3AXEA

The truncated fibrobacter succinogenes 1,3-1,4-beta-d-glucanase v18y/w203y in complex with cellotetraose (cellobiose density was observed)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
241
structure length
234
Chain Sequence
MKDFSGAELYTLEEYQYGKFEARMKMAAASGTVSSMFLYQNGSEIADGRPWVEVDIEVLGKSPGSFQSNIITGKAGAQKTSEKHHAVSPAADQAFHTYGLEWTPNYVRWTVDGQEVRKTEGGQVSNLTGTQGLRFNLWSSESAAWVGQFDESKLPLFQFINWVKVYKYTSDFTLDWTDNFDTFDGSRWGKGDYTFDGNRVDLTDKNIYSRDGMLILALTRKGQESFNGQVPRDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-glucanase
publication title Rational design to improve thermostability and specific activity of the truncated Fibrobacter succinogenes 1,3-1,4-beta-D-glucanase
pubmed doi rcsb
source organism Fibrobacter succinogenes
molecule tags Hydrolase
total genus 56
structure length 234
sequence length 241
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3axeA00
3UK9A 1H9WA 2NMNA 4Y24A 3AP4A 3A0KA 2AH2A 3QCWA 4XHXA 5LK5A 5DZFA 1GKBA 1JHNA 1RIRA 2D6NA 3ZVXA 1S0GA 3IPVB 5H9RA 2ZGLA 2YY1A 4KBBA 3WHTA 4UW3A 3D6EA 2I2SA 3CNAA 1SCSA 2OUJA 5DZGA 1V6OA 5KXDA 2PHUA 1TEIA 4M3CE 1WUVA 1VAVA 5EWSA 3WNXA 3WZ1A 1WBLA 3D4KA 2PHWA 3INAA 3RS6A 3AZYA 1DBNA 3WG1A 2D6OX 3ZXFA 3RQ0A 1DFQA 2JDZA 1BYHA 1V6MA 4YGCA 1WLCA 2ZGKA 5T54A 2WLQA 2AUYA 1CN1A 5DUUA 5DG1A 3BIWE 4M01A 1FV3A 1H30A 5JOWA 2GALA 5EXOA 5CA6A 3M1HA 3SH3A 1UL9A 5IK4A 3USUB 3NV2A 4ATFA 2GNDA 1DQ0A 1WW6A 5EYYA 4YM1A 5GLUA 3O0VA 1IS4A 3WV6A 3WG4A 1G7YA 4M3CB 2A71A 2FHRA 4Y1UA 3IKWA 4FQZA 3RSJA 5JLVA 3WOGA 1QGLA 5GZGA 5T5OA 1QKQA 2ZGPA 2DWRA 5GLTA 2ZGUA 3AP6A 2W39A 1LU1A 3AJZA 3ATGA 2C5DA 3M3CA 5T50A 2A3XA 4WVWA 3WG2A 4R9CA 2A70A 2DU0A 4U36A 3ZSMA 3T1LA 4XJAA 2XG3A 4LBNA 1YIFA 2ZMKA 1AVBA 4GALA 2R1DA 3O12A 4YFZA 3DUIA 4JRAA 4Y20A 3V65A 4YZ2A 1C4RA 1IS3A 3I4IA 5CBLA 2SBAA 4XJWA 1V6NA 1QU0A 5HCAA 1Q8OA 2DVFA 2WT1A 3OPZA 4NO4A 1CONA 1D0HA 1DYKA 2DTYA 3OY8B 5GZFA 4DPNA 3N3HA 1GZWB 3N7LA 3OBTA 2A3WA 1N3OA 4P14A 3PJQA 1LU2A 2E6VA 1I1EA 2VU9A 4H55A 5JOZA 1GNZA 1ULGA 1GLHA 2ZKNA 2ZZJA 4UW5A 1WBFA 3VKOA 3I8TA 4Y22B 1S0IA 1ENRA 2G4IA 3OGGA 2ZHKA 4YW3A 2ZA9A 4YG0A 4GXLA 3SNMA 4CZSA 3WDWA 3WUDA 4XJ9A 3WDYA 4Y20B 1BQPA 3MEPA 2JE7A 1DQ6A 2DYCA 4BOWA 1VLNA 1W6OB 2DVAA 1MS4A 4YG3A 3POSA 2P37A 3PMEA 5AVAA 3W58A 1IOAA 1J1TA 1ENQA 2JD4A 4FVVA 2JJ6A 3SH4A 4BLJA 1MACA 4TYSA 2ZGQA 4RA0A 4U2AA 3VKFC 1LHNA 2GMEA 3IPVA 2A6XA 4FOVA 2GNTA 4XDQA 3AXDA 1PZ7A 4NOTA 5GZDA 1X50A 2AENA 4ISQA 4XTMA 4LBLA 1YXWA 1V6JA 3ILFA 1AXYA 1SLTA 2E51A 1LGBA 4LBQA 3UJOA 5KXBA 5E89A 1S0EA 1PZ9A 1V6IA 1LECA 2ZMLA 3RMXA 2GMPA 3M3EA 1KJLA 1QDOA 2UWCA 1LOFA 1N47A 4YZ5A 5SV8A 1LJ7A 1MR5A 1UX6A 3NWKA 3GALA 5HCBA 4SLIA 3HR9A 2A3YA 1D2SA 1LHOA 4W65A 5T55A 4FPFA 1A3KA 2ENRA 1WLWA 2AR6A 3USUA 3N7KA 4AGVA 1JN2P 1AX0A 3NV4A 5F5QA 2P34A 4ASMB 2AREA 4Z8BA 4D69A 2GMMA 1N3QA 2DVGA 4M3CA 5GJ6A 1S0CA 4ISRA 2W08A 4YGDA 1DYPA 1IKPA 1DQ4A 3M3OA 2DUPA 1SFYA 2GNMA 4Q2FA 4YW2A 3ZSKA 5KXCA 2EXKA 4LBQB 3JUUA 2LALA 4FOQA 1AX1A 5DZEA 5JDBA 4XMAA 2D3RA 1CVNA 2ARXA 2TEPA 4XBLA 1G9FA 4Y1YA 4OZXA 1F31A 1KDMA 1O4ZA 5T5PA 3W59A 4DRRA 5IK5A 3B69A 5DUWA 4FPKA 4C1WA 3AZWA 4FOWA 3AYAA 1AF9A 5GLZA 1KJRA 1LGCA 4FP2A 1CJPA 1JOJA 3MW3A 4YW1A 4CRQA 2CYFA 2PHFA 1KITA 1MZ5A 1ULFA 3UJQA 2A6YA 4LBOA 2AGSA 1FAYA 5IK8A 1MS3A 3IN9A 3OY8A 1IKQA 1AXZA 4Y26A 1MS9A 1GZWA 3KQRA 1G9CA 3BODA 1Z0HA 3RG0A 5JOXA 4BLIA 3V0AB 1V6LA 4GKYA 5GLWA 1QDCA 4I30A 4LBMA 3VKNA 1A78A 4C1XA 4HL0A 4XXAA 3VUOA 3N35A 4XIOA 4R9BA 1LEDA 2DV9A 2UURA 1AZDA 1GV9A 4Q26A 4Y22A 1W6PB 1N1SA 3FUQA 1JW6A 4Y1ZA 4XJUA 2OW4A 5CB7A 5HCFA 1OQ1A 2ZBJA 1N1VA 3ENRA 4FPOB 1GZ9A 3JU9A 4YFWA 5GM0A 3O0XA 1AXKA 3M3QA 3R4SA 5FREA 1IS6A 4UW6A 1FYUA 3FBYA 1LGNA 4LBKA 5IT6A 2UWBA 3V0BB 1N1TA 1AJOA 1W6OA 2D6MA 1RITA 4FPLA 3T1MA 1JYIA 1Q8VA 1G8WA 1LOGA 1W0OA 2V5YA 2R16A 3RMYA 2ZGOA 3WDVA 3MPPG 4AVSA 1QF3A 2WT2A 3WDXA 3LSDA 1UZYA 4XOGA 2R0HA 4DS0A 5JMCA 1HDKA 1C57A 5T5LA 3DGTA 2EIGA 2CTVA 2ZGRA 5H9QA 3SISA 2NM1A 3VKMA 4XYXA 3ZSJA 3B00A 4YZ1A 4FPJA 1JUIA 3POYA 4XXPA 2SLIA 4GA9A 1W6QB 2VH9A 3ASIA 4PF5A 4Q8LA 4XILA 5JVVA 1QMJA 1GNHA 4DFSA 4Q27A 1JBCA 4AWDA 4XJZA 2W68A 1BZWA 2DURA 2WT0A 1WW4A 1MS8A 1PZ8A 2ZGMA 1CPMA 1DGLA 3PVEA 1GANA 1ULEA 2WKKA 4L8QA 2ZGTA 1BKZA 1ULDA 1YO8A 1LHUA 3N36A 2VW2A 4AGGA 1JXNA 1SLCA 2NP0A 2DVDA 1NLSA 1WD4A 4LBQD 4YLZA 3ZPYA 4BPZA 4F83A 4GWMA 1FNZA 2E53A 1G9DA 4P9XA 4XZPA 4P9WA 4YW5A 2D43A 3ZSLA 2PHTA 3VV1A 1AJKA 2P3KA 2UU8A 1VAMA 1WCSA 3QLQA 3H0OA 4YM0A 3HMYA 1FATA 3OYWB 4UW4A 4FPHA 2DU1A 1HQLA 3D5OA 4JCKA 1O4YA 3WDUA 1V00A 2EXHA 3N7JA 3FFZA 4MYEA 1C1LA 4WZFA 2D44A 1ENSA 1WLDA 1BJQA 1UAIA 4Q8KA 1CR7A 3WDTA 1LESA 1S0DA 4XBNA 1QOSA 4Y1XA 5DUVA 5IUQA 3WUCA 4AVVA 4BMEA 4XMIA 3LCPA 1SBDA 4XHBA 3AXEA 1Q8PA 2WSUA 2D3PA 4FPEA 3WG3A 2NZ9A 4XE9A 3FLTA 2VXRA 1Q8SA 3C2UA 2AYHA 1S0BA 3ZXKA 3AK0A 4AVTA 3WVJA 2ERFA 3O0WA 1ZA4A 4R9AA 4RL7A 2KM2A 5T5JA 3WCSA 4BM8A 1WD3A 3AZXA 2YV8A 4YZ4A 1DQ5A 4ATEA 4TZDA 2A6WA 3WHUA 1APNA 3BTAA 5GLVA 3V0AA 1SLIA 1LENA 1N1YA 1ONAA 3AP7A 4FPYA 5T52A 4CTEA 2P2KA 3MW2A 4GWNA 1UZZA 1QNYA 1V6KA 2YXSA 2OUHA 3PVOA 1SBFA 1URXA 2EALA 4YG6A 3BOPA 1W6PA 