1QXRA

Crystal structure of phosphoglucose isomerase from pyrococcus furiosus in complex with 5-phosphoarabinonate
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
187
structure length
187
Chain Sequence
b'MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-6-phosphate isomerase
publication title Structural evidence for a hydride transfer mechanism of catalysis in phosphoglucose isomerase from Pyrococcus furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase
total genus 41
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature ec 5.3.1.9: Glucose-6-phosphate isomerase.
pdb deposition date 2003-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06560 GPI Glucose-6-phosphate isomerase (GPI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qxrA00
4N9IA 4AVAA 2HKXA 2D5HA 4IEYA 4EROA 4MGZE 1RUNA 5E16A 1CAXA 2BNNA 4J1XA 3EHKA 3NW4A 2OZ6A 2UYAA 4J1WA 1JUHA 1FI2A 4ZU7A 4AQ2A 4XETA 2IXIA 4MUVA 4HBNA 4Z82A 4QGLA 1UCXA 4WBBA 4XFGA 4FAGA 3NL1A 1QXRA 1PMIA 1CAVA 5JSPA 1I5ZA 2K9ZA 2PHDA 3ETQA 2Q30A 5I8YA 3UKVA 3SCHA 2Z2SB 2ET1A 3RPQA 5C8WA 4I02A 1RC6A 4MX3A 4WZCA 2N7GA 1YFWA 4LA2A 5KBFA 2XLFA 1LR5A 5FQ0B 1O5UA 3SHRA 4TLFA 1O4TA 2PQQA 2PTMA 4O9GA 2GZWA 2GC3A 2H6BA 3HT1A 4XFFA 3E6BA 2O8QA 3H9AA 1DZRA 4ZU4A 2PA7A 3OCPA 4I0AA 1Y9QA 2BYVE 4IEUA 2XLAA 4NVPA 1J3PA 5FPZA 1X8EA 5I0RA 1QWRA 4OFGA 4QX5A 4BYYA 2IXHA 2XKOA 4Q29A 3E5QA 3QACA 1NE4A 3WW4A 1ZZCA 1O7FA 2Q4SA 2H6CA 4XFHA 2IXCA 3NVCA 3RYPA 3U11A 1CX4A 3ES1A 1WGPA 4JVAA 3I59B 1LKNA 3FWEA 4IERA 5I93A 1XRUA 3FX3A 3IDCB 5KHIA 3CEWA 1NZCA 1SFNA 4FT8A 5I0SA 1EY2A 2Z69A 5FQ0A 1PM7A 4FBFA 5KHGA 3LA2A 4B29A 4Q0UA 4LA3A 4YNIA 1FXZA 3UKTA 4XFIA 4KU7A 3BCWA 1LB2A 4BH9A 3RNSA 4D7SA 4MGYE 4A2UA 5LRRA 1OI6A 4IEZA 3EJKA 1NE6A 3LWCA 4QXKA 4K8FA 5FPXA 1YWKA 5J3UA 3D82A 2UY8A 4KWKA 1ZREA 4OLLA 3ST7A 2FMYA 3MPBA 4P9GA 2QCSB 3S0MA 1O3RA 4IEVA 4I09A 4UBGA 4WVZA 5BY5A 3SXWA 5JAXA 2BGCA 3CF6E 5F1RA 4LUMA 4L11A 4Q0QA 5KHKA 3ZDSA 3H7JA 4HN1A 3KMHA 2B5HA 2E9QA 2QDRA 1DZTA 2FQPA 3BPZA 1CGPA 3WW3A 3BU7A 4IETA 3D0JA 4HSJA 5CVRA 2D40A 4XF3A 1UW8A 1H1MA 5BV6A 2HJIA 3BALA 3EBRA 4UBHA 2EVXA 4JTOA 3LAGA 3GBFA 4XF9A 4UXAA 2XGXA 4HSLA 4PJYA 3H3UA 1CAUB 2B8MA 2DCTA 4MZUA 2ET7A 2IC1A 4CYDA 4JTNA 2Q1ZB 1L3JA 1GQHA 4IEWA 3E6DA 5FCCA 4AQ6A 3LA3A 5JCTA 4ZU5A 3H1YA 1UIKA 1VP6A 3FZ3A 3KGLA 4QGMA 3H3ZA 4LULA 4PIXA 4Q0PA 2D5FA 5FLIA 3QOPA 4HVOA 4F8AA 1OMIA 4EWAA 4MGKE 3HT2A 1ZZ8A 3ELNA 3EO6A 1IPJA 2ETEA 2Y0OA 5I8SA 4AVBA 2OPKA 3MYXA 3UKNA 3DN7A 3WW2A 2UYBA 3FFQA 1FT9A 4KL1A 4I0BA 1LRHA 1YFYA 3EQEA 4DINB 4E2SA 2QJVA 5CU1A 3MDPA 1ZNPA 2VQAA 4XF4A 2B9UA 1H1IA 3H7YA 4Z07A 5BUVA 4IEXA 1OFNA 1ZVFA 2MNGA 4QGNA 4EWDA 1SQ4A 4EWEA 3D0SA 2XLGA 4RD7A 5FLHA 1V70A 3SCFA 1VR3A 4YRDA 3B02A 3CL1A 4EV0A 4YYOA 4PIZA 1CAUA 3N4MA 4N9HA 5I8TA 1XE7A 4XF1A 5BPXA 2H0VA 1VJ2A 1UD1A 3ES4A 3ROUA 4R8HA 1GQGA 3OF1A 5EZWA 1EP0A 1O3TA 4HZFA 4IEQA 3RZZA 2EAAA 4LEJA 4AVCA 1J3RA 1CAVB 5KHJA 5J48A 2CGPA 2VPVA 2PAEA 4XFCA 3I7DA 5KHHA 2MPFA 1QXJA 1HW5A 5FLJA 1X8MA 3I54A 5BXXA 2OYZA 5K8SA 2PFWA 4Q0SA 4META 1ZZ7A 2IXLA 3IIAA 3H1WA 3S7IA 4JV4A 1YLLA 5LEJA 1EYBA 5C6CA 3L2HA 1RUOA 3IWZA 4LLOA 3WW1A 3M3IA 5CADA 1YFUA 2XHKA 2UY9A 3G7DA 2GH2A 4YSFA 5E1RA 1J3QA 3JZVA 3H50A 3FJSA 2KXLA 1I6XA 1YFXA 2F4PA 3E5UA 2PYTA 3DV8A 1YHFA 1DGRA 4QM8A 2VECA 3TNPB 5FDBA 5J7MA 1DGWA 2WC2A 1J59A 2EA7A 5LEKA 2V09A 3PVBB 2XL7A 4KWJA 2IXKA 3I59A 4LUKA 4AXOA 1OD5A 3E5XA 4QMAA 5JR7B 3NJZA 3KSCA 4XFAA 3RYKA 5JSOA 4H7LA 2P17A 3NSTA 1Q5OA 4I3PA 2CAVA 2GC1A 3S7EA 3BB6A 5EFUA 2BNMA 5LRSA 3RYRA 4LTAA 2I45A 4BIFA 1U12A 3OD0A 4R52A 4IESA 4Q0VA 2ZCWA 3USSA 1O3QA 3LOIA 3KCCA 4E2GA 2K0GA 2CAUA 1X7NA 3O14A 1NYWA 4HN0A 1ZZBA 2Q0AA 5T3NA 4HLTA 1J58A 1UPIA 2GAUA 4F7ZA 3SMHA 3U10A 2PAKA 1ZRFA 2OA2A 3H1MA 3ACLA 3KGZA 3SCGA 3NKTA 4O9EA 4QM9A 4GULA 1CAWB 2IXJA 4ORFA 2BEOA 1ZZ9A 1RTVA 1UIJA 3E6CC 4XEZA 4I2OA 4HVQA 2ATFA 2MHFA 3TNQA 3DL3A 1QY4A 3HIFA 4KU8A 2PAMA 1G6NA 1ZX5A 4HMZA 1EPZA 2GC0A 3LA7A 3CJXA 2QVSB 4MGIE 4D7TA 1O3SA 4FAHA 3IBMA 1CAXB 4E2QA 4XFBA 3H8UA 3M70A 3R6SA 5I0UA 3CO2A 4PIYA 2D93A 1RGSA 3U0ZA 4IEOA 1Q3EA 4IEPA 3DKWA 1YUDA 3OGJA 1WA4A 1WLTA 5I0TA 1X82A 4MV2A 2GU9A 1XE8A 3OTFA 2WFPA 4BHPA 4I01A 2BNOA 1ZZ6A 1O5LA 3LZZA 4YARA 5I91A 2GC2A 1IPKA 2C0ZA 1RL3A 2CV6A 2OZJA 3RDIA 4XF0A 2QNKA 3GYDA 1ZRRA 3CLPA 1Y3TA 2O1QA 1ZRCA 2XL9A 1TQ5A 1J1LA 1SEFA 3E97A 3HQXA 3IDBB 1CAWA 5JSRA 5D1IA 4HVRA 1Q43A 5AVPA 4X6RB 4KWLA 4MH0E 4ONUA 3PNAA 3PLQA 4L2NA 2ZKLA 3FE5A 1NXMA 4X6QB 3VHRA 2PHLA 3C3VA 1ZRDA 5HI0A 2XKPA 3MZHA 3FHIB
chains in the Genus database with same CATH superfamily
