2GC1A

The crystal structure of phosphoglucose isomerase from pyrococcus furiosus in complex with sorbitol 6-phosphate and zinc
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
188
structure length
188
Chain Sequence
MMYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Glucose-6-phosphate isomerase
publication title Evidence Supporting a cis-enediol-based Mechanism for Pyrococcus furiosus Phosphoglucose Isomerase
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 39
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature ec 5.3.1.9: Glucose-6-phosphate isomerase.
pdb deposition date 2006-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2gc1A00
5AVPA 2D40A 2GC1A 3GBFA 2OZJA 2PTMA 2K9ZA 3RYRA 2FMYA 4XEZA 2QCSB 1H1MA 2VPVA 2IXCA 4DINB 2E9QA 4MZUA 1OI6A 3EO6A 5FPZA 5I8SA 4QXKA 4YSFA 2D93A 1PM7A 3U10A 3E6BA 3PNAA 5KHIA 3RNSA 5BY5A 5FDBA 4Q0PA 4Q29A 3DKWA 2BYVE 3M3IA 3JZVA 2HJIA 2VQAA 3IDCB 4ZU5A 4EWEA 4LLOA 4I3PA 4XFHA 2PAMA 1XE7A 3PVBB 4LA3A 1DGRA 3H50A 1UCXA 1OFNA 4YRDA 1YFXA 3NJZA 3ST7A 1OD5A 4HVRA 1V70A 2PAKA 4QGNA 5JSRA 4EV0A 2EA7A 2OA2A 4LUKA 4B29A 1VR3A 4H7LA 4I09A 1YWKA 1ZREA 3I59B 1ZZ7A 4HSLA 5EZWA 3O14A 2GC2A 1YUDA 2WC2A 2GC3A 3N4MA 1CAVA 4XF9A 4X6QB 1RUOA 3QACA 4MGZE 1CAXA 4KWJA 2CV6A 5T3NA 3H3UA 1UPIA 1DZRA 4MGYE 4CYDA 5C6CA 5I0TA 4PIXA 2BNNA 3VHRA 4N9IA 4XETA 4IEQA 3LAGA 3EJKA 3QOPA 5KHHA 1NZCA 2EVXA 4AXOA 2D5HA 2PQQA 4EWDA 4KU8A 5J7MA 1Q5OA 2MHFA 1UIKA 3WW1A 4OFGA 3DV8A 2IXLA 4HVQA 1QY4A 3E5QA 2CAUA 5D1IA 2B8MA 1QWRA 3LA3A 3UKNA 5I93A 2ZKLA 5K8SA 4HSJA 2K0GA 3CO2A 2I45A 1UIJA 1RL3A 3RPQA 3ES1A 1YLLA 3S7IA 5I0UA 5FQ0A 4Q0QA 3PLQA 1J3PA 2C0ZA 1CX4A 2H6BA 3LA2A 4IEYA 3LZZA 3EHKA 3H1YA 5BPXA 2O1QA 3SCGA 1O7FA 2ETEA 4IEXA 2GAUA 4IERA 4LUMA 4O9GA 2ATFA 3H9AA 4XFFA 1RC6A 1LR5A 4X6RB 2O8QA 3D82A 5CVRA 2CAVA 3KCCA 1I6XA 5J3UA 4D7TA 4YYOA 4RD7A 1O3SA 2ET7A 4XF0A 3H7YA 4WZCA 3LOIA 1OMIA 2Q1ZB 4D7SA 1YFUA 5I0SA 1CAUA 4XFBA 1ZZBA 2MNGA 2B9UA 3TNQA 2F4PA 2GU9A 2EAAA 3IIAA 3LA7A 3FE5A 1IPKA 4AQ2A 2QVSB 4OLLA 3HT2A 3FJSA 2V09A 4PJYA 4LEJA 3MZHA 1WGPA 4AQ6A 4WVZA 4QX5A 3ZDSA 2XL7A 1VJ2A 1Y3TA 2P17A 5FCCA 4TLFA 1Q3EA 1CAWA 1LRHA 2ET1A 4XFIA 3NW4A 4KWLA 3SHRA 5JAXA 3BPZA 2WFPA 4Z82A 2FQPA 5E16A 3DN7A 3DL3A 3G7DA 3KMHA 4XF3A 1Q43A 3HT1A 1FT9A 3D0SA 2IC1A 3E5XA 1SQ4A 2IXIA 4F7ZA 4FT8A 2Q0AA 2XLGA 1QXJA 1WA4A 2PHDA 1ZRRA 1O5LA 3KGZA 5JR7B 5F1RA 4KU7A 5JSPA 3ACLA 1J58A 2UYAA 5LRSA 3IDBB 4IETA 5BV6A 3FX3A 3I54A 3CEWA 2Q30A 4HBNA 4XFAA 1PMIA 3CLPA 4META 3GYDA 1O4TA 3WW2A 4IEWA 5HI0A 4HN0A 1EPZA 2BNOA 4IESA 2HKXA 5I0RA 3EBRA 2VECA 2XL9A 4J1WA 4P9GA 1JUHA 3NVCA 3ELNA 4ZU4A 2N7GA 4Q0VA 4BHPA 5I91A 4QMAA 3UKTA 1EY2A 1NXMA 1XRUA 1O5UA 1FXZA 3MPBA 4K8FA 3R6SA 1J3RA 1ZRCA 3FFQA 3B02A 4XFCA 4Q0UA 1NE4A 3U0ZA 2XKOA 1XE8A 1L3JA 1X82A 3KGLA 3CF6E 4HN1A 1CAVB 4BH9A 3SCHA 1CGPA 1CAXB 2BGCA 3CJXA 4IEVA 3TNPB 3IWZA 4R52A 5FLHA 3WW3A 3H8UA 4JVAA 3S0MA 5LRRA 3BU7A 4R8HA 4I0AA 1HW5A 1YFYA 5KBFA 1X7NA 3WW4A 5BUVA 4Z07A 4KL1A 5EFUA 1WLTA 2Y0OA 4MGIE 1O3RA 1DGWA 5LEJA 1J1LA 3MDPA 4XF4A 1ZX5A 1ZRFA 3OTFA 4MH0E 4HMZA 2CGPA 1I5ZA 5JSOA 3OD0A 4UBGA 3ROUA 3KSCA 4ORFA 1H1IA 4HZFA 3UKVA 3U11A 4YARA 2H6CA 4E2GA 2XGXA 3I59A 4MUVA 3OCPA 4N9HA 4PIZA 1RUNA 2PFWA 3LWCA 2UY8A 3NL1A 4KWKA 4EWAA 5KHGA 2Z69A 3RYKA 3OF1A 1SFNA 4O9EA 3M70A 5E1RA 4AVBA 1ZVFA 1ZZ8A 2PYTA 4UXAA 3BCWA 4LTAA 3E6CC 3FZ3A 1NYWA 1SEFA 4BYYA 1X8EA 5FQ0B 1J3QA 4LULA 5I8YA 3EQEA 2PAEA 1ZRDA 3RZZA 4E2SA 3HQXA 4LA2A 2MPFA 2XHKA 1RTVA 2OPKA 3I7DA 4GULA 4EROA 3H3ZA 3NKTA 2OYZA 1U12A 2QJVA 4FAGA 1ZNPA 3S7EA 2GC0A 1YFWA 1ZZ9A 2UYBA 1GQGA 4L11A 4JTOA 4WBBA 2IXKA 3E97A 2XLFA 3ES4A 4QM8A 4IEZA 3RDIA 1RGSA 2BEOA 2IXJA 2QDRA 5CADA 3E5UA 3FHIB 1UW8A 1LB2A 2IXHA 4IEOA 1UD1A 1CAUB 3BB6A 1G6NA 4NVPA 4BIFA 3CL1A 5KHKA 4F8AA 1TQ5A 2D5FA 4QGLA 2UY9A 3MYXA 4JTNA 4YNIA 3HIFA 3SXWA 2XLAA 4HVOA 4ONUA 1GQHA 2GZWA 4QM9A 4XFGA 1O3QA 4L2NA 1FI2A 2H0VA 4UBHA 1CAWB 4MX3A 3H1WA 2KXLA 1YHFA 1J59A 3SCFA 1VP6A 3H1MA 5J48A 1LKNA 4HLTA 4I2OA 4A2UA 1O3TA 1IPJA 5I8TA 1DZTA 5FLIA 1QXRA 5BXXA 3ETQA 4I0BA 4J1XA 3FWEA 3H7JA 4E2QA 1ZZCA 1EP0A 3E6DA 3D0JA 1X8MA 3OGJA 2DCTA 2QNKA 2PA7A 4MV2A 5LEKA 3SMHA 3C3VA 2Z2SB 4PIYA 4QGMA 4IEPA 2OZ6A 2GH2A 2PHLA 5JCTA 4ZU7A 3RYPA 2BNMA 1NE6A 3IBMA 5FLJA 3NSTA 1ZZ6A 5C8WA 4JV4A 4IEUA 2ZCWA 4Q0SA 3USSA 4FBFA 4AVAA 2XKPA 4I01A 2B5HA 2Q4SA 3L2HA 4AVCA 5CU1A 4FAHA 1EYBA 1Y9QA 4I02A 4MGKE 3BALA 5FPXA 5KHJA 4XF1A
chains in the Genus database with same CATH superfamily
