1QXRA

Crystal structure of phosphoglucose isomerase from pyrococcus furiosus in complex with 5-phosphoarabinonate
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
187
structure length
187
Chain Sequence
MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-6-phosphate isomerase
publication title Structural evidence for a hydride transfer mechanism of catalysis in phosphoglucose isomerase from Pyrococcus furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase
total genus 41
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature ec 5.3.1.9: Glucose-6-phosphate isomerase.
pdb deposition date 2003-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06560 GPI Glucose-6-phosphate isomerase (GPI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qxrA00
1TQ5A 4KL1A 3DN7A 2IXIA 3H50A 3OCPA 2XGXA 3H1WA 3D82A 2B8MA 2EA7A 5KHJA 5E16A 2PAMA 4N9HA 1WLTA 3EBRA 3H1MA 4YNIA 2BNMA 1QXRA 3OTFA 4CYDA 3ROUA 3N4MA 3EQEA 3CO2A 3H8UA 1Q43A 4NVPA 3E6DA 2XL9A 5FPXA 2E9QA 3MDPA 1UIKA 2BNOA 4O9EA 2BNNA 1X8EA 4Q29A 4I2OA 4IEOA 2CAUA 3OD0A 2HJIA 3RYPA 4E2GA 2D5HA 1CAXA 2MPFA 2XL7A 3UKVA 1XE8A 4Q0SA 4EROA 1NXMA 1UW8A 1NZCA 1OFNA 4HBNA 2OA2A 4RD7A 4R8HA 3HQXA 2I45A 2GC2A 4QM8A 2XKOA 1YWKA 5FLJA 2ZCWA 2B9UA 3O14A 3IIAA 1JUHA 4PJYA 1ZZ7A 3BU7A 4FBFA 3U0ZA 1QY4A 2PFWA 1J1LA 1LB2A 4XFFA 2XKPA 3D0SA 3EO6A 3BCWA 2ET7A 4Q0VA 2H6CA 4BYYA 4KWJA 1XRUA 4MV2A 3BALA 3R6SA 5AVPA 3CL1A 1ZZ6A 5BXXA 3H7JA 4WVZA 3FJSA 2XLAA 1YFYA 2UYBA 5EZWA 3SHRA 2GH2A 1ZRDA 3SCFA 3MYXA 1SEFA 2PAEA 1O3RA 4HN1A 4LEJA 4BIFA 2F4PA 1FT9A 3LA7A 3IDCB 3FZ3A 3NSTA 1OI6A 2N7GA 4P9GA 3RYRA 3RDIA 3C3VA 2D5FA 3E6BA 4D7TA 4AVBA 5D1IA 3WW2A 5KHKA 5T3NA 4I0AA 3FHIB 4HVRA 4H7LA 3S7EA 1GQHA 5J48A 1SFNA 4PIYA 2Z69A 4UBHA 4Q0QA 5LEKA 4AQ6A 1WGPA 3SCHA 3TNPB 3I54A 3LAGA 4KU7A 4KWKA 3M3IA 4TLFA 5FLHA 4LULA 5JAXA 1O3QA 2FMYA 4IEQA 2IXJA 2PHLA 1NYWA 4X6RB 1O4TA 1J3QA 3U10A 4XF1A 3RYKA 2K0GA 1RC6A 3IDBB 4QX5A 4EV0A 5I8TA 5LEJA 3PLQA 5I8YA 4IEZA 5KBFA 2CAVA 1J3RA 4D7SA 5K8SA 2K9ZA 3FFQA 2GU9A 4ZU4A 3JZVA 4F8AA 5FCCA 1DGRA 3LWCA 4XFAA 5E1RA 5CVRA 5FPZA 2GC1A 1ZRCA 3H9AA 2ATFA 1CAVB 3CJXA 3MPBA 1EP0A 3UKNA 1O3TA 1LR5A 4UXAA 3ST7A 1RUNA 2UYAA 3HT1A 3CEWA 3HIFA 3ETQA 2FQPA 4YRDA 5FDBA 4EWAA 4XFIA 4PIXA 5LRSA 1I6XA 4I09A 4J1XA 4BH9A 4EWDA 3VHRA 2IXLA 2Q30A 3FWEA 3PNAA 4E2QA 4MGIE 1J3PA 5JSRA 3E5XA 3LA2A 2MHFA 2IXCA 1ZZ9A 4MZUA 4MGZE 4B29A 1LKNA 1YFUA 3UKTA 4UBGA 4IEXA 1IPJA 4YARA 1XE7A 1O5UA 3E97A 3PVBB 2H0VA 2Q4SA 5J3UA 1U12A 4QXKA 4LA3A 4JTOA 4XF9A 1VP6A 3I7DA 4XFGA 3S7IA 3G7DA 3SCGA 4R52A 2QDRA 2BGCA 2ETEA 4PIZA 1YFXA 2P17A 4MGYE 1PM7A 3IWZA 1QXJA 4AXOA 3NL1A 3E6CC 2PQQA 3M70A 4XF3A 3B02A 1CAXB 1SQ4A 4HLTA 1YFWA 2GC3A 1ZRRA 1RTVA 1O3SA 3KGZA 4MGKE 2HKXA 2EAAA 1Y9QA 1WA4A 1VJ2A 5BV6A 1X8MA 5JR7B 4JV4A 4ORFA 2UY9A 2C0ZA 3ELNA 2D93A 4FAGA 4IEPA 3WW4A 5HI0A 1I5ZA 3SMHA 1CAWB 3LA3A 3GYDA 1EPZA 2PA7A 4KWLA 4QGLA 2V09A 1X82A 1RL3A 3EHKA 3TNQA 2OZ6A 4BHPA 1FXZA 4I02A 4HVOA 1ZREA 1PMIA 4YSFA 3QOPA 2UY8A 1CX4A 3CF6E 2XLFA 2PTMA 1CAVA 5FQ0B 5CU1A 2O1QA 5C6CA 3NJZA 4XFHA 1CAUB 4HZFA 1IPKA 4O9GA 3ES4A 5EFUA 4HSJA 4Z82A 1ZZCA 3H3ZA 3OGJA 2OPKA 3USSA 4META 1ZZ8A 3ES1A 5FLIA 1GQGA 3DV8A 4FAHA 1RGSA 3LOIA 4I0BA 2CGPA 1O7FA 1ZX5A 4KU8A 3BPZA 4ONUA 1ZVFA 4E2SA 3KGLA 1FI2A 1OMIA 2QCSB 4XF0A 4A2UA 4XEZA 1DZRA 4QMAA 4IEVA 2OZJA 3L2HA 5BY5A 2VPVA 3NW4A 4Q0PA 2B5HA 4DINB 1EYBA 3I59B 4AVAA 4WBBA 4WZCA 1ZZBA 4LTAA 1ZRFA 3DKWA 1H1MA 4HVQA 2Q0AA 2QNKA 5F1RA 2CV6A 3RNSA 3ACLA 2H6BA 2Z2SB 3OF1A 5LRRA 3U11A 3CLPA 4I01A 2Q1ZB 5KHIA 2VECA 2Y0OA 1NE4A 4HN0A 1L3JA 5KHHA 2KXLA 5I0TA 1EY2A 3MZHA 3RPQA 4J1WA 3HT2A 3WW3A 4LUMA 4AQ2A 2BYVE 1YUDA 2IXKA 2GC0A 2IC1A 1DZTA 1UD1A 2PHDA 3H3UA 2IXHA 3IBMA 1Q3EA 1X7NA 3KCCA 2O8QA 2XHKA 2ZKLA 4L11A 3NVCA 4LA2A 2DCTA 4IESA 4IEUA 4LLOA 4MH0E 4QM9A 5I0UA 2D40A 3S0MA 4IEYA 3E5UA 4JVAA 3DL3A 3H1YA 1V70A 1CAWA 1VR3A 2QJVA 4JTNA 5I8SA 3NKTA 3GBFA 5KHGA 1QWRA 1DGWA 1HW5A 4GULA 2VQAA 4IERA 4XF4A 4EWEA 1NE6A 1YLLA 2QVSB 3RZZA 5BUVA 2BEOA 5FQ0A 3KSCA 4IEWA 5CADA 2EVXA 1CAUA 3FX3A 1Q5OA 3D0JA 4ZU7A 1UIJA 3QACA 4QGMA 1G6NA 5I93A 4HSLA 5J7MA 4Z07A 3WW1A 3BB6A 4MUVA 4HMZA 4OLLA 5I0RA 2PAKA 4N9IA 3E5QA 3H7YA 4XFBA 2GAUA 2GZWA 4AVCA 4QGNA 4F7ZA 1H1IA 1UCXA 1O5LA 4ZU5A 4X6QB 2PYTA 3FE5A 4YYOA 5BPXA 4K8FA 4L2NA 1CGPA 2WC2A 1UPIA 4XFCA 1J58A 3SXWA 5JCTA 4FT8A 1ZNPA 2WFPA 2ET1A 2XLGA 4MX3A 1LRHA 4LUKA 3I59A 3KMHA 4Q0UA 5JSOA 1OD5A 2MNGA 3ZDSA 5JSPA 5C8WA 4OFGA 4IETA 5I91A 3LZZA 2OYZA 1J59A 1YHFA 4XETA 3EJKA 1Y3TA 5I0SA 1RUOA 4I3PA
chains in the Genus database with same CATH superfamily
