4XQDA

X-ray structure analysis of xylanase-wt at ph4.0
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
188
structure length
188
Chain Sequence
IQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Direct determination of protonation states and visualization of hydrogen bonding in a glycoside hydrolase with neutron crystallography.
pubmed doi rcsb
source organism Hypocrea jecorina
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase 2
total genus 55
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2015-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xqdA00
4NPRA 1QH7A 2DCZA 1REFA 2B45X 3VHPA 3M4FA 4HKOA 4H7MA 4S2GA 4S2FA 1BK1A 3O7OA 1OA2A 4HKLA 1IGOA 3VZNA 5K9YA 2JENA 1H1AA 4HKWA 2C1FA 3VL8A 2DCKA 2VGDA 2NLRA 1NLRA 3VL9A 1KS4A 3B7MA 1H0BA 2DFBA 1XYPA 3VHOA 1YNAA 3VZMA 3WQ7A 2DCYA 3AKQA 3HD8B 3WQ1A 3WP4A 5EJ3A 1PVXA 2D98A 2QZ2A 2Z79A 3VGIA 1HV0A 2VUJA 3B5LB 1W2UA 3LB9A 3AMHA 3MFAA 3AKRA 4S2HA 3WP5A 1M4WA 2QZ3A 2VG9A 3AMPA 1OA3A 2DFCA 3WX5A 3VZJA 3WQ0A 1BCXA 2F6BA 4XQ4A 1C5HA 1XNCA 2BWAA 1REDA 1UU4A 5K7PA 3ZSEA 1C5IA 2JEMA 2BWCA 3RI9A 3VLBB 1XYNA 1OLRA 1AXKA 3AKSA 3LGRA 3WXPA 1HIXA 1XNKA 1H8VA 3AMNA 1BVVA 2B46X 3VZKA 3WT3A 1H4HA 1QH6A 1XNBA 2NQYA 1XXNA 1F5JA 3WR0A 3EXUA 3AKPA 1REEA 3MFCA 3VZLA 2B42B 1HV1A 1H4GA 3MF9A 3AMMA 1UKRA 3MF6A 1T6GC 3AMQA 4IXLA 4XQDA 1ENXA 4HK8A 1KS5A 3WP6A 1OA4A 1OLQA 4S2DA 2BVVA 3VHNA 1TE1B 2VULA 2BW8A 2D97A 2DCJA 1XYOA 3VZOA 3WY6A 5HXVA 3WP3A 1UU5A 3AKTA 1UU6A 3RI8A 2JICA 4HK9A 4XPVA 4XQWA 1XNDA
chains in the Genus database with same CATH superfamily
5BNNB 2ZX1A 4NPRA 5FZFA 3K4AA 5HV4A 2NM1A 1VBB3 4ATEA 5FYIA 5A3TA 4FXGB 4NAMA 3WDVA 3ZFFB 1YQ6A 1QGLA 3MPBA 4AL9A 1DG6A 5CFDA 5A6ZA 2DUPA 1NE4A 2P34A 2J1TA 2WINB 3LDBA 1IKPA 1J58A 2VMEA 4YGDA 5AVPA 3RZZA 5CA6A 2WFF2 2UURA 2WT1A 4IV3C 1NQJA 4CP9A 1RGSA 5DZGA 2ZBJA 2CU5A 3CJIC 3H1YA 1ENRA 3GJAA 5FDBA 3ZX7A 4HN1A 3C7GA 1JUIA 2ZJCA 1CX4A 4QPGC 4AG4A 2AACA 1EV13 4LHLA 1NLRA 1CPMA 4KI5M 4NUBA 1LR5A 3KS7A 3M3CA 1Z7S1 4NMIA 2YFUA 4RHV2 2K9ZA 3MPPG 4KNCA 1W6MA 3LPGA 1YNAA 3J7MA 1WCSA 3O1MA 1NLSA 4BDVB 4IE5A 5T5OA 4AQTA 5JI9A 3O1UA 2QDRA 4B4PA 1H8TA 3AJZA 2TUNA 1Y9GA 3PURA 1D2SA 1YCIA 5E6HA 1OD5A 4Y1VA 1LESA 3WCSA 3IDAA 4JGYC 4JHZA 2JD4A 5T52A 2EA7A 1F9KA 2NMNA 3MO4A 2E53A 4A41A 2QNKA 2QQJA 1WCKA 1E5RA 2XJRA 2FCTA 3LAGA 3SISA 4DXTA 4KWKA 1VBA3 2Y6LA 4IEYA 4DXSA 1OMIA 3A0KA 4OCTA 3FZ3A 5FP4A 4L0PA 5A3WA 5JOWA 1G6NA 4C1WA 5T5LA 1NZCA 1RUF2 3WD5A 4QX7A 1GLHA 3LPFA 4M0NA 5F2SA 1SLLA 4OI4A 4UW5A 5DPNA 1BVVA 2ZX4A 5F3GA 5GZFA 3TEXA 4NWVA 1BLZA 1SG3A 1H4HA 1QXJA 3W59A 4LNVA 4BK4A 1HDKA 2D7FA 1R082 5C4WB 2W94A 4RGKA 4FOVA 1ZRRA 1GBGA 4ZZ8A 1COV3 1TG7A 1CZSA 1LENA 2B5HA 4NO4A 4FQ4A 3WUDA 1BBT1 4I02A 5I93A 2VMHA 2R6QA 3CZJA 3ORJA 1B35C 3BALA 3LA7A 3DPRA 1HXS1 4K3UA 4AVTA 5C7GA 1J1LA 2BYVE 4TLGA 3RZGA 2BVVA 3HNYM 4B7KA 1SBDA 3L9JT 1H9WA 3LE0A 4N53A 4NE9A 5FUPA 5LBFA 1WMEA 2X29A 4LO7A 3KMHA 4LA2A 1EV12 1PGW1 1CAXA 1J3QA 1VLNA 3TNPB 1MS0A 1FNYA 1Q5OA 4Q4X3 1UU5A 4YZ5A 4XJ8A 3USUB 4I30A 2HBTA 2AEYA 2VZVA 1GZWA 3THTA 4RYDA 3B9IA 2JICA 1I1EA 3CEWA 2V5YA 1RJ8A 3NJXA 1H6XA 5FMCA 5LEKA 3I4IA 3OEAA 3O1VA 3BTXA 1PNGA 2WLQA 2JKXA 3PNAA 1H30A 5D2AA 4RGAA 1VBC1 1FOD3 2WQ4A 2D40A 2ID4A 1DQ1A 3DYMA 3IIAA 4XFBA 5EQUA 1U5IA 3ELNA 1LEMA 2C26A 4S2GA 4XXAA 1K5JA 2D3RA 4I01A 4CEYB 2JIJA 5J09A 2VW2A 1P8JA 1X8MA 2JG9C 3ZXLA 1OA2A 2RS13 4LHKA 3CHXA 2BEOA 5C33A 1LHNA 2ERFA 4HKWA 2HWC3 4CUBA 1HKDA 1AX0A 3KHBA 4IE4A 2DCKA 2EIGA 3EB7A 2FMDA 3VBOB 1YQ2A 4UFKA 1PMJX 2A3YA 1OF4A 3VBUC 3W20A 3B7MA 2D5HA 4FPEA 2VUCA 4P00B 2DTYA 1CPNA 1HRI2 3MUZ1 4W6XA 4BOWA 2FZ2A 4MGIE 4LBMA 1GP6A 2N7GA 3OB8A 2E26A 5GZEA 4OHYA 1UYPA 4IW3A 1Y9MA 1O3SA 3ZFFC 2CV6A 4JQTA 5IT6A 5GALA 1RUG1 4HT1T 3RYKA 5FZHA 3MICA 3OBRA 4B4RA 2RDSA 4IEWA 1C4RA 2ZHNA 3B5LB 4CXXA 4E4ZA 4QHBA 1DDLA 1RJ7A 4AI1A 4BQYA 1EAH1 2JDUA 4UAPA 3TN93 5CFCB 3QD6A 4QPIB 2J1EA 1KDMA 3BODA 5KHIA 1OH3A 3JXSA 5C5UA 1PIV2 2WZEA 2ZGSA 3LEMA 3WF4A 1IKQA 2GC3A 1DP0A 4CZSA 5DUVA 3N35A 5C9AC 3JCIA 1XYNA 3J7HA 3HIFA 2FDIA 1HRI1 3OEBA 4R9DA 2HWF3 4NHMA 4EN6B 2MNGA 2V73A 3OGRA 2FDFA 5JAXA 5FYMA 1YXWA 1FMD3 1G86A 2XPJA 2WZR3 3UJQA 4Q4V1 2Z69A 1H1IA 1XE7A 3ZIXA 3EXUA 1JYIA 3GJBA 1C57A 3H50A 4YG3A 2BBAA 3VV1A 5CYYA 4NHKA 4XCAA 2YY1A 2AEZA 2IC1A 4JKLA 4XBNA 1H9PA 1OLMA 5ERLA 1A78A 5A6XA 4QX3A 2D6MA 3M3OA 4M3CF 4LR4A 4RN5A 3HT1A 1L7LA 2IXIA 3T08A 1JHNA 5A3PA 3I59A 1ZRIA 2BU9A 4QPWA 3NKGA 4LUMA 3I54A 1TE1B 3U75A 1BHGA 2SLIA 3OGSA 1YJLA 2LALA 2Y60A 5KXDA 3E6CC 1KQRA 3ACIA 3I97A 2B39A 4YW7A 4YG6A 3SH5A 4P9WA 2ZGLA 2VMDA 4M3CB 1US2A 1W8TA 5CIRA 1GUIA 1EUUA 1IOAA 5IHRA 3AKTA 1W6PA 1DLLA 4CU8A 4CDWB 2D43A 5SV8A 2RV9A 1GSLA 4YZ4A 3OCPA 2ZOEB 5A32A 1JYCA 3J8F1 2C9AA 4LBQA 2CGNA 1D0GA 3NWKA 3KLSA 3OYWB 1LEDA 1ASJ2 3IIIA 5JZGC 2EIEA 2CHHA 3I3EA 4RR3C 3UL2A 1SBFA 3HQXA 4C0HA 4IV1B 2GALA 4M0HA 4DIQA 2RS53 4NHYA 1EP0A 2VVDA 3N9QA 4KH9A 5A3LA 2Y6FA 3WW3A 5JR7B 2Y6JA 4FFGA 1ND3B 3OGVA 2ZEWA 4I0AA 2PLV3 4IERA 2ZEXA 3H8UA 4ZU5A 5C9AA 1H1AA 4Y1YA 1DQ2A 4Q4V2 3B93A 2YBSA 4D6RA 4D6QA 1YIPA 