2VNRA

Family 51 carbohydrate binding module from a family 98 glycoside hydrolase produced by clostridium perfringens.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
172
structure length
172
Chain Sequence
b'SRDVYLSDLDWLNATHGDDTKSKIVQKNHPFTPGNNNQSTKISLKMEDGSISEFEKGLGTIAGSPSTITYDISGAGVTKFFSYLGIDRSANPINEQYAKVDKIEVVVDGKVIYSTINQFPNGLTYETPAIKVDLNIPENAKRLQLKSYAGEKTWGDEVVYADAKFTAKGDFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CPE0329
publication title Divergent Modes of Glycan Recognition by a New Family of Carbohydrate-Binding Modules
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
total genus 39
structure length 172
sequence length 172
ec nomenclature ec 3.2.1.-:
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08305 NPCBM NPCBM/NEW2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1060 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vnrA00
2YGLA 2VMGA 2VMIA 2VNGA 2VNOA 2VNRA 2YGMA 2VMHA
chains in the Genus database with same CATH superfamily
3IIIA 3NKTA 3VDCA 2WT1A 4R8HA 4RHV1 2G9ZA 1T6BX 5DDJ3 3WSOA 1TVGA 1MVQA 3SHRA 4NHXA 1YHFA 4P9WA 4W65A 2BFUL 3ES4A 4FXKB 2ZGKA 4UFMA 4YW6A 1VAKA 4PCRA 1UY1A 2R1BA 1VE0A 1W39A 2F4LA 5BY5A 4QKDA 4M3CE 4CVUA 4AK3A 3O1VA 1NA1A 3J8F3 2VNGA 3B5LB 4E8DA 2B5HA 2FZ2A 1DLLA 5ACA1 5LEKA 2YBPA 1PK6A 1OUXA 3AMHA 1JYIA 1DQ0A 2C9KA 3CIHA 1W90A 1JZ6A 2H0BA 4F3JA 2D6KA 3HBKA 1HV1A 4C90A 3K4DA 5A7SA 3R4UA 4DZGA 4MADA 1W9TA 3HNYM 1MS5A 3HNBM 2YUEA 1ZBE2 2MEV3 3KVBA 5T55A 2JB4A 5FUIA 4DQAA 1S0GA 5GZGA 5L7OB 5GJ6A 1AYN2 1SLBA 4MGSA 4Y5SA 4R9DA 4LO6B 1W9YA 2D40A 3PMEA 1ODMA 2RJLA 3JD72 4Y1VA 3VD5A 4CDXC 5BUVA 5IVFA 1F35A 1E5SA 1H8VA 2OS2A 5FFOC 3IDCB 4HVRA 3ZYPA 4CPBD 1H6XA 1DYOA 5FY1A 4XC9A 1IPSA 3ZMNA 3THTA 3BOWA 4FPGA 2XKPA 1OURA 1Y9MA 2XXZA 2R073 2Q8CA 2J7MA 3OGVA 2EIBA 1OPMA 5I8SA 1KJLA 1R091 5FY0A 1CAUB 3WP3A 2C24A 3ST7A 2D44A 2XHKA 4IEVA 5FZKA 5M0TA 3I3DA 4D69A 1REDA 3UNPA 2X05A 1UNBA 4XBNA 1LTEA 3PVEA 2R062 3JB8A 3U11A 3ZX7A 1YUDA 4WVMB 3ZIWA 2CWSA 2VCCA 1Q43A 2YU2A 1EPWA 1LU2A 2NP0A 3WF4A 1EAH1 5E6HA 4CEYC 1PGW2 2VMIA 3FLRA 5CVRA 3JQWA 1J84A 3WW4A 3T0AA 1OKQA 2XBO2 1RXGA 4BMBA 1DGLA 2GP3A 3DCQA 3D3AA 5J98B 3ZIXA 1GNYA 4WM7A 1BK0A 3LB9A 4AYUA 2JDAA 1QXPA 2GC3A 2ADDA 5F5QA 3BGAA 2P1BA 3WW3A 3U10A 4ZS3A 1G9AA 2FCUA 1IGOA 3DECA 3LEMA 3ZYGA 1ST8A 2DVFA 4XQWA 1C5IA 1FOD2 3KD4A 4E2GA 2ETEA 3GHNA 4XACA 2A70A 2QQKA 3J7NA 3NW4A 2KA3A 3KHBA 3AC0A 3ZXLA 1UMZA 1QOSA 1REEA 1UX6A 5F3GA 5IW0A 1YJKA 2GDFA 3NAPB 4YNIA 1AR72 2XUMA 2ZX0A 1AR92 5IK8A 3VZNA 1JYVA 4COZA 1AXKA 4RS5B 5I8YA 1IS5A 2BFUS 1NCQB 4AWDA 4ES9A 3MF6A 4LTAA 4Y4RA 3UJOA 1N3OA 4K6BA 1WW7A 4TTGA 2JD9A 1QF3A 3MLLA 1QJEA 1W03A 4YGDA 5L7OC 3APBA 2E9QA 4MSVA 4GWIA 5KC5A 3AMNA 4KG0A 3WUDA 3ZN6A 2WSUA 4JHTA 1OA3A 1UIKA 4XF9A 1C5HA 1DYKA 1R082 4HL0A 2IZWA 4NWWA 4MH0E 5JPNB 2JD4A 2VVDA 4Q4W2 3V0BB 3BUCA 2UWCA 2JXAA 3N3HA 3C7OA 2RV9A 1V6IA 2C0ZA 1BBT1 3WNLA 1JU4A 2DCJA 2ZGRA 4K21A 4IE4A 4S2DA 4JGYB 5G05L 3RWNA 3O1PA 1NE6A 1GMMA 1POQA 1NKGA 3CDZB 3WLUA 4URAA 4ZHNA 1HN1A 4RQPA 5LATA 1R093 3VBFB 2X8KA 3VKMA 2HBTA 1S0CA 2VG9A 2NQYA 5DAQA 2FMYA 4ARYA 5A70A 1AR62 3WV6A 3PNAA 3AYCA 5D2AA 2HH9A 5CYYA 5EFUA 3VBRA 3UYJA 3U0ZA 4L8QA 5K9YA 3PUHA 3WQ1A 1RUC2 1C57A 3MIFA 5E16A 3RYPA 3DUIA 3RMYA 4MO3M 3WNKA 5C4WB 5KWRA 2HEYF 3V64A 2C5DA 3ZSMA 2Z2SB 3LD8A 2RDRA 4C1WA 5FO9B 1CWPA 2V4AA 4FFGA 4BIFA 3WX5A 5FPBA 2JDUA 3AVSA 1TME1 1ZZ9A 3MPBA 4NR1A 1V6LA 3QOPA 5AVAA 2DVDA 1S4CA 3OPWA 1Q3EA 3AJZA 3NAPC 2R0HA 2WS92 1AYM2 1S2EA 1D7PM 2WBKA 1CAVB 3B00A 3HMYA 3NJZA 3WDUA 2FCTA 4AVVA 3JCIA 1RUE3 4HN1A 3H9AA 2YU1A 3MIEA 4LHLA 2VUDA 2D6PA 4QGNA 1NCQC 2YYOA 4PQ9A 4X6RB 1WLTA 3O12A 2OKXA 3ACHA 2WUHA 4K8RB 1GANA 1WLWA 1C3HA 1CAXA 1NQJA 1OLRA 2E7TA 4FCAA 4PDWC 4Y1YA 1IQAA 1YQ2A 1RHI1 3FWEA 5DZEA 4Y1ZA 5EQUA 2MHFA 1M4WA 1XNKA 4CCJA 5I0SA 4A3XA 4Y22B 4R52A 1LGCA 1YFYA 3AMQA 3E5QA 4HZFA 1VBB1 2IXKA 1PVC2 3EYPA 4B29A 1HKDA 4NAMA 4AI9A 3KF5A 3EMRA 1I5PA 2VCBA 4LR4A 4QX2A 2AUYA 2P3YA 1DLCA 3I59A 4FO9A 3VL9A 3LFIA 3MW3A 1UKRA 4H55A 4PF1A 5KHHA 2UY9A 1IS4A 2JDYA 2PFWA 3BTXA 2E6VA 2V09A 5C9AA 4ITCA 1AL22 3J9SA 3VBFC 5LWBA 3DF0A 3NO8A 5LBFA 1RC6A 4YVSB 5EV7A 1U5IA 2P3IA 1W8OA 1K45A 1RMU1 4IL7A 4WM8A 1ND3B 1RJ8A 4DXZA 2ZMNA 3BYWA 2W94A 1WA4A 2J1AA 5KXBA 1O4TA 1ZZCA 3GM8A 2XJSA 3IDEA 4HBNA 1QKQA 3OGJA 1EY2A 4XQ4A 2N7GA 3UKNA 1JS9A 2WZR1 3ZYHA 4DNYA 5FY8A 3WF1A 1FV2A 2HYKA 3IAQA 1G6NA 4E4HA 1BLZA 4G9SB 3WUCA 3BB6A 4FBFA 1FMD1 4OI4A 5FZLA 4EQVA 2XB6C 3K4ZA 5A80A 4Y5Z0 3VZJA 3VBHA 1HRV2 5FIXA 3VDBA 2ILMA 2BJSA 2Y33A 4BPZA 5FO7B 4A4AA 3VKOA 1HRI2 1V9U1 2EIGA 5H9SA 1ZZBA 1TME3 1OD3A 2RM21 3TOJA 2WDBA 4HSJA 4YZ2A 2RS33 3CL1A 1G9FA 1OKOA 2B46X 2YPJA 3B3QE 3KM5A 1O7FA 4OZXA 3LKJA 2ZHKA 5EZWA 4DUVA 2AC1A 1XB9A 3DYPA 2PHDA 1NZCA 1R1A2 4XDQA 1JHNA 1H8TB 5EIYB 2A73B 3E6CC 1CR7A 4Q0SA 1DDLA 1S0FA 3KGLA 2D5FA 4Q4Y1 1SLLA 2NZ9A 4ARXA 4MXWA 5FJKA 1H2KA 3T1MA 3BTAA 4M3CA 1RHI3 2E63A 3THPA 1K12A 1EV11 1VBA2 3S5AA 3DKQA 4E8CA 2XMLA 4JDNA 3U78A 4NIAA 5GALA 2WLPA 1BXHA 1VBB3 3EBRA 1XYOA 3H3LA 4LBQA 2X5IA 2VVFA 4NE9A 4NRMA 3VBUA 2VZ1A 2OUHA 3KCYA 4WBBA 