5JIAA 4K21A 5DZEA 2NPIA 1GWKA 1W2AX 1BZWA 3RYRA 3T08A 2AENA 3ZFGA 1GSLA 5FPVA 1SFYA 3WDXA 3PVNA 4BQWA 1WBLA 3VUOA 3RZLA 2WNUC 1ND2B 2VPVA 3AMQA 4XBLA 4ISRA 3JU9A 1MS4A 2WLPA 3BPSA 2HWE3 4MZUA 3IMMA 3EO6A 1C8M1 1W8NA 5F5CA 1JOPA 1RVF2 2VZUA 3UYJA 1PM7A 3DXTA 3E6BA 1FMD3 3OGGA 5KHIA 1QF3A 2VVDA 4Y20B 1DYPA 4O61A 3WDTA 5FMDA 4EN6B 3AFKA 2XUMA 4Q0PA 3IPVB 1NOVA 1C4RA 4Q29A 1GZ9A 4IGQA 5DDJ3 5LASA 3DKWA 1HRI2 2OT7A 2H0BA 3RQ0A 2VQAA 5FTTC 2VVFA 1A6CA 1QQP2 1TME2 4QQHA 5CFCB 2A70A 1GP5A 2Y34A 4BA6A 5LCWL 3APBA 1QJU1 1V00A 2MEV1 2R1DA 2JDUA 4XFHA 3KD4A 2PAMA 1XE7A 4FFGA 1YCIA 4BB3A 5KXBA 4KWUA 3EXUA 1CIYA 3VBUB 1V70A 5JSRA 4YW1A 1Q8OA 5AC91 2C4XA 3VBOA 1HB1A 2EA7A 2XH6A 5BNOA 2FZ2A 4B29A 4H7LA 1YWKA 2RR11 2YB7A 1R091 3CU7A 2JG8A 2ZA9A 2EXKA 3I59B 4JCKA 1HB2A 4NWWA 1S0EA 4OHVA 5BYNA 5EZWA 4I3GA 1VMHA 2WQ4A 1C8M2 3WG4A 4XMIA 2NMOA 2VCMA 5L73A 4OI2A 2VAUA 2P4EA 2A5ZA 4HPKB 2WYFA 1XNTA 4LOSA 4BOWA 2C9AA 2XVGA 4KWJA 4NPRA 3B01A 1DBNA 4UFKA 5BNNB 4GD4A 2BOIA 3LFIA 4L8QA 4N43B 2DTWA 3CHXA 4FFIA 2VUJA 3H3UA 2W3JA 5C3QA 2W92A 1DZRA 3VBOC 4Y1VA 5CB7A 1S0JA 5HXMA 2VMIA 5C7GA 5JOZA 3OD4A 5A6XA 2P3IA 3WNXA 4BK5A 1QJU2 2MEV2 1PX4A 3AZZA 5EJ3A 2QQNA 2ZGTA 4Q8KA 1AX1A 1KS4A 1NZCA 3LEKA 4MADA 3ZLIA 4AXOA 2CNAA 2D5HA 3OPTA 4HANA 4IUGA 5FYMA 5AC92 1Z78A 3LDRA 3VDAA 4D8MA 5C9AA 4QPWA 1BBT3 1OUSA 2YDEA 3IN9A 5FP3A 4AAXA 2JG9A 5CAZA 2RR12 3D6EA 1R092 2RG4A 5IVYA 1PNFA 2A3XA 3AL5A 4N8MA 2IXLA 3TEXA 1I1EA 2YZ4A 1MS3A 1QY4A 3GCWA 1OA3A 2CAUA 3AYCA 1QWRA 3P5BA 1RUH3 5EWSA 1W9FA 1WMXA 5K0UA 2V4VA 5K8SA 2K0GA 4IV3B 1S55A 4N7IA 2I45A 1UQXA 4ZPIA 3LSEA 3OB8A 4YZ5A 1XYOA 4QWNA 4AYUA 2VMGA 5C9AC 3AZVA 2J1AA 4QHOA 1RL3A 4Q2FA 4NHMA 1BQPA 2YGLA 1JN2P 5LATA 3RPQA 2A75A 3K75B 4FPLA 3UJQA 4CEYB 3PHMA 3S7IA 1MS5A 5I0UA 5FZEA 3T30A 3IMNA 5FQ0A 4JQRA 3KVAA 1J3PA 1L7RA 2C0ZA 1I3HA 5C8CA 2R1BA 1DYOA 2WO3A 1F5JA 3PUIA 5K0UC 4XYXA 3WNLA 5GKAC 1Y4WA 1MQTA 4IERA 1XC6A 3NAPA 3OYWB 4IE6A 3ZKUA 5B4NA 1GOGA 2CGNA 3OOXA 5FZIA 3K4DA 2ZHLA 2ATFA 3TB0A 4CDQA 3AZWA 4URAA 1QJY1 1LR5A 2VC9A 1RYYA 1LULA 2C26A 2JWPA 3B94A 3RJ2X 5CVRA 2CAVA 2FZ1A 1H2NA 3KCCA 1I6XA 1QNYA 1XSRA 3ZSMA 4A4AA 2O8OA 3PTRB 4RD7A 1PMJX 1ZYBA 5DZGA 3ZDVA 3LEMA 1W03A 4V2WA 1VBD1 3H7YA 5AFBA 2QQVA 3LOIA 1AR71 4JGYB 2Q1ZB 5FOJB 4QQOA 3AXDA 1MQTC 1KQRA 4QDSA 5I0SA 2OIIA 2HBTA 1PIV3 2QQLA 2VMDA 1QHDA 2F4PA 1LHOA 5CIRA 4O7XA 2F6BA 5A80A 4CDQC 5FO8B 1GZTA 4R9BA 1AXYA 2RDRA 3LA7A 1WW6A 2B7YA 2QVSB 5FPUA 3MZHA 5JWPA 1SBDA 3BYWA 1DGWX 2IVJA 1JHJA 3HOBA 1DLLA 4A42A 3C8XA 4AI9A 1Q3EA 3ZOIA 1LRHA 4AEDC 1CR7A 1QJY2 4W6WA 5A70A 2Q8EA 4TLGA 1UMHA 2JB8A 4MOAA 1SPPB 4LKFA 5D21A 3T1MA 3DL3A 5HCBA 3ASIA 5LB6A 4NR1A 5DUUA 5L7OA 4XJAA 1ULGA 2PELA 5FZ1A 3AMNA 5FKCA 2VW2A 1UY1A 4P08A 5CZKA 4QHBA 1EAH1 4IQPA 1VBD2 5FV3A 3ZFFB 3ZR5A 3WT3A 1Q8VA 1AR72 1ONAA 4BMBA 2IXIA 4CDWB 4GMP0 1C8NA 4COVA 4XQDA 5JLVA 3VBFA 3BIWE 4XIKA 1AXZA 5FZLA 5JSPA 2BFUL 3ACLA 4AFAA 1DIWA 1LU1A 2BJSA 3PTYA 4PI0A 3PUSA 4ASKA 1NZIA 3I54A 5J09A 2J1VA 4FTBA 1CZVA 1M06G 3KB5A 5JXHA 3ZXLA 4BQXA 4XDOA 4BCUA 4META 2W0XA 1P8JA 3GYDA 1TNRA 5GLWA 3ZN6B 1W8OA 1O4TA 3WF1A 4QQPA 1MVEA 3IDAA 2A6VA 3TAYA 3O5SA 3S6PA 4ASMB 4BLIA 4HN0A 1ODMA 2I2SA 4NHLA 1GQPA 3RG0A 2WSUA 3AVRA 1OLMA 1JHNA 3BKZA 2A1XA 5G05L 1UMZA 1JUHA 1LHUA 2X09A 4NJ4A 2WZ8A 3ELNA 1XNAA 4ZU4A 1AXKA 3M3CA 4BHPA 5FMOL 1UOBA 1EAH2 2OXBA 2WN3A 3N9LA 3J8F3 4DFSA 3LPGA 1XRUA 4KMQA 3RFRA 3VDBA 1JYCA 1FXZA 5A3PA 2HBUA 3MPBA 3PU3A 1GZCA 1SBFA 4K8FA 2ZZQA 5FYSA 3VZOA 3ZXEA 2D3SA 3PL0A 5IK5A 4Q0UA 3WF0A 3U0ZA 3FMGA 3AP6A 1L3JA 5A1AA 5HV4A 4ZS2A 4XCBA 1COV1 3MI8A 3C2UA 5JR2A 1VAKA 1BVVA 1C57A 4KBZA 2WWJA 2XJVA 1ND2A 4BH9A 4IXLA 2WWSA 1IS3A 2RM21 4CE8A 4UW3A 2BGCA 4IEVA 3NJYA 1RUC3 2VBDA 3U07A 2QZ2A 4L9BA 1K45A 4HOOA 2RS13 1JOJA 1WLCA 3WW3A 3MIHA 4HL0A 4JQTA 2CDOA 4Y20A 3GNEA 2LTNA 4N53B 4XE9A 3S0MA 1LHVA 3WXPA 2BPA2 3ILRA 4XTPA 4WM7C 2ARCA 3IPVA 4I0AA 1HW5A 1S2KA 1SBEA 5KBFA 1ND3B 2CTVA 4KL1A 4FOWA 1ENXA 2AEYA 3VKFC 1WLTA 5CFCA 1XNDA 1ND2C 1DGWA 4HONA 5FPBA 5LEJA 1MR5A 5C5TA 2J1RA 1AR63 2PN5A 3MDPA 4XF4A 4B4PA 4ES9A 2KD7A 1DP0A 4MH0E 1RXGA 3N7KA 1E57A 3OD0A 3ROUA 3SLIA 3T3YA 3WOGA 1UWWA 5LBFA 3VBUA 4ORFA 2I74A 5A6ZA 3O1OA 4AW7A 1COV2 4HZFA 4ET7A 2ERFA 1KGYA 3DF0A 1BKZA 3U11A 4YARA 2QDNA 2VJXA 1RUE3 2ZS6B 4YW3A 4YZ2A 5IATA 4E2GA 1C5IA 2XGXA 3FL7A 3AX4A 3I59A 3KS7A 1H2MA 2RM22 3OCPA 4MUVA 4MXWB 4YG3A 1WCKA 2UY8A 2WINB 4RGGA 5CFCC 1GFF2 1UZ0A 2FBEA 4AVTA 4E4SA 3RYKA 5JMCA 4HPKA 4OHXA 2DF7A 2BVVA 5TSWA 3M3OA 4LO8A 1ZVFA 1ZZ8A 3LD8A 4L97A 5F5AA 4GAZA 5BNNA 3E6CC 4L0PA 4YLZA 4N43A 4JAAA 3UK9A 2VR4A 2FDHA 4XIOA 2JD9A 3WG1A 2PHWA 4LULA 4CRQA 4Q4W3 1UX6A 2VZTA 3GALA 5FZ6A 3HQXA 2DWRA 2GN3A 4OUSA 4NN0A 2OPKA 4OHYA 1GP4A 4YG0A 1SMVA 2B39A 5C3OA 4JX0A 1H6YA 1C5HA 4OULA 4PLMA 1GNHA 3NKTA 1MZFA 5JDBA 2DU1A 2WYSA 2QJVA 4CDUC 2A6WA 3V0AA 1XSQA 2UYBA 3A7QA 3F95A 1JU4A 5BNNC 3RZJA 3K4ZA 3JQWA 2IXKA 3R0RA 1SLCA 2VCBA 1S0FA 2XLFA 3ES4A 4N43C 4IEZA 4XJ8A 2ADEA 4YM1A 2ZGQA 1OPOA 2BEOA 1V9U1 4CUGA 2SBAA 1W6OB 4RFRB 3M1HA 3CBNA 3SQOA 4A45A 5FYIA 2W9XA 3ZSEA 4AFBA 4GQ7A 3ME2A 2D6PA 2WZR3 4M0HA 3THCA 2IXHA 2J42A 4IEOA 2XQRA 2D6KA 2W94A 3Q8AA 5FMOS 4HG6B 4DY5A 5C70A 3ENRA 2VZRA 1UMIA 4FPOB 4IV3A 1BBT1 2Z4FA 1EUTA 1RIRA 4EN0A 3LSDA 3L9JT 1TQ5A 3TEZA 2VH9A 4QGLA 3RWNA 3MYXA 1GOFA 4JTNA 5FY5A 3SXWA 3HIFA 5H9QA 2XLAA 1HXS3 3I2KA 4HVOA 4RR3B 4CEYA 1BJQA 5FXWA 3RZKA 2GZWA 1O3QA 4QXCA 1YXWA 1RUH1 2Y60A 3H3LA 2FDJA 3NNGA 3SH3A 4P9IA 4UBHA 4XZUG 1CAWB 3KCXA 3OPWA 4GKYA 4MX3A 2CU5A 1LEDA 2IFRA 3KHBA 2B9VA 5EV7A 4FXGB 3OYWA 5FK7A 1LHNA 2KXLA 4IV3C 5F6LB 5LBCA 2WA4A 3T2QA 4ASLA 1NX9A 3NV2A 2B46X 3WF2A 4BMEA 4XUNA 1V9U2 3KF3A 2W1WA 5J37A 4G3YC 3VD7A 3F2ZA 