2GC1A

The crystal structure of phosphoglucose isomerase from pyrococcus furiosus in complex with sorbitol 6-phosphate and zinc
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
188
structure length
188
Chain Sequence
MMYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-6-phosphate isomerase
publication title Evidence Supporting a cis-enediol-based Mechanism for Pyrococcus furiosus Phosphoglucose Isomerase
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase
total genus 39
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature ec 5.3.1.9: Glucose-6-phosphate isomerase.
pdb deposition date 2006-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2gc1A00
1NZCA 1FT9A 2FMYA 4Q0SA 1DZTA 4PIXA 3LWCA 4MX3A 2QCSB 3NW4A 3H8UA 2Y0OA 4HVOA 4HN0A 4Q29A 3TNPB 5LRRA 3KCCA 2QNKA 4IEUA 4KU7A 3WW1A 5JCTA 2EAAA 4I09A 4MUVA 4Q0QA 3BPZA 1O7FA 2HKXA 5FCCA 1O5LA 1O3SA 3R6SA 3H1YA 3DL3A 2FQPA 2N7GA 2Z2SB 5I0UA 4HBNA 3ELNA 2OA2A 4I0AA 3H7JA 5CU1A 5C6CA 3U11A 1DGRA 2MNGA 3NVCA 4IEWA 4YSFA 2PAKA 4D7SA 4N9HA 3PNAA 1RTVA 2D93A 3FWEA 1EY2A 3SCHA 4FBFA 5I8TA 2C0ZA 1ZZ6A 4XF0A 4XETA 2ETEA 4XF4A 5BV6A 3RDIA 4I3PA 1YLLA 1FI2A 2Q30A 4HN1A 3RYPA 1CAXA 4JVAA 1X8MA 2K0GA 4E2SA 5LEJA 1YFWA 4KU8A 4LEJA 2GH2A 2VPVA 2P17A 1ZZ7A 1X8EA 3CLPA 4WBBA 2IXJA 3N4MA 1UCXA 2XLAA 4FAHA 2Q4SA 4AVBA 5C8WA 1VJ2A 5I8SA 1LB2A 3RZZA 4E2QA 4EWDA 4XFGA 5I93A 2VQAA 1RL3A 4J1WA 5I0RA 1H1IA 3ACLA 4IEQA 1O3TA 4YRDA 4HSLA 3LA2A 1FXZA 3WW4A 1I5ZA 3CL1A 3SCFA 4IEOA 3E5XA 3WW3A 4D7TA 2BNOA 4X6QB 5FDBA 1ZNPA 1YFYA 4F8AA 1CAVB 3MDPA 1OFNA 2DCTA 4IETA 5J3UA 4PIZA 4R52A 3DN7A 1CAVA 3D82A 3C3VA 2D5HA 1ZZ8A 4IESA 2O1QA 2CAUA 4CYDA 1UW8A 4FAGA 2XL7A 3H3ZA 4BIFA 1HW5A 2BYVE 4F7ZA 3MYXA 4O9EA 1OMIA 4QX5A 5JSRA 2PAEA 3RPQA 2XKPA 1NE6A 4UBHA 4XFCA 3ETQA 5JSOA 4N9IA 1QY4A 2OYZA 4HMZA 3E6CC 1O3QA 1QXRA 3SMHA 3B02A 1SFNA 4BH9A 4MGKE 4ZU4A 1WLTA 5I91A 1ZRCA 2B5HA 3NJZA 3H1MA 1ZRRA 3EO6A 3I59B 1XE7A 3LAGA 3NSTA 4XFHA 1YUDA 1UPIA 3KGLA 3MPBA 4Q0UA 3HQXA 1ZX5A 2Q0AA 3S7EA 3UKNA 4XFFA 2PYTA 1LKNA 1VR3A 2MHFA 1ZVFA 4E2GA 2MPFA 3I59A 3IWZA 2PQQA 3U0ZA 4IEVA 4XFBA 4EV0A 2BEOA 2PHDA 1J3RA 3U10A 3GBFA 5KBFA 4MGIE 1WA4A 4IEXA 4ONUA 1RUOA 1OD5A 1NYWA 1Q5OA 1IPKA 3KMHA 2WC2A 3HIFA 4HVQA 4QMAA 1X82A 1ZZ9A 4MZUA 4QM8A 4LUMA 5EZWA 1CAWB 4I2OA 3RYKA 1RUNA 3PLQA 4DINB 5KHIA 1DGWA 4LA2A 2ATFA 1CGPA 5I0TA 3BALA 2V09A 1CAWA 1ZREA 4PIYA 2IXIA 1CAXB 4OFGA 5EFUA 2GAUA 3OF1A 2UYAA 3NKTA 4Q0VA 2IXHA 3M3IA 2GC0A 2IXLA 2EVXA 4O9GA 3LOIA 2F4PA 3UKTA 2XKOA 3BCWA 4FT8A 4HVRA 4LA3A 3RYRA 4MH0E 4RD7A 1UD1A 2XLGA 3FZ3A 4UBGA 2GC1A 3OGJA 3NL1A 5E1RA 2CAVA 4NVPA 3HT2A 4XFIA 3ST7A 2ET7A 4XEZA 2XHKA 2IXCA 2D5FA 4I0BA 4HLTA 5KHHA 5KHKA 4META 4GULA 4YARA 2Q1ZB 1UIJA 3JZVA 4Z82A 1ZZCA 1Y9QA 1LR5A 4I01A 1RGSA 4ORFA 4EWAA 1U12A 4JTOA 4HSJA 2PA7A 3I54A 1DZRA 1QXJA 1YFXA 4K8FA 5FPXA 4KWJA 4AXOA 1YFUA 2PHLA 5HI0A 4Z07A 2OZJA 2EA7A 4LTAA 3E5UA 2QDRA 4MGZE 4QM9A 5I0SA 2UY9A 1J3PA 4UXAA 2E9QA 2GC2A 4WVZA 5AVPA 2PFWA 3E6BA 4JTNA 1CAUA 1PM7A 4TLFA 3ES4A 4KWKA 2XLFA 4YYOA 1J58A 3H50A 4AVCA 3FHIB 4IEYA 2BGCA 1GQHA 2QVSB 4WZCA 3SXWA 3H3UA 1I6XA 3EBRA 1V70A 2H6BA 1NE4A 4P9GA 2PTMA 1OI6A 3QOPA 3O14A 4IEPA 4QGMA 4XF3A 2OPKA 1Q3EA 1TQ5A 4L11A 3LA7A 3DKWA 5K8SA 3RNSA 3FFQA 3ROUA 5BXXA 4J1XA 2HJIA 4AQ2A 4LLOA 2I45A 1L3JA 1XE8A 4ZU7A 5FLJA 3D0JA 3EQEA 1O5UA 5BPXA 5T3NA 4QXKA 1ZRDA 4H7LA 1XRUA 1J3QA 1SQ4A 3OTFA 2BNNA 1RC6A 5FQ0B 4YNIA 3BU7A 1NXMA 2CGPA 3EHKA 1J1LA 4AVAA 1VP6A 3D0SA 4OLLA 2QJVA 3E97A 5FQ0A 3IDBB 3IBMA 4R8HA 2KXLA 3FE5A 4MV2A 3FJSA 4LULA 4PJYA 1CX4A 5KHGA 3I7DA 4L2NA 3USSA 1J59A 2H0VA 4Q0PA 2K9ZA 2XL9A 2CV6A 3SCGA 1GQGA 1WGPA 2Z69A 1EP0A 4QGNA 4AQ6A 1YHFA 5F1RA 2IXKA 4HZFA 1EYBA 5J48A 2UY8A 2IC1A 2UYBA 3L2HA 3E6DA 3OCPA 3S0MA 3H9AA 4MGYE 3QACA 1UIKA 5I8YA 5E16A 3CO2A 3H7YA 2WFPA 5BY5A 3ES1A 1Y3TA 3TNQA 2PAMA 3M70A 3E5QA 4QGLA 1IPJA 3SHRA 4KL1A 3S7IA 4XFAA 4A2UA 4BHPA 5JAXA 3OD0A 3FX3A 5FLHA 4LUKA 1O4TA 1PMIA 4IERA 3IIAA 4EWEA 4EROA 3CEWA 3DV8A 5BUVA 2BNMA 3KSCA 2GZWA 5D1IA 1ZRFA 2ZKLA 3PVBB 5CVRA 4XF9A 5JR7B 3IDCB 3EJKA 5LRSA 2GU9A 4XF1A 1G6NA 1YWKA 5KHJA 2ZCWA 3ZDSA 1CAUB 1H1MA 1LRHA 1O3RA 1JUHA 1Q43A 3BB6A 3KGZA 2XGXA 3WW2A 2H6CA 2D40A 3CJXA 2ET1A 3CF6E 3GYDA 2O8QA 3VHRA 2GC3A 1QWRA 4IEZA 3LZZA 1EPZA 4B29A 5JSPA 5FLIA 3G7DA 2B9UA 2OZ6A 4BYYA 5CADA 3H1WA 3HT1A 3UKVA 4I02A 5FPZA 2B8MA 5J7MA 2VECA 4X6RB 1X7NA 1SEFA 4KWLA 4ZU5A 1ZZBA 3MZHA 5LEKA 4JV4A 3LA3A
chains in the Genus database with same CATH superfamily
