA 2CNAA 1H8TA 4DFSA 2R1DA 5F9TA 4XIKA 3H50A 4Y1VA 1G7YA 2ZGSA 1W6QB 1PK6B 2CWMA 1HDKA 3JU9A 4HK9A 4U2AA 1EAH2 4EWEA 1KD7A 2R16A 3M3QA 3RMYA 1HRI3 1ND3B 2Q30A 5AFBA 1PGL2 2E51A 2JEMA 1MS3A 4AWDA 2LUWA 3MW3A 4JRLA 1KFUL 5C8CA 3NAPB 3JBG2 4YVWB 3JD72 4AGVA 3QH7A 4YFZA 2JXAA 5LK5A 3WW1A 2PHUA 4IETA 2A75A 4YM3A 3WZ1A 5FO9B 1CAVB 1TMF1 4MSVA 5T5LA 2X5IA 4C0BA 4XFBA 1S2KA 4DB5A 2XBO3 4I0WB 5E1RA 3TN92 1VB4A 1Q8PA 1CX4A 1ZBA1 2HWC3 4X6QB 4XBLA 5CFCC 2OPKA 1RUC3 4Q4X3 1AR92 4OVEA 1VRH2 2GNTA 2Q5TA 4FPEA 2D98A 4CDUB 3KLSA 5GLUA 5E8AA 4B4RA 1S2BA 4DRVA 2P3KA 5A33B 4WZFA 1PNGA 4BE3A 2B8MA 2Q4SA 3WG4A 5E89A 4WM8C 5L7OC 1QH7A 5L19A 2RS53 3AKRA 1RHI1 3MIEA 3J8F2 2UWCA 2WSUA 4FPLA 1CAUA 2DVFA 4FO9A 5AC91 3ZXEA 1Y3TA 2XWJB 4B7EA 4P9LA 2A3WA 2ZMNA 2YV8A 3APBA 1SLAA 2YROA 4BLIA 4FOWA 5GZEA 1H1MA 5H9SA 5KHIA 1AL21 2D6MA 2XLGA 5FLHA 1MQTA 1NLSA 3OJBA 1HXS1 4OUSA 4BCUA 4Q4Y2 3VBOB 3UL2A 2ZAHA 4XF9A 2WZPP 2WNVB 4F8AA 1C1LA 4DPNA 3LOIA 3PTYA 3ZSEA 5AFEA 4LBNA 3FFZA 2D5HA 3CEWA 4QPIA 2WS91 1G9CA 1FI2A 4ISQA 4M01A 2XVGA 1IS3A 4ZU4A 4IEOA 4Q4W1 4HL0A 4D7YA 4FTBA 2ES3A 1YUDA 3KM5A 4MGKE 3SCGA 1XNDA 3ZSKA 3VV1A 2R043 3HN1A 3LWCA 3WT3A 3USUB 1Q8SA 2WT0A 4IESA 5GJ6A 4C90A 4NR1A 2R6QA 4Q0VA 1MS4A 3VKNA 3KMHA 2YPJA 3BU7A 1DQ4A 3ILFA 2WLPA 2ZKNA 3JZVA 2VG9A 4QU2A 1QQP1 3EXUA 1VJ2A 5F6KA 5EZWA 3RRDA 4AFMA 4LT5A 4RQPB 3VHPA 1BVVA 5H9RA 4MX3A 1QOSA 1O5UA 2EA7A 1KDMA 5CB7A 1MS0A 5BNOB 4LHNA 3ELNA 2WQZC 4KG8A 3FX3A 4GALA 3FUQA 4HBNA 1QXPA 1OQ1A 1LEDA 2HWB2 2KA3A 2BW8A 3KQRA 4Q27A 4R52A 1OLRA 2PHTA 2R0FA 1LHVA 4JV4A 3VBRA 1FYUA 5FMOL 4AEKA 4HKWA 4DXZA 4RHV2 5BNPC 1UF2C 2WFF2 1FOD3 1CJPA 1FMD1 4FPKA 2BWCA 2JG8B 2A6YA 2CGNA 1RVF1 4UXAA 4YW2A 1TQ5A 4COYA 4EWAA 3ZMOA 1KS4A 4DMIA 4AEMA 3O14A 1AVBA 2BPA2 2H6CA 1WW6A 1YI9A 1Z7S2 3O0VA 4OLLA 4Z92B 4C0HA 1ZRFA 1HV0A 4I0AA 3R4DB 1QDCA 1H0BA 5FLJA 1H2KA 4LHKA 2E9QA 4LO5B 4AHYA 1UPSA 4FOVA 3SHRA 5ACA2 3MEPA 2R072 