1QXRA

Crystal structure of phosphoglucose isomerase from pyrococcus furiosus in complex with 5-phosphoarabinonate
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
187
structure length
187
Chain Sequence
MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for a hydride transfer mechanism of catalysis in phosphoglucose isomerase from Pyrococcus furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase
molecule keywords Glucose-6-phosphate isomerase
total genus 41
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature ec 5.3.1.9: Glucose-6-phosphate isomerase.
pdb deposition date 2003-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06560 GPI Glucose-6-phosphate isomerase (GPI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qxrA00
3BU7A 1QXRA 3E97A 4KWJA 2QJVA 2MHFA 2WFPA 5I0UA 4R52A 4Q0SA 5FLJA 5I0RA 4OFGA 3BALA 1O5UA 4MH0E 3HIFA 4P9GA 4XF1A 4QM8A 2OA2A 4IEVA 5BY5A 2BGCA 3IIAA 4MGYE 1LRHA 1Q3EA 3TNQA 1SEFA 1J58A 2Z69A 4MGZE 1SFNA 5LEKA 3HT2A 5FDBA 3CF6E 1RL3A 3KCCA 4ZU7A 2O8QA 4LA2A 3H9AA 3M70A 3ETQA 1L3JA 3R6SA 2ETEA 2Q1ZB 2QDRA 2VECA 2XKOA 1ZZBA 2IXIA 4BH9A 5KHKA 3TNPB 1J3RA 3NSTA 5J7MA 1EPZA 3KSCA 3CLPA 4I09A 1XE7A 3EO6A 4JVAA 3RYPA 2EA7A 2XLFA 1Q5OA 3IWZA 1YHFA 5JSRA 4H7LA 1EP0A 1JUHA 3I59A 5JR7B 4KL1A 2HJIA 1ZZ9A 2OZ6A 2OZJA 1ZZ6A 3ES4A 5KHJA 4HSLA 2B9UA 4AVCA 1RUOA 4Q29A 1FT9A 3H50A 1I5ZA 3BB6A 4MX3A 5JSPA 3KGLA 1ZRFA 4WVZA 2B8MA 2PAKA 4HN0A 3OGJA 4F8AA 1V70A 1ZX5A 4ORFA 4XFAA 3SCHA 3HQXA 3PLQA 4R8HA 3LOIA 4Q0VA 1OFNA 2Q0AA 4LLOA 1NXMA 2GC0A 3CL1A 3E5XA 4XFIA 5HI0A 2QVSB 4HN1A 2E9QA 2BEOA 4AVBA 5I0SA 4IEUA 3KMHA 1O3SA 4X6RB 3G7DA 4ZU5A 3E6CC 3FJSA 3QACA 4ZU4A 3DL3A 4HVOA 3S7EA 2FMYA 4HSJA 1HW5A 4YSFA 2WC2A 3MDPA 3CJXA 3LAGA 5T3NA 2IXCA 5LEJA 3ES1A 4B29A 5CADA 2CV6A 2D40A 4E2SA 4XFHA 1EYBA 2IXKA 3IDCB 1LR5A 5EFUA 2PA7A 4PIXA 1YWKA 1ZZCA 2Q4SA 3UKVA 4J1XA 4IEWA 4MGIE 1ZREA 3PVBB 4FT8A 4QGLA 5JSOA 2PFWA 3D0SA 1OI6A 3UKTA 5C8WA 1LKNA 1ZRCA 1WA4A 2D93A 5KHIA 1VJ2A 1Y9QA 3M3IA 2V09A 3WW2A 1J3QA 3FX3A 3RYKA 4YRDA 4HVQA 1J3PA 2IXHA 4YARA 4IEYA 1RC6A 2BNOA 1YFYA 4YNIA 1OD5A 1Q43A 4E2GA 4E2QA 2I45A 3U0ZA 1NE6A 1UCXA 4HLTA 4J1WA 4N9IA 4LUMA 3N4MA 3SHRA 3H8UA 4LTAA 4L2NA 1IPKA 5EZWA 2XKPA 4L11A 1ZZ7A 2GU9A 4I0BA 4OLLA 2GC2A 3OF1A 3UKNA 4EWDA 5CU1A 4WZCA 4XF3A 5CVRA 3B02A 4XFGA 1UIKA 2PAEA 3U10A 3ELNA 5E1RA 2KXLA 4KU7A 2VPVA 1VP6A 4BIFA 1RUNA 3RDIA 5FLHA 4WBBA 2OYZA 3E5QA 5J3UA 1J59A 2IXLA 5FCCA 1CX4A 1GQHA 4IEXA 4IERA 5LRRA 3LA7A 1YUDA 1YLLA 3I54A 4PIYA 4UXAA 4QGNA 1O3QA 1X82A 5I8YA 3IDBB 5FQ0A 2D5HA 4A2UA 3ROUA 2D5FA 5I0TA 4D7SA 2UYBA 1YFUA 4MUVA 5I93A 4HBNA 5BUVA 2CAVA 5FPXA 4XF0A 1CGPA 1XE8A 4AVAA 1UIJA 4TLFA 1LB2A 4PJYA 5JCTA 3LZZA 2UY9A 1ZZ8A 4AXOA 2GC1A 5FPZA 1PM7A 1QWRA 3FZ3A 3FHIB 2EAAA 4HMZA 3RYRA 3ZDSA 2UYAA 4IESA 2QNKA 4JTOA 4KU8A 1DGWA 4X6QB 3E6DA 3QOPA 4AQ6A 4Z07A 3PNAA 3FE5A 1X7NA 3WW3A 4IEZA 3E5UA 3H7JA 4XF4A 3D82A 1WLTA 2DCTA 4D7TA 4XFBA 4IETA 3NVCA 5K8SA 3SCGA 2MPFA 2IXJA 4I2OA 2XGXA 3MYXA 4F7ZA 3GYDA 4IEOA 3EJKA 2XL7A 4QM9A 3GBFA 2Z2SB 4FBFA 4I3PA 1CAWA 5JAXA 5KHHA 4XEZA 4RD7A 2PTMA 3RNSA 1TQ5A 5I91A 3O14A 4HZFA 2IC1A 3RPQA 1DZTA 2XLAA 2F4PA 2BNNA 4Q0UA 4KWKA 5F1RA 2B5HA 1CAUA 3ST7A 1H1IA 2PQQA 3VHRA 3HT1A 1QXJA 1QY4A 3WW4A 3JZVA 3E6BA 1IPJA 1ZRDA 1X8MA 2H0VA 3H7YA 1OMIA 1ZVFA 4AQ2A 3S7IA 2EVXA 3NKTA 2PAMA 4UBGA 1PMIA 4MV2A 2BYVE 4META 1J1LA 4XF9A 4O9EA 5BPXA 2CGPA 3BPZA 5BV6A 5BXXA 1NYWA 1EY2A 5E16A 2BNMA 3OTFA 3RZZA 3LWCA 1CAWB 1UPIA 5I8TA 3H1YA 1X8EA 2FQPA 2XL9A 2MNGA 2XLGA 4K8FA 1CAXB 4ONUA 1H1MA 1XRUA 4QX5A 2H6BA 1O3RA 2C0ZA 4MGKE 4CYDA 3OCPA 3OD0A 4LA3A 2GAUA 2K0GA 3I7DA 4EWAA 4QGMA 1G6NA 1O7FA 1CAVB 1YFWA 3LA2A 4BHPA 1RGSA 4JV4A 1YFXA 2K9ZA 3H1WA 3H1MA 5LRSA 3LA3A 3CEWA 4FAGA 2GZWA 3KGZA 3WW1A 1CAUB 4EV0A 3MPBA 3S0MA 5FLIA 3I59B 4YYOA 1ZNPA 3IBMA 2ET7A 4IEPA 3U11A 4JTNA 3NW4A 2VQAA 3H3ZA 4MZUA 5FQ0B 2PHLA 4Q0QA 3DN7A 4N9HA 2UY8A 3NJZA 3D0JA 1DZRA 3FWEA 4I01A 4EWEA 5AVPA 1VR3A 4FAHA 5J48A 4QXKA 4NVPA 1NZCA 4KWLA 4LUKA 1UW8A 4PIZA 3SCFA 3MZHA 3EHKA 4LEJA 1WGPA 3EQEA 5KBFA 5D1IA 1I6XA 4UBHA 4IEQA 4Z82A 4GULA 2Q30A 4XETA 1Y3TA 3BCWA 1FXZA 1CAXA 1UD1A 3DKWA 3SXWA 4EROA 3FFQA 1O3TA 3H3UA 4XFCA 2H6CA 3CO2A 2N7GA 2Y0OA 2ZCWA 2QCSB 3ACLA 4O9GA 2ET1A 4DINB 3C3VA 4Q0PA 1DGRA 4XFFA 1SQ4A 3USSA 1U12A 2GH2A 3SMHA 4BYYA 1O4TA 2XHKA 2ATFA 2P17A 1CAVA 1GQGA 2PYTA 3NL1A 2PHDA 4QMAA 1NE4A 2HKXA 2O1QA 1ZRRA 5KHGA 4LULA 1O5LA 3EBRA 3L2HA 2ZKLA 2GC3A 3DV8A 5C6CA 1RTVA 2CAUA 2OPKA 4I02A 1FI2A 5I8SA 4I0AA 4HVRA
chains in the Genus database with same CATH superfamily
