4XQDA

X-ray structure analysis of xylanase-wt at ph4.0
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
188
structure length
188
Chain Sequence
IQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase 2
publication title Direct determination of protonation states and visualization of hydrogen bonding in a glycoside hydrolase with neutron crystallography.
pubmed doi rcsb
source organism Hypocrea jecorina
molecule tags Hydrolase
total genus 55
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2015-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xqdA00
3VZLA 3WQ7A 1H0BA 1AXKA 2B46X 3WP3A 2QZ3A 1KS4A 2NQYA 1ENXA 1HIXA 3VLBB 1XYOA 3WQ0A 3B5LB 2BW8A 2DFCA 4XQ4A 3WP4A 3B7MA 3WP6A 2F6BA 2NLRA 3RI8A 3VZNA 1REEA 3AKRA 3AKSA 3VL9A 2QZ2A 1H1AA 5EJ3A 1IGOA 3VHNA 3AKTA 1XNDA 3AKQA 3WP5A 1XXNA 1NLRA 3AKPA 1W2UA 4HKOA 5K7PA 4XQDA 1XYNA 3MFAA 3VHOA 2D97A 1C5HA 1HV1A 4S2HA 1TE1B 4S2GA 1UU6A 2BVVA 3VZMA 1XYPA 2DCYA 2VGDA 3LB9A 2VULA 3WX5A 3VZJA 3ZSEA 3RI9A 3AMMA 2D98A 1BCXA 3AMPA 1F5JA 2DFBA 3VZOA 4HK9A 1UU5A 2DCKA 3WXPA 2JEMA 4HKLA 3LGRA 3WQ1A 4HK8A 3VZKA 1OA3A 1QH7A 2JICA 1QH6A 2JENA 4NPRA 1YNAA 1REFA 1H4GA 1BVVA 1BK1A 1OLRA 1OLQA 1XNCA 3MF9A 3WT3A 3MF6A 3VL8A 2B42B 3EXUA 3AMQA 3M4FA 4S2FA 4H7MA 4IXLA 1PVXA 1T6GC 4S2DA 1M4WA 4HKWA 3VHPA 3HD8B 1UU4A 1HV0A 1KS5A 3AMHA 1OA2A 2BWAA 2DCJA 5HXVA 3VGIA 2BWCA 2C1FA 3AMNA 3O7OA 3MFCA 3WY6A 1UKRA 2VG9A 2VUJA 1C5IA 5K9YA 2DCZA 3WR0A 4XQWA 1REDA 1OA4A 1XNBA 1XNKA 1H4HA 4XPVA 2Z79A 1H8VA 2B45X
chains in the Genus database with same CATH superfamily
3ZFEB 1WLWA 3OY8B 1JOPA 2DTYA 5A1FA 3BUCA 1H9WA 1P8JA 1GR3A 4NJ4A 2P34A 5KHKA 1G9AA 5LB6A 2R042 5IUQA 1OFSA 3PIJA 4FPOB 5T54A 4I09A 2VO5A 3JUUA 1K3IA 2PLV1 1AR91 4K8FA 2BBVA 1RUC2 5CZKA 3OY8A 2ZZQA 1CGPA 3WP6A 2OVUA 1SQ4A 3IDBB 3IN9A 2WA4A 3B02A 4LEJA 2DU0A 2JB4A 5JCTA 3L2YA 1REEA 3TB0A 5IK7A 1HJGA 4KBZA 2BQPA 1ULDA 2JJ6A 1W04A 4Z1VA 1ZZ6A 4IEOA 3ILRA 2Q1MA 1NOVA 1CAXB 2PAMA 4DNYA 2RMU3 1UQXA 2QQIA 4RQPC 4PT6A 4Z82A 2UYBA 4HN0A 2WUHA 5CFCB 1XXNA 3M3OA 2XWJB 3VBFB 3ETQA 1W2UA 5FZBA 3T4HB 5HPOA 1GZ9A 3T1LA 1V9U1 2P5BA 4OULA 3POGA 3PU8A 3OJBA 4GJYA 5FPLA 1ND2C 3UKVA 3UGFA 4DOUA 3TN92 1AX0A 3BPSA 1JZ8A 4XDPA 5K0UA 5HBAA 5AFBA 4LO8A 2G19A 1EAH1 1VBA3 1O5LA 2VULA 4CTEA 5JR7B 5BNNC 2XHNA 3IWZA 3N35A 2VCBA 4H7LA 2FZ2A 1Q5OA 5EP9A 3VBUB 2ZX2A 1W3VA 2D98A 1WMEA 1JYTA 4XDOA 2VTXJ 2Y26A 5C4WB 4LO5B 2VH9A 3KGLA 4HLTA 4N53B 3TEZA 2QCSB 2VBPA 4X6QB 1LJ7A 4XFBA 1OLRA 2ORZA 1ENSA 4H3WA 1OLQA 1XNCA 2Y6LA 2JD9A 2ZHKA 1D2QA 1LOCA 1PHMA 3FFZA 4AYUA 3O1PA 1WUVA 1X9PA 1RUJ2 3VKNA 5A6QA 3EXUA 1ZZBA 1HB1A 5C4WA 1O4TA 4RD7A 5SV8A 5E1RA 2TBVA 2HWD3 3UYJA 4Z2WA 1JTZX 3USUB 3M2MA 1VBC1 1EUUA 2D6LX 2WKKA 3WF0A 3HD8B 2A73B 4NMIA 3EHKA 3R05A 1UY0A 1XB9A 3AFKA 3W58A 3BGAA 1X82A 2GZWA 2WZEA 4JAAA 3BOPA 4OQ9A 3T08A 1QDCA 4FI9A 1F5FA 3WW1A 1LOGA 2J1AA 4B8EA 3MZHA 3GZTB 3I2DA 1RUF1 1GU3A 3IM0A 1GZTA 2ADDA 3IDCB 4RR3C 3WLUA 1JOBA 5J36A 3GZAA 4Q2FA 3WCRA 4MHRA 3ZXFA 5AVPA 2YPJA 3PHMA 3WQBA 1I6XA 1ALYA 1OOPA 1QU0A 1UKGA 2Q4SA 3D82A 4JKMA 4Y1ZA 1EPZA 1EYBA 1ASJ3 2WNOA 5DN2A 1I3HA 4LIVA 2Y8KA 5FZKA 1O5UA 5L36A 1H4HA 2WS92 4XFCA 1VB4A 2JXAA 4B7EA 1O4ZA 2VW2A 4XPVA 1QQP1 4YW6A 4DMIA 1ACCA 4GWNA 1E5RA 4HZFA 2DF7A 4QDRA 5FLHA 4RFT0 3ASIA 2AZ5A 4OUSA 1EY2A 4W65A 3E5QA 4EWDA 3MW2A 3ZDSA 2ERFA 1OF3A 1WGPA 3SLIA 4MV2A 1UOBA 2J1UA 1QJY2 3OB8A 1RINA 3B5LB 3O14A 4R8HA 5CKQA 2DFCA 3ZN6A 5T50A 1TMF1 3LAGA 3E5XA 4JRLA 4CU6A 5LW9A 2WZR2 1DLLA 1UMZA 3LOIA 2UY8A 1O59A 2WNVA 2Y6HA 2ZX3A 4JVAA 1GLHA 3B00A 4IEUA 5FJKA 4EN0A 4MHUA 4AG4A 1JZ6A 2CNAA 4UFKA 1UIKA 1RHI1 3VDDB 1NLRA 4L8QA 4META 2QBXA 4IV3A 2WQ8A 4AVVA 3WDWA 2YBKA 1C5HA 4MVTA 1US2A 3S7IA 2PYTA 4A4AA 5J3UA 5JMCA 4OMDA 1DQ5A 2IFRA 2W9XA 4J25A 2XL7A 1RUG3 1Z7S3 3VDDA 4P9LA 3DKWA 2FMDA 5F9TA 3U14A 2DU1A 3OSDA 3PTRB 4IV1C 1LKNA 5FXVA 1F5JA 4LTAA 2Q8CA 1UNBA 2P17A 4Q1RA 5HCAA 1D4M2 3KCCA 3LGRA 1WMDA 2D43A 3LZZA 4QAWA 4TLGA 3SEPA 2LTNA 2ZGSA 2ZZJA 3D5OA 3KT7A 4LBKA 4XACA 1JN2P 1LHWA 1WCQA 1QJX3 2IVIB 1AR63 2VZ3A 4AHXA 5C3SA 1PVC2 1LEMA 4GH4A 3KHBA 4JKLA 4PBPA 4R9BA 2E63A 1WW6A 2GP3A 1VBB3 4A7KA 3IKWA 4D6QA 4QB1A 4NIGA 1MS4A 5FOBB 1MEC3 3TYJA 2Y38A 1GWLA 3N7JA 1OD3A 1V0AA 2R041 2AYHA 5JDBA 3P1IA 4QB6A 2RS32 1M4WA 2VMEA 3GJBA 1FPN3 3VHPA 4DINB 1QJEA 5EPAA 4LJHA 3ZFGB 2E33A 3LCPA 3ZSLA 1SDWA 1C3HA 3DUIA 5JOZA 4XC9A 1Z78A 2X10A 2BV4A 3I2IA 1GZCA 5FZ9A 3DXUA 4JQTA 5A33B 4QX3A 4SLIA 4LKFA 3KMHA 2D6PA 1DU3D 4IE6A 3PU3A 3UKNA 4LBQB 5E8AA 2BOIA 2QVSB 2ZMKA 1US3A 1VLNA 2PHWA 5JVVA 3ZFGA 3VD3A 2R7EB 4KWUA 5C71A 3MFCA 1AR93 1UYZA 5BY5A 4E4ZA 2W46A 2JIJA 2QNKA 2XKOA 1OQDA 3U07A 1Y9MA 1CX4A 3OUJA 1QKQA 3FMGA 3IAPA 4JX0A 1O3RA 2EXIA 5J96B 1R1ZA 4FOVA 5FZMA 2FDJA 4O7XA 2WINB 2JDMA 1AYM2 1QNWA 1LULA 1UZYA 4F8AA 2VUDA 2IXKA 4K21A 4ZXEA 1AX1A 2PHDA 4RS5C 3UESA 3J8F3 2O0OA 2W39A 5LY1A 1Y9QA 1ZRIA 2W1SA 1JOJA 1QHDA 3HQUA 1BMV1 2NQYA 5T55A 3FFQA 4U2AA 2ZMLA 4BQWA 1WLCA 4JTNA 4IQPA 3HNMA 3WP4A 5FP8A 2F6BA 1CZTA 5LATA 4TLFA 2XVKA 2HWB3 1WW7A 2AENA 4XJUA 2RM22 5CFCC 1GNHA 2OUHA 3NKTA 3RWNA 