4MSVA

Crystal structure of fasl and dcr3 complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
139
structure length
139
Chain Sequence
LRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Tumor necrosis factor receptor superfamily member 6B
publication title Crystal Structure of the Complex of Human FasL and Its Decoy Receptor DcR3.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4msvA01
1A8MA 5TSWA 2RJLA 1KD7A 3FC0A 1I9RA 3K48A 5KC6A 2ZJCA 1IQAA 5KC5A 5BNQA 5HBAA 3QBQA 1JTZX 4MXVA 1D4VB 3B9IA 2TNFA 2QDNA 4QQPA 1KXGA 2ZPXA 1PK6B 2WNVC 1PK6A 4QQLA 4NN0A 1JH5A 1O91A 4EN0A 1U5ZA 1OQDA 1U5YA 2O0OA 1RJ7A 1RJ8A 4OUMA 2RE9A 4DB5A 3TYJA 2Q8OA 4QPYA 2JG9C 3K51A 2JG9A 2X29A 3AB0A 2E7AA 2HEVF 3V56A 4QQHA 4F3JA 1S55A 2TUNA 5CIRA 3QD6A 1DU3D 2RJKA 2WNVB 3IT8A 4J6GA 1GR3A 2WNVA 2WNUC 4E4DX 1TNRA 3B93A 2WNUA 3L9JT 3ALQA 1XU2A 1ALYA 1D2QA 4KGQA 4OUSA 4QQOA 4HT1T 2R30A 3TWIA 4G4FA 4DOUA 1DG6A 3MI8A 4MXWB 1OQEA 4MXWA 2JG9B 5L36A 4OULA 2Q1MA 3LKJA 4GIQA 4N90A 2KA3A 3URFA 4KG8A 2R6QA 3WD5A 2JG8C 4D7YA 4G3YC 2R32A 2QE3A 2WNUB 1TNFA 1OSGA 1U5XA 2HEYF 2AZ5A 4RSUA 5L19A 4TSVA 1C3HA 4TWTA 3ME2A 1C28A 1WCKA 2HEWF 2Z5WA 1PK6C 4KGGA 1D0GA 1XU1A 4QQ2A 2OIIA 4MSVA 5KWRA 3B94A 2JG8B 4E4SA 2JG8A
chains in the Genus database with same CATH superfamily
3WUCA 1VMFA 4E9KA 1AR61 3H3ZA 4XUQA 1C5HA 1I9RA 1UYPA 3HBZA 5FYMA 5K4LA 1FNZA 5LBEA 3VKFC 1HQWA 5LB6A 3V65A 5FDBA 2CU5A 3K48A 4XBQA 3VHRA 5KXCA 5K8SA 4CCNA 5FCCA 1W90A 1H8TC 1H8TB 3K75B 4WM8A 4IL7A 1LEMA 3PDQA 5IT6A 4DUXA 2JB4A 1CAXA 4QXHA 3ETPA 4Y33A 4K40A 4P9LA 3WQBA 4CDXA 3CL1A 1POV1 2Q8DA 4QXBA 2R7EB 2XHNA 4HK9A 1AYM2 1ZZ6A 4XF4A 5FPVA 1CJPA 4YW1A 1R1A1 3N7LA 3WF4A 2ZTNA 1PGSA 3LFMA 4K8FA 3MF6A 4LKDA 2EVXA 2VBDA 1CAWB 5GJ6A 2VQ0A 4Q4W3 4IE6A 2G9ZA 3WXPA 4BU2A 5BNNA 1JYXA 2QNKA 4WM7B 4KQ7A 2VMIA 1VJ2A 1AUYA 1LHVA 2RE9A 1DBNA 4DB5A 3TYJA 3H0OA 1PM7A 1SCRA 3KM5A 1PHMA 2WQ4A 3BALA 5DAXA 2DCYA 2UYAA 3VDDC 3WR0A 2Z42A 2GC1A 2VO5A 4HXCA 4QQHA 5DZGA 3AKRA 3BODA 5FBJA 4BJ0A 3HQUA 3R4DB 4LBQA 2C5DA 1DU3D 4RQPA 3UGHA 4SLIA 1W2TA 3PVEA 1IS4A 4KI5M 3WDYA 4OHXA 5HV4A 3A22A 4V2WA 4W6YA 3GXUA 4AFAA 4D69A 2WT0A 1CWPA 2AYHA 4R52A 3AP4A 3NAPB 3UT0A 4BK5A 2G1MA 1B35C 4RR3C 2QQPA 1B35B 5F5QA 4LHLA 3IKWA 4GB31 1OUSA 1WMEA 4XHBA 3VD7A 3GZAA 3RGBA 2V73A 1HRI1 2ZHNA 3OGRA 3U1XA 5C5UA 2PAKA 2PHLA 5K0UC 4Y1YA 1NLSA 2A5ZA 4GIQA 1UOFA 2EAKA 2PHRA 3KVAA 5FZOA 1QDOA 2C0ZA 3SEEA 3ZFFA 2OUHA 5J36A 2BV4A 4Y3OA 3T4HB 4FPJA 4MG2A 1D0HA 4CUCA 1QJU2 5F2SA 2E32A 1NE4A 5J09A 4WZFA 2IZWA 2XJRA 3ZSMA 1IS3A 2W2IA 1VBA3 3RZHA 1PO22 1QJY3 2GMMA 3POEA 1YHFA 1RUF1 1O4YA 1SHWB 1GQHA 1FXZA 2UWCA 2HEYF 3R05A 5EYXA 2J1SA 5FIXA 2NQYA 4FPEA 5DABA 4K21A 1I1EA 4TSVA 3NNJA 3WG2A 4UF0B 2JJ6A 3FUQA 5A32A 3VBOB 1VP6A 1XE7A 4GH4A 3E5XA 1OA3A 3ZSKA 2W1WA 1RUJ1 1N47A 2QZ3A 1PGL2 1H6XA 1ND3C 3AFKA 4PQQA 5DG2A 3WHTA 5FMDA 4CU8A 2G4IA 2AR6A 4Y5TA 1G9AA 4HK8A 2J1UA 1W6PB 4YNIA 1UO9A 3KV9A 2YBSA 4A7YA 1UCXA 2RS12 4CEWB 1YXWA 4LK6A 1DIWA 1VRH2 2PN5A 4NROA 2XJQA 1EYBA 1VAKA 4QPIB 3RI9A 1AL0G 5JUVA 1PMHX 4DEQA 1XB9A 1RUE2 4LHKA 4MXVA 2B42B 4MGZE 2BOIA 5EWSA 4DQAA 1D4VB 1K5MA 4AK3A 2PMWB 4JQRA 1QWRA 4FVVA 5LBCA 3N36A 1WW5A 4RS5A 3WEZA 3RWKX 5JZGA 3IPVA 4BQ4A 1UU6A 5FZFA 1JH5A 1XSRA 2YDEA 3IB3A 3KQRA 4RN5A 1W3XA 5FP4A 1DZTA 2OZJA 4NVPA 2F4PA 4PDWA 1RGSA 3ILFA 4RGGA 5T3NA 4RHV3 3AYCA 1AL21 4QWNA 2A6YA 3B5LB 5A80A 2WS93 1OUXA 2DVDA 4ISQA 5IW0A 4N53A 3FHAA 4LO4B 3WP4A 4GWIA 2HBTA 5C6CA 3PMSA 3GZEA 2YMZA 4BLJA 2JG9C 3HOBA 3WNLA 2X29A 3PUQA 3HR9A 2W68A 2GP3A 3WW3A 1KQRA 1OFSA 1MS8A 2LM3A 3ZYFA 5DDJ1 2Y26A 2CGPA 3LA2A 2VMEA 4JAAA 1A78A 3C2UA 5JLVA 2GNTA 4UW4A 2DTWA 2R041 1S2EA 4W8JA 3IT8A 3Q8FA 1BVP1 3D82A 3FHQA 3LEGA 3TEXA 3ACFA 1UZ0A 3OYWB 3ATGA 1NX9A 2ADDA 1ULFA 4E8CA 4OUSA 4YSFA 1D2QA 1ST8A 1NCQC 3OUHA 3MW2A 3PLQA 4CDWB 1QJEA 3EBRA 2ZZJA 3ZXJA 4AI1A 1J83A 1QQP1 5H9SA 4DIQA 1ENRA 1LESA 2WR9A 4OULA 1UY2A 5ABJB 2LROA 3GZTB 5FYCA 1REDA 2EIGA 3QH6A 1DGWX 1JZ2A 3RS6A 3SCHA 2A7AA 3ZXGA 2B5HA 4CEYB 5J7MA 1W8UA 2ZEYA 3LQCA 4NIHA 1YUDA 4JX0A 3ES1A 2FZ1A 4A2UA 3MGUA 4QGMA 2DF7A 1VBE3 5I0TA 5F6LB 3AKSA 1RUH1 3ZIWA 4XDQA 1JYCA 1V6OA 2E63A 2H0VA 3WOGA 4ASKA 5I0SA 4YW3A 1OT5A 3S6PA 3E1F1 3L2HA 1UZZA 2QQUA 3OGSA 1V6LA 3HPNA 4INDA 2XG3A 3HN3A 3Q8AA 3A21A 4UFHA 4D6RA 1COV2 3J7NA 3LPFA 2A3XA 1ENSA 1XRUA 3U37A 4MUVA 1W9YA 2N7GA 5LATA 2QQIA 3BU7A 1CQ9A 5A6QA 4NRPA 1V9U1 3HD8B 1C28A 1R081 3JBG2 2UURA 4CXXA 3N9QA 3SQOA 1RUC2 4AEDB 4CXYA 3VD9A 4ATEA 4CUAA 1WW6A 4P14A 1D4M1 1F35A 1CD3G 1ULGA 5F32A 3K46A 1DQ0A 1NCRC 4ISRA 3LDKA 4K8RB 3ASIA 5EP9A 4DRVA 3RZZA 4E4SA 1W0NA 2R16A 3H8OA 4UXAA 5IK7A 1PX4A 1O4TA 3N9MA 4FXKB 4DEVA 2ZGOA 1ZVFA 2XR4A 4LO5B 1HJGA 2WLPA 2RR12 2ZJCA 1OHFA 4WM8B 1W6NA 1VBD1 4MGYE 4KNCA 1JZ4A 1CAXB 1JTZX 1FOD1 3NV1A 3HWJA 3AMMA 4CDXB 3MIEA 2WFPA 4FPGA 5BNPC 4LE4A 1ND2C 2BERA 1VB2A 5C8CA 1IOAA 4R9AA 4NHLA 4NN0A 3UJOA 4XDOA 4Y1UA 4E8DA 4HL0A 4A3ZA 4FI9A 4DNYA 4ORFA 5DAPA 5BNNC 4XPVA 4AHXA 2XWJB 4CU6A 3K3NA 5BNNB 2Q0AA 5I8YA 4DXZA 3CU7A 2YBPA 3MW3A 1ZA4A 4KBZA 5GZCA 3E6CC 