2Y6KA 4QXBA 3HOBA 4I0WB 4Y1UA 4YW2A 2A6XA 3T1MA 3X29B 3C2UA 5JPMB 5EPAA 5C3PA 4XJUA 2PLV2 1RUD3 2WLPA 4WM7C 2W1SA 2W47A 1BBT2 3KCCA 5H9SA 3IAPA 2AZ5A 1TME3 4UF0B 3VBFC 1EPWA 3IB3A 1AYN2 2A6ZA 4AI9A 4COWA 3HEIA 4YW5A 5EJ3A 1OF3A 1CWPA 2WIIB 4GB31 1DQ0A 1YFXA 4ES8A 1QMJA 2W2IA 2VUJA 5EP9A 1RUI3 5FMBA 4UFLA 3AMHA 4I3PA 1UY3A 4ZY9A 4AZZA 4RR3A 5LBEA 2O8OA 4CUGA 1VBB2 1W8OA 2ZMLA 3B00A 2ZHLA 2FDGA 3UKVA 5C9AB 1IG0A 3T3YA 4OMCA 2MEV3 3D0JA 4P9YA 5C3RA 1S0CA 4N43B 1HQWA 1VBC2 3ACLA 2WNVC 5GM0A 2JEMA 2X5IC 3NV4A 3B02A 3GYDA 1RUI1 5D8AB 4AEDA 2VZQA 1X33A 4GB33 1IPSA 3I2FA 3KQRA 4OUMA 3WDYA 4YM1A 3AL5A 5IK4A 1IS4A 1JODA 3DKQA 4P9IA 1DGLA 1LHVA 3AP6A 4QD2A 1VMJA 3VBRB 2EICA 4AI8A 4A4AA 5BNQA 1A8DA 1GP4A 1YRZA 5HI0A 2V72A 3P3NA 1N1YA 4RS5A 4XFFA 3UJOA 3WF2A 2DU1A 2J42A 4J6GA 4AFMA 5A6YA 3ZXDA 1LU1A 1W6OA 4IV1C 5LEJA 2WO3A 1W03A 1E5IA 1GOGA 3JBG1 4AFAA 1SLAA 1PX4A 1LB2A 1ZREA 5FYSA 4QGMA 1APNA 3WSOA 2BOJA 5K0UA 1UIKA 1R083 1RUNA 2XL7A 4G4FA 4QAWA 2VZOA 4YVWC 4TTGA 1BMV2 3W9AA 1GQGA 4NHXA 3FMGA 5IVCA 5KHGA 1BXHA 2R1BA 2YMZA 4YFWA 3GXUA 2P1BA 3ZVXA 3OY8B 2J1RA 1TNRA 2P2KA 3AFKA 1O3RA 5IVEA 4DRVA 5C8CC 2XQRA 1U12A 2KR2A 3W21A 2CYFA 1SPPB 5A33B 5HXVA 4YYOA 2AR6A 3KZ4C 4MXVA 4NR1A 3KHCA 2FHRA 5LA2A 3VB9A 5I8SA 1ZZ7A 3M7AA 2EXIA 4CCNA 3DL3A 3J8F3 3P3PA 3I3QA 2ES3A 4XPVA 3S7EA 3I3DA 2BTVC 1UMHA 2E7TA 3H7YA 1NA1B 1CJDA 3AVSA 2K0GA 2ZGTA 4Q0PA 3FLRA 1PIV1 3Q8FA 4R9BA 3ZDVA 4BLJA 3JBG2 3QLQA 5LWBA 1AR93 1YQ8A 1V6LA 4L11A 4QQPA 3ES4A 1S0BA 3D4KA 1QDOA 4XUPA 1QOOA 4LITA 4EWEA 2WSUA 2GN3A 3O0WA 1WGPA 4EWDA 4DOUA 2TBVA 5DG1A 5FLJA 2BGCA 5CKNA 4MGKE 3VL8A 2ZEZA 1SEFA 1XSQA 2BJSA 4IGQA 3WNPA 5HCAA 2XWBB 3WV6A 1R1A3 1TNFA 1JHJA 5A33A 1SPPA 5GKAC 3DYPA 5BY5A 5FY1A 3CLPA 3HBZA 3ON7A 2QJVA 1UMZA 2VECA 3OY8A 4O9GA 1VIWB 3UKNA 4TYSA 5L7OC 5FYUA 3NV2A 5FZ9A 1KITA 5A3MA 3IDBB 1CQ9A 1D2QA 4Y3OA 1R1A2 4BQ2A 1S0IA 2DV9A 1SMVA 2ZA9A 4LHNA 5HCFA 3SKVA 1O4TA 2D98A 4MO3M 5BNOA 2YDEA 2D6NA 5DQ0A 1N1VA 1RHI2 2VBPA 4JC1A 4SLIA 2WWJA 1AR91 2B8MA 5A6QA 4QKDA 4DRRA 1WCQA 2A3XA 1M4WA 2VMGA 2ZAHA 3ETQA 5FY7A 2E51A 2J1VA 2I07B 3Q8AA 5FOBB 5J96B 1QJX2 3WQ0A 1ONAA 4AVSA 3B3QE 1DF0A 1QQP1 2W52A 1VE0A 4A45A 3IMNA 2LM3A 4DXRA 5J48A 3PLQA 2Q1MA 4JV4A 3M70A 1EAH3 3GZEA 3KVAA 4URTA 3WW1A 4COVA 3VBUB 3AJYA 2ZAAA 3K2OA 5IYYA 2VL4A 3V56A 3VBOC 1W0PA 4AVBA 1F35A 3C7EA 3N9LA 1U5YA 1TMF1 2YGMA 3EQEA 3D0SA 5FPLA 3SCFA 3VD5A 1ALYA 4P5HA 3JZVA 3DPRC 4XDPA 4F83A 1CVNA 4JGZC 4A6OA 4PI2A 4XURA 1R081 5L7OA 2R073 3ZXJA 5IAXA 3MFCA 5JSRA 2D6PA 4LOTA 3DYOA 5DXDA 4QX1A 3OGJA 5CG9A 2WBKA 5I0RA 4TN7A 1UQXA 4HSJA 3HBKA 2WSVA 3K51A 4BLIA 2KM2A 1OUSA 1HJFA 1AYM1 2GMMA 5I0UA 3OOXA 3WG1A 1ND2C 4HG6B 3LIHA 1NUKA 3DF0A 1KFXL 3U14A 5FYVA 2DBNA 4QHZA 3DN7A 1FOD1 2AREA 2DDUA 1VBA2 2ZABA 4MSVA 1AL23 4XDQA 5IK5A 1ZRFA 2VQ0A 2HWE3 3LWCA 2MEV1 5CADA 2JXAA 1GR3A 3VKNA 4YGCA 5FQ0A 1QJY2 2OQ6A 4JCKA 2VAUA 2VOWA 5FREA 5FK8A 1ODMA 3ZDSA 4Y24A 1OOPA 5FBJA 1W3VA 4BXSV 2Y38A 1G9AA 4FTBA 1F4AA 1WCDJ 2Y6HA 4ET7A 1YLLA 3LFMA 1WA6X 3DECA 4AVAA 5JCTA 4HOOA 1BK1A 4K20A 3VN4A 4ZU7A 5KBFA 2XVGA 3OYWA 2GSYA 1BJQA 4GZ9A 4DZGA 3KVBA 3ZYBA 1FI2A 4YVSC 2JENA 3WLUA 1YQ5A 1CX1A 1W9YA 3DV8A 1RUD1 1BBT3 3OBAA 4LOSA 3OD0A 1UYXA 4ASKA 4CTEA 3ZPOA 4QX5A 5HV0A 2OT7A 4PQ9A 4D8MA 1S2EA 2VPVA 5A70A 4F8AA 1UCXA 5JZGB 3EMRA 1S1AA 3OPZA 2R32A 4HVRA 5FP7A 5FTTC 2HWC2 4LPLA 1IS3A 1OT5A 4FPLA 3WQ1A 4AW7A 3O12A 3LCPA 5FZGA 1GANA 1ZZCA 3POWA 2VQAA 4QKNA 1FATA 5DAWA 3T0DA 1MZEA 3CZUA 2W68A 1FPN1 4Q2FA 3R6SA 2VG9A 3VKFC 1ZRCA 2BRTA 4Q0UA 5A7NA 2DFCA 1H2MA 2HLEA 5KXEA 3O1PA 1M06G 4L2NA 2FBEA 1RVF3 2F6BA 5APAA 3M3QA 2YU1A 4CU6A 1JS9A 1OH4A 4CEWB 1REDA 4JX0A 1GQHA 5EFUA 3C7OA 4Q1RA 1QKQA 3ZSEA 1SHWB 2BWCA 5FZAA 1C1LA 1FXZA 5CFDB 1RUJ3 3LD8A 4Z1VA 1QXPA 3ZSJA 5L7OB 1IPKA 1I5ZA 1XNKA 2XR4A 2ZGQA 4NN0A 5HXMA 3CQOA 1SACA 1ND2A 1W28A 1PO23 1V9U3 1LU2A 3V65A 2DWRA 5F9TA 1QH6A 1XNBA 2BV4A 5FV3A 5ACA3 2IXHA 3FWEA 3B69A 3ZIWA 4XEZA 4HVOA 4AI3A 1W6NA 1SFYA 4Z92B 2RR12 3KCYA 3WW2A 1LGNA 2Z2SB 4AHYA 1ULFA 4DS0A 2QFEA 4QDSA 5DG2A 3VD7A 1JZ5A 4UFMA 1ULGA 5FWEA 3PVBB 4Y1XA 1DYKA 3D3AA 2ARCA 3MBWA 4FAGA 3O1RA 4JGYA 1UX7A 4JGZA 5EYXA 5FXZA 2D3PA 1AXYA 1XOYA 2WZR1 5F6LB 1FMD1 1GYKA 2X53S 2R0FA 4B1MA 3JQWA 3H42B 5C8WA 4EV0A 2JDAA 3DGTA 5A1AA 4YZ1A 2JDNA 5I91A 5KXBA 2H0VA 2MEV2 4Q29A 1O59A 1ZZ6A 4JHTA 2EXKA 3L2YA 2D5FA 3PUSA 1MVQA 4JGZB 2A3WA 4LORA 1UIJA 4WV8A 1J59A 3DUIA 2HEYF 4LKFA 2UU8A 2RJLA 1ND3C 4LJHA 4YGEA 3T4VA 3OUHA 2WAOA 2WQ8A 5FP9A 1MS8A 1CAWA 2PXJA 1QH7A 3TN91 3ZYRA 1JYWA 1LKNA 1VBD3 2ZCWA 3IZOA 1RITA 2B45X 4OMDA 3WDUA 2IXCA 1WUVA 4X6QB 1C8M3 4IEZA 2JE8A 5F5IA 3KF3A 3ZYPA 3NAPA 2OUHA 3B9CA 5DZEA 4BQ4A 1RXFA 3E97A 1AR71 1SLCA 2ZZJA 3GCXA 3HR9A 4MGZE 2BOIA 4QM9A 5A7SA 1QHDA 4YZ2A 2V5DA 3VDDC 5AC92 1UXZA 3WUCA 1ULPA 4A42A 1CR7A 4PQQA 5C3OA 2YC0A 3WZ1A 3MIEA 3GZTB 5FR3A 4WVWA 1UF2C 1KD7A 4LE4A 4QQOA 1OLME 2PQSA 2VVFA 3WNLA 1K5MC 4BHPA 3JD72 2WWUA 4TLFA 4DXZA 1UL9A 5FO8B 1JOPA 2HWC1 3ETPA 3LOBA 4XZUG 3N9PA 1NCRC 5KR7A 4N53B 2RS11 1D4M1 1W3XA 4P14A 4JAAA 4BK5A 4LTAA 3VKMA 4WBBA 4YNIA 1POV3 