3AXEA

The truncated fibrobacter succinogenes 1,3-1,4-beta-d-glucanase v18y/w203y in complex with cellotetraose (cellobiose density was observed)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
241
structure length
234
Chain Sequence
MKDFSGAELYTLEEYQYGKFEARMKMAAASGTVSSMFLYQNGSEIADGRPWVEVDIEVLGKSPGSFQSNIITGKAGAQKTSEKHHAVSPAADQAFHTYGLEWTPNYVRWTVDGQEVRKTEGGQVSNLTGTQGLRFNLWSSESAAWVGQFDESKLPLFQFINWVKVYKYTSDFTLDWTDNFDTFDGSRWGKGDYTFDGNRVDLTDKNIYSRDGMLILALTRKGQESFNGQVPRDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-glucanase
publication title Rational design to improve thermostability and specific activity of the truncated Fibrobacter succinogenes 1,3-1,4-beta-D-glucanase
pubmed doi rcsb
source organism Fibrobacter succinogenes
total genus 56
structure length 234
sequence length 241
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3axeA00
1S0FA 2AR6A 5AVAA 4YGCA 2A3YA 2AUYA 2PHFA 1CESA 2E7TA 1VLNA 3ZPYA 4YG3A 2DVGA 3WG4A 2EXIA 2D3RA 1WD4A 1GV9A 4Q26A 2ARXA 1YRZA 4LBOA 1FYUA 3ZXLA 1G86A 3ATGA 3V0AB 3WCSA 4YM2A 3VUOA 2OUJA 2VXRA 1SFYA 1LODA 1S0EA 1MZ6A 1JN2P 1W6QA 4DRRA 5CAZA 2A6YA 1WBFA 3B69A 5EYYA 5KXEA 2E7QA 3SH5A 1V6KA 3FFZA 3WNXA 1HLCA 1AXZA 4FPHA 3WDUA 3PVNA 2DWRA 3AJZA 4M3CF 3O0VA 5H9SA 2ZGNA 2H0BA 4F83A 2YMZA 1JBCA 2FHRA 3WOGA 2ZZJA 4ATFA 1IS4A 1YIFA 2ZHLA 2EXHA 3BOPA 3MEPA 1SCRA 1I1EA 3W58A 1GZ9A 3MW2A 1WLWA 5GLWA 4YGEA 2W52A 4ITCA 5T54A 1BZWA 4M3CE 4FPGA 2BQPA 4YZ5A 4DPNA 5GLVA 1ULEA 3AX4A 3PVOA 1LGBA 1CPNA 2VUAA 3GNEA 2W39A 3N7MA 5F5QA 2ZGTA 2ENRA 1HDKA 2D3PA 4Y1VA 1MS0A 1W6PB 4R9AA 4XHXA 4DFSA 4YFZA 3HN1A 2JECA 5KXDA 2ES3A 3AYDA 1OQ1A 2EXJA 4XHBA 4XXPA 1XQNA 3AZXA 3ZYRA 2D43A 1WBLA 3UJOA 3MW3A 1BXHA 3AJYA 1QGLA 2GMEA 5CBLA 3B3QE 1FATA 1SACA 4GKXA 4JCKA 2D6OX 1JUIA 2P3KA 3WHTA 1V6NA 2ZMNA 4AGGA 3IKWA 4YZ4A 4BMEA 2YXSA 2ZHKA 3AZYA 3FLTA 2ZMLA 2DVAA 1W6NA 1LCLA 2A6VA 1SBEA 2GN3A 2YY1A 4XJ9A 2R0FA 5JOWA 4FOQA 1A8DA 1YO8A 1GBGA 3B9CA 3WDTA 2A5ZA 4PQ9A 1SLCA 1V6MA 3N7JA 4BLJA 2WSVA 3U4XA 5BYNA 1AX0A 5H9QA 2GNBA 3DGTA 1BJQA 4LBNA 5CB7A 1KQRA 5GZDA 1SLTA 2DU0A 4SLIA 1WLDA 1UZZA 1DBNA 4AWDA 1F9KA 3ILRA 3SNMA 1LENA 5IT6A 3N36A 1RINA 3IPVA 5FREA 4FPFA 1ZA4A 1AXYA 1G8WA 1LECA 4PBOA 2KM2A 1S0JA 1DIWA 4GALA 5EWSA 3M1HA 2ZHMA 1ULFA 2DUQA 2ERFA 4YM0A 3T1LA 3ZSJA 4FPKA 4Q8KA 1WCSA 1YI7A 3AP4A 4Y22A 1G9AA 3AZVA 3T2TA 1SLLA 3IMNA 2ZHNA 4FOVA 3NV2A 1WD3A 1CPMA 1RITA 2WT1A 4GXLA 3WDWA 3W59A 1NXD1 1Q8QA 1LOGA 1W6MA 1SCSA 1WUVA 4BMBA 5DG2A 1GZCA 2OUHA 2PHXA 3ZSMA 2Z42A 1N47A 3BIWE 3OBRA 3WUDA 1N3QA 1N3OA 4YG0A 1Z0HA 4XMAA 4YW5A 3SH3A 2WT0A 1MS5A 1SLAA 3V0BA 1DQ1A 2A71A 1GKBA 1LHVA 3B00A 5GZFA 2A75A 1JYCA 3QLQA 4XJ8A 4W65A 1HQLA 2P3IA 3UJQA 1AXKA 5GALA 4Z8BA 2DV9A 1IS6A 3FBYA 1Q56A 2ZGQA 3VKOA 1HKDA 1QOSA 4Q8LA 1UZYA 5T5JA 4K1YA 2P34A 4YM1A 4Y20A 3ZSLA 2YZ4A 3HMYA 4HL0A 5HCBA 1DQ4A 4LBLA 2Q5TA 3LSDA 2CTVA 3WHUA 2OVUA 2P37A 2V73A 1QOOA 2UWBA 1CQ9A 3ILNA 1MVEA 2WT2A 3AZWA 1OKQA 4YZ1A 2NYYA 4Q27A 1LU1A 3APBA 3I8TA 4XOGA 2R1DA 4XZPA 5DZGA 5T5LA 2D6LX 1URXA 4ISQA 1W6QB 3INAA 3M3OA 4XJUA 4XJAA 3USUA 2D6PA 4Y1ZA 4GWMA 3OY8A 1GICA 4MYEA 2VW2A 2DUOA 1G7YA 2GALA 1UMZA 1LTEA 3OBTA 1VIWB 1LOAA 3M3QA 2JJ6A 1W0OA 1BKZA 1H9PA 3UK9A 3OYWA 2ARBA 3NWKA 1S0GA 1SBDA 1GZWA 2ZGRA 5T50A 5SV8A 1IS3A 4XTMA 1S0BA 1GNZA 2ZAAA 1DLLA 2D6NA 2EALA 4NOTA 1ENSA 2A3WA 2DTWA 3ILFA 4YFWA 3ZXKA 1DGLA 1N1SA 3ZXEA 4Y24A 5DZFA 5GZCA 1W0PA 4P9XA 3V65A 5H9PA 4H55A 1C1LA 1DQ6A 4PCRA 3M3CA 4Y1UA 1MR5A 2DU1A 1APNA 4XMIA 4XJWA 2JKBA 4IQPA 2UU8A 1WW4A 1DQ0A 3BODA 4UW6A 1WW7A 1C57A 2PHWA 4FQ4A 4BLIA 1SLIA 4AYUA 1S0DA 1DZQA 2SLIA 4M3CA 1Z78A 4XILA 1LHOA 3D5OA 1CR7A 3PMEA 2D3SA 1QKQA 4FOWA 2VY0A 3BTAA 4R9BA 1X50A 2NMOA 3NV3A 2AH2A 3VV1A 1DYKA 1MZ5A 2C9AA 3OPZA 3WDVA 3ZXJA 3R4UA 4BPZA 3WDYA 2C5DA 2DVFA 4D69A 1VAVA 2RHPA 1W6NB 4Q1RA 5EXOA 2JDZA 5E8AA 1EPWA 3TB0A 3RG0A 4FPYA 5KXBA 3ENRA 1LESA 4M01A 4XXAA 5DG1A 2VH9A 3KM5A 4YZ2A 3T1MA 3MPPG 5GM0A 1BQPA 5IK7A 4FPLA 1JYIA 2DVDA 4PBPA 1UAIA 1CVNA 1OFSA 1W6OA 2CWSA 3R4SA 1AX1A 4JRAA 3JUUA 1DQ2A 3N7LA 3OJBA 4Y26A 1BYHA 3IPVB 3AXEA 4FOYA 4XTPA 4HANA 4Q1PA 2R16A 1DHKB 1HQWA 1LJ7A 5IUQA 2A6WA 2WLQA 4PF5A 5HCFA 2E53A 1B09A 3AYEA 3L2YA 3WVJA 4TYSA 3RS6A 1UN1A 2CYFA 3FLRA 1IS5A 4FPJA 2NN8A 1O4YA 2EXKA 4XJZA 4Y22B 4R9CA 1MS9A 4Y1XA 2ZGKA 4LBQA 4FP2A 5CNAA 1LEMA 3AFKA 4CZSA 5DXDA 2DTYA 4U2AA 1W6MB 1Q8PA 1LULA 4ATEA 4FQZA 5IK5A 2V5YA 2WQZC 2A6ZA 2PELA 2W68A 3AYAA 4RL7A 4YW1A 3IM0A 3WG1A 1N3PA 2ZA9A 1F5FA 2ZACA 3WG3A 1F31A 3V0BB 4FP3A 1G9FA 4P14A 4CRQA 4U36A 4NO4A 1YYNA 2VW0A 4ISRA 3ZVXA 1RIRA 4DRVA 1KDKA 3HR9A 2NP0A 2XG3A 5CA6A 2YV8A 5F9TA 1N1VA 3ASIA 3AXDA 4BOWA 2CL2A 1ENQA 4RA0A 1FV2A 1Y7BA 2R0HA 2P2KA 3H0OA 3PJQA 4P9WA 4Y20B 1AX2A 2GMMA 1S0IA 3FUOA 2ZGLA 4K20A 3WLUA 2WNEA 1FNZA 2NMNA 3M2MA 3RMYA 5T5OA 1LHUA 4UW4A 2LTNA 1UX6A 3JU9A 1AJKA 5GLTA 1KJLA 1A3KA 1V6LA 1ULDA 1QF3A 1WW6A 1IKPA 1GYKA 2A7AA 2NM1A 4UW5A 1QU0A 1FNYA 5FRAA 1DFQA 4LBKA 3FUQA 3USUB 1GANA 2JD4A 2CNAA 1JW6A 3AP5A 3OY8B 1G9BA 2W08A 4CTEA 3D4KA 4WV8A 1LGNA 3GALA 1V6OA 1CN1A 1SLBA 4YM3A 3OYWB 4BQ1A 1Q8VA 4OZXA 3UL2A 3VKFC 1GZWB 2GN7A 