2B7YA 3BPZA 4KQ7A 4PLMA 2ARBA 3RJ2X 1NCRC 2OVUA 3PHMA 4AFAA 2B46X 3O5SA 4LBMA 3B5LB 1ZA4A 2A7AA 4GMP3 4KGQA 5IK4A 4MXWA 3TNQA 2GDFA 3VZNA 1QJY1 1NOVA 2DWRA 3VBFC 1QDOA 3FFQA 4CDWA 5SV5A 2NPIA 3E97A 2WQ4A 2DTYA 1U5ZA 2FMDA 3AFGA 3R6SA 2AGSA 4QQOA 1N3QA 4HVRA 4K6BA 5JIAA 1LOFA 4MYEA 4XF4A 1JH5A 2XHKA 1QJU3 2D43A 3CJIA 3KGZA 3SLIA 3UK9A 1WCSA 3C3VA 3NKGA 2XKPA 1DGWA 1W6OA 4X8PA 1LENA 3JB4C 3LA2A 3OYWB 4XYXA 4Q4V3 1B35C 4DRRA 1ALYA 1M06G 2R32A 1ASJ3 4BPZA 1AHSA 1R092 1PZ9A 4IV3B 2F4PA 1WBLA 1RUH3 4LA3A 3T1LA 2A3XA 4Z1VA 1H1AA 2A71A 2P3JA 4MZUA 4UBGA 4Y1UA 3VGIA 2NYYA 4BYYA 5C8CB 4Y26A 2HYKA 2DCKA 4ES8A 2YXSA 1YFYA 3VBSA 2BEOA 1OSGA 1RUNA 4PLNA 5H9QA 2WNUC 2R073 1PO22 1QJX2 4YM1A 2I45A 4BOWA 2MPFA 4BM8A 3CU7A 4M0NA 1WD4A 2QDNA 3ZFFA 4X6RB 4IEZA 3U07A 4LBLA 2HWD2 4LBJA 1LGCA 1FPN1 1AYN1 1PVC2 2UYAA 2WINB 2ZX1A 3RI9A 4EJRA 2O8QA 1WLDA 1CN1A 1GICA 3NV4A 4RS5A 4FQ4A 1RJ7A 3GBGA 1EV12 4RR3A 1MVEA 5GZDA 1W6NB 4TSVA 1BVP1 3VDDA 1LU2A 1BXHA 1EAH1 1AUYA 4YZ5A 3NJZA 3ZSJA 4IEWA 2SLIA 1PGL1 1OKQA 1YLLA 2VOWA 3CO2A 3VBHC 5D8AC 3MI8A 5K0UA 5CA6A 4XJZA 1UKGA 1R1A2 2XJRA 4YG3A 3JBG1 3JD71 5IUQA 2EALA 4EN7B 4Y22A 3A0NA 2H0BA 4A3XA 1DLLA 5DUWA 1IS5A 2EXKA 1HKDA 1U0AA 4NWWA 2E6VA 4XXAA 4COUA 1SLIA 4B7KA 4E2GA 1N1SA 2XL9A 1NCQC 1WA4A 1Y9QA 3TN91 4K20A 4LBQA 3X29B 1MQTB 2R49A 3A4UA 2V09A 3FLRA 3ZFEA 3ZXLA 1AR91 5FOJB 1CAXA 4XJWA 2VGDA 1VRH1 3FUOA 1HRV2 4AI3A 4ISRA 1DFQA 1H4HA 1LESA 3OY8A 4LR4A 1UZYA 4OI0A 2AR6A 2WA4A 2DTWA 2XL7A 1UCXA 1JUIA 4CDXA 1J3RA 3BODA 2RS13 3J4UH 4EN0A 2Z5WA 3I59A 1JOJA 1AYM3 2IXCA 3WG3A 3WV6A 3VKMA 5T50A 2JX9A 1H9PA 2WNEA 1OMIA 3GHMA 1FX5A 4FCAA 4AG4A 3J8F1 1H1IA 1OOPB 4IXLA 2RS32 4JGYC 2VMIA 5CFDA 3ECQA 5I93A 3WINE 4E4SA 2ZGRA 2P3IA 2B5HA 1PMIA 1SLTA 2VW2A 4K9SA 1KRIA 4XTPA 3N7LA 2EXJA 3VKLA 1JYIA 1A8MA 1S0GA 4R9CA 3H1MA 2YUEA 1OHFA 1VBB3 4P9GA 4Q2FA 2V5YA 1DF0A 3O0XA 2XJTA 3MF6A 3KT7A 4XEZA 5FPXA 5FTTC 1RUF2 