2GC1A

The crystal structure of phosphoglucose isomerase from pyrococcus furiosus in complex with sorbitol 6-phosphate and zinc
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
188
structure length
188
Chain Sequence
MMYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence Supporting a cis-enediol-based Mechanism for Pyrococcus furiosus Phosphoglucose Isomerase
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase
molecule keywords Glucose-6-phosphate isomerase
total genus 39
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature ec 5.3.1.9: Glucose-6-phosphate isomerase.
pdb deposition date 2006-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2gc1A00
5FQ0A 2O1QA 2MNGA 4QM9A 1X8MA 2MPFA 3FJSA 4PIXA 4Q0VA 3UKTA 4XF9A 3EO6A 4XFHA 3JZVA 3H3ZA 1VJ2A 3SCHA 2BNMA 2QVSB 1WA4A 1XE8A 1PM7A 1NYWA 2ET7A 2P17A 5JR7B 4Q0PA 2FQPA 4UBHA 3RYPA 5LEKA 1EPZA 4XFCA 5KHIA 2OA2A 1ZX5A 4I3PA 1ZVFA 2K9ZA 3KGZA 3LZZA 3BU7A 3WW3A 3I59B 2PQQA 3H1YA 3DKWA 2IXLA 2PTMA 2PHDA 2XLFA 4HSLA 4A2UA 1X7NA 2PA7A 4HVRA 3QOPA 4IEWA 2UYAA 3EJKA 2D93A 1Y9QA 3TNQA 5I0TA 2ET1A 5FPZA 4XFAA 1CGPA 1O5UA 2XKPA 4IEOA 5I8YA 3NSTA 3KCCA 4I0BA 3GYDA 1WGPA 3VHRA 1DGRA 1NZCA 4MX3A 1CAUA 4META 1WLTA 4L11A 3H50A 5F1RA 3I54A 4NVPA 3U10A 4WBBA 4E2SA 2QJVA 4AXOA 3KMHA 1ZZ8A 4XFGA 1TQ5A 2FMYA 4J1XA 2Q1ZB 4EWDA 2IXHA 4O9EA 4IEYA 2CAUA 4IESA 4H7LA 3GBFA 3HT2A 2PAEA 4IEPA 5I93A 1ZRCA 5C8WA 2CV6A 3ETQA 2H0VA 1X82A 3CEWA 1LKNA 3FHIB 1DZTA 4LULA 3NJZA 4EV0A 4I0AA 4HN1A 3U0ZA 4EWAA 3TNPB 2XL7A 2F4PA 5BY5A 1I6XA 2B9UA 2D40A 5I0SA 1NE6A 2XKOA 2OYZA 4FT8A 1EY2A 2B8MA 3IDBB 4PIYA 1QY4A 4IEUA 1O3RA 1I5ZA 5LEJA 4XF0A 2OZJA 5D1IA 1O4TA 1GQHA 4Q0QA 5BPXA 1SQ4A 3ROUA 4MZUA 1RGSA 4MGIE 2Q4SA 3RDIA 4D7TA 4F8AA 1CAWB 1O3TA 3ES4A 1O3QA 5E1RA 4HBNA 4WVZA 3I59A 2KXLA 3H7JA 1O3SA 5KHKA 1RTVA 5I8TA 1QXJA 3FWEA 1UPIA 3S7EA 3LA7A 4AQ2A 3RNSA 5KHGA 1ZRRA 2C0ZA 4XF1A 1YLLA 1QXRA 1V70A 3E97A 1EYBA 4BIFA 5J48A 2XLAA 3C3VA 1RL3A 4HZFA 1SFNA 1ZZBA 3DN7A 4R52A 5FLIA 2Z69A 5K8SA 3N4MA 1VR3A 2DCTA 4I02A 1ZZ7A 4Q29A 4XFBA 2WFPA 5JSPA 5BV6A 2XL9A 5AVPA 4RD7A 5EZWA 4IETA 3U11A 3E6BA 4OFGA 2ZCWA 1H1IA 4KWKA 3WW2A 1CAUB 1O7FA 2ETEA 2PFWA 4E2GA 2Z2SB 1O5LA 4XETA 1UIJA 3R6SA 5KBFA 4PJYA 2GC1A 5JSRA 1ZRDA 3EQEA 1IPKA 1OI6A 3NVCA 3OD0A 2H6CA 2HJIA 1ZNPA 3QACA 3E6DA 3B02A 4HSJA 4YNIA 2UYBA 1CAVA 4HLTA 1XE7A 4ZU7A 3LA3A 4ZU5A 3ES1A 3UKVA 1GQGA 3FE5A 3E5UA 5J3UA 4PIZA 3NKTA 4FAGA 3PNAA 4BYYA 2E9QA 1IPJA 3MYXA 4AVAA 3IIAA 3ST7A 3G7DA 2GH2A 3USSA 2V09A 2QCSB 4HN0A 3H9AA 5I0UA 1UIKA 3M3IA 3OCPA 1DGWA 2Y0OA 4YYOA 1ZZCA 1HW5A 1JUHA 4KWLA 4MUVA 4EROA 3UKNA 4QMAA 3CF6E 3H7YA 1UCXA 4MH0E 3H3UA 4KU8A 5LRRA 1VP6A 2ATFA 3RZZA 5EFUA 1OMIA 4QGMA 4UBGA 3CJXA 5FQ0B 5BUVA 4KU7A 5FLHA 5I8SA 3ACLA 1ZZ6A 3O14A 1L3JA 4AVCA 4AVBA 3S0MA 3MZHA 1J3QA 4K8FA 5JAXA 4XEZA 1Q43A 3I7DA 1ZREA 1YFYA 1YFUA 1ZZ9A 3E6CC 4JV4A 3LA2A 4QGLA 4LTAA 2GZWA 3L2HA 1Q3EA 4YRDA 1YFWA 1LR5A 3H1MA 3BB6A 4LA3A 4KWJA 3FZ3A 5J7MA 4CYDA 2CAVA 4L2NA 4I01A 3SCFA 4P9GA 1PMIA 4X6QB 4J1WA 2IXJA 4JTNA 4UXAA 3RYKA 2GC3A 4GULA 4XFIA 1FI2A 2Q30A 4JVAA 3WW4A 1DZRA 1FXZA 1UD1A 3BCWA 2BNNA 3D82A 3OGJA 4N9IA 1QWRA 3CLPA 4ORFA 4YSFA 2I45A 3NL1A 4IERA 4R8HA 5C6CA 4Q0SA 1ZRFA 3KGLA 2IXKA 3EHKA 4OLLA 5FPXA 2HKXA 3KSCA 3EBRA 5T3NA 2GAUA 2PAKA 1LB2A 1NXMA 4QM8A 4MV2A 2D5HA 2K0GA 2EAAA 2BGCA 1J59A 4ZU4A 3RPQA 2D5FA 2UY8A 4AQ6A 4BHPA 4F7ZA 4IEQA 3E5QA 4I2OA 4ONUA 5KHJA 4YARA 3WW1A 2QNKA 1CAXB 5I91A 2GC0A 2XHKA 2UY9A 2CGPA 3M70A 3RYRA 4LUKA 2QDRA 4XF3A 4MGYE 3SHRA 2VQAA 3MPBA 2B5HA 2MHFA 3LOIA 5CU1A 1RUNA 3H1WA 3NW4A 1J1LA 2N7GA 5JCTA 2OZ6A 4TLFA 3ZDSA 1CX4A 2EA7A 4HVOA 1Y3TA 4X6RB 1YWKA 1J3RA 2EVXA 3DL3A 3PVBB 1CAXA 1J58A 1SEFA 1YUDA 2PHLA 5FDBA 1CAWA 5E16A 2IXCA 4MGZE 5LRSA 3DV8A 2H6BA 3D0SA 3HQXA 4EWEA 1NE4A 5FLJA 2VPVA 3SXWA 4IEZA 5I0RA 2BEOA 4XFFA 4HVQA 2GU9A 3PLQA 4KL1A 2ZKLA 3HT1A 3BALA 3IWZA 1UW8A 5FCCA 3LAGA 3SMHA 2XLGA 2IC1A 2BYVE 4O9GA 3E5XA 2XGXA 1RC6A 2IXIA 3FFQA 1U12A 1FT9A 3OTFA 4IEXA 4QXKA 4DINB 4LEJA 1RUOA 5CVRA 1LRHA 2PAMA 4LLOA 2PYTA 4LUMA 1G6NA 4IEVA 3OF1A 1YHFA 4FAHA 4E2QA 3CL1A 4Z07A 4D7SA 3SCGA 4HMZA 5HI0A 4I09A 4QX5A 4QGNA 1OFNA 4XF4A 3CO2A 1X8EA 1OD5A 3LWCA 3H8UA 3BPZA 4MGKE 1H1MA 3IBMA 4Z82A 3S7IA 5JSOA 4WZCA 5CADA 2O8QA 3IDCB 4BH9A 4Q0UA 2Q0AA 1CAVB 1XRUA 2WC2A 3D0JA 4JTOA 5KHHA 1Q5OA 3HIFA 3MDPA 5BXXA 4N9HA 1J3PA 3FX3A 2VECA 2BNOA 2GC2A 2OPKA 4B29A 1EP0A 4FBFA 4LA2A 1YFXA 3ELNA
chains in the Genus database with same CATH superfamily