1HDKA 4O7XA 2FCTA 1CAUA 4OHYA 4LT5A 1W6QA 4YRDA 4LBNA 2V5DA 5KR7A 3A4UA 2VG9A 2R061 2UWAA 3AB0A 3ZYBA 2VNOA 1XYOA 2ZX2A 1F31A 3I97A 3DV8A 4Q4W2 5BPXA 2A3YA 5A3WA 5EXOA 4F3JA 5JOWA 3PL0A 4LBQB 4RQPC 3JD71 3OUJA 3FFQA 5IVBA 2P3IA 5FPZA 2Q4SA 3NMBA 1DP0A 1NT0A 2WA4A 2WNVA 2Z2SB 3B93A 3WDVA 1CPNA 1L7RA 3EXUA 3VKNA 5LA1A 1NA1A 3J26N 2RMU3 2WO7A 5LRRA 1ZBE3 4QQOA 4BQXA 2DYCA 4HT1T 5F9TA 3O1PA 3I3DA 1SCSA 2VCBA 1JS9A 3H1YA 4U2AA 1W28A 1M06G 3RYPA 2OUJA 2VZUA 2MHFA 3OF1A 1OVSA 1J58A 3P3NA 5FYBA 2JE8A 3M3QA 3SH3A 2RHPA 2JD9A 1J1LA 3T2PA 3ZFFB 2WNOA 1KITA 1IS5A 4UI9L 3POBA 4PF1A 2R6QA 2A71A 2WN2A 3S30A 1OXCA 2GALA 3PU8A 4HSJA 3CBNA 5EFUA 1TNFA 1OSGA 2WZR3 1YJLA 4CP2A 1CX4A 3FLTA 2FHRA 3G7DA 2CGOA 4YG3A 1UWWA 2YPJA 3LA7A 3ENRA 3MFCA 4Q26A 3U10A 1EAH1 1WLTA 3Q9OA 2D5HA 4EZHA 1J59A 1WD4A 2B45X 1C3HA 3NNFA 4UAPA 1LR5A 3DL3A 5A32B 5C3OA 1BK0A 3OEAA 2VZQA 4XVHA 5KHKA 2G9GA 5FY9A 2WSUA 1ODNA 2EIDA 2VU9A 1VBA2 3AJYA 4GH4C 4R9BA 1QJY2 2TEPA 1HRV1 3D0JA 3FBMA 3PVBB 4C1WA 5FMOL 3CJXA 3D3AA 3RSJA 2WLQA 4QDQA 5LA0A 3GZUC 2Z79A 5L9VA 1E5HA 1S0GA 2VTXJ 1FI2A 3NO8A 2JG8A 3Q8EA 2VOVA 2B4KA 1ZRIA 4LITA 2RDRA 4ZZ8A 5C3RA 1ZRFA 4QD2A 2JDMA 5K9YA 4XQWA 1UPIA 5FZCA 1BEV1 3B00A 1YLLA 1JYNA 5D8AA 1KRIA 4OHWA 4PT6A 1RITA 4H14A 5KC5A 4P9JA 5T50A 5I8SA 5L7OA 2P6CA 2SBAA 3QBQA 4F83A 1K5MB 1GZ9A 3LIHA 2ZEWA 3WDXA 1Z0HA 4COWA 3B7MA 4MYEA 4E2GA 5FZHA 3BUCA 1W8FA 2FZ2A 5FUIA 1LEDA 4PHZA 4QQPA 4UT5A 4RS5B 4E2SA 1HXS1 5JZGB 1EV13 3WLUA 4MH0E 3IPVB 1PK6A 1H2LA 2BVVA 2DUOA 3NJVA 3FLPA 5DXDA 2WINB 3RNSA 1QU0A 4PDWB 4PJYA 1RC6A 5CYYA 4IXLA 1W8WA 4S2GA 3P5BA 4YM0A 5CG9A 4FTBA 1N1TA 1OQ1A 3DF0A 3R4UA 4N53C 4AVAA 3BIEA 4YW4A 2VNGA 4N53B 3H7JA 1RJ7A 3D5OA 4QHZA 4CCOA 2VD7A 5FP9A 4LA3A 4DY5A 5A3PA 3IAQA 2QVSB 2UY9A 4BMBA 3LD8A 5EV7A 2YROA 4JRLA 3EQEA 3CF6E 5EQUA 3UK9A 5KHGA 3UNPA 1RUOA 4RHV2 2IWGB 1JYTA 5BNOA 2Y6JA 1AYN3 2WS92 3WW2A 1ZZ8A 2W0XA 2BDRA 3V64A 4FPYA 2HWB1 3EJKA 4UFKA 1GANA 4V1PA 4E2QA 2R071 4P9YA 3WNMA 3ALQA 4XZPA 5FR3A 3C8XA 3CQOA 4QX1A 3CZUA 2I45A 2MEV1 3OSDA 4GA9A 3SKVA 4FP3A 3KS7A 2VZVA 5JI7A 4Y20A 4LA2A 3QCWA 3VDCA 1AL23 3M3EA 4NO4A 1HQLA 1VBB1 2ZEZA 3ZKYA 1XNKA 3I4IA 1VLNA 5LCWL 5FZDA 2OW4A 3VDDA 4Y5SA 5FMCA 2VGDA 2B46X 2JXAA 3O5SA 2DU1A 5BY5A 5DDJ3 4EV0A 1W8NA 5F5AA 4UWDA 1YFYA 4LKEA 3RQ0A 1UX7A 3K3OA 2W47A 4Y4RA 1RUNA 2BP6A 3ZXKA 1L3JA 3I2KA 4BIFA 3IBMA 4FPOB 3H8RA 1XBFA 1MS5A 4IEXA 4RR3A 1MS4A 2YUEA 2YFUA 2FCUA 1ULOA 4LOTA 3I2IA 4COVA 1VBE2 5JOYA 4IEPA 2V09A 4FPLA 2ZGKA 3AZZA 4HN1A 5FZ6A 5JXHA 2VMFA 1RHI1 4QM8A 1Y3TA 1XU1A 1S0CA 4FFHA 1UZVA 1SLIA 2DVFA 4L11A 4UBGA 2P3KA 5KWRA 2QQOA 3A0NA 4Y1VA 4ET7A 3ZPOA 3OBRA 2OA2A 1KD7A 3CDZB 1VPHA 3M3OA 4KWKA 3KZ4C 1H1IA 1QOTA 1VMJA 3TOJA 4OCTA 4PIXA 3LSEA 4HKLA 4XQDA 5F3EA 3VZMA 4WVVA 2O1QA 1W6NB 4OZOA 4FP2A 4XF3A 1JOBA 3MIFA 3ZXLA 1RIRA 1RMU3 2HWF1 1GOGA 1SBEA 4NAMA 1G7YA 4N7UA 3AL5A 5I0UA 2DCJA 3VUOA 1X8EA 2ZGUA 2ET7A 4XFCA 3WVJA 1RINA 2ZPXA 4LBOA 5A70A 4UYBA 3APBA 1NZIA 1ZZ7A 4DUVA 2IXLA 4UFLA 2DBNA 1VRH3 2NN8A 1K3IA 5CVRA 5C8CB 2BBVA 3ZDVA 1SDWA 1NXMA 3IZOA 5FZ3A 3NW4A 2D3SA 3ILRA 4CDQC 4DPNA 1ND3A 3ELNA 1FX5A 2A73B 3THCA 2NMNA 1PMIA 2GN3A 2YV8A 1REFA 3I2HA 1X50A 2RS51 4XABA 5JSPA 4B29A 3I2OA 3N7JA 2VXRA 3POFA 2Z69A 3POIA 5LRSA 4AFDA 2WFF1 2X10A 1W6QB 3I59A 3PHMA 2DCZA 1EP0A 3FMGA 4QHBA 2XWBB 2XVLA 5A1LA 3LFIA 3N9OA 1SFPA 1SLAA 2RM23 4QX3A 3V56A 3SC7X 3MZHA 1W39A 4OI1A 1FPN1 2G9FA 3LPGA 2VY0A 1OA2A 2CGNA 2RJKA 2WNVB 3J8F3 3UGGA 3WP5A 5LASA 1AR62 2GC3A 4N43A 2XJSA 1NA1C 4Q4X1 2JKBA 3X29B 2ZABA 1WBFA 3K2OA 4DO0A 1QY4A 5FZBA 1LGBA 1OLME 1BLZA 4IW3A 1E5IA 3G6JB 5A7NA 5F2WA 4XXAA 2GH2A 1O3RA 2Y60A 1IKPA 4P02B 3EHKA 1NY72 2J7MA 3W20A 1DYOA 4ITCA 4CE8A 4K20A 5L36A 2JDNA 2BOJA 2LS6A 1TMF3 4YW7A 1RUG1 1JYVA 2X5IA 5CG8A 2RMU2 1JI6A 4P9IA 1ZBE2 3IDAA 2E53A 2PLV3 1H0BA 4LXLA 2H0BA 3GF6A 3SCGA 1OMIA 2VC9A 3H50A 1DF0A 5E88A 1S0FA 4BQ3A 4G3YC 2WNUB 3LOIA 4IERA 5CFCC 5IVJA 1YQ8A 4BMEA 1AR91 2CWMA 2PYTA 3JD73 1X36A 4FOWA 1U5XA 4G9SB 2YBKA 2NYYA 3INAA 4JGZC 2D6OX 5FYHA 5DPNA 3BTYA 3FE5A 5A6YA 1AXKA 1J3PA 2YU1A 1Q8QA 4Q4V1 1NCQA 4RYDA 1OURA 5IYYA 1W6MA 3UL2A 5IVCA 2VMDA 1K45A 3KB5A 3BI3A 3ORJA 2WZR2 5EIYB 1E57A 1REEA 4BK4A 5D1IA 4ARXA 4AVCA 4NHKA 3O1VA 4ZY9A 1UZYA 3HT2A 3N9LA 4KGGA 4NIGA 2JD4A 2K0GA 4OQ9A 4EYUA 4S2DA 2OIIA 1XNAA 1BMV1 5C71A 2JG8B 4ONUA 4A42A 4EN7B 2XL7A 3AP9A 3T0AA 3JBG3 4XACA 4JRAA 1G6NA 2C26A 4N9IA 5JVVA 3Q8BA 5FP3A 1MS3A 3U78A 5HCAA 3L2YA 1OA4A 4OHVA 5D8AB 4A41A 3W5NA 5G04L 4LO8A 3ACGA 1HRI2 2QQNA 5KXBA 5L7OB 1CZSA 2E26A 3W9AA 2CV6A 1W0PA 1UYZA 4LULA 2EF6A 4D8MA 4HN0A 3VL8A 4Y1ZA 1OOPA 4DXTA 4CXWA 2VW1A 2W39A 1EAH3 3RJRA 3WF1A 3FL7A 2AC1A 1AX2A 1TME3 4MVTA 4QPGC 4XIKA 5FZKA 4BHPA 3FX3A 1PK6B 1JZ5A 3WW1A 4C91A 3VB9A 4QQLA 2W1SA 1ULPA 1OVPA 2ZHMA 4IUGA 1EUUA 1NCRA 2BFUL 3RFRA 1UIJA 3U07A 2OQ7A 3K4AA 2P2KA 4GJZA 4AAPA 3M70A 2BQPA 1LHNA 3ZN5A 4ATFA 3NNGA 1YFWA 3HJRA 1EV12 1DGRN 2E51A 3PVOA 4QU1A 1BKZA 1WW4A 4IETA 2PHFA 3DXTA 5FREA 1Q8PA 1KFXL 2XXZA 5KXDA 1KDKA 1FAYA 2HEVF 5BNOC 5BNOB 1PO11 3C7FA 5LWBA 1V6NA 