3ILRA 4DRVA 5JOYA 2C9AA 2YZ4A 2ZHMA 2VY0A 1FX5A 4Q1PA 5GZEA 4AGRA 2Z42A 3WCRA 2PHXA 4AYUA 2VUAA 4FQ4A 3WLUA 1KRIA 3B3QE 4P9YA 4YGEA 2D3SA 1S0JA 2EAKA 3AX4A 4FP3A 1WW7A 2W52A 1GSLA 4FPGA 4IQPA 4YGBA 1SBEA 4FPCA 2XB6C 4PBPA 4R9DA 3V0BA 2DVBA 2BQPA 2ZHLA 1OFSA 1LCLA 3ZXEA 2HYKA 1DQ2A 1UMZA 3AP5A 2P3JA 1LOCA 3NV3A 1W6MB 3KM5A 5H9PA 5DG2A 3U4XA 2DTWA 1Q8QA 3AFKA 5CAZA 2D6PA 1W6NB 2A5ZA 1HQWA 4K20A 3PVNA 1LOBA 2WQZC 3OJBA 4M3CF 2VW1A 1MS5A 2E7QA 1UKGA 4YM2A 5H9SA 1F5FA 3ZYPA 2FMDA 4FOYA 1GBGA 2JECA 1MVEA 5IK7A 4YZ3A 3FUOA 2R49A 1W6QA 3IMNA 3NV1A 3AJYA 3ILNA 1LOEA 3R4UA 4ZKTB 5E8AA 2NMOA 2JE9A 1IS5A 3M2MA 1AX2A 4M00A 1MVQA 1OKQA 2ZACA 4K1YA 2UWAA 2WSVA 1I3HA 5BYNA 1SCRA 1JYCA 4PCRA 3T2TA 2V73A 1UPSA 2A6VA 1N3PA 1HLCA 4Y1VA 1EPWA 3AZVA 1DZQA 1HKDA 5KXEA 3HN1A 1YYNA 2EXIA 4BQ1A 2R1BA 2ZGSA 1VIWB 5CNAA 1DIWA 1R1ZA 2EXJA 4WV8A 1Q56A 1BXHA 1Z78A 1GYKA 2PELA 3A4UA 3SH5A 2Q5TA 1LTEA 2YMZA 4Q1RA 1ULCA 1Y7BA 2GDFA 1GICA 3Q9OA 3OYWA 4XIKA 5F9TA 2ZAAA 1FV2A 3AZZA 2ZGNA 1SLBA 3B9CA 2ZABA 3ZXJA 1LHVA 2CY6A 3B01A 3R05A 4PBOA 3RRDA 3APBA 1CQ9A 2CWMA 2WJSA 4BMBA 1G9AA 1H9PA 1U0AA 1SLAA 3AP9A 2H0BA 1DHKB 3UL2A 1LODA 2B7YA 1RINA 1S0FA 1YRZA 2ES3A 3IM0A 4PQ9A 1LEMA 3TAYA 1A8DA 2ARBA 2CL2A 5E88A 3TB0A 3LSEA 3L2YA 4YW4A 2LTNA 4HANA 2A7AA 4XJ8A 3FLPA 2GN3A 2EF6A 1LOFC 1DLLA 4DQAA 4XBQA 5DXDA 1F9KA 3FLRA 3ZXLA 2A75A 3AYCA 3ZYRA 2P3IA 4K21A 5DUXA 2ZMNA 2GN7A 1SLLA 4K1ZA 1QOOA 2VW0A 2YROA 5L73A 3OBRA 4ZXKA 2D6LX 2D6KA 2ZHNA 3SITA 2JKBA 3MW4A 1G86A 1YI7A 3O5SA 2R0FA 1B09A 2DUOA 1NXD1 3VKLA 5GZCA 1KQRA 1C1FA 2E7TA 5FRAA 3N7MA 3V64A 1LHWA 5GALA 5EYXA 1CIWA 2D7FA 2CNAA 2NYYA 2CWSA 3GNEA 4LBJA 3AYDA 2PHRA 3POWA 3SLIA 1G9BA 1SACA 4GKXA 1MZ6A 4YM3A 1VALA 1QOTA 1MS0A 2NN8A 1WW5A 3AYEA 1GZCA 1W6MA 2DUQA 2RHPA 2WNEA 1FNYA 4JC1A 1CPNA 1QNWA 1LOAA 1W6NA 1MS1A 1W0PA 1LULA 1XQNA 2GNBA 1DQ1A 1S1AA 1KDKA 2OVUA 4XTPA 1CESA 3A0NA 2A6ZA 4ITCA 1ZM1A 4WVVA 1UN1A
chains in the Genus database with same CATH superfamily
4D6SA 4IUGA 5FMOL 1H9WA 2NMNA 3VLBB 3A0KA 4XHXA 1F4HA 4HKWA 2QCSB 2WA3A 1S0GA 5H9RA 3LPGA 1YFUA 4KBBA 2AACA 3Q8EA 4NN0A 5FKCA 4UW3A 5FYYA 1UYZA 5C5UA 5ANQA 1DF0A 2OUJA 2Y64A 5DZGA 4CCLA 1E5IA 5EWSA 2XR4A 3ZLIA 5A3TA 5FXXA 1B35C 4RQPC 3RS6A 3INAA 3AZYA 4CU9A 1YFXA 4NHMA 3WG1A 3N9NA 3H7YA 2XONA 1DGRN 3IDAA 5A32B 4E4SA 4Q0PA 1DFQA 3B7MA 3N9QA 2QDNA 3H7JA 4HBNA 1WLCA 4CP9B 2Z69A 4HKLA 1GR3A 2XJRA 1CN1A 4FI9A 5D21A 5DG1A 5DUUA 2XJPA 3MIGA 4AQSA 2GC3A 2WZPP 2WS91 1UL9A 2C24A 5FLIA 3USUB 2GAUA 3NV2A 2OX0A 2GNDA 1XE7A 3ACGA 1WW6A 1VBB3 4NAOA 4NMIA 1COV1 3ES4A 3O0VA 5F2WA 5FYIA 3UNPA 3AC0A 4Y1UA 1QJFA 3IKWA 2J22A 2NPIA 5L9BA 4JKKA 3TRSB 1PO22 3SCFA 4AI3A 1U5YA 5LEJA 2IXCA 5LY1A 5T50A 3J7MA 4PDWA 1ZBE2 3RYPA 3USSA 2XG3A 4MOAA 3D0JA 4XFCA 3M3IA 3MF6A 4NPLA 1YIFA 3NNGA 5CVRA 2KXLA 4LLFA 4MGYE 5BY5A 3ZO0B 1H2LA 1BBT1 2RE9A 4JRAA 1OQEA 2W9XA 1C8M2 1IS3A 3WF0A 2SBAA 4XJWA 1QU0A 1COV3 1OMIA 5HCAA 2DVFA 4KWUA 2WT1A 3OPZA 3OY8B 2YHJA 3N3HA 5J1XA 2VTXA 1OI6A 5JSRA 4MXWA 1I1EA 2J1TA 1GNZA 3CJIB 1GLHA 2IXLA 2YU2A 4LJHA 5FZ1A 4AI0A 4EWAA 1WBFA 2YFUA 3ORJA 4KG8A 3VKOA 3VDBA 1NE4A 3NJXA 5F5CA 3UGHA 1AR71 4AOCA 3MIDA 1W8OA 1RMU2 5A3MA 2W1SA 2W5FA 3SNMA 2YGMA 4ASLA 2PN5A 2V72A 4B1LA 5IAVA 4CZSA 1K12A 2A73B 3WUDA 1BBT3 4Y20B 1BQPA 3TNPB 2QQIA 4A4AA 2ET7A 2DYCA 4BOWA 4CDQC 1VLNA 1W6OB 4IEOA 4YG3A 4Z2WA 3K4AA 2P37A 2C26A 2I45A 2AEYA 4XPVA 1NUKA 1HRI2 5C4WC 4Q0SA 3S7IA 1X82A 3QACA 2WO2A 4QDRA 1MZFA 4U2AA 2HEYF 3D8CA 3LA7A 4I0WB 3JQWA 3IPVA 4FOVA 5HXVA 4H3WA 4NOTA 1PZ7A 5GZDA 1VRBA 1X50A 3I7DA 2VQUA 3RWKX 3SC7X 4WM8C 4MGSA 1SFPA 4XTMA 1CGPA 3POGA 1AR73 1YXWA 2Q1ZB 1SLTA 3ILFA 4LBQA 2JG9C 4BQXA 1W9TA 3I49A 3HIFA 1SPPA 1V6IA 1LECA 5B4XA 5CADA 3TEZA 3M4FA 1QDOA 4DEVA 2CGNA 3A7QA 2ORXA 2RS32 3V56A 1LJ7A 1MR5A 3NWKA 4KWJA 2R072 3UKNA 1AUYA 3ZFFA 4XF4A 2A3YA 1CX1A 1J3RA 1JYVA 1C3HA 5LY2A 2B39A 1O8SA 1W2OA 2R7EB 2WWJA 4AGVA 5FQ0A 4MGTA 5F5QA 1D4VB 4H14A 1H2MA 4YW6A 4Z8BA 2HWE2 5D8AA 4D69A 5BNPB 3MUZ1 2OZ6A 2ZEXA 3E1F1 5GJ6A 5L7OA 4LE4A 1LRHA 1OA4A 3DYOA 4Q2FA 4LTAA 5F3IA 2H6CA 2EXKA 2BGPA 1E5HA 2D3RA 2XVLA 4XBLA 4OZXA 2LW8A 5CISA 3W59A 5IK5A 4DRRA 4J6GA 5DUWA 4AEJA 3VBHC 2FD8A 4FPKA 1OXCA 4C1WA 2C6SA 3AYAA 1AF9A 2BV4A 4XFAA 1LGCA 5D1IA 1JOJA 3ST7A 4EZ4A 3ACIA 1RHI1 2IXHA 1XYPA 2VOVA 3H1MA 2GC2A 3K4ZA 3MYXA 3VDAA 2IXJA 4PDWC 1RC6A 4ARYA 4AR2A 4LBOA 2P6HA 2AGSA 2J1SA 2QFEA 3LEGA 4DNYA 3PURA 1H8VA 4GMP3 2B9VA 1TQ5A 3RVHA 4P5HA 3AB0A 5GLWA 3B93A 1A78A 4HL0A 4O61A 4XXAA 3VUOA 3MDPA 1NE6A 2JIGA 1GQHA 1GV9A 3E5QA 4XCBA 1PX3A 1W2UA 2JG9B 5D2AA 4R4XA 4CU6A 3ACFA 1NCRA 4E4HA 4XJUA 5A3NA 1CAUA 4QPYA 5HCFA 1RUD1 1QH6A 2ZBJA 1N1VA 3HJRA 4YVSA 3JU9A 4BH9A 1DCSA 5GM0A 3BPSA 1RHI3 5FREA 4QKNA 5EPAA 1FYUA 5FZBA 5FZ6A 3JBG2 3RZKA 1IQAA 5LBCA 1AL0G 4EV0A 1Q3EA 5G05L 4NAMA 1UXXX 1W8FA 1KFXL 2RR12 3C7HA 1W0OA 4BQ4A 2R16A 4ZY9A 2ZGOA 5JPMB 1QF3A 4KWLA 5BUVA 3RJ2X 4AEDA 1Z7S2 3GBGA 1VAKA 1UZYA 1YQ2A 2F4LA 3LA2A 5I0RA 5JMCA 2WC2A 1HDKA 1C57A 4QB1A 5T5LA 2EIGA 1CIYA 4CEYA 2DCZA 1J1LA 2XHNA 3ZSJA 4YZ1A 5A70A 3VKMA 3TEYA 4XYXA 3UKVA 3RGBA 4A2UA 5APAA 4LKSA 3FE5A 3W5MA 2WN2A 2SLIA 2RJKA 