1QU0A 1MZEA 1H9PA 4KG0A 2QQMA 4CEYC 3S57A 3CKHA 3ACGA 4Q8LA 2XPJA 3VBSB 4AL9A 4ZXEA 5I8TA 5FR3A 3QBQA 2VZ1A 4I0BA 3ZXJA 1Z7S1 1ZZCA 2Y6KA 4A7YA 3E6DA 1X8MA 1BBT2 2UWBA 4YVWC 3IT8A 1W6QB 3AYDA 4JGYA 5E8AA 1HQLA 3POBA 3M3QA 4OHWA 2ZMNA 5FYBA 1IKQA 1H30A 5LEKA 1IPSA 2WJSA 4PIYA 4QGMA 3W58A 4FTSA 3HEIA 2W08A 1RUH2 2QBXA 3IAQA 1A8MA 2R6QA 2VZQA 2YYOA 4LBJA 4K20A 1YQ6A 2ID4A 1G8WA 2QQOA 3MBWA 4ES8A 5IVVA 1HN0A 4YZ4A 1ZZ6A 2KR2A 1PVXA 1SLLA 1YEWA 1W0NA 4V2VA 2BOJA 4IEUA 2EICA 2ZCWA 1ENRA 4Q0SA 4Y1YA 3T09A 1XQNA 1PIV1 1WMFA 1ZM1A 2XKPA 4YW5A 4JGYC 3VL9A 2Q4SA 1X9TA 1SPPA 5J1XA 3O1PA 3L2HA 2W87A 3WDUA 4E9KA 1JI6A 4J6GA 1OQDA 3VDCA 1JU3A 4IW3A 1Y9QA 2QZ3A 4YPJA 3WD5A 5FP7A 3HWJA 3RMYA 3BALA 1VRBA 5IHRA 5C3RA 1Z7S2 1EUUA 1O4ZA 4GWMA 2ZEXA 2X53S 3ZFFA 2WKKA 2D40A 3HAGA 4UFJA 5A6YA 1POV3 1BEV3 2TBVA 2YFZA 2BP6A 4GWJA 4XAEA 1CIWA 1KS5A 2YPDA 2CDPA 4CDWA 5FY9A 4BU2A 5A7QA 4XEZA 4QPGC 2D6MA 1AX0A 3V65A 1IOAA 3HBZA 4BK4A 1H1MA 1HRV1 3C7FA 1H4GA 1C1FA 2AYHA 4DB5A 2IXCA 4CU6A 3GZAA 1ZA7A 1DF0A 3DEMA 1IKPA 4LO6B 5FZ7A 1BLZA 5I8SA 4QXKA 4YSFA 5LA2A 5C3PA 2CWSA 3U10A 5C71A 4AEMA 3LIGA 1JYIA 3GF6A 2HLEA 2P34A 3MV11 3ZN6A 3K4AA 3PVEA 3W9AA 1PMHX 1PIV2 4UYBA 1TMF3 1D0GA 4AFMA 1RUNA 5LBBA 2WFF3 4QXHA 5JXIA 3U78A 1QIQA 4Q4Y3 2VNOA 3DPRC 1KFXL 1OQ1A 2VXJA 3ZSKA 3NNMA 1JMUB 1DHKB 4FI9A 1C3HA 5E89A 5ANQA 1K42A 2Z42A 2LM3A 2ZABA 5A33B 1YQ5A 5E6HA 2BBVA 2IUWA 4ITCA 3N9PA 3ZXDA 1YQ8A 4LA3A 2WAOA 4D69A 3UNPA 1UCXA 2ZAAA 2UWAA 4Q27A 4YM3A 2YC4A 1E5IA 1HX6A 3RMXA 4EV0A 2ARBA 1UXZA 4AEDB 1GZWB 4R4ZA 5DUWA 1HRV2 3FUQA 4BM8A 1VMFA 2VTFA 4HKWA 4YW7A 5EP9A 2NN8A 2BU9A 1LOFC 2D6LX 4XDQA 1DQ4A 5A7OA 1GWLA 1UZWA 1YUDA 1Q8QA 2WC2A 2GC3A 3I3QA 3SC7X 4BDVB 3WP5A 1XXNA 2DUPA 4BE3A 1LODA 1I5PA 4X6QB 3CZUA 1IS4A 3N9QA 4MGZE 3VKNA 1RUOA 2BGOA 2UU8A 3NRUA 2VD7A 3UGFA 3WF4A 4NUBA 2Z79A 1ZBE3 3KT1A 4LOTA 2R16A 4XILA 2VXRA 2R061 3I3MA 3LEGA 1UPIA 4MGYE 3J26N 4N53A 1NLSA 2ORXA 3ACHA 3KZ4C 3POJA 2XJSA 2BNNA 4PIXA 3VHRA 3ZM8A 4XUTA 1ND3A 1O91A 3JD71 4XETA 4OYUA 3UV9A 2QKDA 1VRH3 3LAGA 3QOPA 1HV0A 4LHKA 2VUDA 1XYPA 1RUC1 1K12A 2ZPXA 1JZ2A 1GLHA 2EVXA 2ZEZA 1VBC3 2PQQA 1AR91 2RS11 4LIUA 3RZGA 5GLTA 2HH9A 1FAYA 3RJRA 1AX2A 1SCRA 4ZXKA 2MHFA 1PM4A 4OFGA 5FZ3A 3FHQA 4XJUA 1OFSA 5ERLA 3WV6A 3LEIA 3V0BB 4I2OA 2VOXA 5FZDA 4FOVA 4N53C 1OXCA 2YHJA 5D1IA 1URXA 1B35C 5A3OA 1ND3C 1SLTA 3QCWA 4MXWA 4Y1UA 3AYEA 2P3JA 2W95A 4I0WB 2PQSA 1PVC3 2ZGOA 4DS0A 3CO2A 1V6JA 2R062 3C7OA 1UF2C 5DUXA 4OQ8A 4PLNA 1PO11 1XYNA 3WX5A 1YLLA 4PF1A 4LKSA 3JB8A 2G4IA 3MIDA 1SHWB 1ST8A 3I2HA 1MVQA 3JD72 3NWKA 4Q0QA 1RMU1 2OKXA 2FDIA 2VVEA 4AZZA 2H6BA 3PU8A 3LZZA 1RUC2 2ZKNA 1QDOA 1DGRN 3EHKA 3H1YA 2JDHA 3BTXA 3FBMA 5CBLA 1AR92 2D6OX 2RS12 4LITA 5ACA1 1O7FA 5IT6A 4IE0A 1DCSA 2GAUA 4YGEA 4D94A 1SACA 3WCRA 1LESA 3EYPA 2WA3A 4HT1T 2GALA 5FYUA 4GJZA 2BRTA 4JHTA 1CESA 1NT0A 2JKBA 5IK8A 2A6XA 1ZRIA 3D82A 1W8UA 4WM7B 4DOUA 2XR4A 1PGW1 1TZOA 4XVHA 1ENQA 2WS91 4EZ4A 4D7TA 5HCFA 1W6OA 3ZXKA 3AMPA 5J36A 4GJYA 2ZAHA 1W2TA 2YBSA 3BOPA 4PT6A 3S30A 4CZSA 2LRPA 5FUPA 2AZ5A 5FK8A 1L7QA 1LU2A 5H9PA 4L92A 1W2UA 1PO12 5IFTA 3VKLA 4MO3M 1YFUA 1ZZBA 5F39A 2Y26A 5EQUA 3IIAA 3AKPA 1AYN1 1IPKA 1RMU2 2WNOA 4OLLA 3FJSA 4AHXA 2V09A 4CUBA 4DEVA 4RR3A 1ZA4A 5E88A 4WVZA 3AB0A 4AG4A 4QKNA 5ACA2 3ZDSA 1AZDA 2WZR1 3LE0A 1Y3TA 4XOGA 2ES3A 2BERA 5T5PA 4FPHA 4QPIC 1PGL1 4XTMA 1CAWA 4ATFA 3RRDA 4KWLA 2BWCA 4D6RA 3GDBA 1NLRA 5FP8A 1PNGA 5I0DA 3WQBA 5EIYB 1LECA 1PGW2 1HN1A 1KDMA 1A34A 1QH6A 4XHBA 4XXAA 3VHPA 1VBA3 5IUQA 5IVFA 1MS1A 1ULFA 1HXS1 1B09A 2WS92 3KMHA 1NQDA 3M3EA 5FBJA 4BQ1A 1MZ6A 1XNCA 1FT9A 2Q1FA 1XJAA 4A3ZA 2AACA 4RR3C 3ZFEC 3GHMA 5FRAA 3VBSA 3ZMOA 3E5XA 3ILFA 1SQ4A 4FT8A 1HIXA 3QH6A 4XJZA 2PHDA 4MHRA 1X9PA 4CDUB 1Q56A 2GNDA 2O0OA 3KGZA 3GJAA 4KU7A 4NIHA 4ZHNA 3AVSA 2UYAA 1W6QA 1LAJA 3IDBB 2VO5A 1AYN2 2XJQA 4IETA 2CSGA 2Q30A 5A3LA 3ZN4A 2P37A 5L9RA 3RI9A 1BK1A 5JOYA 2G1MA 4ARXA 3CJIB 5A32B 3ZVXA 2P2KA 1WD3A 2JIJA 3CLPA 2WZR2 4LMFA 5EJZB 2Q8OA 5C4WC 1PGL2 2JKXA 3EMRA 4J25A 3WW2A 4COUA 3VBSC 2RMU1 3WP4A 4YZ3A 5T5OA 4BQ5A 3KT4A 2DTYA 4YFZA 3DYPA 3UT0A 5C33A 2BNOA 4P9XA 4IESA 4DEQA 1HXS2 2ILMA 3MLKA 1MS9A 2O14A 4DUVA 3RI8A 3ZXGA 3OGSA 1IHMA 1SLIA 4BWOA 2N7GA 3VZNA 2X8KA 1KEXA 2UWCA 2W2IA 3FFZA 4CEWC 2DDUA 4NWVA 2VCCA 2PHFA 1ULPA 2JE7A 4OMCA 2PHUA 4FPEA 5IAVA 4Y26A 1V6LA 4COZA 1UO9A 1VB4A 1W8HA 3R6SA 2GNTA 3BI3A 4PCRA 1NA1C 1J3RA 1RUD3 4TZDA 1D0HA 2D6NA 1K5MB 1W04A 1NE4A 2HEWF 1UOGA 2FD8A 1U0AA 1XB9A 1JZ3A 1X82A 1MEC3 3KGLA 4QQLA 2BVBA 1CPMA 4HFSA 1GANA 2VOVA 4WVMB 2GN7A 4A6OA 1ULDA 5CFDC 1CAVB 3SCHA 5SV8A 4R9DA 4IGPA 3AJZA 1VALA 1CAXB 4LBMA 3I3BA 5B4XA 3TNPB 1N47A 1HQNA 2NLRA 4NMIA 5D8AC 2CL2A 4OI1A 2RMU2 4R52A 2OQ7A 3J7NA 2Y6HA 1POV1 1BEV1 2YMZA 2DVDA 1RUI1 3H8UA 1FPN3 5FLHA 5FZHA 2A6YA 4JVAA 1LOBA 2PLV3 4YVWB 1XNBA 3ZYRA 3IM0A 3BU7A 4R8HA 5EXOA 4XACA 2HWD3 4LE3A 1AHSA 1X7NA 3WNKA 3WSOA 3MHZA 1Q8SA 3AP9A 3Q9OA 2DURA 3HPNA 1J1LA 5A33A 3ZYJB 3AK0A 3LF7A 5FMBA 4PLOA 1S2EA 1ZRFA 1MACA 4R9CA 4B4QA 1I5ZA 2GSYA 5LK5A 1UAIA 1TMF1 2OPWA 3KSCA 5IK4A 1H1IA 3OBZA 2WFF1 2CWMA 2VL4A 4P9YA 