1QXRA

Crystal structure of phosphoglucose isomerase from pyrococcus furiosus in complex with 5-phosphoarabinonate
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
187
structure length
187
Chain Sequence
MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for a hydride transfer mechanism of catalysis in phosphoglucose isomerase from Pyrococcus furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase
molecule keywords Glucose-6-phosphate isomerase
total genus 41
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature ec 5.3.1.9: Glucose-6-phosphate isomerase.
pdb deposition date 2003-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06560 GPI Glucose-6-phosphate isomerase (GPI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qxrA00
3HIFA 5FLJA 4TLFA 4XFBA 1X8MA 4AQ2A 3R6SA 2GC0A 3MPBA 4PIYA 4X6RB 3WW2A 3KGZA 3SMHA 1WLTA 3E5UA 4Q29A 3KCCA 2N7GA 1LR5A 4K8FA 1DZRA 3E5XA 1QWRA 4IESA 4JVAA 4QGLA 4MX3A 2Z2SB 3NL1A 1QXRA 1OD5A 2EVXA 4Q0SA 1UIJA 1WGPA 4P9GA 4MGZE 3H50A 4I01A 3GBFA 4QGNA 4XF4A 2C0ZA 4XFGA 1XRUA 2PAKA 4OFGA 3C3VA 4HBNA 4HLTA 1J3PA 1JUHA 4WZCA 5JAXA 1O3TA 2K9ZA 2PHDA 5FLIA 2IXJA 2FMYA 4META 1GQHA 2Q30A 2Y0OA 2XL7A 1Y9QA 4IETA 3SXWA 3H3ZA 5I0SA 3OTFA 2Z69A 4L11A 1J1LA 4YRDA 5BV6A 2ET7A 5KHKA 4ZU5A 3ZDSA 1ZNPA 4X6QB 2Q0AA 2CGPA 2HKXA 4XFFA 1EPZA 1NE6A 2V09A 2D93A 2XKPA 4MZUA 2IXKA 1X8EA 3CEWA 3WW1A 3LOIA 4EWDA 3H7JA 3FE5A 1QXJA 3NVCA 1CAUB 4A2UA 2PAEA 1YFXA 4YNIA 2OZ6A 3IDBB 1HW5A 4AVAA 5C6CA 4HVOA 4ZU4A 4IEQA 4R8HA 4BYYA 5EFUA 2BNMA 5FDBA 3JZVA 4LA2A 3LA3A 4E2SA 5FPZA 1CAXA 4O9EA 4D7SA 2ZCWA 4IEVA 4I0AA 3TNQA 4XF9A 1OMIA 1U12A 5BPXA 1O7FA 3MYXA 4XF1A 5CADA 4QM8A 3S7EA 4IEOA 1PMIA 2CAUA 2OA2A 5BUVA 3E6CC 1IPJA 5FQ0B 2GZWA 3BPZA 4Q0VA 2UY8A 2E9QA 3ES1A 1YWKA 4I3PA 1ZRDA 5CU1A 2QCSB 3RPQA 4YSFA 1ZZBA 2VPVA 3TNPB 4I2OA 3LAGA 5JCTA 4Q0PA 5FQ0A 1UW8A 5E16A 5JR7B 4Q0QA 5HI0A 2EAAA 4BHPA 2H6BA 1NE4A 3H8UA 4NVPA 2I45A 3D0SA 4XFHA 5I0TA 3IWZA 3H1MA 4OLLA 2BNOA 4E2GA 4FAGA 4MH0E 2QVSB 2O1QA 1ZRCA 1FI2A 4LUMA 4XFIA 1ZZ6A 2WFPA 3ST7A 3IDCB 2BEOA 4IEZA 3RDIA 2F4PA 2UYBA 3PLQA 2H6CA 5D1IA 4F7ZA 1IPKA 2XLFA 1VR3A 4BIFA 3VHRA 2VECA 3SCFA 4HMZA 4XFAA 1J58A 2K0GA 2EA7A 3FWEA 2H0VA 2PHLA 4UBGA 2XKOA 1TQ5A 4JV4A 5T3NA 2D5FA 5LEJA 4HSJA 2IXLA 3FZ3A 1EP0A 3WW4A 3MDPA 1YHFA 5KHGA 4I09A 4QGMA 3CJXA 3RYKA 4I0BA 1O3RA 4HZFA 4KWLA 3LA2A 4I02A 4H7LA 4ZU7A 3U0ZA 2QNKA 3MZHA 3RNSA 1UPIA 1ZRFA 3NSTA 1ZREA 1L3JA 2D40A 1NXMA 5JSPA 4XFCA 2XHKA 3D0JA 1CAVA 3L2HA 4YYOA 2MPFA 4J1XA 3H3UA 4XF3A 2Q4SA 3RYRA 4BH9A 5BY5A 5J3UA 2PQQA 1SQ4A 4MV2A 4EV0A 1O3QA 3M70A 4AVCA 1UIKA 2PFWA 4GULA 3IBMA 3USSA 4LULA 4QXKA 4KWJA 1GQGA 3M3IA 3SCGA 2XLGA 1SEFA 3O14A 2B8MA 2IXCA 2IC1A 3IIAA 1CAWA 4IERA 1UCXA 4LTAA 2OZJA 4HN1A 4AVBA 4IEUA 2VQAA 3N4MA 3HT1A 1O5UA 3BCWA 1H1MA 4HSLA 3FX3A 3H1WA 4PJYA 3HQXA 4PIXA 4LA3A 3LWCA 4IEPA 3FHIB 1YFWA 3U11A 5KHJA 1RL3A 1DZTA 4AQ6A 4LUKA 1I6XA 4AXOA 3DKWA 1RC6A 4MGIE 4O9GA 3OD0A 1WA4A 3PNAA 1ZZ8A 1CX4A 2HJIA 4WVZA 5F1RA 3H7YA 3NW4A 2FQPA 4FAHA 1Q43A 2MHFA 1J59A 1UD1A 3UKNA 2GAUA 5LEKA 5I8YA 5KHHA 3LA7A 1ZZCA 4KL1A 1OFNA 1X7NA 5J48A 2Q1ZB 3UKVA 5I8SA 3RZZA 3B02A 3LZZA 3ROUA 1QY4A 1DGRA 4KU8A 2GH2A 4CYDA 3CLPA 1X82A 3ETQA 4XETA 4IEWA 1O3SA 2BNNA 1PM7A 1YFUA 5FPXA 3EBRA 3DL3A 2BGCA 4E2QA 3KMHA 4EWEA 3ACLA 3D82A 3S7IA 3OCPA 3NKTA 4FBFA 2WC2A 5KBFA 1ZX5A 1RUNA 1LB2A 3ES4A 4XEZA 4UBHA 5JSOA 1CAUA 4ONUA 1CGPA 5I91A 4MGYE 2QDRA 1RUOA 3E97A 5JSRA 2CV6A 1DGWA 4RD7A 2B5HA 1OI6A 5FLHA 3DV8A 1ZZ7A 1H1IA 2CAVA 3E5QA 2QJVA 2B9UA 1I5ZA 1LRHA 3G7DA 5EZWA 1Y3TA 5BXXA 4N9IA 3SHRA 5I8TA 1RTVA 4J1WA 1ZVFA 3DN7A 4QMAA 1CAXB 3U10A 1O5LA 3HT2A 4IEXA 4LLOA 4HN0A 1VJ2A 4WBBA 3S0MA 4KWKA 3PVBB 1FXZA 4MUVA 1G6NA 3E6DA 4EROA 4JTOA 5E1RA 4Z82A 2ETEA 1O4TA 2GU9A 2ATFA 2D5HA 2OYZA 2UY9A 3I7DA 3EQEA 4MGKE 3BALA 2PAMA 3E6BA 3I54A 3ELNA 3WW3A 2GC3A 5KHIA 4UXAA 1NZCA 1YLLA 4N9HA 4QM9A 1YFYA 2XLAA 5LRRA 1NYWA 2DCTA 2ZKLA 5AVPA 4KU7A 4IEYA 1EY2A 1Q5OA 3H9AA 2PTMA 3SCHA 2O8QA 5J7MA 3QACA 4XF0A 4JTNA 3RYPA 2IXIA 3OF1A 3BU7A 4Z07A 4B29A 3OGJA 1XE8A 2BYVE 3QOPA 4FT8A 3CF6E 1RGSA 1EYBA 4HVQA 1J3RA 2UYAA 4PIZA 5C8WA 5CVRA 1CAVB 1FT9A 3GYDA 4ORFA 5K8SA 4Q0UA 1LKNA 3KGLA 4LEJA 4F8AA 3EO6A 2OPKA 4YARA 3FFQA 2GC1A 1SFNA 2P17A 1VP6A 3CL1A 3FJSA 2KXLA 3EJKA 5FCCA 3EHKA 2IXHA 5I0RA 5I93A 2MNGA 2PA7A 4EWAA 4L2NA 3NJZA 3KSCA 3I59B 5LRSA 4QX5A 1XE7A 1YUDA 3BB6A 4DINB 2GC2A 4HVRA 2XGXA 3UKTA 1CAWB 1ZRRA 1Q3EA 1ZZ9A 4R52A 2ET1A 3CO2A 5I0UA 1V70A 3H1YA 2XL9A 4D7TA 1J3QA 2PYTA 3I59A
chains in the Genus database with same CATH superfamily