1GMMA 2VMGA 1RUJ2 4NRMA 2GNMA 1JODA 1W9TA 2QUOA 4TZDA 5BNPA 5A7PA 1NG0A 2WC2A 4JZRA 4E4DX 1ND2A 4SBVA 1YFUA 2DU0A 3DPRA 1H2NA 2BTVC 1C8M3 4I2OA 1CONA 1V6KA 1ODMA 4FTEA 4BDVB 3WF3A 1NQDA 2CL2A 4FQZA 2P4EA 3ZXEA 2YYOA 3KV4A 1YC61 1AYN2 1JZ3A 1JXNA 4Y20B 4XF9A 1LULA 1MZEA 2JDAA 3ZFGA 4WZCA 4A7KA 2RDSA 4XJ8A 4MXWA 4ZHNA 2WN3A 3AP5A 5DUVA 1GWMA 4CU9A 2IC1A 4HBNA 1Q8OA 1QJX1 4LBQD 4R4ZA 1LRHA 3VDDB 3KLSA 2IXKA 3IDBB 4FPHA 4NWWA 1O6UA 1JOPA 5LW9A 4NOTA 4QDRA 4AQTA 2OS2A 4OFGA 5FY8A 1AL22 1K12A 1HX6A 3DKQA 3MYXA 2CAUA 2VOKA 5J37A 4TLGA 5JSRA 2UY8A 1XJAA 4EE2A 1LB2A 1O3QA 3UETA 2DV9A 3DECA 4COZA 1YO8A 2HWB3 2XVGA 4RR3B 2NLRA 3KQ4B 1AZDA 2YGMA 3IMNA 4FFGA 4BQYA 2NPIA 2ZAAA 3BIWE 3GBWA 2WUHA 3H8UA 4TWTA 2KM2A 2EIBA 4Y24A 5DDJ2 1WGPA 2WWUA 3N7KA 4QU2A 4PI0A 1O7FA 1ULDA 2HWD3 5J96B 1VBB3 3VZJA 1GWLA 2XJUA 3EB7A 3H42B 2Z4FA 4FSJA 4Q4Y1 3OPTA 4CDUA 3S0MA 1LOCA 2VXJA 2X05A 4C0HA 3FC0A 3POWA 1QIQA 4L97A 3B02A 1OKQA 3PIGA 1S1AA 4W6WA 1WUVA 3AMPA 5FZ1A 3AP7A 5FP8A 2ZGRA 3SNMA 2W52A 4NHXA 1V00A 5C5TA 5GLUA 4YWAA 1I3HA 3MIBA 3JZVA 3PUSA 3MV01 4LIVA 2YXSA 4Q1PA 4FOVA 2B9VA 2ZGTA 1SMVA 1JMUB 3V0BA 4META 2TNFA 1OI6A 3QOPA 3T09A 3ZOIA 1UZWA 4FAGA 1Y9GA 3OEBA 4B4PA 1GQPA 4JVAA 1W9SA 2BVBA 2DWRA 2V5YA 5K0UA 4ES8A 2W91A 1W9WA 3I2FA 3SKJE 5H9PA 1Z7S3 4Y4YA 3USUA 1RMU2 1ND3B 3WG3A 2VUDA 3DYPA 4QKFA 3VLBB 1GICA 2CYFA 2P6HA 4XZUG 3UV9A 2ILMA 1T6GC 4Z8BA 1O8PA 1RHI3 4OQ8A 1PZ8A 4P9WA 5F8PA 1SFYA 2BRTA 5C9AC 1GNHA 4JKMA 3NJXA 1DQ5A 1E5SA 3I59B 5FPAA 4XE9A 1DGLA 4XUNA 2WDBA 1R082 1DGRA 3POSA 5ANQA 4V2VA 4LK7A 3WG1A 1QF3A 2DUPA 4HLTA 4Y22A 2P1BA 4ZXEA 1S55A 2DBIA 3MO4A 1YEWA 1WD3A 4KU7A 2C9KA 3J7HA 1L7LA 3QD6A 2BPA2 1AYM1 1MR5A 2A6VA 3OCPA 4MGTA 4GMP3 4CP9B 3O0VA 4N43C 1MPXA 2WYFA 3H3LA 1F5FA 1UXZA 2VOWA 2D40A 2KR2A 3SITA 3VHNA 4CCLA 2JDUA 1T2XA 3MIDA 5KBFA 5T54A 1CAVA 3LEKA 4XAEA 5IK8A 4S2HA 4I0WB 1W0OA 4YLZA 3VBHC 1S0BA 1OH3A 2PXJA 2B39A 2RM22 3GYDA 2QFEA 4NHYA 1HN0A 4XTPA 3ZMNA 1URXA 1F9KA 1DG6A 4OI0A 3KVBA 2HBUA 4DMIA 1AR73 3J8F2 4ES9A 4LR4A 5FOJB 3BKZA 1DQ6A 1ZBA1 2JG9B 5ACA1 3AX4A 3R0RA 2X5IC 2X5IB 5LBBA 2WFF3 2XKPA 1R093 4RGKA 4GWJA 4YW5A 3URFA 4EROA 2VCMA 1GV9A 5AC93 1GP4A 2WO1A 3AM2A 3MICA 3O1OA 2NZ9A 1MVEA 5JI9A 1CR7A 4AAXA 4LLFA 5T5JA 3VBSA 2D44A 4IV3A 3O0WA 5DN2A 3GHNA 4QT6A 2FMDA 1TMF2 3RMXA 4E27A 3MHZA 4BIOA 3NQHA 2PLV2 3SHRA 1WLDA 1NCQB 2Y6KA 4Q4X3 4A7ZA 1W6MB 2ARCA 1R64A 1IG0A 3D0SA 2XH6A 3WDWA 5IHRA 1JOJA 3T0DA 3WNNA 3I3BA 4OZXA 2O14A 2BGPA 3JD72 3S5AA 5FK7A 3S7EA 1IG3A 4YW6A 5CISA 1MZ6A 1DHKB 3WQ7A 1UU5A 2ZCWA 5FWEA 5AFBA 2RVAA 3GCWA 1W99A 3R4SA 4P5HA 3RPQA 2GMPA 3AKPA 4QXKA 4FPCA 5FLIA 2HWC3 3GALA 3WNXA 4B4RA 1YYNA 2EIEA 4CU7A 5FPUA 5F37A 3H8XA 5KHHA 3U0ZA 5HBAA 1RVF1 1OOPC 4BPZA 4CCDA 3JQWA 1OOPB 1OKOA 4LQRA 4C0BA 4FPFA 1PIV3 4M4RA 4NIDA 4Y1XA 1U12A 3CIHA 1PVC3 3CZJA 2NM1A 1XPWA 3VBRC 5JXIA 2JE9A 1B09A 1H9PA 1SFNA 3PUHA 5E89A 4WV8A 5FJKA 3UKNA 1LKNA 4AW7A 3ILNA 1NCRB 1X9PA 3BGAA 5CA6A 1O3SA 4L0PA 1O5LA 1IHMA 1WBLA 2GDFA 2VMCA 3CHXA 4XDPA 1EAH2 1UY4A 4IE0A 1TME2 3W58A 5CNAA 3KMHA 3ZR5A 1RXGA 1X82A 4QB1A 5CAZA 3RZKA 2WZPP 5A6XA 1RUE1 2VCCA 1UY1A 2W1UA 1UAIA 5ERLA 1SQ4A 4LBKA 1OF4A 2C9AA 3ROUA 2TUNA 4LNVA 3THPA 4Y26A 4XYXA 5BNPB 1STMA 1V0AA 2CHHA 1ND2B 4BXFA 1KFUL 4J6GA 3DPRC 1GFF2 4Q5OA 1Q56A 5IAVA 4CP1A 3QACA 2D98A 2FDKA 5G05L 1ASJ3 3LWCA 3OBTA 1BEV2 1UNBA 1LU2A 3EO6A 4CDQA 5LK7B 1MEC3 2BEOA 4B1MA 5EPAA 4YVWC 5J3UA 2GN7A 1HKDA 3OJBA 3ZFGC 2AUYA 2F6BA 2ZX3A 3DEMA 1AR63 4MXWB 2Y6GA 3WSOA 5CU1A 5DAVA 1C8M2 5F5IA 1QH7A 3T1MA 4A4AA 1DQ4A 1ZA7A 3NNLA 4H3WA 4XBLA 3I54A 3NV3A 5JMOA 2ZGMA 1YFXA 1YQ2A 1HB4A 3ZVXA 1QH6A 4B7KA 5A1FA 3RZGA 4IE7A 1US3A 4RQPB 3CKHA 4IEOA 4IGOA 4QKDA 2B7YA 1UMHA 3POYA 5GZGA 3DCQA 1N3PA 1POV3 1W8TA 2XDVA 4TN7A 5FPXA 3RYRA 4IESA 2VVEA 3AZYA 2FDFA 4NPRA 1DLLA 1R1A3 4OI4A 4ZU4A 3AK0A 3VDAA 2VUCA 1X7NA 1DQ1A 2ZMNA 1GWKA 1ZZCA 1GP5A 2JDPA 2O8QA 1W9FA 3OG2A 1NYWA 1WCDJ 2QQWA 1VBC1 1HV1A 5FZOB 5L73A 3W5MA 1Y9MA 4R8HA 1WKYA 4KWUA 4X8NA 3HNBM 3FWEA 4D3WA 2HWB2 4QQ2A 4KL1A 4CDUC 3AXDA 2ZKNA 5IATA 1SLTA 5I0RA 4MV2A 1OLRA 3C7OA 3PVNA 4HKWA 3IWZA 1BJQA 5CFCA 2A6ZA 3M4FA 3ACIA 4I3PA 4JGZA 5J98B 3M2MA 4EWAA 3OGGA 4B3NA 2P17A 3MDPA 4WVWA 2HWD2 3LEIA 4XCBA 1VBB2 2WKKA 3FHIB 2ZOEB 5BNQA 3V0BB 1PNFA 5JOZA 4JHTA 4Z92B 1W2UA 3VZLA 1VIWB 4BISA 4AGVA 2QQVA 1U5IA 3VV1A 4GH4B 3ZYIB 1IZ3A 4GB33 1RUC1 1TQ5A 2VE1A 3PTYA 4BQ5A 5K0UB 1NUKA 3WUDA 1HRI3 4WVMA 5FQ0A 2Y0OA 3USUB 2J1TA 2UU8A 4PBPA 4HVQA 2ZEXA 1UKRA 4O9EA 3T2OA 1RUI1 4GJYA 5CB7A 1Q8SA 1GLHA 2D6KA 1YQ5A 5LA2A 1D7PM 1UOJA 3T2QA 1HB2A 2R0HA 3D8CA 1RJ8A 4GZ9A 3ZMOA 4D94A 3VDBA 2L9LA 1JU4A 2RR11 2WWJA 3CJIA 5E16A 4TTGA 4XF0A 3NJYA 4YZ5A 4XMAA 1Z7S2 3SH5A 5F3IA 2Y0IA 3ZYGA 1RUF3 4IGPA 1O4ZA 2JWPA 4Y22B 4AGRA 2CY6A 4BQ2A 2AEZA 3OPWA 1RHI2 1GNYA 2DTYA 3VBFC 3RRDA 1CESA 1V6IA 5AVAA 5J48A 4X8PA 5JXJA 3MFAA 4YVSA 2XBO1 2BGOA 2A75A 2QQJA 4QPGA 3ZYHA 1GR3A 4XIOA 4IEUA 4A3XA 2QJVA 2BYVE 2WT1A 5GKAC 3S5QA 3JUUA 2DURA 1CAVB 2R1DA 4HSLA 4PLOA 3KGLA 1C1LA 3P3PA 2RV9A 4KGQA 1RUJ3 2BBAA 1LNSA 3BOPA 5F5CA 1SPPA 