4XQDA

X-ray structure analysis of xylanase-wt at ph4.0
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
188
structure length
188
Chain Sequence
IQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase 2
publication title Direct determination of protonation states and visualization of hydrogen bonding in a glycoside hydrolase with neutron crystallography.
pubmed doi rcsb
source organism Hypocrea jecorina
total genus 55
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2015-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xqdA00
3VZOA 2B42B 2DCZA 4H7MA 4NPRA 2D97A 1OLQA 1H4GA 2F6BA 2VUJA 1OA4A 1REEA 3AKSA 1IGOA 3WP4A 2JEMA 3B7MA 1HV1A 2C1FA 3VLBB 2JENA 3VHPA 1KS5A 3WR0A 1XNBA 1XYPA 2NLRA 4HK9A 3VL9A 2BVVA 1C5IA 4S2GA 4XQDA 3AKRA 1XYNA 5K7PA 2B46X 4IXLA 3LGRA 1TE1B 3VHOA 1XYOA 1QH6A 1REFA 1H1AA 3VZJA 1XNDA 1ENXA 3AMQA 3WQ0A 1BK1A 1PVXA 3AMPA 3VZMA 4S2FA 3HD8B 3WXPA 1HIXA 4XQWA 3VZLA 1UU6A 3WQ1A 3AKQA 5EJ3A 2VG9A 3WP6A 4HK8A 3WP5A 2BW8A 3B5LB 1F5JA 3MF9A 4HKLA 3VZKA 1XXNA 1H0BA 2B45X 1UKRA 2NQYA 3RI9A 1BCXA 1BVVA 2DFCA 1KS4A 3AMNA 3MFCA 1NLRA 5K9YA 2Z79A 3VHNA 2BWCA 1H8VA 1C5HA 2BWAA 4HKOA 1OA3A 1QH7A 2QZ3A 1UU4A 1OLRA 1OA2A 1M4WA 1YNAA 3AMHA 1UU5A 3M4FA 3O7OA 3ZSEA 3WQ7A 3RI8A 2DCJA 4XPVA 3VL8A 4S2HA 2DCKA 2DCYA 2QZ2A 3WP3A 3MF6A 1XNCA 1H4HA 3VZNA 3AKTA 3WT3A 3MFAA 1XNKA 5HXVA 3WY6A 3WX5A 2D98A 2VULA 1REDA 4S2DA 4XQ4A 4HKWA 2DFBA 3VGIA 3LB9A 3AMMA 3EXUA 1W2UA 3AKPA 1HV0A 2JICA 1AXKA 2VGDA 1T6GC
chains in the Genus database with same CATH superfamily
1GSLA 3VZOA 1CESA 3AM2A 1NT0A 2R0HA 4DNYA 2RJLA 5KR7A 5LBFA 2HLEA 4CTEA 1W6NA 3PIGA 4O61A 5C3SA 3BOPA 5T5OA 5LB6A 4M00A 4HETA 4CP1A 3OGSA 2GZWA 4IETA 3OPWA 3PDQA 1JOBA 3ES4A 3ACFA 5FP8A 4XFGA 2VD7A 4KWUA 3NAPA 3OY8B 4OI0A 3J7LA 2ZX4A 4I0BA 4GH4A 3RMYA 1PK6B 4AG4A 5FYMA 1V6NA 2WR9A 2DBNA 4HPKA 5JSOA 5FZMA 2RE9A 2Y33A 4FPEA 5FZIA 1LHUA 1XPWA 4QXKA 4CDWB 3BODA 3AYCA 2HWF3 2JG9A 1H6XA 1O91A 3WF2A 5GM0A 1D7PM 1ZRRA 4QKBA 3UJOA 1O4YA 5A3WA 4H55A 3M7AA 2B46X 2J1RA 1BQPA 4A6SA 3ASIA 3LA7A 4Q2FA 2WO1A 3VBRB 2EIGA 3VHOA 1XYOA 1M06G 5FQ0A 1SBEA 3E5QA 2BRTA 1CIWA 1LGCA 3GBFA 1WLWA 4I0AA 5FO8B 1JUIA 2ZHLA 4MYEA 5DZFA 1RYYA 4BISA 1VRBA 2PHDA 1PNGA 1SLTA 2N7GA 3MV11 4IV3B 1OD3A 1UOGA 2WWUA 1PIV2 3ZN4A 4Y1YA 2V09A 3QCWA 4A7ZA 1QNWA 3NO8A 5BNNC 1AYN3 4AGGA 2PXJA 5SV5A 5JXHA 5LATA 4INDA 4B4RA 4WVVA 3ZSMA 3AXDA 3FFQA 1Q5OA 1AX2A 5LWBA 3BALA 4QAWA 2PHRA 1W8UA 5LEJA 1O59A 4RS5A 1EUUA 1E5IA 1HKDA 1W99A 4W6XA 3USUA 4P9LA 1EV13 4FPHA 1NOVA 4LLFA 5DUUA 3KMHA 2AEYA 3RQ0A 4BE3A 1QNYA 1YHFA 2DDUA 5T52A 1LU2A 5I0DA 5A6YA 1UIKA 3MUZ1 5K9YA 2Z79A 1HJGA 4LR4A 5A1LA 1FMD1 2UWAA 3NV2A 3VHNA 2F4LA 4E2SA 4L99A 1W0OA 5JMCA 2ZEWA 4PLMA 2WWSA 3C7GA 1J3PA 3DPRA 4PIXA 4J25A 2UURA 5LA0A 2QQJA 1XBFA 2Y6JA 2HYKA 1KQRA 2JKXA 3TN91 3U4XA 3SKVA 2HWB2 4FQZA 5FZOA 2ZKLA 2DCTA 1OD5A 4TLFA 1HW5A 2I74A 4RGGA 2K0GA 2B39A 2ZGKA 2JECA 3I49A 2J7MA 4NRMA 2R062 1OOPC 2VJXA 3V0AA 2XJVA 1GZ9A 3AXEA 1SQ4A 2DTYA 1TNRA 2W46A 2YC4A 4I02A 2Y26A 5DDJ3 3T0BA 3KQ4B 3WP3A 4C90A 5CISA 1H4HA 1I5PA 1PMJX 1W6NB 1R1A2 5J7MA 3MFAA 3O1SA 1QJFA 4WVMA 3T1LA 4XACA 2YY1A 2K46A 4EN0A 4UFJA 4BXFA 5D1IA 2MEV2 4RD7A 4CUBA 5IVVA 4XFHA 3NAPB 4XQ4A 1TME2 3HN1A 4LUMA 3QOPA 2XB6C 3KVBA 1XSRA 3J7NA 3A4UA 5I93A 1HV0A 4HPKB 5FK8A 1T6GC 3HPNA 3H3LA 2VVEA 4Y4YA 2VOXA 3I8TA 2SBAA 4OI1A 5A3TA 2TEPA 1TMF3 4OHZA 2JG9B 2XVLA 1IPJA 5EIYB 2XMLA 4FPOB 3O5SA 1JOPA 2E31A 4CU7A 1JODA 1Z7S3 5JUVA 3PMSA 3N9MA 3HBZA 2WINB 2FDKA 5FQ0B 4HFSA 4HVOA 3T0AA 4XUTA 1HV1A 1FOD1 3LOIA 3CO2A 3VLBB 1KDKA 1Y7BA 1QQP1 2JENA 2ZGRA 3P6BA 3Q8EA 3WNXA 3WR0A 3B9CA 3D6EA 3QH6A 3ENRA 2VE1A 3FJSA 2HJIA 1XRUA 3H1MA 2RM21 3A21A 5A3LA 2ZMNA 3VBHC 3VD3A 4XEZA 1UIJA 5K7PA 3GBGA 4HMZA 2WNUA 1IS4A 2W92A 5IATA 1G86A 4JGZA 2P1BA 1FAYA 1JN2P 3LGRA 4IW3A 4AI2A 4OZOA 1QH6A 1VMFA 3FX3A 4A45A 1HQNA 1VBC2 4RS5B 4L8QA 5LK5A 1H1AA 1K3IA 2VCBA 3WNLA 2JIGA 2ZEXA 1ENXA 1EAH3 3USUB 4CP2A 5J36A 4J6GA 1GOGA 2VU9A 3ACGA 4K9SA 3W59A 2LRPA 4CCLA 3NNLA 4EZ4A 4S2FA 1YQ6A 3GZUC 3KGLA 4AK3A 1VRH2 1UU6A 2KA3A 3GCWA 3I3EA 2A70A 4LBNA 1QJX2 1TZOA 3ZXKA 1YIPA 5J09A 3HEIA 2EXHA 1VBE3 1KXGA 1DDLA 4JKKA 3AL5A 4JVAA 2VVDA 3DYMA 2ORXA 4GXLA 4LULA 1WLCA 1YUDA 3CHXA 3M1HA 3VZKA 2RG4A 1DHKB 2HKXA 4DINB 1S2KA 2XJRA 3L9JT 2BNMA 4MOAA 2J1SA 5C4WC 1JZ8A 1A8MA 1I3HA 4J1WA 3JXSA 1S0DA 4NMIA 1OI6A 4R4XA 1AR92 1VAKA 1ZZCA 1UXZA 3AMNA 1C1LA 4GB32 5CFCC 4NHMA 1SPPB 4D3WA 5C8WA 1BBT3 1RC6A 3JD71 3NW4A 3T4HB 1DQ5A 2X5IC 5EP9A 3V0AB 1W2TA 3CF6E 4RA0A 3BYWA 1UY4A 5DABA 5K0UA 5DAWA 5FMBA 1H2NA 1W6MA 3H50A 1C57A 3IIAA 3OGJA 4FT8A 5BXXA 5CB7A 4CU6A 4WVMB 2XHNA 4BHPA 2OXBA 1YFXA 3AL6A 4M01A 4FSJA 4PI2A 2UYBA 3M3QA 4Y26A 3WDYA 1K42A 4CDXB 4LTAA 1ZBE1 4JRLA 1W39A 4QPIA 4O65A 5FXXA 1UQXA 1IS5A 2R073 2ZOEB 5LY1A 2VH9A 4OULA 1NG0A 1JZ3A 2O0OA 3RI8A 1X7NA 3WZ1A 4FPLA 4ZPIA 4QX7A 2GNBA 3ZKYA 4RHV2 5DG2A 1F35A 4ZHNA 4Q4W2 2IXJA 1Y3TA 1WWYA 1UWWA 1TQ5A 4B7EA 5L19A 2A3YA 1F4AA 3WSOA 2E7TA 1F4HA 3WCRA 5JOXA 4HKWA 1NUKA 1WA6X 1JZ2A 2UWBA 1PM4A 2C26A 2QBXA 2VUAA 2VPVA 3O14A 