1F9KA 4NE9A 1VAMA 4OHZA 5A1FA 5FZLA 5JDBA 3MIGA 3LDKA 5FPLA 5EQUA 1V9U1 3IIIA 1W6MA 4PIYA 1VLNA 2AZ5A 4AW7A 3KGZA 4AFMA 2DBIA 4KGGA 5EWSA 4BWOA 3H8XA 3S5AA 1XJAA 5C7GA 1LR5A 4JGZC 1QWRA 2AEYA 2Z2SB 4B7EA 3K4AA 3OUIA 4Y20A 1RUI1 2RV9A 2EVXA 4Q0SA 2IFRA 2R071 1R1ZA 3O0XA 5SV5A 2W94A 4QGNA 3IAQA 3B00A 1OA4A 2CHHA 4JAAA 3VBSA 4EZ4A 1CJPA 4QPGC 5A7WA 2PAKA 1DG6A 3P3PA 1RYYA 4YVWC 1ODMA 3JCIA 1HQNA 4HLTA 1O3TA 1QJU3 2YMZA 1RUF3 4D6SA 2JE7A 2K9ZA 3M8LA 5IAVA 3VZMA 1FPN1 5A32A 4XBQA 5IVCA 3PMSA 2DURA 4EZHA 5CKNA 2IXJA 2ZGRA 5CFCA 4FPCA 2QQNA 2VOKA 4BQ1A 2J1UA 1JZ2A 3B93A 5A3WA 1AR93 4HK8A 4XJWA 2XJRA 5CKQA 5I0SA 2D3RA 4P02B 4E27A 2J7MA 3A22A 2J22A 4L11A 4YRDA 2WT2A 1ZNPA 3D6EA 1G9CA 2Q0AA 1SACA 2PXJA 4Q5OA 3K77A 2FDJA 4Z92B 4UAPA 2CGPA 3NNMA 4XYXA 2EIGA 2LTNA 1NE6A 2D93A 3VBRB 5DZFA 5JVVA 1X8EA 4QX7A 5BNOB 2XUMA 4JRAA 4LNVA 4YZ2A 1G8WA 1QXJA 1W8HA 4JCKA 4R4ZA 3RZJA 1EAH3 2PAEA 1GANA 1DQ2A 1VRH1 2BGOA 3V0BB 3U4XA 2GMPA 4JQTA 1VBA3 1YQ8A 5EYXA 1FMD1 3WLUA 1K5JA 4LT5A 2F4LA 5DDJ1 5BYNA 1UMHA 1WMXA 3IDAA 4P14A 4QDQA 1XYPA 1QQP3 2VOVA 2W92A 3GDBA 3A0NA 4LE3A 3MEPA 1ND3A 4ARXA 1SBEA 2ZGMA 3BU0A 1QJU2 5IK5A 2I07B 4AI1A 4OYUA 4BQWA 4BPZA 2VNGA 3JZVA 4MXWB 1O8SA 3O1PA 1HQLA 4E2SA 3AXDA 5FPZA 1GP6A 2MEV1 2B7YA 1CAXA 4YVSB 4AAPA 1C57A 2VXRA 1GUIA 2ZCWA 4D7SA 2WQZC 4R9CA 2HBTA 3ACGA 5FMOL 5IJRA 4B4QA 3AMNA 4XF9A 1WCQA 4OI1A 4CP1A 4NN0A 1ENXA 4NIGA 5F7UA 3M3QA 4QM8A 5LY2A 2P2KA 1V6NA 3HVDA 5AFBA 1RUD2 1VMHA 4LK7A 5BNOA 1AR82 5FPBA 3WHTA 5BUVA 4RQPB 1R64A 2HYXA 1LECA 1O8PA 1XQNA 4YM2A 2DCKA 2WNOA 4QPIA 1H8VA 2A6YA 1B35C 3O0WA 3VBHB 3MO4A 1ZRDA 2DU0A 1FPN3 4YSFA 1AR91 2JDAA 4YWAA 2V5YA 2WNVC 1LENA 1BK0A 2VCAA 4CCJA 3BIWE 4LBKA 4S2HA 4MSVA 4FOQA 3SH3A 3WP3A 4RFT0 2EXIA 5TSWA 1ZA7A 4CDXB 2IUWA 3ZXLA 1F4HA 4YZ4A 3WNKA 3HJRA 3OGVA 4UF0B 2C6SA 1ND2B 1IG0A 3TN92 3KHBA 2HWE3 5FFOC 4GH4C 3ZSLA 3A7QA 1GZ9A 2R073 1Y9GA 1AHSA 1N1SA 4XE9A 3RZHA 3H8UA 4HFSA 1TNRA 4Y4RA 2BQPA 3JQWA 4GAZA 4XFHA 3WF3A 4CDQC 3AL5A 1GWKA 5FXVA 1RUI3 1KQRA 4NIDA 2BNOA 1OOPB 1AJOA 2JD9A 5GLVA 3SEPA 4E2GA 5IVJA 4D6RA 1O4ZA 2R1DA 2YG0A 4NIIA 1ZRCA 5AC91 1CQ9A 3V0AA 5EIYB 1W9TA 3WD5A 2RS31 4ZS3A 4FP3A 2WO3A 5C4WB 4OI0A 1MEC1 1C8M3 1KS5A 2RMU3 2VW0A 3FFZA 4FXKB 2F4PA 2ENRA 4NROA 1W8UA 1FAYA 4LBLA 1MEC3 1CJDA 3IZOA 3VB9A 3CZUA 2WZR1 3AZXA 5IUQA 3AXEA 3IMNA 4UFJA 3AP6A 4QX3A 5T54A 3CNAA 3MIEA 1UL9A 4PLOA 5FY0A 4FTSA 2DUOA 3PUIA 4WM7B 4OHWA 3ZFEC 4AHYA 1KS4A 2W95A 2K0GA 1GICA 3PVEA 2WWJA 1NY72 2PHLA 2ZPXA 2C1FA 1ASJ3 1UYZA 5A70A 5C8CA 3RRDA 2X5IC 4CCCA 4QXHA 2VMGA 2YV8A 4DO0A 2HWF1 2VCBA 1TQ5A 1YJKA 4JV4A 2VQ0A 3AP5A 4AEKA 1RUH2 1W6OB 2GNTA 3MDPA 1AL21 2YBSA 4ATFA 1MS8A 2WNUB 2B4KA 4TLGA 2DVFA 5KWRA 3A0KA 4Q27A 5DXDA 3RYKA 1HJGA 3POWA 5DPNA 1PO21 5A3MA 3O1OA 1CWPA 3WT3A 4HZFA 4KWLA 1DIWA 5GJ6A 5K7PA 1QJEA 3B69A 3K4ZA 5HV0A 3VDBA 2HEWF 2R0FA 4H7LA 3POFA 2QNKA 1QJX3 3TN93 2VC9A 2P3YA 2R1BA 1AVBA 2WQ8A 4P9IA 3RNSA 1UKGA 2GDFA 4W6WA 3ZIWA 5LWBA 1JZ6A 1OFSA 1ZRFA 4XILA 3WW4A 2D40A 4IL7A 5FY9A 5JSPA 1PGW2 1SPPB 2EALA 3AP9A 3UT0A 3LCPA 3WQ0A 1DYKA 1UZVA 4XPVA 3L2HA 2NYYA 2JB4A 2MPFA 3WG4A 2DCJA 3MLLA 4BISA 3DPRA 1GNYA 2VUCA 2W68A 3RYRA 3WHUA 3ZDVA 3AYEA 5J3UA 4LHSA 1RUE2 1GNHA 5GKAC 2PQQA 3POJA 2B46X 1LOGA 4Q1RA 3WR0A 4HXCA 4EV0A 4CDUA 1UU6A 1W2NA 3U78A 4AG4A 4MO3M 1W8WA 2ZHNA 4E4ZA 2PFWA 2BFUS 1CZVA 3USSA 1JHJA 1LNSA 2JECA 3FL7A 4TXWA 2JKXA 1AL23 1LU1A 2A73B 3BODA 3EB7A 1SEFA 1RUG2 4G9SB 3PUSA 3ZN5A 3ZX7A 3ZLIA 5A33B 2HWE2 1Q56A 2P6CA 4ATEA 4URAA 4D69A 2VQUA 4IQPA 2XH6A 2OZJA 4HN1A 3O1VA 3BCWA 1Q8SA 2JDMA 4QKDA 3ILFA 1LHVA 2JX9A 4LO4B 1DLCA 5C8CC 4HSLA 4FSJA 3D4KA 3H1WA 1JYTA 3POGA 4LA3A 3LWCA 4FFFA 4NAOA 4AHWA 4Z2WA 1OLMA 4FTEA 4GJZA 4AQ6A 2EIBA 5DAQA 1W2AX 1LHUA 2ZXQA 4ES9A 2P3KA 1NX9A 5JIAA 1O91A 1NLSA 4YVSC 1VBE2 3AKRA 2HWD3 2XONA 1R091 3WNOA 2QQPA 1CX4A 5F1RA 4HK9A 1YIFA 4WVZA 4NOTA 2FQPA 3ORJA 2GN3A 2MHFA 2RG4A 5CFCC 1JYCA 2RM23 4H14A 3W9AA 3WCSA 3VKOA 4LHLA 1RUE3 1AR73 3OUHA 4JGYA 1GWLA 1PM4A 4ASKA 4IE0A 3M2MA 1SBFA 5A7WB 3ZYPA 1ZZCA 1QOSA 1W39A 1GOFA 2ZMKA 5A32B 2Q1ZB 1NZIA 3RZZA 4Y5TA 3I2DA 4Y1VA 2JE9A 1GP4A 4AVTA 2AREA 1JZ5A 3VBHC 5AFEA 1DGRA 4H7MA 4KNCA 5BNNB 5LY1A 2J1EA 3B3QE 3LOBA 4RA0A 3C7GA 3CLPA 3B94A 3TRSB 3VDDC 3SC7X 4IEWA 5FYMA 3HNBM 2W87A 1LULA 1NUKA 4UFLA 3RS6A 4BQ3A 4H55A 1S2KA 4QKBA 2NLRA 1R1A1 1J84A 1VBC2 3EBRA 4E2QA 3HR9A 4DQAA 5C9AA 4XUTA 1ZBE1 2G9ZA 4YW2A 1AR62 2BOIA 2Q1FA 2WNVA 3T2OA 4ZONA 5C3QA 4MYEA 3ENRA 2R30A 3NKTA 4P9JA 4PDWA 5F2WA 4FBFA 5KBFA 1IS3A 1Z7S3 1HN1A 4RR3C 1LB2A 4ES8A 2YYOA 2RJ2A 4ONUA 4HANA 3NJVA 5F5QA 1ZM1A 5I91A 3BGAA 3AYDA 1CGPA 2BV4A 2OT7A 5LCWL 1MVEA 1RUOA 5GZDA 1K5MB 5JSRA 4RHV2 2CV6A 4RD7A 3RI8A 1OHFA 1MZ5A 4BMBA 1ZYBA 3B5LB 5FLHA 1OA2A 1RUJ2 4GXLA 2CAVA 2WA4A 5IVFA 3U07A 3E5QA 1NG0A 3JB8A 5IK4A 2BVVA 2B9UA 1I5ZA 2VAUA 5BXXA 2VUAA 4LBNA 5C3OA 3LSDA 3WUDA 5G04L 4LBQD 1WMDA 5FREA 5F39A 1NOVA 3DGTA 2CWSA 4J1WA 1E57A 4TWTA 3NRUA 5GALA 4QMAA 2VGDA 1CAXB 2WO7A 4IXLA 5LA9A 4H2AA 3T2PA 3U10A 4IEXA 3W5NA 3WP5A 1S0CA 1N1YA 2OUHA 1UOFA 1YQ5A 4XAEA 3S0MA 1MEC2 3TOJA 3OD4A 1XYOA 2ZGNA 5LA2A 3BOPA 3WNLA 3WF4A 1UX7A 3GXUA 4EROA 4JTOA 4Z82A 3ASIA 1OUXA 1O59A 3INAA 2YY1A 3RJ2X 2Z42A 1JODA 2D5HA 2O0OA 3GNEA 3GZEA 2UY9A 3HEIA 2WS93 3I7DA 2X53S 4DXTA 2VE1A 2HEVF 4RQPA 5JI9A 3BKZA 4NAMA 4CCMA 3BALA 2WYFA 3AKPA 2HWC1 1FX5A 2GC3A 4A7YA 1YLLA 4QM9A 4CPBA 1NCRA 1AR83 3ZYGA 1H8TB 1QOOA 3J8F2 4NPRA 4OUMA 1VMFA 2RHPA 3VBHA 3ZMNA 1ULGA 4WM8B 1R081 1RHI2 2E31A 3J26N 1PO22 4Y3OA 1OLQA 1OUSA 5CKMA 3H9AA 2PTMA 4W50A 4Y22B 5T5LA 4DUVA 5J7MA 1GU3A 4QU1A 4YG3A 1BBT1 5LBBA 1PVC1 3PU8A 3BTXA 