4N9IA 1AX2A 5A1AA 2BBVA 3WUCA 4AVAA 4PF5A 3J7NA 3KCXA 1R092 2QQJA 4ZY9A 4FTSA 4IEYA 3MLKA 1H6YA 4P08A 4Y4RA 4I30A 5E16A 1AX1A 1BLZA 5FJKA 2JXAA 5FYIA 1RVF3 4IGPA 2VZTA 3PVOA 5IW0A 2WT0A 3BOPA 3NW4A 3RGBA 3S57A 5DUVA 4MSVA 5F39A 1C5IA 1FI2A 2XVKA 4AQ2A 1KRIA 2DBIA 3U4SA 2E31A 4MUVA 3MEPA 1AXKA 4GD4A 1HB3A 1R1ZA 3CIHA 4BXFA 3TEYA 4Z82A 1KXGA 4AFBA 1KGYA 1VBE3 2V4AA 3I49A 2WYFA 4FAGA 2GNBA 4MVTA 1D7PM 1CAVA 5FRAA 1OKOA 5JSPA 3VL8A 1RMU2 2X53S 2PHDA 3ETQA 1NLRA 1V6KA 2F17A 4BA6A 4XACA 2V5DA 4YVWC 1QJY2 5GZGA 4BE3A 1UOGA 1UX6A 4C91A 4EE2A 4UW6A 1W39A 4FSJA 5BYNA 4MX3A 2XONA 3M2MA 3SITA 1H2LA 2N7GA 1S0EA 2HYKA 1OA3A 4CEYC 2X29A 1ZBE3 4GMP0 1RB8G 3WG3A 2W68A 5FQ0B 1O5UA 2WQZC 3SHRA 5DG2A 2YXSA 1KDMA 3ITQA 3ZKYA 4Y20A 2YBSA 4XFFA 5K0UC 1MVQA 1PHMA 2VZUA 5FFOC 3E6BA 4FFIA 2O8QA 3RFRA 2DYCA 1YI9A 2HWE3 3BU0A 2JJ6A 3O1TA 1DZRA 4ZU4A 2PA7A 2ZOEB 4I0AA 4XJ8A 4CCMA 1Y9QA 4M01A 4DXTA 5B2GB 3OOXA 3WNOA 5HPOA 5JI7A 1EAH3 3WP3A 1PIV1 1V00A 3PVEA 2BJSA 4CPBD 5FPZA 1C1LA 5I0RA 5IVEA 1CESA 2E63A 4OFGA 4FPKA 1ZBA1 2VBPA 5C3QA 4XQDA 4YVSA 4GKXA 2JDNA 1LOAA 3I2OA 2JD4A 2J7MA 3WOGA 4CU6A 4O7XA 1SCSA 1ZZCA 2DVDA 2R063 3WQBA 4PDWA 3V64A 2A3XA 3DECA 1G9DA 1GFF2 5FZ3A 1PNGA 4QDRA 5LA1A 3HWJA 5FZBA 3GZEA 1K5MC 2YGLA 1ENRA 4BIOA 4EQVA 4NE9A 3A21A 4E8CA 2ZZJA 1VAMA 1R083 1CR7A 4AYUA 4GWIA 2OIIA 3V0BA 4RR3A 3AFKA 1RUJ3 2RM22 3AZYA 1F5FA 1JH5A 1LU2A 1WGPA 4AI0A 4YM0A 5A7WB 3BTAA 5FTTC 2HEVF 1AYN2 4CCEA 1OH4A 1PO21 3VBHA 4ISQA 2DFCA 1G8WA 5I93A 3WR0A 5J1XA 5FUPA 4K6BA 5FY7A 5CFCB 2FDIA 5FOBB 1EUUA 4W6YA 1FNYA 1W3VA 1NKGA 3MF9A 5FZOA 3EYPA 1N1YA 3LKJA 3OGVA 5FZCA 3WNXA 4S2HA 4FT8A 1LULA 2X09A 3R4UA 2A6VA 1PM7A 1DFQA 1MS0A 4FBFA 2VJXA 3LA2A 3IDAA 3PUHA 1PK6B 2OUHA 3HN3A 1PGW1 2XUMA 2WWUA 4K20A 4P9YA 4YW6A 3UKTA 2VZOA 3LIGA 5JXHA 4RHV3 5F9TA 2HWF3 4MGQA 4MGYE 4YW4A 5CNAA 5LRRA 5F3IA 1NE6A 3LWCA 2Y8KA 4MXWA 5J3UA 2FDFA 4CUGA 4DNYA 1DYPA 4KWKA 1NY72 4OLLA 5ACA1 1OF3A 1EV12 2CYFA 2FMYA 1W03A 5HV0A 2FDKA 3S0MA 1MZ6A 4LMFA 4YVSC 3OJBA 4HPKB 4CP2A 2VULA 2DBNA 3V0AB 5JAXA 4RL7A 3VBFC 5FMBA 1WMEA 3KQ4B 1H9PA 3DXTA 5A1FA 1TMF3 4L11A 1UN1A 5D8AA 2B4KA 4PDWC 3VD7A 3I3BA 3H7JA 1VIWB 4HN1A 3UNPA 1G86A 3N9OA 3SKVA 1B09A 1IKPA 1RUC2 1W2OA 4AWDA 1UY4A 3MW4A 5FP7A 3IPVA 4A4AA 3LEKA 1QDOA 3TN93 5LWBA 3BTXA 4IE0A 4Q2FA 1UW8A 1H1MA 1POV3 1XNBA 5IK4A 1UXZA 2ZX4A 2JE9A 2BWCA 2VNVA 2VTXA 4DPNA 4LBOA 4QHOA 4AEDB 4YW2A 4UBHA 3WDWA 5EJZB 1HRV2 1VALA 4LIUA 5G05L 4PQ9A 1Y9MA 5DZEA 1XU1A 2BP6A 2W3JA 2ZGKA 5LZ6A 1Q8OA 1CAUB 2ENRA 2B8MA 4MZUA 2ZEXA 1YI7A 3ME2A 1D4M1 2PMWB 2VVFA 2R1BA 2WA4A 3O12A 4Q4V3 4JTNA 3ZSKA 4A7YA 1JXNA 1L3JA 1D2QA 5EQUA 2GNDA 2XVLA 1K5JA 5F5QA 2CY6A 1UU6A 4AQ6A 2WNUA 4ZKTB 4ZU5A 2MEV1 5IAXA 2JE7A 1HIXA 3WVJA 1FV3A 2D44A 1QJX3 2DTYA 2ARCA 4BCUA 2XR4A 3NAPC 3IMMA 4LHNA 4LULA 2FCTA 4XCBA 3VBUA 4PT6A 4PIXA 4LBNA 3ZXFA 2WO1A 1PVC3 4IV3A 5AVAA 5FLIA 3QOPA 4HVOA 5FY8A 1FOD3 2D3PA 4SLIA 5BNQA 4JQTA 4K21A 4ASMB 4MGKE 4NRQA 1KFXL 5L7OA 4LBMA 3CZUA 4Z92B 2QQKA 5C4WC 5JR2A 1RUE3 2Y0OA 4Y22B 5FREA 3SQOA 4YW1A 4LHSA 2VAUA 1AF9A 5A6ZA 1GP4A 4AG4A 1H4GA 2VGDA 2BVBA 2JKBA 2QFEA 2VCMA 2A7AA 5D8AC 2YPJA 2O0OA 4MO3M 2YPDA 1DZQA 4BQWA 2W87A 4MHRA 3IAPA 4M3CA 5DZFA 5FY9A 4KL1A 3VL9A 4I0BA 3ZFEB 1LRHA 2EALA 4FP2A 1QOOA 1KJLA 1V6MA 4E8DA 5I0DA 1SPPA 1GYKA 3LPGA 4NHYA 4S2GA 5LBCA 3SH3A 3WCRA 3P5BA 3H7YA 2VNOA 1ULGA 3J7HA 1JOPA 3AM2A 4J25A 5IHRA 4QGNA 1G9FA 1PO13 3CJIB 2YUEA 4JGZC 4EWEA 1SQ4A 2FBEA 2XLGA 4NWWA 4RD7A 5LCWL 2VY0A 3AC0A 2C26A 4FCAA 3ZXJA 1WWYA 5CA6A 4N90A 4YRDA 1FMD3 1H2NA 2K2SA 5ERLA 4XTPA 4UOJA 1LOCA 3N4MA 2QKDA 1GWKA 4YZ1A 2ES3A 3LEGA 1G9CA 2C9KA 4KMQA 5CFDB 3Q8EA 1MQTC 1MS3A 1VAKA 5GLVA 5JPMB 5FMCA 4NPRA 4XBLA 1UD1A 3MIHA 1M06G 1PIV2 2XVGA 4N43A 1WA6X 1PZ9A 3OPTA 5GZDA 3IT8A 3B9IA 1EP0A 5T5OA 3VV1A 4IEQA 3T1LA 3RZZA 4IV3C 1FYUA 1V9U1 4YW7A 1N1TA 2ZXQA 1ZBA2 1W6OB 2BV4A 5KHJA 3KT4A 2VPVA 5A33A 1IG3A 2R16A 4L0PA 4XHBA 3FC0A 2ZGUA 4MGSA 1RHI1 1QXJA 1XNKA 5HBAA 5FLJA 1QF3A 2QQIA 3DPRA 5BXXA 4Q4X3 3ZXGA 4BQ2A 4UWDA 4Y1VA 5FY1A 4ZZ8A 4NHKA 1OC1A 5SV8A 1TE1B 4UF0B 5C5TA 3UGHA 4XIKA 2WZPP 5FMOL 3IIAA 3T0BA 3T0AA 4AQSA 3INAA 3LPFA 4IW3A 4JV4A 1PX3A 2XXZA 1ULPA 3IWZA 4HT1T 3M3IA 3TBDA 5CADA 1OT5A 2JG9B 1RIRA 2XHKA 3OPWA 2WBKA 4P02B 2OQ7A 4INDA 5C8CA 1TG7A 4K1YA 4OI1A 5DZGA 3BTZA 1PO22 3GJBA 4H14A 1NLSA 2KXLA 3C7EA 3EMRA 2H0BA 5K4LA 3WP6A 3N7LA 4V2VA 4E27A 2VVEA 3JU9A 1OUXA 2RDRA 2V72A 3TNPB 4L99A 4XAAA 3VDDA 2G9ZA 2PXJA 4XBQA 1J59A 5LEKA 2V09A 1YRZA 3PVBB 1JZ6A 4YWAA 1HV1A 2TEPA 1PGW2 4KWJA 4Y5TA 3URFA 3C7GA 4GMP3 1S2EA 1OD5A 3O0VA 2VCBA 3NJZA 3KSCA 3O5SA 3RYKA 4R9AA 2VMFA 1HB2A 2JWPA 2RS11 4COUA 4U2AA 2JIGA 2P17A 4N43C 2EXIA 2NM1A 4Y1YA 2DF7A 3ZPYA 2BWAA 1A34A 5HCFA 1Z7S1 5ACA2 4W4ZA 3O1UA 3VBSB 3VDBA 3B5LB 4B8EA 1JYTA 3KT1A 2BNMA 5FMOS 4JRLA 5LRSA 1VBD3 3KT7A 1KS5A 2I45A 2J1AA 2AH2A 1PK6A 2VOKA 4PBPA 2B46X 4BQ1A 4LO5B 5FYZA 4YGDA 1S2KA 4IESA 4Q0VA 5DUWA 4YZ5A 3BKZA 1UOFA 4H3WA 1O8PA 3N3HA 1W6NB 4H2AA 1R64A 1YCIA 2NZ9A 2G9FA 2R6QA 3A7QA 3GM8A 4YG6A 5DQ0A 5FK8A 5BNNA 5F37A 5IATA 4DFSA 1RINA 2E53A 3C8XA 5CEHA 4HN0A 2X5IB 1TNFA 2Q0AA 5T3NA 3SNMA 4AEMA 3S5AA 2BGPA 4GALA 5KC5A 4WVWA 2TUNA 1JW6A 2Y0IA 2GAUA 4A42A 1H2KA 4RQPB 5JDBA 1QEXA 2YB7A 2WSVA 5JZGA 4MADA 5F2WA 3AYAA 4GZ9A 1VBB1 4XXPA 2XG3A 5H9SA 5C8CC 3ACLA 3SCGA 3NKTA 2JB4A 3J7LA 4IV1A 2YU1A 1BBT3 1GV9A 1SLAA 1OLRA 2C5DA 4BQ4A 1COV3 5J36A 1EPWA 3GHNA 1CAWB 3WQ7A 2IXJA 5FZ9A 5K0UB 1ZZ9A 5DABA 5GJ6A 4UYBA 1D4M2 1ZA7A 5T5JA 4ES9A 4XUQA 2ADDA 1U5XA 4MLOA 4DRVA 1ZBA3 2ATFA 5EYXA 2MHFA 3LCPA 1RUF1 5JUVA 2MEV2 2VZ1A 3AVRA 2ZGMA 2PAMA 2A3YA 1PX4A 