1VRH1 2C26A 1WCQA 2VOVA 3PJYA 3DN7A 1LOAA 4EN9B 3OCPA 4FXGB 1VE0A 1S2KA 1UY2A 2IVIB 2FDFA 4QWNA 3RGBA 1H6XA 2YMZA 3NJYA 4LOTA 4PDWB 5F8PA 5ISLA 3SISA 2BNMA 1GZCA 1QXRA 2MEV1 3OTFA 3ROUA 3VBUC 4CYDA 5A1LA 1W8OA 2Y8KA 3CO2A 3N4MA 4P08A 4BE3A 1Q43A 3OY8A 3WDUA 1EV12 5FPXA 2XL9A 5FP3A 5FFOC 1OUXA 4LO7A 1RIRA 1NT0A 2BNOA 4O9EA 3POJA 4UFMA 2WO2A 3B69A 3G6JB 2WSUA 1XNTA 2VL4A 3K51A 4E2GA 5GKAC 2D5HA 2WNVC 3ZSKA 1WMFA 4DRVA 1CAXA 2MPFA 2ZXQA 3UKVA 1XE8A 2BW8A 4P5HA 2X29A 4Q0SA 4RR3A 2XJRA 4TWTA 1PMHX 3O0WA 3TBDA 4EROA 4AEKA 4LE4A 3C7EA 5C4WC 2JICA 1N3OA 1JHJA 4NIGA 1N3QA 3I2GA 4AVTA 2I45A 1MQTB 2VZUA 3HD8B 4RYDA 4AI9A 5KXBA 2EXHA 2ZX3A 1REEA 5A3NA 5IUQA 1HXS3 3GDBA 1BCXA 1YWKA 4M4PA 3JB4C 4WVVA 3NMBA 3MIBA 4D8MA 1OQEA 4OYUA 3WQ7A 3BU7A 2XVGA 1T6GC 1CIYA 1H4GA 2VZSA 5JOXA 1PO23 3DYPA 3MPPG 3J4UH 3FBMA 1RXFA 3PMSA 4XFFA 5GZEA 1XU1A 1FPN2 1FMD3 1LCLA 2WRAA 3AVRA 4P00B 4R9AA 5CKQA 4CEWB 5DN2A 1W8WA 2D3RA 3T2PA 2OIIA 4BYYA 4ZZ8A 2RS53 1RUE3 1FV3A 2VCMA 3K77A 2V5DA 3NNMA 3RS6A 5BNPA 3R6SA 1BMV1 1YNAA 5DDJ3 5DPNA 1ULDA 2RMU2 1RUD2 1RVF1 4NPLA 1G9FA 3MIHA 5FAXA 2R30A 3H7JA 3JU9A 1YRZA 1R1ZA 1NQDA 2XLAA 4XXPA 2V73A 3KS7A 3PIGA 2WQZC 4YW1A 1RYYA 5ABJB 1BEV2 2HWD3 3JD71 2QQVA 4D6SA 1AYN2 2HWC3 2YGMA 3ITQA 3NQHA 2YROA 3VHOA 1HIXA 4CXWA 4HN1A 4CU7A 1TG7A 2K46A 2Y60A 4BIFA 5K0UA 2HLEA 3I2OA 1FT9A 5DABA 1QNWA 2GNMA 2NPIA 1HB2A 3WF1A 3AP9A 1UOJA 3S5QA 4MHUA 4K3UA 1V6IA 3RYRA 4P9GA 1C4RA 4XURA 1X9TA 3RDIA 2D5FA 5K4LA 3ZSJA 3WW2A 4AGVA 1C8M2 2C9KA 5FYTA 2BWAA 2W95A 3VDDC 3BYWA 2F4LA 4JC1A 3IZOA 3WY6A 1GQHA 3AZZA 4XAEA 4UW6A 4E4HA 5BNOC 1D0HA 5J48A 3B00A 4RGGA 1W9WA 4Q0QA 1ZYBA 3TNPB 1H6YA 2W39A 3RMYA 1FX5A 3VZKA 3I54A 1PX4A 2X09A 1U5YA 1UOFA 2D6MA 2FDHA 4TLFA 5FZ8A 3WOGA 4LULA 3VD5A 5DAVA 2ZA9A 4XQ4A 3FMGA 1COV3 2VMCA 1NYWA 2ZX4A 1D2SA 3OPWA 4X6RB 1O4TA 2NMNA 2Y26A 3A7QA 3U10A 4G9SB 1OOPC 3LQCA 3V65A 1W8HA 4E27A 4XMAA 2R063 3MEPA 1TNRA 3RYKA 5DAQA 4Z92B 1RC6A 3IDBB 5APAA 2R0FA 5LEJA 2ZGKA 2R7EB 4XHXA 3I3DA 1PMJX 3MV01 3B93A 4JRLA 4DXRA 1J3RA 4JZRA 3VD3A 4BDVB 1GKBA 2C9AA 2GU9A 2JE8A 3WG2A 5FUNA 5T5JA 3O0XA 2ZGUA 4OQ9A 5AVAA 3SH4A 2A75A 4UF0B 1XNKA 3DECA 3ZMNA 4QQOA 3AMMA 1G9CA 3MF6A 3KHBA 3PU3A 5FCCA 3T3YA 1XC6A 3LWCA 4DXZA 3A0KA 4DIQA 1LECA 3HVDA 1HRI1 5CVRA 2RJLA 3ZFEB 4A7KA 4C8DA 3FBYA 1DHKB 3W5NA 1MS8A 3GF6A 2ATFA 2NM1A 4GA9A 2Z4FA 3MPBA 2BVBA 1O3TA 1B35A 5EXOA 2J1EA 1UZVA 1EPWA 2ORZA 4AWDA 4UXAA 1SLLA 2PQSA 5IFTA 1TEIA 1HX6A 3CZUA 3OUIA 3RMXA 4CEYB 3WQ0A 5FPAA 4ZONA 1QOTA 4O7XA 1SDDB 3OPTA 3ZX7A 3APBA 2J1RA 2VUCA 2EICA 4FI9A 2E7QA 3ETQA 4CP2A 1AR91 1K3IA 4FPEA 4ZHNA 4MLOA 1H1AA 3WNOA 2VTXJ 4XFIA 5FZOA 3VBUA 2V72A 1POV1 3E1F1 5GZDA 3GBWA 4CUCA 3ZO0B 4J1XA 2R043 5GZFA 2XUMA 3P1IA 3VHRA 3AYDA 3PNAA 4JDNA 3O7OA 1DFQA 1EV11 4OVEA 2WZPP 3JB8A 3VGIA 5JSRA 3LA2A 2MHFA 4XOGA 5IAVA 1ZZ9A 2ZGMA 1ZBE3 3VBHC 2V4VA 1UMZA 5HXMA 1HQWA 2RHPA 5G05L 2VXJA 1VRH3 1U5IA 1G9DA 1AR72 3R4UA 3R4SA 4ATFA 3F2ZA 3KF3A 5C4WA 1VBC2 3PVBB 4LBQD 2CWMA 4A3XA 3IT8A 2YY1A 3LSDA 2ZTNA 5IVFA 3A21A 1FAYA 4J25A 1IG0A 4LA3A 5FO7B 1VP6A 1UZZA 2WBKA 4QHBA 2WLQA 3LEGA 2MEV3 4QPIB 3SCGA 1JS9A 4HK8A 4LO4B 1WKYA 4PQQA 5FUIA 2QDRA 4I0WB 3QD6A 1KJRA 2IZWA 4HANA 4ZS3A 5TSWA 1YFXA 5K9YA 1UU5A 4HOOA 4BLIA 3PVEA 4XJ8A 1WCKA 3NL1A 3USUA 3I3QA 1UXXX 4WM7B 2RV9A 1FPN1 2QUOA 1JN2P 3B5LB 4QKBA 4BQWA 1QHDA 2R16A 4FOYA 3L2YA 1CAXB 2XJVA 3ZYBA 5KC6A 3UESA 2GC3A 1ZRRA 3KGZA 4MGKE 5FXZA 2RMU1 3CQOA 4RHV2 5IFPA 2WA4A 4X8NA 5F3EA 1RUD1 4KQ7A 1WWYA 4Q4X3 5BV6A 1GANA 3KB5A 5JR7B 5A1AA 1VMHA 2QZ2A 4FPHA 3FN9A 2ZS6B 4ORFA 3AMNA 2X5IC 4FTBA 2G4IA 3OOXA 3BN6A 4L92A 4QX8A 1Z78A 1JUIA 3KT7A 1BEV1 1BK0A 3OUHA 4OUMA 3SC7X 1KQRA 2HEVF 1AYN1 3KCYA 4UW5A 4YGEA 4YZ2A 5FYMA 1KDMA 2AR6A 4FQ4A 5DAXA 5A3OA 3RZKA 2VMIA 4OHYA 1OKQA 2ZACA 1W8ZA 2A6XA 3GYDA 1EPZA 4JGZB 4PI2A 4QGLA 2DTWA 3VD7A 4IE6A 4DXSA 4BQXA 3ZYHA 1RVF3 1F2NA 2WKKA 1XSQA 1RL3A 5LBBA 4H2AA 3WXPA 4CDQC 1C8M1 2OZ6A 4BHPA 2NN8A 1YJLA 2QKDA 5H9PA 1PMIA 4PBPA 5T52A 4YSFA 5BNOA 2UY8A 1S0EA 3UYJA 3K48A 2C4XA 3JD73 2XLFA 1CAVA 1F4HA 3URFA 2B39A 1W8NA 4CCDA 4UFKA 5FZEA 1DQ0A 1W3VA 3QH6A 4CPBA 3WHUA 4YZ3A 2D44A 1W90A 1RUF1 1H9PA 3W59A 3EYPA 2WO3A 3BTAA 4CA9A 4LITA 3I2IA 1T6BX 5EFUA 1OOPA 4HSJA 1N1SA 1O91A 2CYFA 3I2JA 4NAMA 2WYFA 4Q4Y2 1OLRA 4DPNA 1NCQC 2W46A 3AK0A 4FOVA 4M00A 2OPKA 3USSA 1W6PB 3NO8A 1FMD2 3ES1A 1GQGA 4QU2A 5FR3A 1C1FA 5FYIA 4GKXA 4B3NA 4MOAA 4FAHA 3UGGA 1UF2C 4AEMA 1LENA 3IDAA 4XJ9A 1VBA2 4CXXA 4AI8A 4I0BA 1SPPB 3PU8A 1O7FA 4D94A 5DG2A 2VUJA 3VZLA 3K46A 5DZGA 3JBG2 2ARBA 4OHZA 3KGLA 2VOWA 1OMIA 2QCSB 5LASA 4A2UA 3GGLA 4AFAA 1DZRA 4YVWB 4AK3A 1K12A 1V9U2 1W6NA 1DG6A 1ND3C 5BY5A 1CJDA 4AEDB 4BJ0A 1X36A 2ZGNA 1DYPA 4XQDA 4DUWA 1LOGA 1GUIA 3IN9A 2R49A 3THDA 3WP4A 3ZSLA 3ZVXA 4AHZA 4XDQA 2TEPA 3J7HA 4FPLA 4B8EA 1GBGA 5L7OC 3I8TA 4TSVA 5FWEA 2ZEZA 1OF3A 4UI9L 4LLFA 1GNYA 4QB6A 5F2WA 4WZCA 4CEWC 1GR3A 1ZZBA 5CNAA 1G86A 1ZRFA 2DVGA 4YGCA 1JYTA 4IGQA 2JG9C 3WF0A 4LXLA 2VUAA 4NUBA 2YV8A 5HBAA 3TEYA 2TBVA 1O6UA 2E53A 3NNLA 3WCRA 4UW4A 4YFZA 2CV6A 3RNSA 2OVUA 4CP9A 3MUZ1 1CIWA 2IFRA 1UY4A 2Q1MA 5FYZA 5LZ6A 2Z2SB 2EALA 4JKKA 5FY8A 1ENRA 2WNUC 2ZEWA 3CLPA 4XTMA 3I2DA 3VLBB 1HRI3 4YGDA 2XQXA 2IFWA 1Q8OA 2BJSA 4XDPA 3UT0A 1CESA 4Q4W2 3VBHA 1GWLA 3V64A 1C5HA 2VUDA 2GH8A 3WNXA 4XJZA 2JB8A 3MZHA 4OQ8A 1VMJA 2QZ3A 4AQ2A 2VNVA 2FZ1A 5FRAA 1AL0G 2BYVE 1W0NA 3UNPA 5LY2A 2GC0A 2YBSA 5C3PA 1MS0A 1UN1A 3TEXA 3ZYJB 2JDMA 1H2KA 3KV6A 2IXHA 3NAPB 1JOJA 1XU2A 1LEMA 1Q3EA 1JH5A 3IBMA 1VBC1 1S0JA 3GZAA 1AR93 3KCCA 5IVVA 1STMA 4LLOA 5AFBA 2XUEA 1V6OA 3HN3A 3AYEA 1QDCA 3E5UA 4JVAA 4ZKTB 1DGLA 