4CSWA 2A6ZA 3GCXA 2G9FA 2JEMA 3BOWA 4Q4Y1 5FR3A 3PDQA 1UMIA 4XXPA 3OF1A 4UF0A 5E88A 4CU8A 3BU7A 4ET7A 3GBWA 2BYVE 3RSJA 1WCUA 4RHV3 5FXWA 4FT8A 1PK6B 3NNFA 2JG9C 2D97A 1ST8A 1RGSA 2VCCA 1HB3A 1W8FA 2I74A 5FO9B 1OT5A 2PLV1 1QJZA 3VZJA 1JYXA 3NAPB 1SFYA 2VMCA 3AVSA 1JHNA 2WO1A 4XIOA 4CA9A 3RWKX 2A6XA 3EO6A 4UFMA 3RZMA 2OPKA 1ASJ1 3N7JA 3V0AB 1U5ZA 3ETPA 4OI4A 3CL1A 1UN1A 2QFEA 3WQ7A 5FCCA 3U1XA 3LDRA 3EHKA 4AQSA 5GLUA 2YDEA 3VD7A 3ACFA 5I93A 4EWAA 3P3NA 4L99A 3NJZA 3VBOA 1JYIA 1F35A 5HXVA 3AX4A 5IT6A 1XE7A 4W8JA 3AMQA 2WZPP 2R061 1KFXL 1UAIA 4IE6A 2JJ6A 3UKTA 3SLIA 4BE3A 4V2WA 1W6MB 2JG8A 4QWNA 4ISRA 4QB1A 1Q3EA 1OA3A 3R4DB 4A6SA 2DVAA 4GWJA 1I3HA 4PBOA 1F31A 4QQPA 4XVHA 2Q8OA 2ET1A 4DS0A 2ORZA 1VB4A 2X5IA 4AFCA 3H1YA 1H0BA 2XL9A 1ND3C 2K2SA 2UU8A 2ZOEB 3I59A 5FZHA 2OVUA 5C8CB 4DXSA 4Q4X2 2TEPA 1VE0A 1DQ5A 2ADEA 4QT6A 4TLFA 4XFBA 2DTWA 2BFUL 5ISLA 3M7AA 4AQ2A 2GC0A 4AVSA 2AEZA 3MPBA 3VBSB 3JUUA 5A1AA 3WW2A 3TEWA 2XWBB 3B7MA 1PVXA 2HWB3 1WLTA 2XVKA 2PHXA 4UT5A 2D6KA 2N7GA 3UGHA 4QGLA 4MX3A 4YW7A 2IFWA 1OH4A 1IG3A 5CFCB 3H50A 1MZFA 4QB2A 2VBDA 4BIOA 4I01A 2WFF2 4XF4A 1W2UA 2C0ZA 2RS52 4XFGA 2A5ZA 2Y6GA 2QQUA 2P6HA 5CZKA 5EJ1B 3V56A 5KXEA 3D5OA 3AYAA 4OFGA 3C3VA 1REFA 3CJIA 1MS9A 4WZCA 3KVAA 1WD4A 5J96B 1KD7A 2PHDA 2ZHMA 3PHMA 1AR81 3I4IA 1U5XA 3GJBA 1QJFA 1PO13 1Q8QA 2WIIB 2A70A 3K51A 3RZKA 1VPHA 2NQYA 3AMHA 4AHXA 5LA0A 1C8NA 1EV11 5BNNC 3GJAA 3MIBA 5FV3A 2Z5WA 3USUB 1MS1A 1DU3D 4COVA 4B1MA 1GMMA 1HXS2 1W04A 2DF7A 3PJYA 4KH9A 2C4XA 1A3KA 1PVC3 3OTFA 3ZKUA 5L7OC 3N9PA 1ULOA 3ACHA 4FPFA 2VG9A 1UYYA 3FC0A 1S1AA 5SV8A 4FXGB 5IATA 4RL7A 2W08A 3VBUC 2HKXA 4IDZA 5D21A 3T4HB 4DEVA 2V09A 2XKPA 1AR72 1KXGA 4ZS2A 3WW1A 3CEWA 1LOAA 5IVYA 1G86A 3WNMA 5JXGA 1N1TA 3FE5A 4D94A 3MV01 3R4UA 1YI9A 3WDXA 3K75B 2ZGLA 5FP9A 4YNIA 2Y6HA 5FZAA 2R32A 2HWB1 4YVSA 3IMMA 3LQCA 5JI7A 2OZ6A 3PUHA 4R9BA 3PIGA 4Z1VA 1SMVA 2RM21 5J36A 2DVDA 5C6CA 3EYPA 2E51A 1FMD3 3SEEA 2QQLA 2EXKA 2GP5A 5LBCA 2WAAA 1JUIA 3LPGA 2BNMA 1QQP1 2RR13 1NQJA 4URTA 1T6GC 3O1RA 1AYM1 1W0PA 4C0BA 4AFBA 5C3PA 4JDNA 5FXZA 1KGYA 5FIXA 4I0AA 3TNQA 4AOCA 4BQ5A 5A6ZA 3VZLA 1IPSA 1U5IA 5BPXA 3MLKA 3FHAA 3MYXA 4NRQA 4XF1A 1RVF2 1UMZA 2W1QA 4O65A 2BW8A 1OKOA 3M3CA 1AR63 2RM22 1ZBA2 1PMIA 1RINA 2CAUA 2E7TA 1ZRIA 2OA2A 3DXTA 3LD8A 3KT7A 1IPJA 1VBC3 3BPZA 5CFDB 3ZSMA 1MS5A 3AZWA 4QPGA 3NJXA 1S0FA 3MLJA 1VBD2 4LO8A 1HRV1 1YWKA 2ZZJA 2D43A 4CDXA 4HG6B 3RZGA 1XYNA 2VOTA 3V0BA 3ZFFB 2QCSB 3RPQA 1GR3A 2QQIA 3J9SA 5CIRA 3ZSEA 3O1SA 3TNPB 4D7YA 4I2OA 2YU2A 1LOBA 1N3PA 3G6JB 4A7ZA 5D8AB 3RWNA 4Q26A 4EN0A 5A1LA 5H9QA 2FMDA 1PGL2 2IVJA 3I2KA 4R4XA 1JZ7A 1IKQA 3A4UA 3N9QA 5C9AB 5HI0A 2EAAA 3VBRC 2WNVB 1V9U2 3AL6A 2YROA 1BMV2 5FKBA 2E32A 4FPKA 4XACA 4IGQA 2HWC3 1APNA 4XUQA 4NVPA 2I45A 3D0SA 5CBLA 4CU6A 1N1VA 3IWZA 1LHWA 3MW4A 4QXCA 4XJZA 3SH5A 5DUVA 4DIQA 4GD4A 4MH0E 3RG0A 3IKWA 1SLIA 4AK3A 4GWMA 2QVSB 2RVAA 4YGCA 2KR2A 4MADA 1DQ0A 4LUMA 1HJFA 3C7EA 2VO5A 3ST7A 4WM7A 1RB8G 2TNFA 4GIQA 5FYSA 3VD4A 3IDCB 2Y0IA 2BEOA 4ITCA 5FZMA 5LA1A 1FV2A 4B7KA 3C8XA 3FBMA 4UFKA 5IW0A 3C7HA 3PUQA 1UX6A 5LK5A 3I2HA 4AQTA 3DYPA 5C4WC 1RMU2 3WOGA 1FV3A 2VECA 3KVBA 4Y1XA 1XB9A 5DAWA 1W6OA 1J58A 3N9MA 5APAA 2XUEA 1RHI3 3BUCA 2EA7A 2WNUA 3JXSA 2KM2A 3FWEA 3NO8A 1UOGA 4SLIA 2CYFA 5FZCA 3MW2A 2CU5A 3TEYA 4PT6A 2XKOA 4R9DA 2WAOA 2RS11 2JIJA 3VBFB 1D4M1 3N9NA 1DP0A 3J8F1 3KV9A 1NCRB 1UZYA 2IXLA 2WS92 3ZN4A 3ZYRA 2WZR3 4FO9A 5FY8A 5KHGA 1YHFA 2JDZA 3LFIA 5GLWA 1BZWA 1S0DA 4CCLA 4OHYA 4QGMA 4AHZA 2NM1A 2JE8A 1US3A 5T55A 1VBA1 3CJXA 3JBG3 5FWEA 1YCIA 2WYSA 4Q2FA 4QQOA 1FOD1 4CDXC 3I3EA 3BI3A 4RGAA 1OD3A 4XZPA 4I02A 1QQP2 1H2NA 4RN5A 4AI9A 4UYBA 5JIUA 2YUEA 1AYM2 4MGTA 1QJX2 3GHMA 5FZBA 1LODA 2WINB 4TSVA 3KD4A 4N53C 2HH9A 4AGGA 1NXMA 1POV3 3AMPA 4XFCA 3VL9A 2A3YA 1MQTB 2XHKA 5CNAA 1BVVA 5IVBA 4W4ZA 4XURA 3NAPA 3RQ0A 4YYOA 4COUA 4XQWA 4P5HA 3BIEA 3BVCA 4X8NA 1M4WA 1COV2 4YG0A 4QDSA 1IS5A 1CESA 2Q4SA 1JI6A 3AZYA 4W65A 4BH9A 4CCNA 4E8DA 1VBB3 4PLMA 2ZGUA 5A33A 4O61A 2JG8C 4XUPA 3WQ1A 4MV2A 1O3QA 3M70A 1V6KA 1N3QA 1NLQA 2VH9A 4GULA 5A80A 4HOOA 3OPTA 5FKCA 3ZIXA 4Y4YA 2DBNA 1OXCA 4B8EA 3OY8B 4D8MA 4L0PA 2Y6JA 4RS5C 3SCGA 1HQWA 1RUD3 2WSUA 2IXCA 3ZFEB 4DZGA 4U2AA 1HN0A 2RJLA 1OKQA 1NLRA 3NV3A 2ARXA 4IERA 2OW4A 2F17A 1W6PB 4GA9A 4I0WB 4KBBA 3T0DA 4AEJA 3AFGA 4NO4A 3O5SA 2RS32 4CPBD 2EXJA 2XWJB 5A6YA 1SLAA 2VTXJ 2X5IB 5BNPB 1O5UA 2TBVA 5K0UC 3LE0A 4ZXEA 4CEYB 3HN3A 4DPNA 3AYCA 2XQRA 2G1MA 2ERFA 3HQXA 2GN7A 4LQRA 4LORA 5FY1A 4LIUA 1H9PA 5ANQA 1C4RA 2WNUC 4JGYB 3RJRA 2D6LX 4LUKA 1B09A 1HV0A 2XVGA 3WCRA 5JOZA 4RSUA 3VUOA 4OUEA 4LR4A 4LO5B 4XAAA 4MGIE 4C0HA 1NT0A 3J7LA 4K8RB 1RIRA 2ZEZA 3PNAA 1ZZ8A 4BXSV 4CU9A 1C8M1 2A3XA 2RMU1 2NN8A 1RUF2 2QZ3A 3KV6A 1RUJ3 2GNDA 3NW4A 2CSGA 3TAYA 3ZYJB 1U0AA 1VBB1 1UD1A 3UKNA 5AC93 1DCSA 2YPDA 1BXHA 5I8YA 5LEKA 1VBB2 4MHUA 4N7IA 1SG3A 2HWF2 3LA7A 2CL2A 2AH2A 3W59A 5FWJA 4L97A 1XSRA 4I30A 4KL1A 1JN2P 4MGSA 4LKSA 3HAGA 5JMCA 2BU9A 2QQJA 3CZJA 1WBLA 5CFDC 1VBE1 3NV1A 4XCBA 4YW1A 4BM8A 3UKVA 3MGUA 3ZPOA 3S30A 4AE2A 4FOYA 1G9FA 2JWPA 2ZA9A 4PF1A 4AI8A 5K9YA 3I49A 