3AXEA

The truncated fibrobacter succinogenes 1,3-1,4-beta-d-glucanase v18y/w203y in complex with cellotetraose (cellobiose density was observed)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
241
structure length
234
Chain Sequence
MKDFSGAELYTLEEYQYGKFEARMKMAAASGTVSSMFLYQNGSEIADGRPWVEVDIEVLGKSPGSFQSNIITGKAGAQKTSEKHHAVSPAADQAFHTYGLEWTPNYVRWTVDGQEVRKTEGGQVSNLTGTQGLRFNLWSSESAAWVGQFDESKLPLFQFINWVKVYKYTSDFTLDWTDNFDTFDGSRWGKGDYTFDGNRVDLTDKNIYSRDGMLILALTRKGQESFNGQVPRDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational design to improve thermostability and specific activity of the truncated Fibrobacter succinogenes 1,3-1,4-beta-D-glucanase
pubmed doi rcsb
source organism Fibrobacter succinogenes
molecule tags Hydrolase
molecule keywords Beta-glucanase
total genus 56
structure length 234
sequence length 241
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3axeA00
2A3XA 4L8QA 3WDXA 5T5OA 1APNA 4YG0A 2YZ4A 4XHXA 5HCBA 3ZYRA 1MZ6A 3OJBA 1AXZA 3FUOA 3O5SA 1W6OA 1Q8QA 4Y20A 3HR9A 4Y1UA 5CAZA 1GANA 4FQ4A 4R9CA 4XXPA 5DUUA 4Y20B 4ISRA 5HCAA 5GM0A 1H9WA 5T52A 1S1AA 4U36A 1MR5A 1Q8VA 2GN3A 4K20A 3O12A 1W6PA 5IK5A 1IS6A 1UZZA 1LEDA 1BYHA 1JYCA 4AVSA 2G4IA 1C4RA 1CR7A 3N7MA 3ZPYA 4YW1A 4JCKA 1W6MB 2A3WA 4RL7A 2WQZC 2NMOA 2ZACA 4R9AA 4WVWA 2ERFA 1DQ5A 1A8DA 3RG0A 3V0BA 2WT2A 4ASMB 5CBLA 1Y7BA 1ULDA 4ITCA 4K1YA 3AXEA 1MS0A 3B3QE 4PQ9A 3N36A 2ZKNA 3PVEA 3I8TA 5JDBA 1KRIA 1WLWA 2JE9A 4YW3A 1QNYA 2PHWA 3FBYA 1LULA 3AZWA 4OZXA 4YZ4A 5KXCA 4XHBA 1CJPA 1SBFA 2GNMA 4XBQA 2P34A 3OGGA 1LGNA 4AGVA 4P9YA 2P2KA 3WNXA 4DRVA 3NV1A 4GWMA 4YGDA 2D3SA 3M3CA 1F5FA 1FV2A 3LSEA 1DIWA 3AP5A 4XOGA 3AJZA 3AZVA 1ZM1A 2ZHLA 1UX6A 1LOBA 1VLNA 3USUB 2ARXA 5JLVA 2ES3A 2ZMNA 1ENSA 3AXDA 5BYNA 2A75A 4Q26A 1LHOA 2ZHMA 1DFQA 3ILRA 4XIOA 1D0HA 4YLZA 3GALA 3WDUA 1PZ8A 4M3CF 4YFWA 3T2TA 2NP0A 4FOYA 1ULGA 2OVUA 1NXD1 1LHVA 4BM8A 2UWCA 4IQPA 1AZDA 3APBA 2GNDA 3UJOA 5IUQA 3TB0A 5JMCA 1KQRA 4RA0A 1FV3A 3AZZA 2UWBA 4YGEA 4FOQA 1PZ9A 1YRZA 5JOXA 3WVJA 1CVNA 3U4XA 1KJLA 4UW6A 5GZEA 4XJWA 2SBAA 1QNWA 3VKOA 4JC1A 1V6MA 4R9DA 4W65A 1DQ4A 1DHKB 2JD4A 5JVVA 1UAIA 1UKGA 3N7KA 3R4SA 4Y22A 4DFSA 1QDCA 2WLQA 2FMDA 3ZXKA 2R49A 3VKFC 1W0PA 1AXKA 3V64A 1G9FA 2ZBJA 5EYXA 1WD4A 3M2MA 3WDVA 5T50A 4YW5A 3T1LA 3ENRA 1IS3A 2CY6A 1N1YA 1MVEA 4YGCA 3TAYA 4FPCA 4BQ1A 1KJRA 1VAMA 5GLUA 5H9SA 4WZFA 4XDQA 4AGRA 4XJ8A 1MS1A 2R16A 2EF6A 2PHFA 4GA9A 3WZ1A 3V0AB 3AP7A 1G9AA 3POYA 3VV1A 2D44A 2AYHA 1QOTA 3MW3A 4XBNA 2A7AA 1H30A 1GSLA 2TEPA 1EPWA 4YFZA 3AJYA 4XYXA 4LBNA 1HQLA 1MS3A 2HYKA 2D6OX 1U0AA 1IOAA 3IPVB 2JDZA 3ILFA 1GZCA 2P37A 2GALA 1LOFC 1XQNA 2GMPA 3CNAA 1G8WA 4YW4A 5DZEA 4AGGA 3PJQA 5JOWA 4JRAA 1QMJA 2UWAA 1DBNA 2WSUA 2ZMKA 2AH2A 2AREA 1GNHA 2ZGOA 1QOSA 2GDFA 2NM1A 4XJ9A 3WDWA 2RHPA 4YM0A 2YMZA 4GWNA 1G86A 2AGSA 4KBBA 4YM1A 2CWSA 4FOWA 1BKZA 5E8AA 4LBQB 4ISQA 1D2SA 1N3QA 3VKLA 1OQ1A 1V6NA 4FPHA 3RQ0A 5HCFA 1BZWA 1JBCA 2ZHNA 4M3CE 4FP3A 1I1EA 4UW5A 2DURA 1Q8PA 4U2AA 1CN1A 2VY0A 1KITA 3SH3A 3IKWA 1HLCA 2H0BA 4P9WA 1OKQA 4BMEA 3W59A 3ZSKA 2WNEA 1S0EA 3C2UA 4GKXA 1SLIA 3OYWA 1RIRA 3AZXA 1LGCA 2ZA9A 5FREA 5T54A 3AYAA 1DZQA 1C1LA 4FPYA 1MVQA 1ENRA 1O4YA 1I3HA 2A6VA 1AXYA 3DUIA 2ZGRA 2LALA 5KXEA 4PCRA 1SLAA 3BIWE 4Z8BA 2YXSA 3ASIA 4GKYA 5IK4A 2AR6A 4BMBA 3SITA 1UPSA 1CONA 4DRRA 3WCRA 3A0NA 1SLBA 2JJ6A 1JHNA 1S0DA 1RITA 4Y1ZA 2ZGLA 1GZWB 4XJZA 4AVVA 4HANA 3FLPA 5GALA 4ATFA 2E7QA 3WG2A 4K21A 3V0BB 4FPOB 3NV4A 4XJAA 5DG2A 4LBQA 2NMNA 2D6LX 1WD3A 1JYIA 1UZYA 3VKMA 2NN8A 2DVAA 1SLCA 2ZABA 1DYKA 1LOAA 1LHNA 3ZSLA 4R9BA 1WLCA 1X50A 1C1FA 4XE9A 1V6KA 5GZCA 1IKPA 1N3OA 3LSDA 1WCSA 5GZGA 5CA6A 2ZGKA 1ULCA 4XMIA 2VW1A 3LCPA 2CTVA 4HL0A 1Q56A 2ZMLA 3A0KA 4FPFA 2D3RA 4Y26A 5DZGA 2AUYA 2W39A 1BQPA 1LOFA 1R1ZA 1URXA 3M3EA 2WJSA 1V6OA 2D6KA 1NLSA 1W6NB 1YXWA 2E7TA 5JOYA 1F31A 1QKQA 1LGBA 2EALA 2A70A 4BOWA 3IN9A 3OBTA 3ZXFA 4Q27A 3WG3A 3WG1A 5T55A 3WHTA 1G7YA 2DUPA 2EXHA 1LESA 4XTPA 2VW0A 4PBPA 1LTEA 4AYUA 2Z42A 1GV9A 3NV2A 2DVBA 4YZ3A 3B9CA 3H0OA 2DU1A 3ZXLA 3OPZA 2D43A 1BXHA 1MS5A 4Y1YA 1SFYA 1Q8OA 2VUAA 1LHWA 2ZGQA 3ILNA 5DZFA 3OY8A 1JXNA 4Q1RA 4XJUA 1S0JA 2ENRA 3SNMA 2LTNA 2P3IA 1GICA 1V00A 3FLTA 5FRAA 4FPEA 3BODA 3WDYA 3AP4A 1CESA 1FYUA 1LJ7A 1DLLA 1DQ2A 1N1SA 3B01A 5SV8A 3OYWB 1WW7A 2ZGMA 3POWA 1WBFA 1LOEA 2W52A 3L2YA 1TEIA 1VAVA 2ZGNA 2E53A 2B7YA 2XG3A 5T5PA 3SLIA 1MACA 5F9TA 3HMYA 1SCRA 3KM5A 3BTAA 4XTMA 5DUWA 4Y1XA 2DVFA 2R1DA 4WV8A 1JUIA 4M3CB 4MYEA 2C5DA 2SLIA 1W6NA 4LBMA 1JOJA 1SLTA 3D4KA 2ZGSA 5F5QA 2VXRA 2CWMA 4CTEA 2GMEA 1YYNA 1G9CA 4Q8LA 1CPNA 1IS5A 3T1MA 2VW2A 3WUDA 1J1TA 2EXIA 3AK0A 3JUUA 3R05A 5IK7A 4YG3A 1CPMA 1LHUA 3IM0A 1HQWA 2P3KA 1AVBA 5KXBA 2PHXA 3FLRA 5GZFA 2JE7A 4SLIA 3ZSMA 4M3CA 1W6MA 2OW4A 1CIWA 2YV8A 3O0XA 2Q5TA 2WT0A 4PF5A 5L73A 2JKBA 4Y24A 2BQPA 2JECA 2YY1A 2VH9A 4P14A 4YZ2A 1MS4A 4P9XA 2D3PA 4YM3A 1WLDA 2DVDA 2WKKA 1LECA 3FFZA 3V0AA 1G9BA 2A6ZA 4M01A 4XXAA 2A6WA 4LBQD 1ENQA 1A78A 1OFSA 1QU0A 1ULFA 1UL9A 2DVGA 2VU9A 2ZHKA 3M1HA 3MW4A 4C1XA 4D69A 2P3JA 1S0GA 2EXKA 1SLLA 3GNEA 3UL2A 3MW2A 2D7FA 3ZSJA 1LODA 1WUVA 5E89A 1LEMA 2DWRA 4TZDA 