4AVVA 3ZXFA 2B7YA 3O12A 5H9RA 1H9WA 1PZ7A 2GMPA 2ZGPA 3AP9A 1MACA 3SLIA 3V0AA 1Q8SA 2ZGUA 4WZFA 2UURA 3IN9A 2DUPA 5GLUA 1NLSA 5DZEA 2DVBA 3D6EA 2E6VA 1SBFA 2PHTA 2R49A 1LGCA 1GNHA 2A70A 2NZ9A 1AZDA 3NV4A 4FVVA 3VKLA 4GKYA 3RMXA 3WUCA 3A4UA 4XE9A 3OGGA 4UW3A 2A3XA 2A6XA 2WKKA 1LHWA 1C4RA 3PVEA 1LOBA 1V6JA 2D7FA 2EAKA 1V6IA 4L8QA 1KDMA 3N35A 4YG6A 1PZ9A 5DUXA 3SITA 4K1ZA 1S0CA 1YXWA 1DQ5A 4K21A 4LBQD 3WCRA 1AVBA 4M3CB 1D0HA 3C2UA 1MS8A 1D2SA 2GNMA 1G9DA 4I30A 1CIWA 1KJRA 4XBNA 1JXNA 2D6MA 3A0NA 2LALA 4Q2FA 1GSLA 3AP7A 2WJSA 2GNDA 4YW2A 3QCWA 3LCPA 1JOJA 2ZABA 3MW4A 1LOCA 1IKQA 4FPOB 1TEIA 4AGRA 1G9CA 1QDOA 1QNYA 5JLVA 2VU9A 1J1TA 1MS3A 5DUVA 2P3JA 4AGVA 1N1YA 2HYKA 5GJ6A 3AP6A 2DURA 1ZM1A 2D44A 1LU2A 2E51A 2PHRA 3NV1A 1W6PA 4DQAA 3WV6A 1FV3A 2SBAA 5JVVA 5HCAA 4YW4A 2XB6C 1LOFC 5GLZA 2YROA 3V64A 1W6OB 2UWCA 1FAYA 3ZSKA 2DYCA 1LOFA 1AF9A 3POSA 1QOTA 2ZBJA 4LBJA 5JOXA 3N3HA 2OW4A 3O0XA 1PZ8A 2CY6A 1MS1A 3R05A 4XDQA 5DUWA 5T55A 3WDXA 2PHUA 4FPCA 2I2SA 2AGSA 1Q8OA 5IK4A 2UWAA 5JOZA 1MVQA 1O4ZA 3POYA 4AVSA 3VKNA 4KBBA 3AZZA 2G4IA 3AK0A 4GWNA 4LBMA 1ENRA 1KITA 3RSJA 2WSUA 1WLCA 2ZGOA 1UPSA 5T52A 5JMCA 4LBQB 4AVTA 4YZ3A 2JE9A 5E89A 2FMDA 2TEPA 5GZGA 4P9YA 5LK5A 4YGDA 4FPEA 4ZKTB 3LSEA 1GLHA 2GNTA 3O0WA 1ULCA 1ULGA 4JC1A 3DUIA 3POWA 1DYPA 3CNAA 4ASMB 2D6KA 1QMJA 3VKMA 1U0AA 4DS0A 1JHNA 1QDCA 5GZEA 1CONA 1UKGA 3O5SA 2JE7A 1QNWA 4YW3A 1A78A 5T5PA 3RQ0A 3Q9OA 4WVVA 4XYXA 1FX5A 5KXCA 3N7KA 2VW1A 3M3EA 4XIOA 1CJPA 3SH4A 1IOAA 5EYXA 4R9DA 2AENA 1VALA 5IK8A 3I4IA 1V00A 5JDBA 1LHNA 1AJOA 4C1WA 4BM8A 1WW5A 2ZMKA 3A0KA 3TAYA 5E88A 4XIKA 1H30A 4YGBA 1LOEA 3AYCA 1ONAA 2AREA 3B01A 3ZYPA 4YLZA 1S1AA 5JOYA 3FLPA 4M00A 2ZKNA 1KRIA 2GDFA 1LEDA 1MS4A 5DUUA 1C1FA 5L73A 3RRDA 2ZGMA 2CWMA 1N1TA 3KQRA 1R1ZA 4XBLA 4WVWA 3SISA 1VAMA 4ZXKA 4C1XA 4TZDA 2R1BA 2ZGSA 4XBQA 1I3HA 2EF6A 4GA9A 2EIGA 2AYHA 1UL9A 3WG2A 3WZ1A 4Y1YA
chains in the Genus database with same CATH superfamily
1NA1A 4NHKA 4DUWA 1PGW2 2C0ZA 5HI0A 1DF0A 2GSYA 2VC9A 1R1A2 4A7KA 1CESA 1QH7A 1YJKA 2DVGA 4UFLA 2B9VA 4IV1B 3O1SA 2EXIA 2JICA 1IG3A 2JDAA 1RUC2 5KR7A 1MQTB 1K5MC 1FYUA 3TWIA 4R52A 1G86A 2R071 1TME2 4NUBA 3RYKA 1H6YA 3WCSA 4LT5A 1U5IA 3K3NA 3KV9A 1RGSA 2VQAA 1MZ6A 1JN2P 4JKKA 1FOD1 1YI9A 5HPOA 3BI3A 1POQA 1O7FA 2AEYA 1T6GC 1WBFA 2FDFA 2AEZA 3ZFFA 5D21A 2RR12 5CKNA 4LLFA 1V6KA 3J26N 3RYRA 3S7EA 3CO2A 3PVNA 3PVBB 1AYN1 1RUJ2 2JDNA 3EXUA 1QQP3 3O0VA 2Y6FA 5IVEA 4ARXA 3JD71 2VGDA 4F83A 1VB4A 1OVPA 1IPSA 1SMVA 2KD7A 4HKLA 4ZXEA 5C9AB 5LEKA 1Z7S1 1YEWA 3J7LA 5CIRA 1IGOA 3W58A 1C8M1 1GZ9A 1E5IA 1WLWA 1HRI1 4YGEA 4E2SA 2W52A 3ORJA 4AQ2A 4M3CE 1BMV2 3BALA 4DPNA 3B5LB 1WZXA 4AHYA 1ULEA 3AX4A 2W0XA 2BNMA 4I01A 2PMWB 4DY3A 2BFUS 3NMBA 1JZ3A 3VL9A 4XW3A 5F5QA 1GUIA 3DYOA 3ETPA 1W8WA 1HDKA 4IW3A 4LQRA 4L99A 4R9AA 1GQPA 1A6CA 4W6YA 4DFSA 2VE1A 3HN1A 4K8FA 2GH8A 4NIGA 4CDXB 1J58A 2OQ7A 3AZXA 4PJYA 1EUUA 4DNYA 5FQ0A 3H8XA 5DAPA 1CX1A 3AJYA 2GMEA 4HZFA 5D8AC 4BCUA 5BNNC 2D6OX 1V70A 1H8TC 2VVEA 3OSDA 3HOBA 1PK6A 3E5UA 5EJ1B 1VBB3 1VBA2 2Q30A 4MGZE 1L7LA 2H6CA 2ZMLA 2DVAA 4MXWB 2FDHA 1TQ5A 1SBEA 2YY1A 3MIFA 4CDQA 4LA3A 1ZZ8A 1YO8A 3B9CA 5FPLA 4QT6A 2D93A 3N7JA 4KMQA 4BQ5A 4NN0A 3Q8CA 4Q4X2 3GZEA 4E8DA 3PL0A 1C8NA 3D8CA 2DU0A 1DYOA 1DBNA 3AC0A 3KV4A 1PIV2 1RINA 4BQYA 4LE4A 2AZ5A 2EVXA 4BK5A 1DU3D 4QX5A 1BEV2 2HEVF 1ZRCA 3WF0A 5FYMA 4YM0A 3ZSJA 4C91A 2P5BA 3JQWA 2HWF1 3AZVA 4XUTA 5LY2A 5AFBA 2BVVA 2ORZA 3G6JB 3IMNA 4RGAA 3T0BA 2F4LA 1FPN1 3USSA 1CPMA 5G05L 3WDWA 3AMPA 2W92A 1Q8QA 4LHLA 4XUQA 1RUOA 3I49A 5JIUA 2VMFA 3ZSMA 4AR2A 1H4GA 2PHXA 4S2HA 5EP9A 5FYUA 3OBRA 3SHRA 4Y3OA 2WWUA 1N3OA 5FPUA 2WA4A 5FPBA 5A70A 1Z0HA 4JKMA 2J22A 4YW5A 3ZYHA 3MI8A 1MS5A 3J4UH 1REDA 4EJRA 2JG8A 2RS32 3B00A 3KVAA 5GZFA 4IEQA 4F8AA 5FWJA 4YSFA 5F5CA 4CCEA 4UFIA 1ZNPA 5FXZA 4W65A 4M4PA 1AXKA 1ND3B 3ZFGC 5GALA 1ASJ3 2WNUB 1IS6A 3N9OA 1FT9A 2HWE3 4Q8LA 3I2KA 1NA1B 2R063 3BPSA 4K1YA 5T5JA 3VBRC 2HEYF 2XBO3 2VOWA 2B46X 2CTVA 3B93A 2E7AA 5J09A 3BYWA 1S2EA 1CQ9A 1IG0A 4E2QA 3ZR5A 2AACA 3LOIA 2WFF3 3LA2A 3WT3A 1ZRFA 1OKQA 4YZ1A 2FCUA 2MHFA 2NYYA 4Q27A 4RFRB 1LU1A 4QDSA 4XDPA 4OQ8A 1NZCA 2D6LX 5KC5A 1G6NA 4G9SB 3AMHA 2JB8A 3USUA 2Z79A 3OB8A 2RDSA 2FDIA 4GWMA 1REEA 4MYEA 4QU1A 1BBT2 2VMDA 5DN2A 1OOPC 1G7YA 1VBD2 2GALA 1UMZA 3IZOA 3MGUA 3ZFFB 2GC0A 2EIBA 4KQ7A 3C7EA 1D0GA 1JZ8A 5EV7A 3POJA 2ARBA 5I0RA 1SBDA 3OBZA 2RMU3 2QFEA 5T50A 4DIQA 4JV4A 5J96B 1S0BA 4W4ZA 4ARYA 4RQPC 5FZ3A 5CEHA 4MV2A 5JXIA 2A3WA 3KT1A 3ILFA 4OI0A 2EICA 2JDUA 2VXJA 1DGLA 3MIBA 4ZU7A 2X53S 2QUOA 2ORXA 3LA3A 5K8SA 3PURA 4QKFA 5G04L 5GZCA 4BE3A 1O3TA 1UY4A 3HNYM 3UV9A 2PLV3 4N53C 4P9XA 3ZN6A 1PVC1 1RUD2 4GULA 5C33A 4GMP1 4PDWC 3CBNA 5F37A 1MR5A 3P5BA 4XJWA 3CEWA 1UYYA 4CEWA 1DQ0A 1C57A 2YG0A 2JDPA 3AMMA 1S0DA 3NRUA 4AEKA 1V9U1 1YQ2A 2VBBA 1GP5A 3WINE 5FQ0B 1Y43B 2RDRA 5I0DA 4RD7A 4GJZA 3BTAA 2HWD3 2K9ZA 5FYBA 2AH2A 5CFDA 4B1MA 1OI6A 1OUSA 3ACFA 4NRQA 1EV11 2OYZA 3TEYA 1PK6B 5ACA1 1WGPA 2C5DA 3J7MA 1IPKA 1L3JA 4W6WA 3KQ4B 1K42A 1VAVA 2RHPA 3BB6A 5EXOA 4Q1RA 1GU3A 1CZTA 5BNPC 4LITA 4CDQB 3N9LA 3MIHA 4FPYA 1LESA 2HBUA 4YZ2A 1QJU1 