2W1UA 3DCQA 3DL3A 5A33A 5BNNA 1POV3 1VBD2 2Q8EA 3ACIA 1LTEA 4S2DA 3RWNA 4E4ZA 4LHNA 4TTGA 5FYHA 4HK9A 3BTXA 5I8SA 3WUDA 1PVC2 1ODMA 1EV13 1IKPA 3PURA 4FCAA 1W28A 2VZQA 1QOSA 2ZGQA 5J36A 1QWRA 1DGWA 4Y1UA 4GULA 1A78A 1KEXA 1YIFA 1UU6A 3GZEA 3GZTB 1S0GA 1GWKA 5LK5A 3H8XA 1GWMA 4EWEA 3RZZA 2Q8CA 4UFIA 5BUVA 5FQ0A 4BM8A 3KSCA 4QXBA 1DQ6A 3K2OA 4V2VA 3VZNA 5CADA 3SKJE 4RHV1 2A3XA 2X5IA 4DRRA 1Q5OA 5J1XA 1UIJA 5FZFA 4QGMA 5LB6A 5I93A 4YPJA 5J7MA 3LIHA 3TRSB 3OGGA 3WW1A 5CFDB 5IT6A 4ES8A 5C9AC 1OT5A 1GOHA 4QX3A 2YXSA 4ASLA 4N9IA 4Y4YA 4L99A 3VL9A 2DURA 1CPMA 4ISQA 4LBQB 4MYEA 5FXWA 3RJRA 2DDUA 2FDGA 1PNGA 4W50A 1D0GA 4QGNA 5KXEA 3CJIC 1W04A 1FPN3 1QQP2 1O5LA 3GXUA 4XTPA 3WSOA 3ZKYA 2PYTA 3T09A 3IPVB 4YYOA 1SLCA 4A45A 1W6QB 2VMGA 2ADDA 4GMP0 4CDQA 5JIAA 3N9MA 4P9JA 1NKGA 3RZGA 2RMU3 1NOVA 1ZBE2 4XBQA 4CEYC 4A7YA 1RUD3 2P3IA 1PIV2 4M3CB 4AW7A 2DUPA 4K8RB 4OUSA 2RDQA 1GP5A 1VRH2 1TME2 2VMDA 1GU3A 3KM5A 4SBVA 4GKYA 4FP2A 3AP6A 1VLNA 4QHOA 3ZKUA 1UZWA 2D6NA 3OBRA 2ZGPA 3VB9A 2RE9A 4I30A 2QQMA 2P3KA 4MX3A 4Y20A 1LRHA 3X29B 1AYN3 5FZ7A 2PHUA 2MNGA 5C8WA 4OFGA 4IETA 5I91A 4K6BA 3LZZA 2D6KA 2MEV2 1YHFA 4OZOA 5F9TA 1Y4WA 4B7EA 2XH6A 1F5JA 4P9LA 4NMIA 2O14A 1RUOA 5ERLA 2IWGB 5CBLA 1W39A 2BV4A 4N8MA 4Q4Y1 4TZDA 4P9IA 1GP6A 2DCYA 2DV9A 4AHWA 2ZBJA 5F5CA 3V0AB 2BPA2 1FMD1 3HNBM 3POSA 4GH4B 5IW0A 4AYUA 5FP4A 1C8M3 2PAMA 5D8AC 5F37A 3S5AA 1IZ3A 4JRAA 4JGYB 1HB1A 1QJU2 1VBA1 1L7QA 4B4QA 3EBRA 2VMEA 4GJYA 4YNIA 2ZHKA 1V6JA 2G1MA 3EQEA 4Q4X2 2WT0A 4CUBA 4UFJA 3T2TA 1MACA 4Y1VA 2V4AA 5LCWL 1UZ0A 1W8TA 2ZX2A 2E9QA 3JBG1 4CDWC 1RUF3 4Q29A 2LRPA 1X8EA 4QPIC 1ND3A 2CAUA 4YG0A 4EN8B 2OPWA 3KCXA 5IVYA 4FPYA 1V9U1 2R072 5L7OA 3WX5A 1QJZA 2NZ9A 3O12A 4XDOA 5FZMA 4XZUG 1R082 2B46X 4K40A 4K20A 1DLLA 4Y26A 1OD3A 4P02B 4UW3A 4HBNA 2JG9A 4OI0A 1F31A 4JKLA 1DZQA 2OA2A 5FZ9A 3C7GA 4Y33A 1BLZA 2QQJA 2W0XA 2GC2A 4FTEA 2DTYA 3KVBA 4QM8A 5L9RA 3T0BA 5FOJB 3ON7A 2XKOA 2ZGOA 1I3HA 2PHWA 2W08A 2WNUA 4JCKA 2I2SA 4LR4A 1JUHA 4AEJA 4FBFA 2WFF2 3U0ZA 3AFKA 2PFWA 4YVSA 1J1LA 1LB2A 2XKPA 3HQUA 1W6NB 3BCWA 2ET7A 4Q0VA 4Y1ZA 4LHLA 2P2KA 2H6CA 3HMYA 5LBFA 1NCRA 1AUYA 5EP9A 2XJUA 5FZ0A 4IV3C 4Q4W1 3ME2A 4RFRB 4XMIA 3VV1A 4B4RA 1F15A 2JKBA 5GLUA 1Q56A 2ZMLA 1W2TA 1W9TA 2GALA 3ILNA 4RS5B 1UY0A 3PTRB 1ZZ6A 3HPNA 3RZHA 1MR5A 4XC9A 1K5MA 1W0OA 3FJSA 2C6SA 3UK9A 1YFYA 4XIKA 1WUVA 2GH2A 1HV0A 1CD3G 4AI3A 1ZBA2 1VBB2 1O3RA 3MHZA 1UO9A 2DBIA 4P14A 3ZYIB 1PO12 1YYNA 2VXRA 1JYVA 1VBD1 1QU0A 2F4PA 1CZTA 1HJFA 2YFZA 3KWVA 4AQSA 4IDZA 3FLRA 2BQPA 3FZ3A 3NSTA 1PVC1 3W5MA 2JD4A 4CDUC 2W94A 5IAXA 1LHUA 3AKSA 3C3VA 5A1FA 3AJYA 3OGRA 1L7LA 5JMCA 3WP5A 4AVBA 4HG6B 3MGUA 1W2NA 3R4DB 1QJY2 4KBZA 5D1IA 5KHKA 1G9AA 2YZ4A 3SQOA 2ZMKA 2NMOA 2OQ7A 2P3JA 3FHIB 4QKNA 1LOEA 1WZXA 4H7LA 3WINE 1VBC3 3W9AA 4WZFA 3JUUA 2WQ4A 1ULPA 1SFNA 4GIQA 4PIYA 5FYBA 3HR9A 4Y22B 4N43B 3MLLA 3T4HB 5BNNB 5C9AA 1YEWA 4YGBA 4AQ6A 5EWSA 4AR2A 1QOOA 2A3YA 2CY6A 5DG1A 3M3IA 4GWJA 4KH9A 5IVEA 5FLHA 4Q5OA 5GALA 2D7FA 1VB2A 1BBT1 3CJIA 2IXJA 2JENA 4DQAA 1IPSA 3P6BA 5IK7A 2FDKA 3GZUC 3M4FA 1WLCA 1QQP1 2VQTA 2YFUA 4AEDC 4EV0A 3T1LA 2JDZA 4FO9A 2J1SA 1LAJA 5I8YA 1S55A 1HQLA 2XJTA 2P4EA 4RHV3 5K8SA 2K9ZA 3FFQA 1C1LA 1GFF2 1NAEA 1PIV1 1ULFA 1YQCA 4AL9A 4ZU4A 1TME1 3VUOA 1QMJA 4F8AA 4UAPA 1PGL2 1DU3D 1AR92 2E26A 4DEVA 4NHKA 5JXIA 1CVNA 2CGNA 2ARXA 2JDNA 2W87A 4LKSA 4QPGB 5A7WB 4BMBA 2WLPA 3LIGA 5KXCA 5J37A 1ZRCA 5JUVA 5L36A 1KFXL 2HYXA 3CJXA 2UU8A 3VKLA 1Q8VA 3VDAA 3WG4A 3O1SA 4HPKB 4K1YA 4L9BA 3M1HA 3VBSB 2ZZQA 4TN7A 3OBAA 1IQAA 3POBA 2XB6C 2GP3A 3AJZA 4IE7A 3ZXDA 3HT1A 4BQ5A 1OVPA 4Z1VA 5C5UA 2FCVA 2DCZA 2BFUS 5GLZA 3KD4A 1ST8A 5D8AA 1YI9A 3AVSA 5IK8A 5BNQA 2RM22 3VZOA 5FDBA 3NAPC 2OX0A 4QPYA 4EWAA 4HT1T 4PIXA 3AL5A 1QJU1 3OGSA 2BTVC 5I0DA 1I6XA 4BH9A 4CCLA 1SG3A 2HWB2 4N53B 1OLME 1NA1A 2C24A 2QQNA 1IKQA 2Q30A 2XDVA 2ZOEB 4Q4X1 5IJRA 3RRDA 4CDWA 2O0OA 3NV4A 2YB7A 4RGKA 4MGIE 1OUSA 3V0BB 3E5XA 2XOMA 3WLUA 3OSDA 2IXCA 4FPGA 1XNBA 3I2KA 2D3SA 4MZUA 3N36A 4MGZE 5EHDA 1QNYA 4B29A 1OQDA 1LKNA 2YC2A 1N1YA 1RUJ2 3UKTA 2VD7A 2R071 5LA0A 4UBGA 2PN5A 1H2NA 2WR9A 4WM8C 4Q4Y3 1JXNA 4LBOA 3ZFFB 1XE7A 3K3NA 4YLZA 1O5UA 1R081 3HJRA 2E7AA 5CKMA 2LTNA 1H8TB 5AC92 2WO1A 1U12A 2WQ8A 1OA4A 4I3GA 4PT6A 4WVWA 1XJAA 1VBA3 3I7DA 3N7KA 5KBFA 1KFUL 5CFCC 1OA2A 5HCAA 5C33A 3AYAA 4R52A 1BVVA 2VJXA 3BKZA 3VBOA 3AKTA 1AF9A 2ETEA 3N3HA 3WNPA 3PJQA 2P17A 3AYCA 1NX9A 3JBG3 1UKGA 4MGYE 1UMIA 2E31A 2WFF1 4X8PA 3K3OA 3HWJA 5H9RA 4FPFA 5CFDC 1I1EA 1GNHA 4AXOA 5AFEA 1TVGA 1UWWA 2AYHA 3RG0A 1ZRIA 1HV1A 1V9U3 3M70A 4IV3A 3VKFC 2GMMA 1VALA 3N9LA 4LHKA 3B02A 1LHWA 4HKOA 4RN5A 2AEYA 4AFMA 1YFWA 1G8WA 3WD5A 3U4XA 1O3SA 4PBOA 2EIDA 1ULCA 3K4AA 2HEWF 2Y6GA 4U2AA 3POIA 3THCA 4QQLA 1VJ2A 4PQ9A 3W21A 2FZ2A 4UT5A 2JG8B 1X8MA 1QF3A 1JI6A 5F6KA 3BVCA 2JB4A 3NRUA 3ZXLA 4INDA 4YZ1A 1W6MA 3T30A 5A3WA 5JPMB 2UY9A 3ELNA 1MS9A 3OGVA 4Z8BA 3Q9OA 2J42A 3ABZA 4EQVA 1ASJ2 1ZBA1 4FAGA 1VBB1 3OEBA 1H30A 5HI0A 1CX1A 1PO11 4LO8A 1GZWB 1HDKA 3AKRA 4ET7A 3H0OA 4BXSV 3ZIWA 2PHRA 4CDUA 1FNZA 4P9WA 4YW7A 3C7FA 4P9XA 1C28A 1T2XA 4LORA 4YM0A 1CAWB 