5JOYA 4OULA 4HMZA 1HJFA 3FFZA 5JI9A 1AR73 1VBC1 5A3OA 5CFCC 2ZGRA 3CJXA 4MGIE 1GMMA 3DEMA 4XJZA 4AOCA 5FY4A 5E88A 2Y6LA 2A6ZA 2HWB1 4Z2WA 5GZCA 1F5JA 3AZZA 5JXJA 3LQCA 1LOGA 3NNMA 3UJOA 2NMNA 4E2QA 2C6SA 2DWRA 1MZFA 3M70A 4OYUA 2JD9A 2VNGA 1UMIA 5I0UA 1RYYA 1DGRN 4PIYA 4IE6A 1PK6C 4WVVA 1PGL1 1Q3EA 4IGQA 2R0FA 2PELA 3OGJA 1JZ7A 2VW0A 3THTA 2ZTNA 4EZ4A 4ZZ5A 2HLEA 4RFRB 3NV4A 3RWKX 5JOXA 2E26A 4DXSA 5CKNA 3AYCA 1XE8A 5DDJ3 3TYJA 2WFPA 4Q1PA 4I01A 4BHPA 2ZMNA 3PURA 5FXVA 3V56A 1JHJA 2JDYA 3LZZA 4YARA 3WF3A 3WHTA 5I91A 4LKFA 3MIFA 3PUQA 2A73B 2OZJA 2P1BA 5GZFA 5A3UA 4DXZA 5JZGC 4UFLA 3CLPA 1W9FA 3VKLA 4LR4A 1C57A 4IV1C 1OLQA 1W6MA 1W06A 3K48A 4Y20B 5FZ8A 2P5BA 1DCSA 2WLPA 3BODA 1SEFA 3D4KA 4L8QA 2EXKA 2G9GA 1N3PA 2P2KA 3B3QE 1HRI3 4XPVA 2WYSA 3ETPA 4XVHA 4MH0E 1NLQA 4FPGA 5AFEA 1QMJA 4L2NA 4KI5M 2DCJA 5JVVA 4QD2A 1GOFA 3J8F1 4X6QB 3RWNA 3VHRA 3WUDA 4GA9A 3C3VA 3AYDA 4YGCA 5HI0A 3ZYPA 1W2UA 2AYHA 1DQ6A 4D0QA 2SLIA 5FY0A 4WZFA 2X10A 1ZA4A 1L7LA 4AHXA 3U4XA 1V9U2 3PJYA 3AJYA 3WX5A 2XUEA 1WD3A 1WLWA 4MGZE 1OUSA 1RUG3 4P5HA 5LBFA 4BK5A 5FYVA 4EROA 5A6QA 1C8M1 1DQ2A 2O8OA 3HBKA 1REEA 3BPSA 4J1XA 4PDWB 5IFTA 3UGFA 1BXHA 2UYAA 1W8TA 2ZHNA 3KS7A 4LLFA 4XJ9A 3VD3A 1X9PA 2ILMA 1LGCA 2JECA 3N9MA 4ZU7A 1OURA 4BWOA 4R4ZA 4FI9A 1G9AA 3I2JA 1YQ8A 2WS93 3V0BB 4GKYA 2GNMA 3HQRA 3T2OA 4RR3B 4XQ4A 3O1OA 3UT0A 4BB3A 1I5ZA 2K9ZA 5A3MA 1D4M3 5JIAA 2HBUA 3P1IA 2VZRA 3UKVA 3ZN5A 3VBHB 1POV0 4BQ3A 3AKPA 3JUUA 1XYPA 2YZ4A 4M4RA 4BPZA 4XMIA 1RC6A 1XSQA 4LOTA 4WZCA 5FZOB 1WBLA 3I3MA 3CMGA 4O61A 3NKGA 1H0BA 2VMIA 5L9VA 2I74A 3K4ZA 3OUIA 4XBNA 1UZVA 4Y1ZA 4DEQA 4N53A 3TOJA 4NJ4A 4NHMA 1AYN1 3JQXA 1UWWA 1WUVA 3LOBA 2EIGA 2VOVA 3J7MA 4M3CE 3NV3A 1IQAA 1H2MA 3OB8A 5FZ4A 4AEKA 5KR7A 2WRAA 3OCPA 4BK4A 4MXWB 3MW2A 5F6LB 5LBBA 4YM3A 2E32A 2FHRA 2BYVE 3CJIC 3OBTA 2R041 3UETA 2RS12 1SACA 2RMU3 5F5IA 1YNAA 3MUZ1 1HXS1 4CXYA 4XHXA 5KXEA 1Z7S2 2PHFA 4MYEA 1QWRA 1J83A 4A45A 1WMDA 4Y5Z0 4AHZA 4OUSA 1DU3D 3I3QA 4O65A 3E5QA 4LKDA 5D8AB 2O14A 5FZ1A 3LDBA 3DUIA 2D3SA 3P6BA 4AHWA 5CFDC 1GNZA 4W6WA 5FYBA 2WZR1 2GALA 3Q8CA 3AFGA 3TEWA 3A0KA 1XB9A 5JOWA 3U78A 1W90A 1AXYA 2H6CA 3IPVB 4A41A 5L36A 2B42B 4UW4A 4XFHA 1OHFA 4AZZA 2IXCA 1VRH1 5FP9A 1JYWA 3ECQA 2QQWA 1V6LA 3UK9A 3POGA 3ZSMA 3VBOA 2ZMLA 3GXUA 2LS6A 4ZONA 2VMDA 4JVAA 1VBB2 2DTWA 2ZX1A 5DAQA 3I59B 3FWEA 4GWMA 2XJVA 3WT3A 3QBQA 4UAPA 2HEYF 4Y3OA 2G4IA 3VKOA 4B4QA 4AVTA 1DYKA 5DAPA 4ZXEA 3KF5A 2BZDA 4LBQD 1VB4A 4JX0A 4R4XA 1ULDA 3ZYFA 4AFCA 3CEWA 1UU4A 5C3SA 2D43A 4K3UA 2Q8CA 2WNUB 1GWLA 2Z69A 2JG9C 1CJDA 4RQPA 4CDWA 1C28A 1RUF2 2WWJA 1QQP1 2RS53 3MO4A 3UJQA 3VBUB 2WKKA 1FXZA 4XFIA 3BCWA 3AXEA 1HN0A 3AP5A 1OVPA 1RHI3 4K8RB 4IV3B 4NIIA 3WHUA 4D7SA 1MR5A 4OI4A 4CDQA 1OI6A 1VBC2 3AXDA 1W2AX 3EJKA 5FPXA 1JYVA 1H30A 1FNZA 5L7OB 2HWB2 3D82A 2UY8A 3OYWB 3SH5A 3N9QA 1QU0A 3DF0A 3ZOIA 2Q8OA 5FYMA 5ISLA 2QCSB 3OEAA 1UY0A 5A6XA 4IEVA 1O3RA 2C1FA 3WNLA 1AX0A 2QBXA 4PI0A 4QB6A 3SXWA 3WZ1A 1W9YA 3BIWE 5EYYA 1H6XA 1FAYA 2VZPA 3WDXA 3RZHA 2NLRA 5F1RA 4M3CB 1RJ8A 4LUMA 2R0HA 2F6BA 4WM7A 3WV6A 4DUVA 2QUOA 4A7KA 4KNCA 1LOFC 2WIIB 2L9LA 3THCA 1SPPB 4XILA 4NPMA 2HWD1 5L9BA 3VBSC 1DZTA 1CGPA 2R073 4HKWA 4BU2A 1UL9A 4IETA 3D0JA 2OKXA 4E4ZA 4OUEA 3VDAA 2BOIA 4S2DA 4B1MA 1W6PB 4GWNA 5BV6A 4AI2A 3POFA 3BALA 1X36A 3EBRA 2OW4A 4OUMA 4JTOA 1GP5A 2W5FA 3GBFA 2D6PA 2YROA 1BHGA 1UYYA 5LY2A 3ZYGA 1ZM1A 4W50A 1OVSA 4XDPA 4AHYA 4UFIA 4CEWA 2X5IC 3POJA 4CDXB 3UL2A 4ES8A 2IC1A 2LW8A 5DUXA 4CYDA 1W9TA 4JCKA 3GDBA 2FCVA 2JDKA 5JLVA 4RQPC 4CDWC 3E6DA 5FCCA 5FZKA 4F83A 4OCTA 3O0WA 2FDHA 1OLMA 5JCTA 1WMFA 3WQ0A 2XJPA 4N43B 3J8F2 3M3CA 2PHXA 3FZ3A 4QGMA 1LEMA 2RS33 4B7EA 1NOVA 2OPWA 3AL5A 1JOBA 3JD71 3Q9OA 4R9CA 1LAJA 2CHHA 4LNVA 4QU1A 4AW7A 2D5FA 4DY3A 2UURA 1HQLA 1E57A 5A33B 5FUNA 5A7QA 1JYCA 3LEIA 4EWAA 4FPOB 2JDHA 1ZZ8A 2YDEA 2VZ3A 3ELNA 1TZOA 4AI3A 3AZXA 1IPJA 3DPRB 1C8M2 3VKFC 1OA4A 1QOSA 2ETEA 1XYOA 3OG2A 1HDKA 4WVMA 5I8SA 4UW5A 1CPNA 1URXA 4RGAA 5EJ3A 5T50A 3SISA 4NROA 4FPJA 3ZYHA 5DAXA 3BUCA 2VMHA 1GLHA 4WM7C 4AI9A 3O1MA 2AUYA 1LNSA 3DCQA 4CEWC 5E8AA 3GCXA 4H55A 3ZLIA 4GB31 2UYBA 3FFQA 1FT9A 1UY3A 4QHBA 1U5IA 1GICA 1QJEA 2AGSA 3VGIA 3EQEA 3HOBA 3I97A 2J22A 3CU7A 4LE3A 4U36A 2ZHKA 5C8CB 2VXJA 1UF2C 2VQAA 3N7KA 3N9PA 4XF4A 3THDA 3K4AA 3POSA 1H1IA 4Z07A 5C3RA 5BNPA 1RUF3 2IFRA 4IEXA 1NUKA 1OFNA 4RGKA 1ZVFA 2MNGA 1XNAA 1HX6A 2IWGB 3PTRB 3VDDB 3RI8A 2ZKNA 1V70A 1VBC3 4QWNA 1OSGA 4FOWA 1BMV2 4P5YA 3B02A 1S0BA 2GP5A 4YGBA 3VHOA 4EV0A 2Z42A 1KQRA 2VNRA 1LGBA 3ACGA 3B7MA 2CDPA 4ZPIA 4PIZA 2DV9A 3THPA 3LSEA 5FP8A 4A6OA 2JDUA 5LB6A 4COYA 3B00A 2ZEYA 1XE7A 2EICA 4FQ4A 4QPGA 3E1F1 2J42A 4NHXA 1BYHA 3RJ2X 2RJLA 1O4ZA 2R042 4KQ7A 4XJWA 1DLCA 3FHQA 1QJU2 3IM0A 3ROUA 5EZWA 1HXS2 1R093 3T3YA 1PZ8A 4AFAA 2EAAA 1RUI1 5F6KA 5G04L 3I8TA 5FYYA 3ZFFA 3AVSA 3EB7A 4TSVA 2P37A 4IQPA 3ACHA 1WBFA 3O0XA 2PAEA 4XFCA 4BQYA 4OQ9A 1YJLA 5F8PA 4CU8A 5FZ6A 1WZXA 2VQTA 1X8MA 3KZ4C 1UYZA 2WZR2 3X29B 5BNNB 5K8SA 4DEVA 1V6OA 2IUWA 1OD3A 3ON7A 5FZDA 2A71A 5CIRA 1A3KA 2PFWA 4XOGA 3F95A 2QZ3A 1GSLA 4CCKA 3TWIA 1A78A 1RMU3 4JAAA 3ZIXA 