4MSVA

Crystal structure of fasl and dcr3 complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
139
structure length
139
Chain Sequence
b'LRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor receptor superfamily member 6B
publication title Crystal Structure of the Complex of Human FasL and Its Decoy Receptor DcR3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 28
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4msvA01
5L36A 4QPYA 1KD7A 2JG9C 1TNRA 3FC0A 4OUMA 4MXWA 5BNQA 1C28A 1GR3A 1U5XA 2ZPXA 1D2QA 3ME2A 3LKJA 4DOUA 3QD6A 2AZ5A 5TSWA 1U5YA 3B93A 4QQPA 2WNVB 5KC5A 4DB5A 1TNFA 1I9RA 2Z5WA 1S55A 2RJKA 4HT1T 4OULA 3L9JT 4KG8A 1DG6A 4QQHA 2QE3A 4QQLA 4MSVA 4F3JA 2HEWF 2E7AA 4D7YA 3AB0A 2WNVA 4QQOA 1RJ8A 2JG8B 2JG8C 1OSGA 2WNUB 2TNFA 4EN0A 1DU3D 3K48A 1IQAA 1D4VB 1C3HA 4QQ2A 2Q8OA 4J6GA 4E4DX 1U5ZA 2WNVC 2TUNA 2X29A 4TSVA 2HEVF 3URFA 1JH5A 1RJ7A 2R6QA 2HEYF 2JG8A 2O0OA 2WNUA 4TWTA 1OQDA 4E4SA 1D0GA 1JTZX 1XU2A 2RJLA 3V56A 3TYJA 1ALYA 2QDNA 5KC6A 3IT8A 4NN0A 5HBAA 1A8MA 1PK6B 2WNUC 4N90A 5CIRA 1OQEA 1XU1A 3TWIA 1WCKA 2JG9B 2RE9A 2ZJCA 1O91A 3K51A 4G3YC 4KGGA 1KXGA 3MI8A 3QBQA 3B9IA 2Q1MA 2OIIA 5L19A 4G4FA 1PK6A 4MXWB 3WD5A 4GIQA 4KGQA 2JG9A 5KWRA 3B94A 4RSUA 4MXVA 3ALQA 4OUSA 2KA3A 2R32A 2R30A 1PK6C
chains in the Genus database with same CATH superfamily
4UAPA 5FWJA 4PDWC 3UETA 4XUNA 1TNRA 1H0BA 1ODMA 3I59B 2XBO2 3I3EA 5KHKA 3AYAA 1SLIA 4AFAA 3I2KA 5LRRA 4H3WA 2EXJA 2VE1A 1HRV2 2VH9A 2VECA 3POBA 4Q4X1 2JIJA 2W39A 1YHFA 5IFPA 5DAVA 4WV8A 3T08A 1MEC3 3VZNA 5FP8A 1UYPA 4QPIA 5SV8A 4FTEA 3N3HA 4DOUA 2F6BA 1XXNA 1QQP1 1NQDA 3WX5A 4DRRA 3WDUA 1RUF3 2PFWA 1H1AA 4IUGA 5IVBA 3NNLA 3RG0A 5LA9A 2A73B 4XJ9A 1SBEA 2V5YA 4LHKA 4NIGA 4FVVA 2ZACA 4Q4W1 3KM5A 4BU2A 5FPBA 5DDJ3 3RZJA 4LK6A 3FUQA 4JGZC 1VMHA 5A3TA 1NLQA 1ZA4A 1VB2A 4RQPA 2VCAA 5A1FA 3SMHA 3MFCA 1NCRA 1YJKA 2JECA 5C9AC 3PVBB 5JZGA 4GB31 4XF1A 3PUAA 4CEYC 4D7YA 4JGYB 3ACGA 2CDOA 4WM7C 1QXRA 2C9KA 2JWPA 4KL1A 4LLFA 5FP7A 1RJ8A 4OHVA 4CCKA 1JU4A 1UYZA 5FP9A 5A70A 2VL4A 4BA6A 5CBLA 1GZWA 1RUD3 2D7FA 1HB1A 3O12A 3KMHA 3Q8AA 3TNPB 3FUOA 3THPA 3N9OA 5CA6A 4YW4A 5J98B 2NYYA 2LM3A 2WNVC 5C70A 5CISA 5JDBA 4AVVA 1MS5A 1YNAA 3AZVA 2GN3A 4E2SA 1N3QA 4OCTA 1SMVA 1AL0G 1PIV1 1X7NA 4FFFA 2RG4A 2PQQA 4RYDA 4AYUA 3FHQA 3JXSA 5IATA 3N7LA 4RS5B 5FOJB 1AL22 1R1A3 5E8AA 4XFGA 1NXD1 1X82A 4M3CF 1G7YA 2D44A 3MO4A 1V6MA 3O0VA 4XHBA 2K9ZA 3AMPA 3IM0A 2LROA 2Y33A 3ZSJA 4EZHA 1SCSA 5CFDA 4IEOA 2A75A 4IEUA 1D2SA 1JYIA 1UX6A 1GOHA 3KSCA 2JXAA 4Q0QA 4E8CA 1PO12 2CU5A 2OT7A 2VCMA 4N53A 5LY2A 2VBDA 3UGFA 2WO7A 4UFKA 1I3HA 1W90A 4XQ4A 2VMEA 1YC61 1EV13 1WWYA 3LA2A 3RI9A 3O1RA 4R4XA 3DYMA 4AW7A 1G9FA 5JOXA 1KITA 3VBRB 4YFZA 3THDA 1HRI1 3WP5A 5L19A 2YFZA 4META 3JQWA 4MXWB 2WYFA 3ZXKA 5F1RA 4YM3A 4DFSA 1LEDA 2HWB3 2PHTA 3CEWA 4H7MA 1XYPA 4XUTA 4CP9B 3LSEA 1LOBA 3FFZA 3VDDA 2DTYA 1DQ4A 2XJQA 3ASIA 4GZ9A 3MBWA 2BERA 2ZMNA 3FHIB 2SLIA 2WDBA 2PXJA 4B1MA 5IFTA 3VHPA 3ZYPA 1KD7A 2ENRA 4ARXA 1W6QA 3FC0A 4XEZA 2VO5A 5T50A 2QQWA 1W06A 1RMU1 1RUE2 2RM21 3HJRA 3PUQA 2WNOA 3X29B 4MH0E 3VKFC 4JTNA 2ZGNA 3IDBB 1D2QA 2GC3A 5J37A 3IIIA 1WD3A 1EUUA 1V0AA 2R061 2BGPA 5FZBA 3S5QA 5BXXA 1FPN3 2K2SA 4CUGA 5ACA2 3WQBA 3ABZA 2VQ0A 3JD72 5EV7A 2IXCA 3WQ7A 5KXDA 4NRQA 4P5YA 5K8SA 2PHDA 4KG0A 1EP0A 5L73A 1C1FA 2E9QA 4QXKA 3JBG3 3MIGA 5DQ0A 3VDCA 3S5AA 2ZAHA 1FXZA 3KV9A 3J8F2 1BBT3 1MS9A 1FV2A 4MGKE 2VW0A 4YZ2A 5C8CB 1QJEA 1XC6A 3CDZB 1D4M2 4Y1XA 3T2TA 4S2DA 2VMCA 4MGTA 3FLRA 3N9NA 1PVC1 1GKBA 4AEKA 4QX5A 4UFJA 1QJX1 1WGPA 4KWKA 4UXAA 2BVVA 4X8PA 5BNPA 3RSJA 4HK9A 5FXWA 2XLGA 4Q0VA 4GULA 1CPNA 4I0WB 5FY0A 1BK1A 3FBMA 3AKRA 2DYCA 3U37A 4DUXA 1RUH1 1XRUA 2RJ2A 1BYHA 1UF2C 2WA4A 3PURA 1MS3A 1RUI1 3T4HB 3BOPA 3TN91 3W20A 4RA0A 1ZM1A 3ZLIA 2QNKA 4LE3A 1NA1B 2R16A 4QM8A 1H1IA 1A78A 4O7XA 3URFA 5BUVA 3H9AA 1N47A 1V6JA 4AHXA 3EO6A 1RUF2 2I45A 2RVAA 3LFMA 2YZ4A 3MICA 3OGGA 1AXYA 1JUHA 2D6LX 5A7OA 3LD8A 4UFMA 4QU2A 4HVRA 5FO9B 3IKWA 3EBRA 3IDCB 4GAZA 4YW3A 5T54A 5K0UB 2ZGSA 4EN8B 1CZVA 2P2KA 4JGYC 3E97A 5DDJ2 3W5NA 4IEXA 3NV3A 1POQA 5KC6A 2VMFA 3NSTA 5IK5A 2MEV1 1PO21 4MGZE 1H4GA 1T6GC 2PTMA 5DMYA 5IK4A 2QQJA 3ZR5A 3PVNA 4OZOA 1CWPA 1H2NA 2P6CA 1REEA 3LA7A 3NV1A 1ZRIA 1GU3A 4C0HA 5A3NA 2A3WA 1OC1A 3J26N 3P5BA 5FZCA 3WF4A 1E5SA 4COWA 5JCTA 1EAH1 1RUD2 2RMU3 4O61A 3VKOA 5EXOA 5FK8A 5F3IA 2UWCA 1QY4A 4ES8A 5IVVA 2B9VA 3M4FA 4QWNA 1H4HA 4RS5C 1ENQA 2YMZA 5FZDA 3VL9A 4E2GA 5F3CA 5JPMB 2XL7A 4YW7A 4XBLA 3AP6A 1AX2A 2PYTA 2JG9A 2YBKA 2ZCWA 4FPFA 4CU9A 2VNRA 4Z82A 1LB2A 4DRVA 2RS53 1R1A2 3WT3A 1HV1A 1V6IA 3BALA 1RUG1 1ZZ6A 5T5LA 2Y8KA 2WFF2 3T2QA 1GP5A 1J1LA 4YG3A 3VBUB 4OUMA 2WZPP 3KZ4C 2WWSA 3T0BA 2QQMA 5CU1A 1C8M1 4Q4Y1 3M2MA 2C6SA 1DBNA 1A6CA 1JYVA 1NT0A 2UYBA 1V6LA 3VBRC 5LA1A 2WINB 1EV12 3C7GA 1C5IA 2MHFA 4K20A 4KBZA 5FYIA 5FYTA 4RN5A 5D8AB 2OQ7A 1ZRRA 2PAMA 2R063 5CG9A 4FXGB 3DYPA 3BGAA 4L0PA 3LOIA 2CV6A 2BNNA 4RR3A 3ZDVA 4WM8B 1Q8PA 4O9GA 1QOSA 1RUC1 3NJXA 1OOPA 1NX9A 3IAPA 1I9RA 4FOWA 3ENRA 3CZUA 2HWB2 1OVPA 2ARBA 2W3JA 2HWE3 3HPNA 