1AJOA 4GWIA 1VBA3 2RS51 1HRV2 4KWJA 4KGQA 1R64A 5I0UA 3GALA 4RQPC 5I0RA 3ZFEC 4ZS2A 3DPRC 5ERLA 1QOSA 2D3SA 2YV8A 4CPBA 5CFDC 2TEPA 1QOOA 1UOBA 4DXRA 4WZFA 1MEC1 5JZGB 1L7LA 3HVDA 4CU9A 2E26A 5I0DA 1VBE3 4EZ4A 5A3WA 5BY5A 2DDUA 4Q1RA 5D8AA 2RS31 3D4KA 4NHYA 1UZWA 3BGAA 1KQRA 4ARYA 4CEYC 1NY71 1C1LA 5JMOA 2X29A 1SFNA 2G4IA 4CUBA 4LO7A 2OUHA 5F5QA 4CEWA 4LK6A 3VBFA 5FDBA 2BZDA 2JG8B 3TAYA 1AF9A 4TSVA 1RL3A 4ZU7A 4LA2A 1GV9A 1S0GA 2F6BA 1Y7BA 3ETQA 4XILA 1L3JA 1POV1 2LALA 2PQSA 1AHSA 1VBC2 1WMXA 3VD3A 1LOBA 2VECA 1O91A 2XKOA 4NHXA 1ZZBA 2YBPA 4UW4A 4WV8A 4YM3A 3NNMA 2A6WA 2YGLA 2QQPA 1J3RA 1BCXA 2G1MA 3IPVB 3NSTA 3UESA 4CE8A 5FMDA 1RUG3 4A42A 5A3NA 3VN4A 3RVHA 1NLRA 1XE7A 4WM7A 4MADA 1FOD3 3GHMA 1TME2 4OYUA 3WXPA 1AYM1 1H9PA 4QQ2A 3BPSA 5EYXA 5JSRA 2BFUL 3CJIC 3WNNA 3HR9A 3ZYJB 1JUHA 3AKTA 4KL1A 5BNPA 1HV0A 1TMF3 1WD4A 2HJIA 2OZ6A 5T5OA 4AF9A 4S2HA 4YG6A 2OZJA 1ZZ6A 2VTXA 4OHZA 1V9U1 2DUOA 1UKGA 2B42B 2PXJA 4Q29A 1WMFA 2WAAA 1QDOA 4Q1PA 1YQCA 2BTVC 3GXUA 3N4MA 1ZYBA 2WQZC 4NWWA 2PAKA 3ZFFA 5EJ1B 1L7QA 3ZR5A 3T2TA 4AI3A 1RUF2 4R4XA 4PBPA 4XFAA 4LKDA 5C71A 2NMNA 3C7EA 4EZHA 3ACGA 5EWSA 5IW0A 3LOIA 5C9AA 4B1MA 2BVBA 1SFYA 2BEOA 4XJWA 3R0RA 4IEUA 2WBKA 5H9PA 3KMHA 1NAEA 3IN9A 3ZFEA 1JHJA 1HB4A 2YFUA 4LBQD 5J98B 1O3SA 1RVF2 4PQQA 4IV1C 4XBLA 1AXKA 1T6GC 4ZU5A 4AW7A 4DY3A 5ISLA 3WSOA 2QZ3A 2B39A 3AMQA 1IG0A 3DL3A 4AHYA 4FCAA 4CUCA 5LY1A 1YRZA 1AX1A 2VZ1A 4FOVA 4UF0A 4YW2A 3BI3A 4HG6B 2BBAA 1H0BA 4CEYA 3TN91 1RUJ1 1RXGA 1TMF1 4LIVA 4OZOA 1VAKA 4FFFA 3WDYA 5A32B 4DXSA 1FMD3 5T5PA 2WC2A 4QQHA 3INAA 5T3NA 2E31A 5CADA 4AFCA 1W90A 3ZYIB 2DUQA 3WD5A 5C33A 5J09A 2ZS6B 2JECA 2MEV1 1EYBA 2WS93 5FY8A 4BA6A 1HRV1 5IATA 3K2OA 5D2AA 3BYWA 4Y4RA 4QPIA 4OQ8A 4B4RA 1LCLA 3D5OA 2W92A 4C0BA 1QOTA 1R1A3 1UMZA 4AGRA 3OD4A 1ZREA 3KVAA 3LD8A 5LW9A 4FT8A 1C1FA 1OH3A 1PO11 2PFWA 2VC9A 4N53C 1GZTA 1OI6A 3UKTA 1AYN1 1PO21 1UOFA 4FPYA 3VHPA 1JYTA 5C8WA 2J1TA 3GCXA 4EN8B 1ENRA 3I3QA 1V00A 1WA4A 2D93A 2DBIA 1WD3A 2XBO3 1TZOA 4AHXA 2JWPA 1HN1A 4GWNA 1HX6A 5KC5A 3FX3A 4RL7A 3WNOA 4NIDA 4RS5B 5ACA1 4B1LA 1O4ZA 5CFCC 4FP2A 4IEYA 4YFZA 3OUIA 3TN93 5HV0A 4Y1ZA 3OGRA 4A7YA 3I3EA 4YNIA 3U07A 5FZ0A 2VOVA 1OD5A 2WS92 1Q43A 3S6PA 4E2GA 3VDAA 5BNNB 2VOWA 1SLTA 1GBGA 3U37A 2WIIB 1NE6A 1EAH3 5IFTA 5F3GA 3VKMA 4SBVA 1Q8QA 3AM2A 1V6OA 3NKGA 3FHQA 4LOSA 5DN2A 2EAKA 1DF0A 2NLRA 3H8UA 3JXSA 2BWAA 2DVDA 1AR73 1AYN2 1PO22 2WNVC 4LBKA 4W50A 5A33A 4DRVA 1ZBE3 2XKPA 2VZOA 3MFAA 1UAIA 1QKQA 1OFSA 1WBFA 4I0BA 4OLLA 2VBPA 4PLMA 3ZYPA 3JQWA 5FZLA 3VZKA 1UY1A 2IFWA 4DUWA 3ZYBA 1XSRA 3B02A 4XFGA 4HPKA 3RSJA 3ACFA 1KDKA 1UIKA 1C4RA 1DYPA 2PAEA 3U10A 1SHWB 2Q8DA 3O1UA 4FXGB 4JGZC 4KGGA 4IV1B 1CZVA 4XUPA 5LBEA 3WF1A 2FDHA 4KU7A 4NUBA 2Z42A 1VP6A 4DFSA 5FYUA 4EN6B 2R073 4GH4C 1CIYA 3E5QA 3ZX7A 1WCKA 4KH9A 4BQ3A 4MHUA 4S2GA 1D4M1 1QNWA 2IXLA 5DAWA 2VCAA 1LODA 4FI9A 2LS6A 2VMEA 5DUXA 4CCLA 3AP9A 5LRRA 2WAOA 2Y6FA 2ADDA 5FYHA 1LHWA 1DQ0A 1O3QA 4O7XA 1BJQA 2YZ4A 1R093 2XUMA 1W6NA 3ZIXA 3WG2A 1AL21 2VNVA 2YGMA 3IDBB 3QCWA 1ALYA 5FQ0A 4A2UA 1RUH3 3WDUA 4PLNA 2UYBA 3DPRA 3ACHA 3RZHA 1BYHA 1W2OA 4LJHA 1QMJA 2VMCA 1XNDA 4QQPA 5DG2A 4COUA 3KD4A 1XBFA 1CX1A 1MACA 3MLLA 4XF0A 3ZDVA 1XE8A 5FPUA 5LA9A 4YM0A 5CIRA 4TLFA 4ASMB 2ARCA 4ET7A 1X33A 5JCTA 3OSDA 2HYXA 4JKMA 4A6OA 1ZZ8A 5FPZA 1PM7A 4HXCA 3FHIB 1X50A 1RITA 2QE3A 2GH8A 3C7OA 3ZDSA 4G9SB 2UYAA 2QNKA 4JTOA 4COWA 1V6IA 4P14A 3GDBA 3E1F1 4X6QB 5KXEA 5BNOB 2GNBA 1IQAA 3DECA 4JGZA 3SEPA 2VULA 4Z07A 1ND2B 2DCKA 3PNAA 2ZEXA 4KBZA 3UK9A 2VXRA 1COV3 1JU3A 3ZN6B 1D2QA 3E5UA 5C4WA 5JI7A 1F4HA 1QJY3 4WM8B 4IUGA 1ULEA 3MV01 2DCTA 4LKFA 4XFBA 4IETA 3KHBA 3GZTB 4P9XA 5K8SA 3SCGA 1W3VA 2VQ0A 5JOXA 4I2OA 5DPNA 1N1SA 3GYDA 4QPYA 3LDRA 4IEOA 2WWSA 1RHI2 1DU3D 1W8TA 1BMV1 4OCTA 2P37A 1NCRB 3CZUA 2WNVA 2XL7A 3VBHB 2P3IA 4EQVA 3T4VA 1K5MA 2Z2SB 3VHNA 2W91A 5A32A 1WKYA 5L36A 2PHRA 5FK8A 2LM3A 5HV4A 4D6SA 2B9VA 4LHSA 2YFZA 4XEZA 4IE6A 4QB6A 4EE2A 4RD7A 3N9LA 4GALA 2QKDA 5T5LA 4RSUA 1J83A 2Y33A 3MUY1 5FZ9A 2PTMA 3RNSA 1TQ5A 5CKMA 5GZGA 4MGTA 1HXS1 1WWYA 2XOMA 3CZJA 1VMHA 2OS2A 3H8OA 3VL9A 1AR63 1TVGA 2V4AA 2C5DA 1DZTA 1AXZA 2JDPA 1MQTB 2XLAA 4CDUC 2BNNA 1BBT1 3VBOB 5T5JA 5F1RA 2JE8A 2Q8CA 3WNLA 3IDEA 1RUC2 1L7RA 3WF4A 1LECA 3HT1A 2D6KA 4AHWA 1F5JA 1Q8VA 3AL5A 4QU1A 4NHKA 1BK1A 1F9KA 4UOJA 1KD7A 1OLMA 1IPJA 2A3YA 2P3YA 3GNEA 4NIIA 3WG3A 2QQJA 1VRBA 1WMDA 4KWUA 4I0WB 1TME3 1JBCA 4P02B 3U1XA 1QH6A 3N7JA 4D8MA 1ZVFA 4LITA 5C3QA 3O1PA 3POWA 3AXDA 5SV5A 3G6JB 5FPLA 4BM8A 2PAMA 1VAMA 4UBGA 2ZGOA 5LA0A 4FPEA 2EIBA 5BPXA 2RR13 2ZHKA 5F2SA 3TEXA 4GZ9A 1WW7A 5L9VA 3OGGA 1MS4A 5E16A 1MZ5A 3SEEA 1N3QA 2E7AA 4PCRA 4HK9A 4YG3A 4NAMA 4XAEA 1CAWB 5FPVA 5DMYA 1UPIA 1WUVA 4LBOA 4AFAA 3TYJA 5KXCA 3CU7A 2W39A 3O5SA 4CEYB 2VH9A 2EICA 3ZN4A 4JKLA 2VTXJ 3IAQA 4K8FA 1FOD2 3C8XA 1CAXB 4L97A 4HETA 1UNBA 5DDJ3 5DDJ2 3ZMNA 1AR83 2FHRA 4QX5A 2O14A 4YW6A 3UGGA 2H6BA 3PHMA 3ZXAC 5JI9A 3O1RA 2RJLA 1UOJA 1ASJ1 2C0ZA 2KR2A 1UZVA 1SLBA 4FPGA 4PF5A 2HWC2 3OCPA 2HWC3 4LA3A 4PQ9A 2JB4A 4QKBA 1DYOA 5FY1A 1AR92 2HWF2 3M7AA 1W2UA 3LKJA 4Q4X3 3BIWE 3OEBA 3FFZA 4OI1A 1RGSA 2FMDA 2ZMNA 4LIUA 5DUUA 4Y24A 2PLV2 1MS8A 3NNJA 3H1WA 4M4PA 5IK7A 3AKSA 4COYA 3VL8A 1BKZA 4E8DA 1AX0A 2DCYA 4IV3A 2R1BA 3PUIA 1ACCA 1OVPA 4XPVA 3RZJA 3CHXA 3V64A 4LE4A 1CAUB 1SBEA 1ZM1A 3S0MA 1G9AA 2VOXA 3MLJA 1OC1A 3I59B 4RQPA 1B09A 1YQ2A 3IMNA 5FMOS 3WP6A 5CFDA 4K6BA 1GNZA 4QX0A 2VQAA 4MGSA 2Q8OA 4UFHA 1LOCA 2DVGA 1LHVA 4DNYA 4UW5A 5JXJA 2VGDA 4WM7C 2HEVF 4AQSA 2VBBA 4P9IA 1Z7S3 1SDWA 1H9WA 4JAAA 1GUIA 4W6XA 5AVPA 1VIWB 3F95A 5L73A 4FAHA 4BLIA 5J37A 3DKQA 1UY3A 