5FDBA 5FRAA 3C7EA 1E5RA 1Q8SA 2VQTA 4KBZA 4I0WB 4CUAA 3K77A 4UBHA 2VMGA 3C2UA 2E51A 1AVBA 1SPPB 1V6OA 3N7MA 5JOWA 1AX1A 1JOPA 2JKBA 2ES3A 1RUOA 4YVSC 2BEOA 3J8F2 3T2OA 1LGBA 2VL4A 4QQLA 1H1AA 2VXJA 3LAGA 4HLTA 3KQ4B 2BRTA 4COWA 1ND3C 2PAKA 5B4XA 3LGRA 2FD8A 1NOVA 3WNPA 1RMU3 1US2A 4V1PA 1LHOA 5CFCA 1W2UA 5DQ0A 3WCSA 5JSPA 1S0IA 4L97A 4YGBA 3VDDA 2VOXA 4HANA 4K20A 2MEV2 4AAPA 4D3WA 2W1UA 3E6DA 3KV4A 4HKWA 1XPWA 3GCWA 4WM7B 3ZXEA 1NCRB 2WQ8A 4RL7A 4XHBA 5DUXA 5IK7A 5KHIA 2W1QA 1WW6A 4XXAA 1DZRA 1QJY1 5L9BA 1VBC3 1RXFA 4LIUA 3OBZA 1YQCA 4CDXB 5FPUA 3ZFFB 3MW2A 5GLWA 3W5NA 3NV1A 1CZVA 4WZFA 4WVWA 5LK5A 2R072 4AQSA 1EPZA 4ZKTB 1DFQA 3AP9A 4UW4A 4XYXA 3ZPOA 1RUH2 3OD0A 1UXXX 2QQNA 4W8JA 4NROA 4XXPA 2RM23 4IXLA 4RR3C 2WWUA 4LQRA 3GF6A 4GZ9A 2VCMA 3GNEA 4MGKE 1OMIA 5FYTA 3T1LA 5BNPA 3ZN5A 2H6CA 4PBPA 2JG9B 3UV9A 3KHCA 2DDUA 1XE7A 3GXUA 5CIRA 2DURA 2FMDA 3U37A 1SG3A 1NT0A 3FC0A 1AYN3 3WVJA 1GNHA 1I1EA 1V6NA 5CZKA 3QH7A 4LITA 4KWLA 3OPZA 1IPJA 2VGDA 4K8FA 4AQ6A 5K0UC 1I5ZA 2WNUA 1OXCA 1EV13 2WRAA 5F5AA 2OA2A 1I6XA 1MPXA 1NG0A 1Y7BA 3MUZ1 1RYYA 1EUTA 4D6QA 4KI5M 2WAOA 2X29A 4OVEA 5A1AA 3V56A 4XBQA 1QIQA 1QXRA 2RDNA 4XTPA 2HEVF 3VUOA 1TE1B 3GZEA 1N1SA 1RVF1 1UAIA 4QB2A 5HXVA 4KWUA 5LBEA 3H8RA 1U5ZA 3IMNA 4JRLA 1O91A 4N8MA 1O6UA 4LBJA 5APAA 1OLME 4LLFA 4AQTA 5HV0A 1JYTA 3Q8FA 2ARAA 1MEC1 3ZMOA 5I8TA 1CZTA 3B93A 4CP1A 1C28A 5DXDA 3EXUA 3O1MA 2ZX4A 4ZXEA 3T09A 5FBZA 4CCEA 3RS6A 2XQXA 1UY4A 2E33A 1U5YA 2XQRA 4EWEA 2BGCA 3RZZA 1OQDA 1QXJA 3ME2A 4OZOA 5A3MA 4Q2FA 4QMAA 2A6ZA 5FPLA 1NCRC 1BHGA 1RUD1 1Y4WA 4LOSA 1ZVFA 4YVWB 1T6GC 4QPGB 2DCZA 3E5XA 1O5UA 4S2FA 2F17A 1LEDA 1OUSA 2QDRA 5EWSA 2DCTA 4RGGA 3RNSA 1D2QA 1UOJA 1C8NA 1QJX1 2W47A 2OW4A 2VZVA 4ZONA 1LODA 4TWTA 5G04L 2BGPA 2RDSA 1VAVA 3HPNA 3MDPA 4LE4A 4N43C 5FK7A 5BNNA 5L36A 4EWDA 1ZRDA 2OPKA 4HOOA 3BU0A 4AHWA 4TZDA 4IE7A 4OHVA 3RG0A 1HB2A 2ADEA 3FLTA 5FYBA 2ZKNA 1R1ZA 1D0HA 2KXLA 2QQIA 3AM2A 3ZFEB 4QXKA 2CL2A 1R092 2VECA 3KMHA 3PURA 5K8SA 4NRPA 3V0AA 5JR2A 4XF4A 3O14A 5FP9A 1JTZX 1SEFA 1UIJA 1Z7S1 4FFIA 3GZAA 3NJXA 3O0WA 2BPA2 4RSUA 2BYVE 2AACA 2WFF1 1HV0A 3ZO0B 1MS1A 2EXHA 3N7JA 4KGQA 1WCKA 4Y1XA 2DU0A 4JDMA 3LA7A 1KD7A 5FMBA 2D93A 1R083 4YZ3A 4CE8A 1D4VB 2RMU3 3RZJA 4ES8A 1XNTA 1SACA 5CBLA 5BXXA 1TZOA 1F5FA 4DUXA 3POWA 4PT6A 2YPDA 2Z79A 4D0QA 4OULA 1W8HA 2EICA 3H3UA 1W8FA 4NN0A 5FMOL 1NX9A 4EN7B 3KV6A 2G1MA 1PNFA 2P37A 3NMBA 2PHLA 3WDTA 3MHZA 5LB6A 4FP3A 4J1WA 5IVBA 5JLVA 1UN1A 1RVF3 3I2DA 5C3QA 1H0BA 3RYKA 1W6MB 2PHRA 3PLQA 4XUQA 5AVPA 2JB8A 4N53B 5EYXA 4C0HA 4YM1A 4OQ9A 4P9IA 1YQ6A 2VH9A 2QTWB 5I0RA 3FBMA 1XE0A 3BOPA 5JMOA 3MBWA 1UWWA 4K1ZA 1RUI1 1SCRA 3WF3A 2ZX1A 1N1VA 4XAAA 1G86A 4M0HA 5K4LA 4A44A 4CCCA 1OOPC 4QPGC 1PGSA 1ENQA 2V5YA 1QJU3 1ZZ7A 2BOJA 2YV8A 2PA7A 4URTA 1SBFA 3FL7A 4F83A 2BDRA 4AI3A 4COVA 3P5BA 4Q0VA 1W8TA 4M4RA 1UL9A 1WGPA 2DFCA 4P9YA 4Y24A 3H50A 4H2AA 4UFLA 1EP0A 2YC0A 4GMP1 4K3UA 5FYVA 3Q8CA 4XABA 4EROA 2PHUA 4XIOA 3VZKA 3S5QA 5A3NA 1GZTA 4GH4B 1Z78A 3S0MA 3EQEA 2JE8A 2DYCA 3QD6A 3ZR6A 1BBT2 2R16A 2HWC1 3NV2A 1RUF1 1S2KA 3USUA 3FUQA 2NM1A 4CP9A 4W6WA 3AB0A 1KFUL 5I0DA 2VY0A 1RTVA 3I54A 2ZZQA 4IEUA 1QDOA 2DCKA 4XE9A 4JAAA 4A42A 1H1MA 5FAXA 1XE8A 1J83A 5ABJB 2BERA 5EHDA 3VD3A 2WFF3 3RZKA 1PVC3 3LPFA 1VMFA 3W59A 4YW3A 4FPOB 1MQTB 5L73A 4C91A 2WNVA 4AOCA 1PO11 2DTYA 2GNTA 1W6QB 1RB8G 1FT9A 2ORXA 4AI8A 1GQPA 4R9BA 3G6JB 1SLIA 1JYNA 1DYPA 1US3A 3D4KA 4YW4A 2J22A 3OBTA 2CDPA 2W52A 1AUYA 4NVPA 4DY3A 4HPKA 1W3VA 4ZZ8A 2ZS6B 3MYXA 1GOHA 1RGSA 3CJIC 4TLFA 3ZFGB 1ULPA 3H3ZA 4L99A 1HN0A 3BPSA 4QPIA 3RJ2X 1TME2 5FZEA 3DKWA 4GB31 4CXXA 5J09A 5FKCA 4AFDA 4LORA 1GZWA 2RS32 4CEWB 5B2GB 2QDNA 5J96B 2GALA 4Q8LA 1YQ8A 4CP0A 4IETA 3OBAA 4RFRB 1PIV1 3BTYA 1WCSA 4DXRA 5FMOS 1IG0A 3UGFA 1LRHA 2VW0A 1LECA 3P3PA 2A6VA 3GHMA 4B7EA 2VJXA 3DXUA 3PMSA 4AAXA 2AH2A 1F8VA 3V65A 1APNA 3KB5A 4QX7A 1F4HA 4GD4A 2I45A 5FZCA 3X29B 1QWRA 1RHI2 1YC61 5ERLA 3T4VA 2Y6LA 1GYKA 3OGRA 4ORFA 1ZA4A 2WO1A 1ND2B 1VBB2 2HWD1 2IWGB 3AKTA 3GZUC 3LDRA 3ACGA 2AEYA 4LK7A 5CFDB 4BA6A 5FCCA 3D0JA 5K7PA 2Y38A 4GH4C 3MIDA 1O59A 1OHFA 2YFZA 3P1IA 5GLUA 1MZEA 4K40A 1AJKA 2RS13 4P00B 4CDQB 4XJWA 3M8LA 1XNDA 3LOBA 1X8MA 3BU7A 4FTSA 3EHKA 3CO2A 3KGZA 2ZGQA 5F2WA 5DMYA 3FLPA 4RN5A 3WY6A 4IGPA 5F3EA 1NLRA 1A8DA 4PHZA 1BVP1 3DL3A 4FTBA 1RMU2 4YFZA 4I02A 5ABJC 2GNDA 4P9JA 1WMXA 4DS0A 3M70A 1ENSA 2VVEA 1VBA3 5FZBA 4BXSV 5JUVA 5FZGA 5BNOB 1DZQA 5A33B 4JGZA 4UFHA 2EXKA 2YY1A 3ALQA 3PIJA 3AL5A 3ZR5A 3I2IA 1NAEA 2WZR2 4OHYA 3VD4A 2B4KA 5JXGA 3KQRA 4FXGB 2A75A 1PO13 5FZ3A 4FPHA 3K48A 1CAWB 4U2AA 4OHXA 2B9VA 1YCIA 3SH3A 4QKFA 1VBC2 1WW4A 4BWOA 3IAPA 5JXIA 3MZHA 1JYCA 1W6OA 4IV1A 5JI9A 1UU5A 1MS8A 1A6CA 1VBE1 4UFIA 4QKBA 1QY4A 2D43A 4CEWC 2BOIA 3UGGA 4BQ5A 4I3PA 5F3CA 2RM22 5IAVA 4Y20A 4S2HA 4E4ZA 4LNVA 2R7EB 5JI7A 2V72A 2FQPA 3IT8A 5LY2A 4Q4V1 3TN91 2W2IA 1ULOA 3I2FA 3GALA 5JZGA 2BNOA 4ATFA 1PIV3 1IKQA 2PQQA 4XF1A 3BIWE 4IE6A 2LW8A 3IDBB 2JG8C 1NA1B 3VBOC 2NMOA 3I3QA 4M3CF 4X8PA 3H0OA 3ZFFC 1CGPA 3M7AA 3R4DB 2Z42A 3IDAA 3SC7X 1PK6B 4FVVA 5AC93 2IXLA 3QLQA 1DG6A 1ND2C 4EN9B 1JZ2A 5DUUA 4HXCA 