1V9U3 3AM2A 4BQ1A 5GLUA 3HWJA 2J1EA 2H0BA 4JCKA 2A6XA 4CTEA 2A3YA 4PIXA 2ERFA 1DQ1A 1CR7A 3LWCA 4LOTA 4MX3A 4OHXA 5T5PA 2QCSB 2RM21 4LNVA 1F8VA 4CCDA 1OLME 2A3WA 1RMU1 1WCKA 4Q26A 3VDDB 4TXWA 2W1SA 3VL8A 3Q8BA 4XXAA 4HN0A 3ZSEA 1K12A 4AQSA 2ZX0A 3TNPB 2VY0A 3NQHA 4LXLA 3TEZA 1AYM1 1Y4WA 1SLCA 1JI6A 2EXKA 1UKRA 4V1PA 3KLSA 4KU7A 4QQPA 1XSRA 3AZYA 4HG6B 2R073 4N53C 4XQDA 1W0OA 5LATA 4DY5A 5DQ0A 1AYM2 3D5OA 1PVXA 2VMFA 2ARBA 4AVTA 2X10A 3GBWA 3R6SA 5H9RA 1NKGA 4Q4X3 5FYTA 3T2PA 4IXLA 5JXIA 1H8TC 2QE3A 2Z2SB 5I0UA 4BQXA 4CCOA 4MYEA 2YGLA 1MZ5A 3D3AA 4Y22A 4ZKTB 4MLOA 4MHUA 4XILA 1K5MC 3USUA 3SEEA 4AFCA 4NIHA 2J1TA 3FBYA 3VBOA 5F5CA 2QQIA 2PAKA 4D7SA 3VKOA 2D93A 5HCAA 3BYWA 4PLMA 3WDXA 3MI8A 1GZWA 3VGIA 4QPGB 4M0HA 5D8AA 2GNTA 4XF0A 4DEVA 1W6MA 2ETEA 2GNBA 5EQUA 2WR9A 1JW6A 1QH7A 5BNNB 4LR4A 4A7ZA 1RUG3 2F6BA 1FI2A 1US2A 2SBAA 5FK7A 4IV1C 4HN1A 4QPWA 4AEDC 5F3GA 3ZYPA 4BWOA 4KNCA 2K0GA 3K3NA 3IT8A 4D3WA 3Q8FA 4E2SA 1AF9A 4LEJA 4QDQA 2GH2A 2VPVA 4UFHA 3VBFC 3WNXA 1OOPB 1X8EA 1MVQA 5FO7B 1DHKB 2OPWA 2PELA 4WBBA 2ZHMA 3N4MA 1UCXA 2XLAA 5FYUA 4FAHA 5C8WA 1US3A 4CDUB 4CUGA 4GH4C 5F6KA 2GMEA 3RZZA 2OVUA 2WNUC 2WS91 4DXSA 2VZUA 4Y20A 3AYAA 5F9TA 3CBNA 3VKFC 1WKYA 4SLIA 4YM3A 1H1IA 3LIHA 3ACLA 5F3CA 3A23A 1XXNA 4D94A 1O3TA 1EUTA 2PMWB 1WW6A 3HD8B 2GMPA 4AWDA 2B4KA 3INAA 1B35C 4AW7A 5FZ3A 3WQBA 4X8NA 2JWPA 4DFSA 4CVUA 3W5MA 1GYKA 1A8DA 4A7YA 2HEWF 3V0AB 2C1FA 4PDWC 4YVSC 3WW3A 3KD4A 4X6QB 4LIUA 2BP6A 1ZNPA 1YFYA 5HXVA 5K0UA 5FDBA 4NIDA 4QQ2A 1RUJ3 4GWMA 3MDPA 3MIEA 1IG3A 2MEV3 2VBPA 3NO8A 3LGRA 2BDRA 1OVPA 4IETA 4HANA 5T5LA 5E6HA 1UOBA 4PIZA 3JD73 4R52A 4XJZA 3WNOA 3D82A 3ZX7A 2LRPA 4OHWA 3MO4A 3OGSA 3VDBA 1ODNA 4IESA 2VXRA 1SPPB 4XIKA 1BBT3 2Y6FA 4RR3C 3ACFA 5FIXA 2YPDA 2XVGA 1T2XA 3C2UA 3POIA 4BIFA 1HW5A 2G19A 2DV9A 2GH8A 1W6OB 5LEJA 1CIWA 3MFCA 1OQ1A 5FUIA 1RUE1 4BXSV 2LM3A 5J1XA 5JSRA 4GZ9A 2YYOA 3RG0A 3TEWA 3J8F1 4IE6A 1UMZA 1NE6A 4UBHA 4XFCA 1KXGA 4KG8A 1QY4A 1RUE2 2BVVA 4N9IA 4NWVA 3KHBA 2OYZA 5ABJC 2ZKNA 4HMZA 4QU2A 3A0KA 1OH4A 2EIDA 3J8F2 1O3QA 2HWF3 3FL7A 2C6SA 3FN9A 2QTWB 4N43C 1JOJA 5GLZA 1SFNA 2D3SA 1WLTA 4P08A 4HPKA 1ZRCA 3H0OA 2JG9C 5JDBA 1F2NA 1GU3A 1XE7A 2OQ6A 4XFHA 3BN6A 3RGBA 2EXIA 3LF7A 3AVSA 4S2DA 2TUNA 2YFUA 4Q0UA 4CDQA 1VPHA 2Q0AA 3S7EA 2PYTA 4CU9A 4JGZA 1K3IA 2BBAA 1YQCA 2ORZA 3FHQA 4W6YA 4YG3A 2PQQA 3W21A 3SKJE 3K48A 1DGWX 1V00A 3M3OA 4D6SA 1E5HA 1N3PA 4UT5A 5D21A 4L92A 5LZ6A 4XFBA 2WA3A 2BRTA 3KHCA 2HWE1 4N90A 2ZACA 4BJ0A 1U5IA 1J3RA 3J7NA 5ISLA 3GBFA 2VTFA 1WA4A 5CKNA 2J1VA 4YZ1A 1NZIA 3ZPYA 4ZHNA 1ZBE1 2RS13 2WO7A 2HWE2 4XJ9A 3WNLA 1Q5OA 2DCKA 1IPKA 3ZR5A 4QD2A 3JBG1 3AMQA 2NYYA 2B9VA 3HIFA 4ZPIA 4BQ2A 3I2OA 2ZGQA 2ZEZA 1GZWB 3FHAA 4Q4W3 5FBJA 2HWD1 4EN7B 1VB2A 1QEXA 3LEGA 4MZUA 3JBG2 4IE7A 5EZWA 4BXFA 2XPJA 2XJUA 2YUEA 4HKLA 2ILMA 3ZXDA 2DBNA 2X09A 1ASJ1 3LB9A 1AR71 2CWMA 2B45X 3GZAA 5I0TA 3RVHA 2D7FA 2V09A 1CAWA 1SDDB 2DVGA 2IXIA 2HWB2 1ASJ2 4UWDA 5DPNA 3VD9A 1VAKA 2AZ5A 2GAUA 4XC9A 5A80A 3CKHA 1JZ8A 5FZCA 4CCNA 2JG8C 1F9KA 1NLQA 2XUMA 1IOAA 1RUH1 2W52A 4CEWB 1TEIA 4O9GA 5BNQA 2HWC1 1VLNA 2W08A 3HR9A 4BK4A 3UKTA 4BMBA 5A70A 3BCWA 1OF3A 4YGEA 1LHOA 3HNBM 3URFA 4A45A 3LDKA 3VZLA 4E8DA 3BTZA 4ZXKA 2XWJB 1HB2A 5H9SA 2JE9A 4FOVA 5FZMA 5CBLA 1RVF3 2XLGA 1NQJA 2Y60A 1PNFA 3AYCA 3IAPA 4M4PA 4CCLA 1NCRB 2QQUA 2UU8A 3I3QA 4XAAA 4B8EA 4JDMA 5C4WA 1WCSA 3P1IA 1K45A 3ST7A 1MS3A 5LY2A 1OUSA 4XEZA 3LEKA 1QGLA 1MS4A 1RUI3 2D5FA 1XU1A 1JXNA 5DZGA 1OD3A 5K0UB 1VBB3 1WW7A 4XJWA 4ZZ8A 4PCRA 1DQ5A 2DVFA 4JGYB 1HLCA 2IVIB 2OIIA 4A3XA 3AMPA 1F15A 3JB8A 2DFBA 3PJQA 2BOJA 2VZTA 1DQ2A 1G9CA 3AYEA 1C1LA 1RYYA 4PQ9A 3OPZA 1URXA 2VOWA 3ILRA 3OPTA 2WT0A 1RUD3 4MGTA 1LGNA 3AL6A 3PHMA 3BI3A 1HN0A 4Z92B 2VNGA 1LODA 5EWSA 2DDUA 4COZA 1OLQA 3I54A 4H14A 5IVJA 1QXPA 1QXJA 1TME1 2A1XA 3WNPA 3O0XA 2J1RA 3CQOA 4RL7A 5DDJ3 5KXCA 5FPXA 4NIIA 1YFUA 2OZJA 4AE2A 5CIRA 4LK6A 1TME2 4GALA 4BB3A 2ZGSA 1DFQA 2YROA 2WNVA 5J36A 1WMEA 5IK8A 1ZBA3 1WA6X 2GC2A 1AR61 1CESA 2D97A 2QQJA 3UGHA 4Y24A 2OUJA 1FX5A 2PFWA 2X5IA 2ZGPA 4YFZA 2BWAA 3QBQA 4FP2A 2Y33A 2R0FA 2E6VA 4JTNA 2LW8A 1S2KA 2VUJA 3JB4C 4W6XA 2BGPA 1PMJX 4CXWA 4QHZA 1VALA 2JDAA 5CFDC 2D43A 2VW2A 3UJOA 3AKPA 1NXD1 2VMDA 5C8CC 5T50A 2VCCA 2AC1A 2WJSA 4YM2A 2BGCA 2V72A 3MLLA 4JGZB 1PK6C 4RN5A 5FBZA 4AEKA 4EN9B 3EBRA 4GMP3 4ZS3A 1NAEA 4FQ4A 3MGUA 1RUF1 3OBTA 1Q8OA 4OUEA 4QGMA 3WX5A 3LCPA 4L11A 3FLRA 1VBA1 2ZHNA 1UZ0A 4DB5A 4LHLA 1QJX1 2QZ2A 5IVCA 1R1ZA 2XB6C 5BXXA 3AYDA 4LE4A 2D44A 3RWNA 5DUUA 4AQ2A 1LHUA 2X29A 1YRZA 3HJRA 2JDPA 4MGSA 2I45A 1VBA2 1L3JA 5IW0A 4AI0A 3QH6A 1V9U1 1XE8A 1T6BX 3D0JA 3EQEA 2VNRA 5T3NA 1ZRDA 5LB6A 2ARAA 3AJZA 4D69A 1COV3 3KB5A 2A7AA 4GB32 2Y0IA 3BOWA 2Y6KA 4QHOA 4XBLA 5F2SA 4C8DA 2BNNA 5FQ0B 4YNIA 5J98B 1V9U2 3NV2A 2YU2A 1S0EA 3WOGA 4Z1VA 1NXMA 4IV3C 1FPN2 1VP6A 5KXDA 1QJU2 4Y33A 4BZ4A 4U2AA 1AX2A 2WFF2 3AJYA 3IDBB 3OJBA 4RS5C 1WLCA 5BNPB 3VBRA 1PGW1 4LO4B 4XAEA 5K7PA 2RMU3 5FZOB 4PLNA 5KHGA 4DUXA 4L2NA 3USSA 2ZGNA 3POBA 1S0BA 2K9ZA 4AL9A 5HCBA 1POV3 1GQGA 2R071 3DXTA 5FYYA 1UO9A 1W2UA 4ASLA 3VD3A 1CX1A 2Z69A 5FZ4A 4HK8A 2K2SA 3ACIA 5AFBA 2VZOA 4FPEA 1HXS2 2HEVF 4Q4X1 3B93A 2R072 3MIBA 2BOIA 3DKQA 5HBAA 3AB0A 3NNMA 1SMVA 1H2MA 2RV9A 3T4HB 1R083 2DBIA 2UY8A 4EN0A 1AR93 2D6LX 2JDKA 3GGLA 3FLPA 3WF3A 1PGSA 3G6JB 3HN1A 3KT4A 4Q4Y2 1QF3A 3E6DA 3CZUA 4BM8A 2DFCA 2QQPA 4FFIA 1VB4A 2XOMA 3CDZB 5ANQA 4AFMA 5I8YA 3DECA 3C7GA 1D4M2 1GP5A 2WFPA 3H7YA 2Q5TA 3M1HA 5BY5A 1XJAA 2EIBA 4CEYC 4CDWB 5C71A 2J1UA 5EPAA 4QHBA 5L7OA 3VD7A 2VZSA 3VBUC 1IS6A 3AP4A 2PAMA 2ZBJA 4P00B 1DYPA 5JOXA 2E63A 3K51A 4YGDA 5A7SA 1Z7S2 2R49A 3AP5A 1RUG1 2NMOA 4Y5Z0 5GALA 1W0PA 3S7IA 2ZJCA 1UL9A 3LDRA 