1URXA 4XBNA 5DAPA 4Q4W3 5JZGB 3GJAA 2PA7A 4URAA 1RUF2 2C1FA 5LBEA 2V09A 3NV2A 3AZYA 5C8CB 4O61A 1PNFA 2A6VA 5A7SA 1O4YA 5A6YA 1QJY1 3ACGA 3D8CA 1K5MB 2WNOA 2TNFA 4ARYA 4Q27A 3H8RA 3IAQA 3FHQA 2YBKA 4I02A 2EIEA 4HVOA 5KR7A 4ITCA 4IV1B 4OI2A 3QOPA 3GCXA 4KG8A 1CX4A 1BHGA 4XUPA 5FPBA 5A7PA 2KR2A 2ORXA 5FMDA 3AKQA 1LULA 2WT2A 1R092 3NJZA 5FY0A 4F3JA 4JQTA 3K4DA 1VBD3 2VZTA 1PK6C 4V1PA 5FZCA 1V6MA 5JIUA 4SLIA 1GQPA 4XUTA 4LKFA 2DFCA 4D6QA 4O9GA 1PVC3 1GP4A 2XBO2 3RJ2X 2BFUL 4FFHA 4MADA 3KF5A 4Z82A 1DBNA 1ZZCA 3H3ZA 1HRV2 3RZMA 3DPRB 2W91A 3OYWB 1ODNA 5A6QA 4MXVA 2Q8OA 1MS5A 4MGQA 1RGSA 3LOIA 1ND2B 3AP7A 1VRBA 3VBFB 4CDXC 3TAYA 2G9FA 3ZFGC 1F4AA 1OC1A 2PELA 4AQTA 2VW0A 2ZX1A 3JCIA 4GD4A 1OA3A 1ACCA 1AYM2 4RQPC 3LEMA 1WCSA 1ZVFA 3BOPA 4ONUA 4Y5Z0 5JLVA 4H14A 1XE0A 1J84A 1MS3A 2VCBA 4XEZA 3WCSA 4D69A 4E4DX 1MVEA 1PGL1 1WD4A 2H0BA 1CQ9A 4IEVA 1ALYA 3QLQA 3T1MA 4CVUA 2WAOA 2VPVA 5JR2A 1BBT3 3HAGA 4IQPA 1CZSA 3P3PA 3KHCA 4K9SA 4YWAA 3ZIXA 4DY3A 5B4NA 4J6GA 3BPSA 2XG3A 2Z42A 4XVHA 4DINB 2EIGA 3I59B 1QQP3 5FMOS 3VBRC 2JX9A 2YYOA 3ZPYA 4EN6B 1EAH2 5HCBA 1NY72 5GLVA 5JOZA 3T0AA 1JOPA 1FOD2 1M06G 2Q0AA 1S2EA 2QNKA 4E9KA 3RI9A 2WAAA 1DQ5A 1RXGA 1UOBA 2WNVA 4FVVA 4MO3M 1PIV3 3M3EA 4FOQA 1S1AA 1TME3 3W58A 2RM21 2H6BA 5IHRA 2YGLA 1G9BA 2FMDA 2ZJCA 1ENXA 3KZ4C 5A32A 3C7OA 4D6RA 2HWB1 1Y9MA 1YC61 1OFSA 4OMDA 2VG9A 2VECA 1NE4A 2BU9A 1XPWA 1TZOA 5KHHA 1PM4A 4Y5SA 3JXSA 2HWF2 2D3PA 4C0HA 2W47A 2KXLA 3HQRA 1EY2A 2CDOA 3OY8B 4WM8A 3KV9A 5I0TA 3RPQA 4J1WA 4WVMA 2ZEXA 1H4HA 4Q1RA 1RUJ1 1YUDA 2IC1A 3POYA 3AKPA 3PUAA 4FQZA 1YQ8A 3AMQA 1S4CA 1UD1A 4MVTA 4MSVA 5FY9A 3H3UA 3PUSA 1ZA7A 4IE4A 3TOJA 4DZGA 4L11A 3ZOIA 2DCTA 4IESA 4IEUA 1H0BA 3GNEA 4NAOA 2GP5A 1H8VA 4ZXEA 4IEYA 3S6PA 4BIOA 1RUI2 4Q8KA 5AC91 5CFCA 2XPJA 4MXWA 4WV8A 1WBFA 3CMGA 1QJU3 1W9FA 4RR3B 3K4ZA 1YJKA 1VR3A 1NA1B 2E32A 4QQ2A 3HNYM 1Z0HA 3H3LA 4UOJA 1NQJA 1ONAA 2JJ6A 5JI9A 1UYYA 5IK4A 1DDLA 5LATA 3VD9A 3I2FA 2BP6A 1QH7A 2VQAA 4IERA 4G4FA 2R073 1QJX2 1RUH2 3R0RA 3IB3A 2CSGA 4M01A 1NLRA 1NE6A 4M3CE 4NHLA 4QX1A 5C3QA 2BEOA 1F8VA 5A3TA 5EYXA 1R083 3LEKA 2WN3A 4FTSA 2Y6HA 2Q1FA 1CAUA 3PUQA 1YI7A 2AACA 3QACA 4KWUA 5BNPB 5F5AA 2EAKA 4EYUA 1WMDA 1E5RA 2XXZA 4GQ7A 4AFDA 2D98A 4CPBD 3VDDA 3VBOB 3WHTA 1W3XA 2PAKA 1C3HA 5FKCA 2LALA 4IL7A 1ASJ1 2WFF3 5FREA 2GAUA 2VZ1A 4QDQA 3VHPA 4F7ZA 3ATGA 5ANNA 1RINA 4CSWA 2VMHA 4BB3A 2P3YA 4YFWA 5SV5A 2AGSA 3MF9A 5K0UB 4PDWC 3MBWA 4IUGA 4CP1A 3RVHA 2QDNA 2FDIA 3VBSC 5FKBA 1Q8QA 5CYYA 5JCTA 4BZ4A 4FT8A 2VAUA 3GALA 3ECQA 4EJRA 2YDEA 5C3OA 2XLGA 2VZOA 4XCBA 5FZLA 1ZBA3 1VBB3 3Q8FA 4A44A 4CXYA 1R091 1OD5A 4BQ2A 3LKJA 5FMOL 2PHFA 5JSPA 1PO13 2AENA 3BTYA 4R4XA 2BERA 1JZ3A 2OYZA 3SNMA 5FYVA 1J59A 2CL2A 3NWKA 5KC5A 3EJKA 2VOKA 5FOBB 5CG9A 1G7YA 2XJQA 2XBO1 2RVAA 1HN1A 1MQTC 1TQ5A 1HRV1 3P5BA 2L9LA 4XIOA 4XUOA 3H50A 1DCSA 1QJY3 4LOSA 1QEXA 2EA7A 4CDXA 3POFA 3AL6A 5KHJA 3ETPA 1D7PM 1S0BA 4N9HA 4XQWA 4H7MA 3ZFGA 1POQA 1GICA 4Q1PA 1HJGA 1REDA 1SBDA 1WLTA 1Z7S2 3C2UA 4QU1A 5C5TA 4RQPA 1H8TC 1A8MA 4FFIA 2LUWA 4YW6A 5BYNA 5CG8A 2GN3A 3H8UA 1QGLA 4FP3A 1AYM1 1LESA 2A5ZA 4LBLA 5G04L 3MDPA 1WLDA 3ZN5A 1JODA 2BNNA 2PXJA 4W6XA 1KDKA 2ZAAA 3IIIA 3OD0A 2AUYA 1P8JA 3KV5A 4LBNA 3WZ1A 2YHJA 3RYPA 1SHWB 4Q8LA 1OHFA 1WCDJ 1CPNA 3VBRA 3ALQA 2XL7A 3LDBA 5ABJC 4EE2A 2GN7A 3LD8A 4UFLA 3MW4A 1NXMA 1H2LA 1EAH1 3DXTA 5L19A 1NY71 2VZVA 3D5OA 4DMIA 3TEZA 4RD7A 1B35B 3LFMA 1FOD1 3HQXA 4R8HA 4XHBA 5IVCA 1GOFA 4NRQA 2D6LX 3BOWA 3VD4A 1A34A 5FV3A 4NROA 2B9UA 2ENRA 3IKWA 1RHI2 4OHVA 3O14A 1SCSA 1ZZ7A 2JDKA 3ZR6A 2E7TA 4OMCA 1OQ1A 3ZXEA 3EO6A 3GBGA 3NKGA 3MW2A 2VTXA 4QX7A 3RZJA 5FZOB 3VBUB 4BQYA 1NLSA 4M0HA 2BGPA 1V6LA 2VULA 2ZMNA 4KWJA 3U75A 2YC0A 1AX2A 3MICA 4NWVA 2HWF1 2W5FA 2WWUA 2LROA 3N35A 2ERFA 3CL1A 3WV6A 4BQ1A 4IXLA 4L0PA 5BXXA 1KXGA 3CDZB 3N7LA 4WVZA 2J1VA 1E5SA 2DVBA 3MO4A 1PGW2 2V5YA 2UYBA 3IMMA 3N9NA 2WNVB 4YG3A 2YG0A 3SHRA 3VDCA 4CUGA 1F35A 5FY7A 4AI0A 5A3PA 2WIIB 1ZRDA 3KT1A 2VVEA 5FY5A 1SEFA 2RR12 2PAEA 2RM23 2XJPA 2YC4A 4B4PA 1RUI1 5FYSA 2P34A 5C4WB 4LEJA 3C7HA 2WYSA 4IE0A 4U36A 4DUVA 4PLNA 1ULOA 2HWB3 2ZGLA 4XXAA 1UOGA 1OI6A 4EN0A 2N7GA 3J8F2 1VPHA 1A6CA 1QH6A 3E6BA 4D7TA 1SACA 2QFEA 4WVMB 1VAVA 2UWCA 5T3NA 1RUJ3 1KJLA 1BBT2 1D4VB 1QJX1 1RUH1 2B9VA 3U07A 1JYCA 3U4SA 3ZM8A 4A6OA 1OURA 2VCCA 3USUB 4JDOA 4QAWA 1GZ9A 1NLQA 3N9QA 4LMFA 4RA0A 1AZDA 1DGRN 5AC93 3ZFEC 2Z69A 1LU1A 1UYXA 4UBHA 2CGOA 2OQ6A 1W8UA 4AVSA 1WGPA 2JD9A 3DF0A 2OXBA 4LIVA 1XYNA 1DQ2A 2VU9A 5B2GB 1JYXA 2ZPXA 1Y7BA 1JYIA 3VKNA 4BQ4A 1AX1A 2CTVA 1O3QA 2FMYA 3POEA 4IEQA 1YQ5A 2PHLA 1D4M2 4DS0A 1J3QA 1YQ2A 4XF1A 4QKFA 2ZHNA 4CCJA 1CR7A 5FBJA 4R9DA 2DCKA 4PDWA 4ASKA 4LKDA 5I8TA 2JIGA 5F2SA 3I97A 1I5PA 3J26N 4IEZA 2KD7A 4QPWA 2CAVA 1IS3A 4QDRA 5FMBA 3SH5A 5EIYB 4D7SA 1PX3A 5T54A 3VZMA 4DXTA 3BGAA 5IYYA 1NCQA 2W92A 4XW3A 1GOGA 3T0DA 1MS1A 3JZVA 1JZ4A 2GMEA 1AL22 2FDJA 3VDDB 1VBE2 3AP5A 1DGRA 5L9BA 5T5PA 4CE8A 2Y0IA 4XFAA 1LGBA 5E1RA 1S0CA 1ASJ3 2WWSA 3OPZA 5GLWA 2Q8DA 5BNOB 3BUCA 3H9AA 3UJOA 2HWE1 4AHYA 2PMWB 3PMEA 1CAVB 3UKNA 2FCUA 4YZ5A 1LR5A 3MIFA 4Y5TA 2GDFA 1RUNA 5JVVA 