2GU9A 3BKZA 5FZEA 3SCGA 4GMP3 1BEV3 5CISA 4HPKA 4Q1PA 1LHWA 4KU8A 4FP2A 1SFNA 3IBMA 2YFZA 5CNAA 1TMF2 1PGL2 1GNYA 4CP0A 3FN9A 2WWSA 1JMUB 4XFGA 4DPNA 3JU9A 1GWKA 1RHI3 4WVMB 3VDAA 2FQPA 4GKXA 1B35B 3ZXEA 4NWWA 2Y6GA 4BIOA 5F2WA 1AHSA 1ND2B 1SDWA 1MEC3 4Q4X1 4GH4B 5J1XA 4L9BA 1S4CA 4CDUA 3O1OA 2WO1A 2WYFA 4NRMA 5CG8A 2NP0A 5M0TA 3LGRA 3G6JB 1HIXA 3P5BA 1AJOA 3MEPA 2R043 2VE1A 5C3QA 4JRLA 4JQRA 4RQPA 3E5UA 2PAEA 5I8YA 2WR9A 4Y20A 2R062 3CJXA 1AL0G 4XF3A 2UWAA 1QDCA 1FOD2 2HWB3 3PJYA 4YRDA 4LBKA 4P9XA 1W2AX 2QQVA 3AZWA 3AMQA 1UOGA 4W65A 5ABJB 2DVAA 1GQPA 2D6KA 4MGSA 2EAKA 1DHKB 3KM5A 5A7PA 2OA2A 2P3YA 1V6KA 1UYZA 2JG8A 2O1QA 4OZOA 3VD4A 3NV1A 4LO6B 1WBLA 5JWPA 3I2KA 5JVVA 1JBCA 4CRQA 4AQ6A 5LRSA 5JIUA 3ABZA 1V00A 1RUC1 2HWD1 1CN1A 1TEIA 4LKSA 4YFZA 1I5PA 5GZCA 1DLCA 4CPBA 1KDKA 5LZ6A 4FOYA 1HQNA 4EN8B 4CDUC 1HW5A 4IEPA 3THPA 1CIWA 3RDIA 2FD8A 3A21A 1PK6C 3ES1A 1CAVB 1AR63 1E5SA 2Y34A 2Y33A 1V70A 2B7YA 1W8WA 2V4AA 3MV01 2VM9A 3DEMA 2B9VA 2X5IB 4R9AA 5IFTA 1DGRA 1YEWA 4XACA 1WD4A 2VOVA 2W08A 2R30A 2AC1A 2PHUA 4MUVA 5FWJA 2XLGA 1WLDA 1FT9A 5F6KA 5FP3A 5T3NA 4A7ZA 4OI1A 3GHNA 5JPNB 3QH7A 1Z7S3 5IVVA 5JOZA 2VGDA 5F37A 2OIIA 5E8AA 4D6SA 4N8MA 3CF6E 4AAPA 4KG8A 1AYN1 3I2HA 3JQXA 2Q5TA 1JU3A 2CTVA 3NAPC 3PMSA 4FQZA 5FOJB 2HEWF 1D4M2 3WCRA 4B8EA 2VTXA 2CSGA 4GD4A 2GMPA 3S5QA 1L7QA 3PUIA 2RJKA 3WP4A 4YM3A 4NROA 2R072 1O4YA 3M8LA 3KF5A 1PGL1 1TQ5A 3O0XA 4PDWC 4C0BA 1FNZA 3GZUC 1QEXA 2W87A 4YM0A 4NHLA 3SH4A 3AZZA 3H8XA 1VBB1 1G7YA 2OPKA 2XLAA 4FXKB 3KD4A 3VBOA 1OFSA 2VUAA 5C71A 1S0FA 5I0TA 3BU7A 3K46A 4P08A 2Z42A 3HJRA 4OFGA 1OKOA 1RUG2 4HMZA 2ARXA 5KC6A 3MZHA 2QQNA 1YO8A 5E88A 4AR2A 3I2GA 4XUNA 5FIXA 1UU4A 5K7PA 3LEKA 1C5IA 3IM0A 1LOAA 3I3BA 4XIOA 3ST7A 4NRPA 4MXWB 2R49A 2ZX0A 4HVQA 2XJUA 4MXWA 2XG3A 3BIWE 1W8NA 4P9GA 4AWDA 3JD73 3SNMA 2ZHMA 4E9KA 1W99A 5L9BA 2YYOA 1H8VA 4Q4W1 1LCLA 2JKBA 3H9AA 3RYRA 2KD7A 1QNWA 4BMEA 4KU7A 2QQUA 1AZDA 4FPKA 1D7PM 3J26N 2WT0A 2X5IA 4Z2WA 1XC6A 1AR82 3NW4A 1JI6A 4DY5A 3KT1A 1UN1A 1AUYA 4E8CA 5FUIA 5CKMA 1OVSA 1ZZ8A 4PIXA 5FY0A 1BKZA 1QIQA 1K5MB 1X9TA 1ENXA 1YYNA 2PFWA 3K3OA 1KS5A 1U5XA 4ES9A 1ULEA 1RUE1 4AOCA 1HJGA 1YQCA 5EXOA 1RUE2 3ZXAC 2WA3A 5IW0A 1UOJA 2W95A 3NRUA 3FLPA 4W50A 2HEVF 2D97A 5HPOA 4CXWA 1XYOA 4UFHA 2RR11 3WY6A 2JECA 3HQUA 1NYWA 1UZWA 5T54A 3UYJA 4B29A 3ZXGA 3R0RA 3SXWA 3QACA 3KT4A 1YFYA 4OYUA 3K77A 4YW3A 2VOXA 2WFF3 2BFUS 2DVDA 3N9OA 3VDBA 3ZKYA 2NZ9A 5EJ1B 2LW8A 3THCA 4BWOA 4XQWA 2ZKNA 3EJKA 4W8JA 5FKCA 4ZHNA 3KB5A 3MGUA 1G9FA 4LMFA 4UWDA 1SLTA 1PM7A 4AHZA 3D82A 1XQNA 1MVEA 4ZKTB 1QJEA 2GZWA 2QQMA 4YW1A 3RJRA 4I2OA 2VXRA 2RMU2 2PA7A 3POYA 5FZ1A 3THDA 4X8PA 3H8RA 3O5SA 5T5JA 4H7MA 3WEZA 2PHRA 5LK5A 3HQRA 3QOPA 1UY1A 1CAVA 1L3JA 4GKYA 3BIEA 2A6YA 2RS31 1VR3A 1RUH3 1PM4A 2ZACA 1ZBE1 3RWKX 5F8PA 1OPOA 1URXA 4E2GA 5K9YA 2AUYA 1OHFA 4O61A 4LK7A 1S2BA 2Z4FA 5AVAA 3NVCA 3PU3A 2KA3A 1W8ZA 4BH9A 2OZ6A 1U0AA 4PI0A 4XXPA 4NJ4A 1MS1A 5FUNA 2ORZA 3OBZA 3RQ0A 1PMIA 3K48A 5FCCA 3RG0A 5J3UA 2OS2A 5FMOL 3ZFEC 1DZRA 4CSWA 2D6OX 4AEJA 5AFBA 2XKPA 1WKYA 3QBQA 3LEGA 4MG2A 1Z0HA 2PAKA 4PT6A 2DVGA 2OVUA 3W5NA 4YGBA 3ZMNA 4O65A 2LS6A 2XWJB 3VBSC 5FPVA 3BTAA 4QU1A 4NRQA 4RR3B 3I59B 2JX9A 1VBE3 4E4DX 2HWE2 3LZZA 3ZYGA 2XBO1 4BPZA 4LUKA 4XMAA 4HPKB 2QCSB 4BU2A 2GMEA 1FPN2 3OPWA 4CYDA 3WNXA 1HN1A 4QXCA 1PVC3 4FPGA 3S5AA 2RS32 2ZTNA 1OA3A 1NAEA 4UFJA 5E16A 3VD9A 2W92A 1UPIA 3FL7A 4H55A 2UYAA 4I0BA 3K4ZA 3KV4A 4YLZA 1Q8PA 1XU2A 4AEMA 5CFDC 4IE7A 2G9ZA 4UFIA 2EVXA 3OF1A 3QCWA 5IAVA 4MV2A 5H9PA 3RWNA 1HB2A 2DCTA 5DAXA 2O8QA 5EZWA 5JIAA 2HKXA 5LA9A 1IHMA 4GWJA 4PLOA 4B7EA 1DZTA 3RI9A 2F4PA 2OUJA 3C8XA 4LBLA 4R8HA 5FZ6A 4CDUB 1XNAA 1VBE1 2C5DA 3WXPA 1CESA 2ILMA 3SLIA 1QY4A 3JUUA 2JIGA 3LEIA 4QX2A 1VB4A 4E27A 1AVBA 1QJY1 1N3OA 1YFUA 3M2MA 3WT3A 1OOPC 2MHFA 4QPGB 1K12A 1J84A 4U36A 4IGPA 1ULOA 2W9XA 2PAMA 1OC1A 1NT0A 3AM2A 4BZ4A 4GJZA 1GNHA 2SBAA 2RM22 5F3CA 3DCQA 2BFUL 3N7MA 3K3NA 3IN9A 4TSVA 2ORXA 4QX8A 2DBIA 2BQPA 1OLQA 2DYCA 4QB2A 4B3NA 1ZBE3 3KGLA 2VW0A 4QQLA 3HT2A 4KL1A 3PUAA 2GC0A 1JOJA 1WW7A 1NCQA 3FBMA 4META 4XF4A 1FV2A 2BW8A 1ZBA3 4XYXA 5HCHA 5BUVA 5FY8A 2B4KA 1Q8SA 2Z5WA 3AP9A 4ONUA 1JZ7A 1RUJ2 2CL2A 5KWRA 2RMU3 3CDZB 5IWFA 4BISA 2RG4A 2YXSA 4ZZ5A 1W9SA 4M01A 3VUOA 2JG8B 4TZDA 5L73A 3BOWA 3BGAA 3E5QA 3POFA 1ZYBA 2VNVA 4AHWA 2BUKA 1PVC2 4YSFA 4XZPA 5IK7A 3NAPB 4BYYA 4KGGA 5DN2A 4FVVA 2WFPA 1KJRA 4A2UA 4G9SB 3SEEA 3E6DA 4XBLA 1QOSA 1NCQC 4MX3A 2RHPA 3L2HA 2OZJA 4Y20B 2ET1A 2R061 3O7OA 5F5CA 2GNTA 2GNMA 2J22A 3KCXA 4RQPB 4XETA 2ZKLA 3WINE 4W4ZA 4EWAA 1S55A 4NPLA 2C24A 3IKWA 2H6BA 5A3OA 4DEQA 3WDWA 4NIDA 2JDMA 2WS91 3POBA 1R093 2C1FA 4K1ZA 4AAXA 2WS92 3GBWA 4RFRB 3AFGA 4DB5A 2E31A 3AP5A 4N53C 4IETA 5FO9B 2P3IA 1HXS2 4FAHA 4ASMB 1PO13 3HNBM 4PIYA 1B35A 1R091 2A1XA 1CIYA 5E89A 5FQ0B 5L36A 2A71A 4D3WA 3I3MA 1R092 2Q4SA 4UBHA 2DF7A 3GCWA 3J4UH 3FUQA 4QB1A 3OSDA 1CZVA 3R4SA 1NQDA 1HQLA 1S0JA 3AP4A 2BPA2 2R063 4Z82A 2LTNA 1F4HA 2ZEYA 3JD71 2Z79A 5LA0A 3KV6A 3OJBA 1CAUA 4GJYA 4XC9A 3MFAA 1PX3A 5BXXA 3WNKA 4F7ZA 2W1WA 2QDNA 4S2HA 4Q4W2 