1AF9A 1RUD1 3TAYA 5AC91 3IWZA 3O1OA 3IAPA 2W94A 2WSVA 3KV4A 2CAVA 3U1XA 3U0ZA 1CZVA 1PZ8A 4BQ5A 2MHFA 2WNUB 1DQ2A 1QMJA 1V6IA 1NLQA 2FDIA 4JGZB 5FY9A 4LKDA 1UX7A 2UY8A 3AKSA 1IHMA 4GA9A 4LA2A 4KL1A 1OT5A 1JYWA 2RS13 3I2IA 1W2OA 3N7JA 1COV1 3UT0A 2X09A 3GF6A 3O1UA 3K51A 3NRUA 3RZLA 4LE4A 4DUXA 2LM3A 2EALA 1BKZA 1NE4A 4YVWB 4RN5A 4Y20A 2WZ8A 5F32A 5FKBA 3JU9A 1GQHA 5T50A 1U5ZA 4P08A 1N3PA 3UYJA 3U37A 1J59A 4RQPC 1W2NA 2JDUA 2W1SA 4XF9A 2K2SA 1Z78A 4RL7A 5DG1A 1UXXX 4JTOA 2WC2A 2ZGQA 4Y5SA 1REFA 1UL9A 1KGYA 2Q1ZB 2RDSA 1UCXA 1HQWA 2FZ2A 4QPGA 2CAUA 1GZTA 2Y6GA 2ARCA 3J8F1 1CAUA 3MW4A 1RUH3 4YG6A 5L9BA 2JE8A 1AL21 5FXWA 1H2LA 3THPA 1SCRA 3ATGA 3HBKA 2JG8A 1S0FA 1ULFA 4DXRA 4XHXA 3D82A 4Z1VA 4AHZA 2R0FA 2Q8DA 5K0UB 3GZAA 1ND2C 3OBZA 4WM7C 1W6MB 3RWNA 5BY5A 2DURA 2EAKA 2RR11 2D6LX 2WT1A 4JDNA 3ZXGA 1OQ1A 2XOMA 3DGTA 1S0BA 1GQPA 2GNTA 3NKGA 4OHWA 5F37A 1GANA 1RUE3 1ULDA 5HCFA 4QPIB 3OG2A 4CCEA 3ZDSA 2Q1MA 1W8ZA 5IUQA 5EWSA 3KF3A 1CVNA 1ZRCA 4QGMA 2XLGA 5HPOA 5KHKA 2OQ6A 1LR5A 1PVC1 1G8WA 1UD1A 2F4PA 3AYDA 3ME2A 4Y24A 4LBKA 1JUHA 4LITA 1UYPA 1YJKA 2VY0A 4QU2A 3AFGA 2XG3A 4EWDA 3W9AA 4QQHA 1YNAA 1CGPA 4IEZA 3VHRA 4NROA 5F9TA 1V70A 3WW3A 4PDWC 3N7LA 2ADDA 4V2VA 2XWBB 3ZO0B 1VALA 4H3WA 2WRAA 2Y8KA 2WO3A 3DUIA 5ANQA 2B9UA 3I54A 1D4M3 3IPVA 3AZVA 3VBOA 4CCJA 4NUBA 2G4IA 5GZEA 4BYYA 3IAQA 5T3NA 5HCAA 1JXNA 5DAVA 2E53A 2WA3A 2QVSB 1CD3G 4XUQA 4Y4RA 4COWA 2YXSA 1MVQA 2WZR1 5IVYA 4URAA 2KXLA 5C3PA 1MEC1 2D3SA 4K8RB 4QX5A 5FOBB 2H6BA 2ORZA 3BCWA 1JS9A 1PO21 4K1ZA 2JDYA 3T2PA 3SXWA 4GALA 3RVHA 4AQ2A 5BNOA 3JBG3 1BZWA 3VDDA 1UOBA 2Y6HA 1PX3A 2YBPA 4MUVA 4Y20B 3WOGA 2WLPA 4GMP0 4XUOA 3LDRA 2VUJA 2Y0IA 4MV2A 4CDUC 1UZYA 3AFKA 3LCPA 1POV1 3CNAA 1MZ6A 5FXVA 3WP4A 3ACHA 1W6OB 2BJSA 2W91A 1UOJA 2WFF1 1AX0A 1QKQA 4NIGA 1K12A 2XH6A 3RYKA 2CU5A 4QPGB 3SHRA 1CAUB 1GOFA 2HWE3 3I2GA 4LLOA 2IUWA 1W04A 1LOFA 1CZTA 5FMOS 1A6CA 4PLNA 2HWD3 1W6QA 2MPFA 4YRDA 5LRRA 1T2XA 2JG8B 4XFAA 4H14A 2H0BA 4AAPA 5GZDA 1FMD2 5ABJB 5FPZA 3UKTA 1ASJ1 1QHDA 3FLPA 1NZIA 3H3ZA 1SZBA 1UPSA 4PBPA 1RUI3 3T3YA 2R32A 3D5OA 4AI1A 4AVSA 1CX1A 2A6YA 2XPJA 4YWAA 2CTVA 2Z4FA 1S0EA 3ELNA 3LWCA 3TN92 1PVXA 2UU8A 4LHLA 5J96B 3WXPA 4YZ3A 1V6LA 2XUEA 4N53A 2HWF1 3M3EA 4XQWA 2BDRA 3IMMA 3VZLA 5DPNA 5JOYA 4OQ8A 1J3RA 2BW8A 2PHLA 4XMIA 1RXGA 2H6CA 1S1AA 3E5UA 4IEPA 2C9AA 4UFLA 5APAA 3WDXA 4GWIA 2EICA 4UW5A 3OD4A 1FV2A 2QQNA 5CKQA 3C8XA 3MF9A 4JX0A 1GU3A 1QXRA 2YC0A 2PHWA 2WSUA 4Q4V3 2CGPA 3AVSA 2SLIA 1BCXA 4NIIA 1SLLA 2UY9A 4KGQA 3R4DB 4LBQA 4YVSC 2BQPA 1PZ7A 3WD5A 2VAUA 1X33A 3LIHA 1SACA 4AHXA 4DB5A 2J22A 5FY0A 5A7WA 3VBOB 1NE6A 2QQOA 3RZHA 2BWAA 2WN3A 5G05L 1UMIA 4XBQA 1Q56A 4QKFA 4DY5A 1QH7A 3DXUA 2VW1A 3ILFA 2B9VA 3PVEA 4OUMA 3ZIWA 1EV11 1OA2A 1LKNA 1W3XA 4NHXA 3NQHA 3AZXA 3K2OA 1SDWA 1E5SA 4OQ9A 1XU1A 1C8M3 1LENA 1QQP2 3PL0A 1JYCA 5IFTA 4UWDA 1NY71 5BNOB 1X9TA 3U75A 3K48A 1VAMA 2C24A 3QBQA 3VDDB 2RM22 4LPLA 1AUYA 1J84A 3UGFA 1MS5A 2P6HA 4K8FA 3ZYBA 4MGTA 5L7OC 2Z5WA 2DYCA 2A6WA 3H9AA 3JUUA 3LEGA 3ZDVA 2VTFA 2V5DA 3MW3A 4N43A 3VDBA 1BEV3 5CIRA 1RVF1 2BGOA 3U10A 1RUC3 2WS93 3I97A 1LODA 1R64A 1SCSA 3E97A 4O7XA 3N4MA 4YGCA 2OW4A 5BNQA 5FJHA 2XVGA 4TTGA 1AYM2 5LBCA 2JDMA 3LFMA 2BP6A 5JXGA 2HEYF 4CEYC 1J58A 2DUQA 5CVRA 1URXA 3C7OA 1W6QB 2NP0A 2H0VA 4HG6B 4FOVA 4BOWA 1G6NA 2D43A 5D8AC 4AEDA 4E4SA 2JE7A 4XE9A 2XJSA 3THDA 2D6KA 1B35C 1CX4A 2RVAA 3D3AA 5DMYA 2FCTA 1GKBA 5HCBA 4ATFA 4R52A 5CADA 1AR82 4HVQA 3POWA 5AFEA 5JOWA 4N53B 1TMF1 1QXJA 4YG0A 5C9AC 4WVWA 4Z07A 3WVJA 2XBO3 3UKVA 4LBOA 2XJUA 1Z7S1 4AFDA 3P1IA 4LO4B 4GULA 5BNPA 3BGAA 4GKXA 4YW3A 3TB0A 1ULGA 3AP5A 5E1RA 5FZ0A 1ZNPA 1ND3A 4CCCA 2GP3A 3AMQA 4ZZ8A 1BJQA 3AMPA 1Z0HA 1RHI3 4OYUA 1L7LA 1I9RA 3ZXFA 1ST8A 5J3UA 4R9CA 4NHKA 4PQQA 4LBQB 1ZBE2 4CDQA 2HWC3 1CPMA 4UW4A 3WG4A 1MS3A 2BNOA 1XU2A 3IN9A 4ORFA 1LHOA 4YW7A 1MS8A 1H0BA 1CONA 4MSVA 5FUPA 4LXLA 5IJRA 5M0TA 1DLLA 4QT6A 1W28A 1UKRA 2AGSA 3LSDA 2NN8A 4CPBA 4NJ4A 1YFWA 5EYYA 3RSJA 3MBWA 3T4VA 1MS0A 1BMV1 4Y1VA 5FZ9A 1LHWA 1WMDA 4O9EA 3BN6A 1LHNA 3MIGA 4XURA 2VZOA 3ZYJB 4UW6A 1RUD2 5AC92 3KCXA 1DQ1A 5JCTA 1NA1B 1RUG1 3VBFA 4C0BA 1U5IA 2QQKA 1FI2A 1RL3A 4Y5Z0 3VKFC 5JWPA 4PHZA 3N3HA 1FT9A 3WHTA 4MGSA 3N9NA 1G7YA 2GP5A 1GUIA 4QB1A 1R083 4N43B 2OZJA 2A1XA 4FFIA 3KF5A 3QH7A 4IEUA 4IDZA 2Z42A 4RR3C 5T5PA 4XJ8A 3VKOA 2BBAA 2QDRA 2PLV1 2BEOA 2ZEYA 3JQXA 4QX3A 4XUNA 3RPQA 1E5RA 4A4AA 5CEHA 1COV2 1DLCA 4LIUA 1NX9A 1QOTA 2XKPA 4WV8A 1WW7A 3POJA 4D7TA 3SH3A 1OLME 4TLGA 4IEXA 3WT3A 4QQ2A 2ZGOA 4BQ4A 5FUNA 4DQAA 2VULA 2R1BA 1DYPA 1REDA 3WDTA 2PHXA 1V00A 4FOWA 3EO6A 3SLIA 3VGIA 3O0VA 3LEMA 3KHBA 3T2OA 4P00B 3AKPA 4Z8BA 5ERLA 1UPIA 2I2SA 2JICA 3V65A 3VD5A 3HOBA 2R071 3MLKA 3ZXLA 1UN1A 1KEXA 2EIEA 4KNCA 5G04L 5L9RA 3J8F2 5I8YA 1PGSA 1YEWA 3ZYRA 1AL22 3OBAA 1NCQC 3PJQA 5FP9A 1ODMA 5ISLA 1GLHA 4HN0A 4CP9A 4DO0A 1MQTC 2QE3A 4JTNA 4UBHA 5BNPB 1R091 3CKHA 1RUF1 4CU9A 2ZHNA 1MZFA 1V0AA 5K8SA 3C7EA 1ND3B 2IFWA 2RR12 3I3DA 3K3NA 4FPYA 2D5FA 1VBD3 4XDPA 5FYIA 4EQVA 1W0PA 2JE9A 3IZOA 3U11A 3OEAA 4HK9A 1YC61 1HQLA 3LAGA 4P5HA 5H9QA 