1EV12 4BQXA 4EZHA 3AMPA 4YZ1A 5CFDC 5GZCA 4BMEA 2ZGSA 4CDWA 3CKHA 3D82A 4DEVA 3W21A 4JKLA 3JZVA 4LE3A 3AXEA 1E5IA 4QX0A 3N9LA 5J1XA 1S2BA 2D6LX 2ARXA 1RUH3 3KF3A 4RGKA 3RGBA 3AP5A 3NKGA 1D4M3 1HB1A 1LESA 4CDQC 2W92A 1NQDA 4D7TA 1G9DA 1GBGA 1GNZA 3C7GA 3ITQA 3OBRA 3R6SA 2HWB3 4CCOA 2UYBA 3JUUA 3Q9OA 3ZYJB 2XVGA 5J37A 5SV5A 5C71A 2VOVA 3NV3A 3J4UH 3I2OA 2K0GA 2ZACA 2H0VA 5FZ4A 1W99A 3N7LA 5KC6A 3RMXA 4AHZA 2GC0A 3SXWA 1L7LA 3T2PA 4OI0A 2DVAA 2BUKA 3ENRA 3TYJA 5GLTA 5L9RA 3AXDA 4XUTA 2BZDA 1GWLA 1VB4A 2YG0A 3LDKA 4A7ZA 4RHV3 3VHNA 5A1LA 1OA4A 2CY6A 3FMGA 3IB3A 3ACIA 1G9BA 5DUVA 3AL6A 3PUIA 1LB2A 1BEV1 5DZGA 3QCWA 1QJY2 5C7GA 5IK5A 2EAAA 2OPWA 1NXMA 2Y26A 3Q8AA 2WA3A 3H1WA 4BB3A 4YM2A 5JXJA 2KD7A 5C8CA 2WWSA 2ZA9A 1CJDA 1TG7A 2WSVA 3NNLA 3FE5A 3N36A 4I01A 4OLLA 4PQQA 4QQPA 4UW3A 2X09A 4S2GA 5ACA3 4MUVA 1AF9A 4ZU4A 5FZ7A 1K5MA 2Y60A 3KT1A 1LKNA 5FMCA 4A45A 3W20A 3TEWA 2GP5A 4NIHA 5FTTC 4ASLA 1NA1C 4Q4V3 1JXNA 4XCAA 5GKAC 4C1XA 3LA3A 3I7DA 1XNAA 4BXFA 3GBGA 1PX3A 1PK6C 1F4AA 4LBQD 2CAUA 1CD3G 4PDWA 4MGTA 3ON7A 3LFMA 1WW5A 2PLV1 1TQ5A 2QUOA 4U36A 1TMF1 2ZTNA 2RMU2 2VNOA 3VKLA 5KHJA 1L3JA 3N9MA 3A7QA 2VXRA 3PTYA 1RUNA 5ISLA 3W58A 4HFSA 1W0OA 1V6MA 3MW4A 2CYFA 1TNFA 3ETPA 3TEYA 2P4EA 4NRQA 4HETA 4AI0A 4NAOA 5HV4A 2JENA 1XU2A 3LIGA 5F2SA 1X9TA 5FUPA 3ZN6B 1BYHA 4DY5A 3RZHA 4FPEA 1XOYA 4CDUA 1UD1A 1VB2A 4EN0A 1MACA 1YIPA 3CNAA 4LHSA 1VRBA 3M2MA 4GMP0 3VN4A 4AGRA 5GZFA 2W87A 1RVF2 4HKOA 2JJ6A 4JRAA 3VDAA 2A5ZA 1J3QA 1FPN1 4P9XA 2VZOA 4QHBA 5KBFA 4FPJA 3PUQA 3TB0A 3RI8A 3S7EA 1CVNA 4XF3A 4BJ0A 4UYBA 4XFGA 5F6KA 1EAH3 2ZHMA 4JVAA 2MPFA 5T52A 4RQPB 4FPKA 4AVBA 3C8XA 1VRH1 3J7LA 4JC1A 3HQRA 4JTOA 5A7OA 3HJRA 1HQNA 3LE0A 4LKFA 3KCCA 3LCPA 4ASKA 1QJU2 4GJZA 4GKYA 2ZGNA 5DZFA 5IVEA 3VBRB 1ZREA 3I2KA 2Y0IA 2XDVA 1V6KA 5ANQA 5F5IA 3ZSLA 4BQ4A 4BQ3A 1BEV3 1JH5A 1WCUA 4I0AA 3H8OA 4WM7C 3OGGA 5EPAA 4UOJA 1CIWA 4I30A 4ZPIA 2ZXQA 3DEMA 5FPZA 4B4QA 2WZ8A 1N47A 5FPAA 2A3YA 1W0PA 3GBFA 2VBPA 2RE9A 4RS5C 4CSWA 3DN7A 4UF0A 1OF4A 2GZWA 4LEJA 4FSJA 1PZ9A 5JVVA 4QQHA 4IEOA 2QQOA 4PIYA 4FOWA 1RUG1 2XUEA 2V73A 1PMJX 1WMFA 3CHXA 4MOAA 4CA9A 5FYMA 2EXIA 2YGMA 1WA6X 5ANNA 3WCRA 2WFF2 4BK5A 2VMEA 4O61A 5BYNA 4FFHA 1SLAA 2OZ6A 2OVUA 2ZEZA 4UBGA 4I0BA 2PLV3 3AX4A 3MFAA 5IYYA 4OYUA 4BU2A 1QDCA 4AW7A 4RFT0 4Y1UA 1CAXB 1V00A 4QB1A 1HDKA 2UWAA 5HBAA 3OUIA 1WBFA 5EYYA 2VMHA 4JGYC 1PNGA 4WVZA 2HKXA 4XFHA 1UKGA 1DGWA 3B01A 1BBT3 1WCDJ 2R041 2VOKA 2BQPA 3C7FA 1JBCA 1ZRCA 2R32A 2WYFA 1J1LA 2RHPA 4TN7A 4HK8A 4B1MA 2OXBA 2IVJA 2LUWA 3SCFA 1CX4A 2ZOEB 3ACFA 3FJSA 3N9PA 1X9PA 3I59B 3S30A 4E4DX 5A3PA 4KNCA 3OG2A 3D0SA 1HLCA 3TWIA 1FPN3 3F95A 3DXTA 4MVTA 4DMIA 1DGRA 3BN6A 1JOBA 3AP4A 4Q27A 4I3GA 5C9AB 4PIZA 4QX5A 4F8AA 4E27A 4FOVA 4Q0UA 4Q5OA 5LW9A 2X53S 2V5DA 5C4WC 2JDNA 2Y6JA 3GGLA 1NY71 2VTXJ 2OQ6A 1OVPA 1RUI2 3AKRA 4QD2A 1XC6A 1VRH3 4WM8B 2PAMA 4OMDA 1LOFA 3R4SA 1MS0A 4GWJA 2CTVA 3VBRC 2CNAA 2VC9A 2ZAHA 2WR9A 2CV6A 4N90A 4BLJA 4LIVA 5SV8A 2HWF1 3ELNA 5FY7A 1GWKA 1UU6A 4W6YA 4XW3A 4QDRA 2E26A 3WP6A 1XSQA 1QHDA 1OBNA 1YXWA 4MHUA 1W8UA 3HR9A 2BWAA 4JQTA 1LJ7A 4V2WA 1WMDA 4E4SA 3ZYRA 2FDGA 1Y9GA 1UY2A 3VZMA 2LTNA 2RS12 3PIGA 4FP2A 4NWVA 4LBNA 1RIRA 2D7FA 5DPNA 4ZZ5A 4CZSA 4YARA 3LPGA 1RUF2 4IE5A 4BZ4A 2A6YA 4RR3A 1ACCA 1NUKA 1RUJ1 2XLGA 2OIIA 2UWBA 3OY8A 4NHLA 3VKNA 3JB4C 1S1AA 3U14A 1DF0A 4EWAA 5E88A 2CDOA 4WVVA 5EJ1B 4B4PA 2XG3A 2VUAA 2W95A 5IUQA 1POV1 5LA0A 1XBFA 3I8TA 2ZABA 1V70A 1DHKB 3IBMA 4DB5A 1NZIA 1LOGA 1UY3A 2XVLA 1O4YA 2KM2A 1YQ5A 3KV9A 4KWJA 1S0EA 2E32A 4A7YA 4AFBA 2QQWA 2VTXA 1DQ5A 4LA2A 1GP4A 5KXDA 1PO12 1XQNA 2LALA 2WO7A 5K0UA 5BV6A 4Q4X1 3POSA 3H7YA 3CU7A 4OHWA 1GSLA 2Y6HA 3CJXA 4MXWB 3N4MA 1BMV1 4KH9A 1JW6A 4Z8BA 5IVJA 3OYWA 4E2SA 4UFJA 4XJUA 2A6XA 2BP6A 3MV11 5F3IA 2ORZA 5A7WA 1W06A 1UQXA 1GU3A 4LBQB 2EAKA 2R043 1UZWA 1LHVA 2X5IB 5FYZA 3VBUB 4QGLA 4DRVA 4AEDA 1ZBA1 2BTVC 1WLDA 1MR5A 2YB7A 5A3OA 2E53A 4ZXKA 5IFPA 3PU8A 3A23A 5C5TA 1YRZA 1OH3A 4FAHA 4CU8A 4QB6A 4LJHA 5C9AC 2O8OA 1OPOA 1PIV2 2PHTA 3I2HA 2ZX3A 2WZR3 4LPLA 5JR7B 1W05A 2NYYA 3VBSA 3WG1A 3VGIA 4WM8C 5I0UA 4GAZA 2ID4A 2R061 3FHAA 4HN0A 1FMD3 4IDZA 4PIXA 3NNMA 5FYSA 5FXXA 4CYDA 1BVVA 3UK9A 5CFCB 4NO4A 1PGW1 4Z1VA 2ZPXA 2C1FA 2ZCWA 4DIQA 1EYBA 2HWE1 2VU9A 2HWD2 1YLLA 3IM0A 3K51A 2I74A 2XJTA 3VDDB 4AEJA 4KMQA 1V9U3 5LASA 3SNMA 4IUGA 5I93A 4N43A 3ZXAC 4Q26A 5AC92 1D4M2 4AFMA 1JZ4A 4LKEA 1FOD1 4LK6A 4P08A 4PLOA 4HG6B 4IGOA 1H8TC 2HWB2 2DUOA 3SISA 3FN9A 4MX3A 5FZ0A 1OI6A 1ALYA 2CSGA 2J1EA 2J1SA 4Z92B 2D98A 1AL0G 2VZPA 1RUJ3 4TYSA 2BVBA 2QVSB 4XZPA 4LT5A 4P5HA 4XUNA 1AR71 1PO21 1Q5OA 4Q4Y3 4ZU7A 5FPXA 2Z5WA 1POV3 3HD8B 3ZDVA 2R1DA 2HEWF 5FZ9A 4BQWA 4R9CA 5FZMA 1WKYA 3UT0A 4ATEA 4MG2A 2P6CA 3J7MA 3NVCA 3NL1A 2JICA 2VQUA 4RHV2 2BNMA 4LOTA 1A34A 3VL8A 3ILFA 4H7MA 2BNNA 4DFSA 2O8QA 5T54A 2VBBA 4QU2A 3T0DA 4JQRA 2WL1A 3UESA 1YFUA 2DU1A 4DXTA 1M06G 5FP4A 2X5IC 2WNUB 4NJ4A 5FZOA 1VJ2A 4FFFA 1F5JA 2A7AA 4B8EA 5FWJA 1X82A 5I91A 5ACA2 2WA4A 4TLGA 1UYPA 1H4GA 2IVIB 3CZUA 1CQ9A 1ZBA3 3ROUA 4QM9A 2VZQA 2P17A 1C8M1 1CJPA 4BOWA 1KRIA 5D8AA 4AXOA 2TBVA 4BE3A 5A32A 4Q4V2 2W5FA 