2WQ8A 2MNGA 5DZEA 5A6XA 1JYVA 4Q0VA 3UKTA 2WLPA 2YYOA 3FBMA 3GCWA 2EICA 4HFSA 5IATA 1JOJA 4R9BA 4Y24A 4E9KA 1PVC1 4H2AA 1VB4A 2V73A 3JZVA 4CUCA 1Y9GA 2VBBA 3H0OA 1VJ2A 1YO8A 5L9RA 3VD4A 1W8FA 4Q4V3 4CCLA 2J1UA 3WOGA 1IKPA 1HB4A 5BYNA 2P4EA 1PM7A 3ZN5A 4BOWA 1GZWA 2PXJA 4N8MA 5A7WA 4BXFA 5AVAA 4I30A 3ZPYA 4AFCA 1OF3A 2G9ZA 3KT7A 4HKOA 4COYA 2V5YA 4DUWA 4Y5TA 3PUQA 4JRLA 4CXXA 4URAA 1DZQA 3RYPA 2VMDA 5LEKA 4CUBA 2C4XA 5KHIA 1QJU3 3VD9A 1ZX5A 1UY1A 1Q8PA 1ZVFA 3LZZA 5JZGB 3BU7A 4Y26A 3MHZA 4P02B 3DKWA 2IXLA 5FP8A 2P34A 4XYXA 4JRAA 3WNKA 2C26A 2WKKA 4Q4X1 3AZYA 3LD8A 2HYKA 2ZGNA 1YQ5A 2XLFA 4HSLA 3DYMA 3GNEA 2UURA 3E1F1 4BLJA 3CJIA 4IV3A 2OUJA 4RYDA 2FCUA 4XUPA 2UYAA 1OBNA 2QQJA 3ENRA 1GUIA 2D93A 1BJQA 1MPXA 4ISRA 2J22A 4PLNA 4QB2A 5FPZA 3MIEA 1LOBA 2A71A 3VZKA 2EAKA 3UETA 3KT1A 1POV1 4YM3A 4GKYA 2J1EA 1WLDA 4IEOA 4A6SA 2FDHA 5JMOA 4YG3A 1N3OA 1OVSA 2DWRA 4HK8A 5CAZA 5LBBA 1TE1B 2Q5TA 1KQRA 4XDPA 5B2GB 2AR6A 1NZCA 5C3RA 2BVVA 4A7KA 2P3JA 2YU1A 4GH4B 5HBAA 1CAUA 3A0NA 4META 4JGYC 1QGLA 4AI3A 1XSQA 2A3YA 3VDDC 4DY5A 3N7KA 1US3A 2RJKA 5D2AA 2LW8A 3WG4A 1NCRA 5ACA3 3BVCA 1RB8G 3U10A 1PVC2 5T55A 4IGPA 1KEXA 5CFCC 3AP6A 2D3SA 2RS12 3PVOA 4XFGA 1RITA 1H9WA 1UAIA 2VBDA 3GF6A 3H8XA 5FZEA 1N1SA 2FMYA 4J1XA 4JHZA 1RUC1 5JPNB 4NIAA 4GB32 4ZPIA 2DUOA 2ZEYA 3ZXKA 5BNPC 2W95A 4EN0A 4IESA 2XPJA 4NPRA 5FYTA 5FJHA 1ZRCA 5C8WA 3WDVA 2D98A 1OVPA 2FBEA 2VXJA 4LO6B 1E5HA 2JDZA 1APNA 2H0VA 1SDDB 3V0BB 3O0WA 1LKNA 2VOTA 3WHUA 1A78A 2X29A 1N1VA 1UYXA 3ILNA 4LMFA 4CUAA 3CNAA 4GD4A 3UT0A 3WDTA 2F4PA 2HWD1 3KB5A 2RR12 4FCAA 3R4DB 3SH5A 1SZBA 2XKOA 2XVLA 1OLRA 3I3QA 4Q4V2 1DDLA 4YW1A 1QY4A 1BK0A 4IDZA 5A3LA 1I5ZA 1WW7A 3JD73 2Q8OA 4ATFA 4AI8A 5LEJA 2RS52 1O4TA 1SCRA 2DDUA 2WQ4A 3KVBA 4WZFA 4CP9B 2HWC2 4MZUA 4N7IA 1RGSA 2ZEWA 1RHI1 2A5ZA 2IWGB 1MACA 1CAWB 1O3TA 1JS9A 1YQ6A 4S2HA 3ES4A 3UGFA 5E1RA 2E31A 2OVUA 4HBNA 5C8CC 2AACA 2JE9A 3VBHC 3PUSA 3B01A 4QXCA 1ENXA 3D4KA 4XTPA 1Q8SA 3RWNA 5D8AA 5FYUA 2XONA 5KHKA 3T3YA 1EPWA 5FYCA 1BVP1 4CDXA 1H30A 1T6GC 3LA7A 1RXFA 1JYXA 3LIGA 1S0CA 5J37A 2JD4A 2WWSA 4XF1A 2CNAA 1V70A 1VBD3 2RDQA 3JQXA 5IVEA 3POGA 4ZONA 1RL3A 2BQPA 2RM22 3IMNA 4R52A 4AVTA 4YVWC 5K8SA 4I0WB 2ZGSA 4Q29A 2AEYA 4EE2A 1HRI1 4OYUA 3T08A 1RUG3 1DQ0A 4DXSA 2AGSA 3U4XA 3TYJA 4RD7A 3MFAA 1H8VA 4H3WA 1ZBA3 3U11A 4AQSA 4OFGA 4QAWA 2Z42A 5BNNB 2J1TA 5FZMA 3AMPA 5IW0A 1JI6A 1AYM3 4A4AA 1XYPA 4SBVA 4AL9A 4OHYA 4PHZA 2Z2SB 1V9U1 1KXGA 1FPN1 4HT1T 4RHV2 5FZOB 5FKCA 2YBKA 2CGOA 3R6SA 5FZIA 4L8QA 3WP4A 2TBVA 2VU9A 1W2OA 5L19A 5LCWL 1GV9A 3AVSA 4JGZB 1NQJA 2G9FA 2H6CA 4HPKA 5F39A 1UU4A 4M3CE 1JH5A 5FUPA 3CKHA 2ZBJA 3OYWB 3VBHA 3WLUA 1FMD2 2UYBA 1WD4A 3OBRA 2VE1A 3JQWA 4GJYA 2XJQA 5IWFA 2JWPA 3D3AA 3MIBA 4XJ9A 2EIGA 2E53A 3LA3A 1SFYA 4XJ8A 5EPAA 3ES1A 4Z2WA 3R4UA 3GBGA 3FE5A 1W2UA 3MW2A 4YFWA 2EF6A 2YUEA 4AFDA 5FZ1A 4L97A 1NT0A 5FZBA 1LCLA 2DVBA 2LTNA 5FBZA 1S0BA 1XNKA 3NNFA 1SLCA 4BYYA 4JCKA 3HN3A 1IPJA 2C9AA 3SISA 2BV4A 4AVAA 3IIAA 2OX0A 4D69A 3OGRA 4Q4X2 2GH2A 1WCKA 3QLQA 5JZGC 3VBOC 1OA3A 1WMEA 2WWJA 5I0UA 1UIKA 3MW4A 3OCPA 4YYOA 4XJUA 4ZZ5A 1RIRA 5A7WB 4OMCA 5D8AC 3UKNA 1RUC3 1UCXA 1ZBA2 4W50A 4M3CB 5LRRA 4KQ7A 1WA6X 2R043 4FPOB 5DAVA 1VP6A 1IOAA 5DUWA 1H2MA 5LWBA 1AR72 1KD7A 2BWCA 1XU1A 5A1AA 1JYNA 3AMNA 1CZVA 1GYKA 2WT2A 3ZYFA 5K0UC 1RVF2 2DTYA 1NCQA 1R1ZA 4INDA 1CONA 3IPVB 4QX2A 3USUA 4DRRA 1HV1A 3O14A 4MG2A 4MLOA 2PHXA 3GBWA 3S0MA 5JLVA 4K8FA 4AI0A 1W8UA 4YZ1A 2KM2A 4XEZA 3UV9A 2RS51 4CEWB 1DBNA 1KJLA 4CCKA 1RUH1 4YW2A 4AVVA 4LBOA 4QGLA 1RUH3 1RMU2 1RUD1 3UESA 5FYVA 4YRDA 3ZFGC 4D6QA 4PQ9A 3AKRA 3ZYIB 3VZMA 5IVCA 4GB31 2CAVA 5GLVA 2W47A 1AX2A 3KV9A 1JOPA 3MIDA 1ULGA 4M3CF 4PF1A 4BLIA 1EAH1 5IVFA 3DXTA 4FPHA 1LOCA 4FO9A 4BQ3A 1AL0G 4JTNA 1UKGA 2W08A 4UXAA 2DCJA 4AEKA 2OXBA 2ZGPA 3VBRB 3OGGA 1JYTA 1XXNA 4XFIA 1BLZA 3OPTA 3WW4A 3BTAA 1UD1A 3BCWA 1D0HA 1ONAA 5F2SA 4O61A 1AL22 4X8NA 5LBEA 5FREA 1S0FA 4N9IA 5EP9A 1QWRA 3UGHA 4LE4A 2XQRA 4ES9A 2VUCA 3NQHA 1BBT2 3KS7A 4IL7A 5T5PA 2Y33A 4HOOA 5C7GA 2CU5A 1PK6B 5CFDB 3U4SA 2ZKNA 2OW4A 4QDSA 3RQ0A 4Y5SA 3WD5A 1V9U2 2XBO2 2Z5WA 1UWWA 1VBD1 2OKXA 4DUVA 4Z8BA 1RVF1 4OLLA 4FTBA 5FPXA 2HKXA 4TWTA 5A32A 3KD4A 3FLTA 4JQTA 5HXMA 1NXMA 2PLV2 1F4AA 5DUXA 4LIVA 2K0GA 2VW1A 1HB1A 4WM8B 2EAAA 3VBSC 1AJOA 1J59A 4LBKA 4BDVB 1X36A 5ISLA 2E51A 4DO0A 1PNFA 3ZFGA 2HWF2 3C2UA 2X5IB 1UMIA 4AQ6A 3BI3A 2B45X 4LPLA 1SPPA 1VLNA 4OI0A 2IVJA 3ATGA 1W8ZA 3JCIA 4ONUA 1DG6A 1HXS3 3WW1A 1ZM1A 2QNKA 4YARA 1L7LA 3RS6A 2WIIB 5JMCA 1US2A 4XUNA 2GC0A 1PO21 2ARXA 2HBUA 2XHKA 4FVVA 2AREA 5GKAC 2YFZA 3M70A 4CDUC 3HR9A 3OPZA 2BWAA 1MS8A 1H2NA 1TMF1 4LUKA 1UY2A 4OHWA 1REDA 4FPKA 2JB8A 1SLIA 2JG8C 1PM4A 2RR13 2ZABA 3OY8B 2A7AA 3ZMOA 4BE3A 2W68A 2MHFA 3J9SA 3KM5A 3LOIA 5FZHA 5DAXA 2RMU2 1A6CA 4MOAA 4C1XA 1QIQA 1DYPA 1DFQA 3IPVA 3IT8A 4XUTA 3NW4A 2NQYA 3MIHA 5A6ZA 5CA6A 2VW2A 4XPVA 4F83A 3WXPA 4TLFA 4E8DA 3FC0A 3T0DA 5EV7A 2QQLA 5FJKA 1OUXA 4LKFA 1PGW2 3M3CA 1YI9A 4JGYB 1B35A 1AR71 2XBO3 4XDQA 5DPNA 5DAQA 2JDPA 4KBBA 4QX3A 1CAXA 4ASMB 1F35A 5FY7A 2ZMNA 3ON7A 2HWD3 2RJLA 1PZ8A 1CAWA 1QEXA 1UN1A 1AHSA 3DPRA 4FOWA 5E16A 4A44A 5LRSA 2H6BA 1HQWA 2K2SA 1W6QA 5A33A 5J36A 3DGTA 5DMYA 5I0RA 2BEOA 4XFFA 2VMHA 3N3HA 2GP5A 2W5FA 1UKRA 4OI1A 1NA1A 2BFUL 2ZKLA 3HT1A 5LATA 3LAGA 3SMHA 3HOBA 5A7OA 1CJPA 4NIGA 4BIOA 5F32A 5LZ6A 4YGCA 3IDAA 3VBUB 5J98B 1RUF1 1YNAA 5E89A 1FPN3 2O14A 4IEXA 4H55A 4QKDA 5FRAA 2GMEA 2XJUA 4DINB 3TEZA 3D5OA 3ZXAC 5L36A 1AXYA 3WG1A 2E33A 3ALQA 4CDUB 1G6NA 4LHLA 4W65A 1W8HA 1ND2A 2CDOA 3WNOA 1G9FA 1CD3G 1JYCA 4XAEA 4CP9A 4M01A 3U07A 4OVEA 2D6KA 3ZFFA 4D7SA 1BMV1 3SCGA 3RZGA 3INAA 4NR1A 4DXZA 4LITA 2DCKA 2XH6A 4QQLA 4XCBA 4XUOA 1B35C 