5FKCA 4B1LA 4Y22A 4CDQB 5FZCA 4YFZA 5FRAA 3DYPA 4CCOA 2E7QA 3M3CA 2RMU3 4TSVA 1TE1B 1ZVFA 2RDRA 4CUCA 1UY0A 4NWWA 1PK6C 4LKFA 4Q26A 1PVC2 2YPJA 2WNVA 3OUHA 4QD2A 2RS11 5CKMA 4QWNA 4XYXA 2RS31 5JI9A 1O3QA 1AXZA 2ZMKA 3DXTA 4QX2A 3RZKA 1HXS1 2HEVF 4AVAA 5JZGA 3WHUA 3VBRC 1KJLA 5FY1A 4RYDA 3WP6A 3ITQA 3OJBA 5A6QA 4NPMA 3B02A 1F5JA 2R6QA 3F95A 3ILRA 3VBFB 5GALA 2VTXA 4LHNA 3AZZA 1N1SA 2WNEA 3FZ3A 4GMP3 4QU1A 1I6XA 1GBGA 1KDMA 4CSWA 4R9BA 1TG7A 2XJQA 4IV3C 4UFIA 4FTSA 1UZZA 1TEIA 1DQ4A 2WZR2 2ZX1A 4MGQA 1BHGA 4KG0A 5IVBA 5JLVA 1JHNA 1OC1A 1MEC2 3MYXA 3DF0A 2WAAA 1Q8OA 3MFCA 3K77A 1X8EA 3ZXJA 4ZKTB 5C3OA 4KBBA 1PO22 5FK7A 5FFOC 1VB4A 4Q1RA 1WD3A 2HWB3 3K3OA 3FLRA 2WDBA 3B01A 4IGOA 2R1DA 1RXFA 4QXBA 4L97A 2KM2A 2ZZJA 5IYYA 3CZUA 4ZU7A 3IDCB 3DECA 1DP0A 4U36A 4BA6A 3QLQA 2C6SA 1JW6A 3T1MA 2W1QA 5J1XA 5LCWL 2HBUA 4RSUA 5FMOL 3V56A 3IBMA 1IPKA 1W8WA 5C3RA 1QF3A 2WFF2 5TSWA 1AJOA 2JDHA 1GNYA 5DAQA 5E88A 4A42A 2A5ZA 2WQZC 1MACA 2XLFA 4RFT0 1W9WA 3EJKA 2LUWA 3MV01 4NVPA 4XBLA 4XPVA 2GNDA 1NCRA 2ET1A 4LMFA 2ID4A 3MZHA 1AR61 3OEBA 1RINA 3D8CA 4Q0UA 3E6DA 3TEWA 2E63A 4ES9A 2C5DA 2FDFA 4M3CB 5H9RA 3ZLIA 1MR5A 1XE7A 5E89A 2OYZA 5JPMB 4L92A 1ASJ2 1PMIA 1UX6A 1VBA1 5EV7A 2A6XA 3EXUA 1UY3A 3RFRA 1W2UA 4C0HA 5FY8A 2D3PA 4CXXA 3I2JA 2VGDA 3E6BA 3VBHA 3E6CC 2B42B 3TEYA 1SBDA 2W5FA 1D4M1 2DCZA 2JDAA 1US2A 3OGRA 4UXAA 2WL1A 5GZGA 1XB9A 4MZUA 2HWF2 3GZTB 4Y22B 2PMWB 4JV4A 1NYWA 4EWEA 2A75A 3NAPC 4XVHA 3AYAA 1EY2A 1REEA 1H1IA 5A3PA 3KQRA 5A6XA 2EXKA 5T54A 4E9KA 4YG3A 3O0WA 4DEVA 3POFA 2OKXA 2WNVB 1LGNA 1WMFA 5JXJA 2JG9C 4GWNA 4HANA 3H8RA 2XL7A 3RNSA 1NAEA 3JBG1 1JI6A 1R1ZA 2A6ZA 3AZWA 1ZBA3 5JZGB 3VKNA 4GH4B 1CAXA 1JU3A 5FZFA 1XYNA 1SLAA 5A3OA 3GDBA 1WCQA 4GJYA 4DPNA 5C5UA 4QM9A 5I0UA 3QD6A 3ZYPA 4MLOA 1VRH3 3I7DA 3OYWA 5C8CA 5IK8A 1IKQA 2G9GA 2GU9A 4FOYA 1QJX3 4HOOA 4ET7A 5KC6A 2ZHKA 3T30A 2R041 5FYSA 1DYOA 1QJU3 1OUXA 3J7MA 1EV12 3Q8AA 4BH9A 1RJ8A 3UJQA 1NZCA 2IZWA 5DUXA 2HWE1 4KI5M 4ZZ5A 5FLIA 1QOSA 5EJ3A 2VG9A 3JZVA 5BUVA 3SH4A 2J1AA 1YFUA 5JSRA 4ZU5A 3THCA 1RITA 4I0WB 1NY72 1YJLA 5JIUA 3B69A 2NYYA 4GB33 4RS5C 3OBTA 3ZSKA 2EIDA 4CDWC 5F3GA 1OLMA 1XXNA 2XVKA 4OUEA 1G9DA 1CIYA 1RUI1 4AZZA 2G1MA 2V4VA 2P3JA 4IEQA 3HMYA 1F31A 1LOCA 3EB7A 5EJZB 1QIQA 2YBKA 4MXVA 1FV3A 1TNFA 3SCHA 1KS4A 2G19A 1XNTA 1YO8A 2JB8A 3Q8FA 1O3SA 1HLCA 1RVF2 2XR4A 5FLHA 3KV5A 1CJPA 1AYM1 4FAGA 1OBNA 1S0IA 4XF3A 4XZUG 4IV1C 3R6SA 4K6BA 1H8VA 2NMOA 3A0NA 1NCRB 2GMPA 3NMBA 5DDJ2 1H9WA 3HT1A 3MICA 4Q4V1 5FJKA 1Q43A 1ZZBA 3JB8A 2PYTA 3LD8A 4XFFA 2RS51 4RHV3 4QGNA 1W9TA 2PHUA 1BLZA 3AK0A 1FPN3 3DPRB 4W4ZA 2YDEA 1W8NA 3UGGA 1W6PA 1AR81 2YMZA 1W0NA 3SEEA 1SLCA 4CUGA 4K40A 4PCRA 5FZOB 4BU2A 1ENRA 2FHRA 4JGYA 3KD4A 1U12A 4UOJA 1NQDA 4A3ZA 4IE5A 2QZ2A 3MF6A 1XNCA 4XJWA 2R7EB 1TMF2 2YROA 5FZHA 2P5BA 4AVCA 2VZSA 2ZTNA 1MPXA 2CL2A 4CDXC 1W90A 3TWIA 3OD0A 2OPKA 2VBPA 3PUIA 1Z7S2 2EF6A 4FAHA 2VQ0A 2D7FA 4QB6A 2I45A 4XETA 1ZA4A 4NHLA 2PFWA 1JZ7A 2VNRA 5DUWA 5LZ6A 4RGAA 5IAVA 1C8M1 4WM8A 3BB6A 2VTXJ 4KH9A 4NRPA 4PT6A 1GYKA 4MVTA 4RQPA 4AHYA 2D97A 1QXPA 3WDVA 1CAXB 1FNYA 2KD7A 2WT2A 2PN5A 1H6YA 4NWVA 3WLUA 2A7AA 4CCDA 1H4GA 1J1LA 3HWJA 1A3KA 1UY1A 1YXWA 4Y1UA 2J1EA 1WD4A 5C8CB 3OYWB 3OPZA 1VLNA 3L2YA 5IT6A 1RUC1 5EPAA 2ET7A 5EQUA 4AEJA 4MH0E 3BUCA 1SMVA 2OQ7A 1XNBA 3WW1A 3C7FA 3ZVXA 1Q8SA 2Q1FA 2WNUC 1LOBA 4B4PA 4Q0SA 1BMV2 4JGZC 3WQBA 4QDQA 5FMDA 2YB7A 1PO11 3UL2A 2J42A 3NJVA 4YW4A 1GMMA 3H7YA 1JH5A 4A6OA 1IG3A 2VW2A 1XNAA 5FYYA 1RUG2 4HLTA 4OMCA 3S30A 4Q4Y1 4DMIA 1Y9QA 5JOZA 4EN6B 4U2AA 1HN0A 3MIDA 4YVWC 2XQRA 3A22A 2ARAA 2D6MA 3G7DA 5GKAC 3ZFFA 1BK0A 3POSA 2GC3A 2X53S 5A1FA 5CKNA 1LRHA 4OLLA 5C70A 4FTEA 2PLV2 1BBT2 1OMIA 2GMMA 2PAKA 1SFNA 3FUQA 1DGRA 4LO5B 2VMCA 4A7YA 4CCNA 5AFBA 5CG9A 1L3JA 4HKLA 4YGDA 5LEKA 1UY2A 1WMEA 3GJAA 1C28A 2YHJA 2E51A 1LJ7A 1OHFA 3VUOA 2W0XA 3NNGA 2BPA2 4QGLA 2VXRA 5CAZA 4P9GA 1OSGA 3MHZA 2VO5A 1E5HA 2Y0OA 4QHZA 3WNNA 4AVBA 1W6PB 3S0MA 1GP6A 5K0UC 5F39A 2R072 1DBNA 3LFIA 3ECQA 2VECA 2ATFA 1C5HA 4JGYB 4JQTA 4MXWA 1ZZ7A 2BZDA 3O1PA 2IXKA 1OLRA 3NVCA 4P9IA 4LK6A 3BOWA 4QPIC 1YQCA 4C91A 1V6JA 3M2MA 3WF3A 1DQ6A 1OKQA 4Y33A 1R092 2J1TA 1RUF2 3FC0A 3OPTA 3O7OA 1HRV1 1K5MA 1NXD1 2VR4A 4KU8A 4P14A 4WM8B 4AQTA 1BYHA 2PAEA 2JB4A 2GH8A 2BYVE 2YUEA 3APBA 4IEVA 4QB2A 4NRQA 4BQWA 1JYTA 3M70A 4AHWA 4P9WA 1AVBA 1D4VB 3ZIXA 3LPGA 2QTWB 4FXGB 3LEIA 3WX5A 1IKPA 1YRZA 3NV1A 4R9DA 3ALQA 3FHIB 4I3PA 4XCBA 1UOFA 5LBBA 5C71A 4FP3A 1R081 5CA6A 2K9ZA 5FYCA 4K20A 2Y64A 1W8OA 2RS12 3NNJA 2RS32 2VMDA 4Y3OA 5B2GB 3VD9A 3RYPA 1HB3A 1HXS2 3H1YA 5F6LB 1IQAA 5JDBA 4BM8A 1LESA 3ZYHA 3NSTA 4BQYA 1UKGA 2VMGA 5FBZA 3FE5A 1L7RA 1V9U1 1UYZA 2W2IA 4UF0A 5F5QA 5LY2A 1ENQA 2W52A 3MIFA 3CBNA 4A3XA 3BI3A 4XMAA 1PNFA 3BTXA 1K45A 2IVJA 1V6OA 4E2QA 2ILMA 1POV0 1ZZ6A 3GM8A 5A7QA 1RUNA 3KT7A 1W3VA 5CFDA 1HJFA 1VBB1 1GR3A 3MIBA 2BU9A 3VBUA 1E57A 2BVVA 3ZFFB 4BIOA 1QJY3 1OF4A 2D6OX 4Y5TA 3WNOA 4Q4X1 4ASLA 1OVPA 3ZN6A 3JB4C 1D2QA 3S5QA 5A32A 2YC2A 5KHIA 3FWEA 4E2GA 3PU8A 3ZKUA 5GJ6A 3IDAA 5EFUA 5FAXA 4BLJA 1UO9A 4QPGC 2O1QA 1GP4A 