1VRH2 3WF1A 3L2HA 3K2OA 3LD8A 1QJY3 4KH9A 4ET7A 5JZGB 2R32A 3G7DA 3PJQA 1RITA 4ITCA 1BEV1 1RXFA 4IV1B 1GZTA 3WDVA 3WXPA 2GH2A 2RDQA 4QT6A 5E1RA 3JZVA 4B4RA 1JHNA 1UY1A 4XJUA 2PLV1 1H9WA 4OHXA 2YC4A 2R49A 4CTEA 3NNGA 1I6XA 1YFXA 2VOXA 4Y4YA 2F4PA 2WZ8A 3VKMA 4AI8A 1WD4A 3E5UA 2Z5WA 4CCJA 2QQVA 1YHFA 1S0GA 2UU8A 4LPLA 4RR3C 4XURA 5C70A 1NZIA 5FPBA 3J4UH 2WC2A 3V65A 4DO0A 3KLSA 3PMEA 3W9AA 3VBHC 4YLZA 4GH4A 1QQP2 3FHAA 4Q4W1 2IXKA 3IDEA 3I59A 4LUKA 2RV9A 1AYM1 1QH7A 4Y33A 3ORJA 5JR7B 4XFAA 2IVIB 1XU2A 2TBVA 1C4RA 3JXSA 3T1MA 2VQ0A 3NSTA 5A1LA 4BOWA 1Z0HA 2CAVA 2PHUA 2GC1A 2UWCA 2WT1A 3BB6A 3NMBA 2XJUA 3S7EA 3RYRA 2VZQA 5M0TA 4CPBA 4QQLA 4NIHA 4CDUA 3VUOA 2XWJB 1PM4A 1AR62 2WQ8A 3OGSA 2VBDA 2WLQA 3LOIA 1QDCA 4CXXA 1LECA 2K0GA 2VUCA 1OFSA 2QQOA 3OYWA 1X7NA 1VBA1 2HWD2 5JIUA 1OOPA 4JQRA 5A3LA 1NAEA 1W6QA 3ZXEA 4LITA 1GKBA 1QNWA 2VTXJ 1UPIA 4OMDA 2RM23 4JGYB 4FVVA 4QXHA 1GZCA 3SMHA 2ZBJA 4QX8A 1AYN3 3POYA 1W6MB 3C2UA 3AP6A 5EPAA 2P3YA 2C9AA 4YFZA 4BZ4A 1X33A 3JQWA 2FZ1A 2OA2A 3H1MA 3KGZA 4EJRA 1IOAA 4O9EA 1YQ5A 3KQRA 2WZEA 3I3EA 2LROA 4LHKA 1U5ZA 3D5OA 4HK9A 1HQWA 4ORFA 2BEOA 2WDBA 3ZO0B 1Q8SA 3ZX7A 1HXS3 4CCNA 2Y26A 5F3GA 3ZXLA 5GLTA 2CGNA 3OBAA 5FZMA 2XMLA 1W6PA 3M3OA 4CP9A 4GH4C 3DL3A 4GXLA 4KU8A 2AEZA 5GALA 1NCQB 1F31A 3RZKA 2P6HA 3LDRA 3GCWA 5FYUA 4M0NA 2Q8EA 2KA3A 4XUNA 3JD72 4EZHA 1MZ5A 1UZ0A 2A1XA 3MIEA 4AFDA 1EV13 3PUSA 4CDXA 4DZGA 2A3WA 1KJRA 3M7AA 4X8NA 1J1TA 5DPNA 4FPCA 3ZM8A 2WNUC 2WO7A 3AJZA 1UZZA 1HV0A 3N9NA 1VRH3 3R6SA 1W3XA 2EAKA 2Y6GA 3NQHA 2D93A 1RGSA 3GNEA 4JHZA 3U0ZA 3VBUC 1UU5A 1JYIA 2Y33A 1YUDA 3POIA 2JDAA 1AR82 1FPN1 1JTZX 1Q8QA 1IS6A 2OVUA 1DHKB 1F4AA 2ZJCA 1UXXX 5FYHA 3W58A 1R1A1 3VB9A 2EIEA 2WL1A 2XBO1 1NG0A 3N36A 2GU9A 1RUC3 4GB32 4AFMA 5L7OC 3OTFA 1W2TA 5L73A 3UV9A 3ALQA 2WR9A 1O5LA 2LUWA 4HXCA 3HAGA 3N35A 1RL3A 2DDUA 2CL2A 3RDIA 1YIFA 3GYDA 2FMDA 1AR92 4LO4B 1AUYA 1HRV3 1QQP3 4RGGA 2D6MA 2GN7A 2PQSA 1ND3A 2JB8A 2Y6JA 4OZXA 3ZXKA 4CCOA 2W39A 4CUAA 3BIEA 3OUHA 3NNLA 4N53B 4QKBA 5JWPA 1ZRCA 4HK8A 3RZLA 1J1LA 5FYSA 1CN1A 3E97A 2RR12 3HQXA 5APAA 4MHUA 5GM0A 5FZHA 2XOMA 5D1IA 4OI2A 2WNEA 1LU1A 4HFSA 4HVRA 1Q43A 4YPJA 4QX7A 1DDLA 2D7FA 5J37A 4F3JA 2RJ2A 4JHTA 3I2DA 4ONUA 1GWMA 4Q27A 1SLLA 4QX0A 5FXXA 3FE5A 1BVVA 1DBNA 5J96B 3NV2A 5IK7A 1YXWA 3H3LA 3UYJA 1LEDA 2XJSA 1M4WA 4QGLA 3ENRA 3MZHA 3WP4A 3WNPA 2WA3A 4P9IA 1RUI2 4LJHA 4MOAA 1S0FA 4CDXC 1LOEA 2D5HA 2QE3A 1XQNA 4FPEA 2YYOA 4IE4A 4UFMA 1RUNA 4ARXA 2XJRA 1Q56A 1UPSA 2BNNA 2CDOA 3ACFA 3EHKA 4YZ2A 2SBAA 1I1EA 1MEC2 2OZ6A 3KVAA 4J1WA 4KWUA 1JUHA 4QQOA 1AJKA 2D6NA 1JYNA 1A8MA 4ZS3A 3O7OA 5FKCA 3H8RA 2C24A 4HBNA 5IVBA 1XOYA 1SBDA 3VZOA 1O91A 2Z4FA 1OLME 3NL1A 1B35A 5DXDA 2J1TA 1H4HA 1QXRA 4XUTA 2G1MA 3VBOB 1PMIA 1VBE1 4EN0A 4NAMA 3DPRC 4I3GA 5AC91 2Q30A 1U0AA 3LIHA 1BEV2 2Z2SB 1PMJX 1OA2A 1AL0G 2BERA 2ET1A 2NN8A 4CCLA 5BNOA 3H0OA 2PLV2 4I02A 3W5NA 2Y6HA 5CKQA 5KBFA 4D6RA 1W0PA 3M3EA 3GHMA 2P6CA 3JD73 1L7RA 4QX2A 4CDWB 1CWPA 3AZWA 2PQQA 3W5MA 4O9GA 2EIBA 3HBZA 3WG4A 2BU9A 2GZWA 2GC3A 5KC6A 3HT1A 2YBPA 5FZFA 1POQA 4Q4W2 4CDQB 4A3ZA 1S55A 1AYM2 1BQPA 4IE7A 3WNMA 2VBBA 3GBGA 1KD7A 1W0NA 2W9XA 2HWE1 1PIV3 4UT5A 1D0GA 4PHZA 4XE9A 4IEUA 5CKMA 3VDDC 3VBRA 2J1SA 2FDJA 3BN6A 4KGQA 3HD8B 3TEXA 2OX0A 5FZLA 3T4VA 4UI9L 3M1HA 1H8TA 3C7OA 3U75A 1W8UA 1EAH1 4GB33 3HR9A 2RDNA 4L9BA 4BYYA 5FYCA 2K46A 4QX5A 2OXBA 4D94A 2IXHA 1LCLA 2DCYA 1WCQA 4QAWA 1BVP1 2P3KA 4WM7B 5JMOA 2DCKA 2JIJA 2QDNA 3BI3A 1MS4A 1V0AA 1XJAA 3QACA 3RS6A 3ZSJA 2Y6FA 4RS5A 3WW4A 1O7FA 1QJFA 4K7JA 2AENA 3VLBB 5EXOA 1CIWA 2Q4SA 5DAWA 1ZYBA 3B93A 2V73A 3LF7A 1ULFA 4BXSV 1GOGA 3WDYA 5IT6A 1VBA2 2BRTA 4QX3A 1LJ7A 3LDKA 3POBA 3B01A 3R0RA 3NJXA 4JC1A 1B35C 1GQPA 1QXPA 3FL7A 2ORZA 2QQMA 4OVEA 4X8PA 1LHOA 1W8ZA 3RYPA 4XUPA 3KV9A 2LTNA 3U11A 5C3OA 3ES1A 1R081 1TME1 1PO23 4LOSA 2DU1A 1REDA 2XJTA 1RUJ1 2BQPA 4HKLA 4XAEA 3PIGA 5BNNC 4IERA 2ID4A 3SKJE 5CAZA 3H8XA 1XRUA 3FX3A 4CEWB 3WF4A 1XYNA 5ABJA 4OHWA 4A7ZA 2A6YA 5C9AA 1C5HA 3IDCB 1BJQA 4H7MA 5KHIA 3PUIA 4TYSA 2CNAA 1F4HA 3FUQA 4XXAA 4JGYA 1AL21 1Y43B 3MLLA 4AE2A 3OUJA 3D6EA 4XJAA 1OF4A 5KHGA 1ND2A 1GZ9A 1VB2A 1GZWA 4PLOA 1GNYA 2A70A 4LA3A 4YNIA 3FLRA 5A7OA 4KU7A 4P14A 1LB2A 2Q1FA 2A6WA 1ASJ1 4DOUA 3RNSA 1XNDA 2VW2A 1WKYA 4A2UA 4ATFA 4IEZA 4QXKA 4RHV1 4CP1A 1LHVA 3LE0A 2VMEA 4N7UA 5ACA3 3POWA 1H8TC 2P4EA 1ZREA 4WVMB 1S2BA 2ZACA 3MPBA 4P9GA 3PUAA 5FY5A 1N3QA 3IMNA 4OQ8A 4UBGA 2B9VA 4WVZA 3NNJA 3AMQA 1DLLA 3I2KA 4TLGA 5TSWA 5BY5A 4P9WA 5EIYB 2OT7A 2BGCA 2QQLA 1NCQA 3UGGA 1FPN2 4Q5OA 3CF6E 3HMYA 1IS5A 3R05A 2W52A 2NPIA 4Q0QA 1R1A2 2WFF2 4YM2A 5KHKA 1U5YA 2KM2A 2XBO2 3ZDSA 3WNKA 3ZMOA 1KDKA 3KMHA 4L97A 1HQNA 1KS4A 2WO3A 2Y34A 3KM5A 5K7PA 1CQ9A 1I9RA 2B5HA 2E9QA 4XDOA 1XPWA 3S30A 5LATA 2CWSA 2V5YA 5T5PA 4DMIA 2ZEZA 4C90A 1WCSA 2AR6A 3M8LA 3WLUA 3WW3A 3BU7A 2ZGTA 4GJYA 3CDZB 5BNPB 3ZXDA 2WN3A 3NRUA 4XF3A 3QLQA 4IXLA 1SG3A 5FP3A 2ZX0A 1JOJA 4YG0A 5FV3A 1AYM3 1OQ1A 3OD4A 5C33A 2EVXA 3I2FA 3LAGA 2C4XA 1ZRIA 4XF9A 3F2ZA 1F2NA 3JB8A 2XGXA 2X05A 3T2PA 1O4YA 5ANNA 3H3UA 1ACCA 1DP0A 4LO7A 2DCTA 3R4DB 1NCRA 2ET7A 4YZ4A 2Y38A 