4YGBA 4QKFA 5HI0A 1W90A 1LEMA 3O1TA 3N7MA 3HD8B 1C8NA 2RMU3 3OEBA 4QGNA 4XF4A 3RWKX 2Y8KA 4C0HA 1UOBA 1ULCA 1HRV3 4DEQA 1QNYA 3FFZA 1CR7A 2WN3A 4LO7A 5DG1A 2W87A 1AL21 1BYHA 4A3ZA 1H2LA 3H8UA 2BW8A 4HKLA 2XOMA 5JOYA 3AL5A 1LOGA 4FOYA 2TNFA 3NAPC 3VBUA 2CTVA 5J1XA 5JSOA 5K0UB 3ITQA 1DLCA 3IDCB 1YIPA 1MQTA 1UNBA 4NAOA 2A6VA 2VCBA 2Y6HA 4YFZA 1XRUA 3D0JA 4JTOA 5KHHA 1QJX3 3MO4A 4B1MA 1FATA 5IFPA 1UZVA 1W6MB 1W6PB 4RGGA 5EIYB 1QJEA 5GZFA 3SC7X 2WBKA 3FX3A 5LASA 4L0PA 5K9YA 2GC2A 3GZAA 4V1PA 3S30A 4DPNA 1MS5A 3ELNA 3NNJA 5IK8A 1IS4A 1UOGA 2Y38A 4NIHA 4QM9A 2NP0A 1QHDA 2VAUA 4FPGA 3ZOIA 5ACA1 3BOWA 1XYOA 3H8RA 4XF9A 3ZMNA 2GNMA 2FCTA 3WF3A 2Y64A 3N9OA 1GFF2 4OCTA 5E88A 2VG9A 3H3ZA 3V65A 4SLIA 1C1LA 3ZXDA 1XE8A 2DURA 2Y34A 4EQVA 2P5BA 2ET7A 4ZS3A 3WCSA 1S55A 3MF9A 3CDZB 1QOOA 2BVBA 1PK6A 1DQ6A 1S0DA 5CFDA 1BMV2 1FYUA 1NZIA 2W1QA 5DZGA 1GBGA 3K75B 1R091 4N53B 4XQ4A 1W0NA 3RMYA 2BOJA 5A7NA 3OBZA 1EPZA 2P3IA 3UGGA 5C3PA 2K9ZA 2WZR1 4XMAA 3UK9A 1QOTA 2VTXJ 1HDKA 5CKNA 1ALYA 5F37A 3VHOA 2C6SA 2Y6FA 3VDCA 5A3OA 4RL7A 2FDKA 1OLME 4FPCA 4IEWA 2G19A 4L9BA 5DN2A 3EJKA 4GQ7A 5I0TA 4TN7A 2BGOA 4XFAA 4QPGC 1W8TA 4L92A 2ZGOA 1W9WA 4ASKA 5A3TA 1O5UA 2XKPA 4N7UA 3WV6A 4N43B 1VMFA 1MS4A 2CGNA 2ZGQA 4FTEA 4MXWA 3U37A 5FYSA 3RI8A 2WLQA 3AP9A 1C1FA 1DQ2A 3ZFFB 2P3KA 1HLCA 3LF7A 3NSTA 3KCCA 4IQPA 3ORJA 4N53A 3IZOA 4I0BA 4Y22B 4B4QA 1AR61 3SH3A 3VHRA 4CCJA 4MX3A 1AYM2 4NPLA 1O4ZA 5T52A 1POV3 1SHWB 4PCRA 2Q8CA 3HEIA 3IM0A 1BK1A 1JU3A 2RR11 4QX7A 4XQWA 2W1SA 4YM1A 1W2TA 1MQTC 4RGAA 2HLEA 4WBBA 4CUGA 4M0NA 4D6RA 3O1MA 4KGQA 5KXBA 1GNHA 4KGGA 3P5BA 3AZVA 3EXUA 4Q27A 4XHXA 4DB5A 2VQUA 3CU7A 1ZZ8A 3TEWA 2ZHKA 4XMIA 4XTMA 4AWDA 4MHRA 5FOBB 5CKQA 5IJRA 4QXHA 5JOZA 1TQ5A 2D7FA 1GMMA 3NJVA 3I3BA 3GHMA 2VCAA 3MPPG 2X10A 3I49A 4IXLA 4AI1A 2IXHA 3SQOA 4O9EA 4XABA 4IV1A 1RUG1 1SBDA 1XNCA 4CSWA 1S0EA 2CAUA 1PGW1 4QPGA 4CEYA 3FBYA 2IFRA 4H7LA 5FZ3A 2PAEA 5I93A 4OZXA 1G9BA 4TYSA 1W0PA 2CV6A 4EN9B 4QX0A 1Z7S1 2G4IA 1U5YA 5IVBA 2UU8A 1X82A 3FHIB 3WNXA 2J7MA 1W8OA 1CX1A 2VUAA 1WW4A 2R061 3N9PA 3NJZA 4W6WA 4EV0A 5FZ7A 4NOTA 2B39A 4I0AA 4HN1A 2YGMA 2ORXA 4Z92B 3GZUC 2ZPXA 4XQDA 5BY5A 2D40A 3T4VA 1UY3A 3VDDA 3WNNA 1AYN2 4WM7A 1WMFA 2VNGA 4LHSA 5EJZB 1FAYA 5KWRA 4G9SB 4IEUA 1MVEA 1HXS1 5KC6A 3TN93 1G9DA 2E6VA 1JW6A 1R081 2YBSA 5FPAA 2XJSA 1SQ4A 4CDWB 3D6EA 3N9LA 1S0GA 4Q4W1 4LBQD 2ZJCA 4UF0B 1PMJX 1S2KA 2JE7A 2Q4SA 3ZN6B 1L7RA 4D7TA 1PX3A 3RMXA 1MR5A 2OQ6A 3FLRA 1DCSA 3M3EA 1S4CA 2R1DA 2JXAA 1N3PA 5FZLA 5LA0A 3I59A 2DV9A 3GXUA 1W8NA 3KWVA 4EN8B 1UXXX 2HWB2 3WF4A 1BEV3 4N43C 3H7JA 1O3SA 2BGPA 5G05L 2Y0IA 1RTVA 2WUHA 2QQUA 2W39A 3ZFFC 3ACIA 4IE0A 3FWEA 4QKNA 4KI5M 4WM8A 3RNSA 2NLRA 4BISA 1A3KA 1WLWA 3J26N 3MLKA 1D2SA 2C0ZA 3B9IA 4LR4A 1VPHA 4CEYC 4CPBD 5BNPA 2OIIA 4NHXA 1QXRA 3E97A 1C3HA 1M4WA 2WNUC 3M3QA 1Y9MA 1DQ5A 3OSDA 3DN7A 3GDBA 2XG3A 2XJTA 3TOJA 4BK4A 3PTRB 2ZTNA 4RQPB 5F6LB 1VR3A 2DCTA 5JSPA 3O1SA 4XFBA 5FPVA 3VBOA 3ZKUA 5BV6A 1IQAA 1N1YA 1OPMA 4YW6A 4HXCA 5K4LA 3JU9A 3DPRB 3A7QA 1LENA 1XPWA 2ZCWA 1WWYA 3J8F1 2VR4A 1PIV2 3ZYRA 3ETPA 1KGYA 1IZ3A 4E2GA 4ZZ8A 3VKMA 1ND3A 3CMGA 3MUZ1 1PHMA 1FOD2 1WMDA 4C91A 4XJZA 1AF9A 5FYYA 4CDXB 3PURA 2Y60A 4JDMA 4EYUA 4PJYA 1UF2C 5JSRA 1VMJA 2JJ6A 2VTFA 2WS92 3EQEA 1IPKA 3AYAA 2G9GA 3NVCA 4QPIB 4BA6A 4F3JA 1X50A 2WA3A 1AR83 4C90A 1TMF3 2VMCA 4OI4A 4AYUA 2DBNA 2HJIA 1ZNPA 4KG8A 3UNPA 1VBE3 3J4UH 4PLOA 1SACA 3RJRA 4UOJA 1VRH2 2VULA 5AFEA 1UX7A 4YNIA 4YM2A 1F31A 4TSVA 5FMBA 3W59A 1CAVA 4LO4B 4A41A 2A3XA 3ZPOA 1XE7A 4A42A 5DG2A 5BNOB 1R1A2 3AB0A 3PMSA 3PMEA 1V00A 4ZU5A 4GIQA 1VBC2 2WNVA 2HBTA 4CDQC 3AVRA 3POJA 1BKZA 1CPMA 1W6QB 2JIGA 4IUGA 3AP7A 4QWNA 5A32B 1S0JA 2D6MA 2GNBA 4PIZA 4LHKA 2B9VA 1X9PA 4FQZA 5A3PA 3OGSA 4UFJA 4FAGA 5KC5A 1OQEA 2ZXQA 4X8PA 1W99A 1IKQA 1OT5A 1LOFC 1O6UA 1WW5A 3P1IA 5DUUA 2WO7A 4BQ4A 1DYKA 2GNTA 1C8M1 3ST7A 2R0FA 5T5JA 3G7DA 3GZTB 3U14A 4NUBA 4NIDA 2I2SA 3I4IA 1G9AA 4HN0A 3H9AA 1MS1A 1QMJA 3AMQA 4LE3A 4AF9A 3EB7A 2AEZA 2Y0OA 5GALA 4XAAA 2O0OA 4OHXA 5JXIA 5DZFA 1ZZCA 2RJ2A 4R9CA 4KWLA 1JUHA 1O8SA 4MUVA 4N43A 2ZGRA 3VKNA 4C1WA 4CU6A 1ND2B 3H3UA 4A6OA 2BZDA 3MGUA 1PIV3 3WDXA 1Z78A 2ATFA 1PIV1 1QJZA 2YMZA 1W3VA 4NHYA 4BWOA 2WFF1 2YB7A 1OOPA 2CDPA 5LA1A 3ZLIA 3CJXA 4YM0A 1L7QA 1GLHA 2A70A 3HMYA 3JBG3 4JGZC 3M1HA 5FQ0B 2QZ2A 3I97A 1AYM1 4P08A 4BXSV 1G86A 3I2JA 1K3IA 1XBFA 2NYYA 3HVDA 5I8SA 5JI9A 2W0XA 3I2OA 4W6XA 5JVVA 2BU9A 1ZZ6A 1AX0A 1L3JA 4GH4C 4AVCA 4AVBA 5BNPB 3MZHA 2DU1A 1XJAA 5JAXA 5K0UA 3PUHA 5F9TA 4CTEA 1ULEA 4GWJA 1G9CA 2XVKA 1ZREA 4LJHA 5EXOA 1O4YA 1REEA 1BXHA 1Z7S2 2RVAA 4Y3OA 4YVSA 3BIEA 3ZXJA 3OGVA 4IV1B 5IUQA 1U5IA 4K1ZA 1YJLA 5CFCB 3MUY1 5BNQA 3L2HA 1DGRN 4S2DA 1Q3EA 5FZ4A 1VBC1 1LR5A 5IAXA 4LA3A 1LHNA 4JKKA 4Y22A 3VBSB 2BFUS 2EXHA 2RS32 1WBFA 2WA4A 4YW3A 5HV4A 1S2EA 3PU3A 4L2NA 5FK7A 4P5YA 3T1LA 5C3OA 4R4ZA 3VGIA 3BTZA 2YY1A 4BPZA 4AAXA 5A3MA 1LGCA 2AUYA 4W8JA 5JXJA 3RYKA 1R082 3VBFC 3VDBA 3PIGA 3VLBB 5L9VA 4QPYA 1FI2A 5IK4A 3SNMA 3OGJA 3FN9A 2VZOA 1AUYA 2VCCA 3BIWE 5FY9A 4YZ2A 1MZ6A 1XQNA 2OPWA 1FOD3 3W21A 5LA2A 4ORFA 3DYPA 4Q8LA 