3NNJA 3RZZA 3ZMNA 4UYBA 2BFUS 4I2OA 5FBJA 1RUJ3 4DXRA 3OD4A 4UW3A 3OUJA 4M4PA 1DP0A 4Q0UA 3ELNA 4KG8A 2QE3A 3JCIA 4WBBA 5FMDA 4TXWA 3WNMA 5FR3A 3KT1A 2RHPA 1PGL2 1U0AA 4QKFA 2EXIA 3U07A 4BQXA 2YU1A 4K1ZA 2CHHA 1OUSA 4SLIA 5A33A 2HYKA 2XWBB 3FN9A 2WNUB 1FATA 3DPRB 4XFIA 4W8JA 5C3OA 5JIUA 2PLV1 1B35B 4CE8A 4GMP1 3A23A 4YFWA 4GXLA 3HT2A 4CPBA 2WUHA 4N8MA 4P9JA 3TN93 1KJLA 1LESA 4P08A 1YQ6A 4TSVA 4TYSA 1BMV2 2W92A 3WHTA 1I5PA 3JB4C 1FPN2 1Y4WA 2IXLA 1XJAA 1QKQA 2BVBA 5C8CC 3CZJA 1UOBA 1AYN3 1IQDC 5FXZA 3WG1A 2JDMA 1OMIA 3JBG2 3DECA 4E4SA 5LEJA 1AR71 3ZMOA 1BBT2 1CAVB 4LITA 3RI8A 2B5HA 4BXFA 1QJU1 4MZUA 3H1YA 2A6VA 4CDQB 4IGOA 5AC93 3E1F1 5BPXA 3VKNA 5FZ9A 3VD3A 1IS3A 1VBE1 3H7JA 3NAPA 1O4YA 1RVF3 4IERA 3RDIA 4G9SB 1GWMA 4XFCA 3WR0A 3I4IA 1NA1C 1OLMA 2B46X 4HBNA 5BNNA 4FFHA 4MV2A 4QDSA 2WZR1 2HWC3 1RGSA 2QJVA 3N9QA 4GJYA 4HSJA 5H9RA 1CIWA 3ON7A 5EYYA 4BMBA 4D69A 1MQTA 1UN1A 2GAUA 2DU0A 3C3VA 5BYNA 4NPRA 3MIEA 3OBTA 5FZIA 3R6SA 4D6SA 2XBO1 4QKBA 3VBFB 5K0UC 1PZ9A 1UD1A 2FMDA 2H0BA 1HRV1 3RJ2X 3WW3A 4D7SA 4N7UA 4LR4A 1W03A 1F31A 1AX1A 1RB8G 3AC0A 2QQIA 5DUUA 3ZFFA 1YJLA 4B29A 1FNYA 1TVGA 2ZX1A 4UT5A 3ZKYA 4N9IA 4AE2A 1ZYBA 3ZSKA 4YPJA 3UKNA 5L7OA 1HDKA 1VIWB 2AYHA 5C5UA 1UMHA 2HH9A 1F35A 3PU3A 4IE5A 3I49A 1GUIA 3WCRA 1OA2A 2JICA 3EB7A 3PL0A 3POSA 3S57A 2UY9A 1YEWA 1W8WA 1LHVA 4XE9A 4EWDA 1YRZA 4PBPA 2C9AA 3LKJA 5HV0A 1LU1A 5A7QA 2RMU2 3O1SA 5JUVA 1YO8A 1LNSA 1VBB3 1W8NA 2RDNA 3WHUA 4AWDA 3KGLA 4BMEA 3J7NA 2B7YA 2IWGB 3FL7A 5JI9A 5DG2A 4S2GA 1HN1A 1Q8VA 2D98A 3PJYA 3AKSA 2ZHLA 5IYYA 4JVAA 4ONUA 1PMIA 1Q8OA 3D8CA 5GLWA 2GP5A 5FDBA 1F15A 3VBUC 5IUQA 4AHZA 1H8TA 5FQ0B 4ZKTB 5FJKA 2RS52 3I8TA 3MPPG 1WW6A 1W39A 4KWLA 2HLEA 3KVBA 2D93A 2RS13 3POGA 4XQWA 1YQ8A 2BNMA 3OGVA 1Y9GA 4CDUB 4EN7B 2P4EA 3I2JA 3U1XA 5FZKA 2XJPA 1IKQA 3ZN6B 2MPFA 5EJ1B 3B69A 3B5LB 4QQOA 5FO8B 1DLLA 1XE8A 3FJSA 4ZS2A 5ANQA 4LEJA 1OBNA 1TZOA 3ATGA 3PDQA 4LULA 2BWCA 5D8AC 1AL21 4IESA 3KHCA 2GH2A 1BZWA 3WNPA 4DMIA 4WM8C 3KF3A 4LNVA 5FZFA 1PMHX 3V65A 3ZYRA 4EWEA 2FDHA 4AAXA 1GQGA 4LJHA 3WOGA 3HEIA 1FMD3 3OBRA 1MZFA 2VQAA 1PO11 1JYCA 2Q8DA 1W04A 4Q1RA 4MGYE 1D0GA 3V56A 1UXZA 1QH7A 3HAGA 4KNCA 2HWE2 1AR73 1VRH3 1W99A 2W1WA 2X10A 2FDGA 1RUJ2 5CADA 3QH6A 3O1OA 3WNKA 3PVEA 3AKPA 4QX2A 4XABA 2W87A 3PJQA 4ISQA 4HZFA 5HBAA 2XLFA 5J3UA 2WNUC 2DUOA 1OQEA 3RJRA 3APBA 4HOOA 1B35C 1UIJA 2YC4A 4XUPA 4AGGA 1GWKA 1W3XA 1XSRA 3JZVA 3H42B 4IV1B 4QXBA 4AI1A 1F8VA 1O91A 3MV01 1VLNA 2VOVA 3VB9A 5I8TA 3BIEA 4IE0A 2D6KA 4ZXKA 2V4VA 5LRSA 1HV0A 5DUXA 4BOWA 3AL5A 1KFXL 2XH6A 1GV9A 2Z69A 2IVJA 2ZZQA 3EYPA 4HONA 5LBCA 5C4WA 4AGVA 4PDWA 4PCRA 3ACLA 3PIJA 1RUE1 2ZGPA 2XBO3 3ROUA 5FOBB 4MXVA 3VHRA 3ES1A 4CDQC 5GKAC 2VULA 1S2BA 1MZ5A 1N1YA 4P02B 1AX0A 4PT6A 2R30A 3EJKA 3GZEA 3HIFA 5EJZB 4CCDA 3U4XA 4CCJA 4JKMA 5L36A 3SKVA 4FPOB 3H1MA 4XIKA 4N9HA 4AEJA 5ACA1 2AENA 2YFUA 4YVSC 4AI3A 5AC92 1QJFA 1XNBA 3JD71 3LB9A 4QHBA 1DIWA 3AP7A 1PMJX 3VBHB 1SCRA 1OKQA 1SPPA 1QMJA 1FOD3 5FZLA 1RVF2 4HETA 5JLVA 3M3QA 3J8F1 3ME2A 2JDNA 3ZYJB 1C1LA 3VBOB 3QCWA 1D4M1 5IVEA 3VBFC 3AXDA 1R092 3HNBM 2HWC2 4JGZA 4YW2A 1OLQA 3UK9A 5JXHA 4OHZA 1ZBE2 5FZEA 4PLMA 4YGBA 3L2YA 5L9RA 3RGBA 2JDHA 5C9AA 2VZPA 4DXSA 1B09A 2ZEZA 2WLQA 1OLME 5AVAA 4N7IA 4WM7A 4D6QA 1NZIA 1VR3A 4OUEA 2WZ8A 4W4ZA 5FZ1A 3TRSB 3SH5A 5JR2A 2V5DA 4EN9B 5CEHA 1KJRA 1BK0A 3WEZA 1MEC1 2XJTA 4HSLA 1LHNA 4QQLA 5J1XA 3OGJA 4F3JA 1UKRA 3AB0A 4NR1A 1ASJ3 2WNVA 3R4SA 3BPZA 3BI3A 5A1LA 5BNOB 3RZMA 3GHNA 5A6YA 4HG6B 4CUCA 3N7JA 4NVPA 1SEFA 1V6KA 2EAAA 1RUF1 1AR63 2JG8C 2Z42A 1VBA3 4QAWA 3ZYFA 4F83A 2DBIA 4PIZA 1P8JA 3WNNA 2VR4A 4IL7A 1WLCA 2VM9A 2ZS6B 2FZ1A 1ULCA 4UOJA 4RD7A 2WYSA 3FE5A 3NNFA 3Q9OA 3RYKA 3BPSA 5DDJ1 2E33A 3SH4A 4EZ4A 1LHWA 1RJ7A 1VBB2 2R6QA 3AP9A 3E5UA 3VL8A 2J1RA 4DXZA 1JS9A 4KBBA 4XFAA 1X8MA 4E27A 1WMXA 3CMGA 4BPZA 3MIFA 5JPNB 4B8EA 3ZPYA 4GWJA 2CDPA 2VUCA 1W8TA 1SLLA 4XILA 4CDUC 2V09A 4AG4A 2OUJA 3BODA 1UY2A 3WUDA 3SCHA 1RUD1 3WG2A 1BJQA 2PHRA 4NROA 1V6NA 1IPSA 4JKLA 3I54A 5FPVA 1SZBA 1RITA 2X53S 1WW7A 3VLBB 1QU0A 2Q4SA 3I97A 4TLFA 2RS12 3T3YA 5T5PA 2CSGA 2R0FA 2ZTNA 2QFEA 1EPZA 2ZGLA 2UY8A 5HV4A 2L9LA 3QH7A 1LGCA 4C91A 1FT9A 1YFWA 2QQPA 2G1MA 2DVGA 1QDOA 3CJIA 4QB2A 1R1A1 3ZKUA 1JZ3A 2HBTA 3USUB 1Q8QA 3CO2A 1S0BA 5CZKA 1DYOA 2I74A 4FP2A 3O1PA 5DAQA 4A41A 5T5JA 4LXLA 2XDVA 3VKMA 1MZ6A 5FLJA 3W58A 3ZFEA 3N35A 3OY8A 3B94A 4ASLA 1EYBA 4MGQA 5FYUA 4W6YA 3DN7A 1LOAA 1FMD2 1DGWA 4CDWB 2OS2A 4M01A 1EV11 1LKNA 1VRH2 3H50A 3BN6A 4YZ5A 3T2PA 2VZ1A 3CHXA 5IT6A 5EZWA 1ZRCA 1UOJA 1V9U3 4FPJA 4NAOA 2ARCA 5ACA3 2PHXA 1KEXA 1XNDA 2AUYA 1CONA 1UNBA 3SNMA 3RWKX 1QOTA 4PBOA 2HWB1 5DABA 4ZHNA 3NV2A 2WN2A 4B7KA 2Y0IA 3J8F3 3WG3A 4NAMA 1CPMA 3NJVA 3FLPA 4NWVA 1ST8A 3I59A 3PVOA 4Q0PA 4QT6A 3UGHA 3OPZA 5G05L 3AVRA 4NE9A 3TEYA 1PGL1 5J09A 4HKOA 1IHMA 2OKXA 5JMCA 1E5RA 1SHWB 2Y34A 1ULPA 2YXSA 3H1WA 4QHZA 1K42A 3T30A 2QDRA 2WS93 1IG0A 2IXHA 4OHWA 5C33A 1GNHA 1VALA 5CB7A 5F9TA 1UYYA 3GHMA 3VBHC 5IHRA 1GSLA 2PA7A 5FZAA 4CYDA 1DHKB 5FZOB 1BMV1 1HX6A 3KB5A 4FPGA 4Y5Z0 1FPN1 2BP6A 