3TN92 2J1RA 2KR2A 5A6QA 1X7NA 3C7HA 2A3XA 2NLRA 1AR61 1XYPA 4LBMA 4M0NA 3VLBB 3WD5A 4XQDA 2DBNA 5CFCC 1J58A 1OOPA 1LOBA 4AR2A 1FNZA 1ULFA 1RUC1 1W2NA 1QJY3 3ZLIA 3LEGA 4XVHA 2VNRA 1U5XA 4XPVA 3VDDC 4JTNA 3ES1A 2NMNA 1GV9A 4ZY9A 1PGL1 2QQLA 4DRRA 2HJIA 3WINE 2WAAA 5J36A 2ZBJA 1LNSA 4N9IA 2FDHA 5IHRA 3PVNA 2CHHA 3RJRA 3TBDA 3LSDA 3PVOA 3ZOIA 5L9VA 3POJA 3DPRA 5F5CA 2JG9C 1LULA 4LO4B 4OCTA 1QOOA 3GDBA 1GFF2 1BJQA 4GWMA 4P9LA 4PI0A 5CNAA 5J48A 1F2NA 3H7JA 2GMEA 4IERA 1MZ5A 5BNNB 3GZTB 4UXAA 2D6NA 4LXLA 1AYM1 1JZ7A 2QZ2A 3RRDA 1PM7A 2F4PA 5JOYA 4H7LA 4GALA 2XL9A 1EAH2 3N9OA 1PO23 3RZMA 1LU1A 5BNQA 3TAYA 2VZSA 3V0AB 1GP6A 2QJVA 3E1F1 2WO3A 5GZEA 1XJAA 2GAUA 2XH6A 3IMMA 1N3PA 4FPLA 4FPYA 2BU9A 3LDBA 3MIBA 1QJFA 5CAZA 2VUJA 2WKKA 2G19A 3ASIA 5F37A 2UY8A 2AYHA 3AP7A 5FO8B 3WP5A 3B9CA 4MGQA 3RPQA 2G9GA 4LHNA 2XJVA 4B1LA 4D94A 2SLIA 2Y6GA 1BEV2 3BALA 1XU1A 3W9AA 2VQ0A 1W6PA 2WNUC 2Q0AA 2YZ4A 4CCLA 2VE1A 1AR81 3FHIB 3WHUA 2D97A 3T30A 4COUA 1F9KA 3CJIA 1E5HA 2ET7A 2PAEA 4HONA 1Y43B 4Q8KA 2VZTA 1MEC3 4NHMA 4AEMA 2IXJA 5HXMA 1UYXA 2ZHNA 2QZ3A 1RJ7A 1NYWA 1HXS1 5JCTA 3HQXA 1TNRA 1PZ7A 3WG2A 1COV1 2WT2A 5CU1A 4Y3OA 2YBKA 2C6SA 3IPVA 3IZOA 2B39A 4QX3A 3PTRB 1ZZ8A 5A7QA 2XKOA 1B35B 1KDKA 4YVWC 1ZYBA 1SDDB 1XXNA 4Y33A 3H42B 1UXZA 4DOUA 3OOXA 4GA9A 1RUD3 3A4UA 4GIQA 5FQ0A 1JI6A 2C4XA 2PLV2 3OEBA 4MYEA 1JUIA 3ZXFA 2A1XA 5JIUA 3WR0A 4QX1A 2GN7A 3A0KA 3F2ZA 1QJX3 1AHSA 2W08A 3ABZA 1MZFA 1WWYA 3HT1A 1QOTA 1ZNPA 3ZFEC 4OUEA 2IXCA 1W6NA 3P3NA 1DCSA 1TEIA 1HRV1 2ARBA 4L9BA 3SKJE 2QQJA 2JDMA 1JMUB 3HOBA 4QDSA 4IEZA 2XLFA 4A41A 5BNNC 2VMFA 3UETA 4BM8A 1Z7S3 2BWCA 2BGOA 3SMHA 1FPN2 4XHXA 3EO6A 3DV8A 3UL2A 2VPVA 3LA2A 1A8MA 1DU3D 3NNFA 4UFKA 4UWDA 1PHMA 3USUB 2RR11 2P6HA 4QPYA 4CP9B 2XONA 4QHZA 5IJRA 2EVXA 3VV1A 4IV3A 1POV0 1R1A1 2YMZA 1GP5A 5H9QA 1VRH2 5JSRA 4UW5A 4Q1RA 4KU8A 4RGAA 1O4ZA 2Z4FA 4KGGA 2CGNA 2OX0A 5C33A 5F7UA 4IQPA 2XWJB 2PN5A 2WNVB 5A7PA 1NLSA 2DV9A 2BVVA 3N35A 2W3JA 3AKQA 4XJ8A 1SZBA 5DDJ1 5FY4A 1AR83 1H1IA 1S0DA 4N53C 4BIOA 5LA2A 2WNEA 5FLHA 1GOGA 2JDPA 1X36A 2W9XA 5FWEA 4EZ4A 4HPKB 3C3VA 2XGXA 2Y64A 2ZEXA 5CG9A 4R9AA 3HNMA 1AXZA 1VPHA 4AHXA 3LWCA 4CU9A 1DQ4A 1HXS3 4HT1T 3O1TA 4QPIB 3J8F1 1B35C 3LSEA 1RUI3 4XFBA 4LULA 1BKZA 1GZWB 4YM3A 3INAA 2JG8A 3VBOA 2ZJCA 4META 4JV4A 4QU1A 4Y4YA 4LKSA 1KQRA 1KDMA 3MIHA 4K7JA 3RZGA 1ULDA 1ULGA 1STMA 1IPKA 2VQAA 4CDXA 2P34A 3ZM8A 1VBD1 4OUSA 2QKDA 2GC2A 3BIEA 2MEV1 1W2AX 5T5LA 1WLCA 4GMP3 2GH2A 4XUPA 3WDXA 3TEXA 1DIWA 3KS7A 4HVOA 5FY9A 4MXVA 3LQCA 4BH9A 3U1XA 4OI1A 4R4XA 2H6BA 4TSVA 1WD3A 3MO4A 2HWC3 4W50A 1NXD1 1RUF3 2O14A 4CU7A 2R042 3KSCA 3LIHA 1IQDC 1W9FA 4Q29A 2WT0A 3R0RA 3OGSA 4NPMA 2CGPA 1CIYA 2R071 2ZAAA 4XF0A 2DTWA 4CUBA 4N9HA 2QQMA 3LEIA 1K42A 4IEYA 4ASMB 1HB3A 3ILNA 1MQTC 2UYAA 5F1RA 1FI2A 3TNPB 2VZRA 3MGUA 1JUHA 4CEYA 2ZX2A 3CZJA 3ETQA 3WQ7A 1JZ5A 4EN6B 1JU3A 1G9CA 1SLCA 2D6MA 2RR13 4BHPA 2YROA 1YO8A 1FMD2 2WO2A 3U75A 3VKFC 1H2NA 4LMFA 5E1RA 3OUJA 2JE7A 2JX9A 4JHZA 3ZFGC 3O1RA 2JKXA 2W91A 4A3ZA 2LROA 1XNBA 5AFEA 1G8WA 3NNGA 1WBLA 3NNJA 3QBQA 4JGZB 5DAPA 1Q8VA 1V9U2 5FKBA 2BBAA 4AI1A 2Q1FA 4JX0A 3I3MA 1W28A 2C9AA 3O0XA 4ONUA 1X50A 2RS51 1HX6A 4GB33 5FV3A 2NN8A 3OF1A 1URXA 3PVBB 3OEAA 1JYWA 4UW6A 1AX0A 1L7RA 1PVXA 2B7YA 5CA6A 2VD7A 1UOGA 4SBVA 3KWVA 1GICA 1PM4A 1W6OB 4IV1B 4L0PA 4QPIC 4L2NA 2GH8A 3EJKA 4YGEA 2LS6A 5FZ1A 1RUJ2 1N3QA 4LO5B 4IEPA 3ZYFA 2ZGTA 1H9WA 2IUWA 3J26N 4Q4Y2 4QX8A 5FREA 2FDKA 2EIDA 3BVCA 3QACA 4TXWA 2P3KA 2VM9A 3O7OA 5L7OA 4KU7A 4Y20B 5LRSA 1OLMA 2YC2A 3O1SA 1HB4A 3IKWA 4M00A 1RITA 5JZGB 2CWMA 2HWD3 3RSJA 4H3WA 1Q8PA 4B3NA 3QH6A 3UGHA 3HEIA 3TRSB 3FUOA 4FPCA 1VBD3 4XUOA 4Q4X2 3T08A 3WDVA 1IKPA 4LO7A 1HQWA 2VW2A 2YDEA 3RYRA 4ISQA 5DAWA 5LRRA 2AREA 2PQSA 1CAUA 3I3EA 3K4AA 3SLIA 3VHPA 2RJ2A 4L92A 4CDWB 1MS9A 4CCMA 5KHKA 3LF7A 2ATFA 2XL7A 4K9SA 1ZBA2 2ZZJA 2DBIA 4O9EA 4XMAA 4WVMA 3BKZA 5BNOC 1L7QA 2EA7A 1ASJ1 1JZ8A 2J1TA 5I0TA 1QEXA 4A6SA 1IG3A 1YJLA 2V4VA 5FOJB 3U07A 5F39A 4XFFA 5J7MA 4NOTA 3SH4A 2CAVA 5GZDA 2HLEA 3AKSA 2JE9A 5A7NA 1F15A 3HN3A 4N7IA 1QU0A 3VHRA 3PUAA 4BLIA 2OQ7A 2PXJA 2VMCA 2W1WA 1ZA7A 1UO9A 1O5LA 4JGZC 3VZOA 1GZCA 4QXBA 1IHMA 1MS3A 5CKMA 4AVAA 4BQYA 3B7MA 2HWE2 2RG4A 1VBE3 1UZYA 3ZSJA 5C8WA 4CP2A 3NAPA 5GLZA 2RS53 2PHXA 3A0NA 3I2GA 2F6BA 2YFUA 4RS5A 3ZXGA 4IV1C 5EXOA 3PJYA 1NCQA 2ARCA 4RYDA 3TN93 1O3RA 3CQOA 2Y34A 4QXHA 5C8CB 3N9QA 1C1FA 3IN9A 3BCWA 5T5PA 3WW1A 1K5JA 1RUE1 3WG3A 5FP8A 3CLPA 1PO22 3WDWA 4D8MA 5JWPA 3GJBA 5JZGC 3EB7A 1K5MB 1LHUA 4IGQA 3I4IA 5LK7B 3WNMA 3AZYA 4DO0A 1Y3TA 4XFIA 3I2JA 3BTZA 3H1MA 2VOTA 1OD5A 2WLQA 3K2OA 4KQ7A 3PU3A 4EV0A 1FNYA 2J42A 1DQ1A 4YW7A 5FZ6A 3V0BA 3D6EA 3NJYA 5FYUA 4PDWB 4A6OA 4NHKA 4BDVB 1X8EA 3POFA 4W6XA 1H2LA 4IEQA 4JGYA 5FR3A 4YM0A 3FHQA 1PMIA 4CDWC 3VBFA 4P02B 2D5HA 2P5BA 3ECQA 2CU5A 1MEC2 4MGIE 4Z07A 4J6GA 1OA2A 1ONAA 2NPIA 1PZ8A 4QXCA 3ZDSA 3SCHA 3HQUA 4Z2AA 1YFXA 2J1VA 2D3SA 2PHWA 4YFWA 2LRPA 3RVHA 4CXWA 1H30A 4CDUB 1OSGA 4YZ4A 2ET1A 4B4RA 5CKNA 3NRUA 5JAXA 3UJQA 3ZKUA 1ASJ3 1C8M2 4CUCA 4JKKA 1MS4A 5LY1A 4KBBA 3O1OA 1CONA 3AVRA 2XWBB 2GN3A 5C4WA 2GU9A 1QQP1 1OVSA 