5BNNC

Crystal structure of human enterovirus d68 in complex with 6'sl
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
247
structure length
247
Chain Sequence
GVPTYLLPGSGQFLTTDDHSSAPVLPCFNPTPEMHIPGQIRNMLEMIQVESMMEINNTDGANGMERLRVDISVQADLDQLLFNIPLDIQLDGPLRNTLVGNISRYYTHWSGSLEMTFMFCGSFMATGKLILCYTPPGGSCPTTRETAMLGTHIVWDFGLQSSITLIIPWISGSHYRMFNSDAKSTNANVGYVTCFMQTNLIVPSESSDTCSLIGFIAAKDDFSLRLMRDSPDIGQSNHLHGAEAAYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Capsid protein VP1
publication title Sialic acid-dependent cell entry of human enterovirus D68.
pubmed doi rcsb
total genus 42
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5bnnC00
1VBE3 3VBHC 5CFCC 5K0UA 1RUF2 5JZGB 1VB4A 1TMF2 1RUE2 1TME2 5BNPB 1RUH2 1K5MB 1VAKA 2Y26A 2HWC3 1AR72 5K0UB 4WM8A 4WM7C 1MEC2 4YVWC 1ASJ3 1RUG1 2WLPA 2MEV2 5D8AC 1QJU3 1VBC2 3JB4C 1PVC1 3VBOA 3J8F1 1PIV2 1HQNA 4CDXA 1NA1A 1HRI1 1X36A 1BEV2 2RS12 4WM8B 4N53C 1AYN3 1POV1 2XBO1 1PO11 1V9U2 3VBFA 3VBOB 4Q4Y2 4Q4X1 4CDXB 4CEYA 1NA1B 1RUD3 1QJU1 4PDWA 1FOD3 4RS5A 1R091 5AC91 2FZ1A 3VDDC 4CEWA 1OOPA 1VBD3 3VBFB 2WZR2 1AR92 5ACA3 4GMP3 4CEYB 1NG0A 1QJY1 5JZGC 4RS5B 1RUJ1 1BMV1 4CEWB 1OOPB 1RUC3 5BNPC 1AYM3 1FOD1 1ZBE2 1AL0G 2IZWA 1VBD1 4QPGB 5ABJC 2R073 1Z7S3 4GB32 3DPRA 3NAPC 4RHV2 1HXS1 2BBVA 3VBSB 5DDJ1 2GSYA 2RR12 1R1A2 2PLV3 1AYM1 2WFF1 1FMD2 1FPN2 3DPRB 1ASJ2 1ZBA1 4AEDA 3VBOC 4IV1A 4Q4W3 5FMOL 1VBA3 1RMU3 4CDXC 1PO22 2WS93 4YVSC 2GH8A 1VRH3 2RMU3 3ZFEB 3JBG1 1RHI3 4AEDB 1RVF3 2PLV1 4IV1B 1WCDJ 1NCRA 1RUF1 1BBT2 4RS5C 1TMF1 4Q4W1 1E57A 3JD72 4CEWC 2WS91 2HWE2 2RMU1 1NCQA 1NCRB 1RUI3 4JGYA 1RHI1 4QPGC 1VBB3 2MEV1 4LLFA 4RQPB 3VBRB 1ND2B 1RUG3 2BFUS 5FMOS 1EV11 2RS52 3VBSC 2HWF1 5CFDB 1NCQB 1GFF2 1QQP1 1QJX2 1PVC3 3J8F3 4Q4V1 3ZFFA 1HRI3 1ND3A 1RUI1 1Z7S2 4CDQA 4Q4Y1 4GMP0 1C8M2 2R063 1VBB1 1POV3 2XBO3 1PO13 2RM22 1NY71 2X5IC 4Q4X3 2RS33 3ZFFB 3ZFEC 1ND3B 1F2NA 4GH4A 4CDQB 1R093 1AR81 1PGW2 5AC93 2BPA2 5BNNA 4N43A 1D4M2 5C4WC 2R061 3ZFGC 1MQTA 4QPIC 1VRH2 2HWB3 4GH4B 2HWD2 2ZZQA 1QJY3 1A6CA 5A32A 1RUJ3 1H8TC 1ZBE1 1PGL1 2RS31 1RVF2 5BNNB 4N43B 1EAH2 3CJIA 1MQTB 4RQPC 3VBUC 4RHV1 3VBRC 1ND2C 5CFDC 2HWB1 1NCQC 1R1A1 2ZAHA 4PDWB 1HXS3 3CJIB 1R081 1FMD1 5DDJ3 2R041 1FPN1 2TBVA 1QJZA 1HRV3 3LOBA 4EJRA 1M06G 2WFF3 4FTBA 1K5MC 3FBMA 1ZBA3 4CDUA 5K0UC 1SMVA 1VBE2 1AR63 1PVC2 5BNOA 3J8F2 3ZFFC 4RR3A 3TN93 4CDQC 1HRI2 3HAGA 1AL21 4RFT0 1HRV1 3ZXAC 3JBG3 2XBO2 4WM8C 1BBT1 5C8CA 2HWC2 5FOJB 5BNOB 4RR3B 4FTSA 1RUF3 3VBHA 5C9AA 4GH4C 2HWE1 1QJU2 1TMF3 2BFUL 1AR61 1TME3 5AC92 1COV1 1NA1C 1RUH3 3TN91 5C8CB 4SBVA 1MQTC 1AYN2 3VBHB 5C9AB 3VBFC 2ZTNA 1POV0 2MEV3 2RS51 4YVWA 1RB8G 1VBC3 1BMV2 4CEYC 5D8AA 4PDWC 2FZ2A 1RUD2 1EV13 2HWF3 1RUE1 1FOD2 1TME1 1BEV3 1QQP3 2RS13 1OOPC 1C8M1 1RUH1 4FTEA 4JGZA 4Q4V3 1VBD2 1V9U3 1AR71 2DF7A 5ACA2 4Q4Y3 5D8AB 1MEC1 1F8VA 4CDWA 1HX6A 1HXS2 4NWVA 1VBC1 5DDJ2 1PGW1 1PIV1 1C8NA 1OHFA 4JGZB 1RUC2 1AYM2 2QQPA 1BEV1 4JGYB 2RS11 1AR83 1CD3G 4CDWB 1V9U1 5BNOC 2R072 2HWD1 3DPRC 1X33A 3IDEA 1VB2A 1EAH1 5C8CC 1ZBE3 5A33A 2PLV2 2WZR1 1AR91 5C9AC 1NOVA 4AEDC 5ABJA 4GB33 4IV3A 4IV1C 4RHV3 3NAPA 4Q4W2 5J96B 1VBA2 1RMU2 2WS92 2RR13 5A33B 1R1A3 2RMU2 1R083 5ABJB 1FMD3 2R043 1FPN3 1RHI2 4IV3B 1OPOA 1NCRC 3NAPB 4Y5Z0 1VBE1 5J98B 4GB31 1PO23 1EV12 2HWF2 5A32B 4YVSA 1QQP2 4JGZC 2RR11 4Q4V2 4JGYC 4NWWA 2HWC1 1RUI2 1AL23 4CDWC 1ASJ1 1VBB2 1DDLA 1BBT3 5GKAC 4YVSB 1NY72 3JD73 4Z92B 1PO21 1RUG2 2HWE3 1B35A 2XPJA 1AYN1 1AR82 1COV3 4FSJA 1ND3C 4QPGA 5L7OA 2R062 4CDUB 1PO12 1RUD1 2BUKA 2RS53 1B35B 3JD71 3VBSA 4Q4X2 1QJX3 1IHMA 1PGL2 5CFCA 2RS32 2VQ0A 1RUE3 5ACA1 4IV3C 1R092 2WWSA 4GMP1 5BNNC 5L7OB 4N43C 1C8M3 2RM23 1AR73 1MEC3 5CFCB 2X5IA 2HWB2 4WM7A 1RUC1 1CJDA 1QJY2 3ZFEA 1QJX1 1R082 1RUJ2 2R042 1PIV3 3CJIC 2R071 1Z7S1 1D4M3 2X5IB 4WM7B 4N53A 5C4WA 4YVWB 2RM21 3ZFGA 2HWD3 4QPIA 1H8TA 5LK7B 1EAH3 1AL22 1HRV2 4N53B 5C4WB 3ZFGB 3VDDA 2WFF2 4RQPA 4QPIB 2WZR3 1AR93 1D4M1 1RMU1 1VBA1 3M8LA 3VBUA 4CDUC 1ZBA2 3VBRA 1H8TB 1ND2A 1VRH1 1B35C 4RR3C 5CFDA 1AR62 4BCUA 1COV2 5JZGA 1RVF1 3TN92 5L7OC 3VDDB 1AUYA 3VBUB 5BNPA 3JBG2 4Y4YA 3JB8A 1K5MA 1W39A 3S6PA
chains in the Genus database with same CATH superfamily
1LKNA 1ZRDA 4HK9A 3T30A 1RUF2 4BE3A 4XURA 2W39A 3PU3A 4YM2A 3CDZB 4XMAA 1TMF2 3LA7A 1DGWA 1RUE2 3ABZA 3DV8A 1TME2 3PUIA 3WD5A 2WO3A 3FHQA 1EYBA 1K5MB 1VAKA 2XMLA 4GALA 3U37A 1IPSA 1UCXA 4GJYA 3BTAA 4K40A 1WMEA 2WYFA 4CPBD 1W06A 4WM7C 2XJTA 1ASJ3 2V4AA 2WLPA 3B00A 4AHZA 1Q8OA 1HQWA 2RVAA 1V6MA 3VGIA 1Y9QA 4XW3A 3AP7A 1N1VA 3VBOA 1KGYA 1HQNA 3NNJA 2PHDA 2W92A 4B3NA 1W05A 3WLUA 1HRI1 1X36A 2BWCA 2A7AA 1WD4A 2VQUA 3C7FA 4WM8B 4R9CA 3WDUA 1A3KA 1ULFA 1UYPA 3MBWA 2XBO1 1PO11 1MZEA 1VRBA 1Z0HA 3ILNA 2Q30A 3B5LB 2EAAA 3D5OA 3GZUC 1W8UA 2IXHA 5LA0A 1FATA 4AOCA 2ZX4A 4CEYA 1NA1B 5I93A 4PDWA 4QQPA 2FDKA 1VLNA 3LD8A 2QQLA 3B9IA 3N9NA 4RS5A 1R091 4BXFA 3BKZA 2A1XA 4LLOA 3WW4A 2Z4FA 4DRVA 5I0RA 1UY2A 4CEWA 2DVAA 4XQDA 1OOPA 1ENSA 2IVIB 3M3QA 1AR92 4HVOA 4ZXKA 5ACA3 1CAWB 1D0GA 3BTZA 5FZ8A 4XF3A 3VZMA 3RZHA 3HQRA 4DMIA 1JYIA 2JECA 1U0AA 2NYYA 3ASIA 