1A8DA 2Q1ZB 1GQHA 4JGYC 4IEWA 4QPGB 2MEV3 1SBEA 4Q4V1 5FWJA 1ND2C 4AL9A 3LA3A 1MACA 3H1YA 1LODA 1VP6A 2WNOA 3HN1A 4NRPA 1Y7BA 3KV4A 2QZ2A 4G3YC 1BMV1 3KGLA 1KFUL 3OY8A 5FIXA 1SFPA 5IYYA 5KXBA 1QJX1 2LALA 4Q0PA 4B7KA 4JZRA 3IZOA 3ZFFB 4D6QA 3CZJA 4F8AA 4N8MA 4ASLA 3DKQA 1PVC1 2ARBA 2WSUA 1VBA3 3ZMNA 3EO6A 4Q1RA 1E5IA 1FOD1 2ZGOA 1W8OA 3ACIA 3OEBA 3WSOA 1D0HA 1UKRA 4V1PA 2YMZA 1JMUB 2W47A 4FPYA 3SEPA 1DQ0A 1QJU1 4AVBA 4XMAA 5FK7A 1RUE1 1NCQC 4XYXA 3A4UA 1VRBA 4ARYA 3RI9A 1FATA 3DN7A 4LO6B 3WW2A 1YQCA 1ENQA 1BCXA 1YFYA 4DINB 1I5PA 1VBE2 1C3HA 5IVJA 1UMZA 3ZYBA 5AC92 2WINB 3SH4A 1GOHA 4FOYA 2W1WA 4QQHA 1O6UA 2B9UA 2YC0A 5ANQA 3T09A 1F15A 1SBFA 3B9CA 1O8SA 3U37A 1WLCA 3IIIA 3K51A 3QD6A 4EWDA 3D0SA 2JICA 4DQAA 3WG2A 2J1RA 1PO11 4KBZA 3SCFA 4FPFA 2BW8A 2VXRA 1VR3A 4QDSA 2VOTA 3CL1A 4GH4B 3A0NA 3ATGA 1DQ1A 3L2YA 1QOTA 1FMD1 3LGRA 4DUWA 3BOWA 2W95A 5FPUA 5I8TA 1F35A 4XF1A 5A7SA 3ILRA 5BPXA 3W59A 4FXGB 2H0VA 4DUXA 2HWE2 1VJ2A 1W28A 1EUTA 1FPN3 5D21A 3RZMA 3ES4A 3T2TA 2VM9A 1V9U3 5FYTA 4N53C 5T54A 4LXLA 3MIDA 1GQGA 1IGOA 4R8HA 4C8DA 2XBO3 4E9KA 1EAH2 1US2A 4E4SA 1K12A 4P9XA 3MIGA 4QQPA 2NMOA 3OBZA 4CA9A 4MGTA 3MF6A 2XDVA 1J3RA 4UFKA 5IJRA 4AVCA 4CDUB 3I2IA 4LQRA 4OZOA 5J48A 2NYYA 4W6XA 4KG8A 3DYOA 3M4FA 3I7DA 5KHHA 1WW6A 3GBWA 2MPFA 2RE9A 1CPMA 3KVBA 5EJ1B 4AGVA 3I54A 2E51A 1QNYA 3TRSB 1RUH1 1NQDA 3BVCA 4YVWA 3AKQA 3Q8AA 5J98B 1OOPB 4Q0SA 4Q4X1 4DRRA 1ZZ7A 1W6QB 2IXLA 3D8CA 1W99A 1YQ2A 3MW3A 3H1WA 2WO2A 1NXD1 2IVJA 1IKQA 1EYBA 5C6CA 1GBGA 4BMBA 1RUOA 3CQOA 1PZ7A 4CEYA 4NOTA 4LLOA 3T08A 3RZGA 2D6OX 3K4DA 1GNHA 3K77A 2VVDA 1AR61 1YFUA 2J1EA 2UY9A 5C3PA 3P3NA 1R082 1TME2 4ZS2A 3VDCA 4YSFA 4BQXA 4OHZA 3T2QA 1DQ4A 1H8VA 1HLCA 1RUJ2 4NPLA 1W8FA 4K9SA 4QPIB 3OGRA 3I3DA 3RJRA 3WF2A 1PNFA 3H50A 3NNFA 1MPXA 1SLIA 4AQTA 4FFGA 3TB0A 1UMHA 4OMCA 1PGL2 1SDDB 1YC61 1DGRA 4QM8A 3ZSEA 5FDBA 3VBOC 2OUJA 3AYEA 5J7MA 1CJPA 3OBRA 1CZTA 4CP9B 1AL22 5A7PA 5F3EA 4AEJA 4AI1A 1F9KA 4S2FA 2ZABA 5GLWA 2VCCA 1W04A 2XL7A 4BJ0A 3LFMA 5FAXA 3WF0A 3ZIWA 1ASJ2 3E5XA 2RS13 4QMAA 3WNNA 1XNCA 1W05A 2VUJA 4GMP1 5HXVA 4RHV2 4DS0A 3WDUA 2HWF2 1Z7S3 1PVXA 2J1UA 1JS9A 3PVNA 2DVAA 4B3NA 1ODNA 5EHDA 1Q5OA 1ULCA 2UWAA 2XJQA 4I3PA 4W8JA 1XSRA 1QHDA 5EV7A 3SC7X 2JE8A 5FZ0A 2Y6KA 1V6IA 1GUIA 1LENA 1YYNA 1K5MA 1US3A 2D6LX 2GH8A 3ZKUA 4BIFA 3KHCA 1U12A 5AC93 4R52A 2PHTA 3R4SA 1VBD1 4CDQC 1D4VB 3ILFA 4BQ5A 5GKAC 1JU4A 1CD3G 3PU8A 5FPVA 1O3QA 5FR3A 2ZX3A 1SHWB 2KD7A 3NV1A 1TMF2 2B7YA 5A3WA 2CAUA 4OI0A 3APBA 3I2HA 4COWA 3KF3A 5FPAA 4Z8BA 4AGRA 1AR81 2A6XA 2YU2A 1VBB3 1JUIA 3IN9A 1ALYA 1ND3B 3TN92 4NO4A 5JXIA 1ZRFA 3J9SA 1ENSA 3AKTA 2JEMA 1W8HA 1SLBA 4XC9A 4QM9A 3WD5A 2ZGPA 3QH7A 3MV11 4RYDA 3GALA 3N9LA 4P00B 4Q4Y1 1BBT1 4NMIA 5F3CA 1COV1 1NT0A 1S0CA 1RTVA 1UIJA 1XBFA 5E6HA 4XEZA 4D3WA 4I2OA 1AR91 5CISA 2HWC1 5DMYA 3MLJA 1WCDJ 4HVQA 4Q4V2 5IVYA 5FO8B 4LBQA 2JG8A 4GQ7A 2CWMA 3HIFA 1DGWX 4OHVA 2B45X 3KV6A 2VO5A 4Y1XA 1VAVA 4J6GA 1PMHX 1C8NA 1ZX5A 2GMPA 2WNVA 2GC0A 3EXUA 1UYXA 2HWB3 3HQUA 1XXNA 2RR11 3LA7A 4FOQA 1QJX2 4GIQA 3VBFA 1GANA 3ZYRA 4FAHA 3AX4A 1AR71 1JBCA 3IBMA 3GZUC 3PU3A 1PVC2 2YV8A 2Y64A 1FOD2 3B69A 1AVBA 5FP4A 3CO2A 3VN4A 4IEOA 5IAVA 4IEPA 1LGNA 3DKWA 1RUE2 1TME3 3HEIA 5CBLA 3H8OA 1WA4A 5A6YA 2ARAA 3JB4C 3O1RA 4QPWA 5K9YA 1B35B 1A6CA 2RVAA 5I0TA 4NR1A 1BK1A 4MV2A 3AMMA 2Q5TA 1LTEA 4N7IA 1BK0A 4YGEA 5FPLA 2VW1A 4NUBA 2P3JA 2ZZQA 5DDJ1 5A32A 1KEXA 1MEC1 4HONA 4IGOA 2GC2A 5L9RA 1IPKA 4AAXA 5BNOB 2OS2A 2CV6A 1NA1B 2A5ZA 4FPHA 1AL23 1X9TA 4XF0A 1RJ7A 2QNKA 2VH9A 3L9JT 3K75B 1ZRRA 5FWEA 4YFWA 4BLIA 2AC1A 3VZJA 1F8VA 1JYXA 1WCKA 1Y3TA 2VCAA 1ASJ3 2GMEA 4HKOA 4QB1A 2DVGA 5A70A 4LT5A 2PHWA 1PO12 1H1AA 2QTWB 4DIQA 5JOZA 2XB6C 3NAPA 1K3IA 3G6JB 4TXWA 4EN6B 5A80A 4BLJA 4LBJA 3IDBB 1JI6A 4KBBA 3ZN6A 5JSRA 1OQEA 3WDTA 5BNPC 1FMD2 4X6RB 4KWLA 4K40A 3J8F3 1SZBA 2RJKA 4V2WA 4EN9B 1HRI1 4FO9A 2VUAA 3PLQA 4TN7A 2VQUA 3JBG1 1VE0A 2JG8C 3VBRB 5C7GA 5C4WA 5GLZA 1P8JA 3VZKA 1H8TB 4LBLA 4WM8A 4QQ2A 4D6SA 2ZGLA 4IE5A 1SCRA 4EN7B 3O1VA 2WNVC 2JDZA 5FZEA 1APNA 3RMYA 3KV5A 5T5LA 2ADEA 2XKPA 3LB9A 3FHIB 4JRAA 5FBZA 3AK0A 3ZR5A 1SFYA 4L92A 4XQWA 3ZYJB 2HKXA 4Z1VA 1PGSA 1DF0A 1C8M3 1CZVA 3QCWA 5LA9A 2E33A 1JZ3A 4QPGC 5F7UA 4RS5B 1CAXA 2DURA 4XUOA 3CHXA 4RA0A 1RUG1 3GZAA 2Y60A 4LIVA 4M4PA 1RUH2 1JN2P 3FMGA 4XETA 2IXIA 3ZPOA 4Q4X2 1XNTA 1NX9A 2GN3A 3PL0A 1W2NA 2XQXA 5IWFA 3AP9A 3ZFFC 1UCXA 4WBBA 3Q8FA 2ZMKA 1AZDA 4XFGA 4JGZA 4K1ZA 1W9WA 2YBKA 2WS91 4JKMA 1W8NA 3LSDA 4QPYA 5I8YA 5C5UA 2BBAA 3KD4A 3SCHA 3SEEA 5ABJB 2W0XA 1UX7A 3KCYA 3RPQA 5C8WA 5C9AB 2WWSA 3N7MA 1HB4A 3AZVA 3CKHA 1YFWA 4LA2A 3ZFGA 4LORA 3AP4A 1MQTA 1OPOA 1LR5A 2XLFA 3OPZA 1V6NA 3VHPA 1T6GC 3NWKA 3KWVA 4TLFA 1ND2B 1O4TA 1GZWB 2PTMA 3ZXAC 4CZSA 1BZWA 1UOBA 2YY1A 1K42A 4CU9A 3WP5A 2H6BA 2D3RA 2BFUL 2DVBA 1G7YA 4ZXKA 4M0HA 3H9AA 1QGLA 4QPIA 2AACA 2D6KA 2EIDA 2R043 4DB5A 1GU3A 1K45A 5FOJB 4AVSA 3MFCA 1WLDA 1QJU3 4QXCA 4YZ3A 4WM8C 1G9BA 2VU9A 1C1FA 4GWJA 3S6PA 1QJZA 2VOWA 2XLAA 1J3PA 4NVPA 4Q8LA 5E89A 3RMXA 1S1AA 2JDPA 3RRDA 1X8EA 2DUQA 3FLTA 2RMU1 4AF9A 1UQXA 1HN1A 1VMHA 5EP9A 4WV8A 