3T3YA 1RUD2 4LBOA 4AF9A 3OUHA 2W68A 1DGWX 4K1YA 4QWNA 1BZWA 3WZ1A 5D21A 4BISA 2R30A 2Z69A 1GUIA 1WZXA 4LBKA 1QJX2 2WYSA 2MNGA 1LR5A 1S0JA 1QNYA 2O0OA 3RDIA 3MV01 4L11A 1PGL2 4CXYA 4AE2A 1CAVA 1HQLA 2GNMA 2XJUA 3WNNA 3KVAA 5IVYA 3KT4A 3TEZA 1J1TA 5FZFA 4OUMA 4CCNA 4XJAA 3JBG1 1S0BA 4ET7A 1A3KA 4FPFA 4QPWA 2WFPA 4EE2A 5C8CC 3LOIA 4BQ1A 5HI0A 5DAVA 1Z7S2 3SQOA 4YW5A 5JOXA 1OQEA 4CRQA 4QQ2A 4X6QB 1WD4A 2RS31 1W0NA 4IESA 3M3EA 4LHKA 5FZHA 1FAYA 1UX7A 2IFRA 2WWJA 3POIA 4Y22A 3WQ0A 4JDOA 4WV8A 1K5MC 3VZLA 1UZ0A 4UF0B 4UT5A 3KLSA 5IFTA 1TMF3 2P2KA 2ZMLA 2Q8EA 4QM8A 5DAXA 1PX4A 3AMMA 4JZRA 1YYNA 1SBEA 3HVDA 4UI9L 4J1XA 2W1SA 3JQXA 1XYNA 1OQ1A 5IWFA 5EP9A 2IC1A 5IATA 3OTFA 1QJZA 1D2SA 3L2YA 2Q8OA 4AVTA 5A3TA 1Q8QA 2HBUA 1OH4A 2LM3A 4J25A 2YC4A 4R4ZA 2JDHA 4XEZA 2Y6KA 1ENRA 4YVSA 4ZU5A 1AR82 4KG8A 3I97A 4P5YA 4UAPA 4IE0A 1P8JA 2DWRA 3PJQA 1UPSA 2ZEWA 3AZVA 1YIFA 2B8MA 3SEEA 1QH7A 1ND3A 2YGLA 4AL9A 2TEPA 2FZ1A 4CDUC 4CPBA 5JIAA 4NUBA 4RQPC 1GOFA 1HXS2 2W0XA 2BV4A 1IOAA 5KXEA 4QQOA 1VALA 5A6XA 5F9TA 3ZXJA 1COV2 2K2SA 2WN3A 4O9GA 3ATGA 3GCXA 4XILA 3WNXA 4YSFA 1ZRIA 2Q5TA 3POBA 4LUMA 1LOCA 2QBXA 1ULEA 1YI9A 5FYYA 4YPJA 3NJVA 3B94A 2DFBA 3MLJA 3WF2A 1QQP3 2TUNA 3B69A 1YEWA 2YHJA 4C8DA 2E31A 3GBWA 5A3LA 3THDA 2O1QA 2OZJA 2B9UA 2G9FA 4YWAA 2JECA 1ZRRA 1UOFA 3VD9A 1MVEA 1WCQA 2ZMKA 4N7UA 4M01A 4YZ5A 3AJYA 2PTMA 4YG3A 3VBHB 4MGZE 3Q8BA 3HAGA 2EALA 4Q0PA 3WDYA 2HWC2 2IFWA 1DQ6A 2WN2A 5FZIA 4I09A 1JZ3A 4QGMA 1VBC1 4YGCA 4IEXA 4YYOA 2DVBA 2WJSA 4KL1A 5FYIA 2ENRA 3JBG3 4MHRA 2WZEA 5DUWA 1H8TA 3NSTA 1W8NA 1RUG3 3E97A 2VUCA 3M3OA 3WXPA 2SBAA 2VO5A 4HK9A 4F7ZA 3MUY1 3B02A 4FQZA 4G4FA 1LCLA 2VR4A 1DBNA 2JWPA 1IS3A 3VB9A 2RR12 5LA9A 4RR3B 3URFA 3ZN4A 1UW8A 3OY8B 4LBLA 2XVKA 2DF7A 3TNQA 1K3IA 4CUGA 1ZBE1 3HBZA 4C0BA 5FY5A 3HIFA 1CPMA 3U4XA 1AYN1 4M3CB 4AEKA 1AX2A 3M3CA 3JD71 1UMIA 2TNFA 5FXWA 1SPPA 4G3YC 4FOQA 1ZRFA 4AGVA 5T5OA 3UKVA 3OJBA 5LBBA 5C3PA 3THCA 1VIWB 2QQUA 4GB32 4INDA 3L2HA 4XDOA 4AVSA 5K0UB 5HCBA 2QE3A 1PMHX 2IXHA 1UOBA 5T3NA 5DDJ2 3M3QA 1O8PA 2OUJA 2GC1A 3O0VA 1FV3A 4DXSA 3OYWB 3AYAA 1O8SA 4YG0A 4Q1PA 2WIIB 2UURA 4LUKA 5A7WB 3AFGA 3WT3A 5C70A 1W9WA 1FXZA 1REFA 1WMEA 4AEDB 2WABA 5KHGA 3HT2A 2ZHLA 4HSLA 4XURA 3RZLA 1NLQA 3KZ4C 5C6CA 1NCRA 5C5UA 3WEZA 1RL3A 2FBEA 4XBLA 3FX3A 3POYA 3ZKYA 4E9KA 3DYMA 1JHJA 1FX5A 3POEA 2XLAA 2DCYA 2XBO1 3WF0A 1I3HA 3K3OA 1UMHA 2HWF3 4CCKA 2ERFA 2FDFA 2FHRA 3ZFFA 3AYDA 3WQBA 1GKBA 2RVAA 4E2QA 1VBD2 2XOMA 4XJ9A 3S7IA 3VBSB 2OYZA 3AZXA 1LOFC 3VBHC 5C3SA 4NIDA 4DEQA 1CESA 4KWKA 2D3RA 1LOEA 3VD7A 1DZTA 1VR3A 2WC2A 4OI2A 1NE4A 1KS4A 4D7YA 1G7YA 2X10A 1JOJA 1O3SA 1GR3A 2HYXA 5E89A 2JG9A 1IS6A 3DGTA 3WW2A 4PI2A 4N43B 1AR91 5EJ3A 3D8CA 4NPLA 1JYXA 5KXCA 1YI7A 4RA0A 4GWNA 1AZDA 5BPXA 3MLKA 2RDQA 5CADA 1HIXA 5BNPB 1S55A 3OPTA 5DABA 2XJRA 2Y6FA 4RD7A 4D6SA 4A7KA 4XTMA 5FUNA 5IT6A 5FZDA 2R0FA 2D6OX 2VNVA 1HW5A 1W04A 2W46A 2WZPP 1ZX5A 2Q30A 3CMGA 2FDJA 1AJOA 4Q4X3 3ZYBA 1LEMA 1ZBE3 4BQ2A 3PHMA 4B7KA 5J3UA 2QQVA 4GXLA 2VMDA 1X33A 3J7HA 1R081 2R49A 2RMU1 3VBUC 4MLOA 3HN1A 1R64A 1SHWB 3JD73 3MIGA 1VBE2 4ISRA 1IZ3A 4Q4W1 5IK4A 4BCUA 4O65A 5C3RA 2PELA 5KR7A 2B45X 5JDBA 4OHZA 3RI9A 5DG2A 4LO8A 2RS52 5LA1A 5CKQA 5JOZA 3T4HB 1W2TA 4AHYA 1QMJA 2XPJA 1VP6A 2CGOA 4NIGA 5F8PA 5A6ZA 4YLZA 1I9RA 2VZUA 1UPIA 2ZGOA 1CZSA 2E7QA 2XHNA 1ZM1A 2JEMA 2VZ3A 4MZUA 4YW2A 5T5JA 4FT8A 3K46A 1KITA 2A71A 5FZOB 4AEDC 1UCXA 5FZ8A 4I2OA 1SFNA 3NWKA 2K46A 4XMIA 4FAGA 4Y26A 4NHYA 2R063 1D0GA 4YVWA 1Q56A 4QPGA 5LZ6A 5DG1A 5D8AB 5A32B 3SITA 4FQ4A 1N1TA 5HCAA 2HWE3 3VBSC 1ENXA 2XBO3 3T2QA 1OT5A 3E5UA 3OD4A 1KJRA 4ZS2A 2VW1A 1N1YA 5FZAA 1SMVA 2GSYA 1QJU1 4DINB 2VBDA 2AR6A 3OB8A 5JSOA 1DGRN 2AGSA 3NV4A 1OOPB 5LBCA 3ZFEA 4MV2A 5B4NA 3O1UA 1FOD3 1B09A 5AFBA 3AZZA 5F6LB 1H2MA 1QGLA 2GMMA 1YWKA 2VOWA 3AP6A 4A2UA 4XIKA 1J3PA 1SCSA 1ODNA 2FCVA 2WS91 5CB7A 2I07B 1BQPA 5HPOA 5JPMB 2QQPA 5TSWA 5CG8A 4AG4A 2UU8A 3ZYIB 1WUVA 1OC1A 2QFEA 1AR73 5T50A 4CU6A 2VTFA 1AR93 5BNPC 1ASJ2 3DPRB 3I3BA 4HVQA 5IVVA 1HJGA 4FOYA 3K75B 2RJKA 2YBSA 1W3XA 1OFNA 2JIGA 4JKMA 4LKDA 3SKVA 3SEPA 1QNWA 3W5MA 1UF2C 3BODA 5FK8A 1BK1A 3KCXA 2DVGA 3UKTA 3N9NA 3M3IA 3AK0A 2XR4A 1XNCA 1PVC1 1T2XA 2EIEA 2VULA 1VMJA 1OF3A 3LEKA 2WINB 4P14A 2P3JA 4EJRA 1LHWA 1AXYA 1LGNA 4XCBA 4XAEA 5CEHA 3OSDA 2QCSB 3ILRA 3O5SA 1LHNA 3A22A 1BMV2 4Q4W3 3U4SA 2W39A 1W6MA 2J1UA 4HKLA 4AZZA 2Q1ZB 4D7SA 1UYYA 1UYZA 4N53A 1XRUA 1AL21 3E6BA 1J3RA 4IW3A 1DQ2A 1SLTA 1OLQA 1C8M3 2VAUA 4HMZA 4GJYA 1W6PB 2Y0OA 4XJZA 5E8AA 3B9IA 4XZUG 2I2SA 2JIJA 4Y5TA 3VHOA 5FOBB 1GZ9A 3CBNA 5FPVA 5LCWL 3CJIB 1GLHA 1UZZA 3CEWA 3I49A 1SFYA 2IXIA 3P6BA 3Q8EA 1AR63 1B35A 3GYDA 1OFSA 5JMCA 3ZXDA 2Q8DA 1RUE2 3NQHA 5A3UA 1CN1A 4PF5A 2ZEYA 1TMF2 3H1YA 4XFCA 5D8AC 5DN2A 2XJPA 2JDKA 1UY0A 4PLMA 2K9ZA 1HJFA 4XDPA 1RUC3 3MF9A 4X8NA 3IPVB 2PYTA 1E57A 3ACLA 5LEJA 4W4ZA 1LAJA 2WNOA 1VMHA 3N7KA 4GH4A 1UZVA 1KS5A 3WNOA 1SBDA 2Y8KA 5FQ0B 1J59A 3RQ0A 1GQHA 1RINA 5FXZA 1HRI1 3ZVXA 5A6YA 1CX1A 4EYUA 1MZ6A 1SQ4A 3IWZA 2VCAA 4M4PA 3GJAA 4NIIA 3ZXKA 1Q8OA 3MPPG 3OCPA 3ORJA 4AGGA 3FFQA 4YG6A 4Q0QA 5FP3A 5GM0A 5HCHA 5A1FA 3CF6E 