4Q4Y1 2O8OA 5FBZA 5AVPA 2W08A 1XXNA 3ENRA 4QHBA 2D6OX 3OGGA 2WZR3 4JRAA 1UX6A 3OPZA 1RUE2 2VNOA 2RM22 2ZX3A 4CEWA 2D3SA 2YGMA 2PHXA 1RIRA 3POYA 5BNNB 1C8M3 3PMEA 3WUDA 3ZX7A 2OUJA 1C5HA 1XQNA 2GU9A 2R062 3AMQA 3UKVA 2GMPA 4MVTA 3LA3A 3A0KA 4L92A 3HQXA 3H3UA 2HEWF 2PHDA 4QQ2A 3HIFA 4IV1C 5C9AC 4H3WA 4XDQA 4AQTA 2ZS6B 5ABJC 4Q8KA 5JPMB 2C5DA 4D7SA 4AVTA 3MPPG 4YYOA 1V6JA 3AMMA 4RA0A 3MLLA 1MS8A 3UKTA 1C3HA 3AK0A 5I8YA 1BBT2 4XMIA 3VHNA 4ITCA 4XQWA 3SH3A 2VNGA 3H1WA 2E53A 4LA2A 2TBVA 1NLRA 1ZBE2 3AXDA 4QM9A 4Q29A 3B01A 1XNBA 1QKQA 4YZ3A 1REFA 1R082 1HV1A 2ZMKA 3GBWA 4EN8B 3IKWA 4MXWB 2HWB1 3ZFGA 4N53B 4XXPA 2HJIA 2VW1A 4RHV1 2VECA 4LLFA 2WFF1 3N3HA 2TEPA 1SLCA 1QHDA 5CFCA 1WLWA 3AB0A 3VZKA 4YSFA 3M3EA 2XJSA 3M8LA 2QVSB 4QPYA 2FZ2A 1N3PA 1GQGA 2HWF2 4K40A 2PQQA 1PIV2 2VVFA 1K5MB 2FQPA 1VBA3 4LLOA 2B39A 1Z7S1 4I01A 1RUJ2 4LE4A 3OGJA 1EP0A 5FAXA 3UJOA 1W6OB 2FBEA 4L9BA 5JDBA 5JOXA 4FBFA 3I2DA 2A6ZA 2EAAA 1NA1C 3B3QE 1IGOA 3AKPA 5ACA1 2FMYA 2R071 1KITA 1HQWA 3TRSB 1ZZCA 1VBE3 2OYZA 4Y1YA 1WLTA 3BIWE 2NN8A 4XJ9A 3E5XA 2ZX0A 1BK1A 1VIWB 2YYOA 3VBSB 1JN2P 4ATEA 5T3NA 3VZOA 1PZ8A 1D4M2 4HFSA 1F5FA 1N1VA 1H2LA 1D4VB 2HWE3 2O1QA 1BZWA 1GYKA 4JTOA 1URXA 1APNA 3WHTA 3CNAA 4ASMB 2JE9A 4LO8A 4LUMA 1QNWA 1QXRA 1X8MA 1S0BA 4H55A 1HX6A 3GF6A 4MUVA 1ND2C 5C8WA 4FSJA 4GH4C 1HRI2 3HWJA 4ONUA 2BUKA 5LRRA 2ATFA 3WOGA 1AR83 1J58A 3D4KA 4YW4A 4BMEA 5IK5A 2B9UA 2R1BA 1R091 1JBCA 4M3CB 1M4WA 2ZBJA 2ZHMA 1O91A 5BUVA 1YNAA 1LKNA 1DQ2A 2GC1A 1PK6C 2VY0A 1IZ3A 5CAZA 5KXCA 1H8VA 4F3JA 4QXKA 2ZTNA 3HR9A 1FXZA 1ND3C 1LGNA 2ZGUA 3FBYA 4I02A 2XBO2 4G9SB 5F1RA 1RB8G 4YNIA 1MS5A 1PO21 1QJX1 1RJ8A 2HWC2 4HN0A 2DU0A 4JGZB 1RUC2 3NAPC 4Q4X2 3R4SA 4YVWC 3AYCA 5F6LB 2DURA 2WIIB 1FV2A 4Y5Z0 2HWD1 1XE8A 3VN4A 2DUPA 1PVC1 4MLOA 5JSRA 5JPNB 2WT2A 3FHIB 1V70A 2WSVA 4XW3A 4FVVA 3E5UA 2I07B 4Q1RA 1CAXB 3ZYIB 1S0IA 4FTEA 2JG9B 5FO8B 3DPRB 1UN1A 3OY8B 3ZN6A 2RMU3 