1IHMA 5LW9A 2VG9A 2XKOA 3H42B 4Q29A 4MXVA 2WZR3 4CRQA 1VBD2 1OBNA 3AMHA 4QKDA 1NE4A 3ILNA 2X8KA 5JXGA 5FXZA 2VR4A 3VD5A 3K3NA 2HBTA 3ZN4A 2W1SA 1DYOA 4COZA 1RUD1 3NVCA 3A22A 4IL7A 4CDUC 3RVHA 3N7JA 3SLIA 2DFBA 2YFZA 4FPLA 3HNBM 1CX4A 2WFF1 4JKKA 1ODMA 1VPHA 3B94A 4Y26A 1WW4A 4PLMA 2YHJA 4QXBA 1OKQA 5IVFA 5FO7B 5FZAA 1LKNA 2IZWA 3WEZA 3T0DA 2BFUS 1OOPC 4RFT0 1NCRB 2BUKA 3U14A 4FTEA 2ZGQA 3NJYA 1AXZA 3ZFGC 4QKFA 4Q4Y2 1BBT2 5D2AA 3DYPA 1COV2 5IK5A 1NZCA 3MUY1 1SFNA 2RHPA 5I0SA 5JPNB 2HWC2 1EY2A 2ZGNA 1SDWA 1ENXA 5FQ0A 3MICA 1VMJA 5FUIA 4B29A 2UWBA 4Q0UA 3WG1A 3HNYM 1YO8A 5F32A 3WCSA 1ULEA 3OY8B 3J26N 4A44A 4OHYA 4QPIC 5CYYA 4ASKA 4BH9A 4M00A 4TTGA 2RS51 2ZHMA 2AEYA 1RUH3 2Z79A 4K8FA 1YWKA 1AR72 2JENA 2VUDA 3ST7A 3POEA 4C1XA 4NWVA 5LY1A 5JMCA 1WW7A 2AREA 4I09A 4PBOA 1AR63 1MS9A 1SMVA 4A3XA 4XZUG 2WUHA 2VZVA 1LESA 2LM3A 4P9LA 1GR3A 1UZYA 3VKNA 4PI2A 2A75A 4FFFA 3C7FA 1JZ4A 1JODA 1MS5A 2HWD3 3AMPA 2E7AA 4NN0A 1E5SA 4QB2A 4AGGA 3ABZA 1JU3A 2QDRA 3LEMA 2FQPA 3BPZA 5DDJ2 1DQ5A 4XTMA 1WMXA 1RVF1 3GZTB 1CIYA 5H9QA 2ZX2A 4HSJA 5CVRA 2D40A 2R071 3AL6A 4HL0A 3O1PA 2GP3A 2VMCA 2D97A 2HJIA 1ULOA 3VZLA 3RSJA 1JZ5A 4FTBA 4P9JA 4CXWA 4BISA 5A7WA 4UXAA 4HSLA 3CBNA 4PJYA 1OPMA 4RN5A 3ZVXA 5CFCA 2XPJA 3MI8A 4NIAA 4Y24A 2CSGA 4SBVA 2WT2A 4XCAA 1NA1A 3D3AA 4I0WB 2Q8DA 1ND3C 5H9PA 4G9SB 1HRI2 3ZYIB 2ZA9A 1S0IA 1KITA 2W1UA 1UIKA 3JBG2 4UFJA 4NHLA 4BDVB 4CCDA 3USUB 5CG9A 3AP7A 4PCRA 4LE4A 5F2SA 3H3ZA 1ZBE1 4DY5A 5FKBA 1MZEA 2RS31 3JCIA 2LRPA 5FJHA 4CVUA 2W1QA 1W0OA 2R1DA 1OMIA 1XE0A 4ATEA 4E4DX 4EYUA 2FZ2A 4W65A 1QIQA 3HT2A 4FOVA 1ONAA 2ZHLA 3MFAA 4NAOA 2WAOA 4XIOA 1Z78A 2YGMA 3GF6A 1AR83 3FLPA 4YVWB 5H9RA 5HCBA 1RUG2 2BOJA 2CU5A 3NJVA 5IVVA 3WY6A 5IUQA 2OPKA 5FZGA 4B4PA 5LA2A 3MYXA 1REFA 2W46A 4HPKA 4Y1UA 5EWSA 1Q8VA 3V0AA 3O1SA 1N1SA 5GZEA 3UKNA 4ZHNA 2ZAAA 5FMDA 4CEYB 3UESA 1MVEA 1SLTA 5AFBA 2HEWF 4Q8KA 4E2SA 4LKEA 4JDOA 4HOOA 4Q4Y3 2VL4A 2WS92 2QJVA 5CU1A 3MDPA 4BM8A 5FZIA 2W2IA 3MHZA 1ZNPA 5CZKA 4YW5A 2BTVC 2FDGA 2R7EB 3DGTA 5B4XA 4B1LA 1AR93 4AVVA 2HWC3 3MGUA 5HCAA 1FX5A 2VD7A 2R061 4M3CF 1LHWA 5BUVA 1X50A 2AZ5A 1YIPA 5J09A 3I4IA 5KWRA 2JKXA 3BYWA 1CVNA 2BGOA 3VZMA 1HJGA 1JZ8A 3AB0A 3W20A 2VE1A 5FLHA 4AEDA 5LBEA 2RR13 2ZPXA 4FFHA 5FZ7A 2W94A 4GJZA 2P34A 3NO8A 4TZDA 1W8WA 4YYOA 5BNOC 1CAUA 1NA1C 3W21A 3WQ1A 1ST8A 4Q26A 4N9HA 5C71A 3VD9A 2JX9A 1UNBA 2I2SA 4UFHA 2V4VA 5T52A 2WABA 1RUI3 3PDQA 3OF1A 1O3TA 4HZFA 3FBYA 1K5MB 2RMU2 4LEJA 5LK7B 3VD4A 5L19A 2QQUA 1R091 1YEWA 2DVFA 5FBJA 1CAVB 2DUOA 2J1VA 3K46A 3WINE 5HCHA 4KG0A 1Y4WA 1MEC3 4PQQA 2CGPA 2ARXA 2WN2A 3CNAA 4CCCA 4XW3A 3TAYA 2HWF1 3AMNA 3VBRC 1HW5A 5LASA 2G19A 4YW3A 1IQDC 3MV01 4QX1A 2OYZA 4A6SA 5KXCA 4QHZA 4Y22A 2EXJA 3FN9A 4META 4MG2A 4PLNA 3ZDVA 1QH6A 4IDZA 3S7IA 5LEJA 1YLLA 1J84A 1UY2A 1S4CA 1MS1A 3P3PA 1RUD2 3HVDA 3K3OA 4LO8A 5F5CA 1Y9GA 1BEV3 3WW1A 1RMU1 4RS5C 4XABA 3ZFEA 4BMEA 2WQ4A 4C0HA 1QJY1 3A23A 2PLV3 3PTYA 1TMF1 4HG6B 4G4FA 3U07A 1J3QA 2HH9A 1IZ3A 1LHUA 4YG3A 1CONA 3JBG3 3FJSA 1UKGA 2ZEWA 4Z2AA 3LFIA 3I2GA 1AHSA 1Q8PA 2PYTA 3DV8A 5SV5A 2NP0A 4AEDC 4AAPA 2ERFA 3CJIA 5FO9B 2VECA 3TN91 2IFWA 1UOJA 4FP3A 2GMMA 4LBQB 2YFUA 1DGWA 2JG8B 2EA7A 1POV1 2ZAHA 4JDMA 4Q4W3 4CUCA 1QKQA 4CUBA 4EN8B 4YVSB 5A3NA 4GAZA 5DG1A 1UO9A 2WNVB 2XQRA 1IG0A 1S0DA 4QU2A 3VBFB 1NQJA 5ABJC 2QQPA 4AXOA 5B4NA 5C9AC 2RS52 2JDMA 4FQZA 5JSOA 1JZ2A 2DUPA 2GSYA 3KHBA 4HETA 4R9DA 1RHI2 1YJKA 4H7LA 5FXWA 2PHRA 2Q1MA 1GP6A 2DU0A 5CFDA 2YC2A 1UAIA 2YG0A 3MBWA 3GJAA 3TEZA 4LHLA 2GNTA 5EFUA 5IK8A 3IAQA 3AKRA 4LTAA 3T30A 3OSDA 5T55A 2VMGA 2ZS6B 4CU7A 5LA0A 1IS4A 4LK6A 2BDRA 1L7QA 3OD0A 1WCUA 2W08A 1W6OA 5A7NA 4URTA 2ZGSA 4TWTA 5A3TA 2ZCWA 4LKSA 3PMSA 3Q8BA 1I3HA 4IUGA 5CB7A 3USSA 2QQNA 1SLCA 3S5QA 3KCCA 4E2GA 5A32B 1MS8A 1IS3A 1D2SA 1W9SA 3GGLA 3O14A 4UF0A 1FV2A 1NYWA 1ZZBA 2PN5A 2VC9A 4HLTA 4NIGA 1J58A 3RG0A 4CP0A 1RVF2 1OQDA 2WJSA 3QH6A 2F4LA 3ZSLA 4F7ZA 1TEIA 2R072 3PHMA 1WW5A 3HPNA 3ZFEC 3AKSA 3U10A 2RM21 2TNFA 4JKLA 2PAKA 4AR2A 2RDSA 2JG9A 4NRMA 2R30A 3ASIA 2EXHA 3NAPB 4QKNA 4GULA 1N1VA 2ORXA 5A3PA 4UW3A 1N47A 4Y5SA 3ZN6B 2VTFA 2E7QA 2I07B 1XC6A 2OQ6A 3VZNA 3KB5A 2W91A 3E6CC 4LK7A 1RXGA 1T6BX 1LHNA 5DUUA 5F5AA 5C4WB 2DCZA 1AJOA 4WM8B 5IVCA 3HNMA 3TNQA 2EF6A 4COVA 5KXDA 1T2XA 1QY4A 1IPSA 1G6NA 2BVVA 3FUOA 2BPA2 1OXCA 3C7HA 3OGGA 3BGAA 1ZBE2 1EPZA 4FXKB 1NCRC 1TNRA 2QVSB 2XHNA 4D7TA 2GDFA 2D98A 2RS32 5CG8A 1O3SA 2WAAA 4KGGA 1CAXB 1NY71 1BKZA 3RZJA 1EV11 4XFBA 1LOFA 3H8UA 3T4HB 1RUD3 1S0JA 2HYXA 4QDQA 3VBSA 4R9BA 4C1WA 3USUA 1R1A3 2WFF3 4RSUA 1WLTA 1VMFA 4JDNA 4CSWA 1LOBA 1E5RA 1DGLA 2FCUA 4JGZB 5DAVA 1X82A 1YQ6A 4C0BA 4LBKA 5DN2A 4AK3A 1N3OA 2BNOA 2CGOA 1W6NA 2KR2A 1E5HA 1ZZ6A 3U1XA 1RUC1 3DXUA 3PIJA 3BTYA 2C0ZA 1VLNA 4PF1A 2E6VA 1O59A 2XH6A 3VHNA 3M3QA 2X5IA 2B39A 4YM1A 1STMA 2R062 1V6JA 3ZFGB 1MQTB 1OH3A 4D69A 3ZR6A 2VZSA 1CZSA 1DIWA 1HKDA 1HRV1 2RG4A 2W92A 4HANA 4CE8A 2O1QA 4D7YA 4D8MA 2XL9A 3IKWA 4ISRA 1TQ5A 1CX1A 2XWBB 2FD8A 5GLUA 4URAA 4E4HA 5IFPA 1CAWA 1UYPA 3DYMA 5K0UA 1TVGA 4XDQA 5AVPA 1DG6A 5HXMA 3FBMA 5LK5A 1UZWA 2CTVA 3PNAA 3RQ0A 2E7TA 2ZKLA 3MIBA 3HJRA 3IB3A 1NXMA 3MPPG 2PHLA 1ZRDA 4DXRA 2P3IA 1HB1A 4NIDA 5HV4A 2NQYA 4XZPA