4LUKA 5EXOA 3JU9A 4N53B 4XMIA 5JIUA 1GZWA 4LHKA 3W9AA 4Q4X1 3U4XA 3K77A 2UWBA 5FZAA 3N9QA 2HLEA 4D94A 2W47A 2W9XA 3MBWA 3DXTA 4LEJA 1VBE1 4AI0A 2YPDA 1UZ0A 5FO7B 4AEMA 4RN5A 1KS5A 5C7GA 3PVOA 2CU5A 4XC9A 3WDXA 5CFCB 5JXGA 3UGFA 4IEQA 4HFSA 3POBA 1AYM2 1ULGA 2WWJA 3JB8A 4W6WA 4Z82A 5CYYA 5F5AA 3LF7A 4QX3A 4M3CA 3IMMA 1VMJA 4S2DA 4R9CA 2Q30A 1B35B 4FPJA 3BCWA 4IE0A 4NIAA 2XPJA 4N8MA 3DKWA 2X8KA 4QT6A 3SXWA 1T2XA 1OHFA 4EN0A 3ZPOA 4LHLA 1X9TA 4Q8KA 3FFQA 5T50A 2NZ9A 2WO7A 3NV4A 4YZ2A 2HWB2 3JBG3 1Z7S1 2VUDA 3LPGA 1OF4A 2E53A 4YVSC 5CA6A 5IK8A 3J9SA 3VZLA 4Q0PA 2ZAAA 1ZBA2 4COZA 1PVXA 4Y5SA 1U12A 1STMA 2LW8A 1O4TA 3V56A 1GQGA 3NL1A 3VBUB 2NQYA 4JCKA 1MZEA 4D3WA 3ZOIA 4NWVA 5KWRA 4LXLA 1RUE1 4Y20B 4BLJA 1GP4A 1O5LA 3ZSKA 3OBZA 2GC3A 3DUIA 1K5MC 4CDUB 3N7MA 3T1MA 4RHV3 5JOYA 1Q8PA 2G9ZA 2OPKA 1WW6A 1V9U3 2Y26A 4I02A 2RS11 2QQNA 1CQ9A 4K7JA 1QJFA 2VXJA 4I0AA 1IKQA 4DQAA 3BU7A 1QXRA 3E97A 2W1WA 2WFPA 2FDJA 3M2MA 4FPLA 4X8NA 4Q0SA 4FFHA 1IPSA 2ZMLA 1NCQB 2DV9A 3BALA 2VE1A 1W2AX 1LAJA 4P9GA 1JZ5A 2CWMA 3GZAA 1XYOA 2GMMA 4XYXA 1OOPB 2G9FA 2OA2A 1SCRA 4KG0A 2BGCA 3IIAA 1YO8A 4MGYE 4LKSA 4MXWA 3WNXA 3BTXA 1H4GA 3ENRA 3POJA 4KBBA 4YGBA 3ECQA 1J58A 2ZBJA 5A6XA 4YWAA 2WA4A 4NO4A 5GZDA 2DTWA 4M3CE 1QIQA 2XVKA 1SDDB 3KCCA 1UY4A 4CP9A 2O8QA 5AFEA 5IVJA 3H9AA 3M70A 1V6MA 2E7QA 1FPN3 1OUSA 1RUD3 1ULCA 3D6EA 4JGYA 4EJRA 5CEHA 1WW4A 1W6PB 2Q1ZB 1ND2C 5FJHA 2ORZA 1RUC1 4LBQA 5IFPA 2C26A 3J4UH 3VBRB 2IXIA 1PK6B 4LE3A 1V6LA 4XXAA 3RMXA 5J7MA 3ITQA 4FO9A 4DEVA 5FBJA 3ZSJA 4GAZA 1WBLA 2WNUC 1EPZA 3KSCA 4S2FA 5LK7B 4QX1A 4CCMA 3HQUA 3O0XA 1P8JA 3X29B 2YBKA 4BQ5A 3RYPA 5FUPA 4YW7A 5A1LA 3HNYM 3H8RA 3IWZA 2B46X 2BWCA 5CG9A 2WZR3 2WA3A 1SFPA 2XONA 1EP0A 1OBNA 1A78A 4RR3B 1RMU1 3I59A 4RQPB 5JR7B 4BXSV 4DB5A 1N1YA 1QJX1 4F3JA 5J1XA 1UKRA 1AR91 3MPPG 4GB32 4P5YA 5KHJA 5HCBA 4AVCA 1RUOA 2XVLA 1SACA 1C8NA 1LOFA 1FT9A 2VOTA 3H50A 2HWD2 1C3HA 3LE0A 4XABA 1APNA 2XR4A 3P3NA 3KGLA 4QXCA 1DQ4A 2Y6GA 1VBD1 4TWTA 4YGDA 2B8MA 4DRRA 1ZRFA 5A3OA 3OGJA 3LIHA 1O59A 2HBTA 4K8RB 1V70A 1LOAA 4MG2A 1ZX5A 4QHBA 2A5ZA 3CIHA 4LQRA 3GM8A 1AZDA 2QDNA 1NCRA 3SCHA 3PLQA 3NO8A 3H3LA 1PK6C 3RWNA 1I5PA 3CL1A 3HWJA 3E5XA 4LO8A 2Z5WA 4HN1A 2IFRA 3JB4C 5I0SA 2AEYA 4Y1XA 3ILFA 3T1LA 4D6QA 3BTZA 2YROA 4NPMA 1XC6A 3NRUA 1LHNA 3BOWA 3M3QA 1AR71 1GNHA 2WT2A 4B3NA 3FJSA 4NMIA 5LBCA 3VBHC 2WNEA 2YG0A 3SQOA 4E4ZA 5JDBA 4JHTA 4XZPA 2FMYA 2VMGA 2CDOA 4JGZB 3N7KA 1DQ6A 5A1AA 5C9AC 2VM9A 3I3DA 3I4IA 4NPLA 4YZ3A 3P1IA 1NXD1 3RWKX 5LBBA 5F8PA 4YSFA 5H9RA 5CG8A 5GZEA 2WLQA 3NNGA 2BV4A 3LAGA 4DY5A 3ZLIA 5LEJA 1W6QA 2JD9A 5JWPA 3AVRA 1TEIA 3PVEA 3AZYA 3FUOA 2ZA9A 4E2SA 1YYNA 1JZ4A 1NLSA 1VBA1 5FOBB 4C0HA 4GXLA 4DOUA 3PTYA 1HQNA 1OLME 4YPJA 3AKPA 4UFLA 2CYFA 4QKDA 2Q4SA 1ND3C 3K4ZA 4CPBD 1ASJ2 1FNZA 1AVBA 4LO6B 4OHXA 3PVBB 1MZ6A 1K45A 2P6CA 5DXDA 1G7YA 3WR0A 4A4AA 1UU6A 5LZ6A 1DCSA 4HK8A 3HD8B 1WLCA 4DUXA 3VZMA 3JD72 3VD5A 1UN1A 4LK7A 1XYNA 3SH5A 1H8TA 1Y9QA 2EXJA 3PU8A 4AVVA 3M8LA 4K21A 1HQWA 2K46A 2V09A 2VMHA 5AC92 3RJ2X 3VDCA 1AX2A 1E5RA 4Z2WA 1LGBA 2R062 3WCSA 3WUDA 1VBC1 1RC6A 2PELA 1SLIA 3IAPA 4L99A 1YFYA 4H3WA 4XURA 3A7QA 4A44A 4CCEA 1US3A 4LO4B 2VW2A 1ST8A 2PHWA 4XQDA 1IS4A 4Q27A 4OI4A 4DXZA 3WNPA 4K20A 4HLTA 4CSWA 4J1WA 4Y1UA 3O7OA 4XDPA 2OQ7A 3OUHA 1B35A 1C8M1 1REEA 3J8F1 5FZBA 3VBRC 2XBO2 4L11A 1RHI1 3FN9A 3OF1A 4QX8A 1JXNA 2C9KA 4WZCA 4QPGC 2VUJA 5FZ1A 4LMFA 3LFMA 4UFKA 2RHPA 2D7FA 5K4LA 3NV3A 1WLWA 1UU5A 3SH4A 3OY8B 4CCDA 4CU8A 1M4WA 2BERA 5E1RA 2XQRA 4Y1VA 2KXLA 4CUAA 2VPVA 3B94A 4BIFA 1HLCA 2R072 3RDIA 1EAH2 1GYKA 4WBBA 3RRDA 4HKLA 3AJZA 2OYZA 4BQYA 2J1EA 5J3UA 1XSQA 4EYUA 3LDBA 1ULPA 1GQHA 4IEXA 4ARXA 5HXMA 3KF3A 4H14A 4RA0A 1DLCA 1YUDA 2PHFA 3RI8A 3I54A 4PIYA 4J6GA 2E6VA 3POIA 4XQ4A 2VJXA 5FYYA 3ZN6A 2EF6A 2OUJA 1U0AA 3MW3A 3MV11 3AX4A 2XG3A 5A7OA 4AOCA 5L7OC 1N3OA 5AFBA 4ZPIA 4N7IA 1HJGA 2ARAA 3ROUA 5I0TA 5FY9A 4D6RA 1Y43B 1BLZA 5F3IA 4ASKA 5FO9B 4ZKTB 5AVAA 5FPBA 4A3ZA 5BUVA 1IGOA 1XNTA 2YY1A 2R0HA 2TNFA 3BTYA 1QJU3 4XJ9A 3SNMA 3B9IA 3W20A 3O0WA 4PJYA 4ES8A 1YJLA 5JOWA 3LZZA 3TN92 4TYSA 1Y9MA 2OXBA 2UY9A 3APBA 5A80A 2GC1A 1QWRA 3FZ3A 3OPWA 5FMBA 3RMYA 2ILMA 4HMZA 3RYRA 4M01A 3FHAA 4IESA 3WDWA 2VZTA 4QXBA 1REFA 4WVVA 1K5JA 2WN2A 2JXAA 1KXGA 1MS1A 3FE5A 2WS91 5JXIA 2Y6KA 2JDAA 3HN3A 3VD9A 2BFUS 3ILNA 4XF4A 3U4SA 4CU6A 2OVUA 4BK5A 1WLTA 4X8PA 2R49A 1PGL2 4BMEA 3NJYA 3VDDA 2VVEA 3NVCA 4Q4V3 1HQLA 1R1A2 3ATGA 3NNLA 4FSJA 3MW2A 2IXJA 1R083 1XXNA 1YI7A 4TLGA 1DFQA 5HCAA 4W8JA 1TMF2 1JYVA 4AVTA 5A6ZA 1GMMA 2E32A 1RUI1 4ATEA 1JN2P 3AYCA 2R32A 3VBRA 4W6YA 5C8CC 4FBFA 4JGYB 4UFMA 2V5YA 4HKWA 1H1AA 4R4ZA 4U2AA 4XUQA 4DXTA 4UYBA 4CP9B 5GLUA 3LOBA 2RM23 4ZZ5A 1DDLA 1NOVA 2BP6A 4GKXA 1CONA 2BGPA 1COV2 3MF9A 2WFF2 4AEKA 4A45A 3KHCA 2WWUA 3THPA 1Y4WA 2AEZA 4GD4A 2F4PA 2Y60A 1LENA 4Q0UA 3AYAA 1UXZA 1W6MB 2VMIA 1BEV3 2WUHA 3AMHA 5J96B 2IVJA 2WO1A 2VTFA 3KQRA 3PUQA 5FMCA 2PMWB 5DUWA 4Z1VA 4OUMA 2PQQA 5FY5A 1QXJA 5FR3A 1QY4A 1CZSA 1S0IA 1UZYA 2WN3A 1RUD2 2B4KA 1X9PA 3VDDC 1VBE2 1ZA7A 2RJKA 1ZRDA 3BVCA 2J1UA 2H0VA 1OLQA 3H7YA 3JCIA 3DPRB 4GKYA 4W4ZA 