1GZWA 4PBPA 1DYKA 1ALYA 1AJKA 2VOKA 4Q4Y1 4YW4A 1O4YA 5FWEA 3RGBA 4UWDA 4BLJA 2XMLA 5A3MA 1FOD1 1WKYA 4AK3A 1WW7A 4N9HA 1IG0A 2ZHMA 3HJRA 3AJYA 1D2SA 1V6IA 2JDYA 3MFCA 5KHGA 3KV5A 2A73B 1WZXA 1BEV2 3OF1A 4O9EA 1RUI2 1QDCA 3A23A 2E63A 4NRPA 2PYTA 3R4SA 2WO7A 4WVWA 1U5XA 2D3RA 2B4KA 2J1EA 3W5MA 1RINA 4QPGB 1YIPA 1QOOA 4BYYA 5LZ6A 1X8EA 4Q4X3 3JBG3 2K46A 1J3QA 2TNFA 2FCUA 5FFOC 5JUVA 2XG3A 4B7EA 3URFA 5JIUA 5JMOA 2R041 4PF5A 4F3JA 1WCDJ 4QKFA 4CU8A 1RB8G 4XJ9A 3V56A 3N9MA 3T4HB 2D7FA 3VHOA 1TMF2 3GZTB 3HMYA 2A6ZA 4CCMA 4LBOA 3S7EA 3VB9A 4LR4A 2ZXQA 1ZZ9A 2WFF2 3BOWA 1HDKA 4Q4Y2 3E97A 2W68A 1FOD2 2AUYA 4W6YA 3RDIA 3A22A 3DPRB 3CNAA 4URTA 1Y9GA 3V0BA 1LCLA 4NPLA 1YRZA 2QDRA 4GWIA 3WQ7A 2RV9A 4LO5B 4TXWA 1JYNA 3PMSA 1VRH1 3B5LB 4W4ZA 2ENRA 3KV4A 3MW2A 3E5UA 1H8VA 1PK6C 4OQ9A 2AREA 3BIEA 1VBC1 1UD1A 1CAUB 2OQ6A 1W90A 3MF6A 5KXDA 1UY2A 4CP9B 1YYNA 5HCAA 4S2FA 1ASJ3 3DUIA 2ZGSA 3A0KA 1RUG3 4NROA 3AL6A 3I8TA 5LK7B 1YIFA 1AYM3 4YNIA 5LA0A 4K1ZA 2JEMA 5GZDA 5JI9A 2E32A 2R042 4LNVA 3ZN5A 4QM9A 1QJX3 2QFEA 5FWJA 4CDXC 4QX0A 2AC1A 1GNYA 3N36A 2D44A 4L2NA 4CCJA 2H0VA 1JYXA 5GLVA 1HLCA 1WW4A 3WP6A 5CKNA 5GZEA 1JUIA 1A8DA 1PVC1 4GB33 3V64A 3WF3A 3MIFA 4CCNA 3VKOA 2JDKA 1NCRB 2LS6A 2VQUA 4CA9A 2EXJA 1DZQA 1GYKA 1YHFA 4QDRA 2R30A 2XJPA 1J83A 1QJFA 2VZSA 4A7ZA 3AP4A 2RS33 1GNZA 1BXHA 4UT5A 3H1MA 1AR83 4CCLA 3NNFA 4WM7A 5J48A 5DUVA 2NP0A 4K9SA 1N3PA 1MZ5A 3M7AA 5FREA 5FUIA 1QH7A 3WQ0A 4A2UA 1O3TA 2D3PA 1VRH2 2JXAA 4RHV3 5GM0A 2RS51 3O1RA 4MGTA 1DZTA 3T2TA 5JOWA 1VBC2 5APAA 4J1XA 4LHLA 4E2QA 3OGRA 1EP0A 4B7KA 1ZBA3 2R073 2DCTA 4JGZB 4C90A 5GLUA 5G04L 1OKOA 4K6BA 3J7MA 3O0WA 3O1VA 2PA7A 2GNMA 3D4KA 4MV2A 2L9LA 5FPLA 3SMHA 3C3VA 1UYPA 4OZXA 3WDYA 3RZHA 4MG2A 5A3UA 2OZ6A 2PHTA 2V5DA 3MFAA 2W1SA 3WNOA 5L9BA 2GH2A 2PHLA 3MUZ1 5F6KA 3WNPA 1B35B 5KXEA 4FCAA 4LORA 2WO2A 1NE6A 4A3XA 1PVC2 3IBMA 1IQAA 5FLJA 1YNAA 4RN5A 2PHXA 3NNJA 2HWE1 4LKDA 4B1MA 3E1F1 2LUWA 4C0BA 4DUXA 4JV4A 4NE9A 2JDAA 5FZKA 2F4LA 1ENSA 1VMJA 3GGLA 1FMD1 4MHUA 1CVNA 3AKQA 5AVAA 4CU7A 5F3GA 5JZGB 5FOBB 1EPWA 3T4VA 1S0IA 2WT1A 3PUAA 1F35A 2QTWB 2P1BA 2RS52 3N7LA 4QDQA 5DDJ1 1EYBA 4FAHA 3KM5A 4BIOA 5FPXA 3J9SA 5KHJA 5AVPA 3ILNA 4XC9A 3NJXA 1OOPB 2EF6A 1NKGA 3GBFA 5FY0A 5FZGA 2BWAA 3I2FA 4RFT0 4H3WA 1F4AA 2ZZJA 4KGGA 4DRVA 4CDUA 3PDQA 4KGQA 3ZX7A 5J96B 3LDBA 1AJOA 1VBA1 2DCKA 3OBAA 4JKMA 1UY3A 3O12A 3ON7A 3OJBA 2G9GA 4DINB 2E9QA 1OI6A 1UPSA 1QMJA 1VBB3 3CJIA 5A32A 2D93A 2ZEWA 4S2HA 2HWE2 2V72A 5EJ1B 3RNSA 4U36A 1WLWA 4XUQA 3VKMA 3RS6A 3KQ4B 1HRI3 1FMD2 3L2YA 4XHXA 3H0OA 1NAEA 2WDBA 4AHYA 1TME3 4FTEA 2D97A 2GH8A 3JZVA 5EHDA 3BUCA 2RE9A 1BK0A 3IDCB 1JYTA 4LHSA 5DDJ2 5F37A 1WCSA 1T6BX 3FLTA 4G9SB 4EWEA 4TTGA 4LLOA 3BTAA 1H2KA 2Y6FA 1T6GC 2Q8CA 3VBRC 5FZ4A 1MS8A 2SLIA 3PVBB 1POQA 3CJIC 1YI9A 3H50A 1OFNA 3ABZA 1JTZX 2QQWA 4XMAA 4YRDA 5FXXA 4FBFA 5GALA 2EIDA 4CXXA 4QB2A 4HVRA 4QPIB 3HR9A 4QGNA 3PJQA 4DMIA 2GP3A 1K3IA 1QOTA 2E6VA 2OA2A 1K5MA 4LUKA 3AMHA 1G7YA 2NM1A 1VBA2 1C8M3 4I09A 5AFEA 1ZREA 1ZZ7A 4MYEA 3NV3A 2A7AA 2YC2A 5FUNA 2VZOA 1F5FA 3O14A 5FBZA 4WVMA 5FZOB 4ZZ5A 1Y7BA 2J1UA 3N4MA 1CAVA 4B3NA 4QB6A 4B8EA 2TEPA 3ZFEB 4QX1A 1W2OA 2HYXA 2Q5TA 3QACA 1CAXA 4CCKA 1E5SA 4JKLA 1RUD1 3IDEA 2YXSA 4DO0A 2W47A 3WLUA 4NRMA 5SV5A 3MIBA 1DG6A 4YVWA 4A6SA 5C6CA 2ZGRA 1MEC1 4O65A 1QJU3 2WRAA 1K5MC 5I0TA 5DG2A 5KWRA 3ECQA 1W3XA 2QQIA 3ZYBA 4BISA 2WUHA 4Q1PA 4N9IA 3U75A 4LK6A 2WNEA 1REFA 2UURA 4IEQA 3POIA 4DPNA 2ZEYA 2HWF3 5A7WB 4SBVA 5C4WB 1CX1A 1WW5A 5F3EA 5BNPB 5FYTA 4EWDA 2VBBA 1R093 4KU8A 5J7MA 1Q5OA 2PLV1 2XJUA 3WW1A 5A3TA 2JDNA 4GMP3 3DV8A 3LPFA 2HWD1 4QX7A 3OUHA 3E5QA 2ZHKA 3EB7A 3I3EA 2RDNA 5IJRA 2B8MA 2QQUA 3THPA 4CEWB 3GHNA 1TNFA 5BNOB 1VIWB 4OMDA 5I93A 2ZKLA 4HSJA 1O59A 1RUD2 4FPCA 1OC1A 2VNRA 1NA1B 4WV8A 1UIJA 3OBTA 5FP4A 1KJLA 1MEC2 1DDLA 3WP3A 1JYWA 1SFPA 2HWB3 1ULCA 2RVAA 2GMMA 3ES1A 4Q5OA 5KC6A 5DPNA 4QPGA 1TE1B 4R4XA 2JICA 2ZGUA 5GJ6A 2VU9A 2NQYA 3H8XA 4M3CE 2ADDA 1ACCA 5FJHA 3WR0A 5CFDB 3LA2A 4IL7A 1W6MB 4IEYA 4LBQD 1R1A3 5FXVA 1G9AA 2ZACA 4PDWC 2ZX4A 2XONA 2WLQA 5BPXA 2VTXJ 3SCGA 3VBHC 4P5YA 5D8AB 4IEXA 4OCTA 3VZLA 4C1XA 4Z92B 5ABJC 2PLV2 3PIGA 2DBIA 4AWDA 2HEVF 3B00A 5A7PA 1QNWA 1GU3A 3H9AA 3NNLA 1RC6A 4WM8C 4XFFA 4QXBA 4X6RB 5F2WA 3RVHA 2HWD2 4GH4C 4Q4X1 1RHI3 3N9OA 3O1TA 3JBG1 3GBGA 1KRIA 5H9SA 3SH4A 3AXEA 4E4ZA 3DPRA 5K9YA 4H2AA 1SZBA 2HEYF 3B3QE 4XQ4A 1O3SA 1YC61 4XF0A 4YWAA 1OMIA 1QOSA 4JDNA 3N7MA 4LO4B 3KWVA 3WINE 4U2AA 2A71A 4BPZA 1D4M3 3H42B 3X29B 5T54A 4ZS3A 4QKBA 1CAUA 4XFBA 2B45X 1GV9A 2GU9A 4CP9A 4CPBD 3RZMA 3VL8A 3VN4A 5IVCA 4AF9A 1OBNA 2X5IC 4AQ2A 5K7PA 4C1WA 4C8DA 5KR7A 3U1XA 1LOFA 3KQRA 4LK7A 1HJGA 3C7HA 4XXPA 4Y22B 3ZKYA 3DXUA 1QJY3 4TLFA 5GLZA 1HB3A 4BQ2A 2DVGA 2XWJB 3GZEA 3KF5A 4XFIA 5JAXA 1UXXX 3SHRA 5C8CB 4RGAA 1ASJ1 2LW8A 2WFPA 1NCRA 2XOMA 4M3CB 2P3YA 2R49A 2FQPA 3JBG2 4K3UA 3DN7A 2VMFA 4Q4X2 3G7DA 2VUCA 3MLLA 4YZ1A 1W9WA 4XF3A 3OY8B 1Q43A 1OPMA 2W52A 4AI8A 4CCEA 4D3WA 1AR73 3D0SA 4UFLA 5K4LA 1QJX1 5LY1A 4N90A 1VAVA 4AGVA 4RS5C 3TEYA 5J98B 4AQSA 4YFWA 4HK9A 2FHRA 1XBFA 1HJFA 2Q0AA 3J8F1 4GB31 