1Y9MA 3V64A 4JDOA 5LBBA 1PIV2 2PHWA 3DXUA 1RUG2 1YQ2A 1VBD3 1BKZA 5DABA 3O1VA 3MEPA 1PMIA 3OOXA 3Q8EA 3MICA 2YC2A 1F31A 4IERA 1SDWA 3IIAA 5EJ1B 4EWEA 4JRAA 5L9VA 5FY1A 4ET7A 5JWPA 1VMJA 2D98A 1G8WA 2RDSA 2JENA 2VVDA 1C5HA 1AL23 3NV3A 5D1IA 3ZVXA 1POV0 2BWCA 3IMNA 5LASA 3U1XA 4IL7A 3ME2A 3PMEA 5FP4A 3D4KA 4XF9A 1NLRA 5JR7B 1E5SA 1WBLA 3A22A 3KF5A 5LBFA 1TE1B 2GU9A 2LTNA 2X5IB 4H2AA 2R32A 3ZXFA 4AEJA 3LEMA 1AYN3 2W1UA 1GZ9A 4TSVA 2BGOA 4EYUA 2JDZA 2GMMA 2XR4A 1ZRIA 2WSUA 5HCHA 4M0NA 4XCAA 1ND3C 3WW2A 5FWJA 3BPSA 1SG3A 2WLPA 3ZFEB 1LTEA 1RJ8A 1RUJ1 2WBKA 3ON7A 4Y1ZA 2MEV1 3GJBA 1G7YA 4DZGA 2VMIA 1V6LA 2O8QA 4AI9A 3WF1A 5CISA 2FDGA 1C8M3 1AX0A 1ULEA 3AXEA 1S1AA 3JD71 1RUJ2 5E8AA 1QWRA 2VZ3A 2D6KA 2MEV2 4AR2A 3LZZA 1YIPA 3KV5A 3BGAA 3K4ZA 1BBT1 3JD72 3POEA 2B9UA 3RWKX 2OZ6A 3ZFFB 1H2KA 5ACA3 4OI2A 1OPOA 1YQ8A 3DPRC 5FPZA 5J7MA 1STMA 2VH9A 4FPLA 2PN5A 4K6BA 3WQ7A 2FDIA 1LEDA 2VECA 4XBQA 1QIQA 1X7NA 2XJTA 1J83A 3B69A 4KWLA 2EIEA 2XDVA 1W8HA 3KV9A 3ZFGA 4JV4A 4C0HA 4E4ZA 4CU6A 5A6YA 5C3RA 1NZCA 4YFWA 3SEPA 1O91A 3DYOA 4U36A 4AAXA 2FDFA 4Q0SA 3O12A 1DYKA 2E31A 2HWF1 2XJSA 4QX7A 5IYYA 3N9OA 3PTYA 1MS1A 4HVOA 4GKYA 1HN1A 2CY6A 4QPIC 4QT6A 4YZ2A 1IS4A 5EYYA 2ZXQA 3VBRB 2AUYA 4Q1PA 3AFKA 2WZEA 3R4DB 3KCCA 2Y34A 3WW1A 3VDDA 1GMMA 1OXCA 1TNRA 5IWFA 3J9SA 4I09A 2P34A 4MVTA 1OQDA 1C4RA 2ZEYA 3BPZA 2VCMA 1ENXA 1HV1A 4IW3A 4QDRA 2JDMA 4GD4A 2ZGMA 3MV11 3DL3A 4GWIA 1RUH3 2FQPA 5GZFA 1S2BA 1UXZA 4XVHA 4Q27A 1SLIA 2YZ4A 2HWC3 1ND2C 1UAIA 3NV4A 5EJ3A 4I0AA 5FY9A 5CU1A 1KJLA 2ZAHA 5FYZA 2V4VA 1KJRA 2MNGA 5FXZA 3K77A 1OBNA 2RS11 4FQZA 3ZLIA 2KM2A 5F2WA 3ZXJA 1UZYA 4QX3A 1RTVA 2ZEXA 4KWUA 3GZTB 2VCAA 2ZABA 2ZHKA 2JEMA 2RS12 2XBO3 3M4FA 4Q4W1 3SCHA 2PHFA 5L7OB 1ZA4A 2OT7A 5JPNB 2WUHA 5I8TA 2YBKA 1H6YA 1JYWA 1SZBA 2XJPA 4O65A 4XETA 2V73A 1CPNA 4XF4A 2R6QA 3RDIA 1S0JA 1WMFA 5A7WB 4ASMB 4I3PA 5IAXA 4DEQA 1JYIA 1UU5A 3RZMA 4FP3A 4QPGA 4XE9A 3NNFA 1XE0A 1TNFA 5A6XA 2XUEA 1XPWA 1VIWB 1X8MA 1MEC2 3JQWA 4JVAA 3PL0A 3O1RA 1DP0A 5FP9A 4FI9A 1CJPA 3WG4A 3MUY1 3PUHA 3M2MA 2JDHA 3CLPA 2WZR3 4UFKA 5M0TA 1UY1A 3F2ZA 4NRMA 4AVBA 2WABA 1AXZA 1VBC2 1MR5A 2WWSA 2ORXA 4E2QA 3N7LA 4GXLA 1OOPA 1CPMA 4N53B 3KQRA 1RVF1 3PURA 1RL3A 1IPSA 1TVGA 4YGBA 3WF4A 1LHVA 5I0RA 4CU8A 4IEQA 3H3LA 4K1ZA 4R4ZA 5CZKA 3WNNA 4KMQA 4HSLA 5FUPA 1H8TB 2BTVC 2VUCA 3KV6A 4MG2A 3HOBA 1FXZA 1UPSA 2CYFA 4IUGA 1RUI1 1I5ZA 3CL1A 1BMV1 3ZKYA 2RE9A 1JBCA 1UZZA 4FFGA 1UMIA 2CWSA 3AL5A 4NE9A 4D7TA 1BVP1 3BUCA 2WLQA 2Y8KA 4F8AA 4AHYA 1RUI2 2NLRA 1XYOA 2ZGOA 4XZUG 4P9XA 4YZ3A 1VBB2 5J3UA 3T30A 3T4VA 1GSLA 1OKQA 1RUD1 5EXOA 2JIJA 1NUKA 3IZOA 5FZFA 2D5HA 5FK8A 3ZYHA 1ZZ8A 3MW2A 3U78A 4E9KA 3WZ1A 2ZMLA 4JZRA 4AEDB 2C9KA 2W1QA 3I3EA 1RUD2 1J1TA 2JXAA 4IV1B 2TBVA 4FAGA 2R043 1W6PB 1RUF3 3MYXA 3VBSC 1UYYA 1FNZA 4O9EA 1PO23 3AMNA 5DDJ1 3IB3A 1OMIA 2RG4A 5DAQA 5IATA 2R1BA 1Z0HA 2XKPA 3VBFB 3ZFGB 1UX7A 5CFCC 1YJLA 3POYA 4BLIA 1NA1C 5JSOA 5JZGC 3ETQA 1W6OA 1R1A2 1H1AA 1JYXA 5FPBA 1YXWA 4FPHA 4DUWA 3KF3A 1ZBA1 5IFPA 1GOFA 2WNUB 4WM8A 5A3OA 3S6PA 1UY3A 3WG2A 3VHNA 1G9AA 4YZ4A 1IZ3A 1FNYA 5HXMA 2WNEA 3IPVA 5EHDA 3B02A 3AZWA 1ZBA2 4MGKE 4ZU4A 3VBHA 3I3BA 5FP3A 1B35B 1U0AA 2XONA 4FFFA 1VAMA 1Y43B 1BQPA 5G04L 3CHXA 3I59B 5FOBB 2AREA 1E5IA 1YUDA 1UPIA 5C9AC 2I2SA 1H8VA 3KGLA 3MPBA 2I74A 3ECQA 2VD7A 4PDWB 4XFFA 4YVSB 1LKNA 1O4YA 4YGCA 2WIIB 1ZVFA 2RM22 2DUOA 2WN2A 4GMP1 1GNYA 1GKBA 5IVFA 1RMU2 4MSVA 5FMDA 4LMFA 1WMDA 1AXKA 4GQ7A 4ARXA 1XBFA 4Y4RA 2WDBA 4B3NA 1UMHA 2VVFA 3THTA 2BEOA 2PHDA 2XXZA 3I2GA 5LA1A 2RJKA 1LAJA 5DAVA 1UU4A 1SBEA 2VBDA 3DUIA 4IEXA 4LKFA 1YNAA 3NAPA 4LOSA 3WP4A 4ONUA 3T0DA 1FYUA 3P6BA 3POJA 1ULDA 1NYWA 5GZEA 4AHWA 2YC4A 3I3MA 1C5IA 2X53S 4RGKA 4AAPA 4HVQA 2ZGUA 1COV1 3VLBB 2P4EA 1ZZ9A 1CJDA 4WM7A 4LIVA 4XOGA 3ZYJB 1DU3D 3WEZA 2FHRA 4BQWA 3T1MA 4XXPA 1G9FA 2D6OX 5ABJB 1COV2 3RYKA 3PLQA 5KHIA 1RUNA 1CGPA 2ID4A 4XQ4A 3O1UA 3NNLA 2WQ8A 3RJ2X 4N43B 5FWEA 4P9IA 4KBBA 5SV8A 2P3JA 1JHJA 5EFUA 5FKCA 2RMU1 1YQ5A 1OA4A 4GKXA 5E88A 1OLMA 1RUC3 2IXHA 3WQ0A 3M3IA 5FZ1A 2RJLA 1POV1 2GC0A 4RA0A 2IXLA 3UETA 2RMU2 2VQUA 2XQXA 3I2KA 2VTXJ 4NOTA 3THCA 1TMF3 1JZ6A 3T2OA 1BK0A 3T2QA 4HVRA 4LA3A 3RYRA 5A3TA 3ZXKA 4HK9A 4RD7A 4W8JA 4CEWA 3P3NA 5C7GA 4E27A 1MS5A 1R081 1YCIA 3KVAA 4UBGA 1AR91 5FYMA 3SH5A 4AVVA 2J1AA 5E1RA 3WV6A 2ARXA 3GDBA 5B4NA 3HT2A 4XFIA 1R082 3IDEA 1AR92 3L2YA 1HB4A 2XHKA 2IXCA 1D2QA 5DG2A 4DO0A 2HYKA 1NCRA 4Q2FA 4META 4GULA 3DF0A 1REFA 5DZFA 2Q8EA 2WS92 4YARA 2Q1ZB 1PZ8A 3LEIA 5ANNA 1M06G 2AR6A 3M7AA 3J7LA 3ACHA 3VL9A 3PUAA 4I01A 1OH3A 1OF4A 1RGSA 1UOFA 2W92A 3A21A 5GZGA 3O7OA 1AJKA 1SCSA 2YBSA 1N1SA 2NMNA 3H8OA 2WL1A 2IZWA 3AXDA 5BYNA 1HX6A 1GWKA 2EICA 4JGYA 4KGQA 5FMOL 1WLWA 4Q8KA 1VBD1 3N7KA 4DUVA 5JOZA 4R9CA 2ZHLA 1SACA 1DZRA 3B9CA 1LECA 5DXDA 3ZXEA 2JG8B 4AQTA 3KVBA 1AL21 3TWIA 5KC6A 2PHLA 4WVWA 1I1EA 4MGQA 4YG6A 2D3RA 2W5FA 4GWJA 4XUNA 1X36A 4AG4A 1QJFA 3Q8AA 2Q8DA 3E5UA 3RSJA 2EIGA 2QDRA 1HRV3 4MGZE 4QM9A 5I0SA 2ZX4A 1L7QA 4WM8B 3TAYA 5AVPA 2NM1A 4WVZA 2ZTNA 1HB3A 3IPVB 4ZZ5A 5BNOC 1AYN1 3WDTA 3ZYFA 5FYIA 3E6BA 3VBHB 1CAUA 3LQCA 