3WQ0A 2V5YA 2WO7A 5A33A 3S6PA 2WQ8A 1VBD1 1CJDA 3HD8B 2Y6LA 4D94A 4DXSA 1VIWB 3RZJA 1WMXA 1KRIA 3N7KA 1YQ2A 3U14A 5ABJC 3VBSA 4TN7A 4TYSA 2RMU1 3ZFEA 4FPJA 3H1WA 4Z2AA 4CXYA 2CDPA 5F2SA 4X8PA 2GN7A 2XONA 3PUHA 1AR62 5JMOA 3O1RA 4KWLA 4MXWB 4Q5OA 4BXSV 4GWJA 1G9BA 3IIIA 4XC9A 2GALA 2CHHA 1OPOA 1GZCA 2VUCA 2IVIB 1LB2A 2IXCA 2QCSB 3HNBM 1VBA2 1O4ZA 3ZFGA 3LKJA 1K5MB 3HJRA 2Y38A 4M0HA 4Q0PA 1OPMA 2VOKA 3BU0A 2IC1A 3POGA 3HAGA 1D4M2 1FOD3 5GLVA 2J1VA 4LUKA 3UESA 5C33A 1VJ2A 4HT1T 4NOTA 1DZRA 2QZ3A 4GMP1 5HBAA 1UU4A 1M4WA 3GYDA 4ITCA 4JDMA 3AB0A 3CQOA 1P8JA 4QX1A 1UU5A 4HVRA 1NLSA 3KSCA 3S7EA 2VMEA 3WW2A 3UV9A 5FY5A 1RMU3 1A8DA 2ADEA 1VMHA 1NKGA 1LULA 3M4FA 3VBOC 4UW3A 3ZXAC 3R4UA 4BB3A 4EN8B 3WQ7A 5FY7A 5EXOA 4OUSA 4XFIA 4S2HA 3VL8A 2NMNA 5IHRA 3JBG2 4NR1A 2JDNA 3HR9A 2ZS6B 2QNKA 2VBBA 5C7GA 5FZLA 2JKBA 1AYN1 3IPVB 1H8TA 4JCKA 4N90A 4UF0B 1YWKA 5FBJA 4AI9A 2W87A 4LO7A 2RV9A 2XWJB 2YGLA 2DFBA 1RIRA 1VPHA 1X50A 3KCCA 3S5AA 1IS6A 4DZGA 5BNOC 4JAAA 5IFPA 4GD4A 2R042 3VDDC 5JSPA 3I3BA 4FFGA 2PTMA 2W47A 2WT0A 2TBVA 2YYOA 4PF5A 4BJ0A 1UMZA 2IFRA 5FUIA 2FCUA 5FXZA 3VBUB 2A3WA 4G3YC 4FVVA 5CFDB 2HBTA 2HWE2 2QDNA 4P9XA 3TYJA 3PVBB 2WABA 2HWD2 5IK7A 5CG8A 1AR73 4OZXA 5A32B 3KWVA 3FFZA 2JEMA 2VCMA 3NNMA 2ARXA 2X10A 4YW2A 5FZ7A 2C1FA 4BQ2A 3JD73 4NIAA 5D2AA 4DRRA 4IESA 4C8DA 4XBNA 1RUI2 1TVGA 1G9AA 2CV6A 4ASKA 5A33B 2OPWA 2C4XA 2WKKA 1LOFC 4AVVA 4XJZA 2BFUS 4GKYA 4S2GA 4XQDA 4HN1A 2LS6A 1DZQA 3AKRA 4FP2A 4JKLA 3ZPYA 3DKQA 3VBSB 1FATA 1CN1A 1W05A 3PTRB 2DVFA 3ZFEB 3MGUA 5DDJ1 3N35A 1HB4A 1SHWB 1OVSA 5DQ0A 5JVVA 1ZBE3 3B9IA 3CJIA 4AGRA 3WNKA 1HX6A 2V73A 4NHYA 5F5AA 1XSQA 4N7UA 4Q4V2 2OUHA 3I2OA 1HRI3 3OGVA 4MO3M 4N53C 1OFNA 1BK1A 2MNGA 4JKMA 4DY3A 2RS52 1ODNA 3OGGA 3VD7A 3ZM8A 5JR2A 1HIXA 4CEWA 3SMHA 1ZBA1 4XF0A 1GV9A 5FZBA 4W6YA 3GJBA 3ZFGB 3ZMOA 2BUKA 4YZ2A 3OB8A 3V0BA 3KM5A 2Q8OA 1DYKA 2B7YA 1D0GA 1WUVA 2JD9A 4COYA 3ILNA 1F15A 5FZGA 5F3CA 2BNNA 3PUSA 4GAZA 4A2UA 3A0KA 4RR3A 5EZWA 4N9HA 4M0NA 1QJU1 5IWFA 1Q3EA 4DS0A 2DU0A 3LA3A 1QWRA 5FPUA 4XCAA 1WCSA 3K4AA 3WCSA 5HI0A 1ACCA 1CR7A 1N1TA 3SISA 3GZEA 1DFQA 1C8M2 3H0OA 2FZ1A 4Q0VA 3RJ2X 2UWCA 5A3MA 3NJZA 3GCXA 1WLTA 2ES3A 5KXEA 2DVDA 3WINE 4OVEA 1H8TB 4XHBA 5I0RA 3MDPA 5LA2A 5A7WB 2AH2A 4IGQA 4OMDA 1L7QA 5JIAA 2CNAA 4OFGA 1OKOA 4YPJA 4AL9A 1O5LA 3UGHA 5FY4A 1MZEA 1RUC2 2WLQA 2WS92 2ZGTA 4H7LA 1EAH1 1Y9MA 3GBWA 1NA1C 3W5MA 4XF4A 3WEZA 2D6PA 3AC0A 4FQ4A 1SBFA 3CLPA 2DCKA 1EPZA 2DCYA 2LALA 2WYFA 5ACA3 2X8KA 2B8MA 3AKTA 3FUOA 2WA4A 3G6JB 1XNKA 4GQ7A 3WUDA 3ABZA 1MQTA 2IWGB 1EPWA 2V72A 4N43C 4P5YA 1PO12 4X8NA 3WF4A 1VBE1 3DCQA 1RUJ3 1KFUL 3J8F3 4IE6A 4AW7A 1J83A 4NIDA 1AL23 4YYOA 5CBLA 3AMMA 3ETQA 4TXWA 3SITA 3T09A 1FPN1 2DVBA 4Q4Y2 3RWKX 2DUPA 3KV6A 3NJYA 4UYBA 4XFCA 5BPXA 4LOSA 5FYTA 2GC2A 4WBBA 1VAVA 1ONAA 1D2SA 2DF7A 3W20A 1GNZA 1IOAA 1S0JA 1SFPA 3WG1A 4IE0A 1BBT1 1QGLA 1V6KA 3KT4A 5LASA 2RR13 3J4UH 3KB5A 5AVAA 3RDIA 1MS9A 4X6RB 5CZKA 1WZXA 1CAWA 2O8QA 5DXDA 5FZDA 4BIFA 2A71A 2OIIA 2QQWA 4MG2A 5H9PA 2VQAA 3CJIB 4KMQA 3POEA 2QQMA 2LROA 4XZPA 1DQ0A 4YGEA 1DCSA 2YU1A 4QPYA 5JAXA 3PUAA 4AEDB 2OUJA 3QACA 4AEMA 3DL3A 1ZRIA 3ZMNA 4HL0A 3B94A 3LF7A 4XJUA 5FO7B 1RHI2 4Q8LA 4A7KA 4CEWB 4YZ1A 2FDHA 4CA9A 5I91A 1I5ZA 2Z2SB 1O8PA 4W65A 1LNSA 3PUQA 3SNMA 4MGYE 3FN9A 2HWC2 3V0BB 2RDQA 5DAPA 5BNPC 4AI3A 4AFCA 4QM8A 4B4QA 1KITA 1ND3C 4BCUA 2AACA 4FPFA 2JD4A 1S0CA 3HT2A 2VZQA 1PMHX 1W06A 1Y9GA 5C3QA 3CJXA 4WVZA 4UFHA 1S2BA 4CDQC 4NN0A 4CP0A 1SEFA 5F2WA 2R30A 5SV8A 5LBEA 3WQ1A 3AKQA 1W9YA 3NKTA 5KXCA 3DN7A 4AI8A 1HRV2 3BIEA 2ERFA 2WZR3 4LT5A 2BVBA 5FP4A 5H9SA 2Q8CA 5BNNA 3U4SA 1MEC3 1X82A 4BQ1A 3J7HA 3GXUA 4KQ7A 1CWPA 2E26A 1D0HA 3P3NA 3H42B 3H7JA 1X36A 4W50A 3JCIA 1JZ4A 4YARA 2XKOA 3I59A 1XC6A 2XJTA 1JYNA 1BVVA 1RUOA 1ULCA 1PIV3 2WYSA 1IG0A 4Q29A 2JJ6A 2CY6A 1WLDA 3U78A 1R082 2YPDA 4DXTA 3TNQA 4YM0A 3ZSLA 1PZ9A 2VMIA 4CCKA 3VBFC 3VV1A 3R05A 3AP4A 4CU8A 2QQLA 4BMBA 2Y6KA 3IT8A 4D0QA 1OXCA 2WFF3 4Q1PA 4DIQA 3VN4A 3LA2A 3AVRA 1W8TA 1MQTB 3I2FA 3POYA 1V9U2 2OVUA 5K4LA 1VR3A 2W9XA 4K1YA 3AMHA 2PHTA 2PHFA 3PIJA 4Q27A 1XE0A 2ZA9A 2ETEA 4BMEA 2Q5TA 4FFFA 2WBKA 1LEMA 4QKNA 2JDPA 2VNVA 4PIYA 1DG6A 1ASJ3 4AF9A 4YGBA 1VBB2 1RUH1 1OOPA 1QDOA 4M4RA 1RB8G 2WZEA 1PGL1 1OF3A 3O1MA 1O4TA 2JXAA 2O14A 4N8MA 4Q4X2 4AEKA 4FOQA 2Q0AA 2RJKA 5FR3A 1CAWB 2PQSA 4ONUA 2ZGNA 3RG0A 2XLAA 3JQWA 3I2HA 4B7KA 3O0XA 2R063 4ZS2A 4WZFA 5KHGA 4D69A 1H2MA 4XIKA 2ZACA 3FHQA 4H7MA 1JYVA 1ZRDA 4MX3A 1R1A3 1VBD2 4E4ZA 1C4RA 1WW5A 4B8EA 1RUE1 2ENRA 4EZHA 1H1MA 2ZABA 2MEV3 4UT5A 1OA4A 2VZVA 3EMRA 1WCUA 2QQPA 3RMXA 4C1WA 3C3VA 4LK7A 1TME3 3Q9OA 2RMU2 2VQUA 5A3NA 2CWSA 3BPZA 4LBQD 3HQUA 2YBSA 3VKMA 1YI9A 5A3UA 5FWEA 3IMNA 1H2KA 3N9LA 1YYNA 4QHBA 2NLRA 4CP9B 5FREA 1DGLA 4YM1A 1FNZA 3VL9A 2CYFA 1C5IA 2FDGA 2AUYA 4I30A 2RJ2A 4LORA 3TOJA 4CDWA 4X6QB 3CU7A 4FI9A 4EJRA 5DZGA 5KBFA 4HZFA 5BNNB 2WNVC 4PIZA 5HV4A 1C8NA 3NL1A 3DYOA 3CMGA 5LRSA 1MS1A 4RFRB 5JI7A 4H2AA 3I59B 1S0GA 5FPXA 5JZGC 1N3OA 3MW2A 4M4PA 4GH4C 3POBA 5A1AA 1XJAA 4IEYA 2VL4A 1GOHA 1US3A 2IXIA 2VCCA 4IQPA 