3NWKA 4FOVA 1W6OB 4K1ZA 2DTYA 2GN7A 5JOZA 1DQ6A 2ZZJA 1WBLA 2NYYA 5CB7A 1GNZA 2DU0A 1N1VA 2PHUA 5EWSA 1KDKA 1GZWA 1JW6A 5EXOA 3N7JA 1BJQA 1Z78A 2GNTA 4Q8KA 3UJQA 5GLTA 4DQAA 3O0VA 1Z0HA 4FPGA 4YGBA 1VIWB 3RS6A 3SISA 3AYDA 5AVAA 4BPZA 3AP6A 3Q9OA 2AENA 4FPJA 2DTWA 4XIKA 5GLVA 3ZYPA 3POSA 1KDMA 1O4ZA 3USUA 1YI7A 1V6JA 1A3KA 4UW3A 4WVVA 2CL2A 3AYCA 3WV6A 4BLJA 2R0HA 5IT6A 3VUOA 2GNBA 4FP2A 3MPPG 1MS9A 3B69A 3N35A 3ZXEA 4AWDA 2DUOA 1MS8A 1MZ5A 2NZ9A 3RRDA 3W58A 1F9KA 4BLIA 1WW6A 2ZGUA 2D6PA 3M3OA 3IPVA 5CNAA 3FUQA 4FQZA 2PHRA 3AZYA 3HN1A 5EYYA 2E51A 3OY8B 4XILA 5LK5A 2ZGPA 1V6LA 1DQ1A 4FPKA 1QOOA 2A6YA 5KXDA 2CNAA 1FX5A 4CZSA 1LU2A 1SBEA 1YO8A 3ATGA 5T5JA 3WUCA 3ZXJA 2R1BA 1WW4A 4YG6A 2A3YA 3R4UA 1LENA 4I30A 1SBDA 2V5YA 4LBLA 1UMZA 1GLHA 3B00A 4PBOA 4NOTA 3RMXA 2EXJA 2W68A 1FAYA 3QCWA 4NO4A 4LBJA 3BOPA 3INAA 3RSJA 1ONAA 5GLZA 2A71A 2UU8A 2E6VA 3RMYA 2EIGA 2YROA 1W6QB 2R0FA 1ZA4A 5H9RA 1W6QA 3WLUA 1B09A 2ZAAA 1DQ0A 3KQRA 4Q1PA 4Y22B 2D6NA 3WG4A 4YZ5A 1FNYA 3IMNA 1H9PA 1HKDA 2DUQA 3WHUA 2DV9A 1DGLA 2WSVA 4Y1VA 4LBKA 2EAKA 2OUJA 1S0FA 1FATA 1LCLA 2I2SA 1SCSA 1LOGA 1AJKA 2ARBA 1AJOA 1AF9A 2ZGTA 1AX2A 1DYPA 4YW2A 3NV3A 2A5ZA 1GKBA 3AFKA 3I4IA 1RINA 4YM2A 4CRQA 3VKNA 3O0WA 4UW4A 3D5OA 1GZ9A 1N1TA 1PZ7A 1HDKA 1Q8SA 3AYEA 3JU9A 3QLQA 1GYKA 3PVOA 2GMMA 1QF3A 2A6XA 2C9AA 3N7LA 4XMAA 2OUHA 4FVVA 3V65A 5DG1A 3SH4A 1ULEA 1VALA 3N3HA 4TYSA 4F83A 1V6IA 3PMEA 4AVTA 4XZPA 5DUXA 4XBLA 1LOCA 1LU1A 2PHTA 1WW5A 5DXDA 1IKQA 3WCSA 4M00A 5GZDA 3UK9A 2WT1A 4GXLA 3WDTA 1C57A 1N3PA 2XB6C 1IS4A 1AX1A 1GBGA 1S0IA 3AP9A 5T5LA 1QGLA 5H9QA 4ZKTB 1UN1A 4LBOA 5GLWA 5DUVA 3WOGA 1QDOA 3MEPA 5H9PA 4H55A 1S0CA 1JN2P 4DPNA 4YZ1A 1FNZA 4FPLA 1CQ9A 4ATEA 2FHRA 4C1WA 2CYFA 1S0BA 4Q2FA 2V73A 2UURA 4ZXKA 2W08A 3M3QA 1N47A 3DGTA 5E88A 3ZVXA 3OBRA 3SH5A 2KM2A 1YIFA 2PELA 5GJ6A 4DS0A 1W0OA 1AX0A 5IK8A 3PVNA 1W6PB 3AX4A 4GALA 3A4UA 1SACA 2D6MA 3D6EA 1G9DA 2DYCA
chains in the Genus database with same CATH superfamily
1H8TC 3WDXA 5ABJA 5T5OA 3MIEA 4COZA 2YZ4A 2DCZA 1UIJA 3OJBA 3RI9A 5FPVA 4Y1UA 1GANA 4R9CA 5C4WC 1TME2 3IIIA 2VQUA 5C8CC 1J3RA 3RWNA 2CGNA 1XSQA 3ZFGC 1PGW2 3A21A 3O12A 4K20A 5CISA 1XXNA 1UZZA 1LEDA 1BYHA 1VBA1 4HK9A 3QH6A 4PI2A 2JDMA 3N7MA 3MUZ1 5FYIA 3ZPYA 5C5TA 4KG8A 4R9AA 1E5IA 2I45A 4NPRA 4B4RA 1A8DA 2PLV2 2WT2A 3N9QA 1DYOA 4ITCA 5A33B 5K8SA 4O7XA 4IV1C 1NCQC 4GJYA 4QT6A 4DXSA 1MS0A 2Q1FA 2WC2A 3GJAA 4PQ9A 1HB4A 4QKBA 2ZKNA 4QQHA 2VL4A 4O61A 3DXUA 4KMQA 5A6QA 3MICA 4PQQA 1WLWA 5E1RA 4YW3A 1QNYA 5A7PA 4AAXA 3AZWA 3BU7A 5KXCA 1OPMA 3ZLIA 2BVVA 2BUKA 5ACA3 2GNMA 5E16A 1AL0G 2P34A 1POQA 1LGNA 1MQTC 5ACA2 4R4XA 1MEC1 3ALQA 1XJAA 4GB33 4QB1A 1FV2A 1HRV3 3OF1A 1DIWA 1I9RA 4YW6A 4AHYA 1RUNA 5FQ0B 5FUIA 1QQP2 1BEV2 4X8NA 4XOGA 3O1SA 2UYBA 5FY8A 2IXIA 4ZPIA 4Z2AA 5L7OC 1VLNA 4LO7A 5FPZA 3CHXA 4L97A 2ZMNA 4A7ZA 4AHXA 2WR9A 3GXUA 3OUIA 4UT5A 4DO0A 3T0DA 1FPN2 3I2FA 3ZR6A 5A3TA 1MQTA 1FOD3 3ILRA 3BVCA 3GHNA 1UZVA 2X5IA 4LUKA 2NP0A 2X29A 4FOYA 5A3UA 2OPWA 1OH3A 2RR13 1ZBA3 2PMWB 2QUOA 4IQPA 4GULA 3UJOA 1HRI1 3THDA 1KS5A 2VOKA 1XYNA 3GGLA 4YGEA 3RZGA 1PZ9A 2WS91 3O1RA 3OD4A 4QWNA 4UXAA 3I2KA 1RMU3 3VHRA 5L36A 1QNWA 1NQJA 3K3NA 3AKTA 1X82A 1VAKA 2V72A 3CBNA 3MGUA 4L2NA 3ZX7A 4TLGA 1DHKB 1RXGA 1W2UA 2B4KA 1O4TA 1U5XA 1UAIA 3VBSB 1TVGA 5C3QA 2AEYA 4XAAA 2FMDA 3CMGA 2ETEA 3K4AA 2G9ZA 1PO23 3VKFC 2HYXA 2XR4A 3ZXKA 4CCNA 2B46X 3U4SA 4Q4V1 3W5MA 4YW5A 4GMP1 3ACFA 1S4CA 3IAQA 3J8F2 5FQ0A 5JXHA 1MVEA 3SXWA 4OHZA 1KJRA 2HWB2 1VE0A 1TNFA 5H9SA 4N43A 3PIJA 5G05L 4IE6A 1RUF1 1H8TA 2R30A 3QACA 5ABJC 5C9AA 4MZUA 1G9AA 2R062 3POYA 4IEQA 2D44A 1HV1A 3IBMA 4IXLA 3VBHC 2VMGA 3VV1A 2WNOA 3ECQA 4XQDA 2HWB1 1FMD2 2YC4A 4AW7A 3I3DA 1GSLA 2TEPA 1EPWA 1QXJA 4Q4W1 4QX5A 3ZMNA 4OUSA 2QCSB 2XKOA 4XF3A 1HQLA 1MS3A 2W47A 2HYKA 3WF3A 2JDZA 1NA1B 2WNUB 3ILFA 4RN5A 3K3OA 4CP9A 3MF6A 2GALA 1UY0A 3L9JT 3CNAA 5A32A 2RM22 5DZEA 3Q8FA 1DG6A 4CVUA 2PQSA 1FPN3 1ZZ6A 2FD8A 5JOWA 2RM23 4JRAA 1OKOA 2K9ZA 4BU2A 2ZMKA 4ZS2A 5L7OB 2D5HA 1QOSA 2NM1A 1WA4A 3RJRA 2VZVA 4PDWC 4CEWC 1XNAA 3K51A 1ASJ1 2BGOA 3CEWA 3WDWA 2HWC1 3RZMA 1W39A 4QU2A 4YM1A 3DPRB 3O14A 4FOWA 5C3SA 2LRPA 4P00B 4FPHA 4TWTA 5HCFA 1BZWA 1JBCA 3S5QA 2DURA 4U2AA 1CN1A 1PNFA 3WP6A 3C7OA 2QTWB 3I2IA 4QX8A 3ZSKA 2WNEA 1SLIA 1ND3C 3ZOIA 1LGCA 4LHNA 5JPNB 1DZQA 1VRH1 1AL21 1C1LA 3AFGA 3VBFB 4PIXA 2GC2A 1F2NA 4CXXA 1I3HA 3WP3A 3BU0A 2ZGRA 2LALA 4FT8A 3ETQA 1VBB1 4WM7A 3BIWE 1ZZCA 4Z8BA 3ZYBA 4GKYA 3VBHA 4LHLA 3GJBA 4Q29A 2VTFA 4CCEA 1W8HA 1CZVA 1ACCA 3ZYGA 1S0DA 4Y1ZA 2JDPA 3LA2A 4N43C 5CKQA 4AVVA 4KGGA 1JYWA 2C24A 3WG2A 5J3UA 2RDRA 2VMDA 3HNMA 4XJAA 4KI5M 3ZR5A 4LBQA 5FZKA 5CG8A 4JVAA 4AOCA 5E6HA 5D8AA 2VTXJ 2WRAA 3ZDSA 3CL1A 1JYIA 1TZOA 1UZYA 4QMAA 3VKMA 4D94A 3MZHA 5L19A 1DGRN 2IC1A 1LOAA 4N9IA 3HQRA 3ZSLA 1UY1A 5JSRA 4XE9A 5B4XA 1OA4A 3ZFFC 1N3OA 3AKQA 3ES1A 1DU3D 5GZGA 2HWD2 1O5UA 4XMIA 1PIV1 3LCPA 3A0KA 4IEWA 4Y26A 3T30A 4MADA 1QJU3 1UYYA 3ZPOA 4BQYA 1NUKA 2FZ1A 3PIGA 3M3EA 3BIEA 3GYDA 4BWOA 1NLSA 1OLRA 2E7TA 4CDUB 2PHLA 2EALA 2A70A 5F37A 2FDIA 2CSGA 1VBB2 2VG9A 3OBTA 4Q27A 5FK8A 1H1AA 3WG3A 5FPAA 4JGZA 5T55A 