4UW5A 4IE4A 3VBFC 1UZWA 2EVXA 3M8LA 2K9ZA 2VNRA 4LUMA 1OKQA 4DY5A 5J1XA 3SC7X 1CX1A 1YI9A 3W9AA 2FCTA 2ET7A 5IVCA 3CJXA 3AZXA 4Q0QA 4YGCA 1YCIA 4XJAA 1HV1A 2W52A 3QCWA 5DAXA 4HPKA 5FY8A 4OVEA 5A70A 3VBUC 3RZMA 4JDMA 4DO0A 3ZSJA 4JDNA 2CV6A 4P9XA 4AEDA 1U5ZA 1VBC3 4MH0E 1SCRA 1PM4A 2RMU2 1SEFA 1PO23 2F4PA 4RYDA 4N53C 4GALA 4B1MA 1FATA 1C28A 1H6XA 2VZQA 4DRRA 1BBT1 4NE9A 3QBQA 5HCFA 5JOYA 4KWKA 2XUMA 1W0OA 3ACFA 4UW6A 1QH7A 3TOJA 1Y7BA 2VNVA 2WBKA 3MIGA 3NNJA 4CCKA 1JMUB 4D8MA 4A7ZA 5A3NA 5BNQA 2GMMA 1W03A 1H4GA 3IIIA 1VBA2 3H8OA 4AI3A 4X8PA 1UX6A 4HN1A 5FZ7A 5IK8A 4KU8A 1H2MA 2B42B 1OUSA 1RL3A 4S2FA 3ACLA 5FK8A 5I0TA 3WF4A 5BNPC 3RJRA 2R0FA 3RZLA 3N3HA 3MV11 1PVXA 1YJKA 4XXAA 5CB7A 2ZGMA 4WZCA 3HMYA 4FBFA 4DUWA 1HQWA 3OF1A 5FPBA 3VD5A 1AR73 2ETEA 4QGLA 4N43B 2DCTA 4Q0SA 1N1VA 1QJY1 4P14A 1UU4A 1NA1B 1C4RA 3UNPA 5FZOB 1DGRA 1CAVB 5IVFA 1Q56A 4DXSA 5A3WA 4OI1A 1QDOA 2A3XA 4CDUA 1MPXA 1OA2A 3RQ0A 5ABJC 1GZWB 4YGBA 2ARXA 5H9QA 1EV13 2WFPA 2BU9A 4QXKA 5G05L 2WZR1 4Q4W2 2JDKA 1VRH1 4XCAA 3J7HA 3CHXA 3AVRA 3HIFA 3ABZA 4N43A 3B9IA 2HWD2 2FHRA 3BTYA 1DF0A 4LLOA 5C8CC 2KXLA 4QX7A 3GXUA 1NA1A 1NKGA 1H8TB 3RG0A 1W9YA 1CAVA 1G86A 1UKRA 2ID4A 2X5IA 2GC3A 3PIGA 4JGZA 3H50A 1NCQB 3TEXA 5EFUA 1WZXA 4W50A 5AVAA 3ZXDA 1LHNA 5CA6A 2VW0A 5F5QA 3H3LA 1NUKA 1QJZA 4O9EA 3GZEA 2A75A 4CVUA 1ZBA2 5EHDA 1RUD1 4NWVA 5BNOA 3GF6A 1WA4A 5LBFA 2PXJA 5FY1A 1RUH3 1W6MB 2WDBA 4GMP0 2WT1A 4LA2A 5A32A 2JDAA 2D40A 4MGYE 1ASJ2 1ZRRA 1D4M1 2W68A 3IAQA 5FZ3A 3GNEA 1PIV1 3RYPA 3OBTA 4CUBA 4JHTA 1GNYA 4P9JA 3VLBB 3WHTA 3I59A 4LBQD 3WG2A 1XYOA 4LBJA 5LASA 5HXMA 2TNFA 4GULA 2D93A 1YFYA 3VKOA 1KQRA 2RV9A 3ILFA 4YZ4A 5HCBA 1DDLA 3T0DA 3TWIA 1YQ8A 4BQ4A 1C57A 3A23A 2CHHA 3RMYA 2NLRA 2YHJA 5JIUA 3AB0A 4YYOA 3KM5A 3ZYGA 3MLJA 1AR81 1YJLA 3WNNA 2HWE3 5FMOS 3KGZA 3R4UA 3CZJA 5DDJ1 1MS9A 2PHTA 1COV2 4A41A 5FMBA 3AKPA 5LBCA 4AK3A 4CEYA 4GKYA 2R061 3TNQA 3WNPA 1O3TA 2JE7A 5B4XA 4J1WA 5FYCA 3WOGA 1JYWA 3Q8BA 4UWDA 2GH8A 3NJYA 1XOYA 2HBUA 4LE3A 4QM8A 3LDBA 2I45A 5JAXA 2VNOA 2ZX1A 5FUIA 2W5FA 1HXS3 4NRMA 1PO11 3WNOA 5A3MA 2JG8A 1JZ3A 5FO9B 2VGDA 5KXEA 1YEWA 3NSTA 4L97A 4NPLA 4CP0A 2PHXA 4Q4Y2 4M3CE 3POYA 3NL1A 4A44A 2OUJA 1PK6C 1WKYA 3WHUA 1BCXA 2QDRA 4CDWC 3VBHB 3PL0A 1HN1A 4GB31 4KG0A 1AF9A 3A0NA 4NHKA 4NOTA 4QHBA 4KH9A 4JGYA 5A7WB 4BOWA 4XILA 5JXJA 2VZTA 4NROA 4EWEA 1OT5A 3ZXKA 3PMEA 2J7MA 3CJIC 4GQ7A 3M1HA 4KU7A 1RUG2 1Z7S2 4COZA 4YM3A 5IATA 4X6RB 3VBHA 3P6BA 1J3RA 1RMU1 2ZBJA 4AFBA 5FO7B 3POIA 3FBYA 5A7QA 1GICA 4H7MA 2CGPA 1YQCA 4RFRB 3HQRA 1W3XA 2IXIA 4RHV3 3MIFA 2FD8A 2WT2A 3HT2A 4Y26A 3MDPA 5EV7A 1QJX2 1ENRA 2P4EA 2HBTA 4OUEA 4W6XA 3RS6A 1JHJA 3ZFFC 4Q29A 2WL1A 3UT0A 1FMD3 1YQ5A 1J59A 1A78A 5H9SA 4I30A 1VBB2 1T2XA 2ZABA 1J1LA 3JBG3 3S6PA 2RM21 2PTMA 2BWCA 1MEC2 1OC1A 1W06A 2WLPA 4M3CA 2VVDA 1UYPA 4BIOA 4FQZA 4UFJA 4BISA 4D69A 1XE8A 2BYVE 3D0SA 1C8M3 2X53S 2A1XA 2C6SA 2W91A 2WZPP 2YC4A 3PUSA 4P00B 1OA4A 1XNBA 1SZBA 4UF0B 4FCAA 4XFFA 4URTA 1BVP1 2HWC3 2RS13 1PZ7A 4V2WA 2LALA 5C7GA 1B09A 2GSYA 4LO6B 5GLWA 3AP7A 4FPEA 1PGSA 1W2NA 3W21A 3VDCA 3BI3A 2VXRA 1Y9GA 4LXLA 3SITA 2WWSA 1RVF3 4DZGA 4YW7A 5DG2A 5FQ0B 3KT1A 2ZAHA 4UF0A 4NVPA 2JG9C 3LFMA 4EJRA 1RUOA 5FZLA 1KFUL 4K8RB 2WSUA 3E6DA 5BNNA 2W08A 3M3QA 4BQ1A 4IESA 4CDXB 1J1TA 2OX0A 2I07B 4GWMA 4M3CF 3ZN5A 5FQ0A 2VZVA 3LEMA 4GWJA 4C1WA 2DURA 1NY72 2DV9A 2FCUA 2ZOEB 1FV3A 2VZPA 3WVJA 4HANA 3K3NA 4PIZA 2WYSA 2LROA 3BKZA 5FZAA 3WUCA 1L7LA 1VALA 1GOGA 3J8F2 3L9JT 4LHNA 4LOSA 2LS6A 2FDGA 1SBDA 4NRQA 5AC93 3BTZA 3MW4A 1SLBA 1IOAA 3INAA 3WP5A 2CTVA 3U0ZA 2VCCA 1CAUB 3FL7A 3H0OA 3C3VA 3SKVA 4OZOA 5IVYA 4CPBD 4AEJA 3WNKA 2IZWA 5FRAA 2ZGRA 4PIYA 5JSOA 1G9FA 2BJSA 3MPPG 3ZYHA 4Q4V2 4Q4W1 5I0SA 5IVJA 5F6KA 3BCWA 1CAUA 3T0BA 3POSA 2WFF1 3Q8AA 1W8OA 4I0AA 4QXBA 4D6SA 1GP5A 4QX5A 1GUIA 3WEZA 2BUKA 4XZUG 1SDDB 2Y64A 1DYOA 4RR3A 2DFBA 4YW3A 3RVHA 5JOXA 2EIEA 2GNDA 2E6VA 3ILNA 3GBWA 5JIAA 2CL2A 2OA2A 5FR3A 1TNFA 4QD2A 4QHOA 2JICA 5L7OC 2JENA 1EPWA 1ZBA1 1UOJA 1H1IA 2XONA 1DQ2A 2CAVA 3B94A 3H8UA 3VL8A 1CVNA 1PO22 3BALA 4Q8LA 3OEBA 4WBBA 4Y3OA 4C0HA 1VBD3 3I8TA 4LPLA 4MX3A 1C8NA 3JD72 4GWIA 1O8SA 2BZDA 5C3QA 4OHWA 2MHFA 1A8MA 4LHLA 4UBHA 2VNGA 3DYPA 1ND3C 1N1SA 3D6EA 4ES8A 3F95A 4UOJA 2VTXA 1XE7A 4YVWA 2OZ6A 3AMHA 3HPNA 2ENRA 3H3UA 3QOPA 5J7MA 2W92A 3WSOA 4I2OA 3TNPB 3RZZA 3TAYA 1WCUA 4HG6B 2QKDA 2C1FA 4R9CA 5LRRA 3ZPYA 4QKFA 1K5MB 3WY6A 4QKDA 1AR72 2VG9A 1J3QA 2LW8A 2PN5A 1COV1 4FT8A 4PDWB 2UU8A 1IQDC 3VV1A 4RL7A 5FIXA 1PNGA 3GHMA 4XAAA 4U36A 3I3DA 3SQOA 1O3SA 3LEKA 4QPIB 1FOD3 1W6QA 2HWF2 1JW6A 4PI2A 2FCVA 1K5MA 1IZ3A 5BPXA 4KL1A 3RNSA 3KVAA 5FZ8A 3R6SA 5FZ6A 2NMOA 5DDJ3 4CXXA 4Q4Y1 3QH7A 2J1RA 1MVQA 3H3ZA 2RHPA 4E2SA 3LKJA 4HBNA 4OUMA 2H6BA 4ARYA 4FVVA 1ULEA 4QMAA 4AXOA 4L11A 1QJU1 2C0ZA 5ERLA 4GMP1 1A8DA 1PGW1 2ZHLA 2TEPA 4MLOA 5IT6A 2AEYA 4CRQA 2YXSA 1YFUA 1LR5A 4DUVA 3W5MA 3N7LA 1RUH2 1W6OA 1AYN1 1GV9A 3F2ZA 4FQ4A 4IEWA 4OI4A 3I7DA 3VL9A 1V70A 4XUPA 3EO6A 1IGOA 4YG3A 5D2AA 3IB3A 2IUWA 2ARCA 5FPAA 4I0BA 5FYBA 2JB8A 4MGKE 2WNUC 4BDVB 2PAEA 1NCRA 3JXSA 5KHHA 