1QXRA

Crystal structure of phosphoglucose isomerase from pyrococcus furiosus in complex with 5-phosphoarabinonate
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
187
structure length
187
Chain Sequence
MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Glucose-6-phosphate isomerase
publication title Structural evidence for a hydride transfer mechanism of catalysis in phosphoglucose isomerase from Pyrococcus furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 41
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature ec 5.3.1.9: Glucose-6-phosphate isomerase.
pdb deposition date 2003-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06560 GPI Glucose-6-phosphate isomerase (GPI)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qxrA00
1IPKA 1ZZ8A 3R6SA 2XLAA 3BU7A 2ET7A 4FAHA 3LA7A 3RYPA 4HLTA 3OGJA 4YARA 5FPZA 4QM9A 4X6QB 1VP6A 4Z82A 1DZRA 1XRUA 1X7NA 2H6BA 1WLTA 1SFNA 3U10A 3OCPA 3H50A 4KWJA 4IEZA 2IXHA 4HSLA 5KHJA 2GZWA 3DV8A 4Q29A 5KHKA 4MUVA 3OF1A 4IEWA 3LZZA 3H9AA 4K8FA 5EFUA 4IEPA 2ZKLA 4I0BA 4WVZA 2XGXA 1UCXA 4UBGA 4E2GA 1EP0A 3DKWA 3FX3A 4QMAA 5FLHA 2F4PA 5LEJA 2XL7A 2QJVA 4ORFA 1CAUA 4XF0A 3NL1A 3RPQA 4MZUA 2PAEA 4XFAA 2P17A 2D5FA 5E1RA 3LAGA 4I0AA 3M3IA 1H1IA 3HT1A 5JCTA 1J3PA 4UXAA 1YFWA 3I7DA 5I0UA 4GULA 4Q0UA 3MDPA 4MV2A 1L3JA 2O1QA 3HT2A 5D1IA 1I6XA 3NJZA 4XF4A 4HSJA 1RUOA 4OFGA 2D5HA 2BNMA 3D82A 3ES1A 2XLFA 2BGCA 4YRDA 1TQ5A 4MH0E 4O9EA 1SEFA 2FMYA 5T3NA 4HVOA 3ZDSA 5AVPA 3SMHA 1NXMA 1LRHA 2I45A 2Z2SB 3KGLA 4F8AA 1PMIA 1UPIA 1CAUB 1CAXB 4IEUA 2PFWA 1UD1A 1O7FA 4JTNA 2IXJA 3IDBB 1O3RA 3I59A 4IETA 1YHFA 3E5XA 1UIJA 4I02A 5FLJA 2PA7A 3H1WA 3RNSA 3UKTA 1J3RA 4ONUA 1NE6A 4KU7A 5JSRA 3H7JA 2PAMA 4FT8A 5BUVA 1ZRFA 3U0ZA 2BNNA 3EJKA 5BPXA 1O4TA 2QCSB 1Y9QA 1H1MA 2CGPA 4ZU4A 2OPKA 1YLLA 3OTFA 1LB2A 4EROA 3H1MA 2MHFA 1UIKA 5LRRA 3CO2A 3EHKA 4HMZA 3KMHA 3FFQA 1ZZBA 4AVAA 2UYBA 4LA3A 3OD0A 5I91A 3N4MA 4XFFA 1LR5A 3NVCA 4BYYA 1NZCA 3E5QA 2WFPA 2XHKA 2VPVA 2PHLA 3BB6A 1ZRRA 1ZZ9A 3MYXA 3E97A 5CADA 3B02A 3SCGA 1O5UA 2E9QA 4Q0SA 4MX3A 4XFHA 2MNGA 4BHPA 2GC0A 1ZRDA 3MPBA 5KHGA 3H3UA 4Q0PA 4HVQA 1RTVA 1X82A 1X8MA 3RYKA 2FQPA 4I3PA 3UKNA 4J1XA 1J1LA 2KXLA 5KHHA 4ZU5A 1YFYA 3H8UA 4EV0A 4FAGA 1FI2A 2PAKA 1DGWA 4QXKA 3QOPA 4YNIA 5FQ0A 2K0GA 4I01A 3IDCB 1JUHA 2OZ6A 4HBNA 1ZZ6A 3UKVA 3KCCA 4D7SA 2H0VA 4F7ZA 2PQQA 1XE7A 2GC3A 2GC1A 5JSPA 4MGYE 1SQ4A 5I8YA 4TLFA 4RD7A 3SCHA 4P9GA 4LULA 4FBFA 2IC1A 3FJSA 1ZNPA 1OFNA 3ES4A 2GH2A 1OD5A 5KBFA 3FWEA 3G7DA 1OI6A 4UBHA 1DZTA 2H6CA 1J58A 1J59A 3WW1A 2Q4SA 4EWEA 3LA3A 1YFXA 4AXOA 4A2UA 1UW8A 2BYVE 4LLOA 3USSA 3CF6E 2QNKA 5HI0A 5FQ0B 1O3QA 4JTOA 3EO6A 3CEWA 3M70A 2V09A 3FZ3A 1I5ZA 5BV6A 4IESA 4PIZA 1EYBA 5F1RA 5LEKA 1EY2A 5EZWA 4QGNA 4XF1A 5JR7B 3U11A 3GBFA 4DINB 4X6RB 3D0JA 4R8HA 4XETA 1RUNA 3PLQA 3E6CC 1CX4A 3SCFA 4YSFA 4MGZE 4E2QA 4WBBA 2PHDA 2C0ZA 4AVBA 1CAWA 1NYWA 3H3ZA 3ROUA 3H7YA 5J3UA 1Q5OA 1GQGA 5J7MA 4XFCA 3CLPA 4HN0A 3SHRA 2CV6A 4LUMA 3LA2A 2Q30A 1VR3A 1ZVFA 2VECA 2QDRA 2CAUA 3ST7A 2Y0OA 4IEYA 4E2SA 2EA7A 2HKXA 3SXWA 2B9UA 5I0RA 5CVRA 4JVAA 4AVCA 5I0SA 4XFGA 2BEOA 1XE8A 2EAAA 1QY4A 2ATFA 3BPZA 3DN7A 5LRSA 3I59B 2GU9A 4PIYA 1G6NA 4Q0VA 3RDIA 1O3SA 2UY8A 4Z07A 1CAWB 4LUKA 4LEJA 1YUDA 3L2HA 2K9ZA 1GQHA 2QVSB 4BIFA 3FHIB 4QGLA 4IEOA 3I54A 1RGSA 2IXLA 3KGZA 1VJ2A 4IEXA 1ZRCA 2OA2A 1QXJA 2IXKA 4QM8A 5BXXA 4ZU7A 5JAXA 5C6CA 2D93A 4EWDA 3S7IA 3HIFA 1CGPA 4PJYA 1ZX5A 3RYRA 4HN1A 1FT9A 5I8TA 1FXZA 3LOIA 5FCCA 3S7EA 4IEVA 4MGIE 3D0SA 1CAVA 3E6DA 1O5LA 4XF3A 3TNPB 4H7LA 3QACA 2WC2A 4N9IA 2O8QA 3BALA 3S0MA 4MGKE 2UY9A 1ZZCA 2ETEA 3WW2A 1IPJA 2CAVA 4O9GA 1J3QA 2XKPA 5I0TA 4XEZA 3IWZA 5E16A 4KU8A 3VHRA 2GAUA 4L11A 4AQ6A 1CAXA 3PVBB 4KWLA 3ACLA 5FLIA 2EVXA 1LKNA 5K8SA 3ETQA 3GYDA 1X8EA 2XLGA 2Z69A 4EWAA 3EBRA 3PNAA 4L2NA 1Q3EA 2DCTA 2UYAA 4WZCA 1PM7A 3E5UA 2XKOA 3DL3A 4IEQA 3RZZA 1CAVB 2BNOA 3ELNA 3JZVA 2OYZA 4I2OA 4R52A 2OZJA 1YFUA 1O3TA 4XFIA 2Q1ZB 3FE5A 3NW4A 4D7TA 1U12A 1WGPA 5C8WA 4KWKA 4I09A 1QWRA 1V70A 3MZHA 1EPZA 3BCWA 1Q43A 2HJIA 2VQAA 2B8MA 4AQ2A 2PYTA 1WA4A 2MPFA 1ZREA 2N7GA 3CL1A 4Q0QA 5JSOA 2IXCA 4YYOA 2D40A 3E6BA 4LA2A 1OMIA 1RL3A 2GC2A 4LTAA 3H1YA 5I8SA 4BH9A 3NKTA 4HZFA 3CJXA 2IXIA 4QGMA 4B29A 3WW3A 5KHIA 2B5HA 3LWCA 5I93A 1HW5A 4PIXA 5FPXA 2ZCWA 3TNQA 3IBMA 3O14A 3WW4A 2ET1A 4META 3HQXA 1ZZ7A 1NE4A 1QXRA 3C3VA 1YWKA 3IIAA 3NSTA 4HVRA 1DGRA 4QX5A 4JV4A 2XL9A 5J48A 4N9HA 1RC6A 1Y3TA 4IERA 4XF9A 5CU1A 4NVPA 2Q0AA 3EQEA 4XFBA 4J1WA 5BY5A 3KSCA 4OLLA 4KL1A 4CYDA 2PTMA 5FDBA
chains in the Genus database with same CATH superfamily