3WQ0A 3KB5A 5FYMA 3NKTA 1F4AA 2DFCA 3VBFB 3FMGA 4C90A 4FXKB 2GALA 1LESA 3LPFA 4META 4RHV2 1HKDA 5FPAA 4CP2A 4DZGA 2RR11 2JJ6A 3RJRA 4TZDA 1OXCA 2CGPA 1VBD2 4RFRB 1NYWA 1EY2A 2R16A 4CUGA 3J7MA 2KD7A 5K9YA 4QX7A 1Q56A 4FPCA 4LPLA 3V0AA 4XJAA 1CESA 2DBNA 3QH6A 4ZXKA 1A8DA 5CB7A 1ZBA3 3MI8A 3V0BA 1G8WA 2AENA 3OY8A 4OVEA 2YUEA 1W6OB 5B2GB 1DYKA 2VW1A 3EXUA 5A1FA 4AEDA 4JC1A 3H1YA 4HPKB 1TG7A 1X8EA 4XE9A 4XTPA 5FRAA 3V0AB 1VBB3 2MNGA 4UF0B 3GZUC 4A3XA 1VRH1 3IZOA 3ZO0B 2YBSA 1VRH2 4NRQA 2YXSA 5FO8B 3VZOA 1XRUA 4LBMA 2XWJB 4Z92B 5FYBA 2HWE1 1AR62 3ZFEB 5C3PA 2VAUA 2J22A 2CTVA 1H6YA 4WM8A 4CYDA 1Q8SA 2P34A 2JIJA 3I7DA 1JYWA 4QGMA 3UNPA 1G6NA 2ZHNA 4XJ8A 1O7FA 5FY0A 2RS52 5G05L 3N9OA 1BQPA 3IT8A 4JQRA 2C1FA 4XBQA 2WQ4A 4BPZA 2RV9A 2I2SA 2RS12 1A6CA 4YGCA 1WZXA 5EIYB 3O12A 4FTSA 1PX4A 4ITCA 2K9ZA 2R30A 4RFT0 3JBG1 1SBFA 4MXVA 5FZIA 5FXVA 1B35C 3H1MA 4IGOA 5F3CA 4Y22A 5DQ0A 3F2ZA 4N7UA 4LT5A 4FVVA 3CEWA 1JZ6A 4UT5A 3MIDA 5FTTC 5LASA 4CCKA 4TTGA 4EV0A 2RDNA 2DF7A 3FLTA 1OOPC 5FFOC 3TB0A 5FYIA 1XOYA 1ODNA 1ZNPA 4BCUA 3MIBA 3DEMA 2D6MA 1OURA 3U11A 5H9SA 4Y3OA 4JTNA 5FP9A 3ZXGA 4N43B 1JHNA 1XQNA 1X36A 3NW4A 5FQ0B 2NPIA 1W6NB 2XHNA 2VY0A 4BIOA 3B7MA 4Q2FA 4YVWC 2PHLA 4Q0QA 4QPIB 4YM2A 2HWB1 3DN7A 3AKQA 1W8UA 2RS13 4QU2A 1FV2A 1W9TA 1EUTA 3K4DA 3UGHA 5FZOB 5J48A 2Z79A 4NVPA 1UYPA 5K0UA 1BBT3 2ZGKA 4O61A 5D21A 1KGYA 1UO9A 3BIEA 2ZX1A 1LHUA 4V1PA 3T3YA 2DVBA 4K3UA 3MZHA 2AC1A 2ZX2A 5LA2A 1PZ9A 3MUZ1 1PVC2 1MEC2 2DVFA 2GN7A 4OZXA 1JOPA 3PJYA 1WGPA 3RZLA 3EQEA 4UBHA 4AAPA 2DVAA 4CRQA 2Q1FA 1LOGA 1VBB2 1PHMA 4HONA 4D0QA 5F32A 3IIIA 1RUH2 2BJSA 1IS6A 1F8VA 2TBVA 5LY2A 1DHKB 2ES3A 4IDZA 2XJSA 4M0HA 1NG0A 1Y3TA 2ZPXA 1FXZA 5FZGA 1W2NA 3MIHA 1XYPA 3HMYA 3ZYGA 4GMP3 3ZXFA 2X5IC 3HOBA 1GR3A 1UY0A 5DG1A 5M0TA 5IHRA 2DWRA 3MEPA 1JS9A 5EP9A 3H3UA 5GLTA 4AI9A 1O3TA 2G19A 2JG8C 2H6CA 4GJZA 2BPA2 5DZEA 2WR9A 3WLUA 2N7GA 4EN9B 4INDA 1ODMA 2ET1A 4FFIA 5F3EA 2A70A 1DGRA 4N43C 4XFFA 5A7WA 5FBZA 1HB2A 2QQLA 3USSA 2GH2A 3SMHA 2VZVA 2XHKA 2P17A 3ME2A 2PYTA 3EB7A 2LRPA 2R0FA 4QMAA 4RGKA 3UV9A 1NE4A 4BOWA 2O1QA 1PMJX 2NM1A 5KHGA 2WZR1 1NCRC 3DCQA 1O4YA 3EBRA 2RR12 3WHTA 1RUJ3 1RINA 2CAUA 5FREA 2XJQA 1POV0 5K7PA 1V6KA 4HVRA 2ZEYA 4XDQA 4CDWA 4AL9A 1S0EA 1S0DA 1S2BA 3I2IA 1QEXA 4GJYA 5HCHA 2JDUA 3B00A 3OGSA 2QJVA 2MHFA 5L7OB 1W6PA 3NWKA 1GP5A 5FXWA 4UI9L 4XTMA 1DGRN 4OFGA 5FLJA 1UL9A 1KJLA 1W04A 2PN5A 1O5UA 4IE7A 4LBNA 3HIFA 3ZXDA 5IAXA 2P5BA 4B4QA 4IEVA 2JE9A 4CEWB 1MQTA 4JHZA 3VGIA 1AJKA 4XCAA 4CU7A 2DCJA 1LRHA 1JI6A 1AYN3 1PO23 1Q3EA 1AUYA 1CPNA 2QZ2A 2ZGTA 3P5BA 4PF1A 2QQIA 1VPHA 2D3RA 5TSWA 4MGZE 3HT2A 1HRI3 4XQWA 1D4VB 1BK0A 3CF6E 3Q8AA 5ANQA 4NR1A 5L9RA 3VD7A 3CJIA 1PX3A 2VQTA 2WABA 1BZWA 1VBA2 2W1SA 2QDRA 1W8NA 5BNPC 3ALQA 1MVQA 1MZFA 2WNVB 3W58A 3AYDA 1JYNA 4UAPA 4BH9A 4P9JA 3TNPB 2FD8A 1H8TC 1ND3B 2ZAHA 3EMRA 1NY72 1D4M2 2ZX4A 4I09A 4XUOA 5FKBA 1F2NA 5FP3A 1HRI2 4V2VA 1D2SA 3ZPYA 1PGW2 1IS3A 4AFDA 2EA7A 1PIV2 4PLOA 2ZX3A 4C1XA 4JGYC 2BRTA 2JG9B 3UETA 3M3CA 4H7LA 2JDNA 3C2UA 1GANA 1W8FA 4C1WA 5FOJB 5FZMA 1QJY2 1WA6X 1ZZ9A 3ZKYA 1OT5A 3ES4A 5FWEA 3O1VA 1G9CA 2WZPP 1RVF3 1F5FA 1I5ZA 2XBO1 4MX3A 3WDTA 5JSPA 1HJFA 3MHZA 3OBRA 5H9QA 2RMU2 2OPWA 1QNYA 1S0CA 4IL7A 4CDXC 1LOEA 1FMD2 1RUF3 1CZTA 3TRSB 4COVA 3T0DA 4ORFA 1US2A 4QDSA 4R8HA 3WP3A 2LROA 1LJ7A 1OFNA 2Q0AA 1NXMA 1QXPA 2YMZA 1GZCA 2VU9A 2ARXA 2NMOA 4NROA 4XFIA 3VDBA 3T2QA 1EAH1 1SZBA 2HYKA 1LOFC 3AMMA 4NAOA 4NHMA 4YFWA 5FYCA 3BTAA 4JZRA 4QPWA 1GU3A 2W94A 3WX5A 1UYXA 5KR7A 4AWDA 1RB8G 1OKOA 2ZOEB 3WP4A 3G7DA 2ZGPA 2YU2A 3CMGA 4J25A 3B93A 3ZFGB 1IKPA 2HWE2 5C3SA 2GN3A 4MLOA 4O65A 3TEYA 4AEJA 3QACA 4OHYA 2ZGUA 4HVOA 2VNRA 3JD71 2E7TA 5LK5A 2D6OX 1CWPA 1A8MA 2AR6A 5FP8A 5LCWL 4ZONA 2WSUA 1CIWA 5JZGA 5JXHA 1AR93 3KZ4C 4N53A 2WT1A 4PHZA 3VBSB 1LU2A 1NCQA 4QWNA 3NJXA 4LNVA 3I3BA 4FPHA 4Q26A 4B29A 3Q8EA 3W21A 3RI9A 3Q8FA 4XFHA 4BQXA 5IYYA 3IDCB 4XUNA 1LR5A 2VMFA 1ZZCA 2EIEA 2AYHA 2Y38A 2WFF3 1JZ8A 4OUEA 1MEC3 2A7AA 5FKCA 3I2DA 4LLFA 4Q5OA 1ZBE2 5JSOA 1ZRIA 2X5IB 3D0SA 4CCCA 3KV9A 5FUIA 3UJQA 2EXHA 1UU4A 5LA1A 1LKNA 2PHXA 1ZRCA 2JKXA 1V0AA 1VJ2A 5KHIA 3M3IA 1UX7A 1ND3A 4QPIC 1J3QA 3FC0A 3RYKA 1S2KA 4HVQA 4RS5A 5IVVA 1W8ZA 1D0GA 1OA3A 4HKOA 4YARA 5JPNB 3O1MA 1DBNA 1OF3A 3PU3A 1POV3 2BBVA 4A41A 1RUD1 3JQXA 1XNKA 5EHDA 1DG6A 3WCRA 3IDAA 1KDMA 4P9LA 3ZSEA 2I45A 5F2WA 3U0ZA 2WJSA 2EIGA 1XB9A 5C8CA 5JZGC 2D3PA 3S30A 2W87A 1JZ2A 2PHUA 3HNBM 1NCQC 2J7MA 4MHRA 5FZEA 1IS5A 3NAPC 4YVSB 1EUUA 4L0PA 4FOYA 1IPKA 2HWD1 2IWGB 2WFF1 4JDNA 1ZZ7A 3HPNA 2GC2A 1DQ5A 1GLHA 3OOXA 1AYM3 4EWDA 4QKFA 5C5UA 2BVVA 4Q8LA 3B69A 1XNAA 1HB3A 3WY6A 4C8DA 3LB9A 2Y6HA 2FCUA 1F31A 2WNOA 2ID4A 3ELNA 1MS3A 3KV5A 1G9DA 1NQDA 4AGGA 4Y26A 5DAPA 3M1HA 4V2WA 1RUNA 1UX6A 2WYSA 3A4UA 5FLHA 4B7EA 1DLLA 4H7MA 1JUIA 2GMEA 2UU8A 5JOZA 1K42A 3QLQA 5CBLA 2HEYF 2J1SA 5KC6A 1J59A 1D4M3 2WLPA 5FCCA 1CX4A 1W8WA 3SC7X 1D7PM 3LA7A 2Y64A 4R9BA 2ZZQA 1YLLA 3VKNA 4QGNA 1R1A1 1X82A 2D6PA 4ISRA 3DF0A 2NP0A 1R091 4FTEA 3TOJA 4AEDC 3W5MA 3KCYA 2D5HA 1H2MA 3T09A 1YJKA 3FLRA 4YW3A 2Y34A 2ZXQA 3C7FA 4GB31 4IGPA 1XE0A 