1U0AA 3WDWA 1KRIA 2I45A 3POSA 3NL1A 4IERA 5JPMB 2RS13 3DXUA 4R8HA 4NPMA 5FZGA 4Q0SA 4BM8A 2QQIA 2VZQA 2GALA 1U5XA 1PGL1 2WZEA 2WZPP 4QB6A 1URXA 1VBB3 5JDBA 3NAPA 5A3WA 3VBUC 1SBEA 4N90A 3MF6A 5FZAA 5SV5A 4MYEA 3VHNA 2WT1A 3SKVA 4PF5A 1VALA 2DVFA 3V0BA 3THPA 1QJFA 3O0XA 2HWE1 1JU4A 4GWIA 3URFA 3DEMA 1V6NA 2A1XA 1UPSA 2CWMA 4ZU4A 4IV1C 4C8DA 2B4KA 3C7EA 4FP2A 1A8DA 3AZZA 4LXLA 1CWPA 3OJBA 2VW0A 4F7ZA 3ILRA 2D6NA 2WN2A 1ODNA 5DUVA 3T1MA 2WO3A 5A3NA 1HB3A 2C9KA 3H3LA 2QQKA 4BB3A 1ND3C 3FHQA 3FUQA 1Y43B 4HONA 1ZA7A 3ZX7A 3KT4A 1CAXB 4YPJA 1W6MA 4ZHNA 5FAXA 1P8JA 4CZSA 3OOXA 4Q8KA 4O7XA 3RYRA 1XB9A 4PLMA 4Q1RA 4YGDA 5C9AC 5JOXA 2QDRA 1R083 4XF3A 4UFLA 5T50A 5FZFA 1EUUA 1BZWA 5A1LA 2VQAA 1SMVA 1AX1A 1NA1B 4XCAA 4UFIA 2E26A 1QJY2 1OLMA 5A6QA 3WT3A 1H9PA 2H0BA 3P6BA 3C7OA 2YC2A 4DZGA 2JD9A 3H1WA 4E4DX 1J1LA 2QQOA 2XDVA 2R1BA 4RHV1 3RG0A 4BK5A 3GCXA 2OZ6A 3VDDB 1BBT1 5EWSA 1CX4A 1FNZA 4V2WA 3SEEA 4LK6A 2VUJA 3Q8EA 4GWMA 4H14A 3T30A 2EA7A 2HEYF 2OQ7A 4BMBA 3VD7A 2PN5A 1Y3TA 2FHRA 4Q4Y1 1OSGA 3LPFA 2FDIA 3MV11 4GMP1 1REFA 4NHMA 5EJ3A 2EIDA 2Q1FA 3PVBB 1UOJA 3ZYPA 1VBD2 5FXVA 2VL4A 1YUDA 4NJ4A 3ZFEC 1HJGA 1T2XA 2IXCA 1Q56A 3DV8A 2XJRA 4P9WA 4EWEA 4ASLA 4MGTA 1VBA1 5E8AA 1J1TA 1NE4A 1WCDJ 3OB8A 4TXWA 3RVHA 2CWSA 2VPVA 4COWA 1HN0A 4HL0A 5JOWA 2HWE2 4Y33A 2DTWA 2YGLA 3OY8A 1CQ9A 4K7JA 4S2FA 2W1WA 1HX6A 1SLBA 2JDMA 3HAGA 1UW8A 3Q8FA 4IE6A 1Q8QA 1GQPA 2WL1A 5FCCA 3OUJA 4J25A 4O9GA 1GNZA 4DQAA 3MV01 4RA0A 2XGXA 4B7KA 4N53C 2FDFA 1CPNA 5CB7A 2IXIA 4FQ4A 4MADA 1ASJ3 1U12A 3OTFA 4QXKA 3WEZA 3AXDA 4DMIA 5DDJ1 5FY1A 1EV11 4G4FA 1JZ6A 1NY71 4QHOA 4A45A 4QU1A 3OF1A 1YHFA 1NAEA 3AC0A 4D3WA 4EN7B 2BPA2 4FOVA 1A34A 1K5MC 1AVBA 4Z07A 1DLLA 2PHFA 3I8TA 3LFIA 2ZX2A 3IIIA 4HMZA 1XC6A 4BCUA 3ZM8A 1DGWX 1PO22 1RUJ3 2TUNA 3ABZA 4FPFA 1E57A 5H9SA 2FDGA 1C5HA 4XXPA 4WVMA 5LK7B 4DY3A 1TMF2 1W8WA 1RXGA 1IG3A 3CO2A 1MEC2 2P2KA 5JUVA 2B42B 5HCAA 3DUIA 4J6GA 5IVJA 1GZTA 3ZSKA 1GOHA 2WSUA 1VRH3 1YQ2A 1QQP1 3AYDA 3BPZA 4XACA 2WO2A 2OUHA 1LULA 1WKYA 4MGKE 4ATEA 1H1MA 1ULPA 5C8CB 1JZ8A 4TTGA 5EJ1B 4AEDB 4CPBA 1H4GA 1Y7BA 4LBNA 5FMDA 4K6BA 2ERFA 2VVEA 3K2OA 1NUKA 1ENSA 4K21A 3PJQA 5FMOS 1W03A 3WDYA 4YWAA 2A6WA 3RJ2X 4BH9A 2GN3A 4Q0UA 1NCRC 4JC1A 3CBNA 1W6NB 2YU2A 4DXRA 4YW4A 1Q5OA 4CCCA 3HIFA 2JB4A 3MDPA 2CL2A 4AR2A 5ANQA 1HV0A 4BJ0A 1J3PA 3RSJA 2BNOA 2OPKA 4B29A 1SLAA 4QHBA 1EUTA 5LA9A 1RUI1 4YVWA 1YFXA 3HNYM 4YW5A 3R05A 4RGKA 3KCXA 1COV1 4AGVA 4NIIA 3AXEA 3FJSA 1CZSA 3LSDA 5T54A 1AR93 3BGAA 3N9NA 3KHBA 5C8CA 2X09A 4Y20A 4NMIA 3AJZA 1UO9A 2Q1MA 2W46A 1D4M1 3KV5A 3J8F2 3A22A 1N1TA 3SCHA 4A7YA 5A1FA 1WA4A 4S2GA 3M3OA 3THDA 2WYSA 4OUEA 3OYWA 4NRMA 5K7PA 2VC9A 5ANNA 4LLFA 4Q0PA 4OQ8A 3GJAA 5CFCA 2FQPA 2E63A 1GP6A 1NLQA 1PO11 1D4M3 1QH7A 1VBC3 2KA3A 4W4ZA 3TWIA 4XFCA 1NOVA 4I3PA 3KGZA 4UFHA 3I59B 1KITA 2PQQA 4WVWA 3VHPA 2V5DA 1PK6C 2PTMA 4B4RA 2A6XA 5CFDC 1OH4A 5L7OB 2RM23 2JDAA 3KF3A 4K20A 4GMP0 5FYZA 3OD4A 4UW5A 2HYXA 5FMOL 4Q4X3 2HWD2 3SEPA 3WY6A 4CCDA 1RUG2 4HVRA 5FFOC 1E5SA 3QH7A 4OULA 2C1FA 1UXZA 2Y6JA 3TNQA 4HKWA 1WBLA 5A7PA 1VBA3 2WO1A 5FO7B 4YVSB 1XU2A 4IE5A 1OC1A 4DNYA 1UYPA 3BN6A 1D7PM 1A8MA 3WCRA 1W0OA 1V6KA 4AGRA 3I2IA 2K46A 2FCVA 4V2VA 1MZ5A 2HWF1 3VL9A 4A7ZA 3WQ0A 4AE2A 1RHI3 4UAPA 4CEWC 1WGPA 3RGBA 1DGRA 1SLLA 3TBDA 4BQ2A 3AK0A 4NHKA 1X33A 2QQMA 2J1AA 4L11A 3H50A 2ILMA 3IB3A 1OHFA 2KR2A 5L73A 2OS2A 4JZRA 3ACGA 3N9QA 4XBLA 2Y6LA 3NNLA 3J7HA 2JKBA 3Q8CA 3VBRA 1NXD1 3ZFEB 1W2NA 1TEIA 2QJVA 2RV9A 4P9LA 4E2SA 4NN0A 5HV0A 2YXSA 4QPIA 4L99A 1DP0A 3DPRC 3ASIA 2ZAAA 1EV12 3QH6A 4RR3B 2YROA 4LO8A 5FP4A 2Q1ZB 4EWDA 4GJZA 3VBHB 1Z0HA 3M2MA 1SPPB 3I2KA 2HWF3 4D6SA 3D8CA 5LW9A 3Q8BA 5CIRA 2UWAA 3C7FA 1Y4WA 3KHCA 4P9IA 1KDMA 1XSRA 3HT2A 3ECQA 3PU8A 4Z1VA 2PLV3 2WSVA 3CJIC 1ULFA 3ETQA 4IV3C 1G7YA 4UYBA 2R49A 4Q26A 3VV1A 1K5MB 2MEV1 1OH3A 2C5DA 2DFCA 2HH9A 2PELA 2V4AA 5E6HA 4RQPC 5FYIA 5GZCA 5JXGA 5JXHA 4FOQA 4E4SA 2VMIA 4EWAA 2JENA 2VZ1A 3NV3A 4OMDA 1AR92 4Y20B 2ZGKA 5JWPA 1I6XA 2B9UA 2GH8A 5I0SA 2ZX1A 3OUHA 3GGLA 4QX1A 1NE6A 4XDOA 3ZXGA 4FSJA 2OYZA 4FT8A 1IS5A 5DABA 3IDBB 4B8EA 1H1AA 1F15A 1QDCA 1IGOA 4CCEA 1OF4A 5F8PA 3ZDVA 1O3RA 4XF0A 4AHWA 3S5AA 2OZJA 3HNBM 3SKJE 5BPXA 2VMEA 3ACHA 2BP6A 5F3GA 2WNUA 5GLUA 1SFPA 2PHWA 1RUF2 3WUDA 2QDNA 4PDWC 4F8AA 3AZWA 2YBPA 2FDJA 1JZ7A 3I2FA 5DDJ2 2ZZJA 4GZ9A 4FP3A 4WVZA 5A70A 1RUF3 1BCXA 4WVMB 2VOXA 2RE9A 3LOBA 2KXLA 1YI7A 3BTXA 3DKQA 4TLGA 5FUNA 5FZ0A 4BQ1A 3F2ZA 2CY6A 4QQHA 4RR3C 5EYYA 3N7JA 4RSUA 3QBQA 1FMD3 1VBB2 1GR3A 1UPIA 4XOGA 1H0BA 1ZYBA 3ZSLA 2JDNA 4AQ2A 1VRBA 1YEWA 5H9QA 4LOSA 5KHGA 3NWKA 4P9JA 4B7EA 4ZXEA 1EYBA 4ARXA 4NAMA 1R1A1 2JG9C 2R7EB 3MIFA 4BIFA 4EN6B 5J48A 3C3VA 1SFNA 4HZFA 4JDNA 1R092 1WUVA 1ZZBA 3LIHA 2HWB1 3W5NA 1V6JA 5FIXA 1YJKA 2BJSA 1ZZ7A 1GZ9A 3AX4A 2WFPA 3W58A 4CRQA 1UY0A 3B00A 3WG2A 3ZYHA 3ZYBA 2B7YA 1XNTA 2JIJA 5LBFA 5A6YA 4AEDC 2F17A 5AVPA 3NKGA 4H7MA 5EZWA 2ZGMA 4UFMA 4IETA 4AW7A 1IPSA 3HWJA 1RUE2 3WVJA 3V0AB 2P6CA 4P5HA 2UWBA 1VBE1 2QKDA 1O7FA 2R042 2A73B 2WNEA 3ZSMA 1AR81 1DGLA 3K3OA 3UJQA 5CYYA 2PHUA 3IMMA 1UIJA 4XZPA 5KBFA 2DCYA 