1XNTA 3ES4A 1WCUA 3BTXA 1D2SA 4KWKA 3RZJA 4D8MA 3CJIC 4OCTA 1AYN2 5FZ0A 4AGVA 2WQ4A 4B7KA 4Q1RA 4E4DX 2BPA2 3PDQA 3FHIB 4YVWA 4GJZA 4HFSA 2W0XA 3I2IA 1HV0A 4WZCA 1C8M1 3ZN4A 3OEBA 4XBNA 3B7MA 3GXUA 3WP5A 4BLJA 2ENRA 1V70A 2H6BA 2WWJA 5JOWA 1W8ZA 1MVEA 4E8CA 1UOJA 2PTMA 5DG1A 1EV13 2FDHA 3SITA 4XF3A 1HKDA 2OPKA 2W46A 4CDXC 1QOOA 2VZQA 5ACA1 5L36A 3DKWA 4C91A 3S57A 1H0BA 1NCQC 2RS53 3TBDA 1JZ3A 1ZYBA 2YHJA 5FAXA 3ROUA 3NAPB 5ACA2 5BNNC 3BTYA 4LLOA 2DVBA 1OVSA 1XNKA 4LK7A 1RXFA 1UOGA 2YV8A 3KCXA 4QXKA 2A73B 4H7LA 4WZFA 4WM7B 1QQP3 4FOQA 2WYSA 3OBRA 2WA4A 1BVVA 3SH4A 1DYOA 4CCEA 1HJGA 5C70A 1J1LA 1ZBE2 3C7HA 4AVAA 1D0GA 4CDUC 2K46A 3OUIA 1U5YA 5FQ0A 4RGAA 2OUHA 1QMJA 4DQAA 4A4AA 2E7AA 2HWD2 2KXLA 3O1PA 3FJSA 3ZIWA 3PVOA 2WT2A 4K7JA 2WO3A 2YY1A 2H0VA 2V5YA 3KV4A 4N7UA 5CFDB 2CV6A 3SCGA 4O7XA 1AR72 4XPVA 3KM5A 2LS6A 5BNPA 5C8CB 2E7TA 3MPPG 5FZOA 1BZWA 4AQ6A 1PK6B 4QKFA 1VRBA 2JECA 3QH7A 1AJOA 1BXHA 4LPLA 5AVAA 2UYBA 2W2IA 4JHTA 1RUH2 3OUHA 1L7LA 4XACA 1I3HA 2O14A 4URTA 3I49A 2HWC2 1UIKA 4P14A 5FY0A 2WZ8A 5GLWA 4RQPA 1DGRN 1LOCA 3P5BA 4Q4V3 2WZPP 1Y3TA 2XBO1 3E1F1 3OY8B 2DUQA 1CONA 4CP9B 4XIOA 4A6OA 4DOUA 3E5QA 3U07A 3R0RA 2XBO2 3C7EA 2Q8CA 4CDWA 4ZXEA 4CP1A 3MFAA 4KL1A 4QXBA 1YO8A 4L0PA 3POFA 2J22A 4M3CE 4XFAA 4D7YA 4QQLA 2DF7A 1XOYA 2HYXA 5CG8A 1HJFA 4XUPA 5A3UA 4CCMA 3FX3A 3MLKA 3TN93 3GZUC 5F7UA 3UV9A 5FFOC 2WZR1 2Y38A 3EXUA 3GCWA 5BUVA 2BNMA 4P9LA 3QD6A 4R4XA 3OB8A 5CKMA 1SBDA 4DXZA 1GV9A 1GWLA 2ZKLA 1LOFA 2WZR2 2VXJA 2YBPA 3DCQA 4JHZA 3K75B 5FMCA 3I2FA 2Z5WA 4UOJA 3IDCB 1UYPA 2VR4A 5KXBA 4MHRA 1MQTA 1E5RA 4LITA 4B4QA 4NHXA 5AC93 5LRSA 4MOAA 3IM0A 2GN3A 3CIHA 3UGGA 4ARYA 5KHJA 5C3OA 4K20A 1JOBA 3MIHA 3ZDSA 1CAUB 1H1MA 1QJY1 1AL0G 2VOXA 4UW4A 4L99A 1JUHA 5A7QA 3ZSLA 1Q43A 2DUPA 3BB6A 3UJQA 1RB8G 3JQXA 3PIJA 3NJXA 5F5QA 3UNPA 5LA2A 3DGTA 2HLEA 4P5YA 4QXCA 5JR2A 3O1SA 2OXBA 5IVYA 4A42A 4MXWB 4YVWB 1A6CA 1AR62 3MIFA 3CF6E 1UN1A 3VBUB 4QPYA 4FCAA 3VBOC 3ZFEA 4OYUA 3ATGA 4B29A 2A3XA 5JSPA 3AP6A 4I3GA 3S5AA 3P3PA 1UX6A 5FLIA 1CIYA 4RHV3 1MS9A 4RSUA 2XH6A 2VZVA 3BIWE 4BMEA 4CXYA 4BYYA 2BERA 4DRRA 3H1WA 2R041 3HT1A 5D8AC 4QX2A 5G05L 5LK7B 1N3QA 3SISA 1G86A 1NLSA 1PO21 2EXJA 2FZ1A 3ALQA 2AEZA 4I02A 3U4XA 4ISQA 5DZEA 5CYYA 1QU0A 1R093 3ZFFA 4DXTA 1KS5A 1N1VA 3WF2A 3MZHA 3U4SA 1RUF2 1LU1A 2L9LA 4I2OA 2I07B 3LA3A 1PO22 3WCRA 1VBE3 2BV4A 5EIYB 5L9BA 4DS0A 5JMOA 1LB2A 1BJQA 1W9FA 2ZPXA 3N9LA 1G9BA 2VJXA 1DZTA 3FC0A 2ZOEB 3TRSB 1XYPA 1C57A 1QJX2 2QKDA 4NPRA 5T52A 5FR3A 2VM9A 2VUAA 3NJVA 3NW4A 2E32A 1W28A 1ALYA 2FDJA 4C1WA 3VZNA 2Y0OA 4H3WA 5FJKA 5C3PA 4L8QA 4K8RB 1O59A 3WQ1A 2VC9A 4ASKA 2D6PA 1N47A 2Q1MA 3M8LA 3VZKA 2NPIA 4XYXA 2LALA 4TWTA 5FYSA 4YW1A 1M4WA 1ND3B 2BBVA 1UWWA 2DVAA 4IEUA 5IUQA 1W9YA 3FFZA 2A71A 3IMMA 1EPWA 4NAMA 4WVVA 1W6QB 3R4UA 5AFEA 5T5OA 2HKXA 5FCCA 1O5LA 3VKMA 4XZPA 5IK7A 4DRVA 1O3SA 1LHWA 4AHXA 2QQLA 4S2GA 1JZ7A 1PGW2 2N7GA 1W04A 1HIXA 4W6WA 5K0UC 2NP0A 1F4HA 3ELNA 3DYMA 3O5SA 2Z42A 4HBNA 2OA2A 4F83A 2D3PA 2ZMNA 3HBZA 3H7JA 5C6CA 3D6EA 1IS3A 1DGRA 2JD9A 4DIQA 4JKMA 4IEWA 3MW3A 5A6QA 4LBQB 1KQRA 2A6YA 5FKBA 5A1AA 1ACCA 1W0NA 2O8OA 3O0WA 4N9HA 3DPRB 4RQPB 4CCJA 4NHKA 3FWEA 1OQEA 5FZ6A 1EY2A 4Q4X2 4TLGA 1W2NA 5KWRA 3RZHA 1GOHA 3WF0A 2PHTA 4W65A 4MO3M 4HKWA 4NPLA 5C5UA 3WUCA 1H9WA 5IFTA 3VZMA 1UYXA 1DQ4A 4NIGA 2WQZC 1ZZ6A 2OKXA 5FYBA 2KA3A 2CDPA 2E7QA 2P3IA 1OA2A 5FZEA 4V2VA 3MF6A 3RYPA 3ACGA 2DURA 4Y1XA 1CAXA 1FV3A 3T09A 4XTMA 5A7WA 3ZYRA 1JU3A 2EALA 5LA9A 1RUC1 4ES9A 4F3JA 4XJAA 3VDAA 5FO9B 3SH3A 2P17A 1ZZ7A 5DAWA 2ZS6B 1ULGA 3VZJA 3AP7A 1RUC2 2Q4SA 4G3YC 4QKBA 1TMF1 1VJ2A 1D7PM 5I8SA 5FPVA 4EWDA 2X05A 4IDZA 2VQAA 3GCXA 4EE2A 4LT5A 3PU8A 1POQA 1TMF2 2GSYA 4JQRA 1MQTB 2R30A 4YRDA 5C5TA 1UZVA 4CDQC 1KDMA 1KD7A 2AACA 3AC0A 2X8KA 4YPJA 4JGZC 4HONA 4B4PA 2A6VA 4N53A 4UFMA 1ND2B 4CUAA 3MIGA 4LE3A 3WW4A 1REEA 1Q8QA 3S5QA 4IEOA 4PBOA 4TYSA 1G9DA 1YEWA 2ZX2A 4C90A 1NY71 1RXGA 1H8TA 2ZX1A 2EXHA 1PO13 3IN9A 5JXGA 4HOOA 3A4UA 1CAVB 1WD4A 2D6MA 1OFNA 3W9AA 4CPBA 3LFIA 2Q1FA 4L97A 1K5MA 4YLZA 1W06A 1YQ6A 3UL2A 1WMXA 4B1MA 1GNZA 3HEIA 4B7EA 1V6OA 4Z2AA 3DN7A 3VKLA 4D6QA 3C3VA 4Q8LA 1KEXA 1K5JA 5DAXA 2FCTA 2JDYA 2O0OA 4FVVA 1UW8A 4A44A 4NWWA 3H3ZA 4WVMB 3ZXLA 2XJQA 1Y9GA 3WLUA 5FJHA 4CUBA 3AFGA 3M3CA 5FUNA 2PAEA 3RPQA 2YC0A 4E4HA 2XVKA 3B9IA 1VE0A 1N1TA 4IV1A 4AEDA 5JXJA 5LY1A 2QFEA 2XVLA 5F3EA 4FTSA 5LK5A 1S0IA 1W6PA 1BBT2 1S4CA 5FOJB 1HRV1 2ZGKA 4LQRA 4CCKA 2C24A 2YMZA 3VDCA 5FXWA 3VBFA 3K2OA 3NKGA 2OQ7A 4A7KA 4CP2A 2RJ2A 4GIQA 2IFRA 1DF0A 1HRV2 3CNAA 4TZDA 2WAAA 3ZXGA 1ULPA 4BH9A 2VG9A 1WBFA 1W99A 1AXYA 4GH4A 4Y26A 5FXVA 3KS7A 2B5HA 5DN2A 2WNUA 3R05A 4UFJA 4CPBD 1ZRRA 1MACA 1UNBA 3EO6A 4QB1A 3NSTA 4FXKB 4OHYA 2UURA 3VD4A 2HWF2 5LBCA 4PI0A 1LGBA 1AR83 1ZX5A 3UKNA 3ZN6B 5A3LA 5C4WC 5LBEA 1B35A 1AX1A 1ULOA 2YXSA 5JI9A 4E2GA 2MPFA 3I59A 2AGSA 3DEMA 2P3YA 1A8MA 1Q8PA 3MIDA 3WDUA 1UY4A 4IEVA 1EV11 5EJZB 1RINA 2IUWA 4PDWA 4YVSA 5LWBA 2G9ZA 1OA3A 2C5DA 2QDNA 3J26N 4EV0A 2RS51 5FPAA 3C7FA 4NHYA 5IVBA 2DVDA 2PHRA 5IVVA 4QKDA 2G9FA 1PX3A 3WDWA 1PVC3 2R16A 2IFWA 2RS52 3KMHA 