1EV11 2RS52 1W6MA 1V6KA 3MFAA 4RSUA 4Z8BA 2IXIA 1CR7A 2W0XA 5IT6A 1RMU3 5BNPA 3WG2A 1WMFA 3I59B 4GWMA 4UW4A 3IN9A 4CDUC 1R1A1 1W39A 1G8WA 4RL7A 1LOCA 3ES1A 4BA6A 3AYAA 1JHNA 5DZEA 2AH2A 2BTVC 2QJVA 4A7ZA 5CNAA 1JW6A 2BQPA 4XIOA 2Q1MA 2H6BA 2AENA 2BNOA 1I9RA 3BOPA 4FP2A 3ZYJB 1QMJA 2CY6A 4B3NA 1DQ6A 3WP3A 2UWBA 1NCRA 1TME3 4P5HA 3RYRA 5TSWA 4MV2A 4PBPA 2UU8A 1HRV1 1PNFA 3MYXA 1ZVFA 3FLPA 4GB33 1GFF2 3D0JA 3U10A 3VBFA 2A6WA 2QFEA 1WMDA 3TBDA 3VBOC 1CVNA 1W6PB 1RUG3 5FPZA 2WNVC 4CEWB 2R042 4AVSA 1AR73 2DU1A 3WUCA 3ZSMA 3WDVA 1O5LA 2D97A 5J96B 3Q9OA 3FLTA 3VBUB 4COWA 1LU1A 2GMMA 2RS31 4XILA 1BJQA 4XTMA 5IK8A 4JDOA 2ZZQA 1W0PA 3S0MA 4AI0A 1MR5A 3WY6A 1B35A 4HPKB 2BNNA 2ZX2A 3WDXA 3H8UA 4GXLA 1SACA 1ZZ6A 4LBQD 3CF6E 2VULA 1U5IA 1RUF1 1XNKA 4XHBA 2GC0A 4KNCA 2SBAA 1Q3EA 1G9DA 2A5ZA 5K9YA 1XE7A 1I6XA 4WM7B 5C4WB 1ZRRA 1YCIA 3E6CC 2BVBA 5JR7B 5A32A 1RUE1 4XJ8A 3ATGA 1L3JA 2RM21 1FOD2 1MEC3 1GZWA 4RQPC 1NE4A 4YVSB 4WBBA 1S0EA 4TWTA 1FV3A 1AR63 3GALA 3ZFGB 1T6GC 5T54A 4D3WA 5CG8A 1RC6A 4FXGB 5BNOC 1X36A 1UMZA 2W52A 1Z0HA 4IEPA 4XZPA 3ZN4A 4Y1ZA 4AVCA 2R061 4CDQB 1S0CA 3WDWA 3J9SA 3ME2A 1G6NA 2EIGA 1RUD3 3S30A 1COV3 2QZ2A 1IKQA 2X29A 2ZACA 3EQEA 5LEJA 4DOUA 2W39A 1A6CA 1S55A 1Q5OA 2QCSB 4ZU7A 4GMP0 5FQ0A 2XJQA 2G9GA 3RQ0A 2JG8C 2O0OA 4QQPA 1S0FA 4YRDA 1WCKA 3N4MA 1RTVA 4S2DA 4CYDA 2EF6A 2ZGPA 3SCFA 4QGMA 1SLLA 1GV9A 5D8AA 1GNHA 1V6MA 1BBT1 3FMGA 4AE2A 4NHKA 2D44A 2GALA 4BIFA 1UW8A 4HKOA 3SISA 1OLQA 4XBNA 5JCTA 1ZBE1 3SXWA 2RJLA 4JVAA 4B4PA 5GKAC 4K21A 1ULDA 4R8HA 1R081 1O7FA 2JJ6A 3QCWA 4K7JA 1ULEA 4C1XA 4LEJA 2QQPA 1XYNA 5BPXA 1Z78A 3RZZA 4Q0PA 1QJU2 1W2UA 4N7UA 3WXPA 1DYKA 1VBD3 3N7JA 3SMHA 1UL9A 2ZA9A 3OD0A 4QPGB 4ZXKA 2DCTA 2HWF1 4HSJA 3IPVA 1PIV1 1PO13 4Q4V2 4DY3A 4AQ6A 3AP6A 4U36A 2BYVE 3KB5A 2Q8OA 1RUJ1 2DCJA 1ASJ2 2K2SA 3WG1A 4OI1A 4FP3A 1HQLA 1LB2A 5D1IA 4LO4B 2MEV3 2PLV3 1RUH2 1OPOA 1WW5A 3S7IA 2QZ3A 2HEVF 2ZX4A 