chains in the Genus database with same CATH topology
4N9IA 1AX2A 2BBVA 3WUCA 4AVAA 4PF5A 3KCXA 1R092 4FTSA 4IEYA 3MLKA 4I30A 5E16A 1AX1A 2JXAA 1RVF3 3PVOA 2WT0A 3BOPA 3NW4A 5DUVA 4MSVA 1C5IA 1FI2A 2XVKA 4AQ2A 1KRIA 4MUVA 3MEPA 1AXKA 1R1ZA 4Z82A 1KXGA 4AFBA 1VBE3 4FAGA 2GNBA 4MVTA 1CAVA 5FRAA 5JSPA 3VL8A 1RMU2 2X53S 2PHDA 3ETQA 1NLRA 1V6KA 4BA6A 4YVWC 1QJY2 5GZGA 4BE3A 1UX6A 4C91A 4UW6A 1W39A 4FSJA 5BYNA 4MX3A 3M2MA 3SITA 1H2LA 2N7GA 1S0EA 2HYKA 1OA3A 4CEYC 2X29A 1ZBE3 4GMP0 1RB8G 3WG3A 2W68A 5FQ0B 1O5UA 2WQZC 3SHRA 5DG2A 2YXSA 1KDMA 4Y20A 4XFFA 5K0UC 1MVQA 1PHMA 5FFOC 3E6BA 2O8QA 2DYCA 1YI9A 2HWE3 2JJ6A 1DZRA 4ZU4A 2PA7A 2ZOEB 4I0AA 4XJ8A 1Y9QA 4M01A 5B2GB 5JI7A 1EAH3 3WP3A 1PIV1 1V00A 3PVEA 5FPZA 1C1LA 5I0RA 1CESA 2E63A 4OFGA 4FPKA 1ZBA1 4XQDA 4YVSA 4GKXA 1LOAA 2JD4A 3WOGA 1SCSA 1ZZCA 2DVDA 2R063 4PDWA 3V64A 2A3XA 1G9DA 1GFF2 1PNGA 3HWJA 1K5MC 2YGLA 1ENRA 4BIOA 2ZZJA 1VAMA 1R083 1CR7A 3V0BA 2OIIA 4RR3A 3AFKA 1RUJ3 2RM22 3AZYA 1F5FA 1JH5A 1LU2A 1WGPA 4AI0A 4YM0A 3BTAA 5FTTC 2HEVF 1AYN2 5I93A 1PO21 3VBHA 4ISQA 2DFCA 1G8WA 3WR0A 4K6BA 5CFCB 5FOBB 4W6YA 1FNYA 3MF9A 1N1YA 3LKJA 3WNXA 4S2HA 4FT8A 1LULA 3R4UA 2A6VA 1PM7A 1DFQA 1MS0A 4FBFA 3LA2A 1PK6B 2OUHA 1PGW1 2XUMA 4K20A 4P9YA 3UKTA 4RHV3 5F9TA 2HWF3 4MGYE 4YW4A 5CNAA 5LRRA 1NE6A 3LWCA 4MXWA 5J3UA 4DNYA 1DYPA 4KWKA 1NY72 4OLLA 5ACA1 1EV12 2CYFA 2FMYA 3S0MA 1MZ6A 4YVSC 3OJBA 4HPKB 4CP2A 2VULA 3V0AB 5JAXA 4RL7A 3VBFC 1WMEA 1H9PA 1TMF3 4L11A 1UN1A 5D8AA 4PDWC 3H7JA 1VIWB 4HN1A 1G86A 1B09A 1IKPA 1RUC2 4AWDA 3MW4A 3IPVA 1QDOA 3TN93 4Q2FA 1UW8A 1H1MA 1POV3 1XNBA 5IK4A 2ZX4A 2JE9A 2BWCA 4DPNA 4LBOA 4AEDB 4YW2A 4UBHA 3WDWA 1HRV2 1VALA 4PQ9A 5DZEA 1XU1A 2ZGKA 1Q8OA 1CAUB 2ENRA 2B8MA 4MZUA 1YI7A 3ME2A 1D4M1 2WA4A 2VVFA 2R1BA 3O12A 4Q4V3 3ZSKA 4JTNA 4A7YA 1L3JA 1JXNA 1D2QA 2GNDA 2XVLA 5F5QA 2CY6A 1UU6A 4AQ6A 2WNUA 4ZKTB 4ZU5A 2MEV1 2JE7A 1HIXA 3WVJA 1FV3A 2D44A 1QJX3 2DTYA 4BCUA 3NAPC 4LHNA 4LULA 3VBUA 4PIXA 4LBNA 3ZXFA 1PVC3 4IV3A 5AVAA 5FLIA 3QOPA 4HVOA 1FOD3 2D3PA 4SLIA 5BNQA 4K21A 4ASMB 4MGKE 5L7OA 1KFXL 4LBMA 4Z92B 5C4WC 1RUE3 2Y0OA 4Y22B 5FREA 4YW1A 1AF9A 4AG4A 1H4GA 2VGDA 2BVBA 2JKBA 2QFEA 5D8AC 2A7AA 2YPJA 2O0OA 1DZQA 4M3CA 5DZFA 4KL1A 3VL9A 4I0BA 3ZFEB 1LRHA 2EALA 4FP2A 1QOOA 1KJLA 1V6MA 1GYKA 4S2GA 3SH3A 3WCRA 3H7YA 2VNOA 1ULGA 3AM2A 4QGNA 1G9FA 1PO13 3CJIB 2YUEA 4JGZC 4EWEA 1SQ4A 2FBEA 2XLGA 4NWWA 4RD7A 2VY0A 4FCAA 3ZXJA 5CA6A 4N90A 4YRDA 1FMD3 1H2NA 2K2SA 4XTPA 1LOCA 3N4MA 2QKDA 4YZ1A 2ES3A 1G9CA 5CFDB 5GLVA 1MQTC 1MS3A 1VAKA 5JPMB 4NPRA 4XBLA 1UD1A 3MIHA 1PIV2 2XVGA 4N43A 1PZ9A 5GZDA 5T5OA 3IT8A 3B9IA 1EP0A 3VV1A 4IEQA 3T1LA 3RZZA 4IV3C 1FYUA 1V9U1 1N1TA 1ZBA2 1W6OB 5KHJA 3KT4A 2VPVA 5A33A 2R16A 4XHBA 3FC0A 2ZGUA 5HBAA 1RHI1 1QXJA 1XNKA 5FLJA 1QF3A 3DPRA 5BXXA 4Q4X3 3ZXGA 4Y1VA 4NHKA 5SV8A 1TE1B 4XIKA 2WZPP 5FMOL 3IIAA 4AQSA 3INAA 4JV4A 3IWZA 4HT1T 3M3IA 3TBDA 5CADA 2JG9B 1RIRA 2XHKA 4INDA 5C8CA 4K1YA 4OI1A 5DZGA 1PO22 4H14A 1NLSA 2KXLA 2H0BA 3WP6A 3N7LA 4E27A 2VVEA 3JU9A 3TNPB 3VDDA 4L99A 4XBQA 1J59A 5LEKA 2V09A 1YRZA 3PVBB 1HV1A 2TEPA 1PGW2 4KWJA 3URFA 4GMP3 1OD5A 3O0VA 3NJZA 3KSCA 3O5SA 3RYKA 4R9AA 2RS11 4COUA 4U2AA 3ZPYA 2P17A 4N43C 2EXIA 2NM1A 4Y1YA 2DF7A 2BWAA 5HCFA 1Z7S1 5ACA2 3VBSB 3B5LB 4B8EA 3KT1A 2BNMA 5FMOS 4JRLA 5LRSA 1VBD3 3KT7A 1KS5A 2I45A 2AH2A 1PK6A 2VOKA 4PBPA 2B46X 4BQ1A 4LO5B 4YGDA 1S2KA 4IESA 4Q0VA 5DUWA 4YZ5A 4H3WA 3N3HA 1W6NB 1YCIA 2NZ9A 4YG6A 2G9FA 2R6QA 1M06G 5BNNA 4DFSA 1RINA 2E53A 4HN0A 2X5IB 1TNFA 2Q0AA 5T3NA 3SNMA 4AEMA 4GALA 5KC5A 4WVWA 2TUNA 1JW6A 2Y0IA 2GAUA 1H2KA 4RQPB 5JDBA 2WSVA 5JZGA 3AYAA 4XXPA 1VBB1 5C8CC 2XG3A 5H9SA 3ACLA 3SCGA 3NKTA 4IV1A 1BBT3 1GV9A 1SLAA 1OLRA 2C5DA 1COV3 5J36A 1EPWA 3GHNA 1CAWB 3WQ7A 2IXJA 5K0UB 1ZZ9A 5GJ6A 1D4M2 5T5JA 4ES9A 1U5XA 4MLOA 4DRVA 1ZBA3 2ATFA 5EYXA 2MHFA 3LCPA 1RUF1 2MEV2 2ZGMA 2PAMA 2A3YA 5JOYA 4OULA 4HMZA 3FFZA 5JI9A 1AR73 1VBC1 5CFCC 2ZGRA 3CJXA 4MGIE 4XJZA 5E88A 2A6ZA 2HWB1 4Z2WA 5GZCA 1F5JA 3AZZA 3UJOA 1LOGA 2NMNA 4E2QA 2DWRA 1MZFA 3M70A 2VNGA 5I0UA 1DGRN 4PIYA 1PK6C 4WVVA 1PGL1 1Q3EA 2R0FA 2PELA 3OGJA 2VW0A 3THTA 2ZTNA 3NV4A 5JOXA 3AYCA 1XE8A 5DDJ3 3TYJA 2WFPA 4Q1PA 4I01A 4BHPA 2ZMNA 3V56A 3LZZA 4YARA 3WHTA 5I91A 3MIFA 2A73B 2OZJA 5GZFA 4DXZA 5JZGC 3CLPA 3VKLA 4LR4A 1C57A 4IV1C 1OLQA 1W6MA 3K48A 4Y20B 2WLPA 3BODA 1SEFA 3D4KA 4L8QA 2EXKA 2G9GA 1N3PA 2P2KA 3B3QE 1HRI3 4XPVA 4MH0E 4FPGA 5AFEA 1QMJA 4L2NA 2DCJA 5JVVA 4QD2A 3J8F1 4X6QB 3RWNA 3VHRA 3WUDA 4GA9A 3C3VA 3AYDA 4YGCA 5HI0A 3ZYPA 1W2UA 2AYHA 1DQ6A 2SLIA 4WZFA 1ZA4A 4AHXA 3U4XA 1V9U2 3PJYA 3AJYA 3WX5A 4P5HA 1WD3A 1WLWA 4MGZE 4EROA 1RUG3 1C8M1 1DQ2A 2O8OA 1REEA 4J1XA 4PDWB 1BXHA 2UYAA 2ZHNA 3KS7A 4XJ9A 4LLFA 2ILMA 1LGCA 2JECA 4ZU7A 4BWOA 4R4ZA 1G9AA 2WS93 3V0BB 4GKYA 2GNMA 4RR3B 4XQ4A 1I5ZA 2K9ZA 5A3MA 1D4M3 5JIAA 3UKVA 3ZN5A 3VBHB 1POV0 3AKPA 3JUUA 1XYPA 2YZ4A 4BPZA 4XMIA 1RC6A 4WZCA 1WBLA 3NKGA 1H0BA 2VMIA 2I74A 4XBNA 4Y1ZA 4N53A 3TOJA 4NHMA 1AYN1 3JQXA 3LOBA 1WUVA 2EIGA 2VOVA 4M3CE 3NV3A 1IQAA 1H2MA 