2XKOA 4QM9A 1GZTA 4QDQA 1BQPA 2XL7A 5IK7A 1XE8A 1KS4A 3T4HB 4PBPA 2XUEA 3KZ4C 1OFSA 1YQCA 1PGW1 2CWSA 1AX1A 2QQLA 5DDJ2 1R1A1 2YC4A 4NAMA 4WVMA 3I3QA 3N7LA 1AL23 4YYOA 3UETA 1YLLA 2QDNA 2WS93 3AM2A 2BBAA 1NCRC 1RUC1 3C7GA 3THTA 5JPNB 2EIDA 1UU4A 1DHKB 1L7RA 2HWB3 2V5DA 1ZBE3 4NRMA 2WLQA 4PF5A 5K9YA 2E53A 4EV0A 1UXXX 1JHJA 2YPJA 3K3OA 4TYSA 1OUXA 3MUZ1 1NG0A 1UN1A 3RS6A 1SEFA 2UY9A 3FLRA 5IVYA 5I0SA 5J37A 1W2NA 4WM8C 2JXAA 3RNSA 1RUH2 4ET7A 3LEMA 1UOGA 2XR4A 4KGQA 1AYM1 5DMYA 4Y1XA 2QQUA 2ZGKA 4LBQA 4FP2A 3J8F1 2XJQA 2PQQA 3AFKA 3PTYA 2RR11 4MVTA 4XABA 5C4WA 4MGTA 2ZX4A 2HLEA 4KWJA 2B9UA 2Q8DA 3AL5A 2UYAA 3EBRA 3WNLA 5IK5A 5CKQA 1W9SA 3NJVA 5JXHA 2PELA 5FYVA 4CP1A 2P4EA 4MGKE 3SC7X 4D6RA 3IM0A 4EWEA 4D6QA 2ZA9A 4JTOA 4NIHA 4UXAA 2F6BA 1ODNA 4QPGC 3WG3A 4CXXA 4D7YA 2VBDA 4FP3A 5M0TA 1W8HA 1BVVA 1NCQA 2JG8B 4BIFA 4NO4A 3GHMA 2XPJA 4CCNA 4LO8A 4ISRA 1X9PA 1RIRA 2W1QA 1KDKA 3R4DB 1Y3TA 4RHV3 4LUKA 2YV8A 5F9TA 2RJKA 1HX6A 3E6DA 2J1VA 4IGPA 2CL2A 4BOWA 4EN0A 1AR91 1ENQA 3IBMA 1Y7BA 2WZR3 3H0OA 4QPIC 5ISLA 1AX2A 3HJRA 3PUAA 1FNZA 3RWNA 2OX0A 2VNRA 2RM23 4UF0A 5T5OA 3VBSC 3IDEA 1VR3A 1AJKA 3KHCA 2QTWB 4OVEA 5FZ1A 5F2SA 2XMLA 1V6LA 1QF3A 1GOGA 3VBHA 3WNOA 2RJ2A 1VRH1 1R64A 1DFQA 3B7MA 4CCLA 1NY71 3USUB 4IGOA 4IE0A 3FZ3A 5L9RA 1YFXA 2W08A 2YU1A 1MEC1 3PLQA 1UU6A 3DPRA 4WV8A 5L9BA 3M7AA 5FPVA 4Q4Y2 4QXHA 1V6OA 2C1FA 2WINB 4BJ0A 4PIZA 1FOD3 5KHIA 3CL1A 2FBEA 1Q8VA 5A7QA 4AVVA 4OUEA 1NX9A 3ZPOA 1KEXA 1H1MA 2B7YA 2PAEA 3PUSA 1H9WA 4F3JA 3V0AA 2GMPA 2ZGPA 3VBUA 2VUCA 1Q8SA 2P17A 2FD8A 1HJFA 4FT8A 4PIXA 1X8EA 4H14A 1AYN3 4GB33 2Y6LA 3JD73 1GNHA 3VKLA 4FVVA 3UGHA 1DZRA 4TXWA 3RMXA 4HK9A 3WUCA 3ZN6B 4CYDA 3OGGA 1W8FA 2A3XA 2A6XA 2BVBA 1Z7S3 4HBNA 5JR7B 1GOHA 3LB9A 1LOBA 1C8M3 2O8QA 4L8QA 1Y9GA 3QOPA 1KDMA 3N35A 4YG6A 3H8RA 2IFWA 4CEWB 4K7JA 2JDYA 1XSRA 3FFQA 5DUXA 5FZCA 3SITA 4WBBA 1S0CA 1YXWA 1KGYA 4IV3A 1AVBA 5FO8B 1PM7A 1D0HA 5A32A 1G9DA 4Q4W1 3OUIA 4I30A 1CIWA 5CFCC 5JSPA 4FAGA 3A0NA 1BK1A 5JMOA 3N9QA 1GSLA 5CFDB 4CSWA 1JYXA 4A7YA 3BTXA 4YW2A 4CDWC 5L9VA 3LCPA 1XU2A 1LOCA 3EYPA 3WD5A 4AGRA 4AEDC 2AC1A 5JLVA 1NXMA 2WZ8A 5DUVA 4GIQA 3FBMA 5I8SA 3T0DA 1H4HA 1ZYBA 5GJ6A 3DF0A 1ZM1A 2E51A 4DQAA 3NNGA 5JZGA 1W6PA 1W2TA 4Z92B 3JBG1 4KG8A 1DGWA 5JCTA 5JVVA 4RS5C 5GLZA 2XB6C 4P5YA 5FYYA 1TE1B 1H0BA 1XPWA 1QJX3 4Y4RA 3RZMA 4PI2A 4WVMB 2IZWA 1QOTA 2IVIB 3BOWA 2ZBJA 2PAKA 3HT2A 1NAEA 5FAXA 5JOXA 4YWAA 2CY6A 3R05A 2R30A 5EIYB 4CCOA 5IK4A 4FFIA 1MVQA 1O4ZA 3LFIA 3MUY1 2HBTA 3VKNA 1OVSA 3SKVA 1QJY1 1KITA 1RUE2 2WSUA 2ZGOA 4L2NA 4Q0QA 4CE8A 4LBQB 3A22A 5FZ4A 1HB3A 2FMDA 2TEPA 3LDRA 4G3YC 5GZGA 5C4WB 5IAXA 4FPEA 1GLHA 4YPJA 4Q5OA 2WFPA 3POWA 4P02B 3CNAA 3JB4C 5FZEA 2HWF3 1U0AA 1JHNA 3JXSA 4LO4B 5CG9A 3H3UA 1OQDA 3RZLA 2Q1FA 3O5SA 1FPN3 4OI1A 3I3MA 1JYNA 3OGJA 2HEWF 3RQ0A 1Q5OA 4R4XA 2BDRA 5E16A 5CISA 3N7KA 1CIYA 1NCQB 4QQHA 2IXKA 4XIOA 1WMFA 4URTA 5FUNA 1IOAA 2VPVA 4JGYC 3NL1A 2XJSA 2J1RA 2KR2A 5IK8A 1POV1 2VQTA 4LHKA 5JDBA 3KCYA 1UX7A 3NAPA 3TN91 1WW5A 1UYXA 1EY2A 2H0VA 3F95A 4LLOA 1W99A 2TUNA 4XIKA 5FZOA 1ONAA 1VMFA 3H3LA 5DAXA 4AOCA 5I8YA 1S1AA 4UF0B 4AQTA 1DGRA 3U0ZA 4QHOA 4MUVA 2I07B 2Y0OA 3LEIA 4M0HA 2QQWA 3EB7A 1I6XA 5L73A 1W9FA 1TMF2 2VCCA 2WDBA 4D94A 1GP4A 3KQRA 3VBHB 4XBLA 2WBKA 4WVWA 3CJIA 5FIXA 4QQLA 1CAWA 3BU7A 3QACA 3MIEA 4UOJA 1I3HA 4GA9A 1W05A 1K3IA 2XJPA 3BGAA 3WZ1A 1OPOA 2GH2A 4PLOA 4XCBA 4YGCA 5EPAA 2L9LA 2A3YA 3DPRB 5FY7A 2PHFA 4BXSV 3R6SA 3ZPYA 1COV2 4YG3A 3WG4A 4AI3A 3TN92 1OLME 5IYYA 3K51A 3B94A 2W2IA 1OF3A 3KV6A 2ARXA 1JYTA 1YRZA 4LBOA 2W87A 3T09A 3N4MA 1O5UA 4LE3A 3R0RA 3ATGA 3V0AB 3VBUB 1K5MA 3VUOA 5LK7B 1LODA 1S0EA 1W6QA 2RS12 5FZMA 3OEBA 1J3RA 4DRRA 2KA3A 3LDKA 4D3WA 1ND2C 5CG8A 3DYMA 3IT8A 4GH4C 3SH5A 4XF3A 4Y4YA 2VMGA 2VZUA 1AXZA 1XJAA 4OMCA 4XURA 3WNKA 1PO22 2PHDA 2P1BA 1UMIA 3AJZA 3IDBB 4M3CF 4UBGA 4WM7C 1RUH1 3T2OA 3ZXGA 2ZGNA 2H0BA 2VBPA 5A1AA 4JDNA 3NKTA 5CU1A 4HSJA 3E5QA 1B35C 4Z07A 1PVC3 3WOGA 4ATFA 4IV3B 4GMP3 1AL0G 5A32B 3BOPA 2PTMA 1SCRA 3I2FA 2QBXA 3AMNA 4IE6A 3MW2A 3VHNA 1VBC2 1JZ7A 1UZWA 1BZWA 5T54A 1HIXA 5C3PA 3ROUA 3GBWA 3KCXA 4ZHNA 1V9U3 1PGL2 2BW8A 3GNEA 3I2JA 1ZZ7A 3N7MA 3WY6A 3PIGA 4DMIA 1ENXA 3NSTA 1AR72 5KHHA 5F3CA 2D3PA 1EV13 5FMOL 5JZGB 2MEV2 1W6PB 3E6CC 5ACA3 2JECA 4D8MA 1ZA7A 2Z2SB 4B4QA 3ZYIB 2WLPA 4JVAA 4NIDA 1PX3A 1UCXA 4Z2AA 3F2ZA 4GKXA 1QJZA 1QJU3 5D8AA 3URFA 1OQEA 2WO2A 1XB9A 4RGGA 4O9EA 1H8TA 2YXSA 3AZYA 5FY4A 4DEVA 5AC92 4YRDA 4Y5Z0 5I0UA 2WZEA 2GAUA 4XJ9A 2R041 2R0FA 5FMCA 5FR3A 2ZZQA 3MFAA 3KF3A 3QH6A 1A8DA 3WDTA 4LHSA 4ZS3A 5K7PA 4BLJA 3U4XA 4FFHA 2ZCWA 2YHJA 2GNBA 3DGTA 4FBFA 4O61A 1BJQA 1W9WA 5C5UA 5KHJA 3LIHA 1RUG1 3DV8A 4HVRA 1RUNA 2OXBA 3K46A 4AWDA 2H6BA 2YGMA 3Q8AA 4OI2A 3L9JT 3N36A 4W8JA 1AR61 3IPVA 1U12A 5FREA 2C6SA 1AYM3 1ZA4A 2VQ0A 3UGGA 5HCHA 2KM2A 3J8F3 1BMV1 3GZTB 2XOMA 2OZJA 3HIFA 4AEMA 5FZBA 3GZAA 1YI7A 3O1MA 3BVCA 3WW3A 3HAGA 2ZEZA 3T2TA 1SLLA 4FOVA 5BNOC 1JTZX 3NV2A 3NAPB 1PO11 2VUJA 1RITA 4GXLA 5FP3A 3W59A 5K4LA 1NXD1 1GOFA 1RUI1 1SCSA 4BMBA 5FZOB 5FZLA 1UKRA 3SCGA 3MO4A 2RDNA 3W5MA 1FMD1 2Z42A 1N3QA 5L36A 1QXRA 4YG0A 2W3JA 