1W6NB 2Y26A 4O9EA 2QZ3A 1NLQA 3AMPA 5C4WA 3ZN4A 1WW5A 4GWMA 2WJSA 2WUHA 2A6VA 3RYPA 3S30A 1LGCA 2C9KA 1I3HA 4PF5A 1YC61 2V09A 3E6BA 3RS6A 1X8EA 3ITQA 3U0ZA 4XFCA 4DUXA 2X09A 4BA6A 2DUOA 5K8SA 1PZ8A 4FI9A 3BUCA 2WO2A 4K9SA 5F3EA 1AL22 1N47A 1NOVA 4BJ0A 1ZBA1 5FZ0A 4LBQD 1QJU1 5F5QA 4EN9B 1XB9A 5AC91 3AMNA 1W8FA 5BNNA 3N7KA 2B46X 2GN7A 1O3QA 3INAA 1WLTA 3U07A 4ZS2A 5IFPA 2RM21 1MPXA 3WDXA 1BVP1 1ZBE2 1F5JA 3BTZA 3OD4A 1UY0A 2YC2A 2PHDA 1RL3A 3EO6A 1XRUA 1H6YA 1W2OA 2W39A 4GMP0 2B42B 3OG2A 1AYN3 4NOTA 3ZYFA 4D0QA 4DNYA 3HN3A 2A6WA 2CWMA 2QUOA 2NYYA 1AYM2 4KMQA 2WC2A 1H8TC 2XXZA 3Q9OA 1X36A 2VMCA 3WP6A 1KGYA 1BZWA 1OA4A 4PBOA 4JVAA 1GZWB 1MS5A 5JSPA 4N7IA 4Y5Z0 1QXRA 3UGGA 2RJ2A 3VBSA 1YIFA 3TBDA 4BQWA 3MIGA 5BNPC 5FLIA 4ZXKA 5BNOB 2PYTA 2MPFA 4QWNA 1QJX1 4ZS3A 1JZ2A 1JZ4A 1EYBA 1NXMA 1RMU2 4YVSA 4IEUA 5DAPA 2ZX2A 4QB6A 3T30A 2QVSB 1WW4A 4JGYB 5LRRA 1RUC2 2HWD2 1NCRB 4WM8B 1U5ZA 2K2SA 2IUWA 1O5LA 5FZ8A 3POEA 1IS6A 3QH6A 2DCZA 4Q4Y1 3O1TA 2AH2A 3IWZA 1Y7BA 4QKBA 1DIWA 1YUDA 2HYXA 1S0GA 1H1MA 1O8PA 3D5OA 5HBAA 1Q3EA 4SBVA 4S2FA 3U37A 2EAAA 2WDBA 2HWB2 4QKFA 5FYYA 2YB7A 4XF9A 1W0NA 5JXHA 4Y26A 3ZXFA 3PHMA 1JU4A 2P3KA 1UMIA 5T5PA 2O0OA 1W9WA 4DMIA 1BK0A 3USUA 2A70A 4CE8A 2NLRA 3WF0A 3ALQA 3FX3A 3VKLA 3ZXKA 5FLHA 5LA1A 2R7EB 1LGBA 2JDZA 2X05A 1YJKA 2BERA 2QQWA 3VHOA 1WMDA 3VD3A 5CEHA 2B9UA 5D21A 1IG3A 3FBYA 2VZUA 3DXUA 1W6PB 2FCUA 4COYA 2WN3A 1AX2A 4NAOA 2HBUA 3P1IA 1LOFA 2CNAA 2WT2A 2VTXJ 4JDNA 3VGIA 1JYVA 4D94A 2VTFA 5GLWA 2Q8OA 5JOXA 3AKRA 3WP5A 5D1IA 2JG8C 3WG3A 3ZMOA 1STMA 2PN5A 2NN8A 2ZGPA 2A5ZA 2FDKA 2ZHKA 2VOKA 3LA3A 5ABJA 1OURA 2IXLA 5JZGA 4PDWB 5DMYA 2WZPP 1ND3A 1UKGA 3RJ2X 4GA9A 5FJHA 4UW3A 5IVYA 4NIAA 2BZDA 4RGGA 1CD3G 3A22A 1SQ4A 4Q26A 1MR5A 2Q8CA 1RMU3 3AYDA 1OLRA 2YGLA 4GMP1 4YWAA 3ZO0B 1W6QA 4RS5B 3TRSB 1PO12 3A4UA 3NO8A 1ENSA 4AQSA 2D6LX 4XDOA 2JE7A 5GLVA 1RIRA 2JG9A 1RUE3 3BN6A 2ZGOA 4LBQB 2YZ4A 4B4QA 5LBCA 2HYKA 1UOBA 2P3JA 3VZLA 1B09A 4PLMA 3C7HA 4AGVA 3ECQA 1OOPB 4AI0A 4LO4B 2WZR2 4M3CA 1DYPA 3ZLIA 2P5BA 4CEWC 2QE3A 2RE9A 4WZFA 4HK8A 1ZBA2 1GKBA 2J7MA 2VOTA 4XE9A 5FPAA 5CB7A 4LLFA 4DEVA 3OPTA 3SITA 4D7TA 1VRH1 3H3UA 2YBKA 1J3RA 2IZWA 3MV11 2Q1FA 2XVKA 1KXGA 2F17A 4HL0A 4M00A 2RDNA 2ZGRA 3PDQA 3M1HA 2VBBA 4QGLA 1PK6A 4K8RB 5JI7A 4AEKA 2EF6A 3LFIA 4XUOA 5A7WB 1MQTC 1GOHA 5TSWA 1DBNA 1J1TA 4V1PA 5JLVA 2YU2A 3VDDB 4BM8A 1WLWA 1ZM1A 2Q0AA 3BYWA 2VQTA 2A7AA 4FFFA 3ILRA 4UF0A 1W39A 1N3QA 1G9BA 2V4VA 4Y22B 5K0UB 2YROA 4Q4Y2 4KQ7A 5FKBA 1DQ6A 1HRV1 1VBE2 2VQUA 4GWIA 4QHOA 5DDJ2 4CU7A 4JKKA 3ILNA 3ZOIA 3ZKUA 1LTEA 5FZOB 4BQ3A 4OQ9A 4JDMA 3SEPA 1W9TA 4XAEA 5I0DA 4FPOB 3ZFFA 4HKOA 1JZ8A 2VZ1A 2Y0OA 4IE6A 4HETA 1I6XA 3BPSA 3WOGA 1SZBA 3GF6A 1IGOA 3LSDA 2PHXA 4DINB 5JR2A 1HX6A 3O14A 1ULDA 4OULA 3I2IA 2BBVA 4IUGA 1TME2 3IMMA 4CP2A 1UY4A 1UD1A 2BGPA 4IV1A 3IPVA 3UV9A 2GDFA 3H3ZA 1JYXA 3AZXA 3R4UA 4PBPA 1CAWB 4N43A 1PZ7A 4K6BA 3OTFA 3T1LA 2WNUC 1V6IA 4J25A 3VZMA 1JW6A 4N7UA 4RHV1 4NIGA 1VP6A 4ISQA 2ARAA 3HWJA 1H2KA 2F4LA 1PO21 1J83A 3AB0A 2I45A 5EIYB 2JJ6A 5DDJ1 5FZKA 2VNGA 1OXCA 4XF1A 4CCLA 4MGYE 5FO7B 1X50A 2QQOA 3FUOA 4QMAA 2ZMKA 1O91A 4Q0QA 1GMMA 3U11A 3PVOA 2Y0IA 1GICA 5FZLA 4BIFA 4LLOA 2PHLA 2J1AA 3NNMA 1WZXA 3IT8A 3CKHA 4UW4A 5CVRA 1C1FA 3V0AA 1UYYA 4W6WA 3I2JA 4OHWA 1RVF1 2QQPA 4CCOA 5FXWA 1LOEA 4CDXA 4RA0A 4Z07A 4AYUA 3RGBA 2VY0A 3VBRA 3NL1A 1GWMA 3OGGA 1TVGA 3D6EA 2GNDA 2XJVA 1FPN3 2P17A 2R16A 1BEV2 3I7DA 4RD7A 4UT5A 3NNGA 4ZU4A 4EZHA 2QQKA 1GZCA 4XTPA 3AX4A 1RUC3 2HWD3 1LOCA 1GNZA 2VW1A 4MGTA 3OBTA 5DDJ3 1Q43A 3N3HA 4LA3A 3B94A 2LRPA 4OUSA 5DUUA 3ZN5A 2NQYA 2RDRA 5FYTA 3WNMA 1HLCA 2WZ8A 1XSRA 3AZYA 3MF9A 3VDDA 4YW6A 1MZ5A 1NA1A 3WNNA 4PLNA 3ACHA 3ZSKA 3RZJA 4FCAA 3PVEA 1FMD2 3GZAA 3LA2A 4KG0A 1OBNA 4NPMA 1OD3A 4ARXA 4ASLA 3V0BA 3DXTA 4XCBA 5FZIA 3MI8A 1ACCA 1SFPA 2R041 4FPFA 4ISRA 4QGNA 1W04A 2DUQA 2CAUA 4H7LA 2ZXQA 4W6YA 3POJA 1NE6A 4XVHA 5JXGA 3JB4C 3K75B 3H8OA 1H2LA 1HB3A 2IVIB 3S0MA 4A44A 2VCMA 1PGW2 4MVTA 1OUXA 4LBJA 2XOMA 4LO5B 3RI8A 3IDEA 1RHI1 3LF7A 3U10A 2UWBA 2HWE1 1N1TA 5L19A 2ARBA 3T2QA 5FMOS 1W2NA 1AL21 1O4ZA 1RUF1 3CJIA 1W6OB 3LDRA 1DGRN 4P5YA 1AF9A 4WM8C 4XFHA 4RL7A 1C8NA 3I8TA 1X9PA 1BEV1 2ZGKA 1SDDB 4GALA 3ZYIB 1JZ3A 4CP9B 4HKLA 1QU0A 4FBFA 3TAYA 3NMBA 3VZNA 1SBEA 3AYCA 2WO7A 5LW9A 5CZKA 4AEDC 4FPCA 2LROA 4KWLA 2GH8A 3WHTA 4CDWA 4Q5OA 4JRAA 3T2PA 2PHFA 4XJ9A 3AYEA 1DU3D 1V6MA 4LEJA 4BE3A 4QX0A 4OZXA 3KWVA 5JUVA 1HB1A 1NA1C 4NIIA 1H8TB 1XYPA 2C4XA 2GAUA 2GP3A 1ODNA 2R071 4AHXA 5C6CA 4MLOA 4WVMA 4QPIA 1AR73 4XAAA 1LRHA 2WNVA 5FY9A 3AKQA 3LOIA 4EN0A 3I2OA 5CFCC 3TNQA 1NY72 1TMF3 2VD7A 4CDQB 2BGOA 2WNOA 3V64A 2RS52 1W06A 1VBD1 1RUF3 2KXLA 1F31A 1N3PA 3EBRA 1VBD2 2IFRA 3MIDA 4LHSA 3CBNA 4XJWA 5CU1A 3PVNA 4FP3A 3VBFA 3AP7A 1GV9A 4O7XA 4XUQA 4FSJA 3UESA 1VMFA 1X82A 2Q1ZB 2AYHA 2AGSA 2WKKA 2XUMA 2YC4A 3F95A 2Q8EA 3A23A 4BQ5A 5G05L 3TEYA 2QTWB 1L7RA 2JDPA 4PHZA 2P4EA 5F5AA 3RRDA 5A3UA 4YVWA 2UYBA 3UNPA 5LY1A 1V6JA 1AXKA 5FXXA 4AFCA 3MIHA 3PMEA 3W58A 2DURA 2QQLA 3PUQA 4KBBA 2YPDA 4QDQA 4Y5SA 3VZKA 5C8CA 1H2NA 4RSUA 1LAJA 5F3IA 