4WZFA 2VQUA 2WSUA 4E2QA 2WR9A 5BNPC 1YIPA 2WFPA 4FOVA 1PHMA 1JOBA 4Q5OA 4W65A 2H6BA 2G9GA 2XKPA 4XMAA 3VBOC 3WZ1A 4NIIA 3JUUA 3JBG1 1FOD2 1IZ3A 5EHDA 1CIYA 2FCUA 2Y6LA 1POV0 1BBT1 1F2NA 3LEGA 4LBLA 4PQQA 1CX1A 4ZU7A 1HB3A 2Z2SB 2BRTA 5E88A 1ZRFA 3IB3A 4ZU4A 1OF4A 4FCAA 4WVZA 3WINE 4O65A 2XJVA 1SBFA 4CXWA 3VZKA 3B7MA 4QB6A 2VPVA 4QHOA 1AXZA 2KR2A 4FFGA 2B42B 1CR7A 1N1VA 3I2FA 2ZHNA 3WW2A 1SDDB 5FAXA 5IVJA 1YFUA 4TZDA 4OI2A 2VJXA 2ARAA 1HIXA 5JXJA 3BU0A 1W8FA 5FKBA 3WG4A 4R9DA 3N4MA 1H1MA 5BNOC 3PMEA 3CLPA 1G9DA 5JMOA 2PHFA 2D6MA 1LODA 1WLDA 2F17A 2W9XA 1XPWA 5CIRA 4LUMA 1GYKA 2WABA 1S0IA 1DLCA 1ASJ2 3FWEA 4RS5A 2XWJB 1BVP1 2IXIA 3WNLA 2FCTA 2IZWA 3OPWA 5GLTA 5GZGA 1APNA 4S2HA 4A42A 2ZX2A 2JX9A 4LBKA 5C3SA 5HI0A 2Y6GA 4CCEA 5FRAA 1AR62 5KHGA 1VBA2 3ZIWA 2LTNA 2XJUA 3RQ0A 5JWPA 1DQ2A 4QGMA 5JOYA 1VAMA 3SC7X 3H3UA 2Q1MA 3UV9A 2V73A 2WKKA 4G4FA 3O0WA 3ZYBA 4DINB 4BK4A 3A0KA 5FMOS 4Q1PA 3FX3A 2WFF3 4GALA 1IS6A 4JQRA 5JSOA 2IUWA 2ZXQA 4HK8A 2Q30A 4DEQA 2XB6C 3ZDSA 5KR7A 2VMDA 3CQOA 4FPYA 3VBRA 1PZ8A 4FOYA 3UJQA 4DS0A 2EIBA 4BDVB 5I91A 4MXWA 5BNQA 2RMU1 5I0UA 1W6OB 2D6OX 2VD7A 4CCOA 2ZEYA 1OPOA 4Y1ZA 2WRAA 1W6PB 1N1TA 5DG1A 2QQUA 4XJAA 1OFSA 3VZLA 5CAZA 1V70A 4JHTA 2ZPXA 1CAXB 4Y26A 1UO9A 4GKYA 2C5DA 3GDBA 2J1AA 5FZHA 4QM9A 3VBSB 2Y60A 2XJRA 2DVBA 2RS51 3LEKA 5T55A 1UU4A 1CAWB 3E5XA 1UAIA 1ENXA 4QX7A 1RL3A 2HWD2 4LO8A 5GM0A 3NW4A 1O59A 1XOYA 1GOGA 4LHSA 3FMGA 2Z5WA 1VMFA 4FOQA 4CDWC 1JZ7A 4LHNA 1CAUB 2YDEA 1O4ZA 2N7GA 4HVOA 5B4XA 2ZZJA 3V0BB 4NIHA 4ZZ5A 4AFDA 4GH4B 4OMDA 5F2WA 5FY1A 1C4RA 3AKTA 5A3LA 2QUOA 4AK3A 2VMIA 3A0NA 4Y1VA 4Y22B 4CXYA 5I0TA 1NE6A 2VXJA 4RGAA 1J3QA 1JXNA 4IEVA 4YW1A 1D7PM 3V0AB 3C7EA 4QGNA 4UBGA 5KXBA 3LPGA 5I93A 1V9U2 1JZ6A 3POIA 4EE2A 5B2GB 5C8CA 3RZKA 1OSGA 4I0BA 3ZN4A 4CXXA 3LDKA 2EAKA 2G9FA 5FYVA 2ZX0A 2PAKA 1NUKA 4BISA 5DXDA 1WMFA 4COUA 1IPJA 2TUNA 1G9AA 1V6OA 3HNYM 3M3IA 2BEOA 2HWE1 3RFRA 4AZZA 2A6XA 3ORJA 2OXBA 1A34A 3AMMA 1RUJ1 2Q8EA 4XJ8A 3Q8EA 1X50A 4ES9A 1XYNA 4FBFA 4BB3A 5K4LA 1GQHA 3O14A 1FV3A 4YGCA 4DUVA 3KV6A 3USSA 4Q26A 3G7DA 4BWOA 1OQDA 3D0SA 5LCWL 5GZFA 4J1XA 3I2OA 1LTEA 2VNVA 4ASKA 3J4UH 1NA1A 1QNWA 2WS92 3E6BA 3T0DA 1R082 3LF7A 2NMOA 2IC1A 2JIGA 1HQWA 4N90A 4IXLA 1MS8A 1SLAA 3LEIA 3A22A 2DVAA 2ET1A 4YLZA 1REDA 3ZXDA 1ZRDA 1BKZA 5FTTC 4CDXC 2V4AA 1O8PA 5K0UA 4YG0A 1SFPA 1AYN1 3O0XA 2NP0A 4FO9A 1KXGA 1NLSA 3QBQA 3LOBA 1UU5A 2A6YA 4QX1A 1GNYA 3MEPA 1SG3A 4Z8BA 5JSRA 3VD7A 5A7WB 4D0QA 1PM4A 5KHHA 3MHZA 1POV3 1NQJA 1UMIA 2UWAA 5CYYA 5AC91 3BTAA 5KWRA 1DYKA 1DQ0A 2VBBA 2Z4FA 3K4AA 4YVWA 1OD5A 5I8YA 3IPVA 3OYWB 2W95A 2JB4A 1RVF1 1VMJA 2X5IB 2JDUA 3IAQA 2WIIB 2ZEXA 1X36A 1QHDA 3FFQA 1FAYA 2OQ6A 4SBVA 4JTOA 2PHWA 5A3WA 1R091 1RUOA 2HWC1 2CGPA 4XDQA 3PU8A 4ITCA 3WNXA 1YQ5A 1ZBE1 1ULFA 3BYWA 1N3PA 3T1LA 4MVTA 1F4AA 2WT1A 2VUAA 4CUAA 4COZA 4P5HA 4DY3A 5C6CA 1Q5OA 1J83A 2AEYA 2C26A 2P5BA 2ZABA 2W2IA 3ETPA 3F95A 4YSFA 5IK7A 1NY72 4D6RA 2JKXA 1OURA 4FT8A 3THTA 5CFCA 3VBUA 3B93A 4M4RA 4QQPA 5H9SA 5EYXA 3RS6A 1W05A 1AR83 5KC5A 2X8KA 4DB5A 4XACA 1DCSA 5F6KA 4L97A 4UFIA 4YZ1A 1WLWA 4AFCA 3MUY1 4FFIA 1TMF3 4Z1VA 3PTYA 1XNTA 2OYZA 1JN2P 5I0DA 2FDFA 3DKQA 5D8AA 4Y4YA 3RYPA 1DQ6A 4MO3M 4QB1A 4WZCA 1AUYA 1UKGA 4DQAA 5FY5A 3GF6A 3OUIA 5AFBA 4BQ4A 1KGYA 1QJY3 4MYEA 2R7EB 4WM8A 1XBFA 2IFWA 1NE4A 2VOWA 2FDKA 1L3JA 1E57A 1Z0HA 1LOEA 4JX0A 3HMYA 5E6HA 1VBB1 1OVSA 4LBQB 2FDJA 2J1UA 3E6CC 3WDTA 3AJZA 3IN9A 3VBSC 1J58A 2XUEA 1K5JA 3DGTA 2V72A 3S0MA 1G86A 1C3HA 1STMA 4P9LA 4Z07A 2DTWA 2B8MA 3T0AA 5EFUA 2ZKNA 5JOWA 2VBPA 2WAAA 1SACA 4GMP0 4Y5TA 4GH4C 4LA3A 2RS11 2QTWB 2WNUA 2NQYA 1UZ0A 4LBJA 3KV5A 3DPRA 4UFLA 5B4NA 1JTZX 4TTGA 3LPFA 4INDA 1B35A 1LOFC 2IXKA 4MLOA 3GZUC 4XPVA 4E8DA 5JR7B 3UNPA 1Y9MA 2CNAA 3PHMA 3POYA 2DVDA 4MX3A 4LKDA 1CN1A 3A21A 2W1SA 1GFF2 3POWA 4NWWA 2FMYA 1OLRA 2WL1A 4IDZA 1PK6B 2ID4A 4AQTA 2RDQA 3K4ZA 1XQNA 5D2AA 2Q1ZB 2J42A 1Z7S3 2D3SA 3B01A 3WXPA 3K2OA 3J7HA 1US2A 4LOTA 1AHSA 2P1BA 3NWKA 1CAVA 1TEIA 2C1FA 4JRLA 1WUVA 3D6EA 5FKCA 3RZLA 5FYYA 3SH3A 1FMD1 3VDDC 5DZEA 1JYXA 1W9YA 2LALA 1IPKA 1DF0A 4CDQA 1TQ5A 4ZU5A 5FXXA 3CIHA 5I0RA 4CCLA 2UWBA 2IXJA 3MIBA 1YFXA 1PVXA 1VRH1 2I2SA 1UL9A 4NHKA 3JQXA 5DZGA 3CKHA 4CCNA 1JODA 4IE6A 3KHBA 4XFBA 2LUWA 4CP1A 3THCA 1S0GA 4IGQA 1IS4A 4K7JA 4XHXA 1H2KA 2VMGA 1G9CA 4AI9A 5CKNA 1GWLA 3U10A 3O1MA 2BWAA 2P17A 4YVSB 4HANA 1DGWX 1HXS3 4QXHA 4XURA 2Y6HA 3I2DA 4RFRB 2O8QA 3VBFA 3H8RA 1R093 1WCDJ 5DPNA 2R0HA 5KHIA 4Y33A 3LIGA 3ECQA 3ZO0B 1ZBE3 2EIDA 2Y26A 4XZPA 2I07B 3WF1A 1UY0A 2XHKA 1RC6A 1G6NA 4LO6B 2C24A 3IBMA 3TEZA 1QGLA 2CL2A 2YGMA 4EROA 1UX7A 3KWVA 3LSDA 3HWJA 3PUIA 5GZDA 2ERFA 2HBUA 2OZ6A 4CU7A 3K46A 1AYM3 4IE4A 3WP3A 5F32A 5FZ4A 1VJ2A 4XAAA 5EPAA 3ZN5A 1UOGA 2JD9A 2YPDA 5HCFA 2ZAAA 2ZMKA 2X5IC 4OI0A 3UGGA 4ZONA 3OGSA 1RXFA 3VUOA 1LOGA 1REFA 4L11A 5JOZA 3CBNA 4NHXA 4NHYA 2YPJA 1FOD1 4NMIA 2EA7A 2OA2A 2YUEA 3WDYA 4MUVA 4JCKA 4YM2A 2GMPA 4IQPA 3A7QA 5FUIA 1YUDA 4Y20B 1W2UA 2VAUA 3NJYA 3PIGA 2FQPA 2JG8B 3R4DB 4BE3A 1WKYA 2WT2A 2XONA 1S0FA 4AI2A 4V2WA 4FI9A 4IETA 1ZZCA 5FQ0A 