4OUEA 1QXJA 1V6MA 1WA4A 5FYCA 3VDDC 1Y9MA 1ZRRA 4DQAA 1O5LA 1UKRA 5JR7B 4DXTA 2R0FA 4NIIA 5GZGA 4JGZA 5LRSA 5DAQA 1R083 2WL1A 1NCRC 1W3VA 2RS31 4HBNA 5A3WA 1ODNA 3H8RA 1RITA 2DYCA 3MUY1 1IS5A 1JH5A 2ZGKA 3SEPA 4AEJA 1W9TA 3ACIA 1QJEA 1S2BA 1S0DA 4P9WA 1B35A 4FP3A 4HKLA 1A78A 4P14A 3R4UA 1PK6B 2AH2A 4IEWA 3SISA 2ORZA 5HI0A 2XVKA 2R071 3GCXA 4HK8A 3TWIA 1ASJ2 1OLME 2QQJA 3USUB 1FNYA 2IFWA 3N7JA 2Y6GA 1EPZA 2YGMA 3JCIA 2W1UA 4CPBA 4JGZC 2VECA 1EAH3 4P9GA 5JZGA 3KLSA 1GKBA 3HQUA 1N3OA 1QJX2 2DVAA 2AEZA 4X8PA 2WIIB 5EPAA 2ZX3A 3JB4C 1NUKA 4QT6A 3VZKA 5F5IA 1PO23 5T5JA 4CDXB 4GB32 3J8F2 4FO9A 3PJYA 4HXCA 4YVSC 2HWC3 4GIQA 1ZRCA 3Q8FA 3VD9A 3VD3A 1OOPA 4XFCA 2WO1A 4QAWA 4FP2A 1GBGA 2VCAA 1AR61 3WG3A 1GOHA 2XKOA 1UU5A 4LBKA 2RS32 1LENA 2WZPP 2YFUA 1WUVA 1NXD1 2JECA 4K40A 4LBLA 1N1VA 3CF6E 4CVUA 5JZGC 4HN1A 1DU3D 1W8ZA 4XABA 4P9JA 4RL7A 3KVBA 1IQDC 4QB1A 1WBFA 2JIGA 1RJ7A 1RUE1 3FHAA 2E33A 4AGRA 3K48A 2C24A 4B4RA 2R072 1E5HA 1S0BA 1LGCA 4DXRA 2GP5A 4LE4A 3T0AA 3N3HA 4GALA 1OOPC 1LGBA 5LRRA 1G9BA 1BYHA 1G9DA 3I2GA 1UY4A 1OLRA 3ZYIB 2P6HA 1E5RA 1UYYA 4MXVA 2ZGNA 3AKRA 4UF0B 3WW4A 3LB9A 2VZVA 4Z07A 5JPNB 1UL9A 4MGIE 5IK7A 2QE3A 3AP5A 5JI7A 1LTEA 1VBB1 1O3RA 1OLQA 5DXDA 4Q4W1 4IE7A 5FYZA 3WEZA 1NY71 4XBQA 1ZX5A 3OTFA 2BTVC 3WHUA 4CUCA 4HMZA 4RQPC 3U37A 5FZ9A 5JSOA 1AR62 3WUDA 3AMMA 4P02B 4GZ9A 4Z8BA 1SCSA 3DGTA 4QPIA 3HN3A 2AR6A 4FPKA 3U4SA 3ZYHA 3VD5A 2BGPA 3UKVA 1ULOA 4LIVA 1VPHA 2BQPA 3I4IA 4D6QA 5JPMB 2H6CA 1H8TB 3LKJA 5FYYA 2DUOA 1SLAA 1US2A 1WMEA 1AL0G 1D7PM 1IZ3A 4PIZA 2ZX2A 1N1YA 1RUE2 3WY6A 3OEAA 4LPLA 5FYVA 5FZOA 1S1AA 3M4FA 1UU4A 3K2OA 2Z69A 2ZGPA 3DCQA 1SFNA 4MLOA 1YQ2A 1BMV1 2CY6A 3M70A 3ZFEA 4YM2A 4KQ7A 2WNVB 4AI0A 3B7MA 3K77A 4FPYA 1CJPA 4UXAA 1CONA 3BCWA 4LTAA 4BXSV 3UGGA 1NCQB 4KH9A 3VZJA 4OI4A 1NYWA 1SEFA 1QEXA 1RXFA 1W6PB 2VZPA 3EQEA 1ZRDA 5CISA 3W20A 1VBB2 4YGDA 1YJLA 2E7TA 2W1QA 2MPFA 2XHKA 4Q4W2 1XOYA 4UW6A 5CKQA 3I7DA 4GULA 1HQWA 1NY72 3WZ1A 3M2MA 2ZMLA 3ZFGC 1Z0HA 4LQRA 4XPVA 1JZ6A 3H3ZA 5A7WA 5C4WA 2OYZA 1U12A 1PHMA 2RJKA 5BNPA 1ZNPA 2GC0A 3BODA 1GQGA 3K3OA 2F17A 4L11A 3VV1A 4JTOA 4NIGA 1D2QA 2YG0A 4WBBA 2VUAA 2XQXA 4QM8A 1LJ7A 1GICA 2C9KA 3ZSJA 4NO4A 4BXFA 2IXJA 2PMWB 3NJVA 4LHNA 4UFMA 3MIGA 1OQEA 5CADA 3HQRA 4F83A 4XCAA 4AGGA 3QD6A 4COYA 2FCVA 3Q8EA 4UFHA 4RA0A 3T2OA 2PXJA 2GNBA 2WWUA 4D6SA 4CEWA 3VBRB 1JS9A 1BMV2 3POWA 2HWF1 3FHIB 4EZHA 1KXGA 1VBE3 1LB2A 1LOAA 5A7NA 3NQHA 3BB6A 2IVIB 3P1IA 4E8CA 1IG3A 1NQJA 4LJHA 4NVPA 3WDVA 3OSDA 5BNPC 5KHKA 1NA1A 5FZ8A 3WCSA 4MVTA 2UY9A 3TN93 2JE8A 1TEIA 4GMP1 4QU2A 1OT5A 1G86A 1RUJ3 1S4CA 2WSVA 3O1SA 3ZXAC 4EN8B 2EIBA 1DQ1A 2VG9A 5FZMA 5T50A 2J22A 5CFDA 5FIXA 4OUMA 4UW4A 5FAXA 5T5LA 1FI2A 1W6MA 3MF9A 4FXKB 3ZPYA 3C7GA 4UAPA 4CU9A 3TEWA 3CQOA 3H1WA 1KITA 3FC0A 4FQZA 5BNOC 1Q8PA 3CMGA 2BZDA 3O1MA 2RHPA 4MGSA 5D8AA 3RSJA 3S5QA 2TUNA 3FN9A 1V9U3 4JZRA 1C1LA 5A1FA 4AE2A 4OZOA 2JG8C 3PIJA 4DNYA 1IS6A 3SCFA 5BNQA 2HWB1 4Y5TA 2ZOEB 3AKSA 4UFIA 2X29A 3THTA 2BV4A 3DYOA 4HLTA 1DQ5A 1HKDA 3P3PA 4JRLA 4KG8A 2XVLA 5B2GB 1R1A1 2XB6C 3WVJA 1FV3A 3WUCA 2HWF2 5FLIA 1QXRA 4GXLA 2ZBJA 3ETQA 3IZOA 2VNGA 4C0HA 3FWEA 3H7JA 1QGLA 4E4DX 3LCPA 3ACFA 4XBNA 4FVVA 2AGSA 1H2LA 3POYA 1DGLA 3GBWA 2QNKA 2J7MA 4TYSA 4AEDA 2FDKA 5FZFA 1HB4A 4L99A 1GR3A 2E7QA 1RHI1 2Z2SB 3D5OA 4CCDA 5EYYA 2ARXA 2XXZA 1IGOA 1H6XA 3GJBA 3OPZA 4ZU7A 5EYXA 4AFDA 5A3NA 4KI5M 5C5UA 3WNMA 4IGOA 5L19A 3I49A 1AF9A 4LXLA 1XPWA 2RDQA 1SDDB 4Y22A 4GA9A 2JG9C 2R32A 2DBNA 4XDPA 1D4M1 3NMBA 4CP0A 4QU1A 5CG9A 4ISQA 4ZKTB 4AVAA 3AYAA 3B9IA 1OVSA 2HWB2 1G9CA 4OI0A 3ZR6A 2B5HA 2R0HA 5FO7B 3TRSB 2RJLA 4XUPA 5FKBA 1GMMA 2ZGLA 4M3CA 4JHZA 4AI1A 4FPFA 5CU1A 2NMNA 4NHKA 1R1A2 1Z7S3 4YGBA 1AVBA 1R1ZA 2VMHA 2XUEA 3OEBA 3OY8A 5GZFA 3IKWA 1D4VB 4PI2A 2B42B 4XF1A 2VBPA 4PDWB 4M4RA 2GC1A 3VBHB 1RJ8A 2OZJA 3POEA 2PTMA 2K9ZA 4EN9B 3QLQA 3WHTA 5CA6A 5ABJB 3BU0A 3B69A 2FMYA 2JD4A 2VGDA 2VOWA 3ZYPA 1JZ7A 4WM8B 3P3NA 5F7UA 1RHI2 4EJRA 2QCSB 4M3CF 2PHRA 4A44A 4GH4B 5C8CC 5LWBA 2C1FA 3UJOA 1KDKA 5H9RA 1W9YA 4DZGA 1W39A 2XWBB 1F2NA 3I2IA 5FPZA 4IE5A 3VHNA 2JJ6A 4AQTA 3SKVA 3NAPC 1FX5A 5FY7A 5DQ0A 4H14A 3PNAA 1PZ9A 2XBO3 1W9SA 3DECA 5HV0A 1D4M2 5BY5A 2GMEA 4A7KA 5FDBA 1PK6A 5FY8A 2VULA 3ALQA 4E27A 3AZYA 1LHWA 2WT0A 1JXNA 2BBAA 2BUKA 3USUA 4HETA 2BYVE 1R081 3M3IA 3HD8B 5LY2A 1ZBE1 2HJIA 4M4PA 4Y1XA 4ZU5A 2A3YA 3I2OA 1N1SA 3S5AA 2X5IB 3Q8BA 1X50A 1VB2A 2WQ8A 4H55A 4COWA 5JVVA 4A41A 2YBKA 4I3PA 3LGRA 4QPYA 5FYHA 1DGRA 4JC1A 3M8LA 5FZ0A 2YUEA 3FBYA 1YFXA 2V5YA 1H1AA 3NJZA 3ST7A 3QH7A 3USSA 4CDXA 1OD5A 4BQYA 1HRV3 2PAKA 1SG3A 1O8SA 1YO8A 3GM8A 4Y5SA 4W8JA 2Q8DA 4QQ2A 4Z1VA 1VR3A 5FXZA 1OKQA 3OUJA 4HSLA 4S2GA 4AR2A 4OHZA 3AFGA 3AZXA 5CG8A 2GC2A 2OUJA 5FZBA 1PZ8A 2VE1A 3R05A 2DFCA 2XJRA 4XF9A 2DCYA 1QXPA 4JKKA 4XZPA 1W6NB 4RS5B 1PO21 4YM0A 4D0QA 1PZ7A 1QKQA 4Q4V3 4QX3A 1REDA 2CV6A 5T3NA 4JDOA 2HWC1 2Y38A 1YI7A 4RGKA 4LKEA 3VDDB 1S0GA 4IV1B 1R082 1APNA 4CYDA 1ZBE2 5L7OC 3ZIXA 3J7LA 5JOXA 5IW0A 1AL23 1XE0A 4NHYA 3MPPG 5F8PA 1W06A 4UF0A 4PQQA 5IYYA 1UYXA 3WDWA 2GMPA 3BN6A 2VTXA 3EJKA 3HBKA 5KHHA 1V6NA 