3AP5A 5I93A 1WCSA 5ABJC 5C9AB 3O0VA 2A6YA 2CAVA 1W0OA 2HWD3 3WINE 1CGPA 2D6LX 2PLV3 5B4XA 1UIJA 4AVAA 4XBNA 3WOGA 1ULOA 1LB2A 4IV3B 5FZ3A 5CNAA 2D6NA 5FYTA 4Q4X2 2VCCA 5DDJ1 3AZWA 4AXOA 2C6SA 2RVAA 2CY6A 1V6NA 1H8TB 2EAAA 1FMD1 4FP3A 3OEAA 4GH4B 2C4XA 2WYFA 1DZQA 1DGWA 3E6DA 2SBAA 3PURA 2EXIA 2YDEA 1REDA 1NZIA 1X7NA 2HH9A 4OMCA 3V65A 3Q8BA 3H7JA 3I2HA 3D82A 4LKEA 1QJY1 2JD4A 1S55A 4YG0A 4D7TA 4WM7B 4XCBA 4DS0A 4B8EA 4ASLA 2ENRA 2MPFA 4P00B 4CCOA 3DYPA 4ZXEA 3CNAA 3MYXA 4JDMA 4F7ZA 1GSLA 1Z78A 1URXA 4GB33 3NAPA 2RMU1 4P9WA 4AI2A 4PDWC 1CPMA 1QQP2 3VBHA 1TNRA 3FL7A 2RDSA 2R071 4YVWA 2JKBA 5A3PA 1LGNA 4RR3C 3HAGA 1CAWA 3AJYA 5JAXA 5KXDA 2XDVA 1NX9A 3PVNA 1GFF2 3Q9OA 1GZ9A 5T54A 2DYCA 2UURA 4XW3A 3ZFGA 3I2JA 1E57A 4BZ4A 3NNFA 3T0AA 1PGW1 4CDQA 4K9SA 2R7EB 3VV1A 3RPQA 5JR2A 5CKNA 4CDXA 1VALA 2I07B 1OOPA 3HEIA 3OB8A 3UT0A 2DTYA 4XVHA 1RUJ2 4JX0A 2W68A 2B5HA 5FP7A 1GWLA 1CAUA 3ST7A 4E4DX 1YNAA 3P6BA 3MIFA 1V9U2 1JW6A 3VHRA 3JBG2 4QKNA 2EXKA 1UY2A 3CBNA 3JZVA 4GMP0 3WW4A 4B4PA 4NHLA 2D44A 3VZNA 2V73A 1HB1A 4B7KA 2XJVA 1MS9A 5ABJA 1EPWA 3P3PA 1X8MA 5A70A 1AXYA 2ZEWA 3WQ7A 3LEGA 4RGGA 1TME1 3ZKUA 3AFKA 1OMIA 2JDKA 4AQ2A 1E5IA 2WINB 5FMOL 5LATA 5F6KA 3RGBA 2JG8A 2EVXA 3NV1A 5A7PA 1C5HA 2VZRA 1YQ8A 4K40A 1JYCA 1PMIA 3I97A 3LEKA 3R05A 4XHBA 1LEDA 4XF9A 4O9EA 3J7NA 5IK4A 3S5AA 2JEMA 4TXWA 2HWB3 5D8AB 1W9SA 2TUNA 4FOWA 5BXXA 3O1OA 4E27A 3BODA 4BJ0A 1QJU2 3LEIA 3RZZA 3O1TA 5A3LA 3LWCA 1UPSA 4CDQC 2B45X 4MGQA 4A7KA 4FQZA 4ZZ8A 5A3UA 3VBSA 1ZBA1 2KA3A 4AG4A 4QB2A 1UYYA 3ZXLA 5DAQA 3SISA 2P3KA 1K5MB 1EV11 3CKHA 4QXHA 5I8TA 3CJIB 4QPGA 1XPWA 2FBEA 1PGSA 3ZYHA 1MS5A 2ZGQA 5J36A 2A73B 2FQPA 4IGQA 2JB8A 2XLGA 4ISQA 5GZFA 5CAZA 1NUKA 2RG4A 2WZR2 4PDWA 3ILRA 3ZVXA 2W0XA 4BISA 2KM2A 1U5ZA 4IV3C 5LWBA 1LEMA 4MXWB 4N43A 1PGL1 2VVFA 2QQKA 3OD0A 1GOFA 2GAUA 2HWF1 3FLPA 1W9WA 2CWSA 3WT3A 1COV1 2VBDA 2JDZA 2ZHMA 1CAVB 4DO0A 3KQ4B 2RS53 4BDVB 2WL1A 2A75A 2Y6LA 2CGOA 1DGLA 1YFWA 2JDMA 1OQDA 3LA2A 3ACIA 3THDA 5FXXA 4Q4V2 2VZQA 2A71A 4XXPA 1PVC1 5L7OA 2XB6C 1YFXA 4LO5B 3I2OA 4YM1A 4NJ4A 3N9PA 4LR4A 5FZHA 5LRSA 4ATFA 4QDRA 5T55A 3THCA 3NV2A 1N1VA 1SBDA 2D43A 2GZWA 1GWKA 3KGZA 4Y5Z0 1QDCA 4Z8BA 2RS32 2GNMA 5C70A 2C24A 5HPOA 3KLSA 3KCXA 1NKGA 1OPMA 1O8PA 2A3XA 1JOBA 2P1BA 1NA1B 4YYOA 4R9DA 1W9FA 2CGNA 3VBSC 3IBMA 4Y20A 3N35A 4IEPA 4XUTA 1POQA 4AE2A 4F83A 3NJVA 1MPXA 3H3ZA 3N9MA 1TNFA 3EYPA 4JDOA 2VZ3A 3VLBB 2O0OA 2QTWB 1R092 2YPJA 3K48A 3PL0A 1NLQA 3C7HA 3FWEA 4I01A 1K3IA 4EWEA 3TEZA 3U75A 1ENQA 2HWF3 4AFBA 3M3EA 5FP4A 1KS4A 3CDZB 1RUG2 2DCZA 1MR5A 1NZCA 1RUG1 1QQP1 4XAAA 4XIOA 3RZKA 2FDFA 2ZGLA 5AC93 4PIZA 2X05A 2OT7A 1S1AA 2J1AA 5BNOC 1O8SA 3MW4A 4Q4W3 1FOD1 2Y6JA 1CN1A 4IV1A 5EPAA 4GWJA 1BVVA 5FAXA 5GLZA 2BW8A 1VAVA 1DP0A 3SKJE 1AR72 1LULA 5KBFA 2GNTA 1I6XA 1QJX3 5FYSA 1WCUA 1PNGA 5F7UA 4I3GA 5GLWA 2VNGA 1J84A 1HDKA 2GNDA 2VOKA 1ASJ3 3POEA 4IE5A 4R9AA 1HRI1 5FYVA 3S5QA 4AQTA 1QF3A 3J8F2 4P5HA 2R041 1VBD3 1BBT2 1CAXA 4WVMB 2CL2A 1JMUB 1W0NA 1UD1A 5FYZA 1OUXA 1BMV2 1CD3G 1SG3A 2QFEA 4GMP1 4NN0A 5JMCA 5BNNA 4ZHNA 5ABJB 2ZACA 4XIKA 1OD3A 4GWMA 2V72A 2Y0OA 1SCSA 2O8OA 3ACLA 4SLIA 5APAA 1JYIA 2RS33 3GBWA 4BQ2A 5DZFA 3UYJA 1CJPA 4CDWB 1SQ4A 4MSVA 2VNOA 3AYEA 3WF0A 4AYUA 4BYYA 1RJ8A 1W8HA 2ATFA 1W28A 2W3JA 1H30A 1VMFA 2PHDA 3DGTA 2HKXA 1PIV1 1OH4A 1ZRRA 2QQOA 3VD4A 1UXXX 3OBTA 1RUE2 1ENXA 2RDQA 3KT1A 3L2HA 4M3CF 5FK7A 5A7QA 3WQ1A 5F5IA 2CHHA 1RTVA 5JIAA 3WHUA 4OI0A 4JRAA 3T2OA 3POSA 4AR2A 2GDFA 2W2IA 3URFA 1RVF1 5GZCA 2F17A 3ZIWA 3WQBA 3WG4A 1XNCA 2MEV3 1FX5A 2UWCA 4QB1A 1HRV3 4QPGB 2A6ZA 2J1RA 3MIGA 4R52A 1Z7S2 4NE9A 1DQ2A 3W59A 5FZCA 5ACA2 1H4HA 3BU0A 3NAPB 2J1VA 3K75B 4MH0E 1Y9GA 4XF1A 3U14A 4OHWA 4QM8A 4DMIA 1JH5A 2XWBB 2W1QA 4CDWC 1PO13 1YCIA 2QQWA 4XJUA 2VUAA 3RQ0A 2ORXA 4BQWA 5F9TA 2FDKA 3K4AA 3KT7A 3VDDB 1UQXA 1SEFA 3TNQA 1UWWA 2Z69A 1YIFA 5LEKA 1BHGA 4GQ7A 2AZ5A 5BYNA 4QAWA 3BOPA 2A1XA 3HN1A 3LDKA 1PIV3 4BQ4A 4RGAA 1C5IA 3OUJA 2OX0A 4Y33A 1CR7A 1SLCA 2P3JA 2XJPA 3R6SA 2Q5TA 2VR4A 4HL0A 3I49A 2VL4A 4WM8C 2ETEA 2VO5A 3VBOC 2MEV2 3HQRA 3ORJA 1WW5A 3POGA 5FZ7A 5GJ6A 3V0BB 3I8TA 5FZ4A 1ULDA 5E6HA 5KHKA 3ZFFB 4CP0A 4FPKA 4C91A 3CLPA 2XVGA 2E33A 1N1TA 2GMPA 3AMNA 2XXZA 3EO6A 1VB2A 4JVAA 3RZGA 1ZBE1 1LU1A 3KM5A 1I1EA 2XLFA 1Q5OA 2QUOA 3AKRA 1R1ZA 1YHFA 4LOTA 5C4WB 1GOGA 1VE0A 4L8QA 1WCQA 2JDHA 5DAXA 1HV1A 1RMU2 1ND2A 1S0BA 2WT0A 2ZJCA 4IE4A 3RG0A 3VUOA 4DUVA 3KWVA 4AGVA 1OSGA 4OULA 4HSLA 2B9UA 3ZXJA 2VUCA 3KS7A 3ASIA 5L19A 4Y22B 3BB6A 3PIGA 1BEV2 3PTRB 1GWMA 2WNUA 4WVZA 3ZN5A 3ZSMA 1RUI2 4HN0A 4F8AA 1N47A 4YVWB 2FZ2A 1OLRA 3ETPA 3ZR6A 4DIQA 3VKFC 3A22A 1W99A 3POFA 1NA1C 3HQXA 4QHOA 2QQUA 3TWIA 3N3HA 4MO3M 2Z4FA 4LLOA 1PMHX 3D3AA 4Q0VA 4WVMA 2GC0A 4Q4Y2 5HI0A 1JODA 4CVUA 2QVSB 3KV6A 4M4RA 5EJ3A 2ZGSA 1RUH1 1W3XA 2E9QA 2RM22 3FUQA 4A6SA 4IW3A 4AVBA 4DPNA 2I74A 3OG2A 3T30A 2A3WA 2L9LA 3J8F3 4X6RB 1QJX2 1ZA4A 4ZY9A 5IT6A 1JYXA 4ES9A 3E6CC 5F39A 3A0NA 1I3HA 1QJU1 4PDWB 2JE7A 4ZU4A 3S7EA 4BXFA 2GSYA 3U78A 1FAYA 1FPN2 4HSJA 1HW5A 2DURA 4UWDA 3WV6A 1W6OA 4G4FA 3A23A 5IVBA 3QD6A 1DGWX 3IM0A 3MDPA 5FIXA 1RUC3 