4FO9A 4D0QA 3VBSB 4K40A 1BEV3 3PU3A 2HWB3 1QQP1 4QMAA 4RR3A 1HQLA 1X82A 5CFCB 5LW9A 1K42A 3ZM8A 5GZCA 3N7JA 4QM8A 1NA1B 5JZGB 4AEMA 3ZR6A 2R1DA 2B42B 2QQVA 2ZA9A 1QQP2 1DGWA 3U37A 1JU4A 4FPJA 3UESA 2Z4FA 2ATFA 4LA2A 5FV3A 1NG0A 3MUZ1 3OSDA 4YM1A 3APBA 1ZREA 2P1BA 1CAXB 4OFGA 3SLIA 4TTGA 4INDA 1JS9A 2XJRA 4N8MA 4Q4W2 2XJVA 5ABJA 2WNVC 1GBGA 4Q0VA 1OT5A 2AH2A 1WCQA 5GJ6A 2C26A 4N43A 4Y1UA 5JMCA 4OHZA 3ZIXA 2F4PA 1I9RA 2XKOA 4FT8A 5FRAA 3EB7A 4KBZA 2JG9A 3ZSKA 3K3OA 5KR7A 5FZIA 1UD1A 4UW5A 1YI9A 2R063 1LOBA 1W2AX 1XB9A 2GC1A 1DZQA 3OGJA 3NL1A 1LU2A 3ETPA 1HDKA 4LO5B 1IG0A 4NVPA 1NQDA 3HNYM 1JODA 1NCQA 3ZKUA 3DYPA 1W39A 3C8XA 4Q4V1 5KHKA 1YJKA 4UF0B 4GWNA 4NO4A 1RVF2 5JUVA 1UIJA 2R0HA 4OI0A 3JZVA 3K4DA 4Z82A 3N9NA 3KCYA 1Y9QA 4QU1A 4Q4V2 1QJY3 4GJYA 4HL0A 1S0GA 1K5MB 3HMYA 3TOJA 5LCWL 1QHDA 3LPGA 4ORFA 4EWAA 2A70A 2PLV1 4JX0A 2VO5A 5FREA 1F5JA 3W58A 1H2NA 5DUVA 3IIIA 2HBUA 3GZEA 1ULFA 2RR13 1JOPA 4MXVA 3O1MA 4LBKA 3QLQA 2YFZA 2VE1A 3TN91 4HSJA 1NT0A 1LJ7A 3PUQA 5B2GB 3AKRA 2GDFA 5J37A 2Y6GA 4KG0A 1W6NA 2BZDA 2NN8A 3TN92 4AXOA 2GNDA 5HI0A 2WO2A 3BTAA 3PMSA 4Z07A 4LTAA 4AFDA 1ENSA 4ZY9A 3VBRC 5A3MA 2JICA 2WN3A 4BQ3A 2JG8A 2VW0A 4Y4YA 1GUIA 4OMDA 4ES8A 4XJ8A 1J3PA 4UXAA 1BLZA 5AC91 1ZM1A 1XQNA 1XNCA 2AYHA 5DDJ2 2JDUA 2FZ2A 4RFT0 3J7HA 4DNYA 4GH4B 1RUOA 1PM7A 5AC92 3ZYBA 3HQUA 2XLFA 4BQYA 2LROA 4AGRA 4CE8A 1IHMA 3O1OA 1TG7A 3OBZA 1P8JA 2Y26A 2UWBA 3T2TA 3NMBA 4DXRA 1V6JA 3UYJA 1FOD3 2QVSB 2VULA 4QX0A 1QDOA 3H3UA 3SXWA 2P3KA 2QQNA 4XDQA 4BCUA 3VV1A 3HQRA 2YGMA 1N3OA 1W90A 2RDRA 2WNOA 1NE4A 3ILFA 2QQMA 4P9GA 4RHV1 3QOPA 4IEPA 4B4RA 3N9PA 1V6IA 2JKBA 3LA7A 4JAAA 2V4AA 4GB33 5L7OC 1PMHX 4COYA 2PHXA 3FFQA 4RHV2 3M3EA 5FZKA 1MZ6A 2DTWA 2VZ1A 4KH9A 1R091 5F32A 4AOCA 4J1XA 2HJIA 2Y64A 5FY7A 1FPN3 3WDYA 3WHUA 1XSQA 1QJU3 4LLFA 1HB1A 2QQOA 1VBE1 3N9MA 1S0CA 1C28A 1OFSA 5FLJA 5JIAA 2WFF3 1R092 4OHVA 5BPXA 2V5DA 5T5JA 4RR3B 3C7OA 1XRUA 5CB7A 3OGGA 1J3QA 4P9JA 1SQ4A 5A7PA 3OTFA 1VBE2 4UFIA 1W2TA 2VZRA 2E26A 2W3JA 3EHKA 3UT0A 3FBMA 3D0SA 3RI9A 3V65A 3I4IA 4OLLA 1OURA 1ENQA 2QJVA 3CMGA 4EJRA 3K46A 4NMIA 5BNOB 1SBFA 1HXS3 3V56A 4LBQD 4R8HA 3FE5A 4MV2A 4LULA 4PJYA 1CX4A 1SFYA 1J59A 3CJIB 1UYZA 3AZVA 1GP4A 2YU1A 4Q0PA 4LO7A 2XL9A 4FXGB 4IQPA 3WDVA 1AHSA 1XNAA 4Q4Y3 4NPMA 2JKXA 4JKKA 1EP0A 4O61A 4PI2A 1DDLA 3J4UH 3RI8A 5EYXA 4OI1A 2JG9B 4LO8A 1D4M3 3B3QE 1O6UA 1YC61 5A7NA 5SV5A 4QX8A 1KFXL 5CFDA 5HV0A 1CZTA 1JZ4A 3BIEA 3GF6A 4HZFA 5C8CA 2FCVA 2QZ3A 2ZGTA 5A7OA 3THDA 3HN3A 4N7IA 4E4SA 2IC1A 1H30A 2G9GA 3EMRA 4AI1A 3L2HA 1PK6A 4CDXB 4MGYE 1EAH3 1Z7S3 1NCQB 2A6ZA 4NN0A 4COVA 3WD5A 3CO2A 4UW3A 5APAA 2TEPA 3PUIA 4CUCA 4URAA 4IGQA 1CN1A 1PIV3 1REDA 2CGNA 1DG6A 1PM4A 1RJ7A 2W1WA 2XWBB 5CAZA 3H8XA 4XHXA 4LBJA 4LBOA 2HBTA 5IAVA 1IPJA 4YW7A 3OY8A 2YPJA 3AMMA 1HRI3 4CP9A 5FO8B 1S2EA 3ZFGC 4A2UA 5JAXA 4CU7A 3OD0A 1UZWA 2VGDA 1DLLA 4GAZA 2FBEA 5FLHA 4EN6B 3WXPA 3RZKA 3ZMOA 4XW3A 1OSGA 2YB7A 3LKJA 4IV3A 5FZLA 2WYFA 5GM0A 1W6NB 3HPNA 5A32A 3HNMA 4JRLA 5GLTA 3KSCA 2GZWA 3OUJA 3T3YA 1O8PA 2JB4A 4RS5A 1ZRFA 3PVBB 3V0BA 1GR3A 1VBD2 1JN2P 5CVRA 1WWYA 4K9SA 5FY4A 1KFUL 3N9QA 2R7EB 4Z2WA 3EJKA 3WSOA 4BU2A 4QQOA 1DCSA 1GZCA 1OC1A 2WRAA 3VDDC 3T0BA 3VUOA 2YDEA 2W47A 3B94A 1LOAA 3Q9OA 5FP8A 4AFBA 2WT1A 1AL22 2ZCWA 1W8OA 4M00A 1LRHA 4QXHA 1V6NA 3ILNA 3OEAA 3SQOA 5HCFA 4NRQA 2HH9A 3MHZA 4LKDA 4IE4A 4LKSA 1PO11 1XU2A 2D40A 4LKEA 1W05A 3WNKA 2RVAA 3CJXA 2RS33 2QBXA 4Q5OA 2E33A 5FYCA 2W87A 3GBGA 2CGOA 1FV2A 1ST8A 4QQHA 1WLDA 3GYDA 4NR1A 3O1TA 1PO12 5F5IA 4IEZA 4A41A 1EUUA 1F5FA 4AVSA 4HKOA 4MXWA 4OZOA 4QWNA 4WV8A 4CEYA 4S2HA 3G7DA 3D8CA 1IS5A 4TN7A 4XHBA 3VBUA 3WP6A 3ZYGA 2PXJA 1LOEA 2NQYA 3VHOA 2BVBA 4M01A 4A3ZA 3UKVA 1DIWA 1C8M2 2FDKA 4V2WA 3KQ4B 1XYNA 2CDOA 4EQVA 5CEHA 5CG9A 3AKQA 4G9SB 1CZVA 2W91A 4X6RB 2Q8OA 3VN4A 4BQ5A 4ZU5A 4CRQA 1ZZBA 4QPGC 3LFMA 4Y1YA 2XMLA 1R64A 4NJ4A 2OX0A 3VHPA 1GWMA 1FT9A 4I30A 2FMYA 2PQSA 3W20A 4ITCA 4W50A 3OD4A 3RZGA 2F4LA 3OGVA 2C4XA 3POWA 3ZPOA 1YYNA 4LORA 4P5HA 3H8UA 3IDAA 3B01A 3ITQA 1DGLA 2WO1A 1OOPC 4Q29A 1CD3G 5C33A 1VRH3 2BFUL 1KGYA 3NRUA 2KD7A 3IAQA 5LRRA 1AR81 2RDNA 2QNKA 5JCTA 2VZPA 3ASIA 3VZOA 4OQ9A 2FCUA 2VMEA 1YIFA 2EAAA 5T54A 1W8NA 4MUVA 4Q0QA 1ENRA 1AR82 1LESA 1O7FA 4Y22B 4YM0A 2B39A 1ND3A 4ATFA 3USUB 3H1YA 3SNMA 2OS2A 3HBKA 1W8UA 2DTYA 3VBOB 1JTZX 1LCLA 5H9PA 5C3SA 4ATEA 1FMD3 4ZS2A 1W6QA 5A3WA 2CU5A 5FYVA 2WWUA 3U11A 3NVCA 2VTXA 3OGRA 4PT6A 5F3IA 3NV1A 2JE8A 1PVC1 2QUOA 3POSA 5A3NA 1ULCA 3F95A 5D8AB 1C8NA 3I8TA 4YSFA 3PNAA 4EN8B 1BEV1 1W6MB 4FFHA 2HWB1 2DCZA 1HQWA 5H9QA 1PVC2 4FBFA 2VOTA 1MEC3 4LBQA 4LHNA 4QB6A 5C4WB 3A7QA 1CQ9A 1BEV2 2C0ZA 2GP5A 3DPRA 2Y6JA 5BV6A 2C9AA 1UQXA 3BU0A 2UWCA 5A33A 4MADA 1YLLA 2P5BA 3S30A 4AF9A 3NNGA 2Q30A 5EV7A 5KC5A 1VBC3 5FY8A 4C0BA 3TEXA 1J84A 1SHWB 3GJAA 1RHI3 5IJRA 1YFWA 2BUKA 1ONAA 2PLV3 2ZZQA 1ZA7A 4KU8A 5L19A 4IV3B 3EYPA 4WM8C 4BIOA 4OZXA 4FPFA 2XHNA 4Y20B 5A32B 3ZO0B 1IGOA 2IXJA 1WW4A 2ARCA 1GANA 2TNFA 4FPKA 4YW6A 2W68A 2ZMKA 3AMHA 5IVEA 4RS5B 3VBHC 2AENA 4FSJA 4QPIA 3V0BB 1WCDJ 4CA9A 3I3DA 5FZGA 2DU1A 4XFGA 4CXXA 5I93A 