2W46A 3VBFC 4LBQB 4FFFA 2A3WA 2BW8A 2ZTNA 3N9NA 3OG2A 1OH4A 4FPGA 4FQ4A 5DAVA 1JZ5A 3ZYFA 3K3NA 3O0XA 1UIKA 2NYYA 3J4UH 1UX7A 4LT5A 3ZPOA 3LIHA 3I2JA 5LA9A 4DXSA 5ANNA 2JENA 4HVQA 5A7SA 3H8OA 3NV4A 1H8TA 1POV0 2FMDA 4XAAA 2ZX1A 3LA3A 2JDZA 3AM2A 3UGHA 2ZHNA 1PO22 3POGA 3UKNA 1W8FA 5F3IA 4CP1A 2R063 2HWC2 2CGOA 3O0VA 1US3A 4KBBA 1VE0A 2J1TA 4YVSB 1RUF3 1BVP1 3MW4A 2WNVA 2QQKA 4W6XA 3ZSLA 5JXJA 3INAA 4AAPA 3WNNA 3JD73 4Y3OA 2X10A 2FCTA 5ISLA 1NCQA 4M0NA 3LFMA 1OVPA 1V0AA 4UI9L 3CZJA 1FYUA 1M4WA 3PLQA 1TVGA 1W6PA 1I9RA 1CX4A 1AR93 1EV13 3VGIA 5FY1A 1H8TC 2QQPA 2VMCA 1UZVA 2O1QA 3LOBA 2ETEA 1MS0A 1FNZA 2W39A 4ZZ8A 5F2SA 4LUMA 4O9GA 1LGNA 1WCUA 2WAAA 2YU2A 3VLBB 2VM9A 3MICA 1JZ4A 1WA6X 2OVUA 2WNVC 2O8QA 2Y8KA 3D8CA 2VOTA 2I07B 1NCQC 3P6BA 4K8RB 3B93A 2CYFA 5J3UA 5IVEA 4K1YA 3OBRA 2HYKA 2VY0A 4W50A 2DUQA 4XQWA 4YYOA 2IZWA 2ET7A 5FMCA 1UU6A 4AEKA 1PO13 1RVF3 5LA1A 4CXWA 4WZCA 2JDPA 5CNAA 3VBRA 4D7SA 4Y5Z0 2D43A 4Y24A 4SLIA 4RQPB 2E26A 2Y6JA 1S0CA 3HNYM 3MO4A 2DVFA 2MNGA 2B9UA 3TNQA 1RMU3 2FDGA 2YU1A 2EAAA 2D98A 1F31A 3T0DA 3FE5A 1W05A 1OSGA 1CZTA 1K5JA 2JE9A 5LBEA 3HT2A 4Y4YA 5ACA3 1QQP3 4PJYA 4LEJA 2OUHA 1WGPA 4AHZA 4AQ6A 3U14A 4QX5A 2XL7A 1VJ2A 2P17A 4BZ4A 4C91A 2ZGMA 5F32A 1VBE1 5FCCA 3UL2A 2ZMKA 3FUOA 3VBUC 5HCHA 4TWTA 2Z5WA 2ET1A 2WNUB 1JBCA 2Q1MA 3NW4A 3BPZA 3DKQA 5T55A 3PURA 2WS93 4Z82A 1W8WA 2BFUS 2YV8A 1UNBA 5E16A 3TN91 4OVEA 2ZX0A 1OURA 3HNMA 3HT1A 2EXHA 1LEMA 1RUJ1 1UZZA 5DN2A 2VMEA 3J7HA 3KV6A 4RYDA 4AI3A 4LO7A 2Y64A 3BGAA 2IC1A 3SH5A 1N1TA 1W0PA 3ZFGB 1UYZA 3CIHA 4F7ZA 4AVSA 2XLGA 2G9FA 4CCCA 1AYN3 1WLDA 5FP9A 2XDVA 3GXUA 4B1LA 5F1RA 2WABA 1J58A 1WD4A 4UOJA 5BV6A 1OHFA 3FX3A 3CEWA 4QX2A 4XFAA 3ETPA 4AHWA 1J84A 4QKDA 1R64A 2DU0A 3FLPA 2YC0A 2BDRA 3U4XA 1PX3A 4K7JA 4X8NA 5KXCA 1PMIA 2MEV3 5FO9B 4M00A 1VBE2 3FLRA 1MPXA 2X05A 4QX8A 3SITA 5AC93 1FATA 1REEA 2VQTA 3TN92 4AVVA 4PHZA 4E4HA 5DZFA 1ULEA 1BCXA 3AKTA 2HKXA 1GUIA 3EBRA 1T2XA 1XNKA 2XL9A 2RR13 1FPN1 4J1WA 5I0RA 1RUJ2 3NVCA 3UESA 4BQ4A 4Q0VA 5FZCA 5I91A 4QMAA 4W65A 1EY2A 3UKTA 1PGSA 1NXMA 2VQ0A 2W91A 3AP7A 1C28A 5DAWA 5FJKA 3TBDA 4NIDA 1O5UA 5M0TA 2FDFA 3BTZA 1JZ8A 3A0NA 4PDWA 3VBOB 3R4DB 4NAOA 5T52A 3FFQA 3B02A 4TN7A 1Y43B 1DFQA 2DCZA 2WR9A 3VBHA 4GWNA 4Q26A 5F3CA 1XE8A 3K51A 2XJTA 3A4UA 5ABJA 3D3AA 1DQ6A 2JG8B 4P5HA 2YBPA 4WM8A 5A1LA 1JODA 2E31A 3PMEA 3SKJE 5JXGA 2ARAA 2IWGB 1W0OA 3CDZB 4GH4A 4ZY9A 3JUUA 1OH3A 1CGPA 2RMU3 3CJXA 1LOCA 2EXIA 3IWZA 4EYUA 4Z2WA 1JOBA 3ITQA 1YJKA 3T2PA 1SLBA 2OS2A 3W21A 5LW9A 2Y6LA 4CCOA 1OA2A 2EIGA 2OX0A 3IB3A 3BVCA 3MIEA 2K2SA 4NAMA 4TSVA 1CN1A 2E51A 1UZYA 1FPN2 1YFYA 2KA3A 4LLFA 4ARYA 5IVBA 2XHNA 5IWFA 4ZONA 5BUVA 3RWKX 1CD3G 5EFUA 5HXVA 4CUAA 2Y0OA 2X5IA 1O8PA 1OD3A 4CP2A 4DRRA 3ZMNA 3POSA 4G4FA 4XW3A 2QUOA 4EN7B 5C9AB 1CJDA 2XBO1 1GWMA 3JXSA 2G19A 3DYMA 2WT2A 1G9FA 2OW4A 1U5ZA 4BJ0A 2CGPA 2JG9B 4FFHA 4FOYA 3K46A 3ORJA 1NLQA 4UBGA 4XUOA 4Y1ZA 4KNCA 5DAXA 1UN1A 5L9VA 1UY0A 2WZEA 5CYYA 4DIQA 1A3KA 1UKGA 3GZUC 3PUQA 3OUIA 5K0UB 2Y0IA 3KV9A 1H4HA 2PFWA 2P6CA 3LWCA 1RUI3 3NL1A 4KWKA 2R7EB 4NRQA 4EWAA 2VW0A 5DG1A 1TG7A 2C6SA 1STMA 2VZ3A 1OA4A 1W6NA 3NKGA 4RS5A 5E1RA 1YQCA 1CZSA 1U5IA 2E53A 3THDA 4AVBA 3NO8A 3PUHA 2P5BA 4QHZA 4EE2A 2EALA 1H9WA 4NIAA 3FZ3A 3ATGA 3VDDA 3I97A 5F5QA 2J1SA 1X36A 4IV1A 4AFCA 2LROA 5FQ0B 5HPOA 4WVVA 1W99A 1JW6A 1KJRA 2WN2A 1CQ9A 5DMYA 3ZXFA 5I8YA 1OF3A 1RUG1 2PAEA 3OGVA 3RZZA 4E2SA 1WWYA 1AYM1 3HNBM 2EIEA 1NG0A 4LA2A 1RTVA 3ZFFC 1QJZA 4HKOA 4XURA 1MQTB 1VBD3 2XBO2 3NAPB 2P3KA 4JRAA 5D2AA 4Q4V1 4EROA 4CDWC 2RJ2A 2V4AA 3LQCA 4CDQB 1BHGA 4LBQA 1F15A 4FAGA 1FOD3 1YFWA 2CHHA 4Y33A 4CXYA 3VZMA 5A6QA 3W5NA 4JDMA 2WQZC 5IFPA 1AL21 4NOTA 1OF4A 1UOJA 4IV1C 1RGSA 2GDFA 3BTYA 3V0AB 1VLNA 4V1PA 1AR81 3MV01 1F4HA 1KFUL 5C3SA 1UW8A 1LNSA 2G9ZA 4Q1RA 4N7UA 3KHCA 2KM2A 4YW6A 4RHV1 1G6NA 1U5YA 4CTEA 4D7YA 1DQ2A 4BIFA 3CL1A 3MEPA 4R9AA 4YVSA 4F8AA 2D5FA 1JYVA 3MW3A 5DAPA 1ZBA1 2R043 4I30A 3POFA 5FY4A 3ZIWA 1RUG2 1L7LA 4Y4RA 3O7OA 3UETA 3O1UA 3W59A 4UW5A 4ONUA 1AYM2 1GQHA 4XFGA 3SNMA 4NPMA 1LOGA 3VD4A 1FV2A 3MGUA 4DXZA 1VAMA 3C7EA 2C5DA 4Q4V2 2RDSA 5IAXA 5FPAA 2YROA 2DCJA 4AI2A 1O6UA 5CEHA 1RUF1 4YGCA 1HV1A 5KC5A 3AC0A 1CWPA 3ZO0B 4Z2AA 2NZ9A 4QD2A 4IE4A 1AL22 1XU1A 4M01A 4YG6A 1J59A 5L7OB 3WG2A 2DFBA 1VP6A 2LALA 4H7MA 3SEEA 2WBKA 2V73A 1F8VA 1LKNA 2W5FA 3KT7A 3IIIA 4GKXA 4BQ3A 4RSUA 1IPJA 4DUWA 1AR82 1EV11 4P00B 5L36A 3KCYA 3I3DA 4P9LA 1H0BA 1SDWA 1UOFA 3N35A 4NHXA 2DV9A 3LDKA 4S2DA 4XJWA 4YW2A 2JB4A 2ZJCA 5BXXA 4RHV2 4EQVA 4INDA 3VBFB 1W8TA 3D0JA 3OGJA 1V6OA 2JDMA 1OUXA 4PQ9A 5FZAA 5GZCA 4IDZA 4AOCA 1X33A 2JX9A 1CPNA 1F9KA 4MGQA 1J1TA 1ZBA2 4RQPA 3ZYGA 1W28A 4DY3A 3HVDA 2E7AA 3T0BA 1DLCA 1W2NA 1WCQA 4FPJA 4IEPA 2VW1A 4PBOA 4WZFA 5JCTA 3JQXA 3MLJA 3TYJA 3RYPA 2BNMA 1GP6A 2YPJA 2VNVA 1LOEA 1RVF1 1XU2A 3NSTA 3Q8CA 1RUF2 5C8WA 1V6KA 2YY1A 2EAKA 3T1LA 4MSVA 1N3QA 1DQ0A 2Y33A 5F9TA 4ATEA 3IAPA 3A21A 3HN1A 4I01A 5DABA 4E8DA 5HBAA 2WNUA 3I2DA 1KD7A 3NV1A 4FSJA 1COV3 4CSWA 2RS53 5IVJA 4LBNA 1HRI1 3G6JB 3TOJA 4AVCA 3B9CA 1EV12 1QQP1 1TME1 3WQ1A 4I02A 5CKMA 2RM23 2DVBA 4FOQA 4MGKE 1WMDA 1AUYA 3PVOA