5F5IA 1COV3 1FX5A 2QBXA 4BQ5A 1UYYA 4RFT0 4QB1A 4LORA 1QU0A 2XB6C 4YLZA 1GP4A 3B3QE 5CNAA 2VM9A 4RR3A 3T2PA 3J8F3 4W6YA 3AFKA 2EXKA 2MEV3 4M4RA 3E6DA 1LODA 3B02A 2FZ2A 2WT0A 4HSJA 5F6KA 1EAH3 2VNVA 1LESA 2ZGUA 4UT5A 5C9AB 2ZGLA 1ODMA 4ZXKA 2PHRA 1ST8A 4BQYA 1AR62 1JN2P 4HLTA 1HRV2 4RS5A 3B69A 5FTTC 2VUDA 2ZZQA 5LBCA 1W6PA 4PQQA 3MEPA 2P6HA 4PBOA 3UKVA 1ZA4A 4D0QA 1GQGA 1W04A 1F8VA 1HKDA 1RMU3 1UZZA 1OURA 2UWCA 2SLIA 2QQWA 1VB2A 4OHZA 1AZDA 5J3UA 5C3SA 1PGSA 2D44A 3NKTA 4FFIA 5L7OA 1VRH1 5IYYA 3PNAA 5FZ6A 2ZAHA 4PBPA 1FMD1 2E9QA 5T5LA 4AAPA 3WQ1A 1RUH2 1W06A 5BNNC 1UL9A 3PL0A 4LKEA 3USSA 4AEDA 5FYHA 2V09A 2BOIA 1OA2A 3ZN4A 1I5PA 3ZXFA 3TEYA 1VIWB 3H8OA 3LEKA 3POEA 3M3IA 2AYHA 3ME2A 4AOCA 1DGWA 1W9FA 3JBG1 2QFEA 4QMAA 4MH0E 4MXWB 1JXNA 1RUE3 1W6NA 4XBQA 1YQCA 5J09A 4KU8A 2XBO1 2VNRA 5IAVA 5BNOA 1SDWA 3CHXA 1MS0A 1STMA 3POWA 4QDQA 3RZZA 5EFUA 2R041 1UZYA 1DQ1A 2R30A 3AYCA 1OFSA 4QGMA 4R9DA 4UBGA 1V9U3 3MIGA 4LKSA 1DIWA 3S6PA 1AR91 2VZUA 5BUVA 5KXCA 3HBKA 5JIUA 5FLHA 1RINA 2VGDA 1ZBA1 4FFGA 5EYXA 2D43A 5GZGA 2WFF3 2F6BA 3VD5A 5A7QA 3Q9OA 2GSYA 1K5JA 2YPJA 1Q43A 2VNOA 1YFYA 2Y6KA 1VE0A 1YFUA 5GLZA 4CCNA 1MZFA 4I3GA 3E6CC 1LTEA 5F3EA 2BERA 2ZS6B 4D94A 3JXSA 2W3JA 1H6YA 2ZHLA 3OPWA 2FZ1A 4XJWA 4EZ4A 3O1UA 1LGNA 4WM8C 4LTAA 4E8CA 2GZWA 2V4VA 3NNGA 4LNVA 3K4AA 1HJFA 2ZOEB 3BB6A 3AP5A 1UZWA 4KWJA 5J7MA 3O5SA 3V0AA 2Z4FA 1OKOA 2RDSA 2DU0A 5IVYA 2ZX0A 4I01A 3WP3A 1Q8VA 4GKXA 2RDNA 4HANA 2Q8EA 4P9GA 3SCFA 4BQWA 3ACFA 5F5AA 3UYJA 1LU2A 2WQZC 4J1WA 2IXJA 1OPOA 4FPLA 1QXPA 4GULA 1WCQA 2ENRA 3VKLA 1RMU1 1RUD2 2Q30A 3ZIXA 3X29B 4YZ3A 3CJIB 1DZRA 4IV3B 2BNNA 3D82A 4GA9A 2ORZA 3V56A 4DS0A 4HPKB 5FY8A 5HCBA 5HCHA 4FTSA 4AVSA 3BPSA 3JB8A 3I3MA 5GJ6A 2X5IA 1RVF3 2RG4A 2W9XA 3CLPA 3WF1A 4AEJA 2W91A 5C9AA 3LDBA 1NA1C 1F5FA 4YSFA 1EAH2 1COV2 4BU2A 1MVQA 4JHTA 1RUE1 3WZ1A 3ZR5A 3NNMA 3NJYA 2HWB3 5C6CA 1ZRFA 3KF5A 4NE9A 3IAQA 2DF7A 1R1A3 3RZHA 1FOD1 2JDHA 3W9AA 2WINB 3Q8AA 3VD3A 3EHKA 1FNYA 3UL2A 4M4PA 3KSCA 3EBRA 2FMDA 2PQSA 3AMHA 3K3NA 4JQRA 4UWDA 5T3NA 3HBZA 4EJRA 2JG9A 2YDEA 5F5CA 2PAKA 4XZUG 5EHDA 3ZFEA 3AMMA 4E27A 3BUCA 4QM8A 4KG0A 1NKGA 1F9KA 2D5HA 1QJX2 3B7MA 4CE8A 1YXWA 3MLLA 1VBB1 2UY8A 3WP6A 4P9YA 4AFAA 4ZKTB 3RZMA 2YFUA 1ZRIA 1TNFA 4BHPA 1HRV1 4ES8A 2G1MA 3B9CA 2Y26A 3E5QA 4FFHA 1R093 2RMU1 3VZOA 1HN1A 4I2OA 1ASJ2 3B5LB 1V6OA 5KHJA 1RUD3 1QKQA 4CEYB 1SG3A 5I91A 1TME3 2R073 3POBA 4XHBA 5CKMA 2YC4A 4M0HA 4Q4W3 3TB0A 2D3RA 1KFXL 2CGPA 2DCZA 3N9MA 2Z79A 4G3YC 1MS3A 4LBLA 4P00B 2RS53 5FZ8A 5B4NA 3TN91 2XR4A 1LHWA 3SHRA 3OEAA 1ZBE1 3MPBA 5F3IA 2CYFA 3IDEA 3ZSEA 4LOTA 3DECA 1NCRB 3A0KA 3AYEA 5CU1A 4ZS2A 5HCFA 4AI9A 1UQXA 1ZRDA 1LEDA 3CQOA 3JUUA 4LKDA 1GZCA 1WCSA 2VVDA 1C8M3 2N7GA 3LE0A 4TZDA 5GZEA 4FXKB 2XXZA 1JHJA 2VOWA 2WNVC 3MLJA 5BNOC 4XIOA 2EALA 2YHJA 2WABA 4Q2FA 1W39A 3P3PA 3AKPA 4CDXC 3OUIA 2P1BA 1M06G 1YWKA 1J3RA 2EVXA 3DL3A 3J7MA 2J42A 2WFF2 1C4RA 2ZX3A 1HRI3 4DFSA 3HPNA 1GICA 2X8KA 1XNBA 1J58A 2PHLA 3IAPA 1QJU2 3VBSA 1ULOA 4MGZE 4E4ZA 5BNNA 3POFA 4AHYA 4Q4Y3 3SXWA 4IEZA 4CP2A 4EZHA 2ADDA 4HVQA 1AXKA 2GU9A 2WNOA 4NWVA 5LY1A 1W6OB 4CP1A 3BALA 3IWZA 2GNDA 1H2KA 2VMGA 3NMBA 2EIBA 1CJDA 2XLGA 4FXGB 4Q4Y2 2BYVE 3T2OA 4O65A 4Y1XA 3E5XA 1D2QA 2PLV1 3KCYA 2RS33 3VZNA 4CXWA 2D3PA 1J83A 1RC6A 3FFQA 4GXLA 1OOPC 1FT9A 2JG8B 2KD7A 1RUOA 2HWC1 1IG0A 2L9LA 3QCWA 4QKBA 1BQPA 5CVRA 1VAMA 4YG0A 3T4HB 5F7UA 1OUSA 4LLOA 2PYTA 5CG9A 3BU0A 2ZHMA 5KR7A 1GWMA 5F3CA 2GP3A 4FAHA 1LECA 2DYCA 4WVVA 3WR0A 1N47A 2WNUB 1PVC3 3JBG2 1FV3A 4CU8A 3JD72 4I09A 4FFFA 1OFNA 1XOYA 1ZBE3 2VY0A 3I2DA 1WMXA 1NCQB 5FZOA 1F2NA 2IFWA 5FYBA 2RM21 3LWCA 3MICA 4Y1UA 3AZXA 4GALA 2R063 4YZ5A 3W5MA 1OXCA 2DBIA 1AR63 3NJXA 1R64A 3RZLA 1TME1 2R071 4QX8A 4CCOA 2A6ZA 4BQXA 1JZ5A 2JECA 1CVNA 1PVXA 1UY4A 2O8QA 4CDQA 1WLCA 2JE8A 3L9JT 3LEMA 2WWUA 3DCQA 4K8RB 3RI9A 3POYA 4P9XA 1I3HA 3G6JB 2F4LA 1UOFA 1ENQA 4NHLA 3VBFB 1K12A 5C71A 3O0VA 3DYOA 4IGQA 2LALA 3HNMA 3M4FA 1VAKA 4FBFA 3GZEA 3L2YA 5FZDA 4GAZA 4E4HA 1GANA 1TVGA 3AP4A 5FQ0A 1K5MA 2O1QA 2D6LX 1X8MA 2MPFA 4PIXA 3BTYA 5DAPA 3AFGA 1PMHX 3EO6A 4IGOA 4XFHA 5FXXA 1RUI3 2IZWA 1PNGA 4NWWA 3GJBA 1VBE2 2BNMA 2VH9A 2QVSB 1RUJ1 3MI8A 3R4SA 1NYWA 3SH4A 1W9SA 2WS93 1MQTB 2P17A 5JR7B 2CSGA 4PI0A 4QPIC 3HJRA 1E5RA 1WW6A 5LB6A 5ABJB 4ZY9A 2A3WA 1LOFA 4LHNA 4UBHA 2E7TA 2ARBA 4QU2A 4YGEA 3WHTA 4XC9A 1ZBE2 2BTVC 2R16A 2JDUA 3WP5A 2OA2A 3JB4C 3NAPB 4GH4A 2EXIA 4QXBA 4UI9L 3WW3A 2W52A 3H1YA 3BYWA 2FD8A 3RFRA 2R062 1YRZA 5SV8A 4DIQA 1LU1A 1WD3A 4AG4A 2PHDA 4CU7A 5ERLA 5JIAA 3B93A 4AEMA 2ZEZA 1DYOA 1AJKA 4A2UA 1X7NA 1CIYA 2PA7A 2P3YA 3QOPA 3K51A 2ZHNA 2W94A 2AC1A 2GN7A 4AHZA 1Y9QA 2JDYA 2ET1A 4R9AA 1JYIA 5F5QA 3S5QA 3SITA 2JEMA 1S1AA 4MXVA 1GZWB 1CGPA 4PT6A 5KXEA 2HEVF 2W1UA 1S2BA 2ADEA 4CA9A 5I8YA 1O91A 5AFBA 2AZ5A 3LDRA 4YZ4A 1V0AA 1J84A 2I07B 2IVIB 4U36A 1AR73 1LOEA 2ID4A 3FL7A 3K48A 1UMHA 3MFCA 1JYWA 4FPEA 3GYDA 2ZGTA 2O8OA 3PTYA 4K1YA 4ITCA 1RUC2 1WLTA 5GM0A 2SBAA 4OI2A 1WCUA 3F95A 2VTXA 3VUOA 5F1RA 3I54A 4NVPA 5FPBA 1XNDA 2X5IC 4AXOA 1D4M2 4PDWB 1CIWA 2WJSA 3NV1A 3KMHA 3PIJA 4OUSA 5ACA2 