3K3NA 4IE4A 2X09A 4O7XA 4LO6B 5EWSA 1RUJ1 1XYPA 2ZOEB 4YW2A 1D2QA 3AXEA 1I9RA 3I54A 1RUC3 1SDWA 3AFKA 1UX7A 2QKDA 5CISA 1QHDA 3K2OA 4XIKA 4JAAA 4I02A 1XB9A 3H8RA 4N9IA 3ZR6A 2QZ2A 4CP2A 2WIIB 5LWBA 3PUSA 2DU0A 2VMIA 3AMQA 2QUOA 1QOTA 2Y6LA 4NAOA 5FBJA 4XAAA 2P17A 4AHWA 1O6UA 2VM9A 3H1YA 4X6RB 4OZXA 5FMBA 3ZXGA 3RMYA 4CCKA 1NUKA 4NHMA 1MS9A 4NMIA 2RR12 4RA0A 1JYCA 4TLGA 5E16A 3WG3A 1RUOA 4AI0A 4ORFA 3V56A 2PHLA 4IXLA 1BCXA 3BPZA 1FMD2 4CP0A 5CEHA 1FPN2 3N7LA 1ZBA1 5A6QA 1WLTA 3MUZ1 4K1YA 2VZVA 2XG3A 3T0DA 4A42A 1LGBA 2K0GA 5FFOC 2ES3A 1RMU3 1GU3A 2PHWA 2WO1A 4KWJA 5F32A 2EA7A 4GWJA 2NM1A 2GH8A 1VRH3 2RMU3 2D5HA 3OYWA 4YGCA 4IESA 4Y1VA 1NT0A 3D6EA 4FPOB 1EUUA 2A6WA 1BHGA 1UU6A 2PELA 4PIYA 5A7SA 3JBG1 4YGEA 1QOSA 1CIYA 3THDA 5LRSA 5EYYA 2LROA 4YW4A 5G04L 3LE0A 5IVCA 1KS4A 2AENA 3H50A 4YM0A 3VV1A 2GNMA 3DXTA 3ZYPA 4FFHA 1HIXA 2KD7A 1JZ4A 2ZGUA 1LHVA 2IFWA 2VXRA 2WWUA 4L0PA 1OXCA 4Q4W1 1W2OA 3JD72 4AL9A 3HVDA 2WNOA 3LEIA 4QWNA 4C0HA 5LEJA 2O8OA 2WKKA 5LBBA 2NP0A 2JE7A 4HKLA 4P5HA 4COWA 1RHI1 1PK6A 4KH9A 4LBNA 2GN7A 3C7HA 1HJGA 4RQPB 3W58A 3O1OA 2VY0A 3NKGA 2Z69A 1RUG3 1NX9A 1XXNA 2BFUS 1EV11 3B9CA 5FMOS 4BQWA 1G8WA 5CFDB 4QKNA 1UPIA 4W4ZA 4XF4A 1PVC3 3EXUA 3M1HA 3J8F3 3PTRB 1W9FA 3O1UA 3HMYA 2J7MA 2RJLA 2VTFA 1X50A 3ZXLA 3BU0A 4HONA 5KXDA 4D0QA 4HLTA 5JLVA 2B9VA 1POV3 4ARXA 5A3LA 1O4YA 4LUKA 4XFFA 1JODA 4LK6A 4TWTA 2WUHA 5DUUA 2LW8A 3U78A 4PI2A 2Q4SA 2RS33 5F5QA 4ZKTB 2VC9A 3VD9A 1ND3B 1F2NA 1ULGA 3NJYA 4GH4A 1W6NB 1ZZ8A 1AR81 1PGW2 1PMJX 2C9AA 4M00A 1RYYA 4AHYA 2E31A 5BNNA 1SBDA 1F31A 2ZGMA 4L2NA 4YRDA 2Q8EA 2EAKA 1L7QA 3AVSA 5H9RA 2LUWA 3AX4A 3Q8BA 4LBLA 2C26A 5EPAA 3KMHA 4R9BA 1BQPA 1J3QA 1O7FA 2A73B 1A6CA 4YW7A 5BPXA 1ULCA 1H8TC 3JCIA 1A8MA 1PGL1 1TZOA 4ZXEA 2PXJA 3I3MA 3EO6A 3DYMA 4FVVA 3I2HA 4DS0A 4OHYA 1O8PA 2IC1A 2BEOA 1MQTB 4RQPC 1AJKA 5F5IA 5A70A 4KWLA 3SXWA 1YRZA 3I97A 4DUVA 3HQXA 1P8JA 1U12A 1QH6A 2OPKA 3I2KA 5CFDC 2JWPA 1WW7A 2KM2A 1R1A1 3WY6A 1DHKB 2D7FA 4FAGA 5BNQA 2SBAA 1HXS3 2ZGOA 3RRDA 3DN7A 3CJIB 1A34A 3PMEA 5LY1A 1R081 3J7LA 5DDJ3 1ULPA 2R041 5E6HA 3CL1A 2WLQA 3FMGA 4XBLA 1XU2A 4O9EA 4NUBA 2OZ6A 3C7EA 4CCCA 1M06G 2VTXJ 5A1LA 2Y34A 4M3CE 4D8MA 3OF1A 5JI7A 4ZONA 4QU1A 3AFGA 3FLTA 3H3UA 4DPNA 3AVRA 1WW4A 4GKYA 4XPVA 4E27A 5K0UC 1UOGA 1VP6A 4JRLA 4AZZA 1W9SA 2O8QA 4K9SA 5FZGA 5H9SA 3TBDA 4LO8A 5BNOA 4HOOA 4RR3A 3VZLA 5JSOA 4CA9A 4YG0A 3TN93 1QEXA 2Q0AA 3W9AA 1VAVA 4OI2A 1SFYA 1AL21 4FP3A 5FO7B 2ZBJA 4RFT0 1HRV1 2BOIA 4UF0A 4XQ4A 3V65A 2LTNA 1BBT1 5FPVA 4B7EA 3R4DB 4CCLA 5M0TA 3J7HA 3IMNA 3GCXA 5C9AA 2HWE1 2ET7A 4FFGA 2BGCA 2FMDA 3C7GA 2RDNA 1AHSA 5AC92 2LALA 5JPMB 1JZ7A 1ZM1A 1OURA 3EQEA 1QU0A 4WBBA 1O3RA 2Q8DA 3SLIA 4LOSA 1UIKA 5DUWA 1MQTC 3UESA 2NLRA 5JXIA 2VVDA 3VBHB 2E7QA 4A6SA 3EBRA 3M7AA 4BQ2A 3UGHA 4JZRA 5JMCA 1JZ6A 4WVMA 2D6PA 1BLZA 4ISQA 3ZYRA 5AVAA 4LULA 2W2IA 3WOGA 3ZPYA 4E4HA 3KV5A 4E2GA 1D7PM 1LECA 4LKDA 5DPNA 5FPAA 1BEV3 5FWEA 1OFSA 1QQP3 1FI2A 2RS13 2YHJA 3O1PA 4L97A 1X82A 3WCSA 3WP6A 2ZMLA 1V9U3 5KXCA 3O12A 2DF7A 5ACA2 1S1AA 5FZOA 1W8ZA 2FCUA 2DTWA 2XJQA 5D8AB 4AE2A 1J83A 3BI3A 1V6IA 5JUVA 1UMHA 2D5FA 3WDXA 3MIHA 3RYRA 5DAVA 4NWVA 2XLAA 5CIRA 3PNAA 2ZAAA 2B7YA 2W68A 4NPMA 3ZYGA 4EV0A 1OHFA 5FZKA 3RZGA 1RUC2 2P4EA 4GQ7A 1OUXA 5ANNA 3T09A 4JGYB 1REFA 4FQZA 3AK0A 1GP5A 3AP6A 2FHRA 3CMGA 3PL0A 4CDWB 5FZIA 1Y3TA 2GP3A 1CAUA 3JQXA 3DPRC 3IDEA 4IEXA 1X33A 4H2AA 4NHKA 5FY1A 3RYPA 1LU1A 3AMHA 3VD3A 1VB2A 2OA2A 1OF4A 4LJHA 4XMIA 5CYYA 3AZVA 5SV5A 1OSGA 3D8CA 2FDJA 2JB4A 5CNAA 3THPA 3USSA 2ZZJA 4I3PA 1ZBE3 4FOWA 1QXRA 3HD8B 4BIOA 1E5RA 4K7JA 3TYJA 3A23A 3POSA 2GC2A 5FY9A 1W3VA 5A7WA 2XUMA 2DFCA 1NOVA 2VAUA 4CCOA 5DAXA 1W8WA 4Y26A 3ZXJA 2VVEA 4IV1C 4JKMA 5EV7A 2W1UA 2VMFA 4MYEA 4H14A 1KJLA 3NAPA 4Q1PA 1RMU2 3VHPA 1JZ8A 2E7TA 4COZA 1AVBA 1DFQA 1PGSA 4Y5SA 4XFGA 2DDUA 2RMU2 3ZIXA 4BK4A 4NIHA 2AREA 2HYXA 3GBFA 2XXZA 5GZCA 3U1XA 1HKDA 3OPTA 1ZZ7A 3LOIA 2EALA 4XXAA 4Y5Z0 3RVHA 1BK0A 5APAA 5I0TA 5FXZA 2WAAA 3PVOA 4GB31 1PO23 3NL1A 1QDOA 4YM1A 3KF5A 5KC5A 1E5SA 4Z2WA 5J1XA 2J42A 2JX9A 3LCPA 2VJXA 2CY6A 2K2SA 1C3HA 3E6BA 4H7LA 2ORXA 4Q4V2 4JGYC 2BRTA 3GF6A 4J6GA 3M3EA 4CDWC 1S0DA 4PIXA 1OLQA 4R52A 1VALA 5FYYA 4CPBA 1DDLA 3T2PA 2VE1A 4FOVA 1O8SA 1G6NA 1UF2C 3AB0A 3URFA 2ZA9A 1YC61 1RUG2 4GJZA 4KL1A 1IZ3A 1AJOA 2DTYA 1ONAA 4PQ9A 4G4FA 5C33A 4LKSA 3ENRA 1B35A 5C7GA 2ZGNA 4QM9A 4KGQA 1H6XA 4OHZA 4FSJA 5FTTC 3WNPA 3BODA 1XNCA 2JG8B 4YM3A 1GWKA 5L7OA 2UWCA 3S57A 1LULA 3ZN6B 5KHGA 1UX6A 3PIGA 1UW8A 4OHXA 4HT1T 1SLIA 1WW5A 2BUKA 2RS53 3AYDA 3FWEA 3C2UA 3DGTA 1IHMA 5DZFA 5CFCA 2RS32 3B3QE 5EQUA 1YEWA 5DUXA 2VZOA 1RUE3 4MGQA 4Y22A 2AR6A 3ACLA 5F3GA 4Y5TA 2W52A 3TWIA 1NZCA 1W03A 2GN3A 3APBA 2JIGA 4AFDA 5FUIA 5C5UA 1OMIA 2RM23 3MEPA 4FPGA 3I3DA 4IE6A 5A80A 3ZX7A 2BJSA 4AVTA 2VCAA 1W6MA 5DZEA 3BYWA 5IVVA 2X5IA 5FCCA 4RSUA 5LCWL 2EIDA 4GZ9A 2CWSA 4FCAA 4RL7A 3LPFA 4LKEA 4UXAA 4BK5A 1QJX1 3THCA 3ZXDA 1IQAA 1G9FA 2WT2A 3SQOA 1DGLA 4CCJA 4PT6A 4CU7A 2B4KA 4X6QB 3VDBA 4XOGA 1D4M3 1XOYA 4BHPA 1ENRA 1JN2P 2ZKLA 2VZUA 3J7NA 4FXGB 4AGGA 4N53A 1UKRA 2PHUA 3SKVA 2E6VA 