4DEQA 1TME1 3P5BA 5F7UA 3FZ3A 5FMOL 2DUPA 3VDDC 3ZXAC 3D3AA 1CAUA 1LESA 2R072 1BBT1 1NKGA 3HQXA 1CAWB 3PLQA 5C9AC 4Q4Y2 4XDOA 4BXSV 2EAAA 3S30A 2ADDA 3VL8A 4AF9A 4OQ9A 5FZDA 1Z7S1 5ISLA 4CE8A 4YWAA 2XQXA 4W6XA 3O1MA 3OY8A 3I2JA 2WWJA 2ENRA 2WINB 3I7DA 4AFMA 2H0VA 3P1IA 4F8AA 1VBD2 2WZEA 3FLTA 4LHKA 1WCQA 2WUHA 5B2GB 3I2OA 3N9OA 4RQPB 1DQ2A 3T0AA 5A1LA 5F3GA 2W52A 5F3IA 1A8MA 2OYZA 4CDQC 4CDXC 3MFAA 4WVZA 5FP8A 5T5PA 4NWWA 5J48A 5FV3A 4AI2A 3SCFA 4JDOA 5JR2A 2VZTA 1JUIA 4B4PA 1RYYA 4MYEA 2SLIA 2VOTA 2WO3A 2CWMA 5EIYB 4P9GA 4CTEA 5FOJB 2PAEA 1PVC2 1YYNA 2L9LA 4UBHA 1CPNA 1G9CA 1H4GA 4OMDA 3T1MA 4WVMA 4CUAA 1PVC3 1J1TA 4QQLA 2EXIA 2JG9C 2XWJB 3JUUA 4RQPA 5C3OA 5IK7A 1AVBA 2QQNA 2F4PA 5C3PA 3ZSMA 1SZBA 2WO2A 1AYN1 2OA2A 3HJRA 3WY6A 2E7AA 2JG8C 2UY8A 3N9PA 2V4AA 1GOFA 1G6NA 2WFF2 2YGMA 2JG8A 3KHBA 2YC0A 4P14A 1PMHX 5FY9A 1ST8A 4D7SA 4P9XA 2XBO1 4E4ZA 2D3PA 4DIQA 2KXLA 5C71A 2DVDA 2WKKA 1TQ5A 2W46A 1GNYA 1BVVA 1GP6A 1NLRA 1ZBE1 2WYSA 2Y0IA 4IV3B 5CYYA 5BNQA 5CFCA 2A6WA 4ASKA 3WF4A 1K5MB 1ULFA 3M1HA 3NNMA 4RFRB 4I3PA 3WQBA 4D69A 4N9HA 5FZ9A 2P3JA 1S0GA 4NHLA 1SLLA 4AEMA 3X29B 2HBTA 3EXUA 1LODA 3IZOA 5LA0A 4D8MA 2KR2A 1LEMA 5DAVA 4HXCA 4X8PA 1PX4A 1W6OB 4K1ZA 2DTYA 4IETA 4W6WA 5FPXA 2WQ4A 1AR93 5FZIA 2ZZJA 4CYDA 2BWAA 3AMQA 4BQ4A 1RUD3 3ZM8A 4MGTA 5EXOA 1JW6A 1BJQA 1R082 1H6YA 1Z0HA 2CU5A 4FPGA 4QX1A 4YGBA 3SISA 4B3NA 1YJLA 1YIPA 5AVAA 4UFIA 4IV1B 1CD3G 3CDZB 3Q9OA 1RUJ1 2DTWA 3POSA 3DPRC 1KDMA 4MGKE 1F5JA 5IJRA 2JENA 1O4ZA 1ASJ3 2GH8A 3C7GA 3USUA 4JX0A 4EV0A 5LA9A 4UYBA 1C3HA 3WV6A 5I8YA 3BB6A 5FP3A 1IQDC 4MUVA 1I5PA 4FP2A 3CU7A 3I49A 1QJY3 1RVF1 2WAAA 3N35A 2DUOA 1IPKA 2IFRA 4MLOA 1B35A 4Q5OA 2DCYA 2VBDA 4BLIA 1VBC2 4IEVA 2XKPA 4JZRA 4XF9A 3GBGA 3RDIA 4FQZA 5EYYA 3OEAA 2CV6A 1QIQA 5I0TA 3OY8B 1EPZA 3MPBA 4YVSA 4D0QA 2ILMA 1DQ1A 3U07A 2A6YA 3ABZA 2CNAA 1PNGA 3GZAA 2QDNA 4CZSA 1EV13 1LU2A 1EAH3 1RHI3 1T6GC 3ATGA 3U0ZA 3PU8A 3ZXJA 1OBNA 2GC1A 3S0MA 1NYWA 2A3YA 3FL7A 5A7SA 3B00A 2PA7A 1H4HA 3RMXA 1RC6A 2W68A 3OGVA 5FZ3A 4E2SA 3QCWA 1QJY1 3BALA 4LBJA 3BOPA 4IGPA 1U5IA 1M4WA 3JQXA 1PM7A 2XOMA 4CP2A 3PUIA 3OEBA 4AI9A 5IATA 3RWKX 2VOVA 3JBG2 1BMV2 1RJ8A 1J83A 3GZUC 3ZYJB 4E2GA 3KT1A 4ONUA 2Q8EA 4N53C 1KFXL 1XNKA 1W6QA 1D0GA 2A1XA 1AR83 2OT7A 1W8UA 2D6NA 4GJZA 5BNPB 1GOHA 1IG0A 5IVFA 1H9PA 5JXJA 4DY3A 2WS93 3WHUA 2DV9A 1DGLA 5KHHA 1AUYA 2Y33A 2VZRA 3PURA 4LO5B 2X8KA 4GB31 4LK6A 1HRV1 1Y43B 4YVSB 4EN6B 3KVBA 4R4ZA 3TN91 1AF9A 4CEWB 1W04A 4CEYC 1GKBA 3I4IA 5A3MA 3NKGA 4ZU4A 4Q4X2 4Y5SA 3HOBA 2ATFA 3HNBM 3NNGA 1HDKA 3AYEA 3I3EA 5BNOB 3PVOA 2GMMA 2A6XA 3T09A 4XFBA 4EJRA 5D8AB 1AR81 2OUHA 1UOBA 4EWDA 3NJZA 3ZYIB 5J1XA 5FO9B 4EWAA 1ULEA 3JZVA 3VBUB 3WNLA 3N3HA 4F83A 1HXS1 3I3BA 4HKWA 5CFDC 2ZPXA 2EA7A 1AYN3 2OQ6A 5DXDA 3TNPB 2ZS6B 2XVLA 4M00A 2KA3A 2QDRA 4UFJA 3UK9A 3DECA 4FXGB 3WDTA 5C70A 2XB6C 5IYYA 1S0IA 1AR82 5F32A 4UBGA 4D7TA 4RHV3 2IFWA 4LBOA 2R7EB 1DF0A 3Q8EA 2XJTA 4BK5A 1UOJA 1W0NA 3MEPA 5KR7A 4HKLA 1K12A 2VECA 4FPLA 1H6XA 2CYFA 3OB8A 2V73A 2UURA 4ZXKA 1ZZ9A 3LA3A 3DGTA 3ZVXA 1UOFA 1BBT2 2RDNA 3M70A 3OBRA 4JHZA 3SH5A 2KM2A 2W92A 1WMXA 1JZ2A 1OPOA 4OMCA 4FAHA 2JXAA 1W6PB 5F6KA 3KCXA 2GSYA 1MQTB 1CAVA 3OSDA 4GH4A 1UCXA 5L7OA 2VXJA 4B8EA 2A3XA 3RZJA 4XHXA 5A80A 3DPRA 3O5SA 1GQGA 1W6OA 4Y20A 1FOD1 1J84A 4FQ4A 3VBUC 3CLPA 4ASLA 3V56A 5I0DA 2VMFA 3MIHA 1Q8VA 2GN3A 5LBEA 3NW4A 4K8FA 3WSOA 1JUHA 1IS6A 5IK5A 1JYCA 2JEMA 2WO1A 3VZKA 5L9BA 1A6CA 1NCQA 2I07B 2YU1A 1UIKA 4RL7A 4ZZ8A 2ERFA 3UV9A 3NJVA 4N7IA 3RG0A 3IDEA 1X9TA 2BP6A 1ULDA 3NKTA 2E26A 4NRMA 3RPQA 2XHKA 5DAWA 4EZHA 5FJKA 1Y3TA 3LFIA 4DB5A 3PVEA 5FPLA 3VDDB 5KBFA 4Z92B 1DGWA 3PUQA 1KRIA 4TN7A 2JE9A 4GWJA 2PHWA 1HJGA 3AL5A 1UO9A 2C9KA 3EJKA 4XHBA 2R041 1PM4A 3HT1A 5JIUA 4NIAA 4XBQA 3OBAA 1XC6A 3OGGA 1EV11 4DRVA 4N53B 1EAH1 2Z5WA 4FFFA 5A3LA 2ET1A 2D3SA 1NZIA 3M3CA 4XCBA 5I8SA 5KHJA 3MIDA 4ZONA 1QH6A 1ZBA2 5BNPC 1R092 2ZHLA 2YGLA 1AL22 1UX6A 5FP9A 3EB7A 4EN8B 1LOBA 1T6BX 1YFUA 1HIXA 2OPKA 1UNBA 2ES3A 4INDA 2O1QA 3AXDA 4BA6A 5BYNA 1K3IA 4Q26A 1LHOA 3IWZA 4RGAA 2XPJA 1DFQA 1O3QA 4XIOA 1D0HA 2VMIA 5LB6A 3KV6A 2JG9A 5EJ1B 4YFWA 3DCQA 3KS7A 2OVUA 1NXD1 4QDQA 4CCOA 1LHVA 4BM8A 3LEKA 2ZEZA 1AZDA 4B4QA 5IUQA 5JMCA 1ZZ7A 1FV3A 3AZZA 1NT0A 2W1WA 4H3WA 4FOQA 3DYMA 4QKFA 2HWC2 3U10A 2YUEA 2FMYA 1YNAA 4UW6A 1X8EA 2HWC3 2YDEA 3MDPA 4OI2A 1S2BA 4HONA 4XJWA 2HWB3 3H3ZA 5IHRA 2TUNA 3H3LA 1RUH1 3U78A 4R9DA 4W65A 2QE3A 2JD4A 5JVVA 5LBBA 2IVIB 4D6RA 1ZRDA 3U14A 4DFSA 1QDCA 2WLQA 4HPKB 5LEJA 3IIAA 3ST7A 4GB32 2CAVA 4MGZE 3M2MA 3W5NA 4Q0SA 1OLQA 4OUEA 5A7QA 4DXZA 3ENRA 1OT5A 1RXFA 2CY6A 4QGLA 4BQ1A 3DL3A 1WGPA 1XYPA 5ANQA 3B93A 4Z2WA 1VAMA 5GLUA 3KB5A 1YQCA 1C8M1 4XJ8A 1MS1A 2EF6A 2PHFA 3H50A 5G04L 3UGFA 1NE4A 3WZ1A 4Y4YA 3V0AB 3TYJA 3MW3A 2HWE1 4LA2A 5F5AA 4XBNA 2A7AA 1OFNA 3IDAA 1O6UA 4BE3A 1UY4A 3JB8A 2W95A 3MO4A 3I59A 3RGBA 1RUG1 4M0NA 5DAQA 3SEPA 1PVC1 2D6OX 3N9NA 4JV4A 1YQ5A 1SDWA 2UYAA 2P37A 1GUIA 1TE1B 1ZX5A 3NRUA 1XQNA 5D1IA 3K4ZA 3ZN5A 3PJQA 4BB3A 2UWAA 3TEYA 2RJ2A 2WSUA 2AH2A 2AREA 1GNHA 2J1EA 1ND3B 2GDFA 2RS53 2ZGOA 3PUAA 3OGJA 1IHMA 3F95A 2RHPA 4YM0A 2YMZA 