4FOWA 3WF1A 1Q8OA 5FYCA 5B4XA 1Y4WA 3DKWA 1VB2A 3LQCA 1O7FA 1UZ0A 3NJVA 3VBUA 1IZ3A 3RZHA 3BVCA 4BQ1A 2XJSA 3N7JA 3T0BA 4CA9A 4EQVA 2QBXA 4N43C 2QKDA 2A75A 1RTVA 3P6BA 4I3GA 1G9DA 3MW3A 4IEVA 4WVZA 1JOBA 4FPJA 5ACA1 2WL1A 1MS3A 5A32B 3NSTA 4BQXA 1V9U1 5ACA2 2OQ7A 5B2GB 4L97A 3VHNA 3TEWA 2ZX3A 5IATA 2ZMNA 3LSEA 5AFEA 1UZVA 5B4NA 4PJYA 2ZPXA 1QNYA 3ZFEA 2PHTA 1OKQA 1RUJ1 5KHHA 2GNBA 4N9HA 3ZYHA 4FFHA 1JXNA 2E32A 1UWWA 2Q30A 3MYXA 4Q4Y3 4RFT0 3IPVB 3KQ4B 1IQAA 1OPMA 4INDA 4JDOA 1UU6A 2ENRA 2BP6A 4Q8KA 3WHUA 4BMBA 4P9LA 1S0EA 3RVHA 4YARA 1N1SA 2IXKA 5J37A 4HZFA 1D0HA 1VAKA 2Y8KA 3PUHA 4IV3A 1NZIA 2R042 4WM7B 2XGXA 1GWLA 1ZA7A 3KGZA 3LKJA 3TB0A 1CJPA 4GXLA 4M3CE 1NKGA 2GP5A 5EJZB 1REFA 5A7OA 3M3IA 4LBNA 1LOGA 2VZPA 1NX9A 3TYJA 3AZVA 4AF9A 5JOYA 3APBA 1GFF2 3IDCB 3BCWA 1DYOA 1RXGA 1KRIA 2XB6C 2ADEA 1JYNA 3U1XA 1W90A 2ETEA 3UGHA 4RHV3 2WNEA 4A6SA 4AXOA 5FZDA 3ZFGB 4AVVA 4KWUA 5HCBA 2E7AA 1OVPA 5KHJA 1OQDA 4XMIA 1OFNA 4H14A 2IWGB 3AC0A 1LOFC 3SH3A 4IEOA 3NJYA 5CAZA 1E57A 2X8KA 1QJU2 1Y43B 4CEWA 4EYUA 5KC5A 4ZXEA 1NY71 5EWSA 2YPJA 2VZ3A 3O0VA 5F32A 2VR4A 3WQ7A 1FAYA 2RM23 4LT5A 4AE2A 1VRBA 3UKTA 3LDKA 4F3JA 4Z2AA 5FJKA 3BOPA 5FY5A 5GLTA 4HSLA 5KHKA 1WWYA 1T6BX 1VJ2A 1ZRDA 2PHWA 2EIDA 4LULA 3HVDA 3NNJA 4XJZA 3ZR6A 4AGRA 1A34A 1O8SA 2G9FA 1HV0A 2D93A 3AL6A 5I8TA 1MS4A 4HFSA 5FZ4A 2BNMA 4YZ3A 3CO2A 2G19A 2FDHA 1HRV3 4N9IA 1ZX5A 3PU8A 1JZ6A 5ANNA 3VDCA 1RUI2 3FE5A 4XF0A 4AFBA 3ZFGA 1WMFA 4XQ4A 1K3IA 3NJZA 1PNFA 3CIHA 5FPBA 4EJRA 1POV0 3H7JA 1LJ7A 5FFOC 4QXKA 2XMLA 4IGOA 3MUY1 4P9JA 4KWJA 4Y1ZA 3MIFA 1UO9A 5FZ7A 2XJTA 3CMGA 3U4XA 1UPSA 3GBFA 3OUIA 2YHJA 4IV3B 1VRH3 1WCUA 4NIHA 1AYM3 3NV3A 4XILA 1POQA 4OI0A 4IEXA 4IDZA 1TME1 4K40A 3WR0A 5FY4A 4JTNA 5GJ6A 3AKPA 3URFA 1REEA 3SCHA 1W9FA 4ITCA 5D8AA 1GZ9A 1PZ9A 1UZYA 1HV1A 4AEDB 1F2NA 1NXD1 3AMMA 1DCSA 1UKRA 1F8VA 2ZS6B 2O14A 3R05A 4XHXA 1V9U2 3OUJA 4MHUA 3MF6A 1SLIA 1Q56A 2XUEA 4LIUA 3CL1A 2P6HA 5BNNC 3ZFEB 4XQDA 2FMYA 3FFQA 4ZONA 5FZMA 4LO8A 4GWNA 3WNOA 3KV9A 3F2ZA 4EROA 1DFQA 1QJZA 4CCMA 3VBFB 4C1XA 2AENA 4EZ4A 1BMV1 2WNUB 2VULA 3H3LA 1TZOA 2DCJA 3CU7A 1W8UA 5J98B 1CAXB 4TWTA 3BB6A 1RMU1 4L92A 4QDRA 4LKDA 2W0XA 3PTRB 1AJKA 3WP3A 3WW4A 2PMWB 4D7SA 2WQZC 1MEC2 2HJIA 2PTMA 2XONA 3M3EA 5JMOA 1QQP3 3EHKA 1AR92 1WMXA 3DPRB 5FMDA 4ZPIA 5C8CB 2VVEA 2WYSA 1GZTA 3NKTA 4LK6A 5JMCA 2XJPA 3RZMA 2VU9A 4FT8A 4ARYA 1WLCA 1VALA 5DABA 2DTWA 2EIBA 3GDBA 4FFIA 3VKOA 5C5TA 5CBLA 1QQP2 3BPZA 4OHXA 1Y3TA 3C7FA 4XTMA 2I2SA 3M4FA 3VHPA 4ATFA 3B01A 4YVWB 4E8DA 2XL9A 3AXDA 3UK9A 1R64A 4UYBA 1LECA 3AK0A 3E1F1 1CZTA 1C3HA 1QJFA 3CNAA 1NCRA 3ZR5A 4CCCA 5L9VA 3ZPYA 3T4HB 3R4DB 2CGPA 4Q27A 3H1WA 5BPXA 3MLJA 4MZUA 3ACGA 4YVSB 1MQTB 2H6CA 2EXHA 1R1A1 1X7NA 4X6RB 4J1WA 1YFWA 1H0BA 5IJRA 3O1SA 2J1UA 3FHAA 1G8WA 3GALA 3VBHB 4XBQA 5SV5A 4BXFA 4CDQC 1C28A 4DUVA 1AXZA 5LBBA 3T2TA 1DZQA 5D8AC 4Y33A 4Q4V3 1KJLA 5EYYA 1QJY3 4UI9L 2VNRA 3Q8EA 1W2TA 2OX0A 4XUTA 2EXJA 2IXJA 2QZ2A 2JDYA 1EPZA 1CGPA 1HRI3 5FXVA 2VCBA 4PF1A 5F7UA 3ILFA 4X8NA 4A7YA 2Y64A 4RQPC 4AQ2A 1PIV3 5FZBA 4GB32 3MDPA 1AR62 1ST8A 3T2OA 3VZJA 2XBO2 3IAQA 2E6VA 1ZZ9A 1W6MB 5A3NA 3ZN6B 2BWAA 4CPBD 1V6OA 1ZZBA 1QJX3 2VZTA 1PHMA 1Z7S2 3ENRA 3VLBB 3MLKA 3AKSA 5C4WC 1OSGA 4GIQA 4MHRA 3SMHA 3HNMA 3GM8A 3U78A 4OVEA 1RUG3 3WF3A 1US3A 4LIVA 4Y22A 1XJAA 1IS5A 2I74A 2JD9A 5ANQA 4AK3A 3A7QA 3NQHA 4I09A 2VH9A 1AR72 3AVRA 2VJXA 2DVBA 1MZ6A 3AXEA 5C70A 4FTEA 3JBG3 3TWIA 2RS12 1ENQA 5GLZA 2RDQA 5A7WA 4K1YA 4XFIA 4WM7A 1XE8A 3GGLA 2VZRA 3POSA 1CAUB 1YI7A 3MW4A 1IQDC 1XU1A 1RUH2 4OLLA 5CFCA 5FPXA 2FZ1A 4XW3A 1O5UA 1RUH1 5A1FA 2GC1A 5A7QA 2Q8DA 4FO9A 5IVBA 5AC93 3BU0A 1QWRA 4XHBA 1Z78A 2XKOA 1QJU3 4JTOA 1CONA 1W8HA 2XJQA 5LATA 1K5MA 2VZSA 3Q8BA 3VZOA 2XHKA 1SCRA 1WA4A 1GOFA 3J7NA 3USSA 5FYHA 2VMFA 1COV2 4BCUA 2BNOA 5FRAA 2W3JA 2IFWA 2R0HA 4CUCA 1R1ZA 3N7LA 5JDBA 2QQIA 3JB8A 4QQHA 4CCKA 4COUA 2CDPA 3S6PA 2VCCA 3BI3A 3KT7A 3PL0A 2JG9B 1IPJA 2C6SA 4CEYC 5LASA 5BNPA 4XIKA 1FYUA 5I0SA 1HN0A 4OHVA 1Q8QA 4HONA 2VCAA 1MZFA 4YG0A 2IVJA 4LXLA 4Q4X2 3I2DA 3LIGA 4QU2A 2OPWA 2FDJA 4XFAA 1J3PA 3CJIB 2ZZQA 5C3SA 2UY8A 4XJAA 4R9CA 4PDWA 4QPYA 4CDXB 4L99A 3Q8CA 3U4SA 4CEYA 1NG0A 1HXS3 4YPJA 3SKJE 5JSOA 5DAVA 1HB4A 4M4PA 1V0AA 2ZGMA 1PO11 1LNSA 2ZGUA 2VBDA 5FK7A 3EYPA 1QF3A 1UY2A 1RYYA 3NNFA 4C90A 5ABJC 4GULA 4MYEA 2CY6A 2JE9A 1FV3A 3KV5A 2WS93 4FPHA 5FBZA 4YM2A 4RS5C 2TNFA 1WD3A 2G4IA 2LUWA 2PLV1 3RMYA 1UZZA 3HD8B 4Q0SA 4CVUA 4XOGA 4AFDA 1OQ1A 4Q4W3 3ZSLA 4PCRA 1BYHA 1KFUL 2VUDA 2YG0A 3H0OA 4IESA 4Q0VA 1XE0A 1A3KA 2RS51 2W46A 2BVBA 1W0OA 3KSCA 3LB9A 5EV7A 4UW6A 4CDQA 1MQTA 1W05A 2PELA 5KXCA 3TEZA 2E33A 2JWPA 4H3WA 3RFRA 3WG2A 4MOAA 2XLFA 3WX5A 4R52A 3HN1A 1VBA1 1AX1A 4J1XA 3ME2A 4AVCA 1BCXA 4MH0E 1V6NA 2J1SA 3FC0A 4P02B 4UBGA 4UOJA 1XNCA 2OYZA 2P37A 4QM8A 2RMU1 3FHQA 3ZSMA 3ZM8A 1EUTA 3WG4A 5E1RA 1RC6A 1O6UA 2GC2A 4D7YA 3TN92 1XNTA 4HBNA 4GAZA 3POGA 2CGOA 2YUEA 4Z8BA 5K0UC 2VO5A 4U2AA 4CDXC 1ZVFA 5JXIA 5ISLA 4PIZA 1RUOA 3C3VA 2E9QA 3POIA 4WM8A 2WRAA 5FP8A 3WVJA 4CCDA 1GU3A 5FYZA 1W6QB 2UWCA 1C8M2 1PGSA 3ACFA 3HMYA 