4LIUA 1LHVA 3WSOA 1I9RA 1U5ZA 2VO5A 3FHAA 5T5OA 3ZFGB 4U2AA 4RFRB 1O59A 5EQUA 3ZVXA 1QDOA 1GOGA 3KLSA 1EV13 3LKJA 1H4HA 1GKBA 2B46X 1UU6A 2NMOA 5FP3A 1POQA 1TNRA 1D4VB 5JR2A 2XWJB 2ZX4A 4IEYA 4MVTA 2NN8A 5C4WC 3CZJA 3LEIA 5FY4A 3GBFA 2EXJA 4IEPA 4XUQA 1KJRA 3ZSJA 4UW4A 4D8MA 4QPWA 5FMCA 4URTA 1DF0A 1XE0A 4OZOA 3VZJA 2R32A 1HXS2 4IE7A 2R6QA 1O8PA 2JG9B 3CEWA 4KBZA 1MZEA 1DZTA 1W6OA 2QUOA 1POV0 2ZA9A 4LULA 1NG0A 4QDRA 4AHXA 4C0BA 4YVSC 2YG0A 1UMZA 3U0ZA 5DAWA 3C8XA 5FZCA 2VVFA 2RHPA 3TNPB 2XL7A 3ZYJB 3OG2A 3PUIA 5FPUA 2C24A 3K77A 5C3QA 2JG8A 5FXZA 2WZR3 1EY2A 1IHMA 2LS6A 2B8MA 1F5JA 4PIYA 3THCA 4XIKA 4COVA 2ARAA 3GM8A 3K4ZA 5D21A 5FP9A 4CDUA 5GZDA 4LK7A 1IS3A 5D1IA 3PHMA 2MEV2 1GQHA 2QTWB 4Q0QA 1K42A 3ROUA 1UU5A 4HK9A 2RS11 3C7GA 4M3CA 1C28A 3TEXA 1JHNA 4B3NA 5FO9B 1RUI2 1GP5A 4MGIE 5CZKA 3RDIA 3ZXLA 4BZ4A 3NRUA 1W28A 2ZMKA 3RZKA 1LNSA 1H6XA 1G8WA 1O3QA 2W92A 4FI9A 3T2QA 1AYN1 1BHGA 2VZTA 5M0TA 1FV2A 2VQTA 4Q5OA 5I8TA 3J7LA 1QXJA 3S7EA 4Q1PA 1DU3D 3KQRA 2JDKA 2VZ3A 1ZRRA 1YLLA 1Z7S3 3A21A 5AC93 5TSWA 5A7SA 2LM3A 4CDQB 2XLAA 3WNLA 1SLTA 2Z69A 5FLIA 1B35B 1PO12 5L9BA 4I02A 3N4MA 4LT5A 3VZLA 3WDUA 4GMP3 2IUWA 1TME2 2R072 1QJX1 4XURA 5GLWA 4WM7C 2XL9A 5IFTA 2WZ8A 2D6PA 3E6BA 3WW2A 1JUIA 1H1IA 2VZRA 4KWKA 4DUXA 1CAUB 4AI2A 2ETEA 2PFWA 5FK8A 1NX9A 1GWLA 4HETA 1YQ8A 2XHNA 4OUMA 1ASJ1 1O5LA 1QF3A 4XETA 1TG7A 3P3NA 4XJAA 4MGSA 3U78A 1GWKA 2GC1A 2VZVA 1OI6A 4DEVA 1LHOA 4UW3A 3LQCA 2XMLA 5IHRA 2QZ3A 2V72A 3LB9A 1UX6A 3OD0A 3QACA 4LBMA 2E7AA 5CBLA 2AENA 3FMGA 3O1PA 1ENRA 1RJ8A 3MW3A 4ARYA 3AL6A 1W2AX 2W2IA 2DFBA 3AM2A 4AQTA 3A4UA 5FV3A 1TZOA 1MS9A 4WV8A 4ZU7A 3B94A 4FPJA 1RJ7A 2XJVA 2WR9A 4IW3A 1JZ3A 2BBVA 5JZGA 3OBAA 1QNWA 4YVWB 3E5UA 4QT6A 1HRI2 1DQ4A 2R0HA 1KFUL 1YYNA 5JI7A 5C70A 1D0GA 1KS5A 2Q8DA 2YPDA 1QOSA 3NV4A 4Y1YA 4RN5A 5FWEA 1V6MA 2VOKA 4LQRA 1UZ0A 2VQ0A 3MYXA 4NO4A 5FPLA 4B4PA 1I1EA 3N7LA 2TEPA 2QCSB 3VDAA 5IVVA 1PX4A 1NCQC 1ULDA 2XUMA 2ZMLA 3VKOA 4WM7B 4KH9A 1E5IA 2QE3A 3O7OA 3T09A 3V64A 4B1LA 1HW5A 4EROA 2DVDA 2YC0A 1CESA 3CF6E 3H7YA 4MO3M 5IK5A 2XJPA 5ABJA 2NZ9A 5FKBA 2DUQA 3ZN6A 1PGL2 2DUPA 3HQRA 3O1VA 1C8M2 1XYNA 1X9TA 3N36A 4XXAA 1OMIA 4LBQB 2VJXA 5CG8A 1NQDA 3KZ4C 1IQDC 1LGBA 5B4XA 4CU9A 4IE4A 4R4XA 5C4WA 4KU7A 2HWC3 3CIHA 3ACLA 3FLPA 4D7YA 1DHKB 4PDWA 1VAVA 2DVGA 5HPOA 4MGQA 2RS31 4Y4YA 1J3QA 3ZYGA 4LBJA 1W9YA 2I74A 1MEC3 2D6OX 3I7DA 1JODA 4LO5B 1OD3A 3WUCA 4XILA 4XVHA 4YG6A 2LUWA 1ZZ9A 1CN1A 1KS4A 4JV4A 2LROA 3LA2A 1JBCA 4KWUA 4MSVA 4CCMA 4ISQA 2QQVA 3I2GA 5CISA 1YFWA 4XBNA 4Y1VA 3H1MA 3QD6A 3LPGA 2VZSA 3FZ3A 4CYDA 1K45A 4Y5Z0 2ARCA 5G04L 1SCSA 1PMIA 4X6QB 3WQ7A 2QQPA 3HN1A 2VZPA 2RDRA 3PVEA 1AYN3 4DRVA 1JMUB 1H8TA 1OQ1A 5C33A 2GC3A 3WF0A 1AL23 3BKZA 1F4HA 4JVAA 3EMRA 1FXZA 3T2TA 2YZ4A 4CDWC 2XVGA 4JAAA 2ZACA 3VL8A 4DXTA 2JKXA 3AKQA 1NLSA 2OT7A 4FPYA 2ZEXA 3GALA 3ZIWA 5F2WA 1XNAA 3TN92 3R0RA 5FR3A 5FZ9A 5LK5A 4KMQA 3VN4A 3PVNA 1AR82 3KGLA 2XUEA 1OKQA 1GOFA 1OLQA 4MHUA 1HQNA 4XE9A 4CVUA 2WYFA 2WNVB 3KV6A 2IXKA 4KNCA 3NV2A 4OQ9A 2JICA 5D8AB 2GAUA 2X53S 5H9PA 3OBTA 4AGGA 5LY2A 1LB2A 1OA4A 1OQDA 1W9TA 3LCPA 5AC92 2WAAA 2VD7A 4MV2A 2HWE3 2VXRA 3ZR6A 1CZTA 2BGCA 4A3XA 5I0DA 2NMNA 3RPQA 2D5FA 2XWBB 3KVAA 4CXYA 3C7HA 3K46A 1H8TC 1PZ9A 2P37A 5FO8B 1QJU1 3FUOA 3GHNA 3SLIA 2J1SA 1NLRA 2VBPA 4IEQA 3ILFA 4JX0A 5DXDA 5FOJB 1IS6A 5KXDA 1LOAA 1RYYA 3EYPA 1YIFA 1QJY1 1T6BX 5H9RA 1FPN2 3VBRC 5J96B 4COUA 2BUKA 2E7QA 1GSLA 2UY9A 1QQP3 2PMWB 1OOPB 3ZXEA 1JZ4A 1BBT3 3WG3A 4MGYE 1W05A 1MEC1 3O12A 2YV8A 5GLTA 1C57A 3WNPA 5C4WB 2B5HA 1YC61 5FYMA 2LRPA 1BEV1 1JZ2A 2J1RA 2WZR2 3I3EA 3DF0A 1RUNA 2J1VA 4RS5C 3WF2A 2EIEA 5C5TA 5JCTA 4PI2A 1LHUA 5A80A 1V6LA 3ZDSA 2D97A 2Y6GA 1BVVA 1AXZA 3TRSB 2GMMA 3S57A 1LAJA 2VOVA 1KDKA 4QQ2A 3VKFC 4CEWA 3M7AA 3RZJA 3JD71 1UYZA 4HVOA 5DDJ3 3POIA 4X6RB 1V6IA 4AFBA 3LSEA 5FUIA 4K40A 5FP7A 2PHTA 3VBOB 4QQPA 1SEFA 5FDBA 4JKMA 5APAA 3O1RA 2WRAA 1W3XA 3A23A 3D0SA 1HIXA 3HQXA 3LDKA 3NO8A 3PUAA 5FLJA 2XQXA 1ACCA 4HG6B 4QD2A 4JKLA 5FBJA 3BOPA 3PLQA 1ND3B 4KL1A 4Z2AA 2NPIA 1H8TB 3KV4A 3T0BA 3THTA 3RRDA 4AK3A 1S0IA 2IC1A 1SBFA 4QHZA 3K4DA 1GNYA 5A3UA 5DQ0A 1PO13 2GMPA 3W20A 3WNMA 3AKTA 2HEWF 3AJYA 2BRTA 2VCMA 4JGZA 2JX9A 3LGRA 4QQOA 4ET7A 5C5UA 5IT6A 3BODA 4Y4RA 4YW7A 4LEJA 3TAYA 2CHHA 3WX5A 4RQPA 3O1OA 3T0AA 1LRHA 2PAMA 4P14A 4JGYA 5HXVA 4LUMA 2BBAA 4IEVA 3I3DA 3UJOA 1LJ7A 1QQP2 4CDWA 3AKSA 3VB9A 3MBWA 2X05A 1PO23 3CL1A 4NRPA 4UF0A 4E2QA 2A6YA 2BDRA 3M8LA 4K9SA 4RHV3 4UW6A 3VBFA 2A75A 3PDQA 5FY0A 2WAOA 3APBA 3H42B 3CZUA 3U75A 3U1XA 4COZA 4QX5A 4Q4V1 1QJY3 1HQLA 3HQUA 3KQ4B 5A33B 1BEV2 3LEGA 1HB2A 4K3UA 1PZ7A 3IN9A 1B09A 4BMEA 2WDBA 3IKWA 1RUJ2 1JOBA 4GWNA 1X8EA 3ZKYA 5ABJC 3LFMA 4Y1ZA 5FWJA 1OD5A 4XW3A 5FXWA 4CP0A 2E32A 3USUB 3ZO0B 4AFMA 2ES3A 1Q8OA 2DVAA 3I2HA 3IBMA 1VMHA 4Z82A 3S7IA 1ND2C 4DOUA 4WZCA 5CEHA 5IK7A 5CADA 3N35A 4GB33 3J7NA 4AZZA 2NM1A 4NRQA 3WINE 5FY5A 4OHVA 2Q0AA 1CAVB 2AH2A 1YCIA 4M00A 2QQNA 5FZKA 2WC2A 1WZXA 5L7OC 1C5IA 4RS5B 1JTZX 4NROA 4QPGB 4JDOA 5BXXA 3WQBA 4N9HA 2VMFA 3PJYA 4UFKA 2GDFA 2VECA 1N3QA 4Q4W2 1EP0A 4LBQA 5AC91 1GU3A 4LA2A 1NY72 1QH6A 1RHI2 1VBA2 2WS91