2LROA 4KBBA 4XEZA 2YYOA 3LWCA 1YFWA 1BKZA 1COV3 5E8AA 5B4NA 1D2SA 1OQ1A 5J98B 3ZIWA 1V9U3 2BPA2 4M3CE 1OA3A 1Q8PA 4HLTA 2VY0A 1DP0A 3SH3A 5AC93 1LRHA 4S2FA 3ZN6A 4BMEA 4HMZA 3TEXA 3W59A 3DN7A 3C2UA 1S0EA 4GKXA 1Q3EA 5IVJA 2Q4SA 2IXCA 1F15A 4QD2A 4LO8A 5FREA 3KHCA 1D4M2 4XFHA 1K42A 4QXBA 1BHGA 1OA2A 1RL3A 2A6VA 3R4DB 3LA7A 3LEIA 1C28A 2RJKA 5DPNA 2C1FA 3T3YA 1SLAA 3CKHA 4MGIE 1SDDB 3UETA 2ZX1A 1BBT3 5C6CA 1WCKA 2QQIA 4OYUA 1XBFA 4PI0A 1UPSA 3K77A 1CONA 3FBMA 3QD6A 4DRRA 4YPJA 1SLBA 5FOBB 3VB9A 1RITA 2Y6JA 1QJU1 5J37A 1RUG2 4KWLA 2BV4A 4LIUA 4Z82A 4HVQA 4ATFA 2I74A 1PK6A 1US3A 1YHFA 1BK0A 4FPOB 2XJRA 4HT1T 3NV4A 5DG2A 5FCCA 3TRSB 2NMNA 5CFDB 3ZN4A 3OGRA 4CUCA 4F7ZA 2R6QA 1UPIA 4RD7A 3VN4A 4RR3A 4KWUA 1SLCA 3LIGA 2Q8OA 1DYKA 4CDWB 4R52A 5FPUA 3H1WA 5FXZA 1LHNA 4GAZA 3UNPA 1WLCA 1C1FA 3H8OA 1V6KA 1WKYA 2DDUA 2FCVA 3AKPA 3CZJA 4AE2A 1WCDJ 1CIYA 2Y6LA 1YI9A 5CA6A 2ZGKA 1ULCA 4AQ6A 4I01A 4RHV2 4PT6A 5F5IA 5FBZA 4OI0A 5DMYA 2JKXA 4JQTA 4QPIC 1YQ2A 2R061 4QM8A 1KGYA 4RSUA 4W8JA 2W2IA 2AUYA 2W39A 3RZKA 4K40A 1BQPA 1LOFA 1R1ZA 5FDBA 3TNQA 1AYN2 4LITA 4LULA 1YXWA 1H2NA 2VAUA 3WT3A 1RHI2 4XVHA 1RUJ3 1AR62 2B42B 2VZOA 3MLJA 3WG1A 5JR7B 4Q4V2 3WHTA 4IEOA 4BQWA 1G7YA 2EXHA 3KD4A 4IE7A 3VBSA 4PBPA 1UOGA 2VOWA 5ABJB 1GV9A 3NV2A 2DVBA 3N9LA 1RVF3 3MIFA 2XUMA 1YFXA 4XUTA 3ZXLA 2D43A 1BXHA 1MS5A 2EVXA 4Y1YA 5L9VA 3QH7A 5AFBA 4KU8A 2C4XA 3KLSA 1V0AA 4BIFA 3ACHA 1JXNA 1S0JA 3VD5A 1QQP3 1JTZX 4EZ4A 1V00A 2YB7A 3BODA 3WDYA 3AP4A 1CESA 2VR4A 1ENXA 1LJ7A 2ZEXA 3BUCA 2Q0AA 3B01A 3AMPA 1D2QA 2ORXA 2BOJA 1EYBA 1WW7A 2ZGMA 2O0OA 3DKWA 1WBFA 1LOEA 2YPDA 2JX9A 3POWA 1STMA 1OLME 3VBFA 2QNKA 2ZGNA 2J42A 5J09A 1GZTA 3SLIA 2WN3A 1SCRA 2CHHA 3BTAA 2WZR3 2N7GA 4Y1XA 5DUWA 1V70A 4CCMA 4MX3A 3T0BA 1UX7A 4LBMA 4B1MA 5K9YA 1JOJA 4AXOA 3D4KA 3BTXA 4KWJA 2VXRA 3GHMA 2R071 2MHFA 2D40A 4Q8LA 5FLIA 3FJSA 5LA1A 4N8MA 2VW2A 4RS5A 2QQUA 3B94A 1O3SA 5KHKA 3OCPA 3R05A 1HRI3 3AK0A 3ON7A 1CPMA 2K0GA 1JS9A 1LHUA 3IM0A 1CAUB 1HQWA 4LLFA 4YG3A 1RHI1 4IV3C 2VZUA 3FLRA 1OC1A 5GZFA 2JE7A 4QHBA 2AACA 3IMMA 4J1WA 5KWRA 1NE6A 1POV0 1ZRRA 1RUF2 2WT0A 4QPWA 2JKBA 4Y24A 4AR2A 4AVBA 4PF1A 2X05A 4N43B 2VNRA 1QJX3 4QHZA 1ZZBA 4XPVA 4ES8A 1JODA 2JG8B 2BBAA 4YM3A 4LO4B 3BYWA 5A7WA 5HCHA 2BVBA 2W9XA 1AYM1 2R063 1C5IA 4PHZA 4XXAA 2QQOA 2BNNA 2VZQA 4LJHA 1ENQA 1D7PM 3B9IA 2ZHKA 5CADA 3MW4A 4NE9A 1H1MA 2O8OA 1O3RA 2VOXA 2EXKA 5FYSA 4FTBA 4JAAA 4Y3OA 1DGWX 4NN0A 1KS4A 2VQAA 2HKXA 2DWRA 4Q0PA 4TZDA 4FOVA 2CDOA 5C9AB 2BU9A 2H6BA 1I5ZA 1NCRC 2GN7A 2QBXA 4LUMA 2G1MA 4GQ7A 3FMGA 3KV9A 4HKOA 3VBFC 3VZNA 2B5HA 1W2AX 1GNZA 1TMF1 1YCIA 1N1VA 2PHUA 5EWSA 4CCLA 3ACIA 4X6QB 4ES9A 2XLGA 4QQPA 3N7JA 2FCUA 5FFOC 4IW3A 5CFDA 3UJQA 4UFHA 3O0VA 2PFWA 3HVDA 3WXPA 3AYDA 2W91A 2X09A 5C8CA 5FZCA 4BJ0A 4MXWB 3AP6A 3JD73 3WX5A 1W06A 1ZA7A 4FPJA 2C0ZA 3GCWA 4G4FA 3E5UA 4WM7B 4YVWB 5GLVA 3SHRA 4WBBA 2W87A 1YI7A 1V6JA 4JTOA 5JWPA 4URTA 3ZFEC 3AYCA 4BLJA 4BQXA 1HXS3 3IT8A 4J25A 5FYMA 2R0HA 1LB2A 1GP5A 2Y64A 3VBSC 1HXS2 1O3TA 2D97A 1DLCA 5EHDA 1MS9A 2Y8KA 3GBWA 1OURA 3QBQA 4Q4W3 1MS8A 2NZ9A 1CAWA 1L3JA 2F6BA 1W2NA 3RRDA 5BNOA 1VBD1 3TEZA 1CX1A 3M8LA 3ZSEA 2ZGUA 1OLMA 3LFMA 3E97A 1OF3A 5CNAA 3RZHA 4MXWA 1V6LA 5KXDA 4FPKA 5AC92 3K4DA 1ZVFA 4N90A 2DCKA 4GZ9A 1UMIA 3PTYA 3T2OA 4XETA 3TN92 1ND3A 4LT5A 3GF6A 5A3WA 2VZ1A 1WMFA 3RJ2X 1WW4A 1WZXA 1L7LA 5BNNB 1SBDA 3OUHA 4DINB 2V5YA 2Q8DA 1UMZA 1GLHA 2Y60A 4WM8B 4AEKA 3J8F3 4EQVA 2EXJA 2CDPA 1REDA 4JDNA 2RS32 1X9PA 2XVGA 4BIOA 3RSJA 5F2SA 4G9SB 3ZYHA 1M06G 3EO6A 4RR3C 2A71A 2VUDA 2UU8A 3U75A 4BDVB 1DZTA 3IAPA 1SFNA 1W8FA 1YQ6A 1X36A 3H42B 4V2VA 4YSFA 5A7OA 2R0FA 3DYOA 3HN3A 1UYZA 1ZA4A 2WNVA 2IXLA 2HWD1 3K2OA 3ROUA 4CEYB 1TNRA 4H2AA 2ZAAA 3EQEA 4BK4A 4Q1PA 2JWPA 4S2DA 1VB2A 2RG4A 4YZ5A 3IMNA 2FDJA 4EN9B 2VVDA 1HB1A 3HIFA 4QGMA 2EAKA 4CCJA 3WNMA 1XE8A 2P6CA 4QDSA 3LQCA 4LE3A 2I2SA 1SCSA 3S5AA 2E32A 1EP0A 3BPZA 5IVBA 1OD3A 1AJOA 4NROA 1J59A 2VM9A 2ZGTA 3DF0A 3H7YA 1W28A 3NV3A 1W8OA 2A5ZA 2QZ2A 2WFPA 2WO7A 4YM2A 5C3RA 4NIDA 3ZKUA 1QJY2 1VRBA 4LKSA 1SQ4A 1CZSA 3MFCA 4C0BA 1PZ7A 3ZFEB 3JU9A 2P1BA 3N7LA 4AI0A 4PIZA 5FR3A 4QM9A 4HFSA 4FVVA 1UXZA 2MNGA 3F2ZA 5FAXA 1NA1C 2WNUC 4K6BA 4FFGA 1V6IA 4NIIA 4YVWA 5DUXA 2Y26A 3KSCA 1LOCA 2PHTA 4LMFA 4H7MA 4NWVA 4N7UA 1OOPA 5GZDA 4MO3M 4GXLA 1JYTA 1N3PA 4IEZA 4CDQB 5T5LA 5H9QA 3CQOA 1PMIA 1UN1A 2YFUA 4LEJA 1WWYA 4ARXA 4ZKTB 2QQPA 4LA3A 5FO8B 2J1UA 4DXRA 3MYXA 4H55A 1QQP1 1JN2P 1PO12 5T3NA 3RYRA 1IGOA 2D5FA 3POBA 3FWEA 4FBFA 4YZ1A 2CGPA 4QDRA 3PL0A 1Q43A 1NX9A 1TMF2 2XL7A 5E88A 2PN5A 2YC2A 2WBKA 4LTAA 2PELA 5CFCC 4DS0A 1K5MC 4QX2A 1AX0A 1PHMA 2JG9B 2Q1MA 3KV4A 3O1TA 3PVBB 3A4UA 5EQUA 3D6EA 3MUY1 2IZWA 1G9DA 3H8RA 5FZHA 1XYOA 3WF1A 5C4WB 2DYCA 5FYTA 3MLKA 3ACLA 4L8QA 4C0HA 4XC9A 4IEUA 1IPJA 1FMD3 3WQ1A 5C8CB 3LOBA 3ZYRA 1MZ6A 2JB8A 1ZBE3 3MBWA 3ME2A 1Q8QA 3HR9A 3NAPA 2WWSA 1AYM2 1J58A 3E6DA 3P3NA 3FHAA 4XQWA 4P08A 5T52A 3PTRB 1S1AA 1VBA2 1E5RA 3CF6E 5FYZA 1MR5A 4LE4A 5FKBA 2ADEA 3THPA 3WEZA 1O91A 4QPGC 4NIHA 1W3XA 2GP5A 4MOAA 3SEEA 1W6PA 4E9KA 2PQQA 4AVSA 1C4RA 1ULPA 3FN9A 4ZU7A 1ZYBA 4IERA 3MV11 2FDGA 2VNVA 3I97A 