1LTEA 4TWTA 2P6HA 1XU1A 5FYMA 3WNXA 1CZVA 5KHJA 2E7TA 2RS51 1OPMA 3KB5A 2YU1A 2YB7A 5FK7A 4CUGA 2Y0IA 4BK5A 1RUI3 4S2HA 1QOTA 2P3IA 4ISRA 5IFPA 4R52A 1MQTA 2BVBA 1DZQA 1W6PB 1UWWA 3ROUA 3VBSB 2VJXA 3MIEA 1W8TA 5F3GA 1D2SA 1WD3A 1KDMA 2ZAAA 1MS0A 2HWE2 4ZZ5A 2W87A 3UL2A 1EP0A 3KSCA 4Q4X1 5JLVA 2R1DA 4WM7C 5FYSA 4XBQA 4LE4A 1L7RA 2SLIA 4FAGA 2VE1A 5F37A 5FMCA 3WNMA 3PUAA 1W6PA 3Q8CA 3VBSA 5K0UB 3EQEA 3THPA 4CCDA 5LEKA 4C91A 4ITCA 1HXS2 1QH6A 2R071 3KZ4C 1VBE1 3PJQA 5C70A 1REFA 1K12A 3JQXA 5FP3A 3HWJA 1FYUA 3DL3A 4XFAA 1DLCA 2XBO1 3OPTA 1R083 2OPKA 1HRI2 4YNIA 4AVAA 3VUOA 2Y60A 1GKBA 1YQ2A 1W9WA 2DYCA 2H0VA 4BQYA 5FXWA 1R1A3 1QGLA 4HKWA 4P02B 1S55A 3AYCA 4WM8C 5F5CA 3I3BA 1O3QA 2D3RA 2XGXA 3V0AA 4QHZA 2XL9A 5GZCA 5CU1A 2DBNA 5FPUA 1OH4A 3POFA 4OCTA 2VUAA 4MADA 1ZM1A 2UYAA 2VMIA 3AL6A 5C5UA 5FPXA 1RJ7A 4HVOA 2OYZA 1QEXA 3GHNA 5F2SA 3O0XA 4RHV2 3ELNA 1N47A 2AR6A 4P9YA 3DPRB 4QQOA 3AYDA 5K9YA 4FPJA 4HETA 3U4SA 4IGQA 5FY5A 3S7EA 1FMD2 3K2OA 1GWMA 1QF3A 2A6WA 1H2LA 5F3CA 3KWVA 1LOFA 2PFWA 4LBMA 3JBG2 1HB2A 5JXIA 3IMNA 3X29B 1I9RA 1O4YA 3E97A 1AL0G 2HEVF 4AQ2A 1ZBE3 1UZZA 3DPRA 2RR11 4K6BA 4XURA 2XJQA 5F5AA 5F32A 4B1LA 2WAOA 1OOPB 1PZ9A 2GMPA 2RE9A 1C8M2 2VBBA 3JZVA 4J1XA 2QQNA 1R093 2B46X 1W0NA 3WG4A 1BLZA 5FUPA 4D7YA 5EYXA 2R32A 2WLQA 3NV1A 2RS12 4GJZA 1CJPA 2E26A 4A42A 3AX4A 1AL21 4HVQA 1OI6A 4MGIE 4FXGB 2VVEA 3O12A 1RVF2 5D21A 2DWRA 3OGVA 4FFFA 4FPYA 4CU7A 1OKOA 1ZZ8A 4DXTA 2Q1FA 2IXHA 3H9AA 1LGCA 2VR4A 3I3QA 1ZA7A 4LMFA 2BGCA 5FBJA 5L9BA 4BA6A 3DV8A 3S57A 3MEPA 3RZHA 3AJZA 3O0VA 1AZDA 1BEV1 3ZN6B 1J58A 1WW4A 2ARAA 2NMNA 2QQUA 3T1MA 1OXCA 2Y0OA 2QQMA 3I2FA 2VOVA 2GN7A 5ACA3 1J83A 1WBFA 2RJKA 2WNVB 3BPZA 4PLMA 4AFDA 5FWJA 4AHWA 5JUVA 4KWJA 4WV8A 3LB9A 4AF9A 4B4PA 4EYUA 2EAAA 2BGPA 1IPKA 2ZX4A 3UGHA 1VMJA 4CE8A 5AC92 2A7AA 1G9CA 2A3YA 2QQVA 2QUOA 4IV3B 1HLCA 4P9WA 2YROA 2DCKA 3B01A 2P37A 2JEMA 5CISA 2LRPA 3E6CC 1UW8A 3E1F1 5I8SA 1OA3A 3RRDA 3ST7A 2ZHNA 5ANNA 3U10A 4QX2A 2HWF1 4BLIA 1GP6A 1SMVA 2XLFA 2J22A 4XIOA 3NKGA 1TME2 3MF9A 1BXHA 1RUE3 2MEV3 4XXPA 3O1UA 3FBMA 5KXDA 3M4FA 1MZFA 3LIGA 4N90A 4CP1A 5C33A 1G9BA 1AJOA 4BMEA 4D94A 3VD7A 2D6MA 3GGLA 5L9VA 2C9KA 4LKDA 1CPNA 1DGWA 1S0EA 5GLVA 1ZZ7A 5FYYA 3QD6A 4XF4A 4CCOA 5J37A 2QQPA 4QQ2A 2E9QA 4GH4B 2OIIA 1QNYA 1X33A 2WAAA 4JQRA 4XEZA 4YFZA 2CGNA 2VMFA 2HJIA 1W2TA 1S0BA 2JE9A 2XWBB 2Z42A 1WWYA 3HBZA 2OZJA 2Z69A 1MS8A 4DS0A 2IXJA 1DCSA 2XXZA 3DYMA 3A0KA 3MUY1 1VBD2 2XR4A 4AEMA 5I91A 2Q8EA 3LSEA 1SHWB 4QB2A 5CFDB 4PDWC 2VMDA 2OT7A 2P6CA 2PHRA 3KS7A 4M00A 4XJ8A 2IXCA 5F5IA 5FAXA 3CEWA 2BTVC 2VUJA 1DQ4A 2ARBA 3WDVA 2XJTA 1UY1A 2WO1A 4ZKTB 1XRUA 3AZWA 1FI2A 3UJQA 4CEWA 1XNKA 5CFDA 1B35C 2VZUA 3ZXAC 4BXSV 1POV3 1GOFA 2Y6KA 2D6OX 3PUHA 5IWFA 1YFWA 4ZU4A 3ZSKA 4CXWA 1QWRA 1RUC1 2UWCA 3UKTA 5I0DA 1KEXA 3IDEA 5D8AB 3NWKA 2YV8A 4YVSC 3VZLA 4AVCA 5DPNA 5I8YA 4IGOA 5JSPA 2FDFA 1IKPA 2CU5A 2YBPA 5F7UA 1NQJA 3M70A 5APAA 5F39A 4OHYA 4LHKA 4UBGA 3AP4A 3SKJE 1JU3A 5JZGC 5FOJB 4CP9A 1FOD2 2PLV3 4CDWA 2AACA 2NPIA 5D8AA 3LEGA 4KGGA 5C9AA 4QWNA 1IG0A 1W39A 3OUHA 1HRV2 3O1SA 2VBDA 3RZJA 3MYXA 1O8PA 3VD9A 3TN91 3D3AA 1CD3G 2VQ0A 3ZFEC 2VY0A 5LRSA 4P5HA 3DYOA 1Q3EA 3KT4A 1OUXA 3FHIB 4PLOA 4R9AA 5GLTA 3SH5A 4ZS3A 5GKAC 4FSJA 4QPGA 1IS3A 4Y5TA 1V9U3 1HQLA 3CF6E 1O7FA 4XABA 1YC61 2ZGKA 3J9SA 2Y6JA 3FZ3A 2UY9A 1UPSA 4FFGA 1UZ0A 4FPGA 1EAH3 4K7JA 3ZFFA 3OBRA 2GC0A 2WIIB 3CU7A 1W28A 5IK4A 2VQTA 2H0BA 2ZEZA 3EJKA 4CXYA 4PI0A 3RI9A 2E31A 5K0UC 1RUJ1 2JKXA 3LFIA 1NXD1 4Z92B 4Y5SA 4XFHA 4TTGA 1W2OA 4FFHA 4HPKB 3SH3A 5GJ6A 1KDKA 1RUI2 2IC1A 2DDUA 5FO8B 3CMGA 3MIBA 2FDHA 4FTBA 5J48A 4JHZA 4AEDB 2ZA9A 4FOQA 4RN5A 5FZ0A 4KNCA 3O1TA 4EZHA 3H7JA 2NM1A 4WVZA 4LK6A 1SPPB 1FNZA 4CCJA 2ZKLA 4Y4RA 1S0CA 3QH6A 1OH3A 4HL0A 3AZYA 3PUQA 4AOCA 1UMIA 2VOTA 1LHVA 5C4WC 1I1EA 4L0PA 1E5IA 3PNAA 1NXMA 1SPPA 5FZHA 1D0GA 2RDRA 2QJVA 3UV9A 2AEZA 2DCJA 3I2HA 3NAPB 5T5JA 1DGRN 1R082 4A45A 1UYYA 5A6XA 1RUF3 4MXWA 3H8XA 4FP3A 2WS91 2E7AA 1HQNA 4QXHA 1Q8PA 1R1A2 4OZXA 4UT5A 1VMHA 2JKBA 1BJQA 4LQRA 2Y34A 3E5UA 3HEIA 1UY3A 4CDUB 4IETA 3NAPA 4M01A 2R0HA 2W1UA 4E27A 1Q43A 5DXDA 3AZVA 5HCHA 1V00A 3OYWA 4ZU5A 4AE2A 4LR4A 1OOPC 4YZ3A 4AR2A 5I0UA 4CDQB 3LA2A 4YW5A 5JI7A 1QQP3 1U5YA 2OQ7A 4AZZA 3ZXEA 1QIQA 3LF7A 3T09A 3VN4A 2B45X 2X5IB 4MGSA 2RG4A 5FLJA 1LHOA 1MACA 3ZIWA 3AFGA 4JGZB 4AVSA 5LA1A 3WDXA 3AXEA 5T5LA 1OURA 4P08A 3G6JB 1IS4A 5FP4A 3B93A 4COUA 4LK7A 4M4RA 4O9GA 3VBRB 4ATFA 5AFEA 4CDQA 5A7NA 1AXZA 3UGGA 4UFLA 5A7SA 4M4PA 4CP2A 3NO8A 5BNOB 2ZGTA 3VDBA 1WBLA 4EROA 1TMF3 2O8QA 2YC0A 2R1BA 5A32B 5KXBA 4QX8A 1UL9A 1W8UA 4Z8BA 1YFXA 3VBRA 5L7OA 4I3GA 2F4LA 5CIRA 3PMSA 4XHXA 1E5SA 1R092 3I3EA 4QDQA 4F83A 2VPVA 3I59B 3L2HA 2XJPA 1W90A 1RHI3 3AKTA 3U75A 1LU2A 2R16A 4HKOA 3ZM8A 4Y1VA 1UPIA 3JB4C 1XYNA 2WSVA 5I93A 2V72A 1QOOA 4A3XA 2Q0AA 3T2PA 4ET7A 3CO2A 5C3RA 3K4ZA 2OXBA 3ETPA 1ULGA 2RJ2A 4XJWA 3BN6A 3WD5A 1PVC1 4MXVA 5IAXA 3SCFA 2ADEA 2XQRA 1DG6A 5FZCA 3AMMA 4ZZ8A 4CEYB 4H2AA 3SNMA 2FDKA 3AYAA 1DQ0A 1HB4A 1NAEA 2KM2A 4KMQA 4LUKA 2Q8DA 1CZSA 3VDDC 1L7QA 4L99A 3URFA 