2VULA 2E7QA 4HPKA 2K46A 3ZFFC 4KU8A 3LFMA 1WMFA 4CYDA 5FPAA 3USUA 4PDWB 1S0BA 3NNJA 1I9RA 5HCAA 3KT1A 3K3OA 2PHTA 1W2OA 2C9KA 4A3XA 2O14A 1A78A 1D7PM 1PM7A 2YC0A 2BWAA 3CIHA 5FPXA 1BLZA 2ZABA 1E5SA 1EV13 4N7UA 4PHZA 3DL3A 1K5MA 5IYYA 3JBG2 1MPXA 3OEAA 1OF4A 3ACLA 3FLTA 3ZYHA 1BMV1 3OCPA 1R1A3 3UL2A 4OHXA 2BERA 2WC2A 3I2FA 3BTYA 1BQPA 2R7EB 1RUNA 1D4M3 4XEZA 4UBHA 3DYMA 5JSOA 3UETA 5FMDA 5FZOB 2WO2A 1XC6A 1F15A 3R05A 5ERLA 2QDRA 5HV4A 2FDGA 2JDKA 5T52A 4UWDA 1XU2A 2VXJA 3NNLA 4EN7B 1VAKA 4ZZ8A 3I2IA 2BUKA 4COYA 4IE5A 4AF9A 4JDMA 1ENRA 1YC61 2QDNA 1UY3A 1A8DA 1UY1A 1UYXA 4D3WA 4AFDA 1JZ3A 2QJVA 3G7DA 2C24A 1Y3TA 2W46A 5I8TA 4QX8A 2E33A 3DEMA 4Z8BA 5DUWA 4GZ9A 3HBZA 1PMJX 3N7LA 1ZVFA 4EN6B 3DN7A 1QGLA 4S2GA 3H0OA 1XNBA 3ACIA 4LE4A 3HT2A 3I2GA 4Q4Y2 3ZMOA 4CXYA 4HN0A 2JDPA 4XIKA 2EF6A 3OG2A 2YPJA 2XVLA 4JHZA 4KWKA 1K45A 3T3YA 1H8TA 1Z7S1 1YXWA 3WP6A 1FXZA 1S2EA 2OQ6A 1WA6X 1ZBE2 3E6DA 1UKRA 4QX2A 4WM8A 3KF3A 3KWVA 3PL0A 3R4SA 1MACA 1O4TA 3HBKA 3K2OA 4FVVA 4Y22A 1K42A 3OPWA 5CFDA 2LRPA 4QPGB 3E6BA 2VNOA 3I54A 3MUZ1 3WW3A 5A3UA 2QQKA 5IFPA 1I1EA 1NCRC 4N9HA 2C5DA 2XLAA 5F6LB 3ZVXA 1AXZA 5LRRA 1SLTA 5F6KA 2FZ1A 3ZXKA 3ZFFA 4BDVB 4ISQA 1DYPA 1GBGA 1UF2C 2LS6A 3K4DA 2VZQA 1EY2A 2W39A 2O8QA 1W9FA 2ZGPA 1YNAA 3AKQA 1ULEA 5HBAA 5H9RA 2RDNA 5D8AA 3N7MA 3S6PA 1REDA 1AUYA 2IXIA 2XJPA 2ZJCA 3DUIA 1JZ4A 1UO9A 3P5BA 3ZO0B 4PCRA 1QDOA 5E8AA 4B29A 3OGJA 2HYKA 3VHOA 3VKFC 4A3ZA 3VHNA 3U37A 2GMEA 2ZEYA 1XNAA 1SLBA 4HVQA 1EYBA 3OB8A 3EMRA 2AGSA 2OKXA 5C8WA 4LK6A 1MS0A 4RHV1 5A3OA 3UYJA 5F37A 1COV1 3OBZA 1NXD1 3GYDA 5K8SA 1TME3 4N53A 4Y33A 5DG2A 5FP3A 4BQ4A 4YARA 4LJHA 2YC4A 2GC1A 1QXPA 2YBPA 2VMFA 5A3NA 5L36A 1VP6A 2JG8B 2SLIA 5A7OA 4BJ0A 4Q1PA 2VOWA 1LAJA 3ZXAC 1D0GA 3LGRA 4FFGA 4CTEA 1UZZA 1AR61 1V6OA 4GH4A 1PHMA 4KMQA 3Q8AA 1W6NB 1HX6A 2D98A 3MW3A 4C90A 4WZFA 5FO7B 4B4PA 2PA7A 4LBQB 2JDHA 1UU5A 3I59B 1K12A 3FN9A 5EPAA 5FY5A 4YM3A 1IKPA 1YUDA 1FYUA 2RS51 3JBG1 5C71A 2GC2A 4FPYA 3VKMA 2A1XA 1R1A2 2W0XA 3HQRA 4P9YA 3O12A 4YG6A 5FZEA 1OSGA 3H8OA 4R52A 2VZTA 5GZEA 4JX0A 2YBKA 4AI2A 3KCYA 2BBVA 5BNPC 5I0UA 5M0TA 1V70A 2FDHA 2DDUA 5B4NA 2RS13 2L9LA 4Q4W3 2VY0A 1CVNA 2JDUA 1AX0A 3HIFA 4P08A 5FLJA 5FXXA 3ZXDA 1V6JA 3WEZA 3CBNA 4JGYC 3R6SA 1CIYA 1W3VA 2BBAA 4KGQA 1GOHA 4WM8C 1F8VA 1HRV2 2ID4A 3AP7A 4UW5A 4OZXA 3SMHA 5L73A 4MOAA 4YGBA 1WD3A 2YZ4A 3KCCA 4A7KA 3CJIB 4XTPA 3SQOA 4IESA 3E5XA 4JVAA 2ZACA 3VZNA 1T2XA 3NL1A 3POBA 3LDBA 1QXRA 1UXZA 2YHJA 1OD5A 1VMJA 2D44A 4JC1A 1UIJA 4LO6B 3Q8BA 4TN7A 2AR6A 2WLQA 3GGLA 4J6GA 5DN2A 1COV3 3GBFA 1PVC2 1L7RA 1W0NA 1FATA 2R062 4L8QA 1XRUA 1OC1A 4P9LA 1YQ6A 1AYN2 1PK6C 3T2TA 4OMCA 4HBNA 2R043 1CN1A 1J3PA 1JUHA 1JOJA 4AGRA 3WP4A 1ENSA 1KEXA 2E63A 1V00A 4G4FA 2GNMA 1VRBA 1W9YA 5FLIA 1MQTA 1LU2A 1PIV2 3KS7A 2DVBA 1CIWA 3DCQA 4K40A 1PO12 1XNTA 4META 4K1YA 1GQHA 2FCUA 2Y0OA 2FD8A 5CEHA 4JHTA 4XC9A 2ZX1A 1Y9QA 1OURA 3GZUC 4IETA 4LO7A 4QHBA 5FYZA 2D3PA 3SXWA 3ZYIB 2ZGSA 2IZWA 3AMMA 2Z69A 1J1LA 5DQ0A 4K20A 3OYWA 4ZU5A 2ZTNA 2PYTA 4M4RA 4X6QB 3WG3A 2ZGKA 5FK8A 4Y26A 3SKJE 3CDZB 1V6IA 4XFFA 1UNBA 1EPZA 1DDLA 2XXZA 3OY8A 4FQZA 5FYBA 3FMGA 1HIXA 3QH6A 4NHLA 1HKDA 2WWSA 3LOIA 4QB6A 1WBFA 2VZOA 1EUUA 2KD7A 3U4SA 4AFAA 5IAXA 1D2SA 1NQDA 1ZBA3 3I3BA 1YFXA 2XBO3 1JS9A 1K3IA 5F5CA 3HQUA 1FNYA 2VMHA 5EHDA 2VOXA 2R49A 3FBYA 2A71A 4BLIA 4EN8B 5BNPA 3C7OA 1RUJ1 1XE0A 3LEMA 1Q8PA 4YW4A 4S2DA 4CEYA 1ENQA 4IV3C 4M00A 1OQDA 4LLFA 1WKYA 1HW5A 4AVAA 3ATGA 2JENA 4AEDC 4HVOA 4Y1YA 3JD71 5FY7A 2H0BA 4CP9B 4IEQA 1W06A 1ZBA1 1AXYA 5EFUA 4BYYA 2QBXA 4OVEA 4FP2A 1WLCA 2W1WA 2Y8KA 3I3MA 2FHRA 1FPN2 4P5YA 3ILRA 4Q4V2 5I0DA 5LZ6A 5FUPA 1X9PA 3A23A 3GZTB 3WG2A 3MF9A 4GALA 1V6LA 4V1PA 2VZ1A 1U12A 1O7FA 3VBOC 4CP2A 3PJQA 3B01A 1OH3A 1VBA2 2VZVA 4D6QA 5FMOS 2GSYA 2BP6A 4IEOA 3PU3A 2NZ9A 4NWVA 1AL22 5EYYA 4BA6A 1OVPA 3HN1A 4DXRA 2GZWA 2ZKNA 3FUQA 4A41A 4AEDA 3ES1A 2RS12 2VTXA 2XJSA 2ES3A 2AACA 2J1VA 4P00B 5CU1A 1FNZA 1VRH3 3Q9OA 5JWPA 1W9SA 1DZQA 2VPVA 1PMHX 2ZGOA 1AR71 1C28A 1JTZX 3KM5A 3LAGA 5JCTA 1XPWA 1WCSA 4M3CB 4IE4A 4Q0PA 5FQ0A 3S57A 1UW8A 2WLPA 3POEA 4IE7A 2JIGA 1E5HA 5DZEA 3VBUB 5JR7B 1U5YA 3KF5A 5C70A 3MV11 1WCDJ 2JKBA 4Y5Z0 5JZGB 2EAKA 1X36A 4B4RA 1QNWA 5FZ4A 2LW8A 4CDWA 3TBDA 3UK9A 1SHWB 3KQ4B 5D8AC 2BZDA 2VQTA 1ODNA 1NE4A 4HKWA 2J1TA 4LXLA 2E53A 1NA1B 1ACCA 2J1RA 5C9AC 1DGRN 3K3NA 2WDBA 2WWUA 4QD2A 2FDIA 2ARAA 5JMOA 4GWIA 3H1MA 5F9TA 4GJYA 4OLLA 4IV1A 1QJX1 1JZ8A 5FOBB 1WW6A 4YM1A 4PF5A 1PO11 3JQXA 1O4YA 4XFIA 2ZEXA 4M4PA 3VZOA 2J1AA 4N43C 2QQMA 1HB4A 4NWWA 5C33A 2OXBA 2P5BA 3UJOA 1NCQA 1WLDA 2VTFA 4IEZA 1F2NA 4PQQA 4Q4W1 2BWCA 3H42B 3PLQA 4MVTA 4OI2A 4HETA 2YXSA 4CP0A 2HLEA 3J4UH 3F2ZA 4XZUG 2VZRA 4BIFA 4Q4X3 4XHXA 3VBFA 3SCFA 4HMZA 2Y60A 4B3NA 4QKNA 1CD3G 2PHRA 1GWMA 4XFAA 4QQHA 1ULDA 3MF6A 2ORXA 1PX3A 3POYA 2A3WA 2VBBA 1ZA4A 5CB7A 4HONA 4DNYA 3NJYA 3KV5A 3ZYFA 4TYSA 3E1F1 5ANNA 4N43A 3LIHA 5ABJB 1BK1A 1BKZA 2XJUA 4HSJA 5C5TA 5LK7B 3FZ3A 1RMU1 5L9RA 5LBEA 4KBZA 4K6BA 5FZ7A 5FZ0A 2ZGTA 2Y38A 5FZ1A 2G4IA 2VZUA 2Q8EA 3U75A 4LBOA 1W0OA 1DLLA 2WZR2 1RUC2 1V0AA 1W9WA 2DUQA 4I09A 4IUGA 