5GZDA 1LHUA 1H4GA 2R1DA 1EV11 2YV8A 3N36A 4ORFA 5LY2A 1XPWA 2H0BA 2VMIA 3VBRC 3GHMA 2BDRA 5J7MA 2ATFA 3ZN6A 1PK6B 1F5FA 4IXLA 1F15A 4UXAA 2W1UA 5LB6A 2XHNA 4A3XA 4DQAA 4S2DA 5FZ3A 3SHRA 3FHIB 2CWSA 2WNVB 2K46A 1K45A 4URAA 1UX6A 4R4XA 4K8FA 2TEPA 4K7JA 1A6CA 2HWF1 1I9RA 1DGWA 3J8F2 3S7IA 1ZNPA 3ROUA 4HN0A 1PMHX 5JXJA 1LOBA 2X10A 3MW2A 3N9MA 5T55A 1AR61 1JYTA 5A80A 1EAH2 1WBFA 1WW6A 4HLTA 1ZA4A 2NPIA 2FCVA 3PTYA 3V0BB 4HXCA 4HK9A 4A3ZA 1JUHA 1S0DA 2CAVA 4AGGA 5EHDA 4LBOA 5DAQA 1VAMA 3VBHA 2CDOA 1Q8VA 4CP1A 5GZGA 4C91A 1ASJ1 3RNSA 1PVC1 4K21A 4OUEA 1JTZX 3NNLA 3MHZA 4L8QA 3J7LA 4MGQA 5T50A 2WAAA 5L9RA 5BV6A 5H9RA 1MACA 2XBO3 2A73B 1GP5A 4GH4A 3PIGA 5FZOA 2XVLA 2P6CA 4CXYA 3AYAA 1VAVA 2RVAA 2ZGNA 3G7DA 4QQ2A 3BTYA 5DZFA 3S57A 3T0AA 3TOJA 1UW8A 2DVFA 4AI2A 4KGQA 4TXWA 1OI6A 2ADDA 2WN2A 4Y5TA 1O3TA 4A7KA 3J9SA 4N90A 4Y4YA 5G04L 1E5HA 3GBGA 4Y4RA 1FX5A 1ULCA 4DY3A 5K4LA 2WA4A 2OW4A 4G3YC 2HWB1 4GH4C 3VL9A 1KS4A 4R4ZA 3SC7X 5J36A 3I49A 4LQRA 5FAXA 5LCWL 2XH6A 3FJSA 2DFBA 2L9LA 4XABA 3WDTA 5GLUA 4GQ7A 1AR83 5F39A 3PIJA 4Q8LA 2DCYA 3A0NA 4H2AA 4MADA 4NVPA 4QT6A 5BNOC 2BNNA 2W1QA 3V0AB 2RS33 4WZCA 2E7QA 1PVXA 4KBZA 1RB8G 2HH9A 5FPZA 1UXXX 2E63A 4QXHA 1W2UA 2W91A 1VBC3 4OHZA 4OQ8A 4M4RA 2VC9A 1MEC1 2WNUA 4D69A 4CDWC 4E4SA 3RZLA 1UOFA 4CUAA 4FPYA 2YBPA 1G9CA 2OXBA 1SCSA 1LULA 1PO22 4IE0A 4EN7B 2UY9A 2WFF1 4CCEA 4V2VA 4HANA 3FFZA 1C5HA 2HWF2 4IEQA 3VBHC 4LKEA 2VNOA 2ET7A 4DUWA 4COZA 3RSJA 4C8DA 5CKQA 5H9QA 5IK8A 2EALA 1T2XA 4OI2A 3UT0A 2RR13 1HRV2 5IVJA 4BB3A 3WQBA 1DQ4A 1POV1 1RUD2 1K42A 1SLBA 5FYBA 1D4M3 1LODA 2W5FA 1JN2P 3E5XA 2VXJA 1A8MA 3VHRA 2XQXA 1UAIA 1AR81 1JH5A 1XXNA 3ASIA 5DUXA 1YI9A 1KEXA 1OQEA 5F1RA 4YW4A 3K4DA 1MS9A 3FLTA 4CU9A 3RZKA 1VMHA 2JB8A 5FZCA 1COV1 1DGWX 1YWKA 1BQPA 1Y9QA 1YHFA 4CCJA 2GH2A 2XDVA 4FOQA 3UETA 5LK7B 5BNPB 4E2QA 3N9NA 3ATGA 1T6GC 2JB4A 4JZRA 5FPUA 3UGFA 3HAGA 4EE2A 1VRH2 3VBSB 1QOTA 2OKXA 3RMXA 1NCQB 2WABA 3PJQA 4FTSA 3W5MA 1S2KA 1UNBA 4IQPA 4E4HA 3MLLA 3T09A 3N4MA 3SQOA 1LHOA 2D44A 2JDKA 1C8M1 4LE3A 3ZFGC 5IVFA 2G1MA 3RPQA 2PQQA 1D4VB 5BYNA 5DUWA 1RVF2 4V2WA 4DO0A 1DQ5A 4QPIC 3HPNA 1ASJ3 3MIBA 5IUQA 3H1MA 4JKMA 1EY2A 1VPHA 3D8CA 3ZYJB 2G9GA 1RINA 4DFSA 2DU0A 2D3SA 4WVVA 4QPGA 4E2SA 3GNEA 4B1LA 2NMOA 5A1LA 1XBFA 2JDHA 4IL7A 2C0ZA 1XNDA
chains in the Genus database with same CATH topology
5BNNB 2ZX1A 4NPRA 2NM1A 1VBB3 4ATEA 4FXGB 3WDVA 3ZFFB 1QGLA 3MPBA 1DG6A 5CFDA 2DUPA 1NE4A 2P34A 2WINB 1IKPA 1J58A 4YGDA 3RZZA 5AVPA 5CA6A 2WFF2 2UURA 2WT1A 4IV3C 1NQJA 1RGSA 5DZGA 2ZBJA 3CJIC 3H1YA 1ENRA 5FDBA 3ZX7A 4HN1A 1JUIA 2ZJCA 1CX4A 4QPGC 4AG4A 1EV13 4LHLA 1NLRA 1CPMA 1LR5A 3KS7A 3M3CA 1Z7S1 4RHV2 2K9ZA 3MPPG 4KNCA 1W6MA 1YNAA 1WCSA 1NLSA 5T5OA 4AQTA 5JI9A 2QDRA 4B4PA 1H8TA 3AJZA 2TUNA 1D2SA 1YCIA 1OD5A 4Y1VA 1LESA 3WCSA 4JGYC 5T52A 2JD4A 2EA7A 1F9KA 2NMNA 2E53A 2QNKA 3LAGA 1WCKA 2XJRA 3SISA 4KWKA 1VBA3 4IEYA 1OMIA 3A0KA 3FZ3A 5JOWA 1G6NA 4C1WA 5T5LA 1NZCA 1RUF2 3WD5A 1GLHA 4M0NA 1SLLA 4OI4A 4UW5A 1BVVA 2ZX4A 5GZFA 4NWVA 1H4HA 1QXJA 3W59A 4LNVA 1HDKA 2D7FA 1R082 5C4WB 4FOVA 1ZRRA 1GBGA 1COV3 4NO4A 1LENA 2B5HA 4FQ4A 3WUDA 1BBT1 4I02A 5I93A 2VMHA 2R6QA 1B35C 3BALA 3LA7A 3DPRA 1HXS1 4K3UA 4AVTA 1J1LA 2BYVE 2BVVA 4B7KA 1SBDA 3L9JT 1H9WA 4N53A 4Z8BA 1WMEA 2X29A 4LO7A 3KMHA 4LA2A 1EV12 1PGW1 1CAXA 1J3QA 1VLNA 3TNPB 1MS0A 1FNYA 1Q5OA 4Q4X3 1UU5A 4YZ5A 4XJ8A 3USUB 4I30A 3THTA 1GZWA 3B9IA 2JICA 1I1EA 3CEWA 2V5YA 1RJ8A 5LEKA 3I4IA 1PNGA 2WLQA 3PNAA 1H30A 4RGAA 1VBC1 1FOD3 2WQ4A 2D40A 4XFBA 1DQ1A 3IIAA 1U5IA 3ELNA 1LEMA 4S2GA 4XXAA 2D3RA 4I01A 4CEYB 5J09A 2VW2A 1X8MA 3ZXLA 2JG9C 1OA2A 2RS13 4LHKA 2BEOA 5C33A 1LHNA 2ERFA 4HKWA 2HWC3 1HKDA 1AX0A 2DCKA 2EIGA 2FMDA 3VBOB 2A3YA 3VBUC 3B7MA 2D5HA 4FPEA 2DTYA 1CPNA 1HRI2 4W6XA 4BOWA 2FZ2A 4MGIE 4LBMA 2N7GA 5GZEA 4OHYA 1O3SA 3ZFFC 2CV6A 5IT6A 5GALA 1RUG1 4HT1T 3RYKA 3MICA 3OBRA 4B4RA 4IEWA 1C4RA 2ZHNA 3B5LB 4E4ZA 4QHBA 1DDLA 1RJ7A 4AI1A 1EAH1 3TN93 5CFCB 3QD6A 4QPIB 1KDMA 3BODA 5KHIA 1PIV2 2ZGSA 1IKQA 2GC3A 4CZSA 5DUVA 3N35A 5C9AC 3JCIA 1XYNA 3HIFA 1HRI1 4R9DA 2HWF3 4NHMA 4EN6B 2MNGA 2V73A 5JAXA 1YXWA 1FMD3 1G86A 2XPJA 2WZR3 3UJQA 4Q4V1 2Z69A 1H1IA 1XE7A 3ZIXA 3EXUA 1JYIA 1C57A 3H50A 4YG3A 3VV1A 4NHKA 2YY1A 2IC1A 4XBNA 1H9PA 1A78A 2D6MA 3M3OA 4M3CF 4LR4A 3HT1A 2IXIA 1JHNA 3I59A 3NKGA 4LUMA 3I54A 1TE1B 2SLIA 1YJLA 2LALA 5KXDA 3E6CC 1KQRA 2B39A 4YG6A 3SH5A 4P9WA 2ZGLA 4M3CB 5CIRA 1IOAA 3AKTA 1W6PA 1DLLA 4CDWB 2D43A 5SV8A 1GSLA 4YZ4A 3OCPA 2ZOEB 5A32A 1JYCA 3J8F1 2C9AA 4LBQA 2CGNA 1D0GA 3NWKA 3KLSA 3OYWB 1LEDA 1ASJ2 5JZGC 3UL2A 4RR3C 1SBFA 3HQXA 4C0HA 4IV1B 2GALA 4M0HA 2RS53 1EP0A 2VVDA 4KH9A 5A3LA 3WW3A 5JR7B 1ND3B 4I0AA 2PLV3 4IERA 3H8UA 4ZU5A 5C9AA 1H1AA 4Y1YA 1DQ2A 4Q4V2 3B93A 1YIPA 4I0WB 4Y1UA 4YW2A 2A6XA 3T1MA 3X29B 3C2UA 5JPMB 4XJUA 2PLV2 1RUD3 2WLPA 4WM7C 1BBT2 3KCCA 5H9SA 2AZ5A 1TME3 3VBFC 1EPWA 1AYN2 2A6ZA 4COWA 4YW5A 5EJ3A 2WIIB 4GB31 1DQ0A 1YFXA 4ES8A 1QMJA 2VUJA 1RUI3 3AMHA 4I3PA 4RR3A 2O8OA 1VBB2 2ZMLA 3B00A 2ZHLA 3UKVA 5C9AB 2MEV3 3D0JA 4P9YA 1S0CA 4N43B 1HQWA 1VBC2 3ACLA 2WNVC 5GM0A 