1UKGA 1WMXA 1SBDA 1YRZA 2DDUA 3ZFEC 1TZOA 2R49A 1QOSA 5FYVA 3BTZA 2BWCA 3O1UA 4JQTA 3WCRA 1ZZBA 3HQXA 4LMFA 4M0NA 3DXUA 5I0DA 3EYPA 1BQPA 3T1LA 2XGXA 1YNAA 2K46A 1AF9A 2LALA 4KG0A 4DINB 4EN6B 2KD7A 4NUBA 3ZO0B 2JE7A 1ONAA 2Y8KA 5FK8A 4ZPIA 3CO2A 1OPOA 1V6MA 1EUTA 1W6OA 3KT1A 5E6HA 4HG6B 3LB9A 5C33A 2FBEA 2D93A 2QKDA 1A6CA 2OXBA 4D7YA 2JKXA 3VBSC 1AR72 4IV3C 2VQUA 3VBSB 4QXCA 2RS52 4IV3B 1CN1A 2PFWA 5FUPA 1SLBA 3LA3A 2WFF2 3GDBA 4AF9A 2IXIA 1R092 4OUEA 1WCSA 2C4XA 5M0TA 2AZ5A 5L19A 4IV1C 5AC92 2ZHKA 1UYYA 3ZYJB 4IE4A 1AR81 5FZLA 4AEMA 1K5JA 1JYWA 2VQTA 4TYSA 1AHSA 2OKXA 3VGIA 3V0AA 2HEWF 2WYSA 4HKOA 1PNGA 2VNVA 1XSQA 2VTFA 1D0GA 4OVEA 1UMIA 1ZBA3 4HETA 4Q0SA 5EJ3A 2ZGSA 1QNWA 4XFGA 4HANA 1XOYA 4Q4X2 3UGFA 2VZRA 2FDJA 4MHRA 3HIFA 3WW4A 3SXWA 1VAVA 4YM3A 4XJ9A 3W59A 3WT3A 4PF5A 5EYYA 3RG0A 5FZ4A 2R043 5JR2A 3KCCA 1UN1A 2XOMA 3B69A 2GMEA 5LY2A 3WQ1A 1WMFA 2A3WA 1FYUA 5FKCA 5BV6A 1O8SA 5IFTA 1VMHA 2ETEA 3T30A 2W08A 5FYZA 3HVDA 1VBA1 1NLQA 1OH4A 1QJY1 2VCAA 3LSDA 2HWC2 5GLZA 3KV6A 3O1RA 5IAXA 1QQP3 2A6WA 2ARBA 1LOFC 3OTFA 3KCYA 4FTSA 4YYOA 2I07B 1ZZ9A 2E9QA 3J7MA 1I6XA 4JDOA 1PIV2 5FJHA 1U5ZA 2Y64A 2PAEA 2IFWA 1GZWA 2V4AA 1PVC2 1YIPA 4Q4V2 2Y34A 3AMNA 2VULA 1S0DA 2WWSA 2VBBA 4AFBA 1JZ6A 4QX0A 3BPSA 1RUH3 3WV6A 3DUIA 5JSOA 2PHWA 2ZAHA 4KU8A 1ZREA 1JYIA 3LDRA 1H4HA 3RI8A 4CPBD 1G9BA 1RVF3 1JW6A 4ZS2A 5JPNB 2W1QA 2AENA 2YB7A 4LBMA 1IGOA 3U11A 1V9U3 1R083 1W2AX 4DFSA 1PMJX 1PGW1 3MLLA 4I30A 4CDQB 3VD5A 2W5FA 2WBKA 5FYYA 1XU2A 1D4M3 4Z2AA 4Q1RA 4YZ2A 1VALA 1UW8A 2ADEA 4TLFA 5FXVA 1UX6A 4XFAA 1GU3A 1CAUB 1KJRA 3OPZA 3MI8A 4CCKA 5C9AA 4LORA 4IDZA 4KBBA 3ZN4A 4R4XA 4AWDA 5F3CA 5FY7A 1ASJ2 1S0EA 1E5RA 2EXHA 1NLRA 1FV2A 4RHV1 3NKTA 3LGRA 1Y43B 1A8DA 2EXJA 1MEC2 2BU9A 1VBD3 2I74A 2WS91 4PIYA 4MLOA 5EHDA 2OYZA 1NKGA 1X8MA 3I2DA 1FOD3 3AYDA 4BZ4A 4CUGA 2IFRA 1S0JA 2QE3A 1OLMA 3BVCA 3AMHA 2JX9A 4JV4A 3U75A 3SCFA 3KT4A 4BQWA 1NA1B 1QJFA 2VW2A 3UKVA 4FT8A 4EN8B 3OBZA 4YARA 5HXVA 4D0QA 1WZXA 3NNMA 4GKXA 1OF3A 4GXLA 4YZ4A 3VBHA 1JN2P 2CTVA 2VVFA 4M3CA 4MZUA 4RSUA 1H2MA 5H9QA 5JCTA 2W95A 1LAJA 3T2TA 3ME2A 3ZPYA 4IQPA 2P3YA 4K1YA 5FXWA 5IVYA 1UMZA 3LDBA 4K9SA 3KT7A 4JCKA 1MACA 1WA6X 3JB4C 3LCPA 3JU9A 1Q43A 4XF1A 5CZKA 3SMHA 4LUKA 4ASMB 1LHWA 3SH4A 1PZ9A 1R1A2 3ITQA 4H7LA 3KGZA 4XUPA 2R063 4D6SA 2VAUA 1Y7BA 1A8MA 1POQA 2VZ3A 4Q2FA 4LOSA 1WW7A 1FMD1 3UJQA 5CFCB 2G19A 2GU9A 3AVSA 3NWKA 4JGZB 4XCAA 4F7ZA 3VZKA 2GNBA 3A0KA 5GZEA 1QNYA 3AZVA 2QCSB 4DS0A 2P34A 2PA7A 2RJ2A 5FZ8A 1OLQA 1YIFA 4EN9B 5FZIA 4BCUA 2FDIA 4ZU5A 2Y6LA 4AGGA 1MZ5A 2JDHA 2D3PA 4P08A 2JDZA 3Q8CA 4ASLA 2ZKLA 1C1FA 2ZHLA 2XJVA 3E5UA 4Q0PA 5F39A 5T55A 4FFIA 2H6BA 2VOTA 4WVMB 5FQ0B 1BBT1 4PI2A 2GZWA 4LUMA 3ZSJA 3DYMA 3TB0A 2DVAA 3WF2A 4OI2A 2GC0A 2VL4A 4BOWA 1C8NA 1H4GA 1YI7A 4FOQA 2ARXA 2VTXA 3S7IA 3CJIC 4U36A 5HPOA 5K7PA 4W65A 2JENA 1AXYA 1H8VA 4GB32 3IIAA 4A6SA 2GAUA 3E5QA 4COUA 4DY3A 2HLEA 3BN6A 4M4PA 3E97A 1RXFA 3T4VA 3RMYA 4ARYA 4IEVA 1CX1A 4LPLA 2E33A 5ABJA 2YG0A 1SZBA 4UFMA 3VL9A 1PX3A 1BHGA 5FZMA 5E1RA 4YVSC 4JGYA 2ORXA 3MLKA 4YVSB 1N1YA 4Q4Y2 1VB4A 2E6VA 2ENRA 4QPGB 4XBNA 3SEPA 4UW5A 1S0IA 4YG0A 1WCQA 2LTNA 1TNRA 2XJTA 3VBRA 3WX5A 4QHOA 2Q1ZB 4CRQA 2PHDA 2UYBA 2XUMA 3U4SA 3PUAA 1HRV3 2HWE1 1Y9QA 3OY8A 1RUF2 4OMDA 4QKNA 5DUWA 5IJRA 1Y4WA 1ZNPA 3VBUA 2C24A 4F8AA 1SPPB 2H6CA 1O3TA 5FMBA 1QOOA 5DUXA 4Q0QA 3ZXFA 2FDHA 1RUI3 5FY0A 1W04A 2W3JA 2VZOA 3ZIXA 3RZLA 2ZX0A 4M01A 4PCRA 2AGSA 3UESA 4LO7A 1LECA 1BEV3 1LCLA 2QDRA 2WQ8A 4AHYA 2Q1MA 3QLQA 4NWVA 4ZXKA 5CKQA 2EALA 5LEJA 1NQJA 1HB1A 2KA3A 1W6OB 4KMQA 1AXZA 1JBCA 4B1LA 2VECA 2RDNA 2D5FA 4KG8A 1H9WA 1FV3A 5CKNA 1QXPA 3PMEA 4XQ4A 3WY6A 1BCXA 2FMYA 1ACCA 3DYOA 2PHTA 3MUZ1 4J25A 2BZDA 4URTA 3MF9A 3H9AA 4QB2A 4XC9A 1HXS3 2XBO3 3AVRA 3M3IA 4AFCA 3MPPG 1C57A 5FPBA 5L9RA 3WHUA 4XMIA 3F95A 2YGLA 3I3EA 4YVWA 3AJZA 1BYHA 5GM0A 1C5IA 2XHKA 4L92A 3RVHA 1NY71 3I3QA 3RZJA 3V0AB 4AOCA 1QXJA 1J84A 3AKTA 3KF3A 3ON7A 5DAWA 2VZPA 4AE2A 5FOBB 4CUBA 2BW8A 2RMU1 2WO2A 1ZBE1 3GHMA 2YC2A 5JPMB 4YM2A 3SLIA 5IUQA 1V6JA 2IUWA 2ZXQA 2R0FA 3B94A 2YC4A 4AVSA 2AH2A 4FBFA 1W03A 1XNDA 2XQXA 4N8MA 1MS1A 4AVTA 3N9NA 5A7QA 2QQLA 4WM7C 5A7WA 3A23A 5A6ZA 4AI2A 4GMP0 3FZ3A 3I7DA 2ZA9A 4QX8A 3TRSB 1PM4A 3T08A 2VPVA 2J42A 2CAVA 2ZACA 5SV8A 4Q8KA 1GKBA 3HQRA 4Q0VA 2JIJA 1ZBA2 5A3OA 3BCWA 5ACA2 2R073 4RA0A 4URAA 5FV3A 3H1WA 4P5YA 3TNQA 4D7TA 4JTOA 4MGQA 2QDNA 2VNRA 3DN7A 4I01A 2MEV3 1HV0A 2WZR1 4LKFA 2PHXA 5E8AA 4JKLA 1AR83 1WLCA 4MGKE 2R042 4NJ4A 2B9UA 3KWVA 1QDCA 4MOAA 4AFMA 3FJSA 2CDOA 2J1VA 2FDGA 1X9TA 1LODA 2GP5A 4HVRA 1IPJA 5FO9B 1GBGA 2HH9A 4X6QB 2WIIB 3NAPC 4EN0A 3VZOA 3OOXA 4CCMA 1GZWB 2YU2A 1PZ7A 4NHMA 4AR2A 2J1EA 2CDPA 4OUMA 4DXRA 2CNAA 2D6MA 3TN91 4OYUA 1F15A 4IGQA 3O14A 3GBGA 1RUD1 2V72A 1QQP2 2VVDA 2RS31 3J9SA 2WA3A 2Q5TA 5FZ7A 5IK5A 2BNMA 2ZGNA 4BB3A 1YCIA 1XC6A 2DUQA 3AZXA 4QB6A 4XILA 1GSLA 5FWJA 3NV2A 2VBPA 5IWFA 4Q29A 3RYKA 2XLGA 4K3UA 5DUUA 1SACA 3VN4A 3HT1A 4O65A 4YG6A 4K1ZA 2DCKA 1PVXA 1RUH2 4QPWA 3ZKUA 2P5BA 3L9JT 4AHWA 4Z07A 4CCCA 1F4HA 2OZ6A 4KWJA 