2WS93 1AYM3 1JN2P 3M4FA 3DYOA 5ABJA 1ULCA 4H14A 4YRDA 3FZ3A 5D1IA 4DUWA 2RS11 1W6NB 3DPRC 4XOGA 1YFWA 5CISA 5EJZB 4OFGA 1MQTA 3WG4A 1C1LA 4D6RA 4EN8B 1GQGA 1W6QA 2JDZA 5IVCA 4GKXA 3USSA 1W8WA 2WQZC 3A21A 4YW1A 5FYCA 2GNBA 5FYHA 1O3QA 1W9SA 3ZSKA 3JXSA 1QQP2 3ZPYA 1VBA1 1KEXA 1LENA 2Q4SA 4JCKA 3M1HA 3WHTA 1O3TA 2D3PA 3L9JT 3ZFGA 2AZ5A 1KGYA 1H9PA 4DPNA 4IV3B 5FLIA 2ZGUA 1FATA 4CEWA 2DUPA 2ZGLA 5JXHA 4O7XA 5FLJA 2E7AA 1JODA 2AENA 3AKPA 2G4IA 1CPNA 2PMWB 3LZZA 5FMDA 3RWKX 4NMIA 2R6QA 2XJQA 3IIAA 4LA3A 1ZZ6A 3JBG2 4AFAA 1VAMA 1AL23 1COV3 1GWMA 1RUG2 2EF6A 3MEPA 4QDQA 2C26A 4Z82A 3JU9A 1V6JA 4XFAA 3POGA 5IAXA 1SFPA 1KFXL 3MFCA 3PL0A 3T0BA 4P9GA 4BK4A 5C3OA 1W2OA 1W8ZA 2WQ4A 4QHOA 4NPRA 3MICA 3BI3A 2BW8A 4IEWA 2OT7A 1ND2A 5FJHA 3H8XA 3H8UA 1Y9QA 2PHFA 3PUSA 5FP7A 5CFDA 2YXSA 1V0AA 3HWJA 4AQ2A 4CCDA 4Z2WA 1SDWA 4OMCA 4V2VA 3MI8A 4AFCA 1EUUA 2ZKLA 3R05A 4BYYA 2JG8B 5AC91 3VBOB 4SLIA 4COYA 4XETA 1Z0HA 1QH6A 3K3NA 2FDIA 1A78A 1F31A 1C4RA 2ZGMA 5FXVA 3ZSEA 4AI2A 2B42B 4PBOA 4AVCA 1HRV3 4CDQA 1KXGA 3FBYA 4QT6A 3RFRA 3WP4A 2AEZA 4PLNA 5HCFA 1VLNA 3D5OA 5H9RA 1HRI3 2ZGPA 3S6PA 3BPZA 1RUH1 4WZCA 1D4M1 2A6WA 3AFKA 3AYEA 4LLOA 3WOGA 3T2TA 3S57A 2DUQA 5BNOA 5A33A 5F32A 1DP0A 2HWB1 1XSRA 3KT7A 4GULA 5H9PA 1LOAA 5A3WA 1FYUA 4QKNA 1NY72 5L19A 4GQ7A 1R1A3 3AZWA 4FI9A 4QAWA 2QNKA 3KV5A 1U0AA 2EXJA 2Q1MA 4PJYA 4CTEA 2GMPA 1YNAA 3PDQA 1H6YA 3FFZA 1CAWA 4FTEA 1UU4A 2L9LA 4MGYE 2WNVC 5FBJA 3SCGA 2HWF2 4CEYB 1U12A 1BCXA 1H4HA 3G7DA 4IV3C 2A3WA 5GLVA 3SH5A 4OQ8A 2BBVA
chains in the Genus database with same CATH topology
3NKTA 2WT1A 4R8HA 4RHV1 5DDJ3 1MVQA 3SHRA 1YHFA 4P9WA 4W65A 2BFUL 3ES4A 4FXKB 2ZGKA 1VAKA 4PCRA 2R1BA 1W39A 5BY5A 4M3CE 4AK3A 1NA1A 3J8F3 2VNGA 3B5LB 2B5HA 2FZ2A 1DLLA 5ACA1 5LEKA 3AMHA 1PK6A 1JYIA 1DQ0A 2H0BA 4F3JA 2D6KA 1HV1A 4C90A 3R4UA 4DZGA 1MS5A 2YUEA 1ZBE2 2MEV3 5T55A 4DQAA 5GZGA 1S0GA 5L7OB 5GJ6A 1AYN2 1SLBA 4R9DA 4LO6B 2D40A 3PMEA 2RJLA 3JD72 4Y1VA 4CDXC 5BUVA 1H8VA 5FFOC 3IDCB 4HVRA 3ZYPA 3ZMNA 3THTA 3BOWA 4FPGA 2XKPA 2R073 5I8SA 1OPMA 1KJLA 1R091 1CAUB 3WP3A 3ST7A 2D44A 2XHKA 4IEVA 4D69A 1REDA 4XBNA 1LTEA 3PVEA 2R062 3JB8A 3U11A 3ZX7A 1YUDA 4WVMB 3ZIWA 2CWSA 1Q43A 1EPWA 1LU2A 2NP0A 1EAH1 4CEYC 1PGW2 2VMIA 3FLRA 5CVRA 3JQWA 3WW4A 1OKQA 2XBO2 4BMBA 1DGLA 3ZIXA 5J98B 4WM7A 4AYUA 3LB9A 1QXPA 2GC3A 5F5QA 3WW3A 1G9AA 3U10A 1IGOA 3ZYGA 2DVFA 4XQWA 1C5IA 1FOD2 3KD4A 4E2GA 2ETEA 3GHNA 2A70A 3NW4A 2KA3A 3ZXLA 1UMZA 1QOSA 1REEA 1UX6A 1YJKA 2GDFA 3NAPB 4YNIA 1AR72 2XUMA 2ZX0A 1AR92 5IK8A 3VZNA 4COZA 1AXKA 4RS5B 5I8YA 1IS5A 2BFUS 1NCQB 4AWDA 4ES9A 3MF6A 4LTAA 3UJOA 1N3OA 4K6BA 1WW7A 1QF3A 3MLLA 4YGDA 5L7OC 3APBA 2E9QA 4MSVA 5KC5A 3AMNA 4KG0A 3WUDA 3ZN6A 2WSUA 1OA3A 1UIKA 4XF9A 1C5HA 1DYKA 1R082 4HL0A 2IZWA 4NWWA 4MH0E 5JPNB 2JD4A 2VVDA 4Q4W2 3V0BB 2UWCA 2JXAA 3N3HA 1V6IA 2C0ZA 1BBT1 2DCJA 2ZGRA 4K21A 3RWNA 4S2DA 4JGYB 1NE6A 3WLUA 4RQPA 3VBFB 1R093 3VKMA 2X8KA 1S0CA 2VG9A 2NQYA 2FMYA 1AR62 3WV6A 3PNAA 3AYCA 5EFUA 3VBRA 3U0ZA 4L8QA 5K9YA 3WQ1A 1RUC2 1C57A 3MIFA 5E16A 3RYPA 3DUIA 3RMYA 5C4WB 5KWRA 2HEYF 3V64A 2C5DA 3ZSMA 2Z2SB 4C1WA 5FO9B 4BIFA 3WX5A 1TME1 1ZZ9A 3MPBA 4NR1A 1V6LA 3QOPA 5AVAA 2DVDA 1Q3EA 3AJZA 3NAPC 2R0HA 2WS92 1AYM2 3HMYA 4AVVA 1CAVB 3B00A 3NJZA 3WDUA 3JCIA 1RUE3 4HN1A 3H9AA 3MIEA 4LHLA 2D6PA 4QGNA 1NCQC 2YYOA 4PQ9A 4X6RB 1WLTA 3O12A 1GANA 1WLWA 1C3HA 1CAXA 1NQJA 1OLRA 2E7TA 4FCAA 4PDWC 4Y1YA 1IQAA 1RHI1 3FWEA 5DZEA 4Y1ZA 2MHFA 1M4WA 1XNKA 5I0SA 4A3XA 4Y22B 4R52A 1LGCA 1YFYA 3AMQA 3E5QA 4HZFA 1VBB1 2IXKA 1PVC2 4B29A 1HKDA 4LR4A 2AUYA 3I59A 4FO9A 3VL9A 3MW3A 1UKRA 4H55A 5KHHA 2UY9A 1IS4A 2PFWA 2E6VA 2V09A 5C9AA 4ITCA 1AL22 3J9SA 3VBFC 3DF0A 3NO8A 1RC6A 4YVSB 5EV7A 1U5IA 2P3IA 1RMU1 4IL7A 4WM8A 1ND3B 1RJ8A 4DXZA 2ZMNA 1WA4A 5KXBA 1O4TA 1ZZCA 2XJSA 3IDEA 4HBNA 1QKQA 3OGJA 1EY2A 4XQ4A 2N7GA 3UKNA 2WZR1 4DNYA 1FV2A 2HYKA 1G6NA 4G9SB 3WUCA 3BB6A 4FBFA 1FMD1 4OI4A 2XB6C 4Y5Z0 3VZJA 3VBHA 1HRV2 2ILMA 4BPZA 5FO7B 3VKOA 1HRI2 1V9U1 2EIGA 5H9SA 1ZZBA 1TME3 2RM21 3TOJA 4HSJA 4YZ2A 2RS33 3CL1A 1G9FA 2B46X 2YPJA 3B3QE 3KM5A 4OZXA 1O7FA 3LKJA 2ZHKA 5EZWA 2PHDA 1NZCA 1R1A2 4XDQA 1JHNA 1H8TB 3E6CC 2A73B 1DDLA 1CR7A 4Q0SA 1S0FA 3KGLA 2D5FA 4Q4Y1 1SLLA 2NZ9A 4MXWA 1H2KA 3T1MA 3BTAA 4M3CA 1RHI3 2E63A 3THPA 1VBA2 1EV11 4JDNA 5GALA 2WLPA 1BXHA 1VBB3 3EBRA 1XYOA 4LBQA 3VBUA 2X5IA 2VVFA 2OUHA 3KCYA 4WBBA 5FDBA 5FRAA 1Q8SA 4I0WB 4UBHA 2VMGA 3C2UA 2E51A 1AVBA 5JOWA 1V6OA 3N7MA 1AX1A 2JKBA 2ES3A 1RUOA 4YVSC 2BEOA 3J8F2 1LGBA 4QQLA 1H1AA 3LAGA 4HLTA 4COWA 1ND3C 2PAKA 3LGRA 1NOVA 1RMU3 4V1PA 1LHOA 5CFCA 1W2UA 3WCSA 5JSPA 1S0IA 4L97A 4YGBA 3VDDA 2VOXA 4HANA 4K20A 2MEV2 4D3WA 3E6DA 4HKWA 3ZXEA 1NCRB 4RL7A 4XHBA 5DUXA 5IK7A 5KHIA 1WW6A 4XXAA 1DZRA 1QJY1 1VBC3 3ZFFB 3MW2A 5GLWA 3NV1A 4WVWA 4WZFA 5LK5A 4AQSA 2R072 1EPZA 4ZKTB 1DFQA 3AP9A 4UW4A 4XYXA 1RUH2 3OD0A 4XXPA 2RM23 4IXLA 4RR3C 3GF6A 3GNEA 4MGKE 1OMIA 3T1LA 5BNPA 3ZN5A 2H6CA 4PBPA 2JG9B 3UV9A 1XE7A 5CIRA 2DURA 2FMDA 3FC0A 1AYN3 3WVJA 1GNHA 1I1EA 1V6NA 3QH7A 4KWLA 3OPZA 1IPJA 2VGDA 4K8FA 4AQ6A 5K0UC 1I5ZA 2WNUA 1EV13 2OA2A 1I6XA 1NG0A 1Y7BA 2X29A 4OVEA 3V56A 