3WQ1A 1FNYA 4HK8A 5EJZB 4YZ1A 2OS2A 5EQUA 4LKEA 2JG8B 2RS31 2QFEA 4XJ9A 1YNAA 2J42A 1AUYA 5FKBA 2ZEYA 1BK1A 3USSA 4BCUA 3VHRA 2HLEA 1W2AX 3EBRA 3H1YA 5A7OA 2K0GA 1KXGA 3M3CA 4UW4A 3KLSA 1POV0 1D4VB 2YG0A 1UYXA 2R043 4HMZA 4B4QA 2HYXA 3DEMA 2DTWA 3OGSA 4JGYB 2BPA2 5T52A 2P2KA 5I8TA 1X7NA 4EE2A 2EXHA 3MIHA 4XOGA 1JU4A 5LZ6A 2BRTA 4IEYA 2EF6A 1UOGA 5A6ZA 1UAIA 5LA9A 1CJDA 5DAVA 1LGNA 1VB2A 3ALQA 4PLNA 2V5YA 1JYNA 1HRV1 3ZR5A 2VZSA 4DXRA 2MEV2 1RUE2 2F17A 4TZDA 4AFMA 1HJFA 2X09A 5FZEA 5JWPA 3ZDVA 2QTWB 1NQDA 5FPZA 1N1TA 3OBAA 3GJAA 1T6BX 4AGVA 3VBOA 1AYM1 1MZEA 2D6NA 2J1VA 3ON7A 4M0HA 3NV3A 2CWSA 2ZMNA 1C5IA 4CZSA 2B8MA 4LHSA 1S0IA 3KQ4B 2OW4A 3LQCA 3WR0A 3ZFGC 1G7YA 2J1TA 3PVOA 3ZO0B 3AZZA 1PMJX 3RPQA 4RGAA 3N9LA 3TRSB 2XJSA 5FZ1A 1SACA 1I5ZA 3TEWA 4NHXA 4M3CB 3ACHA 5FZ4A 4Q0VA 3OEAA 2YMZA 1AR62 1EUTA 2YY1A 3ZYIB 1K5JA 2VOXA 4MGTA 2PQQA 3AK0A 5F6LB 3OG2A 2W95A 3ZPOA 1H6YA 1UY4A 5FYVA 2ORXA 2DUPA 3PJYA 4WM7A 5JI9A 5KC5A 1DQ1A 2LUWA 3AP9A 1FPN2 1ENXA 1K45A 2FQPA 4D0QA 2OPWA 2GALA 3WQ0A 1XC6A 2MPFA 1ND2B 2EIBA 1I5PA 1MS3A 1PX4A 4NHMA 2VQUA 1HKDA 2PELA 3GYDA 3M7AA 4QT6A 3T3YA 3BIEA 2C5DA 4RQPA 4N9HA 4NRPA 5FY4A 4JC1A 2QZ2A 5BNNB 2VMGA 2OQ6A 1MR5A 5LA2A 3AYEA 3KCYA 2YDEA 4GAZA 4ZS2A 3I2GA 4FPKA 1IPJA 1XNDA 1ND2A 1YO8A 2BFUL 3FUOA 5A80A 2PLV2 1AR92 1Y4WA 2RMU1 3N9NA 4UAPA 5CYYA 3WUDA 4YZ2A 2YYOA 4Y5Z0 3C7HA 3FWEA 1DGWX 4INDA 5K7PA 3ITQA 5CEHA 1YRZA 2WYFA 1ONAA 2Z5WA 3I2KA 3MFAA 3OPZA 1ULOA 4ZPIA 3RFRA 1VPHA 2WZ8A 1HW5A 1CWPA 4Y1XA 5I0RA 4WM8A 1UU6A 3D4KA 4F7ZA 3N9MA 1IS5A 1V6LA 2VCAA 2DCYA 3RWKX 2D7FA 1NLQA 1O6UA 4LULA 3WCSA 4AAXA 4XZPA 5KHIA 4A7YA 3WX5A 2EXJA 4YW4A 2PMWB 1KFXL 1VBA1 5DQ0A 3OD0A 3VZJA 3OBZA 1RIRA 2GC1A 5HV0A 1NE6A 1BBT3 1V9U2 3SH4A 3APBA 4AQTA 1F35A 5CVRA 3OPWA 4AEDC 4COVA 4DPNA 2YFUA 1CR7A 2AREA 4XUQA 5FFOC 4NIHA 5FMOL 3S5AA 1MS5A 2QE3A 4MUVA 3AJYA 4DIQA 3N9QA 4BQXA 4PF5A 2WQ4A 3UK9A 1W8HA 2WWUA 4RR3B 3J7NA 3K48A 4BB3A 2JE8A 2HWB2 3O1VA 3FLRA 5A3PA 4Q5OA 1SLAA 3SISA 4EQVA 4IXLA 2BERA 1WCKA 2XDVA 3NVCA 1T6GC 4S2DA 2Z2SB 5BYNA 2HWD1 4PCRA 5DZGA 3ZYJB 1QJY3 4BZ4A 1SLTA 4QPWA 3A4UA 5B2GB 4RGKA 1BZWA 4H55A 5JOWA 4IERA 3S5QA 3NMBA 1N3PA 4LOTA 1NE4A 1Q8VA 3LDRA 3CDZB 4Q26A 2E51A 2WZR3 4ATEA 4URAA 1VRH3 1SLCA 1JYXA 3NJVA 1S0FA 2PHUA 3A21A 4IW3A 3H1WA 3MLLA 1UO9A 3WINE 1PX3A 4GZ9A 1F8VA 1VBC2 4UFIA 3MV01 2JDHA 5C5TA 4YVWB 3PVNA 1CAWB 4N43C 1VJ2A 1H1MA 3RMXA 2CDOA 1DGLA 1ASJ1 1NA1C 3N36A 2EXKA 4K1YA 4UW3A 1NYWA 4XTMA 4NHLA 3O1RA 4E4HA 1OMIA 2PQSA 3HN1A 1RUF2 1RUD3 3KV9A 3CLPA 1V6OA 2BNNA 3ME2A 2O14A 1U12A 1Z0HA 1CAWA 4XMIA 5T3NA 2TUNA 5GZGA 2ET1A 3BTAA 1UOFA 1MZ5A 1H8TC 4OI0A 4A2UA 5C6CA 1D4M3 1ZRCA 2YU2A 1PIV3 3IIAA 5DG1A 2NN8A 1YHFA 1YIFA 1W6QB 3JQWA 1ENQA 1NCQC 3MBWA 4JCKA 4BU2A 4R9DA 1QXPA 2V5DA 1LRHA 1QQP2 1DZRA 1U5IA 4FFIA 4LBOA 3B7MA 4FAHA 2YZ4A 3T4VA 3VZNA 4BWOA 1DYKA 2EA7A 2RDSA 1EV12 1AR83 4GD4A 4NAOA 4D7SA 3EMRA 1V6MA 3EB7A 4PHZA 3THTA 4IE5A 1DBNA 1DYPA 3GZUC 3H42B 2CDPA 3IMMA 4JRAA 1OSGA 1SCSA 1RYYA 3CZUA 3I2JA 4HSLA 3RGBA 1VAKA 2C4XA 2VMCA 4PIXA 2ZGPA 1JI6A 2R063 1OVSA 4NAMA 4Y22B 1F4AA 2B4KA 4YG0A 2PA7A 1W8NA 2W0XA 4HSJA 4NPMA 4B4RA 1W6OB 2Y6FA 1TMF2 1FX5A 2G9GA 1JS9A 2SBAA 2ZS6B 3Q9OA 1TE1B 2Q8OA 1PO13 4ZY9A 2QQLA 4IV1A 2EICA 4CEYC 5JXGA 1MVEA 5BUVA 2G9FA 1NCRB 3V56A 1HB3A 1RUG1 1Z7S1 4Y22A 4YPJA 1RUNA 1RHI2 2UURA 4JV4A 5A7PA 1W9FA 3U1XA 2BBAA 3IPVB 3PTYA 2JG8C 3P3PA 4GB33 3ZSMA 2V73A 3WXPA 4BPZA 1WLTA 3IZOA 5A3TA 4PBOA 1MQTB 1VRBA 2DUQA 3I4IA 3N9PA 4N7IA 1N3OA 3MPBA 4YFWA 2WO3A 1AJKA 1QJX1 2J1SA 1AR61 3IPVA 4JGYC 1RMU3 2XMLA 1B35A 1U5XA 1BHGA 1VBB1 3PDQA 1UCXA 4YM1A 3U78A 1K42A 1IHMA 2DVBA 1ZX5A 2DBIA 2ZHMA 3HOBA 5FTTC 1MEC1 3ZYRA 1NT0A 2HEYF 4J6GA 3VBHC 3LE0A 4BQ5A 1H9PA 4Y4YA 1FPN1 2BOJA 5CBLA 2XVLA 4RA0A 3GCWA 5FPVA 4AAPA 3KQRA 1KS5A 1JH5A 2R6QA 2A3WA 3N7KA 1W8FA 3RDIA 3THCA 5JZGA 2RM23 4QPYA 5HXVA 2RDNA 1S2BA 1POQA 2E53A 2ZACA 1CESA 4OFGA 2IWGB 4QKBA 4NIDA 5TSWA 1YLLA 2KA3A 1LAJA 4OLLA 2BEOA 5FXXA 5EXOA 3AMNA 3BVCA 4FP2A 4XJZA 1OLME 4RS5B 2BGOA 1NZCA 2ATFA 3ZFEA 3I3MA 3V0AB 5IW0A 3R4DB 1IKQA 3NV2A 4XQWA 5H9RA 1REDA 5GALA 1F31A 5DUUA 3SCGA 1KJRA 4TYSA 4XW3A 1UF2C 2Z4FA 3ZXJA 3SMHA 4FTEA 3R0RA 2R49A 2GMEA 2ZX0A 3KD4A 4RS5A 3T2TA 1NY71 2WWJA 4XF0A 1F4HA 3WQ7A 4P9IA 1HN0A 4CU8A 1F9KA 4NR1A 4PQ9A 1SLIA 3ZYPA 3OTFA 1OQEA 1KITA 3J8F1 4A6OA 4ORFA 1XNAA 4KQ7A 4BQ3A 1CAXA 4F3JA 1HIXA 2HKXA 3MGUA 2I2SA 5CFCA 3G7DA 4OHZA 4XETA 3VBFA 5CADA 4MZUA 1VR3A 2NZ9A 4UFHA 1LODA 5F1RA 3DN7A 5FYTA 1SBEA 5J98B 3AKSA 4XBLA 2HWB1 5A6YA 4Q4V1 4Z2AA 3I54A 5ISLA 3GM8A 4CCCA 5EJ3A 2P3YA 1SG3A 1OLMA 2VVFA 2EALA 2CGOA 2VC9A 2VZ1A 3ENRA 4YGEA 1VIWB 4E2GA 1A34A 1BMV2 1LNSA 2WC2A 3NV4A 3DCQA 1LCLA 3ACIA 4Q1PA 4AI2A 1G9DA 3VBUA 3MO4A 3IT8A 3LIHA 4MSVA 4CDXC 3VHOA 1C1FA 3D8CA 3S0MA 1RB8G 4Q4W3 5FYIA 2HEWF 2HWC2 4N53A 4E9KA 2BNMA 4JZRA 1KRIA 1W99A 1JYCA 2WFF3 5A3UA 3I97A 2E7QA 5BNPB 4WZFA 1N1YA 5FYUA 2B5HA 1PO21 3BU7A 5CG8A 3U11A 4Y1YA 3WW2A 4DQAA 5K8SA 3JD71 4HKLA 2VXJA 1Q8OA 4OHVA 3C8XA 4C8DA 4XMAA 3ACGA 3VZKA 2O1QA 3HNYM 2FBEA 5DZFA 1W05A 2XH6A 4FXKB 