4CYDA 3PNAA 4TXWA 3THDA 3SISA 1RVF2 2Q30A 3MUY1 5C9AB 1EV11 2JECA 3I49A 3GM8A 4XEZA 4AQ6A 4LHSA 1V9U2 2WAOA 2Q8CA 3VBOC 1A34A 2FQPA 4FQ4A 1XYNA 2MPFA 2X8KA 5I91A 2VZSA 4FO9A 4ZS3A 1M4WA 1RL3A 1UL9A 1D4M2 3MIGA 2HWF3 4A6OA 3LEMA 5A3NA 3VBFA 3C3VA 2VR4A 5FY4A 5IVVA 3ETQA 4OLLA 4N43B 3ZXDA 4AHZA 3TEYA 1TG7A 1NAEA 2LW8A 5FTTC 5FUNA 2ID4A 3O0XA 4CEWC 5GALA 1W8ZA 2WNEA 4BXSV 5GZFA 3PURA 3VBHB 1EY2A 1HW5A 3AKQA 4M3CB 4QPIC 2F17A 3C7GA 4L8QA 1AYN1 1VBD2 4HOOA 5DQ0A 4NIIA 3T0BA 3ZFEA 4MX3A 1FOD2 4GULA 4EWEA 4YGDA 5FY5A 2RS53 3E6BA 1O59A 2YC0A 5FXXA 5T5OA 3ZDSA 3TBDA 4I0BA 4YFWA 1NOVA 4MGSA 2Z5WA 3IN9A 5AFEA 1HB3A 4FXGB 1RYYA 2WQZC 4O61A 1NXD1 1LTEA 3AYEA 4NIAA 5FAXA 3RWNA 1JU3A 2OX0A 4HVOA 2ZMKA 4LBJA 4CZSA 4D6QA 5TSWA 3C7HA 5CBLA 5ANNA 5APAA 1DCSA 2XPJA 1DZQA 4YZ3A 5H9RA 2DFBA 2WO3A 1FPN3 3WCSA 5BYNA 5F7UA 3USSA 3GBFA 3WDTA 1JUIA 1X33A 3N3HA 1IQAA 3M8LA 1EPZA 4RL7A 4IV1A 2R062 4NAOA 5EJ1B 1KEXA 2BJSA 3WNKA 4AEKA 2XQRA 3N7MA 4ZONA 1G8WA 1XNBA 4AI9A 1LOAA 1QEXA 2OPWA 2D6PA 4IEWA 1LHUA 3OD0A 4LIUA 1N1SA 1D2SA 2Y6FA 1DZRA 5IK4A 1ENQA 2WABA 2Y6HA 5FZ0A 4E4HA 1YI9A 2FCVA 2KXLA 5BUVA 4H2AA 4L99A 4CCJA 5B4NA 1CPMA 1QJU1 1N3OA 1RUG3 4C1XA 1RB8G 2WJSA 3I2JA 1APNA 1U5YA 4QX2A 1PO21 5SV5A 1MZFA 3ZX7A 3S57A 2BGCA 3WDUA 4CDWC 1Q3EA 4RFRB 3LOBA 2DVGA 1POV0 3NKGA 5F3GA 5FO7B 3M1HA 2ZX4A 1FMD3 5LA9A 3K51A 1AR93 4PIZA 1LU1A 2ZGLA 1GYKA 2MNGA 3IDCB 5ABJC 1SLLA 5FYTA 3ECQA 5GLVA 5A3UA 5JWPA 5FZAA 4Y5Z0 1VBC2 4DXSA 5IVFA 4KWLA 5A3LA 1UY0A 3JB8A 4JGYC 4A45A 4CEYC 4JGYB 5LEKA 1LJ7A 3ZSLA 4Q4V3 3MLJA 5C3QA 5JDBA 1MS9A 3PTRB 4XFIA 3VBRB 4AQ2A 1PGL1 3N9PA 3UYJA 3N35A 3C7EA 1RMU1 4GALA 4XURA 1GNZA 3BTXA 1C4RA 2PQSA 1NZCA 2VM9A 1LOFA 3FLRA 3OY8B 1DYKA 3VBUC 3VBUB 5I93A 2TBVA 1BBT3 1W3VA 1CVNA 5A33A 1MQTA 1SG3A 2RS11 2VOXA 2ZGPA 4G4FA 2XVKA 5FZ9A 1Q5OA 4DOUA 5C7GA 2D6NA 1H1MA 5FYSA 3R6SA 1VRH1 3VZNA 4BYYA 4CA9A 2WRAA 5CEHA 1OQEA 2K9ZA 3AC0A 2QBXA 4WBBA 4HFSA 1HQNA 2A6XA 2A70A 4AEDC 3O1SA 1HRV2 2D7FA 3BB6A 3F2ZA 4N7IA 4RD7A 4R9DA 4N90A 3WZ1A 1JZ8A 3FFZA 3WP3A 3ZSEA 5B4XA 1OBNA 2PTMA 2ATFA 2RDQA 1XXNA 4QX5A 4COYA 2R32A 1RUI2 4HPKA 3VKOA 3DPRB 2WZ8A 3IM0A 2HYKA 4J1XA 5JMCA 3GNEA 2ES3A 2RM21 2B8MA 4WM8C 2BNOA 4NPLA 4YVWB 2ZZQA 3ZFGB 3H7YA 4AVVA 5IFPA 1ULCA 2HWE3 1WWYA 2ZX1A 3POJA 4HMZA 5CFDA 2ZGQA 3J8F1 4CDXC 5FZEA 2XMLA 4XXPA 4QKBA 1OC1A 2LRPA 1J3QA 3KD4A 1WCKA 3BYWA 1JHJA 3AFGA 4AZZA 5C8WA 4EQVA 4NR1A 1HXS2 3ACLA 2XBO2 3OGVA 5A3MA 1OD5A 1HJFA 2ZMLA 5FBZA 4MO3M 5FLJA 5HCFA 5KHIA 1L7QA 1XYPA 1N3QA 3ZN6A 1I5ZA 3VHPA 3DGTA 1CGPA 1PO13 3CNAA 5GLWA 5A7WB 4K6BA 2BFUS 2J1RA 1TE1B 4I02A 4O9GA 4Q8LA 4X6RB 4UBHA 1UYXA 5T52A 3TAYA 1A3KA 4CTEA 4AI8A 4BH9A 1TMF1 2W87A 1XNTA 2XKOA 1G86A 4PQ9A 1R1ZA 2PLV1 4XETA 1UU4A 2E7QA 4DZGA 1I5PA 1IPSA 5LZ6A 5FXZA 2XONA 5AVPA 1AX1A 1H2KA 2EAAA 4XW3A 3JCIA 2NP0A 4K7JA 4L9BA 1YQ6A 3K4DA 4CDUB 5JAXA 2R072 1QGLA 1QJX3 2P37A 1AX0A 2O0OA 4I0AA 4AI3A 1ZRRA 2MEV2 4NPMA 2XJPA 3ACHA 2IVJA 3M3CA 2Q8OA 1AR82 5FYUA 1AJKA 3U14A 4XOGA 3BPZA 2JEMA 3KV5A 1FATA 3LE0A 3T3YA 1COV1 2WT2A 2WSVA 2Q1FA 2D6LX 2E7AA 4JTNA 2VJXA 2D43A 4W50A 3ZFFC 5C3SA 2C1FA 3JBG1 3KF5A 4XFBA 2Y33A 2W9XA 1ZX5A 1CIYA 1DGWA 2C6SA 4UW3A 1O5UA 3KHBA 1F2NA 2WZEA 4YGBA 2WNUA 4AI0A 4HZFA 2VZTA 2JIGA 4XFHA 3D4KA 5C3PA 1CJDA 4M0HA 4PLMA 4UOJA 5EJZB 4YGCA 1DFQA 1YJKA 1OFNA 3AMQA 2R30A 4W4ZA 5EZWA 4EWDA 2VUJA 4LHNA 3MBWA 1EPWA 3OBAA 1TME1 4Q4Y3 5FRAA 3NL1A 1KS5A 1DYPA 3N4MA 1GZCA 4CP0A 4KH9A 3M7AA 2HKXA 1BXHA 1KGYA 2ARAA 1QMJA 3VHOA 1H6YA 3TN93 4IEYA 2X09A 4AG4A 4WVZA 1RUD3 3VBFB 4AVBA 5C4WA 2RS33 1ENXA 5DAQA 4QAWA 1LGNA 3P1IA 5LY1A 3J7LA 4HONA 5FYIA 1DDLA 3NV4A 1GZTA 2PAMA 5HI0A 3OD4A 5HV0A 4C8DA 1HN1A 2E7TA 1YWKA 3TEWA 4DRRA 2ORZA 2VH9A 4OMCA 4CVUA 3ZFEB 2HWF2 1JHNA 4H55A 1K5MC 4MHUA 4MGIE 4PBOA 5FZGA 5JXGA 3H1MA 3HEIA 2J22A 5IVEA 1C8M1 4RS5C 1F8VA 5JZGC 4JDNA 3H3UA 5B2GB 4XJAA 5D21A 2RG4A 4Q4W1 4XUOA 3WNPA 1UPSA 3TEZA 5FFOC 3VD3A 5FO8B 2Q8EA 4Z1VA 4PDWC 2VW0A 3K77A 4P9XA 4B4QA 1PGW2 2CWSA 2AEYA 5L9BA 2RJLA 4H7MA 2EICA 3B3QE 2OQ6A 3K4ZA 3WQ0A 3HAGA 5FP7A 1WA4A 1F4AA 1AYM3 1FT9A 1Q8VA 1QKQA 4FPKA 4NRQA 1GUIA 3FN9A 5CKMA 2W94A 5JR7B 3ZYPA 3VKLA 2IVIB 1UOGA 4JDMA 1XNCA 1LOGA 1H8TA 2XUEA 4IV1B 1W2OA 3AYAA 3B9IA 5HCBA 2J1AA 3OB8A 2OVUA 2AACA 2I2SA 2P3JA 1FPN2 2ET1A 2OPKA 4XAAA 4DUWA 3CLPA 2BWAA 1UD1A 2PQQA 1CAWA 4NE9A 1HIXA 2DCTA 1OQDA 2YPDA 4OHZA 1OD3A 1NE6A 3WINE 2E31A 1KDMA 3QH7A 4WM7A 4LKSA 1LENA 4CCEA 1BZWA 4M00A 5GLTA 4QPYA 2XL9A 2WL1A 2HWD1 4YW2A 5D2AA 4AYUA 1ZRDA 2GH8A 4BWOA 1RUG2 4B8EA 1LHOA 3WNOA 5CIRA 1G9CA 1S2KA 4BQ1A 3IAPA 1WMDA 5CADA 3PJYA 3HBKA 2YFZA 3HNMA 1UOBA 2D3RA 3POGA 1FMD2 1GP6A 4Z82A 5BXXA 1AR92 4IEZA 2ZBJA 4E4ZA 1VAMA 4YPJA 2YY1A 3O7OA 1ALYA 2LUWA 4LLOA 1W06A 1MQTC 3PJQA 3NAPA 3O12A 1MQTB 5A33B 2AREA 4D7SA 5J1XA 3MW4A 3TWIA 4Z2WA 1B35A 1QJU3 1WCUA 2VMHA 4C90A 1Z7S1 1AVBA 3O1TA 4J1WA 1PO23 5HXMA 1IKQA 1OPMA 3GGLA 4UW6A 3LKJA 4BA6A 1BBT2 1XQNA 4IE5A 3B01A 1AJOA 2UWBA 3WD5A 2PELA 3I2GA 4MADA 1BMV2 3LF7A 2ZS6B 3BU0A 4HPKB 2NMOA 4XUTA 1G9DA 1LOBA 1U0AA 3PU3A 2YZ4A 2K2SA 