4XBQA 1QXRA 3VUOA 4XTPA 2HEVF 1TE1B 5HXVA 1N1SA 1RVF1 1UAIA 1U5ZA 3IMNA 4JRLA 1O91A 4LBJA 4AQTA 4LLFA 3ZMOA 1MEC1 5I8TA 3B93A 4CP1A 1C28A 5DXDA 3EXUA 2ZX4A 5FBZA 3RS6A 1U5YA 4EWEA 2BGCA 3RZZA 1OQDA 1QXJA 3ME2A 5A3MA 4Q2FA 4QMAA 2A6ZA 1NCRC 1RUD1 1ZVFA 4YVWB 1T6GC 4QPGB 2DCZA 3E5XA 1O5UA 4S2FA 1LEDA 2QDRA 5EWSA 2DCTA 4RGGA 3RNSA 1D2QA 1C8NA 1QJX1 3ZFFC 2OW4A 4FAGA 1LODA 4TWTA 4N43C 3MDPA 1VAVA 4LE4A 5BNNA 5L36A 4EWDA 1ZRDA 2OPKA 4AHWA 4TZDA 4OHVA 3RG0A 3FLTA 2ZKNA 1R1ZA 1D0HA 2KXLA 3AM2A 3ZFEB 4QXKA 2CL2A 1R092 2VECA 3KMHA 5K8SA 3V0AA 4XF4A 3O14A 1JTZX 1SEFA 1UIJA 1Z7S1 3GZAA 3O0WA 2BPA2 4RSUA 2BYVE 2WFF1 1HV0A 3ZO0B 1MS1A 2EXHA 3N7JA 4KGQA 1WCKA 4Y1XA 2DU0A 4JDMA 3LA7A 1KD7A 2D93A 1R083 4YZ3A 1D4VB 2RMU3 4ES8A 1SACA 5CBLA 5BXXA 1F5FA 3POWA 2Z79A 4OULA 3H3UA 4NN0A 5FMOL 4EN7B 1PNFA 2P37A 2PHLA 3WDTA 4FP3A 4J1WA 5JLVA 1UN1A 1RVF3 3I2DA 1H0BA 3RYKA 1W6MB 2PHRA 3PLQA 5AVPA 4N53B 5EYXA 4C0HA 4YM1A 4P9IA 2VH9A 5I0RA 3FBMA 3BOPA 4K1ZA 1RUI1 1SCRA 2ZX1A 1N1VA 1G86A 4M0HA 1OOPC 4QPGC 1PGSA 1ENQA 2V5YA 1QJU3 1ZZ7A 2YV8A 2PA7A 4URTA 1SBFA 4F83A 4AI3A 4COVA 4Q0VA 1UL9A 1WGPA 2DFCA 4P9YA 4Y24A 3H50A 1EP0A 2YC0A 4GMP1 4K3UA 4EROA 2PHUA 4XIOA 3VZKA 4GH4B 1Z78A 3S0MA 3EQEA 2DYCA 3QD6A 1BBT2 2R16A 2HWC1 3NV2A 1RUF1 1S2KA 3USUA 3FUQA 2NM1A 4W6WA 3AB0A 1KFUL 2VY0A 1RTVA 3I54A 2ZZQA 4IEUA 1QDOA 2DCKA 4XE9A 4JAAA 1H1MA 5FAXA 1XE8A 5ABJB 2WFF3 1PVC3 3W59A 4YW3A 4FPOB 1MQTB 5L73A 4C91A 2WNVA 1RB8G 1PO11 2DTYA 2GNTA 1W6QB 1FT9A 4AI8A 4R9BA 3G6JB 1SLIA 1DYPA 3D4KA 4YW4A 3OBTA 4NVPA 2W52A 1AUYA 4DY3A 4HPKA 2ZS6B 3MYXA 1RGSA 4TLFA 3CJIC 3ZFGB 3H3ZA 4L99A 4QPIA 3RJ2X 1TME2 3DKWA 4GB31 5J09A 4AFDA 1GZWA 2RS32 4CEWB 5B2GB 2QDNA 5J96B 2GALA 4Q8LA 4CP0A 4IETA 1PIV1 1WCSA 5FMOS 1LRHA 2VW0A 1LECA 3P3PA 2A6VA 3GHMA 4B7EA 3PMSA 2AH2A 1F8VA 3V65A 1APNA 3KB5A 2I45A 3X29B 1QWRA 1RHI2 1GYKA 4ORFA 1ZA4A 1ND2B 1VBB2 2HWD1 2IWGB 3AKTA 3GZUC 5CFDB 4BA6A 5FCCA 3D0JA 5K7PA 2Y38A 4GH4C 3MIDA 1OHFA 5GLUA 1MZEA 4K40A 1AJKA 2RS13 4CDQB 4XJWA 3M8LA 1XNDA 3LOBA 1X8MA 3BU7A 4FTSA 3EHKA 3CO2A 3KGZA 2ZGQA 3FLPA 3WY6A 1NLRA 1A8DA 1BVP1 3DL3A 4FTBA 1RMU2 4YFZA 4I02A 5ABJC 2GNDA 4P9JA 4DS0A 3M70A 1ENSA 2VVEA 1VBA3 5BNOB 1DZQA 5A33B 4JGZA 2EXKA 2YY1A 3ALQA 2WZR2 4OHYA 3KQRA 4FXGB 2A75A 1PO13 4FPHA 3K48A 1CAWB 4U2AA 4OHXA 3SH3A 1YCIA 1VBC2 1WW4A 4BWOA 3MZHA 1JYCA 1W6OA 4IV1A 5JI9A 1UU5A 1MS8A 1A6CA 1VBE1 1QY4A 2D43A 4CEWC 4I3PA 2RM22 4Y20A 4S2HA 4E4ZA 4LNVA 5JI7A 2FQPA 3IT8A 5JZGA 4Q4V1 3TN91 3GALA 2BNOA 4ATFA 1PIV3 1IKQA 2PQQA 4XF1A 3BIWE 3IDBB 2JG8C 1NA1B 3VBOC 2NMOA 4X8PA 4M3CF 3H0OA 1CGPA 3M7AA 3R4DB 2Z42A 1PK6B 4FVVA 5AC93 2IXLA 3QLQA 1DG6A 1ND2C 4EN9B 5DUUA 1EV12 4YZ1A 5CFDC 3AMPA 5GZCA 4BMEA 2ZGSA 4CDWA 3D82A 3JZVA 4LE3A 3AXEA 1S2BA 2D6LX 2ARXA 1RUH3 3AP5A 3NKGA 1D4M3 1LESA 4CDQC 1NQDA 4D7TA 1G9DA 1GBGA 1GNZA 3OBRA 3R6SA 2HWB3 2UYBA 3JUUA 3Q9OA 3ZYJB 2XVGA 5J37A 5SV5A 2VOVA 3NV3A 3J4UH 2K0GA 2ZACA 2H0VA 3N7LA 5KC6A 3RMXA 4AHZA 2GC0A 3SXWA 4OI0A 2DVAA 2BUKA 3ENRA 3TYJA 5GLTA 3AXDA 1VB4A 4A7ZA 4RHV3 3VHNA 1OA4A 2CY6A 3FMGA 1G9BA 5DUVA 1LB2A 1BEV1 5DZGA 3QCWA 1QJY2 5IK5A 2EAAA 1NXMA 2Y26A 2WA3A 3H1WA 4YM2A 5C8CA 2WWSA 2ZA9A 1CJDA 2WSVA 4OLLA 4I01A 3FE5A 3N36A 4QQPA 4WM7B 4UW3A 4S2GA 5ACA3 4MUVA 1AF9A 4ZU4A 1K5MA 3KT1A 1LKNA 5FTTC 4ASLA 1NA1C 4Q4V3 1JXNA 5GKAC 4C1XA 3LA3A 3I7DA 3GBGA 1PK6C 4LBQD 2CAUA 1CD3G 4PDWA 1WW5A 2PLV1 1TQ5A 2QUOA 4U36A 1TMF1 2ZTNA 2RMU2 2VNOA 3VKLA 5KHJA 1L3JA 2VXRA 3PTYA 1RUNA 3W58A 4HFSA 1W0OA 1V6MA 3MW4A 2CYFA 1TNFA 4HETA 4AI0A 2JENA 1XU2A 3ZN6B 1BYHA 4FPEA 4CDUA 1UD1A 1VB2A 4EN0A 1MACA 1YIPA 3CNAA 3M2MA 4GMP0 3VN4A 4AGRA 5GZFA 1RVF2 4HKOA 2JJ6A 4JRAA 2A5ZA 1J3QA 1FPN1 4P9XA 4QHBA 5KBFA 4FPJA 3TB0A 3RI8A 3S7EA 1CVNA 4XF3A 4XFGA 5F6KA 1EAH3 2ZHMA 4JVAA 2MPFA 5T52A 4RQPB 4FPKA 4AVBA 1VRH1 4JC1A 4JTOA 1HQNA 3KCCA 3LCPA 1QJU2 5DZFA 4GKYA 2ZGNA 3VBRB 1ZREA 2Y0IA 1V6KA 3ZSLA 1BEV3 1JH5A 4I0AA 4WM7C 3OGGA 4B4QA 1CIWA 4I30A 5FPZA 1N47A 2A3YA 1W0PA 3GBFA 2RE9A 4RS5C 3DN7A 2GZWA 4LEJA 4FSJA 1PZ9A 5JVVA 4QQHA 4IEOA 4PIYA 4FOWA 1RUG1 2V73A 1WMFA 2EXIA 2YGMA 3WCRA 2WFF2 5BYNA 1SLAA 2OZ6A 2OVUA 4UBGA 4I0BA 2PLV3 3AX4A 3MFAA 1QDCA 4AW7A 4RFT0 4Y1UA 1CAXB 1V00A 1HDKA 2UWAA 5HBAA 1WBFA 5EYYA 2VMHA 4JGYC 1PNGA 4WVZA 2HKXA 4XFHA 1UKGA 1DGWA 3B01A 1BBT3 1WCDJ 2R041 2VOKA 2BQPA 1JBCA 1ZRCA 2R32A 1J1LA 2RHPA 4HK8A 2LUWA 3SCFA 1CX4A 2ZOEB 3FJSA 3S30A 3I59B 4E4DX 4KNCA 3D0SA 1HLCA 3TWIA 1FPN3 4MVTA 4DMIA 1DGRA 4Q27A 3AP4A 4I3GA 5C9AB 4PIZA 4QX5A 4F8AA 4E27A 4FOVA 4Q0UA 2X53S 5C4WC 1NY71 4QD2A 1RUI2 3AKRA 1VRH3 4WM8B 2PAMA 1LOFA 3R4SA 1MS0A 3VBRC 2CTVA 2CNAA 2ZAHA 2CV6A 4N90A 4BLJA 5SV8A 2HWF1 3ELNA 1UU6A 4W6YA 4XW3A 3WP6A 1QHDA 1YXWA 3HR9A 2BWAA 1LJ7A 1WMDA 4E4SA 3ZYRA 3VZMA 2LTNA 2RS12 4FP2A 4NWVA 4LBNA 1RIRA 2D7FA 4CZSA 4YARA 1RUF2 4BZ4A 2A6YA 4RR3A 2XLGA 1RUJ1 4NHLA 2OIIA 2UWBA 3OY8A 3VKNA 3JB4C 1S1AA 4EWAA 1DF0A 5E88A 4WVVA 4B4PA 2XG3A 2VUAA 5IUQA 1POV1 3I8TA 2ZABA 1V70A 1DHKB 3IBMA 4DB5A 1LOGA 2XVLA 1O4YA 2KM2A 4KWJA 1S0EA 4A7YA 4AFBA 1DQ5A 4LA2A 5KXDA 1PO12 1XQNA 2LALA 5K0UA 5BV6A 4Q4X1 3POSA 3H7YA 3CU7A 4OHWA 1GSLA 3CJXA 