4MXVA 1NCRA 2NMOA 2B45X 2WQZC 1PGL1 1DQ5A 3VBOB 4ASMB 4CDWC 5CBLA 1Y7BA 1SPPB 1ODNA 5ERLA 1BVP1 5LZ6A 2WQ8A 1PMJX 3AXEA 5FBJA 2QFEA 3B3QE 2YU2A 4IEPA 1UU5A 2WABA 3J9SA 2RS31 3I8TA 1VMHA 2BNOA 4I0AA 4RS5B 4F3JA 2G9GA 3AMNA 3UESA 1LULA 4YZ4A 4CDXB 1XB9A 3HAGA 2GC0A 5FY0A 2YBPA 1RUH2 1ZRIA 4LORA 4P9YA 3R6SA 3ORJA 1H8VA 5A1AA 1MZEA 3NV1A 2RS11 1YFYA 1R1A3 2JDAA 3NAPC 5C5UA 1VRH3 2B8MA 3NMBA 2WS92 1W9TA 2J1VA 2IXJA 2Y6FA 3AP5A 2J1RA 3E6BA 1TMF3 3AJZA 3AZVA 3KZ4C 1ZM1A 3CJXA 5JLVA 1SFPA 3BTZA 1ENSA 2WLPA 4FO9A 4Y5TA 2V4VA 4QXCA 3M7AA 2DCJA 2ZHMA 1NOVA 4XUNA 1KD7A 4NIGA 3GALA 3HQUA 3WDUA 1PZ8A 4M3CF 2RE9A 4OI1A 2ZX4A 4B29A 3U1XA 1ULGA 2WZR2 2OKXA 3TBDA 2VMCA 5BY5A 3APBA 2GNDA 1E5SA 2WZPP 3TB0A 4COUA 3LDKA 5F6LB 2QVSB 4AEJA 5LBCA 4AI1A 3U11A 2WZ8A 3LPFA 3HD8B 3O1VA 3OG2A 4A44A 1JZ3A 5JOXA 4OLLA 5IAXA 1OQDA 2JIGA 2GAUA 4DXTA 1EAH2 4UF0B 2SBAA 4HVRA 3VKOA 1VBE1 5LRSA 4DZGA 2VTXA 4KU7A 4Q4Y1 4CDXA 1V6MA 1O8PA 4IGQA 4XF1A 2RR12 3N7KA 1UKGA 4MHUA 3R4SA 4Y22A 3URFA 4A6OA 1NAEA 2X53S 5C7GA 5J36A 4AFDA 1VBC3 4QPGB 2OIIA 2ZBJA 1PIV3 3WDVA 3HBKA 3POGA 1QJEA 1SPPA 5FZBA 4HN1A 4P9LA 3NNLA 5LRRA 3T1LA 3VBUA 2VBPA 3AVSA 5LY2A 1R093 4YGCA 4WM8C 3RNSA 2VC9A 2PLV1 4FPCA 4HVOA 3VD7A 1ZREA 5FLJA 4WZFA 3DKQA 4R8HA 1H8TB 5DQ0A 4GA9A 4GH4C 3AP7A 1POV3 4CUBA 1NZCA 3JBG1 1QXPA 1XPWA 3AJYA 3H9AA 4LBNA 4OFGA 5KHIA 3GDBA 1QJU2 1U0AA 3IPVB 4E4HA 5FMDA 5CEHA 1LOFC 4JGYB 1GP4A 2XQRA 4IDZA 5K0UC 1RUOA 4UAPA 4AGGA 1AR92 2VBBA 5F39A 3EYPA 1QMJA 2WNVC 3W20A 2NQYA 2RDQA 3I2DA 4JKKA 3WP4A 3G7DA 3WP5A 3FFQA 5IVEA 1G86A 2AGSA 4K7JA 1JOPA 2CWSA 4MGSA 4XABA 1RUI2 4CP0A 3K46A 1ZZ8A 3SQOA 3VKLA 3NAPB 4AK3A 1QEXA 2AEZA 4E4DX 4UW5A 2WZR1 4FFHA 1WA6X 4LO6B 4QHOA 3EBRA 4P9WA 1OKQA 3KQ4B 3VZOA 1DZRA 3MF9A 3SCHA 3ZN6B 3OYWA 4OHXA 1RIRA 3AZXA 2HWF2 2VJXA 2ZA9A 5T54A 1S2KA 3AYAA 1RUI3 1ALYA 1XOYA 4FPYA 2HEVF 3M4FA 2P3YA 1O4YA 4ORFA 1AXYA 2ZAHA 3DUIA 4CP1A 4BH9A 1IG3A 1F4AA 4XURA 2RS12 5DN2A 3KF5A 3PDQA 4UFKA 4G3YC 3ASIA 4BYYA 4CU9A 2CGOA 1QH7A 5FMOS 4K8RB 2AR6A 2ID4A 4C90A 4PLMA 3H1YA 4XDPA 1H2KA 2VZ3A 4YW7A 2Y6KA 4V1PA 3A0NA 4L9BA 4LNVA 5ANNA 2DF7A 4KH9A 3UYJA 4I2OA 1US2A 1GZWB 4ZY9A 3POIA 1UD1A 4KWKA 4QX3A 2E7QA 1E5HA 4N53A 3VBOA 3T2QA 4CXYA 4D7YA 4A7KA 3ZXGA 2NN8A 4OI4A 1JZ6A 2JDNA 1O59A 2RS13 4O65A 2C26A 5LW9A 1IZ3A 4R9BA 4CUGA 1UZ0A 4EE2A 3OGSA 5IVCA 2V09A 2OS2A 2XLAA 3BPSA 4Q4W2 4MH0E 5IWFA 1RJ7A 2Y34A 1OUSA 2VW1A 4HL0A 1UY3A 2BDRA 2ZMLA 2P4EA 2XGXA 5DZGA 3JXSA 3W21A 2BRTA 2R043 4TXWA 2BEOA 4A4AA 3LF7A 4Q0QA 5C33A 2WN2A 2D6KA 4LKDA 3VDAA 5JXGA 1W6NB 1RUF3 5JOYA 4JHTA 1QKQA 1LGBA 3PMSA 5HXMA 1MEC3 2IUWA 1OD5A 4BOWA 1OF4A 2WWUA 3IN9A 5FZLA 5J7MA 5EJZB 3D8CA 2XL9A 4LKEA 4OHWA 1W9WA 3E6CC 1AHSA 4FTSA 4O9GA 1FOD2 4CU8A 2WNVB 3ZO0B 4A42A 1UWWA 2VW0A 4XTPA 3VHNA 4AYUA 2Z42A 4OCTA 1PK6B 3Q8AA 2DU1A 3J7MA 3OPZA 2JE8A 2FZ2A 1SFYA 2RMU3 4CU7A 1Q8OA 2VUAA 1BEV3 1LHWA 2ZGQA 4FI9A 2XJPA 5BV6A 5DZFA 1REFA 4Q1RA 4UF0A 1VBC1 2P3IA 2VZSA 1GICA 1RUC3 2ARCA 3JD71 5FRAA 4BHPA 1VBA3 1FYUA 2WIIB 3LIHA 1R091 4YARA 2BNMA 5SV5A 3FHIB 3L2YA 3RYKA 4UWDA 4L99A 3KGZA 4CA9A 1TEIA 1R1A2 5I0UA 3KV5A 4IV1A 2E53A 2B7YA 2XG3A 5JSPA 1GQPA 1W8NA 3CJIA 2PTMA 3FX3A 3S57A 1RGSA 3HMYA 1RTVA 4QX7A 2DVFA 4NJ4A 3MIGA 2C5DA 1VBD3 3ACGA 5F5QA 4ZU5A 3FE5A 1YC61 2GMEA 1UU4A 4HN0A 4XF4A 1BEV1 4A3XA 2WA4A 1IS5A 1CAXB 4AL9A 1R081 3M3IA 1GU3A 5KXBA 4IE0A 4H14A 4EN0A 4A41A 1J3QA 1C8NA 1WCUA 1E57A 4M3CA 4JGYC 4AVCA 1W6MA 1TME3 1Q5OA 4NMIA 4RYDA 1XNTA 2YV8A 3O0XA 2Q5TA 2D98A 4P5HA 4PF5A 4CDUC 4BQ3A 1QHDA 2BQPA 2FBEA 3KGLA 3RYPA 2VH9A 4YZ2A 1MS4A 2HJIA 2BGCA 5A1FA 3A22A 1REEA 1LECA 3I3MA 3VZLA 5FTTC 3V0AA 2A6ZA 4IE4A 4JGZB 5CVRA 4E4SA 5D2AA 5FXWA 1XNCA 2V5DA 1GWMA 4LBQD 4Y33A 1OFSA 1QU0A 2VU9A 1C8M2 2XBO2 4C1XA 1P8JA 1GR3A 3BN6A 1I6XA 3NNJA 1YQ8A 2BYVE 3JCIA 3MW2A 3UL2A 5FJHA 2BFUS 3ZYFA 2RS51 2D7FA 3GM8A 4QGNA 3ZSJA 2BWCA 3GZEA 5I91A 2VVFA 5E89A 1W99A 4RR3B 2Q8CA 4CDWA 2VPVA 3OD0A 4CP9B 2KD7A 5JOZA 1COV1 4UI9L 2C6SA 1DQ6A 2VCMA 2E9QA 1WBLA 4NUBA 2NYYA 5CB7A 1V9U1 1OOPC 4CCKA 5IFTA 4RGGA 2ZXQA 1PX3A 4BXFA 1RUH3 1QWRA 1Z78A 2GNTA 4FXKB 1VBE2 4BQ2A 4JDMA 4ARYA 1VIWB 3Q8CA 5A7NA 5A70A 2W94A 1W8TA 1S55A 3KMHA 4V2WA 3ZYPA 4XUQA 5FZOA 4QPIB 4DNYA 2E33A 4CU6A 3RI8A 2DBIA 4UW3A 4DUXA 1U12A 4WVVA 2CL2A 4PLNA 4NHYA 5DDJ2 4KL1A 5CU1A 5FP7A 5IT6A 1EUUA 1DDLA 2QZ3A 3NVCA 4XUPA 3WQ0A 2VO5A 3B69A 3ZFGB 1CGPA 3JQWA 4AWDA 3WW1A 4JGZC 1VB4A 1F9KA 2YHJA 2RMU2 2NLRA 2RS33 2HWE3 1WW6A 1NY71 2W1QA 2D6PA 4L11A 3M3OA 3UT0A 3IPVA 3HN1A 2WA3A 2OQ7A 4GD4A 2K46A 4XILA 5LK5A 5FZ7A 5M0TA 3ES4A 1QOOA 3VLBB 3FHQA 4QPIA 1SBEA 1YO8A 3D82A 4Z07A 5T5JA 1HN0A 3VD3A 5FPBA 3WUCA 1IPSA 2RM21 3IB3A 4AI8A 1LENA 4I30A 4E8DA 4LBLA 1NCQB 3VL9A 3WW2A 1PO22 2JB4A 3HBZA 4ET7A 4P02B 1FAYA 2J7MA 4LXLA 5FY7A 5JPMB 3VBRC 1ONAA 2XWBB 4KGQA 5HCAA 5GLZA 1X8MA 5FO7B 3RMYA 2EIGA 5D8AC 1FMD1 2QQWA 4PDWA 4QB6A 5A3PA 3P6BA 2YROA 4Y4RA 1W6QB 5FMCA 4WZCA 1PK6C 1JZ4A 3W9AA 2WYFA 4Q4V3 5EPAA 1D4M3 3UKTA 4Q0VA 2DUQA 1HKDA 1ND2C 5IFPA 2W1SA 2OUJA 2XONA 3OBZA 4OVEA 1S0FA 4OHYA 1ZRFA 2AC1A 1LCLA 3H7JA 1LOGA 2DBNA 4C8DA 5HBAA 1AX2A 1DYPA 3AL6A 5A7WB 