1R64A 2HWD3 4FXKB 4QPIA 1LGCA 1BYHA 5FR3A 3X29B 5C3OA 4M0HA 4OUMA 5F6KA 3OB8A 5HBAA 4XTPA 2A3XA 5LK7B 1EAH3 3NNGA 4CYDA 2RHPA 4E9KA 3R6SA 3VL8A 4EQVA 2PAMA 4BQ3A 2OPWA 1S2KA 2OW4A 3FLPA 4AI2A 5GALA 3ZFGB 2JG8C 3B94A 1Q3EA 1O5LA 2CAUA 4IERA 4AFCA 4B8EA 1V6NA 2Y0OA 4DIQA 1AR93 1VBA1 5F1RA 2R0HA 5EYXA 2XWBB 3FC0A 4EZ4A 1J3RA 3KSCA 2ZGRA 3QLQA 4YW3A 1W2UA 3SH4A 2R1BA 1UZZA 4A7KA 3WF0A 4LBKA 1DZRA 5DAQA 3K3OA 1RVF1 3SMHA 1CAVB 1Q43A 2W95A 3TN92 4B1LA 1I5PA 2MNGA 3VDDB 1X7NA 3VBUB 3N7JA 5EP9A 2E51A 5GLVA 1S4CA 5FZ4A 2E9QA 3T2QA 2KR2A 2QZ3A 2X53S 2L9LA 2YC2A 3E1F1 3P3NA 4YZ3A 4E8DA 1LENA 4FI9A 5JZGB 2HH9A 5IK4A 3HQUA 1K45A 5DMYA 2WQ8A 3M3IA 1ZZCA 3OEBA 3QOPA 1K3IA 4HETA 2YC4A 3EYPA 2C9KA 4OMDA 1PZ9A 3FE5A 2Y26A 1L7RA 1AR72 3KVAA 4GIQA 2PMWB 2ZX3A 3MPPG 3Q8CA 4IGPA 4XQWA 2VZQA 4AVCA 1W99A 2DFBA 4JHTA 4I30A 3OD4A 5GZEA 4OULA 5IW0A 1PIV2 4C90A 1YXWA 3SEPA 3AKRA 4LBQB 2C4XA 1SQ4A 1ZRRA 3SISA 2XHNA 2MHFA 1IPJA 1BEV2 1IKPA 1Y4WA 2UWAA 2RS12 3AKTA 4QU2A 2PTMA 3GBWA 2H0BA 1JS9A 2WNVC 4FPYA 1V9U2 3AMPA 3HNMA 2C6SA 4MVTA 3VBFA 2VUAA 3VBOB 2GH2A 3BVCA 1G86A 2YDEA 2YPJA 2W87A 1QNYA 2HBUA 1RUD3 3POIA 1QJU1 2R49A 4QXHA 1GP6A 4YW6A 2JIJA 2VOVA 5JWPA 5T3NA 3VDDC 1ENQA 4ZU5A 3VUOA 4CP1A 2R0FA 3KT1A 4IW3A 5EJZB 3U10A 4IL7A 3JQWA 5C3SA 2Y6JA 4LT5A 2Z5WA 1WMDA 3WUCA 4B1MA 4CEYB 3SITA 1NG0A 1FX5A 3HN1A 2WINB 3POBA 3T4HB 3DEMA 5FPUA 2ZMKA 4RS5B 4Y33A 5JZGC 5FZFA 2WYSA 2HJIA 3KHCA 1BMV1 4MG2A 2DVDA 1LHWA 2WQ4A 3MDPA 4CEWB 5IVYA 1OOPB 4O61A 4AFMA 3RNSA 1JHNA 1FOD1 3WINE 2D44A 4AQSA 1EPWA 1ZBE2 4NAMA 1AL0G 1EUTA 2B39A 1OBNA 1VBD1 1RXFA 1OKQA 1OUSA 2ETEA 5ABJC 5JDBA 4COUA 4D7YA 2R073 1XJAA 3I3BA 4PJYA 5EIYB 4AQ6A 4QAWA 4EWDA 1MS8A 5A3OA 3RI8A 1R1ZA 2GC3A 3OJBA 1DIWA 2JG9C 4O65A 3N9LA 4XTMA 2ZABA 2GSYA 1YIPA 3PMSA 5L36A 3MZHA 1IOAA 3MFAA 5ANQA 1AYM1 1SLTA 2FQPA 2WFF1 3IPVA 4ARYA 1JU4A 1KXGA 1LU2A 2UU8A 4IEZA 3O1SA 4XUNA 3OG2A 4COVA 4HK8A 4AEDA 4QX5A 2JB8A 4GXLA 3VBOC 5A6YA 4Q4W3 5FMOL 1HLCA 2VBBA 1ZA4A 2WNUC 1PO22 4XILA 5ERLA 1OFNA 1SLLA 2P3YA 1Q8SA 4YVSC 1WCQA 5C3RA 3ZFEB 4P9WA 4OCTA 4QMAA 1GZTA 4P02B 2Y8KA 3Q8EA 1RHI3 4QGNA 1ULOA 1YFXA 1D4VB 4M3CF 2E7AA 4N8MA 1LGNA 1W04A 1NCRA 2W47A 4I0AA 1RUF1 4LMFA 3VKNA 2YBSA 1LEMA 2F4LA 5J48A 4RS5C 3RZZA 5FP7A 1TMF1 4META 4A41A 3ZN5A 2QQKA 4CEWC 2ORZA 4MUVA 2ET1A 3BCWA 1OVSA 1L3JA 3ZYHA 3U07A 5FPZA 2PHFA 5A3MA 3IKWA 1JOJA 4FPKA 4BIFA 1Q8VA 4OI1A 3USUA 1KRIA 1QJEA 1MS4A 2WZEA 1CZTA 1YI7A 3AL5A 1YQCA 3VBRB 1XE7A 3OOXA 4D6SA 1ND2B 3ILRA 1QMJA 1ZNPA 1RC6A 2RS52 3I3QA 2HWF1 3LDRA 4GWNA 4CP9A 1DLCA 1UPSA 3D0SA 4C1XA 2ZHMA 3CHXA 1IS3A 4G9SB 2DUOA 4AI1A 1PK6B 1DQ0A 1RITA 4P5YA 3WX5A 5LATA 3ZFFA 4LHSA 2ZX2A 1YYNA 1Y7BA 1Z7S2 4LQRA 4XHXA 4CDQA 4IEUA 4LHNA 3H3LA 4GMP0 1VBB1 3NKTA 4FPLA 2RM22 2F17A 4I01A 1H8VA 1NY71 2OT7A 3ITQA 4DEQA 3RQ0A 3WP5A 4BQXA 4Q4X3 5FO9B 1XYOA 3ZFEC 3LQCA 1X8EA 2ZJCA 3MFCA 3WW1A 2ARXA 1LESA 4Y20A 3POEA 3ZSLA 5AC93 4LORA 2YC0A 3PIJA 3IB3A 3E97A 4TYSA 3SCFA 2OQ7A 4N43A 4GWIA 1D4M2 3MW3A 2RJ2A 2P37A 5C4WC 1W8HA 2R061 2VNRA 5FYVA 1DP0A 5A3WA 4ZY9A 3ATGA 1DYKA 4XETA 5CKQA 5IVBA 2ZHNA 4GH4B 2ZX0A 2HWD2 4Q2FA 1Q8QA 1QJY3 3WDWA 4D7TA 3AMMA 5A32A 3AL6A 3B02A 4QX3A 3VKLA 3HWJA 5BNNB 5KC6A 3ROUA 2XL7A 2YU1A 2NQYA 3PHMA 1EAH2 2O14A 3ME2A 1RUNA 2FBEA 1H2LA 2B8MA 1LHOA 1Z78A 4KBBA 1WWYA 1W9WA 2VOKA 3OPWA 3VBRC 1ND2C 1AF9A 1W2AX 3I49A 2D6OX 5LBCA 3T2OA 2HWB1 1JH5A 1ZZ6A 3GJBA 1RXGA 4CXYA 1PK6C 1SBFA 2FCTA 4QKBA 4XJWA 1FMD1 5LZ6A 4W65A 1FPN1 1HRV3 2QQNA 5FXXA 3O14A 1M4WA 4BQ5A 4EJRA 3VHRA 4Q8KA 1PMIA 4F7ZA 2BNMA 4FTBA 1H2MA 1K5MC 2QQVA 3WHTA 5T5PA 3H7YA 3FBMA 2P1BA 4NIGA 5GLUA 5HXVA 1UXZA 4GWMA 2VD7A 2A6VA 2JE9A 3LKJA 1UMIA 4FQ4A 1GWMA 2DWRA 4NRPA 2XKOA 4DINB 4R8HA 2WDBA 3ILFA 1GBGA 3RJRA 4LIVA 5KXBA 4LO5B 4OLLA 2AEZA 1HRI2 3HAGA 1MVQA 3CF6E 3LWCA 1VMJA 2XUEA 3KQ4B 4UW6A 2XBO2 1XSQA 4WM8C 5A3UA 5FOJB 3SCGA 2FMYA 5B4NA 1WCKA 2FCVA 5BNOB 4RR3B 1GNHA 4Y4RA 4ISRA 4Y1XA 4GH4C 4UW5A 2D97A 5FYZA 1LAJA 1AR61 4CXXA 1GP4A 1E5HA 3BB6A 1COV1 1NA1C 3LSDA 3N7KA 4U36A 5A3TA 2R6QA 1YJLA 2WNEA 3OGGA 4DEVA 3RZMA 5LASA 4SBVA 1JYNA 4K3UA 5FZHA 4N90A 5C9AB 2ZTNA 1GWLA 1V6KA 3VDAA 4CCMA 1ZVFA 2MEV3 2XL9A 5FZCA 5I0DA 2P3JA 4JVAA 1UWWA 2ADEA 3CZJA 3WNLA 1GR3A 2V5DA 5LBEA 3N4MA 1RB8G 1MS5A 2JJ6A 5JSPA 3FHIB 1RUD2 4QKDA 2FZ2A 1A78A 3UKNA 2XJSA 1RUH1 3VN4A 4FTEA 1S0EA 4JGZA 1DYOA 4Q4V3 4XDPA 2ARCA 2AGSA 1F15A 5JR7B 4KU7A 3WG4A 3C3VA 1SEFA 1UZVA 4Q4Y3 3VDCA 1MEC1 5T55A 4BH9A 2GU9A 2QDRA 1VMFA 4IE5A 2CSGA 3ACHA 1UQXA 1HX6A 2A5ZA 2J1TA 3MYXA 3A0KA 3OSDA 1VBC1 1T2XA 2VL4A 1TNRA 1WBFA 1PGW1 1XNDA 3NJVA 4DZGA 1C8NA 3IBMA 3KT4A 3KCCA 1LOCA 4JV4A 1GZWA 5FZOB 3UT0A 1URXA 1K12A 4UYBA 5DXDA 1MZ5A 1CD3G 2E63A 2PQQA 5DAPA 1CR7A 4DQAA 3T0BA 5BNOC 2JDZA 2R072 1DU3D 2PYTA 1OQDA 4QQHA 2ZPXA 4DUWA 4OUEA 1JZ5A 3S5AA 1US3A 3ZYIB 5FZ6A 4XVHA 5A3NA 4NIAA 2HLEA 4XFAA 1PVXA 1XBFA 1GZCA 1S0BA 3BU7A 3MIEA 1DBNA 4JDMA 4PLNA 1H1IA 3I8TA 3V0AA 4YZ2A 5GZDA 5A33A 1JYXA 3VLBB 4MXVA 1CAUB 5BY5A 5FMCA 2WZR1 1OVPA 1GYKA 5C9AC 2DUPA 2WO2A 4MXWB 4GB33 2BW8A 4IV3A 1WGPA 3GM8A 4QQOA 1KJRA 5DABA 4XAEA 4RHV3 1W6OA 