4MXWB 3N4MA 1BMV1 4KH9A 1JW6A 4Z8BA 3OYWA 4E2SA 4XJUA 2A6XA 4LBQB 2EAKA 2R043 2X5IB 1LHVA 3VBUB 4DRVA 4QGLA 4AEDA 1ZBA1 2BTVC 1WLDA 1MR5A 2E53A 4ZXKA 1YRZA 4FAHA 5C9AC 2O8OA 1OPOA 1PIV2 2PHTA 2ZX3A 2WZR3 5JR7B 2NYYA 3VBSA 3WG1A 3VGIA 4WM8C 5I0UA 2R061 5AC92 4HN0A 1FMD3 4PIXA 4CYDA 1BVVA 3UK9A 5CFCB 4NO4A 1PGW1 4Z1VA 2ZPXA 2C1FA 2ZCWA 1EYBA 2HWE1 2VU9A 2HWD2 1YLLA 3IM0A 3K51A 2I74A 2XJTA 3VDDB 4AEJA 1V9U3 3SNMA 5I93A 4N43A 3ZXAC 4Q26A 1D4M2 4AFMA 1FOD1 4PLOA 3SISA 1H8TC 2HWB2 2DUOA 4MX3A 1OI6A 1ALYA 4Z92B 2D98A 1AL0G 4TYSA 1RUJ3 4XZPA 2BVBA 2QVSB 4LT5A 4P5HA 1AR71 1PO21 1Q5OA 4Q4Y3 4ZU7A 5FPXA 2Z5WA 1POV3 3HD8B 2R1DA 2HEWF 4R9CA 4ATEA 3NVCA 3NL1A 2JICA 4RHV2 2BNMA 3VL8A 3ILFA 4H7MA 2BNNA 4DFSA 2O8QA 5T54A 4QU2A 4JQRA 2WL1A 1YFUA 2DU1A 1M06G 2X5IC 2WNUB 1VJ2A 1F5JA 2A7AA 4B8EA 1X82A 5I91A 5ACA2 2WA4A 1H4GA 1CQ9A 1ZBA3 3ROUA 4QM9A 2P17A 1C8M1 1CJPA 4BOWA 1KRIA 5D8AA 4AXOA 2TBVA 4BE3A 5A32A 4Q4V2 3TN92 1X7NA 2A3XA 2NLRA 1AR61 1XYPA 4LBMA 4M0NA 3VLBB 3WD5A 4XQDA 5CFCC 1J58A 1OOPA 1LOBA 1FNZA 1ULFA 1RUC1 1QJY3 2VNRA 1U5XA 4XPVA 3VDDC 4JTNA 3ES1A 2NMNA 1GV9A 1PGL1 4DRRA 2HJIA 3WINE 5J36A 2ZBJA 4N9IA 3PVNA 3RJRA 3TBDA 3LSDA 3PVOA 3DPRA 2JG9C 1LULA 4LO4B 4P9LA 1QOOA 4GWMA 1GFF2 1BJQA 5CNAA 5J48A 1F2NA 3H7JA 2GMEA 4IERA 1MZ5A 5BNNB 3GZTB 4UXAA 2D6NA 1AYM1 2QZ2A 3RRDA 1PM7A 2F4PA 5JOYA 4H7LA 4GALA 2XL9A 1EAH2 1PO23 1LU1A 5BNQA 3TAYA 3V0AB 2QJVA 5GZEA 2GAUA 2XH6A 4FPLA 1N3PA 4FPYA 3MIBA 5CAZA 2VUJA 2WKKA 3ASIA 5FO8B 2UY8A 2AYHA 3AP7A 3WP5A 3B9CA 3RPQA 2G9GA 4LHNA 2XJVA 4D94A 2SLIA 3BALA 1BEV2 3W9AA 1XU1A 2VQ0A 1W6PA 2WNUC 2Q0AA 2YZ4A 3FHIB 1AR81 3WHUA 2D97A 4COUA 1F9KA 3CJIA 2ET7A 2PAEA 1Y43B 4Q8KA 1MEC3 4NHMA 4AEMA 2IXJA 2ZHNA 2QZ3A 1RJ7A 1NYWA 1HXS1 5JCTA 3HQXA 1TNRA 1PZ7A 3WG2A 1COV1 2WT2A 5CU1A 3IPVA 2B39A 1ZZ8A 2XKOA 1B35B 1KDKA 4YVWC 1ZYBA 1XXNA 4DOUA 4GA9A 1RUD3 3A4UA 4GIQA 5FQ0A 2PLV2 4MYEA 1JUIA 3ZXFA 5JIUA 3WR0A 2GN7A 3A0KA 1QJX3 1AHSA 2W08A 1MZFA 3HT1A 1QOTA 1ZNPA 3ZFEC 2IXCA 1W6NA 3P3NA 1TEIA 1HRV1 2ARBA 4L9BA 5BNNC 4IEZA 2XLFA 4BM8A 1Z7S3 2BWCA 3SMHA 1FPN2 4XHXA 3EO6A 3DV8A 3UL2A 2VPVA 3LA2A 1A8MA 1DU3D 1PHMA 3USUB 2RR11 4QPYA 2EVXA 3VV1A 4IV3A 1POV0 1R1A1 2YMZA 5H9QA 1VRH2 5JSRA 4UW5A 4Q1RA 4KU8A 4RGAA 1O4ZA 4KGGA 2CGNA 5C33A 4IQPA 2XWJB 2PN5A 2WNVB 1NLSA 2DV9A 2BVVA 3N35A 3AKQA 4XJ8A 5DDJ1 1AR83 1H1IA 1S0DA 4N53C 4BIOA 2WNEA 5FLHA 1X36A 4HPKB 3C3VA 2XGXA 5CG9A 4R9AA 1AXZA 4AHXA 3LWCA 1DQ4A 1HXS3 4HT1T 4QPIB 3J8F1 1B35C 3LSEA 1RUI3 4XFBA 4LULA 1BKZA 1GZWB 4YM3A 3INAA 2JG8A 3VBOA 2ZJCA 4META 4JV4A 4Y4YA 1KQRA 1KDMA 3MIHA 4K7JA 1ULDA 1ULGA 1IPKA 2VQAA 4CDXA 2P34A 1VBD1 4OUSA 2QKDA 2GC2A 2MEV1 5T5LA 1WLCA 4GMP3 2GH2A 3WDXA 1DIWA 3KS7A 4HVOA 4MXVA 4BH9A 4OI1A 4R4XA 2H6BA 4TSVA 1WD3A 2HWC3 1NXD1 1RUF3 2R042 3KSCA 4Q29A 2WT0A 3R0RA 2CGPA 2R071 2ZAAA 4XF0A 2DTWA 4N9HA 4IEYA 4ASMB 3ILNA 1MQTC 2UYAA 5F1RA 1FI2A 3TNPB 4CEYA 3MGUA 1JUHA 2ZX2A 3ETQA 3WQ7A 4EN6B 1G9CA 1SLCA 2D6MA 2RR13 4BHPA 2YROA 1YO8A 1FMD2 3VKFC 1H2NA 5E1RA 2JE7A 2JX9A 3ZFGC 1XNBA 5AFEA 1G8WA 3QBQA 1WBLA 4JGZB 1Q8VA 1V9U2 4AI1A 2C9AA 3O0XA 4ONUA 1X50A 2RS51 1HX6A 4GB33 2NN8A 3OF1A 1URXA 3PVBB 4UW6A 1AX0A 1PVXA 2B7YA 5CA6A 4SBVA 1GICA 1W6OB 4IV1B 4QPIC 4YGEA 4L2NA 2GH8A 3EJKA 1RUJ2 1N3QA 4LO5B 4IEPA 2ZGTA 1H9WA 3J26N 4Q4Y2 5FREA 3QACA 2P3KA 3O7OA 5L7OA 4KU7A 4Y20B 5LRSA 3IKWA 4M00A 5JZGB 1RITA 2CWMA 2HWD3 3RSJA 4H3WA 1Q8PA 4B3NA 3QH6A 3TRSB 3FUOA 4FPCA 1VBD3 4Q4X2 3WDVA 1IKPA 4LO7A 1HQWA 2VW2A 2YDEA 3RYRA 4ISQA 5LRRA 1BMV2 2AREA 1CAUA 3SLIA 3VHPA 4L92A 4CDWB 1MS9A 5KHKA 2ATFA 2XL7A 4K9SA 1ZBA2 2ZZJA 4O9EA 4XMAA 4WVMA 5BNOC 2EA7A 1ASJ1 5I0TA 1YJLA 5FOJB 3U07A 5J7MA 4XFFA 4NOTA 3SH4A 2CAVA 5GZDA 3AKSA 2JE9A 4N7IA 1QU0A 3VHRA 4BLIA 1O5LA 4JGZC 3VZOA 1GZCA 1IHMA 1MS3A 4AVAA 3B7MA 2HWE2 1VBE3 1UZYA 3ZSJA 5C8WA 4CP2A 3NAPA 5GLZA 2RS53 2PHXA 3A0NA 2F6BA 4RS5A 3ZXGA 4IV1C 5EXOA 3PJYA 1NCQA 3TN93 1O3RA 5C8CB 1C1FA 3IN9A 3BCWA 5T5PA 3WW1A 1RUE1 3WG3A 3CLPA 1PO22 3WDWA 5JWPA 5JZGC 1K5MB 1LHUA 3I4IA 5LK7B 3AZYA 1Y3TA 4XFIA 3H1MA 1OD5A 2WLQA 4KQ7A 4EV0A 1FNYA 1DQ1A 3V0BA 3D6EA 4PDWB 4NHKA 1X8EA 4W6XA 1H2LA 4IEQA 4JGYA 4YM0A 1PMIA 4CDWC 3VBFA 2D5HA 3ECQA 1MEC2 4MGIE 4Z07A 4J6GA 1OA2A 1ONAA 2NPIA 1PZ8A 3ZDSA 3SCHA 1YFXA 2D3SA 2PHWA 4YFWA 1H30A 4CDUB 1OSGA 4YZ4A 2ET1A 4B4RA 5JAXA 3UJQA 1ASJ3 1C8M2 1MS4A 4KBBA 1CONA 2XWBB 2GN3A 5C4WA 2GU9A 1QQP1 1RUD2 4LBOA 4AF9A 2W68A 1DGWX 4K1YA 1BZWA 3WZ1A 2R30A 2Z69A 4LBKA 1QJX2 2MNGA 1LR5A 1S0JA 1QNYA 2O0OA 3RDIA 4L11A 1PGL2 4AE2A 1CAVA 1HQLA 2GNMA 2XJUA 3KT4A 1J1TA 4OUMA 4XJAA 3JBG1 1S0BA 1A3KA 4FPFA 2WFPA 5C8CC 3LOIA 4BQ1A 5HI0A 1Z7S2 5JOXA 4YW5A 1OQEA 4CRQA 4QQ2A 4X6QB 1WD4A 2RS31 4IESA 3M3EA 4LHKA 1FAYA 2IFRA 3WQ0A 4Y22A 4JDOA 4WV8A 1K5MC 3VZLA 3KLSA 1TMF3 2P2KA 2ZMLA 4QM8A 3AMMA 1YYNA 1SBEA 4J1XA 3JQXA 1XYNA 1OQ1A 2IC1A 3OTFA 1QJZA 1D2SA 3L2YA 2Q8OA 4AVTA 1Q8QA 2LM3A 4XEZA 4R4ZA 1ENRA 4YVSA 4ZU5A 1AR82 4KG8A 2DWRA 3PJQA 1UPSA 3AZVA 1YIFA 2B8MA 1QH7A 1ND3A 2YGLA 2TEPA 2FZ1A 4CDUC 5JIAA 4RQPC 1HXS2 2W0XA 1IOAA 5KXEA 4QQOA 1VALA 5F9TA 3ZXJA 1COV2 2K2SA 4O9GA 3ATGA 4XILA 3WNXA 4YSFA 2Q5TA 4LUMA