3B9CA 3CJXA 2AUYA 2IXCA 1I9RA 2YYOA 2JG9C 3AL6A 3ES1A 4FPOB 2CV6A 1G9BA 4L9BA 5FWJA 2VW0A 2C9AA 2D40A 1Q8OA 3OYWB 5SV8A 4CDUA 5GKAC 2IXKA 1K12A 2RE9A 5EFUA 4BK4A 2PA7A 2G9GA 4PIXA 3PUSA 1YWKA 3HNMA 5E8AA 4AK3A 1JZ3A 3UKVA 4YZ1A 1W39A 4J1XA 5A33B 4IEWA 2ZZJA 4MGIE 5A7NA 3GZEA 4E4SA 5DZGA 4CXYA 4RR3A 5GALA 4NIHA 2ARBA 1NA1A 4QGLA 4OQ9A 1HN0A 2ZX0A 2VD7A 4D7YA 2JX9A 1U5YA 5FZKA 5BNOA 2R1DA 5C3RA 5DUVA 5FZFA 1AL0G 3MIEA 4XZUG 3WW2A 2X10A 4YRDA 1IQDC 2PHTA 1J3PA 5ACA3 2IXHA 2YC0A 2R6QA 3BUCA 3H8XA 5A3MA 1SPPB 1UMHA 2BNOA 3I2GA 1JOJA 3ON7A 5ANNA 1W9YA 2B7YA 3AK0A 4FTBA 4QQLA 1W6MA 3VBUC 4LORA 1FV3A 2A6VA 2XJTA 3N9NA 4HOOA 3VBFC 4E2QA 3R4SA 1UCXA 1GQPA 3J26N 1AR61 3K51A 3TBDA 5A6YA 4BWOA 4N9IA 5BNQA 4UFIA 2CNAA 4LUMA 4NRPA 3DYMA 4LTAA 3SHRA 4H2AA 5BNNC 2CDPA 4L2NA 5EZWA 3WNMA 2BGOA 4AI8A 2GU9A 3ZFFC 3UKNA 1GICA 1MQTC 5CU1A 2AGSA 2WO3A 1W05A 4Y5TA 4XF3A 2Q1MA 1KFUL 5CVRA 4KWKA 3ZFGC 4XDOA 5FY7A 3N7LA 2ZTNA 3OYWA 3OPZA 1OPOA 4I30A 5LB6A 3VB9A 2D97A 2ZGMA 1M06G 2BUKA 5IAVA 3PIJA 2JDYA 1ONAA 1E5SA 3NQHA 4QD2A 2VZPA 4ZS3A 1TE1B 3FBMA 4DEQA 3UL2A 1S2EA 5C5TA 5E88A 2DU0A 2ZHLA 1JU4A 1QJEA 2NYYA 4IERA 2P4EA 2QQMA 1NQJA 3LCPA 4JKKA 1C28A 5IK5A 2VZUA 4KQ7A 3ZXEA 1KFXL 1KJRA 4NRMA 4UXAA 1GOHA 2ZKNA 3KT4A 5I8YA 1CVNA 1AL23 2Q8EA 2FDIA 4AFMA 4KMQA 3WG1A 3AZXA 2D5FA 3VBUA 4D7SA 3POYA 2ZEZA 3GBGA 1YFUA 2CSGA 3M4FA 1MS0A 4HBNA 4MUVA 3FBYA 4MOAA 4OMDA 4QDQA 4XJZA 5FY4A 5FV3A 2W08A 5FPXA 1RYYA 2YC4A 5IWFA 4E8CA 4FFGA 5FJKA 1S0JA 5JPMB 4JRLA 2XUEA 3LSEA 1DIWA 2X09A 1F35A 3JD73 4OI2A 5T52A 2E51A 3AZVA 3WEZA 5E89A 1VRH3 1VBC3 2WNUB 4FQ4A 4PT6A 4BMBA 1N3PA 3USUA 4Y1YA 3ZM8A 2OQ6A 3MLKA 4KU8A 4Q4W2 2XQXA 2WSVA 3LFIA 3QOPA 4AQ6A 4CDXB 5BNPB 3WW3A 4IEZA 3O1SA 3N36A 5A3TA 3B3QE 1JTZX 4A7ZA 3KF5A 4M3CB 1AL22 1H2LA 2BQPA 3THTA 2SLIA 3RFRA 1QHDA 3T0BA 3I2FA 5CFCA 4EN7B 1R081 2BU9A 2WO2A 4URAA 3SKVA 2XGXA 3PMSA 4AVSA 3K3NA 4N90A 5FZ6A 3K46A 1W6QB 2P2KA 3EJKA 2W95A 2LTNA 4QM9A 2FDGA 2X53S 3GBFA 5EYYA 1FYUA 3OPTA 2A6XA 1VLNA 1S0FA 5EQUA 1PZ7A 4CTEA 1H6XA 2PLV1 4I3PA 1FATA 3VZJA 3IB3A 1AR82 2XH6A 4YW5A 3SLIA 3A0KA 3AFGA 1BVP1 5KHHA 4WVWA 3H42B 5IVFA 2DU1A 1OA4A 2RM21 4URTA 3AP4A 2VQUA 2YU1A 4CCJA 3VKOA 2QQVA 3T08A 2BOJA 4BU2A 3RZMA 2HWE3 5I91A 3WDVA 3O14A 4HZFA 2IC1A 2VCBA 2WKKA 2JICA 2VG9A 1KEXA 1W8OA 2ZMKA 5CZKA 5L9BA 4YZ5A 1C8M3 3JUUA 4JQTA 1U5XA 2R042 3BN6A 2GP3A 3NMBA 4GH4A 4IQPA 1XNBA 1BEV1 2F4LA 3AP6A 5D8AC 5IJRA 2FCTA 2JIGA 1RHI3 1YIPA 3L2YA 1H1IA 3MO4A 2OKXA 1SMVA 1G86A 1PVC3 3A21A 2W52A 3PUAA 4XACA 2BDRA 3E6BA 2EIDA 3HBZA 1J1TA 2WZEA 4BQ1A 4HT1T 1D0HA 3D8CA 4PBOA 2RMU3 4KG8A 1AR81 4CP1A 3R4UA 1YQ5A 5JLVA 2VVDA 3BKZA 4MYEA 4RS5C 4CXXA 5IVCA 2NN8A 1QU0A 1W0PA 1WLDA 1YEWA 2OIIA 2UWAA 3S7IA 5KXBA 1C8M2 2QBXA 4NPRA 2FZ1A 4KNCA 4MV2A 3I3MA 2BYVE 3WF3A 5DAVA 1LNSA 5F5CA 2ADEA 1J1LA 3WP5A 2J42A 3I2KA 4CDQB 1R082 3ZMOA 4E9KA 4Q4V1 3AP7A 1HIXA 3BPZA 5EV7A 5BV6A 5LBFA 1GNYA 4BB3A 2BNMA 3OTFA 3SH3A 3AXEA 3WZ1A 2AH2A 4TN7A 1XU2A 3IPVA 4GIQA 1BXHA 3AZZA 4LBQB 2EALA 2XJUA 5AC91 3LSDA 4YZ4A 3ZYFA 4U36A 4UW6A 5C4WC 5IUQA 4AHZA 4Q4Y1 2WDBA 5K0UB 2V5DA 5A7SA 2XL9A 5JVVA 3L9JT 1O6UA 2RJ2A 3S57A 1QH7A 1RUE3 4ONUA 4YLZA 5IVYA 1H1MA 5FZDA 5F37A 5FUNA 2VZSA 4K1YA 5HCFA 4RHV1 3WF2A 2VMDA 1GP6A 3K3OA 5CISA 1O3RA 1UOGA 4QHZA 1HXS3 2ERFA 4CA9A 4M0NA 3W5NA 4D69A 1A34A 4MGKE 1W06A 4IXLA 4PI2A 2K0GA 1E5HA 4M00A 5CFDB 2V4VA 2IUWA 3UJOA 4EWAA 2IVIB 5FXZA 1T6BX 1V6JA 3WNKA 4QX2A 4UFJA 5G04L 4LHNA 2GP5A 1NT0A 3ABZA 4RYDA 3TEWA 3WVJA 4AI1A 2W5FA 5A7WB 5A6QA 3HJRA 2R061 4XMAA 5GLVA 4BHPA 1S4CA 1IOAA 4JV4A 3USUB 4BE3A 5IVEA 1OA2A 1YI9A 3GJBA 3PMEA 4YW4A 2XJRA 1W03A 2Y0IA 1QJZA 1RUI3 2P6HA 2DFBA 3LA3A 3T4HB 3WUCA 4FAGA 3WW1A 3C7GA 4H55A 1PZ8A 1F15A 2XMLA 5K0UC 3MPBA 2ZABA 3AC0A 3QBQA 3AB0A 1EV13 3OBAA 1EV12 2BOIA 3AMPA 3M3OA 3VBOA 1Z0HA 3Q8CA 5FLIA 3H0OA 4NIGA 2FCVA 4Q4Y3 1GKBA 1HXS2 2ET7A 3GGLA 3QH7A 2OW4A 1OKQA 4FPFA 1IHMA 4MZUA 1CJDA 4HANA 3GCWA 3GHNA 3MICA 2AACA 1SLAA 1RIRA 3LEMA 3GF6A 4E4HA 3LQCA 5C3OA 4N9HA 2UY8A 3NJZA 4L92A 4XHXA 4CXWA 2LUWA 3D0JA 1DZRA 4OHVA 4W65A 2YB7A 1VR3A 1PK6A 2D98A 1YC61 3PUHA 3B5LB 4QXKA 4Y4YA 3VHOA 3KV4A 1UZZA 4YW1A 4YGEA 1PNFA 4FOQA 1QQP3 1H8VA 4KWLA 5F6LB 4AAXA 4AEDB 1XJAA 1UW8A 4LBJA 3SCFA 3R4DB 2DUPA 1LHOA 2R063 2W1UA 4KI5M 2RDRA 3PJQA 1KITA 3EHKA 1MVEA 1KRIA 1W2TA 5FZOA 1VBB1 3DYOA 4GA9A 1YQ6A 1SLLA 3KVBA 5HXVA 1IG3A 1RMU3 4G3YC 5D1IA 5HBAA 2YC2A 3J7HA 1OQEA 4UW3A 3VKLA 1H2KA 3OJBA 1DQ1A 1UF2C 1LGCA 2VCMA 2YHJA 1UYZA 5CKQA 4GULA 3DXUA 1JZ7A 2Y8KA 3RS6A 4YVSA 3ZSLA 3LGRA 3HBKA 2HWC1 1XU1A 2W46A 4OUSA 2ZGRA 4XETA 1WMEA 4XOGA 3MFCA 3GJAA 5EJZB 4AZZA 3IKWA 5C8CB 1PM4A 1RUF1 5GM0A 3B01A 3PDQA 4EROA 1QGLA 1GZWB 1FNYA 1IZ3A 4XFCA 1VB4A 3ZYRA 3T2PA 5JUVA 1G9FA 3MGUA 1SPPA 3CO2A 1ENSA 2WQ8A 2ZGNA 2ZCWA 2QCSB 4O9GA 4PI0A 3AVSA 1UMIA 3LIGA 1OVSA 4DINB 2AREA 3C3VA 1H2NA 4CEWC 4CZSA 2H0BA 4K1ZA 2JENA 2HEWF 4P9YA 1OQ1A 4Q4W1 1A3KA 1CAVA 1RJ7A 3OGVA 4MVTA 4CCNA 5B4NA 1C57A 3ZXKA 2JG9A 1LTEA 2X5IA 4LULA 1RXFA 2IZWA 2WZ8A 1ULFA 4NOTA 2WRAA 2ZKLA 1FPN1 1PO12 1WCDJ 2E63A 2HBUA 3DV8A 5DABA 4QQOA 5C6CA 4LBLA 2K2SA 5FZ8A 3SITA 1FI2A 1YXWA 4P08A 4Z2AA 5I8SA 3CQOA 3J7LA 1U5IA 3MF6A 2R043