chains in the Genus database with same CATH topology
2MNGA 5DZEA 4Q0VA 3UKTA 2WLPA 2YYOA 3FBMA 4HFSA 1JOJA 4R9BA 4Y24A 4E9KA 1PVC1 1VB4A 2V73A 3JZVA 3H0OA 1VJ2A 1YO8A 4Q4V3 3WOGA 1IKPA 5BYNA 1PM7A 3ZN5A 4BOWA 1GZWA 5AVAA 4I30A 3ZPYA 4AFCA 3KT7A 4HKOA 4COYA 2V5YA 4JRLA 1DZQA 3RYPA 5LEKA 5KHIA 1QJU3 1ZX5A 1ZVFA 1Q8PA 5JZGB 3LZZA 3BU7A 4Y26A 3DKWA 2IXLA 2P34A 4XYXA 4JRAA 2WKKA 4Q4X1 3AZYA 2HYKA 2ZGNA 2XLFA 4HSLA 3GNEA 2UURA 4BLJA 3CJIA 4IV3A 2OUJA 2UYAA 3ENRA 2D93A 1BJQA 4ISRA 4PLNA 5FPZA 3MIEA 1LOBA 2A71A 3VZKA 2EAKA 4YM3A 3KT1A 1POV1 4GKYA 4IEOA 1WLDA 4YG3A 1N3OA 2DWRA 4HK8A 5CAZA 1TE1B 2Q5TA 1KQRA 5B2GB 2AR6A 1NZCA 2BVVA 4A7KA 2P3JA 4GH4B 5HBAA 1CAUA 3A0NA 4META 4JGYC 1QGLA 4AI3A 2A3YA 3VDDC 4DY5A 3N7KA 2RJKA 3WG4A 1NCRA 5ACA3 1RB8G 3U10A 1PVC2 5T55A 5CFCC 3AP6A 2D3SA 2RS12 3PVOA 4XFGA 1RITA 1H9WA 1UAIA 3GF6A 1N1SA 2FMYA 4J1XA 1RUC1 4GB32 2DUOA 3ZXKA 5BNPC 4EN0A 4IESA 2XPJA 4NPRA 1ZRCA 5C8WA 3WDVA 2D98A 2FBEA 4LO6B 2JDZA 1APNA 2H0VA 3V0BB 3O0WA 1LKNA 3WHUA 1A78A 2X29A 1N1VA 3ILNA 3CNAA 3WDTA 2F4PA 2HWD1 3KB5A 2RR12 4FCAA 3R4DB 3SH5A 2XKOA 2XVLA 1OLRA 4Q4V2 1DDLA 4YW1A 1QY4A 5A3LA 1I5ZA 1WW7A 3JD73 2Q8OA 4ATFA 4AI8A 5LEJA 2RS52 1O4TA 1SCRA 2WQ4A 4WZFA 2HWC2 4MZUA 4N7IA 1RGSA 1RHI1 2A5ZA 2IWGB 1MACA 1CAWB 1O3TA 4S2HA 3ES4A 5E1RA 2OVUA 4HBNA 5C8CC 2JE9A 3VBHC 3B01A 1ENXA 3D4KA 4XTPA 1Q8SA 3RWNA 5D8AA 5KHKA 1EPWA 1BVP1 4CDXA 1H30A 1T6GC 3LA7A 1S0CA 5J37A 2JD4A 2WWSA 4XF1A 2CNAA 1V70A 1VBD3 3JQXA 1RL3A 2BQPA 2RM22 3IMNA 4R52A 4AVTA 4YVWC 5K8SA 4I0WB 2ZGSA 4Q29A 1HRI1 1RUG3 1DQ0A 2AGSA 3U4XA 3TYJA 4RD7A 3MFAA 1H8VA 4H3WA 1ZBA3 3U11A 4AQSA 4OFGA 5BNNB 2Z42A 3AMPA 1AYM3 1XYPA 4SBVA 4OHYA 2Z2SB 1V9U1 1KXGA 1FPN1 4HT1T 4RHV2 3R6SA 2CGOA 4L8QA 3WP4A 2TBVA 2VU9A 5L19A 1GV9A 4JGZB 1NQJA 2G9FA 2H6CA 4HPKA 1UU4A 4M3CE 1JH5A 2ZBJA 3OYWB 3VBHA 3WLUA 1FMD2 2UYBA 1WD4A 3OBRA 3JQWA 2XJQA 4XJ9A 3MIBA 2EIGA 2E53A 3LA3A 1SFYA 4XJ8A 3ES1A 4Z2WA 3R4UA 3GBGA 3FE5A 1W2UA 3MW2A 4YFWA 2EF6A 2YUEA 4AFDA 4L97A 1LCLA 2DVBA 2LTNA 5FBZA 1S0BA 1XNKA 1SLCA 4BYYA 4JCKA 3SISA 1IPJA 2C9AA 4AVAA 3IIAA 4D69A 4Q4X2 2GH2A 1WCKA 3QLQA 5JZGC 3VBOC 1OA3A 1WMEA 5I0UA 1UIKA 3MW4A 3OCPA 4YYOA 4XJUA 1RIRA 3UKNA 5D8AC 1RUC3 1UCXA 1ZBA2 4M3CB 5LRRA 4KQ7A 2R043 4FPOB 1VP6A 1IOAA 5DUWA 1H2MA 1AR72 1KD7A 2BWCA 1XU1A 3AMNA 2WT2A 1GYKA 5K0UC 1RVF2 2DTYA 1NCQA 1R1ZA 4INDA 1CONA 3IPVB 3USUA 4DRRA 1HV1A 3O14A 4MLOA 2PHXA 3GBWA 3S0MA 5JLVA 4K8FA 4AI0A 4YZ1A 2KM2A 4XEZA 3UV9A 2RS51 4CEWB 1DBNA 1KJLA 1RUH1 4YW2A 4AVVA 4LBOA 4QGLA 1RUH3 1RMU2 1RUD1 4YRDA 3ZFGC 4PQ9A 3AKRA 3ZYIB 3VZMA 4GB31 2CAVA 5GLVA 1AX2A 3MIDA 1ULGA 4M3CF 4BLIA 1EAH1 4FPHA 1LOCA 4FO9A 1AL0G 4JTNA 1UKGA 2W08A 4UXAA 2DCJA 4AEKA 2ZGPA 3VBRB 3OGGA 1XXNA 4XFIA 3WW4A 3BTAA 1UD1A 3BCWA 1D0HA 1ONAA 1AL22 4X8NA 5FREA 1S0FA 4N9IA 1QWRA 4LE4A 4ES9A 1BBT2 3KS7A 4IL7A 5T5PA 1PK6B 5CFDB 2ZKNA 2OW4A 3RQ0A 3ZXGA 3WD5A 1V9U2 2Z5WA 2XBO2 1VBD1 4Z8BA 1RVF1 4OLLA 4FTBA 5FPXA 2HKXA 4TWTA 5A32A 3KD4A 3FLTA 1NXMA 2PLV2 5DUXA 2K0GA 2VW1A 4WM8B 3VBSC 2EAAA 1AJOA 1J59A 4LBKA 1X36A 2E51A 1PNFA 3ZFGA 2HWF2 3C2UA 2X5IB 4AQ6A 2B45X 1VLNA 4OI0A 3ATGA 4ONUA 3JCIA 1DG6A 1HXS3 3WW1A 1ZM1A 2QNKA 4YARA 3RS6A 2WIIB 5JMCA 2GC0A 1PO21 2ARXA 5GKAC 2XHKA 4FVVA 2AREA 3M70A 4CDUC 3HR9A 3OPZA 2BWAA 1MS8A 1H2NA 1TMF1 4LUKA 4OHWA 1REDA 4FPKA 1SLIA 2JG8C 2ZABA 2RR13 3OY8B 2A7AA 3ZMOA 4BE3A 2W68A 2MHFA 3J9SA 3KM5A 3LOIA 2RMU2 1A6CA 4C1XA 1DYPA 1DFQA 3IPVA 3IT8A 3NW4A 2NQYA 3MIHA 5CA6A 2VW2A 4XPVA 4F83A 3WXPA 4TLFA 3FC0A 5EV7A 1PGW2 3M3CA 1YI9A 4JGYB 1B35A 1AR71 2XBO3 4XDQA 4KBBA 1CAXA 4ASMB 2ZMNA 2HWD3 2RJLA 1PZ8A 1CAWA 1UN1A 3DPRA 1AHSA 4FOWA 5E16A 5LRSA 2H6BA 1HQWA 2K2SA 1W6QA 5A33A 5J36A 3DGTA 5I0RA 2BEOA 4XFFA 2VMHA 3N3HA 4OI1A 1UKRA 1NA1A 2BFUL 2ZKLA 3HT1A 3LAGA 3SMHA 1CJPA 4BIOA 4YGCA 3VBUB 5J98B 1RUF1 1YNAA 5E89A 1FPN3 4IEXA 5FRAA 4H55A 2GMEA 2XJUA 4DINB 3D5OA 3ZXAC 5L36A 1AXYA 3WG1A 3ALQA 4CDUB 1G6NA 4LHLA 4W65A 1ND2A 1G9FA 1CD3G 1JYCA 4M01A 3U07A 4OVEA 2D6KA 3ZFFA 4D7SA 1BMV1 3SCGA 3INAA 4NR1A 4DXZA 2DCKA 2XH6A 4QQLA 5HI0A 4YGBA 1B35C 1LEMA 3N7MA 3HD8B 1C8NA 2RMU3 4QGNA 4XF4A 4C0HA 1ULCA 1HRV3 1QNYA 3FFZA 1CR7A 4LO7A 5DG1A 1AL21 1BYHA 1H2LA 3H8UA 2BW8A 4HKLA 5JOYA 4FOYA 1LOGA 2TNFA 3NAPC 3VBUA 2CTVA 5JSOA 5K0UB 3IDCB 1YIPA 1MQTA 2A6VA 4YFZA 1XRUA 3D0JA 4JTOA 5KHHA 1QJX3 1FATA 1W6MB 1W6PB 4RGGA 5GZFA 3FX3A 5K9YA 2GC2A 3GZAA 4V1PA 3S30A 4DPNA 1MS5A 3ELNA 5IK8A 1IS4A 2Y38A 4QM9A 2NP0A 1QHDA 4FPGA 5ACA1 3BOWA 1XYOA 4XF9A 3ZMNA 2GNMA 3V65A 1GFF2 5E88A 2VG9A 3H3ZA 4SLIA 1C1LA 3ZXDA 1XE8A 2DURA 2ET7A 3WCSA 1S55A 3MF9A 1QOOA 2BVBA 1PK6A 1DQ6A 1S0DA 5CFDA 1BMV2 1FYUA 5DZGA 1GBGA 1R091 4N53B 4XQ4A 3RMYA 1EPZA 2P3IA 2K9ZA 2WZR1 4XMAA 3UK9A 1QOTA 1HDKA 1ALYA 3VHOA 4RL7A 4FPCA 4IEWA 4L9BA 3EJKA 4GQ7A 5I0TA 4XFAA 4QPGC 4L92A 2ZGOA 1O5UA 2XKPA 4N7UA 3WV6A 4N43B 2ZGQA 1MS4A 2CGNA 4FTEA 4MXWA 3RI8A 2WLQA 3AP9A 1C1FA 1DQ2A 3ZFFB 2P3KA 1HLCA 3NSTA 4IQPA 3KCCA 4Y22B 4N53A 4B4QA 5JPNB 4I0BA 1AR61 3SH3A 3VHRA 4MX3A 1AYM2 1O4ZA 5T52A 1POV3 4PCRA 3IM0A 1BK1A 2RR11 4YM1A 4XQWA 