3BVCA 3WY6A 2R061 1B09A 4J1WA 3LSEA 1S55A 4R9BA 4EZHA 1PNGA 1SCRA 2JDNA 2DCYA 2VU9A 3N35A 2JB8A 2IWGB 3LA2A 2AEYA 4OMCA 2CHHA 3KZ4C 4RGGA 2R062 5L9RA 1QNWA 3ZSJA 3WUDA 4EZ4A 3SCFA 3BOPA 3ORJA 3ZSMA 3GM8A 1DBNA 3AKSA 3E5XA 1WW5A 4PF5A 2BU9A 5T55A 1F4AA 4OQ8A 1UF2C 2BNOA 3HAGA 4IE5A 1X9TA 3I2JA 3LIGA 3MBWA 1ND2A 3QCWA 4L9BA 2DCTA 3WINE 3JUUA 3NAPC 1QDCA 1D4VB 2WINB 2GALA 3MF9A 1QJY2 4FOWA 1CAVA 4GA9A 3RMYA 4CEYB 2RR11 2NZ9A 5GKAC 1W9SA 2Z79A 4OVEA 3N3HA 2O1QA 4LBNA 5E89A 1T6GC 1R1A3 1X33A 2CAUA 3UGFA 4WM7C 5JLVA 4CYDA 2CTVA 3W5NA 2XL7A 4XDOA 4M3CA 2BYVE 2RR12 4F7ZA 3LD8A 1QOSA 3LPFA 5F5AA 4QX5A 5J09A 1RITA 2ES3A 2VNVA 4QKNA 3OBAA 4WVMA 5FYHA 2BW8A 3AZXA 2P6HA 5CNAA 5KXEA 3U75A 2YG0A 4XUTA 2J1SA 1LGCA 5JI7A 5K4LA 1KS4A 3E6CC 2GNMA 1QXRA 2R042 1UY2A 1BHGA 1H9PA 4HPKB 4NROA 4Y5TA 3SMHA 1JZ5A 3RZLA 1JYNA 4NUBA 3RQ0A 5L73A 4DY3A 1E57A 2RM23 4Y1VA 1QJEA 5HPOA 4CDQB 3NWKA 4HETA 1RMU3 2QQWA 3ENRA 2VMHA 3MV01 3TYJA 3NJZA 5I91A 3H1MA 1SFPA 4BA6A 3VKNA 4R9DA 4PF1A 3LAGA 5EP9A 5FXXA 3ZMNA 4CEWC 2WSVA 4M4RA 3OG2A 4PLOA 3HQXA 1AYM3 1FOD1 4XUQA 2VUDA 4P02B 4HT1T 1GP6A 1VR3A 2MHFA 3THPA 2XG3A 3IWZA 1MS8A 2JX9A 1FOD2 3FLTA 1JHNA 3MW4A 3U0ZA 1NCRC 3GNEA 4FTEA 3ZN6A 3PUSA 5JVVA 4GB31 4BISA 1VMHA 4BQ4A 3U10A 4AFAA 4CCCA 4FPCA 4AI2A 5FY5A 5KBFA 3I2HA 4MGIE 2EF6A 3RFRA 1LEMA 3ZDVA 4UYBA 1FPN1 3AKTA 1I5PA 1OD5A 1QJU1 2VMCA 4OUSA 2A75A 2BJSA 2WC2A 2WFF1 4JGYC 1JYVA 4JKLA 1OLRA 3NNJA 3PJYA 3R4SA 3PVEA 1CAWB 4LJHA 4LUMA 4LO6B 2VBBA 4XDPA 5F6LB 4BDVB 5FZ8A 3VBSA 3X29B 2FD8A 1PHMA 2EAKA 4DINB 5A33B 1DLCA 3O0VA 5CFCA 3ZN5A 3POGA 1X50A 1W03A 3BALA 4XURA 5ERLA 1NA1A 4PIYA 5JZGA 2A5ZA 3M3QA 4KGGA 1HXS1 5CA6A 3OF1A 2UYAA 3NKTA 3H42B 4FPYA 4QAWA 5LA0A 4FOYA 1CVNA 1C3HA 1ODMA 3ABZA 3WP3A 4Q4Y1 1O4ZA 4GMP0 2EVXA 3LOIA 3WNMA 1W9WA 4UFLA 2UWAA 3SC7X 4XMAA 1D4M1 1PZ7A 1HQNA 1SLLA 4QPIB 4W4ZA 4Y3OA 3B00A 2DCJA 4ZU7A 3H8RA 1H6XA 4MH0E 3ZYIB 2WS93 1BK1A 3FZ3A 5C9AA 3PIGA 5FZ7A 5I0DA 4QX1A 4LHSA 4CZSA 4YVWC 3WR0A 4AYUA 2CAVA 1A34A 1D0HA 1EAH1 1Z7S1 2DU0A 3PVNA 2ET7A 4XCBA 2A6WA 5FZAA 2D6NA 4I0BA 4HLTA 5KHHA 1JH5A 1S0FA 1EAH2 1PIV1 4KI5M 3I97A 3JXSA 4YW5A 2FMDA 1Z78A 1MZFA 1ZZCA 1LR5A 5F37A 1NX9A 4UI9L 5B4XA 3FUQA 1JUIA 4QB2A 4UF0A 1UU6A 1V6MA 4J25A 3WG3A 4CSWA 1HRI1 1U12A 3TB0A 4UAPA 2VOKA 3T08A 4FTBA 1WUVA 3RRDA 2ZX3A 1NY72 1HRI2 3GALA 1L7RA 4JTOA 3LDBA 4XQWA 2PA7A 4M3CB 3Q8CA 1PGL1 1QOTA 1PZ9A 3N36A 1KRIA 1YFXA 4YG0A 1IKPA 4K8FA 5F39A 3WG1A 2WNVB 3J7MA 1RUE3 3KT1A 4KWJA 2RHPA 4LHKA 5GZDA 1GNHA 1QNYA 3HVDA 1PGL2 2EA7A 3J8F3 4A6SA 1GICA 1WD3A 1N1YA 2W39A 4FPOB 3JU9A 4AZZA 4C1XA 2SLIA 2UY9A 2E9QA 4SBVA 5FMOS 4D6RA 4BK5A 4K1YA 3KT7A 2JD4A 5DUWA 5A6ZA 5F8PA 5BNPC 4M3CF 2Y6HA 1LOGA 2XQRA 3JCIA 4TLFA 3OYWA 3VB9A 2G1MA 2BQPA 4JC1A 1W8FA 1J58A 3H50A 1SLAA 4H7MA 1GLHA 4YYOA 1S0DA 2RS31 4P9WA 4AVCA 4K21A 2Y6LA 4AI8A 4AI3A 1O8SA 2GN7A 4IEYA 1WZXA 1GQHA 2ADEA 2VW1A 1Q56A 2QQKA 1I6XA 1LULA 2RS32 2VNOA 4PHZA 2ZGRA 3UK9A 2LUWA 5FP7A 2J42A 4RQPC 2E51A 1OI6A 2VQ0A 3O14A 2P2KA 3T1LA 2WAOA 5DUXA 4BPZA 1QJZA 1Q3EA 1TQ5A 1SLTA 1X9PA 3WHTA 1JYTA 5K8SA 5A1FA 1CZSA 1A3KA 1IKQA 2HWE3 3RNSA 5IK4A 5A1LA 4X8PA 1JMUB 1JYCA 4OULA 4COWA 2G4IA 4CDWC 4DPNA 5IK5A 1OKOA 1ZBE3 2VMGA 5DAPA 3JBG3 3LSDA 1EV12 1UKGA 1O5UA 1XNBA 1GFF2 4NAOA 3K4AA 4KQ7A 3LOBA 3GHMA 2HWD3 1TZOA 1RC6A 2CSGA 1XC6A 3BU7A 4IGPA 5FZ9A 1MZEA 2WKKA 2CGPA 1NOVA 5A3PA 1ASJ3 1QH6A 3ZXAC 1AR73 5JPMB 2E53A 2JJ6A 5HV4A 2ZZJA 4DMIA 3E97A 1RIRA 1LOFC 3PTRB 2VVEA 4YW2A 4NHMA 1C1FA 1VRH1 3NJYA 3TEYA 2VOVA 1V6KA 3I7DA 4XJUA 5FPLA 5K9YA 5IT6A 1MQTC 5FMBA 1QKQA 3OPWA 5BNOA 1VRH2 4OI4A 1AZDA 4K3UA 4LBMA 1IQAA 1WGPA 4XMIA 4Y5SA 2ADDA 1OUXA 4QGNA 1LENA 1U5ZA 1YHFA 3AX4A 1KITA 3AZZA 3CJIA 4PQQA 4BOWA 1LNSA 2ZGLA 5F1RA 2IXKA 2X5IC 1FMD1 2BFUS 3CU7A 5C9AB 1IQDC 1EYBA 1H2LA 5J48A 3MLJA 5JIUA 2ZEWA 2B7YA 4J6GA 1SLBA 4AGGA 3RMXA 1AUYA 3BKZA 3OCPA 1VMFA 2PHUA 3S0MA 3H9AA 1FMD2 1KDKA 4LBLA 3QACA 3CZJA 1FAYA 1GZTA 3IKWA 5E16A 3AK0A 4UW6A 5TSWA 3WCSA 2W94A 3ZFEC 5IHRA 3ES1A 5CKQA 4XUOA 1BCXA 2J7MA 4YZ5A 1FATA 1MEC1 2DWRA 3GHNA 3TNQA 4CDXA 4Z8BA 2KR2A 1W2OA 3M70A 1Q8VA 4QGLA 4ISRA 4I0WB 1APNA 5FTTC 5BNNA 4XABA 2OW4A 3SHRA 3ZFFC 3L9JT 1VBC1 4RFRB 4G4FA 2P37A 4AHZA 5FPUA 4BHPA 1H4HA 1H4GA 5JXHA 2GP3A 1RHI1 1BYHA 4LUKA 1XNDA 1O4TA 3RJRA 3N7MA 4AK3A 1GQPA 1AVBA 1W3VA 5J96B 3FMGA 4CP0A 3I2DA 4P9YA 4YW4A 2VL4A 1Y7BA 3T0AA 1A78A 1TME3 4EROA 1MS0A 5C3QA 3CEWA 4NIAA 1RHI2 3DV8A 5FZHA 2PLV2 4BE3A 1W9TA 1W8WA 4CDUA 3LE0A 4B1LA 4FPGA 5GLVA 1F35A 2VAUA 2F17A 1W8TA 4RYDA 3BODA 4JDNA 4H55A 4NRPA 1VAVA 1AR63 3RS6A 1V0AA 1G6NA 4R9AA 1OHFA 1VBB1 1YWKA 1LHNA 4XF1A 3U14A 3ZOIA 1MPXA 3WVJA 2DYCA 1YI7A 3VD5A 2W9XA 2IVJA 2RDQA 3AP9A 3SKVA 5JOYA 2JE7A 2VQTA 3B5LB 2HEYF 3OYWB 1O3RA 3KGZA 2XGXA 3V0AA 2H6CA 1CWPA 1OPMA 4ZONA 1BMV2 4YW3A 1Q8SA 4JQTA 1DQ0A 2B46X 2ET1A 4OUMA 4XTPA 5FZBA 3VHRA 3WT3A 2CL2A 4QDSA 5D2AA 5FZDA 1JZ2A 2GC3A 2ZAAA 4HXCA 3W59A 4IE0A 1EPZA 3KWVA 4NHLA 4PBPA 3AVRA 1W3XA 1R1A1 1SPPA 3FUOA 1UY0A 4COUA 2W95A 1DQ6A 1GOGA 2VCBA 1U5XA 5CADA 4IGOA 1UXXX 1VBA3 1QJX3 2B8MA 4YWAA 2JIGA 2P6CA 1PX4A 3A0NA 1SEFA 5DMYA 4S2FA 5LEKA 2CNAA 3IBMA