2JECA 2UYAA 1PZ7A 3IMNA 2R1BA 2HBUA 1QDOA 4GJZA 3CEWA 3HIFA 1OOPB 3I49A 2BZDA 4LE3A 2WL1A 4YRDA 3O5SA 5B4XA 4XABA 3PDQA 4CEWA 4JQRA 3KV4A 4KNCA 5A3UA 1UAIA 1Z7S1 5LRSA 4WM7C 2A6YA 1SLTA 2VZPA 4BCUA 3I4IA 5DMYA 4I09A 4B7KA 1A8DA 5A80A 3WQBA 2IXLA 4BA6A 1R093 3O1MA 3I3BA 4BPZA 4E2QA 1J3PA 1S0FA 2CNAA 2GSYA 1KS5A 3ILRA 2XBO3 1YFUA 2RG4A 4FPKA 3CU7A 4IEXA 1HRV3 3M2MA 4YARA 3UETA 2RJKA 3MLKA 1BK1A 2ES3A 1RMU2 2H0VA 3IAPA 5FBZA 2Q4SA 2RS32 1ENSA 1X9PA 4R9BA 4A6SA 3LPFA 4OUEA 5J3UA 2W52A 2ZKNA 3Q8EA 2AH2A 3KQRA 2QTWB 4JTOA 3DYMA 4XF9A 5E89A 2E63A 4XFGA 3S7IA 3G7DA 3NNFA 4QB1A 4S2HA 1QKQA 4LKEA 3H8OA 1K45A 2F17A 4JGZC 1AYM3 1SFYA 1RHI1 1QXJA 3E6CC 1E57A 3AM2A 4CP9B 2NP0A 2PQQA 4DOUA 5F3IA 3LSEA 2J7MA 4XF3A 2YUEA 4CCMA 1SQ4A 3AXEA 4TYSA 2EXJA 2VOTA 3OG2A 3NJVA 3ACFA 2HKXA 4DB5A 4BMEA 3WR0A 1UX6A 1HLCA 1ULGA 1Y9QA 4OHWA 5IATA 1EAH3 1DQ4A 3VBHB 4COWA 3MFAA 4JV4A 5FY4A 4CCEA 4E8CA 1FOD3 4ATEA 1AR82 2XJSA 1PGW1 3WNKA 1JYNA 2VR4A 2C0ZA 1PHMA 2D93A 1XYPA 2RR11 3SEPA 3WQ1A 1IHMA 4EN7B 4URTA 3WW4A 4XACA 1S0IA 3RFRA 1W9YA 2P1BA 1I5ZA 2DVAA 3VN4A 2IUWA 3S30A 4COZA 3SMHA 1JZ5A 2VNRA 4XJUA 5A33B 4Z2AA 4XCAA 4NIDA 5JOYA 3CHXA 5CZKA 3J8F1 3UJQA 4YW2A 3IDEA 2HWF3 2J1TA 4N7UA 4MGTA 4PLOA 5EPAA 4C1XA 1X82A 3AZXA 4AI1A 3AX4A 3B7MA 1JBCA 2DBNA 3EHKA 1UX7A 2B7YA 3TNQA 1HKDA 1ZREA 1AX0A 1FXZA 4BQ3A 2QE3A 4YVWC 4CUAA 1YXWA 2ZHLA 3ZFEA 5FYCA 5FO8B 3CF6E 3FL7A 2OW4A 5FQ0B 1RJ7A 1JU3A 1M4WA 1RUI3 2O1QA 3DYOA 5T5LA 4XFHA 3ZXJA 4CEYA 2VNOA 1IS4A 2DVFA 1W6OA 2BGOA 4HZFA 2X5IB 4HKLA 1RITA 2XONA 2ZGRA 3HOBA 3ZYRA 2ZABA 3ZXGA 3AMPA 3FFZA 1Q8SA 2R32A 4LQRA 3OGJA 3POGA 1D4M1 3T08A 1OSGA 5HPOA 1X33A 2C5DA 2YBPA 4META 1ZZ8A 3PVNA 5F6LB 1V6NA 3DV8A 1QJX3 1RUH3 2WSVA 2ZAHA 4DUXA 3UGFA 3RWKX 5JXHA 2XHNA 4BU2A 4FPJA 4A4AA 1R1A3 2JXAA 1F5FA 5IK5A 2CGPA 3CKHA 4YW3A 1QIQA 1U0AA 1ZX5A 2WO7A 4KU8A 2HH9A 3U14A 4CDQB 3ENRA 3FUOA 2VC9A 1SBEA 5FO9B 2BRTA 1FI2A 4RSUA 1AL21 4QT6A 2A6WA 1VBE1 3PVOA 3OBZA 2OZJA 2VNGA 2A70A 3L2HA 1UY1A 4NR1A 3N7MA 2OUHA 4HL0A 5ACA1 3NW4A 4Q0PA 1SLBA 2B5HA 4Y20B 2K2SA 2W1WA 1EYBA 4XUQA 3LGRA 3B3QE 5F39A 1WBLA 3BIEA 2B42B 4AVAA 2BBAA 2D6PA 4QPIA 3I3EA 4WBBA 5DUUA 2WZ8A 1WA6X 3WNNA 1UQXA 1H1MA 4R9CA 4HVQA 1LODA 4ZPIA 4W6YA 5CKNA 1NCQB 3O0VA 4P5YA 1DLCA 1XYOA 5FZ1A 4COUA 4YW4A 1GYKA 1OLMA 4WM7A 1YCIA 1WW4A 1PGSA 1R64A 1YQ6A 3TN92 4NHMA 1XNDA 4GB33 2DYCA 5CIRA 2XWBB 1O8SA 2Q1ZB 3EXUA 1AVBA 3MLJA 3HBKA 4M4RA 5FXVA 1F9KA 4AGRA 4HN0A 3ZPOA 5A3LA 2HWE3 3AMHA 4W8JA 5FXXA 5JPNB 2VH9A 2FBEA 3LFIA 2NLRA 5H9SA 1WMEA 2RJ2A 3O1RA 3HT2A 4MGSA 1DIWA 2YPJA 4QQHA 3ZXFA 4MG2A 1ND3B 2DUOA 1DZTA 3VKOA 5EQUA 2PHDA 3BU0A 1I9RA 2A6ZA 5E88A 2A7AA 1RMU1 2WUHA 2ZGSA 5L7OB 2WZR2 5I0UA 2RS31 2Y6KA 2W1SA 4K21A 4BISA 2HBTA 5F32A 1UXZA 3OBTA 3H1YA 1Z7S3 1V70A 2KM2A 2YPDA 4JGZA 1MEC2 4NN0A 2JG9B 2QJVA 4PHZA 3LDKA 5FK7A 3PUIA 5FP9A 1XSRA 5CISA 2LW8A 2XWJB 5T50A 4NIHA 5KHGA 1W0PA 3CNAA 2ZEYA 3CIHA 2R0HA 2VBBA 2WNUB 4CTEA 2VE1A 1AR62 5FZIA 3PL0A 4YVSB 1YLLA 2QVSB 4EZHA 3B9IA 1O8PA 1WLWA 4LT5A 5IVBA 1VIWB 2GNDA 5FK8A 3B9CA 1VAMA 4IEWA 2EVXA 1NCRB 3KVAA 3FX3A 2WS92 4AG4A 1W9SA 1BZWA 1UNBA 3ZR5A 1US2A 5J98B 1LGNA 2PLV2 5FTTC 4HSLA 1CZVA 4NOTA 1DGWX 4Z07A 1AR81 3M3OA 3WNLA 3OUJA 4NPMA 4NE9A 3BB6A 4MUVA 4AVVA 2VVFA 1CJPA 2RDRA 5I0RA 4Q4V2 5T5OA 1J1TA 1Q8PA 3H7YA 1W6PA 3NV3A 1RHI3 1IGOA 4XFBA 5IVJA 1V6KA 2B45X 2BUKA 5LK7B 1IOAA 4KG0A 1MZ5A 4AVCA 5KXDA 1ENQA 4C1WA 5JDBA 1H1IA 2Y6FA 3ASIA 4GH4C 2AZ5A 1TMF2 1UCXA 2VTFA 4RL7A 1SPPA 1HB3A 1PVXA 4D0QA 1N3PA 1BJQA 3FE5A 3J7NA 4JGYC 4JKMA 1QJFA 1JW6A 2WC2A 3ZXKA 2XQRA 4H55A 3BODA 4R4ZA 4XFCA 3FC0A 2Y6LA 4XAAA 5DUWA 2EIBA 4YVWA 3F95A 1DQ1A 4AEDA 1MVQA 5CAZA 2VZRA 3C8XA 2X10A 2JDUA 1W03A 2RR13 3DXUA 3RQ0A 3Q8AA 1Y43B 2VW1A 2GNBA 1GLHA 4D3WA 4HETA 4Q0UA 3ZDSA 2A3WA 3AP4A 2WDBA 5GZGA 2E6VA 4M3CF 1AXYA 3T2OA 1WW6A 2Y33A 5F5QA 4ZY9A 5C9AB 1Y3TA 4JHTA 5I0SA 1RUG2 1N47A 3J8F3 4YM1A 2E51A 2BVVA 1OKOA 4COYA 2F6BA 4KL1A 1SBFA 5EJ3A 4E8DA 4ZZ5A 4GWIA 2IXIA 4NHXA 2XGXA 3H1WA 3D82A 2B8MA 3HNMA 3CJIB 2Q5TA 3HBZA 3CBNA 4GZ9A 4KBBA 3B94A 5E16A 5JXJA 1GV9A 4K7JA 4GWNA 4NRPA 4QHZA 2W2IA 3JQXA 4HXCA 3H1MA 1SCRA 3J7MA 2BDRA 1JU4A 4NVPA 2DU0A 3E6DA 1W6OB 1FV2A 1W05A 1UIKA 4RS5C 2NQYA 3Q8CA 2UWAA 4I2OA 2JDAA 4IEOA 1E5IA 3NAPA 2HJIA 2VGDA 3DKQA 3KT4A 5FZ3A 5FZKA 2BWCA 5FZBA 5FJHA 1D4M3 3MW3A 2OUJA 2WNEA 1U5ZA 1S0DA 5K7PA 2I07B 3NJXA 5A7QA 2QQIA 1UW8A 1NZCA 1OFNA 1OH3A 3WP6A 1JZ6A 2EXIA 1CWPA 4FPCA 2YU1A 4OZXA 4QDSA 1PZ9A 5FLJA 2ARAA 3N7JA 1LHOA 2ZCWA 3WNMA 3IIAA 5FPLA 4PJYA 1CONA 5GLTA 1QY4A 2Z79A 2VBDA 1AL23 3A0NA 4OCTA 5D8AB 3TN91 3IM0A 1VBE3 2JE9A 3D0SA 1JZ8A 3PHMA 4UWDA 3UL2A 3WDYA 4QXCA 4XJAA 4NWWA 1VB4A 2RS12 1NZIA 3KLSA 2EF6A 1MZEA 1KITA 5ACA3 3VDBA 1RUC2 1XRUA 2WN2A 3VHNA 4MV2A 5D2AA 3BALA 4CDWB 5AVPA 5JOWA 5CFDA 1W2OA 3AZWA 4N43C 1SDWA 1LOFC 5FJKA 5BNNC 2ID4A 4NPRA 4NRMA 4E4SA 5JMOA 1LNSA 4Q26A 5L73A 1LOCA 5F3CA 4K1ZA 4LBQA 4D7YA 5EZWA 1NXD1 4AAPA 4S2FA 2TUNA 3FUQA 3SCFA 3MYXA 4B1MA 2WZR1 2CU5A 2VZ3A 1LU2A 2DCJA 3HN1A 4FSJA 2GNTA 5A6XA 1DF0A 1R1A2 3DGTA 3IPVA 4L8QA 5J96B 1MEC1 1VAKA 1W6QA 3QBQA 3LEIA 