1MQTC 4RGAA 4WBBA 4M0NA 4KGQA 5KXBA 1GNHA 4KGGA 3AZVA 3EXUA 4Q27A 4XHXA 4DB5A 3CU7A 1ZZ8A 2ZHKA 4XMIA 4XTMA 4AWDA 5FOBB 5JOZA 1TQ5A 2D7FA 3GHMA 3MPPG 4IXLA 4AI1A 2IXHA 4O9EA 4IV1A 1RUG1 1SBDA 1XNCA 1S0EA 2CAUA 1PGW1 4QPGA 4CEYA 3FBYA 2IFRA 4H7LA 2PAEA 5I93A 4OZXA 1G9BA 4TYSA 1W0PA 2CV6A 4EN9B 1Z7S1 2G4IA 1U5YA 2UU8A 1X82A 3FHIB 3WNXA 2VUAA 1WW4A 2R061 3NJZA 4W6WA 4EV0A 4NOTA 2B39A 4I0AA 4HN1A 2YGMA 4Z92B 3GZUC 2ZPXA 4XQDA 5BY5A 2D40A 3VDDA 1AYN2 4WM7A 1WMFA 2VNGA 5KWRA 1FAYA 4G9SB 4IEUA 1MVEA 1HXS1 5KC6A 3TN93 1G9DA 2E6VA 1JW6A 1R081 2XJSA 1SQ4A 4CDWB 3D6EA 1S0GA 4Q4W1 4LBQD 2ZJCA 1S2KA 2JE7A 2Q4SA 3ZN6B 4D7TA 3RMXA 1MR5A 3FLRA 3M3EA 2R1DA 2JXAA 1N3PA 3I59A 2DV9A 4EN8B 2HWB2 1BEV3 4N43C 3H7JA 1O3SA 2Y0IA 1RTVA 2W39A 3ZFFC 3FWEA 4WM8A 3RNSA 2NLRA 1A3KA 1WLWA 3J26N 3MLKA 1D2SA 2C0ZA 3B9IA 4LR4A 4CEYC 5BNPA 2OIIA 1QXRA 3E97A 1C3HA 1M4WA 2WNUC 3M3QA 1DQ5A 3DN7A 2XG3A 2XJTA 3TOJA 2ZTNA 4RQPB 5F6LB 1VR3A 2DCTA 5JSPA 4XFBA 3VBOA 5BV6A 1IQAA 1N1YA 1OPMA 3JU9A 3DPRB 1LENA 2ZCWA 3J8F1 3ZYRA 1PIV2 1IZ3A 4E2GA 3VKMA 1ND3A 1PHMA 1FOD2 1WMDA 4C91A 4XJZA 1AF9A 4CDXB 4JDMA 4PJYA 1UF2C 5JSRA 1ZRDA 2JJ6A 2WS92 3EQEA 4F3JA 1IPKA 3AYAA 2G9GA 3NVCA 4QPIB 4BA6A 1X50A 2WA3A 1AR83 4C90A 1TMF3 4OI4A 4AYUA 2HJIA 4KG8A 1ZNPA 1VBE3 3J4UH 4PLOA 1SACA 3RJRA 1VRH2 2VULA 5AFEA 4YNIA 4YM2A 1F31A 4TSVA 3W59A 1CAVA 4LO4B 2A3XA 1XE7A 5DG2A 5BNOB 1R1A2 3AB0A 3PMSA 3PMEA 1V00A 4ZU5A 4GIQA 1VBC2 2WNVA 4CDQC 1BKZA 1CPMA 1W6QB 3AP7A 5A32B 1S0JA 2D6MA 2GNBA 4PIZA 4LHKA 4FQZA 4FAGA 5KC5A 1OQEA 4X8PA 1IKQA 1LOFC 1WW5A 5DUUA 1DYKA 2GNTA 1C8M1 3ST7A 2R0FA 5T5JA 3G7DA 3GZTB 2I2SA 3I4IA 1G9AA 4HN0A 3H9AA 1MS1A 1QMJA 3AMQA 4LE3A 4AF9A 2Y0OA 5GALA 2O0OA 4OHXA 5DZFA 1ZZCA 4R9CA 4KWLA 1JUHA 4MUVA 4N43A 2ZGRA 3VKNA 1ND2B 3H3UA 3MGUA 1PIV3 3WDXA 1Z78A 2ATFA 1PIV1 1QJZA 2YMZA 4BWOA 2WFF1 1OOPA 3CJXA 4YM0A 1GLHA 2A70A 3HMYA 3JBG3 4JGZC 3M1HA 5FQ0B 2QZ2A 1AYM1 1G86A 2NYYA 5JI9A 5I8SA 2W0XA 4W6XA 5JVVA 1ZZ6A 1AX0A 1L3JA 4GH4C 4AVCA 4AVBA 5BNPB 3MZHA 2DU1A 5JAXA 5K0UA 5F9TA 1G9CA 4CTEA 1ULEA 1ZREA 2XVKA 5EXOA 1O4YA 1REEA 1BXHA 1Z7S2 4YVSA 3ZXJA 4IV1B 5IUQA 1U5IA 4K1ZA 1YJLA 5CFCB 5BNQA 3L2HA 1DGRN 4S2DA 1Q3EA 1VBC1 1LR5A 4LA3A 1LHNA 4Y22A 3VBSB 2BFUS 2EXHA 2RS32 1WBFA 2WA4A 4YW3A 4L2NA 3T1LA 4R4ZA 3VGIA 2YY1A 4BPZA 5A3MA 1LGCA 2AUYA 3RYKA 1R082 3VBFC 3VLBB 4QPYA 1FI2A 5IK4A 3SNMA 3OGJA 1AUYA 3BIWE 4YZ2A 1MZ6A 1XQNA 1FOD3 4ORFA 4Q8LA 1U0AA 3WDWA 1KRIA 2I45A 3POSA 3NL1A 4IERA 5JPMB 2RS13 4R8HA 4Q0SA 4BM8A 2GALA 1U5XA 1PGL1 2WZPP 1URXA 1VBB3 5JDBA 3NAPA 3VBUC 1SBEA 4N90A 3MF6A 5SV5A 4MYEA 3VHNA 2WT1A 4PF5A 1VALA 2DVFA 3V0BA 3THPA 3O0XA 2HWE1 3URFA 1V6NA 1UPSA 2CWMA 4ZU4A 4IV1C 4FP2A 1A8DA 3AZZA 3OJBA 2VW0A 4F7ZA 3ILRA 2D6NA 5DUVA 3T1MA 1ND3C 3FUQA 3ZX7A 1Y43B 3KT4A 1CAXB 1W6MA 5FAXA 4CZSA 4Q8KA 3RYRA 4PLMA 5C9AC 4Q1RA 4YGDA 5JOXA 2QDRA 1R083 4XF3A 5T50A 1BZWA 2VQAA 1SMVA 1AX1A 1NA1B 1QJY2 3WT3A 1H9PA 2H0BA 4DZGA 4E4DX 3H1WA 1J1LA 2R1BA 4RHV1 3RG0A 2OZ6A 3VDDB 1BBT1 5EWSA 1CX4A 1FNZA 2VUJA 4GWMA 4BMBA 4H14A 2EA7A 2HEYF 2PN5A 1Y3TA 2FHRA 4Q4Y1 1OSGA 4GMP1 1REFA 4NHMA 5EJ3A 3PVBB 3ZYPA 1VBD2 1YUDA 3ZFEC 2IXCA 1Q56A 3DV8A 2XJRA 4P9WA 4EWEA 4ASLA 1VBA1 5E8AA 1J1TA 1NE4A 1WCDJ 4COWA 2CWSA 2VPVA 5JOWA 4HL0A 2HWE2 2DTWA 2YGLA 3OY8A 1CQ9A 4K7JA 4S2FA 1HX6A 1SLBA 3HAGA 1UW8A 5FCCA 1Q8QA 2WL1A 4O9GA 1GNZA 4DQAA 4RA0A 2XGXA 4B7KA 4N53C 1CPNA 5CB7A 2IXIA 4FQ4A 1ASJ3 1U12A 3OTFA 4QXKA 3AXDA 4DMIA 5DDJ1 1EV11 4G4FA 1NY71 4D3WA 4EN7B 3OF1A 1YHFA 2BPA2 4FOVA 1K5MC 1AVBA 4Z07A 1DLLA 2PHFA 3I8TA 2ZX2A 4HMZA 4BCUA 1DGWX 1PO22 1RUJ3 2TUNA 4FPFA 5H9SA 1E57A 1C5HA 4XXPA 4WVMA 5LK7B 4DY3A 1TMF2 3CO2A 1MEC2 2P2KA 2B42B 5HCAA 3DUIA 4J6GA 3ZSKA 5FOJB 3AYDA 2WSUA 1VRH3 1QQP1 3BPZA 1LULA 2OUHA 4MGKE 4ATEA 5C8CB 1H1MA 5CG9A 4AEDB 1H4GA 1Y7BA 4LBNA 4K6BA 2ERFA 2VVEA 4K21A 1ENSA 3WDYA 3PJQA 5FMOS 2A6WA 3RJ2X 4BH9A 2GN3A 4Q0UA 1NCRC 4JC1A 1W6NB 4YW4A 1Q5OA 3HIFA 3MDPA 2CL2A 1HV0A 1J3PA 3RSJA 2BNOA 2OPKA 4B29A 1SLAA 4QHBA 1RUI1 4YVWA 1YFXA 4YW5A 3R05A 3KCXA 1COV1 4AGVA 3AXEA 3FJSA 3LSDA 5T54A 1AR93 5C8CA 4Y20A 3AJZA 2Q1MA 1D4M1 3J8F2 3SCHA 1N1TA 4A7YA 1WA4A 4S2GA 3M3OA 3OYWA 5K7PA 4LLFA 4Q0PA 5CFCA 2FQPA 2E63A 1QH7A 1PO11 1D4M3 1VBC3 2KA3A 3TWIA 4XFCA 1NOVA 4I3PA 3KGZA 3I59B 1KITA 2PQQA 4WVWA 3VHPA 1PK6C 2PTMA 4B4RA 2A6XA 5CFDC 5L7OB 2RM23 4K20A 4GMP0 3OD4A 4UW5A 5FMOL 4Q4X3 2HWD2 3WY6A 1RUG2 4HVRA 5FFOC 3QH7A 4OULA 2C1FA 3TNQA 4HKWA 1WBLA 1VBA3 5FO7B 4YVSB 1XU2A 4DNYA 1A8MA 3WCRA 1W0OA 1V6KA 4AGRA 1MZ5A 2HWF1 3VL9A 4A7ZA 3WQ0A 4AE2A 1RHI3 4CEWC 1WGPA 1DGRA 1SLLA 3TBDA 3AK0A 4NHKA 1X33A 4L11A 3H50A 2ILMA 1OHFA 5L73A 4XBLA 2JKBA 3VBRA 1NXD1 3ZFEB 4P9LA 1TEIA 2QJVA 4E2SA 4NN0A 2YXSA 4QPIA 4L99A 3DPRC 3ASIA 2ZAAA 1EV12 3QH6A 4RR3B 2YROA 4LO8A 2Q1ZB 4EWDA 3VBHB 1Z0HA 3M2MA 2HWF3 3D8CA 5CIRA 2UWAA 4P9IA 1KDMA 3HT2A 3ECQA 4Z1VA 2PLV3 2WSVA 3CJIC 1ULFA 3ETQA 4IV3C 1G7YA 2R49A 4Q26A 3VV1A 1K5MB 2MEV1 2C5DA 2DFCA 2PELA 4RQPC 5GZCA 4FOQA 4E4SA 2VMIA 4EWAA 2JENA 3NV3A 4Y20B 1AR92 5JWPA 2ZGKA 1I6XA 2B9UA 2GH8A 5I0SA 2ZX1A 1NE6A 4FSJA 2OYZA 4FT8A 1IS5A 3IDBB