4HXCA 1ZBA3 1X9TA 4IE7A 2X05A 3USUA 4IE0A 5BNPA 5ABJB 2WRAA 2IFWA 1SFNA 4ZONA 5IVVA 1JYVA 2H6CA 4IEZA 1BBT2 1RTVA 3GALA 4BMBA 5C8CB 2AH2A 4LA3A 4B7KA 1YUDA 4K9SA 2WA3A 1JBCA 3U37A 1X50A 4XDQA 5ABJA 1ST8A 4NN0A 3NNLA 1X8EA 3ATGA 1NZIA 1AR71 4QX0A 3T2OA 2BDRA 1D7PM 3H1MA 4AQ6A 2Y33A 5L73A 1Q8QA 4DUXA 5IHRA 3VKMA 1HV0A 3H8RA 2NP0A 2GN3A 4EWAA 2BWAA 2GDFA 4NIIA 5C8CA 2XOMA 1JZ4A 2FDIA 3OGRA 2VQAA 3LA3A 1EV11 5JSRA 3HAGA 1S2KA 1ULFA 5LBBA 5B4NA 4AGGA 2CY6A 1NX9A 4YVWC 5E88A 5FWEA 1COV3 4FPLA 1IG3A 3W5NA 1V6NA 4A3ZA 3FHQA 1WA6X 2ZKNA 2VZRA 5T5PA 5EIYB 4E4DX 1VRH2 2GAUA 5M0TA 2DVGA 5CKMA 3O1MA 2VZOA 3FUQA 5E6HA 4GXLA 4QDSA 4Q4Y3 5HV4A 2Z79A 4UI9L 3PLQA 5KR7A 1S0DA 1RUH1 3Q8EA 1S0JA 1K5MC 1LGBA 1W0PA 2V4AA 3BIWE 2YGLA 5DZEA 4CEWB 1LOBA 3WP3A 3KVBA 4K20A 2ZGOA 3V64A 1QJU3 4GMP3 3HR9A 2W3JA 3NNFA 3K4AA 3MLKA 4LBLA 1IQAA 1RUD2 1X36A 1YYNA 4QPIC 2D5FA 4XUOA 3R4SA 3MICA 5GLUA 2ZPXA 4CYDA 1AYN3 5HI0A 1YI7A 2D6KA 2WN2A 3ZKUA 2KR2A 3N9OA 1J3PA 4DEQA 1KJLA 3BODA 1L3JA 1PIV2 1H2KA 3AVSA 1PK6B 4CP9B 2AUYA 3POBA 4AHYA 3LD8A 3WNLA 4AGRA 4CDWB 1CIWA 2HWE1 1C1LA 3AKQA 3K3OA 5FJHA 3FX3A 3EYPA 3ES1A 3SEEA 5C9AB 4Q27A 2RS53 3FJSA 4AEKA 3GDBA 4IEXA 5FREA 2YGMA 1NCRC 1LECA 2VOKA 3CJIB 1RC6A 5FP7A 1PK6A 2BVVA 1AR82 4CCMA 4HFSA 4XE9A 3UETA 4CU9A 1HXS1 4QXCA 4ASLA 2G9ZA 1GSLA 4L2NA 3I2OA 4Q4X3 4XCBA 2I74A 3LPFA 4Y24A 4G4FA 1OVPA 2FMYA 5DDJ2 4QPGB 2OKXA 1XNTA 4XUTA 3ZSEA 1MQTC 1GQPA 2JIGA 2R062 1HRI1 3VZOA 1Y3TA 3CJIA 2GC2A 3E6BA 4A6SA 1ULPA 3RSJA 4AI0A 2G1MA 2RJLA 3CQOA 3FHAA 5EYYA 2R073 1PO12 1VBE3 3ZFFB 3JU9A 4ASKA 1BVVA 1YWKA 2B39A 4WVVA 1W6NB 2XBO3 4FPCA 3VBSC 5FCCA 4JKKA 3PVBB 5A33A 3W59A 1LESA 5BXXA 4LO7A 1MZ6A 1OFNA 4GB32 1CQ9A 3ZVXA 1JHNA 4LBQA 3D0JA 3NRUA 1MS1A 5FY0A 3NW4A 4EN8B 2JX9A 1VAVA 5E89A 4RHV1 1A6CA 5DUXA 1W6NA 5G04L 5IAVA 1VP6A 2WQZC 1RMU2 3AXDA 4KI5M 1FMD1 1S0GA 4MGQA 1H2NA 4P9GA 4LNVA 5FV3A 1UIJA 2CAUA 4P5YA 3K46A 1UXZA 3JBG1 1SBFA 1ZRFA 2C9AA 2PHFA 4RGGA 4MG2A 1XQNA 3SCHA 1ZRDA 3GBFA 1ZNPA 2JG9B 4QQHA 1V6JA 4LO4B 1HX6A 2PHLA 3PUIA 4Q0UA 3WDTA 4ES9A 4W4ZA 1OD5A 4YW2A 5GZEA 5A3OA 1C8M1 5JPNB 1DFQA 3VKFC 3ZX7A 1WCDJ 1BK0A 1TQ5A 4Z07A 3S30A 4AFAA 4I3PA 5J09A 5DMYA 4Q4V3 4MXWB 3M3IA 3CL1A 3RJ2X 4BQ2A 2V4VA 2CWMA 2HWC1 2JG9A 2K2SA 2RS11 2HYKA 3BB6A 2RR13 1NLSA 3KF3A 4CCEA 5FKCA 5KBFA 4BYYA 4SBVA 1H8VA 4C90A 1LOFC 4QQLA 1RVF1 4XYXA 3HQXA 4LORA 4ONUA 1H0BA 2VW1A 3DPRC 4DEVA 1GNZA 1AX2A 5CKNA 3OYWB 5IK5A 4BJ0A 2XLGA 5E16A 4Q8KA 1KS4A 5C3OA 4E2QA 2Q1ZB 1AL23 1S1AA 4XHBA 5FYZA 2K46A 4UYBA 2LM3A 1NG0A 2BW8A 2XLAA 3BU0A 1TZOA 1LOEA 4MYEA 2JDPA 2W2IA 1URXA 1OQ1A 5IFTA 3J26N 4Q0PA 4X8NA 2VUCA 4BE3A 3JD73 2VOWA 1QXRA 2DVAA 3KV5A 3B9CA 1RJ8A 3KF5A 2P3JA 3K51A 4BK4A 1GANA 3LEIA 2R30A 4LIUA 2VM9A 4EN6B 1BEV3 5AC91 3DGTA 3K75B 4EN9B 5GM0A 3WZ1A 5KWRA 3J4UH 1PNFA 5IJRA 5L7OB 2D97A 1S2EA 2ES3A 3PURA 5FUNA 3PVEA 4W6YA 4FPHA 4S2GA 3KV4A 2AGSA 4L9BA 2ZEXA 5A1AA 3A22A 3T30A 4K1ZA 4EN7B 1ZBE2 2WO7A 4GA9A 3HT1A 5BV6A 4KG8A 4YSFA 5DAWA 1TME1 4BLJA 2QQKA 1G8WA 3LWCA 3WF3A 1UU5A 4M0NA 5H9PA 4YZ5A 4FTSA 4CUCA 3ZOIA 1ND3B 2RDQA 4AW7A 4YM2A 2HWF3 2ZTNA 1FAYA 1PM7A 3IBMA 3V65A 2C26A 2AC1A 2NYYA 4UXAA 2WNVC 4YW1A 3WDUA 2KD7A 2IXLA 2PAKA 2WFF2 1DZTA 3O0WA 4ISQA 1RXGA 5FZOA 3M3EA 4FPFA 5LK7B 3J7MA 3WT3A 1IPSA 1QY4A 3C7FA 1ND3A 1GZWA 4I02A 4QGNA 1VBD1 1YXWA 4IV3C 5JXHA 4ASMB 4BXFA 2UWBA 2D3PA 1WW5A 5LY2A 4PJYA 4V2VA 2ZJCA 4OQ8A 1H8TA 2BFUS 4QGMA 5CNAA 2XKPA 2J1EA 3HNBM 2D3SA 4D6RA 1NCQA 4FOWA 3WG3A 4L92A 2QQOA 1VE0A 4ZXKA 1PGL1 5SV5A 4NHYA 1GWKA 5T5OA 5ACA2 4I0WB 4UFMA 3K77A 1GYKA 5C3PA 1ZZ9A 3CNAA 3NNGA 4CPBA 1AHSA 3THDA 4DB5A 2WO2A 4CCNA 3AM2A 3O7OA 1ZVFA 3N7MA 2WN3A 3UJOA 2GNMA 2B7YA 3B3QE 4LT5A 1W6MA 4YRDA 4V1PA 4COWA 4OMCA 1IS6A 2XVGA 2GH2A 4GH4C 4TXWA 1JZ7A 2A5ZA 2JDUA 2W1QA 1S4CA 1WCSA 3ZKYA 3MW3A 1FOD1 4EV0A 4BIFA 3VBOB 1RUC3 1JZ5A 1TNRA 2D5HA 3VDAA 1GP4A 4CEWC 4YM0A 1DIWA 5EWSA 5CFDC 2XQXA 4IUGA 5FZIA 1DP0A 1QOSA 2DVFA 2JDZA 4Y20B 4ZHNA 5KHGA 4DY3A 4IEQA 1JUIA 4IEPA 2WNUB 3ZXLA 1TG7A 1WMXA 2QZ3A 4W6WA 4E4SA 3GCXA 3ZYBA 2HH9A 1F2NA 4H14A 3OD4A 2BNOA 1BKZA 2CYFA 3POWA 1LB2A 5LCWL 4EZ4A 4AL9A 4YG6A 4W8JA 4Y20A 3JCIA 4XQ4A 1PMIA 4AWDA 4CSWA 2WT0A 4IGPA 3MUZ1 2G4IA 1HRI3 2P1BA 2WNUA 3CBNA 3RI8A 3TN93 3DKQA 1BYHA 3HVDA 5D8AC 3O1OA 1H1AA 2O8OA 1WLDA 5C9AC 3Q8FA 4WM7B 2VU9A 3VHNA 2JWPA 2VMHA 1QJU2 2XHKA 3VB9A 3KCXA 4XFIA 1PGW2 4QM9A 4C0BA 1CPMA 2JDNA 3ZMOA 2N7GA 2QQJA 2YPDA 1W9TA 3QACA 5FBZA 5FXZA 4XQDA 4QU1A 1UZVA 2V09A 2WNEA 2VAUA 1AYN2 4RQPB 3RYRA 5DUWA 3FLPA 4BH9A 1RUI1 3P5BA 3T0AA 1SFPA 4QPGC 4Y33A 5A7WA 1BQPA 1XYPA 2ZGLA 3C7GA 3J7LA 4N7UA 5F3EA 5DAPA 2RVAA 1RITA 4QQPA 1OHFA 3U4XA 1F15A 1GOHA 1KD7A 2XPJA 1RUJ3 4HT1T 1DHKB 1UD1A 3C2UA 3AMPA 2GNTA 2W94A 2RS52 3WF1A 3BYWA 5FYHA 5L19A 3VD4A 4WM8B 2A6VA 1Q8SA 3WW4A 3ZXGA 3AP5A 4NPRA 5LWBA 2XB6C 1N3QA 2VECA 1V6KA 4KBBA 1PGL2 3NJXA 3T2QA 4Q4X2 4QKNA 3ZN4A 1CN1A 4G9SB 1XSQA 2YC2A 1LHUA 1RXFA 3AMQA 4NWWA 1ODMA 1R081 5IVEA 2JECA 4R4XA 2XG3A 2ZGNA 4MGZE 3I49A 2EIGA 5FZFA 4PF1A 4XVHA 3V0BB 2Q5TA 1R1A1 4N9IA 4AHZA 5GLZA 2R072 4GKXA 1ZREA 1VBE2 