2GNBA 3I2HA 3VBSC 1MS5A 1GNHA 2XJQA 1Y7BA 3IMMA 1WCQA 2C6SA 4P5YA 3TBDA 3ABZA 1US3A 5H9PA 1LHOA 2YBKA 3AJZA 3OGJA 3AL5A 3U07A 4IE6A 5DG2A 4RFT0 4YARA 2VCCA 4F3JA 4XJ9A 2VULA 5F6KA 4FQ4A 2FCUA 1K45A 1VP6A 1Z7S1 3NRUA 4RFRB 4WV8A 2GP5A 4Z82A 5ANNA 4I30A 4AQTA 3VBHB 4GD4A 3FBMA 1WLTA 4HG6B 5CFDC 1DQ4A 1G9BA 1SFNA 2VH9A 3RZHA 4JDOA 3H50A 1MS9A 4JGZB 4AVSA 4OQ8A 4FTSA 5JVVA 4A6OA 2WZR1 1GP4A 3WQ7A 2VMGA 3DV8A 4Q29A 5KHKA 1JZ8A 4K21A 4IEWA 3JBG1 1LECA 3MW2A 4BQ5A 1LEDA 3H9AA 3T2PA 4PI2A 1OOPB 5EFUA 3ZX7A 3AKRA 4CXYA 4IGPA 1CIYA 2WINB 4KBZA 1TMF2 2ZKLA 1VBE1 5FIXA 5DAWA 3ZFEC 4NAOA 2IFWA 1VRBA 1QJY2 1OD3A 3J4UH 4XZUG 4AEDB 2FZ2A 4P9JA 5FREA 1ZM1A 4E2GA 2WN3A 1EP0A 4KG8A 3DKWA 5CG8A 2WO3A 1Y9MA 1TMF3 3LFIA 2JDNA 1JZ3A 1YXWA 5F3CA 2XL7A 3HBKA 1CAUA 1QJY3 3RJ2X 3NL1A 2VXJA 4MZUA 4RHV3 3O1PA 1UN1A 1SZBA 3PMEA 3VDDA 4E8CA 1KS5A 4A7ZA 1RXGA 5DN2A 3U14A 5JLVA 5A3MA 3LAGA 1WLCA 4I0AA 4JAAA 4M3CE 4FPKA 3M3IA 3FHQA 1F4HA 1UY4A 5IJRA 1H1IA 1UNBA 3VD3A 2P34A 5FWJA 5J98B 4UXAA 4COUA 3DYOA 1N1VA 5IUQA 1AR83 1MEC2 2O0OA 4C91A 1YFWA 1S4CA 3I7DA 3BTYA 4YZ4A 3O0WA 3OUIA 5FPVA 5FKCA 5FUPA 3MDPA 4MV2A 5FP3A 2O1QA 3ZOIA 2GDFA 3HT2A 3N3HA 5ACA1 4LHNA 5D1IA 2ZHNA 3NJZA 5A7WA 2BJSA 1MEC3 1CJPA 4UI9L 1H0BA 3HEIA 3U4XA 5FUIA 3AP7A 4NMIA 4QQOA 1RUOA 1J83A 4GQ7A 3PUHA 5A3WA 4KNCA 3D82A 4XC9A 3SEPA 1M06G 3R05A 3AYAA 1F31A 2DVFA 1DQ6A 1O4YA 1XXNA 1IKPA 5FY5A 1YI9A 4HVOA 1C3HA 1EAH2 4RR3C 1NX9A 3HNBM 4L0PA 1NXMA 1JHNA 5FXWA 4F8AA 3WG1A 1WCSA 5CBLA 2RS11 4QXCA 4YGEA 1CAUB 1N1TA 4N53B 1PX3A 5FY1A 2GMPA 1EAH3 4RSUA 1PGL2 1O7FA 4JTNA 3VDDB 3G6JB 4ZS2A 1O3RA 4IETA 2FD8A 1BK1A 1X9TA 1XNAA 2LUWA 2OXBA 4TWTA 5FYVA 3N7LA 4QU1A 3VDCA 4YM1A 1XOYA 3UKTA 5CA6A 3KVAA 1XYPA 5AVAA 2XBO1 3BOPA 5L7OA 4S2HA 1GWMA 4RQPC 1IZ3A 4AI0A 4FT8A 4BCUA 2NMNA 1UXXX 5BUVA 4Q4W2 3U0ZA 2BNNA 2W68A 3MW3A 4IW3A 3WDWA 1W28A 2JG9B 5AC92 2D3RA 2QCSB 1HRI2 3WCSA 1IKQA 1H1MA 3NV2A 4Z8BA 2DFBA 4ZU4A 4Q4W3 2YUEA 3LEGA 3OTFA 4COZA 5A32A 4JZRA 2QQIA 4LITA 2X5IA 4PBPA 3H1MA 5AC93 2MHFA 3RWNA 2A7AA 1HRI3 5T5OA 3QCWA 5JPNB 2BBVA 3WV6A 1JYNA 4NUBA 4BXFA 2ZGPA 4NIDA 3AP9A 3O0VA 4K9SA 2W1UA 4WVVA 2J1AA 1YYNA 3RZJA 1C8M1 4AVAA 1Q8SA 5C4WB 1UXZA 5I91A 5A3OA 1NY71 4KI5M 3RQ0A 4AVVA 3NKGA 2NLRA 4IV3B 1RUJ2 4CCOA 3ZM8A 2VR4A 3VZJA 2VJXA 4NPLA 3JUUA 4V2VA 3D4KA 4LBKA 2WQZC 4GAZA 4QPIB 2C5DA 2VPVA 4P14A 2PHLA 4PQ9A 4U2AA 5F6LB 4JGYC 4N90A 1ACCA 1WBLA 1ZZ9A 3PL0A 2DUOA 2JDYA 4AEMA 5LWBA 4MYEA 5CADA 1LOEA 3ZLIA 1GOHA 3B02A 2WO2A 2YC2A 4XBNA 3SCGA 1DLCA 5L7OB 1ENXA 1UU6A 4FI9A 3UJOA 1OQ1A 1UYXA 4JC1A 5A7OA 2VU9A 2GC0A 5LA2A 3MPBA 5B4XA 2WAOA 1W6MA 3IPVA 1KGYA 4Q0PA 4RGKA 1LAJA 2VXRA 3OJBA 2VUJA 3KZ4C 4JKLA 4WVMA 2VCMA 2VOVA 3RYKA 3T08A 4TSVA 5A32B 3WNNA 4EN8B 1J1LA 2RMU1 2X5IB 4OHZA 1AXZA 3N35A 1S2BA 2OIIA 2ZX3A 1P8JA 1VB4A 4P00B 4P9LA 1YFYA 3H8UA 4EV0A 1JZ5A 4YZ1A 3HN1A 3THTA 4GWNA 1VPHA 3WF3A 3OUJA 4CDQA 2BRTA 5FYBA 1CWPA 1PGW2 2JG8A 2CGOA 2RHPA 2WFF3 3UJQA 1KFUL 4C90A 5H9SA 1WW4A 4I01A 3VGIA 1UX7A 1JUHA 2CSGA 4LKFA 3KCCA 1LGNA 4D7SA 3HWJA 2H0VA 1PZ9A 1QOTA 1DGLA 1ASJ1 4AHXA 4CVUA 2E31A 4QXBA 1SQ4A 4MXWA 3LPGA 1FATA 3A21A 5DG1A 1QH6A 4DIQA 1DP0A 4KWUA 1OURA 4P9GA 4N43C 4LULA 2VM9A 1QQP1 3P1IA 3B7MA 4H2AA 1NCQB 4NIIA 3IPVB 5FP9A 5FRAA 4R4ZA 1PVXA 3KM5A 3ES4A 2WZEA 1E5IA 3IB3A 3KQRA 4WVMB 3VD7A 1WCUA 3ZSLA 5KBFA 1JZ6A 3FWEA 3G7DA 1OI6A 4Q2FA 2VNGA 2WZPP 1HQWA 1HLCA 1GOFA 2NMOA 3FHAA 5K4LA 2Q4SA 4QQHA 4ES9A 2A3WA 4K7JA 5C5UA 1VBB2 3B9CA 2V5YA 4JHTA 4EWEA 3RZLA 4CDQB 1OLQA 2XJTA 2X29A 2BYVE 4LLOA 1GOGA 2JG8B 2CU5A 3CF6E 4IDZA 4XDOA 1O3QA 4DXZA 2OW4A 3CEWA 1ND2A 1VBB3 1Z0HA 4AG4A 4ASLA 2WS91 4ZKTB 2WO7A 3K4DA 2V09A 3CZJA 3IAQA 1RUE2 5BV6A 2J1RA 4FPEA 4XMIA 2ZHKA 2JB4A 2BFUS 3L9JT 3U11A 4MXWB 1W2AX 4YWAA 4I0WB 5A7PA 2GN3A 3MIFA 3WT3A 1RUE3 3Q9OA 4E2QA 1ALYA 1X9PA 1RB8G 2Z79A 4JKKA 1C1FA 2XONA 3O12A 2KA3A 4XZPA 1ST8A 4IL7A 1A3KA 3WINE 1CAWA 4D69A 4FTBA 5IWFA 1OLMA 5FXZA 4NRQA 2DBIA 1YIFA 2AC1A 3D6EA 3VBOA 4DEQA 3DPRB 2VZQA 1WMDA 2AZ5A 3GJAA 2E33A 2ZZQA 3FUQA 2AACA 4BIOA 1MVEA 4HN0A 3PVEA 5FPLA 3V64A 5ABJA 5C70A 2CV6A 4XBLA 2NZ9A 5E88A 1FV2A 1OF4A 3POYA 1MZ6A 1LU2A 2E7TA 4CU9A 4FFHA 4AL9A 1VR3A 4AZZA 4BQYA 2VECA 1OKQA 1H30A 1GQPA 1V6KA 2CAUA 2QDRA 4MHRA 2WKKA 1PIV2 2VW1A 1W06A 2W95A 5AFEA 2TEPA 1G8WA 2Q5TA 2VD7A 5FWEA 1L7QA 1IS3A 3N9MA 5I0RA 3V56A 3DUIA 2D3PA 3VKOA 3WVJA 1J84A 3ZMOA 1PIV3 5FZ0A 4HETA 3POIA 3AXEA 2GU9A 1Z78A 2VZVA 1DYKA 2XH6A 3FLRA 1ULPA 4XJ8A 4Q0VA 5FZDA 2A3YA 3ZYFA 2JDZA 3Q8EA 5HCFA 4YW6A 1CAWB 2GMMA 4NE9A 2EALA 4GWJA 3D5OA 5GZEA 3W9AA 3ZYHA 2VW0A 5IATA 4EN9B 2IZWA 1SDWA 3JD71 2K9ZA 1GQHA 5LB6A 5A6ZA 4OVEA 3NJYA 5K7PA 5JZGA 1SLIA 4IEOA 4Z2AA 4XURA 3MF6A 3I54A 2X09A 5T52A 3BUCA 5JDBA 1U5YA 3KF5A 1W9WA 3M4FA 3AKQA 4HOOA 3T0DA 5JWPA 1NLRA 1HN0A 1QXJA 1BKZA 4MVTA 4D6RA 4OHYA 3KCXA 3ZYIB 1SBDA 3C7GA 2QQNA 3WNMA 3WDTA 2Y33A 3DYMA 4EWDA 1MS4A 4CEWC 1XPWA 2JECA 3AM2A 4AVTA 1VRH2 3PVNA 1WCDJ 5G04L 2LTNA 4Y1XA 3N7JA 5F9TA 1FT9A 3GF6A 2YROA 3VD9A 3LOIA 1W6QA 2VZ1A 5IK7A 4W6YA 3JB8A 2JD9A 2DV9A 1VRH3 3QLQA 3KV5A 2ZXQA 1OLME 3M8LA 4Y22B 4Y5Z0 3ZYPA 3S7EA 1D4M1 3FUOA 2WNVA 3I3MA 1V0AA 5GALA 2W1WA 3ATGA 3VBHC 3L2YA 1HRV1 1CAVA 3E6DA 5A33A 3BTZA 4QQ2A 3QACA 3BPSA 2EIDA 2K46A 4JGZC 4N9IA 3VKLA 3LDBA 5FPAA 5J96B 4PF5A 1YI7A 4I3GA 5FZBA 1A8DA 2G4IA 4RGAA 5K0UB 5HCBA 2UY9A 1B09A 2ETEA 2Y34A 1WMEA 4M0HA 2KM2A 1IPJA 4UFKA 2XKPA 5IVFA 4OQ9A 1OOPC 2WLPA 1JS9A 1K5JA 2XJPA 4XQDA 2Y6GA 4LHKA 4LBOA 2P3KA 2QQKA 2GAUA 4AEDC 1ENQA 1VMHA 4AQ6A 4COWA 3WHUA 5A3LA 5KXDA 3EYPA 2R073 3LEKA 3OPWA 5A1FA 5IK4A 1QJU1 3ILRA 1LGBA 4AW7A 1XNKA 4QKFA 4KGQA 2ZX2A 