1GP6A 4L97A 4CP2A 4UWDA 1OF4A 4P9JA 1OH4A 4YNIA 1SLAA 1AR93 2WR9A 2VUDA 1D4M2 4IDZA 2A71A 2VTFA 2RJLA 5FP4A 4BYYA 3BIEA 4N7IA 4TN7A 4XJ8A 4DB5A 3CJIB 4IE5A 5D2AA 3UJQA 1CAWB 4DOUA 3VDCA 4J1XA 3ZFGA 1F15A 2O14A 1HKDA 3AKQA 2GC2A 4N90A 4Y20A 4EWDA 2YZ4A 5A1FA 1H8VA 5HCBA 4LBLA 5F32A 2Q5TA 1VRH3 3KVBA 1PX4A 2QQJA 3VBRA 2OVUA 4B1LA 2J7MA 3NNLA 3ABZA 1O91A 1C3HA 2G9ZA 2CAUA 3VZNA 3HD8B 1MVEA 1MEC3 1BCXA 4N9IA 3AZWA 4Q4V3 4AVBA 4L0PA 5A3TA 2YU2A 3OPWA 1K5MB 3I8TA 4Z82A 5T5LA 4B4PA 1MZEA 1URXA 1H1IA 1W6QB 3KCCA 3M3OA 2BFUL 1JU3A 4XQDA 2D6PA 2JDKA 4G4FA 4XJAA 4Y1ZA 4ZONA 5HXVA 2VW2A 4E4SA 2QCSB 1I5PA 2LRPA 3LF7A 3GJBA 1OOPA 4CCMA 1W0OA 5JI9A 2W91A 1BKZA 1H9PA 3AB0A 1VBE2 1S0GA 3ACLA 4HKWA 1WMDA 4XTMA 1DLLA 2D6NA 5LRRA 3LEGA 1UYZA 4NOTA 1AUYA 4RQPA 4AQ6A 3ZXKA 3UKNA 5EJZB 2WNVC 3E97A 2J42A 1W04A 1QXPA 4Y24A 1DZTA 4OUSA 3WW4A 1HN1A 1W0PA 1OA3A 2C26A 1YFUA 2QQOA 3FHQA 4AZZA 4N53A 3N9PA 1WMEA 1T2XA 2CU5A 3M3CA 4Q4W3 4CA9A 2DU1A 4LKFA 4I0AA 1APNA 4PDWA 3WR0A 4COVA 2JKBA 1WW4A 3FN9A 1WW7A 5C9AC 3OTFA 5LA2A 3BU0A 1CZSA 1HXS2 3KT7A 4FQ4A 4PF1A 4AYUA 4BLIA 2SLIA 1UY3A 1RMU2 2BZDA 1Z78A 2OZ6A 4LUMA 4XILA 5A6ZA 5FZGA 2V72A 2HWC2 2QDRA 2QE3A 2D3SA 3PUQA 4QXKA 2VY0A 4OCTA 4SBVA 1X50A 1DP0A 3WDVA 3OPZA 3T2PA 5D8AB 5C71A 4XUNA 3JBG3 3THCA 4LORA 1ZRRA 3S30A 1H8TB 1SFNA 4LOTA 2QQPA 4J25A 5FZ9A 3RG0A 5KXBA 5BNPA 5J7MA 4XXAA 5DG1A 3KM5A 3HBKA 5GM0A 3S7IA 1UNBA 1UXZA 1EAH2 2DVDA 4CDUC 1UAIA 4NIIA 4HETA 1H2MA 3TEXA 5FV3A 3UESA 2X29A 3UT0A 3OJBA 1QJY3 3BTZA 3IPVB 1Y9MA 3AXEA 4FOYA 4XTPA 4Q1PA 3RJRA 3ES1A 1RVF1 4LKEA 3SCFA 5LBCA 1GMMA 1NCRA 5IUQA 1JZ4A 1ZBA3 3PUHA 2MPFA 1B09A 4J6GA 2CYFA 1ZVFA 2QVSB 3MFCA 1O4YA 2EXKA 4XJZA 3L2HA 4R9CA 1MS9A 5DAVA 3KT4A 1YFWA 4WM8A 3T4VA 4HN0A 2B8MA 2W46A 3K2OA 5CNAA 4FI9A 2XHKA 4D6SA 5A3OA 2DTYA 4NR1A 4U2AA 1LULA 4ATEA 4QQOA 5IW0A 1JU4A 3VD7A 4QHZA 2CGNA 1QQP2 1E5HA 3IDAA 3PUIA 1YCIA 2YB7A 1ZRIA 5FCCA 1POV3 3I2IA 2Y60A 4OHYA 3ZOIA 2Y8KA 1R091 3RPQA 5HBAA 4TSVA 2ATFA 2XKPA 2ZACA 3K4AA 1DDLA 2QQVA 4QPGA 2PHLA 1VBC1 1UIJA 5FLIA 3U14A 2YYOA 2XG3A 4I02A 3PHMA 5CA6A 3I3DA 2IFRA 4WZCA 2CDOA 4JDMA 4Y20B 2GMMA 1HRV1 1S0IA 1RUF1 2ZGLA 4AL9A 3VBRB 4QPIA 2G9FA 1LHUA 2MEV1 2TBVA 3JU9A 1RHI1 1C5HA 3VBSA 2VR4A 4ASKA 3WNNA 3HPNA 4I2OA 4XF4A 4BDVB 4B7EA 4CEYC 5A6XA 2PYTA 3WQ0A 1XNAA 1XE0A 1IKPA 3ZDSA 3ZM8A 2FQPA 1NLRA 4LBKA 3EJKA 1OURA 1VBB2 2JD4A 2JENA 2CNAA 3AP5A 4FSJA 1OD3A 1J59A 2YFZA 5A3WA 3RFRA 2VZQA 1OOPB 2C4XA 1K5JA 1CN1A 1SLBA 4D7TA 2RS51 4BQ1A 3UNPA 3SEEA 2WN3A 2FCVA 5I93A 4N43C 3HEIA 2Y64A 4XFAA 1HV1A 2JX9A 5ANNA 3O12A 5JUVA 5H9RA 3SLIA 4RQPB 1UOJA 3ZFEC 1CAUA 1IQAA 1VRBA 4EE2A 3K48A 4HVOA 1NLSA 2MNGA 2PXJA 2E6VA 2PHTA 3ZFFC 1LGCA 2HJIA 1AZDA 1VE0A 5A3MA 2FDGA 3AL6A 4K3UA 3VBFC 4A42A 4BQ3A 2B42B 3A4UA 4IE4A 5LBFA 3PU3A 1CAXA 3O14A 4UW3A 4XE9A 3MZHA 2WKKA 4N53B 1AR81 1O3SA 4QX8A 2VNGA 4BB3A 4PDWB 3MDPA 3OBAA 4CUBA 4E4DX 2NLRA 2VZOA 2W1SA 2R6QA 4S2FA 5FP7A 4LBQD 2D5FA 2WYFA 1D2SA 1VB2A 2GNMA 2JD9A 4XBNA 3CDZB 3TNQA 4Q2FA 2IXJA 1TG7A 5IFTA 3KSCA 5CFCA 4DINB 3CLPA 2WJSA 1V0AA 3VZJA 3QCWA 5FO7B 3OF1A 3Q8BA 5LCWL 1D4M1 3RZZA 4CDWA 1W06A 2QKDA 1QNYA 2Z5WA 4GWJA 2VU9A 2N7GA 1N1YA 4AEDA 2JIGA 3AP6A 1NQDA 3NV1A 4BHPA 5BNPB 3H42B 5FLHA 3WV6A 1OHFA 1FV3A 2WL1A 1ASJ2 2SBAA 1LOFC 3RWKX 1BK0A 3B02A 4IESA 2HWE2 3OUJA 2E26A 2R062 2R043 2DYCA 4RS5A 1AF9A 4XFFA 2XBO2 3POSA 5C3RA 5IATA 2OW4A 4XDQA 3LWCA 2VJXA 4AAPA 5IVCA 1YNAA 1NCRB 4BQ4A 1RUG3 2WFF2 4ZPIA 4AVSA 3SMHA 1TME1 3PIJA 5AFEA 3AZZA 4GWNA 1AR63 3LIGA 3OUHA 4MGSA 3RSJA 3P1IA 4B29A 4QX1A 2E9QA 3A21A 5F39A 5JXJA 4WM8B 5LRSA 2JE9A 4BXFA 1NYWA 4YVSA 5LK5A 1L7QA 1R083 1T6BX 4ZKTB 3PJYA 4RN5A 1EPZA 4QD2A 1VBE1 1RUJ1 4E8CA 4O7XA 2D6KA 5CYYA 5FXVA 2RMU2 4OZOA 1QDCA 5FBJA 1CGPA 4Y5TA 5F5AA 1PO13 5T5PA 3TEWA 5F7UA 1RUI3 3NO8A 2NPIA 2VNOA 4XZUG 4OHXA 4QPGB 1FMD3 3SH4A 1U5YA 2VMHA 5EYXA 4BQXA 4L92A 4MGYE 1DGWX 1UF2C 5FTTC 5FZDA 1LHNA 1OXCA 4JGYA 2PLV2 3ZYJB 4JZRA 4BM8A 2XJUA 2ZX0A 3A0KA 3RJ2X 5A7SA 4X8PA 1K12A 2VCMA 3MF6A 3U10A 3FX3A 4QGNA 4LK7A 3MICA 4TTGA 5KBFA 4QPIB 4QM8A 5JOYA 2OPKA 1HXS1 4M00A 3POGA 5L7OC 3VBSB 1VPHA 4IXLA 1JZ2A 3FHIB 1YWKA 1C1FA 3D3AA 4AFDA 5A6QA 4NWWA 2ZGMA 3ZYGA 2CWMA 1N1TA 5LA1A 3S5AA 1F5JA 3LD8A 4RYDA 2HWD2 2VMIA 5FZHA 3SISA 4TZDA 4DY5A 2ZGSA 3C3VA 4XBQA 4CPBD 5JXGA 1VBA1 2GNDA 2AYHA 1UL9A 1JYCA 5FK7A 5KXCA 3W5NA 4Y1YA 3KV5A 4COZA 5AVAA 2R073 3ALQA 1F4AA 4LA2A 5EJ3A 1P8JA 4OHWA 1VLNA 1RTVA 1MPXA 2D3RA 2Y6JA 1WLTA 2G1MA 4FXGB 3VZMA 4Q26A 1GV9A 1D2QA 4Q4X1 3VDDC 4UI9L 5F3EA 5FY0A 3IWZA 4M4RA 1AL22 1SFYA 1CAUB 2JG9C 2X10A 3OGSA 4EN6B 1PIV1 4A44A 5A7PA 2WS92 3VD4A 4PLNA 1PHMA 4OLLA 5CAZA 2ID4A 1GWKA 2WUHA 2C24A 1BEV1 2HWB2 1ZBE2 2JB4A 4QU2A 4B3NA 1ND2A 4XAEA 1CAXB 4K40A 1NLQA 2ZEXA 3IAQA 3M4FA 3WNXA 1HLCA 1UY1A 4FPHA 4GH4A 3Q8FA 1WCQA 2DWRA 1GQHA 1HRI3 2EA7A 2XJTA 3DN7A 3KHBA 5LA0A 4WM7A 1CD3G 5FJKA 5LATA 5ABJC 3WP4A 4AK3A 1JBCA 5IWFA 1SHWB 5BPXA 2E32A 1HB2A 1IS4A 1YIFA 2LROA 4JX0A 2EXHA 1B35A 1OLRA 3SEPA 2BOJA 3NJYA 4JGZC 2WA3A 2Q1ZB 4RR3A 5GLWA 2ZX2A 4ITCA 2YBPA 3P3PA 5A3NA 5CFCB 4YZ5A 2BQPA 2IUWA 2ZOEB 4CCKA 1LGBA 4AE2A 3WEZA 