4YW2A 1UU6A 1ND2A 4AEDB 5EFUA 3AFKA 2IVJA 3H8UA 4CRQA 2JDHA 2WFF1 1VPHA 3MHZA 4OQ8A 2FDHA 2ZX2A 2GH2A 3CJIB 1Q8SA 1N1TA 2GZWA 4M3CB 3E5XA 4OUMA 4XMAA 3KCCA 5LATA 4WM8A 1JZ7A 2C9AA 3BI3A 4BISA 4MG2A 3SH4A 1WMDA 2YFZA 3KF3A 2W1UA 4XZUG 4CPBD 1RVF2 2QQJA 4XAEA 4O9EA 4AVTA 1R1A1 3KVAA 4XZPA 2IXKA 2ZTNA 4QKDA 3VBRA 2ZX0A 1LU1A 1GOGA 5K7PA 3BKZA 2EIBA 2XLFA 4A2UA 5LEKA 1BK1A 4A7YA 1AR63 1RUJ2 1GBGA 5L9RA 1HJFA 1QGLA 3ZXDA 5GLWA 5DUVA 3WOGA 3LZZA 5A3OA 5JZGC 1QDOA 2VVEA 5H9PA 1RUC1 3ZFFB 1KFUL 5FYCA 4DPNA 1FNZA 4XFCA 4YRDA 3SCGA 2FHRA 3N4MA 5I0SA 1JH5A 2E31A 2QQLA 4JTNA 3WR0A 1LKNA 2W08A 3M3QA 2ORZA 1N47A 1EUTA 1NLQA 3KT7A 2BZDA 3GBFA 3I2HA 3G6JB 4PJYA 3VBRB 1YIFA 3WW4A 3WNNA 2ZEYA 5GJ6A 5CKNA 3VGIA 1ASJ2 3PVNA 3BGAA 4HSJA 3AX4A 4GALA 4CSWA 1SACA 1X33A 3NJYA 2D6MA 4QB2A 3O1PA 4XACA 1QJX1 4RGKA 5BNPA 1APNA 4S2HA 4YG0A 5HCBA 1V9U2 2DFBA 5KC6A 4DUVA 1AXZA 3FUOA 3MLLA 5A33A 3RFRA 5CAZA 1ZBE2 3SKJE 4XXPA 3PUHA 5DUUA 1GFF2 4ISRA 4Y20B 5GM0A 1HQNA 1H9WA 1GQHA 1SMVA 1BCXA 2VUCA 4PDWB 4FCAA 4U36A 5FYUA 4COWA 2WDBA 4MV2A 5EP9A 2RS52 4EYUA 4RS5C 3ELNA 4YYOA 3Q8BA 2HH9A 1HN1A 1F4HA 5FY4A 4P9IA 2G4IA 4A45A 1CR7A 5DABA 4S2GA 4AQ2A 4AEDC 1VMJA 5JXIA 4YW1A 4JCKA 3WNKA 1W6MB 2A3WA 2ZACA 4NHXA 2J1SA 4WVWA 1BMV1 3H1MA 1PIV2 1RUD1 3V0BA 2JD9A 2VQTA 3CJIC 4K1YA 2JDUA 3C3VA 3J4UH 3N36A 1QJX2 5LBFA 1UQXA 2YPJA 3GZTB 3VBHB 4P5YA 5JDBA 1A34A 4NRPA 4CXWA 3FBYA 5FZ4A 4OZXA 5BNNC 1OMIA 1NY72 1CJPA 1TG7A 2RDSA 1SBFA 2GP3A 3O7OA 1KEXA 1ZNPA 2MEV1 4AGVA 3RZZA 2P2KA 4LHSA 3WNXA 4GWMA 4YGDA 5C4WA 1B35B 2VGDA 2VQ0A 3USSA 5IW0A 1JOBA 4AZZA 5FP4A 4MGYE 2QQKA 1F5FA 4LQRA 3LSEA 3PNAA 5AVPA 5FWEA 4K9SA 5JSOA 1RUC2 2VNOA 2EICA 5LY1A 3ETPA 4JKMA 1Y9GA 3OOXA 2JDKA 1POV1 2LUWA 5A6ZA 3USUB 1QJFA 2ARXA 5I93A 2ZJCA 4A6SA 1UZWA 2A75A 5FYYA 3WD5A 5FUNA 4AHWA 3OPTA 3VD9A 4YLZA 3LE0A 4KNCA 4ZS3A 3T2TA 5DDJ3 4BQ5A 4I0BA 5BNNA 4IGOA 5FZ8A 4UFLA 1XE0A 4E8CA 2UWCA 2R32A 1JU3A 4FFIA 1VRH2 2MEV3 1D4M1 1KQRA 4QPYA 4RA0A 2UWBA 3S6PA 2XUEA 4IESA 4FTEA 1Y9QA 1YRZA 3WVJA 1CVNA 1L7QA 5IVVA 1KJLA 2TBVA 5GZEA 5A32B 5HV4A 3TWIA 3U4XA 5F5CA 5EZWA 4XUOA 1F35A 1UYPA 5C8WA 1ND2B 3THCA 4AEDA 1JZ8A 1VR3A 4JC1A 1O8SA 1OI6A 4META 4CDQA 1AR91 4NHMA 1DQ4A 5I0RA 3ZMOA 1L7RA 2LM3A 4L0PA 2XXZA 2R49A 1W0PA 1AXKA 2QJVA 1G9FA 3V64A 5EYXA 1WD4A 3O1OA 2ARAA 3HEIA 5T50A 4LKFA 2G9FA 3VZJA 3TEWA 3LPGA 4AAPA 1IS3A 2VULA 4IUGA 2A73B 4XFGA 1N1YA 4XFIA 3TAYA 2VNGA 3OTFA 3AKSA 3VHOA 3WINE 4B1LA 1S2EA 3QOPA 2B39A 3POJA 4XDQA 4AGRA 2R16A 3P3PA 1KXGA 2F17A 3NSTA 4CEYA 4QXHA 1Y4WA 1JHJA 2AYHA 1QOTA 2PAKA 4A3ZA 3AMHA 4Y5Z0 5FZMA 4P9JA 1D4VB 1K5MA 4AQTA 4J1XA 1H30A 5FZAA 4YFZA 3SKVA 4XYXA 2GU9A 3TOJA 5LA2A 4BCUA 4IE5A 2HWE2 3D0SA 3H3UA 4LLOA 1IOAA 5FIXA 3T08A 4B7KA 1PO21 1GZCA 3PHMA 3ZIXA 5JCTA 3DEMA 2GMPA 3MIBA 2RR11 1G8WA 4YW4A 3PU3A 4W50A 4HZFA 1SEFA 1QXRA 2G19A 4J6GA 4BZ4A 3MI8A 4LOTA 1K5JA 1DBNA 2P17A 1F8VA 4XJ9A 3J8F1 3BCWA 4L92A 3WF0A 3ZFFA 3FC0A 4GWNA 1VP6A 2HWF3 2MPFA 3WF2A 1AR72 4EN7B 5BUVA 1HW5A 5LWBA 2X5IB 3LOIA 1XSRA 1W3VA 4LBQB 4QU1A 5F2WA 4ISQA 1N3QA 1PO13 1YEWA 4ZZ5A 2HEWF 3NNFA 1V6NA 1NG0A 3HWJA 4XQ4A 3JD72 1UYXA 2XJSA 2ZHNA 2ZX3A 4FP3A 4NAOA 3RQ0A 1JZ5A 1I1EA 2BOIA 3N9MA 1KITA 1UW8A 3IDBB 3IKWA 1HLCA 2BTVC 2H0BA 2Q30A 4AFAA 2J1AA 3VBOC 1LAJA 1OOPB 2FDKA 3T4HB 4Z1VA 4PIYA 5DAPA 3IDCB 1FT9A 1R083 2PAMA 3POEA 1JYVA 4M0HA 1HRI2 4C91A 5KC5A 2BJSA 3C8XA 4QXKA 1DGRA 1MVQA 3KT4A 3OPWA 1ENRA 4NPLA 1UF2C 1W2OA 5FKCA 3MV01 4TSVA 1OUXA 4WM7C 5KXEA 1AR61 3VDBA 2CAUA 4PCRA 1B35C 3LGRA 2YXSA 4I3GA 2IXHA 5DAXA 5FYHA 4TLFA 2E63A 5FY5A 5IK4A 5LK7B 4W6YA 1FI2A 4Q0UA 3SITA 4BMBA 2OZ6A 5IAVA 1SG3A 4IEXA 4JQRA 3TN93 4E2QA 3WCRA 1J1LA 2XJUA 1NQDA 2JJ6A 2WL1A 1JHNA 1U5YA 3ZFEA 3I54A 1XNBA 1BLZA 1COV2 2DCTA 2ZGLA 1K45A 1ZBA1 4XJZA 4HANA 2EIDA 3FLPA 3LD8A 4GMP3 3LDBA 5GALA 2ZEWA 4K21A 3V0BB 2VMHA 3LEGA 2D6LX 2VUJA 1WD3A 5ACA1 4XW3A 4GMP0 2DVAA 2OZJA 4JRLA 2ZABA 2R042 4COVA 1X50A 5FZGA 3UGGA 3S7IA 4RHV1 1IKPA 2OXBA 2Y0OA 5GZCA 2RVAA 2ZKLA 3LSDA 1WCSA 1YWKA 2YBSA 3UKVA 1OQEA 4OZOA 3EMRA 2CTVA 3ZDVA 4HPKA 1Q56A 2R073 3AM2A 2D3RA 4FPFA 1W8WA 4M4RA 2HEYF 4B7EA 4LOSA 4I02A 1URXA 4CPBA 5JUVA 2WJSA 1V6OA 4NR1A 2HLEA 4K3UA 1F31A 1PGW1 2B9UA 4NRQA 2X5IC 5FZFA 3R0RA 2LS6A 4W4ZA 1ULOA 1W9FA 3ZXFA 2XHNA 3VD4A 2NPIA 4FSJA 4DEVA 2JICA 4LR4A 3LB9A 4KQ7A 5J96B 2VCBA 3EHKA 3LKJA 1LTEA 4JKLA 3B02A 2P5BA 3KWVA 1IQAA 3E1F1 3B9CA 3KCYA 3H0OA 1RUE2 4YZ3A 5F3CA 1QY4A 3RZLA 2GC3A 3ILNA 1H1IA 1YUDA 3AKRA 2HBUA 4HOOA 4XJUA 1FPN1 1W9SA 1XU2A 5FY1A 3SNMA 2LTNA 3B5LB 3NL1A 3AVRA 4OULA 4FPEA 1RMU2 1AL23 5JZGB 1XU1A 2WAOA 1DLLA 2D93A 4NAMA 1N1SA 5SV8A 3OYWB 4AVAA 2XJQA 5FZ1A 1OXCA 2O14A 5EV7A 3GCXA 1VAVA 3B7MA 1WLTA 1OVSA 2PXJA 3K48A 4XF0A 5FYBA 3SMHA 3VHPA 5F9TA 1MACA 3JB4C 2J1TA 3KM5A 4GIQA 2MEV2 4XTMA 2R1DA 4WV8A 3J7HA 1UMHA 3J7LA 5GKAC 1JYNA 2WFF3 4KBZA 1W6NA 1SLTA 5LASA 1OSGA 2ZGSA 5KHGA 4Q4X1 3O1UA 2Z4FA 1OHFA 3I3QA 1R64A 3ZFGA 5D21A 2QKDA 3WUDA 2Z2SB 5CFCB 1HB2A 1O5LA 3NQHA 4DMIA 1RUE3 3WNPA 2HWD3 2P3KA 2BERA 4QQOA 2YBKA 1CJDA 3WW3A 2PHXA 4MVTA 4SLIA 1HRV2 2Y38A 3UKNA 4D6QA 5A3NA 3T4VA 2OW4A 1CIWA 1XNDA 4AHZA 5L73A 