1W8WA 4KGQA 3KHCA 2E32A 3BTXA 1AXYA 4DRVA 1XPWA 3CIHA 2JDYA 3H7YA 4CA9A 1U0AA 2XBO2 1XJAA 2B9VA 4D3WA 1TEIA 3HN3A 1VMFA 3VGIA 1LOAA 3BOWA 1W9SA 2WS93 3MI8A 3NQHA 4KWLA 3V0BA 5KC6A 3MHZA 1A3KA 1EAH2 4JDOA 3OGGA 2QQWA 4XIKA 3ZYFA 1UX7A 4N8MA 4MO3M 1FV2A 4Y1UA 5FY7A 1AVBA 2DCZA 2B9UA 1HDKA 3CKHA 4TN7A 3ORJA 1UXXX 4R4ZA 5LEJA 5JMOA 1PZ8A 3B69A 4AI8A 4LITA 5KXCA 3OCPA 2L9LA 3QLQA 1FXZA 4LKSA 3HBKA 4DXZA 3POJA 1GBGA 1ZA4A 4FOYA 3NAPC 4MOAA 4CDXA 1SLLA 4IL7A 1DQ6A 1ZBE1 5FP9A 4BHPA 1TVGA 1J84A 5FLIA 4K3UA 2ZEWA 1JUHA 3DECA 4I01A 4XUNA 5F8PA 4PQQA 1GMMA 4E8CA 5CAZA 3RZGA 4GIQA 1AXKA 1ODNA 3ZLIA 5EJ1B 1WD4A 1R091 4CDUC 4K40A 4HVRA 4DFSA 3SXWA 4OI2A 1QMJA 3ZR6A 5C8WA 4NIAA 1CONA 2X29A 4CUAA 2RR12 5A3LA 2P3KA 4E8DA 4CDQC 4QU2A 1TME3 2C24A 2CSGA 2VTFA 2YBSA 5FZDA 3WDYA 1CIYA 4D7TA 2QDNA 3WW3A 3HJRA 2JD4A 3AKRA 1YQ6A 2X5IC 2EAKA 2MNGA 4JGZC 4AFCA 1RGSA 4XBNA 4NO4A 5JPMB 4YWAA 3VBRC 1KGYA 1Y43B 3AL5A 3FC0A 3O5SA 1AL22 3LDKA 5GZFA 2A6YA 5D1IA 2YFZA 1E5HA 1SFYA 2A70A 4O65A 5DABA 1PMHX 4AVBA 3LA7A 1X8MA 5BNOC 2D44A 1GQGA 1STMA 1XU2A 3C7EA 3C7OA 2WABA 3OGJA 3P3NA 3WF2A 4B3NA 2XJVA 3OOXA 4AVTA 3POEA 5ACA1 3VZMA 4YLZA 2GNBA 2DUOA 1OF4A 4B29A 2ZCWA 1GQHA 1PVC3 3SHRA 5LBEA 1XE0A 5DUVA 5F2WA 3FE5A 1JXNA 4LBNA 5LA0A 5ANQA 2IVJA 2Q30A 5F3IA 1BEV2 4OYUA 5FZGA 1GFF2 4AI9A 4C1XA 3K4DA 4HK9A 1OPOA 2Y6GA 3ES4A 3NNMA 4XF9A 2A6XA 1O91A 3WV6A 1R64A 2VCMA 2X8KA 4HONA 2RS33 4IV1B 1JODA 4IEVA 5FY9A 5DAQA 4ARXA 2VL4A 4XTPA 3AP6A 2BP6A 2ILMA 1APNA 3LSDA 4G3YC 1OBNA 3GBGA 4WVMB 3TEYA 1XSRA 3MF6A 2GP5A 2DVDA 2W1WA 2MEV1 1RUE1 4AQSA 3RZKA 3LOBA 1FT9A 1D0HA 3DF0A 1YIPA 1UY2A 2ZGQA 4AI1A 3N4MA 1LU1A 3LPGA 4CCLA 2ZXQA 1V6IA 4HOOA 3VKLA 1QXJA 2YUEA 1WMFA 1ZZCA 2XUEA 3RYKA 3DXTA 4BM8A 1M06G 3WG1A 5LK5A 4WVMA 1JZ2A 1B35B 1HRV3 3JB8A 4PDWA 4ZU7A 2ZGUA 5IYYA 3NJZA 5GZDA 4FO9A 1XBFA 2VD7A 4WVWA 4YGDA 1E57A 3OUIA 4JTOA 1ULCA 5JR2A 5EZWA 4QPIA 5FDBA 2XJUA 4YVSB 1W8ZA 1AYM3 1QJFA 3A7QA 1VAMA 4XAEA 3AC0A 2A71A 1LEDA 3FN9A 2UWAA 2GU9A 2WR9A 4QX1A 5FMDA 4YARA 4O61A 5A1LA 3MIDA 3W20A 4XF1A 3ECQA 5JZGB 5L9RA 3TBDA 5CG9A 1H30A 4NUBA 3VBOC 1JYIA 2XJRA 1LENA 1ZYBA 2WJSA 4LLFA 4RSUA 4YVSA 4XF3A 2FZ1A 1UN1A 3ZIXA 3ZMNA 4COYA 5IVBA 4TSVA 1POV1 3KV6A 4OHXA 1G6NA 2W47A 2A6ZA 4XFGA 5K4LA 1UMHA 3IDAA 4IDZA 2EIDA 3FLTA
chains in the Genus database with same CATH topology
3ZFEB 1WLWA 3OY8B 2DTYA 1H9WA 1GR3A 2P34A 5KHKA 1G9AA 2R042 5IUQA 1OFSA 4FPOB 5T54A 4I09A 3JUUA 2PLV1 1AR91 4K8FA 2BBVA 1RUC2 3OY8A 2ZZQA 1CGPA 3WP6A 2OVUA 1SQ4A 3IDBB 3IN9A 2WA4A 3B02A 4LEJA 2DU0A 5JCTA 3L2YA 1REEA 3TB0A 5IK7A 2BQPA 1ULDA 2JJ6A 4Z1VA 1ZZ6A 4IEOA 3ILRA 2Q1MA 1NOVA 1CAXB 2PAMA 4DNYA 2RMU3 4RQPC 5CFCB 4Z82A 2UYBA 4HN0A 1XXNA 3M3OA 2XWJB 3VBFB 3ETQA 1W2UA 1GZ9A 3T1LA 1V9U1 4OULA 3OJBA 3UKVA 1ND2C 4DOUA 3TN92 1AX0A 5K0UA 5HBAA 5AFBA 4LO8A 1EAH1 1VBA3 1O5LA 2VULA 4CTEA 5JR7B 5BNNC 3IWZA 3N35A 4H7LA 2FZ2A 1Q5OA 3VBUB 2ZX2A 2D98A 1WMEA 2Y26A 5C4WB 4LO5B 2VH9A 3KGLA 4HLTA 4N53B 2QCSB 4X6QB 1LJ7A 4XFBA 1OLRA 4H3WA 1ENSA 1OLQA 1XNCA 4AYUA 2ZHKA 3FFZA 1D2QA 1LOCA 1PHMA 1WUVA 1RUJ2 3VKNA 3EXUA 1ZZBA 5C4WA 1O4TA 4RD7A 5SV8A 5E1RA 2TBVA 2HWD3 4Z2WA 1JTZX 3USUB 3M2MA 1VBC1 2D6LX 2WKKA 3HD8B 2A73B 3EHKA 3R05A 3AFKA 3W58A 1X82A 2GZWA 4JAAA 3BOPA 1QDCA 1F5FA 3WW1A 1LOGA 4B8EA 3MZHA 3GZTB 3I2DA 1RUF1 3IM0A 4RR3C 3WLUA 5J36A 3IDCB 3GZAA 4Q2FA 3WCRA 3ZXFA 5AVPA 2YPJA 3PHMA 1I6XA 1ALYA 1OOPA 1QU0A 2Q4SA 1UKGA 3D82A 4Y1ZA 1EPZA 1EYBA 1ASJ3 1I3HA 1O5UA 5L36A 1H4HA 2WS92 4XFCA 1VB4A 2JXAA 4B7EA 1O4ZA 2VW2A 4XPVA 1QQP1 4DMIA 4HZFA 4GWNA 2DF7A 5FLHA 4RFT0 3ASIA 2AZ5A 4OUSA 1EY2A 4W65A 3E5QA 4EWDA 3MW2A 3ZDSA 2ERFA 1WGPA 3SLIA 4MV2A 1QJY2 1RINA 3B5LB 3O14A 4R8HA 2DFCA 3ZN6A 5T50A 1TMF1 3LAGA 3E5XA 4JRLA 2WZR2 1DLLA 1UMZA 3LOIA 2UY8A 2WNVA 4JVAA 2ZX3A 1GLHA 3B00A 4IEUA 4EN0A 4AG4A 2CNAA 1UIKA 1RHI1 3VDDB 1NLRA 4L8QA 4META 4IV3A 4AVVA 3WDWA 1C5HA 4MVTA 3S7IA 2PYTA 5J3UA 5JMCA 1DQ5A 2IFRA 2XL7A 1RUG3 1Z7S3 3VDDA 4P9LA 3DKWA 2FMDA 5F9TA 2DU1A 4IV1C 1LKNA 1F5JA 4LTAA 2P17A 4Q1RA 5HCAA 1D4M2 3KCCA 3LGRA 1WMDA 2D43A 3LZZA 2LTNA 2ZGSA 2ZZJA 3D5OA 3KT7A 4LBKA 1JN2P 1LHWA 4AHXA 1QJX3 1AR63 1PVC2 1LEMA 4GH4A 4PBPA 4R9BA 2E63A 1WW6A 1VBB3 4A7KA 3IKWA 1MS4A 1MEC3 3TYJA 2Y38A 3N7JA 5JDBA 2R041 2AYHA 2RS32 1M4WA 1FPN3 3VHPA 4DINB 3ZFGB 3LCPA 3ZSLA 1SDWA 1C3HA 3DUIA 5JOZA 1Z78A 1GZCA 5A33B 4SLIA 3KMHA 2D6PA 1DU3D 3UKNA 4LBQB 5E8AA 2QVSB 2ZMKA 1VLNA 2PHWA 5JVVA 3ZFGA 3MFCA 1AR93 5BY5A 4E4ZA 2QNKA 2XKOA 1OQDA 3U07A 1CX4A 1QKQA 3FMGA 1O3RA 2EXIA 5J96B 1R1ZA 4FOVA 2WINB 1AYM2 1QNWA 1LULA 1UZYA 4F8AA 2IXKA 4K21A 1AX1A 2PHDA 4RS5C 3J8F3 2O0OA 2W39A 1Y9QA 1JOJA 1QHDA 1BMV1 2NQYA 5T55A 3FFQA 4U2AA 2ZMLA 1WLCA 4JTNA 4IQPA 3WP4A 2F6BA 4TLFA 2XVKA 2HWB3 1WW7A 2AENA 4XJUA 2RM22 5CFCC 1GNHA 2OUHA 3NKTA 3RWNA 4UW5A 3VBFC 2EVXA 3M8LA 2K9ZA 2VNRA 4LUMA 1OKQA 4DY5A 1YI9A 3W9AA 2ET7A 3CJXA 3AZXA 4Q0QA 4YGCA 1YCIA 4XJAA 1HV1A 2W52A 3QCWA 4HPKA 4OVEA 3VBUC 4JDMA 3ZSJA 4JDNA 2CV6A 4P9XA 4AEDA 1U5ZA 1VBC3 4MH0E 1SCRA 2RMU2 1SEFA 1PO23 2F4PA 4N53C 4GALA 4DRRA 1FATA 1C28A 1BBT1 3QBQA 