2YUEA 3THDA 2W39A 4CDWB 1W3VA 2RS31 2WO1A 2QJVA 3ZIWA 1OLQA 2Y6HA 2ZGTA 4KGGA 4AEDB 4CU9A 1OSGA 1JMUB 1NE4A 3K75B 3MV11 4JTNA 4Y5SA 3AMQA 5KXDA 4CXYA 2XVKA 4YFZA 4RHV2 3AYDA 2EXJA 4XHBA 3GGLA 4XXPA 4XCAA 1DCSA 1XQNA 4HMZA 3VL8A 3ZYRA 2D43A 1WBLA 5CFDC 2WZR2 1BXHA 2Y38A 1QGLA 4RS5B 4E4ZA 1VJ2A 3UYJA 3LA7A 1FATA 1HW5A 4TLGA 3A7QA 4X8NA 1JUIA 2RM22 1V6NA 2W9XA 4YZ4A 1W03A 2FZ2A 2ZHKA 3CZUA 4QAWA 2OKXA 1GR3A 5DAWA 1LCLA 2XQRA 2GN3A 3DXUA 2IXCA 3IMMA 2OQ6A 1ZZ6A 4QX2A 1GBGA 2A5ZA 3D82A 2YC0A 3LZZA 1SLCA 1V6MA 4XFGA 4QQ2A 2WSVA 3AVRA 4RFT0 5FLJA 4OFGA 5H9QA 3J7NA 4C0HA 1RVF3 2VZTA 3VD5A 1BBT1 4AG4A 4LBNA 1VBD1 5CB7A 5C8CA 5L19A 1UQXA 4YVSB 4K8RB 1UZZA 2CDPA 1SQ4A 3E6BA 1F9KA 5IT6A 4IEXA 4I0WB 3EHKA 4CVUA 1FOD2 1UOFA 5IVBA 4FPFA 4I09A 5J36A 1AXYA 2BEOA 2OS2A 1VMJA 2ADDA 1LR5A 1S0JA 2ARAA 4GALA 2D40A 4UBHA 5EWSA 4N7UA 4FTEA 2QZ2A 2DUQA 2ERFA 4Q8KA 2IWGB 1DLCA 4FPKA 4BIOA 5LZ6A 3AP4A 1AYN2 3M3IA 4Y22A 4GB32 3VGIA 1J1LA 1G9AA 4AVAA 5C4WC 2Z4FA 3JD72 4LPLA 4AHXA 4MOAA 1JODA 2ZHNA 3JB8A 1R093 2XWJB 4JGYB 4URAA 4QB1A 1RUD1 1WD3A 2WO7A 2OPWA 2XQXA 1W6MA 1LOGA 1X7NA 1Z7S2 4GZ9A 4KWUA 4M0NA 4UFMA 3VDAA 2Q8OA 1C8M2 1N47A 2BNOA 3BIWE 4META 1PGSA 1O3QA 1YQ8A 5CVRA 1ALYA 1OBNA 4XMAA 3SH3A 1QJEA 3TBDA 1TNFA 2WABA 1XE7A 2BJSA 2OIIA 4KBZA 3V0BA 4K6BA 3VZLA 5IVFA 3KMHA 2XJRA 1ZZCA 1IZ3A 1HRV3 2Y33A 1RUF3 2A75A 2Y26A 3KS7A 3QLQA 4P9LA 2P3IA 1ZZ9A 2PFWA 4Z8BA 1RHI3 2DV9A 3VB9A 5D1IA 2DCZA 1D4VB 1QOSA 4PI0A 5B4XA 3ZSLA 1U5ZA 2P34A 4NVPA 4YM1A 5FOJB 1PMJX 3HMYA 4HL0A 2YFUA 3ZX7A 1CAVA 4XFCA 3LSDA 1C28A 2YDEA 4MGQA 4XC9A 2XH6A 4ZU4A 2ZPXA 2P37A 5JSRA 3M70A 2UWBA 3I2DA 2OA2A 3ILNA 1S55A 2PAMA 3GCXA 4MH0E 2VOXA 3AVSA 2X05A 2CGPA 4LO5B 1QJX2 4LMFA 2QZ3A 5DDJ1 3APBA 3O7OA 3ZMOA 3ECQA 2WAAA 5FFOC 5KHKA 2RS53 4ISQA 2DCYA 2XJVA 3A23A 3INAA 1UMHA 1WMXA 5J1XA 1GICA 5FP8A 2VZSA 4FFFA 2VTXJ 4AHZA 4MXVA 3PDQA 3MIDA 1LTEA 3OBTA 5IVVA 1ND2B 1LRHA 1VIWB 3DXTA 3S0MA 1LOAA 3M3QA 2JJ6A 4QKBA 2WIIB 4D7SA 2PN5A 2XGXA 4GH4B 1J3PA 1ULOA 2VQUA 3OYWA 1HQNA 3WF3A 1RYYA 2QNKA 1QEXA 2ZGRA 4MLOA 1IS3A 2X5IC 4WM7B 3PU8A 1GNZA 3GDBA 1XNDA 4H7LA 1ENSA 1GNYA 3FL7A 2DTWA 3HQRA 1AR83 4YFWA 1B35B 3LPFA 4AFBA 2F17A 4RR3B 4HN1A 2HWF2 2JDMA 4B7KA 2WNVA 5DZFA 3S57A 1J84A 3TOJA 2P6CA 3OCPA 3I2GA 3V65A 1EP0A 1FPN2 4H55A 4YVWC 1DQ6A 4PCRA 1XNBA 2PA7A 4WVZA 4E2GA 1K45A 1OKOA 3EO6A 5LA9A 4NHYA 3WSOA 3S6PA 4RSUA 2IXHA 4IQPA 2UU8A 3C8XA 5KHGA 4AAXA 3LKJA 4LEJA 2PLV1 1SLIA 2BWAA 1SFPA 2VOVA 3UKTA 1LHOA 2RE9A 3D5OA 3PMEA 4R4ZA 1UZ0A 3HVDA 1QKQA 3GXUA 4R9BA 2NMOA 3KGLA 3I59A 1KFUL 1MZ5A 2C9AA 4P9GA 3ZXJA 4BPZA 4PHZA 1POV0 3QD6A 3ZYBA 5BNNA 2DVFA 2CHHA 5LBEA 2VG9A 4NHXA 4A7ZA 2WWSA 1R1A3 2JDZA 4E27A 3NW4A 1RL3A 1U5XA 3G7DA 3TB0A 3ENRA 4IUGA 3THPA 2R7EB 3MPPG 4FPLA 1RUC3 3LAGA 4NHMA 4C0BA 2Z69A 3R4SA 1UWWA 1GFF2 4JRAA 2Q4SA 1TME3 4CDUA 5C8CB 3JUUA 3WX5A 1DQ2A 4Q4Y1 4HSLA 3P6BA 5F8PA 3EQEA 4HANA 5F1RA 4V2VA 5EFUA 2R16A 4E9KA 3KD4A 4EZHA 5A80A 1LJ7A 2YBSA 3NQHA 2RR13 4LKSA 3AYEA 3L2YA 1SDWA 3HQXA 3AKRA 4XUOA 5HCFA 4CCCA 3WVJA 4CU8A 3ZO0B 2QQKA 1IS5A 1QY4A 2LM3A 1RUJ3 1W3XA 1QIQA 3KF5A 4GQ7A 4Y22B 5FYZA 2BRTA 3U75A 2CSGA 1W39A 3ES4A 2VECA 5C6CA 1IQDC 3OGRA 3RZJA 5FMOS 1LEMA 4CZSA 5C5TA 1W6MB 1Q8PA 4LR4A 2V5YA 2WQZC 2Y6GA 2W68A 4RL7A 1KD7A 2NQYA 5IFPA 4P5HA 5FOBB 1N3PA 4C8DA 4QPYA 1F5FA 4PLMA 1LAJA 1PVC2 1F31A 3V0BB 3CZJA 1G9FA 4P14A 4U36A 1YYNA 2VW0A 2ADEA 4ZZ8A 3NAPC 4NHLA 4PT6A 3ZVXA 5ANQA 5K0UC 2NP0A 2YGLA 1VP6A 3OG2A 1A8MA 3ASIA 4ZS2A 1V9U2 2VULA 4J1WA 2B5HA 4RA0A 2R0HA 2P2KA 3ZLIA 2ET7A 4NRPA 4Q29A 2QQNA 2WNEA 2ZKLA 3RMYA 1EV12 1WCDJ 3H50A 1UX6A 4JHZA 5ACA2 3CU7A 1XNKA 5J48A 5DAQA 1VBA3 1KJLA 4XETA 1A3KA 5FO9B 2IXIA 1WWYA 4OYUA 3N9NA 3CMGA 3T08A 2VTXA 4KH9A 3VBOC 3IIAA 4UW5A 1QU0A 3W21A 4AQSA 2ETEA 2ZAHA 4CEYA 4HPKA 1QJU2 4JQRA 2B45X 5FRAA 4QX3A 5E1RA 3ZN5A 4OMDA 2ILMA 1GANA 1G9BA 4Q4X3 4HXCA 5BY5A 4CTEA 1ZZBA 4QMAA 4IV1C 3POFA 5A7OA 1LGNA 2E33A 5FZAA 1LKNA 2K0GA 2B39A 1ODMA 4A4AA 5F6LB 1PIV3 4BWOA 1W2UA 1Y4WA 5FYTA 1MQTC 3OYWB 4YM3A 1YHFA 4QXCA 1RUE1 5J98B 2GN7A 1BEV3 5FKCA 3ZXFA 2GU9A 4TWTA 2GP5A 3NNJA 4N43A 1PZ7A 3AP9A 2HYXA 2RDQA 3CIHA 3SCHA 2FMYA 2UURA 3IN9A 2DUPA 4CUGA 2BERA 3D6EA 4I0BA 4RGKA 1SBFA 3RGBA 3ZFEA 4OHVA 3H9AA 1UY0A 1AYM2 2WNVB 2WC2A 1WCUA 2W95A 3J8F2 3VBFA 4BH9A 4FTSA 3OD0A 4KNCA 3MYXA 2EAKA 4PQQA 1V6IA 4GB31 5C3SA 4HK8A 1PZ9A 4O65A 2J1UA 4MX3A 3ZXAC 2XUMA 5FZ7A 2WWJA 1DQ5A 1LNSA 3RZGA 3C2UA 1RXFA 2RG4A 3CJXA 3W9AA 1OA4A 1JXNA 2D6MA 2RS33 1OMIA 3ELNA 2E63A 1YQ6A 2V09A 4AI8A 3I59B 3AP7A 4A2UA 4Q0SA 4E4HA 3WW1A 5CADA 1H6XA 4FO9A 3RVHA 2QQIA 4V2WA 2ZABA 4EROA 5BNNB 2O1QA 3MW4A 3D0JA 1AR92 1TEIA 3ON7A 2A1XA 1G9CA 1JH5A 1QDOA 1TMF1 3FHAA 2P3JA 3K4ZA 3LE0A 4HT1T 2P3YA 2HYKA 3H1YA 3WCRA 2ZJCA 2PHRA 2D44A 2VZVA 3IB3A 3PNAA 4A3XA 4CDXC 1Q43A 1US3A 1O4TA 2YROA 4NIAA 1GWMA 3V64A 2DBNA 5LY1A 1FAYA 3ZSKA 4CDUB 1LOFA 2YBKA 4QGLA 1SZBA 2VO5A 1VAKA 1COV1 1RJ7A 1VRH2 1EYBA 1X33A 3K77A 3N3HA 1NZIA 4HONA 4OUMA 1UU5A 2LUWA 5DUWA 2WN2A 2HH9A 5T55A 2XWBB 1NY72 3KWVA 4XF1A 5DPNA 3U1XA 3UKVA 3DEMA 3BTYA 2WQ4A 2I2SA 1BBT3 3WP3A 1BVP1 1Q8OA 1VBD3 1MEC2 4UFJA 