4RFT0 4CDUA 4CCCA 2JECA 4XFAA 2YY1A 3I2GA 5JI7A 1QJZA 4JGYA 2ZCWA 4QQ2A 3VDDA 4H7LA 1U5ZA 4AI3A 2BGPA 1WLDA 1RUG3 1RUD2 4IV3A 3FFZA 1PGL2 5IVYA 4XCAA 1G9BA 2XDVA 2Z79A 4M01A 2LW8A 4RQPC 1H0BA 3RVHA 4COYA 2PLV3 1A78A 1UL9A 4CCDA 1HX6A 2DVGA 1NCRB 3SC7X 4LK7A 4LPLA 4AFBA 3GNEA 4GWIA 1C5HA 2JDYA 5AFEA 2W3JA 4MGQA 5APAA 1WUVA 1VJ2A 2PYTA 3C7EA 2EIEA 3BOWA 3NWKA 1CWPA 5FXXA 4NHKA 2P6HA 3PJYA 5F1RA 1FXZA 2DU0A 5HPOA 2X10A 2FDFA 1VBE3 1KDKA 1GZWA 2XBO3 4Q8KA 4QPGA 5AC91 3VDCA 5GLTA 4DQAA 2RJLA 4HG6B 4YVWC 4QKNA 1AR73 2TNFA 3RS6A 2J22A 3H8XA 2QQVA 5A6YA 5I8TA 5K4LA 4BPZA 1NXMA 5EJ3A 1CX4A 4XIKA 2AENA 4DY5A 2VD7A 5JMOA 1GWLA 4YNIA 4SBVA 4AG4A 4LIVA 5JI9A 1A3KA 1H2LA 1UY2A 2HWF1 3POFA 5CKMA 3LEMA 3PUSA 5F3EA 5FUPA 1JI6A 3C7HA 3NO8A 2OX0A 1PO11 1C8M3 2GNBA 2K2SA 3A7QA 3MPPG 3VUOA 4TTGA 3ZXEA 1WMEA 2ZOEB 5CIRA 3CO2A 1MZ5A 3CZUA 1RMU1 3AB0A 3W58A 2UY9A 3DYPA 3AC0A 1O7FA 2Z69A 1Z7S3 5FMBA 5K0UB 1AYM3 2VZPA 2BBVA 1W2TA 3FUQA 2PHRA 3AZYA 5FLHA 2ZZQA 2E51A 1SHWB 1AR71 2ZGPA 4I0WB 1JU4A 2FCTA 3LDRA 5FZEA 1FX5A 3E5QA 1RUE1 4X6RB 1MEC2 2O8QA 5JZGA 2W0XA 1EV12 3CIHA 1ODMA 2R1BA 4YG6A 4D3WA 4D6SA 2H6CA 1X7NA 3R4UA 5FXVA 2YG0A 3DV8A 1YLLA 1W90A 3K75B 4PBOA 4NOTA 4QX0A 5A6XA 4NO4A 2XJVA 3INAA 1W8ZA 4ZHNA 2IWGB 3I59B 4Q4Y3 1OVPA 3OUJA 2BW8A 2E6VA 1Y9MA 1NA1A 2WNUA 2XVKA 4NPMA 4UOJA 1YJKA 4CEWA 3HT2A 5FWJA 1LR5A 2XMLA 3WNOA 1W03A 1CAXA 1MPXA 2VCAA 1XE7A 5H9RA 1EY2A 3WLUA 4URAA 1B09A 2VMEA 4NVPA 4HSLA 1DQ0A 3KQRA 4Y22B 3WG4A 1FNYA 4HETA 2XH6A 1ZRCA 5CZKA 1DCSA 1W9YA 4YVSC 2WSVA 3HNYM 3C7FA 3A23A 3LAGA 4Y1VA 2F4LA 4LBKA 1MZFA 3J7NA 1HB3A 5HXVA 1FATA 1T2XA 1RB8G 1AJKA 1UKRA 1JMUB 5TSWA 2ARBA 5CG9A 3JBG3 3ITQA 2QQMA 4AFCA 4WVMB 2W5FA 3T2PA 4PLOA 1UXXX 4MHRA 1RINA 4QAWA 3VKNA 4FAGA 2Y6HA 3O0WA 4UFMA 3U37A 4UW4A 1CAVB 2VCCA 3D5OA 1GZ9A 5JAXA 4Q4X3 1LNSA 3QLQA 3S7EA 1GYKA 4ZXEA 1QF3A 5JIAA 4E27A 4DUWA 1OH4A 3V65A 4M4PA 5DG1A 3VZMA 3HPNA 1VALA 4TYSA 2ET7A 5FK7A 2DFCA 1W05A 3PMEA 3UGHA 5BXXA 1VMFA 4XBLA 3AMMA 2AZ5A 1WW5A 4IL7A 1IKQA 2VE1A 3WCSA 1HV0A 4MSVA 4KG0A 2WT1A 2JIJA 1XRUA 1C57A 5FZ6A 1VBB3 1IS4A 1AX1A 3AP9A 2RMU1 4HBNA 4GH4B 3L2HA 3THTA 3BTYA 1GWKA 3DXTA 1CZTA 1Z7S2 4I09A 4IEYA 3ZKYA 1S0CA 5K0UA 4DOUA 5LCWL 3J26N 1CQ9A 5FZ0A 2BFUL 5DDJ1 3WQ7A 4ATEA 1S0BA 4C1WA 4Q2FA 4EWEA 5BPXA 4AQSA 1H2MA 2Q1ZB 2B9VA 1RUI1 4OHVA 5FZOB 2Y6GA 4XFFA 1PGSA 3D0JA 4EROA 5BNOC 1JYXA 1PVXA 1W0OA 5IK8A 5F8PA 2FQPA 5HV0A 2RV9A 1J3PA 2PHDA 3NJXA 1GMMA 5HI0A 5FYVA 4HK8A
chains in the Genus database with same CATH topology
1H8TC 3WDXA 5ABJA 5T5OA 3MIEA 4COZA 2YZ4A 2DCZA 1UIJA 3OJBA 3RI9A 4Y1UA 1GANA 4R9CA 5C4WC 1TME2 5C8CC 1J3RA 3RWNA 2CGNA 3ZFGC 1PGW2 4K20A 3O12A 1XXNA 1UZZA 1LEDA 1BYHA 1VBA1 4HK9A 3QH6A 3N7MA 3ZPYA 4KG8A 4R9AA 4NPRA 2I45A 4B4RA 1A8DA 2PLV2 2WT2A 4ITCA 5A33B 5K8SA 4IV1C 1NCQC 4QT6A 1MS0A 2WC2A 4PQ9A 2ZKNA 4QQHA 3MICA 1WLWA 5E1RA 4YW3A 1QNYA 3AZWA 3BU7A 5KXCA 1OPMA 2BVVA 2BUKA 5ACA3 2GNMA 5E16A 1AL0G 2P34A 1LGNA 1MQTC 5ACA2 4R4XA 1MEC1 3ALQA 4GB33 1FV2A 1HRV3 3OF1A 1DIWA 1I9RA 4AHYA 1RUNA 5FQ0B 1QQP2 1BEV2 4X8NA 4XOGA 2UYBA 2IXIA 5L7OC 1VLNA 4LO7A 5FPZA 4L97A 2ZMNA 4A7ZA 4AHXA 1FPN2 1MQTA 1FOD3 3ILRA 3GHNA 2X5IA 4LUKA 2NP0A 2X29A 4FOYA 2RR13 1ZBA3 2QUOA 4IQPA 4GULA 3UJOA 1HRI1 1KS5A 2VOKA 1XYNA 4YGEA 1PZ9A 2WS91 3OD4A 4UXAA 1RMU3 3VHRA 5L36A 1QNWA 1NQJA 3AKTA 1X82A 1VAKA 3MGUA 4L2NA 3ZX7A 1DHKB 1W2UA 1O4TA 1U5XA 1UAIA 3VBSB 2FMDA 3ZXKA 2ETEA 1PO23 3VKFC 2B46X 4Q4V1 4YW5A 4GMP1 5FQ0A 3J8F2 1MVEA 3SXWA 4OHZA 1KJRA 2HWB2 1TNFA 5H9SA 4N43A 5C9AA 1RUF1 1H8TA 2R30A 3QACA 5ABJC 4MZUA 1G9AA 2R062 3POYA 4IEQA 2D44A 1HV1A 3IBMA 4IXLA 3VBHC 2VMGA 3VV1A 3ECQA 4XQDA 2HWB1 1FMD2 4AW7A 1GSLA 2TEPA 1EPWA 1QXJA 4Q4W1 4QX5A 3ZMNA 4OUSA 2QCSB 2XKOA 4XF3A 1HQLA 1MS3A 2HYKA 2JDZA 1NA1B 2WNUB 3ILFA 3MF6A 2GALA 3L9JT 3CNAA 5A32A 2RM22 5DZEA 1DG6A 1FPN3 1ZZ6A 5JOWA 2RM23 4JRAA 2K9ZA 2ZMKA 5L7OB 2D5HA 1QOSA 2NM1A 1WA4A 3RJRA 4PDWC 4CEWC 3K51A 1ASJ1 3WDWA 3CEWA 2HWC1 1W39A 4QU2A 4YM1A 3DPRB 3O14A 4FOWA 4FPHA 4TWTA 5HCFA 1BZWA 1JBCA 2DURA 4U2AA 1CN1A 1PNFA 3WP6A 3ZSKA 2WNEA 1SLIA 1ND3C 1LGCA 4LHNA 5JPNB 1DZQA 1VRH1 1AL21 1C1LA 3AFGA 3VBFB 4PIXA 2GC2A 1F2NA 1I3HA 3WP3A 2ZGRA 2LALA 4FT8A 3ETQA 1VBB1 4WM7A 3BIWE 1ZZCA 4Z8BA 4GKYA 3VBHA 4LHLA 4Q29A 3ZYGA 1S0DA 4Y1ZA 3LA2A 4N43C 4AVVA 4KGGA 3WG2A 5J3UA 4XJAA 4LBQA 5CG8A 4JVAA 5D8AA 3ZDSA 3CL1A 1JYIA 3MZHA 1UZYA 4QMAA 3VKMA 4D94A 5L19A 1DGRN 2IC1A 1LOAA 4N9IA 3ZSLA 5JSRA 4XE9A 1OA4A 3ZFFC 1N3OA 3AKQA 3ES1A 1DU3D 5GZGA 2HWD2 1O5UA 4XMIA 1PIV1 3LCPA 3A0KA 4IEWA 4Y26A 1QJU3 2FZ1A 3M3EA 3GYDA 4BWOA 1NLSA 1OLRA 2E7TA 4CDUB 2PHLA 2EALA 2A70A 1VBB2 2VG9A 3OBTA 4Q27A 1H1AA 3WG3A 4JGZA 5T55A 1TME1 3FZ3A 5FMOL 2DUPA 3VDDC 3ZXAC 1CAUA 1LESA 2R072 1BBT1 3HQXA 1CAWB 3PLQA 5C9AC 4Q4Y2 2EAAA 3S30A 4AF9A 3VL8A 1Z7S1 4W6XA 3OY8A 2ENRA 2WINB 3I7DA 4AFMA 2H0VA 4F8AA 1VBD2 3FLTA 4LHKA 5B2GB 4RQPB 1DQ2A 2W52A 2OYZA 1A8MA 4CDQC 4CDXC 3MFAA 4WVZA 5T5PA 4NWWA 5J48A 4AI2A 3SCFA 4JDOA 4B4PA 1JUIA 4MYEA 2SLIA 2CWMA 4P9GA 4CTEA 5FOJB 2PAEA 1PVC2 1YYNA 4UBHA 1G9CA 1CPNA 1H4GA 3T1MA 4WVMA 1PVC3 1J1TA 4QQLA 2EXIA 2JG9C 2XWJB 3JUUA 