5HCFA 5JOYA 4KWKA 2XUMA 1W0OA 4UW6A 1QH7A 3TOJA 1Y7BA 3MIGA 5BNQA 4A7ZA 2GMMA 1H4GA 1VBA2 4AI3A 4X8PA 1UX6A 4HN1A 5IK8A 4KU8A 1H2MA 2B42B 1RL3A 4S2FA 3ACLA 5I0TA 5BNPC 3RJRA 2R0FA 3N3HA 1PVXA 1YJKA 4XXAA 5CB7A 2ZGMA 4WZCA 3HMYA 4FBFA 1HQWA 3OF1A 1AR73 2ETEA 4QGLA 4N43B 2DCTA 4Q0SA 1N1VA 1QJY1 4P14A 1UU4A 1NA1B 1C4RA 1DGRA 1CAVB 1Q56A 4CDUA 4OI1A 1QDOA 2A3XA 1OA2A 3RQ0A 5ABJC 1GZWB 4YGBA 2ARXA 5H9QA 1EV13 2WFPA 4QXKA 2WZR1 4Q4W2 1VRH1 3HIFA 4N43A 3B9IA 2HWD2 2FHRA 1DF0A 4LLOA 5C8CC 2KXLA 1NA1A 1H8TB 3RG0A 1CAVA 1G86A 1UKRA 2X5IA 2GC3A 4JGZA 3H50A 1NCQB 5EFUA 5AVAA 3ZXDA 1LHNA 5CA6A 2VW0A 5F5QA 1QJZA 4O9EA 2A75A 1ZBA2 1RUD1 4NWVA 5BNOA 3GF6A 1WA4A 1RUH3 1W6MB 4GMP0 2WT1A 4LA2A 5A32A 2D40A 4MGYE 1ASJ2 1ZRRA 1D4M1 2W68A 3GNEA 1PIV1 3RYPA 3OBTA 4P9JA 3VLBB 3WHTA 3I59A 4LBQD 3WG2A 1XYOA 4LBJA 2TNFA 4GULA 2D93A 1YFYA 3VKOA 1KQRA 3ILFA 4YZ4A 5HCBA 1DDLA 3TWIA 1C57A 3RMYA 2NLRA 2YHJA 5JIUA 3AB0A 4YYOA 3KM5A 3ZYGA 3MLJA 1AR81 1YJLA 2HWE3 5FMOS 3KGZA 3R4UA 5DDJ1 1MS9A 2PHTA 1COV2 3AKPA 4AK3A 4CEYA 4GKYA 2R061 3TNQA 1O3TA 2JE7A 4J1WA 3WOGA 2GH8A 4LE3A 4QM8A 2I45A 5JAXA 2VNOA 2ZX1A 1HXS3 1PO11 5A3MA 2JG8A 5FO9B 2VGDA 5KXEA 3NSTA 4L97A 4CP0A 2PHXA 4Q4Y2 4M3CE 3POYA 3NL1A 2OUJA 1PK6C 3WHUA 1BCXA 2QDRA 4CDWC 3VBHB 4GB31 4KG0A 1AF9A 3A0NA 4NHKA 4NOTA 4QHBA 4KH9A 4JGYA 4BOWA 4XILA 4EWEA 3ZXKA 3PMEA 3CJIC 4GQ7A 3M1HA 4KU7A 1RUG2 1Z7S2 4COZA 4YM3A 4X6RB 3VBHA 1J3RA 1RMU1 2ZBJA 4AFBA 5FO7B 3FBYA 1GICA 4H7MA 2CGPA 4RHV3 2IXIA 3MIFA 2WT2A 3HT2A 4Y26A 3MDPA 5EV7A 1QJX2 1ENRA 4W6XA 3RS6A 3ZFFC 4Q29A 2WL1A 1FMD3 1J59A 1A78A 5H9SA 4I30A 1VBB2 2ZABA 1J1LA 3JBG3 3S6PA 2RM21 2PTMA 2BWCA 1MEC2 2WLPA 4M3CA 2VVDA 4BIOA 4FQZA 4D69A 1XE8A 2BYVE 3D0SA 1C8M3 2X53S 2WZPP 1OA4A 1XNBA 4FCAA 4XFFA 4URTA 1BVP1 2RS13 2HWC3 1PZ7A 2LALA 1B09A 2GSYA 4LO6B 5GLWA 3AP7A 4FPEA 1PGSA 2VXRA 4DZGA 3SITA 2WWSA 1RVF3 5DG2A 5FQ0B 3KT1A 2ZAHA 4NVPA 2JG9C 4EJRA 1RUOA 1KFUL 2WSUA 3E6DA 5BNNA 2W08A 3M3QA 4BQ1A 4IESA 4CDXB 1J1TA 4GWMA 2I07B 4M3CF 3ZN5A 5FQ0A 4C1WA 2DURA 1NY72 2DV9A 2ZOEB 1FV3A 3WVJA 4HANA 4PIZA 3WUCA 1VALA 3J8F2 3L9JT 4LHNA 1SBDA 5AC93 3MW4A 1SLBA 1IOAA 3INAA 3WP5A 2CTVA 3U0ZA 1CAUB 3H0OA 3C3VA 4AEJA 2IZWA 5FRAA 2ZGRA 4PIYA 5JSOA 1G9FA 3MPPG 4Q4V2 4Q4W1 5I0SA 5F6KA 3BCWA 1CAUA 3POSA 2WFF1 4I0AA 4QX5A 2BUKA 4YW3A 4RR3A 2DFBA 5JOXA 2GNDA 2E6VA 3ILNA 3GBWA 5JIAA 2CL2A 2OA2A 1TNFA 4QD2A 5L7OC 2JICA 2JENA 1EPWA 1ZBA1 1H1IA 1DQ2A 2CAVA 3B94A 3H8UA 3VL8A 1CVNA 1PO22 3BALA 4Q8LA 4WBBA 4C0HA 1VBD3 3I8TA 4MX3A 1C8NA 3JD72 4OHWA 2MHFA 1A8MA 4LHLA 4UBHA 2VNGA 1ND3C 1N1SA 3D6EA 4ES8A 1XE7A 4YVWA 2OZ6A 3AMHA 2ENRA 3H3UA 3QOPA 5J7MA 4I2OA 3TNPB 3RZZA 3TAYA 2QKDA 2C1FA 4R9CA 5LRRA 3ZPYA 1K5MB 3WY6A 1AR72 2VG9A 1J3QA 2PN5A 4FT8A 1COV1 4PDWB 2UU8A 3VV1A 4RL7A 1PNGA 3GHMA 4U36A 1O3SA 4QPIB 1FOD3 1W6QA 2HWF2 1JW6A 1K5MA 1IZ3A 5BPXA 4KL1A 3RNSA 3R6SA 2NMOA 5DDJ3 4Q4Y1 3QH7A 3H3ZA 1MVQA 2RHPA 4E2SA 3LKJA 4HBNA 4OUMA 2H6BA 4FVVA 1ULEA 4QMAA 4AXOA 4L11A 1QJU1 2C0ZA 4GMP1 1A8DA 1PGW1 2ZHLA 2TEPA 4MLOA 5IT6A 4CRQA 2YXSA 1YFUA 1LR5A 3N7LA 1RUH2 1W6OA 1AYN1 1GV9A 4FQ4A 4IEWA 4OI4A 3I7DA 3VL9A 1V70A 3EO6A 1IGOA 4YG3A 4I0BA 4MGKE 2WNUC 2PAEA 1NCRA 5KHHA 1LTEA 4TWTA 1XU1A 3WNXA 5KHJA 2E7TA 2RS51 1OPMA 3KB5A 2Y0IA 1RUI3 4S2HA 1QOTA 2P3IA 4ISRA 4R52A 1MQTA 2BVBA 1DZQA 1W6PB 3ROUA 3VBSB 3MIEA 1D2SA 1WD3A 1KDMA 2ZAAA 1MS0A 2HWE2 1PGL1 3UL2A 1EP0A 3KSCA 4Q4X1 5JLVA 2R1DA 4WM7C 4XBQA 4LE4A 2SLIA 4FAGA 1W6PA 3VBSA 5K0UB 3EQEA 3THPA 5LEKA 4C91A 4ITCA 1HXS2 2R071 1QH6A 3KZ4C 1VBE1 3PJQA 1REFA 3JQXA 3HWJA 1FYUA 3DL3A 4XFAA 2XBO1 1R083 2OPKA 1HRI2 4YNIA 4AVAA 3VUOA 1GKBA 2DYCA 2H0VA 1R1A3 1QGLA 4HKWA 1S55A 3AYCA 4WM8C 1O3QA 2D3RA 2XGXA 3V0AA 2XL9A 5GZCA 5CU1A 2VUAA 1ZM1A 2UYAA 2VMIA 5FPXA 1RJ7A 4HVOA 2OYZA 3GHNA 3O0XA 4RHV2 3ELNA 1N47A 2AR6A 4P9YA 3DPRB 4QQOA 3AYDA 5K9YA 4FPJA 4HETA 3S7EA 1FMD2 1QF3A 2A6WA 1H2LA 1LOFA 2PFWA 4LBMA 3JBG2 3IMNA 3X29B 1I9RA 1O4YA 3E97A 1AL0G 2HEVF 4AQ2A 1ZBE3 1UZZA 3DPRA 2RR11 4K6BA 2XJQA 1OOPB 1PZ9A 2GMPA 2RE9A 1C8M2 3JZVA 4J1XA 1R093 2B46X 3WG4A 4D7YA 5EYXA 2R32A 2WLQA 3NV1A 2RS12 1CJPA 4HVQA 3AX4A 1AL21 1OI6A 4MGIE 4FXGB 2VVEA 3O12A 1RVF2 2DWRA 4FPYA 1ZZ8A 3H9AA 2IXHA 1LGCA 2BGCA 4BA6A 3DV8A 3MEPA 3AJZA 3O0VA 1AZDA 1BEV1 3ZN6B 1J58A 1WW4A 2NMNA 3T1MA 2Y0OA 2VOVA 2GN7A 5ACA3 1WBFA 2RJKA 2WNVB 3BPZA 4PLMA 4AFDA 4AHWA 4KWJA 4WV8A 3LB9A 4AF9A 4B4PA 2EAAA 1IPKA 2ZX4A 5AC92 1G9CA 2A7AA 2A3YA 2QUOA 4IV3B 1HLCA 4P9WA 2YROA 2DCKA 3B01A 2P37A 2JEMA 3E6CC 1UW8A 5I8SA 1OA3A 3RRDA 3ST7A 2ZHNA 3U10A 2HWF1 4BLIA 1SMVA 2XLFA 4XIOA 3NKGA 1TME2 3MF9A 1BXHA 1RUE3 2MEV3 4XXPA 3FBMA 5KXDA 3M4FA 1MZFA 4N90A 5C33A 4CP1A 1G9BA 1AJOA 4BMEA 4D94A 2D6MA 1CPNA 1DGWA 1S0EA 5GLVA 1ZZ7A 3QD6A 4XF4A 5J37A 2QQPA 4QQ2A 2E9QA 4GH4B 2OIIA 1QNYA 1X33A 4JQRA 4YFZA 4XEZA 2CGNA 2HJIA 2JE9A 1S0BA 3HBZA 2XWBB 2Z42A 4DS0A 2OZJA 2Z69A 1MS8A 2IXJA 3A0KA 4AEMA 1VBD2 5I91A 3LSEA 5CFDB 4PDWC 3KS7A 2PHRA 4M00A 4XJ8A 2IXCA 5FAXA 3CEWA 2BTVC 2VUJA 1DQ4A 2ARBA 3WDVA 2XJTA 4ZKTB 1XRUA 3AZWA 1FI2A 3UJQA 4CEWA 1XNKA 5CFDA 1B35C 3ZXAC 1POV3 2D6OX 