5GZFA 4YGEA 1ZBE3 1POQA 1JU3A 2DUPA 4NRMA 3VBFC 3ILNA 5ACA1 3T1LA 1OF3A 4I0BA 2B42B 2MEV2 3S5QA 3OOXA 5IK8A 2E7AA 4OHVA 1H1AA 3V64A 4LKDA 1SCSA 1LOFA 3AB0A 4ZU7A 3U0ZA 1Z0HA 5FYIA 3MZHA 5JOYA 4DY5A 4LPLA 1GV9A 2GMMA 3PTRB 3NSTA 3R0RA 1L3JA 1B35B 1AYN3 3RMYA 1C3HA 1SCRA 1VAVA 5JOXA 2R042 2DVGA 4H3WA 5HCBA 5LBFA 2HWE1 1IQDC 2WKKA 3ECQA 2D3SA 1AYN1 3WINE 4QQLA 1Z78A 2OIIA 3KQRA 4N53B 5DZGA 4QPIC 3OGRA 4XF3A 3ZFEA 1RJ8A 5BY5A 4WVMB 4XMIA 1VRH2 1PGL1 2QZ2A 1W6PA 4Q8KA 1SQ4A 2XJVA 1Q8VA 1OQEA 2UWBA 3VD9A 1UIKA 1LOFC 2YU1A 4GH4B 1C5IA 3IBMA 4OQ8A 3J8F3 1HRV3 1AR92 4LBQA 4K21A 1DGLA 1GQGA 5JUVA 4FI9A 1G9BA 3WNPA 1POV0 2XLGA 3O14A 2B8MA 3WG1A 3BN6A 1OOPC 1HB1A 1W6QB 1W99A 5J37A 1JH5A 1RMU3 2W9XA 2P37A 3NKGA 3ZXGA 4Q4V1 1TG7A 4AVBA 4IEUA 3OJBA 1REEA 4CEWC 2W1UA 3THDA 1H1MA 3QCWA 4IV3B 4GKYA 4JRLA 1H6XA 2W52A 3WNXA 4PI2A 3JD72 3POIA 1CONA 1GSLA 3FX3A 1GZCA 4PJYA 3LPFA 4PIXA 2WN2A 2WS91 3L2YA 4YZ3A 3CU7A 3FHIB 5BNOC 1Y9MA 3U11A 2ADDA 3BTZA 5KHJA 2BVBA 1RL3A 1DZTA 2G9GA 4AXOA 3DF0A 3POSA 5FYYA 1LESA 1X33A 1KJLA 1NAEA 1KDKA 2Y64A 3DKWA 5DAVA 1TEIA 4O9GA 5FMBA 3ZOIA 3QH7A 4QU2A 3OD0A 2GNBA 2IVIB 4UI9L 3LF7A 4MGQA 1SBDA 4Z2AA 1LJ7A 1VIWB 3Q8EA 3J7NA 2PHUA 1Q43A 4FAHA 1J59A 3DECA 2VMEA 4UOJA 5DUXA 4HPKB 2RJKA 4OQ9A 2OQ7A 4GWNA 3UGFA 4OCTA 3VDCA 4DY3A 2RS53 4CEWA 2WQ4A 4AI3A 2XDVA 5KHHA 3IPVB 5FYUA 4YLZA 1QMJA 1UY0A 3QBQA 1PZ9A 4XJ8A 4XABA 1BEV1 2QTWB 3KB5A 5J48A 1PZ7A 3T0AA 4K9SA 5JXHA 1BEV2 2BGPA 5A6XA 5A7QA 4RGKA 2FCTA 3B02A 3ZXEA 1LGNA 3N35A 1F5FA 2P1BA 3SH4A 1QJY2 1GOGA 5FZFA 1C1FA 1H4GA 1H30A 5J98B 5D2AA 2P3JA 3NWKA 2BOJA 3ME2A 1OQ1A 5F3IA 5T5OA 1BBT2 1O3SA 2DFBA 3QD6A 3BTAA 2BJSA 5FZOA 1YFUA 2D6NA 5FP8A 1RJ7A 2E26A 2C9AA 3WVJA 3ZXFA 1TE1B 1BYHA 5FPUA 5JXIA 3DKQA 1UY2A 3KMHA 1V6MA 4RS5B 3UNPA 2MEV3 3BPSA 3D82A 3RFRA 3S7IA 2Z79A 3ZN6B 5ACA2 5F3CA 3ES4A 2YB7A 1OLME 2ARBA 3NNGA 2WR9A 4XBLA 1UWWA 3MIFA 3OBAA 5F2SA 4ASLA 2Y33A 3I8TA 1N47A 4FPJA 5DDJ3 1ASJ2 2Y6LA 1W8ZA 1DGWA 1HXS3 3ABZA 4QXBA 3GF6A 2Q1MA 3I3QA 1OI6A 4MG2A 3AC0A 3ZFGC 5DABA 5FTTC 5IWFA 1WZXA 3DV8A 1ZZ7A 1BVP1 1H1IA 1S55A 4PI0A 4DRRA 3MI8A 4AGVA 4AZZA 4LMFA 1H4HA 2D7FA 5T50A 5K0UA 3OSDA 5KXCA 1WW4A 1TMF2 2X10A 2ZAHA 4JKMA 1J1TA 4DUWA 1GFF2 1YO8A 3AVRA 2JG9A 5BNQA 5KXDA 1IOAA 4CUBA 5DUUA 5AVAA 3HWJA 1Y7BA 1LGBA 4AWDA 2Y6KA 3PTYA 3WXPA 1O5LA 3APBA 1PNGA 3C2UA 2LM3A 3VLBB 1SDWA 3JD73 2V73A 3CMGA 1C8M2 2RMU2 1H2LA 1R092 3PVBB 4YW3A 4R9AA 2Y34A 3FUOA 3KLSA 4PQ9A 3VN4A 1YEWA 1G6NA 4MUVA 3ZSKA 3IB3A 4JQRA 4OMDA 5CYYA 5FZDA 3IN9A 1X50A 3N7KA 2ETEA 2LROA 2VZPA 2WL1A 3ZSJA 2GU9A 4WVWA 4NJ4A 3EQEA 2XBO1 1L7LA 1JOPA 4MGKE 3T30A 4L92A 2VBPA 2PAMA 3B9IA 5ABJC 5J09A 2V4VA 3ELNA 5KHIA 1NZCA 4E4SA 1YFYA 2R6QA 4GB32 1O6UA 4O7XA 4NIAA 1QDCA 2JDNA 5EV7A 1POV1 2R0HA 2DCTA 3JU9A 2DCZA 4ZPIA 1BBT3 4FQ4A 1CX1A 2HWD2 3SCHA 1DGWX 4ZKTB 3QACA 1AL0G 1RUG1 3DYOA 1R083 3VBUA 2WZ8A 2VU9A 1MR5A 1UOBA 5JZGA 2TUNA 4IV1C 3AZVA 3AJZA 1YIPA 3EXUA 2LALA 4BCUA 4CDWB 1BEV3 2QKDA 2ZMNA 1XE8A 2WZEA 2YGMA 5DDJ2 3LEKA 3QOPA 1ULFA 5FZ8A 2WSVA 2CDPA 4YVWB 1XU1A 2X29A 1A8MA 4A42A 2CNAA 4EQVA 3N3HA 2HWD1 2ZX0A 1NCQC 1W6NA 3VDDB 1CAVB 4E8CA 2ZAAA 2JXAA 4ORFA 2CWMA 1TMF3 4Q0UA 2VUDA 3WF2A 4F8AA 5AC92 5IVEA 2HEYF 2OS2A 2V4AA 5JPMB 4FPHA 5F3EA 1SFNA 4FOWA 1PGW1 3KT4A 3FJSA 1HLCA 5FPVA 4CU7A 4XUNA 1UPSA 1S0GA 2KXLA 3EJKA 4Q4W2 1VBE3 2YC2A 4IGPA 5KR7A 2W47A 5I0RA 4OULA 3ZR5A 4L2NA 3ZFGA 2NP0A 3KSCA 4XTMA 2CY6A 3FHQA 5K4LA 3RVHA 1A34A 1Z7S2 3BB6A 3NMBA 1GQPA 1CAWB 3N9LA 1RITA 5CA6A 1JW6A 4YW5A 1JU4A 5F5IA 3CO2A 3UV9A 2Q8CA 1SDDB 5JR2A 4QPIB 1LEDA 4D7TA 5C3SA 2WBKA 2DWRA 2VZ3A 4KI5M 5JLVA 1UY4A 3TEXA 5FZKA 1X8MA 4YGDA 3W58A 4XJ9A 1HRI2 1PGSA 4CCEA 2XOMA 4X6RB 3HPNA 2SBAA 4XJUA 3E5UA 1IS4A 4Q29A 3SNMA 3L9JT 5FO8B 5CG8A 4K8FA 1DZRA 2WFF3 4QQ2A 4JGZA 3NQHA 3J7HA 1CZTA 3I3DA 3VHPA 1W28A 2A75A 4HKLA 1WGPA 2BTVC 4P9GA 4MGZE 4JKLA 3OGSA 4Y5SA 5A6QA 3MHZA 3WX5A 1HXS1 2DTYA 3WDYA 1S0EA 5FP7A 5JAXA 4NUBA 2PHWA 4CE8A 1SFPA 4FPEA 2VUJA 4LOSA 1QEXA 3OYWB 3IM0A 2DFCA 4RQPC 1QH7A 2PLV3 2FMYA 3K48A 1QJU1 2EIDA 5H9SA 2Q30A 5FYTA 1G9AA 4CUGA 2YFZA 4Y1ZA 5EJZB 4CRQA 2XL7A 2CGOA 3GM8A 1SLLA 2XBO2 4E4HA 1JYWA 1D0HA 5DAPA 2D6PA 3H3ZA 4WVMA 3PVNA 1VBC1 5BV6A 2Z4FA 3HNYM 2W5FA 3M3EA 1F5JA 2ET7A 4LIVA 4M0NA 5KHKA 3ZDSA 3UJQA 4P9WA 3WNNA 3N9OA 4RR3A 1CPNA 2CGNA 2CTVA 4DB5A 1AZDA 1LOCA 4JZRA 5FAXA 2VD7A 1HDKA 2GH8A 4XMAA 4Y24A 4MZUA 4XOGA 3SITA 2IXKA 4RGGA 3H8RA 3I2OA 1G9DA 2A7AA 3DPRC 1E5IA 4ARYA 5IVVA 4EWDA 3H7JA 4QHOA 1JMUB 3HD8B 1W6QA 4N90A 4CP9A 1G7YA 1CAUB 3NVCA 5L9BA 4A2UA 5KC5A 4GMP1 1FOD3 4KQ7A 4XXAA 5FOJB 1RUE1 4KWUA 5FJKA 5JXJA 4XCAA 1BHGA 2EICA 1F4AA 3IDBB 3RMXA 4E4DX 3MUY1 4XUOA 1Y4WA 1CR7A 4CVUA 4ZU4A 1OPOA 2JICA 3MFAA 3CJIC 2XQXA 4R8HA 1QOTA 3WY6A 3ZM8A 5FDBA 2V5DA 4LA2A 3LA3A 4BK4A 1DQ4A 1RXGA 1S0IA 2QE3A 4W6XA 1LHOA 4O9EA 4M3CF 4YFWA 4IEVA 5DG1A 5JOWA 2VNRA 4AEDB 3GALA 3OGGA 4N8MA 3NV2A 2DYCA 1MS4A 5FYHA 4PLNA 1N3OA 1UU4A 1OPMA 3T1MA 4C1XA 1OMIA 2D6OX 1W8OA 4FPLA 2NMOA 4L9BA 3T08A 1ND3B 4PBPA 5HPOA 1E5RA 3THPA 4YFZA 1WCKA 1MS3A 4WM7C 5CADA 3GCWA 3S7EA 4CCKA 4KG0A 3ZXJA 2X8KA 