3AKTA 3ASIA 2G1MA 5JVVA 4DFSA 4I0BA 1JBCA 5DQ0A 1ND3A 1RUD3 2RS53 4XJZA 5FO9B 3MGUA 1BZWA 2DURA 2ZX1A 3VBHB 5FPBA 4AF9A 1DG6A 2C9KA 1FOD3 1CPMA 1DGLA 1PZ8A 1ULEA 2WKKA 3H3ZA 3WF1A 5I8SA 1BKZA 4UWDA 3ROUA 5A7SA 3R6SA 1LHUA 1QQP1 1SLCA 1TNRA 4LBQD 2WUHA 3FHAA 3LE0A 2GSYA 5DN2A 5FZDA 4BPZA 4F83A 2JDPA 5JPNB 3LWCA 1FNZA 2OQ7A 4BB3A 2HBUA 4P9XA 1V9U2 2VMFA 5FYTA 5I93A 1ZZ8A 3UYJA 1O6UA 2RJLA 3JXSA 3ZSLA 4D6RA 1IPJA 1OKOA 4Z2AA 3C3VA 4CEWA 4CYDA 4JGZB 1NCQB 2VL4A 4OUEA 3T2OA 3U75A 2JX9A 4IV3A 1RUJ2 5IJRA 4BQWA 3ZFFC 3O14A 4FPHA 4R4ZA 5FZLA 1JU3A 4QU1A 3GZUC 2WO1A 4JCKA 2XBO1 2YU1A 1R081 3U1XA 1A6CA 3K2OA 3I2JA 4QQOA 3FFZA 2G9ZA 4MYEA 1JYXA 4HXCA 3LF7A 2FDJA 2QQJA 5D8AC 4LOTA 4WVVA 3S6PA 5L7OC 1S0DA 1QOSA 4BMEA 4G3YC 1QQP3 1BVP1 3OGSA 1O5LA 4COUA 4D7SA 3LCPA 4YRDA 3IDEA 4XHBA 2WO7A 2D3PA 3WG3A 2NZ9A 4XE9A 2XH6A 1XSRA 2VXRA 1PK6C 1Q8SA 3C2UA 4HFSA 3H8UA 4P02B 3ZXKA 5LA2A 4COWA 3WVJA 2FZ1A 3D0SA 4OHZA 3LDKA 2A6WA 1AR92 5F3CA 1D4M2 1SLIA 3VD9A 3ZN5A 2BRTA 1XE0A 4HG6B 5FUPA 1S55A 3JB8A 5BNQA 2ET1A 2XBO3 1OQDA 2VZ3A 2HJIA 5FY9A 1CJDA 1R083 2EICA 5A33A 1VRH2 2KA3A 4FAHA 3BOPA 1IPSA 5CFCA 5FYHA 2C9AA 1FX5A 3WW4A 3F2ZA 3MBWA 5FZ3A 1JOPA 3WCRA 1HXS3 2DBNA 3ZFGB 3DN7A 1XYOA 2D3SA 4IE5A 3AX4A 3HAGA 3BUCA 1O5UA 1WW7A 1GSLA 4GB31 4IQPA 1SBEA 4FPCA 2DVBA 4EE2A 2HYKA 1RUH3 5FAXA 2AZ5A 3AP5A 2P3JA 1NCRC 4FXKB 1W28A 5FUNA 2IVIB 3KM5A 4OZOA 2DTWA 2QBXA 3J8F2 5FZKA 5FOJB 2A5ZA 2PLV3 4HOOA 1ZX5A 3AMMA 2V5DA 4XC9A 3KS7A 3VBSC 3KT4A 4RHV2 1S2BA 1ZZ9A 2VW1A 4MSVA 4YM2A 2Q8OA 4MVTA 4QKDA 4RGAA 4WM7C 3ZYPA 2JECA 4ZU7A 1JH5A 2IUWA 2QNKA 3NV1A 3ILNA 2WZR2 1UY2A 4FFIA 5E8AA 5FXWA 4B3NA 1FPN2 3O1RA 2NMOA 2ORZA 1IS5A 4AEDC 4QPIA 4RN5A 3WQ0A 1W3XA 1GFF2 2HKXA 4HT1T 5IATA 5FMBA 1RL3A 4IE7A 2V73A 4CEYC 5FPVA 4Y4RA 1UOJA 3M70A 4GB33 4XUPA 4Y4YA 2DFCA 2V4VA 5JI9A 3AZVA 3WNPA 4LIUA 1PK6B 5FP7A 1J83A 1YYNA 3N9MA 1BMV2 2P17A 2ZGSA 1VIWB 4Q4X2 1DIWA 1R1ZA 3UESA 3DKWA 5JSPA 1CAXB 4BYYA 5ACA3 1W90A 1Z78A 3SH5A 3SHRA 1U5IA 5FMOS 5A6YA 1F2NA 4BXFA 3KZ4C 4BWOA 2VG9A 1ULCA 5F37A 1QJY2 5FBZA 3LD8A 5F9TA 2NQYA 1OVPA 4XFFA 4L11A 3S5QA 4HPKB 3ME2A 4BE3A 5C3SA 2ZEYA 3B9CA 1UPIA 3AMNA 2BOJA 3B01A 4PBOA 1JMUB 1L7QA 3RRDA 2CWMA 2WJSA 4XAAA 4KNCA 4XFIA 2JWPA 1VPHA 4QPGC 1UZVA 4CEWC 1DHKB 1AR81 1UU6A 1X8MA 4LULA 4E27A 4TSVA 3O1VA 3HT2A 1IQDC 2B5HA 4IV3C 3GBFA 2QJVA 4PQ9A 5LA0A 4Q5OA 3LEKA 3WQ1A 5JZGA 5E88A 3HQRA 3LSEA 3L2YA 1JI6A 2Z79A 4IV1B 4MXVA 4ONUA 4PI0A 5IVBA 1LOFC 5IWFA 2WA4A 4LA3A 4A3XA 5FZGA 5L19A 1F9KA 4HZFA 2P3IA 1O8PA 3RWNA 4XABA 5DPNA 4TTGA 5DUXA 3J7HA 5EZWA 2JB4A 3H3UA 4TLGA 5JXHA 1A8MA 4WM7B 5KHGA 5LK7B 1YI7A 3DF0A 4GWIA 4URTA 3ZYFA 1NAEA 2PHLA 3N9LA 2ZX0A 3O5SA 4A41A 1RUNA 2DUOA 1NXD1 1HRV2 3VKLA 1KQRA 3OTFA 1AR83 2IXKA 2QVSB 4D94A 1PIV1 3ZYBA 2O1QA 1PVC2 2ADDA 4J1XA 2ETEA 4JTOA 2VMIA 5EYXA 4XF1A 3I2GA 1QHDA 2CWSA 4LBJA 3T0BA 3AYDA 3TYJA 1MEC2 2VZOA 2PHRA 1VALA 1QOTA 2QZ3A 4YVWC 4LXLA 4XURA 4G9SB 1MQTB 1LULA 5HV4A 3JQXA 1D2QA 1EY2A 1GP6A 1WA6X 1XQNA 2WBKA 4COVA 1DQ1A 1S1AA 2OVUA 4QHZA 1GOFA 4ITCA 3ZMOA 4YW1A 3LPFA 3UK9A 4Z82A 1YQ8A 1ZRIA 3AP4A 3N4MA 4AAPA 3QCWA 1X36A 3POFA 5CIRA 1H6YA 4J25A 1GKBA 4X6QB 5FPZA 4BQYA 2WNVA 5LBBA 1PGL2 2BNNA 2YY1A 2X09A 2IZWA 1REFA 2H6BA 2HWF2 3HQXA 3MLJA 4QPGB 3VB9A 4AE2A 3T0DA 1EV13 3D6EA 2I2SA 2VZVA 1EP0A 1V6OA 2VMGA 1WUVA 2E7AA 2AC1A 4XF3A 1YIPA 3D4KA 1ZZ7A 5JIUA 3DCQA 5FJHA 4AAXA 3RJRA 3POJA 1OFNA 3BTYA 3ZXFA 3RQ0A 5IFTA 3PUAA 1GWKA 3K3NA 4QPIC 1K5JA 4YNIA 1BYHA 4D7TA 4QM8A 1V6MA 3VL8A 2G9FA 1PMHX 4XFBA 1CAVB 3MV01 4QB2A 3R0RA 4XQDA 4M01A 1FV3A 1R1A2 5FPLA 1TME2 1OPOA 3HN3A 1W9WA 2Y0OA 3PTYA 2W3JA 2MEV1 1YUDA 4L92A 4MGKE 5GLUA 3EB7A 3ZN6B 1CWPA 5ERLA 1BEV3 1J3QA 1CZTA 4CU8A 1G7YA 3NAPC 4CVUA 2A71A 3KCXA 4FQZA 5JLVA 5C3RA 4YWAA 4WVMB 4QKFA 2JG8A 4Y3OA 1H1MA 2BFUL 1BK1A 2DWRA 2ZGPA 3AP6A 5CU1A 1LU1A 5GLTA 4AQ2A 2IFWA 4CDUB 1CD3G 1GMMA 4E9KA 2RS12 3ATGA 2QQMA 2IFRA 3M3CA 3WG2A 4BCUA 4AFDA 5BNNB 2A70A 1XNAA 3DYMA 3ZDVA 1STMA 5EIYB 1AHSA 5JIAA 3H3LA 3H42B 1ENXA 5AC91 5IAXA 4Y33A 1SEFA 2XQRA 4E4ZA 3ZIXA 2W1QA 4QXBA 1AVBA 3GYDA 4GALA 3O12A 4YFZA 1PO21 1XE8A 4Y20A 1H2KA 1GNYA 3KV6A 4AVCA 2C4XA 3JZVA 1SHWB 3VZOA 3RZGA 1V6NA 2MEV3 3KMHA 3KHBA 5JZGC 1Q8OA 5FZ4A 4B4QA 2DTYA 1RUE1 5GZFA 1RUF2 1UU5A 2XJQA 4DPNA 1GZWB 3N7LA 1OOPB 2A3WA 2VQ0A 3DL3A 4FO9A 4M0NA 5DAQA 1LU2A 1KD7A 4MHUA 3GJBA 4H55A 2ZX4A 5JOZA 3DEMA 4K3UA 1L7RA 1PX4A 3JD72 4CCEA 1AYN2 4QX1A 5ANNA 4FTBA 2WNUB 4Y22B 5A80A 5CFDA 4OHVA 1UIKA 4N8MA 4A7YA 4CDXC 4YG0A 1AR61 4CCNA 2HEWF 4GXLA 1HB2A 4Q0QA 2VMDA 3KV9A 4LQRA 4XJ9A 1PO23 5C5TA 3WDYA 1XRUA 2GU9A 1OUSA 1FMD1 1PHMA 1DQ6A 3H9AA 3ZKYA 4AXOA 3ZX7A 1ZRCA 5B2GB 2Y0IA 2DVAA 4KBZA 1MS4A 1W8TA 1RGSA 5FY4A 2OKXA 4OI1A 4ZU4A 1EAH1 1ENQA 4UI9L 1ALYA 2JD4A 4FVVA 4AI8A 2JJ6A 3SH4A 2DBIA 3BALA 4DXZA 1MACA 5C9AA 1RMU1 2Y6HA 3NAPB 3D3AA 4I09A 2GMEA 1SQ4A 2WYFA 3CQOA 2A6XA 4KU7A 3J7LA 3HVDA 3VD7A 4COZA 2MPFA 5FP9A 3VBUB 3B9IA 1JYWA 3MPBA 2ARAA 1C8M3 3VGIA 4CP1A 4ISQA 2ZOEB 2W46A 3VZJA 1R64A 4HLTA 4OULA 2E51A 1ZZ6A 1LGBA 2R042 3CF6E 5HI0A 5KXBA 1RJ8A 1AR63 3HT1A 3WX5A 2XWJB 4AHZA 1GWMA 3RMXA 1NA1A 3C7FA 