5K8SA 4FOYA 1JUIA 1X8EA 4ZS3A 3TRSB 4MGTA 1UZZA 1H9WA 1SPPB 4KQ7A 3VKMA 2YBPA 2BOIA 3EBRA 3JU9A 3PNAA 4DO0A 5IVBA 1Q3EA 2FCVA 4XTPA 5F2SA 3VKFC 4LBQA 4WZCA 1NT0A 5B2GB 4UFJA 4IEQA 4Q5OA 4RS5B 1CAVB 5A33B 1APNA 1F35A 5SV5A 3W58A 4BQ4A 2OZJA 2XXZA 5GLUA 3OUHA 1VBD3 4AFDA 3KT7A 3CQOA 1UZVA 1WGPA 3TOJA 4KWKA 4OUSA 2WJSA 4YGBA 4HANA 5DAPA 1EPWA 4HK8A 2EXIA 3S5AA 3HR9A 1OHFA 3WHTA 5KC6A 2HYXA 4CCEA 1HDKA 1V70A 3A7QA 3EMRA 1LESA 3RFRA 1EPZA 3BCWA 5EYYA 4AE2A 4LHLA 4BLIA 4NR1A 2Y38A 1YRZA 4BPZA 3V0BB 2W94A 1SCRA 2E32A 1JN2P 4EZHA 1ZREA 3KLSA 3HVDA 2HWF2 4Q0QA 4UOJA 1A78A 2D43A 5JSOA 4YYOA 3PU8A 1H6XA 4GIQA 3E6BA 4N53C 3B69A 4LT5A 1TG7A 2ES3A 1OMIA 1COV2 3VDDC 2HWF3 1W3XA 1TMF1 3FLTA 5DABA 3VHNA 5GLTA 3BOWA 3GCWA 4YM3A 3O1MA 2IXIA 2Y6KA 3C7OA 3PUSA 1IQDC 1XQNA 4HKLA 1QJY1 4QB2A 1MZEA 4JQRA 3DEMA 3QH6A 1TE1B 1K12A 2YYOA 3QH7A 1LGCA 4GKYA 4WZFA 3LWCA 5I93A 4QAWA 5LATA 5FZOB 1S0CA 2ZCWA 5FY7A 2JDPA 2JJ6A 4XCAA 5FP8A 2MEV2 1XNCA 4META 4XMAA 4YG6A 5F2WA 5FJKA 1ZZ7A 1V6IA 2WO1A 3ZXDA 2Q1MA 4O65A 2JG9C 4AQSA 5D21A 2I74A 4FO9A 2DCJA 4HPKA 4OI4A 4QX2A 4XUOA 3ZSJA 1D7PM 2MEV3 1CJDA 2DWRA 3I3BA 2WSVA 3ZXLA 1V6JA 1KRIA 1HQNA 2DYCA 2WNUA 3HD8B 1SG3A 4IERA 4ZPIA 1PGSA 1MEC1 3K4ZA 1W6PA 2J1VA 3SH4A 5EV7A 1A34A 3CIHA 2O14A 5FBZA 4KL1A 2VG9A 1SLLA 3OGSA 5C4WC 3V65A 1IPKA 3UETA 4CCLA 4IV3C 1W2TA 3K3NA 4QDQA 1RUG2 5FOJB 1T2XA 5C8CA 1JMUB 3LA7A 3RYPA 5IT6A 3Q8BA 4HLTA 1K5MB 1W8FA 4QPIC 1GKBA 2B39A 2OQ7A 3OPTA 4W65A 3I2GA 1EAH1 5FPZA 4YVWA 1RUG3 1XE0A 4QM9A 4W6WA 1SDDB 1VAVA 1VBC2 5F39A 1H2LA 3WCRA 1DZRA 1XRUA 3VZNA 2P37A 1PGL1 4YGDA 5BNOA 3ETPA 3FC0A 2IUWA 4XIOA 1J1TA 4IEZA 5DZGA 1VBC3 1D2SA 2DVBA 4HPKB 4WVWA 5DUXA 1ULCA 3NV1A 3OF1A 1DIWA 1CPMA 4NIHA 1PVC2 2B42B 3R4DB 1HJGA 2WNUB 1AR92 4AHZA 3AVSA 4K8FA 1O91A 3PDQA 1MS1A 3BI3A 1UCXA 5KXCA 1PVC3 1Q8VA 2EIEA 2YGMA 1O6UA 2OUJA 4Q4W1 5T5PA 1JZ4A 3U78A 1MPXA 5AC91 5D2AA 2F4PA 4NRPA 2F4LA 4K6BA 1H4GA 4ORFA 4CEYC 4XF0A 1QDOA 2QQLA 3OY8B 3PUQA 1CZVA 3MIDA 4IQPA 4XFAA 2P17A 2D5FA 5E1RA 2B4KA 2VOKA 4LNVA 4YVWB 2BGPA 5KC5A 1SBEA 4QDSA 5H9QA 4C1WA 2ARCA 2VTXJ 3CU7A 3ENRA 1R1A1 2W1QA 3HT1A 4DFSA 5JIUA 1BYHA 1RXFA 2CY6A 3ACFA 1OVSA 5EPAA 5BNOB 5D8AA 5IVJA 2QBXA 5E89A 3PIGA 1RUJ1 1W8HA 2A5ZA 1NCQC 3R4UA 4GJYA 4MSVA 4C0BA 4GULA 2WYFA 2ZMLA 2FDFA 3VL9A 1E5RA 1K3IA 5IW0A 3VZLA 3F95A 4DNYA 2VUDA 3GZEA 2ZS6B 3OG2A 4YZ5A 4XF4A 5FP4A 4DUXA 1PO12 1SACA 4HSJA 2BQPA 4AFMA 5FY8A 3T2QA 5BNNA 5FO9B 2D5HA 3HNMA 2XLFA 2BGCA 1PO13 2YV8A 2ZZJA 1TQ5A 2VZTA 4PLMA 3CJIA 3T0AA 5T50A 5AVPA 3ZDSA 5DAXA 1W6NA 3SMHA 2W5FA 3I4IA 2JDHA 4PDWA 2A6ZA 2JDAA 5JMOA 3WG3A 1KS4A 2BZDA 3WQ1A 4CP2A 1UYYA 1QOOA 2PFWA 1UD1A 2DU0A 2WWSA 3N7KA 2IXJA 2JDKA 4UYBA 2E6VA 5EWSA 5HPOA 1PK6B 4WM7A 3E5XA 3FN9A 4I02A 3H1WA 1PGW1 2EIBA 1C57A 2VBPA 4XE9A 5D8AB 1J3RA 4CSWA 4ONUA 4QX1A 4YVSA 4FTEA 1NE6A 1REFA 4KU7A 4MGSA 4KGGA 1UYPA 3MLLA 3KV6A 1UAIA 1XB9A 2A71A 2HH9A 1ZRFA 3LSEA 3EJKA 4Y24A 4L99A 4AI1A 3TEWA 2DFCA 3DPRC 2C4XA 2JDUA 4H55A 4BMEA 2B9VA 5BNNB 3RRDA 5J1XA 5CIRA 4TZDA 2F6BA 2Q1FA 2OPKA 2D98A 4XXAA 4AGRA 2ZGTA 5C3PA 2JD4A 4V2WA 1LB2A 1W2UA 3CJIB 4OHWA 1HX6A 2W3JA 1UIKA 2Y60A 4H14A 4QPGA 3CO2A 1W6NB 5LRRA 3EHKA 4PDWB 3BIEA 4HT1T 3U1XA 4AEJA 2SBAA 3TWIA 2E63A 1RINA 4CDXA 1ZZBA 3Q8CA 1KDKA 3CHXA 2VQ0A 1W6OA 3AFKA 5HCAA 4URTA 2WNOA 4XFFA 1POQA 1LR5A 2HWC3 3N7MA 4LLFA 3KHBA 4WM7B 1VBB1 2BBAA 2DF7A 3E5QA 4AWDA 1SCSA 2VZPA 2PHWA 4CA9A 1LHWA 1S2KA 3ZXKA 2HWE2 3E97A 5GJ6A 2E9QA 2WLQA 1TEIA 3J8F2 5IK8A 3RZMA 4XFHA 1ZBA3 1JYIA 1RUE1 2J1UA 3ZR5A 2HWE3 2D44A 5F7UA 3KV9A 1VBA1 1WA6X 1AJKA 1OQDA 1NG0A 4A44A 5LW9A 1ZRDA 2ZGOA 3SKJE 3I3QA 4FQZA 3H3UA 3NNGA 3J8F3 4M3CB 3ZFGA 1AL0G 4ATEA 4I3PA 3UKNA 2IWGB 1HN1A 5BNPA 2Q8DA 2YMZA 5CFCB 3BN6A 4Y20A 5DMYA 5E6HA 4FAGA 4LKSA 3MIEA 3OEBA 3VBUC 4BQXA 4IGOA 2AH2A 4QXKA 5LA9A 4CDXB 4R9DA 2C24A 1W6OB 2R062 4UFLA 1AR63 2OUHA 2D97A 4HBNA 3N9OA 1ZZ6A 2W9XA 4RHV2 1QHDA 5FZ8A 5JI7A 3I2FA 3USUA 1PNFA 2R063 1ULGA 2GC3A 1ZA7A 2GC1A 4MXVA 5JSPA 2ZKNA 4LE3A 3EXUA 5I8YA 5IVVA 1AXKA 2PN5A 1JBCA 1PIV1 2XWJB 4GB32 4IV1A 3POWA 4TLFA 4TXWA 4TYSA 5FYCA 3SCHA 1AR82 4XUPA 4EN0A 1G9DA 4FPFA 5FYZA 3KCYA 3PURA 4FBFA 3VDBA 4GB33 5K0UC 1JYXA 2PXJA 3S5QA 5LK5A 3ZFGB 1JYTA 2GH2A 5LA0A 2R1DA 1OVPA 2P3IA 4NHYA 4UBHA 5DZFA 5GM0A 2VZOA 1DZTA 3RMXA 4XXPA 1F5JA 1J58A 1J59A 4CDUA 4Y20B 3LE0A 4A7YA 5A80A 4XOGA 3LA3A 4AXOA 4CE8A 4A2UA 3AKTA 1KITA 1UYZA 2OX0A 3K46A 3H0OA 5FYIA 3EO6A 2LROA 4AOCA 4P02B 2XJRA 3M70A 3VBRA 1WW5A 2ZACA 2QE3A 3RVHA 3FZ3A 5DUVA 3USUB 5F1RA 5LEKA 5J09A 1EY2A 1UOFA 3OYWA 1W8ZA 5FKBA 1AYN2 4CP9A 5JR7B 1RHI2 1PO21 1NLSA 3GBFA 4DINB 1RUNA 4TLGA 4RS5C 1CX4A 4YSFA 1UY0A 1WCKA 5IAXA 4LBQD 1OUSA 1AYN3 1VRH1 1RHI3 1YC61 4XILA 5GKAC 4UF0A 2C0ZA 2ZAHA 2YPDA 4AVBA 1ND3A 1IQAA 2VOXA 1NYWA 3H3ZA 3ZXAC 1Q5OA 1OBNA 3KVBA 1GQGA 5F8PA 2OS2A 2R042 5FV3A 2HYKA 4AF9A 5A7WB 3PTYA 1HB4A 4CZSA 4DQAA 4UAPA 4CCDA 3HJRA 1RUD2 1ULOA 3C2UA 4LE4A 5FYSA 3LA2A 4LO8A 2Q30A 3SNMA 2R043 1ZVFA 1ODNA 1HV0A 3ST7A 4IEYA 3BGAA 4D0QA 1RUD3 2WYSA 2EF6A 4S2FA 2EA7A 1FX5A 4Y1VA 3SXWA 4BOWA 3ACGA 3VD4A 2BVBA 4CP9B 1JOJA 4ZXKA 