2B45X 5EJ3A 4FCAA 1HRI3 1HV1A 3M3OA 4TZDA 3E6CC 4M3CA 5FQ0B 4XDPA 4COWA 2UURA 4Q0VA 2HBUA 2UY8A 4NR1A 4U36A 2E9QA 1NKGA 2JDYA 2VNVA 5FZ6A 3O0VA 4FFHA 3OBTA 4BU2A 4C1WA 3TN91 1KRIA 4I3PA 3IDEA 1IHMA 5DAXA 1NY71 4Y1UA 1MQTC 5A3TA 3FLPA 4LITA 4XDQA 1ZZBA 4CUCA 4X8PA 1AXKA 1QJY3 2R041 1NA1A 1ND2C 5FJHA 3AKTA 5E16A 4LKEA 4QPWA 4IV1B 2UWAA 3VV1A 1URXA 2OUJA 4Q0QA 4RS5A 3D8CA 4NPMA 2VW1A 2WN3A 5H9PA 4BHPA 2ZS6B 4CDQB 1R082 2H6BA 2VJXA 3ZN6A 2HWF3 5GM0A 3GHNA 4ZXKA 2ZHKA 1XNKA 3T2QA 4FPOB 1YRZA 1FOD2 2UWCA 5F3GA 3ALQA 4XQ4A 1NCQB 2PELA 4OUSA 5I0TA 3OEBA 1XXNA 3WV6A 1GZWA 5L7OB 1RUC3 4FAGA 3TWIA 5FBJA 1V9U3 5FZ3A 1NA1C 1ND2A 1VB2A 2O1QA 1DQ6A 1FI2A 4QDRA 4DOUA 1ZZ6A 2WFPA 1CZSA 1SZBA 3I97A 3OUJA 5K0UB 4QKFA 2A6WA 4YW6A 3WZ1A 4CEYC 4GKXA 4C91A 1EPWA 2QUOA 2W91A 3RDIA 2WJSA 2UYBA 4AEMA 5EP9A 2XB6C 2IWGB 1OOPA 2V72A 2H6CA 2Q5TA 3MIDA 4S2FA 4JKKA 4UFHA 5D1IA 3T09A 1IPKA 4F7ZA 1VALA 2XLFA 3JB4C 4N43B 1VR3A 5ABJA 4BOWA 5C3RA 1KDMA 2ARCA 3VHRA 5A7NA 1IS6A 4EE2A 2BRTA 4ZHNA 2FDFA 5C4WA 5HCHA 2ZGQA 5GLTA 5FUNA 1WWYA 4HL0A 5FP4A 2ZX4A 1W8TA 2YGLA 1JOBA 2AENA 2H0VA 1AJKA 1OBNA 4UW3A 3KHCA 1J83A 3KCXA 4UBGA 5FYCA 5LW9A 2WUHA 4K7JA 4M01A 4TTGA 5T3NA 3WF1A 2DV9A 2D5FA 5LEJA 2VCMA 4BXFA 1W3XA 1WLWA 1EP0A 1W8NA 1US2A 5FZGA 2A6VA 1DFQA 3VZKA 1W90A 1S4CA 1B35A 3HNMA 2ZX3A 4Y20B 3WQBA 1D2QA 2WNEA 1S0JA 3WDVA 5JZGC 4PDWC 1O3RA 4Q4Y3 2VR4A 3LA2A 1AX2A 1WMEA 2AC1A 4GMP0 3AK0A 2AYHA 4RYDA 3Q8FA 4K1ZA 2ILMA 1RVF3 4AL9A 1RUC1 2XPJA 3W5MA 3FLRA 4BMEA 5F8PA 1WW7A 1UPIA 5T5JA 1XNCA 2EXHA 1UOJA 1PZ8A 1ZREA 4LHKA 3V65A 1H9WA 3WDTA 1HB2A 4COZA 5FUIA 1H2KA 3D0JA 4RFRB 4YZ5A 2WT0A 5E89A 1TMF1 1CAVA 1XNDA 2P3IA 2RR12 1T6BX 4HT1T 3VGIA 4J1XA 4W6YA 5A3LA 4NHXA 4BQ2A 5CAZA 2P4EA 3W20A 2WFF1 3H3UA 1FMD2 1M06G 2PN5A 4CCOA 2DU1A 1EUTA 2VVFA 1RUI2 3LIGA 5FMCA 1C5HA 1IGOA 2RDRA 1SPPA 2X09A 3LEGA 4I3GA 2FCVA 3MBWA 4Q8LA 1YYNA 3VD3A 4AVCA 4CDUC 3AKSA 5ACA3 3O1TA 5B4XA 2ZEWA 3CHXA 4LULA 4QXKA 3VKLA 4KWJA 4IV3A 1P8JA 2E6VA 1QIQA 2D6MA 3M3IA 3AZZA 1CPMA 2XG3A 3VBRA 5CG9A 3DPRB 2OPWA 1DBNA 2IC1A 2VM9A 2XMLA 1TZOA 3IIAA 1CAWA 4E9KA 5GZGA 3X29B 1UCXA 1UQXA 1IQAA 4DXZA 1RHI1 2XJTA 4LTAA 2FDKA 4BLJA 3Q8CA 4LKFA 2VQAA 3N4MA 3HT1A 2JB8A 1JYNA 4AI0A 1PIV1 1KITA 1LEMA 2PHFA 5JPNB 2Y26A 3AJYA 3H3LA 5G05L 5LATA 4CXXA 3MICA 2R16A 1RUH1 4LOTA 4BZ4A 5IFTA 2RDQA 4IEPA 3QLQA 1YFWA 4CEWB 2WA3A 5J1XA 1X9TA 3IPVA 1I6XA 4MLOA 4MXWA 3OPZA 1W03A 1RC6A 4K3UA 3THCA 1MZ6A 4JGZB 1TME1 2J42A 2X05A 4CZSA 1A6CA 1WA4A 3IAPA 2XR4A 2HJIA 3LEIA 4A4AA 1LTEA 3H7YA 3SKVA 4MHRA 3O1UA 4BQXA 1OVSA 1PX4A 2GAUA 1GNZA 4AAXA 1H6YA 2R063 1QJY1 4INDA 5IK7A 3HOBA 3F95A 1GYKA 4HKOA 5KC6A 1GP5A 1OFNA 1X7NA 3CKHA 2W1SA 4DRVA 3VL8A 1YI7A 2ZX2A 1VBD1 1PNFA 5A7SA 4YM0A 2DCYA 1BJQA 5I8SA 1LCLA 1WUVA 2VVEA 3LZZA 1Q8OA 3ROUA 1QY4A 2C26A 1GZTA 2PQSA 4NRPA 3AM2A 2ZZQA 1LOEA 1MZEA 2GH2A 4GB31 4IW3A 1EV12 3ETQA 1X82A 4C8DA 1QF3A 4XETA 4QX1A 1YJLA 3PUAA 5FY4A 2BNNA 2KA3A 4J25A 1VBD3 3K46A 5LASA 2CDOA 3TYJA 3M4FA 2O8OA 4RR3B 3M1HA 5FRAA 2BPA2 2BGCA 2ZBJA 1ONAA 4EWEA 4F3JA 2XJQA 5HCFA 4UW6A 5BNNA 2BDRA 1EAH2 1H2MA 1ULCA 3LSEA 3MPPG 1K5MC 4QHZA 4FFIA 5E6HA 3SISA 3ZR6A 2EIEA 4DFSA 1ZX5A 3AP4A 4EN9B 4A6OA 1XSQA 1IZ3A 4NMIA 1CAUA 3RZLA 4MGYE 5FBZA 4D0QA 2JG9B 4UFIA 3E97A 3BYWA 3PIJA 1W2TA 2HWB2 1D4M2 5F5AA 2B5HA 2VW2A 3NAPC 4NHKA 3O1MA 1QH6A 4XDOA 2GP3A 3GBGA 4BQYA 5HXMA 4LBJA 5C5UA 1DQ1A 2WABA 2Y6FA 4OZOA 4V2VA 3WDUA 4GMP3 1YQCA 4XW3A 2OX0A 4CUAA 1UZWA 1LRHA 3W21A 1DYOA 2R072 4Q4X1 5EZWA 5EXOA 1ALYA 2RR11 2ZHLA 3P1IA 1PIV3 4N9IA 5GLZA 2LUWA 4M3CE 3RI9A 3SHRA 3MIHA 5FZIA 5KXBA 1AYM3 1RTVA 1BCXA 1L7QA 4DUXA 1TVGA 3B9CA 1OLRA 1RUD1 3LKJA 4G3YC 4LHNA 1AF9A 4MXVA 3THTA 2F6BA 3WF0A 5FK7A 4NPLA 1TNFA 2YFUA 3A21A 4LLOA 1VJ2A 3VKNA 4WBBA 3VD5A 4A44A 1W05A 3PVOA 3O7OA 3TEZA 1JXNA 1SLCA 3ZKYA 2WRAA 5E1RA 4AR2A 1ULPA 1LHNA 1DF0A 1QNYA 2FZ2A 4QX0A 1H8TC 1XOYA 4WV8A 1STMA 5L19A 3TB0A 4NHYA 4GQ7A 2ATFA 3U14A 2QQOA 3UGGA 5FZ9A 1YQ2A 2OYZA 1RUH3 5A7PA 4AYUA 1I5PA 3AFKA 2QQWA 5T5PA 4XQDA 1GKBA 3LB9A 4EJRA 5B2GB 4QAWA 3WSOA 4UXAA 4XJAA 1UYPA 3J7MA 2W3JA 1EAH1 2QQVA 3HMYA 3ON7A 5DMYA 5LB6A 5IHRA 1NYWA 4GB33 4NIHA 3UESA 2ZKLA 5AVPA 4WVVA 4KU7A 3VBSC 4IEYA 2RDSA 4M0HA 4ASMB 1Q5OA 3RGBA 1S2BA 4YVWA 1GLHA 3P6BA 3DXUA 3N36A 5A3PA 1WW5A 4XF0A 3URFA 3VDDA 4JTNA 1XBFA 3RYPA 3ZYBA 1KJRA 2JD4A 1RXFA 4BB3A 1LGCA 3D3AA 4YPJA 4CDQA 2VMDA 1MVQA 3GZAA 4LBMA 4Z07A 4IGOA 1C1LA 2G19A 2I2SA 4FOVA 2VVDA 1D4VB 2AUYA 1RUF1 3MFCA 4FPGA 3WDWA 3CF6E 4YZ1A 4CCDA 2WT1A 1Y43B 5GZCA 1J3RA 2UYAA 4PIZA 4ZZ5A 2ZMLA 4QPYA 3NV4A 3I2JA 4DMIA 3KZ4C 5CVRA 1HRI1 4CDWC 3VDAA 4FTBA 1PO23 1FT9A 1GZWB 2Q8DA 4CXWA 1QU0A 2VMIA 3T4VA 1QKQA 3OBRA 3ZFGB 4DEQA 5L7OA 4UW4A 1JYVA 1LKNA 3KGLA 4LEJA 3CQOA 1RUG3 4SBVA 5FYVA 2NMNA 3FFQA 3PURA 1UXXX 2J1SA 4A45A 2P17A 2HWC2 3T0BA 4B1LA 5L9VA 4JDOA 1PK6A 4KG8A 4P9XA 2P34A 4CDUB 1KFUL 3ZPYA 1TME2 2FBEA 2IXHA 4EYUA 1RVF1 1AX1A 1JBCA 5F32A 2B39A 4AVVA 4BK5A 2MNGA 4Q4V3 2PMWB 3IT8A 5LRSA 2NPIA 4QX5A 2B9VA 2GALA 2VZSA 3C7FA 2W2IA 1QHDA 4DINB 4HVRA 2XGXA 5CISA 4F83A 1ZRRA 1DHKB 2XHNA 4XHBA 3PMEA 3WUCA 1ZZ9A 1R093 2VL4A 2RS33 4ZY9A 3ITQA 4XBNA 2RE9A 1UZ0A 3KV4A 1J3QA 3VBOB 2PLV2 4NHMA