5I0SA 3NMBA 4JAAA 3KVAA 1LULA 3RWNA 5C7GA 1O5UA 1SFNA 2CY6A 4JV4A 3SLIA 4R8HA 1T2XA 4HXCA 4Y1UA 3OSDA 1GZTA 2A71A 4D94A 3U0ZA 1JH5A 4CDUA 3ZN6A 1CZSA 1WD4A 3H8XA 1JOPA 3KQRA 4W50A 4XJUA 1GANA 1Y3TA 1AR82 4TWTA 1OI6A 1ASJ1 1YLLA 2P3JA 4CUBA 3ITQA 1X9PA 5FXVA 4B4PA 1TMF2 1R64A 1H6XA 4LLOA 1AR61 3GCXA 2RV9A 1QWRA 1VBA1 2PMWB 1ZREA 1DZQA 2P37A 3OEBA 4S2FA 4H2AA 1GZCA 2ATFA 1A8MA 3EHKA 4NHMA 4QPWA 1QJY2 3TWIA 4CA9A 4YM1A 1BVVA 4RHV3 3TBDA 3VD4A 2VNOA 3LIHA 1RIRA 3KLSA 3AYCA 4DZGA 3GBFA 4EQVA 4LIUA 1S0EA 5FK7A 1VBD3 4YGEA 2VMHA 4L2NA 3S7IA 2GZWA 5FPXA 2WC2A 1T6BX 3ZFGB 1QOOA 1ZZ8A 2NN8A 3GZAA 4GWNA 4QPGA 5EJ3A 5I8SA 4AQSA 1W0OA 4BQWA 2JDKA 5FYSA 1SFYA 4IV1A 5CKQA 5FREA 1UZYA 3AKQA 4HFSA 5LA0A 3O1TA 3ALQA 2FBEA 2WBKA 1GP4A 2J22A 4UBHA 4YW5A 3ZX7A 3OEAA 4NO4A 4XF9A 5ABJB 4LMFA 2BTVC 1PK6C 4Q27A 1W6NB 2GU9A 3OOXA 3KCXA 3WDXA 4ZZ8A 5BV6A 5C71A 1ULDA 2WN3A 4IV3B 1J84A 2HWD1 1O6UA 4XVHA 1C57A 4AVSA 3KCYA 4FP3A 1NOVA 1Z7S2 2W52A 3UKVA 3I2GA 1OPMA 1Y7BA 2O1QA 2R1DA 4PI0A 4QDRA 2AZ5A 2DFCA 3I3BA 1WCQA 4K21A 4N43B 1K12A 1US3A 1CJPA 1YIFA 2XR4A 1UW8A 5DUVA 1HQLA 4AVAA 3IIAA 2VTXA 1QF3A 2GMMA 1W6MA 3VBHA 3AP4A 3K3OA 4I3GA 4FAHA 4BH9A 2FHRA 2XHNA 4UFHA 5T3NA 4EYUA 4PF1A 2RR13 1A3KA 1UY3A 5E89A 1V9U1 4D7TA 5K9YA 2EF6A 1HB4A 3VBOA 2GNMA 2WQ4A 4XTPA 1JHJA 3R4UA 2BFUL 1W2NA 3POFA 1PNGA 4YZ4A 4F8AA 4LPLA 2VG9A 1K3IA 2AC1A 3C7HA 3VD9A 1K5MB 4XYXA 4YNIA 4URAA 4Q4V2 3IMNA 5EP9A 4KMQA 4AVTA 3PUHA 1HXS2 2VVEA 2WNEA 3GJAA 4ZS3A 4DO0A 4ZXEA 5C5TA 2VUDA 3HN1A 1UXXX 2LW8A 4LQRA 2TNFA 4HPKB 2CYFA 4K3UA 3ZIXA 4UW5A 1I1EA 1ACCA 1IKPA 1DZTA 2AACA 4J6GA 1QJZA 4E4DX 3U11A 1W9FA 3M3OA 1LGNA 1FNZA 2TBVA 3MLLA 4CEYA 4BQYA 2WS91 1CX4A 4LKFA 1JBCA 1ONAA 1R081 3DV8A 4I30A 3RMYA 3POEA 5FIXA 5FPUA 1QXPA 3BKZA 3R0RA 1IGOA 1XB9A 3SISA 3LCPA 2VZUA 1AYM2 4DUWA 4DPNA 1C5HA 2RJLA 2QZ3A 2BV4A 5IJRA 3EQEA 2F4LA 1L7RA 4KWUA 1H2MA 5FV3A 5FMBA 3IT8A 1LEMA 4MGIE 5FZ8A 3VHNA 1TG7A 5A6QA 3AYEA 1ND3B 2VGDA 2E7TA 3BB6A 3AMHA 2XUMA 3FBYA 3D5OA 3VZOA 3OG2A 2RS33 5HXVA 4DEVA 2DCJA 3LA3A 1NXMA 3K51A 4G3YC 4BIFA 3B9CA 2ZHMA 3K75B 2ORXA 2A6WA 2FZ2A 4XDOA 4C90A 3ZFFC 3U4SA 3IWZA 2YYOA 4PJYA 2DUQA 2DWRA 5A32B 2XVKA 1C8M2 3NQHA 3W9AA 5IAXA 1QXJA 2RDSA 4WVMB 3ZVXA 3BTXA 4BQ5A 1M4WA 4LBQD 1MZEA 4CP2A 4YYOA 1ULEA 5FY4A 3USUA 3DF0A 2TEPA 1ND2B 4Y5SA 2WQ8A 3VD5A 2EXKA 4A7YA 1ODNA 2A1XA 4IW3A 1L7LA 1NY71 1OH3A 2WQZC 1DDLA 3I3DA 3MW4A 3CJXA 4UF0A 2ILMA 1C28A 2HJIA 4KWJA 4AVBA 5D21A 3LWCA 1BCXA 5FZMA 2HWD3 4RHV2 2GC0A 5FP3A 2ZX3A 5E1RA 2WFF1 3ZFGC 4CDWA 3LEMA 3QD6A 4IEZA 1ZBA3 2W5FA 3NKTA 1AXKA 1VBD2 1SLCA 3D4KA 5F39A 3HQRA 3I3QA 1PZ7A 4CCMA 1XE7A 1GLHA 2ES3A 1WLTA 4M3CB 3PUSA 5ABJC 4HN1A 4R9BA 4XF3A 1UU6A 3V64A 3ZM8A 3D82A 2G19A 2P3IA 4KH9A 5LK7B 5FYMA 1CJDA 3HBKA 1JHNA 4ORFA 2BQPA 4OULA 1JZ4A 1MVEA 3ES4A 4HVQA 1VBC3 4IV3C 2EVXA 5IVFA 2HEWF 2JEMA 4OLLA 4ATFA 1Z78A 2J7MA 4OQ8A 1DGLA 3CJIB 1ZZ9A 2QKDA 1ZX5A 3WQ1A 1O5LA 1GZ9A 1RXGA 2UURA 1AJKA 3KT4A 4MHUA 2BUKA 1GICA 3INAA 2DUPA 2RDRA 4N43C 3WW1A 3RYRA 5BY5A 1LOCA 4B4QA 2A7AA 1KDKA 4RGGA 3ZFEB 3ACHA 5HPOA 1TME3 2KXLA 1W2AX 3MFAA 1OD3A 2VVDA 2GP3A 3AK0A 3JU9A 3O1VA 1NCQB 1EPWA 4OVEA 4JZRA 2HEVF 1DQ1A 2QQOA 2UU8A 4A45A 1J59A 2DCKA 1Q56A 2XLAA 5FZOA 4BZ4A 2WO3A 1WMDA 2K0GA 5A3MA 1G9BA 1U5IA 2JE9A 1R083 1X8EA 2HYXA 2VZOA 4UW4A 4XBNA 2GNBA 4BHPA 4CPBD 2BGOA 1M06G 1YI9A 5A6ZA 1JYNA 1MR5A 1FYUA 3T2OA 2RR12 1H6YA 2VOXA 1LU2A 1W8OA 4ET7A 1K5MC 1YI7A 1VP6A 3OGRA 1ULGA 4OHYA 2ORZA 3N36A 4WVWA 2QVSB 2CTVA 3KT7A 2ZGMA 4XC9A 4F7ZA 3U14A 5A3UA 3IDAA 4I01A 2Q1FA 4MG2A 4GWIA 3MLKA 2NLRA 4K1YA 5IAVA 5FY7A 2ADDA 4CDXB 1JUIA 1E5HA 1BEV3 2XVGA 5FPZA 2YC0A 3NL1A 2DVFA 4JGYA 4XBQA 4AHWA 2LRPA 3TEWA 4AEDB 1OKOA 4CEWB 2GN7A 3AZXA 3ZYIB 3O7OA 4FPEA 4NPLA 4BM8A 4AF9A 2JE8A 1SDWA 4BCUA 5LA2A 4QX3A 4KQ7A 3VDAA 3HN3A 5F7UA 2SBAA 2WAOA 4Y1YA 2QCSB 4XF4A 4K40A 4OFGA 1WBLA 3DKWA 3IDEA 4Y3OA 3KQ4B 3T4VA 5KXEA 1COV3 4LE4A 2VNGA 4QPIB 2H0VA 5T52A 5JXIA 1ND3C 2DURA 4QPYA 2YGLA 5F8PA 1IS5A 4LKSA 2AH2A 3RMXA 3GJBA 2YG0A 3NVCA 1GR3A 3SHRA 5LW9A 2YC2A 1GQPA 3H8UA 1OHFA 1S4CA 5EWSA 4DNYA 1UPIA 2J1VA 3WLUA 4LBMA 1QDCA 4AFBA 2Y6FA 2RS32 4ZPIA 2DDUA 1POV1 3ILNA 2HWF2 3POJA 1RHI3 1YYNA 2D5HA 1NAEA 4QU1A 1DYPA 2VU9A 4RQPB 5J96B 1NCRB 4EV0A 5SV5A 2EIEA 5JZGB 1W6OA 1PGW2 5FO7B 4AHYA 1DGRN 3LDRA 4XXAA 2ZGQA 1UY1A 1W6PA 2AREA 1AVBA 1TNFA 2QQNA 3HVDA 2QBXA 1ND2C 2X05A 3LE0A 1CAXA 4GA9A 3DXUA 5FY8A 3UT0A 1GZWB 3NNGA 3WVJA 3P3NA 5FZ3A 1SBDA 2VVFA 4LK7A 1RTVA 2XL9A 5JAXA 1J3PA 1UQXA 2CWSA 4GWMA 3MW3A 5APAA 1SQ4A 3VBSA 2DV9A 4CP9A 3W5MA 4K6BA 1DG6A 2P6HA 4BYYA 1CAWA 1W0PA 3K3NA 2ZGUA 1F9KA 1ZZBA 1R1ZA 5FJHA 3BU7A 2YBPA 4XAEA 4Q29A 4XJZA 3U75A 1CAUA 3GALA 3AFKA 4QX0A 3V0BA 2JDAA 3BTYA 4I0AA 2GDFA 1ENRA 1AR81 2B9UA 3DL3A 4GH4A 1DU3D 1KS4A 2NMNA 2YU2A 3NJZA 3S6PA 1AF9A 1PGSA 4Y22A 1U5ZA 2R043 2GMEA 3F2ZA 5LZ6A 1LOFA 4CCCA 5CFDB 1TMF1 1ZBA2 5LATA 3WF3A 3V0AA 5LBBA 4OHXA 1OUXA 5LASA 4CU6A 4FAGA 2VQTA 3MW2A 2GNDA 1G8WA 3NO8A 4N53B 2HEYF 2A6ZA 5C3QA 4M0NA 2O0OA 1MPXA 1EY2A 4NIAA 1NLRA 2ZOEB 1QJY1 3ZXEA 3VZJA 2DCYA 