2EAAA 4GXLA 1QY4A 1JW6A 5A7NA 2DCYA 3BPZA 2A75A 2SLIA 1N3OA 2YDEA 2FCTA 1XU2A 5FPUA 1O3SA 5CB7A 2UY8A 1CONA 1U5XA 4Z07A 2J1TA 1DQ0A 3VBFA 2FZ1A 4HFSA 1FOD2 3I3DA 3J7NA 4LORA 1JYVA 3S30A 1YQCA 1YUDA 5F3GA 3IT8A 1W3VA 3M3CA 3OOXA 5HV4A 3FHIB 1I5PA 4BB3A 1FOD3 2VUCA 1RMU2 1GANA 3WNKA 3OGRA 1WW6A 4IEXA 2WBKA 3J9SA 3OBAA 1ZRCA 3ORJA 1TZOA 4FPHA 1TNFA 4XW3A 3HAGA 1Q8OA 1RMU3 5EXOA 5JXJA 4KMQA 1ZBE2 2Y6FA 3DCQA 5BXXA 1XSRA 3BU0A 3RZKA 4CTEA 3O1UA 1YQ6A 4BWOA 2WFF2 4NHLA 3R0RA 5FJHA 2JKXA 2ZGQA 2ZGUA 2XOMA 2BVVA 3CKHA 3P3PA 4PJYA 5FZOA 1ZBE3 1AHSA 3VN4A 3RYRA 1ODMA 2Y6LA 3ZKYA 1K5MC 4W6XA 1CR7A 5E8AA 1BQPA 2TBVA 4FFIA 3RI8A 4P9XA 5I8TA 5EHDA 3WF0A 1C8NA 5FCCA 4COYA 1VMJA 2HWF1 1NA1A 2G9ZA 1UMIA 2JDMA 4Y5TA 4YW1A 1DQ2A 1JHJA 4XABA 3VBFB 2JENA 4CXXA 1EUUA 1COV1 2BTVC 4LK6A 3CMGA 1MQTA 2QQOA 3N9QA 3CBNA 5F5QA 4OUMA 4ISRA 1OH4A 1H8TA 3AP6A 4G4FA 3INAA 3ILNA 3OD4A 2V4AA 5CEHA 4GWIA 1B35A 1QIQA 5FR3A 2P3JA 1NCRA 1W6MB 5I0TA 2R16A 2NQYA 3J26N 4BZ4A 3NV4A 1CN1A 4Y26A 2MEV1 2RR12 4CU7A 3SH3A 2XDVA 3VHRA 2OKXA 1UZ0A 3PU3A 4QB1A 4XIKA 4Y1UA 2FDGA 4MADA 3MFCA 1POV3 3UESA 1CAXA 4GH4A 3ZFFA 1UQXA 2HEVF 3K51A 2ILMA 2RR13 1FNZA 2JIJA 3ACLA 4OZOA 1DQ1A 2DVGA 2JKBA 2EXKA 2VOWA 4YLZA 5FLIA 5FMDA 3ZN4A 2WT1A 4BQ2A 3ETQA 1W2OA 1QJX2 5IHRA 2DTYA 1JI6A 2ARXA 2XLGA 2Z69A 3AXDA 3MLKA 4EWAA 4XDQA 2RM22 3ZXJA 2ZBJA 3ZIWA 1O8PA 4XBQA 2P6HA 1N1SA 1GWKA 1NA1B 2QZ2A 4L2NA 3S57A 4LXLA 1QJX3 2R6QA 3AKPA 3E5UA 3NNFA 3LPFA 4LHSA 3NAPA 2RM23 3ELNA 3JZVA 2PHRA 4QHOA 1BBT2 1QNYA 2Y26A 5EJZB 2OYZA 3RG0A 2JE9A 2RJKA 1RUG1 1MQTB 3HN3A 2DDUA 3FE5A 3NW4A 3D3AA 1IGOA 2VUAA 1U12A 4P08A 3PJQA 2ZHMA 4B3NA 4I09A 5IVYA 1UOBA 1H8TB 1FV3A 1UMZA 3N9NA 1BBT3 4Y5SA 4BXSV 4CDWA 1B35B 2C9KA 2QQWA 3LKJA 3W5NA 1VBC1 1LOFA 2VQAA 4WM8C 2B8MA 1H1AA 2DVDA 1LNSA 2PYTA 1XYOA 5FMCA 3IKWA 4CXWA 1LOGA 2N7GA 4Z92B 3ZFFB 2IXCA 4B7EA 4D6QA 2CNAA 4HONA 3VBSA 4FPCA 4LIUA 1N47A 4LA2A 2P2KA 2QQUA 3JQXA 1AR91 5IK5A 3PIJA 4PF1A 4JX0A 2EIGA 2GC2A 1ND2B 3JXSA 3NKTA 4LMFA 4BH9A 1W9TA 1PK6C 3AZZA 4GMP0 4HZFA 3JBG2 1ONAA 1NLQA 1SBFA 4KG0A 4CP1A 1WUVA 1H2MA 5LZ6A 4QGMA 4JRLA 4B29A 5FZ1A 3WZ1A 2Q8EA 5KHIA 5LCWL 4IE7A 3KF3A 1VBE2 4ITCA 2L9LA 1IPSA 2R32A 4XHXA 3JBG3 5CFDA 4CCMA 3C7EA 4LJHA 3WW4A 4W8JA 2ET1A 3TEYA 1VBE3 1NE4A 3EB7A 4UFHA 3CNAA 5FYUA 1YWKA 5FO7B 2FDKA 5FUNA 4BLJA 3IIAA 4GWMA 4OCTA 2CTVA 4YM2A 2AEZA 3VBOB 4INDA 5FZGA 1RC6A 1Y3TA 5CU1A 3ZFEA 1CVNA 1YNAA 2W46A 2FBEA 1NAEA 1E5HA 2P1BA 4KBBA 2X05A 5ABJB 4BA6A 4J1WA 2WA4A 5BY5A 4NWWA 2ZJCA 3KSCA 1PO11 2WQ4A 3LQCA 3THPA 4A3ZA 2ZTNA 2Z4FA 1V9U2 1ENSA 5JOWA 3R6SA 4OMDA 3BU7A 2ET7A 3RGBA 4H7MA 3TN92 5CZKA 4Q4V2 1O8SA 5LA1A 1IHMA 1RUI2 2C26A 1V9U3 1WMXA 1HXS2 5CFDB 4X6QB 1OKOA 3TN93 3KD4A 4Q4V3 1UU4A 1H2NA 2WZ8A 1KXGA 3HQUA 3NNJA 1RUI3 4ET7A 4FPYA 3U10A 5JXIA 4XYXA 4KWJA 3POEA 4DXRA 1HXS3 3WNLA 3WNPA 2OQ6A 3B94A 1Y43B 3ZYGA 2GZWA 4HKWA 1US2A 4PT6A 2X8KA 2W87A 2VC9A 5KR7A 1S1AA 2QUOA 5JZGB 1VB2A 5FXXA 5CFCC 4YZ2A 1OPOA 2VTFA 3NNMA 2XQRA 3KV4A 3WQ0A 4I0BA 4WVZA 3RSJA 2CWSA 3SLIA 2RG4A 4RR3A 2YC0A 1AX0A 2W0XA 5C71A 2R072 4XJAA 4XVHA 4CDXC 4QMAA 2HEWF 3FX3A 3WDVA 4JRAA 4AFBA 1H2KA 1YO8A 4LPLA 2QJVA 2G19A 4OUEA 3MGUA 2VMCA 1AJOA 3GZUC 4N7UA 1BEV2 3WSOA 2ZX4A 3ZXGA 2DCKA 5LBBA 4Z1VA 1G9CA 1W6QB 2WUHA 1L7RA 5LASA 3WD5A 1URXA 1BVVA 1JU3A 1BEV3 1J3PA 1VBD2 4P9WA 4RQPA 3ZSMA 4DZGA 1DCSA 2RS52 2WNVB 3ZN6A 2YXSA 1LODA 2DVAA 3PJYA 1OC1A 1S0BA 4Q8LA 3WP3A 1DF0A 4RN5A 4JDMA 2E53A 3GALA 1I6XA 1BLZA 2F17A 2RS53 1IOAA 2VW2A 2HWE1 2BV4A 1U5ZA 2HWB2 4LBJA 4LO5B 2GALA 2FDHA 1C8M3 5HBAA 2RJLA 2WSUA 4OFGA 2QTWB 2ZMNA 4QX3A 3J8F1 3ECQA 4RR3B 3RMYA 1DFQA 1VE0A 1UKGA 5IFTA 2HWB3 2FMYA 2VTXA 4JQTA 5A3TA 3MO4A 4DRVA 2Z2SB 3ON7A 4DXSA 2WAAA 1R082 2DTWA 3GBWA 3DECA 1BHGA 3GJBA 2A6WA 1RJ8A 3J7LA 2YY1A 3BTXA 1S0FA 4RA0A 3OEAA 1H9PA 4UW3A 2A1XA 3SKVA 3ZIXA 3IDBB 4D7YA 1GV9A 3I59A 1R083 4D3WA 1DGRN 4JGYA 1PZ8A 5FLJA 4OHVA 4DY5A 1BCXA 2QDNA 2R061 4LBQB 3ZN6B 2PHFA 2RMU3 4LKDA 5FOBB 4RHV1 3H7JA 3IM0A 1F8VA 1CPNA 3TB0A 2AGSA 5FZHA 3UGHA 1O4TA 2XB6C 2FDJA 2LM3A 4FOQA 1OQEA 2RV9A 4GB31 2CGPA 4B4QA 3BVCA 1YLLA 1AR81 1W03A 2Y8KA 1U0AA 1LENA 4B8EA 5HV0A 4TTGA 3R4SA 4XAAA 3I97A 4BQ3A 3URFA 1REEA 3KMHA 3FFQA 5FZIA 3ACIA 2P6CA 4V1PA 4NIAA 4DXTA 2UYBA 2WA3A 3OD0A 2PQSA 4O7XA 3O1RA 4AR2A 5LY1A 4EZ4A 1UY2A 3NVCA 4JGYB 1QQP3 2VVFA 4BYYA 1NZCA 1X50A 2WFPA 3B00A 1QH7A 3WQBA 4URAA 1SLCA 1RIRA 3UGFA 3DXUA 1FNYA 2EXHA 3X29B 3MYXA 2W1SA 1GFF2 2JEMA 4N43A 4MGQA 5FZ4A 1C28A 2R30A 2VZ3A 3GZTB 2VAUA 2D6KA 4Q4Y2 3VHOA 2DCZA 3K3OA 3P5BA 3M3EA 4HXCA 3VL8A 5L7OC 4OI2A 1AYN1 1RHI1 5KHGA 3OBTA 1LJ7A 2ERFA 3NQHA 1RTVA 4Q4Y3 1KD7A 2YFZA 1X8MA 1DQ5A 2XMLA 2JXAA 4J1XA 5EP9A 3DXTA 3MFAA 3MPPG 3WF1A 4NHKA 2VNVA 2AENA 2VY0A 3C7FA 2J7MA 4ZU5A 5KHHA 4L9BA 3W59A 4Y4RA 2X5IC 5C3OA 1OLRA 5EIYB 1MS8A 1CZSA 2GH8A 2R49A 2RJ2A 1JU4A 4RL7A 1DGWA 1W6PB 1ZRIA 4FPJA 3ZPYA 3QOPA 5T5LA 1YEWA 4YNIA 3VZMA 2Z42A 3ZR6A 4LBLA 5FQ0A 3GCXA 1CQ9A 3IDCB 1D0GA 3UT0A 4M4RA 2KR2A 4B4RA 1G9AA 1R1ZA 4Q27A 3UKVA 3JB4C 1RUD1 1HRI1 1F2NA 5FY0A 1N3QA 3AP4A 1ZA4A 3SC7X 3AYDA 2BOJA 2PQQA 1XE7A 5C8CB 