chains in the Genus database with same CATH topology
5JIAA 4K21A 5DZEA 2NPIA 1BZWA 3RYRA 3ZFGA 2AENA 1GSLA 3VUOA 1SFYA 3WDXA 3PVNA 1WBLA 2WNUC 1ND2B 2VPVA 3AMQA 4XBLA 4ISRA 3JU9A 1MS4A 2WLPA 2HWE3 4MZUA 3EO6A 1C8M1 1RVF2 1PM7A 3E6BA 1FMD3 3OGGA 5KHIA 1QF3A 2VVDA 4Y20B 1DYPA 3WDTA 4EN6B 3AFKA 2XUMA 4Q0PA 3IPVB 1NOVA 1C4RA 4Q29A 1GZ9A 5DDJ3 3DKWA 1HRI2 2H0BA 3RQ0A 2VQAA 5FTTC 2VVFA 1A6CA 1QQP2 1TME2 4QQHA 5CFCB 2A70A 4BA6A 3APBA 1QJU1 1V00A 2MEV1 2R1DA 4XFHA 3KD4A 2PAMA 1XE7A 1YCIA 5KXBA 3EXUA 3VBUB 1V70A 5JSRA 4YW1A 1Q8OA 5AC91 3VBOA 2EA7A 2XH6A 5BNOA 2FZ2A 4B29A 4H7LA 1YWKA 2RR11 3CU7A 1R091 3I59B 2JG8A 2ZA9A 2EXKA 4JCKA 4NHLA 4OHVA 4NWWA 1S0EA 5BYNA 5EZWA 4I3GA 2WQ4A 1C8M2 3WG4A 4XMIA 2NMOA 5L73A 4OI2A 2A5ZA 4HPKB 4BOWA 2C9AA 2XVGA 4KWJA 4NPRA 3B01A 1DBNA 5BNNB 4L8QA 4N43B 2DTWA 2VUJA 3H3UA 1DZRA 3VBOC 4Y1VA 5CB7A 1S0JA 2VMIA 5JOZA 3OD4A 2P3IA 3WNXA 1QJU2 2MEV2 3AZZA 5EJ3A 2ZGTA 4Q8KA 1AX1A 1KS4A 1NZCA 4AXOA 2CNAA 2D5HA 4HANA 5AC92 3V0AB 1Z78A 5C9AA 1BBT3 3IN9A 2YDEA 2JG9A 5CAZA 2RR12 3D6EA 1R092 1PNFA 2A3XA 2IXLA 1I1EA 2YZ4A 1MS3A 1QY4A 1OA3A 2CAUA 3AYCA 1QWRA 1RUH3 5EWSA 5K0UA 5K8SA 2K0GA 4IV3B 1S55A 4N7IA 2I45A 3LSEA 4YZ5A 1XYOA 4AYUA 2VMGA 5C9AC 3AZVA 1RL3A 4Q2FA 4NHMA 1BQPA 2YGLA 1JN2P 3RPQA 2A75A 4FPLA 3UJQA 4CEYB 3PHMA 3S7IA 1MS5A 5I0UA 3IMNA 5FQ0A 4JQRA 1J3PA 2C0ZA 5C8CA 1I3HA 2R1BA 1F5JA 5K0UC 4XYXA 5GKAC 1MQTA 4IERA 3NAPA 3OYWB 2CGNA 2ZHLA 2ATFA 3TB0A 4CDQA 3AZWA 1QJY1 1LR5A 1LULA 3B94A 3RJ2X 5CVRA 2CAVA 2FZ1A 1H2NA 3KCCA 1I6XA 1QNYA 3ZSMA 2O8OA 4RD7A 1ZYBA 5DZGA 1VBD1 3H7YA 5AFBA 3LOIA 1AR71 4JGYB 2Q1ZB 5FOJB 4QQOA 3AXDA 1MQTC 1KQRA 5I0SA 2OIIA 1PIV3 1QHDA 2F4PA 1LHOA 5CIRA 2F6BA 5FO8B 4CDQC 4R9BA 1AXYA 3LA7A 1WW6A 2B7YA 2QVSB 3MZHA 5JWPA 1SBDA 1DGWX 1DLLA 1Q3EA 1LRHA 4AEDC 1CR7A 1QJY2 4W6WA 3T1MA 3DL3A 5HCBA 3ASIA 4NR1A 5DUUA 5L7OA 4XJAA 1ULGA 2PELA 3AMNA 2VW2A 4QHBA 1EAH1 4IQPA 1VBD2 3ZFFB 3WT3A 1Q8VA 1AR72 1ONAA 4BMBA 2IXIA 4CDWB 4GMP0 1C8NA 4COVA 4XQDA 5JLVA 3VBFA 3BIWE 4XIKA 1AXZA 5JSPA 2BFUL 3ACLA 4AFAA 1DIWA 1LU1A 3PTYA 3I54A 5J09A 4FTBA 1M06G 3KB5A 3ZXLA 4BCUA 4META 2W0XA 3GYDA 1TNRA 5GLWA 3ZN6B 1O4TA 4QQPA 1MVEA 2A6VA 3TAYA 3O5SA 3S6PA 4ASMB 4BLIA 4HN0A 2I2SA 3RG0A 2WSUA 1JHNA 1UMZA 1JUHA 1LHUA 4ZU4A 3ELNA 1AXKA 3M3CA 4BHPA 5FMOL 1EAH2 3J8F3 4DFSA 1XRUA 1JYCA 1FXZA 3MPBA 1GZCA 1SBFA 4K8FA 2ZZQA 3VZOA 3ZXEA 2D3SA 5IK5A 4Q0UA 3U0ZA 3FMGA 3AP6A 1L3JA 1COV1 3MI8A 3C2UA 1VAKA 1BVVA 1C57A 2XJVA 1ND2A 4BH9A 4IXLA 2WWSA 1IS3A 2RM21 4UW3A 2BGCA 4IEVA 1RUC3 3U07A 2QZ2A 4L9BA 2RS13 1JOJA 1WLCA 3WW3A 3MIHA 4HL0A 4Y20A 3GNEA 2LTNA 4N53B 4XE9A 3S0MA 1LHVA 3WXPA 2BPA2 3ILRA 4XTPA 4WM7C 3IPVA 4I0AA 1HW5A 1S2KA 1SBEA 5KBFA 1ND3B 2CTVA 4KL1A 4FOWA 1ENXA 3VKFC 1WLTA 5CFCA 1XNDA 1ND2C 1DGWA 5LEJA 1MR5A 2PN5A 1AR63 3MDPA 4XF4A 4ES9A 4B4PA 4MH0E 3N7KA 1E57A 3OD0A 3ROUA 3SLIA 3WOGA 3VBUA 4ORFA 2I74A 4AW7A 1COV2 4HZFA 2ERFA 3DF0A 1BKZA 3U11A 4YARA 2QDNA 2ZS6B 1RUE3 4YW3A 4YZ2A 4E2GA 1C5IA 2XGXA 3AX4A 3I59A 3KS7A 1H2MA 2RM22 3OCPA 4MUVA 4MXWB 4YG3A 1WCKA 2UY8A 2WINB 4RGGA 5CFCC 1GFF2 2FBEA 4AVTA 4E4SA 3RYKA 5JMCA 4HPKA 4OHXA 2DF7A 2BVVA 5TSWA 3M3OA 4LO8A 1ZVFA 1ZZ8A 4L97A 5BNNA 3E6CC 4YLZA 4N43A 4JAAA 3UK9A 4XIOA 3WG1A 2PHWA 4LULA 4CRQA 4Q4W3 1UX6A 3GALA 3HQXA 2DWRA 2GN3A 4OUSA 4NN0A 2OPKA 4OHYA 4YG0A 1SMVA 2B39A 1C5HA 4OULA 4PLMA 1GNHA 3NKTA 1MZFA 5JDBA 2DU1A 2QJVA 4CDUC 2A6WA 3V0AA 2UYBA 5BNNC 3JQWA 2IXKA 3R0RA 1SLCA 2XLFA 1S0FA 3ES4A 4N43C 4IEZA 4XJ8A 4YM1A 2ZGQA 1OPOA 2BEOA 1V9U1 2SBAA 1W6OB 3M1HA 4AFBA 3ZSEA 4GQ7A 3ME2A 2D6PA 2WZR3 4M0HA 2IXHA 4IEOA 2D6KA 5FMOS 4DY5A 3ENRA 4IV3A 4FPOB 1BBT1 4EN0A 1RIRA 3LSDA 3L9JT 1TQ5A 2VH9A 4QGLA 3RWNA 3MYXA 4JTNA 3SXWA 3HIFA 5H9QA 2XLAA 1HXS3 4HVOA 4RR3B 4CEYA 1BJQA 2GZWA 1O3QA 1YXWA 1RUH1 3SH3A 4P9IA 4UBHA 1CAWB 3KCXA 4GKYA 4MX3A 1LEDA 2IFRA 5EV7A 4FXGB 3OYWA 1LHNA 2KXLA 4IV3C 5F6LB 2WA4A 4ASLA 3NV2A 2B46X 4BMEA 1V9U2 5J37A 4G3YC 1QU0A 1MZEA 1H9PA 4KG0A 4CEYC 4Q8LA 2XPJA 3VBSB 5I8TA 3QBQA 4I0BA 3ZXJA 1Z7S1 1ZZCA 4A7YA 3E6DA 1X8MA 1BBT2 2UWBA 4YVWC 3IT8A 1W6QB 3AYDA 4JGYA 5E8AA 1HQLA 3M3QA 4OHWA 2ZMNA 1IKQA 1H30A 5LEKA 2WJSA 4PIYA 4QGMA 3W58A 4FTSA 2W08A 1RUH2 1A8MA 2R6QA 2YYOA 4LBJA 4K20A 4ES8A 1G8WA 4YZ4A 1ZZ6A 1PVXA 1SLLA 4IEUA 4Y1YA 2ZCWA 1ENRA 4Q0SA 3USSA 4FBFA 1XQNA 2XKPA 1PIV1 1WMFA 1ZM1A 4YW5A 4JGYC 3VL9A 2Q4SA 3L2HA 3WDUA 4E9KA 4J6GA 1OQDA 1Y9QA 2QZ3A 3WD5A 3HWJA 3RMYA 3BALA 1Z7S2 1O4ZA 4GWMA 2X53S 3ZFFA 2WKKA 2D40A 3HAGA 1POV3 1BEV3 2TBVA 1CIWA 1KS5A 4CDWA 4XEZA 4QPGC 2D6MA 1AX0A 3V65A 1IOAA 3HBZA 1H1MA 1HRV1 1H4GA 1C1FA 2AYHA 4DB5A 2IXCA 3GZAA 1DF0A 1IKPA 4LO6B 5I8SA 4QXKA 4YSFA 2CWSA 3U10A 4AEMA 1JYIA 3GF6A 2P34A 3ZN6A 3PVEA 3W9AA 1PIV2 1TMF3 1D0GA 4AFMA 2WFF3 4Q4Y3 2VNOA 3DPRC 1KFXL 1OQ1A 3ZSKA 1DHKB 5E89A 1C3HA 2Z42A 2LM3A 2ZABA 5A33B 2BBVA 4ITCA 3ZXDA 4D69A 4LA3A 1UCXA 2ZAAA 2UWAA 4Q27A 4YM3A 1HX6A 3RMXA 4EV0A 2ARBA 4AEDB 1GZWB 4R4ZA 5DUWA 1HRV2 3FUQA 4BM8A 4HKWA 2NN8A 1LOFC 2D6LX 4XDQA 1DQ4A 1YUDA 1Q8QA 2WC2A 2GC3A 3WP5A 1XXNA 2DUPA 4BE3A 1LODA 4X6QB 1RUOA 1IS4A 4MGZE 