1RXFA 1Y4WA 2GMPA 3KVBA 1ASJ1 1UY0A 1KJLA 3M3EA 3VD3A 1WCQA 2R061 2PAMA 2VNOA 1FMD3 1ZRDA 5ISLA 4DUVA 4N43B 4W6WA 3GALA 5HCBA 1RUG2 1CAWA 1EAH3 3HR9A 2O8QA 5A7WA 3ZYGA 4HVQA 4FPFA 1DZRA 2ENRA 1PO12 2LUWA 5FZAA 1RMU3 1VBB1 2W1WA 3LEIA 4ASMB 1QY4A 2C1FA 3O1TA 2FBEA 2GMMA 4M3CA 4Z92B 2FDHA 2BPA2 4YGDA 1DYPA 5A3WA 1IKPA 4I02A 3CU7A 4V2WA 3W21A 1H1IA 1UW8A 3OUHA 1SFYA 4Q4W1 4YW2A 4URAA 5AFEA 4GZ9A 1AX1A 2TEPA 3E5UA 3EXUA 1H4HA 1US3A 4NRPA 4LEJA 5BNOB 3B69A 3N9PA 4CDXB 1ASJ3 1JYNA 5C8CA 4FTSA 2R063 1JZ6A 3BU0A 5FZ7A 1DZTA 1UU4A 1OH3A 2IC1A 1KJRA 1CJPA 1UZ0A 2CYFA 2PHFA 1BK0A 1KITA 2WFF1 4OCTA 3UJQA 4NRMA 2Q1MA 1W3VA 1D7PM 3OEBA 1VBC2 2W92A 3ELNA 2PQSA 3K51A 4QD2A 4N53A 2BDRA 3J26N 3VBRB 4ORFA 3RZZA 5IK8A 3WR0A 3VD4A 3LAGA 3OSDA 1G9CA 5FLJA 4XUOA 1Z0HA 3TEWA 5JOXA 4N9IA 2ZZQA 4NIGA 1QDCA 4Q4W3 1UYXA 4I30A 1UX7A 1ACCA 4C1XA 5DDJ1 1GU3A 4LHLA 3KV5A 3N35A 3NNJA 1TMF2 5A7QA 2LM3A 5CZKA 4ZU5A 1AZDA 4Q26A 2PTMA 1W6PB 5LZ6A 5IVYA 3SQOA 5AFBA 2ZPXA 4QGNA 2OW4A 2RG4A 2RMU1 3ENRA 4Z07A 1GQGA 1WCKA 1AXKA 1ZBA2 2PHDA 3M3QA 3R4SA 5FV3A 4EQVA 2WFF3 2I07B 2WL1A 1PGW2 4UW6A 1SMVA 3AKSA 3EHKA 1UY1A 2UWBA 3LOBA 1W8UA 3I2DA 1KXGA 2HWD1 2D6MA 3WD5A 3WNKA 3N9OA 3T1MA 5CFDC 1LOGA 3OBZA 5JSOA 1RVF2 2V5YA 1UOFA 4NPRA 2JKXA 2HH9A 2WT2A 4QX5A 3VBOA 3WDXA 4IEZA 3R4DB 1JOBA 3RPQA 4DS0A 2BW8A 5DDJ3 1K5MA 3E6DA 1SDWA 3BIEA 3SISA 2NM1A 2V4AA 4AEMA 3S57A 3THPA 1B35B 4XXPA 4RQPB 1W6QB 4UF0A 1L7LA 2D5FA 4PF5A 4Q8LA 3U0ZA 1QMJA 1GNHA 4Q27A 2RMU3 3WP5A 5C9AC 2A1XA 3I2IA 2Z5WA 4V2VA 1MS8A 1A34A 1NY72 2QQVA 3EJKA 5JMOA 2VUCA 1ULDA 3N36A 2LRPA 3UT0A 1JXNA 4JQTA 2PMWB 3TN92 1NLSA 2K9ZA 2HWD3 4XW3A 3H1WA 4GWMA 1TE1B 3ZXAC 5AVPA 4UBHA 2WYSA 1NA1C 3LEMA 3LZZA 4W6YA 2RDSA 5ABJA 2PHTA 1JYTA 1AJKA 2CDPA 4B7EA 4D0QA 4Q4V1 1WCSA 4NHYA 3QLQA 4CP0A 4NIIA 2CSGA 2WRAA 1NZIA 1ODNA 4AHYA 4HSJA 4Q0VA 4E8DA 1FATA 3OYWB 4BXSV 3I2OA 1DGRA 3PLQA 2Q8CA 2DU1A 3KCCA 2RR13 2ZKLA 3WDUA 4DY5A 3HBZA 2VR4A 1UF2C 4Q4Y1 1C1LA 3C7EA 1XB9A 1XNBA 4AG4A 1Z7S3 5JR7B 4Q8KA 1BJQA 1VBE1 2EVXA 1EUUA 1IGOA 3FHQA 4Y1XA 4KMQA 5DUVA 5IUQA 3VDDA 4EYUA 5LBFA 3S5AA 2HBTA 2X5IA 4DXRA 2BOIA 4AFAA 3AXEA 1Q8PA 2E26A 1UOBA 4IETA 1CX4A 2AYHA 1ZNPA 1S0BA 2WWUA 2BYVE 2JDMA 3LB9A 1L3JA 1ZA4A 4R9AA 5C8CC 2WWSA 4Q4V3 3AZXA 1QXPA 4GMP1 4TZDA 3CLPA 2WN3A 3WHUA 4AQ6A 1QIQA 5A6QA 3V0AA 1VR3A 1LENA 2VVEA 1N1YA 2YG0A 3AP7A 3MLKA 2K2SA 3PIGA 4OLLA 4CSWA 2X53S 2X8KA 3W5NA 3MW2A 4GWNA 1QNYA 2RJ2A 2C0ZA 1V6KA 5FLHA 1VJ2A 2OUHA 3PVOA 1SBFA 1URXA 2EALA 1V9U3 3OF1A 4N53C 1UIJA 4Q4Y3 4C91A 3ILRA 1DGWX 1VP6A 1VBE3 4AFCA 2YZ4A 2XL9A 2XJTA 2Z42A 3C7GA 3RZHA 2CGPA 5K4LA 4AYUA 1G6NA 4JDMA 5EFUA 4YGEA 2QQUA 5FZ8A 1D4M1 1GZTA 3MFCA 2VMEA 2BBVA 3PJYA 4GJZA 4JHZA 1S0JA 2EAKA 5FYSA 4CDQB 4FP3A 4FPGA 4QGMA 4QDQA 3SXWA 3V0BA 1MPXA 4PBPA 3OGRA 2WS92 2RDRA 2BQPA 4R9DA 4TWTA 1LCLA 3ZXEA 1E5RA 1DQ2A 5C4WB 4OUMA 1UMZA 3LIHA 1COV2 1LOCA 3LFIA 4HETA 3U4XA 1HV0A 3PUHA 4WBBA 3P3NA 1OSGA 2D6PA 3I59B 3Q8CA 4HVRA 1H0BA 1ZA7A 3PVNA 2VOKA 2WQZC 4LUMA 2PAEA 4M3CF 1JZ5A 4CDWA 2E7QA 2PAKA 4XUQA 4WM8B 1F5FA 4OMDA 1MZEA 1GBGA 1GP5A 5JI7A 4QDSA 3R4UA 4ZKTB 1RXGA 1RYYA 1VMJA 1LOEA 3POIA 3VD5A 4XUNA 5FXZA 4L9BA 4MH0E 2VOXA 2RS51 1LB2A 2FZ2A 3VBOC 1FOD1 2IWGB 2J1UA 3BCWA 1MVQA 4M00A 3RI9A 3IIAA 4EN8B 1D4M3 2WSVA 1I3HA 2Y6KA 1JYCA 1OLME 3VBFA 1UPSA 1LAJA 1BBT2 2GH8A 3TBDA 2QE3A 3ZFEA 3WY6A 2ZX3A 1HKDA 5KXEA 3GM8A 3HN1A 2P4EA 5J36A 1UXZA 2EXIA 2NLRA 5KWRA 5J37A 4META 5CNAA 1W9SA 3MIFA 4GQ7A 4AFMA 1T2XA 4B4PA 4BA6A 3KCYA 3A4UA 3K4DA 3I54A 2Q5TA 2OYZA 1LTEA 1ZZBA 1R091 3I2HA 1GICA 4RS5A 4XIKA 3T2QA 2OIIA 3OD4A 4AEKA 1FV2A 4M4PA 4EWDA 1AR72 2FQPA 1LHVA 2CY6A 3T2PA 2JICA 5ABJC 3APBA 3J8F3 3ZMNA 1X33A 1G9AA 3NNMA 1U0AA 5BV6A 2H0BA 1OPMA 1XOYA 3BI3A 2Y6GA 3P6BA 2XLFA 1AL21 1UWWA 4PDWB 5T3NA 3IM0A 2ARBA 3TB0A 2WZR3 4UYBA 2LTNA 3BYWA 4HANA 4XJ8A 1FPN3 1I5ZA 3OGVA 5C8WA 1WMFA 5FWEA 4DQAA 4A6OA 4MGZE 3T4HB 3ZXLA 2A75A 2KD7A 1W8WA 3ETPA 3ZYRA 1R093 1NLQA 3GBWA 2L9LA 2ZMNA 1W9FA 3ZYJB 3H8RA 2K46A 2VBPA 1QOOA 2YROA 3OG2A 3UGGA 3WINE 3OBRA 3CMGA 2Q1FA 4OMCA 4ZXKA 2D6LX 4HN1A 3U4SA 4FTEA 1VBD1 2JKBA 3SCHA 1SFNA 2BFUS 1WA4A 2G9GA 3THTA 1Y43B 4PLMA 1AYM1 5FZOA 2P1BA 2BWAA 1C1FA 3MIEA 1HXS1 4MXWB 3AL6A 1SZBA 1VMFA 2PXJA 4ET7A 5FUIA 4BIOA 1AL23 3RYRA 2CNAA 2O0OA 2QKDA 3MIHA 4QPWA 1S2KA 1MZ6A 4YM3A 1RUH1 5EHDA 3AYEA 2YBKA 2Y60A 1W6MA 2DUQA 1UCXA 3THCA 5C3PA 1CPNA 1QNWA 1W6NA 2PLV1 1MS1A 4CXXA 1IHMA 1W06A 4C0HA 1VE0A 3IT8A 2GC1A 3QBQA 3A0NA 4XTPA 1VBD3 5FKBA 3WEZA 3CEWA 5A1FA 2Q0AA 3W9AA 4ZPIA 1UN1A 5GKAC 2GZWA 2K0GA 1ND2A 1AYM3 5G04L 2AH2A 3ACLA 2Z4FA 1GWLA 1JHNA 4I3PA 1RIRA 1V70A 3WW2A 4QX3A 3IPVB 5CKNA 3WHTA 3EBRA 2XXZA 3CNAA 4CDWC 1RHI2 3BGAA 3ZM8A 4AI2A 3NNFA 3P3PA 5FY0A 1TEIA 2QUOA 1VAVA 4PF1A 5KC6A 3UGFA 5BNNA 1Q5OA 4LA2A 3DPRA 3PL0A 3PU8A 3FN9A 1RB8G 2B9UA 1SPPB 3I3DA 4N90A 1DBNA 2VM9A 4YVSC 4A45A 1OD3A 3M7AA 1IG0A 3J7NA 4GH4A 3VZNA 5JXIA 1YNAA 5ACA1 4RR3A 4HVOA 1PGL1 1UMHA 2HWF1 2ZGKA 1ODMA 3NMBA 4ZZ8A 2WLQA 4P9IA 2AUYA 3L9JT 1O3RA 3BIWE 1DGWA 3ZFFB 4IXLA 2GALA 3ZFEC 5EXOA 2YFZA 2JDKA 3C7OA 4P00B 3SH3A 2CHHA 3ZN4A 5CA6A 5IK4A 5FQ0B 1RTVA 2VULA 