1G9FA 4AEJA 2JB8A 1LGCA 3GJBA 1S4CA 5KXEA 5FKBA 1ZRCA 2ERFA 1TEIA 2R1BA 3IMMA 4GAZA 2X53S 3JXSA 4QGLA 1KJLA 3AL6A 5FY1A 2QQKA 3IIIA 5CFDC 1ZYBA 4ZZ5A 5CFDB 2VQAA 4GMP1 4M3CF 4QGNA 3RJ2X 5A1AA 4UF0A 5KHJA 1W8OA 2HJIA 3FBYA 1FNYA 4P00B 2RS13 3VBOA 2BUKA 4A44A 2JDKA 4GWMA 4QX7A 4S2FA 5A3TA 5C8CC 4RGAA 4XJZA 4CPBA 3RDIA 2SLIA 3VD4A 3AZWA 5FLHA 1RUE3 3BOWA 2HYXA 3KSCA 4MSVA 4QMAA 3ZN6B 1W2NA 3ZYRA 5T5PA 2HWE2 1AR71 3D6EA 5A7SA 1W6PA 4BLIA 1T6BX 1W8HA 2DFCA 4XFFA 4QDSA 3A7QA 2VUAA 4FCAA 4UFJA 4CEWA 3WP6A 5KC6A 3KHCA 1SBFA 1R091 4YZ1A 4NMIA 4AL9A 1DQ2A 4QPIA 4XTMA 3B9CA 5AC91 4YM1A 2IXJA 3UKTA 1UF2C 1LOEA 1UXXX 4AXOA 1VR3A 3JQXA 1PO12 2WAAA 1SDDB 3GJAA 1JUHA 2D97A 3MIHA 1KXGA 3CEWA 1US2A 1XE8A 2IXHA 4JC1A 4LJHA 3NJZA 4FOYA 5LK5A 2WNVC 5A7OA 1MS0A 4CP9A 4GWNA 2XLAA 3ZXAC 5DG1A 1KS4A 2JICA 3FUOA 4EJRA 4LE3A 4GD4A 3AP6A 1WLWA 4LO6B 1UQXA 1O91A 3I8TA 2DVBA 5I8TA 3KCXA 1N1VA 3RZMA 2QTWB 4R9CA 4BM8A 1ULEA 4YFZA 1H1AA 3ABZA 1GOFA 4XHXA 1ZM1A 5DMYA 2GC2A 5GZDA 1V70A 3IDEA 1JZ7A 1TVGA 3LAGA 4GQ7A 3ZLIA 2JG9A 3BTAA 4M3CE 1Z78A 2QZ2A 1K42A 2EXIA 1QJX2 2BNNA 3DKWA 4IEQA 2EXKA 1VBE1 5FPLA 5JOXA 1J1TA 1J3RA 2XB6C 4LBLA 3TNPB 3ZM8A 5ISLA 3LZZA 2HWC1 3P6BA 2Y38A 1YQCA 1UIKA 5JIAA 3WF0A 3E6DA 1F5JA 2WNUC 3EMRA 3LIGA 2FD8A 2IXCA 2XLFA 4ZU7A 1GQGA 3ST7A 3OYWA 5HCHA 1VBC3 1QXRA 3J4UH 2W46A 3HNYM 1MVQA 1PIV1 4GKYA 2EA7A 1P8JA 1W05A 4BE3A 1UY3A 3CMGA 1PVC1 3MEPA 2O8OA 1SLCA 3CJIB 4EZ4A 4B7EA 2QQMA 3NSTA 1BK1A 1QHDA 4CDWA 5ACA3 3U4XA 2JDYA 3NVCA 2F4LA 1HLCA 3GCXA 1IQDC 4JKKA 5DZEA 2PHUA 4JHZA 3THTA 4LEJA 3PUIA 4ZKTB 4FAHA 4YGEA 4FFFA 2VZ1A 1DLCA 1BVVA 3MV11 4PLNA 4UFIA 1COV3 5C4WC 5C4WB 5JIUA 2V4VA 2JG8C 4CEYA 1H30A 3WG4A 4XJUA 4N9HA 3AXEA 4Q0UA 1QJZA 1S2BA 5C70A 2A1XA 1CZVA 4AQSA 1CZTA 3W21A 1RUC3 4RFT0 5D8AC 1VRBA 3OGJA 4I3GA 1SEFA 3TN92 5L7OC 4L2NA 3ZR6A 1RUD2 4XJWA 2CSGA 1RTVA 1IS6A 3ES4A 4LTAA 2YHJA 2RS32 4QM9A 2W92A 1VE0A 4I09A 3HMYA 1GOHA 3MPBA 3NRUA 4W6XA 1CIWA 1ASJ1 4Q27A 1PK6C 5F6KA 2RR13 5F1RA 2GSYA 2OT7A 4AEDA 1XE0A 5T5LA 4CSWA 3O1MA 3I3MA 1MEC1 3HN1A 1IPKA 3OUIA 5DZFA 2GNDA 5FMOS 5LBFA 3VKMA 3PIJA 4P9GA
chains in the Genus database with same CATH topology
3WUCA 4E9KA 1AR61 3H3ZA 1C5HA 1I9RA 3HBZA 3VKFC 1FNZA 1HQWA 3V65A 5FDBA 5KXCA 3K48A 4XBQA 3VHRA 5K8SA 5FCCA 1H8TC 1H8TB 4WM8A 4IL7A 1LEMA 5IT6A 1CAXA 4K40A 4P9LA 4CDXA 3CL1A 1POV1 4HK9A 1AYM2 1ZZ6A 4XF4A 1CJPA 4YW1A 1R1A1 3N7LA 2ZTNA 1PGSA 4K8FA 3MF6A 2EVXA 5GJ6A 1CAWB 2VQ0A 4Q4W3 3WXPA 5BNNA 2QNKA 4WM7B 4KQ7A 2VMIA 1VJ2A 1AUYA 1LHVA 2RE9A 1DBNA 4DB5A 3TYJA 3H0OA 1PM7A 1SCRA 3KM5A 1PHMA 2WQ4A 3BALA 2DCYA 2UYAA 3VDDC 3WR0A 2Z42A 2GC1A 4QQHA 5DZGA 3AKRA 3BODA 3R4DB 4LBQA 2C5DA 1DU3D 4RQPA 4SLIA 3PVEA 1IS4A 3WDYA 4OHXA 4AFAA 4W6YA 4D69A 2WT0A 2AYHA 4R52A 3AP4A 3NAPB 1B35C 4RR3C 2QQPA 1B35B 5F5QA 4LHLA 3IKWA 4GB31 1WMEA 4XHBA 3GZAA 2V73A 1HRI1 2ZHNA 2PAKA 2PHLA 4Y1YA 1NLSA 2A5ZA 4GIQA 2EAKA 2PHRA 1QDOA 2C0ZA 3ZFFA 2OUHA 5J36A 4FPJA 1D0HA 1QJU2 1NE4A 5J09A 4WZFA 2IZWA 2XJRA 3ZSMA 1IS3A 1VBA3 1PO22 1QJY3 2GMMA 1YHFA 1RUF1 1O4YA 1GQHA 1FXZA 2UWCA 2HEYF 3R05A 5EYXA 2NQYA 4FPEA 4K21A 1I1EA 4TSVA 3WG2A 2JJ6A 3FUQA 5A32A 3VBOB 1VP6A 1XE7A 4GH4A 3E5XA 1OA3A 3ZSKA 1RUJ1 1N47A 2QZ3A 1PGL2 1ND3C 5DG2A 3AFKA 3WHTA 1G9AA 2G4IA 2AR6A 4HK8A 1W6PB 4YNIA 4A7YA 1UCXA 2RS12 4CEWB 1YXWA 1DIWA 1VRH2 2PN5A 2XJQA 1EYBA 1VAKA 4QPIB 3RI9A 1AL0G 4LHKA 1RUE2 4MXVA 2B42B 4MGZE 5EWSA 4DQAA 1D4VB 1K5MA 4AK3A 4JQRA 1QWRA 4FVVA 3N36A 1WW5A 4RS5A 5JZGA 3IPVA 1UU6A 1JH5A 2YDEA 3KQRA 1DZTA 2OZJA 4NVPA 2F4PA 4PDWA 1RGSA 3ILFA 4RGGA 5T3NA 4RHV3 3AYCA 1AL21 2A6YA 3B5LB 2WS93 2DVDA 4ISQA 4N53A 4LO4B 3WP4A 5C6CA 3PMSA 2YMZA 4BLJA 2JG9C 2X29A 3HR9A 2W68A 3WW3A 1KQRA 1OFSA 1MS8A 2LM3A 5DDJ1 2Y26A 2CGPA 3LA2A 4JAAA 1A78A 3C2UA 5JLVA 2GNTA 4UW4A 2DTWA 2R041 3IT8A 1BVP1 3D82A 3OYWB 3ATGA 1ULFA 4OUSA 4YSFA 1D2QA 1NCQC 3MW2A 3PLQA 4CDWB 3EBRA 2ZZJA 3ZXJA 4AI1A 1QQP1 5H9SA 1ENRA 1LESA 4OULA 5ABJB 3GZTB 1REDA 2EIGA 3QH6A 1DGWX 3RS6A 3SCHA 2A7AA 3ZXGA 2B5HA 4CEYB 5J7MA 1YUDA 3ES1A 2FZ1A 4A2UA 3MGUA 4QGMA 2DF7A 1VBE3 5I0TA 5F6LB 3AKSA 1RUH1 3ZIWA 4XDQA 1JYCA 1V6OA 2E63A 2H0VA 3WOGA 5I0SA 4YW3A 3S6PA 3L2HA 1UZZA 1V6LA 4INDA 2XG3A 1COV2 2A3XA 1ENSA 1XRUA 4MUVA 2N7GA 3BU7A 1CQ9A 1V9U1 3HD8B 1C28A 1R081 3JBG2 2UURA 1RUC2 4AEDB 4ATEA 1WW6A 4P14A 1D4M1 1CD3G 1ULGA 1DQ0A 1NCRC 4ISRA 4DRVA 3ASIA 3RZZA 4E4SA 2R16A 4UXAA 5IK7A 1O4TA 4FXKB 2ZGOA 1ZVFA 4LO5B 2WLPA 2RR12 2ZJCA 1OHFA 4WM8B 1W6NA 1VBD1 4MGYE 4KNCA 1CAXB 1JTZX 1FOD1 3NV1A 3HWJA 3AMMA 4CDXB 3MIEA 2WFPA 4FPGA 5BNPC 4LE4A 1ND2C 1VB2A 5C8CA 1IOAA 4R9AA 4NHLA 4NN0A 3UJOA 4Y1UA 4HL0A 4DNYA 4ORFA 5BNNC 4XPVA 4AHXA 2XWJB 5BNNB 2Q0AA 5I8YA 4DXZA 3CU7A 3MW3A 1ZA4A 5GZCA 3E6CC 1HDKA 1CAUA 4OHYA 4LT5A 1W6QA 4YRDA 4LBNA 3A4UA 2VG9A 2R061 2UWAA 3AB0A 2VNOA 1XYOA 2ZX2A 1F31A 3DV8A 4Q4W2 5BPXA 2A3YA 4F3JA 5EXOA 5JOWA 4LBQB 4RQPC 3JD71 3FFQA 2P3IA 5FPZA 2Q4SA 2WA4A 2Z2SB 2WNVA 3B93A 3WDVA 1CPNA 3EXUA 3VKNA 1NA1A 3J26N 2RMU3 5LRRA 1ZBE3 4QQOA 2DYCA 4HT1T 5F9TA 1SCSA 3H1YA 4U2AA 1M06G 3RYPA 2OUJA 2MHFA 3OF1A 