3LA7A 5FWJA 3IDCB 1APNA 2VCAA 1UMHA 3AB0A 1NUKA 4M3CA 3TEWA 3WT3A 4DNYA 3T4VA 1LHNA 1H2MA 3FLPA 3THTA 1SLIA 1AR61 2A1XA 3AZVA 1OLQA 1OVSA 1XB9A 4Y3OA 1V0AA 4Y1YA 1CN1A 3DEMA 4I0AA 4CCNA 2YU2A 4HVRA 5FZGA 3P3NA 3O1TA 4LBMA 2ADEA 4DO0A 1XOYA 1WW7A 2GMPA 3S7EA 1HN0A 2XVLA 1RMU3 4IV3B 4KMQA 1POV0 4W4ZA 2RS33 4QPGC 1DYKA 2Y38A 3GCWA 5EV7A 2WS91 1WMXA 3WF4A 1REFA 4C90A 4LBKA 3PTYA 3ZYGA 5LEKA 2PLV1 3SCHA 2CHHA 1J83A 3LAGA 5FPUA 4KU7A 4KWKA 3WDWA 4JX0A 2JDPA 4Q4V1 4G3YC 3M8LA 2OT7A 3V0AA 3THPA 5JAXA 1W6MB 4DFSA 4GH4A 1GSLA 3SLIA 1LOBA 3T2QA 4YW5A 4GB32 4UYBA 2DF7A 4AHXA 4JGYA 4BK5A 1TMF1 3LB9A 1PK6A 2K0GA 4QX5A 2XVKA 5FZDA 1V00A 1UYPA 1KS4A 3GJBA 3L9JT 1AHSA 4QX2A 2HWE2 3ILFA 1XBFA 3PLQA 4LPLA 5HXVA 3QCWA 4CDUB 4COVA 1Y9GA 4LIUA 4Q2FA 5M0TA 1BYHA 4N53C 4IGOA 3W20A 2VM9A 1HXS2 4CP0A 4C91A 1SFPA 3SH3A 1JYWA 2G9ZA 5LA2A 1AR83 4LK7A 4FOWA 1PO22 5FP7A 4BLJA 5FZHA 1AJKA 1BKZA 5EJZB 4LJHA 3M3QA 1W06A 4A3ZA 2QQPA 2P6CA 5EJ1B 5FPZA 3ZFFC 2GC1A 2Y6JA 4YG6A 2RS52 1RUE2 3A23A 3I2HA 1EP0A 4OHXA 5DDJ2 4OI4A 3ST7A 3GHNA 2I74A 5FYUA 2UWBA 2R6QA 1RUG1 5IWFA 3LE0A 4N7IA 5ANQA 4W65A 5JXGA 3J7LA 1AJOA 4PLMA 2WA3A 4AF9A 1UU4A 2FQPA 2HWD2 3WDVA 3RZLA 3ZLIA 2HWC2 3A4UA 4ISRA 4RGAA 2P6HA 4XE9A 5A6ZA 4YM2A 5GZCA 1UZYA 4EWDA 1BXHA 4RS5A 5E6HA 2XR4A 2EXKA 3D4KA 2JWPA 3FWEA 4GMP1 4O65A 4A7ZA 5LW9A 1K5JA 2Y64A 1A3KA 2QQWA 2OKXA 4GAZA 4PI0A 2JG8C 1OH4A 5DZEA 1TE1B 4IE5A 4OI1A 5LA1A 4XBLA 1O4ZA 1S2BA 1UL9A 3GHMA 3PIJA 1C57A 1IPJA 4B1LA 5A3MA 3EB7A 2A73B 4P9YA 2ZHMA 3WDXA 3E97A 4AZZA 1N1TA 1OF4A 2JDYA 3FLTA 3MFCA 4AAXA 4YVSC 3R05A 4LHSA 4ARXA 2G19A 4QXKA 2W9XA 1UY3A 5FY1A 3I3MA 2W1QA 1JTZX 3OEAA 1KD7A 5DQ0A 2BBVA 2P37A 3BTZA 5C70A 1NCRC 3WG1A 2JDHA 5JZGC 2BGCA 4PIZA 5DUVA 3LDRA 2XMLA 2J22A 2PHTA 5A7OA 3NNJA 2SLIA 1COV2 1K42A 1PM7A 3IWZA 5C8CC 1YO8A 3PUHA 1AR71 4GWMA 1AXKA 3SKVA 1K5MC 5F5IA 3ZN6A 1EUTA 1MZFA 2R062 5C71A 3AXDA 1C8NA 3S57A 1ZA4A 2RS11 4IV1C 3H42B 4HLTA 4Y22A 4N43A 1RUC1 1LOFA 1RTVA 5A32B 2DWRA 2WZEA 4AFBA 4FPOB 3ZMOA 5HV4A 4A41A 5D21A 2EAAA 4LBJA 4HONA 1WA4A 3NV1A 3A22A 4PCRA 2W68A 4IW3A 5C3SA 4AGGA 4QX0A 1LEDA 4ES9A 4WM8B 1HB4A 5FZ6A 3WG3A 5CA6A 3MUY1 5LBCA 5GM0A 2D43A 2RDNA 5C7GA 4GXLA 1FNYA 2D6OX 1LJ7A 3B01A 2WINB 4BXFA 2VQUA 4IEPA 5FYYA 3VL8A 3WF3A 3DPRC 4LO5B 4CCCA 3TN93 1R1A1 3J9SA 3U1XA 1KRIA 4HFSA 3TWIA 3WEZA 4BOWA 5CFCB 2CWSA 1DYOA 3LOBA 4MXWB 1ND2C 3BI3A 5HCHA 3VBFC 5FPVA 4QQPA 2DU1A 3LA3A 4QB2A 5HCFA 4KWLA 3GM8A 1U5XA 1D2QA 3MI8A 1W2UA 3K75B 2ZGTA 1YIPA 4CU6A 4NIIA 5A7WA 1TNFA 2WWJA 1LGCA 3WVJA 4QPGA 3ACHA 3AC0A 2WJSA 3HEIA 1C5IA 2VY0A 4OULA 3WF2A 2WZR3 2JIJA 2PTMA 2AREA 2R042 5FUPA 4PF5A 5CU1A 1H9WA 5EYYA 4HPKA 3NNGA 5C6CA 1FATA 1IS5A 4TLGA 3VBSA 4A42A 5DZFA 1MEC3 3Q8BA 3KQ4B 3MIGA 1CAUB 3ZXAC 1IPKA 3O1UA 1LHVA 4RFT0 5SV8A 3O1VA 3LCPA 3ES4A 3OJBA 5J09A 1GMMA 1E5HA 1AR63 4GB31 4XUNA 1OXCA 4AE2A 2HEYF 2RDSA 1BEV3 5FLIA 2X8KA 5FZAA 5C3RA 1WCUA 2HYKA 2JKXA 4N53A 5ACA2 4FFGA 1ZM1A 4UFHA 5FP8A 1EUUA 1IS6A 1MQTA 4LNVA 3V0BA 5H9QA 1HXS1 2WS93 2QBXA 3BPZA 4F83A 4XYXA 2PLV3 2J1UA 2VVDA 4E2SA 1WD3A 3WDTA 2JEMA 4XF0A 1PO21 4TXWA 4QMAA 2VW2A 4Q4V3 3ZFFA 2ZX0A 2X53S 2J1AA 5FIXA 2ZZJA 1H8TA 2OS2A 4L97A 4BWOA 3O1PA 2AC1A 4MHRA 1BQPA 1L7RA 1RUE1 2RS51 5F3GA 1TMF3 1PK6B 2DVDA 2O8OA 5DDJ1 3ZN4A 4KGQA 4GALA 4NO4A 4RR3C 4LTAA 2VQ0A 3DKWA 2ARCA 4M0NA 1W99A 1NA1C 4Y1XA 3SEEA 1BVP1 4HKWA 4LO6B 3JQWA 1IQDC 4DY5A 5F1RA 4AI2A 1AXZA 3M3CA 2HWD1 3QH7A 3SITA 5ABJA 5LY1A 4XPVA 2DFBA 2HWC1 4XJWA 1IG3A 3ACLA 4ZS2A 5L9VA 1HQNA 3OF1A 1OPMA 5LRRA 5KWRA 1US3A 4FFFA 3WUCA 4CDXB 4Z2WA 1UKRA 4I01A 3UGHA 3EMRA 1MS4A 3ZFGB 5KHIA 1SZBA 4YM3A 2Y0OA 2LS6A 4CU9A 1L3JA 3N9OA 3VZJA 2JG8A 4RQPB 1BMV2 3ZYPA 4CRQA 2PHXA 4NHYA 4LK6A 4QKDA 5BNPC 1RVF2 3WW3A 4LUMA 3O1OA 5DUXA 1RUG3 2IXKA 5FMCA 2BOJA 5FZ4A 4NIAA 3VBOC 2CDPA 2D97A 3U11A 2G9GA 1X7NA 1UYZA 2O8QA 2QQOA 2VBPA 2XHKA 2ZKLA 1GZWA 3JD72 3NVCA 4LA2A 4MH0E 1JHNA 2QQUA 4QM9A 4ZXKA 2D40A 5E8AA 1PZ8A 1GZTA 3TB0A 3MIEA 3VBRB 3S0MA 1FYUA 4C0BA 3ZSMA 2FHRA 4PF1A 1CAWA 5JZGA 2JE7A 1RJ8A 3LPGA 2R1DA 2VMFA 1XXNA 2BOIA 3AFGA 4IGPA 5GJ6A 2KA3A 4JDMA 4JTNA 4GMP3 5C8CA 5K0UC 3NKTA 3ZSEA 5LA9A 1N1VA 4AFCA 2FD8A 1UPSA 3GBFA 1OPOA 1COV1 4AOCA 1HW5A 4IV1A 3V56A 2Z5WA 3D6EA 2Y34A 2R061 4YZ4A 5DAWA 3UV9A 1GNZA 1QJEA 4XF4A 3ORJA 2ILMA 1RB8G 1X50A 3LF7A 2FCTA 2P5BA 5A7NA 5LWBA 1SMVA 4Y24A 3VKMA 3OB8A 2UURA 1JOBA 1ULEA 3D0JA 3U37A 4XILA 3N9PA 2X05A 4ZU7A 5A70A 1G6NA 1MZ6A 3DUIA 2WABA 4XZPA 1W2AX 2SBAA 4OLLA 4UF0A 4HMZA 2NYYA 2IVJA 3MIDA 2DUQA 3DPRA 3E5QA 3M7AA 3OYWA 5JI7A 2W3JA 1OBNA 4H3WA 4W6WA 3TYJA 2GZWA 2WT1A 4V2WA 3ZN6B 1AR73 1ND2A 3RSJA 5F7UA 1JZ7A 3VBFA 1B09A 1MPXA 4CZSA 3POWA 1VMFA 1W8FA 4ZU5A 4N90A 1JMUB 2RS13 4X6QB 4DEQA 4CU8A 1O59A 3OD4A 5BPXA 4K8FA 4KGGA 1XNCA 4EZ4A 5JWPA 1RUC3 3WP3A 2A71A 2VO5A 4L2NA 1CGPA 1UPIA 1J58A 2AEZA 3D3AA 3CZJA 3INAA 3SXWA 4ASMB 4JHZA 4CCKA 4QXHA 5HV0A 3RI8A 4Y4RA 1JZ2A 2QQLA 4BK4A 1ZNPA 1NG0A 3ZYFA 3ZDVA 2VOXA 2WFPA 2ET1A 4S2GA 4KI5M 5T55A 5CEHA 1QXPA 4LUKA 1XQNA 1HRI2 2LM3A 2R041 1DP0A 3I59A 4QD2A 3BIWE 3KMHA 5JSOA 2E33A 4FXKB 4NJ4A 3FHAA 4JAAA 5CB7A 1SLAA 1KGYA 4XETA 2QQKA 5DXDA 1WW5A 1ZBE1 3MV11 4CCOA 3U78A 2B4KA 1B35C 1XNAA 4I3PA