1RUC1 5D8AB 1POV1 1U12A 3WG4A 2J7MA 2XDVA 2FHRA 1RUD2 3JCIA 5J3UA 5L7OB 3QD6A 5GZGA 4LUKA 3OOXA 5T5OA 5IVJA 1QKQA 2ZGUA 2W39A 1TNFA 4RS5C 3OUJA 2C5DA 3F95A 2YPJA 2DU0A 1ND3C 3KWVA 2JEMA 4LMFA 3T1LA 4XJAA 1W2AX 3MLLA 3T08A 3MIBA 4MHRA 4LBNA 3OPWA 2HWF3 2ZMKA 1YQ5A 4XEZA 3TEXA 2MHFA 2TBVA 1J3PA 3DYPA 3DUIA 1QJX1 4GIQA 4D8MA 1YQ6A 3V65A 3SEEA 5IVEA 3I4IA 3VHRA 5CBLA 4O9EA 5M0TA 4NHLA 4JGYA 5FP3A 1RUC3 4Y5SA 3NSTA 3GCXA 4NO4A 5CKMA 1DYKA 1IPKA 1POV3 1OA2A 1J59A 5CEHA 4LO5B 1N3OA 4QWNA 4AHWA 3PJQA 4NHKA 2E6VA 3ALQA 4IEVA 5K9YA 1DP0A 2VU9A 1QQP2 1PMJX 1ULGA 2ZKNA 4XQ4A 2EAAA 1I5PA 4OVEA 2UY8A 1H8TA 2W87A 3POBA 4O7XA 3I8TA 3DECA 2HWB1 2IXIA 2N7GA 3KB5A 5FPAA 4AW7A 5I91A 2BUKA 1ENRA 3FHIB 3OGGA 2ZHKA 1NCRB 2ZA9A 3PUSA 1YJLA 1CAUB 4MZUA 2F6BA 5F2SA 5DAWA 4YVSB 5K0UA 3U10A 4LKFA 3WDWA 4AQTA 4UFJA 1QJX3 4LO7A 4M4RA 3VBSB 4NRQA 3ZIWA 4OI0A 2XL7A 4JTNA 3MI8A 5FZ9A 4UFKA 2E63A 1O3TA 1HB1A 4KU8A 1PNFA 3TNQA 2XBO2 4NIAA 4UFHA 4B29A 1JZ7A 4AVAA 5KHKA 1QJU1 5FYCA 4BLJA 4EN0A 5I0SA 2ZGQA 4RA0A 5FBJA 4AEDB 2HWC1 3PMSA 3VKFC 1LHNA 4J1WA 4L2NA 5I8YA 1EV11 2VXJA 3AXDA 4CEYB 4QU2A 2JENA 1UO9A 2HWB3 4IGPA 1H2NA 4LHNA 1AXYA 2JDYA 3UJOA 5CFCC 5E89A 1JUHA 1S0EA 1PVXA 3PVBB 1PZ9A 1K42A 3WXPA 1ND3B 3BPZA 1JTZX 4K9SA 1HJGA 3NO8A 5A32A 2XHKA 4ZXEA 3PHMA 5C70A 3WP3A 3TOJA 4XETA 1N47A 2XOMA 4UFIA 3ZOIA 4YZ5A 4CP9A 5LRSA 1S4CA 1UX6A 2VTFA 4SLIA 1XXNA 2YPDA 4AFBA 2BP6A 4DMIA 1LHOA 4W65A 4PHZA 2VUJA 3H1YA 1WLTA 1A3KA 3DPRC 3WF2A 1KS4A 1WLWA 2XJUA 1OH4A 1HV1A 1QJU3 3N7KA 3USUA 3VHNA 3LQCA 4S2FA 1AX0A 3IIIA 5K8SA 1X9TA 1Y9QA 2HWC3 2VUDA 4OYUA 1C5HA 1BEV1 2AREA 4GH4C 4I01A 5C6CA 4RR3C 1XPWA 1S0CA 3LDBA 1BCXA 2W08A 4ISRA 3VHOA 4CEWB 2VMCA 1W03A 4YSFA 1DQ4A 2RM21 3M3OA 4NWVA 3QOPA 2DUPA 4IV3B 5KXCA 3ZSKA 5FWJA 5KHHA 3JUUA 1K3IA 2LALA 4PIZA 5DZEA 2GP3A 3AKQA 3HQUA 4S2HA 2ARXA 4P5YA 4Y1YA 3AKRA 1KDMA 1O4ZA 2YBSA 2Z2SB 1F4AA 1KFUL 1UQXA 2DF7A 3AZWA 4FOWA 4K7JA 5LA1A 2VZTA 2FCTA 4E4DX 5FO7B 2OS2A 3MW3A 4CRQA 1MZ5A 1QH7A 4E2GA 1ULFA 3HBKA 3DXTA 4DXSA 2A6YA 3ZYHA 4CCKA 2BTVC 1EYBA 1C5IA 3MV11 1FAYA 3E5XA 2Y6LA 3OY8A 4EJRA 4IE4A 1AXZA 1UY3A 4IESA 5JXJA 3BODA 3RG0A 2BNOA 4D3WA 5C7GA 1PM7A 2RM23 3OD0A 2E31A 2XUMA 4GKYA 5FZCA 4LBMA 1XNCA 1KS5A 2YYOA 4NWWA 3CJIA 1HQNA 5A33B 3MF9A 1UD1A 4OQ9A 2OA2A 1Y9GA 2DV9A 2UURA 3UETA 2QQNA 5CFCB 3FUQA 2Q8DA 2VCCA 3ZXGA 4NPMA 4Y1ZA 3ZKUA 2VVDA 4YVWB 4CP2A 3H8OA 5CB7A 1TG7A 1OQ1A 5HV0A 3KHCA 1UOGA 2OQ6A 1GZ9A 3SKJE 1P8JA 3CDZB 1EPZA 3GHNA 5DAVA 2XVGA 4EN9B 3FBYA 1LGNA 4LBKA 4MG2A 4E8CA 4B4RA 1WMXA 5KC5A 4ES9A 3K3OA 5C33A 1N1TA 1AJOA 1W6OA 1ZBE1 4DOUA 1RITA 4FFFA 1OD5A 4FPLA 1JYIA 4F8AA 1Q8VA 1G8WA 4BK4A 5FY8A 3BKZA 1S2EA 4MO3M 3MPPG 4AVSA 2VNRA 3LSDA 4FSJA 4W4ZA 1QJEA 2R0HA 3FJSA 1LR5A 1AR82 2VO5A 1NLRA 4WVZA 4MX3A 4XZUG 1C8M1 2O8OA 5JUVA 5J98B 1VBC3 3POYA 4NR1A 4GA9A 4MADA 4NUBA 2VH9A 1OBNA 2W95A 5DAXA 4AHXA 5HPOA 4XILA 1VBA2 3KGZA 4IGQA 2VZSA 4OHWA 3GXUA 2W68A 4H7MA 5E16A 2WT0A 4GULA 4QPIB 4KL1A 2ZGMA 1QXRA 2VZUA 4L8QA 1RUI2 3WQ7A 1OA3A 1YO8A 1XNDA 2VW2A 4CU7A 3ZSEA 4O65A 3WP4A 2DVDA 4QX8A 4YLZA 1ZBE3 3ZPYA 2ZX2A 2VPVA 1HW5A 1VB2A 1CZSA 4QQPA 4R8HA 1XNKA 1UNBA 1ZYBA 1YLLA 1G9DA 4CXYA 4LLOA 2VZ1A 4BQ3A 3VV1A 1VAMA 5BNPA 4UT5A 5I0TA 3C8XA 4P9JA 3CO2A 1NZCA 2FCUA 1PIV2 1WMDA 4YW7A 5A1LA 4DB5A 4XQWA 1ULOA 2ILMA 3AVSA 1F15A 2DCYA 3PIJA 2J1EA 1HRI1 1V00A 4HKOA 1RVF3 3S7EA 3N7JA 3ZYIB 1UY4A 2WNVC 2D44A 1PGSA 2PA7A 3NQHA 1CR7A 3WDTA 4RFT0 1NQDA 3AFGA 4QAWA 1HN1A 2BGCA 2R32A 2BNMA 2VZQA 1SBDA 4RGKA 1IG3A 3AKPA 5F7UA 1OVSA 3SKVA 5I8TA 2JIJA 5JZGB 3CL1A 4PI2A 4QMAA 4IERA 1NT0A 1REDA 1XSQA 4AVTA 4ARXA 1JU4A 3O0WA 3ON7A 1BHGA 5T5JA 1WD3A 2WDBA 2YV8A 3SEPA 4ATEA 4HK8A 2QQKA 1ZRRA 3WQBA 3TWIA 1M06G 2E9QA 2RS31 4CUCA 1XYNA 3TN93 4NE9A 2P2KA 4XDPA 2VTXJ 2R071 4W50A 2CDOA 3URFA 1HRI3 2YXSA 3RZJA 2R30A 4YG6A 2JG9A 4QKBA 4DRVA 4CCOA 2HWE1 3G7DA 4Q1PA 5GZEA 2VCMA 2JG8C 1YCIA 2PHXA 2X29A 3T4VA 2VUAA 4LPLA 1KRIA 1EUTA 1WZXA 5KHIA 2F17A 3AM2A 3CJIC 3PU3A 2CAUA 4O9GA 4YGBA 3ABZA 2WNOA 2XB6C 5LASA 2ZHLA 3KGLA 2W2IA 3LKJA 4RYDA 5FYBA 2MEV2 2Y26A 1D0GA 2VOWA 3NV3A 4H2AA 5DG2A 5H9PA 1Q8QA 3AFKA 4E2SA 4K20A 2RS33 3U37A 1LOBA 3ZPOA 5JAXA 3OJBA 2R073 4CUGA 3A23A 4XACA 3EYPA 3DXUA 3A22A 5H9SA 3LA3A 2FMDA 5F6LB 1MVEA 5TSWA 2KR2A 5IK7A 3FUOA 2R49A 3ZDSA 2RDQA 3GHMA 4CUBA 3AJYA 2JDAA 2HWE3 1O3SA 5AC92 4IGOA 1OLMA 1ZREA 4BHPA 2WNVB 3RI8A 1F35A 3VBHA 4IEWA 1OKQA 2ZACA 4K1YA 5BYNA 1SCRA 1YQCA 1H6XA 5A7OA 1XJAA 1FXZA 2ARCA 2A6VA 2MNGA 5FZ0A 4DINB 1O7FA 4DUXA 1HLCA 4FXGB 4Y1VA 3EQEA 1DZQA 1REEA 5FOBB 2WLPA 4CCDA 4GJYA 4FFHA 1RUE2 2XMLA 2JB8A 2VMHA 1HB4A 4DEQA 1M4WA 1Q56A 2XLGA 4XDOA 5E1RA 1C8NA 2WFPA 5F32A 4JDNA 1RUOA 2RV9A 3L2HA 4HK9A 2J1VA 4JGZA 1NCQA 4LE3A 4Q1RA 3HNMA 3JBG1 3Q9OA 2JDHA 4BJ0A 4QXKA 2CU5A 3EO6A 2WS93 4FAGA 1JS9A 3AZZA 2ZXQA 1SLBA 3RNSA 2RR11 2BZDA 2ZABA 3KF3A 3ZXJA 3EMRA 4F3JA 2PQQA 3T09A 1AR62 3T0AA 3I3QA 1CQ9A 1Z7S1 5BNPC 3GGLA 2FDGA 1YFWA 2WINB 2JG8B 5IFPA 1V0AA 3UL2A 1FT9A 2B7YA 1TZOA 1FMD2 1RINA 1S0FA 3KLSA 1O3QA 2ES3A 4IW3A 1JZ8A 3DKQA 3IMMA 4BISA 1LEMA 2W94A 1EAH2 1W8HA 2CL2A 4EZHA 4TN7A 2A7AA 3FLPA 2GN3A 2EF6A 