chains in the Genus database with same CATH topology
1V9U3 3AM2A 4BQ1A 5GLUA 3HWJA 2H0BA 4JCKA 2A6XA 4CTEA 2A3YA 4PIXA 2ERFA 1DQ1A 1CR7A 3LWCA 4MX3A 4OHXA 5T5PA 2QCSB 2RM21 4LNVA 1F8VA 2A3WA 1RMU1 1WCKA 4Q26A 3VDDB 3VL8A 4XXAA 4HN0A 3ZSEA 4AQSA 2ZX0A 3TNPB 2VY0A 1AYM1 1SLCA 2EXKA 1UKRA 4V1PA 3KLSA 4KU7A 4QQPA 3AZYA 2R073 4N53C 4XQDA 1W0OA 4DY5A 1AYM2 3D5OA 1PVXA 2ARBA 4AVTA 3GBWA 3R6SA 5H9RA 4Q4X3 4IXLA 1H8TC 2QE3A 2Z2SB 5I0UA 4MYEA 2YGLA 1MZ5A 4Y22A 4ZKTB 4MLOA 4XILA 1K5MC 3USUA 4AFCA 3FBYA 3VBOA 2PAKA 4D7SA 3VKOA 2D93A 5HCAA 4PLMA 3WDXA 3MI8A 1GZWA 3VGIA 4QPGB 4M0HA 5D8AA 2GNTA 4XF0A 1W6MA 2ETEA 2GNBA 5BNNB 1JW6A 1QH7A 4LR4A 4A7ZA 1RUG3 2F6BA 1FI2A 2SBAA 4AEDC 4IV1C 4HN1A 3ZYPA 4BWOA 4KNCA 2K0GA 4D3WA 3IT8A 4E2SA 1AF9A 4LEJA 3VBFC 2GH2A 2VPVA 3WNXA 1OOPB 1X8EA 1MVQA 5FO7B 1DHKB 2PELA 4WBBA 2ZHMA 3N4MA 1UCXA 2XLAA 4FAHA 5C8WA 4CDUB 4GH4C 5F6KA 2GMEA 3RZZA 2OVUA 2WNUC 2WS91 4Y20A 3AYAA 5F9TA 3VKFC 4YM3A 4SLIA 1H1IA 3ACLA 1O3TA 1XXNA 4D94A 1WW6A 3HD8B 2GMPA 4AWDA 3INAA 1B35C 4AW7A 4X8NA 4DFSA 1GYKA 1A8DA 4A7YA 2HEWF 3V0AB 2C1FA 4PDWC 4YVSC 3WW3A 3KD4A 4X6QB 5K0UA 1ZNPA 1YFYA 5HXVA 5FDBA 4QQ2A 1RUJ3 4GWMA 3MDPA 3MIEA 2MEV3 3NO8A 3LGRA 4IETA 4HANA 5T5LA 4PIZA 3JD73 4R52A 4XJZA 3D82A 3ZX7A 4OHWA 4IESA 2VXRA 4XIKA 1BBT3 4RR3C 2XVGA 3C2UA 4BIFA 1HW5A 2GH8A 2DV9A 1W6OB 1CIWA 3MFCA 1OQ1A 1RUE1 2LM3A 5JSRA 2YYOA 3RG0A 3J8F1 1UMZA 1NE6A 4UBHA 4XFCA 1KXGA 4KG8A 1QY4A 1RUE2 2BVVA 4N9IA 4NWVA 2OYZA 5ABJC 2ZKNA 4HMZA 4QU2A 3A0KA 1O3QA 3J8F2 2HWF3 4N43C 1JOJA 5GLZA 1SFNA 2D3SA 1WLTA 1ZRCA 4HPKA 3H0OA 2JG9C 5JDBA 1F2NA 1XE7A 4XFHA 2EXIA 4S2DA 2TUNA 4Q0UA 4CDQA 2Q0AA 3S7EA 2PYTA 4JGZA 4W6YA 4YG3A 2PQQA 3K48A 1DGWX 1V00A 3M3OA 1N3PA 4L92A 4XFBA 2WA3A 2HWE1 4N90A 2ZACA 1U5IA 1J3RA 3GBFA 1WA4A 4YZ1A 3ZPYA 1RUOA 2RS13 1ZBE1 4XJ9A 2HWE2 1Q5OA 2DCKA 1IPKA 4QD2A 3JBG1 3AMQA 2NYYA 3HIFA 2ZGQA 1GZWB 4Q4W3 4EN7B 2HWD1 1VB2A 4MZUA 3JBG2 5EZWA 2XPJA 2XJUA 2YUEA 4HKLA 2ILMA 3ZXDA 1ASJ1 3LB9A 1AR71 2CWMA 2B45X 3GZAA 5I0TA 2D7FA 2V09A 1CAWA 2DVGA 2IXIA 2HWB2 1ASJ2 1VAKA 2AZ5A 2GAUA 2JG8C 1F9KA 2XUMA 1IOAA 1RUH1 2W52A 4CEWB 1TEIA 4O9GA 5BNQA 2HWC1 1VLNA 2W08A 3HR9A 4BMBA 3UKTA 3BCWA 4YGEA 1LHOA 3URFA 3VZLA 4ZXKA 2XWJB 5H9SA 2JE9A 4FOVA 5CBLA 1RVF3 2XLGA 1NQJA 1PNFA 3AYCA 1NCRB 4B8EA 2UU8A 4JDMA 5C4WA 1WCSA 3ST7A 1MS3A 4XEZA 1QGLA 1MS4A 1RUI3 2D5FA 1XU1A 1JXNA 5DZGA 5K0UB 1VBB3 1WW7A 4XJWA 4PCRA 1DQ5A 2DVFA 4JGYB 1HLCA 2OIIA 4A3XA 3AMPA 3JB8A 2DFBA 3PJQA 1G9CA 1DQ2A 3AYEA 1C1LA 4PQ9A 3OPZA 1URXA 2VOWA 3ILRA 2WT0A 1RUD3 1LGNA 3PHMA 4Z92B 2VNGA 1LODA 5EWSA 4COZA 1OLQA 3I54A 4H14A 1QXPA 1QXJA 1TME1 5KXCA 3O0XA 4RL7A 5DDJ3 5FPXA 1YFUA 2OZJA 4AE2A 5CIRA 1TME2 4GALA 2ZGSA 1DFQA 2YROA 2WNVA 5J36A 1WMEA 5IK8A 1ZBA3 2GC2A 1AR61 1CESA 2D97A 4Y24A 2OUJA 1FX5A 2PFWA 2X5IA 2ZGPA 4YFZA 2BWAA 3QBQA 4FP2A 2R0FA 2E6VA 4JTNA 1S2KA 2VUJA 3JB4C 4W6XA 1VALA 5CFDC 2D43A 2VW2A 3UJOA 3AKPA 1NXD1 5C8CC 5T50A 2WJSA 4YM2A 2BGCA 3MLLA 4JGZB 1PK6C 5FBZA 4AEKA 4EN9B 3EBRA 4GMP3 4FQ4A 3MGUA 1RUF1 3OBTA 1Q8OA 4QGMA 3WX5A 3LCPA 4L11A 3FLRA 1VBA1 2ZHNA 4DB5A 4LHLA 1QJX1 2QZ2A 1R1ZA 2XB6C 5BXXA 3AYDA 4LE4A 2D44A 3RWNA 5DUUA 4AQ2A 1LHUA 2X29A 1YRZA 4AI0A 1VBA2 2I45A 1L3JA 3QH6A 1V9U1 1XE8A 3D0JA 3EQEA 2VNRA 5T3NA 1ZRDA 3AJZA 4D69A 1COV3 3KB5A 2A7AA 4GB32 2Y0IA 3BOWA 4XBLA 2BNNA 5FQ0B 4YNIA 5J98B 1V9U2 3NV2A 3WOGA 1S0EA 4Z1VA 1NXMA 4IV3C 1FPN2 1VP6A 5KXDA 1QJU2 4BZ4A 4U2AA 1AX2A 2WFF2 3AJYA 3IDBB 3OJBA 4RS5C 1WLCA 5BNPB 3VBRA 1PGW1 4LO4B 5K7PA 2RMU3 4PLNA 5KHGA 4L2NA 3USSA 2ZGNA 1S0BA 2K9ZA 5HCBA 1POV3 1GQGA 2R071 1W2UA 4ASLA 2Z69A 4HK8A 2K2SA 5AFBA 4FPEA 1HXS2 2HEVF 4Q4X1 3B93A 2R072 3MIBA 5HBAA 3AB0A 1SMVA 1H2MA 1R083 2UY8A 4EN0A 1AR93 2D6LX 3FLPA 1PGSA 3G6JB 3HN1A 3KT4A 4Q4Y2 1QF3A 3E6DA 4BM8A 2DFCA 2QQPA 1VB4A 5I8YA 4AFMA 1D4M2 3H7YA 2WFPA 3M1HA 2Q5TA 5BY5A 4CEYC 4CDWB 4QHBA 5L7OA 3VBUC 1IS6A 3AP4A 2PAMA 2ZBJA 1DYPA 5JOXA 2E63A 3K51A 4YGDA 1Z7S2 2R49A 3AP5A 1RUG1 2NMOA 4Y5Z0 5GALA 1W0PA 3S7IA 2ZJCA 1UL9A 3V64A 4JDOA 1PIV2 2PHWA 1RUG2 1VBD3 1BKZA 3MEPA 1PMIA 3MICA 1F31A 4IERA 1SDWA 3IIAA 4EWEA 4JRAA 5JWPA 2D98A 1G8WA 2JENA 2VVDA 1C5HA 1AL23 3NV3A 5D1IA 3ZVXA 1POV0 2BWCA 3IMNA 4IL7A 3ME2A 3PMEA 3D4KA 4XF9A 1NLRA 5JR7B 1WBLA 1TE1B 2GU9A 2LTNA 2X5IB 2R32A 3ZXFA 4AEJA 1AYN3 1GZ9A 4TSVA 2JDZA 2GMMA 2WSUA 4M0NA 1ND3C 3WW2A 2WLPA 3ZFEB 1LTEA 1RJ8A 1RUJ1 4Y1ZA 2MEV1 1G7YA 4DZGA 2VMIA 1V6LA 2O8QA 1C8M3 1AX0A 1ULEA 3AXEA 1S1AA 3JD71 1RUJ2 5E8AA 1QWRA 2D6KA 2MEV2 3LZZA 1YIPA 1BBT1 3JD72 3ZFFB 2B9UA 2OZ6A 1H2KA 5ACA3 4OI2A 1OPOA 3DPRC 5FPZA 5J7MA 2VH9A 4FPLA 2PN5A 4K6BA 3WQ7A 1LEDA 2VECA 4XBQA 2XJTA 1X7NA 3B69A 4KWLA 4C0HA 3ZFGA 4E4ZA 4JV4A 1NZCA 4YFWA 1O91A 4U36A 4Q0SA 3O12A 1DYKA 2HWF1 2XJSA 3PTYA 1MS1A 4HVOA 4GKYA 2CY6A 4QPIC 4YZ2A 4QT6A 1IS4A 5EYYA 3VBRB 2AUYA 4Q1PA 3AFKA 3R4DB 3KCCA 3WW1A 3VDDA 1TNRA 3J9SA 4I09A 2P34A 4MVTA 1OQDA 1C4RA 3BPZA 1ENXA 1HV1A 2ZGMA 3DL3A 1RUH3 2FQPA 5GZFA 1S2BA 4Q27A 1SLIA 2YZ4A 2HWC3 1ND2C 1UAIA 3NV4A 5EJ3A 4I0AA 5CU1A 1KJLA 2ZAHA 1KJRA 2MNGA 2RS11 4FQZA 2KM2A 3ZXJA 