4FFFA 1S0JA 5C9AA 3UL2A 5KXEA 3BKZA 5T54A 2CL2A 4FOVA 3CDZB 4RD7A 2RE9A 1W8UA 2ZGSA 1SLAA 5DQ0A 4ARYA 1PX4A 3AYEA 2D6PA 4AHWA 4FFGA 3N9PA 3NJVA 5FAXA 1L7LA 2IC1A 2ZPXA 4CUBA 4AI3A 4E4HA 4XCBA 5L73A 3B93A 1SLBA 1W9SA 4M0NA 4QPYA 1YJKA 1QEXA 1GBGA 1QJZA 3WLUA 5FFOC 4LR4A 3WW1A 3K77A 1AX2A 3T1LA 4QB6A 2Q8OA 1X36A 1FOD1 3AP5A 3POJA 3O1OA 1YFXA 4XQ4A 1JH5A 4YW4A 4QU2A 1UW8A 3USSA 2QNKA 2VZRA 5HI0A 2XJVA 5FQ0B 2BWCA 5FTTC 5DDJ2 5T55A 5FO8B 2X53S 4CDQC 4OZXA 4FCAA 4NJ4A 1RMU1 2IVIB 2JG8C 5FZKA 2BW8A 2ZGKA 1XSQA 4NOTA 2VBBA 4GZ9A 4IESA 1UZYA 3NJXA 2GMEA 2W39A 4M01A 1S0GA 4PIZA 5DZEA 1NA1C 5DDJ3 3WUCA 5C9AB 5LK7B 1OF3A 1W9FA 5C3SA 1ZBE1 3WY6A 3D0JA 5A3NA 2VMFA 3E6CC 3SCFA 1MS0A 2WFF1 1HJFA 4XJZA 2PHDA 4LK7A 4IE0A 3K48A 4XPVA 3M2MA 5CYYA 2VGDA 4ISQA 5APAA 1R092 1UU5A 2D6OX 3ZDVA 2AUYA 1SFYA 3B9IA 3WX5A 2CHHA 4AI9A 3T09A 1XC6A 4M3CF 4E27A 4GA9A 5J7MA 3KT1A 1WD4A 5JOYA 3H8RA 1R093 3QD6A 3SHRA 5K9YA 2HWD2 3W5MA 4LUMA 4BDVB 2G9GA 2WIIB 3MIGA 1GU3A 1WMFA 1XNDA 2XJSA 4QX8A 4CEWA 2XPJA 1LTEA 2HWD3 5FZ3A 1SHWB 1XU1A 4XDPA 4E2SA 4P9YA 1C4RA 1POV1 4PCRA 1ND2C 2HKXA 4FPOB 2HWC2 5CVRA 5C3QA 5I0SA 4UFMA 4XFGA 2RR11 2ZGMA 1XE8A 5FZ7A 3AVRA 5FY9A 5I0DA 2ATFA 2GNTA 5HXMA 1KJLA 5LRSA 2XVKA 2V4VA 2P5BA 4GJZA 3VBHA 5F3EA 3J7MA 5ERLA 3D8CA 4K20A 5GLZA 2HLEA 3PUAA 5A7SA 2A6XA 4CCCA 4JGZA 4KH9A 5JMCA 1ZBA2 1QJX1 1F5FA 3IDEA 3MICA 4LUKA 5LBFA 3UNPA 1U5IA 2R7EB 3HMYA 4LEJA 2RM21 4YVSB 5IVEA 2C1FA 2CGNA 1VAKA 4NHMA 4PQQA 3ZN5A 4CP0A 3L2HA 1H6YA 2A6VA 4DB5A 2H0BA 1CESA 3UV9A 1TNRA 3WDYA 2ZAAA 4BIFA 2HBTA 1OOPA 1PZ7A 5EQUA 5ISLA 2V72A 3VBOC 1RGSA 4FPGA 1OSGA 1DU3D 1BBT1 2IXLA 3GHMA 1VJ2A 1OPMA 1DGWX 3A23A 2EICA 3C7HA 4AEDA 4D94A 2OA2A 4DOUA 2R1BA 1M4WA 2ADEA 5ABJC 4IXLA 1DG6A 1W0NA 4QM8A 1QU0A 5FYHA 4CEWB 3VB9A 1HB2A 3ILFA 3T2TA 3I2IA 5C6CA 5JAXA 3IDAA 4QPGB 3S7IA 1LCLA 1F15A 4GKXA 4Q4X2 4MHUA 4CRQA 3RI9A 1AR62 5F37A 3K4AA 1TME2 4Y1ZA 2BPA2 2ARAA 3T3YA 5JXHA 3LDKA 4DUWA 1DDLA 3NMBA 4Q1RA 5A6YA 1PMHX 4Q4X3 3IAPA 1RUF2 1C5HA 4JKMA 2XVLA 3PUIA 1TME3 1UL9A 4GALA 5EJ1B 1Q8PA 3KS7A 2NN8A 2XVGA 2DURA 4IEVA 5A1AA 1W39A 1RUF3 1XJAA 1FPN2 1LHNA 1MR5A 4Y3OA 4BE3A 4XUNA 2VNOA 3SISA 1C1LA 1LHVA 1RUC2 1UOGA 2WC2A 4R9AA 1BMV2 3ACHA 2P3YA 1I3HA 3P3NA 3BALA 3PTRB 1RITA 4MO3M 1FPN3 4ZZ5A 1AF9A 1ZZCA 3WW2A 2E7AA 5CKMA 4O9GA 1BVP1 1RUC3 2FHRA 3WP4A 5FZ6A 1WKYA 2GNDA 5JZGC 1YQ2A 3T30A 4AAXA 3SQOA 3LEIA 1GNYA 3DGTA 2I2SA 5E16A 1V6LA 4KU8A 3THCA 5FY4A 5BNPB 2Y6HA 5HXVA 1LU1A 4NN0A 4UFIA 4N53A 4JCKA 1GZCA 3BODA 3MIBA 1NKGA 2RS32 1N3PA 1I9RA 4PLOA 1OT5A 2WDBA 3J7HA 1AR72 4YFWA 3GYDA 5GLVA 3AZWA 5LY2A 2RS33 1QJFA 2UYAA 1HB1A 4UW4A 4NHXA 2QKDA 1AR73 1PM7A 4QXHA 2ZGLA 2NP0A 2KD7A 1IS4A 2W47A 1RUH2 1AL22 2IVJA 1JTZX 4UT5A 2WNVC 1V9U1 4XFIA 4Q8KA 1O3TA 4IV1B 1X33A 2P4EA 2Y64A 1PNGA 4D7TA 2JG9A 2TUNA 3M1HA 3TN91 4Q4V1 2XR4A 2OT7A 1QWRA 2XHNA 5FYTA 1RUI1 1RUH3 1XNBA 1AL23 4GMP3 2YU1A 4CU6A 3I8TA 3IMNA 1HXS1 2GP3A 1Q43A 4IE4A 5L9VA 4YM0A 3OBRA 3U75A 2NM1A 1S55A 2PHXA 4AQ2A 2XWBB 3MW4A 4EN6B 3GNEA 1UO9A 1WA4A 1QXPA 4D8MA 3CL1A 4CDUB 2JICA 2YB7A 2LW8A 4LQRA 4QQLA 3AMNA 1T6GC 4FXKB 1WLDA 2VZSA 4E4DX 2AR6A 4QQPA 5C4WA 3RJRA 3OPZA 2ZGRA 2VOTA 3ITQA 4IV3A 4OI1A 3AFGA 5FMOL 4ASKA 3MEPA 4CUAA 4K8RB 4AAPA 3H1YA 1IG0A 4QPIA 2GNMA 1FAYA 1VIWB 3VBRB 1GUIA 4OHXA 2R071 3WW3A 4JHZA 3OYWB 3E1F1 1EUTA 2B5HA 3THDA 4AI8A 3M3QA 4PIXA 4XJUA 4FOWA 1QOSA 2VMEA 4QKBA 3ZXFA 5C5TA 4O61A 2R0FA 1Y9GA 2YHJA 3ZKUA 1KFXL 1QXRA 2ZABA 3MV11 1BEV1 3C3VA 2W52A 4UF0B 3VV1A 1W8NA 1ND3B 2WT2A 3NSTA 2AYHA 4K40A 4HVRA 1PMJX 2C9AA 2D6NA 4QX5A 4JV4A 4E8DA 2ORXA 5J48A 4N9HA 1VBD1 3LB9A 1GICA 1ULEA 3KHCA 4XF9A 2RS51 1NQJA 4NVPA 4X8NA 4B4PA 4AFCA 1R1A2 4G9SB 5DPNA 5JXGA 3EQEA 5J36A 1F9KA 2WL1A 3LCPA 4QDRA 4ZZ8A 4FXGB 2Y0IA 4HKOA 2BWAA 4CYDA 1FMD2 3NV3A 1YQ8A 2PTMA 2VZUA 3DKQA 4M00A 2HWB1 4CEYA 1R1A3 2ORZA 5IVCA 4OULA 1ZZ8A 4XAEA 2ZMKA 1A8MA 4F83A 1HKDA 2XLAA 1ULFA 3ZYRA 4FAHA 1KJRA 1RUJ3 2JX9A 1FMD3 2WABA 1W99A 3VKNA 3WF4A 1IS6A 2YGLA 3AMHA 4COVA 2RVAA 4CUCA 5A1LA 1DBNA 3VD5A 1R081 5FP7A 4NPMA 3O1SA 3LSDA 5L9RA 1NCQA 3OSDA 1X7NA 2H6BA 4QHZA 4E9KA 5CISA 4ATFA 3POFA 4XUTA 4EN7B 2VQUA 3ASIA 3OCPA 1RVF2 1GZ9A 2QQMA 2TNFA 2D6LX 1CIWA 1G86A 2IXHA 3AMPA 3O7OA 4HSLA 4QX0A 4YW3A 5KHJA 3AZVA 1Q8QA 5L19A 4D6SA 4EE2A 5GLWA 2EXJA 4MUVA 5TSWA 3BYWA 2YBSA 3FL7A 3O0XA 3LZZA 2O8OA 1RVF3 3U37A 5A6XA 4IEPA 4Z2WA 3WEZA 5IYYA 2WNUC 2BERA 2XGXA 2J42A 4UBGA 2BDRA 4CCNA 4A41A 2DU1A 5FBJA 2ZEWA 4CEYB 5F5CA 2PLV2 1S0DA 5FLHA 5C3RA 4PBOA 5FYYA 5LEJA 1IG3A 1ZYBA 3OBZA 3MBWA 1JOBA 2WRAA 3RPQA 4IUGA 3TAYA 1DYPA 2Q8CA 1WZXA 3VZKA 5GZFA 3RZGA 2LRPA 2OPWA 2PAEA 2PLV3 5C8CC 1SFPA 1IS5A 1QNWA 2ZHLA 4YG0A 1ULDA 2UU8A 4DEVA 1EV12 2W08A 4YVWC 5EYXA 3WNXA 5JCTA 3AKSA 3SITA 1HIXA 3Q8FA 3WOGA 2YPJA 3QBQA 5BNQA 3I2OA 5I0UA 3I3EA 1AXYA 1EV13 4BU2A 1W90A 4Q0UA 1MZ5A 3DPRA 1LOCA 1L3JA 1LEMA 1W04A 1XBFA 4EYUA 2AEYA 5JI9A 1AYM2 4BK5A 3JCIA 3V0AA 3MLJA 4DY3A 1YIPA 2RDSA 4AEKA 3A0NA 3TEZA 4LO6B 2BNMA 4QKDA 1LULA 3WG4A 1NCRB 4JDNA 3ES1A 2WQ8A 4Q4Y1 2VCAA 4XACA 3RS6A 5F3IA 4YRDA 1W0OA 5FYMA 1AYM3 3WNOA 4MH0E 3MHZA 1SEFA 4O9EA 