4AK3A 5B4NA 4PIYA 4NIHA 5DXDA 5HXMA 3FLRA 3KD4A 4JKMA 5A3LA 3NL1A 1X9PA 2Y8KA 3JBG3 2FMYA 4K1ZA 4JHTA 3FFQA 3POEA 5F5IA 4Q29A 2UY9A 2ZHNA 1XNTA 2DDUA 3VZKA 2DCTA 2GC0A 4XF9A 1ST8A 1G86A 1V9U1 3E6CC 3RZMA 3ZXDA 4CXWA 1B09A 2GH2A 5L9VA 1ASJ2 3BU7A 2E7TA 4L0PA 2R062 4C0BA 3HPNA 2D40A 1F8VA 3ZFGA 4MGQA 4S2GA 4UAPA 2ATFA 1Y9MA 1RUJ1 2D7FA 1E5SA 1GOHA 1I9RA 3KT7A 4I0AA 5FP4A 4BIFA 2QDRA 3PTRB 2VCBA 3AMHA 2D97A 2EIDA 3FZ3A 5CFDB 2OPWA 3I2KA 4GKXA 2DCJA 1G9BA 5J48A 4A7ZA 2NN8A 4JZRA 4KGGA 1VBB2 1OLRA 5LA9A 1GZCA 2VD7A 2YUEA 1WWYA 3VL9A 5LW9A 1FNYA 2Y33A 3O1UA 5BPXA 1W0PA 2G19A 1VB4A 3I3EA 5A7PA 1H1AA 5A3PA 4YYOA 2GNBA 4QT6A 2VAUA 1YC61 4Q4W2 1KDKA 4K8FA 1NYWA 4GAZA 1BVVA 2A6ZA 1MS0A 1YI9A 3AMPA 3VHPA 4AZZA 3FX3A 2ID4A 4Y24A 4UFLA 4XFHA 2WIIB 2CGOA 5C9AB 5LK5A 3WF3A 5DZFA 1TVGA 5CYYA 3ZVXA 2D6NA 1AR91 1KEXA 2BJSA 2ZGLA 4I3GA 4LO6B 4PT6A 4OI4A 4UXAA 2I74A 4QXCA 1RUJ3 1HJFA 1O59A 1O91A 1SCSA 2WFF2 3K46A 4KI5M 5KXDA 2PHUA 2YBPA 3M8LA 4M3CE 3WNXA 3WZ1A 1WMEA 1VRH1 5FZEA 1WBLA 4JV4A 1PK6A 1W99A 2PHWA 5F6KA 3CJXA 2F4PA 4NHXA 4V1PA 1NA1B 1OUXA 3CHXA 2D6OX 4NROA 3E97A 2JDZA 1CAXA 5IYYA 5JR2A 4YGCA 4OFGA 5T54A 4XCAA 3WW1A 5DDJ2 3AMQA 3MO4A 1CAWB 1H30A 5JOWA 5A7WB 2VZRA 3M1HA 3NJZA 4HPKA 4TXWA 5FP8A 2ZEZA 2XGXA 4CCMA 1BLZA 4ATFA 3Q8AA 1DQ0A 4KH9A 5EYYA 4YM1A 4PQQA 1NG0A 5A1AA 1IS4A 4LOSA 1NX9A 1AR93 3WV6A 3J8F1 4KWKA 1NXMA 2RMU2 4M3CB 3OUIA 3RSJA 4A44A 4R52A 2JXAA 1QGLA 1K5MC 3WOGA 4OHYA 5E6HA 3J9SA 4JGZC 4RHV1 1NCQC 5EQUA 3AJZA 4BQ2A 5C71A 1DLCA 1VRH3 2A3XA 4WVWA 5FY1A 2HWD2 4R9CA 1ZRFA 4U36A 1HX6A 3ECQA 3PNAA 3CZUA 2WZR1 3ZSMA 4TLFA 4XF0A 4IV1A 5L9RA 4PJYA 1FPN1 4DO0A 5C8CB 2YDEA 5I0UA 2FDIA 4QQ2A 2XPJA 2JD9A 1W8ZA 2CV6A 2YC4A 4HONA 5K7PA 3B94A 2XJSA 3CKHA 5FK8A 2R1DA 1H4GA 2P5BA 3GZTB 4BZ4A 5FK7A 3VBSA 2VECA 3PDQA 3U78A 3KT1A 2VC9A 3ES1A 4YZ2A 1C4RA 3E6BA 1XBFA 2D5HA 4HSLA 1J84A 3HWJA 2OT7A 4FFGA 1QEXA 4N53B 4IL7A 4WM7A 4XFGA 1BMV1 1CONA 1D0HA 4JKLA 4Q4X1 4NJ4A 2XWBB 2WR9A 3OBTA 4P14A 4EN6B 4RHV3 5C3OA 2W47A 4QM9A 4JQRA 4RFRB 1QJY1 3FMGA 2ZZJA 4L97A 4XAEA 5LB6A 4LR4A 4QB6A 4UW5A 2D98A 4IE6A 2WAAA 3OGJA 4ES8A 2BVVA 1S0IA 2WQ8A 3FWEA 2G4IA 2QQPA 4YW3A 3H8XA 2PYTA 3VDDC 4A6SA 4Q4V2 1W9YA 2X5IC 1MQTA 2ZS6B 3ZFGC 2EA7A 3MEPA 2RVAA 2JE7A 3HD8B 5A7NA 5J96B 2VBBA 4GWJA 1X7NA 3RYKA 4MGIE 3SCGA 5BXXA 3SMHA 3POSA 3PMEA 5AVAA 4ZS2A 3W58A 1IOAA 3ZR5A 3CZJA 5FDBA 1J1TA 4Q4X3 1YWKA 4D7YA 4Q4Y2 4TYSA 3VBOB 5FZMA 3WNNA 1VBE2 2YB7A 3HOBA 1C28A 2GNTA 1K5MB 4QPGA 1QJY3 4XDQA 4F7ZA 2JE8A 4B1MA 2VE1A 4COYA 2AENA 3OB8A 1OHFA 4LBLA 2QQWA 3NKGA 1V6JA 4LO8A 4UF0B 4GMP0 2VOTA 3ITQA 3S30A 3AVRA 1W2NA 2V09A 2ZMLA 3LDRA 1HRV1 4OUSA 4YPJA 3BN6A 2UWCA 2UYBA 1YHFA 1LOFA 1PMIA 2W1UA 2QQLA 4KQ7A 4PLNA 2H0VA 5SV8A 2Y34A 1HN0A 1PVC1 2J1RA 3FBMA 3QH6A 1CAVA 3GCWA 2Q8EA 4LT5A 2WABA 3I3BA 3P5BA 4OHXA 4W8JA 2WO3A 1MEC1 1RJ7A 2P6CA 3B5LB 1D2SA 5T55A 1DU3D 4K40A 2AR6A 4B7KA 1JN2P 3MHZA 3NV4A 4CCCA 2P34A 4GD4A 5ABJB 3ZN6A 2TUNA 1U5ZA 1N3QA 2DVGA 2VQAA 4H7LA 3WP6A 3I3MA 4WVMA 2GNMA 3QH7A 2OPKA 1SG3A 4LBQB 4PLOA 5EJ1B 3WF4A 4KG0A 4FOQA 4CDUA 4DXTA 5JDBA 4XMAA 4AL9A 4ZS3A 1CVNA 4CUAA 1G9FA 1F31A 5T5PA 2XQXA 2EIBA 2WQ4A 3KF5A 4QHBA 1HRV3 5FMCA 4BK5A 1OC1A 5F1RA 3X29B 3VDDB 2HEVF 4YVWA 1PVC3 3A21A 1PM4A 3GJAA 1W39A 3K48A 2X5IB 3OBAA 2O14A 4FP2A 5GLZA 1W04A 3VBFC 3O1SA 4FBFA 4L99A 3U07A 1MEC3 5F8PA 4IEYA 2BU9A 3UV9A 5KBFA 1U5XA 4DIQA 2VJXA 3O7OA 4QX2A 4E2QA 4X8PA 4RD7A 1IZ3A 4IV1C 1MS3A 2ZEWA 1UMIA 3IN9A 1IKQA 2RS52 4Y26A 3GF6A 1MS9A 1GZWA 3KQRA 1OOPA 1FOD2 4JX0A 4CCJA 4CA9A 4DUWA 4BLIA 4X8NA 1V6LA 2VNGA 3V0AB 3VZMA 3VKNA 1WCUA 1Q43A 1R1A1 1TME1 3GDBA 4XIOA 4A7KA 4R9BA 5JWPA 1LEDA 5LEKA 4XVHA 4LHKA 2HLEA 2WNUA 4Y22A 1N1SA 4AVBA 1JW6A 3MICA 4NIDA 3IAQA 3VDCA 2BBAA 4B8EA 2BVBA 3BTXA 4QGLA 3RZLA 4FPOB 2P3YA 4YFWA 4I2OA 2J42A 1W05A 4AI1A 3O0XA 4MUVA 4N7IA 1IS6A 2BGOA 5IT6A 1R092 5IVFA 1NOVA 4G4FA 1UKRA 1O4TA 2RS11 5FYMA 3V0BB 4BDVB 1JZ2A 3P1IA 4JAAA 4CE8A 1NQJA 3WW3A 2Y6JA 3LIGA 1QWRA 3IB3A 4UBGA 2HYXA 3RMYA 3WDVA 4Z1VA 5FO8B 3T3YA 3O1MA 1T6GC 5FY5A 3NAPA 4IEPA 1MQTC 4XOGA 5HBAA 4CPBA 2YC2A 2X10A 2UYAA 2TNFA 1R1A3 3DGTA 4LHSA 4CDWB 1TME3 3KQ4B 2CTVA 2ZGRA 2LS6A 4JRLA 5H9QA 3VBUA 5J7MA 3MZHA 3B00A 1AL22 3HNYM 4FPJA 3Q8FA 1JUIA 5I0DA 1F5JA 3VZLA 1RUF1 5L36A 5IW0A 3K75B 1GP4A 4AWDA 5F3GA 1WW4A 1WCDJ 3PVEA 1GANA 4K6BA 2ZGTA 3VN4A 4M0HA 2ZTNA 3T30A 3VBFB 2RS13 3THDA 4QQHA 4AGGA 2NP0A 4N43A 1WD4A 3JD71 4QHOA 5FYZA 1AYN1 3ZFEB 5EP9A 3GZAA 4UOJA 1VBD2 3OCPA 1R082 2E53A 5FIXA 2DFBA 1US2A 3I2FA 3NNLA 3FL7A 4XZPA 3DV8A 4P9WA 1VBA1 4QX0A 5CKQA 4YW5A 5FZFA 2D43A 1GUIA 3WNLA 1AYM2 4A42A 2P3KA 3IDCB 2UU8A 1XU2A 1HXS2 1RUI1 2VVFA 3IDBB 3H0OA 4YM0A 1OURA 2D93A 3HMYA 4RS5B 3PUQA 2AEZA 2WZEA 3GZEA 3MFAA 4UW4A 1HQLA 3Q8BA 3D5OA 2B8MA 1O4YA 1ND2C 1OF4A 3IZOA 4EN7B 2FDFA 3KV4A 1RUF3 4JDOA 3O1PA 2EXHA 1RUH2 4LIVA 3BVCA 3NJVA 2X05A 4DZGA 5BNOA 4WZFA 2QQOA 4CDXA 4WZCA 5A3UA 1NKGA 1ENSA 1WLDA 2B45X 1UAIA 4P9LA 3WUCA 5FPXA 1LESA 4XBNA 2PLV2 4AVVA 1HB3A 4XMIA 4QX7A 3JD73 1AYN3 3OEAA 2WSUA 4FPEA 4CDUC 2BEOA 5BNNC 1CZVA 1OT5A 3FLTA 5EJZB 5CG9A 4KGQA 2R041 3I97A 2VQTA 4Y5Z0 