2GDFA 3BOPA 5JSRA 4IEVA 4Q4W2 3QH6A 3AYCA 2PHXA 4C1WA 1C1FA 5JMOA 1H9WA 1DLLA 4YPJA 1JUIA 3K48A 4OI0A 2DURA 5A7WB 4M4PA 3ZYBA 1W2NA 4XFHA 3KGZA 1RHI2 4HXCA 1YQ8A 3DUIA 3P6BA 3NAPB 2D6MA 3PUQA 4BZ4A 4UAPA 3ETQA 2D3PA 4YGBA 1ALYA 3TNPB 1PX4A 4WVZA 4LBMA 3SKJE 5TSWA 1J84A 1EV12 1KFUL 1XU1A 1N1TA 1ZRFA 3DXUA 2CNAA 4XUPA 4NHYA 1LJ7A 1UD1A 4WZFA 4ES8A 5HV4A 2VZ3A 4IE0A 1LRHA 1IQDC 2XKPA 1OLMA 1CAWA 1N3OA 1ENXA 1ASJ1 1NAEA 2QFEA 2CGNA 4YZ5A 4A7YA 2X29A 2OZJA 3MW4A 4XDQA 4MGTA 4AW7A 1UZYA 5KHJA 5FP9A 1YQ2A 4NIIA 2P2KA 1UOJA 3WQBA 5GLTA 2Y60A 3S7EA 4BU2A 1DYPA 3UGFA 1NLQA 1WZXA 2Y0IA 3RDIA 2TNFA 1AR82 4I2OA 1JZ2A 1F4HA 1ND3C 1REDA 3EJKA 4ATFA 5EZWA 3LIGA 3V64A 3LEKA 1H9PA 5E8AA 1V6OA 1SDDB 2Q8OA 2DCZA 2D93A 3E5XA 5IJRA 3ON7A 4CDUB 1UU4A 2BERA 2KXLA 2LM3A 4Y24A 1TNFA 1B35B 1XNKA 2W5FA 4Y1ZA 5D21A 4Q4X2 1QJX3 3RS6A 4PF5A 4YZ1A 4FOQA 2D3SA 1PGL2 4FPJA 4C0BA 2B42B 2VQ0A 4GAZA 3UETA 1UYZA 3OBRA 4FP2A 3IT8A 5ACA1 5L7OB 3LFMA 1S0CA 2VW1A 1UY1A 2VMDA 4LUMA 4BPZA 4NPRA 5DQ0A 5K9YA 1C8M3 2BVVA 1HB3A 2JDUA 3WDYA 1HB1A 1OI6A 3ACFA 1MPXA 1QXJA 1AR73 4W50A 4Q26A 1AXZA 4LNVA 5CA6A 4BQ1A 4XZPA 2YB7A 5FP4A 1PZ8A 4AGRA 5CFCB 1NE6A 2GAUA 1DQ4A 3GXUA 3WVJA 1RUC1 2W0XA 4Q0VA 3MIGA 1QJY2 2WT1A 2YXSA 4Y22B 5JOZA 3VD4A 1UZ0A 1R082 2ATFA 3MO4A 3O7OA 2R042 4YG6A 1PIV3 4KU8A 5BV6A 1YFYA 3INAA 3CJIC 2FDHA 3E5QA 4DY5A 4QQ2A 4LR4A 1S2EA 1QXPA 1W6MB 1CJPA 2X5IB 4YVWB 3ZDVA 5KHHA 2Y33A 4CSWA 3VZNA 2I2SA 5KHKA 4PLOA 1CVNA 5T5LA 3O1VA 1KITA 3RFRA 1H8TA 2ZEXA 3GZAA 2VPVA 4J1WA 1AL22 1UY0A 4YARA 1VMHA 3S0MA 1HRV2 2W08A 1UOFA 4N53B 3SNMA 3UGGA 2A6YA 1QJFA 4QGLA 4IE7A 5F6LB 4RQPA 4QPIB 3M8LA 2VMHA 4DXSA 1RMU1 5F3EA 1RL3A 4CDUC 4YFZA 1UU5A 2EVXA 3GZEA 4UBHA 1VRH1 4BISA 1B35C 1PM7A 2XQXA 3KQRA 5CFDA 4HSJA 4JRAA 4CZSA 3WEZA 2HEWF 4LBQD 1YFUA 3LF7A 4M0NA 3CEWA 4M01A 4H3WA 1N3PA 4QB2A 4QDQA 3UK9A 3DKQA 2I45A 5L7OC 3PLQA 1AUYA 4F8AA 1ULDA 4JHZA 5K7PA 5BNPA 5FKBA 1W28A 2VBDA 1CZSA 4QT6A 4Y4YA 4BDVB 1FYUA 4YWAA 3S6PA 2VW0A 5JCTA 1NLSA 1VBE3 5JVVA 3VBHC 2BYVE 4NHLA 5K0UA 5CFCC 3O0WA 4AAPA 1STMA 3N9MA 4QX7A 1GZ9A 1VB4A 3L2HA 4L11A 4XUTA 4B4PA 2EXJA 4TZDA 2EIEA 5IATA 1GNZA 3BTXA 3KV9A 2X10A 2HWC3 4EYUA 5F7UA 3ZSKA 4TTGA 2G9FA 4YVWC 4QB1A 1RUG1 3KZ4C 2MEV2 1W9TA 5D8AC 3CLPA 1QJU3 3ZN4A 1U5YA 3ZR5A 1W0OA 1PVC1 2F6BA 3ST7A 1F9KA 3J8F1 4R4XA 3FBYA 2DVFA 2EXIA 2N7GA 3H1WA 4CDXA 3ZIWA 3PJQA 2ZEYA 4W6XA 5FYSA 2W91A 4QPYA 1YFWA 4HMZA 1J3PA 4N53C 1AYN3 4UOJA 5C8WA 3ELNA 1POV1 4PQQA 4YZ4A 2GMPA 4XJZA 2HKXA 3BALA 4Z1VA 4MGZE 2OX0A 2WZ8A 3G6JB 4Q4Y2 3OBTA 1W8TA 2ILMA 2VNOA 3KV4A 3LEMA 5HI0A 1I3HA 2RJKA 4W6YA 5I0UA 2V73A 4AFBA 1FNZA 3RYKA 1FOD3 2VVFA 4HFSA 1LB2A 1SCSA 2FZ1A 2JDPA 2IXCA 1DGRA 5EFUA 1KS5A 4NRMA 1T6GC 1W0PA 3O5SA 1VBD3 3VBFB 1GUIA 4B7KA 1FAYA 2P3KA 3EB7A 3M70A 4GMP3 4MGYE 2DVGA 1RTVA 2UY8A 2V5YA 3G7DA 5FXVA 4Z8BA 2QBXA 2JDKA 3O0VA 2DBIA 2VXJA 3KT7A 4NIDA 1YI9A 3WNNA 1OPMA 2YROA 3P5BA 2H6BA 2VNGA 4DXZA 5CBLA 3GGLA 5DAWA 5C3PA 5E89A 3W59A 2IXKA 4A2UA 1AYM3 2C24A 4YNIA 4EROA 1REEA 3H8UA 1YLLA 2VMGA 3ES4A 3RI9A 1GMMA 2YYOA 4FFIA 4UW3A 2IZWA 5IWFA 5K8SA 2D6LX 4QPGB 4UFIA 4XZUG 5K4LA 5FWJA 1Z7S3 2WA3A 4GB32 3DPRA 2EXKA 5I0SA 1H0BA 4RHV2 2NN8A 5AVPA 1HXS1 4MX3A 3VBSB 2YY1A 2QQWA 4OI4A 5DDJ1 4DOUA 4WV8A 3RJ2X 4D69A 5A7NA 1WLWA 2R16A 5FJKA 1JYWA 5T5JA 4LA3A 4CXWA 1YWKA 4YYOA 4F3JA 3E6CC 5GZFA 5F8PA 4CE8A 4HN0A 1DZTA 3UJOA 4ZS3A 1WD3A 1XNBA 4IEOA 2DCYA 3NMBA 3VKMA 1I5ZA 1YHFA 2OS2A 4IV1A 3KB5A 1UYXA 5LA2A 3PVEA 4UFHA 2VG9A 3MUY1 2ADDA 3OY8A 5JIAA 4BLJA 4CUAA 3LGRA 2RDSA 1F5JA 5JR2A 5F3CA 2VZTA 5T54A 4AXOA 4XHBA 4AYUA 4AEDB 3OEAA 1HV1A 2PLV1 4S2HA 3IIIA 4K21A 4HVQA 2FD8A 2QCSB 1G9CA 4K6BA 1KDKA 2VZRA 5L9VA 1QF3A 2CTVA 2XVLA 2J1SA 2PQSA 3HJRA 4NROA 2WS91 4KG0A 1LTEA 3WHUA 4XYXA 2BOJA 4IEPA 2BGOA 4AHXA 1NCQA 3IWZA 1NCRB 4JGYA 3RGBA 1JYVA 3DL3A 4AQ2A 4FBFA 2XR4A 2XLFA 4QPGC 4AVVA 5JIUA 1VBB3 4AEJA 3AKSA 4LLFA 4AWDA 4Q0QA 3JZVA 4QDRA 5KBFA 1UAIA 2D40A 3W5MA 1V00A 4JDOA 3JUUA 4XFIA 4YW5A 3UKTA 3VBSC 4BMEA 2GP5A 3B7MA 5A7OA 1GFF2 3JU9A 1QQP1 3K51A 4JKLA 1QJX2 3TNQA 3ES1A 1LOAA 3OGVA 4JC1A 4QB6A 3I2FA 4AEKA 2VOWA 1YUDA 1BK1A 3HEIA 3I4IA 4XJAA 1HRI3 2P6CA 2BU9A 5LW9A 1RUI1 1JOPA 5FKCA 3MLKA 1C8M2 2R063 3J4UH 4EN8B 2XBO3 1PO13 1WMFA 4CP9B 4P9LA 1ZRCA 3NNMA 1CX4A 1VR3A 3FHAA 2WSVA 3MF6A 5BXXA 3ORJA 3ZFFB 2EIBA 1SFNA 2D6KA 4MZUA 1B09A 2XB6C 2WC2A 1LOFA 1UL9A 4CDQB 1H30A 1W8FA 1R093 4XXPA 5FZ7A 4FFFA 2QQUA 5FMDA 2AC1A 5GM0A 5IFPA 1GQHA 3AMNA 2IVJA 4CUGA 2VZ1A 3PVNA 4KBZA 1U5XA 2VH9A 3ZFGC 1AX0A 4H55A 1EP0A 2HWB3 2XJPA 4QDSA 5IT6A 3RZJA 5KXEA 1DGWX 1OT5A 2VUCA 4DRRA 1XNTA 3MV01 1GV9A 1RUJ3 2WL1A 4Y20B 1HDKA 1ZBE1 3JXSA 5FXWA 1RVF2 5L9RA 3FFZA 3CBNA 4N43B 3SCHA 4O9GA 3VD7A 3WDTA 5F37A 1VE0A 4A4AA 3VBUC 1JU3A 4AF9A 1IG3A 3AJYA 2ARAA 1OQ1A 4U2AA 5T5OA 4UFMA 4V2VA 1W9YA 1UY4A 1W6PA 5F39A 4RD7A 5I8YA 2ZAHA 2WBKA 2VCBA 4PDWB 5FLIA 3QACA 1O3QA 3WDVA 1LOEA 4Q8LA 4ZPIA 3LB9A 3V0BA 2TBVA 3THTA 3TB0A 1H1AA 1QJZA 2Q1ZB 3ZLIA 1CAXA 4M3CA 3AYEA 3LIHA 4AAXA 2AH2A 4BB3A 2EXHA 2JG8A 4XFBA 1YNAA 3I59A 4MHUA 4NHXA 1YQ5A 4I09A 1ZBA3 4PBOA 1HV0A 3R4UA 