chains in the Genus database with same CATH topology
1AJOA 1VBA3 2RS51 1HRV2 4KWJA 4KGQA 5I0UA 3GALA 4RQPC 5I0RA 3ZFEC 3DPRC 1QOSA 2D3SA 2YV8A 5CFDC 2TEPA 1QOOA 4WZFA 1MEC1 5JZGB 1VBE3 5BY5A 4Q1RA 5D8AA 2RS31 3D4KA 1KQRA 4CEYC 1NY71 1C1LA 2X29A 1SFNA 2G4IA 4LO7A 2OUHA 5F5QA 4CEWA 3VBFA 5FDBA 2JG8B 3TAYA 1AF9A 4TSVA 1RL3A 4ZU7A 4LA2A 1GV9A 1S0GA 2F6BA 1Y7BA 3ETQA 4XILA 1L3JA 1POV1 2LALA 1AHSA 1VBC2 1LOBA 2XKOA 1O91A 2VECA 1ZZBA 4UW4A 4WV8A 4YM3A 2A6WA 2YGLA 2QQPA 1J3RA 1BCXA 3IPVB 3NSTA 1RUG3 3VN4A 1NLRA 1XE7A 4WM7A 1FOD3 3GHMA 1TME2 3WXPA 1AYM1 1H9PA 4QQ2A 5EYXA 5JSRA 2BFUL 3CJIC 3HR9A 3ZYJB 1JUHA 3AKTA 4KL1A 5BNPA 1HV0A 1TMF3 1WD4A 2HJIA 2OZ6A 5T5OA 4AF9A 4S2HA 4YG6A 2OZJA 1ZZ6A 4OHZA 1V9U1 2DUOA 1UKGA 2B42B 4Q29A 1WMFA 4Q1PA 1QDOA 2BTVC 3N4MA 1ZYBA 2WQZC 4NWWA 2PAKA 3ZFFA 3T2TA 4AI3A 1RUF2 4R4XA 4PBPA 4XFAA 2NMNA 5EWSA 3LOIA 5C9AA 2BVBA 1SFYA 2BEOA 4XJWA 3R0RA 4IEUA 5H9PA 3KMHA 3IN9A 3ZFEA 4LBQD 5J98B 1O3SA 1RVF2 4XBLA 4IV1C 4ZU5A 1AXKA 1T6GC 4AW7A 4DY3A 2QZ3A 2B39A 3AMQA 4AHYA 3DL3A 4FCAA 1YRZA 1AX1A 4YW2A 4FOVA 1H0BA 4CEYA 3TN91 1RUJ1 1TMF1 3WDYA 1VAKA 5A32B 1FMD3 5T5PA 2WC2A 4QQHA 3INAA 5T3NA 5CADA 4AFCA 3ZYIB 2DUQA 3WD5A 5C33A 5J09A 2ZS6B 2JECA 2MEV1 1EYBA 2WS93 4BA6A 1HRV1 4QPIA 4B4RA 1LCLA 3D5OA 4C0BA 1QOTA 1R1A3 1UMZA 4AGRA 3OD4A 1ZREA 4FT8A 1C1FA 1PO11 2PFWA 4N53C 3UKTA 1OI6A 3VHPA 1AYN1 1PO21 4FPYA 5C8WA 4EN8B 1ENRA 1V00A 1WA4A 2D93A 1WD3A 2XBO3 4AHXA 4GWNA 1HX6A 5KC5A 3FX3A 4RL7A 4RS5B 5ACA1 1O4ZA 5CFCC 4FP2A 4IEYA 4YFZA 3TN93 4Y1ZA 4A7YA 3U07A 4YNIA 3S6PA 2VOVA 1OD5A 2WS92 1Q43A 4E2GA 5BNNB 2VOWA 1SLTA 1GBGA 2WIIB 1NE6A 1EAH3 3VKMA 4SBVA 1Q8QA 3AM2A 1V6OA 3NKGA 2EAKA 1DF0A 2NLRA 3H8UA 4LBKA 2BWAA 2DVDA 1AR73 1AYN2 1PO22 2WNVC 4DRVA 5A33A 1ZBE3 2XKPA 3MFAA 1UAIA 1QKQA 1OFSA 1WBFA 4I0BA 4OLLA 3ZYPA 4PLMA 3JQWA 3VZKA 2IFWA 3B02A 4XFGA 4HPKA 3RSJA 1KDKA 1UIKA 1C4RA 1DYPA 2PAEA 3U10A 4FXGB 4JGZC 4KGGA 4IV1B 4KU7A 2Z42A 1VP6A 4DFSA 4EN6B 2R073 4GH4C 3E5QA 3ZX7A 1WCKA 4KH9A 4S2GA 1D4M1 1QNWA 2IXLA 1LODA 5DUXA 3AP9A 5LRRA 1LHWA 1DQ0A 1O3QA 1BJQA 2YZ4A 1R093 2XUMA 1W6NA 3ZIXA 3WG2A 1AL21 3IDBB 2YGMA 3QCWA 5FQ0A 1ALYA 4A2UA 1RUH3 3WDUA 4PLNA 2UYBA 3DPRA 1BYHA 5DG2A 1QMJA 4QQPA 1XNDA 4COUA 3KD4A 1MACA 3MLLA 4XF0A 1XE8A 4YM0A 5CIRA 4TLFA 4ASMB 1X33A 5JCTA 1ZZ8A 5FPZA 1PM7A 3FHIB 1X50A 1RITA 2QE3A 2GH8A 3ZDSA 4G9SB 2UYAA 2QNKA 4JTOA 4COWA 1V6IA 4P14A 5KXEA 4X6QB 5BNOB 2GNBA 1IQAA 4JGZA 2VULA 4Z07A 1ND2B 2DCKA 3PNAA 3UK9A 2VXRA 1COV3 3ZN6B 1D2QA 3E5UA 5C4WA 5JI7A 1QJY3 4WM8B 1ULEA 2DCTA 4XFBA 4IETA 5K8SA 3GZTB 4P9XA 3SCGA 2VQ0A 5JOXA 4I2OA 1N1SA 3GYDA 4QPYA 4IEOA 2WWSA 1RHI2 1DU3D 1BMV1 2P37A 1NCRB 2WNVA 2XL7A 3VBHB 2P3IA 1K5MA 2Z2SB 3VHNA 5L36A 5A32A 2PHRA 2LM3A 4XEZA 4RD7A 4GALA 2QKDA 5T5LA 4RSUA 2PTMA 3RNSA 1TQ5A 5GZGA 1HXS1 3VL9A 1AR63 2C5DA 1DZTA 1AXZA 2XLAA 1MQTB 4CDUC 2BNNA 1BBT1 3VBOB 5T5JA 5F1RA 3IDEA 1RUC2 1LECA 3HT1A 2D6KA 4AHWA 1F5JA 1Q8VA 4NHKA 1BK1A 1F9KA 1KD7A 3GNEA 1IPJA 2A3YA 3WG3A 1WMDA 4I0WB 1TME3 1JBCA 1QH6A 3N7JA 1ZVFA 3POWA 3AXDA 5SV5A 3G6JB 4BM8A 2PAMA 1VAMA 4UBGA 2ZGOA 4FPEA 5BPXA 2RR13 2ZHKA 1WW7A 3OGGA 1MS4A 5E16A 1MZ5A 1N3QA 2E7AA 4PCRA 4HK9A 4YG3A 1CAWB 1UPIA 1WUVA 4LBOA 4AFAA 3TYJA 5KXCA 3CU7A 2W39A 3O5SA 4CEYB 2VH9A 3ZN4A 4K8FA 1FOD2 1CAXB 4L97A 4HETA 5DDJ3 5DDJ2 3ZMNA 1AR83 2FHRA 4QX5A 5JI9A 2H6BA 3PHMA 3ZXAC 2RJLA 1ASJ1 2C0ZA 1SLBA 4FPGA 4PF5A 2HWC2 3OCPA 2HWC3 4LA3A 4PQ9A 1AR92 2HWF2 3M7AA 1W2UA 3LKJA 4Q4X3 3BIWE 4OI1A 3FFZA 1RGSA 2FMDA 2ZMNA 5DUUA 4Y24A 2PLV2 1MS8A 3H1WA 5IK7A 3AKSA 4COYA 3VL8A 1BKZA 1AX0A 2DCYA 4IV3A 2R1BA 4XPVA 3V64A 4LE4A 1CAUB 1SBEA 1ZM1A 3S0MA 1G9AA 2VOXA 3MLJA 3I59B 4RQPA 1B09A 3IMNA 5FMOS 3WP6A 5CFDA 4K6BA 1GNZA 2VQAA 2Q8OA 1LOCA 2DVGA 1LHVA 4DNYA 4UW5A 2VGDA 4WM7C 2HEVF 4AQSA 4P9IA 5AVPA 1Z7S3 1SDWA 1H9WA 4JAAA 4W6XA 5L73A 5J37A 1VIWB 4FAHA 4BLIA 5EXOA 4LUKA 3JU9A 4N53B 4XMIA 5JIUA 1GZWA 4LHKA 3W9AA 4Q4X1 3U4XA 2UWBA 4D94A 4LEJA 1VBE1 4AI0A 5FO7B 4AEMA 1KS5A 3PVOA 3WDXA 5CFCB 4IEQA 4HFSA 1AYM2 1ULGA 3JB8A 4W6WA 4Z82A 4M3CA 4S2DA 4R9CA 2Q30A 1B35B 4FPJA 3BCWA 2XPJA 3DKWA 2X8KA 4QT6A 3SXWA 1OHFA 4EN0A 4LHLA 4Q8KA 3FFQA 5T50A 2NZ9A 3NV4A 4YZ2A 2HWB2 3JBG3 1Z7S1 2E53A 4YVSC 5CA6A 5IK8A 3J9SA 3VZLA 4Q0PA 2ZAAA 1ZBA2 4COZA 1PVXA 1U12A 1O4TA 3V56A 1GQGA 3NL1A 3VBUB 2NQYA 4JCKA 1MZEA 4D3WA 4NWVA 5KWRA 1RUE1 4Y20B 4BLJA 1O5LA 3ZSKA 2GC3A 3DUIA 1K5MC 4CDUB 3N7MA 3T1MA 4RHV3 5JOYA 1Q8PA 2OPKA 1WW6A 1V9U3 2Y26A 4I02A 2RS11 1CQ9A 4K7JA 4I0AA 1IKQA 4DQAA 3BU7A 1QXRA 3E97A 2WFPA 3M2MA 4FPLA 4X8NA 4Q0SA 2ZMLA 1NCQB 2DV9A 3BALA 4P9GA 2CWMA 3GZAA 1XYOA 2GMMA 4XYXA 1OOPB 2G9FA 2OA2A 1SCRA 4KG0A 2BGCA 3IIAA 1YO8A 4MGYE 4MXWA 3WNXA 1H4GA 3ENRA 4KBBA 4YGBA 3ECQA 1J58A 2ZBJA 2WA4A 4NO4A 5GZDA 2DTWA 4M3CE 2XVKA 3KCCA 5AFEA 2O8QA 3H9AA 3M70A 1V6MA 2E7QA 1FPN3 1RUD3 1ULCA 3D6EA 4JGYA 4EJRA 1WW4A 1W6PB 2Q1ZB 1ND2C 1RUC1 4LBQA 3J4UH 3VBRB 2IXIA 1PK6B 4LE3A 1V6LA 4XXAA 3RMXA 5J7MA 4FO9A 3ZSJA 1WBLA 2WNUC 1EPZA 3KSCA 4S2FA 5LK7B 3O0XA 3X29B 3RYPA 3IWZA 2B46X 