4M3CE 3SEEA 1AR92 2XJSA 4Z92B 5GLZA 2W91A 4A2UA 4P9IA 2C4XA 1UOFA 1W8UA 2OPKA 4Q8LA 5F5CA 4E9KA 2GNTA 3CJIC 4LHLA 2VW1A 4DY5A 4GQ7A 3N9PA 3RPQA 1S2EA 5C8WA 4LKEA 2YROA 4NN0A 4UI9L 1H30A 2R073 1VBC2 5CNAA 3UESA 1NYWA 4FSJA 3WF0A 4DIQA 1O4TA 3OCPA 2CAVA 4A7ZA 3KCCA 3ZFEC 4EWAA 3RNSA 3N9MA 2YHJA 3TB0A 4FTBA 2ZJCA 1HQNA 4A4AA 1NCQC 3SCFA 4QKNA 2BBAA 3VDDB 5F5IA 5J48A 2GH8A 4PLNA 3GNEA 3MI8A 1JW6A 2D6PA 1TME2 4Q4X3 3AZZA 2WT0A 1W8ZA 1W6QB 1SLBA 3N7KA 4ARYA 4V2VA 4KGQA 1OT5A 4E4HA 4DXTA 4U2AA 1DFQA 2OVUA 1HLCA 5A80A 4QX8A 1QQP3 2Z79A 4YZ3A 4JHZA 5F2SA 3R05A 2R32A 3TOJA 2E51A 4QKDA 5JSPA 1Z7S1 2XVLA 4FPKA 3D0JA 4O9EA 4XETA 4I3PA 5FPLA 3LDBA 4JDOA 1GBGA 2E63A 5F3EA 2E53A 1RYYA 1F4HA 4JDNA 4Q4W3 5H9PA 5A7WA 1JMUB 3M3EA 1JYTA 4LTAA 5C3PA 4LIVA 4AEDC 1U5XA 4CEWC 3M1HA 5A7NA 2A3XA 4XIOA 4FPHA 1CD3G 2P3YA 1MS4A 3OYWA 1XSQA 4GB33 3PLQA 4MHRA 4YW6A 1BEV2 1W2TA 4IGPA 3Q8FA 1XNKA 2D3PA 3VZMA 2X5IA 3P3PA 4LO5B 4HLTA 3I3MA 1U12A 3N9LA 3VV1A 4NHLA 1MEC2 1YQCA 2OX0A 3WUCA 5DZFA 2AEZA 5BNPB 1XNAA 3ZOIA 1YFYA 2W68A 4Q0SA 4QPIC 4NOTA 2ADEA 4Q4V1 5JVVA 4IEYA 1LENA 5LBEA 1HXS1 5AFEA 3BVCA 4ZY9A 3B00A 2RJKA 1CESA 1PIV3 4K8FA 1W0NA 2XXZA 4JC1A 1COV2 4AXOA 1F5JA 1YQ2A 3UKTA 2E7AA 3U78A 3WY6A 3ZSMA 1HN0A 1LECA 3KF5A 4FPCA 5LWBA 4FQ4A 4YG6A 3TEXA 5IK8A 4D8MA 4Q8KA 2VZTA 3O5SA 3GCWA 1UYXA 4RQPC 2C0ZA 2BDRA 1NCRC 5JZGC 1D4VB 1BXHA 4NUBA 1AYM1 3AL6A 2WO1A 1OF3A 1S0CA 3UL2A 1UMZA 1ZZ7A 2X29A 2J1EA 4AAPA 1RHI2 4XCBA 4CVUA 4YVWB 3ZPOA 3IPVB 2GC1A 2OZJA 4PF5A 3RRDA 3WNOA 4LBQA 5JXGA 3SEPA 3M8LA 1PM7A 2R49A 3B02A 3ZSLA 4MOAA 1BHGA 1HRI3 1XU2A 2QQVA 4AR2A 1QIQA 2ZGOA 3WW4A 1NKGA 2QDNA 3AJYA 1N1SA 5FZ6A 2FDIA 1QEXA 4FXKB 5HCBA 4Z2WA 3ILFA 1OH4A 3VKLA 1XU1A 1LAJA 2JG9B 1HJFA 3AZWA 4J25A 5CFCB 2JDYA 1JZ2A 4LOSA 4YRDA 1ZA7A 4B3NA 2CGOA 1WMEA 3L2HA 2XGXA 4R9AA 5F6LB 5FPAA 3PMSA 1IG3A 5CFDC 1S1AA 3MZHA 4NIDA 5ANNA 4GD4A 1S0JA 2CWMA 1RMU3 5HXMA 2RM23 1QNYA 4JQTA 3B9IA 3GM8A 3MIHA 2XQXA 4MADA 4N53C 5FLHA 2E7QA 2R042 5A3OA 5K7PA 2ZA9A 1PK6A 3W21A 2QQLA 4R52A 3BOWA 1QH6A 2EIGA 2W46A 4H14A 3OB8A 4I02A 3T09A 4QXCA 2WZEA 1MS1A 1Q43A 2JDPA 5FMOL 2VY0A 4OUSA 1URXA 1X9TA 4C0BA 3I7DA 5A1AA 2O14A 2WJSA 3T1MA 4RHV1 3GGLA 3LFIA 4AI8A 2WO2A 1SLTA 4P00B 4TLGA 3N7MA 4QD2A 5E16A 3HOBA 1VBD1 1W9SA 2Q8CA 5HCAA 4RR3B 3FLTA 2R072 5G04L 1OOPB 4B4RA 1PVC3 3W59A 5FMCA 4AGRA 2GC2A 2OPWA 2H6CA 3NKGA 1QJX3 4XOGA 1O8SA 2ZBJA 2VZRA 3E6DA 1UZVA 3MLJA 3ZYGA 4CU8A 2XOMA 1GMMA 1U5YA 4A7KA 4IE7A 3HQXA 1RUH3 4AVCA 4YVSA 4CTEA 3LQCA 1W8HA 4BQ1A 3SXWA 4Q4X2 2BGCA 3GZTB 4L99A 3VDBA 1RUI3 4GKXA 1NG0A 2F4PA 2BU9A 3MGUA 1WW4A 5A33B 5L9VA 2XPJA 4QGLA 2EXHA 1WCSA 1FX5A 3DXTA 1QQP2 2KD7A 4Q4V3 4ATEA 1O3QA 4HT1T 3L9JT 2YV8A 4QQHA 4MSVA 2YB7A 4QMAA 2OW4A 5FUPA 3MDPA 3GBWA 3GBGA 4XJWA 5FZ7A 2VCBA 3PNAA 4BIOA 3HNMA 1JU3A 5EIYB 4Q4W2 1YWKA 5FCCA 1EUTA 2Y6JA 4OMCA 1O7FA 1VRBA 2ZEWA 1VB4A 1OA3A 3SCGA 3H3LA 2WLPA 5L9BA 1KRIA 2MEV3 1PO23 4AQ2A 1NZCA 5LB6A 1UCXA 2DF7A 2JDZA 2J1SA 3HQUA 3NRUA 4GB32 1DZRA 2DFBA 4XF0A 2PQSA 3BTZA 2YY1A 2RR11 4PIYA 3ZYHA 1Y9QA 3GXUA 3TAYA 2VZ3A 2E26A 3OF1A 3PTRB 4Y20A 5GZEA 5F5AA 1H9WA 1EAH3 2HKXA 2JG8A 2PAEA 2J1TA 2X09A 3NAPB 1WCUA 4URTA 4XFHA 5F5QA 2AR6A 4IEPA 1OXCA 1UWWA 3OBAA 1OQ1A 1OFNA 4M0HA 4D3WA 2G9ZA 2VXRA 4L9BA 4COYA 1LJ7A 1XNCA 3K4DA 4AI0A 5A6XA 5BNNB 5ISLA 3WP6A 2W94A 3AM2A 5GJ6A 3ZXGA 5F37A 4LT5A 1PIV2 5FZ0A 1KFUL 4M00A 5J7MA 2BOJA 2WSVA 1MQTB 2B45X 3UJOA 1WA4A 4RFT0 1H9PA 3MPBA 4IEQA 5IWFA 1W28A 1RUG3 2BOIA 2RE9A 3ST7A 4AEMA 5M0TA 1LGBA 1ULOA 4V1PA 5LY1A 1JYWA 4OYUA 5JI7A 5T5OA 4WVVA 2ETEA 1KQRA 4YVWC 5FBZA 1C8M3 4Q4Y3 2JE7A 4CP0A 3ZFFB 3FHAA 3OTFA 2MNGA 3AFGA 1FI2A 1X33A 4KI5M 2E31A 4H55A 1J3RA 3LAGA 2VZVA 2G4IA 4OI1A 5L7OB 2A5ZA 4QDQA 4BXSV 2ZGRA 3P1IA 1LRHA 1WA6X 1CQ9A 3AMQA 4OQ9A 3C7OA 5CVRA 3NNMA 4KU8A 5A7PA 4A44A 2JD4A 1HRI2 2ZMLA 2VOTA 1XE0A 1RUC3 2BBVA 2RS31 3C7FA 2HWF1 4JDMA 2JG9C 3SKJE 2NM1A 3ZFGA 5CFCC 4NRPA 3J7MA 1HW5A 5GALA 4B1LA 2Q5TA 3FZ3A 5GLVA 2Y38A 1PGW1 4B7EA 4EJRA 2PELA 4X6RB 4XFFA 4A6SA 1N3OA 5FYBA 1JZ8A 3VN4A 4AL9A 4PIXA 3OBZA 5KHJA 3G6JB 1GOFA 1UY4A 5ABJA 3Q8BA 3AP5A 2WWUA 2PHLA 4HKWA 3DYOA 4BLJA 1H8TB 1RUNA 1AJOA 4PLOA 1W3VA 2O8OA 5TSWA 1CZTA 1W6NA 1RMU2 4XXPA 5FFOC 1MVQA 2QQKA 2RM22 3AXEA 3SITA 2VZQA 2XKOA 4XDPA 4NJ4A 3HT1A 4JKKA 3QLQA 4IV3A 4OZXA 4FTSA 4LUKA 3KGZA 2PLV3 5FYZA 2WA3A 3WQ0A 5LEKA 4E4ZA 4GMP3 2ZGKA 2B4KA 2VOKA 1LHUA 4PI2A 1S55A 4YWAA 2R062 3KV4A 4W6XA 2PN5A 3VHOA 1S2KA 1K45A 2CGNA 5A3PA 3O1UA 3WCSA 4N43A 4J1WA 1D0HA 1ENSA 4LO4B 3P6BA 2IFRA 4RR3C 3E5QA 3VGIA 2BJSA 1H8VA 1I5ZA 4P9WA 3MF6A 1OOPC 4XCAA 3WF2A 2D97A 2A3YA 3BCWA 4CSWA 1O3SA 2D40A 4RL7A 5DAPA 1ZBA1 1QJU3 2DCZA 2W0XA 4BLIA 2P3KA 4XTMA 1HKDA 1GNZA 2JKBA 3AX4A 4QPGB 1PVC2 3DPRC 5GLUA 2NPIA 1VPHA 2A70A 4QQ2A 4W6WA 1AR91 1UPSA 1UIKA 4L8QA 5EQUA 1VBE3 1QJX2 3KS7A 3TNQA 4K8RB 4P9XA 4OI4A 1GP6A 4KU7A 1K5MA 1RUH2 2ET7A 2W08A 3BUCA 4LBOA 4P14A 1VBC1 1WW5A 2WZR3 1RUI2 2BW8A 2JJ6A 4HPKA 1DGRA 2D5FA 3TN92 1W2OA 2XQRA 3K77A 4PHZA 4BK5A 2BPA2 5AVPA 1C8NA 5JIAA 3ACFA 2Y64A 1E5IA 1AYN2 1HJGA 3ILRA 