2JEMA 2X5IC 3NV4A 3B02A 3GYDA 1RUI1 5D8AB 4AEDA 1X33A 4GB33 3KQRA 4OUMA 3WDYA 4YM1A 5IK4A 1IS4A 4P9IA 1DGLA 1LHVA 3AP6A 4QD2A 3VBRB 5BNQA 4AI8A 5BY5A 5HI0A 1A8DA 1YRZA 3P3NA 1N1YA 4RS5A 4XFFA 3UJOA 2DU1A 4AFMA 4J6GA 3ZXDA 1LU1A 1W6OA 4IV1C 5LEJA 3JBG1 4AFAA 1SLAA 1LB2A 1ZREA 4QGMA 1APNA 5K0UA 1UIKA 1R083 1RUNA 2XL7A 4G4FA 4YVWC 1BMV2 3W9AA 1GQGA 3FMGA 5KHGA 1BXHA 2R1BA 2YMZA 4YFWA 3ZVXA 3OY8B 1TNRA 2P2KA 3AFKA 1O3RA 4DRVA 5C8CC 1U12A 2CYFA 5A33B 5HXVA 4YYOA 2AR6A 3KZ4C 4MXVA 4NR1A 2FHRA 5I8SA 1ZZ7A 3M7AA 2EXIA 3DL3A 3J8F3 3P3PA 3S7EA 2ES3A 4XPVA 2BTVC 2E7TA 3H7YA 1NA1B 1CJDA 2K0GA 2ZGTA 4Q0PA 3FLRA 1PIV1 4R9BA 4BLJA 3JBG2 3QLQA 1AR93 4L11A 1V6LA 4QQPA 3ES4A 1S0BA 3D4KA 1QDOA 1QOOA 4EWEA 2WSUA 2GN3A 3O0WA 1WGPA 4EWDA 4DOUA 2TBVA 5DG1A 5FLJA 2BGCA 4MGKE 3VL8A 1SEFA 5HCAA 2XWBB 3WV6A 1R1A3 1TNFA 5A33A 5GKAC 3CLPA 3HBZA 4O9GA 2QJVA 1UMZA 2VECA 3OY8A 3UKNA 1VIWB 5L7OC 4TYSA 3NV2A 1KITA 5A3MA 3IDBB 1CQ9A 1D2QA 1R1A2 1S0IA 2DV9A 1SMVA 2ZA9A 4LHNA 5HCFA 1O4TA 2D98A 5BNOA 2YDEA 2D6NA 1N1VA 1RHI2 4JC1A 4SLIA 1AR91 2B8MA 4DRRA 2A3XA 1M4WA 2VMGA 2ZAHA 3ETQA 2E51A 2I07B 5FOBB 5J96B 1QJX2 3WQ0A 1ONAA 4AVSA 3B3QE 1DF0A 1QQP1 2W52A 3IMNA 2LM3A 5J48A 3PLQA 2Q1MA 4JV4A 3M70A 1EAH3 4URTA 3WW1A 4COVA 3VBUB 3AJYA 2ZAAA 3V56A 3VBOC 1W0PA 4AVBA 1U5YA 1TMF1 2YGMA 3EQEA 3D0SA 3SCFA 1ALYA 4P5HA 3JZVA 3DPRC 4F83A 1CVNA 4JGZC 1R081 5L7OA 2R073 3ZXJA 3MFCA 5JSRA 2D6PA 5DXDA 3OGJA 5CG9A 5I0RA 4HSJA 2WSVA 3K51A 4BLIA 2KM2A 1AYM1 2GMMA 5I0UA 3WG1A 1ND2C 3DF0A 1KFXL 3DN7A 1FOD1 2AREA 1VBA2 2ZABA 4MSVA 1AL23 4XDQA 5IK5A 1ZRFA 2VQ0A 2HWE3 3LWCA 2MEV1 5CADA 2JXAA 1GR3A 3VKNA 4YGCA 5FQ0A 1QJY2 4JCKA 2VOWA 5FREA 3ZDSA 4Y24A 1OOPA 1G9AA 2Y38A 4FTBA 1WCDJ 1YLLA 4AVAA 5JCTA 1BK1A 4K20A 3VN4A 4ZU7A 5KBFA 2XVGA 3OYWA 2GSYA 1BJQA 4DZGA 1FI2A 4YVSC 2JENA 3WLUA 3DV8A 1RUD1 1BBT3 3OD0A 4CTEA 4QX5A 4PQ9A 2VPVA 4F8AA 1UCXA 5JZGB 1S1AA 3OPZA 2R32A 4HVRA 5FTTC 2HWC2 1IS3A 4FPLA 3WQ1A 4AW7A 3O12A 3LCPA 1GANA 1ZZCA 3POWA 2VQAA 1FATA 1MZEA 2W68A 1FPN1 4Q2FA 3R6SA 2VG9A 3VKFC 1ZRCA 4Q0UA 2DFCA 1H2MA 5KXEA 1M06G 4L2NA 2FBEA 1RVF3 2F6BA 3M3QA 4CEWB 1REDA 1GQHA 5EFUA 3ZSEA 4Q1RA 1QKQA 2BWCA 1C1LA 1FXZA 5CFDB 1RUJ3 4Z1VA 1QXPA 3ZSJA 5L7OB 1IPKA 1I5ZA 1XNKA 2ZGQA 4NN0A 1SACA 1ND2A 1PO23 1V9U3 1LU2A 3V65A 2DWRA 5F9TA 1QH6A 1XNBA 5ACA3 2IXHA 3FWEA 3B69A 3ZIWA 4XEZA 4HVOA 4AI3A 1W6NA 1SFYA 4Z92B 2RR12 3KCYA 3WW2A 1LGNA 2Z2SB 4AHYA 1ULFA 4DS0A 2QFEA 5DG2A 1ULGA 3PVBB 4Y1XA 1DYKA 4FAGA 4JGYA 4JGZA 5EYXA 2D3PA 1AXYA 2WZR1 5F6LB 1FMD1 1GYKA 2X53S 2R0FA 3JQWA 5C8WA 4EV0A 3DGTA 4YZ1A 5I91A 5KXBA 2H0VA 2MEV2 4Q29A 1ZZ6A 2EXKA 3L2YA 2D5FA 1MVQA 4JGZB 2A3WA 4WV8A 1UIJA 1J59A 3DUIA 2HEYF 2UU8A 2RJLA 1ND3C 4YGEA 1MS8A 1CAWA 1QH7A 3TN91 3ZYRA 1LKNA 1VBD3 2ZCWA 1RITA 2B45X 3WDUA 2IXCA 1WUVA 4X6QB 1C8M3 4IEZA 3ZYPA 3NAPA 2OUHA 3B9CA 5DZEA 3E97A 4MGZE 1AR71 1SLCA 2ZZJA 3HR9A 4QM9A 1QHDA 4YZ2A 3VDDC 5AC92 3WUCA 1CR7A 2YC0A 3WZ1A 3MIEA 3GZTB 4WVWA 1UF2C 1KD7A 4LE4A 4QQOA 2VVFA 4DXZA 1K5MC 4BHPA 3JD72 4TLFA 1UL9A 5FO8B 2HWC1 3LOBA 1NCRC 4N53B 2RS11 1D4M1 4P14A 4JAAA 4LTAA 3VKMA 4WBBA 4YNIA 1POV3 2GU9A 3SCGA 4GMP3 1BEV3 4HPKA 4Q1PA 1LHWA 4KU8A 4FP2A 1SFNA 3IBMA 5CNAA 1TMF2 1PGL2 4CP0A 2WWSA 4XFGA 4DPNA 3JU9A 1RHI3 4WVMB 2FQPA 4GKXA 1B35B 3ZXEA 4NWWA 4BIOA 1AHSA 1ND2B 1SDWA 1MEC3 4Q4X1 4GH4B 4L9BA 4CDUA 5CG8A 2NP0A 3LGRA 3G6JB 1HIXA 1AJOA 3MEPA 2R043 4JRLA 4JQRA 4RQPA 3E5UA 2PAEA 5I8YA 4Y20A 2R062 3CJXA 1AL0G 4XF3A 2UWAA 1QDCA 1FOD2 2HWB3 3PJYA 4YRDA 4LBKA 4P9XA 3AZWA 3AMQA 4W65A 5ABJB 2DVAA 2D6KA 2EAKA 1DHKB 3KM5A 2OA2A 1V6KA 2JG8A 2O1QA 3NV1A 4LO6B 1WBLA 5JWPA 4CRQA 5JVVA 1JBCA 4AQ6A 5LRSA 5JIUA 1V00A 1RUC1 2HWD1 1CN1A 1TEIA 4YFZA 5GZCA 1KDKA 4FOYA 1HQNA 4EN8B 4CDUC 1HW5A 4IEPA 3THPA 1CIWA 3RDIA 1PK6C 3ES1A 1CAVB 1AR63 1V70A 2B7YA 2X5IB 4R9AA 1DGRA 1WD4A 2VOVA 2W08A 2R30A 2PHUA 4MUVA 2XLGA 1WLDA 1FT9A 5F6KA 5T3NA 4A7ZA 4OI1A 3GHNA 5JPNB 3QH7A 1Z7S3 5JOZA 2VGDA 2OIIA 5E8AA 3CF6E 4KG8A 1AYN1 3JQXA 2Q5TA 2CTVA 3NAPC 3PMSA 4FQZA 5FOJB 2HEWF 1D4M2 3WCRA 4B8EA 2GMPA 2RJKA 3WP4A 4YM3A 2R072 1O4YA 3M8LA 1PGL1 1TQ5A 3O0XA 4PDWC 4C0BA 1FNZA 3GZUC 4YM0A 4NHLA 3SH4A 3AZZA 1VBB1 1G7YA 2OPKA 2XLAA 4FXKB 3KD4A 3VBOA 1OFSA 2VUAA 1S0FA 5I0TA 3BU7A 2Z42A 4OFGA 1RUG2 4HMZA 5KC6A 2ARXA 3MZHA 1YO8A 5E88A 1UU4A 5K7PA 1C5IA 3IM0A 1LOAA 4XIOA 3ST7A 4MXWB 2R49A 2ZX0A 4HVQA 2XJUA 4MXWA 2XG3A 3BIWE 4P9GA 4AWDA 4E9KA 3JD73 3SNMA 2ZHMA 2YYOA 1H8VA 4Q4W1 1LCLA 2JKBA 3H9AA 3RYRA 1QNWA 4BMEA 4KU7A 1AZDA 4FPKA 3J26N 2WT0A 2X5IA 4Z2WA 1AR82 3NW4A 4DY5A 3KT1A 1UN1A 1AUYA 4PIXA 1ZZ8A 1BKZA 2PFWA 1K5MB 1YYNA 1ENXA 1KS5A 1U5XA 4ES9A 1ULEA 1RUE1 5EXOA 3ZXAC 1RUE2 2WA3A 3FLPA 2HEVF 2D97A 1XYOA 2RR11 3WY6A 2JECA 1NYWA 5T54A 4B29A 3ZXGA 3R0RA 3SXWA 3QACA 3KT4A 1YFYA 4YW3A 2VOXA 2WFF3 2BFUS 2DVDA 2NZ9A 4BWOA 4XQWA 2ZKNA 3EJKA 3KB5A 3MGUA 1G9FA 1SLTA 1PM7A 4AHZA 3D82A 1XQNA 1MVEA 4ZKTB 2GZWA 4YW1A 3RJRA 4I2OA 2VXRA 2RMU2 2PA7A 3POYA 4X8PA 3O5SA 5T5JA 4H7MA 2PHRA 5LK5A 3QOPA 1CAVA 1L3JA 4GKYA 2A6YA 2RS31 1VR3A 1RUH3 2ZACA 1ZBE1 4E2GA 1OPOA 1URXA 5K9YA 2AUYA 