chains in the Genus database with same CATH topology
1F9KA 4OHZA 1VAMA 5JDBA 3MIGA 1V9U1 1W6MA 4PIYA 1VLNA 2AZ5A 4AW7A 3KGZA 4AFMA 4KGGA 5EWSA 4BWOA 1LR5A 4JGZC 1QWRA 2Z2SB 4B7EA 4Y20A 1RUI1 2EVXA 4Q0SA 2IFRA 2R071 1R1ZA 3O0XA 5SV5A 4QGNA 3B00A 1OA4A 3VBSA 4JAAA 1CJPA 4QPGC 2PAKA 1DG6A 3P3PA 4YVWC 3JCIA 4HLTA 1HQNA 1O3TA 1QJU3 2YMZA 1RUF3 2JE7A 2K9ZA 3M8LA 3VZMA 5A32A 1FPN1 4XBQA 3PMSA 2DURA 2IXJA 2ZGRA 5CFCA 4FPCA 2VOKA 4BQ1A 3B93A 1AR93 4HK8A 4XJWA 2XJRA 5I0SA 2D3RA 4E27A 4L11A 4YRDA 2WT2A 1ZNPA 3D6EA 1G9CA 2Q0AA 1SACA 2CGPA 4Z92B 4XYXA 2EIGA 2LTNA 1NE6A 2D93A 3VBRB 5DZFA 5JVVA 1X8EA 2XUMA 4JRAA 4LNVA 4YZ2A 1G8WA 1QXJA 4JCKA 4R4ZA 1EAH3 2PAEA 1GANA 1DQ2A 1VRH1 3U4XA 2GMPA 1VBA3 3WLUA 5EYXA 1FMD1 4LT5A 5DDJ1 5BYNA 4P14A 1XYPA 1QQP3 2VOVA 3A0NA 4LE3A 3MEPA 1ND3A 1SBEA 2ZGMA 1QJU2 5IK5A 2I07B 4AI1A 4BPZA 2VNGA 3JZVA 4MXWB 1HQLA 4E2SA 3AXDA 5FPZA 2MEV1 4YVSB 2B7YA 1CAXA 1C57A 2VXRA 2ZCWA 4D7SA 2WQZC 4R9CA 5FMOL 4B4QA 3AMNA 4XF9A 4OI1A 4CP1A 4NN0A 1ENXA 3M3QA 4QM8A 2P2KA 1V6NA 5AFBA 1RUD2 5BNOA 1AR82 3WHTA 5BUVA 4RQPB 1LECA 1XQNA 4YM2A 2DCKA 4QPIA 1H8VA 2A6YA 1B35C 3O0WA 3VBHB 1ZRDA 2DU0A 1FPN3 4YSFA 1AR91 2V5YA 2WNVC 1LENA 3BIWE 4LBKA 4S2HA 4MSVA 4FOQA 3SH3A 3WP3A 4RFT0 2EXIA 5TSWA 4CDXB 3ZXLA 4YZ4A 1ND2B 3TN92 2HWE3 5FFOC 4GH4C 3ZSLA 1GZ9A 2R073 1AHSA 1N1SA 4XE9A 3H8UA 4HFSA 1TNRA 2BQPA 3JQWA 4XFHA 4CDQC 1RUI3 1KQRA 2BNOA 1OOPB 1AJOA 5GLVA 4E2GA 1O4ZA 2R1DA 1ZRCA 5AC91 1CQ9A 3V0AA 3WD5A 2RS31 4FP3A 4OI0A 5C4WB 1MEC1 1C8M3 1KS5A 2RMU3 2VW0A 3FFZA 4FXKB 2F4PA 2ENRA 1FAYA 4LBLA 1MEC3 1CJDA 2WZR1 3AZXA 5IUQA 3AXEA 3IMNA 3AP6A 5T54A 3CNAA 3MIEA 1UL9A 4PLOA 4FTSA 2DUOA 4WM7B 4OHWA 3ZFEC 4AHYA 1KS4A 2K0GA 1GICA 3PVEA 1NY72 2PHLA 2ZPXA 2C1FA 1ASJ3 5C8CA 3RRDA 2X5IC 2VMGA 2YV8A 2HWF1 1TQ5A 1YJKA 4JV4A 2VQ0A 3AP5A 4AEKA 1RUH2 1W6OB 2GNTA 3MDPA 1AL21 4ATFA 1MS8A 2WNUB 2DVFA 5KWRA 3A0KA 4Q27A 5DXDA 3RYKA 3POWA 1PO21 5A3MA 3WT3A 4HZFA 4KWLA 1DIWA 5GJ6A 5K7PA 3B69A 2HEWF 2R0FA 4H7LA 3TN93 2QNKA 1QJX3 2R1BA 1AVBA 4P9IA 3RNSA 1UKGA 2GDFA 4W6WA 3ZIWA 1OFSA 1ZRFA 4XILA 2D40A 4IL7A 5JSPA 1PGW2 2EALA 3AP9A 3LCPA 3WQ0A 1DYKA 4XPVA 3L2HA 2NYYA 2MPFA 3WG4A 2DCJA 3MLLA 3DPRA 2W68A 3RYRA 3WHUA 3AYEA 5J3UA 1RUE2 1GNHA 5GKAC 2PQQA 2B46X 1LOGA 4Q1RA 3WR0A 4EV0A 4CDUA 1UU6A 4AG4A 4E4ZA 2ZHNA 2PFWA 2BFUS 3USSA 2JECA 1AL23 1LU1A 2A73B 3BODA 1SEFA 1RUG2 4G9SB 3ZN5A 3ZX7A 5A33B 2HWE2 1Q56A 4ATEA 4D69A 4IQPA 2XH6A 2OZJA 4HN1A 3BCWA 1Q8SA 3ILFA 1LHVA 2JX9A 4LO4B 5C8CC 4HSLA 4FSJA 3D4KA 3H1WA 4LA3A 4AHWA 3LWCA 4Z2WA 4FTEA 4AQ6A 1LHUA 4ES9A 2P3KA 5JIAA 1O91A 1NLSA 4YVSC 1VBE2 3AKRA 2HWD3 1R091 2QQPA 1CX4A 5F1RA 4HK9A 1YIFA 4WVZA 4NOTA 2FQPA 2GN3A 2MHFA 5CFCC 1JYCA 2RM23 4H14A 3W9AA 3WCSA 3VKOA 4LHLA 1RUE3 1AR73 4JGYA 3M2MA 1SBFA 3ZYPA 1ZZCA 1QOSA 1W39A 2ZMKA 5A32B 2Q1ZB 3RZZA 3I2DA 4Y1VA 2JE9A 4AVTA 2AREA 3V0BB 3VBHC 5AFEA 1DGRA 4H7MA 4KNCA 5BNNB 3B3QE 3LOBA 4RA0A 3CLPA 3B94A 3TRSB 3VDDC 4IEWA 1LULA 3RS6A 4H55A 1S2KA 2NLRA 1R1A1 1VBC2 3EBRA 4E2QA 3HR9A 4DQAA 5C9AA 1ZBE1 4YW2A 1AR62 2WNVA 4MYEA 3ENRA 2R30A 3NKTA 4P9JA 4PDWA 4FBFA 5KBFA 1IS3A 1Z7S3 4RR3C 1LB2A 4ES8A 2YYOA 4ONUA 4HANA 1CGPA 5F5QA 1ZM1A 5I91A 3AYDA 1MVEA 1RUOA 5GZDA 1K5MB 5JSRA 4RHV2 2CV6A 4RD7A 3RI8A 1OHFA 1MZ5A 4BMBA 1ZYBA 3B5LB 5FLHA 1OA2A 1RUJ2 4GXLA 2CAVA 2WA4A 3U07A 3E5QA 1NG0A 3JB8A 5IK4A 2BVVA 2B9UA 1I5ZA 5BXXA 2VUAA 4LBNA 3LSDA 3WUDA 4LBQD 1WMDA 5FREA 1NOVA 3DGTA 2CWSA 4J1WA 1E57A 4TWTA 5GALA 4QMAA 2VGDA 1CAXB 4IXLA 3U10A 4IEXA 3WP5A 1S0CA 1N1YA 2OUHA 3S0MA 1MEC2 3TOJA 3OD4A 1XYOA 2ZGNA 3BOPA 4EROA 4JTOA 4Z82A 3ASIA 3INAA 2YY1A 3RJ2X 2Z42A 2O0OA 2D5HA 3GNEA 5BNOB 2UY9A 3I7DA 2WS93 5JI9A 2X53S 4RQPA 2HEVF 3BALA 3AKPA 2HWC1 1FX5A 2GC3A 4A7YA 1YLLA 4QM9A 1NCRA 1AR83 3ZYGA 1H8TB 1QOOA 3J8F2 4NPRA 4OUMA 2RHPA 3VBHA 3ZMNA 1ULGA 4WM8B 1R081 1RHI2 3J26N 1PO22 1OLQA 3H9AA 2PTMA 4Y22B 5T5LA 5J7MA 4YG3A 1BBT1 1PVC1 2A6ZA 3BOWA 2G9FA 2JEMA 4Q4Y1 4XXPA 3OF1A 5E88A 3BU7A 3GBWA 2BYVE 3RSJA 4RHV3 4FT8A 1PK6B 2D97A 2JG9C 1RGSA 2I74A 5FO9B 2PLV1 1QJZA 3VZJA 3NAPB 1SFYA 1JHNA 4XIOA 2A6XA 3EO6A 2OPKA 1ASJ1 3N7JA 3V0AB 1U5ZA 4OI4A 3CL1A 1UN1A 2QFEA 3WQ7A 5FCCA 3EHKA 4AQSA 5GLUA 2YDEA 5I93A 4EWAA 3P3NA 4L99A 3NJZA 3VBOA 1JYIA 5HXVA 3AX4A 5IT6A 1XE7A 2WZPP 3AMQA 2R061 1KFXL 1UAIA 2JJ6A 3UKTA 3SLIA 4BE3A 1W6MB 2JG8A 4ISRA 1Q3EA 1OA3A 2DVAA 1I3HA 4PBOA 1F31A 4QQPA 2Q8OA 4DS0A 2ET1A 1VB4A 2X5IA 4AFCA 3H1YA 2XL9A 1H0BA 2UU8A 1ND3C 2K2SA 2ZOEB 3I59A 5C8CB 2OVUA 4Q4X2 2TEPA 1DQ5A 4QT6A 4TLFA 4XFBA 2DTWA 2BFUL 3M7AA 4AQ2A 2GC0A 4AVSA 3MPBA 3VBSB 3JUUA 3WW2A 2XWBB 3B7MA 1PVXA 2HWB3 1WLTA 2XVKA 2PHXA 2D6KA 2N7GA 4QGLA 4MX3A 2IFWA 5CFCB 3H50A 1MZFA 4BIOA 4I01A 2WFF2 4XF4A 1W2UA 2C0ZA 2RS52 4XFGA 2A5ZA 3V56A 5KXEA 3D5OA 3AYAA 4OFGA 3C3VA 1REFA 3CJIA 1MS9A 4WZCA 1WD4A 5J96B 1KD7A 2PHDA 2ZHMA 3PHMA 1AR81 3I4IA 1U5XA 1PO13 1Q8QA 2WIIB 2A70A 3K51A 2NQYA 3AMHA 4AHXA 1C8NA 1EV11 5BNNC 3MIBA 2Z5WA 3USUB 1MS1A 1DU3D 4COVA 2DF7A 1HXS2 3PJYA 4KH9A 1A3KA 1PVC3 3OTFA 5L7OC 4FPFA 2VG9A 3FC0A 1S1AA 