1QJX1 2D98A 4Q4V2 1GQGA 2D5HA 5T3NA 5LBBA 4A45A 1X9TA 5JOZA 1TZOA 3MHZA 2G4IA 1W8TA 4MHUA 3AK0A 4LBMA 2RS11 3VDBA 3WXPA 1ENRA 2X09A 1O3RA 3WQBA 4EYUA 1UPSA 5T52A 5JMCA 4AVTA 4YZ3A 5E89A 3VZOA 3TNPB 5I91A 1SDDB 5BV6A 3OPTA 1ULCA 4JC1A 1W2AX 4XF9A 1PO21 1UW8A 4CP9A 5DABA 4ASMB 3P3NA 1QMJA 4DS0A 1UKGA 4AI9A 2JEMA 3UGFA 1RUD3 2JE7A 2VD7A 3ZYFA 5FY9A 3T2QA 4FAHA 1XOYA 3JCIA 4WVVA 3W20A 4AF9A 3FMGA 4UYBA 3M3EA 3LOBA 4GAZA 2AENA 4I3PA 3ZIXA 5FZ8A 1V00A 3I2HA 3CHXA 3WNPA 1AJOA 3ZN4A 4A6OA 4ES9A 2VCAA 3O1TA 1PGL1 1OC1A 2RV9A 2XLGA 3GHNA 3VLBB 4Q4W2 3ZFGB 5JR2A 2WAOA 4HLTA 5E88A 1QH6A 4CUAA 1ZRDA 1LOEA 4CP0A 1AR71 3AYCA 3ZYPA 4BQ2A 1RC6A 3FLPA 4IEOA 2O0OA 2ZKNA 3VD9A 4XFHA 2FDJA 3ZMNA 1KRIA 2GDFA 3H8UA 1MS4A 5DUUA 5FYCA 2FCTA 1XYOA 2JE8A 3LEKA 5J3UA 5L7OA 3B9IA 4LXLA 3T0AA 3RZKA 3MF9A 5FXWA 4JHTA 1STMA 1ND3C 1R1ZA 3AKTA 5IAVA 2WNUC 4CEYB 5BXXA 1M06G 4HPKB 3JBG2 1NA1C 2EF6A 4BA6A 2EIGA 3NJZA 3WG2A 3NJXA 5AC91 4IE7A 3POIA 1UYPA 1S0FA 2AR6A 2WNOA 2XDVA 5DDJ3 3ZKYA 2DCTA 2AUYA 1H2NA 3FC0A 2E7TA 3MPBA 1XRUA 1I9RA 3U37A 4NROA 2FDKA 5B2GB 1JYVA 1WD4A 3RYPA 2ZEWA 4QPWA 3U78A 1W2OA 4DZGA 2GC3A 3ZXLA 1XYPA 2CV6A 2BGCA 4N43B 3VDDA 1NQJA 4YM2A 2OUJA 4I3GA 2VXRA 3DL3A 1QJY2 4FFGA 1RUH3 2JG9A 1F35A 3ZFEB 4B4RA 2A6YA 1M4WA 2WZPP 3B69A 1OLMA 2ZX3A 5EYYA 5LASA 2E7QA 1QJFA 2BP6A 5HXMA 4XF0A 5KXEA 1ZBA2 3QBQA 3VBFB 5BUVA 1PMIA 4MZUA 3FFZA 3WQ7A 3WDUA 1REFA 4COUA 2R32A 5H9SA 1YFYA 1KFXL 1ZREA 4EN8B 5JIAA 2YMZA 2JDHA 4JKLA 3DCQA 3CKHA 2FHRA 1JOBA 5C8WA 2ZZJA 3OEAA 4UFKA 5ABJA 3T30A 2ZHLA 3DKWA 1ZX5A 3MEPA 5FPAA 1W28A 1I1EA 4LJHA 2B4KA 4O9GA 5FKBA 2VCBA 4ONUA 4AHWA 2K2SA 5CZKA 2BBVA 1RJ8A 4JGZA 5LWBA 4HKOA 2ZEYA 5LEJA 4FPGA 1YUDA 2VVDA 5GLVA 1DG6A 4KWLA 3PVOA 3BPZA 2XHNA 1CPNA 2VUAA 5I0TA 1W0NA 5A1LA 2ENRA 3GBFA 5DQ0A 3GJAA 1S2KA 1MS0A 3IIIA 4IEZA 4UAPA 4XHXA 4Y1VA 2BWCA 2ZXQA 2ES3A 1OQ1A 1HB1A 3UJOA 1CZVA 3MW3A 3SQOA 4Z1VA 5CBLA 5FUPA 1XXNA 3B3QE 4UT5A 1PK6C 1SACA 2DFBA 4JCKA 4IEPA 2VZRA 1FI2A 1VMHA 2P3KA 2ZMNA 3WHTA 1E5SA 4LK6A 2Y6KA 3IKWA 4NMIA 4AGGA 4R8HA 4Y33A 4UFHA 4BMEA 4CDQC 2XLFA 2Y34A 3FLTA 1W6NA 1XBFA 2A6VA 1ACCA 5FBZA 4BQWA 3AKPA 5JOWA 4FOQA 3VHRA 4Q4Y3 2BTVC 4BU2A 4PQ9A 4XUPA 4Z2WA 4HG6B 5BYNA 1YQ5A 1AX0A 3NNMA 4L9BA 3GBGA 1BHGA 3LFMA 4QDRA 3SKJE 3H3ZA 5A7NA 4DEQA 4X6RB 1KQRA 1OH3A 1SLTA 5GZDA 3J7HA 4SLIA 3OOXA 4XQ4A 3ZR6A 1Q3EA 1NKGA 1WLDA 3ILRA 3SNMA 4L11A 1LENA 3SXWA 4P9IA 3ZSEA 4CP9B 5EZWA 2BOIA 4Q0UA 4QB6A 1G8WA 1H2LA 1LECA 1J83A 4PBOA 3FE5A 5B4NA 1KXGA 5IHRA 1DIWA 4DUXA 3M1HA 2RVAA 2ZHMA 1ULFA 5FP9A 3T1LA 3GCWA 5FMDA 2VMCA 4EQVA 1WCSA 3I3BA 3OGVA 5FYIA 3MLLA 2XL9A 2DBIA 3FJSA 3PMSA 4EN7B 2DCKA 2FZ1A 4ORFA 3WP5A 4NPRA 4S2DA 3BN6A 2XLAA 4NPLA 3BKZA 1PNFA 2WT1A 2V4AA 3H7YA 2GP3A 1W90A 3WF4A 1UD1A 1WUVA 5DG2A 1GZCA 2OUHA 2ET1A 4LKDA 4ZZ5A 3WUDA 5C70A 4XQWA 1W8NA 2WT0A 4OI4A 1OT5A 1RMU1 2JG8C 2Q8EA 3ACGA 1DQ1A 2A73B 4GMP0 5L7OB 1GKBA 1LHVA 2HWC1 3LDBA 4MSVA 5CKMA 4CU7A 3HN3A 4ES8A 2P6HA 4ZU5A 1HQLA 2UYBA 1O5LA 3RZHA 1WKYA 3X29B 2EIEA 3AFGA 3FBYA 1Q56A 2ZGQA 3VKOA 3H7JA 1UZYA 4MGIE 4HVQA 1DQ4A 3HQUA 5FZ6A 4IGQA 4AXOA 5HV4A 3WHUA 2BV4A 2V73A 1EAH1 1QOOA 4K9SA 2WT2A 1SPPA 4MO3M 3WP6A 2R042 3VDDB 1UIKA 2W5FA 2X8KA 4XOGA 2R1DA 4IEYA 4XZPA 5DZGA 5IJRA 3KLSA 3DKQA 1WA6X 1CJDA 1UO9A 1RUE3 2JG9B 4XJUA 3I3EA 5FZKA 1UOBA 3OY8A 2DDUA 2DUOA 4Q4V1 1RUG2 3GM8A 1XSQA 4GD4A 5FWEA 4H3WA 4QKDA 4XPVA 2JKXA 2XONA 1YC61 3N9MA 3UK9A 3NWKA 2EAAA 3ST7A 1AR62 1JI6A 3JQXA 1GZWA 5SV8A 2ZAAA 3DECA 5F6KA 2EALA 2X5IA 1R082 1JS9A 5ABJB 3U11A 2UY8A 3WNMA 4BK4A 4NJ4A 4AI0A 1N1SA 2JWPA 3ACHA 2KXLA 3AKSA 3NVCA 3ZXEA 3O1RA 1QQP1 1OPMA 2CAVA 2F4PA 2Q1MA 2VL4A 4LULA 4JGZB 5FY1A 1O8PA 4Q0PA 3Q8EA 1F4HA 5H9PA 1EUTA 1PO12 5SV5A 4DXSA 4JRLA 1C1LA 1W9YA 5HV0A 4Y1UA 1RUI2 4A6SA 1QWRA 4Q0VA 4YVWA 4XMIA 4CEWC 1NT0A 1Y9QA 1FMD2 4QQPA 3E1F1 3BODA 4UW6A 2VMEA 2PHWA 3U4SA 4QX7A 4X6QB 4AW7A 1DZQA 1OFNA 1SG3A 2XVGA 4GJYA 4LO6B 4M3CA 2YPDA 3K4DA 1TMF3 1CR7A 3V56A 4NPMA 1CX4A 1KS5A 1CWPA 4FOWA 5F3GA 3NV3A 3VV1A 4EWAA 3GZUC 4CPBA 1DYKA 2BNNA 5FY5A 2VAUA 3GF6A 1H1AA 3R4UA 4GWIA 5FXXA 4JQTA 3WDYA 5I8TA 1BLZA 3I97A 4D69A 1OA2A 1W6NB 2TNFA 5E8AA 1EPWA 1COV3 3LGRA 4AEJA 4M01A 1F2NA 1X8MA 2VH9A 4IEUA 3TN93 3T1MA 3M8LA 5C3OA 1JZ5A 1JYIA 3H1MA 1IHMA 1VBB1 2J1TA 3HWJA 2BGPA 4BZ4A 1XNCA 2ZX1A 1CVNA 1W6OA 2WYSA 5FDBA 2VOKA 4OQ9A 3KGZA 2R072 2VZ3A 2DCJA 4BISA 3VN4A 3O1PA 3CQOA 1XC6A 2BUKA 1BYHA 2RS13 4Y26A 1HN0A 2WRAA 3JZVA 1NUKA 4ZY9A 4MG2A 3BCWA 3QH7A 1H2KA 4MHRA 4NE9A 2GC1A 1HQWA 2CGOA 2A6WA 1J3QA 1W8OA 4FXKB 5A33A 3MV01 1S4CA 4DXRA 3E5XA 1PO23 4FPJA 2NN8A 3ETQA 2Q0AA 1JZ6A 4YVSC 4QXBA 4S2GA 4V1PA 2G9GA 4MADA 1AHSA 1ZBA1 4P00B 3I54A 3CF6E 4LNVA 1PNGA 5DXDA 4COWA 5BNOA 4COYA 5FZIA 4FQZA 2BU9A 4QB2A 2A6ZA 3AYAA 1VBC3 1HRI2 5FPZA 4YW1A 3ME2A 2DFCA 3WG1A 4N8MA 4JAAA 4IEWA 2LW8A 4HFSA 1NCQC 4PIYA 2BGOA 4XEZA 3T3YA 3VZKA 4DUVA 1YJLA 1XNTA 4CRQA 5FPXA 2JIJA 1AR73 4KL1A 1FXZA 1UPIA 5JSOA 3J9SA 4DRVA 1I5ZA 2MEV3 2C9KA 3HR9A 3WQ1A 5K0UA 2K46A 5FZFA 4LTAA 1N1VA 1E57A 1RXGA 3AXDA 4N9HA 4H2AA 1FV2A 1TNRA 5ERLA 2LS6A 3PJQA 4P9WA 3WF2A 4XACA 2ZS6B 3FUOA 4K20A 3WLUA 3M2MA 