1W9SA 4IV1A 1QJY1 5LK7B 1CPNA 1DU3D 4YM3A 4HK8A 4XAEA 5LW9A 4YFWA 3TBDA 5EHDA 4IGPA 1N3QA 4EN7B 3SKJE 2TNFA 2FMDA 2A3XA 2Y60A 1VBC3 1RVF3 2D5HA 1ZREA 5T55A 3MO4A 5GZCA 1SPPA 3AP9A 4CCMA 3HIFA 3TEZA 2B45X 1MZ5A 2VZ3A 5FYVA 2NQYA 1PGW1 5C4WA 1AYN2 1N1YA 4XTPA 3ST7A 4AR2A 2D6NA 4JQRA 2QJVA 3C7HA 1NXMA 1IZ3A 4XTMA 4XW3A 3OBRA 5B4XA 2Z69A 3TNPB 3ZX7A 1LCLA 4E8CA 1YQ5A 5CFCA 4GIQA 2P2KA 1WA4A 3KZ4C 3HNYM 3IKWA 4NE9A 4YW6A 5I8TA 3A7QA 4OCTA 1RJ7A 2X5IA 3FBMA 1UF2C 1OQDA 4CDXA 1OOPB 4E27A 2JX9A 5KHJA 2VOTA 3FLTA 3BIWE 2X05A 4Z2WA 2HWD1 3PLQA 2P3YA 4UAPA 4ISRA 3AZYA 1AR93 4XXAA 3MPPG 1WGPA 3PVOA 1O8SA 1JTZX 2BFUL 2XDVA 3P5BA 4UFMA 4F8AA 2NM1A 5I0TA 3N9OA 5F3EA 4FPGA 3M8LA 4FPKA 1X8MA 3ZSEA 1UAIA 1NCRC 1DGRN 3IDEA 5A7PA 4M3CF 4D8MA 1LOGA 2PA7A 2V4AA 1WW6A 2A73B 1DF0A 4BQXA 2QQVA 5IAXA 3WY6A 4MHRA 2OZ6A 3DPRC 1EYBA 1QEXA 5FV3A 1YIFA 2QKDA 2W95A 2YGMA 4FXKB 4GZ9A 4JHZA 1RTVA 1W03A 1YFYA 3N9QA 4AFAA 5GZFA 1RMU1 5EYXA 4EV0A 3T2TA 5FOJB 2W1UA 3RGBA 4Q4W3 4NPRA 2HEWF 3N9PA 4GWMA 1ZBA2 1ZZ9A 1S2EA 2PELA 3VBHB 2E7AA 4CPBD 3O1TA 4LHKA 4R4ZA 4YVWA 1SLBA 1ZYBA 5FPAA 3RZZA 2CSGA 1KS5A 3Q8CA 3VHPA 3POIA 4D7YA 4QXHA 5LA1A 4G9SB 3BTYA 1ALYA 5J98B 2ZHMA 1QJU2 3H8OA 1RUG3 3LSEA 2VOWA 4KBZA 3W21A 3ZOIA 4XOGA 1I1EA 3URFA 3PMEA 4IV1B 2JDKA 2I07B 5IVEA 2FBEA 4R8HA 2VW0A 4JC1A 3R4SA 4TWTA 5C8CC 4FO9A 4EN9B 4IL7A 2GMEA 5F7UA 1QY4A 1AR71 2NZ9A 4Y1ZA 2FCVA 5FTTC 4QHOA 3GNEA 4J1XA 5A80A 4AYUA 2PLV3 3OCPA 2VXJA 2DWRA 4P9YA 4QDRA 4XFBA 4FFHA 3D0JA 4SBVA 5C4WB 3ON7A 1BEV1 5FZEA 4YZ5A 1S4CA 1BVP1 2WS91 3ACIA 3AJZA 5FYBA 3PVNA 5CFCB 3SCFA 3WP5A 3LOBA 3WNMA 1EAH2 1KJRA 3KV9A 3BKZA 1JBCA 4DXZA 4LIVA 3MLJA 2X5IB 3HQRA 3M3OA 1LAJA 2QFEA 3FMGA 2WAOA 3BU7A 5FYUA 3SCGA 1W9FA 3OF1A 1ND2A 2AC1A 1WBFA 4LNVA 4WM7A 5L36A 4BPZA 2GNMA 1HRI1 1VBE2 2DFCA 2DU1A 4URTA 5ANNA 3OTFA 1N1VA 1CQ9A 5AVPA 5IVJA 3PJYA 5T5JA 4BZ4A 1JHJA 2QQIA 2YU2A 5DUVA 1FPN2 5FPBA 4ZONA 3BVCA 4F83A 5L9VA 3LZZA 2D44A 4I3GA 2OX0A 2AREA 2JDZA 3BTZA 1R093 4I09A 5FZ8A 4XAAA 1RUF3 5JXIA 1XQNA 4BK5A 5F1RA 4Z82A 4DOUA 2XBO1 4PF1A 1Q8VA 1GQGA 3B3QE 1YLLA 5FYHA 3O1VA 4CUAA 4AXOA 4Q0QA 4LE3A 5GLWA 3WF1A 3LIGA 4JGYC 3RS6A 4LKEA 4COVA 1CZSA 4PDWA 1UZWA 2G9ZA 3S7IA 4XF1A 1RHI1 3DEMA 2E32A 1WKYA 2CGOA 4DFSA 3RZMA 5FDBA 3C2UA 1GICA 2HWC1 2RS33 2W39A 2Y34A 5KWRA 1J1TA 2DTWA 2D98A 1HXS3 4QQPA 3E1F1 1OH4A 2AEZA 4YW5A 1OUSA 2YV8A 3X29B 4WM8C 2VUDA 4W6WA 4DRVA 5DZEA 4IERA 2C0ZA 3BTAA 5FWJA 1BXHA 3NJXA 3ZN5A 1VMJA 2ZAHA 1YCIA 2EXIA 2GAUA 2WN2A 1G9FA 1CAVA 2DUOA 5KHHA 5HV0A 1H30A 2E6VA 3I3QA 4K21A 3ZPOA 1W6OA 1WBLA 3KLSA 3LPFA 5ACA1 3HNMA 1O3RA 4HBNA 4HXCA 4E4HA 2GC1A 2P37A 1RUJ1 4META 4RQPB 1LOEA 5CU1A 3VDCA 4CDUA 4LHSA 2W08A 4L2NA 3WW4A 1DZTA 4F3JA 1N47A 4YZ4A 1W8FA 5I0SA 1GNHA 1UW8A 3K4ZA 3WDUA 4A44A 3KCYA 4AVTA 2YFUA 5ABJA 4N7IA 3RJRA 3PHMA 1AHSA 5LA9A 2BOJA 1NQJA 4FPCA 1DIWA 2PQQA 4Y1XA 2LW8A 4D6QA 1Y4WA 2FQPA 1W8HA 2ZX2A 3H8UA 3AP6A 4IUGA 3P3PA 3VB9A 2EXJA 5HXMA 1F5FA 3VZJA 1ND2B 3NNFA 4WM7B 5D21A 3ZFFC 2E33A 2WO2A 4LO6B 1SFYA 3NV4A 4I01A 4PJYA 4QKDA 3WV6A 1AR63 2ZZQA 4QMAA 1G9CA 1ULOA 4QQOA 3HVDA 1ZA7A 2G9FA 2ZX0A 2EA7A 3VDAA 1FMD3 4L9BA 2D40A 2Q4SA 1PHMA 4QX8A 3MIEA 5IK5A 2WFPA 4JHTA 3SEPA 1GFF2 4C1XA 1VBA3 1RUH2 4OI2A 1PGL2 4JRAA 1LEDA 2GSYA 2VQTA 4K3UA 1GZWA 3TN93 2XUMA 1GWLA 3FBYA 4MHUA 5F6KA 2P3KA 3ACLA 3KS7A 1OH3A 4ISQA 5C5TA 3CEWA 4MGKE 2VMHA 1AZDA 2IXLA 4KG8A 1WW4A 2EAAA 4YVSA 3J26N 4PDWB 2B4KA 3LE0A 4XDQA 4AOCA 3FL7A 2D3RA 2JG8C 1JZ6A 3I2KA 3L2HA 3EQEA 5E6HA 1UZ0A 1A34A 1RUE2 2J1UA 1AX1A 2VZUA 2EIBA 1O6UA 2WQ4A 4KWKA 4HSLA 1PIV1 4XJ9A 1K5MC 1EP0A 2D93A 4B29A 3T08A 3KVAA 2FDJA 2DCJA 3D0SA 2P17A 2C9KA 3RYRA 1CAVB 4AI0A 3OUIA 1LGBA 2P34A 1HDKA 3MLLA 4PBOA 2WZPP 1VE0A 2R043 4NAOA 3INAA 1PM7A 3A23A 5FZAA 4KGGA 3AJYA 5GLUA 4YSFA 2IXHA 3K75B 2VCAA 2ZX3A 4S2DA 4ASMB 2AR6A 4CDUB 5L7OA 2ZKNA 1QQP3 4LKSA 3I2DA 4YLZA 3U07A 4EWAA 1U5YA 4XXPA 5A7OA 4EE2A 1OURA 4XILA 2Q30A 4D6SA 2RM23 4QXCA 3N7MA 2VVFA 2XXZA 2XGXA 1QDCA 2XL9A 1JYIA 1ZRFA 5E16A 5FMCA 1OLQA 1QJY2 4CEYA 2F6BA 3RZGA 4JZRA 1IPSA 2HWB1 3UK9A 5FIXA 5FLJA 1H9PA 1LOAA 4FBFA 4AAXA 1XOYA 5D8AA 5E8AA 1C1FA 2F17A 5CYYA 1AYM3 4DUVA 4ZXKA 5CFDC 2R061 3VBUC 2ZPXA 2NPIA 5F5CA 1B35A 3K46A 1PGW2 1XYPA 2PAMA 2VM9A 2GC0A 2W1WA 3GALA 4AGVA 5BV6A 3N36A 4M3CE 3OSDA 1R1A1 3SQOA 5HCHA 2ZBJA 3IDBB 4NPLA 1ZX5A 4IE4A 5C9AA 4IXLA 2RS53 2MEV1 4OHVA 1PX4A 3WNPA 1LTEA 5BYNA 2OS2A 1TME1 2HH9A 2OA2A 3GGLA 4XDOA 2O8OA 4YM2A 1J3QA 5A7NA 3WDWA 1SDDB 2KR2A 3FHAA 1XNDA 3ZN6B 1AR83 2P4EA 1GZWB 5F5IA 3ZYGA 5KXDA 5FP7A 3DV8A 3LEKA 2QUOA 4MGZE 4COUA 4AFMA 1OQEA 1POQA 4XUPA 4Q8KA 4XIOA 1YI7A 3VBSC 4D7SA 4B1MA 1QOOA 4LA3A 4NO4A 4ZY9A 1O7FA 3ZFEC 4COZA 3WG3A 4YVSB 4B3NA 4ZS3A 3THTA 2Q8EA 4ARYA 4XABA 3OOXA 1IS3A 1MVEA 3ES1A 2ZGLA 3UETA 4N9IA 2ARBA 1AJKA 1FOD2 3EYPA 4BLIA 5KXBA 3ZR6A 2YFZA 4WZCA 4TZDA 1S55A 2ZCWA 2BGCA 2ZGMA 3WG2A 4YW1A 5FZ6A 2HYXA 3ZFGC 2X29A 2LTNA 4DUWA 1NA1A 5C6CA 1KD7A 3IM0A 4IEWA 4ZXEA 2L9LA 2FD8A 1RMU2 4BWOA 3LQCA 2BWCA 5A6ZA 4L0PA 2WIIB 1UNBA 2CGNA 3HN3A 4P9JA 3H8XA 3I4IA 1VBC1 2GDFA 4HKOA 4E8DA 