2DUQA 2UWBA 2BU9A 3AMMA 3PVOA 5T3NA 3W21A 4ES8A 4YPJA 4DUVA 3O1TA 3KGLA 1LRHA 2I45A 4P5HA 5FK7A 2JWPA 1PMIA 1UPIA 1Z7S2 5LBEA 3T2OA 1VBA2 2ENRA 2XJUA 1CAXB 4GH4B 3GZAA 4IEUA 1PM4A 4QHBA 1HV1A 4AK3A 1XNTA 4K1ZA 5C9AC 2VBDA 1MVQA 5CKQA 2UWAA 1AVBA 1GMMA 1CD3G 2VQTA 2NPIA 1Z7S3 4YZ3A 1NXD1 1PVC1 1V6OA 1YHFA 4Y4YA 1VBA3 2WZR2 5FZLA 4R9BA 2K2SA 1UIJA 1KEXA 2DBNA 4A45A 4CPBA 1JZ2A 2PA7A 1QF3A 2HBUA 3WP5A 1OH3A 1RJ7A 4YW2A 3RNSA 3ZXEA 3LIHA 2WZR3 3NAPB 5JSRA 1H4HA 2PAMA 5D8AC 4EJRA 5JUVA 1UY3A 4X8PA 3HOBA 2ZEYA 1V6MA 5BPXA 2EAKA 3AC0A 1G9FA 2A73B 3V0AB 1Y9QA 5KWRA 4IE5A 4CDWB 1HQLA 3LFMA 5JIAA 5BNNC 3UYJA 2QQVA 3T1MA 4LO7A 3HPNA 1S0EA 4EROA 4NAMA 1YJLA 3GDBA 4QPWA 3VBUA 3AX4A 2JE8A 3HBZA 5GZCA 1WD3A 4YGCA 1DHKB 2ZEXA 4HMZA 3CJIC 2D3SA 1UX6A 2QZ3A 3A4UA 4PDWC 4LA3A 3GHNA 5IAVA 3VBSB 4W50A 3N4MA 4DRRA 2XUMA 2J1EA 3POGA 4Y22A 3AYCA 4PLNA 2XHKA 4A7KA 2VMDA 2CWMA 1NUKA 5ACA2 3B01A 1JYWA 5CG9A 1MS3A 2RDRA 1ZRRA 1RYYA 3BB6A 4L8QA 4WM7C 5DDJ1 3U4SA 4AFAA 4NWVA 5A3UA 4NROA 1O5UA 1BXHA 4Y33A 1QDCA 3H42B 4Q0SA 5ACA3 4MX3A 2FDIA 4YVSC 1GP6A 2MNGA 3B5LB 5K0UA 3OB8A 3MUY1 4MLOA 4BHPA 1UWWA 1GNZA 2YC4A 1PHMA 4HVQA 3VDAA 2RS12 5JOZA 5KXBA 3FLPA 1X82A 3KQ4B 3WP6A 3DYPA 2FQPA 4S2DA 3A0KA 4OMCA 2XG3A 1PO22 1SMVA 3NNLA 2KXLA 4FSJA 4H3WA 3VBUB 5F5IA 1V6NA 2RS13 3FFZA 3M7AA 3NO8A 5ANQA 1R091 1KDMA 3GM8A 1QMJA 4QKNA 1FI2A 1YQ5A 2PAKA 4QPGC 1PO23 4BISA 3AJYA 4N7IA 1UKRA 2HEYF 3OGGA 1XYNA 3ZYJB 3ZSKA 2XBO2 2K0GA 1SPPA 2XUEA 2YG0A 3K75B 4QT6A 4LOTA 5SV8A 2OZ6A 3ZFEB 4AGGA 2HWD1 4RGGA 1UZWA 2IFRA 1FYUA 4NO4A 1GZWA 3ZSEA 2XBO3 4F7ZA 3LF7A 4RS5A 5GZGA 4Q1PA 1W9YA 4MGYE 1O4ZA 1R64A 5DUWA 3VHPA 4BM8A 3PMSA 4A3XA 3TYJA 4BJ0A 1BJQA 2HWC1 1Y4WA 4M4PA 4BQ1A 2DUPA 4YW5A 3FJSA 4NRMA 1ZNPA 5FZAA 4K3UA 5B4NA 1MZFA 1OFNA 5FZMA 1OA2A 1NOVA 2PHUA 3BTAA 1OD5A 4U36A 1C8M2 4A6SA 2VE1A 1JODA 3ZFGC 3V0BA 1NY72 2H6CA 1ZBA1 2VO5A 5M0TA 2RDQA 4DPNA 5BNPC 1I1EA 3I2KA 1DZQA 1LOBA 3MF9A 4AI2A 3ZO0B 3O1VA 2W92A 2UWCA 4JTOA 3ME2A 4RYDA 1JZ7A 3SEEA 2E7QA 1AUYA 4ZONA 4ARXA 5A70A 1I5ZA 3GXUA 1EYBA 1GZWB 5EZWA 4QGNA 4XF1A 4CCJA 2PELA 4X6RB 1OXCA 4R8HA 4XETA 3PLQA 1AX1A 1YCIA 2VNRA 2WNEA 1POV0 2W2IA 4MGZE 1REDA 4Q4X1 3RWKX 5J37A 1DLLA 1AR61 1V00A 5L9BA 2RMU2 4WBBA 1JYCA 4IV1C 1TME1 5FK8A 1O59A 2E51A 4RQPB 4YG3A 3APBA 1RUF1 4LO4B 3AZXA 3ROUA 3H7YA 3UK9A 5CAZA 1LOAA 5J3UA 3H8XA 2B7YA 1ENRA 4ASMB 3BIWE 3FBYA 4XFCA 3CLPA 3LIGA 1Q56A 4UW5A 2V73A 2Y6JA 1FPN1 4CCKA 1D4VB 5DAVA 2YZ4A 4XTMA 4QX7A 4CDUC 5C33A 1RUC1 5A3PA 1BMV1 1T6BX 1ASJ2 2FMDA 4Y1YA 4B7KA 5C7GA 5CKNA 2CDPA 2R0HA 2ID4A 2Y0OA 3K2OA 1W0PA 3KB5A 4IGQA 1D2QA 4TN7A 2BP6A 4HK9A 5BNOC 3HQRA 3MI8A 1K5MA 2ARBA 1ASJ3 4R9CA 5A7QA 2B9UA 2B46X 1COV3 3CZUA 4JVAA 4LBMA 1QQP2 4SLIA 3VBRC 4AVCA 2BEOA 2W91A 2BUKA 2D6MA 2E26A 2GN7A 4B1LA 4C1XA 4DS0A 4LIVA 3DN7A 4UW6A 3WF2A 4FP3A 2QFEA 2BFUL 2PHTA 3I59B 4W4ZA 4NIGA 4PIYA 4XJWA 4J25A 1G6NA 3C8XA 5CNAA 3RDIA 4E4SA 3HNYM 1CZTA 5FPBA 1NQDA 2RS31 2ZX0A 4XUQA 1AR71 1SLTA 4EQVA 5FZEA 2QQPA 3LD8A 4AHYA 1ND3C 2G9FA 2J1SA 3OGVA 1W05A 3AK0A 2QVSB 5IFPA 4QGLA 3WDUA 3MIHA 3TEXA 2WS92 3FMGA 4E4ZA 1RUH1 2YFUA 1AL21 1F4AA 3KGZA 4GMP1 3IZOA 2JE7A 4MG2A 3AMQA 2IXKA 4SBVA 4C0HA 1OUXA 3WDXA 5FZFA 1VMFA 4NPRA 4ZU7A 2WS93 2D93A 4B1MA 3ZYBA 2AREA 3HIFA 4AYUA 5F5AA 1CGPA 3OY8A 2BGOA 1W8OA 1ZX5A 5JR2A 3GBGA 2JB8A 2WR9A 4HN1A 3I49A 4HL0A 2RDNA 5GZDA 1FXZA 2R041 4FPLA 5DUUA 1GLHA 3H8OA 5FZ9A 3I2DA 5T5JA 1JXNA 1N1YA 1W8TA 5HCHA 3MUZ1 4MGIE 3UGGA 3Q8AA 3D0SA 4FVVA 1WWYA 2WN2A 1GYKA 1O5LA 1STMA 3ALQA 3A22A 1HB3A 4H7LA 4XF3A 3TNPB 4K1YA 3WG2A 4N43B 2O8QA 3P6BA 3VBFC 1A6CA 3S0MA 2I07B 4MGKE 3WUDA 1QJEA 4ZXEA 3F2ZA 3POBA 4OYUA 4BQWA 4WM8A 2G1MA 2B45X 2CAVA 2A3XA 1J3QA 5L36A 1BZWA 3LGRA 3W20A 3N36A 1AR93 2A6YA 4XEZA 1GWLA 3T4VA 1UPSA 1WBFA 2NYYA 3IWZA 1G7YA 3B3QE 4PI0A 5AFBA 1UMHA 1W2NA 4L11A 2ZEZA 4FP2A 3PVBB 1BK0A 3KWVA 5LBCA 5FMOS 4XHBA 4KWLA 4LBNA 3LEMA 2EVXA 3SH5A 1LKNA 4Q26A 1JOPA 1PK6A 5FZCA 2A70A 4R4XA 2ADDA 3ZVXA 3DF0A 1W8WA 2JIGA 2DCTA 3JD72 4J6GA 2OVUA 4CUGA 1FMD1 2XKOA 3DL3A 3RZZA 3T4HB 4I2OA 2BNOA 1UF2C 3VZOA 4R52A 2Z5WA 1NZIA 1YFUA 2YU2A 1H8VA 3JD73 2VL4A 3GGLA 2Q1ZB 4UWDA 5C8WA 2CYFA 3IN9A 1E57A 1UOJA 1MQTC 3MV01 1QGLA 4WM8B 5A6QA 2GSYA 3AL6A 3ZPOA 3MZHA 1WLWA 3AZYA 1E5SA 1H8TC 1GR3A 2HJIA 3PHMA 4QD2A 4QWNA 4DMIA 1B35C 1K42A 1NCRC 2LALA 5DAQA 4A4AA 4XQWA 1CX1A 2MPFA 3ZMNA 1S2EA 2PMWB 1MACA 3KT4A 4C8DA 1RVF1 4ZHNA 2ZOEB 1C5IA 5H9RA 3LOBA 1LHUA 3I2JA 2X10A 2WWJA 4OI0A 1D4M2 2D40A 1UY1A 1D0HA 4GH4C 3VUOA 3ZFFC 3WR0A 4CU8A 1HRV2 3JQWA 2VVDA 1RL3A 3LDRA 1TVGA 4MOAA 5EJ3A 1VALA 4LTAA 5I8SA 2V5DA 3H3LA 3O5SA 5FMBA 1OA4A 1D4M3 2VCBA 3CJXA 4YW7A 3WXPA 1HRV3 2WT0A 2ZGNA 3IIIA 4L97A 3AB0A 4N8MA 4ZY9A 1HW5A 5FPXA 2PLV1 3TNQA 2ZA9A 4CPBD 3N9LA 3IBMA 3T0BA 4BMBA 3NAPC 5G05L 3O14A 4P9IA 2UURA 5JPMB 3HQXA 1DYOA 1GSLA 4PHZA 3VLBB 4M3CA 4L92A 5FXVA 1GP5A 1VLNA 1QKQA 4S2GA 4AGVA 2VMIA 1OFSA 1OA3A 1QJU2 2LS6A 4CDWC 1DGRA 1EV11 3M3OA 2VMHA 5F32A 1KQRA 4A42A 5CFCA 2QQJA 2VVEA 2XL9A 2WWUA 3S6PA 1VAMA 3POSA 1LOFC 2ZX1A 1S0IA 1GZTA 1QJU3 2CDOA 2Q0AA 4BK4A 4G3YC 4YFZA 1WW7A 5DXDA 1AZDA 4XFBA 3NWKA 5JOXA 4LKEA 5BYNA 4OLLA 2XQXA 2D7FA 1AYM1 5FDBA 4LOSA 2J22A