3MIDA 2C5DA 3VZKA 1SMVA 1VBE2 2E32A 1ZA7A 2DYCA 4LO4B 4A3XA 3CZUA 1AR63 5I8TA 3ZFFC 1G9BA 1W6QA 2Z79A 2AZ5A 4CDQC 1QDCA 4CU9A 2YBKA 5D1IA 5FY4A 4OQ8A 3RZKA 3QCWA 4Z2AA 2PN5A 3KCYA 2IXLA 4ITCA 3ZXAC 3JBG3 2MPFA 5GLWA 1K5JA 4V1PA 5C8CA 2HWC2 1NQJA 4XJUA 5FYIA 4I3GA 1G7YA 3ZMOA 4FTSA 1TQ5A 1UMZA 4A7ZA 3A7QA 1QJU2 3IDAA 2Q1MA 4CCEA 4CTEA 3PTYA 2BFUL 3FUOA 4E4SA 5HCBA 3KGLA 4XJ9A 4D6RA 1WW6A 1RUH3 2BP6A 5FP3A 4AVAA 4Y1UA 4AFAA 3NV3A 2Q1FA 4S2FA 3SH5A 3DKWA 5J36A 2XJVA 4COYA 1AYN2 1XC6A 2ARBA 2P3IA 3BIWE 3OGJA 4NRQA 3LPGA 4W6WA 2VGDA 3MI8A 1YO8A 2RS51 4NOTA 4TSVA 3S30A 1FT9A 3IAPA 2B46X 1IG0A 1VBC3 4HZFA 3RWNA 4CEYC 5IVJA 1BMV2 4PDWC 3I2IA 1C5HA 4XBQA 4L92A 3FFQA 1IPKA 2NPIA 4XF9A 5FBZA 2NMOA 4HPKA 1EV13 3OYWB 1RUE1 1QGLA 3POWA 1FOD2 1TME1 3WQ0A 2O0OA 4UFLA 2P34A 5A3PA 5JAXA 1ZZBA 1OOPC 1PM4A 4MGKE 1VBD2 2J22A 4Z82A 2BWAA 4XUQA 3CU7A 2WNVA 1DG6A 2YBPA 1ULEA 2ZHLA 3W5NA 3H7JA 3M4FA 4LHKA 1OKOA 1QH7A 2G9ZA 2VUJA 4Q0SA 2E33A 1SG3A 3Q9OA 1Q8PA 2YV8A 2Z2SB 1CWPA 5CZKA 4MH0E 4JGZB 3UV9A 2AYHA 2UY9A 4XDOA 1AYM2 2BDRA 4L9BA 2QQPA 1ST8A 1AR83 4EE2A 1AXKA 3I2OA 5A6XA 4KGGA 1C5IA 1G9AA 2HWD1 4MGIE 1SPPA 2WO7A 5BYNA 4S2DA 3LDKA 4CUBA 2VOTA 3BGAA 4QXKA 4TN7A 1PHMA 1GZWB 4Q0PA 1EAH1 5FREA 2Y6FA 3T1LA 4D3WA 1XNAA 3IZOA 3I3EA 3NNFA 3M3OA 3RMXA 3ZSEA 4DXRA 4IQPA 5EJ3A 2VW2A 3VL9A 4YSFA 1NZIA 1AR91 1SBEA 2RE9A 5B2GB 3LSEA 4RGAA 5ABJA 1UZWA 4ATEA 3PUHA 3O0XA 5HCHA 4K8RB 4XC9A 1OH4A 2V4VA 1CX1A 2EICA 4V2WA 5FZBA 3V0AB 2JG9A 4YG3A 5A33B 2K46A 1R1A3 3TOJA 2ID4A 4LBQA 3N9OA 1HQLA 1OH3A 5JXJA 1CESA 5FYMA 1R083 2P5BA 4NR1A 3HIFA 2R043 2XJRA 4IV3B 2BTVC 2UWBA 2VBPA 3AP5A 1W6OB 2AACA 4OHVA 3ZO0B 3O1RA 1UO9A 2VZPA 5J98B 4DB5A 5A6ZA 2OKXA 5B4XA 2Y6KA 4FOYA 2QQMA 4UT5A 1S0IA 3MF9A 2WNUA 2HWF2 4AI9A 4CCDA 1JZ3A 1QY4A 1JHJA 4YVSA 4XIOA 5HCFA 4JGZC 2RR11 3GALA 3HT2A 5D2AA 2CGPA 2FDIA 3WT3A 2WAOA 4NWWA 2XJUA 1WCSA 1MS3A 1AL23 5LA9A 2IWGB 3AM2A 3H42B 1MACA 1VBB2 2J1AA 2QNKA 2XWJB 4EN7B 2JDMA 1BBT3 3CO2A 3OUHA 1W2TA 4IEWA 3J7MA 5GKAC 1WBLA 1NY72 3IM0A 4JCKA 5F3IA 4EN9B 4LITA 4MLOA 3T08A 4BQYA 2HWE3 3NV1A 1OA3A 1NE4A 4I0WB 4AGVA 4HN1A 3A21A 1SZBA 4ZHNA 2E26A 2VCMA 5FPLA 1W8NA 2PHTA 2W9XA 2LS6A 1GOHA 1POQA 2ZGSA 2BGPA 3FL7A 4RN5A 4EN0A 2R062 2QTWB 1PO12 4Y3OA 1RUD1 3L9JT 5F9TA 5FY8A 3KS7A 3BN6A 3JD71 5J09A 3ZOIA 3GZTB 4BA6A 2GC1A 3D82A 4MGSA 3N35A 4FPHA 5DG2A 3MHZA 1R092 2ERFA 2YU2A 4IV3C 5BNNC 4L8QA 4UF0B 2PAEA 4Y1YA 5CG8A 2VO5A 1EY2A 1YIFA 2J1VA 1WKYA 4LE4A 4QD2A 3RWKX 3H8XA 1DCSA 5FK8A 4ASLA 2PA7A 5FZMA 5JXGA 1LOGA 3VKOA 3T3YA 1MR5A 5HCAA 3P1IA 2A6ZA 2HWB2 3L2YA 2JDAA 4WM7A 1NQDA 4D7SA 5ISLA 4QM8A 1CJDA 2OIIA 4UWDA 3N36A 4JDNA 4R9AA 3SH3A 3ZFEA 1RUJ2 3C7OA 4BM8A 4DFSA 1BVP1 1ODMA 4E8CA 2OUJA 2J1EA 4PI0A 4XABA 4OQ9A 4YLZA 1KQRA 2R071 4WZCA 5KWRA 2W1SA 3GYDA 1Q5OA 2GMMA 1V6LA 4MO3M 5C4WA 2WRAA 1BKZA 5FQ0A 4WVMB 3B69A 1S0FA 3BUCA 2ZCWA 3KM5A 3T1MA 3QBQA 3N3HA 1W3XA 2D43A 1UIJA 4ZU4A 1WMXA 3MIFA 2JDHA 4LPLA 3WNMA 2ZGKA 3NVCA 3NJXA 1BXHA 1SACA 4B4QA 3E6DA 2O1QA 1SLBA 5IAVA 4YFWA 1S0GA 1O4ZA 1T6BX 2LRPA 3I7DA 3J26N 4QHBA 1WCUA 2QVSB 3DYPA 2UYBA 3MPBA 4KMQA 1NXD1 4W8JA 3AKQA 1ZBA2 2CAVA 3VBRA 1O4TA 3WP4A 1APNA 1H8TB 1ND2A 2H0VA 3WSOA 3KWVA 4MV2A 2C1FA 4RR3C 1JTZX 1YQ6A 4LXLA 1AR62 1RINA 4XBNA 4D6QA 4BCUA 5JXHA 1COV2 3HBZA 4FPCA 3AJZA 4MHRA 5FZ1A 3LZZA 1JW6A 3FZ3A 1N3QA 3BOWA 3POFA 2DCTA 3JBG2 4LIUA 2GNDA 2JDNA 3CKHA 4TXWA 1F35A 1K5MA 1W39A 4FPFA 2QJVA 1HN0A 4UW4A 2WN2A 3WNXA 1NYWA 4HVRA 1XRUA 1IS5A 3NV4A 3U14A 1HN1A 1U5ZA 3NRUA 4BQ4A 3OUJA 2WN3A 2XGXA 1S55A 3WF1A 3WP3A 4R9DA 5FYBA 5DG1A 2BVBA 3PDQA 5BNPB 4E2SA 1IS4A 1V6JA 1RUH2 3PURA 4SLIA 1VPHA 3HNBM 3PUAA 4GKXA 5FY5A 1MZFA 2VOXA 4M4RA 4P08A 3O1MA 2Q8CA 5K0UB 4WM8A 1OD3A 4QGMA 1MEC2 4URAA 4RYDA 1GSLA 2JKXA 1IKQA 3NWKA 5FPBA 2GNBA 1N1SA 2B45X 1VBC2 1NKGA 3JB4C 3WR0A 4ASMB 1V70A 1CQ9A 4S2GA 4AR2A 2D6NA 3ZSJA 1FV3A 5CB7A 1NA1A 1SLCA 3ZYJB 4LBJA 1CN1A 2VR4A 3IIAA 1J1TA 3DECA 3VKFC 1UY3A 2BZDA 2DVBA 3AZYA 1PNFA 3C8XA 3S5QA 4QXCA 4KWKA 4F83A 5FRAA 4UFKA 3ETPA 4XACA 4CCNA 1JBCA 3KF3A 5FZLA 5JOYA 4Q4X1 1LNSA 2V09A 2Y6GA 5FZEA 3ZKYA 2J1RA 5F5AA 3VZJA 1UN1A 4B4RA 4CDXB 5IFTA 1VJ2A 1H4GA 1BVVA 3WV6A 4XUOA 4DNYA 5FYHA 5AC91 3S7IA 4QXBA 2CYFA 2WZR2 4K8FA 3K4DA 2BQPA 2ZX1A 3DCQA 4PBPA 2JICA 4BYYA 3N7MA 1QJY1 2JXAA 2FDFA 4UI9L 2XLGA 3HOBA 3HT1A 5LY2A 4PCRA 1VAMA 5G05L 4Q1RA 4XF0A 2IXJA 4MOAA 4JQTA 3WXPA 3OD0A 5BNPC 1C4RA 5C71A 1JOBA 2BNOA 1PMHX 2ZKNA 1W8OA 2GZWA 1SFPA 4Q27A 4XEZA 3POGA 4AQTA 3BIEA 3H8OA 1OQEA 5L19A 3FJSA 3T2TA 3UKVA 3J9SA 3NAPC 2EF6A 4P9XA 2I07B 3IDBB 1O59A 2BBVA 5CAZA 1W0NA 1K42A 1KFXL 2G19A 1SHWB 3DF0A 4X8NA 2G4IA 2JD9A 1R1A2 2UYAA 4JTNA 4Q29A 2PLV3 5IK7A 5LK5A 1JI6A 4MSVA 3DPRB 3OTFA 1DF0A 4BJ0A 1ASJ2 4CUCA 2IXIA 1UXXX 1Q56A 2D3RA 2JENA 2H6CA 4B29A 1VBA3 4CDXC 3TEWA 4Z07A 5EJ1B 2CDPA 2WS93 3CNAA 1WA4A 2QE3A 1A8DA 3ECQA 4IGQA 2ZEWA 3ZM8A 1CZVA 5FZAA 3AZXA 5LB6A 3UL2A 1IGOA 5HV0A 5FLHA 3R05A 1RVF3 1OC1A 2R7EB 2YGLA 3WG1A 2G1MA 3H3ZA 4IV1B 1WCDJ 1XE8A 3TEYA 5IUQA 1GOFA 2CGOA 3LAGA 1ZZ9A 5FK7A 1BZWA 2WR9A 1W90A 2A71A 1AZDA 2CDOA 2W1WA 2YZ4A 3OY8B 