4LOTA 4AQSA 1WCDJ 1UZVA 1JZ5A 1IQDC 2TUNA 3ZXDA 2B5HA 1KFXL 2BOIA 4L11A 3I3MA 1F8VA 4Z92B 3MPBA 1U5XA 3OUJA 3UNPA 5L7OB 4V2WA 1VRH1 5B4NA 4OHYA 3NV3A 3LDKA 5GLTA 1QJX1 1RUD3 3GHNA 2P3IA 4KU7A 1PO13 4PI0A 3SC7X 5AC93 2ZMLA 3B93A 1ZM1A 1FX5A 1F9KA 1T6BX 2VNOA 3AYEA 3KHCA 2BV4A 2VMFA 2BBVA 1O5UA 3LDBA 4LJHA 3E5XA 1K5JA 4LBJA 1JYXA 1ULPA 4Q4Y3 3VZNA 1H8TC 4PQ9A 1VP6A 4CEYB 2DVAA 4MGIE 5J37A 4F7ZA 4FTBA 2CWMA 4K7JA 1AR91 5FYZA 5IVCA 4OI4A 4GB31 4HSJA 2P6CA 3H3UA 1AR72 2YG0A 3LB9A 5D8AB 2ZAAA 5FZ4A 4CVUA 4IEOA 4QPWA 1X9PA 1COV3 2DV9A 5A7SA 3W58A 1WCKA 3VD4A 1C3HA 3JD72 4QX0A 5JR7B 4ATEA 3R0RA 1B35B 2JWPA 4A41A 1SLIA 1EUTA 2AZ5A 5JPNB 1Y43B 4BQ3A 3MI8A 3WF0A 1Q8PA 5CNAA 1BEV2 3T0DA 4NIHA 3PU3A 4ZU4A 1XE8A 3UKNA 1JU4A 5IK4A 2CDOA 2VZPA 4DEQA 5C9AB 2RHPA 3S57A 3DKWA 1GWMA 4NAMA 5FP3A 4AWDA 2JIJA 4EROA 1IGOA 1NCQA 2R16A 3B7MA 4LQRA 4UI9L 2VBDA 2W68A 1ZZ8A 5FPVA 1UMHA 4UFKA 3ZYFA 2EVXA 3T2QA 2XJPA 2VNGA 3USSA 2YZ4A 4O9GA 1YQ8A 2Y6FA 3GHMA 3W5NA 1SG3A 4JDOA 1RGSA 2OT7A 2BERA 4RHV1 3K4DA 1HRI2 1DGWA 4UBGA 5T5LA 4SLIA 4Q4W1 4AE2A 5FO9B 5J48A 4AFBA 1MS4A 2XHKA 1JOJA 5IW0A 5KC5A 1FYUA 1AL0G 2ZXQA 4CE8A 3KT1A 4I2OA 3CJIC 3VKLA 4IE7A 2WNOA 2VOVA 1VB2A 3M3IA 5IVFA 3OY8A 2RDNA 3MIHA 5FZ3A 1PK6A 1DGWX 5EJ1B 4AEDC 1HRV3 3ETPA 4PLOA 2R49A 2XBO2 4XJAA 3ROUA 4CEWC 2ZEZA 3VZMA 2W3JA 2E9QA 2GH2A 1LECA 2VZRA 5L73A 5GLZA 3EBRA 3B5LB 3NWKA 4P02B 3VBRA 1HB2A 1PVC3 3PTYA 3CIHA 4FCAA 1LHVA 5FCCA 1QU0A 5FPLA 2VZ1A 2ZGUA 2DVGA 3ZSJA 2WJSA 1GP5A 4ES8A 1APNA 5F3IA 5FZ1A 3EHKA 4BDVB 2ZGSA 1QJEA 5FZKA 2ZGPA 3MUY1 1HN1A 2WUHA 3RI9A 1U0AA 1O3TA 1ENSA 4GJZA 3WUCA 4IV3A 5A70A 1V6MA 1QJZA 4EYUA 1STMA 1Q8QA 3BPSA 2VC9A 1NLRA 3RRDA 1V9U3 4HONA 4RR3B 1B09A 2FMYA 1F2NA 2VZTA 4OHXA 3PNAA 2BGPA 4G4FA 4W8JA 3F2ZA 3SH5A 2GN3A 3B00A 3HQXA 4ARXA 1GWKA 3AX4A 4BK4A 3PURA 4QQLA 1UYYA 1OA3A 3TEXA 4CRQA 5ACA2 3O12A 4RGKA 2AENA 2XQXA 3D4KA 2QQUA 2UYAA 1OFSA 1VBB3 5I8SA 4R9AA 1RUJ2 1PO23 1LU1A 4MADA 1JMUB 3ORJA 4Q4X3 3TRSB 3ZYIB 3ZR5A 4CYDA 1W2AX 4E4DX 2WWJA 4CZSA 5DN2A 2AYHA 4V1PA 4M3CA 1FXZA 4KWJA 4LBLA 1AXYA 3CL1A 4LO8A 1HB1A 3IB3A 4AQ6A 4CXWA 5HXVA 4QDSA 3V64A 5F8PA 1POV3 1UYXA 2DBIA 2ZJCA 1NCQB 4LBMA 3MEPA 2A6VA 3CZJA 1A78A 4LEJA 3AP7A 3Q8BA 3CDZB 3KGZA 4YNIA 3J9SA 2BTVC 5DAXA 3ZXEA 1AXKA 1ULEA 4D6RA
chains in the Genus database with same CATH topology
1GSLA 3VZOA 1CESA 3AM2A 2R0HA 4DNYA 2RJLA 4CTEA 1W6NA 3BOPA 5T5OA 4M00A 4HETA 4CP1A 2GZWA 4IETA 3ES4A 4XFGA 3NAPA 3OY8B 4OI0A 2ZX4A 4I0BA 4GH4A 3RMYA 1PK6B 4AG4A 1V6NA 5JSOA 4HPKA 2RE9A 4FPEA 1LHUA 4QXKA 3BODA 3AYCA 2HWF3 2JG9A 1O91A 5GM0A 1ZRRA 3UJOA 1O4YA 4H55A 3M7AA 2B46X 1BQPA 3ASIA 3LA7A 4Q2FA 3VBRB 3VHOA 2EIGA 1M06G 1XYOA 5FQ0A 1SBEA 3E5QA 1CIWA 1LGCA 3GBFA 1WLWA 4I0AA 5FO8B 1JUIA 2ZHLA 4MYEA 5DZFA 2PHDA 1PNGA 1SLTA 2N7GA 4IV3B 1PIV2 3ZN4A 4Y1YA 2V09A 3QCWA 4A7ZA 1QNWA 3NO8A 5BNNC 1AYN3 4AGGA 5SV5A 4INDA 4B4RA 4WVVA 3ZSMA 3AXDA 3FFQA 1Q5OA 1AX2A 3BALA 2PHRA 5LEJA 4RS5A 1HKDA 4W6XA 3USUA 4P9LA 1EV13 4FPHA 1NOVA 4LLFA 5DUUA 3KMHA 3RQ0A 4BE3A 1QNYA 1YHFA 5T52A 1LU2A 1UIKA 5K9YA 2Z79A 4LR4A 1FMD1 2UWAA 3NV2A 3VHNA 4E2SA 4L99A 1W0OA 5JMCA 4PLMA 2WWSA 1J3PA 3DPRA 4PIXA 2UURA 3TN91 3U4XA 2HYKA 1KQRA 2HWB2 4FQZA 2ZKLA 2DCTA 1OD5A 4TLFA 1HW5A 2I74A 4RGGA 2K0GA 2B39A 2ZGKA 2JECA 2R062 1OOPC 3V0AA 2XJVA 1GZ9A 3AXEA 1SQ4A 2DTYA 1TNRA 4I02A 5DDJ3 2Y26A 4C90A 3WP3A 1H4HA 1W6NB 5J7MA 1R1A2 3MFAA 4WVMA 3T1LA 2YY1A 4EN0A 5D1IA 2MEV2 4RD7A 4XFHA 3NAPB 4XQ4A 1TME2 3HN1A 4LUMA 3QOPA 2XB6C 5I93A 3A4UA 1HV0A 4HPKB 1T6GC 2VVEA 4Y4YA 2VOXA 3I8TA 2SBAA 4OI1A 2TEPA 1TMF3 4OHZA 2JG9B 2XVLA 1IPJA 4FPOB 3O5SA 1Z7S3 3PMSA 3HBZA 2WINB 5FQ0B 4HFSA 4HVOA 1HV1A 1FOD1 3LOIA 3CO2A 3VLBB 1KDKA 1Y7BA 1QQP1 2JENA 2ZGRA 3WNXA 3WR0A 3B9CA 3D6EA 3QH6A 3ENRA 3FJSA 2HJIA 1XRUA 3H1MA 2RM21 5A3LA 2ZMNA 3VBHC 4XEZA 1UIJA 5K7PA 3GBGA 4HMZA 2WNUA 1IS4A 1G86A 4JGZA 1FAYA 1JN2P 3LGRA 4AI2A 1QH6A 3FX3A 1HQNA 1VBC2 4RS5B 4L8QA 5LK5A 1H1AA 4CDWB 4CP2A 1ENXA 1EAH3 3USUB 5J36A 4J6GA 2VU9A 4K9SA 3W59A 4S2FA 3KGLA 3GZUC 4AK3A 1VRH2 1UU6A 2KA3A 2A70A 4LBNA 1QJX2 3ZXKA 1YIPA 5J09A 2EXHA 1VBE3 1KXGA 1DDLA 4JVAA 2VVDA 4LULA 4GXLA 1WLCA 1YUDA 3M1HA 3VZKA 1DHKB 2HKXA 4DINB 1S2KA 2XJRA 3L9JT 2BNMA 5C4WC 1A8MA 1I3HA 4J1WA 1S0DA 1OI6A 4R4XA 1AR92 1VAKA 1ZZCA 3AMNA 5CFCC 1C1LA 4GB32 4NHMA 4D3WA 5C8WA 1BBT3 1RC6A 3JD71 3NW4A 1DQ5A 2X5IC 3V0AB 3CF6E 4RA0A 5K0UA 1H2NA 1W6MA 3H50A 1C57A 3IIAA 3OGJA 4FT8A 5BXXA 5CB7A 4WVMB 4BHPA 4FSJA 1YFXA 4M01A 2UYBA 3M3QA 4Y26A 3WDYA 4CDXB 4LTAA 1ZBE1 4JRLA 1W39A 4QPIA 1IS5A 2R073 2ZOEB 2VH9A 4OULA 1NG0A 2O0OA 3RI8A 1X7NA 3WZ1A 4FPLA 2GNBA 4RHV2 5DG2A 4Q4W2 2IXJA 1Y3TA 1TQ5A 4B7EA 5L19A 2A3YA 2E7TA 3WCRA 5JOXA 4HKWA 2UWBA 2VUAA 2VPVA 3O14A 1AF9A 1RUD1 3TAYA 5AC91 3IWZA 2WSVA 2CAVA 3U0ZA 1PZ8A 2MHFA 2WNUB 1DQ2A 1QMJA 1V6IA 4JGZB 2UY8A 3AKSA 1IHMA 4GA9A 4LA2A 4KL1A 2RS13 3N7JA 1COV1 3GF6A 3K51A 4LE4A 2LM3A 2EALA 1BKZA 1NE4A 4YVWB 4Y20A 3JU9A 1GQHA 5T50A 1U5ZA 1J59A 1N3PA 4RQPC 4XF9A 2K2SA 1Z78A 4RL7A 5DG1A 4JTOA 2WC2A 2ZGQA 1REFA 1UL9A 2Q1ZB 1UCXA 1HQWA 2FZ2A 4QPGA 2CAUA 