2UU8A 2Z79A 1ZBE3 3KT1A 4XILA 2R16A 2VXRA 2R061 1UPIA 4MGYE 3J26N 4N53A 1NLSA 3KZ4C 2XJSA 2BNNA 4PIXA 3VHRA 1ND3A 1O91A 3JD71 4XETA 3UV9A 2QKDA 1VRH3 3LAGA 3QOPA 1HV0A 4LHKA 1XYPA 1RUC1 2ZPXA 1GLHA 2EVXA 1VBC3 2PQQA 1AR91 2RS11 5GLTA 3RJRA 1FAYA 1AX2A 1SCRA 4ZXKA 2MHFA 4OFGA 4XJUA 1OFSA 3WV6A 3V0BB 2VOXA 4FOVA 4N53C 2YHJA 5D1IA 1URXA 1B35C 1ND3C 1SLTA 3QCWA 4MXWA 4Y1UA 3AYEA 2P3JA 4I0WB 1PVC3 2ZGOA 4DS0A 3CO2A 1V6JA 2R062 1UF2C 5DUXA 4PLNA 1PO11 1XYNA 3WX5A 1YLLA 3JB8A 2G4IA 3MIDA 3JD72 3NWKA 1MVQA 4Q0QA 1RMU1 2VVEA 2H6BA 3LZZA 1RUC2 2ZKNA 1QDOA 1DGRN 3EHKA 3H1YA 3FBMA 5CBLA 1AR92 2D6OX 2RS12 5ACA1 5IT6A 1O7FA 2GAUA 4YGEA 4D94A 1SACA 3WCRA 1LESA 4HT1T 2WA3A 2GALA 5IK8A 1CESA 2JKBA 2A6XA 3D82A 4WM7B 4DOUA 1PGW1 1ENQA 2WS91 4D7TA 5HCFA 1W6OA 3ZXKA 3AMPA 5J36A 2ZAHA 3BOPA 3S30A 4CZSA 2AZ5A 1LU2A 5H9PA 4L92A 1W2UA 1PO12 3VKLA 1YFUA 1ZZBA 2Y26A 3IIAA 3AKPA 1AYN1 1IPKA 1RMU2 4OLLA 3FJSA 4AHXA 2V09A 4RR3A 1ZA4A 5E88A 4WVZA 3AB0A 4AG4A 5ACA2 3ZDSA 1AZDA 2WZR1 1Y3TA 4XOGA 2ES3A 5T5PA 4FPHA 4QPIC 1PGL1 4XTMA 1CAWA 4ATFA 3RRDA 4KWLA 2BWCA 1NLRA 1PNGA 1LECA 1PGW2 1KDMA 1QH6A 4XHBA 4XXAA 3VHPA 1VBA3 5IUQA 1MS1A 1ULFA 1HXS1 1B09A 2WS92 3KMHA 1NQDA 3M3EA 4BQ1A 1MZ6A 1XNCA 1FT9A 4RR3C 3ZFEC 3GHMA 5FRAA 3VBSA 3ZMOA 3E5XA 3ILFA 1SQ4A 4FT8A 1HIXA 3QH6A 4XJZA 2PHDA 4CDUB 1Q56A 2GNDA 2O0OA 3KGZA 4KU7A 2UYAA 1W6QA 3IDBB 1AYN2 2XJQA 4IETA 2Q30A 5A3LA 3ZN4A 2P37A 3RI9A 5JOYA 1BK1A 3CJIB 5A32B 3ZVXA 2P2KA 1WD3A 3CLPA 2WZR2 2Q8OA 5C4WC 1PGL2 3WW2A 4COUA 3VBSC 2RMU1 3WP4A 4YZ3A 5T5OA 3KT4A 2DTYA 4YFZA 5C33A 2BNOA 4P9XA 4IESA 1HXS2 2ILMA 3MLKA 1MS9A 3RI8A 3ZXGA 4BWOA 1IHMA 1SLIA 2N7GA 3VZNA 2X8KA 2UWCA 3FFZA 4CEWC 4NWVA 2PHFA 2JE7A 2PHUA 4FPEA 4Y26A 1V6LA 4COZA 1VB4A 3R6SA 2GNTA 4PCRA 1NA1C 1J3RA 1RUD3 4TZDA 1D0HA 2D6NA 1K5MB 1NE4A 2HEWF 1U0AA 1X82A 1MEC3 3KGLA 4QQLA 2BVBA 1CPMA 4HFSA 1GANA 2VOVA 4WVMB 2GN7A 1ULDA 5CFDC 1CAVB 3SCHA 5SV8A 4R9DA 3AJZA 1VALA 1CAXB 4LBMA 3TNPB 1N47A 1HQNA 2NLRA 5D8AC 4OI1A 2CL2A 2RMU2 4R52A 5FLHA 1POV1 1BEV1 2YMZA 2DVDA 1RUI1 3H8UA 1FPN3 4DQAA 2A6YA 4JVAA 1LOBA 2PLV3 4YVWB 1XNBA 3ZYRA 3IM0A 3BU7A 4R8HA 5EXOA 2HWD3 4LE3A 1AHSA 1X7NA 1Q8SA 3AP9A 3Q9OA 2DURA 1J1LA 5A33A 3ZYJB 3AK0A 4PLOA 1ZRFA 1MACA 4R9CA 4B4QA 1I5ZA 2GSYA 5LK5A 1UAIA 1TMF1 5IK4A 3KSCA 1H1IA 2WFF1 2CWMA 4P9YA 4PBPA 1GZWA 4AEDA 2VOKA 1DYKA 1ALYA 1AJKA 4Q4Y1 4YW4A 1O4YA 4BLJA 5A3MA 1FOD1 4AK3A 1WW7A 4N9HA 2ZHMA 3AJYA 1D2SA 1V6IA 3MFCA 5KHGA 2A73B 1BEV2 3OF1A 4O9EA 1RUI2 1QDCA 2E63A 2PYTA 3R4SA 4WVWA 1U5XA 2D3RA 1RINA 4QPGB 1YIPA 1QOOA 4BYYA 1X8EA 4Q4X3 3JBG3 1J3QA 2TNFA 5FFOC 2XG3A 4B7EA 3URFA 5JIUA 2R041 4PF5A 4F3JA 1WCDJ 1RB8G 4XJ9A 3V56A 2D7FA 3VHOA 1TMF2 3GZTB 3HMYA 2A6ZA 4LBOA 3S7EA 4LR4A 1ZZ9A 2WFF2 3BOWA 1HDKA 4Q4Y2 3E97A 2W68A 1FOD2 2AUYA 4W6YA 3RDIA 3DPRB 3CNAA 4URTA 3V0BA 1LCLA 1YRZA 2QDRA 3WQ7A 4LO5B 3PMSA 1VRH1 3B5LB 2ENRA 3MW2A 3E5UA 1H8VA 1PK6C 2AREA 1VBC1 1UD1A 1CAUB 5KXDA 3MF6A 1YYNA 5HCAA 4S2FA 1ASJ3 3DUIA 2ZGSA 3A0KA 1RUG3 3I8TA 5LK7B 1YIFA 1AYM3 4YNIA 4K1ZA 2JEMA 5GZDA 5JI9A 2R042 4LNVA 3ZN5A 4QM9A 1QJX3 2QFEA 4CDXC 3N36A 4L2NA 2D44A 2H0VA 5GLVA 1HLCA 1WW4A 3WP6A 5GZEA 1JUIA 1A8DA 1PVC1 4GB33 3V64A 3MIFA 3VKOA 1NCRB 2EXJA 1DZQA 1GYKA 1YHFA 2R30A 2XJPA 4A7ZA 3AP4A 2RS33 1GNZA 1BXHA 3H1MA 1AR83 5J48A 4WM7A 5DUVA 2NP0A 4K9SA 1N3PA 1MZ5A 3M7AA 5FREA 4A2UA 1QH7A 3WQ0A 1O3TA 4I2OA 2D3PA 1VRH2 2JXAA 4RHV3 5GM0A 2RS51 1DZTA 3T2TA 5JOWA 1VBC2 4J1XA 4LHLA 4E2QA 1EP0A 4B7KA 2R073 1ZBA3 2DCTA 4JGZB 4C90A 5GLUA 4K6BA 3O0WA 2PA7A 2GNMA 3D4KA 4MV2A 3WDYA 3SMHA 3C3VA 4OZXA 2OZ6A 2PHTA 3MFAA 2GH2A 2PHLA 5F6KA 5KXEA 1B35B 4FCAA 1NE6A 4A3XA 1PVC2 3IBMA 1IQAA 5FLJA 1YNAA 2PHXA 2HWE1 2LUWA 4C0BA 4JV4A 1ENSA 1FMD1 5AVAA 1CVNA 3AKQA 5JZGB 5FOBB 1EPWA 1S0IA 2WT1A 3N7LA 2RS52 5DDJ1 4FAHA 1EYBA 3KM5A 4BIOA 5FPXA 3J9SA 5KHJA 5AVPA 3ILNA 1OOPB 2EF6A 3GBFA 2BWAA 4RFT0 4H3WA 2ZZJA 4KGGA 4DRVA 4CDUA 4KGQA 3ZX7A 5J96B 1AJOA 1VBA1 2DCKA 3O12A 3OJBA 2G9GA 4DINB 2E9QA 1OI6A 1UPSA 1QMJA 1VBB3 3CJIA 5A32A 2D93A 4S2HA 2HWE2 3RNSA 4U36A 1WLWA 3VKMA 3RS6A 1HRI3 1FMD2 3L2YA 4XHXA 3H0OA 4AHYA 1TME3 4FTEA 2D97A 2GH8A 3JZVA 2RE9A 3IDCB 5DDJ2 1WCSA 4G9SB 3FLTA 4EWEA 4LLOA 3BTAA 1H2KA 1T6GC 3VBRC 1MS8A 2SLIA 3PVBB 3CJIC 3H50A 1YI9A 1OFNA 4XMAA 1JTZX 4YRDA 5GALA 4HVRA 4QPIB 3HR9A 4QGNA 3PJQA 4DMIA 1QOTA 2E6VA 2OA2A 1K5MA 4LUKA 3AMHA 1G7YA 2NM1A 1VBA2 1C8M3 4I09A 5AFEA 1ZREA 1ZZ7A 4MYEA 3NV3A 2A7AA 1F5FA 3O14A 5FBZA 4WVMA 1Y7BA 3N4MA 1CAVA 4B3NA 4B8EA 2TEPA 3ZFEB 2Q5TA 3QACA 1CAXA 1RUD1 3IDEA 2YXSA 3WLUA 5SV5A 3MIBA 1DG6A 4YVWA 5C6CA 2ZGRA 1MEC1 1QJU3 1K5MC 5I0TA 5DG2A 5KWRA 3ECQA 4Q1PA 4N9IA 2WNEA 1REFA 2UURA 4IEQA 4DPNA 2HWF3 5C4WB 4SBVA 1WW5A 5BNPB 4EWDA 1R093 4KU8A 5J7MA 1Q5OA 2PLV1 2XJUA 3WW1A 4GMP3 3DV8A 2HWD1 3E5QA 2ZHKA 2B8MA 3THPA 4CEWB 3GHNA 1TNFA 5BNOB 1VIWB 5I93A 2ZKLA 4HSJA 1RUD2 4FPCA 2VNRA 1NA1B 4WV8A 1UIJA 3OBTA 1KJLA 1MEC2 1DDLA 3WP3A 2HWB3 1ULCA 3ES1A 2GMMA 5KC6A 5GJ6A 4QPGA 1TE1B 4R4XA 2JICA 2ZGUA 2VU9A 2NQYA 4M3CE 3WR0A 5CFDB 3LA2A 4IL7A 1W6MB 4IEYA 4LBQD 1R1A3 1G9AA 2ZACA 4PDWC 2ZX4A 2WLQA 5BPXA