4HKWA 1BBT2 5IK8A 1GKBA 5CADA 4NN0A 1GICA 1GOGA 1E57A 2OXBA 2WJSA 1F4AA 3FUQA 4AI8A 2XONA 1XYNA 4ZU7A 2ZGPA 1ODNA 2DBNA 2HWE2 2RMU1 5HXMA 4RGKA 5A7QA 4XFCA 3POYA 1RUI3 2PFWA 1CONA 2NZ9A 3D4KA 3EHKA 4J1XA 2HEYF 1KEXA 2P6HA 1KDMA 3POJA 5GLZA 3GHMA 2MEV1 5F5CA 2OUHA 2VCCA 4LTAA 2A70A 2XOMA 5CKNA 5E1RA 3SEEA 1C28A 4KWUA 3ZSMA 3QD6A 1DGRN 3HR9A 4HG6B 4A45A 2G9GA 5C6CA 2A6XA 4ET7A 1L7LA 1NCQB 2CL2A 4XCBA 5FZ0A 3AP9A 3ACGA 1SLAA 3HNYM 4JTOA 3ZKUA 4Q4V1 1J58A 4E4ZA 4EZHA 5IHRA 1XSRA 3HPNA 3T4VA 5H9PA 1ND3A 2JDYA 2TUNA 1W6NA 4Q4Y1 3N9PA 2J1UA 4P9YA 4MXWA 4AG4A 4K1ZA 4XJ8A 1O3SA 3CIHA 3ZMNA 5C70A 2X5IC 3HBKA 3ZVXA 1KD7A 4OFGA 4AI3A 1H1MA 2DV9A 3TEZA 2W1QA 1VIWB 3RZLA 2NMNA 2WA4A 3MW2A 1GQGA 3KCXA 4ZS2A 4PF1A 3VD5A 4OYUA 2WFPA 5GZGA 1DQ1A 1GLHA 2ZMNA 4BMBA 3AZWA 5L73A 3SC7X 2BPA2 3WF2A 5C3QA 4PHZA 3MV11 4QX8A 3K75B 2QQOA 1QNWA 3PU8A 5FY7A 4ZZ5A 1H6YA 1CGPA 5CVRA 4J25A 1MQTA 3FX3A 1VRH2 4QPIC 1QOOA 3ALQA 4WVVA 2R30A 2ZZQA 4P9GA 2BNNA 4R4ZA 4Q0UA 5FV3A 3H1MA 2RS31 3B93A 2F4PA 4TLFA 5LA1A 5EXOA 1Y9GA 2RDQA 2BV4A 2KA3A 3WF4A 4QQLA 5I8SA 5IVEA 1N1YA 3CJIA 1J59A 1YJKA 2VULA 4PLMA 4RHV1 4WVWA 5FJHA 4KNCA 2W94A 4RGGA 2JKBA 1H2KA 4GULA 3LDBA 2VECA 4KI5M 1NCQC 2R1DA 5KHIA 3LEGA 1LCLA 1I6XA 1OLRA 4XF1A 3GCWA 4QHOA 3FN9A 5EHDA 1YCIA 3GHNA 5FDBA 4A3ZA 3ZXKA 3E5UA 3WQ1A 3WNKA 3LOBA 2ZACA 1S0JA 1I1EA 3OBAA 2WFF3 3PVBB 3OCPA 3M2MA 1AX1A 1W6PB 3NW4A 4CDUA 5KR7A 4UFJA 2XHKA 3NNLA 4A6OA 1DQ6A 2VMEA 1RIRA 3OUIA 3D0JA 3V0BB 1OA4A 4C91A 1PVC2 4N7IA 3J8F2 4QKFA 5FY0A 1D0HA 3U75A 2WT0A 5T50A 1CAXB 2OYZA 4M3CB 4JQRA 4CU8A 3BPSA 3I59B 3K4ZA 1MVEA 1TE1B 4RFRB 3UYJA 1H4HA 3ZDSA 3LA3A 4ZZ8A 5JPNB 2W46A 3IN9A 5C5TA 1FNYA 1FXZA 1HW5A 4LEJA 1RUF3 1BJQA 1W6QB 3VBHA 4DY3A 4I0BA 1LOFC 1TG7A 1TEIA 2CWMA 1TMF3 5A1AA 2WWJA 2CV6A 1TME3 3M3CA 3T0AA 5LBFA 5J3UA 2YMZA 2OQ6A 3TN91 1CPMA 2TEPA 3IAQA 5C8CB 3IPVB 4QX0A 3NJZA 3KV6A 1OF3A 1OA2A 3VB9A 4CRQA 3KLSA 4P00B 1E5IA 1IS6A 2BBAA 2V72A 2CU5A 3VBFC 2RDRA 5CU1A 5GJ6A 1POV0 3RSJA 2GMEA 4YVWA 4CVUA 3FLRA 3UNPA 4BLIA 3MGUA 4HBNA 5D8AA 1J1LA 1LODA 2Y64A 4AVBA 2IFRA 2HWF3 4NVPA 2XQRA 4GA9A 4AVSA 1HB2A 2HEVF 1C8M1 3AXDA 3IMMA 3N9QA 1AR71 4N9HA 2A3YA 2UURA 2X05A 5FZ9A 2WQZC 5FUPA 5IK5A 1F8VA 4EWAA 2RV9A 1JXNA 1PZ7A 2DUQA 4HPKB 4XCAA 4CDWA 1ZRIA 1G9DA 1HXS2 4LO7A 1U5IA 3EMRA 5DDJ2 1UNBA 2JE8A 3CQOA 2I74A 2VQTA 1PIV1 3U0ZA 4CU6A 5FO8B 1DZQA 3AP4A 1BEV1 2ZHKA 2WNVB 2RS11 2DU1A 4BXSV 2ZGLA 3I2DA 4IETA 5FP8A 3P3PA 4P14A 3USUB 4AEMA 1V9U1 3KVBA 1PNGA 4IGOA 4FT8A 3WF3A 3NSTA 5FPXA 3UJQA 2X8KA 3WW2A 3WW3A 1XPWA 3ZPOA 5FOBB 5I91A 3O1TA 1V0AA 3D3AA 1ZREA 1O5UA 1RJ8A 4LA2A 2R32A 4ASKA 5FUNA 2XVGA 5IVFA 4QX1A 4C8DA 5C8CC 1HJFA 3ACIA 1Y9MA 3ZYFA 4DO0A 1QIQA 3Q8FA 2PLV2 4ONUA 3F2ZA 4PIZA 1UKGA 2ZGQA 3LFIA 1SPPB 3VHNA 3NV2A 3R4SA 3ZXEA 4AEDC 3W20A 1OD5A 3GNEA 3IDCB 4HKOA 3MICA 5DZGA 3SHRA 5J96B 1VBA2 2VMCA 4P9IA 2HBTA 2WS92 2B5HA 1ZX5A 2RR13 1O3TA 2YFUA 4OHWA 3HN3A 5F2WA 3RG0A 3WCRA 3RPQA 2Y38A 3DYOA 1ACCA 1X8MA 4FPEA 4IDZA 2Z42A 1X9TA 4KG8A 1ZYBA 5ABJB 1FMD3 4KQ7A 3OGSA 1FPN3 3K46A 3H9AA 1LEDA 2B9UA 1MS1A 5E88A 1OPOA 1NCRC 4OZOA 1VBE1 1Y43B 5JOXA 4FO9A 4GD4A 5FYUA 4EN6B 2JG9B 4JKKA 4OUSA 5IYYA 4P9JA 5F2SA 4ES9A 4JX0A 4UBGA 3MLJA 2GC0A 2Q5TA 2WSUA 3KHBA 3WG2A 5A32B 5AFBA 1C1LA 1QQP2 4IEQA 4NO4A 5BUVA 5FYCA 1QKQA 5FZ3A 3QH7A 4LHLA 2YPDA 1N47A 2VZSA 4G3YC 2K9ZA 4NPLA 4BWOA 5IAXA 3K4AA 2HWC1 1JMUB 1RUI2 3VHOA 4LE3A 2A3WA 1HB4A 5SV8A 3TAYA 2WABA 1QWRA 1OLME 2YFZA 4N7UA 3GJAA 3W21A 1S2BA 5J37A 2WNUB 3K77A 3TEXA 4YVSB 3I2GA 1CPNA 2VQAA 2YGMA 1UYYA 3JD73 1EPZA 1PO21 3ZN6A 3B01A 4Z92B 2YUEA 3A0NA 2HYKA 5LRRA 1O91A 4XE9A 3CJXA 1US2A 2XPJA 1GANA 1AYN1 1FV2A 1COV3 2JD4A 4YW1A 1LHNA 1D2SA 1NLRA 2QQIA 3MLLA 2GNTA 4QPGA 1XE0A 4Q5OA 2Y6HA 2ZEZA 4E2QA 4URTA 1PX3A 3A4UA 3WUDA 3WNOA 1LR5A 2VU9A 1GQPA 4YGDA 5CKMA 2DCKA 1UOBA 3LA2A 2PAKA 4INDA 1RGSA 4X8PA 1GNYA 3VBSA 4A44A 2PHRA 5FZDA 4NJ4A 3H0OA 4HANA 2EIGA 2C0ZA 4L99A 1JUHA 2XVKA 4LBOA 2RG4A 3BTYA 2AUYA 4LOTA 2WWSA 3MIBA 1MZ6A 3PJYA 3A22A 4GMP1 4NE9A 4N43C 2VUDA 5LEKA 5A1FA 4FAHA 3ZXFA 5AFEA 2AEYA 5T52A 4IUGA 3Q8AA 4QX2A 4EWEA 2W3JA 4QPWA 2IUWA 1MEC3 3AZZA 5J7MA 5CG9A 2SLIA 1WLCA 2CHHA 2ZXQA 3OPZA 1MS0A 4MADA 5A7PA 1SCRA 4OVEA 5JI9A 3WZ1A 1CIWA 3I2JA 3OGRA 5L9BA 4DUXA 1RJ7A 3U4SA 4D94A 5FLJA 1JYTA 1AXYA 1WLDA 1Z7S1 3AYAA 3U11A 2ZGTA 1LOBA 2OVUA 3NQHA 1WA6X 4DXTA 4WM7B 2QQJA 5JOWA 2RM21 5FAXA 3ZFGA 5FYTA 5DN2A 1AX2A 1X9PA 3KD4A 4H7MA 3OBZA 3GDBA 4E4DX 4HL0A 3F95A 3AC0A 3GBGA 3U4XA 4AK3A 2XDVA 4OMCA 2E53A 2VTXA 4HSLA 4QHZA 3TRSB 3VZOA 2ENRA 3WQ7A 5C4WB 1CAVA 5FQ0B 1WUVA 3VDDA 2WFF2 5H9QA 3VBUA 2WZR3 1D4M1 1DQ5A 4LK7A 1DQ2A 3R0RA 4K20A 5DUVA 2VNVA 1NXMA 4BOWA 4IEYA 2QDNA 1XQNA 2YG0A 2GALA 3NO8A 5JZGA 1TVGA 1H2NA 1F5FA 2JEMA 2DCJA 5HPOA 2FDGA 1LHUA 2D98A 4LKFA 1C57A 5FIXA 2ZS6B 3AKPA 3JB8A 2WZPP 2A75A 2XH6A
chains in the Genus database with same CATH topology