4NVPA 1VBA3 5FXVA 3AK0A 3VBRA 5C3QA 1W2TA 1QJZA 2ERFA 3CIHA 4RL7A 3WCSA 3NRUA 2FDKA 2KM2A 4BM8A 1YFYA 4YZ4A 3ACHA 1DQ5A 5FTTC 4IDZA 3BOWA 4IEXA 1RUI3 1APNA 2E32A 4K8RB 3BTAA 2CAVA 4LKEA 4X6RB 5GLVA 1ONAA 5T52A 4FPYA 4CTEA 5FJKA 5F39A 1RUG1 2EIEA 4GB32 1POQA 1PNGA 1UZZA 2ZAHA 3WNOA 3BTZA 1PO11 2DCKA 3RFRA 5IVCA 5A6ZA 1W6PA 3RDIA 1E57A 5FZOB 1VMHA 4SBVA 5JOYA 5FY7A 2ZHMA 4PIXA 1GOGA 1OOPC 2VY0A 2JDUA 4AGRA 3IAPA 5FZIA 3S0MA 5ACA2 1PIV3 3WLUA 2XKPA 3AL5A 4FQ4A 1UZWA 3B3QE 4P9YA 4Q0UA 4UFMA 4ZHNA 2LROA 5FPUA 1XU1A 4DY3A 2R043 2W52A 4JVAA 5JCTA 5FFOC 1POV0 3LOIA 2J1AA 2WNUC 1OFSA 3W20A 3LFMA 5LBEA 3LGRA 3PUIA 1RUC2 1W6MB 2W0XA 5CAZA 3J4UH 2VNVA 1W6NB 4Y5TA 1HQWA 4BU2A 5FR3A 5IVVA 2OXBA 5DABA 3WT3A 1RUG3 4EWEA 3H50A 1MS5A 5EV7A 1UKGA 4LK7A 3K77A 4C90A 3B02A 1PO13 4N7UA 4FOYA 4JGYC 1VBC1 2B42B 4YZ3A 1B35A 4RQPA 1W6QA 1QXJA 1ND2B 3IMNA 1ULPA 1WKYA 1X8EA 2ADEA 1YEWA 2JE9A 2XUEA 4CPBD 2VCAA 5FMDA 2XVKA 3CBNA 1AX2A 3M2MA 4OI2A 2BWCA 1W8NA 4LK6A 5DAPA 2UWAA 4A3ZA 4PCRA 2OZJA 3T2TA 3BB6A 1QJX2 3VBUC 3WSOA 1H8TC 3KVAA 1N3PA 1TMF1 1XC6A 4D6QA 1EPWA 2JDNA 2VBDA 3DPRB 5FCCA 3NKTA 1UYYA 2Y38A 4QQLA 4BQ1A 2R1BA 5K0UC 2GP5A 4S2DA 2EXJA 1W0NA 4GH4B 4WV8A 1YJKA 2FCVA 2PFWA 5FYVA 4RR3B 5FYUA 1Y3TA 1BXHA 4AI9A 1GYKA 1ZBA1 2PELA 4INDA 3G6JB 1PGW1 2YMZA 3FC0A 2E33A 4IEQA 1Y7BA 4N43C 2GDFA 4XUTA 4YARA 5FZHA 5KHJA 3OYWA 2ZAAA 5CG8A 2ZGNA 2HWB2 4ZONA 2Y6FA 2BERA 4QXHA 2B4KA 1RVF1 3R05A 4N9HA 2YC0A 4BMBA 1GQPA 4P9GA 4LNVA 5F5AA 1J58A 3U11A 4OQ8A 3IWZA 1H9PA 3AP9A 1SLAA 4LORA 3KSCA 5A6XA 1LODA 2Q4SA 4RGGA 1TMF3 1YRZA 4FCAA 1FI2A 1UYPA 2QZ2A 3TAYA 5LWBA 1A8DA 3WNMA 2WAOA 4YW4A 1OLQA 5AC93 5BNOC 4FT8A 3ZR6A 1QJU2 2IVJA 3NVCA 5A3OA 1DLLA 4W6XA 1ZBA3 2HWC2 2W91A 2YGLA 4HMZA 4XBQA 2R6QA 1ZVFA 1NY71 3AYCA 2RDNA 5LRRA 4K21A 1LNSA 1EV12 2GN7A 1SLLA 3D82A 2XKOA 3TN91 4BQ5A 4ASKA 4IEUA 2QTWB 2VW0A 5L73A 3HEIA 1T6BX 5JXGA 5F3EA 3SITA 2D6KA 4IE0A 3JB4C 4HN0A 4JGYB 3MW4A 2ZCWA 3VBRC 3HNBM 4P08A 1RUE3 2VGDA 1HIXA 3MUY1 2R0FA 5HCHA 2XLAA 5EJ3A 3ETQA 5GZCA 5FRAA 3N7MA 4ZZ5A 1SDDB 3V64A 2B46X 1LHWA 1JZ3A 5GALA 2VZPA 1CIWA 1JHJA 5IHRA 5LATA 4CDQA 2NYYA 1LKNA 3GNEA 3UKTA 1H8TB 2ZJCA 4LKDA 5DMYA 3POWA 3SLIA 1JZ4A 1SACA 4C8DA 4EROA 5KR7A 3IBMA 2WZ8A 5C4WA 4RSUA 1JODA 1K45A 1WW5A 1DYOA 2Q30A 4LO4B 3U14A 5K0UB 2WNEA 1BEV2 2RHPA 3O1OA 1KGYA 5LCWL 3NJYA 2XJVA 4JC1A 5J09A 4LITA 1I6XA 1LOAA 1OF3A 3I59A 3NW4A 5SV5A 1WGPA 2RM22 1ZZCA 4MLOA 1CESA 4WM8A 1DDLA 4MV2A 1ZM1A 3OPTA
chains in the Genus database with same CATH topology
5FMOL 1H9WA 2NMNA 3VLBB 3A0KA 4XHXA 4HKWA 2QCSB 2WA3A 1S0GA 5H9RA 4KBBA 1YFUA 4NN0A 4UW3A 1DF0A 2OUJA 5DZGA 5EWSA 1B35C 4RQPC 3RS6A 3INAA 3AZYA 1YFXA 4NHMA 3WG1A 3H7YA 1DGRN 4E4SA 5A32B 4Q0PA 1DFQA 3B7MA 2QDNA 3H7JA 4HBNA 1WLCA 2Z69A 4HKLA 1GR3A 2XJRA 1CN1A 5DUUA 5DG1A 2XJPA 3MIGA 4AQSA 2GC3A 2WZPP 2WS91 1UL9A 5FLIA 3USUB 2GAUA 3NV2A 2GNDA 1XE7A 1WW6A 1VBB3 1COV1 3ES4A 3O0VA 4Y1UA 3IKWA 2NPIA 3TRSB 1PO22 3SCFA 4AI3A 1U5YA 5LEJA 2IXCA 5T50A 4PDWA 1ZBE2 3RYPA 3USSA 2XG3A 3D0JA 4XFCA 3M3IA 3MF6A 1YIFA 5CVRA 2KXLA 4LLFA 4MGYE 5BY5A 3ZO0B 1H2LA 1BBT1 2RE9A 4JRAA 1OQEA 1C8M2 1IS3A 2SBAA 4XJWA 1QU0A 1COV3 1OMIA 5HCAA 2DVFA 2WT1A 3OPZA 3OY8B 2YHJA 3N3HA 1OI6A 5JSRA 4MXWA 1I1EA 1GNZA 3CJIB 1GLHA 2IXLA 4AI0A 4EWAA 1WBFA 4KG8A 3VKOA 1NE4A 1AR71 3MIDA 1RMU2 5A3MA 3SNMA 2YGMA 4ASLA 2PN5A 4CZSA 2A73B 3WUDA 1BBT3 4Y20B 1BQPA 3TNPB 2ET7A 2DYCA 4BOWA 4CDQC 1VLNA 1W6OB 4IEOA 4YG3A 4Z2WA 2P37A 2I45A 4XPVA 1HRI2 5C4WC 4Q0SA 3S7IA 1X82A 3QACA 1MZFA 4U2AA 2HEYF 3D8CA 3LA7A 4I0WB 3JQWA 3IPVA 4FOVA 5HXVA 4H3WA 4NOTA 1PZ7A 5GZDA 1X50A 3I7DA 4WM8C 4XTMA 1CGPA 1AR73 1YXWA 2Q1ZB 1SLTA 3ILFA 4LBQA 2JG9C 3HIFA 1V6IA 1LECA 5CADA 3M4FA 1QDOA 2CGNA 2RS32 3V56A 1LJ7A 1MR5A 3NWKA 4KWJA 2R072 3UKNA 1AUYA 3ZFFA 4XF4A 2A3YA 1J3RA 1C3HA 2B39A 5FQ0A 4AGVA 5F5QA 1D4VB 4H14A 1H2MA 4Z8BA 2HWE2 5D8AA 4D69A 5BNPB 2OZ6A 5GJ6A 5L7OA 4LE4A 1LRHA 1OA4A 4Q2FA 4LTAA 2H6CA 2EXKA 2D3RA 2XVLA 4XBLA 4OZXA 5IK5A 3W59A 4DRRA 4J6GA 5DUWA 4AEJA 3VBHC 4FPKA 4C1WA 3AYAA 1AF9A 4XFAA 1LGCA 5D1IA 1JOJA 3ST7A 3ZYGA 1RHI1 2IXHA 1XYPA 2VOVA 3H1MA 2GC2A 3MYXA 2IXJA 4PDWC 1RC6A 4LBOA 2AGSA 2QFEA 4DNYA 1H8VA 4GMP3 1TQ5A 4P5HA 3AB0A 5GLWA 3B93A 1A78A 4HL0A 4XXAA 3VUOA 3MDPA 1NE6A 1GQHA 1GV9A 3E5QA 1W2UA 2JG9B 4R4XA 1NCRA 4XJUA 1CAUA 4QPYA 5HCFA 1RUD1 1QH6A 2ZBJA 1N1VA 4YVSA 3JU9A 4BH9A 5GM0A 1RHI3 5FREA 1FYUA 3JBG2 1IQAA 1AL0G 4EV0A 1Q3EA 1KFXL 2RR12 1W0OA 2R16A 2ZGOA 5JPMB 1QF3A 4KWLA 5BUVA 3RJ2X 4AEDA 1Z7S2 3GBGA 1VAKA 1UZYA 3LA2A 5I0RA 5JMCA 2WC2A 1HDKA 1C57A 5T5LA 5JI9A 2EIGA 4CEYA 2DCZA 1J1LA 3ZSJA 4YZ1A 3VKMA 4XYXA 3UKVA 4A2UA 3FE5A 2SLIA 2RJKA 3AKTA 3ASIA 5JVVA 4DFSA 4I0BA 1JBCA 1ND3A 1RUD3 2RS53 4XJZA 5FO9B 3MGUA 1BZWA 2DURA 2ZX1A 3VBHB 4AF9A 1DG6A 1FOD3 1PZ8A 1CPMA 1DGLA 3H3ZA 1ULEA 2WKKA 5I8SA 1BKZA 3ROUA 3R6SA 1LHUA 1QQP1 1SLCA 1TNRA 4LBQD 4F83A 4BPZA 2GSYA 5JPNB 3LWCA 1FNZA 4P9XA 1V9U2 1ZZ8A 2RJLA 3ZSLA 1IPJA 3C3VA 4CEWA 4CYDA 4JGZB 1NCQB 2JX9A 4IV3A 1RUJ2 3ZFFC 3O14A 4FPHA 4R4ZA 3GZUC 4JCKA 2XBO1 1R081 1A6CA 4QQOA 3FFZA 4MYEA 5D8AC 5L7OC 3S6PA 1S0DA 1QOSA 4BMEA 4G3YC 1QQP3 