4YG6A 3J8F1 1CAUA 3MW4A 1RUH3 1AL21 1H2LA 3THPA 1SCRA 3ATGA 2JG8A 1S0FA 1ULFA 4XHXA 3D82A 4Z1VA 4AHZA 2R0FA 5K0UB 3GZAA 1ND2C 3RWNA 4WM7C 1W6MB 2DURA 2EAKA 2RR11 2D6LX 2WT1A 4JDNA 3ZXGA 1OQ1A 3DGTA 1S0BA 3NKGA 2GNTA 4OHWA 1GANA 1RUE3 1ULDA 5HCFA 4QPIB 3ZDSA 2Q1MA 5IUQA 5EWSA 1CVNA 1ZRCA 4QGMA 2XLGA 5KHKA 1LR5A 1PVC1 1G8WA 1UD1A 2F4PA 3AYDA 3ME2A 4Y24A 4LBKA 1JUHA 1YJKA 2VY0A 4QU2A 3AFGA 2XG3A 4EWDA 3W9AA 4QQHA 1YNAA 1CGPA 4IEZA 3VHRA 5F9TA 1V70A 3WW3A 4PDWC 3N7LA 2XWBB 3ZO0B 1VALA 4H3WA 3DUIA 2B9UA 3I54A 1D4M3 3IPVA 3AZVA 3VBOA 2G4IA 5GZEA 4BYYA 5T3NA 5HCAA 1JXNA 2E53A 2WA3A 2QVSB 1CD3G 4COWA 2YXSA 1MVQA 2WZR1 2KXLA 1MEC1 2D3SA 4QX5A 5FOBB 2H6BA 3BCWA 4K1ZA 1PO21 3SXWA 4GALA 4AQ2A 5BNOA 3JBG3 1BZWA 3VDDA 4Y20B 3WOGA 4MUVA 2WLPA 4GMP0 2VUJA 2Y0IA 4MV2A 4CDUC 1UZYA 3AFKA 3LCPA 1POV1 3CNAA 1MZ6A 3WP4A 1W6OB 2WFF1 1AX0A 1QKQA 2XH6A 3RYKA 4QPGB 3SHRA 1CAUB 2HWE3 4LLOA 1LOFA 5FMOS 5LRRA 1A6CA 4PLNA 2HWD3 1W6QA 2MPFA 4YRDA 2JG8B 4XFAA 4H14A 2H0BA 5GZDA 1FMD2 5ABJB 5FPZA 3UKTA 1ASJ1 1QHDA 3FLPA 3H3ZA 4PBPA 1UPSA 1RUI3 4AVSA 2R32A 3D5OA 4AI1A 2A6YA 2XPJA 2CTVA 1S0EA 3ELNA 3LWCA 3TN92 1PVXA 2UU8A 4LHLA 5J96B 3WXPA 4YZ3A 1V6LA 4N53A 4XQWA 2HWF1 3M3EA 3VZLA 5JOYA 1J3RA 2BW8A 2PHLA 4XMIA 2H6CA 3E5UA 1S1AA 4IEPA 2C9AA 3WDXA 4UW5A 3OD4A 1FV2A 3MF9A 1QXRA 2YC0A 2PHWA 2WSUA 4Q4V3 2CGPA 2SLIA 1BCXA 1SLLA 2UY9A 4KGQA 3R4DB 4LBQA 4YVSC 2BQPA 1PZ7A 3WD5A 1X33A 1SACA 4AHXA 4DB5A 3VBOB 1NE6A 2BWAA 4XBQA 1Q56A 4DY5A 1QH7A 2VW1A 3ILFA 3PVEA 4OUMA 3ZIWA 1EV11 1OA2A 1LKNA 3AZXA 1SDWA 1XU1A 1C8M3 1LENA 1QQP2 1JYCA 1NY71 5BNOB 3K48A 1VAMA 3QBQA 3VDDB 2RM22 1AUYA 1MS5A 4K8FA 5L7OC 2Z5WA 2DYCA 2A6WA 3H9AA 3JUUA 3MW3A 4N43A 1BEV3 5CIRA 1RVF1 3U10A 1RUC3 2WS93 1LODA 1SCSA 3E97A 3N4MA 4YGCA 2OW4A 5BNQA 2XVGA 1AYM2 2HEYF 4CEYC 1J58A 2DUQA 5CVRA 1URXA 2NP0A 1W6QB 2H0VA 4FOVA 4BOWA 1G6NA 2D43A 5D8AC 4AEDA 4E4SA 2JE7A 4XE9A 2XJSA 2D6KA 1B35C 1CX4A 1GKBA 5HCBA 4ATFA 4R52A 5CADA 1AR82 4HVQA 3POWA 5AFEA 5JOWA 4N53B 1TMF1 1QXJA 4YG0A 5C9AC 4WVWA 4Z07A 3WVJA 2XBO3 3UKVA 4LBOA 2XJUA 1Z7S1 4AFDA 4LO4B 4GULA 5BNPA 4GKXA 4YW3A 3TB0A 1ULGA 3AP5A 5E1RA 1ZNPA 1ND3A 3AMQA 1BJQA 3AMPA 1Z0HA 1RHI3 3ZXFA 1I9RA 5J3UA 4R9CA 4NHKA 4LBQB 1ZBE2 4CDQA 2HWC3 1CPMA 4UW4A 3WG4A 1MS3A 2BNOA 1XU2A 3IN9A 4ORFA 1LHOA 1MS8A 1H0BA 1CONA 4MSVA 1DLLA 4QT6A 1UKRA 2AGSA 3LSDA 2NN8A 1YFWA 5EYYA 3RSJA 1MS0A 1BMV1 4Y1VA 1LHWA 1WMDA 4O9EA 3MIGA 1LHNA 3ZYJB 4UW6A 1RUD2 5AC92 3KCXA 1DQ1A 5JCTA 1NA1B 1RUG1 3VBFA 4C0BA 1U5IA 1FI2A 1RL3A 4Y5Z0 3VKFC 5JWPA 3N3HA 1FT9A 3WHTA 1G7YA 1R083 4N43B 2OZJA 3QH7A 4IEUA 4RR3C 5T5PA 2Z42A 3VKOA 5BY5A 4XJ8A 2QDRA 2PLV1 2BEOA 3JQXA 3RPQA 1COV2 1QOTA 2XKPA 4WV8A 1WW7A 4D7TA 3SH3A 4IEXA 3WT3A 4QQ2A 2ZGOA 4DQAA 2VULA 2R1BA 1DYPA 1REDA 3WDTA 2PHXA 1V00A 4FOWA 3EO6A 3SLIA 3VGIA 3O0VA 3AKPA 4Z8BA 3V65A 1UPIA 2I2SA 2JICA 2R071 3MLKA 3ZXLA 1UN1A 4KNCA 3J8F2 5I8YA 1PGSA 3ZYRA 1AL22 1NCQC 3PJQA 1GLHA 4HN0A 1MQTC 2QE3A 4JTNA 4UBHA 5BNPB 1R091 1RUF1 2ZHNA 1MZFA 5K8SA 1ND3B 2IFWA 2RR12 4FPYA 2D5FA 1VBD3 1W0PA 2JE9A 3U11A 4HK9A 1HQLA 3LAGA 4P5HA 5H9QA 4CDQB 4Y22A 4YFZA 5FRAA 2E7QA 3M3CA 2RMU3 4TSVA 1TE1B 1ZVFA 4NWWA 1PK6C 4Q26A 1PVC2 2YPJA 2WNVA 4QD2A 2RS11 5JI9A 4XYXA 1O3QA 2RS31 1AXZA 2ZMKA 1HXS1 2HEVF 4AVAA 5JZGA 3WHUA 3VBRC 1KJLA 3WP6A 3OJBA 3B02A 1F5JA 2R6QA 3ILRA 3VBFB 5GALA 4LHNA 3AZZA 1N1SA 2WNEA 3FZ3A 4GMP3 1I6XA 1GBGA 1KDMA 4R9BA 2XJQA 4IV3C 4FTSA 1UZZA 1TEIA 1DQ4A 2WZR2 2ZX1A 5JLVA 4KG0A 1JHNA 1MEC2 3MYXA 3DF0A 3MFCA 1Q8OA 3ZXJA 1X8EA 4ZKTB 4KBBA 1PO22 5FFOC 1VB4A 4Q1RA 1WD3A 2HWB3 3FLRA 3B01A 2R1DA 4L97A 2KM2A 2ZZJA 4ZU7A 3IDCB 4U36A 4BA6A 3QLQA 1JW6A 3T1MA 4RSUA 5FMOL 3V56A 3IBMA 1IPKA 1QF3A 2WFF2 5TSWA 1AJOA 5E88A 2A5ZA 2WQZC 1MACA 2XLFA 4RFT0 3EJKA 4NVPA 2LUWA 4XBLA 4XPVA 2GNDA 1NCRA 2ET1A 3MZHA 1AR61 1RINA 3D8CA 4Q0UA 3E6DA 2E63A 4ES9A 2C5DA 4M3CB 5H9RA 1MR5A 1XE7A 5E89A 2OYZA 5JPMB 4L92A 1ASJ2 1PMIA 1UX6A 1VBA1 5EV7A 2A6XA 3EXUA 4C0HA 1W2UA 2D3PA 2VGDA 3E6BA 3VBHA 3E6CC 2B42B 1SBDA 1D4M1 2DCZA 4UXAA 2WL1A 5GZGA 4MZUA 2HWF2 3GZTB 4Y22B 4JV4A 1NYWA 4EWEA 2A75A 3NAPC 3AYAA 1EY2A 1REEA 1H1IA 3KQRA 2EXKA 5T54A 4E9KA 4YG3A 3O0WA 2WNVB 1LGNA 1WMFA 2JG9C 4GWNA 4HANA 2XL7A 3RNSA 3JBG1 1R1ZA 2A6ZA 3AZWA 1ZBA3 5JZGB 3VKNA 4GH4B 1CAXA 1XYNA 1SLAA 4DPNA 4QM9A 5I0UA 3QD6A 3ZYPA 4MLOA 1VRH3 3I7DA 3OYWA 5C8CA 1IKQA 2G9GA 2GU9A 4FOYA 1QJX3 5KC6A 2ZHKA 2R041 1QJU3 1EV12 4BH9A 1RJ8A 3UJQA 1NZCA 2IZWA 5DUXA 2HWE1 5FLIA 1QOSA 5EJ3A 2VG9A 3JZVA 5BUVA 3SH4A 1YFUA 5JSRA 4ZU5A 1RITA 4I0WB 1NY72 1YJLA 5JIUA 3B69A 2NYYA 4GB33 4RS5C 3OBTA 3ZSKA 4CDWC 1XXNA 2XVKA 1G9DA 1RUI1 2P3JA 4IEQA 3HMYA 1F31A 1LOCA 4MXVA 1FV3A 1TNFA 3SCHA 1KS4A 1YO8A 1O3SA 1HLCA 1RVF2 5FLHA 1CJPA 1AYM1 4FAGA 1S0IA 4XF3A 4IV1C 3R6SA 4K6BA 1H8VA 2NMOA 3A0NA 1NCRB 2GMPA 5DDJ2 1H9WA 3HT1A 3MICA 4Q4V1 1Q43A 1ZZBA 3JB8A 2PYTA 4XFFA 2RS51 4RHV3 4QGNA 2PHUA 3AK0A 1FPN3 3DPRB 2YDEA 1W6PA 1AR81 2YMZA 1SLCA 4K40A 4PCRA 1ENRA 2FHRA 4JGYA 3KD4A 1U12A 1NQDA 2QZ2A 3MF6A 1XNCA 4XJWA 1TMF2 2YROA 4AVCA 2ZTNA 2CL2A 4CDXC 3TWIA 3OD0A 2OPKA 1Z7S2 2EF6A 