4AQ6A 5FWEA 1OA4A 1TE1B 1Q3EA 1HRV3 3BIWE 1RINA 2OUHA 3CF6E 1TME1 5FYCA 5C4WB 3NV4A 1XYOA 4PDWB 3RZHA 1JI6A 1KS5A 4RGKA 3I2HA 3ZXAC 3EXUA 2KM2A 4GJZA 3DUIA 2E6VA 2JENA 1DQ5A 3H8OA 4P9YA 4X8NA 1PX4A 1I6XA 2UYAA 4KGGA 5BNOA 1W6MB 4Q2FA 2MEV2 1PO22 4A3XA 1WZXA 3RVHA 1LCLA 3NAPC 3S7EA 1ND3A 3WD5A 1VAVA 2ZGTA 4GIQA 4Y24A 4A3ZA 4CRQA 3H0OA 3MF9A 4X6QB 4ISRA 4RSUA 5DAXA 5BNNC 1CVNA 1PNFA 1EAH2 4NRMA 4BQ2A 1SPPB 2FD8A 4HN0A 1H2LA 2ARXA 2QZ2A 3CL1A 3SQOA 1MQTC 2VTFA 1UZZA 4LO7A 2Q0AA 3IMMA 4TN7A 1BEV1 4FQZA 1W9WA 5FUNA 3J9SA 2BZDA 1JOJA 1UZWA 4JGZB 3Q8CA 1AZDA 2HWF3 5A32A 5DN2A 5A7SA 3LGRA 4K9SA 4HMZA 4AOCA 3HBZA 3WV6A 5C9AB 3S30A 4WVMA 3QACA 4UWDA 3MIDA 4CEYB 1RUG2 1LR5A 2E32A 3OPTA 4WM7B 4HL0A 4IEWA 5GZCA 5KXCA 5FLIA 2CAUA 1ND2A 2ZHKA 3ZR6A 3WP4A 2GALA 3AMNA 1O3TA 5L7OC 4Q4Y2 3OJBA 4R9CA 1COV1 1ZVFA 2VUJA 2VCCA 5ERLA 1HB2A 1KDMA 1S0DA 1AL23 2WNVB 4XUQA 2WWJA 2EALA 2XMLA 4JRAA 4MGSA 1V00A 3EMRA 1BQPA 4L92A 3GYDA 4XQDA 5DUWA 4BQ3A 3AYDA 4Z2AA 3IZOA 4XMIA 2Y0OA 2R1BA 4LORA 3DEMA 4NPMA 4A6OA 1PO13 5LK5A 1RUC2 3RZGA 2DCTA 4UW6A 2D6NA 1RHI1 2VTXJ 4M3CA 4C1XA 3DCQA 2W1UA 1H8TC 2IVIB 3ZXJA 4PQ9A 3ZXFA 2FCVA 4EN0A 1ZNPA 3C2UA 3K48A 1IQAA 3WDWA 2BNOA 2Q8OA 1VE0A 2PHUA 5F3GA 5FP4A 3QOPA 4ASMB 2XG3A 1AR93 3MUZ1 4I09A 1PX3A 3OD0A 4H7LA 1LHOA 2W1QA 3B3QE 1A8DA 3I2IA 4FPLA 5FY9A 3AZYA 4XZUG 3ZSEA 2GSYA 4COVA 3LZZA 2PLV2 4LBNA 5DAWA 2JB8A 2K46A 2BYVE 4C8DA 4UF0B 4YGDA 3TYJA 1ALYA 3KD4A 3WDVA 4AFMA 4EN6B 5IW0A 1NCQA 1WBFA 3M3CA 1F5FA 3HD8B 2EICA 5H9QA 5IVYA 1RUE3 5FZGA 3CNAA 2VZSA 1L7QA 3M7AA 1BLZA 5J36A 5LBFA 4BJ0A 2VW2A 3H3ZA 2R041 3OUHA 4P9GA 4QPGC 2D3RA 4YM0A 1WCKA 4LA2A 3OY8B 1AR72 1YXWA 2Y6KA 3UYJA 1J1TA 2AGSA 4IV1C 1QJU2 2B39A 3MV11 3JB8A 1Y43B 5CKMA 4CZSA 1Q8SA 5IVCA 2DBNA 2DU1A 4R4ZA 4XUOA 3WSOA 5FYHA 1W9TA 3CU7A 3JD73 1CGPA 3MYXA 4U36A 3A4UA 2ZKLA 1O3RA 5KBFA 3C8XA 2OIIA 2P34A 1VBE2 1YCIA 2D43A 3M70A 4HKLA 3D3AA 4C1WA 3HR9A 5D1IA 5CG8A 3ZXLA 3J7LA 5HCHA 1MS0A 4CDXA 2YBSA 4Y4RA 1D4M3 2R071 1JZ5A 2ZX4A 3H7YA 4XW3A 2WZR2 2KA3A 2LS6A 3ACIA 1MACA 4YARA 5C3RA 4AEDA 1IOAA 2VC9A 3ETQA 4CEWA 3AVSA 1VAKA 2NZ9A 5C4WC 2W47A
chains in the Genus database with same CATH topology
4PDWC 1TNRA 1H0BA 5KHKA 3I59B 2XBO2 3AYAA 1SLIA 4AFAA 5LRRA 4H3WA 2EXJA 1HRV2 2VH9A 2VECA 4Q4X1 2W39A 1YHFA 4WV8A 1MEC3 3VZNA 4QPIA 5SV8A 4FTEA 3N3HA 4DOUA 2F6BA 1XXNA 1QQP1 1NQDA 3WX5A 4DRRA 3WDUA 1RUF3 2PFWA 1H1AA 3RG0A 2A73B 4XJ9A 1SBEA 2V5YA 4LHKA 4FVVA 2ZACA 4Q4W1 3KM5A 5DDJ3 3FUQA 4JGZC 1ZA4A 1VB2A 4RQPA 3SMHA 3MFCA 1NCRA 1YJKA 2JECA 5C9AC 3PVBB 5JZGA 4GB31 4XF1A 4D7YA 4CEYC 4JGYB 4WM7C 1QXRA 4KL1A 4LLFA 1RJ8A 4OHVA 5CBLA 4BA6A 1GZWA 1RUD3 2D7FA 3O12A 3TNPB 3KMHA 3FUOA 3THPA 5CA6A 4YW4A 5J98B 2NYYA 2LM3A 2WNVC 5JDBA 4AVVA 1MS5A 1YNAA 3AZVA 2GN3A 4E2SA 1N3QA 1SMVA 1AL0G 1PIV1 1X7NA 2PQQA 4AYUA 3N7LA 4RS5B 5FOJB 1AL22 1R1A3 5E8AA 4XFGA 1NXD1 1X82A 4M3CF 1G7YA 2D44A 4XHBA 1V6MA 3O0VA 2K9ZA 3AMPA 3IM0A 3ZSJA 1SCSA 5CFDA 4IEOA 2A75A 4IEUA 1D2SA 1JYIA 1UX6A 3KSCA 2JXAA 4Q0QA 1PO12 4N53A 1I3HA 4XQ4A 1EV13 3LA2A 3RI9A 4R4XA 4AW7A 1G9FA 5JOXA 1KITA 3VBRB 4YFZA 1HRI1 3WP5A 5L19A 4META 3JQWA 4MXWB 3ZXKA 5F1RA 4YM3A 4DFSA 1LEDA 2HWB3 2PHTA 3CEWA 4H7MA 1XYPA 3LSEA 1LOBA 3FFZA 3VDDA 2DTYA 1DQ4A 2XJQA 3ASIA 2ZMNA 3FHIB 2SLIA 3VHPA 3ZYPA 1KD7A 2ENRA 1W6QA 3FC0A 4XEZA 5T50A 1RMU1 1RUE2 2RM21 3X29B 4MH0E 3VKFC 4JTNA 2ZGNA 3IDBB 1D2QA 2GC3A 5J37A 1WD3A 2R061 5BXXA 1FPN3 2K2SA 5ACA2 2VQ0A 3JD72 5EV7A 2IXCA 3WQ7A 5KXDA 5K8SA 2PHDA 4KG0A 1EP0A 5L73A 1C1FA 2E9QA 4QXKA 3JBG3 3MIGA 2ZAHA 1FXZA 3J8F2 1BBT3 1MS9A 1FV2A 4MGKE 2VW0A 4YZ2A 5C8CB 1D4M2 4Y1XA 3T2TA 4S2DA 3FLRA 1PVC1 1GKBA 4AEKA 4QX5A 1QJX1 1WGPA 4KWKA 4UXAA 2BVVA 4X8PA 5BNPA 3RSJA 4HK9A 2XLGA 4Q0VA 4GULA 1CPNA 4I0WB 1BK1A 3FBMA 3AKRA 2DYCA 1RUH1 1XRUA 1BYHA 1UF2C 2WA4A 1MS3A 1RUI1 3BOPA 3TN91 4RA0A 1ZM1A 2QNKA 4LE3A 1NA1B 2R16A 4QM8A 1H1IA 1A78A 3URFA 5BUVA 3H9AA 1N47A 1V6JA 4AHXA 3EO6A 1RUF2 2I45A 3OGGA 2YZ4A 3MICA 1AXYA 1JUHA 2D6LX 4QU2A 4HVRA 5FO9B 3IKWA 3EBRA 3IDCB 4YW3A 5T54A 5K0UB 2ZGSA 4EN8B 2P2KA 4JGYC 3E97A 5DDJ2 4IEXA 3NV3A 5KC6A 5IK5A 3NSTA 2MEV1 1PO21 4MGZE 1H4GA 1T6GC 2PTMA 5IK4A 3PVNA 1H2NA 1REEA 3LA7A 3NV1A 4C0HA 2A3WA 3J26N 4COWA 5JCTA 1EAH1 1RUD2 2RMU3 3VKOA 5EXOA 2UWCA 1QY4A 4ES8A 3M4FA 1H4HA 4RS5C 1ENQA 2YMZA 3VL9A 4E2GA 5JPMB 2XL7A 4XBLA 3AP6A 1AX2A 2PYTA 2JG9A 4FPFA 2ZCWA 2VNRA 4Z82A 1LB2A 4DRVA 2RS53 1R1A2 3WT3A 1HV1A 1V6IA 3BALA 1RUG1 1ZZ6A 5T5LA 2WFF2 1J1LA 4YG3A 3VBUB 4OUMA 2WZPP 3KZ4C 2WWSA 5CU1A 1C8M1 4Q4Y1 3M2MA 1DBNA 1A6CA 2UYBA 1V6LA 3VBRC 2WINB 1EV12 1C5IA 2MHFA 4K20A 4BOWA 5CG9A 5D8AB 1ZRRA 2PAMA 2R063 4FXGB 3LOIA 2CV6A 2BNNA 4RR3A 4WM8B 1Q8PA 4O9GA 1QOSA 1RUC1 1OOPA 1I9RA 4FOWA 3ENRA 2HWB2 2ARBA 3RZZA 2HWE3 3ZMNA 2BFUS 4I2OA 1RUJ3 3OD4A 4UW3A 4Q0UA 3ELNA 4KG8A 2QE3A 3JCIA 4WBBA 3KT1A 2RHPA 1PGL2 1U0AA 2EXIA 3U07A 4K1ZA 4SLIA 5A33A 2HYKA 2XWBB 2WNUB 1FATA 3DPRB 4XFIA 5JIUA 2PLV1 1B35B 4GMP1 4YFWA 4GXLA 3HT2A 4P9JA 3TN93 1KJLA 1LESA 4TSVA 4TYSA 1BMV2 3WHTA 3JB4C 1FPN2 2IXLA 1QKQA 2BVBA 5C8CC 1AYN3 3WG1A 