1LKNA 1ZRDA 4HK9A 1RUF2 4BE3A 2W39A 4YM2A 4XMAA 1TMF2 3LA7A 1DGWA 1RUE2 3DV8A 1TME2 3WD5A 1EYBA 1K5MB 1VAKA 4GALA 1UCXA 3BTAA 4K40A 1WMEA 4WM7C 2XJTA 1ASJ3 2WLPA 3B00A 4AHZA 1Q8OA 1HQWA 1V6MA 3VGIA 1Y9QA 4XW3A 3AP7A 1N1VA 3VBOA 1HQNA 2PHDA 4B3NA 3WLUA 1HRI1 1X36A 2BWCA 2A7AA 1WD4A 4WM8B 4R9CA 3WDUA 1A3KA 1ULFA 2XBO1 1PO11 1MZEA 1Z0HA 3ILNA 2Q30A 3B5LB 2EAAA 3D5OA 3GZUC 2IXHA 1FATA 2ZX4A 4CEYA 1NA1B 5I93A 4PDWA 4QQPA 1VLNA 3B9IA 4RS5A 1R091 4LLOA 3WW4A 4DRVA 5I0RA 4CEWA 2DVAA 4XQDA 1OOPA 1ENSA 3M3QA 1AR92 4HVOA 4ZXKA 5ACA3 1CAWB 1D0GA 4XF3A 3VZMA 4DMIA 1JYIA 2JECA 1U0AA 2NYYA 3ASIA 5EWSA 4LO6B 1RUJ1 1XYPA 2ZOEB 4YW2A 1D2QA 3AXEA 1I9RA 3I54A 1RUC3 1SDWA 3AFKA 2QKDA 1QHDA 4XIKA 4JAAA 4I02A 4N9IA 2QZ2A 4CP2A 2WIIB 2DU0A 2VMIA 3AMQA 2QUOA 1QOTA 2P17A 4AHWA 3H1YA 4X6RB 4OZXA 3ZXGA 3RMYA 4NHMA 1MS9A 2RR12 4RA0A 1JYCA 5E16A 3WG3A 1RUOA 4AI0A 4ORFA 3V56A 2PHLA 4IXLA 1BCXA 3BPZA 1FMD2 4CP0A 1FPN2 3N7LA 1ZBA1 1WLTA 4K1YA 2XG3A 1LGBA 2K0GA 5FFOC 2ES3A 1RMU3 2PHWA 4KWJA 2EA7A 2NM1A 2GH8A 1VRH3 2RMU3 2D5HA 3OYWA 4YGCA 4IESA 4Y1VA 3D6EA 4FPOB 2A6WA 2PELA 4PIYA 1UU6A 5LRSA 3JBG1 4YGEA 1QOSA 5EYYA 4YW4A 1KS4A 2AENA 3H50A 4YM0A 3VV1A 2GNMA 3ZYPA 1HIXA 2ZGUA 1LHVA 2IFWA 2VXRA 4Q4W1 3JD72 4C0HA 5LEJA 2O8OA 2WKKA 2NP0A 2JE7A 4HKLA 4P5HA 4COWA 1RHI1 1PK6A 4KH9A 4LBNA 2GN7A 4RQPB 3W58A 2VY0A 3NKGA 2Z69A 1RUG3 1XXNA 2BFUS 1EV11 3B9CA 5FMOS 1G8WA 5CFDB 1UPIA 4XF4A 1PVC3 3EXUA 3M1HA 3J8F3 3HMYA 2RJLA 1X50A 3ZXLA 5KXDA 4HLTA 5JLVA 1POV3 5A3LA 1O4YA 4LUKA 4XFFA 4TWTA 5DUUA 2Q4SA 2RS33 5F5QA 4ZKTB 1ND3B 1F2NA 1ULGA 4GH4A 1W6NB 1ZZ8A 1AR81 1PGW2 4M00A 2C9AA 4AHYA 5BNNA 1SBDA 1F31A 2ZGMA 4L2NA 4YRDA 2EAKA 5H9RA 2LUWA 3AX4A 4LBLA 3KMHA 4R9BA 1BQPA 1J3QA 1O7FA 2A73B 1A6CA 5BPXA 1ULCA 1H8TC 3JCIA 1A8MA 1PGL1 3EO6A 4FVVA 4OHYA 4DS0A 2IC1A 2BEOA 1MQTB 4RQPC 1AJKA 4KWLA 3SXWA 1YRZA 3HQXA 1U12A 1QH6A 2OPKA 5CFDC 1WW7A 2KM2A 1R1A1 3WY6A 1DHKB 2D7FA 4FAGA 5BNQA 2SBAA 1HXS3 2ZGOA 3RRDA 3DN7A 3CJIB 3PMEA 1R081 5DDJ3 2R041 3CL1A 2WLQA 3FMGA 4XBLA 1XU2A 4O9EA 2OZ6A 1M06G 4M3CE 3OF1A 5JI7A 3AFGA 3FLTA 3H3UA 4DPNA 1WW4A 4GKYA 4XPVA 4E27A 5K0UC 1VP6A 4JRLA 3TBDA 2O8QA 4K9SA 5H9SA 4LO8A 5BNOA 4RR3A 3VZLA 5JSOA 4YG0A 3TN93 2Q0AA 3W9AA 1VAVA 4OI2A 1SFYA 1AL21 4FP3A 5FO7B 2ZBJA 4RFT0 1HRV1 4XQ4A 3V65A 2LTNA 1BBT1 4B7EA 3R4DB 3IMNA 5C9AA 2HWE1 2ET7A 2BGCA 2FMDA 1AHSA 5AC92 2LALA 5JPMB 1ZM1A 3EQEA 1QU0A 4WBBA 1O3RA 3SLIA 1UIKA 5DUWA 1MQTC 2NLRA 2VVDA 3VBHB 2E7QA 3EBRA 3M7AA 5JMCA 4WVMA 2D6PA 4ISQA 3ZYRA 5AVAA 4LULA 3WOGA 3ZPYA 4E2GA 1LECA 1BEV3 1OFSA 1QQP3 1FI2A 2RS13 2YHJA 4L97A 1X82A 3WCSA 3WP6A 2ZMLA 1V9U3 5KXCA 3O12A 2DF7A 5ACA2 1S1AA 2DTWA 2XJQA 5D8AB 4AE2A 1V6IA 2D5FA 3WDXA 3MIHA 3RYRA 4NWVA 2XLAA 5CIRA 3PNAA 2ZAAA 2B7YA 2W68A 3ZYGA 4EV0A 1OHFA 1RUC2 4GQ7A 4JGYB 1REFA 4FQZA 3AK0A 3AP6A 2FHRA 4CDWB 1Y3TA 1CAUA 3JQXA 3DPRC 3IDEA 4IEXA 1X33A 4NHKA 3RYPA 1LU1A 3AMHA 1VB2A 2OA2A 4XMIA 3AZVA 5SV5A 1OSGA 3D8CA 3USSA 3THPA 5CNAA 2ZZJA 4I3PA 1ZBE3 4FOWA 1QXRA 3HD8B 4BIOA 4K7JA 3TYJA 3POSA 2GC2A 2XUMA 2DFCA 1NOVA 3ZXJA 4Y26A 2VVEA 4IV1C 5EV7A 4MYEA 4H14A 1KJLA 3NAPA 4Q1PA 1RMU2 3VHPA 2E7TA 4COZA 1AVBA 1DFQA 1PGSA 4XFGA 2RMU2 3ZIXA 2AREA 3GBFA 5GZCA 1HKDA 1ZZ7A 3LOIA 2EALA 4XXAA 4Y5Z0 5I0TA 3PVOA 4GB31 1PO23 3NL1A 1QDOA 4YM1A 5KC5A 4Z2WA 2JX9A 3LCPA 2CY6A 2K2SA 1C3HA 3E6BA 4H7LA 4Q4V2 4JGYC 3GF6A 4J6GA 3M3EA 4CDWC 1S0DA 4PIXA 1OLQA 4R52A 1VALA 1DDLA 4FOVA 1G6NA 1UF2C 3AB0A 3URFA 2ZA9A 1RUG2 4KL1A 1IZ3A 1AJOA 2DTYA 1ONAA 4PQ9A 4G4FA 5C33A 3ENRA 1B35A 2ZGNA 4QM9A 4KGQA 4OHZA 4FSJA 5FTTC 3BODA 1XNCA 2JG8B 4YM3A 5L7OA 2UWCA 1LULA 3ZN6B 5KHGA 1UX6A 1UW8A 4OHXA 4HT1T 1SLIA 1WW5A 2BUKA 2RS53 3AYDA 3FWEA 3C2UA 3DGTA 1IHMA 5DZFA 5CFCA 2RS32 3B3QE 5DUXA 1RUE3 4Y22A 2AR6A 3ACLA 2W52A 3TWIA 1NZCA 2GN3A 3APBA 4AFDA 1OMIA 2RM23 3MEPA 4FPGA 3ZX7A 4AVTA 1W6MA 5DZEA 2X5IA 5FCCA 4RSUA 2CWSA 4FCAA 4RL7A 4UXAA 1QJX1 3ZXDA 1IQAA 1G9FA 2WT2A 1DGLA 4X6QB 4XOGA 1D4M3 4BHPA 1ENRA 1JN2P 2ZKLA 4FXGB 4AGGA 4N53A 1UKRA 2PHUA 2E6VA 4FXKB 2HWD3 4QPIA 1LGCA 1BYHA 3X29B 4M0HA 4OUMA 5F6KA 5HBAA 4XTPA 2A3XA 5LK7B 1EAH3 4CYDA 2RHPA 4E9KA 3R6SA 3VL8A 2PAMA 2OW4A 1S2KA 3FLPA 4AI2A 5GALA 3ZFGB 2JG8C 3B94A 1Q3EA 1O5LA 2CAUA 4IERA 4AFCA 4B8EA 1V6NA 2Y0OA 5F1RA 1AR93 1VBA1 2R0HA 5EYXA 2XWBB 3FC0A 1J3RA 3KSCA 2ZGRA 3QLQA 4YW3A 1W2UA 3SH4A 2R1BA 1UZZA 4A7KA 4LBKA 1DZRA 3SMHA 1RVF1 1CAVB 1Q43A 3TN92 2MNGA 3VDDB 1X7NA 3VBUB 3N7JA 2E51A 5GLVA 2E9QA 2QZ3A 4YZ3A 2X53S 3P3NA 1LENA 5JZGB 5IK4A 3M3IA 1ZZCA 3QOPA 4HETA 1PZ9A 3FE5A 2Y26A 1AR72 4GIQA 2ZX3A 3MPPG 4XQWA 4AVCA 2DFBA 4I30A 3OD4A 5GZEA 4OULA 1PIV2 4C90A 1YXWA 3AKRA 4LBQB 1SQ4A 1ZRRA 3SISA 2MHFA 1IPJA 1BEV2 1IKPA 2UWAA 3AKTA 2RS12 4QU2A 2PTMA 3GBWA 2H0BA 2WNVC 4FPYA 1V9U2 3AMPA 3VBFA 4MVTA 2VUAA 3VBOB 2GH2A 1G86A 2YDEA 2YPJA 1QNYA 1RUD3 1QJU1 2R49A 2VOVA 5JWPA 5T3NA 3VDDC 1ENQA 4ZU5A 3VUOA 4CP1A 2R0FA 3KT1A 3U10A 4IL7A 3JQWA 4LT5A 2Z5WA 1WMDA 3WUCA 4CEYB 3SITA 1NG0A 1FX5A 3HN1A 2WINB 5JZGC 2ZMKA 4RS5B 1BMV1 2HJIA 2DVDA 1LHWA 2WQ4A 3MDPA 4CEWB 4AFMA 1OOPB 3RNSA 1JHNA 1FOD1 3WINE 2D44A 4AQSA 1EPWA 1ZBE2 1AL0G 2B39A 1VBD1 2ETEA 1OKQA 5ABJC 5JDBA 4COUA 4D7YA 2R073 4PJYA 4AQ6A 4EWDA 1MS8A 3RI8A 1R1ZA 2GC3A 3OJBA 1DIWA 2JG9C 4XTMA 2ZABA 2GSYA 1YIPA 3PMSA 5L36A 3MZHA 1IOAA 3MFAA 1AYM1 1SLTA 2FQPA 