5SV8A 4FXGB 4RL7A 2W08A 3VBUC 2HKXA 2V09A 2XKPA 1AR72 1KXGA 3WW1A 3CEWA 1LOAA 1G86A 1N1TA 3FE5A 4D94A 3R4UA 1YI9A 3WDXA 2ZGLA 4YNIA 2R32A 2HWB1 4YVSA 5JI7A 2OZ6A 4R9BA 4Z1VA 1SMVA 2RM21 5J36A 2DVDA 5C6CA 2E51A 1FMD3 2EXKA 1JUIA 2BNMA 1QQP1 2RR13 1NQJA 4URTA 1T6GC 1AYM1 1W0PA 4C0BA 4AFBA 4JDNA 4I0AA 3TNQA 3VZLA 1U5IA 5BPXA 3MLKA 3MYXA 4XF1A 1RVF2 1UMZA 2BW8A 3M3CA 1AR63 2RM22 1ZBA2 1PMIA 1RINA 2CAUA 2E7TA 2OA2A 3KT7A 1IPJA 1VBC3 3BPZA 5CFDB 3ZSMA 1MS5A 3AZWA 4QPGA 1S0FA 3MLJA 1VBD2 4LO8A 1HRV1 1YWKA 2ZZJA 2D43A 4CDXA 1XYNA 3V0BA 3ZFFB 2QCSB 3RPQA 1GR3A 5CIRA 3J9SA 3ZSEA 3TNPB 4D7YA 4I2OA 1LOBA 1N3PA 3G6JB 4A7ZA 5D8AB 3RWNA 4Q26A 4EN0A 5H9QA 2FMDA 1PGL2 4R4XA 1IKQA 3A4UA 5C9AB 5HI0A 2EAAA 3VBRC 2WNVB 1V9U2 2YROA 1BMV2 4FPKA 2HWC3 1APNA 4NVPA 2I45A 3D0SA 5CBLA 1N1VA 3IWZA 1LHWA 3MW4A 4XJZA 3SH5A 5DUVA 4MH0E 3RG0A 3IKWA 1SLIA 4AK3A 4GWMA 2QVSB 4YGCA 1DQ0A 4LUMA 3ST7A 4WM7A 1RB8G 2TNFA 4GIQA 3IDCB 2Y0IA 2BEOA 4ITCA 1FV2A 4B7KA 3FBMA 1UX6A 5LK5A 4AQTA 5C4WC 1RMU2 3WOGA 1FV3A 2VECA 4Y1XA 1W6OA 1J58A 1RHI3 2EA7A 2WNUA 2KM2A 3FWEA 3NO8A 4SLIA 2CYFA 3MW2A 2XKOA 4R9DA 2RS11 3VBFB 1D4M1 3J8F1 1NCRB 1UZYA 2IXLA 2WS92 3ZN4A 3ZYRA 2WZR3 4FO9A 5KHGA 1YHFA 2JDZA 4OHYA 5GLWA 1BZWA 1S0DA 4QGMA 4AHZA 2NM1A 5T55A 1VBA1 3CJXA 3JBG3 1YCIA 4Q2FA 4QQOA 1FOD1 4CDXC 4RGAA 4XZPA 4I02A 1QQP2 1H2NA 5JIUA 2YUEA 1AYM2 1QJX2 3GHMA 1LODA 2WINB 4TSVA 3KD4A 4N53C 4AGGA 1NXMA 3AMPA 1POV3 4XFCA 3VL9A 2A3YA 1MQTB 2XHKA 5CNAA 1BVVA 3NAPA 3RQ0A 4YYOA 4COUA 4XQWA 4P5HA 4X8NA 4YG0A 1M4WA 1COV2 1IS5A 1CESA 2Q4SA 3AZYA 4BH9A 4W65A 1VBB3 4PLMA 2ZGUA 5A33A 2JG8C 3WQ1A 4MV2A 1O3QA 3M70A 1V6KA 1N3QA 2VH9A 4GULA 3ZIXA 4Y4YA 4B8EA 3OY8B 4RS5C 3SCGA 1HQWA 1RUD3 2WSUA 2IXCA 3ZFEB 4DZGA 4U2AA 2RJLA 1OKQA 1NLRA 3NV3A 2ARXA 4IERA 2OW4A 1W6PB 4GA9A 4I0WB 4KBBA 4AEJA 3AFGA 4NO4A 3O5SA 2RS32 2EXJA 2XWJB 1SLAA 2X5IB 5BNPB 1O5UA 2TBVA 5K0UC 4CEYB 4DPNA 3AYCA 2ERFA 3HQXA 2GN7A 1H9PA 1C4RA 2WNUC 4JGYB 3RJRA 2D6LX 4LUKA 1B09A 1HV0A 2XVGA 3WCRA 5JOZA 4RSUA 3VUOA 4LR4A 4LO5B 4MGIE 4C0HA 1RIRA 3PNAA 1ZZ8A 2RMU1 1C8M1 2A3XA 1RUF2 2QZ3A 2NN8A 1RUJ3 2GNDA 3NW4A 3TAYA 3ZYJB 1U0AA 1VBB1 1UD1A 3UKNA 5AC93 5LEKA 1BXHA 5I8YA 1VBB2 4N7IA 3W59A 2HWF2 3LA7A 2CL2A 2AH2A 4L97A 4I30A 4KL1A 1JN2P 3HAGA 5JMCA 1WBLA 5CFDC 1VBE1 3NV1A 4YW1A 4BM8A 3UKVA 3MGUA 3S30A 4AE2A 4FOYA 1G9FA 2ZA9A 5K9YA 4AI8A 2VULA 2E7QA 4HPKA 3ZFFC 4KU8A 1WMFA 4CYDA 3USUA 4PDWB 1S0BA 1I9RA 5HCAA 3KT1A 2PHTA 4A3XA 1A78A 1PM7A 2YC0A 2BWAA 5FPXA 2ZABA 1EV13 4N7UA 3DL3A 1K5MA 3JBG2 3ACLA 3FLTA 1BMV1 3OCPA 1R1A3 3UL2A 4OHXA 2WC2A 1BQPA 1RUNA 1D4M3 4XEZA 4UBHA 5JSOA 3R05A 2QDRA 5T52A 1XU2A 4EN7B 1VAKA 2BUKA 4COYA 4AF9A 4JDMA 1ENRA 2QDNA 1A8DA 4D3WA 4AFDA 2QJVA 3G7DA 1Y3TA 5I8TA 4Z8BA 5DUWA 3HBZA 3N7LA 1ZVFA 4EN6B 3DN7A 1QGLA 4S2GA 3H0OA 1XNBA 4LE4A 3HT2A 4Q4Y2 3ZMOA 4HN0A 4XIKA 2EF6A 2YPJA 2XVLA 4KWKA 1H8TA 1Z7S1 1YXWA 3WP6A 1FXZA 3E6DA 1ZBE2 1UKRA 4WM8A 3R4SA 1MACA 1O4TA 4FVVA 4Y22A 5CFDA 4QPGB 3E6BA 2VNOA 3I54A 3WW3A 1I1EA 1NCRC 4N9HA 2C5DA 2XLAA 5F6LB 3ZVXA 1AXZA 5LRRA 1SLTA 5F6KA 2FZ1A 3ZXKA 3ZFFA 4ISQA 1DYPA 1GBGA 1UF2C 1EY2A 2W39A 2O8QA 2ZGPA 3AKQA 1YNAA 1ULEA 5HBAA 5H9RA 5D8AA 3N7MA 3S6PA 1REDA 1AUYA 2IXIA 2XJPA 2ZJCA 3DUIA 3ZO0B 4PCRA 1QDOA 5E8AA 4B29A 3OGJA 2HYKA 3VHOA 3VKFC 3VHNA 2GMEA 1SLBA 4HVQA 1EYBA 2AGSA 5C8WA 1MS0A 4RHV1 1COV1 1NXD1 3GYDA 5K8SA 1TME3 4N53A 5DG2A 4YARA 2GC1A 1QXPA 5L36A 1VP6A 2JG8B 2SLIA 4Q1PA 2VOWA 3ZXAC 1D0GA 3LGRA 4CTEA 1UZZA 1AR61 1V6OA 4GH4A 1PHMA 1W6NB 1HX6A 2D98A 3MW3A 4C90A 4WZFA 5FO7B 4B4PA 2PA7A 4LBQB 1UU5A 3I59B 4YM3A 1IKPA 1YUDA 1FYUA 2RS51 3JBG1 2GC2A 4FPYA 3VKMA 1R1A2 2W0XA 4P9YA 4YG6A 3O12A 1OSGA 4R52A 5GZEA 4AI2A 3KCYA 2BBVA 5BNPC 5I0UA 1V70A 2RS13 4Q4W3 2VY0A 1CVNA 3HIFA 1AX0A 3ZXDA 5FLJA 1V6JA 4JGYC 3R6SA 4KGQA 4WM8C 1F8VA 1HRV2 3AP7A 4UW5A 4OZXA 3SMHA 5L73A 4YGBA 1WD3A 2YZ4A 3KCCA 4A7KA 3CJIB 4XTPA 4IESA 3E5XA 4JVAA 2ZACA 3VZNA 3NL1A 1QXRA 2YHJA 1OD5A 2D44A 4JC1A 1UIJA 4LO6B 2AR6A 2WLQA 4J6GA 1COV3 3GBFA 1PVC2 1FATA 2R062 4L8QA 1XRUA 4P9LA 1AYN2 1PK6C 3T2TA 4HBNA 2R043 1CN1A 1J3PA 1JUHA 1JOJA 4AGRA 3WP4A 1ENSA 2E63A 1V00A 4G4FA 2GNMA 5FLIA 1MQTA 1LU2A 1PIV2 3KS7A 2DVBA 1CIWA 4K40A 1PO12 4META 4K1YA 1GQHA 2Y0OA 2ZX1A 1Y9QA 3GZUC 4IETA 4LO7A 4QHBA 2D3PA 3SXWA 3ZYIB 2ZGSA 2IZWA 3AMMA 2Z69A 1J1LA 4K20A 3OYWA 4ZU5A 2ZTNA 2PYTA 4X6QB 3WG3A 2ZGKA 4Y26A 1V6IA 4XFFA 1EPZA 1DDLA 3OY8A 4FQZA 3FMGA 1HIXA 3QH6A 4NHLA 1HKDA 2WWSA 3LOIA 1WBFA 4AFAA 1D2SA 1NQDA 1ZBA3 1YFXA 2XBO3 1FNYA 2VMHA 4EN8B 2VOXA 2R49A 3FBYA 2A71A 4BLIA 5BNPA 1RUJ1 1Q8PA 4YW4A 4S2DA 4CEYA 1ENQA 4IV3C 4M00A 1OQDA 4LLFA 1HW5A 4AVAA 3ATGA 2JENA 4AEDC 4HVOA 4Y1YA 3JD71 2H0BA 4IEQA 1ZBA1 1AXYA 5EFUA 4BYYA 4OVEA 4FP2A 1WLCA 2FHRA 1FPN2 3ILRA 4Q4V2 3GZTB 3WG2A 3MF9A 4GALA 1V6LA 4V1PA 1U12A 1O7FA 3VBOC 4CP2A 3PJQA 3B01A 1VBA2 5FMOS 2GSYA 4IEOA 2NZ9A 4NWVA 1AL22 5EYYA 4BA6A 3HN1A 2GZWA 2ZKNA 3FUQA 4AEDA 3ES1A 2RS12 2XJSA 2ES3A 5CU1A 1FNZA 1VRH3 3Q9OA 5JWPA 1DZQA 2VPVA 2ZGOA 1AR71 1C28A 1JTZX 3KM5A 3LAGA 5JCTA 4M3CB 1WCSA 4Q0PA 5FQ0A 1UW8A 2WLPA 5DZEA 3VBUB 5JR7B 1U5YA 1WCDJ