4FAHA 2VQ0A 2D7FA 2I45A 4XETA 1ZA4A 4NHLA 2PFWA 2VNRA 5DUWA 4RGAA 1C8M1 4WM8A 3BB6A 4KH9A 1GYKA 4MVTA 4RQPA 4AHYA 2D97A 1QXPA 3WDVA 1CAXB 1FNYA 2WT2A 4NWVA 2PN5A 3WLUA 2A7AA 1H4GA 1J1LA 3HWJA 1A3KA 1YXWA 4Y1UA 1WD4A 5C8CB 3OYWB 3OPZA 1VLNA 3L2YA 5IT6A 1RUC1 2ET7A 4AEJA 4MH0E 1SMVA 1XNBA 3WW1A 3ZVXA 1Q8SA 2WNUC 1LOBA 4B4PA 4Q0SA 1BMV2 4JGZC 1PO11 3UL2A 4YW4A 3H7YA 1JH5A 2VW2A 3S30A 1RUG2 4HLTA 4Q4Y1 4DMIA 1Y9QA 5JOZA 4EN6B 4U2AA 3MIDA 4YVWC 2D6MA 3G7DA 5GKAC 3ZFFA 3POSA 2GC3A 2X53S 1LRHA 4OLLA 4FTEA 2PLV2 1BBT2 1OMIA 2GMMA 2PAKA 1SFNA 3FUQA 1DGRA 4LO5B 4A7YA 5AFBA 5CG9A 1L3JA 4HKLA 4YGDA 5LEKA 1WMEA 1C28A 2YHJA 2E51A 1LJ7A 1OHFA 3VUOA 2W0XA 2BPA2 4QGLA 2VXRA 5CAZA 4P9GA 1OSGA 2Y0OA 4AVBA 1W6PB 3S0MA 5K0UC 2R072 1DBNA 3ECQA 2VECA 2ATFA 1C5HA 4JGYB 4MXWA 1ZZ7A 2IXKA 1OLRA 3NVCA 4P9IA 3BOWA 4QPIC 4C91A 1V6JA 3M2MA 1DQ6A 1OKQA 1R092 1RUF2 3FC0A 3O7OA 1HRV1 1K5MA 1NXD1 4KU8A 4P14A 4WM8B 4AQTA 1BYHA 2PAEA 2YUEA 2GH8A 2BYVE 3APBA 4IEVA 3M70A 4AHWA 4P9WA 1AVBA 1D4VB 3ZIXA 4FXGB 3WX5A 1IKPA 1YRZA 3NV1A 4R9DA 3ALQA 3FHIB 4I3PA 4FP3A 1R081 5CA6A 2K9ZA 4K20A 2RS12 2RS32 5B2GB 3RYPA 1HXS2 3H1YA 5F6LB 1IQAA 5JDBA 4BM8A 1LESA 3NSTA 1UKGA 2VMGA 5FBZA 3FE5A 1V9U1 5F5QA 1ENQA 2W52A 3MIFA 4A3XA 4XMAA 1PNFA 1V6OA 4E2QA 2ILMA 1POV0 1ZZ6A 1RUNA 3KT7A 5CFDA 1VBB1 3MIBA 1GR3A 3VBUA 3ZFFB 5IK8A 1E57A 2BVVA 4BIOA 1QJY3 2D6OX 4Q4X1 4ASLA 3ZN6A 3JB4C 1D2QA 5A32A 5KHIA 3FWEA 4E2GA 5GJ6A 4BLJA 5EFUA 5FAXA 4QPGC 2O1QA 3WQ0A 2V5YA 5A33A 3S6PA 1VBD1 1CJDA 3HD8B 4D94A 1VIWB 1KRIA 3N7KA 5ABJC 3VBSA 4TYSA 2RMU1 3ZFEA 4FPJA 3H1WA 4X8PA 2GN7A 1AR62 4KWLA 4MXWB 1G9BA 2GALA 1OPOA 1GZCA 1LB2A 2IXCA 2QCSB 1VBA2 1O4ZA 3ZFGA 3LKJA 1K5MB 2Y38A 4M0HA 4Q0PA 1OPMA 2VOKA 2IC1A 3HAGA 1D4M2 1FOD3 5GLVA 5C33A 4LUKA 1VJ2A 4HT1T 4NOTA 1DZRA 2QZ3A 4GMP1 5HBAA 1UU4A 1M4WA 3GYDA 4ITCA 4JDMA 3AB0A 1UU5A 4HVRA 1NLSA 3KSCA 3S7EA 3WW2A 3UV9A 1RMU3 1A8DA 3M4FA 1LULA 3VBOC 3ZXAC 4UW3A 4EN8B 3R4UA 3WQ7A 5EXOA 4OUSA 4XFIA 4S2HA 3VL8A 2NMNA 3JBG2 4NR1A 3HR9A 2ZS6B 2QNKA 2JKBA 1AYN1 3IPVB 1H8TA 4JCKA 4N90A 1YWKA 4LO7A 2XWJB 2YGLA 2DFBA 1RIRA 1X50A 3KCCA 1IS6A 4DZGA 5BNOC 4JAAA 2R042 3VDDC 5JSPA 2PTMA 2WT0A 2YYOA 2TBVA 4PF5A 1UMZA 2IFRA 3VBUB 5CFDB 2A3WA 4G3YC 4FVVA 2HWE2 2QDNA 4P9XA 3TYJA 3PVBB 2HWD2 5IK7A 5CG8A 1AR73 4OZXA 5A32B 3FFZA 2JEMA 4YW2A 2ARXA 2C1FA 3JD73 4DRRA 4IESA 4XBNA 1RUI2 1G9AA 2CV6A 5A33B 2WKKA 1LOFC 4AVVA 4XJZA 2BFUS 4GKYA 4S2GA 4XQDA 4HN1A 4FP2A 1DZQA 3AKRA 3ZPYA 3VBSB 1FATA 1CN1A 2DVFA 3ZFEB 3MGUA 5DDJ1 3N35A 4B4QA 5JVVA 4AGRA 1ZBE3 3B9IA 3CJIA 1HX6A 2V73A 4N7UA 4Q4V2 2OUHA 1HRI3 4DY3A 4N53C 1OFNA 1BK1A 2MNGA 2RS52 3OGGA 1HIXA 4CEWA 3SMHA 1ZBA1 4XF0A 1GV9A 4W6YA 3ZFGB 3ZMOA 2BUKA 4YZ2A 3V0BA 3KM5A 2Q8OA 1DYKA 2B7YA 1D0GA 1WUVA 4COYA 3ILNA 2BNNA 4A2UA 3A0KA 4RR3A 5EZWA 4N9HA 4M0NA 1QJU1 1Q3EA 4DS0A 2DU0A 3LA3A 1QWRA 1WCSA 3WCSA 5HI0A 1CR7A 1N1TA 3SISA 1DFQA 1C8M2 3H0OA 2FZ1A 4Q0VA 3RJ2X 2UWCA 5A3MA 3NJZA 1WLTA 2ES3A 5KXEA 2DVDA 3WINE 4OVEA 1H8TB 4XHBA 5I0RA 3MDPA 2AH2A 5JIAA 2CNAA 4OFGA 1O5LA 2WS92 1MZEA 2WLQA 1RUC2 2ZGTA 4H7LA 1EAH1 3GBWA 1NA1C 4XF4A 2D6PA 4FQ4A 1SBFA 3CLPA 2DCKA 1EPZA 2DCYA 2LALA 5ACA3 2X8KA 2B8MA 3AKTA 3FUOA 2WA4A 3G6JB 1XNKA 4GQ7A 3WUDA 1MQTA 2IWGB 1EPWA 4N43C 1PO12 4X8NA 1VBE1 1RUJ3 1KFUL 3J8F3 4AW7A 1AL23 4YYOA 5CBLA 3AMMA 3ETQA 3SITA 1FPN1 2DVBA 4Q4Y2 2DUPA 4XFCA 5BPXA 2GC2A 4WBBA 1VAVA 1ONAA 1D2SA 2DF7A 1GNZA 1IOAA 1S0JA 3WG1A 1BBT1 1QGLA 1V6KA 3KT4A 2RR13 3J4UH 3KB5A 5AVAA 3RDIA 1MS9A 4X6RB 1CAWA 2O8QA 5DXDA 4BIFA 2A71A 2OIIA 5H9PA 2VQAA 3CJIB 4XZPA 1DQ0A 4YGEA 4QPYA 5JAXA 4AEDB 2OUJA 3QACA 4AEMA 3DL3A 3ZMNA 4HL0A 3B94A 5FO7B 4XJUA 1RHI2 4Q8LA 4A7KA 4CEWB 4YZ1A 5I91A 1I5ZA 2Z2SB 4W65A 3SNMA 3V0BB 4MGYE 2HWC2 5BNPC 4AI3A 4AFCA 4QM8A 1KITA 1ND3C 4BCUA 4FPFA 2JD4A 1S0CA 3HT2A 3CJXA 4WVZA 1S2BA 4CDQC 4NN0A 4CP0A 1SEFA 2R30A 5SV8A 3WQ1A 3AKQA 3NKTA 5KXCA 3DN7A 4AI8A 1HRV2 2ERFA 2WZR3 4LT5A 2BVBA 5H9SA 5BNNA 1MEC3 1X82A 4BQ1A 4KQ7A 1D0HA 3P3NA 3H7JA 1X36A 3JCIA 4YARA 2XKOA 3I59A 2XJTA 1BVVA 1RUOA 1ULCA 1PIV3 4Q29A 2JJ6A 2CY6A 1WLDA 1R082 3TNQA 4YM0A 3ZSLA 1PZ9A 2VMIA 3VBFC 3VV1A 3R05A 3AP4A 4BMBA 3IT8A 2WFF3 4Q1PA 3VN4A 3LA2A 1MQTB 3POYA 1V9U2 2OVUA 1VR3A 4K1YA 3AMHA 2PHTA 2PHFA 4Q27A 2ZA9A 2ETEA 2Q5TA 1LEMA 4PIYA 1DG6A 1ASJ3 4AF9A 4YGBA 1VBB2 1RUH1 1OOPA 1QDOA 1RB8G 1PGL1 1O4TA 2JXAA 4Q4X2 4AEKA 4FOQA 2Q0AA 2RJKA 1CAWB 4ONUA 2ZGNA 3RG0A 2XLAA 3JQWA 4B7KA 3O0XA 2R063 4WZFA 5KHGA 4D69A 1H2MA 4XIKA 2ZACA 4H7MA 1ZRDA 4MX3A 1R1A3 1VBD2 4E4ZA 1C4RA 1WW5A 4B8EA 1RUE1 2ENRA 1H1MA 2ZABA 2MEV3 1OA4A 2QQPA 3RMXA 4C1WA 3C3VA 1TME3 3Q9OA 2RMU2 2CWSA 3BPZA 4LBQD 3VKMA 1YI9A 3IMNA 1H2KA 1YYNA 4QHBA 2NLRA 5FREA 1DGLA 4YM1A 1FNZA 3VL9A 2CYFA 1C5IA 2AUYA 4I30A 3TOJA 4CDWA 4X6QB 3CU7A 4EJRA 5KBFA 5DZGA 4HZFA 5BNNB 2WNVC 4PIZA 1C8NA 3NL1A 5LRSA 1MS1A 5JI7A 3I59B 1S0GA 5FPXA 5JZGC 1N3OA 3MW2A 4GH4C 4IEYA 2IXIA 4IQPA 4IV1A 1QJY1 5LK7B 1CPNA 1DU3D 4YM3A 4HK8A 4YFWA 3TBDA 1N3QA 4EN7B 2TNFA 2FMDA 2A3XA 1VBC3 1RVF3 2D5HA 1ZREA 5T55A 5GZCA 3AP9A 3HIFA 2B45X 1MZ5A 2NQYA 1PGW1 5C4WA 1AYN2