4RQPA 5IK7A 1AVBA 2F4PA 3ZSMA 1AYN1 2OA2A 3WY6A 2E7AA 2JG8C 2UY8A 1G6NA 2WFF2 2YGMA 2JG8A 2YC0A 4P14A 4D7SA 4E4ZA 4P9XA 2XBO1 2D3PA 2KXLA 2DVDA 2WKKA 1TQ5A 1BVVA 1NLRA 1ZBE1 5CFCA 2Y0IA 4IV3B 5BNQA 2A6WA 1K5MB 1ULFA 3M1HA 4I3PA 4D69A 4N9HA 2P3JA 1S0GA 4NHLA 1SLLA 4AEMA 3X29B 3EXUA 1LODA 1LEMA 4X8PA 1W6OB 4K1ZA 2DTYA 4IETA 4W6WA 5FPXA 2WQ4A 1AR93 2ZZJA 4CYDA 2BWAA 3AMQA 1RUD3 5EXOA 1JW6A 1BJQA 1R082 4FPGA 1Z0HA 4YGBA 4B3NA 3SISA 1YJLA 1YIPA 5AVAA 4IV1B 1CD3G 3Q9OA 1RUJ1 2DTWA 3POSA 3DPRC 1KDMA 4MGKE 1F5JA 1O4ZA 2JENA 1ASJ3 2GH8A 3USUA 4EV0A 1C3HA 3WV6A 5I8YA 3BB6A 4MUVA 4FP2A 3CU7A 1QJY3 1RVF1 3N35A 2DUOA 1IPKA 2IFRA 4MLOA 1B35A 2DCYA 4BLIA 1VBC2 4IEVA 2XKPA 4XF9A 3GBGA 3RDIA 4FQZA 5EYYA 5I0TA 2CV6A 3OY8B 1EPZA 3MPBA 4YVSA 2ILMA 1DQ1A 3U07A 2A6YA 2CNAA 1PNGA 3GZAA 2QDNA 4CZSA 1EV13 1LU2A 1EAH3 1RHI3 1T6GC 3ATGA 3U0ZA 3ZXJA 2GC1A 3S0MA 1NYWA 2A3YA 3B00A 2PA7A 1H4HA 3RMXA 1RC6A 2W68A 4E2SA 3QCWA 1QJY1 3BALA 4LBJA 3BOPA 1U5IA 1M4WA 3JQXA 1PM7A 4CP2A 2VOVA 3JBG2 1BMV2 1RJ8A 3ZYJB 3GZUC 4E2GA 3KT1A 4ONUA 4N53C 1KFXL 1XNKA 1W6QA 1D0GA 1AR83 2D6NA 5BNPB 1H9PA 4DY3A 2WS93 3WHUA 2DV9A 1DGLA 5KHHA 1AUYA 4LO5B 2X8KA 4GB31 1HRV1 1Y43B 4YVSB 4EN6B 4R4ZA 3TN91 1AF9A 4CEWB 4CEYC 1GKBA 3I4IA 5A3MA 3NKGA 4ZU4A 4Q4X2 2ATFA 1HDKA 3AYEA 5BNOB 3PVOA 2GMMA 2A6XA 4XFBA 4EJRA 5D8AB 1AR81 2OUHA 4EWDA 3NJZA 3ZYIB 5FO9B 4EWAA 1ULEA 3JZVA 3VBUB 3N3HA 4F83A 1HXS1 4HKWA 5CFDC 2ZPXA 2EA7A 1AYN3 5DXDA 3TNPB 2ZS6B 2XVLA 4M00A 2KA3A 2QDRA 3UK9A 4FXGB 3WDTA 2XB6C 1S0IA 1AR82 4UBGA 4D7TA 4RHV3 2IFWA 4LBOA 1DF0A 2XJTA 3MEPA 4HKLA 2VECA 4FPLA 2CYFA 2V73A 2UURA 4ZXKA 1ZZ9A 3LA3A 3DGTA 3ZVXA 3OBRA 1BBT2 3M70A 3SH5A 2KM2A 1OPOA 4FAHA 2JXAA 1W6PB 5F6KA 3KCXA 2GSYA 1MQTB 1CAVA 4GH4A 1UCXA 5L7OA 4B8EA 2A3XA 4XHXA 3DPRA 3O5SA 1GQGA 1W6OA 4Y20A 1FOD1 4FQ4A 3VBUC 3CLPA 4ASLA 3V56A 3MIHA 1Q8VA 2GN3A 3NW4A 4K8FA 5IK5A 1JUHA 1IS6A 1JYCA 2JEMA 3VZKA 1A6CA 1NCQA 2I07B 1UIKA 4RL7A 2ERFA 3UV9A 4N7IA 3RG0A 3IDEA 1ULDA 3NKTA 3RPQA 2XHKA 1Y3TA 4DB5A 3PVEA 3VDDB 5KBFA 4Z92B 1DGWA 1KRIA 2JE9A 2PHWA 3EJKA 4XHBA 2R041 3HT1A 4XBQA 3OGGA 1EV11 4DRVA 4N53B 1EAH1 2Z5WA 5A3LA 2ET1A 2D3SA 3M3CA 5I8SA 5KHJA 3MIDA 1QH6A 1ZBA2 5BNPC 1R092 2ZHLA 2YGLA 1AL22 1UX6A 4EN8B 1LOBA 1YFUA 1HIXA 2OPKA 2ES3A 4INDA 2O1QA 3AXDA 4BA6A 5BYNA 4Q26A 1LHOA 3IWZA 4RGAA 2XPJA 1DFQA 1O3QA 4XIOA 1D0HA 2VMIA 2JG9A 4YFWA 3KS7A 2OVUA 1NXD1 1LHVA 4BM8A 1AZDA 4B4QA 5IUQA 5JMCA 1ZZ7A 1FV3A 3AZZA 4H3WA 4FOQA 3U10A 2HWC2 2YUEA 2FMYA 1YNAA 4UW6A 1X8EA 2HWC3 2YDEA 3MDPA 4OI2A 1S2BA 4XJWA 2HWB3 3H3ZA 2TUNA 1RUH1 4R9DA 4W65A 2QE3A 2JD4A 5JVVA 1ZRDA 4DFSA 1QDCA 2WLQA 4HPKB 5LEJA 3IIAA 3ST7A 4GB32 2CAVA 4MGZE 3M2MA 4Q0SA 1OLQA 4DXZA 3ENRA 2CY6A 4QGLA 4BQ1A 3DL3A 1WGPA 1XYPA 3B93A 4Z2WA 1VAMA 5GLUA 3KB5A 1C8M1 4XJ8A 1MS1A 2EF6A 2PHFA 3H50A 3WZ1A 1NE4A 3V0AB 4Y4YA 3TYJA 3MW3A 2HWE1 4LA2A 4XBNA 2A7AA 1OFNA 4BE3A 3JB8A 3I59A 1RUG1 4M0NA 1PVC1 2D6OX 4JV4A 1SDWA 2UYAA 2P37A 1TE1B 1ZX5A 1XQNA 5D1IA 3ZN5A 3PJQA 2UWAA 2WSUA 2AH2A 2AREA 1GNHA 2ZGOA 1ND3B 2GDFA 2RS53 3OGJA 1IHMA 2RHPA 4YM0A 2YMZA 4KBBA 4XEZA 2YYOA 3LWCA 1YFWA 1BKZA 1COV3 5E8AA 1D2SA 1OQ1A 5J98B 3ZIWA 1V9U3 2BPA2 4M3CE 1OA3A 1Q8PA 4HLTA 2VY0A 3SH3A 5AC93 1LRHA 4S2FA 3ZN6A 4BMEA 4HMZA 3W59A 3DN7A 3C2UA 1S0EA 4GKXA 1Q3EA 2Q4SA 2IXCA 4QD2A 4LO8A 5FREA 1D4M2 4XFHA 1OA2A 1RL3A 2A6VA 3R4DB 3LA7A 1C28A 2RJKA 2C1FA 1SLAA 4MGIE 2ZX1A 1BBT3 5C6CA 1WCKA 1UPSA 1CONA 3FBMA 3QD6A 4DRRA 5FOBB 1SLBA 1RITA 1QJU1 5J37A 1RUG2 4KWLA 4HVQA 4Z82A 4ATFA 2I74A 1PK6A 1YHFA 4FPOB 4HT1T 2XJRA 5FCCA 3NV4A 5DG2A 3TRSB 5CFDB 2NMNA 3ZN4A 4F7ZA 2R6QA 1UPIA 4RD7A 3VN4A 4RR3A 2Q8OA 1SLCA 4CDWB 1DYKA 4R52A 3H1WA 1LHNA 1WLCA 1C1FA 1V6KA 3AKPA 4AE2A 1WCDJ 1YI9A 5CA6A 2ZGKA 1ULCA 4AQ6A 4I01A 4RHV2 5FBZA 4OI0A 4QPIC 2R061 4QM8A 4RSUA 2AUYA 2W39A 4K40A 1BQPA 1LOFA 1R1ZA 5FDBA 3TNQA 1AYN2 4LULA 1YXWA 1H2NA 3WT3A 1RHI2 1RUJ3 1AR62 2B42B 3MLJA 3WG1A 5JR7B 4Q4V2 3WHTA 4IEOA 1G7YA 2EXHA 3KD4A 3VBSA 4PBPA 2VOWA 5ABJB 1GV9A 3NV2A 2DVBA 1RVF3 3MIFA 2XUMA 1YFXA 3ZXLA 2D43A 1BXHA 1MS5A 2EVXA 4Y1YA 3QH7A 5AFBA 4KU8A 3KLSA 4BIFA 1JXNA 1S0JA 1QQP3 1JTZX 1V00A 3BODA 3WDYA 3AP4A 1CESA 1ENXA 1LJ7A 2Q0AA 3B01A 3AMPA 1D2QA 2ZGMA 1EYBA 1WW7A 2O0OA 3DKWA 1WBFA 1LOEA 3POWA 2JX9A 3VBFA 2QNKA 2ZGNA 5J09A 3SLIA 1SCRA 3BTAA 2WZR3 2N7GA 4Y1XA 5DUWA 1V70A 4MX3A 4LBMA 5K9YA 1JOJA 4AXOA 3D4KA 4KWJA 2VXRA 3GHMA 2R071 2MHFA 2D40A 4Q8LA 5FLIA 3FJSA 2VW2A 4RS5A 1O3SA 3B94A 5KHKA 3OCPA 3R05A 1HRI3 3AK0A 4YG3A 1CPMA 2K0GA 1LHUA 4LLFA 3IM0A 1CAUB 1HQWA 1RHI1 4IV3C 3FLRA 5GZFA 2JE7A 4QHBA 4J1WA 5KWRA 1NE6A 1POV0 1ZRRA 1RUF2 2WT0A 4AVBA 2JKBA 4Y24A 4N43B 2VNRA 1QJX3 4XPVA 1ZZBA 4ES8A 2JG8B 4YM3A 4LO4B 2BVBA 1AYM1 2R063 1C5IA 4XXAA 2BNNA 1ENQA 3B9IA 2ZHKA 5CADA 3MW4A 1H1MA 2O8OA 1O3RA 2VOXA 2EXKA 4FTBA 4JAAA 1DGWX 4NN0A 1KS4A 2VQAA 2HKXA 2DWRA 4Q0PA 4TZDA 4FOVA 5C9AB 2H6BA 1I5ZA 1NCRC 2GN7A 4LUMA 4GQ7A 3FMGA 3VZNA 4HKOA 3VBFC 2B5HA 1GNZA 1TMF1 1YCIA 1N1VA 2PHUA 5EWSA 4X6QB 4ES9A 2XLGA 4QQPA 3N7JA 5FFOC 5CFDA 3UJQA 3O0VA 2PFWA 3WXPA 3AYDA 5C8CA 4MXWB 3AP6A 3JD73 3WX5A 4FPJA 2C0ZA 4G4FA 4YVWB 3E5UA 4WM7B 5GLVA