4AEKA 3OCPA 4MXWB 3MW2A 5F6LB 4YM3A 2FHRA 2BYVE 3CJIC 3OBTA 2R041 2RS12 1SACA 2RMU3 1YNAA 1HXS1 4XHXA 5KXEA 1Z7S2 2PHFA 4MYEA 1QWRA 1WMDA 4Y5Z0 4AHZA 4OUSA 1DU3D 5D8AB 3E5QA 3DUIA 2D3SA 4AHWA 5CFDC 1GNZA 4W6WA 2WZR1 2GALA 3AFGA 3A0KA 5JOWA 1AXYA 2H6CA 3IPVB 5L36A 2B42B 4UW4A 4XFHA 1OHFA 2IXCA 1VRH1 3ECQA 1V6LA 3UK9A 3ZSMA 3VBOA 2ZMLA 4JVAA 1VBB2 2DTWA 2ZX1A 3I59B 3FWEA 4GWMA 2XJVA 3WT3A 3QBQA 2HEYF 2G4IA 3VKOA 4B4QA 4AVTA 1DYKA 4LBQD 4R4XA 1VB4A 1ULDA 4AFCA 3CEWA 1UU4A 2D43A 4K3UA 2WNUB 2Z69A 2JG9C 1CJDA 4RQPA 4CDWA 1C28A 1RUF2 1QQP1 2RS53 3UJQA 3VBUB 2WKKA 1FXZA 4XFIA 3BCWA 3AXEA 3AP5A 3WHUA 1RHI3 4IV3B 4D7SA 1MR5A 4OI4A 4CDQA 1OI6A 1VBC2 3AXDA 3EJKA 5FPXA 1H30A 1FNZA 5L7OB 2HWB2 3D82A 2UY8A 3OYWB 3SH5A 1QU0A 3DF0A 2Q8OA 2QCSB 1O3RA 4IEVA 2C1FA 1AX0A 3SXWA 3WZ1A 3BIWE 5EYYA 3WDXA 1FAYA 2NLRA 5F1RA 4M3CB 1RJ8A 4LUMA 2R0HA 2F6BA 4WM7A 3WV6A 2QUOA 4A7KA 4KNCA 1LOFC 2WIIB 4XILA 2HWD1 3VBSC 1DZTA 1CGPA 2R073 4HKWA 1UL9A 4IETA 3D0JA 4E4ZA 4S2DA 1W6PB 4GWNA 5BV6A 4AI2A 3BALA 1X36A 3EBRA 2OW4A 4OUMA 4JTOA 3GBFA 3ZYGA 2D6PA 2YROA 1ZM1A 4AHYA 4CDXB 4CEWA 4ES8A 2X5IC 3UL2A 2IC1A 5DUXA 4CYDA 4JCKA 5JLVA 4RQPC 4CDWC 3E6DA 5FCCA 4F83A 3O0WA 5JCTA 1WMFA 3WQ0A 2XJPA 4N43B 3J8F2 3M3CA 2PHXA 3FZ3A 4QGMA 1LEMA 2RS33 4B7EA 1NOVA 3JD71 3Q9OA 4R9CA 4LNVA 4AW7A 2D5FA 4DY3A 2UURA 1HQLA 1E57A 5A33B 1JYCA 4EWAA 4FPOB 1ZZ8A 2YDEA 3ELNA 4AI3A 3AZXA 1IPJA 3DPRB 1C8M2 3VKFC 1OA4A 1QOSA 2ETEA 1XYOA 4WVMA 1HDKA 5I8SA 4UW5A 1CPNA 1URXA 4RGAA 5EJ3A 5T50A 3SISA 4FPJA 2VMHA 1GLHA 4WM7C 2AUYA 5E8AA 4H55A 4GB31 2UYBA 3FFQA 1FT9A 4QHBA 1U5IA 1GICA 2AGSA 3VGIA 3EQEA 4U36A 4LE3A 3CU7A 2ZHKA 5C8CB 1UF2C 2VQAA 3N7KA 4XF4A 3POSA 1H1IA 4Z07A 5BNPA 1RUF3 2IFRA 4IEXA 1OFNA 1ZVFA 2MNGA 1HX6A 2IWGB 3VDDB 3RI8A 2ZKNA 1V70A 1VBC3 1OSGA 4FOWA 1BMV2 3B02A 1S0BA 4YGBA 3VHOA 4EV0A 2Z42A 1KQRA 2VNRA 1LGBA 3B7MA 4PIZA 2DV9A 3THPA 3LSEA 4COYA 3B00A 1XE7A 4FQ4A 4QPGA 1BYHA 3RJ2X 2RJLA 1O4ZA 2R042 4KQ7A 4XJWA 1QJU2 3IM0A 3ROUA 5EZWA 1HXS2 1R093 4AFAA 1PZ8A 2EAAA 1RUI1 5F6KA 3I8TA 3ZFFA 4TSVA 2P37A 4IQPA 1WBFA 3O0XA 2PAEA 4XFCA 1YJLA 1X8MA 3KZ4C 2WZR2 5BNNB 3X29B 5K8SA 1V6OA 2A71A 5CIRA 1A3KA 2PFWA 4XOGA 2QZ3A 1GSLA 3TWIA 1A78A 1RMU3 4JAAA 3ZIXA 1VRH2 3L2HA 1QJY3 4KH9A 5JZGB 2R32A 3G7DA 3PJQA 1RITA 4ITCA 1BEV1 4IV1B 3WXPA 3WDVA 2GH2A 4QT6A 5E1RA 3JZVA 4B4RA 1JHNA 4XJUA 2PLV1 1H9WA 4OHXA 2R49A 4CTEA 1I6XA 1YFXA 2VOXA 4Y4YA 2F4PA 3VKMA 4AI8A 1WD4A 3E5UA 2Z5WA 1YHFA 1S0GA 2UU8A 4RR3C 3J4UH 2WC2A 3V65A 3KLSA 3PMEA 3W9AA 3VBHC 4YLZA 4GH4A 1QQP2 4Q4W1 2IXKA 3IDEA 3I59A 4LUKA 1AYM1 1QH7A 5JR7B 4XFAA 1XU2A 2TBVA 1C4RA 3T1MA 2VQ0A 3NSTA 4BOWA 1Z0HA 2CAVA 2PHUA 2GC1A 2UWCA 2WT1A 3BB6A 3S7EA 2XJUA 3RYRA 4QQLA 4CDUA 3VUOA 2XWJB 1AR62 2WLQA 3LOIA 1QDCA 1LECA 2K0GA 1OFSA 3OYWA 1X7NA 1VBA1 2HWD2 5JIUA 1OOPA 4JQRA 5A3LA 1W6QA 3ZXEA 1GKBA 1QNWA 1UPIA 2RM23 4JGYB 4FVVA 1GZCA 3SMHA 2ZBJA 1AYN3 3POYA 1W6MB 3C2UA 3AP6A 2C9AA 4YFZA 4BZ4A 1X33A 3JQWA 2FZ1A 2OA2A 3H1MA 3KGZA 4EJRA 1IOAA 4O9EA 3KQRA 4LHKA 1U5ZA 3D5OA 4HK9A 1HQWA 4ORFA 2BEOA 3ZO0B 1Q8SA 3ZX7A 1HXS3 2Y26A 3ZXLA 5GLTA 2CGNA 1W6PA 3M3OA 4GH4C 3DL3A 4GXLA 4KU8A 5GALA 1NCQB 1F31A 4M0NA 2KA3A 3JD72 1MZ5A 3MIEA 4AFDA 1EV13 4CDXA 4DZGA 2A3WA 1KJRA 3M7AA 4X8NA 1J1TA 4FPCA 2WNUC 3AJZA 1UZZA 1HV0A 3R6SA 1VRH3 2EAKA 2D93A 1RGSA 3GNEA 3U0ZA 1JYIA 3VBUC 1UU5A 1YUDA 2ZJCA 1AR82 1FPN1 1JTZX 1Q8QA 1IS6A 2OVUA 1DHKB 3W58A 1R1A1 2WL1A 2XBO1 1NG0A 3N36A 2GU9A 1RUC3 4GB32 4AFMA 5L7OC 3OTFA 5L73A 3UV9A 3ALQA 1O5LA 2LUWA 3HAGA 3N35A 1RL3A 2CL2A 3RDIA 1YIFA 3GYDA 2FMDA 1AR92 4LO4B 1AUYA 1HRV3 1QQP3 4RGGA 2D6MA 2GN7A 4OZXA 1ND3A 3ZXKA 2W39A 4N53B 5JWPA 1ZRCA 4HK8A 1J1LA 5GM0A 1CN1A 3E97A 2RR12 3HQXA 5D1IA 4OI2A 2WNEA 1LU1A 4HFSA 4HVRA 1Q43A 1DDLA 2D7FA 5J37A 4F3JA 3I2DA 4ONUA 4Q27A 1SLLA 3FE5A 1BVVA 1DBNA 5J96B 3NV2A 5IK7A 1YXWA 1LEDA 2XJSA 1M4WA 4QGLA 3ENRA 3MZHA 3WP4A 2WA3A 4P9IA 1RUI2 1S0FA 4CDXC 1LOEA 2D5HA 2QE3A 1XQNA 4FPEA 2YYOA 1RUNA 2XJRA 1Q56A 1UPSA 2BNNA 3EHKA 4YZ2A 2SBAA 1I1EA 1MEC2 2OZ6A 4J1WA 4QQOA 1JUHA 1AJKA 2D6NA 1A8MA 3O7OA 4HBNA 1SBDA 3VZOA 1O91A 3NL1A 1B35A 5DXDA 1H4HA 1QXRA 3VBOB 1PMIA 1VBE1 4EN0A 3DPRC 4I3GA 5AC91 2Q30A 1U0AA 1BEV2 2Z2SB 1OA2A 1AL0G 2ET1A 2NN8A 5BNOA 3H0OA 2PLV2 4I02A 5KBFA 1W0PA 3M3EA 3GHMA 3JD73 4CDWB 3AZWA 2PQQA 4O9GA 3HBZA 3WG4A 2GZWA 2GC3A 5KC6A 3HT1A 4Q4W2 4CDQB 1S55A 1AYM2 1BQPA 3GBGA 1KD7A 2HWE1 1PIV3 1D0GA 4XE9A 4IEUA 3VDDC 3VBRA 4KGQA 3HD8B 3M1HA 1H8TA 1EAH1 4GB33 3HR9A 4L9BA 4BYYA 4QX5A 4D94A 2IXHA 1LCLA 2DCYA 1BVP1 2P3KA 4WM7B 2DCKA 2QDNA 1MS4A 3RS6A 3QACA 3ZSJA 4RS5A 3WW4A 1O7FA 4K7JA 2AENA 3VLBB 5EXOA 1CIWA 2Q4SA 1ZYBA 3B93A 2V73A 1ULFA 5IT6A 3WDYA 1VBA2 1LJ7A 4JC1A 3B01A 3R0RA 1B35C 1QXPA 4OVEA 4X8PA 1LHOA 3RYPA 3U11A 2LTNA 3ES1A 1R081 1TME1 1PO23 2DU1A 1REDA 2XJTA 1RUJ1 2BQPA 4HKLA 5BNNC 4IERA 5CAZA 1XRUA 3FX3A 4CEWB 1XYNA 5ABJA 4OHWA 4A7ZA 2A6YA 5C9AA 1C5HA 3IDCB 1BJQA 4H7MA 5KHIA 4TYSA 2CNAA 3FUQA 4XXAA 4JGYA 1AL21 1Y43B 3MLLA 4AE2A 3D6EA 4XJAA 5KHGA 1ND2A 1GZ9A 1VB2A 1GZWA 4PLOA 2A70A 4LA3A 4YNIA 3FLRA 4KU7A 4P14A 1LB2A 2A6WA 1ASJ1 4DOUA 3RNSA 1XNDA