1OMIA 3JBG2 4E4SA 5LEJA 1AR71 3ZMOA 1BBT2 1CAVB 3RI8A 2B5HA 1QJU1 4MZUA 3H1YA 2A6VA 4CDQB 5AC93 5BPXA 3VKNA 1IS3A 1VBE1 3H7JA 3NAPA 1O4YA 1RVF3 4IERA 3RDIA 4G9SB 4XFCA 3WR0A 3I4IA 1NA1C 2B46X 4HBNA 5BNNA 4MV2A 2WZR1 2HWC3 1RGSA 2QJVA 4HSJA 5H9RA 1CIWA 5EYYA 4D69A 4BMBA 1MQTA 1UN1A 2GAUA 2DU0A 3C3VA 5BYNA 4NPRA 3MIEA 3OBTA 3R6SA 2XBO1 3VBFB 5K0UC 1PZ9A 1UD1A 2FMDA 2H0BA 1HRV1 3RJ2X 3WW3A 4D7SA 4N7UA 4LR4A 1F31A 1AX1A 1RB8G 5DUUA 3ZFFA 1YJLA 1FNYA 2ZX1A 4AE2A 4N9IA 1ZYBA 3ZSKA 3UKNA 5L7OA 1HDKA 1VIWB 2AYHA 3WCRA 1OA2A 2JICA 3POSA 2UY9A 1LHVA 4XE9A 4EWDA 1YRZA 4PBPA 2C9AA 3LKJA 1LU1A 2RMU2 1YO8A 1VBB3 3WHUA 4AWDA 3KGLA 4BMEA 2B7YA 2IWGB 5JI9A 5DG2A 4S2GA 1Q8VA 2D98A 3PJYA 3AKSA 2ZHLA 4JVAA 4ONUA 1PMIA 1Q8OA 3D8CA 5GLWA 5FDBA 3VBUC 4AHZA 5IUQA 1H8TA 5FQ0B 4ZKTB 2RS52 3I8TA 3MPPG 1WW6A 1W39A 4KWLA 2D93A 2RS13 4XQWA 2BNMA 4EN7B 4CDUB 3ZN6B 2XJPA 1IKQA 2MPFA 3B69A 3B5LB 4QQOA 5FO8B 1DLLA 1XE8A 3FJSA 4LEJA 5D8AC 3ATGA 4LULA 2BWCA 1AL21 4IESA 2GH2A 1BZWA 4DMIA 4WM8C 4LNVA 3V65A 3ZYRA 4EWEA 1GQGA 3WOGA 1FMD3 3OBRA 1MZFA 2VQAA 1PO11 1JYCA 4Q1RA 4MGYE 1D0GA 3V56A 4KNCA 1QH7A 3HAGA 2HWE2 1AR73 1VRH3 1RUJ2 5CADA 3QH6A 3PVEA 3AKPA 3PJQA 4ISQA 4HZFA 5HBAA 2XLFA 5J3UA 2WNUC 2DUOA 1OQEA 3RJRA 3APBA 1B35C 1UIJA 4AGGA 3JZVA 4IV1B 4AI1A 1F8VA 1O91A 5I8TA 1VLNA 2VOVA 4ZXKA 2D6KA 5LRSA 1HV0A 5DUXA 1KFXL 2XH6A 1GV9A 2Z69A 2ZZQA 5C4WA 4AGVA 4PDWA 4PCRA 3ACLA 1RUE1 2ZGPA 2XBO3 3ROUA 5FOBB 4MXVA 3VHRA 3ES1A 4CDQC 5GKAC 2VULA 1S2BA 1MZ5A 1N1YA 1AX0A 2R30A 3EJKA 3HIFA 3U4XA 5L36A 4FPOB 3H1MA 4XIKA 4N9HA 4AEJA 5ACA1 2AENA 4YVSC 4AI3A 5AC92 3LB9A 1XNBA 3JD71 4QHBA 1DIWA 3AP7A 3VBHB 1SCRA 1OKQA 1QMJA 1FOD3 5JLVA 1RVF2 4HETA 3M3QA 3J8F1 3ME2A 3ZYJB 1C1LA 3VBOB 3QCWA 1D4M1 3VBFC 3AXDA 1R092 3UK9A 2HWC2 4JGZA 4YW2A 1OLQA 4OHZA 1ZBE2 4PLMA 4YGBA 3L2YA 5C9AA 1B09A 2WLQA 5AVAA 4N7IA 4WM7A 1VR3A 3TRSB 3SH5A 4EN9B 1KJRA 1MEC1 2XJTA 4HSLA 1LHNA 4QQLA 3OGJA 4F3JA 1UKRA 3AB0A 4NR1A 1ASJ3 2WNVA 3R4SA 3BPZA 5BNOB 3GHNA 3N7JA 4NVPA 1SEFA 1V6KA 2EAAA 1RUF1 1AR63 2JG8C 2Z42A 1VBA3 4F83A 4PIZA 4IL7A 1WLCA 2ZS6B 2FZ1A 1ULCA 4RD7A 3FE5A 3Q9OA 3RYKA 5DDJ1 3SH4A 1LHWA 1RJ7A 1VBB2 2R6QA 3AP9A 3E5UA 3VL8A 4DXZA 4KBBA 4XFAA 1X8MA 4E27A 4BPZA 3MIFA 5JPNB 4B8EA 3ZPYA 1SLLA 4XILA 4CDUC 2V09A 4AG4A 2OUJA 3BODA 3WUDA 3SCHA 1RUD1 3WG2A 1BJQA 2PHRA 1V6NA 3I54A 1RITA 2X53S 1WW7A 3VLBB 1QU0A 2Q4SA 4TLFA 2RS12 5T5PA 2R0FA 2ZTNA 2QFEA 1EPZA 2ZGLA 2UY8A 2QQPA 3QH7A 4C91A 1LGCA 1FT9A 1YFWA 2DVGA 1QDOA 3CJIA 1R1A1 3USUB 1Q8QA 3CO2A 1S0BA 2I74A 4FP2A 5T5JA 3VKMA 3ZFEA 1MZ6A 5FLJA 3W58A 3N35A 3OY8A 3B94A 4ASLA 1EYBA 4W6YA 3DN7A 1LOAA 1FMD2 1DGWA 4CDWB 4M01A 1EV11 1LKNA 1VRH2 3H50A 4YZ5A 5IT6A 5EZWA 1ZRCA 1V9U3 4FPJA 5ACA3 2PHXA 2AUYA 1XNDA 1CONA 3SNMA 1QOTA 4PBOA 2HWB1 3NV2A 4B7KA 2Y0IA 3J8F3 3WG3A 1CPMA 3FLPA 4NWVA 3I59A 3PVOA 4Q0PA 4QT6A 3OPZA 1PGL1 5J09A 4HKOA 1IHMA 5JMCA 2YXSA 3H1WA 2QDRA 2WS93 2IXHA 4OHWA 5C33A 1GNHA 1VALA 5CB7A 5F9TA 3GHMA 3VBHC 1GSLA 2PA7A 4CYDA 1DHKB 1BMV1 1HX6A 3KB5A 4FPGA 4Y5Z0 1FPN1 4WZFA 2WSUA 4E2QA 1YIPA 2WFPA 4FOVA 1PHMA 4W65A 3VBOC 3VHOA 2H6BA 2G9GA 2XKPA 4XMAA 3WZ1A 3JUUA 3JBG1 1FOD2 1IZ3A 1POV0 1BBT1 1F2NA 4LBLA 4ZU7A 2Z2SB 5E88A 1ZRFA 3WINE 4ZU4A 4FCAA 4WVZA 2XJVA 1SBFA 3VZKA 3B7MA 2VPVA 1AXZA 1CR7A 2B42B 1N1VA 2ZHNA 3WW2A 5FAXA 4TZDA 1YFUA 4OI2A 1HIXA 3WG4A 4R9DA 3N4MA 1H1MA 5BNOC 3PMEA 3CLPA 1G9DA 2PHFA 2D6MA 1LODA 1WLDA 5CIRA 4LUMA 1GYKA 1S0IA 4RS5A 1ASJ2 3FWEA 2XWJB 1BVP1 2IXIA 5GZGA 2IZWA 5GLTA 1APNA 4S2HA 2ZX2A 2JX9A 4LBKA 5HI0A 5FRAA 1AR62 5KHGA 1VBA2 3ZIWA 2LTNA 2XJUA 3RQ0A 5JWPA 1DQ2A 4QGMA 5JOYA 1VAMA 3H3UA 2Q1MA 3UV9A 2V73A 2WKKA 4G4FA 3O0WA 4DINB 3A0KA 5FMOS 4Q1PA 3FX3A 2WFF3 4GALA 1IS6A 4JQRA 5JSOA 4HK8A 2Q30A 2XB6C 3ZDSA 4FPYA 3VBRA 1PZ8A 4FOYA 3UJQA 4DS0A 5I91A 4MXWA 5BNQA 2RMU1 5I0UA 1W6OB 2D6OX 4Y1ZA 1OPOA 1W6PB 1N1TA 5DG1A 4XJAA 1OFSA 3VZLA 5CAZA 1V70A 2ZPXA 1CAXB 4Y26A 4GKYA 2C5DA 4QM9A 3VBSB 2XJRA 2RS51 2DVBA 5T55A 1UU4A 1CAWB 3E5XA 1UAIA 1ENXA 1RL3A 2HWD2 4LO8A 5GM0A 3NW4A 3FMGA 2Z5WA 4FOQA 4CDWC 4LHNA 1CAUB 2YDEA 1O4ZA 2N7GA 4HVOA 3V0BB 2ZZJA 4AFDA 4GH4B 1C4RA 3AKTA 5A3LA 2QUOA 4AK3A 2VMIA 3A0NA 4Y1VA 4Y22B 5I0TA 1NE6A 4RGAA 1J3QA 1JXNA 4IEVA 4YW1A 3V0AB 4QGNA 4UBGA 5KXBA 5I93A 1V9U2 5B2GB 5C8CA 1OSGA 4I0BA 3ZN4A 2EAKA 2G9FA 2ZX0A 2PAKA 5DXDA 1WMFA 4COUA 1IPJA 2TUNA 1G9AA 1V6OA 3M3IA 2BEOA 2HWE1 2A6XA 3AMMA 1RUJ1 4XJ8A 1X50A 4ES9A 1XYNA 4FBFA 1GQHA 3O14A 1FV3A 4YGCA 3USSA 4Q26A 3G7DA 4BWOA 1OQDA 3D0SA 5GZFA 4J1XA 1LTEA 3J4UH 1NA1A 1QNWA 2WS92 3E6BA 1R082 2NMOA 2IC1A 4N90A 1HQWA 4IXLA 1MS8A 1SLAA 2DVAA 2ET1A 4YLZA 1REDA 3ZXDA 1ZRDA 1BKZA 5FTTC 4CDXC 5K0UA 4YG0A 1AYN1 3O0XA 2NP0A 4FO9A 1KXGA 1NLSA 3QBQA 3LOBA 1UU5A 2A6YA 3MEPA 4Z8BA 5JSRA 5KHHA 5KWRA 1POV3 1NQJA 2UWAA 5AC91 3BTAA 1DYKA 1DQ0A 5I8YA 4YVWA 1OD5A 3IPVA 3OYWB 1RVF1 2X5IB 2WIIB 1X36A 1QHDA 3FFQA 1FAYA 4SBVA 4JTOA 2PHWA 1RUOA 1R091 2CGPA 2HWC1 4XDQA 3WNXA 4ITCA 1ZBE1 1ULFA 1N3PA 3T1LA 4MVTA 2WT1A 2VUAA 4COZA 4P5HA 4DY3A 5C6CA 1Q5OA 2ZABA 5IK7A 4YSFA 1NY72 4FT8A 3THTA 5CFCA 3VBUA 3B93A 