2NMNA 1ST8A 3MLJA 3RDIA 4UW4A 2DF7A 2LTNA 1RB8G 1ASJ1 5GLTA 3ZKUA 4CXWA 5AC93 2W47A 2W1WA 4AI2A 3VBHC 2HWE1 1SPPB 2R061 5A7WA 1ULDA 1WW6A 2XBO1 1GYKA 2A7AA 2NM1A 4LOSA 4KU7A 1FNYA 3OD4A 3BUCA 3POEA 3VBOA 4NWVA 2J1SA 3FUQA 3ACIA 2YC2A 3MIGA 3NNFA 5C7GA 4OHZA 3I2OA 1JW6A 3DPRC 3OY8B 4QWNA 2J1EA 5EHDA 3WF1A 4DXTA 3TRSB 2VVFA 2WFF1 4ASLA 4F7ZA 5JI7A 3D4KA 3I7DA 5A6YA 1GWLA 2BYVE 3GALA 4EN9B 4IV1A 4KWKA 2J1AA 4OULA 3VKFC 4OZXA 3UL2A 1DGRN 1GZWB 2HKXA 1RVF2 1MQTA 3VBUC 3RI8A 3VHOA 2X5IB 1W8ZA 4LO7A 1MACA 5BNQA 1W9TA 4IEVA 1XYNA 2VNVA 5F5IA 2ZGUA 4WZFA 5GLUA 1QHDA 5DZEA 3O1UA 2DVBA 2R49A 4QHBA 1TVGA 4B8EA 3HNBM 2A70A 2RMU1 2NZ9A 3LPGA 3NV4A 2OT7A 5JPMB 5LW9A 1W8UA 3POBA 4GKYA 4XAAA 3H1WA 1LHWA 4CCJA 1C4RA 3PVEA 4DXZA 1V6JA 2D7FA 4YVWB 3S5QA 3GYDA 5FK8A 2ARCA 3HT1A 4C90A 4IV3C 4K1ZA 2IXLA 1HV0A 1R092 4H7MA 2W1UA 2I45A 4K21A 4XFBA 1NE6A 1NOVA 2XVLA 4M3CB 4XVHA 5C9AA 1MS8A 1D4M3 4RR3C 4YARA 1KJRA 4A3ZA 2LALA 3FWEA 3WW2A 1UZVA 4JDOA 1HJGA 2IVJA 5FUIA 4AFCA 3ZXDA 3EMRA 1ULPA 5FYSA 1JOJA 5F3IA 1IKQA 1S2BA 4FPOB 1X36A 5LB6A 4CU6A 5IVJA 1MZFA 1J1TA 1MS3A 2PQSA 2VM9A 4AGVA 5JZGC 1HRV2 1JYWA 1RUF2 2HWD1 2DURA 2Y0IA 1LU2A 2WO3A 1D7PM 2E31A 5FYHA 4QKNA 5GKAC 1RHI2 2ZTNA 5HCAA 1LB2A 4TLFA 1JUHA 3PTRB 4YW4A 4CDXA 3O1VA 2XXZA 1WA4A 3RI9A 1W6OB 4FCAA 2UWCA 4DO0A 4CCDA 1C5IA 5FZ0A 4LBJA 3VD3A 1O8SA 3MLKA 3O0XA 1PZ8A 5FJHA 1MS1A 1XU1A 2VZ1A 3WDXA 4AFMA 2PHUA 4FPCA 4MXWA 2AGSA 3C7OA 1QXJA 2UWAA 4IETA 4AI1A 3POYA 1US2A 1X82A 4INDA 5A33B 3O1OA 2GZWA 2WQ8A 3D0SA 4KBBA 1AL21 1IPJA 2VOTA 1VBE3 4W50A 4KI5M 1JOPA 2RS52 2WS91 5C8CC 1WLCA 3C7HA 4KG0A 4LHNA 5AVPA 4D0QA 4NAOA 4A41A 2HWB1 1ZBE1 3ZDVA 4P9YA 2D97A 4YGDA 1YIPA 3LSEA 5FMBA 3KB5A 2GNTA 1O59A 1PMHX 1O6UA 3O0WA 1HB4A 1ULGA 4AVCA 1E5RA 2I74A 4LIUA 5BNOB 4CUCA 3DUIA 3DYPA 1DYPA 2QQMA 4IL7A 5EQUA 3VKMA 5A3UA 2IC1A 3NKGA 4XDOA 1WCKA 5E6HA 4EZ4A 5JWPA 4QX0A 4LIVA 1CONA 5GZEA 3TYJA 1QNWA 4YW3A 1A78A 1R081 3IDCB 3ITQA 4P08A 3Q9OA 1AR82 3HBZA 4KU8A 4XYXA 1FX5A 2VW1A 3TEZA 1F8VA 5FY8A 5C3QA 1CJPA 3U07A 2BPA2 4R9DA 3H8OA 1VALA 4QGMA 3I4IA 1HXS3 4W6XA 3VHPA 5K0UB 4C1WA 3LQCA 5KC6A 1RMU3 2ZMKA 3MBWA 3IAPA 5KWRA 5A3LA 3TAYA 1A34A 2HWC3 1H30A 4YGBA 2VZPA 4YW7A 2O8OA 3B01A 5APAA 1CAVB 2AREA 4YLZA 2W94A 4RHV1 2V4VA 4HOOA 1LEDA 1UY2A 2G19A 1OD5A 4FTBA 2WZR1 5A7WB 3RRDA 4YW6A 3CJIC 3HNMA 5F2WA 2Q8CA 4IERA 4XFIA 5TSWA 1VAMA 3C7FA 2RM21 4ZXKA 1ND3A 4AFAA 4C1XA 2R1BA 3VBOB 1PVXA 2WNUA 1EAH3 1PM4A 5A3PA 5JAXA
chains in the Genus database with same CATH topology
1NA1A 4NHKA 1PGW2 2C0ZA 5HI0A 1DF0A 2GSYA 4A7KA 1R1A2 1CESA 1QH7A 1YJKA 2DVGA 4IV1B 2EXIA 2JICA 1RUC2 1MQTB 1K5MC 1FYUA 3TWIA 4R52A 1G86A 2R071 1TME2 3RYKA 3WCSA 4LT5A 1U5IA 1RGSA 2VQAA 1MZ6A 1JN2P 1FOD1 1YI9A 1O7FA 1T6GC 1WBFA 3ZFFA 2RR12 4LLFA 1V6KA 3J26N 3RYRA 3S7EA 3CO2A 3PVNA 3PVBB 1AYN1 1RUJ2 3EXUA 1QQP3 3O0VA 3JD71 2VGDA 4F83A 1VB4A 1SMVA 4HKLA 5C9AB 5LEKA 1Z7S1 5CIRA 1IGOA 3W58A 1C8M1 1GZ9A 1WLWA 1HRI1 4YGEA 4E2SA 2W52A 4AQ2A 4M3CE 1BMV2 3BALA 4DPNA 3B5LB 4AHYA 1ULEA 3AX4A 2W0XA 2BNMA 4I01A 4DY3A 2BFUS 3VL9A 4XW3A 5F5QA 1HDKA 4L99A 4R9AA 4DFSA 1A6CA 4W6YA 3HN1A 4K8FA 2GH8A 4CDXB 1J58A 3AZXA 4PJYA 4DNYA 5FQ0A 3AJYA 2GMEA 4HZFA 5D8AC 4BCUA 5BNNC 2D6OX 1V70A 1H8TC 2VVEA 1PK6A 3E5UA 1VBB3 1VBA2 2Q30A 4MGZE 2H6CA 2ZMLA 2DVAA 4MXWB 1TQ5A 1SBEA 2YY1A 3MIFA 4CDQA 4LA3A 1ZZ8A 1YO8A 3B9CA 4QT6A 2D93A 3N7JA 4NN0A 4Q4X2 1C8NA 3D8CA 2DU0A 1DBNA 1PIV2 1RINA 4LE4A 2AZ5A 2EVXA 1DU3D 4QX5A 1BEV2 2HEVF 1ZRCA 4YM0A 3ZSJA 4C91A 3JQWA 2HWF1 3AZVA 5AFBA 2BVVA 3G6JB 3IMNA 4RGAA 1FPN1 3USSA 1CPMA 3WDWA 3AMPA 1Q8QA 4LHLA 1RUOA 5JIUA 3ZSMA 1H4GA 2PHXA 4S2HA 3SHRA 3OBRA 1N3OA 2WA4A 1Z0HA 4YW5A 3MI8A 1MS5A 3J4UH 1REDA 4EJRA 2JG8A 2RS32 3B00A 5GZFA 4F8AA 4IEQA 4YSFA 1ZNPA 4W65A 1AXKA 1ND3B 3ZFGC 5GALA 1ASJ3 2WNUB 1IS6A 1FT9A 2HWE3 4Q8LA 1NA1B 2R063 4K1YA 5T5JA 3VBRC 2HEYF 2XBO3 2VOWA 2B46X 2CTVA 3B93A 2E7AA 5J09A 1CQ9A 4E2QA 3LOIA 2WFF3 3LA2A 3WT3A 1ZRFA 1OKQA 4YZ1A 2MHFA 2NYYA 4Q27A 1LU1A 1NZCA 2D6LX 5KC5A 1G6NA 4G9SB 3AMHA 3USUA 2Z79A 4GWMA 1REEA 4MYEA 1BBT2 4B4PA 1OOPC 1G7YA 1VBD2 2GALA 1UMZA 3MGUA 3ZFFB 2GC0A 4KQ7A 1D0GA 5EV7A 2ARBA 5I0RA 1SBDA 2RMU3 2QFEA 5T50A 4JV4A 5J96B 1S0BA 4RQPC 4MV2A 2A3WA 3KT1A 3ILFA 4OI0A 1DGLA 3MIBA 4ZU7A 2X53S 2QUOA 3LA3A 5K8SA 5GZCA 4BE3A 1O3TA 3UV9A 2PLV3 4N53C 4P9XA 3ZN6A 1PVC1 1RUD2 4GULA 5C33A 4GMP1 4PDWC 1MR5A 4XJWA 3CEWA 4CEWA 1DQ0A 1C57A 3AMMA 1S0DA 4AEKA 1V9U1 3WINE 5FQ0B 1Y43B 4RD7A 3BTAA 2HWD3 2K9ZA 5CFDA 2AH2A 1OI6A 1EV11 2OYZA 1PK6B 5ACA1 1WGPA 2C5DA 1IPKA 1L3JA 4W6WA 1VAVA 2RHPA 3BB6A 5EXOA 4Q1RA 5BNPC 4CDQB 3MIHA 4FPYA 1LESA 4YZ2A 1QJU1 2XKOA 4QM9A 1BQPA 2XL7A 5IK7A 1XE8A 1KS4A 4PBPA 3KZ4C 1OFSA 2CWSA 1PGW1 1AX1A 5DDJ2 1R1A1 4WVMA 3N7LA 1AL23 4YYOA 1YLLA 2QDNA 2WS93 3AM2A 1NCRC 1RUC1 3THTA 5JPNB 1UU4A 1DHKB 2HWB3 1ZBE3 2WLQA 4PF5A 5K9YA 2E53A 4EV0A 2YPJA 4TYSA 1NG0A 1UN1A 3RS6A 1SEFA 2UY9A 3FLRA 5I0SA 5J37A 4WM8C 2JXAA 3RNSA 1RUH2 4KGQA 1AYM1 4Y1XA 2ZGKA 4LBQA 4FP2A 3J8F1 2XJQA 2PQQA 3AFKA 3PTYA 2RR11 4MVTA 5C4WA 2ZX4A 4KWJA 2B9UA 3EBRA 2UYAA 5IK5A 2PELA 4CP1A 4MGKE 3IM0A 4EWEA 2ZA9A 4JTOA 4UXAA 