chains in the Genus database with same CATH topology
2GNBA 3VBSC 1MS5A 1GNHA 2XJQA 1Y7BA 3TBDA 5H9PA 1LHOA 3AJZA 3OGJA 3U07A 4YARA 5DG2A 4RFT0 4F3JA 4XJ9A 2VULA 5F6KA 4FQ4A 1VP6A 1Z7S1 4Z82A 4WV8A 4I30A 4AQTA 3VBHB 3FBMA 1WLTA 5CFDC 1DQ4A 1G9BA 1SFNA 2VH9A 4JDOA 3H50A 1MS9A 4JGZB 4AVSA 4FTSA 5JVVA 2WZR1 3WQ7A 2VMGA 3DV8A 4Q29A 5KHKA 4K21A 4IEWA 3JBG1 1LECA 3MW2A 1LEDA 3H9AA 1OOPB 5EFUA 3ZX7A 3AKRA 2WINB 1TMF2 2ZKLA 1VBE1 3ZFEC 2IFWA 2FZ2A 1QJY2 3J4UH 4AEDB 4P9JA 5FREA 1ZM1A 4E2GA 1EP0A 4KG8A 3DKWA 5CG8A 1TMF3 1YXWA 2XL7A 1CAUA 1QJY3 3RJ2X 3NL1A 4MZUA 4RHV3 1UN1A 3PMEA 3VDDA 1KS5A 4A7ZA 5JLVA 5A3MA 3LAGA 1WLCA 4I0AA 4JAAA 4M3CE 4FPKA 3M3IA 1H1IA 2P34A 5J98B 4UXAA 4COUA 1N1VA 5IUQA 1AR83 1MEC2 2O0OA 4C91A 1YFWA 3I7DA 4YZ4A 3O0WA 3MDPA 4MV2A 2O1QA 2GDFA 3HT2A 3N3HA 5ACA1 4LHNA 5D1IA 2ZHNA 3NJZA 1MEC3 1CJPA 1H0BA 3U4XA 3AP7A 4QQOA 1RUOA 4GQ7A 4KNCA 3D82A 1M06G 3R05A 3AYAA 1F31A 2DVFA 1DQ6A 1O4YA 1XXNA 1IKPA 1YI9A 4HVOA 1C3HA 1EAH2 4RR3C 1NXMA 1JHNA 4F8AA 3WG1A 1WCSA 5CBLA 2RS11 4YGEA 1CAUB 1N1TA 4N53B 2GMPA 1EAH3 4RSUA 1PGL2 1O7FA 4JTNA 3VDDB 3G6JB 1O3RA 4IETA 1BK1A 2LUWA 4TWTA 3N7LA 4YM1A 3UKTA 5CA6A 5AVAA 1XYPA 2XBO1 3BOPA 5L7OA 4S2HA 4RQPC 1IZ3A 4AI0A 4FT8A 4BCUA 2NMNA 5BUVA 4Q4W2 3U0ZA 2BNNA 2W68A 3MW3A 3WDWA 2JG9B 5AC92 2D3RA 2QCSB 1HRI2 3WCSA 1IKQA 1H1MA 3NV2A 4Z8BA 2DFBA 4ZU4A 4Q4W3 2YUEA 5A32A 3OTFA 4COZA 4PBPA 2X5IA 5AC93 3H1MA 2MHFA 3RWNA 2A7AA 1HRI3 5T5OA 3QCWA 5JPNB 2BBVA 3WV6A 2ZGPA 3AP9A 3O0VA 4K9SA 4WVVA 1YYNA 1C8M1 4AVAA 1Q8SA 5C4WB 5I91A 1NY71 3RQ0A 4AVVA 3NKGA 2NLRA 4IV3B 1RUJ2 3VZJA 3JUUA 3D4KA 4LBKA 2WQZC 5DXDA 4QPIB 2C5DA 2VPVA 4P14A 2PHLA 4PQ9A 4U2AA 5F6LB 4JGYC 4N90A 1WBLA 1ZZ9A 2DUOA 4AEMA 4MYEA 5CADA 1LOEA 5L7OB 3B02A 4XBNA 3SCGA 1ENXA 1UU6A 1OQ1A 4JC1A 2VU9A 2GC0A 3MPBA 1W6MA 3IPVA 4Q0PA 2VXRA 3OJBA 2VUJA 3KZ4C 4WVMA 3RYKA 2VOVA 4EN8B 4TSVA 5A32B 1J1LA 2RMU1 2X5IB 4OHZA 1AXZA 3N35A 1S2BA 2OIIA 2ZX3A 1VB4A 4P9LA 1YFYA 3H8UA 4EV0A 4YZ1A 3HN1A 3THTA 4GWNA 4CDQA 1PGW2 2JG8A 2CGOA 2RHPA 2WFF3 3UJQA 1KFUL 4C90A 5H9SA 1WW4A 4I01A 3VGIA 1JUHA 3KCCA 1LGNA 4D7SA 3HWJA 2H0VA 1PZ9A 1QOTA 1DGLA 1ASJ1 4AHXA 1SQ4A 4MXWA 1FATA 5DG1A 1QH6A 4P9GA 4N43C 4LULA 1QQP1 3B7MA 1NCQB 3IPVB 5FRAA 4R4ZA 1PVXA 3KM5A 3ES4A 3KQRA 4WVMB 3ZSLA 5KBFA 3FWEA 3G7DA 1OI6A 4Q2FA 2VNGA 2WZPP 1HQWA 1HLCA 2NMOA 2Q4SA 4QQHA 4ES9A 2A3WA 4K7JA 1VBB2 3B9CA 2V5YA 4EWEA 4CDQB 1OLQA 2XJTA 2X29A 2BYVE 4LLOA 2JG8B 3CF6E 1O3QA 4DXZA 2OW4A 3CEWA 1ND2A 1VBB3 1Z0HA 4AG4A 4ASLA 2WS91 4ZKTB 2V09A 1RUE2 5BV6A 4FPEA 4XMIA 2ZHKA 2BFUS 3L9JT 3U11A 4MXWB 4I0WB 2GN3A 3MIFA 3WT3A 1RUE3 3Q9OA 4E2QA 1ALYA 1RB8G 2Z79A 1C1FA 3O12A 2KA3A 4XZPA 4IL7A 1A3KA 3WINE 1CAWA 4D69A 4FTBA 3VBOA 1YIFA 3D6EA 3DPRB 1WMDA 2AZ5A 2ZZQA 3FUQA 4BIOA 1MVEA 4HN0A 3PVEA 3V64A 5ABJA 2CV6A 4XBLA 2NZ9A 5E88A 1FV2A 3POYA 1MZ6A 1LU2A 2E7TA 1VR3A 2VECA 1OKQA 1H30A 1V6KA 2CAUA 2QDRA 2WKKA 1PIV2 2VW1A 5AFEA 2TEPA 1G8WA 2Q5TA 1IS3A 5I0RA 3V56A 3DUIA 2D3PA 3VKOA 3WVJA 3ZMOA 1PIV3 4HETA 3AXEA 2GU9A 1Z78A 2XH6A 1DYKA 3FLRA 4XJ8A 4Q0VA 2A3YA 2JDZA 5HCFA 1CAWB 2GMMA 2EALA 3D5OA 5GZEA 3W9AA 2VW0A 4EN9B 2IZWA 1SDWA 3JD71 2K9ZA 1GQHA 4OVEA 5K7PA 5JZGA 1SLIA 4IEOA 3MF6A 3I54A 5T52A 5JDBA 1U5YA 3M4FA 3AKQA 5JWPA 1NLRA 1QXJA 1BKZA 4MVTA 4OHYA 3KCXA 3ZYIB 1SBDA 3WDTA 4EWDA 1MS4A 4CEWC 2JECA 3AM2A 4AVTA 1VRH2 3PVNA 1WCDJ 2LTNA 4Y1XA 3N7JA 5F9TA 1FT9A 3GF6A 2YROA 3LOIA 1W6QA 5IK7A 4W6YA 3JB8A 2DV9A 1VRH3 3QLQA 3ZYPA 3M8LA 4Y22B 4Y5Z0 3S7EA 1D4M1 3FUOA 2WNVA 5GALA 3VBHC 3ATGA 3L2YA 1HRV1 1CAVA 3E6DA 5A33A 4QQ2A 3QACA 4JGZC 4N9IA 3VKLA 5J96B 4PF5A 1YI7A 4I3GA 1A8DA 2G4IA 4RGAA 5K0UB 5HCBA 2UY9A 1B09A 2ETEA 4M0HA 1WMEA 2KM2A 1IPJA 2XKPA 1OOPC 2WLPA 4XQDA 2XJPA 4LHKA 4LBOA 2P3KA 2GAUA 4AEDC 1ENQA 4AQ6A 4COWA 3WHUA 5A3LA 5KXDA 2R073 5IK4A 1QJU1 3ILRA 1LGBA 4AW7A 1XNKA 4KGQA 2ZX2A 5K8SA 4FOYA 1JUIA 1X8EA 3TRSB 1UZZA 1H9WA 4KQ7A 3VKMA 3JU9A 3EBRA 3PNAA 1Q3EA 4XTPA 3VKFC 4LBQA 4WZCA 5B2GB 4IEQA 4RS5B 1CAVB 5A33B 1APNA 5SV5A 3W58A 2OZJA 5GLUA 1VBD3 4AFDA 3KT7A 1WGPA 3TOJA 4KWKA 4OUSA 2WJSA 4YGBA 4HANA 1EPWA 4HK8A 2EXIA 3HR9A 1OHFA 3WHTA 5KC6A 1HDKA 1V70A 4AE2A 1LESA 1EPZA 3BCWA 5EYYA 4LHLA 4BLIA 4NR1A 2Y38A 1YRZA 4BPZA 3V0BB 1SCRA 1ZREA 1JN2P 3KLSA 2HWF2 4Q0QA 5JSOA 1A78A 2D43A 4YYOA 4GIQA 3E6BA 4N53C 3B69A 4LT5A 2ES3A 1OMIA 1COV2 3VDDC 2HWF3 1TMF1 3FLTA 3VHNA 4YM3A 5GLTA 3BOWA 2IXIA 1XQNA 4HKLA 1QJY1 1MZEA 4JQRA 3QH6A 1TE1B 2YYOA 3QH7A 4GKYA 1LGCA 4WZFA 3LWCA 5I93A 1S0CA 2ZCWA 2JJ6A 2MEV2 1XNCA 4META 4XMAA 4YG6A 1ZZ7A 1V6IA 3ZXDA 2Q1MA 2JG9C 4AQSA 2I74A 4FO9A 2DCJA 4HPKA 4OI4A 3ZSJA 4Z2WA 2MEV3 1CJDA 2DWRA 2WSVA 3ZXLA 1V6JA 1KRIA 1HQNA 2DYCA 2WNUA 3HD8B 4IERA 1PGSA 1MEC1 1W6PA 3SH4A 5EV7A 5FBZA 4KL1A 2VG9A 1SLLA 5C4WC 3V65A 1IPKA 4IV3C 1RUG2 5FOJB 5C8CA 3LA7A 3RYPA 5IT6A 4HLTA 1K5MB 4QPIC 1GKBA 2B39A 4W65A 1EAH1 5FPZA 4YVWA 1RUG3 4QM9A 4W6WA 1VBC2 1VAVA 3WCRA 1H2LA 1DZRA 1XRUA 3VZNA 2P37A 1PGL1 4YGDA 5BNOA 3FC0A 4XIOA 1J1TA 4IEZA 5DZGA 1VBC3 1D2SA 2DVBA 4HPKB 4WVWA 5DUXA 1ULCA 