2BWCA 5CG9A 2WZR3 2WA3A 1EP0A 4RR3B 1A78A 1RMU1 3I59A 4RQPB 5JR7B 4DB5A 1N1YA 1QJX1 4F3JA 1UKRA 1AR91 3MPPG 4GB32 5KHJA 5HCBA 4AVCA 1RUOA 2XVLA 1SACA 1C8NA 1LOFA 1FT9A 3H50A 2HWD2 1C3HA 5DXDA 1APNA 3P3NA 3KGLA 4TWTA 1DQ4A 4YGDA 1VBD1 1ZRFA 4DRRA 2B8MA 3OGJA 1V70A 1LOAA 1ZX5A 4QHBA 2A5ZA 1AZDA 2QDNA 1NCRA 3SCHA 3PLQA 3NO8A 1PK6C 3RWNA 3CL1A 3HWJA 3E5XA 4LO8A 2Z5WA 4HN1A 2IFRA 3JB4C 5I0SA 4Y1XA 3ILFA 3T1LA 2YROA 1LHNA 3BOWA 3M3QA 1AR71 1GNHA 2WT2A 4B3NA 3FJSA 3VBHC 2WNEA 4E4ZA 5JDBA 4XZPA 2FMYA 2VMGA 4JGZB 3N7KA 1DQ6A 5C9AC 3I4IA 4YZ3A 1NXD1 4YSFA 5H9RA 5CG8A 5GZEA 2WLQA 3LAGA 4DY5A 5LEJA 1W6QA 5JWPA 1TEIA 3PVEA 3AZYA 3FUOA 2ZA9A 4E2SA 1YYNA 1NLSA 1VBA1 5FOBB 4C0HA 4GXLA 4DOUA 3PTYA 1HQNA 3AKPA 2CYFA 2Q4SA 1ND3C 1ASJ2 1FNZA 1AVBA 4LO6B 4OHXA 3PVBB 1MZ6A 1G7YA 3WR0A 1UU6A 4HK8A 3HD8B 1WLCA 3VZMA 3JD72 1UN1A 1XYNA 3SH5A 1H8TA 1Y9QA 2EXJA 4AVVA 3M8LA 4K21A 1HQWA 2V09A 2VMHA 5AC92 3RJ2X 1AX2A 4Z2WA 1LGBA 2R062 3WCSA 3WUDA 1VBC1 1RC6A 2PELA 1SLIA 4L99A 1YFYA 4H3WA 4LO4B 2VW2A 2PHWA 4XQDA 1IS4A 4Q27A 4OI4A 4DXZA 4K20A 4HLTA 4J1WA 4Y1UA 3O7OA 1B35A 1C8M1 1REEA 3J8F1 3VBRC 2XBO2 4L11A 1RHI1 3OF1A 1JXNA 4WZCA 4QPGC 2VUJA 2RHPA 2D7FA 3NV3A 1WLWA 1UU5A 3SH4A 3OY8B 1M4WA 5E1RA 4Y1VA 2KXLA 2VPVA 3B94A 4BIFA 1HLCA 2R072 3RDIA 1EAH2 1GYKA 4WBBA 3RRDA 4HKLA 3AJZA 2OYZA 5J3UA 1GQHA 4IEXA 4H14A 4RA0A 3RI8A 1YUDA 2PHFA 3I54A 4PIYA 4J6GA 2E6VA 4XQ4A 3ZN6A 2EF6A 2OUJA 1U0AA 3MW3A 3AX4A 2XG3A 5L7OC 1N3OA 5AFBA 3ROUA 4N7IA 5I0TA 1Y43B 5FO9B 4ZKTB 5AVAA 5BUVA 1IGOA 2YY1A 2R0HA 2TNFA 1QJU3 4XJ9A 3SNMA 3B9IA 3O0WA 4PJYA 4ES8A 1YJLA 5JOWA 3LZZA 3TN92 4TYSA 3APBA 2UY9A 2GC1A 1QWRA 3FZ3A 3RMYA 2ILMA 4HMZA 3RYRA 4M01A 4IESA 3WDWA 1REFA 4WVVA 2JXAA 1KXGA 1MS1A 3FE5A 2WS91 2BFUS 3ILNA 4XF4A 2OVUA 1WLTA 4X8PA 2R49A 1PGL2 4BMEA 3VDDA 2VVEA 3NVCA 4Q4V3 1HQLA 1R1A2 3ATGA 4FSJA 3MW2A 2IXJA 1R083 1XXNA 1YI7A 1DFQA 5HCAA 1TMF2 4AVTA 1RUI1 4ATEA 1JN2P 3AYCA 2R32A 3VBRA 4W6YA 5C8CC 4FBFA 4JGYB 2V5YA 4HKWA 1H1AA 4R4ZA 4U2AA 3LOBA 5GLUA 2RM23 1DDLA 1NOVA 4GKXA 1CONA 1COV2 3MF9A 2WFF2 4AEKA 3THPA 2F4PA 1LENA 4Q0UA 3AYAA 1W6MB 2VMIA 1BEV3 3AMHA 5J96B 3KQRA 4Z1VA 5DUWA 4OUMA 2PQQA 1QXJA 1QY4A 1S0IA 1UZYA 1RUD2 3VDDC 1VBE2 2RJKA 1ZRDA 2H0VA 1OLQA 3H7YA 3JCIA 3DPRB 4GKYA 3WQ0A 3KB5A 3NKTA 2DFCA 3VBFB 3FMGA 4C90A 4FXKB 2GALA 1LESA 4RHV2 4META 1HKDA 4CP2A 4DZGA 2RR11 2JJ6A 3RJRA 4TZDA 2CGPA 1VBD2 1NYWA 1EY2A 2R16A 5K9YA 1Q56A 4FPCA 3V0AA 4XJAA 1CESA 3QH6A 4ZXKA 1A8DA 5CB7A 1ZBA3 3MI8A 3V0BA 1G8WA 2AENA 3OY8A 4OVEA 2YUEA 1W6OB 5B2GB 1DYKA 2VW1A 3EXUA 4AEDA 4JC1A 3H1YA 4HPKB 4XE9A 1X8EA 4XTPA 5FRAA 3V0AB 1VBB3 2MNGA 3GZUC 4A3XA 1VRH1 3ZO0B 1VRH2 2YXSA 5FO8B 3VZOA 1XRUA 4LBMA 2XWJB 4Z92B 2HWE1 1AR62 3ZFEB 2CTVA 4WM8A 4CYDA 1Q8SA 2P34A 3I7DA 4QGMA 1G6NA 2ZHNA 4XJ8A 1O7FA 2RS52 1BQPA 3IT8A 4JQRA 2C1FA 4XBQA 2WQ4A 4BPZA 2I2SA 2RS12 1A6CA 4YGCA 4FTSA 3O12A 4ITCA 2K9ZA 2R30A 4RFT0 3JBG1 1SBFA 4MXVA 1B35C 3H1MA 4Y22A 4N7UA 4LT5A 4FVVA 3CEWA 3MIDA 5FTTC 4EV0A 2DF7A 3FLTA 1OOPC 5FFOC 3TB0A 1ZNPA 4BCUA 3MIBA 2D6MA 3U11A 5H9SA 3ZXGA 4JTNA 4N43B 1JHNA 1XQNA 1X36A 3NW4A 5FQ0B 2NPIA 1W6NB 4BIOA 2VY0A 3B7MA 4Q2FA 4YVWC 2PHLA 4Q0QA 4QPIB 4YM2A 2HWB1 3DN7A 3AKQA 2RS13 4QU2A 1FV2A 5J48A 2Z79A 4NVPA 5K0UA 1BBT3 2ZGKA 2ZX1A 1LHUA 4V1PA 2DVBA 4K3UA 3MZHA 2ZX2A 1PZ9A 1PVC2 1MEC2 2DVFA 2GN7A 4OZXA 3PJYA 1WGPA 3EQEA 4UBHA 2DVAA 4CRQA 1LOGA 1VBB2 1PHMA 1RUH2 1F8VA 1IS6A 2TBVA 1DHKB 2ES3A 2XJSA 4M0HA 1NG0A 1Y3TA 2ZPXA 1FXZA 3MIHA 1XYPA 3HMYA 3ZYGA 4GMP3 3ZXFA 2X5IC 1GR3A 5DG1A 1O3TA 2DWRA 3MEPA 5GLTA 3H3UA 2JG8C 2H6CA 2BPA2 5DZEA 3WLUA 2N7GA 4EN9B 4INDA 2ET1A 2A70A 1DGRA 4N43C 4XFFA 5FBZA 3USSA 2GH2A 3SMHA 2XHKA 2P17A 3ME2A 2PYTA 2R0FA 4QMAA 3UV9A 1NE4A 4BOWA 2O1QA 2NM1A 5KHGA 2WZR1 1NCRC 1O4YA 3EBRA 2RR12 3WHTA 1RUJ3 1RINA 2CAUA 5FREA 2XJQA 1POV0 5K7PA 1V6KA 4HVRA 4XDQA 4CDWA 1S0EA 1S0DA 1S2BA 3B00A 2QJVA 2MHFA 5L7OB 1W6PA 3NWKA 5FLJA 4XTMA 1DGRN 4OFGA 1UL9A 1KJLA 2PN5A 1O5UA 4LBNA 3HIFA 3ZXDA 4B4QA 4IEVA 2JE9A 4CEWB 1MQTA 3VGIA 1AJKA 2DCJA 1LRHA 1Q3EA 1AYN3 1PO23 2QZ2A 1AUYA 1CPNA 2ZGTA 2D3RA 5TSWA 4MGZE 3HT2A 1HRI3 4XQWA 1D4VB 3CF6E 4NR1A 3CJIA 1BZWA 1VBA2 5BNPC 2QDRA 3ALQA 1MVQA 1MZFA 2WNVB 3W58A 3AYDA 4BH9A 4P9JA 3TNPB 1H8TC 1ND3B 2ZAHA 1NY72 1D4M2 2ZX4A 4I09A 1F2NA 1HRI2 1D2SA 3ZPYA 1PGW2 1IS3A 4AFDA 2EA7A 1PIV2 4PLOA 2ZX3A 4C1XA 4JGYC 2JG9B 3M3CA 4H7LA 3C2UA 1GANA 4C1WA 5FOJB 1QJY2 1ZZ9A 3ES4A 1G9CA 2WZPP 1RVF3 1F5FA 1I5ZA 2XBO1 4MX3A 3WDTA 5JSPA 3OBRA 5H9QA 2RMU2 1QNYA 1S0CA 4IL7A 4CDXC 1LOEA 1FMD2 1RUF3 3TRSB 4COVA 4ORFA 4R8HA 3WP3A 1LJ7A 1OFNA 2Q0AA 1NXMA 1QXPA 2YMZA 1GZCA 2VU9A 2ARXA 2NMOA 4XFIA 1EAH1 2HYKA 1LOFC 3AMMA 4NHMA 4YFWA 3BTAA 3WX5A 4AWDA 1RB8G 2ZOEB 3WP4A 3G7DA 2ZGPA 3ZFGB 3B93A 1IKPA 2HWE2 2GN3A 4MLOA 4AEJA 3QACA 4OHYA 2ZGUA 4HVOA 2VNRA 3JD71 2E7TA 5LK5A 2D6OX 1A8MA 2AR6A 2WSUA 1CIWA 5JZGA 1AR93 3KZ4C 4N53A 2WT1A 3VBSB 1LU2A 1NCQA 4B29A 4LNVA 4FPHA 4Q26A 3RI9A 4XFHA 3IDCB 1LR5A 1ZZCA 2AYHA 2Y38A 2WFF3 1MEC3 2A7AA 3I2DA 4LLFA 1ZBE2 5JSOA 2X5IB 3D0SA 3UJQA 2EXHA 1UU4A 1LKNA 2PHXA 1ZRCA 5KHIA 1VJ2A 3M3IA 1ND3A 4QPIC