1REEA 5KBFA 4YG0A 4JGYA 2X8KA 1OA3A 5JZGB 4Y20A 4A7YA 2VMGA 4BH9A 1WBFA 1LHNA 1XU2A 4D69A 2HEYF 1BEV3 2DYCA 4AGRA 3H3ZA 3V0BB 3KT4A 2CGOA 3AZZA 5FMOS 1NQDA 1QU0A 1VBC2 3POWA 4IV3C 4LO7A 4WZCA 1MS9A 2JD4A 3IT8A 4Q8LA 4XE9A 5DZGA 1D4M1 2UY8A 2BGCA 3NV1A 2NMNA 5C8CC 4RFT0 4MGYE 2XKOA 4F83A 5GLTA 5DG2A 2XJVA 3EBRA 5DZFA 1WGPA 5CBLA 1Q56A 1J3QA 5GZFA 3DL3A 1YIPA 4P9JA 4Q26A 3O0WA 4COVA 2OZJA 1FAYA 1HRI1 2YMZA 4JQRA 1GNZA 2LM3A 1RUI3 1V9U3 5I91A 3J26N 3LB9A 3THPA 5EWSA 3ZN6B 2CTVA 5H9PA 1H8TB 2XB6C 1W6MB 4M3CF 3VZMA 1QGLA 1GBGA 4DY5A 2XG3A 3CL1A 4PDWA 1CAWA 1ZZ7A 2ZJCA 4M0HA 4UBHA 4E9KA 3DKWA 3AMHA 5FRAA 5DG1A 1BKZA 3USSA 1H2NA 4IV1A 2RR13 5AVAA 2XBO1 5CIRA 1OQDA 2RJKA 5ABJA 2HWC1 3VL8A 1RUOA 4AEDA 1JXNA 1RUC1 3WP4A 2A3YA 4Q4X1 3ZVXA 3H9AA 5JOWA 1VAKA 1RL3A 5HCFA 2X5IB 1WLCA 3RYKA 2CWSA 1VBC3 1MZEA 5I0SA 4K8FA 3VKFC 2EXIA 2RS12 3K48A 3BCWA 4W65A 2ZOEB 3QD6A 1DQ5A 1HLCA 1AYM2 1LEMA 1POV0 1MQTC 3KCXA 2RS51 4FQZA 5JIUA 4GQ7A 3D82A 3GZUC 4WVWA 4NVPA 2ZAAA 4PCRA 4AVAA 1DZTA 4C1WA 1C57A 2WFPA 3JCIA 2X53S 2R30A 5DDJ3 3E6BA 4FPJA 1MS1A 2EXHA 2OZ6A 1O3SA 2A6XA 1CPNA 2ZGLA 4QX5A 1VR3A 5KC6A 1AX1A 3T2TA 4HETA 1FATA 1VBB2 1IPKA 1OI6A 4UW5A 1OOPC 1CAUB 1NA1A 4G3YC 2UWAA 4GKXA 3OBRA 4OHVA 2IFRA 4AHXA 1ENSA 3ZN5A 4AI1A 3PLQA 2WZR2 2WL1A 1OFSA 1PGW2 1AXKA 4PLOA 2XVKA 2ET7A 4J1XA 2BWAA 4CEYA 2DFCA 2BFUL 3IDCB 4XMAA 3ZYRA 1ZYBA 1DIWA 3U4XA 5GLVA 5A32B 1C8M2 1CIWA 1YJLA 4OI2A 4N43A 2XGXA 3ASIA 3B00A 3AJZA 3WP5A 1FT9A 3AYEA 1GZWB 1HW5A 5GLZA 2R041 2XWBB 2YZ4A 3ROUA 1XNCA 3LCPA 4FPHA 4QPIB 3PVBB 2ERFA 4A7KA 5K7PA 3ZSLA 4CP0A 4E2SA 4GH4A 5BNNC 4YFWA 1C8NA 5FQ0B 5EJ3A 1DZRA 2AYHA 2IXLA 1POV3 4NN0A 3UJQA 4KWJA 3OD4A 1V6OA 1UU5A 2DVAA 1MZ5A 4C91A 2AZ5A 1W6QA 1PK6A 3D6EA 3ETQA 3LSEA 4O9EA 2D6KA 2OIIA 4XF3A 4AXOA 1R1ZA 4WVMA 4Z07A 5A3LA 1A78A 1NXMA 4MH0E 1DQ1A 1FOD1 3ZIWA 2VQAA 4XF1A 1ULCA 3ACLA 2Z2SB 3NAPA 4YZ4A 4YVWA 2Y0IA 2PAEA 4HVQA 3JQXA