1OHFA 1S2BA 5AVAA 3NVCA 2KA3A 4BH9A 2OZ6A 1U0AA 4XXPA 1MS1A 3RQ0A 1PMIA 3K48A 5FCCA 3RG0A 5J3UA 5FMOL 3ZFEC 1DZRA 2D6OX 4AEJA 5AFBA 2XKPA 3QBQA 1Z0HA 2PAKA 2DVGA 2OVUA 4YGBA 3ZMNA 2XWJB 3VBSC 3BTAA 4RR3B 3I59B 2JX9A 1VBE3 4E4DX 2HWE2 3LZZA 3ZYGA 2XBO1 4BPZA 4LUKA 4XMAA 4HPKB 2QCSB 2GMEA 1FPN2 4CYDA 3WNXA 1PVC3 4FPGA 2RS32 2ZTNA 1OA3A 5E16A 4H55A 1UPIA 4I0BA 2UYAA 4YLZA 5CFDC 1Q8PA 1XU2A 4AEMA 2EVXA 3OF1A 3QCWA 4MV2A 5H9PA 3RWNA 2DCTA 2O8QA 5EZWA 5JIAA 2HKXA 1IHMA 4PLOA 4B7EA 1DZTA 3RI9A 2F4PA 2OUJA 4LBLA 4R8HA 4CDUB 1VBE1 2C5DA 3WXPA 1CESA 2ILMA 3SLIA 1QY4A 3JUUA 1VB4A 4E27A 1AVBA 1QJY1 1N3OA 1YFUA 3M2MA 3WT3A 1OOPC 2MHFA 4QPGB 4U36A 2PAMA 3AM2A 4BZ4A 1GNHA 2SBAA 2RM22 2BFUL 3N7MA 3IN9A 4TSVA 2BQPA 1OLQA 2DYCA 4B3NA 1ZBE3 3KGLA 2VW0A 4QQLA 3HT2A 4KL1A 2GC0A 1JOJA 1WW7A 1NCQA 3FBMA 4META 4XF4A 1FV2A 2BW8A 1ZBA3 4XYXA 5BUVA 2Z5WA 3AP9A 1Q8SA 4ONUA 1RUJ2 2CL2A 5KWRA 2RMU3 4TZDA 2YXSA 3VUOA 4M01A 2JG8B 5L73A 3BOWA 3E5QA 1ZYBA 4AHWA 2BUKA 1PVC2 4YSFA 4XZPA 5IK7A 3NAPB 4BYYA 4KGGA 4FVVA 2WFPA 1KJRA 4A2UA 4G9SB 3E6DA 4XBLA 1QOSA 1NCQC 4MX3A 2RHPA 3L2HA 2OZJA 4Y20B 2ET1A 2R061 3O7OA 2GNTA 2GNMA 3KCXA 4RQPB 3WINE 4XETA 2ZKLA 4EWAA 1S55A 3IKWA 2H6BA 3WDWA 2WS91 4K1ZA 1R093 2C1FA 2WS92 3GBWA 3AFGA 4DB5A 3AP5A 4N53C 4IETA 5FO9B 2P3IA 1HXS2 4FAHA 4ASMB 1PO13 4PIYA 1B35A 1R091 5L36A 5E89A 5FQ0B 2A71A 4D3WA 1R092 2Q4SA 4UBHA 2DF7A 3J4UH 3FUQA 3R4SA 1NQDA 1HQLA 1S0JA 3AP4A 2BPA2 2R063 4Z82A 2LTNA 3JD71 2Z79A 3OJBA 1CAUA 3MFAA 5BXXA 4F7ZA 2QDNA 4S2HA 4Q4W2 1W6NB 2Y26A 4O9EA 2QZ3A 3AMPA 5C4WA 3ZN4A 1WW5A 4GWMA 2WJSA 2A6VA 3RYPA 3S30A 1LGCA 4PF5A 1I3HA 2V09A 3E6BA 3RS6A 1X8EA 3U0ZA 4XFCA 4BA6A 2DUOA 5K8SA 1PZ8A 4K9SA 1AL22 1N47A 1NOVA 1ZBA1 4LBQD 1QJU1 5F5QA 4EN9B 5AC91 3AMNA 5BNNA 3N7KA 2B46X 2GN7A 1O3QA 3INAA 1WLTA 3U07A 2RM21 3WDXA 1BVP1 1ZBE2 1F5JA 3OD4A 2PHDA 1RL3A 3EO6A 1XRUA 2W39A 4GMP0 4NOTA 2B42B 4DNYA 1AYN3 2A6WA 2CWMA 2QUOA 2NYYA 1AYM2 2WC2A 1H8TC 3Q9OA 1X36A 3WP6A 1OA4A 1BZWA 4PBOA 4JVAA 1GZWB 1MS5A 5JSPA 4N7IA 4Y5Z0 1QXRA 3VBSA 1YIFA 3TBDA 3MIGA 5BNPC 5FLIA 4ZXKA 5BNOB 2PYTA 2MPFA 1QJX1 1EYBA 1NXMA 1RMU2 4YVSA 4IEUA 2ZX2A 2QVSB 1WW4A 4JGYB 5LRRA 1RUC2 2HWD2 1NCRB 4WM8B 1U5ZA 2K2SA 1O5LA 1IS6A 3QH6A 2DCZA 4Q4Y1 2AH2A 3IWZA 1Y7BA 1DIWA 1YUDA 1S0GA 1H1MA 3D5OA 5HBAA 1Q3EA 4SBVA 4S2FA 2EAAA 2HWB2 4XF9A 4Y26A 3ZXFA 3PHMA 2P3KA 5T5PA 2O0OA 4DMIA 3USUA 2A70A 2NLRA 3ALQA 3FX3A 3VKLA 3ZXKA 5FLHA 1LGBA 2JDZA 1YJKA 3VHOA 1WMDA 2B9UA 3FBYA 1W6PB 4COYA 1AX2A 1LOFA 2CNAA 2WT2A 4JDNA 3VGIA 4D94A 5GLWA 2Q8OA 5JOXA 3AKRA 3WP5A 5D1IA 2JG8C 3WG3A 3ZMOA 2PN5A 2ZGPA 2NN8A 2A5ZA 2ZHKA 2VOKA 3LA3A 5ABJA 2IXLA 5JZGA 4PDWB 2WZPP 1ND3A 1UKGA 3RJ2X 4GA9A 4UW3A 4RGGA 1CD3G 4Q26A 1SQ4A 1MR5A 1RMU3 3AYDA 1OLRA 2YGLA 4GMP1 3ZO0B 1W6QA 4RS5B 3TRSB 1PO12 3A4UA 3NO8A 1ENSA 4AQSA 2D6LX 2JE7A 5GLVA 1RIRA 2JG9A 1RUE3 2ZGOA 4LBQB 2YZ4A 4B4QA 2HYKA 2P3JA 3VZLA 1B09A 4PLMA 4AGVA 3ECQA 1OOPB 4AI0A 4LO4B 2WZR2 4M3CA 1DYPA 4CEWC 2QE3A 2RE9A 4WZFA 4HK8A 1ZBA2 1GKBA 5CB7A 4XE9A 4LLFA 3SITA 4D7TA 1VRH1 3H3UA 1J3RA 2IZWA 2XVKA 1KXGA 4HL0A 4M00A 2ZGRA 3M1HA 4QGLA 1PK6A 4AEKA 5JI7A 2EF6A 1MQTC 5TSWA 1DBNA 1J1TA 4V1PA 5JLVA 3VDDB 4BM8A 1WLWA 1ZM1A 2Q0AA 2A7AA 3ILRA 1W39A 1N3QA 1G9BA 4Y22B 5K0UB 2YROA 4Q4Y2 4KQ7A 1DQ6A 1HRV1 1VBE2 5DDJ2 3ILNA 1LTEA 4JDMA 4FPOB 3ZFFA 4HKOA 2Y0OA 4HETA 1I6XA 3WOGA 3GF6A 1IGOA 3LSDA 2PHXA 4DINB 1HX6A 3O14A 1ULDA 4OULA 2BBVA 1TME2 4CP2A 1UD1A 4IV1A 3IPVA 3UV9A 2GDFA 3H3ZA 3AZXA 3R4UA 4PBPA 1CAWB 4N43A 1PZ7A 4K6BA 3OTFA 3T1LA 2WNUC 1V6IA 3VZMA 1JW6A 4N7UA 4RHV1 1VP6A 4ISQA 3HWJA 1H2KA 1PO21 3AB0A 2I45A 2JJ6A 5DDJ1 2VNGA 4XF1A 4MGYE 5FO7B 1X50A 3FUOA 4QMAA 3U11A 2ZMKA 1O91A 4Q0QA 3PVOA 2Y0IA 1GICA 4BIFA 4LLOA 2PHLA 3IT8A 4UW4A 5CVRA 1C1FA 3V0AA 4W6WA 4OHWA 1RVF1 2QQPA 1LOEA 4CDXA 4RA0A 4Z07A 4AYUA 2VY0A 3VBRA 3NL1A 3OGGA 3D6EA 2GNDA 2XJVA 1FPN3 2P17A 2R16A 1BEV2 3I7DA 4RD7A 4ZU4A 1GZCA 4XTPA 3AX4A 1RUC3 2HWD3 1LOCA 1GNZA 2VW1A 3OBTA 5DDJ3 1Q43A 3N3HA 4LA3A 3B94A 4OUSA 5DUUA 3ZN5A 2NQYA 1HLCA 3VDDA 3MF9A 3AZYA 1MZ5A 1NA1A 4PLNA 3ZSKA 4FCAA 3PVEA 1FMD2 3GZAA 3LA2A 4KG0A 3V0BA 4ASLA 3MI8A 4ISRA 4QGNA 2R041 4FPFA 2DUQA 2CAUA 4H7LA 4W6YA 1NE6A 3JB4C 1H2LA 3S0MA 1PGW2 4MVTA 4LBJA 4LO5B 3RI8A 3IDEA 1RHI1 3U10A 2UWBA 2HWE1 1N1TA 5L19A 2ARBA 5FMOS 1AL21 1O4ZA 1RUF1 3CJIA 1W6OB 1DGRN 4WM8C 1AF9A 4XFHA 4RL7A 1C8NA 3I8TA 1BEV1 2ZGKA 4GALA 3ZYIB 4HKLA 1QU0A 4FBFA 3TAYA 3VZNA 1SBEA 3AYCA 4AEDC 4FPCA 4KWLA 2GH8A 3WHTA 4CDWA 4JRAA 2PHFA 4XJ9A 3AYEA 1DU3D 1V6MA 4LEJA 4BE3A 4OZXA 1NA1C 1H8TB 1XYPA 2R071 2GAUA 5C6CA 4AHXA 4MLOA 4WVMA 4QPIA 1AR73 1LRHA 2WNVA 3AKQA 3LOIA 4EN0A 5CFCC 3TNQA 1NY72 1TMF3 4CDQB 3V64A 2RS52 1VBD1 1RUF3 2KXLA 1F31A 1N3PA 3EBRA 1VBD2 2IFRA 3MIDA 5CU1A 4XJWA 3VBFA 3PVNA 4FP3A 3AP7A 1GV9A 4FSJA 2WKKA 1X82A 2Q1ZB 2AYHA 2AGSA 2XUMA 3RRDA 4YVWA 2UYBA 1V6JA 1AXKA 4AFCA 3MIHA 3PMEA 3W58A 2DURA 4KBBA 3VZKA 5C8CA 1H2NA 4RSUA 4FOWA 1Q8OA 3DKWA 1VB2A 1O7FA 3VBUA 1IZ3A 4BQ1A 2XJSA 3N7JA 4N43C 2QKDA 2A75A 1RTVA 4I3GA 1G9DA 3MW3A 4IEVA 4WVZA 4FPJA 5ACA1 2WL1A 1MS3A 5A32B 3NSTA