1BVP1 1O5LA 4COUA 4D7SA 3LCPA 4YRDA 3IDEA 4XHBA 2D3PA 3WG3A 2NZ9A 4XE9A 2XH6A 2VXRA 1PK6C 1Q8SA 3C2UA 4HFSA 3H8UA 3ZXKA 4COWA 3WVJA 2FZ1A 3D0SA 4OHZA 2A6WA 1AR92 1D4M2 1SLIA 3ZN5A 1S55A 3JB8A 5BNQA 2ET1A 2XBO3 1OQDA 5A33A 2HJIA 1CJDA 1R083 1VRH2 2KA3A 4FAHA 3BOPA 5CFCA 2C9AA 1FX5A 3WW4A 3WCRA 1HXS3 3ZFGB 3DN7A 1XYOA 2D3SA 3AX4A 3HAGA 1O5UA 1WW7A 1GSLA 4GB31 4IQPA 1SBEA 4FPCA 2DVBA 2HYKA 1RUH3 5FAXA 2AZ5A 3AP5A 2P3JA 1NCRC 4FXKB 3KM5A 2DTWA 3J8F2 5FOJB 2A5ZA 2PLV3 1ZX5A 3AMMA 3KS7A 3VBSC 3KT4A 4RHV2 1S2BA 1ZZ9A 2VW1A 4MSVA 4YM2A 2Q8OA 4MVTA 4RGAA 3ZYPA 4WM7C 4ZU7A 2JECA 1JH5A 2QNKA 3NV1A 3ILNA 2WZR2 5E8AA 4B3NA 1FPN2 2NMOA 1IS5A 4AEDC 4QPIA 3WQ0A 1GFF2 2HKXA 4HT1T 1RL3A 2V73A 4CEYC 3M70A 4GB33 4Y4YA 2DFCA 3AZVA 1PK6B 1YYNA 1BMV2 2P17A 2ZGSA 1VIWB 4Q4X2 1DIWA 1R1ZA 5JSPA 3DKWA 1CAXB 4BYYA 5ACA3 1Z78A 3SH5A 3SHRA 1U5IA 5FMOS 1F2NA 3KZ4C 4BWOA 2VG9A 1ULCA 1QJY2 5FBZA 5F9TA 2NQYA 4XFFA 4L11A 4HPKB 3ME2A 4BE3A 3B9CA 1UPIA 3AMNA 3B01A 4PBOA 3RRDA 2CWMA 2WJSA 4KNCA 4XFIA 4QPGC 4CEWC 1DHKB 1AR81 1UU6A 1X8MA 4LULA 4E27A 4TSVA 3HT2A 4IV3C 2B5HA 3GBFA 2QJVA 4PQ9A 3WQ1A 5JZGA 5E88A 3LSEA 3L2YA 4IV1B 2Z79A 4MXVA 4ONUA 1LOFC 2WA4A 4LA3A 4A3XA 5L19A 1F9KA 4HZFA 2P3IA 3RWNA 5DUXA 5EZWA 3H3UA 1A8MA 4WM7B 5KHGA 5LK7B 1YI7A 3DF0A 4URTA 2PHLA 3O5SA 2ZX0A 1RUNA 2DUOA 1NXD1 1HRV2 3VKLA 1KQRA 3OTFA 1AR83 2IXKA 2QVSB 4D94A 1PIV1 2O1QA 1PVC2 4J1XA 4JTOA 2ETEA 5EYXA 2VMIA 4XF1A 1QHDA 2CWSA 4LBJA 3TYJA 3AYDA 1MEC2 2PHRA 1VALA 1QOTA 2QZ3A 4YVWC 4G9SB 1MQTB 1LULA 3JQXA 1D2QA 1EY2A 1XQNA 4COVA 1DQ1A 1S1AA 2OVUA 4ITCA 3ZMOA 4YW1A 3UK9A 4Z82A 3AP4A 3N4MA 3QCWA 1X36A 5CIRA 1GKBA 4X6QB 5FPZA 2WNVA 1PGL2 2BNNA 2YY1A 2IZWA 1REFA 2H6BA 2HWF2 3HQXA 3MLJA 4QPGB 4AE2A 1EV13 3D6EA 2I2SA 1EP0A 1V6OA 2VMGA 1WUVA 2E7AA 4XF3A 1YIPA 3D4KA 1ZZ7A 5JIUA 3RJRA 1OFNA 3ZXFA 3RQ0A 4QPIC 4D7TA 4YNIA 1BYHA 4QM8A 1V6MA 3VL8A 2G9FA 4XFBA 1CAVB 3R0RA 4XQDA 4M01A 1FV3A 1R1A2 1TME2 1OPOA 2Y0OA 3PTYA 2MEV1 1YUDA 4L92A 4MGKE 5GLUA 3ZN6B 1BEV3 1J3QA 1G7YA 3NAPC 2A71A 3KCXA 4FQZA 5JLVA 4WVMB 2JG8A 1H1MA 2BFUL 1BK1A 2DWRA 2ZGPA 3AP6A 5CU1A 1LU1A 5GLTA 4AQ2A 2IFWA 4CDUB 1CD3G 4E9KA 2RS12 3ATGA 4BCUA 2IFRA 3M3CA 3WG2A 5BNNB 4AFDA 2A70A 1AHSA 5JIAA 1ENXA 5AC91 1SEFA 4E4ZA 3ZIXA 1AVBA 3GYDA 4GALA 3O12A 4YFZA 1PO21 1XE8A 4Y20A 1H2KA 4AVCA 3JZVA 3VZOA 1V6NA 2MEV3 3KMHA 5JZGC 1Q8OA 4B4QA 2DTYA 1RUE1 5GZFA 1RUF2 1UU5A 2XJQA 4DPNA 1GZWB 3N7LA 1OOPB 2A3WA 2VQ0A 3DL3A 4FO9A 4M0NA 1LU2A 1KD7A 4H55A 2ZX4A 5JOZA 4K3UA 3JD72 1AYN2 4FTBA 2WNUB 4Y22B 5CFDA 4OHVA 1UIKA 4A7YA 4CDXC 4YG0A 1AR61 2HEWF 4GXLA 4Q0QA 4XJ9A 1PO23 3WDYA 1XRUA 2GU9A 1FMD1 1PHMA 1DQ6A 3H9AA 4AXOA 3ZX7A 1ZRCA 5B2GB 2Y0IA 2DVAA 1MS4A 1RGSA 4OI1A 4ZU4A 1EAH1 1ENQA 1ALYA 2JD4A 4FVVA 4AI8A 2JJ6A 3SH4A 4DXZA 3BALA 5C9AA 1MACA 1RMU1 3NAPB 4I09A 2GMEA 1SQ4A 2A6XA 4KU7A 4COZA 2MPFA 3VBUB 3B9IA 3MPBA 3VGIA 1C8M3 4CP1A 4ISQA 2ZOEB 3VZJA 4HLTA 4OULA 2E51A 1ZZ6A 1LGBA 2R042 3CF6E 5HI0A 5KXBA 1RJ8A 1AR63 3HT1A 3WX5A 2XWJB 4AHZA 3RMXA 1NA1A 2GMPA 3M3EA 1ASJ1 1KJLA 2R061 2VNOA 2PAMA 1FMD3 1ZRDA 4N43B 4W6WA 3GALA 5HCBA 1RUG2 1CAWA 1EAH3 3HR9A 2O8QA 4HVQA 4FPFA 1DZRA 1PO12 2LUWA 2ENRA 1RMU3 1VBB1 4ASMB 1QY4A 2C1FA 2FBEA 2GMMA 4M3CA 4Z92B 2BPA2 4YGDA 1DYPA 1IKPA 4I02A 3CU7A 1H1IA 1UW8A 1SFYA 4Q4W1 4YW2A 5AFEA 1AX1A 2TEPA 3E5UA 3EXUA 1H4HA 5BNOB 4LEJA 3B69A 4CDXB 1ASJ3 5C8CA 4FTSA 2R063 1DZTA 1UU4A 2IC1A 1KJRA 1CJPA 2CYFA 2PHFA 1KITA 2WFF1 3UJQA 2Q1MA 1VBC2 3ELNA 4QD2A 3K51A 4N53A 3VBRB 3J26N 4ORFA 3RZZA 5IK8A 3WR0A 3LAGA 1G9CA 5FLJA 1Z0HA 5JOXA 4N9IA 2ZZQA 1QDCA 4Q4W3 4I30A 4C1XA 5DDJ1 4LHLA 3N35A 1TMF2 2LM3A 4ZU5A 1AZDA 4Q26A 2PTMA 1W6PB 5AFBA 2ZPXA 4QGNA 2OW4A 2RMU1 3ENRA 4Z07A 1GQGA 1WCKA 1AXKA 1ZBA2 2PHDA 3M3QA 3R4SA 2WFF3 2I07B 2WL1A 1PGW2 4UW6A 1SMVA 3AKSA 3EHKA 2UWBA 3LOBA 3I2DA 1KXGA 2HWD1 2D6MA 3WD5A 3T1MA 5CFDC 1LOGA 5JSOA 1RVF2 2V5YA 4NPRA 2WT2A 4QX5A 3VBOA 3WDXA 4IEZA 3R4DB 3RPQA 4DS0A 2BW8A 5DDJ3 1K5MA 3E6DA 1SDWA 3SISA 2NM1A 4AEMA 3THPA 1B35B 4XXPA 4RQPB 1W6QB 2D5FA 4PF5A 4Q8LA 3U0ZA 1QMJA 1GNHA 4Q27A 2RMU3 3WP5A 5C9AC 2Z5WA 1MS8A 1NY72 3EJKA 1ULDA 3N36A 1JXNA 3TN92 1NLSA 2K9ZA 2HWD3 4XW3A 3H1WA 4GWMA 1TE1B 3ZXAC 5AVPA 4UBHA 4W6YA 1NA1C 3LZZA 5ABJA 2PHTA 1AJKA 4B7EA 4Q4V1 1WCSA 4CP0A 3QLQA 4AHYA 4HSJA 4Q0VA 1FATA 3OYWB 1DGRA 3PLQA 2DU1A 3KCCA 2RR13 2ZKLA 3WDUA 4DY5A 3HBZA 1UF2C 4Q4Y1 1C1LA 1XNBA 4AG4A 1Z7S3 5JR7B 4Q8KA 1BJQA 1VBE1 2EVXA 1IGOA 4Y1XA 5IUQA 3VDDA 5DUVA 2X5IA 4AFAA 3AXEA 1Q8PA 4IETA 1CX4A 2AYHA 1ZNPA 1S0BA 2BYVE 3LB9A 1L3JA 1ZA4A 4R9AA 5C8CC 2WWSA 4Q4V3 3AZXA 1QXPA 4GMP1 4TZDA 3CLPA 3WHUA 4AQ6A 3V0AA 1VR3A 1LENA 2VVEA 1N1YA 3AP7A 3MLKA 2K2SA 4OLLA 2X53S 2X8KA 3MW2A 4GWNA 1QNYA 2C0ZA 1V6KA 5FLHA 1VJ2A 2OUHA 3PVOA 1SBFA 1URXA 2EALA 1V9U3 3OF1A 4N53C 1UIJA 4Q4Y3 4C91A 3ILRA 1DGWX 1VP6A 1VBE3 4AFCA 2YZ4A 2XL9A 2XJTA 2Z42A 2CGPA 4AYUA 1G6NA 4JDMA 5EFUA 4YGEA 1D4M1 3MFCA 2BBVA 3PJYA 4CDQB 1S0JA 2EAKA 4FP3A 4FPGA 4QGMA 3V0BA 3SXWA 4PBPA 4R9DA 2WS92 4TWTA 2BQPA 1LCLA 3ZXEA 1DQ2A 5C4WB 4OUMA 1UMZA 1COV2 1LOCA 4HETA 3U4XA 1HV0A 4WBBA 3P3NA 1OSGA 2D6PA 3I59B 4HVRA 1H0BA 3PVNA 2VOKA 2WQZC 4LUMA