1J58A 3P3NA 3M3QA 3SH3A 2RHPA 1J1LA 3ZFFB 1KITA 1IS5A 2R6QA 2A71A 3S30A 2GALA 4HSJA 5EFUA 1TNFA 1OSGA 2WZR3 1YJLA 4CP2A 1CX4A 3FLTA 2FHRA 3G7DA 2CGOA 4YG3A 2YPJA 3LA7A 3ENRA 3MFCA 4Q26A 3U10A 1EAH1 1WLTA 3Q9OA 2D5HA 1J59A 1WD4A 2B45X 1C3HA 1LR5A 3DL3A 5A32B 5KHKA 2G9GA 2WSUA 4GH4C 3AJYA 2VU9A 1VBA2 5K0UC 4R9BA 1QJY2 2TEPA 1HRV1 3D0JA 3FBMA 3PVBB 4C1WA 5FMOL 3CJXA 3RSJA 2WLQA 3GZUC 2Z79A 1S0GA 1FI2A 3NO8A 2JG8A 2VOVA 1ZRFA 4QD2A 5K9YA 4XQWA 1UPIA 1BEV1 3B00A 1YLLA 1KRIA 5D8AA 4OHWA 1RITA 4H14A 5KC5A 4P9JA 5T50A 5I8SA 5L7OA 2SBAA 3QBQA 4F83A 1K5MB 1GZ9A 3WDXA 1Z0HA 4COWA 3B7MA 4MYEA 4E2GA 2FZ2A 1LEDA 4QQPA 4RS5B 4E2SA 1HXS1 5JZGB 1EV13 3WLUA 4MH0E 3IPVB 1PK6A 1H2LA 2BVVA 2DUOA 3FLPA 5DXDA 2WINB 3RNSA 1QU0A 4PDWB 4PJYA 1RC6A 5CG9A 4IXLA 4S2GA 4YM0A 4FTBA 1N1TA 1OQ1A 3DF0A 3R4UA 4N53C 4AVAA 4YW4A 2VNGA 4N53B 3H7JA 1RJ7A 3D5OA 4LA3A 4DY5A 2QVSB 2UY9A 4BMBA 5EV7A 2YROA 4JRLA 3EQEA 3CF6E 3UK9A 5KHGA 1RUOA 4RHV2 2IWGB 5BNOA 1AYN3 2WS92 3WW2A 1ZZ8A 2W0XA 3V64A 4FPYA 2HWB1 3EJKA 1GANA 4V1PA 4E2QA 2R071 4P9YA 3ALQA 4XZPA 2I45A 2MEV1 4GA9A 4FP3A 3KS7A 5JI7A 4Y20A 4LA2A 3QCWA 1AL23 3M3EA 4NO4A 1HQLA 1VBB1 1XNKA 3I4IA 1VLNA 2OW4A 3VDDA 2VGDA 2B46X 2JXAA 3O5SA 2DU1A 5BY5A 5DDJ3 4EV0A 1YFYA 3RQ0A 1RUNA 3ZXKA 1L3JA 4BIFA 3IBMA 4FPOB 1MS5A 4IEXA 4RR3A 1MS4A 2YUEA 4COVA 1VBE2 5JOYA 4IEPA 2V09A 4FPLA 2ZGKA 3AZZA 4HN1A 1RHI1 4QM8A 1Y3TA 1XU1A 1S0CA 4L11A 1SLIA 2DVFA 4UBGA 5KWRA 2P3KA 3A0NA 4Y1VA 3OBRA 2OA2A 1KD7A 3M3OA 4KWKA 3KZ4C 1H1IA 1QOTA 3TOJA 4PIXA 4XQDA 3LSEA 4HKLA 3VZMA 4WVVA 2O1QA 1W6NB 4FP2A 4XF3A 3ZXLA 3MIFA 1RIRA 1RMU3 2HWF1 1SBEA 1G7YA 4N7UA 5I0UA 2DCJA 3VUOA 1X8EA 2ZGUA 2ET7A 4XFCA 3WVJA 1RINA 2ZPXA 4LBOA 3APBA 1ZZ7A 2IXLA 2NN8A 1VRH3 5CVRA 2BBVA 5C8CB 1SDWA 1NXMA 3NW4A 2D3SA 3ILRA 4CDQC 4DPNA 1ND3A 3ELNA 1FX5A 2A73B 2NMNA 1PMIA 2GN3A 2YV8A 1REFA 5JSPA 1X50A 2RS51 4B29A 3N7JA 2VXRA 2Z69A 5LRSA 4AFDA 2WFF1 1W6QB 3I59A 3PHMA 2DCZA 1EP0A 3FMGA 4QHBA 2XWBB 2XVLA 3V56A 1SLAA 2RM23 3MZHA 1W39A 4OI1A 1FPN1 2G9FA 2VY0A 1OA2A 2CGNA 2RJKA 2WNVB 3J8F3 3WP5A 1AR62 2GC3A 4N43A 2XJSA 1NA1C 4Q4X1 2JKBA 3X29B 2ZABA 1WBFA 1QY4A 1LGBA 3G6JB 4XXAA 2GH2A 1O3RA 1IKPA 3EHKA 1NY72 4ITCA 4K20A 5L36A 1TMF3 5CG8A 1RUG1 2X5IA 2RMU2 4P9IA 1ZBE2 2E53A 2PLV3 1H0BA 2H0BA 3GF6A 3SCGA 1OMIA 3H50A 1DF0A 5E88A 1S0FA 4G3YC 2WNUB 3LOIA 4IERA 5CFCC 4BMEA 1AR91 2CWMA 2PYTA 3JD73 1X36A 4FOWA 1U5XA 4G9SB 4JGZC 2NYYA 3INAA 2D6OX 3FE5A 1AXKA 1J3PA 1Q8QA 4Q4V1 1NCQA 1W6MA 3UL2A 3KB5A 2WZR2 1E57A 1REEA 5D1IA 4AVCA 4NHKA 1UZYA 3HT2A 4KGGA 2JD4A 2K0GA 4S2DA 2OIIA 1BMV1 2JG8B 4ONUA 4EN7B 2XL7A 3AP9A 3JBG3 4JRAA 1G6NA 4N9IA 5JVVA 5HCAA 1MS3A 3L2YA 1OA4A 4OHVA 5D8AB 4LO8A 1HRI2 5KXBA 5L7OB 3W9AA 2CV6A 1W0PA 4LULA 2EF6A 4HN0A 3VL8A 4Y1ZA 1OOPA 2VW1A 2W39A 1EAH3 3RJRA 4XIKA 1AX2A 1TME3 4MVTA 4QPGC 4BHPA 3FX3A 1PK6B 3WW1A 4C91A 4QQLA 2ZHMA 1NCRA 2BFUL 1UIJA 3U07A 2P2KA 3M70A 2BQPA 1LHNA 3ZN5A 4ATFA 1YFWA 1EV12 1DGRN 2E51A 3PVOA 1BKZA 1WW4A 4IETA 2PHFA 5FREA 5KXDA 1Q8PA 1KFXL 1KDKA 1FAYA 2HEVF 5BNOC 5BNOB 1PO11 1V6NA 2VMGA 1RUJ2 2GNMA 2QUOA 4TZDA 5BNPA 1NG0A 2WC2A 4E4DX 1ND2A 4SBVA 1YFUA 2DU0A 3DPRA 1H2NA 2BTVC 1C8M3 4I2OA 1CONA 1V6KA 4FTEA 1NQDA 2CL2A 4FQZA 3ZXEA 2YYOA 1AYN2 1JXNA 4Y20B 4XF9A 1LULA 1MZEA 3ZFGA 4WZCA 4A7KA 4XJ8A 4MXWA 3AP5A 5DUVA 2IC1A 4HBNA 1Q8OA 1QJX1 4LBQD 4R4ZA 1LRHA 3VDDB 3KLSA 2IXKA 3IDBB 4FPHA 4NWWA 4NOTA 4AQTA 4OFGA 1AL22 1HX6A 3MYXA 2CAUA 2VOKA 5J37A 5JSRA 2UY8A 1LB2A 1O3QA 4COZA 2DV9A 1YO8A 2HWB3 2XVGA 4RR3B 2NLRA 1AZDA 2YGMA 3IMNA 2NPIA 2ZAAA 3BIWE 3GBWA 4TWTA 3H8UA 2KM2A 4Y24A 5DDJ2 1WGPA 3N7KA 4QU2A 1O7FA 1ULDA 2HWD3 5J96B 1VBB3 3VZJA 2XJUA 4FSJA 4Q4Y1 4CDUA 3S0MA 1LOCA 4C0HA 3FC0A 3POWA 4L97A 3B02A 1OKQA 1S1AA 4W6WA 1WUVA 3AMPA 3SNMA 3AP7A 2ZGRA 2W52A 1V00A 5GLUA 1I3HA 3MIBA 3JZVA 2YXSA 4Q1PA 4FOVA 2ZGTA 3V0BA 1SMVA 4META 2TNFA 1OI6A 3QOPA 4FAGA 4B4PA 4JVAA 2DWRA 2BVBA 2V5YA 5K0UA 4ES8A 5H9PA 1Z7S3 4Y4YA 3USUA 1RMU2 1ND3B 3WG3A 3VLBB 1GICA 2CYFA 3UV9A 2ILMA 1T6GC 4Z8BA 1RHI3 1PZ8A 4P9WA 1SFYA 5C9AC 1GNHA 1DQ5A 3I59B 4XE9A 1DGLA 1R082 1DGRA 3POSA 3WG1A 1QF3A 2DUPA 4HLTA 4Y22A 1S55A 1WD3A 4KU7A 3QD6A 2BPA2 1AYM1 1MR5A 2A6VA 3OCPA 4GMP3 3O0VA 4N43C 1F5FA 2VOWA 2D40A 3SITA 3VHNA 3MIDA 5KBFA 5T54A 1CAVA 5IK8A 4S2HA 4I0WB 1W0OA 4YLZA 3VBHC 1S0BA 3GYDA 2RM22 2B39A 4XTPA 3ZMNA 2QFEA 1URXA 1F9KA 1DG6A 4OI0A 4DMIA 1AR73 3J8F2 4ES9A 4LR4A 5FOJB 1DQ6A 1ZBA1 2JG9B 5ACA1 3AX4A 3R0RA 2X5IC 2X5IB 2WFF3 2XKPA 1R093 4YW5A 3URFA 4EROA 1GV9A 5AC93 3AM2A 3MICA 2NZ9A 1MVEA 5JI9A 1CR7A 4LLFA 5T5JA 3VBSA 2D44A 4IV3A 3O0WA 3GHNA 4QT6A 2FMDA 1TMF2 3RMXA 4E27A 4BIOA 2PLV2 3SHRA 1WLDA 1NCQB 4Q4X3 4A7ZA 1W6MB 3D0SA 2XH6A 3WDWA 1JOJA 4OZXA 3JD72 3S7EA 1MZ6A 1DHKB 3WQ7A 1UU5A 2ZCWA 5AFBA 3R4SA 4P5HA 3RPQA 2GMPA 3AKPA 4QXKA 4FPCA 5FLIA 2HWC3 3GALA 3WNXA 4B4RA 1YYNA 5KHHA 3U0ZA 5HBAA 1RVF1 1OOPC 4BPZA 3JQWA 1OOPB 4C0BA 4FPFA 1PIV3 4Y1XA 1U12A 1PVC3 2NM1A 3VBRC 2JE9A 1B09A 1H9PA 1SFNA 5E89A 4WV8A 3UKNA 1LKNA 4AW7A 3ILNA 1NCRB 5CA6A 1O3SA 1O5LA 1IHMA 1WBLA 2GDFA 1EAH2 1TME2 3W58A 