1YFWA 4ZU4A 3ZSKA 1QWRA 1RUC1 2UWCA 3UKTA 3IDEA 5D8AB 3NWKA 2YV8A 4YVSC 3VZLA 4AVCA 5I8YA 5JSPA 1IKPA 1NQJA 3M70A 4OHYA 4LHKA 4UBGA 3AP4A 5JZGC 5FOJB 1FOD2 2PLV3 4CDWA 2NPIA 5D8AA 4KGGA 5C9AA 1W39A 1HRV2 3MYXA 3TN91 3ZFEC 1CD3G 2VQ0A 2VY0A 5LRSA 4P5HA 1Q3EA 3KT4A 4PLOA 3FHIB 4R9AA 5GLTA 3SH5A 5GKAC 4FSJA 4QPGA 1IS3A 1V9U3 1HQLA 3CF6E 1O7FA 2ZGKA 3J9SA 3FZ3A 2UY9A 1UPSA 4FPGA 1EAH3 4K7JA 3ZFFA 3OBRA 2GC0A 2WIIB 3CU7A 5IK4A 2H0BA 3EJKA 3RI9A 5K0UC 1RUJ1 1NXD1 4Z92B 4XFHA 4HPKB 3SH3A 5GJ6A 1KDKA 1RUI2 2IC1A 5FO8B 3MIBA 4FTBA 5J48A 4AEDB 2ZA9A 4FOQA 4KNCA 3H7JA 2NM1A 4WVZA 1FNZA 2ZKLA 1S0CA 3QH6A 4HL0A 3AZYA 1LHVA 5C4WC 3PNAA 1NXMA 1D0GA 2QJVA 3UV9A 2DCJA 3NAPB 5T5JA 1DGRN 1R082 1RUF3 4MXWA 4FP3A 2WS91 2E7AA 1HQNA 1Q8PA 1R1A2 4OZXA 2JKBA 1BJQA 3E5UA 4CDUB 4IETA 3NAPA 4M01A 2R0HA 4E27A 1Q43A 5DXDA 3AZVA 1V00A 3OYWA 4ZU5A 4AE2A 4LR4A 1OOPC 4YZ3A 5I0UA 4CDQB 3LA2A 4YW5A 5JI7A 1QQP3 1U5YA 3ZXEA 3VN4A 2B45X 2X5IB 5FLJA 1LHOA 1MACA 3ZIWA 3AFGA 4JGZB 4AVSA 3WDXA 3AXEA 5T5LA 3G6JB 1IS4A 3B93A 4COUA 4O9GA 3VBRB 5AFEA 4ATFA 4CDQA 1AXZA 4CP2A 3NO8A 5BNOB 2ZGTA 1WBLA 4EROA 1TMF3 2O8QA 2YC0A 2R1BA 5A32B 5KXBA 1UL9A 4Z8BA 1YFXA 3VBRA 5L7OA 4I3GA 5CIRA 3PMSA 4XHXA 1R092 4F83A 2VPVA 3I59B 3L2HA 2XJPA 3AKTA 1RHI3 1LU2A 2R16A 4HKOA 4Y1VA 1UPIA 3JB4C 1XYNA 2WSVA 5I93A 1QOOA 4A3XA 2Q0AA 3CO2A 1ULGA 4XJWA 3WD5A 1PVC1 4MXVA 3SCFA 1DG6A 3AMMA 4CEYB 3SNMA 3AYAA 1DQ0A 2KM2A 4LUKA 3VDDC 3URFA 4L99A 3WQ1A 1FNYA 4HK8A 4YZ1A 2JG8B 2RS31 2QFEA 4XJ9A 1YNAA 1AUYA 3USSA 1BK1A 4BCUA 3VHRA 3EBRA 3H1YA 2K0GA 1KXGA 3M3CA 4UW4A 3KLSA 1POV0 1D4VB 2R043 4HMZA 4B4QA 4JGYB 2DTWA 2BPA2 5T52A 2P2KA 5I8TA 1X7NA 2EXHA 3MIHA 4XOGA 4IEYA 2EF6A 1UAIA 1CJDA 1LGNA 1VB2A 3ALQA 4PLNA 2V5YA 1HRV1 2MEV2 1RUE2 4TZDA 4AFMA 5JWPA 1NQDA 5FPZA 1N1TA 4AGVA 3VBOA 1AYM1 1MZEA 2D6NA 4M0HA 3NV3A 2CWSA 2ZMNA 1C5IA 4CZSA 2B8MA 1S0IA 3WR0A 2OW4A 3ZFGC 1G7YA 3PVOA 3ZO0B 3AZZA 3RPQA 4RGAA 3TRSB 2XJSA 1SACA 1I5ZA 4M3CB 4Q0VA 2YMZA 1AR62 2YY1A 3ZYIB 2VOXA 2PQQA 3AK0A 5F6LB 2DUPA 3PJYA 4WM7A 5JI9A 5KC5A 1DQ1A 2LUWA 3AP9A 1FPN2 1ENXA 2FQPA 2GALA 3WQ0A 2MPFA 1ND2B 1MS3A 4NHMA 1HKDA 2PELA 3GYDA 3M7AA 4QT6A 2C5DA 4RQPA 4N9HA 4JC1A 2QZ2A 5BNNB 2VMGA 1MR5A 3AYEA 3KCYA 2YDEA 4FPKA 1IPJA 1XNDA 1ND2A 1YO8A 2BFUL 3FUOA 2PLV2 1AR92 2RMU1 4YZ2A 3WUDA 2YYOA 4Y5Z0 3FWEA 1DGWX 4INDA 5K7PA 1YRZA 1ONAA 2Z5WA 3MFAA 3OPZA 1HW5A 4Y1XA 5I0RA 4WM8A 1UU6A 3D4KA 4F7ZA 1IS5A 1V6LA 2DCYA 3WCSA 2D7FA 4LULA 4XZPA 5KHIA 4A7YA 3WX5A 2EXJA 4YW4A 3VZJA 1KFXL 1VBA1 3OD0A 1RIRA 2GC1A 1NE6A 1BBT3 1V9U2 3SH4A 4AQTA 5CVRA 4AEDC 4COVA 1CR7A 2AREA 5FFOC 5FMOL 1MS5A 2QE3A 4MUVA 3AJYA 4PF5A 2WQ4A 3UK9A 4RR3B 3K48A 2HWB2 3FLRA 1SLAA 3SISA 4IXLA 1WCKA 3NVCA 5BYNA 1T6GC 4S2DA 2Z2SB 2HWD1 4PCRA 5DZGA 3ZYJB 1QJY3 4BZ4A 1SLTA 3A4UA 5B2GB 1BZWA 4H55A 5JOWA 4IERA 1N3PA 1NE4A 1Q8VA 4Q26A 2E51A 2WZR3 4ATEA 1VRH3 1SLCA 1S0FA 2PHUA 3H1WA 3MLLA 3WINE 1F8VA 1VBC2 4YVWB 3PVNA 1CAWB 4N43C 1VJ2A 1H1MA 3RMXA 3N36A 1DGLA 1ASJ1 1NA1C 4K1YA 2EXKA 4UW3A 1NYWA 4XTMA 4NHLA 1OMIA 3HN1A 1RUF2 1RUD3 3CLPA 1V6OA 2BNNA 3ME2A 1U12A 1Z0HA 1CAWA 4XMIA 5T3NA 2TUNA 5GZGA 2ET1A 3BTAA 1MZ5A 1H8TC 4OI0A 4A2UA 5C6CA 1D4M3 1ZRCA 1PIV3 3IIAA 5DG1A 2NN8A 1YHFA 1YIFA 1W6QB 3JQWA 1ENQA 1NCQC 4JCKA 4R9DA 1QXPA 1LRHA 1QQP2 1DZRA 1U5IA 4LBOA 3B7MA 4FAHA 2YZ4A 3VZNA 4BWOA 1DYKA 2EA7A 1EV12 1AR83 4D7SA 1V6MA 3THTA 1DBNA 1DYPA 3GZUC 4JRAA 1OSGA 1SCSA 4HSLA 1VAKA 4PIXA 2ZGPA 2R063 4YG0A 4Y22B 2PA7A 4HSJA 2W0XA 4B4RA 1W6OB 1TMF2 1FX5A 2G9GA 2SBAA 2ZS6B 3Q9OA 1TE1B 2Q8OA 1PO13 4IV1A 4CEYC 1MVEA 5BUVA 2G9FA 1NCRB 3V56A 1RUG1 1Z7S1 4Y22A 1RUNA 1RHI2 2UURA 4JV4A 3IPVB 3PTYA 3ZSMA 2JG8C 3P3PA 4GB33 2V73A 3WXPA 4BPZA 1WLTA 4PBOA 1MQTB 2DUQA 3I4IA 4N7IA 1N3OA 3MPBA 4YFWA 1AJKA 1QJX1 1AR61 3IPVA 4JGYC 1RMU3 1B35A 1U5XA 1VBB1 1UCXA 4YM1A 1IHMA 2DVBA 1ZX5A 5FTTC 2ZHMA 3ZYRA 1MEC1 4J6GA 2HEYF 3VBHC 1H9PA 4Y4YA 1FPN1 5CBLA 2XVLA 4RA0A 3KQRA 1KS5A 1JH5A 2R6QA 2A3WA 3N7KA 3RDIA 5JZGA 2RM23 4QPYA 5HXVA 1S2BA 2E53A 2ZACA 1CESA 4OFGA 2IWGB 5TSWA 1YLLA 2KA3A 4OLLA 2BEOA 5EXOA 3AMNA 4FP2A 4XJZA 4RS5B 1NZCA 2ATFA 3ZFEA 3V0AB 3R4DB 1IKQA 3NV2A 4XQWA 5H9RA 1REDA 5GALA 1F31A 5DUUA 3SCGA 1KJRA 4TYSA 4XW3A 1UF2C 3ZXJA 3SMHA 4FTEA 3R0RA 2R49A 2GMEA 2ZX0A 3KD4A 4RS5A 3T2TA 1NY71 4XF0A 3WQ7A 4P9IA 1F9KA 4NR1A 4PQ9A 1SLIA 3ZYPA 3OTFA 1OQEA 1KITA 3J8F1 4ORFA 4KQ7A 4F3JA 1CAXA 1HIXA 2HKXA 3MGUA 2I2SA 5CFCA 3G7DA 4OHZA 4XETA 3VBFA 5CADA 4MZUA 1VR3A 2NZ9A 1LODA 5F1RA 3DN7A 1SBEA 5J98B 3AKSA 4XBLA 2HWB1 4Q4V1 3I54A 5EJ3A 2VVFA 2EALA 2CGOA 3ENRA 4E2GA 4YGEA 1VIWB 1BMV2 2WC2A 3NV4A 1LCLA 4Q1PA 4AI2A 1G9DA 3VBUA 3IT8A 4CDXC 4MSVA 3VHOA 1C1FA 3D8CA 3S0MA 1RB8G 4Q4W3 2HEWF 2HWC2 4N53A 4E9KA 2BNMA 1KRIA 1JYCA 2WFF3 2E7QA 5BNPB 4WZFA 1N1YA 2B5HA 1PO21 3BU7A 5CG8A 3U11A 4Y1YA 3WW2A 4DQAA 5K8SA 3JD71 4HKLA 1Q8OA 4OHVA 4XMAA 3VZKA 2O1QA 5DZFA 2FBEA 4FXKB 2XH6A 1ZBA3 3USUA 5BNPA 5ABJB 2IFWA 1SFNA 2H6CA 4IEZA 1BBT2 1RTVA 3GALA 4BMBA 5C8CB 2AH2A 4LA3A 4B7KA 1YUDA 4K9SA 2WA3A 1JBCA 1X50A 4XDQA 5ABJA 4NN0A 1X8EA 3ATGA 1AR71 3H1MA 4AQ6A 5L73A 1Q8QA