chains in the Genus database with same CATH topology
1VRH1 2VOVA 3PJYA 3DN7A 1LOAA 4EN9B 3OCPA 4FXGB 1S2KA 2YMZA 4PDWB 3SISA 2BNMA 1GZCA 1QXRA 2MEV1 3OTFA 3ROUA 3VBUC 4CYDA 3N4MA 3CO2A 4BE3A 1Q43A 3OY8A 3WDUA 1EV12 5FPXA 2XL9A 5FFOC 4LO7A 1RIRA 2BNOA 4O9EA 3B69A 3G6JB 2WSUA 3K51A 4E2GA 5GKAC 2D5HA 2WNVC 3ZSKA 1WMFA 4DRVA 1CAXA 2MPFA 3UKVA 1XE8A 2BW8A 4P5HA 2X29A 4Q0SA 4RR3A 2XJRA 4TWTA 4EROA 3O0WA 3TBDA 4AEKA 4LE4A 5C4WC 2JICA 1N3OA 1N3QA 2I45A 1MQTB 3HD8B 5KXBA 2EXHA 2ZX3A 1REEA 5IUQA 1HXS3 1BCXA 1YWKA 4WVVA 3JB4C 3MIBA 1OQEA 3WQ7A 3BU7A 2XVGA 1T6GC 5JOXA 1H4GA 1PO23 3MPPG 3J4UH 3FBMA 3PMSA 4XFFA 5GZEA 1XU1A 1FPN2 1FMD3 1LCLA 4R9AA 4CEWB 2D3RA 2OIIA 4BYYA 2RS53 1RUE3 1FV3A 3RS6A 5BNPA 1BMV1 3R6SA 1YNAA 5DDJ3 1ULDA 2RMU2 1RUD2 1RVF1 1G9FA 3MIHA 5FAXA 2R30A 3H7JA 3JU9A 1YRZA 1R1ZA 1NQDA 2XLAA 4XXPA 2V73A 3KS7A 2WQZC 5ABJB 1BEV2 2HWD3 3JD71 1AYN2 2HWC3 2YGMA 3VHOA 2YROA 1HIXA 4HN1A 4BIFA 5K0UA 1FT9A 1QNWA 2GNMA 2NPIA 3AP9A 4K3UA 1V6IA 3RYRA 4P9GA 1C4RA 3RDIA 2D5FA 3ZSJA 3WW2A 4AGVA 1C8M2 2BWAA 3VDDC 4JC1A 3WY6A 1GQHA 3AZZA 4UW6A 5BNOC 1D0HA 5J48A 3B00A 4RGGA 4Q0QA 1ZYBA 3TNPB 3RMYA 2W39A 3VZKA 1FX5A 3I54A 1U5YA 2D6MA 4TLFA 3WOGA 4LULA 2ZA9A 4XQ4A 3FMGA 1COV3 1NYWA 2ZX4A 1D2SA 4X6RB 1O4TA 2NMNA 2Y26A 3U10A 3V65A 4G9SB 1OOPC 4E27A 4XMAA 2R063 3MEPA 1TNRA 3RYKA 4Z92B 1RC6A 3IDBB 5LEJA 2R0FA 2ZGKA 4XHXA 4JRLA 3B93A 1J3RA 1GKBA 2C9AA 2GU9A 3WG2A 5T5JA 3O0XA 2ZGUA 3ZMNA 5AVAA 3SH4A 2A75A 1XNKA 1G9CA 4QQOA 3AMMA 3MF6A 5FCCA 3LWCA 4DXZA 3A0KA 1LECA 1HRI1 5CVRA 2RJLA 3ZFEB 4A7KA 3FBYA 1DHKB 1MS8A 3GF6A 2ATFA 2NM1A 4GA9A 1O3TA 3MPBA 2BVBA 1B35A 5EXOA 1EPWA 4AWDA 4UXAA 1SLLA 1TEIA 1HX6A 4CEYB 3RMXA 3WQ0A 1QOTA 3ZX7A 3APBA 2E7QA 3ETQA 4CP2A 1AR91 4FPEA 4MLOA 1H1AA 4XFIA 3VBUA 1POV1 5GZDA 3GBWA 3ZO0B 4J1XA 2R043 5GZFA 2XUMA 3VHRA 3AYDA 3PNAA 4JDNA 3O7OA 1DFQA 1EV11 4OVEA 2WZPP 3JB8A 3VGIA 5JSRA 3LA2A 2MHFA 4XOGA 1ZZ9A 2ZGMA 1ZBE3 3VBHC 1UMZA 1HQWA 2RHPA 1VRH3 1U5IA 1G9DA 1AR72 3R4UA 3R4SA 4ATFA 5C4WA 1VBC2 3PVBB 4LBQD 2CWMA 4A3XA 3IT8A 2YY1A 3LSDA 2ZTNA 1FAYA 4LA3A 5FO7B 1VP6A 1UZZA 4QHBA 2WLQA 2MEV3 4QPIB 3SCGA 4HK8A 4LO4B 2QDRA 4I0WB 3QD6A 1KJRA 2IZWA 4HANA 5TSWA 5K9YA 1YFXA 1UU5A 4BLIA 3PVEA 4XJ8A 1WCKA 3NL1A 3USUA 4WM7B 1FPN1 2QUOA 1JN2P 3B5LB 1QHDA 2R16A 4FOYA 3L2YA 1CAXB 2XJVA 5KC6A 2GC3A 1ZRRA 3KGZA 4MGKE 2RMU1 4RHV2 2WA4A 4X8NA 1RUD1 4KQ7A 4Q4X3 5BV6A 1GANA 3KB5A 5JR7B 2QZ2A 4FPHA 2ZS6B 4ORFA 3AMNA 2X5IC 4FTBA 2G4IA 4L92A 1Z78A 1JUIA 3KT7A 1BEV1 4OUMA 1KQRA 2HEVF 1AYN1 3KCYA 4UW5A 4YGEA 4YZ2A 1KDMA 2AR6A 4FQ4A 2VMIA 4OHYA 1OKQA 2ZACA 2A6XA 3GYDA 1EPZA 4JGZB 4QGLA 2DTWA 1RVF3 1F2NA 2WKKA 4CDQC 1RL3A 3WXPA 1C8M1 2OZ6A 4BHPA 2NN8A 1YJLA 2QKDA 5H9PA 1PMIA 4PBPA 5T52A 4YSFA 5BNOA 2UY8A 1S0EA 3K48A 3JD73 2XLFA 1CAVA 3URFA 2B39A 1DQ0A 3QH6A 3WHUA 4YZ3A 2D44A 1RUF1 1H9PA 3W59A 3BTAA 5EFUA 1OOPA 4HSJA 1N1SA 1O91A 2CYFA 4Q4Y2 1OLRA 4DPNA 1NCQC 3AK0A 4FOVA 4M00A 2OPKA 3USSA 1W6PB 3NO8A 1FMD2 3ES1A 1GQGA 4QU2A 1C1FA 4B3NA 4GKXA 4FAHA 1UF2C 4AEMA 1LENA 4XJ9A 1VBA2 4AI8A 4I0BA 1O7FA 4D94A 5DG2A 2VUJA 3VZLA 5DZGA 3JBG2 2ARBA 4OHZA 3KGLA 2VOWA 1OMIA 2QCSB 4A2UA 4AFAA 1DZRA 4YVWB 4AK3A 1V9U2 1W6NA 1DG6A 1ND3C 5BY5A 1CJDA 4AEDB 1X36A 2ZGNA 1DYPA 4XQDA 1LOGA 3IN9A 2R49A 3WP4A 3ZSLA 3ZVXA 4AHZA 5L7OC 4XDQA 2TEPA 4FPLA 4B8EA 1GBGA 3I8TA 4TSVA 4CEWC 4LLFA 4WZCA 1GR3A 1ZZBA 5CNAA 1G86A 1ZRFA 2DVGA 4YGCA 2JG9C 2VUAA 2YV8A 5HBAA 2TBVA 3WCRA 2E53A 4YFZA 4UW4A 2CV6A 3RNSA 2OVUA 1CIWA 2IFRA 2Q1MA 2Z2SB 2EALA 1ENRA 2WNUC 3CLPA 4XTMA 3I2DA 3VLBB 1HRI3 4YGDA 2IFWA 1Q8OA 1CESA 4Q4W2 3VBHA 3V64A 1C5HA 2GH8A 3WNXA 4XJZA 3MZHA 2QZ3A 4AQ2A 2FZ1A 5FRAA 1AL0G 2BYVE 2GC0A 1MS0A 1UN1A 3ZYJB 1H2KA 2IXHA 3NAPB 1JOJA 1LEMA 1Q3EA 1JH5A 1XU2A 3IBMA 1VBC1 1S0JA 3GZAA 1AR93 3KCCA 4LLOA 5AFBA 1V6OA 3AYEA 1QDCA 3E5UA 4JVAA 4ZKTB 1DGLA 3DL3A 5A33A 5BNNA 1POV3 1VBD2 1LTEA 4S2DA 3RWNA 4E4ZA 4LHNA 4HK9A 5I8SA 3WUDA 1PVC2 1EV13 1IKPA 4FCAA 1QOSA 2ZGQA 5J36A 1QWRA 1DGWA 4Y1UA 4GULA 1A78A 1YIFA 5LK5A 1UU6A 3GZTB 1S0GA 4EWEA 3RZZA 5BUVA 5FQ0A 4BM8A 3KSCA 1DQ6A 3VZNA 5CADA 4RHV1 2A3XA 2X5IA 4DRRA 1Q5OA 1UIJA 4QGMA 5I93A 5J7MA 3TRSB 3OGGA 3WW1A 5CFDB 5IT6A 4ES8A 5C9AC 2YXSA 4ASLA 4N9IA 4Y4YA 4L99A 3VL9A 2DURA 1CPMA 4ISQA 4LBQB 4MYEA 3RJRA 1PNGA 1D0GA 4QGNA 5KXEA 3CJIC 1FPN3 1QQP2 1O5LA 4XTPA 2PYTA 3IPVB 4YYOA 1SLCA 1W6QB 2VMGA 4GMP0 4CDQA 5JIAA 4P9JA 2RMU3 1NOVA 1ZBE2 4XBQA 4CEYC 4A7YA 1RUD3 2P3IA 1PIV2 4M3CB 4AW7A 2DUPA 4OUSA 1VRH2 1TME2 4SBVA 3KM5A 4GKYA 4FP2A 3AP6A 1VLNA 2D6NA 3OBRA 2ZGPA 2RE9A 4I30A 4MX3A 2P3KA 4Y20A 1LRHA 3X29B 1AYN3 2PHUA 2MNGA 5C8WA 4OFGA 4IETA 5I91A 4K6BA 3LZZA 2D6KA 2MEV2 1YHFA 5F9TA 4B7EA 2XH6A 1F5JA 4P9LA 1RUOA 2IWGB 5CBLA 1W39A 4Q4Y1 4TZDA 4P9IA 2DCYA 2DV9A 4AHWA 2ZBJA 3V0AB 2BPA2 1FMD1 3POSA 4AYUA 4GH4B 1C8M3 2PAMA 5D8AC 1IZ3A 4JRAA 4JGYB 1QJU2 1VBA1 4B4QA 3EBRA 4YNIA 2ZHKA 1V6JA 3EQEA 4Q4X2 2WT0A 3T2TA 1MACA 4Y1VA 2ZX2A 2E9QA 3JBG1 4CDWC 1RUF3 4Q29A 1X8EA 4QPIC 1ND3A 2CAUA 4YG0A 4EN8B 3KCXA 4FPYA 1V9U1 2R072 5L7OA 