2F6BA 4QPGC 3WG3A 4D7YA 4FP3A 1BVVA 1NCQA 2JG8B 4BIFA 4NO4A 3GHMA 2XPJA 4LO8A 4ISRA 1RIRA 1KDKA 3R4DB 1Y3TA 4RHV3 4LUKA 2YV8A 5F9TA 2RJKA 1HX6A 3E6DA 4BOWA 2CL2A 1AR91 1ENQA 3IBMA 1Y7BA 2WZR3 3H0OA 4QPIC 1AX2A 1FNZA 3RWNA 3VBSC 2VNRA 2RM23 5T5OA 3IDEA 1VR3A 1AJKA 4OVEA 1V6LA 1QF3A 3VBHA 1VRH1 1DFQA 3B7MA 1NY71 3USUB 3FZ3A 1YFXA 2W08A 3PLQA 1MEC1 1UU6A 3DPRA 4WV8A 3M7AA 4Q4Y2 1V6OA 2C1FA 2WINB 4PIZA 1FOD3 5KHIA 3CL1A 2FBEA 1Q8VA 4AVVA 1H1MA 2B7YA 2PAEA 1H9WA 4F3JA 3V0AA 2GMPA 2ZGPA 3VBUA 1Q8SA 2P17A 4FT8A 4PIXA 1X8EA 4H14A 1AYN3 4GB33 3JD73 1GNHA 3VKLA 4FVVA 1DZRA 3RMXA 4HK9A 3WUCA 3ZN6B 4CYDA 3OGGA 2A3XA 2A6XA 2BVBA 1Z7S3 4HBNA 5JR7B 3LB9A 1LOBA 1C8M3 2O8QA 4L8QA 4YG6A 3QOPA 1KDMA 3N35A 2IFWA 4CEWB 4K7JA 3FFQA 5DUXA 3SITA 4WBBA 1S0CA 1YXWA 4IV3A 1AVBA 5FO8B 1PM7A 1D0HA 5A32A 1G9DA 4Q4W1 4I30A 1CIWA 5CFCC 5JSPA 4FAGA 3A0NA 1BK1A 1GSLA 5CFDB 4A7YA 4YW2A 4CDWC 3LCPA 1XU2A 1LOCA 3WD5A 4AGRA 4AEDC 5JLVA 1NXMA 5DUVA 4GIQA 3FBMA 5I8SA 1H4HA 1ZYBA 5GJ6A 3DF0A 1ZM1A 2E51A 4DQAA 5JZGA 1W6PA 4Z92B 3JBG1 4KG8A 1DGWA 5JCTA 5JVVA 4RS5C 5GLZA 2XB6C 1TE1B 1H0BA 1QJX3 4WVMB 2IZWA 1QOTA 3BOWA 2ZBJA 2PAKA 3HT2A 5FAXA 5JOXA 2CY6A 3R05A 2R30A 5IK4A 1MVQA 1O4ZA 3VKNA 1QJY1 1KITA 1RUE2 2WSUA 2ZGOA 4L2NA 4Q0QA 4LBQB 2FMDA 2TEPA 4G3YC 5GZGA 5C4WB 4FPEA 1GLHA 2WFPA 3POWA 3CNAA 3JB4C 2HWF3 1U0AA 1JHNA 4LO4B 5CG9A 3H3UA 1OQDA 3O5SA 1FPN3 4OI1A 3OGJA 2HEWF 3RQ0A 1Q5OA 4R4XA 5E16A 3N7KA 4QQHA 1NCQB 4XIOA 2IXKA 1WMFA 4URTA 1IOAA 2VPVA 4JGYC 3NL1A 2XJSA 5IK8A 1POV1 4LHKA 5JDBA 3KCYA 3NAPA 1WW5A 1EY2A 2H0VA 4LLOA 2TUNA 4XIKA 1ONAA 5I8YA 1S1AA 4AQTA 1DGRA 3U0ZA 4MUVA 2I07B 2Y0OA 4M0HA 1I6XA 5L73A 1TMF2 4D94A 3KQRA 3VBHB 4XBLA 4WVWA 3CJIA 4QQLA 1CAWA 3BU7A 3QACA 3MIEA 1I3HA 4GA9A 2XJPA 3WZ1A 1OPOA 2GH2A 4PLOA 4YGCA 3DPRB 2A3YA 2PHFA 3R6SA 3ZPYA 1COV2 4YG3A 3WG4A 4AI3A 3TN92 3K51A 3B94A 2ARXA 1YRZA 4LBOA 3N4MA 1O5UA 4LE3A 3R0RA 3ATGA 3V0AB 3VBUB 1K5MA 3VUOA 5LK7B 1LODA 1S0EA 1W6QA 2RS12 1J3RA 4DRRA 2KA3A 4D3WA 1ND2C 5CG8A 3IT8A 4GH4C 3SH5A 4XF3A 4Y4YA 2VMGA 1AXZA 1PO22 2PHDA 3AJZA 3IDBB 4UBGA 4WM7C 4M3CF 3ZXGA 1RUH1 2ZGNA 2H0BA 4JDNA 3NKTA 5CU1A 4HSJA 3E5QA 1B35C 4Z07A 1PVC3 3WOGA 4ATFA 4IV3B 4GMP3 1AL0G 5A32B 3BOPA 2PTMA 1SCRA 3AMNA 3MW2A 3VHNA 1VBC2 5T54A 1BZWA 1HIXA 3ROUA 3GBWA 3KCXA 1V9U3 1PGL2 2BW8A 3GNEA 1ZZ7A 3N7MA 3WY6A 4DMIA 1ENXA 3NSTA 1AR72 5KHHA 2D3PA 1EV13 5FMOL 5JZGB 2MEV2 1W6PB 3E6CC 5ACA3 2JECA 2Z2SB 3ZYIB 2WLPA 4JVAA 1UCXA 4GKXA 1QJZA 1QJU3 5D8AA 3URFA 1OQEA 4RGGA 4O9EA 1H8TA 2YXSA 3AZYA 5AC92 4YRDA 4Y5Z0 5I0UA 4XJ9A 2GAUA 2R041 2R0FA 2ZZQA 3MFAA 3QH6A 1A8DA 3WDTA 5K7PA 4BLJA 3U4XA 2ZCWA 2YHJA 2GNBA 3DGTA 4FBFA 1BJQA 5KHJA 1RUG1 3DV8A 4HVRA 1RUNA 4AWDA 2H6BA 2YGMA 4OI2A 3L9JT 3N36A 1AR61 3IPVA 1U12A 5FREA 1AYM3 2VQ0A 1ZA4A 2KM2A 3J8F3 3GZTB 2OZJA 3HIFA 4AEMA 3GZAA 1YI7A 3WW3A 3HAGA 3T2TA 1SLLA 4FOVA 5BNOC 1JTZX 3NV2A 3NAPB 1PO11 2VUJA 1RITA 4GXLA 3W59A 1NXD1 1RUI1 1SCSA 4BMBA 3SCGA 1UKRA 1FMD1 2Z42A 1N3QA 5L36A 1QXRA 4YG0A 4L97A 4CP2A 4P9JA 4YNIA 1SLAA 1AR93 1D4M2 2A71A 2RJLA 4BYYA 4N7IA 4XJ8A 4DB5A 3CJIB 3UJQA 1CAWB 4DOUA 4J1XA 3ZFGA 1HKDA 3AKQA 2GC2A 4N90A 4Y20A 4EWDA 2YZ4A 1H8VA 5HCBA 4LBLA 2Q5TA 1VRH3 3VBRA 2OVUA 1O91A 1C3HA 2CAUA 3VZNA 3HD8B 1MVEA 1MEC3 1BCXA 4N9IA 3AZWA 4Q4V3 4AVBA 1K5MB 3I8TA 4Z82A 5T5LA 1MZEA 1URXA 1H1IA 1W6QB 3KCCA 3M3OA 2BFUL 4XQDA 4XJAA 2D6PA 4G4FA 4Y1ZA 5HXVA 2VW2A 4E4SA 2QCSB 1OOPA 1W0OA 5JI9A 1BKZA 1H9PA 3AB0A 1VBE2 1S0GA 3ACLA 4HKWA 1WMDA 4XTMA 1DLLA 2D6NA 5LRRA 4NOTA 1AUYA 4RQPA 4AQ6A 3ZXKA 3UKNA 2WNVC 3E97A 1QXPA 4Y24A 1DZTA 4OUSA 3WW4A 1W0PA 1OA3A 1YFUA 4N53A 4Q4W3 1WMEA 3M3CA 2DU1A 4I0AA 1APNA 4PDWA 3WR0A 4COVA 2JKBA 1WW4A 1WW7A 5C9AC 3OTFA 1HXS2 3KT7A 4FQ4A 4AYUA 4BLIA 2SLIA 1RMU2 1Z78A 2OZ6A 4LUMA 4XILA 2HWC2 2QDRA 2QE3A 2D3SA 4QXKA 2VY0A 4SBVA 1X50A 3WDVA 3OPZA 5D8AB 3JBG3 1ZRRA 3S30A 1H8TB 1SFNA 2QQPA 3RG0A 5KXBA 5BNPA 5J7MA 4XXAA 5DG1A 3KM5A 5GM0A 3S7IA 1EAH2 2DVDA 4CDUC 1UAIA 4HETA 1H2MA 2X29A 3OJBA 1QJY3 3IPVB 3AXEA 4FOYA 4XTPA 4Q1PA 3RJRA 3ES1A 1RVF1 3SCFA 1NCRA 5IUQA 1ZBA3 2MPFA 1B09A 4J6GA 2CYFA 1ZVFA 2QVSB 3MFCA 1O4YA 2EXKA 4XJZA 3L2HA 4R9CA 1MS9A 3KT4A 1YFWA 4WM8A 4HN0A 2B8MA 5CNAA 2XHKA 2DTYA 4NR1A 4U2AA 1LULA 4ATEA 4QQOA 2CGNA 1QQP2 1YCIA 5FCCA 1POV3 4OHYA 3RPQA 1R091 5HBAA 4TSVA 2ATFA 2XKPA 2ZACA 1DDLA 4QPGA 2PHLA 1VBC1 1UIJA 5FLIA 2YYOA 2XG3A 4I02A 3PHMA 5CA6A 2IFRA 4WZCA 4JDMA 4Y20B 2GMMA 1HRV1 1S0IA 1RUF1 2ZGLA 3VBRB 4QPIA 2G9FA 1LHUA 2MEV1 2TBVA 3JU9A 1RHI1 1C5HA 3VBSA 4I2OA 4XF4A 4CEYC 4B7EA 2PYTA 3WQ0A 1IKPA 3ZDSA 2FQPA 1NLRA 4LBKA 3EJKA 1VBB2 2JD4A 2JENA 2CNAA 3AP5A 4FSJA 1J59A 1OOPB 1CN1A 1SLBA 4D7TA 2RS51 4BQ1A 5I93A 4N43C 4XFAA 1HV1A 2JX9A 3O12A 5H9RA 3SLIA 4RQPB 3ZFEC 1CAUA 1IQAA 3K48A 4HVOA 1NLSA 2MNGA 2E6VA 2PHTA 3ZFFC 1LGCA 2HJIA 1AZDA 5A3MA 4K3UA 3VBFC 2B42B 3A4UA 4XE9A 1CAXA 3O14A 4UW3A 3MZHA 2WKKA 4N53B 1AR81 1O3SA 2VNGA 4PDWB 3MDPA 4E4DX 2NLRA 2R6QA 4S2FA 4LBQD 2D5FA 1D2SA 1VB2A 2GNMA 4XBNA 3TNQA 4Q2FA 2IXJA 3KSCA 5CFCA 4DINB 3CLPA 2WJSA 3VZJA 3QCWA 5FO7B 3OF1A 1D4M1 3RZZA 4CDWA 2QKDA 1QNYA 2Z5WA 2VU9A 2N7GA 1N1YA 4AEDA 3AP6A