4QQPA 5H9SA 5EYXA 3RS6A 1AR83 5KC5A 2X8KA 4DB5A 5F6KA 4L97A 4YZ1A 1WLWA 4AFCA 1TMF3 4Z1VA 3PTYA 2OYZA 1JN2P 5D8AA 4Y4YA 3RYPA 1DQ6A 4WZCA 1AUYA 1UKGA 4DQAA 3GF6A 5AFBA 1QJY3 4MYEA 4WM8A 2IFWA 2VOWA 1NE4A 1L3JA 1E57A 1Z0HA 1LOEA 3HMYA 1VBB1 4LBQB 3E6CC 3WDTA 3AJZA 3IN9A 3VBSC 1J58A 3DGTA 3S0MA 1G86A 1C3HA 4P9LA 4Z07A 2DTWA 2B8MA 5EFUA 2ZKNA 5JOWA 1SACA 4GMP0 4GH4C 4LA3A 2RS11 2WNUA 2NQYA 4LBJA 3DPRA 1JTZX 4INDA 1B35A 1LOFC 2IXKA 4MLOA 3GZUC 4XPVA 5JR7B 2CNAA 3PHMA 3POYA 2DVDA 4MX3A 1CN1A 1GFF2 3POWA 4NWWA 2FMYA 1OLRA 2WL1A 1PK6B 4AQTA 1XQNA 2Q1ZB 1Z7S3 2D3SA 3B01A 3WXPA 1AHSA 3NWKA 4JRLA 1CAVA 1TEIA 2C1FA 1WUVA 3D6EA 3SH3A 1FMD1 3VDDC 5DZEA 2LALA 1IPKA 1DF0A 4CDQA 1TQ5A 4ZU5A 5I0RA 2UWBA 2IXJA 3MIBA 1YFXA 1PVXA 1VRH1 2I2SA 1UL9A 4NHKA 3JQXA 5DZGA 4XFBA 2LUWA 4CP1A 1S0GA 1IS4A 4K7JA 4XHXA 1H2KA 2VMGA 1G9CA 3U10A 2BWAA 2P17A 4YVSB 4HANA 1DGWX 1HXS3 4B29A 3I2DA 3VBFA 2O8QA 1R093 1WCDJ 2R0HA 5KHIA 3ECQA 3ZO0B 1ZBE3 2Y26A 4XZPA 2I07B 2XHKA 1RC6A 1G6NA 4LO6B 3IBMA 1QGLA 2CL2A 2YGMA 4EROA 5GZDA 3LSDA 3HWJA 5BNPC 2ERFA 2OZ6A 3ZN5A 1AYM3 3WP3A 1VJ2A 5HCFA 2ZAAA 2ZMKA 2X5IC 4OI0A 3VUOA 1LOGA 1REFA 4L11A 5JOZA 2YPJA 1FOD1 3WDYA 2EA7A 2OA2A 2YUEA 4MUVA 4JCKA 4YM2A 2GMPA 4IQPA 1YUDA 4Y20B 1W2UA 3R4DB 2FQPA 2JG8B 4BE3A 2WT2A 1S0FA 4AI2A 4IETA 1ZZCA 5FQ0A 5I0SA 4JAAA 1LULA 3RWNA 1O5UA 1SFNA 2CY6A 4JV4A 3SLIA 4R8HA 4Y1UA 2A71A 4D94A 3U0ZA 1JH5A 4CDUA 3ZN6A 1WD4A 3KQRA 4XJUA 1GANA 1Y3TA 1AR82 4TWTA 1OI6A 1ASJ1 1YLLA 2P3JA 4B4PA 1TMF2 4LLOA 1AR61 1QWRA 1VBA1 1ZREA 1DZQA 2P37A 4S2FA 1GZCA 2ATFA 1A8MA 3EHKA 4NHMA 1QJY2 3TWIA 4YM1A 1BVVA 4RHV3 3TBDA 2VNOA 1RIRA 3KLSA 3AYCA 4DZGA 3GBFA 1S0EA 1VBD3 4YGEA 2VMHA 4L2NA 3S7IA 2GZWA 5FPXA 2WC2A 3ZFGB 1QOOA 1ZZ8A 2NN8A 3GZAA 4GWNA 4QPGA 5EJ3A 5I8SA 4AQSA 1W0OA 1SFYA 4IV1A 5FREA 1UZYA 3AKQA 4HFSA 3ALQA 2FBEA 4UBHA 4YW5A 3ZX7A 4NO4A 4XF9A 5ABJB 2BTVC 1PK6C 4Q27A 1W6NB 2GU9A 5BV6A 3KCXA 3WDXA 1ULDA 4IV3B 2HWD1 1C57A 4AVSA 3KCYA 4FP3A 1NOVA 1Z7S2 2W52A 3UKVA 1OPMA 1Y7BA 2O1QA 2R1DA 2AZ5A 2DFCA 4K21A 4N43B 1CJPA 1YIFA 1UW8A 5DUVA 1HQLA 4AVAA 3IIAA 1QF3A 2GMMA 1W6MA 3VBHA 3AP4A 4I3GA 4FAHA 4BH9A 2FHRA 5T3NA 2RR13 1A3KA 5E89A 1V9U1 4D7TA 5K9YA 2EF6A 3VBOA 2GNMA 2WQ4A 4XTPA 3R4UA 2BFUL 1PNGA 4YZ4A 4F8AA 2VG9A 1K5MB 4XYXA 4YNIA 4Q4V2 3IMNA 4AVTA 1HXS2 2VVEA 2WNEA 3HN1A 2TNFA 4HPKB 2CYFA 4K3UA 3ZIXA 4UW5A 1I1EA 1IKPA 1DZTA 4J6GA 1QJZA 4E4DX 3U11A 3M3OA 1LGNA 1FNZA 2TBVA 3MLLA 4CEYA 2WS91 1CX4A 1JBCA 1ONAA 1R081 3DV8A 4I30A 3RMYA 1QXPA 3R0RA 1IGOA 3SISA 3LCPA 1AYM2 4DPNA 1C5HA 2RJLA 2QZ3A 3EQEA 1H2MA 3IT8A 1LEMA 4MGIE 3VHNA 3AYEA 1ND3B 2VGDA 2E7TA 3BB6A 3AMHA 2XUMA 3FBYA 3D5OA 3VZOA 2RS33 5HXVA 2DCJA 3LA3A 1NXMA 3K51A 4G3YC 4BIFA 3B9CA 2ZHMA 2A6WA 2FZ2A 4C90A 3ZFFC 3IWZA 2YYOA 4PJYA 2DUQA 2DWRA 5A32B 2XVKA 1C8M2 3W9AA 1QXJA 4WVMB 3ZVXA 1M4WA 4LBQD 1MZEA 4CP2A 4YYOA 1ULEA 3USUA 3DF0A 2TEPA 1ND2B 2EXKA 4A7YA 1NY71 2WQZC 1DDLA 3MW4A 3CJXA 2ILMA 1C28A 2HJIA 4KWJA 4AVBA 3LWCA 1BCXA 2HWD3 4RHV2 2GC0A 2ZX3A 5E1RA 2WFF1 3ZFGC 4CDWA 3QD6A 4IEZA 1ZBA3 3NKTA 1AXKA 1VBD2 1SLCA 3D4KA 1PZ7A 1XE7A 1GLHA 2ES3A 1WLTA 4M3CB 5ABJC 4HN1A 4R9BA 4XF3A 1UU6A 3V64A 3D82A 2P3IA 4KH9A 5LK7B 1CJDA 1JHNA 4ORFA 2BQPA 4OULA 1MVEA 3ES4A 4HVQA 1VBC3 4IV3C 2EVXA 2HEWF 2JEMA 4OLLA 4ATFA 1Z78A 1DGLA 3CJIB 1ZZ9A 2QKDA 1ZX5A 3WQ1A 1O5LA 1GZ9A 2UURA 1AJKA 3KT4A 2BUKA 1GICA 3INAA 2DUPA 4N43C 3WW1A 3RYRA 5BY5A 1LOCA 4B4QA 2A7AA 1KDKA 4RGGA 3ZFEB 1TME3 2KXLA 3MFAA 3AK0A 2VVDA 3JU9A 1NCQB 1EPWA 4OVEA 2HEVF 1DQ1A 2UU8A 1J59A 2DCKA 1Q56A 2XLAA 4BZ4A 1G9BA 1WMDA 2K0GA 5A3MA 1U5IA 2JE9A 1R083 1X8EA 4UW4A 4XBNA 2GNBA 4BHPA 1M06G 1YI9A 1MR5A 1FYUA 2RR12 2VOXA 1LU2A 1K5MC 1YI7A 1VP6A 1ULGA 4OHYA 3N36A 4WVWA 2QVSB 2CTVA 3KT7A 2ZGMA 4F7ZA 4I01A 3MLKA 2NLRA 4K1YA 4CDXB 1JUIA 1BEV3 2XVGA 5FPZA 2YC0A 3NL1A 2DVFA 4JGYA 4XBQA 4AHWA 4AEDB 4CEWB 2GN7A 3AZXA 3ZYIB 3O7OA 4FPEA 4BM8A 4AF9A 1SDWA 4BCUA 4KQ7A 2SBAA 4Y1YA 2QCSB 4XF4A 4K40A 4OFGA 1WBLA 3DKWA 3IDEA 5KXEA 1COV3 4LE4A 2VNGA 4QPIB 2H0VA 5T52A 1ND3C 2DURA 4QPYA 2YGLA 1IS5A 3RMXA 2AH2A 3NVCA 1GR3A 3SHRA 3H8UA 1OHFA 5EWSA 4DNYA 1UPIA 3WLUA 4LBMA 1QDCA 4AFBA 2RS32 1POV1 3ILNA 2HWF2 1RHI3 1YYNA 2D5HA 1DYPA 2VU9A 4RQPB 5J96B 1NCRB 4EV0A 5SV5A 5JZGB 1W6OA 1PGW2 5FO7B 4AHYA 1DGRN 4XXAA 2ZGQA 1W6PA 2AREA 1AVBA 1TNFA 1ND2C 1CAXA 4GA9A 1GZWB 3WVJA 3P3NA 1SBDA 2VVFA 1RTVA 2XL9A 5JAXA 1J3PA 2CWSA 3VBSA 4GWMA 3MW3A 1SQ4A 2DV9A 4K6BA 1DG6A 4BYYA 1CAWA 1W0PA 2ZGUA 1F9KA 1ZZBA 1R1ZA 3BU7A 4Q29A 4XJZA 1CAUA 3GALA 3AFKA 3V0BA 4I0AA 2GDFA 1ENRA 1AR81 2B9UA 3DL3A 4GH4A 1DU3D 1KS4A 2NMNA 3NJZA 3S6PA 1AF9A 1PGSA 4Y22A 1U5ZA 2R043 2GMEA 1LOFA 5CFDB 1TMF1 1ZBA2 3V0AA 4OHXA 4FAGA 3MW2A 2GNDA 1G8WA 3NO8A 4N53B 2HEYF 2A6ZA 4M0NA 2O0OA 1EY2A 1NLRA 2ZOEB 1QJY1 3ZXEA 3VZJA 2DCYA 4M3CE 1AR92 2XJSA 4Z92B 5GLZA 4A2UA 4P9IA 4Q8LA 2OPKA 4E9KA 2GNTA 3CJIC 4LHLA 2VW1A 4DY5A 4GQ7A 3RPQA 5C8WA 2YROA 4NN0A 1H30A 2R073 1VBC2 5CNAA 1NYWA 4FSJA 1O4TA 3OCPA 2CAVA 4A7ZA 3KCCA 3ZFEC 4EWAA 3RNSA 2YHJA 3TB0A 4FTBA 2ZJCA 1HQNA 1NCQC 3SCFA 3VDDB 5J48A 2GH8A 4PLNA