1UZYA 1RTVA 3GZTB 2ZABA 2ZHKA 2JEMA 2RS12 2XBO3 3M4FA 4Q4W1 3SCHA 2PHFA 5L7OB 1ZA4A 5I8TA 2XJPA 4XETA 2V73A 1CPNA 4XF4A 2R6QA 3RDIA 1S0JA 1WMFA 4ASMB 4I3PA 1JYIA 1UU5A 4FP3A 4QPGA 4XE9A 1TNFA 1VIWB 1X8MA 1MEC2 3JQWA 4JVAA 1CJPA 3WG4A 3M2MA 3CLPA 2WZR3 4AVBA 1AXZA 1VBC2 1MR5A 2WWSA 4E2QA 3N7LA 4GXLA 1OOPA 1CPMA 4N53B 3KQRA 1RVF1 1RL3A 4YGBA 1LHVA 5I0RA 4IEQA 4K1ZA 4R4ZA 4HSLA 1H8TB 2BTVC 1FXZA 1UPSA 2CYFA 1RUI1 1I5ZA 3CL1A 2RE9A 1JBCA 1UZZA 2CWSA 4D7TA 1BVP1 2WLQA 4F8AA 4AHYA 1RUI2 2NLRA 1XYOA 2ZGOA 4P9XA 4YZ3A 1VBB2 5J3UA 1GSLA 1OKQA 1RUD1 5EXOA 2D5HA 1ZZ8A 3MW2A 4E9KA 3WZ1A 2ZMLA 4AEDB 4IV1B 4FAGA 1RUD2 1J1TA 2JXAA 2TBVA 2R043 1W6PB 1RUF3 3MYXA 3VBSC 5DDJ1 1FNZA 4O9EA 1PO23 3AMNA 1OMIA 2R1BA 1Z0HA 2XKPA 3VBFB 3ZFGB 5CFCC 1YJLA 3POYA 4BLIA 1NA1C 5JSOA 5JZGC 3ETQA 1W6OA 1R1A2 1H1AA 1YXWA 4FPHA 1ZBA1 2WNUB 4WM8A 3S6PA 3WG2A 3VHNA 1G9AA 4YZ4A 1IZ3A 1FNYA 2WNEA 3IPVA 3B02A 3AZWA 1ZBA2 4MGKE 4ZU4A 3VBHA 1B35B 1U0AA 1VAMA 1Y43B 1BQPA 3I59B 5FOBB 2AREA 1YUDA 1UPIA 5C9AC 2I2SA 1H8VA 3KGLA 3MPBA 2I74A 3ECQA 4PDWB 4YVSB 4XFFA 1LKNA 1O4YA 4YGCA 2WIIB 1ZVFA 2RM22 2DUOA 4GMP1 1GKBA 1RMU2 4MSVA 1WMDA 1AXKA 4GQ7A 4B3NA 2VVFA 3THTA 2BEOA 2PHDA 2RJKA 1UU4A 1SBEA 4IEXA 3DUIA 3WP4A 1YNAA 3NAPA 4ONUA 1FYUA 1ULDA 1NYWA 5GZEA 4AHWA 1C5IA 2X53S 4HVQA 2ZGUA 1COV1 3VLBB 4XOGA 1ZZ9A 1CJDA 4WM7A 3ZYJB 1DU3D 2FHRA 3T1MA 4XXPA 1G9FA 2D6OX 5ABJB 1COV2 3RYKA 3PLQA 5KHIA 1RUNA 1CGPA 4XQ4A 3RJ2X 4N43B 4P9IA 4KBBA 5SV8A 2P3JA 5EFUA 2RMU1 1OA4A 4GKXA 5E88A 1RUC3 2IXHA 3WQ0A 3M3IA 2RJLA 1POV1 2GC0A 4RA0A 2IXLA 2RMU2 4NOTA 1TMF3 4HVRA 4LA3A 3RYRA 3ZXKA 4HK9A 4RD7A 4CEWA 3P3NA 4E27A 1MS5A 1R081 1YCIA 4UBGA 3SH5A 1AR91 4AVVA 5E1RA 3WV6A 2ARXA 3HT2A 4XFIA 1R082 3IDEA 1AR92 3L2YA 2XHKA 2IXCA 1D2QA 5DG2A 2HYKA 1NCRA 4Q2FA 4META 4GULA 3DF0A 1REFA 5DZFA 2WS92 4YARA 2Q1ZB 1PZ8A 1M06G 2AR6A 3M7AA 3VL9A 4I01A 1RGSA 5GZGA 3O7OA 1AJKA 1SCSA 1N1SA 2NMNA 2WL1A 2IZWA 3AXDA 5BYNA 1HX6A 4JGYA 4KGQA 5FMOL 1WLWA 4Q8KA 1VBD1 3N7KA 5JOZA 4R9CA 2ZHLA 1SACA 1DZRA 3B9CA 1LECA 5DXDA 3ZXEA 2JG8B 4AQTA 1AL21 3TWIA 5KC6A 2PHLA 4WVWA 1I1EA 4YG6A 2D3RA 1X36A 4AG4A 3E5UA 3RSJA 2EIGA 2QDRA 1HRV3 4MGZE 4QM9A 5I0SA 2ZX4A 4WM8B 3TAYA 5AVPA 2NM1A 4WVZA 2ZTNA 3IPVB 5BNOC 1AYN1 3WDTA 3E6BA 3VBHB 1CAUA 3ES4A 1D2SA 4KWKA 3CJIC 1AYN2 4AGVA 2WQ4A 4B7KA 4Q1RA 4E4DX 2BPA2 3FHIB 4YVWA 4HFSA 2W0XA 4WZCA 1HV0A 3ZN4A 1C8M1 4XBNA 3B7MA 3WP5A 4BLJA 2ENRA 1V70A 2H6BA 5JOWA 1MVEA 2PTMA 5DG1A 1EV13 3SITA 4XF3A 1HKDA 2OPKA 4CDXC 5ACA1 1QOOA 5L36A 3DKWA 4C91A 1H0BA 1NCQC 2RS53 3TBDA 1ZYBA 2YHJA 5FAXA 3ROUA 3NAPB 5ACA2 5BNNC 4LLOA 2DVBA 1XNKA 2YV8A 3KCXA 4QXKA 2A73B 4H7LA 4WZFA 4WM7B 1QQP3 4FOQA 3OBRA 2WA4A 1BVVA 3SH4A 1J1LA 1ZBE2 4AVAA 1D0GA 4CDUC 5FQ0A 1U5YA 4RGAA 2OUHA 1QMJA 4DQAA 2E7AA 2HWD2 2KXLA 3FJSA 3ZIWA 3PVOA 2WT2A 4K7JA 2YY1A 2H0VA 2V5YA 4N7UA 5CFDB 2CV6A 3SCGA 1AR72 4XPVA 3KM5A 5BNPA 5C8CB 2E7TA 3MPPG 1BZWA 4AQ6A 1PK6B 2JECA 3QH7A 1AJOA 1BXHA 5AVAA 2UYBA 1RUH2 1I3HA 4URTA 2HWC2 1UIKA 4P14A 5GLWA 4RQPA 1DGRN 1LOCA 4Q4V3 2WZPP 1Y3TA 2XBO1 3OY8B 2DUQA 1CONA 4XIOA 4DOUA 3E5QA 3U07A 3R0RA 2XBO2 4CDWA 4CP1A 3MFAA 4KL1A 1YO8A 4XFAA 4M3CE 4D7YA 4QQLA 2DF7A 5CG8A 3FX3A 3MLKA 3TN93 3GZUC 3UV9A 5FFOC 2WZR1 2Y38A 3EXUA 5BUVA 2BNMA 4P9LA 3QD6A 4R4XA 4DXZA 1SBDA 1GV9A 2ZKLA 1LOFA 2WZR2 2Z5WA 3IDCB 5KXBA 1MQTA 4B4QA 5AC93 5LRSA 3IM0A 2GN3A 5KHJA 4K20A 3ZDSA 3MIHA 1CAUB 1H1MA 1QJY1 1AL0G 2VOXA 4UW4A 4L99A 1JUHA 3ZSLA 1Q43A 2DUPA 3BB6A 3UJQA 1RB8G 3JQXA 5F5QA 3DGTA 4MXWB 4YVWB 1A6CA 1AR62 3MIFA 3CF6E 1UN1A 3VBUB 4QPYA 4FCAA 3VBOC 3ZFEA 3ATGA 4B29A 2A3XA 5JSPA 3AP6A 4I3GA 3P3PA 1UX6A 5FLIA 4RHV3 1MS9A 4RSUA 2XH6A 3BIWE 4BMEA 4BYYA 4DRRA 3H1WA 2R041 3HT1A 5D8AC 5LK7B 1N3QA 3SISA 1G86A 1NLSA 1PO21 2EXJA 2FZ1A 3ALQA 4I02A 3ZSMA 3U4XA 4ISQA 5DZEA 1QU0A 1R093 3ZFFA 1KS5A 1N1VA 3MZHA 1RUF2 1LU1A 4I2OA 2I07B 3LA3A 1PO22 3WCRA 1VBE3 1LB2A 4DS0A 1BJQA 2ZPXA 1G9BA 1DZTA 3FC0A 2ZOEB 3TRSB 1XYPA 1C57A 1QJX2 2QKDA 4NPRA 5T52A 2VUAA 3NW4A 1ALYA 4C1WA 3VZNA 2Y0OA 4H3WA 4L8QA 3WQ1A 2D6PA 1N47A 2Q1MA 3M8LA 3VZKA 2NPIA 4XYXA 2LALA 4TWTA 2BBVA 4YW1A 1M4WA 1ND3B 2DVAA 4IEUA 5IUQA 3FFZA 2A71A 1EPWA 4WVVA 1W6QB 3R4UA 5AFEA 5T5OA 2HKXA 5FCCA 1O5LA 3VKMA 4XZPA 5IK7A 4DRVA 1O3SA 1LHWA 4AHXA 4S2GA 1PGW2 2N7GA 1HIXA 4W6WA 5K0UC 2NP0A 4HBNA 3ELNA 3O5SA 4F83A 2Z42A 2OA2A 2D3PA 2ZMNA 3HBZA 3H7JA 5C6CA 3D6EA 1IS3A 1DGRA 4IEWA 3MW3A 4LBQB 1KQRA 2A6YA 2O8OA 3O0WA 4N9HA 3DPRB 4RQPB 4NHKA 3FWEA 1OQEA 1EY2A 4Q4X2 5KWRA 2PHTA 4W65A 4HKWA 3WUCA 1H9WA 3VZMA 1DQ4A 2WQZC 1ZZ6A 2KA3A 2E7QA 2P3IA 1OA2A 3MF6A 3RYPA 2DURA 4Y1XA 1CAXA 1FV3A 4XTMA 3ZYRA 2EALA 4ES9A 1RUC1 4F3JA 4XJAA 5FO9B 3SH3A 2P17A 1ZZ7A 2ZS6B 1ULGA 3VZJA 3AP7A 1RUC2 2Q4SA 4G3YC 1TMF1 1VJ2A 5I8SA 4EWDA 2VQAA 4LT5A 1TMF2 2GSYA 4JQRA 1MQTB 2R30A 4YRDA 4CDQC 1KDMA 1KD7A 2X8KA 4JGZC 4B4PA 2A6VA 4N53A 1ND2B 3MIGA 4LE3A 3WW4A 1REEA 1Q8QA 4IEOA 4PBOA 4TYSA 1G9DA 2ZX2A 4C90A 1NY71 1H8TA 2ZX1A 2EXHA 1PO13 3IN9A 3A4UA 1CAVB 1WD4A 2D6MA 1OFNA 3W9AA 4L97A 1K5MA 4YLZA 3UL2A 4B7EA 1GNZA 1V6OA 3DN7A 3VKLA 3C3VA 4Q8LA 2O0OA 4FVVA 1UW8A 4NWWA