2WFF1 3IPVA 1KXGA 1LU2A 4IEZA 2UU8A 4COVA 4HK8A 4AEDA 4QX5A 3VBOC 4GXLA 4Q4W3 5FMOL 1HLCA 1ZA4A 2WNUC 1PO22 4XILA 1OFNA 1SLLA 1Q8SA 4YVSC 3ZFEB 4P9WA 4QMAA 1RHI3 4QGNA 1YFXA 1D4VB 4M3CF 2E7AA 1LGNA 3VKNA 1NCRA 4I0AA 1RUF1 1LEMA 5J48A 4RS5C 3RZZA 1TMF1 4META 3ZN5A 4CEWC 4MUVA 2ET1A 3BCWA 1L3JA 3U07A 5FPZA 2PHFA 5A3MA 3IKWA 1JOJA 4FPKA 4BIFA 1Q8VA 4OI1A 3USUA 1KRIA 1MS4A 1YI7A 3VBRB 1XE7A 1ND2B 3ILRA 1QMJA 1ZNPA 1RC6A 2RS52 4GWNA 2HWF1 3D0SA 1UPSA 4C1XA 2ZHMA 1IS3A 4G9SB 2DUOA 4AI1A 1PK6B 1DQ0A 1RITA 3WX5A 3ZFFA 2ZX2A 1YYNA 1Y7BA 1Z7S2 4XHXA 4CDQA 4IEUA 4LHNA 4GMP0 1VBB1 3NKTA 4FPLA 2RM22 4I01A 1H8VA 1NY71 3RQ0A 3WP5A 4Q4X3 5FO9B 1XYOA 3ZFEC 1X8EA 2ZJCA 3MFCA 3WW1A 2ARXA 1LESA 4Y20A 3ZSLA 5AC93 2YC0A 3E97A 4TYSA 3SCFA 4N43A 1D4M2 3MW3A 2P37A 5C4WC 2R061 2VNRA 3ATGA 1DYKA 4XETA 2ZHNA 4GH4B 2ZX0A 2HWD2 4Q2FA 1Q8QA 1QJY3 3WDWA 4D7TA 3AMMA 5A32A 3B02A 3VKLA 3HWJA 5BNNB 5KC6A 3ROUA 2XL7A 2NQYA 3PHMA 1EAH2 3ME2A 1RUNA 2FBEA 1H2LA 2B8MA 1LHOA 1Z78A 4KBBA 2VOKA 3VBRC 1ND2C 1AF9A 2D6OX 2HWB1 1JH5A 1ZZ6A 1PK6C 1SBFA 4XJWA 1FMD1 4W65A 1FPN1 1HRV3 3O14A 1M4WA 4EJRA 3VHRA 4Q8KA 1PMIA 4F7ZA 2BNMA 4FTBA 1H2MA 1K5MC 3WHTA 5T5PA 3H7YA 3FBMA 5GLUA 5HXVA 4GWMA 2A6VA 2JE9A 3LKJA 4FQ4A 2DWRA 2XKOA 4DINB 4R8HA 3ILFA 1GBGA 3RJRA 5KXBA 4LO5B 4OLLA 1HRI2 3HAGA 1MVQA 3CF6E 3LWCA 4UW6A 2XBO2 4WM8C 5FOJB 3SCGA 2FMYA 1WCKA 5BNOB 4RR3B 1GNHA 4ISRA 4Y1XA 4GH4C 4UW5A 2D97A 1AR61 3BB6A 3LSDA 3N7KA 1COV1 1NA1C 4U36A 2R6QA 1YJLA 2WNEA 3OGGA 4SBVA 4K3UA 4N90A 5C9AB 2ZTNA 1V6KA 1ZVFA 2MEV3 2XL9A 2P3JA 4JVAA 1RB8G 1GR3A 3N4MA 1MS5A 2JJ6A 5JSPA 3FHIB 1RUD2 2FZ2A 1A78A 3UKNA 2XJSA 1RUH1 3VN4A 4FTEA 1S0EA 4JGZA 4Q4V3 2AGSA 5JR7B 4KU7A 3WG4A 3C3VA 1SEFA 4Q4Y3 1MEC1 5T55A 4BH9A 2GU9A 2QDRA 3MYXA 1HX6A 2A5ZA 3A0KA 1VBC1 1TNRA 1WBFA 1PGW1 1XNDA 4DZGA 1C8NA 3IBMA 3KT4A 3KCCA 1LOCA 4JV4A 1GZWA 1URXA 5DXDA 1MZ5A 1CD3G 2E63A 2PQQA 1CR7A 4DQAA 5BNOC 2JDZA 2R072 1DU3D 2PYTA 1OQDA 4QQHA 2ZPXA 3ZYIB 4XFAA 1PVXA 3BU7A 1GZCA 1S0BA 3MIEA 4JDMA 1DBNA 4PLNA 1H1IA 3I8TA 3V0AA 4YZ2A 5GZDA 5A33A 3VLBB 4MXVA 1CAUB 5BY5A 2WZR1 1GYKA 5C9AC 2DUPA 4MXWB 4GB33 2BW8A 4IV3A 1WGPA 4QQOA 1KJRA 4RHV3 1W6OA 2GDFA 3BOPA 5JSRA 4IEVA 4Q4W2 3QH6A 3AYCA 2PHXA 4C1WA 1C1FA 1H9WA 1DLLA 1JUIA 3K48A 4OI0A 2DURA 4XFHA 3KGZA 1RHI2 3DUIA 3NAPB 2D6MA 4BZ4A 4YGBA 3ETQA 2D3PA 1ALYA 3TNPB 4WVZA 4LBMA 5TSWA 1EV12 1KFUL 1XU1A 1N1TA 1ZRFA 2CNAA 1LJ7A 1UD1A 4WZFA 4ES8A 1LRHA 2XKPA 1CAWA 1N3OA 1ENXA 1ASJ1 2QFEA 2CGNA 4YZ5A 4A7YA 2X29A 2OZJA 3MW4A 4XDQA 4AW7A 1UZYA 5KHJA 2P2KA 5GLTA 3S7EA 1DYPA 2Y0IA 3RDIA 2TNFA 1AR82 4I2OA 4ATFA 1ND3C 1REDA 3EJKA 5EZWA 3V64A 1H9PA 5E8AA 1V6OA 2Q8OA 2DCZA 2D93A 3E5XA 4CDUB 1UU4A 2KXLA 2LM3A 4Y24A 1TNFA 1B35B 1XNKA 4Y1ZA 4YZ1A 4Q4X2 1QJX3 3RS6A 4PF5A 4FOQA 2D3SA 1PGL2 4FPJA 4C0BA 2B42B 2VQ0A 4FP2A 3OBRA 3IT8A 5ACA1 5L7OB 4LUMA 1S0CA 2VW1A 4BPZA 4NPRA 5K9YA 1C8M3 2BVVA 3WDYA 1OI6A 1QXJA 1AR73 4Q26A 1AXZA 4LNVA 5CA6A 4BQ1A 4XZPA 4AGRA 1PZ8A 5CFCB 1NE6A 2GAUA 1DQ4A 3WVJA 1RUC1 2W0XA 4Q0VA 3MIGA 1QJY2 2WT1A 2YXSA 4Y22B 5JOZA 3O7OA 1R082 2ATFA 2R042 4YG6A 1PIV3 4KU8A 5BV6A 1YFYA 3INAA 3CJIC 3E5QA 4DY5A 4QQ2A 4LR4A 1QXPA 1W6MB 1CJPA 2X5IB 4YVWB 5KHHA 3VZNA 2I2SA 5KHKA 4PLOA 1CVNA 5T5LA 1KITA 1H8TA 3GZAA 2VPVA 4J1WA 1AL22 4YARA 3S0MA 1HRV2 2W08A 4N53B 3SNMA 2A6YA 4QGLA 5F6LB 4RQPA 4QPIB 3M8LA 2VMHA 1RMU1 4CDUC 1RL3A 4YFZA 1UU5A 2EVXA 4UBHA 1VRH1 1B35C 1PM7A 3KQRA 5CFDA 4HSJA 4JRAA 4CZSA 2HEWF 4LBQD 1YFUA 4M0NA 3CEWA 4M01A 4H3WA 1N3PA 3UK9A 5L7OC 2I45A 3PLQA 1AUYA 4F8AA 1ULDA 5K7PA 5BNPA 4QT6A 4Y4YA 1FYUA 3S6PA 2VW0A 5JCTA 1NLSA 1VBE3 5JVVA 3VBHC 2BYVE 4NHLA 5K0UA 5CFCC 3O0WA 1GZ9A 1VB4A 3L2HA 4L11A 4B4PA 2EXJA 4TZDA 1GNZA 2HWC3 3ZSKA 2G9FA 4YVWC 1RUG1 3KZ4C 2MEV2 5D8AC 3CLPA 1QJU3 3ZN4A 1U5YA 1W0OA 1PVC1 2F6BA 3ST7A 1F9KA 3J8F1 4R4XA 3FBYA 2DVFA 2EXIA 2N7GA 3H1WA 4CDXA 3ZIWA 3PJQA 4W6XA 4QPYA 1YFWA 4HMZA 1J3PA 4N53C 1AYN3 5C8WA 3ELNA 1POV1 4YZ4A 2GMPA 4XJZA 2HKXA 3BALA 4Z1VA 4MGZE 4Q4Y2 3G6JB 3OBTA 2ILMA 2VNOA 5HI0A 1I3HA 2RJKA 4W6YA 5I0UA 2V73A 4AFBA 1FNZA 3RYKA 1FOD3 2VVFA 4HFSA 1LB2A 1SCSA 2FZ1A 2IXCA 1DGRA 5EFUA 1KS5A 1T6GC 1W0PA 3O5SA 1VBD3 3VBFB 4B7KA 1FAYA 2P3KA 3M70A 4GMP3 4MGYE 2DVGA 1RTVA 2UY8A 2V5YA 3G7DA 4Z8BA 3O0VA 3KT7A 1YI9A 1OPMA 2YROA 2H6BA 2VNGA 4DXZA 5CBLA 5E89A 3W59A 2IXKA 4A2UA 1AYM3 4YNIA 4EROA 1REEA 3H8UA 1YLLA 2VMGA 3ES4A 3RI9A 2YYOA 4UW3A 2IZWA 5K8SA 2D6LX 4QPGB 1Z7S3 2WA3A 4GB32 3DPRA 2EXKA 5I0SA 1H0BA 4RHV2 2NN8A 5AVPA 1HXS1 4MX3A 3VBSB 2YY1A 4OI4A 5DDJ1 4DOUA 4WV8A 3RJ2X 4D69A 1WLWA 2R16A 5T5JA 4LA3A 1YWKA 4YYOA 4F3JA 3E6CC 5GZFA 4HN0A 1DZTA 3UJOA 1WD3A 1XNBA 4IEOA 2DCYA 3VKMA 1I5ZA 1YHFA 4IV1A 3KB5A 3PVEA 2VG9A 3OY8A 5JIAA 4BLJA 3LGRA 1F5JA 4AXOA 5T54A 4XHBA 4AYUA 4AEDB 1HV1A 2PLV1 4S2HA 4K21A 4HVQA 2QCSB 1G9CA 4K6BA 1KDKA 1QF3A 2CTVA 2XVLA 2WS91 4KG0A 1LTEA 3WHUA 4XYXA 4IEPA 4AHXA 1NCQA 3IWZA 1NCRB 4JGYA 3DL3A 4AQ2A 4FBFA 4AVVA 2XLFA 4QPGC 5JIUA 1VBB3 4AEJA 3AKSA 4LLFA 4AWDA 4Q0QA 3JZVA 5KBFA 1UAIA 2D40A 1V00A 4JDOA 3JUUA 4XFIA 4YW5A 3UKTA 3VBSC 4BMEA 3B7MA 1GFF2 3JU9A 1QQP1 3K51A 1QJX2 3TNQA