3NV1A 3OF1A 1DIWA 1CPMA 1PVC2 2B42B 3R4DB 2WNUB 1AR92 4AHZA 4K8FA 1O91A 1MS1A 1UCXA 5KXCA 1PVC3 1Q8VA 2YGMA 4Q4W1 2OUJA 5T5PA 5AC91 2F4PA 4K6BA 1H4GA 4ORFA 4CEYC 4XF0A 1QDOA 3OY8B 3MIDA 4IQPA 4XFAA 2P17A 2D5FA 5E1RA 2VOKA 4LNVA 4YVWB 5KC5A 1SBEA 5H9QA 4C1WA 3CU7A 3ENRA 1R1A1 3HT1A 4DFSA 5JIUA 1BYHA 2CY6A 5BNOB 5D8AA 5E89A 4C0BA 1RUJ1 2A5ZA 3R4UA 1NCQC 4MSVA 4GULA 2ZMLA 3VL9A 3VZLA 4DNYA 2ZS6B 4YZ5A 4XF4A 1PO12 1SACA 4HSJA 2BQPA 4AFMA 5BNNA 5FO9B 2D5HA 2XLFA 2BGCA 1PO13 2YV8A 2ZZJA 1TQ5A 4PLMA 3CJIA 5T50A 5AVPA 3ZDSA 1W6NA 3SMHA 3I4IA 4PDWA 2A6ZA 3WG3A 1KS4A 3WQ1A 4CP2A 1QOOA 2PFWA 1UD1A 2DU0A 2WWSA 3N7KA 2IXJA 2E6VA 5EWSA 1PK6B 4WM7A 3E5XA 4I02A 3H1WA 1PGW1 1C57A 5D8AB 4XE9A 1J3RA 4ONUA 4FTEA 4YVSA 1NE6A 1REFA 4KU7A 4KGGA 3MLLA 1UAIA 2A71A 1ZRFA 3LSEA 3EJKA 4Y24A 4L99A 4AI1A 2DFCA 3DPRC 4H55A 4BMEA 5BNNB 3RRDA 5CIRA 4TZDA 2F6BA 2OPKA 2D98A 4XXAA 4AGRA 2ZGTA 2JD4A 1LB2A 1W2UA 3CJIB 4OHWA 1HX6A 4QPGA 1UIKA 5LRRA 4H14A 3CO2A 1W6NB 3EHKA 4PDWB 4HT1T 4AEJA 2SBAA 3TWIA 2E63A 1RINA 4CDXA 1ZZBA 1KDKA 2VQ0A 1W6OA 3AFKA 5HCAA 4URTA 4XFFA 2HWC3 1LR5A 3N7MA 4LLFA 4WM7B 1VBB1 2DF7A 3E5QA 4AWDA 1SCSA 2PHWA 1LHWA 1S2KA 3ZXKA 2HWE2 3E97A 5GJ6A 2E9QA 2WLQA 1TEIA 3J8F2 5IK8A 4XFHA 1ZBA3 1JYIA 1RUE1 2HWE3 2D44A 1VBA1 1ZRDA 1AJKA 1OQDA 1NG0A 2ZGOA 4FQZA 3H3UA 3J8F3 4M3CB 3ZFGA 1AL0G 4ATEA 4I3PA 3UKNA 2IWGB 5BNPA 2YMZA 5CFCB 4Y20A 4FAGA 3MIEA 3VBUC 2AH2A 4QXKA 4CDXB 4R9DA 1W6OB 2R062 1AR63 2OUHA 2D97A 4HBNA 1ZZ6A 4RHV2 1QHDA 5JI7A 3USUA 1PNFA 2R063 1ULGA 2GC3A 2GC1A 4MXVA 5JSPA 2ZKNA 4LE3A 3EXUA 5I8YA 1AXKA 2PN5A 1JBCA 1PIV1 2XWJB 4GB32 4IV1A 3POWA 4TLFA 4TYSA 3SCHA 4AFAA 1AR82 4EN0A 1G9DA 4FPFA 3KCYA 4FBFA 4GB33 5K0UC 5LK5A 3ZFGB 2GH2A 2R1DA 2P3IA 4UBHA 5DZFA 5GM0A 1DZTA 3RMXA 4XXPA 1F5JA 1J58A 1J59A 4CDUA 4Y20B 4A7YA 4XOGA 3LA3A 4AXOA 4A2UA 3AKTA 1KITA 3H0OA 3EO6A 2XJRA 3M70A 3VBRA 1WW5A 2ZACA 2QE3A 3FZ3A 5DUVA 3USUB 5F1RA 5LEKA 5J09A 1EY2A 3OYWA 1AYN2 5JR7B 1RHI2 1PO21 1NLSA 3GBFA 4DINB 1RUNA 4RS5C 1CX4A 4YSFA 1WCKA 4LBQD 1AYN3 1VRH1 1RHI3 4XILA 5GKAC 2C0ZA 2ZAHA 4AVBA 1ND3A 1IQAA 2VOXA 1NYWA 3H3ZA 3ZXAC 1Q5OA 1GQGA 2R042 2HYKA 4AF9A 3PTYA 4CZSA 4DQAA 1RUD2 3C2UA 4LE4A 3LA2A 4LO8A 2Q30A 3SNMA 2R043 1ZVFA 1HV0A 3ST7A 4IEYA 1RUD3 2EF6A 4S2FA 2EA7A 1FX5A 4Y1VA 3SXWA 4BOWA 2BVBA 1JOJA 4ZXKA 2EAAA 4GXLA 1QY4A 1JW6A 2DCYA 3BPZA 2A75A 2SLIA 1N3OA 2YDEA 1XU2A 1O3SA 5CB7A 2UY8A 1CONA 1U5XA 4Z07A 1DQ0A 3VBFA 2FZ1A 4HFSA 1FOD2 3S30A 1YUDA 3IT8A 3M3CA 3FHIB 1FOD3 1RMU2 1GANA 1WW6A 4IEXA 3J9SA 1ZRCA 4FPHA 1TNFA 4XW3A 3HAGA 1Q8OA 1RMU3 5EXOA 5BXXA 1ZBE2 4CTEA 4BWOA 2WFF2 4NHLA 3R0RA 2ZGUA 2ZGQA 3P3PA 4PJYA 2BVVA 5JPMB 1ZBE3 1AHSA 3VN4A 3RYRA 1K5MC 4W6XA 1CR7A 5E8AA 1BQPA 2TBVA 3RI8A 5I8TA 4P9XA 1C8NA 5FCCA 4COYA 2HWF1 1NA1A 4YW1A 1DQ2A 3VBFB 2JENA 1COV1 2BTVC 1MQTA 5F5QA 4OUMA 4ISRA 1H8TA 3AP6A 4G4FA 3INAA 3ILNA 3OD4A 1B35A 2P3JA 1NCRA 1W6MB 5I0TA 2R16A 2NQYA 3J26N 4BZ4A 3NV4A 1CN1A 4Y26A 2MEV1 2RR12 3SH3A 3VHRA 4XIKA 4Y1UA 3MFCA 1POV3 1CAXA 4GH4A 3ZFFA 2HEVF 3K51A 2ILMA 2RR13 1FNZA 3ACLA 5FLIA 1DQ1A 2DVGA 2JKBA 2EXKA 2VOWA 4YLZA 3ZN4A 2WT1A 3ETQA 1QJX2 2DTYA 2ARXA 2XLGA 2Z69A 3MLKA 3AXDA 4EWAA 4XDQA 2RM22 3ZXJA 2ZBJA 3ZIWA 4XBQA 4L2NA 1N1SA 1NA1B 2QZ2A 1QJX3 2R6QA 3AKPA 3E5UA 3NAPA 2RM23 3ELNA 3JZVA 2PHRA 2OYZA 2Y26A 1BBT2 1QNYA 3RG0A 3UJOA 5BNOC 2JE9A 2RJKA 1RUG1 1MQTB 3FE5A 3NW4A 1IGOA 2VUAA 1U12A 3PJQA 2ZHMA 4B3NA 4I09A 1H8TB 1FV3A 1UMZA 1BBT3 4CDWA 1B35B 3LKJA 1VBC1 1LOFA 2VQAA 4WM8C 2B8MA 1H1AA 2DVDA 2PYTA 1XYOA 3IKWA 1LOGA 2N7GA 4Z92B 3ZFFB 2IXCA 4B7EA 2CNAA 3VBSA 4FPCA 1N47A 4LA2A 2P2KA 3JQXA 1AR91 5IK5A 2EIGA 2GC2A 1ND2B 4BH9A 3NKTA 4GMP0 1PK6C 3AZZA 4HZFA 3JBG2 1ONAA 1SBFA 4KG0A 4CP1A 1WUVA 1H2MA 4QGMA 4JRLA 4B29A 3WZ1A 5KHIA 1VBE2 4ITCA 4XHXA 2R32A 3JBG3 5CFDA 3WW4A 2ET1A 1VBE3 1NE4A 3CNAA 1YWKA 5FO7B 4BLJA 3IIAA 4GWMA 2CTVA 4YM2A 3VBOB 4INDA 1RC6A 1Y3TA 5CU1A 3ZFEA 1CVNA 1YNAA 2FBEA 4KBBA 5ABJB 4BA6A 4J1WA 2WA4A 5BY5A 4NWWA 2ZJCA 3KSCA 1PO11 2WQ4A 3THPA 2ZTNA 1V9U2 1ENSA 5JOWA 3R6SA 3BU7A 2ET7A 4H7MA 3TN92 4Q4V2 1IHMA 1RUI2 1V9U3 1HXS2 5CFDB 4X6QB 3TN93 3KD4A 4Q4V3 1UU4A 1H2NA 1KXGA 1RUI3 4FPYA 3U10A 4XYXA 4KWJA 1HXS3 3B94A 1Y43B 3ZYGA 2GZWA 4HKWA 2X8KA 1S1AA 2QUOA 5JZGB 1VB2A 5CFCC 4YZ2A 1OPOA 3WQ0A 4I0BA 4WVZA 3RSJA 2CWSA 3SLIA 4RR3A 2YC0A 1AX0A 2W0XA 2R072 4XJAA 4CDXC 4QMAA 2HEWF 3FX3A 3WDVA 4JRAA 4AFBA 1H2KA 1YO8A 2QJVA 3MGUA 1AJOA 3GZUC 4N7UA 1BEV2 2ZX4A 3ZXGA 2DCKA 4Z1VA 1G9CA 1W6QB 3WD5A 1URXA 1BVVA 1BEV3 1J3PA 1VBD2 4P9WA 4RQPA 3ZSMA 4DZGA 2RS52 2WNVB 3ZN6A 2YXSA 1LODA 2DVAA 3PJYA 1S0BA 4Q8LA 3WP3A 1DF0A 4JDMA 2E53A 3GALA 1I6XA 2RS53 1IOAA 2VW2A 2HWE1 4LBJA 1U5ZA 2HWB2 4LO5B 2GALA 1C8M3 5HBAA 2RJLA 2WSUA 4OFGA 2ZMNA 3J8F1 3ECQA 4RR3B 3RMYA 1DFQA 1UKGA 2HWB3 2FMYA 4DRVA 2Z2SB 1R082 2DTWA 3GBWA 2A6WA 1RJ8A 2YY1A 1S0FA 4RA0A 1H9PA 4UW3A 3ZIXA 4D7YA 3IDBB 1GV9A 3I59A 1R083 4D3WA 1DGRN 4JGYA 1PZ8A 5FLJA 4OHVA 4DY5A 1BCXA 2QDNA 2R061 4LBQB 3ZN6B 2PHFA 2RMU3 5FOBB 4RHV1 3H7JA 3IM0A 1F8VA 1CPNA 3TB0A 2AGSA 1O4TA 2XB6C 2LM3A 4FOQA 1OQEA 4GB31 2CGPA 4B4QA 1YLLA 1AR81 1U0AA 1LENA 4B8EA