5CNAA 3KMHA 1X82A 5CAZA 2WZPP 1RUE1 1UAIA 1SQ4A 4LBKA 2C9AA 3ROUA 2TUNA 4LNVA 3THPA 4Y26A 4XYXA 5BNPB 1ND2B 1KFUL 4J6GA 3DPRC 1GFF2 1Q56A 4CP1A 3QACA 2D98A 1ASJ3 3LWCA 3OBTA 1BEV2 1LU2A 3EO6A 4CDQA 5LK7B 1MEC3 2BEOA 4YVWC 5J3UA 2GN7A 1HKDA 3OJBA 3ZFGC 2AUYA 2F6BA 2ZX3A 1AR63 4MXWB 5CU1A 1C8M2 1QH7A 3T1MA 1DQ4A 4H3WA 4XBLA 3I54A 3NV3A 2ZGMA 1YFXA 4B7KA 3ZVXA 1QH6A 4RQPB 4IEOA 2B7YA 3POYA 5GZGA 1N3PA 1POV3 5FPXA 3RYRA 4IESA 2VVEA 3AZYA 4NPRA 1DLLA 1R1A3 4OI4A 4ZU4A 3AK0A 1X7NA 1DQ1A 2ZMNA 1ZZCA 2O8QA 1NYWA 1WCDJ 1VBC1 1HV1A 5L73A 4R8HA 4X8NA 3FWEA 4D3WA 2HWB2 4QQ2A 4KL1A 4CDUC 3AXDA 2ZKNA 1SLTA 5I0RA 4MV2A 1OLRA 3PVNA 4HKWA 3IWZA 1BJQA 5CFCA 2A6ZA 3M4FA 4I3PA 4JGZA 5J98B 3M2MA 4EWAA 3OGGA 4B3NA 2P17A 3MDPA 4WVWA 2HWD2 5BNQA 1VBB2 2WKKA 3FHIB 2ZOEB 3V0BB 1PNFA 5JOZA 4Z92B 1W2UA 3VZLA 1VIWB 4AGVA 1U5IA 3VV1A 4GH4B 3ZYIB 1IZ3A 4GB33 1RUC1 1TQ5A 5K0UB 3PTYA 3WUDA 1HRI3 4WVMA 5FQ0A 2Y0OA 3USUB 4PBPA 2UU8A 4HVQA 1UKRA 4O9EA 1RUI1 5CB7A 1Q8SA 1GLHA 2D6KA 3ZMOA 3D8CA 2R0HA 1RJ8A 4D94A 2RR11 3CJIA 5E16A 4XF0A 4YZ5A 4XMAA 1Z7S2 3SH5A 2Y0IA 3ZYGA 1RUF3 1O4ZA 4Y22B 4AGRA 2CY6A 1RHI2 2DTYA 3VBFC 3RRDA 1CESA 1V6IA 5AVAA 5J48A 4X8PA 3MFAA 4YVSA 2XBO1 2A75A 4QPGA 1GR3A 4XIOA 4IEUA 4A3XA 2QJVA 2BYVE 2WT1A 5GKAC 3JUUA 2DURA 1CAVB 2R1DA 4HSLA 4PLOA 3KGLA 1C1LA 3P3PA 4KGQA 1RUJ3 3BOPA 1UKGA 1SBDA 1YRZA 3ZFEC 2R49A 1QOSA 2BWCA 3WCRA 1ZZBA 3HQXA 4M0NA 3T1LA 1BQPA 2XGXA 1YNAA 4KG0A 1AF9A 2LALA 4DINB 4EN6B 3ZO0B 2JE7A 1ONAA 3CO2A 1OPOA 1V6MA 1W6OA 3KT1A 3LB9A 5C33A 2FBEA 2D93A 2QKDA 1A6CA 4D7YA 3VBSC 1AR72 4IV3C 3VBSB 2RS52 4IV3B 2PFWA 1CN1A 1SLBA 3LA3A 2WFF2 4AF9A 2IXIA 1R092 1WCSA 2AZ5A 5L19A 4IV1C 5AC92 2ZHKA 3ZYJB 1AR81 4AEMA 4TYSA 1AHSA 3VGIA 3V0AA 2HEWF 4HKOA 1PNGA 1D0GA 4OVEA 1ZBA3 5ACA3 4HETA 4Q0SA 5EJ3A 2ZGSA 1QNWA 4XFGA 4HANA 4Q4X2 3HIFA 3WW4A 3SXWA 1VAVA 4YM3A 4XJ9A 3W59A 3WT3A 4PF5A 5EYYA 3RG0A 2R043 3KCCA 1UN1A 3B69A 2GMEA 3WQ1A 1WMFA 2A3WA 1FYUA 5BV6A 2ETEA 2W08A 1VBA1 1QJY1 3LSDA 2HWC2 5GLZA 1QQP3 2A6WA 2ARBA 1LOFC 3OTFA 3KCYA 4FTSA 4YYOA 2I07B 1ZZ9A 2E9QA 4JDOA 1I6XA 1PIV2 1U5ZA 2PAEA 2IFWA 1GZWA 1PVC2 1YIPA 4Q4V2 3AMNA 2VULA 1S0DA 2WWSA 4AFBA 1RUH3 3WV6A 3DUIA 5JSOA 2PHWA 2ZAHA 4KU8A 1ZREA 1JYIA 1H4HA 3RI8A 1G9BA 1RVF3 1JW6A 5JPNB 2AENA 4LBMA 1IGOA 3U11A 1V9U3 1R083 4DFSA 1PGW1 3MLLA 4I30A 4CDQB 1XU2A 1D4M3 4Q1RA 4YZ2A 1VALA 1UW8A 4TLFA 1UX6A 4XFAA 1CAUB 1KJRA 3OPZA 3MI8A 5C9AA 4KBBA 3ZN4A 4R4XA 4AWDA 1ASJ2 1S0EA 2EXHA 1NLRA 1FV2A 4RHV1 3NKTA 3LGRA 1Y43B 1A8DA 2EXJA 1MEC2 2I74A 1VBD3 2WS91 4PIYA 2OYZA 4MLOA 1X8MA 3I2DA 1FOD3 3AYDA 4BZ4A 2IFRA 1S0JA 2QE3A 4JV4A 3AMHA 2JX9A 3SCFA 3KT4A 1NA1B 2VW2A 3UKVA 4FT8A 4EN8B 4YARA 5HXVA 4GKXA 4GXLA 4YZ4A 3VBHA 1JN2P 2CTVA 2VVFA 4M3CA 4MZUA 4RSUA 1H2MA 5H9QA 5JCTA 3T2TA 3ME2A 3ZPYA 4IQPA 4K1YA 1UMZA 4K9SA 3KT7A 4JCKA 1MACA 3LCPA 3JB4C 4XF1A 3JU9A 1Q43A 3SMHA 4ASMB 4LUKA 1LHWA 3SH4A 1PZ9A 1R1A2 4H7LA 3KGZA 2R063 1Y7BA 1A8MA 4Q2FA 1WW7A 1FMD1 3UJQA 5CFCB 2GU9A 3NWKA 4JGZB 4F7ZA 3VZKA 2GNBA 3A0KA 5GZEA 1QNYA 3AZVA 2QCSB 4DS0A 2P34A 2PA7A 1OLQA 1YIFA 4EN9B 4BCUA 4ZU5A 4AGGA 1MZ5A 2D3PA 2JDZA 4ASLA 2ZKLA 1C1FA 2ZHLA 2XJVA 3E5UA 4Q0PA 5T55A 2H6BA 4WVMB 5FQ0B 1BBT1 2GZWA 4LUMA 3ZSJA 3TB0A 2DVAA 4OI2A 2GC0A 4BOWA 1C8NA 1H4GA 1YI7A 4FOQA 2ARXA 3S7IA 3CJIC 4U36A 5K7PA 4W65A 2JENA 1AXYA 1H8VA 4GB32 3IIAA 2GAUA 3E5QA 4COUA 4DY3A 3E97A 3RMYA 4IEVA 5ABJA 3VL9A 5E1RA 4YVSC 4JGYA 3MLKA 4YVSB 1N1YA 4Q4Y2 1VB4A 2E6VA 2ENRA 4QPGB 4XBNA 4UW5A 1S0IA 4YG0A 2LTNA 2XJTA 1TNRA 3VBRA 3WX5A 4CRQA 2Q1ZB 2PHDA 2UYBA 2XUMA 1HRV3 2HWE1 1Y9QA 3OY8A 1RUF2 5DUWA 3VBUA 1ZNPA 4F8AA 2H6CA 1O3TA 1QOOA 5DUXA 4Q0QA 3ZXFA 1RUI3 3ZIXA 2ZX0A 4M01A 4PCRA 2AGSA 4LO7A 1BEV3 1LECA 1LCLA 2QDRA 4AHYA 2Q1MA 3QLQA 4NWVA 4ZXKA 2EALA 5LEJA 1NQJA 2KA3A 1W6OB 1AXZA 1JBCA 2VECA 2D5FA 4KG8A 1H9WA 1FV3A 1QXPA 3PMEA 4XQ4A 3WY6A 1BCXA 2FMYA 4URTA 2PHTA 3MF9A 3H9AA 1HXS3 2XBO3 3M3IA 4AFCA 3MPPG 1C57A 3WHUA 4XMIA 2YGLA 4YVWA 3AJZA 1BYHA 5GM0A 1C5IA 2XHKA 4L92A 1NY71 3V0AB 1QXJA 3AKTA 4AE2A 5FOBB 2BW8A 2RMU1 1ZBE1 3GHMA 5JPMB 4YM2A 3SLIA 5IUQA 1V6JA 2R0FA 3B94A 4AVSA 2AH2A 4FBFA 1XNDA 4AVTA 1MS1A 4WM7C 4AI2A 4GMP0 3FZ3A 3I7DA 2ZA9A 3TRSB 2VPVA 2CAVA 2ZACA 5SV8A 4Q8KA 1GKBA 4Q0VA 1ZBA2 5ACA2 3BCWA 2R073 4RA0A 3H1WA 3TNQA 4D7TA 4JTOA 2QDNA 2VNRA 3DN7A 4I01A 2MEV3 1HV0A 2WZR1 2PHXA 5E8AA 1AR83 1WLCA 4MGKE 2R042 2B9UA 1QDCA 4AFMA 3FJSA 4HVRA 1LODA 1IPJA 5FO9B 1GBGA 4X6QB 2WIIB 3NAPC 4EN0A 3VZOA 1GZWB 1PZ7A 4NHMA 4OUMA 2CNAA 2D6MA 3TN91 3O14A 3GBGA 1RUD1 1QQP2 2VVDA 2RS31 3J9SA 2WA3A 2Q5TA 5IK5A 2BNMA 2ZGNA 1YCIA 2DUQA 3AZXA 4XILA 1GSLA 3NV2A 4Q29A 3RYKA 2XLGA 4K3UA 5DUUA 1SACA 3VN4A 3HT1A 4YG6A 4K1ZA 2DCKA 1PVXA 1RUH2 3L9JT 4AHWA 4Z07A 2OZ6A 4KWJA 4CYDA 3PNAA 3SISA 1RVF2 2Q30A 5C9AB 1EV11 2JECA 4XEZA 4AQ6A 1V9U2 3VBOC 2FQPA 4FQ4A 1XYNA 2MPFA 2X8KA 5I91A 4FO9A 1M4WA 1RL3A 1UL9A 1D4M2 3MIGA 2HWF3 3VBFA 3C3VA 3ETQA 4OLLA 4N43B 3ZXDA 4AHZA 5FTTC 3O0XA 4CEWC 5GALA 2WNEA 5GZFA 3VBHB 1EY2A 1HW5A 3AKQA 4M3CB 4QPIC 4L8QA 1AYN1 1VBD2 3ZFEA 4MX3A 1FOD2 4GULA 4EWEA 4YGDA