3WX5A 1QJZA 2NZ9A 3O12A 1R082 2B46X 4K40A 4K20A 1DLLA 4Y26A 4UW3A 4HBNA 2JG9A 4OI0A 1F31A 1DZQA 2OA2A 2W0XA 2GC2A 4FTEA 2DTYA 4QM8A 2XKOA 2ZGOA 1I3HA 2PHWA 2W08A 2WNUA 4JCKA 2I2SA 4LR4A 1JUHA 4AEJA 4FBFA 2WFF2 3U0ZA 3AFKA 2PFWA 4YVSA 1J1LA 1LB2A 2XKPA 1W6NB 3BCWA 2ET7A 4Q0VA 4Y1ZA 4LHLA 2P2KA 2H6CA 3HMYA 1NCRA 1AUYA 2XJUA 4IV3C 4Q4W1 3ME2A 4XMIA 3VV1A 4B4RA 1G9AA 2JKBA 5GLUA 1Q56A 2ZMLA 3ILNA 2GALA 4RS5B 1ZZ6A 1MR5A 1K5MA 1W0OA 3FJSA 3UK9A 1YFYA 4XIKA 1WUVA 2GH2A 1HV0A 1CD3G 4AI3A 1ZBA2 1VBB2 1O3RA 4P14A 3ZYIB 1PO12 1YYNA 2VXRA 1VBD1 1QU0A 2F4PA 4AQSA 3FLRA 2BQPA 3FZ3A 3NSTA 1PVC1 2JD4A 4CDUC 1LHUA 3AKSA 3C3VA 3AJYA 5JMCA 3WP5A 4AVBA 3MGUA 3R4DB 1QJY2 5D1IA 5KHKA 2YZ4A 2ZMKA 2NMOA 2P3JA 3FHIB 1LOEA 4H7LA 3WINE 1VBC3 3W9AA 4WZFA 3JUUA 2WQ4A 1SFNA 4GIQA 4PIYA 3HR9A 4Y22B 4N43B 3MLLA 5BNNB 5C9AA 4AQ6A 4YGBA 5EWSA 1QOOA 2A3YA 2CY6A 5DG1A 3M3IA 4KH9A 5FLHA 5GALA 2D7FA 1VB2A 1BBT1 3CJIA 2IXJA 2JENA 4DQAA 5IK7A 3GZUC 3M4FA 1WLCA 1QQP1 4AEDC 4EV0A 3T1LA 2JDZA 4FO9A 5I8YA 1S55A 1HQLA 2XJTA 4RHV3 5K8SA 2K9ZA 3FFQA 1C1LA 1GFF2 1PIV1 1ULFA 4ZU4A 1TME1 3VUOA 1QMJA 4F8AA 1PGL2 1DU3D 1AR92 4NHKA 1CVNA 2CGNA 2ARXA 5KXCA 4QPGB 4BMBA 2WLPA 1ZRCA 5J37A 5L36A 1KFXL 3VKLA 3CJXA 2UU8A 3WG4A 1Q8VA 4HPKB 4K1YA 4L9BA 3M1HA 3VBSB 2ZZQA 1IQAA 2XB6C 3AJZA 3ZXDA 4Z1VA 3HT1A 2DCZA 2BFUS 5GLZA 3KD4A 5D8AA 1YI9A 5IK8A 5BNQA 2RM22 3VZOA 5FDBA 3NAPC 4EWAA 4QPYA 4HT1T 4PIXA 1QJU1 2BTVC 1I6XA 4BH9A 2HWB2 4N53B 1NA1A 4CDWA 1IKQA 2Q30A 2ZOEB 4Q4X1 3RRDA 2O0OA 3NV4A 4MGIE 3V0BB 3E5XA 3WLUA 2IXCA 4FPGA 1XNBA 2D3SA 4MZUA 3N36A 4MGZE 1QNYA 4B29A 1OQDA 1LKNA 1N1YA 1RUJ2 3UKTA 2R071 4UBGA 2PN5A 1H2NA 4WM8C 4Q4Y3 1JXNA 4LBOA 3ZFFB 1XE7A 4YLZA 1O5UA 1R081 2E7AA 2LTNA 1H8TB 5AC92 1U12A 1OA4A 4I3GA 4WVWA 1VBA3 3I7DA 3N7KA 1KFUL 5CFCC 1OA2A 5HCAA 5C33A 3AYAA 4R52A 1BVVA 3VBOA 3AKTA 1AF9A 2ETEA 3N3HA 4BQ1A 3PJQA 2P17A 3AYCA 4YW1A 3JBG3 1UKGA 4MGYE 2WFF1 4X8PA 5H9RA 3HWJA 5CFDC 4FPFA 1I1EA 1GNHA 4AXOA 5AFEA 2AYHA 3RG0A 1HV1A 1V9U3 3M70A 4IV3A 3VKFC 2GMMA 1VALA 4LHKA 3B02A 1LHWA 4HKOA 4AFMA 3U4XA 1YFWA 1G8WA 3WD5A 1O3SA 4PBOA 1ULCA 2HEWF 4U2AA 4QQLA 1VJ2A 4PQ9A 2FZ2A 2JG8B 1X8MA 1QF3A 5F6KA 3ZXLA 4INDA 4YZ1A 1W6MA 5JPMB 2UY9A 3ELNA 1MS9A 4Z8BA 3Q9OA 1ASJ2 1ZBA1 4FAGA 1VBB1 1H30A 5HI0A 1PO11 4LO8A 1GZWB 1HDKA 3AKRA 3H0OA 3ZIWA 2PHRA 4CDUA 1FNZA 4P9WA 4P9XA 1C28A 4YM0A 1CAWB 1URXA 4XBNA 5JZGB 4Q4W3 2PA7A 1RUF2 2C1FA 2V09A 3NV2A 3AZYA 5C8CB 1PNFA 2A6VA 1O4YA 1QJY1 3D8CA 1K5MB 2TNFA 4Q27A 4I02A 4HVOA 4ITCA 4IV1B 4OI2A 3QOPA 4KG8A 1CX4A 3AKQA 1LULA 2WT2A 1R092 3NJZA 4F3JA 1VBD3 1PK6C 4V1PA 5JIUA 1V6MA 4SLIA 2DFCA 4O9GA 1PVC3 2XBO2 3RJ2X 2BFUL 4Z82A 1DBNA 1ZZCA 3H3ZA 1HRV2 3DPRB 3OYWB 4MXVA 2Q8OA 1MS5A 1RGSA 3LOIA 1ND2B 3AP7A 3VBFB 4CDXC 3TAYA 2G9FA 3ZFGC 2PELA 4AQTA 2VW0A 2ZX1A 3JCIA 4RQPC 1OA3A 1AYM2 4ONUA 1WCSA 1ZVFA 3BOPA 4Y5Z0 5JLVA 4H14A 1MS3A 3WCSA 4XEZA 4D69A 4E4DX 1MVEA 1PGL1 1WD4A 2H0BA 1CQ9A 4IEVA 1ALYA 3QLQA 3T1MA 2VPVA 1BBT3 3HAGA 4IQPA 3P3PA 4K9SA 4DY3A 3ZIXA 4J6GA 2XG3A 2Z42A 4DINB 2EIGA 3I59B 1QQP3 5FMOS 3VBRC 2JX9A 2YYOA 3ZPYA 4EN6B 1EAH2 5HCBA 1NY72 5GLVA 5JOZA 1M06G 1FOD2 2Q0AA 4E9KA 2QNKA 3RI9A 1DQ5A 2WNVA 4FVVA 1PIV3 3M3EA 4FOQA 1S1AA 1TME3 3W58A 2RM21 2H6BA 2YGLA 1G9BA 2FMDA 2ZJCA 1ENXA 3KZ4C 5A32A 2HWB1 1OFSA 2VG9A 2VECA 1NE4A 5KHHA 2HWF2 2D3PA 4C0HA 2KXLA 5I0TA 1EY2A 3OY8B 4WM8A 3RPQA 4J1WA 4WVMA 1H4HA 4Q1RA 1RUJ1 1YUDA 2IC1A 3POYA 3AKPA 4FQZA 3AMQA 4MSVA 1UD1A 4MVTA 3H3UA 3TOJA 4DZGA 4L11A 2DCTA 4IESA 4IEUA 1H0BA 3GNEA 5AC91 1H8VA 3S6PA 4IEYA 4BIOA 4Q8KA 1RUI2 5CFCA 2XPJA 4MXWA 4WV8A 1WBFA 4RR3B 1QJU3 1YJKA 1VR3A 1NA1B 4QQ2A 1Z0HA 1NQJA 1ONAA 2JJ6A 5JI9A 5IK4A 1DDLA 1QH7A 2VQAA 4IERA 4G4FA 2R073 1QJX2 1RUH2 3R0RA 4M01A 4M3CE 4AVTA 1NLRA 1NE6A 4NHLA 5FOJB 1F8VA 2BEOA 5EYXA 1R083 4FTSA 1CAUA 1YI7A 3QACA 5BNPB 2EAKA 1WMDA 4AFDA 4GQ7A 2D98A 3VDDA 3VBOB 3WHTA 2PAKA 1C3HA 2LALA 4IL7A 1ASJ1 2WFF3 5FREA 2GAUA 3VHPA 4F7ZA 3ATGA 1RINA 2VMHA 4YFWA 5SV5A 2AGSA 3MF9A 5K0UB 4PDWC 4CP1A 2QDNA 3VBSC 1Q8QA 5JCTA 4BZ4A 4FT8A 3GALA 3ECQA 4EJRA 2YDEA 2XLGA 1ZBA3 1VBB3 1R091 1OD5A 5JSPA 3LKJA 5FMOL 2PHFA 1PO13 2AENA 4R4XA 2OYZA 3SNMA 1J59A 2CL2A 3NWKA 5KC5A 3EJKA 2VOKA 5FOBB 5CG9A 1G7YA 2XJQA 2XBO1 1MQTC 1TQ5A 1HRV1 4XIOA 3H50A 1QJY3 2EA7A 4CDXA 5KHJA 1S0BA 4N9HA 4XQWA 4H7MA 3ZFGA 1GICA 4Q1PA 1REDA 3C2UA 1SBDA 1WLTA 1Z7S2 4RQPA 1H8TC 1A8MA 2LUWA 5BYNA 5CG8A 2GN3A 3H8UA 1QGLA 4FP3A 1AYM1 1LESA 2A5ZA 4LBLA 3MDPA 1WLDA 3ZN5A 2BNNA 4W6XA 1KDKA 2ZAAA 3OD0A 2AUYA 4LBNA 3WZ1A 2YHJA 3RYPA 4Q8LA 1OHFA 1WCDJ 1CPNA 3VBRA 3ALQA 2XL7A 5ABJC 2GN7A 3MW4A 1NXMA 1H2LA 1EAH1 5L19A 1NY71 4DMIA 3D5OA 4RD7A 1B35B 4R8HA 1FOD1 3HQXA 4XHBA 2D6LX 3BOWA 2B9UA 2ENRA 3IKWA 1RHI2 4OHVA 3O14A 1SCSA 1ZZ7A 2E7TA 1OQ1A 3ZXEA 3EO6A 3GBGA 3NKGA 3MW2A 3VBUB 1NLSA 4M0HA 1V6LA 2VULA 2ZMNA 4KWJA 2YC0A 1AX2A 3MICA 4NWVA 2HWF1 3N35A 2ERFA 3CL1A 3WV6A 4IXLA 5BXXA 1KXGA 3N7LA 4WVZA 2DVBA 1PGW2 2V5YA 2UYBA 4YG3A 2WNVB 3SHRA 4AI0A 2WIIB 1ZRDA 3KT1A 2VVEA 1SEFA 2RR12 2PAEA 2RM23 2XJPA 4B4PA 1RUI1 2P34A 5C4WB 4LEJA 4U36A 4PLNA 2HWB3 2ZGLA 4XXAA 1OI6A 4EN0A 2N7GA