2VNRA

Family 51 carbohydrate binding module from a family 98 glycoside hydrolase produced by clostridium perfringens.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
172
structure length
172
Chain Sequence
SRDVYLSDLDWLNATHGDDTKSKIVQKNHPFTPGNNNQSTKISLKMEDGSISEFEKGLGTIAGSPSTITYDISGAGVTKFFSYLGIDRSANPINEQYAKVDKIEVVVDGKVIYSTINQFPNGLTYETPAIKVDLNIPENAKRLQLKSYAGEKTWGDEVVYADAKFTAKGDFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CPE0329
publication title Divergent Modes of Glycan Recognition by a New Family of Carbohydrate-Binding Modules
pubmed doi rcsb
source organism Clostridium perfringens
total genus 39
structure length 172
sequence length 172
ec nomenclature ec 3.2.1.-:
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08305 NPCBM NPCBM/NEW2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1060 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vnrA00
2YGLA 2VMIA 2VMHA 2VNGA 2VNRA 2YGMA 2VNOA 2VMGA
chains in the Genus database with same CATH superfamily
1WD4A 4XFCA 2EIDA 1NYWA 3LEKA 1RVF2 4FXKB 2D40A 4QPGC 1UOBA 2Y0OA 4XF3A 3VDDC 2DU1A 1C5IA 3VD3A 2WL1A 3MF9A 4LOTA 4NRMA 1W8HA 4YM1A 3UGFA 3ZYHA 4Q1RA 3OD4A 2QZ2A 4I09A 4XTPA 1W99A 2RR12 4AL9A 4IW3A 1WLWA 1OLME 1QJY1 2R1DA 4PLMA 5A7SA 1YIFA 4NWWA 5KHGA 1AX2A 1IGOA 1VAVA 3WP5A 5EXOA 1S2BA 3AC0A 4EROA 2WFF2 3K4ZA 3NAPC 4SBVA 4D6QA 3OBTA 5D21A 3R05A 1S0DA 3U14A 1UD1A 2YROA 4DRVA 5IK4A 1BJQA 2X5IA 3QLQA 5DQ0A 1O91A 4RS5A 3VBRB 1NE6A 5JZGA 2VVDA 4Q8LA 4YZ4A 1JHJA 2Q30A 2ZHNA 3HT1A 1C57A 1ULFA 3AX4A 3HQRA 4NRPA 4LPLA 1BMV2 4NIIA 3JUUA 5FMOL 2ZACA 1MQTC 1VBA3 2PHTA 1TQ5A 2VNRA 2P34A 4XQ4A 5LBEA 1RUE3 1K5MA 3UGHA 1OLRA 1PVXA 1TE1B 2VE1A 5I8TA 4YG0A 1M4WA 5L7OB 2DDUA 3FLRA 4LBQB 2VD7A 4Q4V2 1VRH2 1OH4A 5A3LA 2ADEA 4NPRA 4JRLA 2ZGPA 1ASJ2 1C4RA 2IXCA 2ZABA 4W65A 5J1XA 1W8OA 4A2UA 4Q0UA 1MZFA 1UMIA 4LIVA 1CX1A 2AC1A 2DVFA 3TAYA 4BXFA 3H7YA 3THCA 2A6ZA 3ZFGA 4Y1ZA 4HMZA 2WFPA 1VIWB 3UV9A 1CX4A 4XJ9A 3UL2A 3EYPA 5IVVA 1ENXA 3PUIA 5J7MA 4XEZA 3S7IA 2PLV3 2YB7A 3Q9OA 3VD7A 2ZX2A 1Z7S3 1GU3A 1W2OA 1NT0A 2PA7A 3I2GA 1WMXA 4NVPA 4WM8C 3T2TA 2B9UA 3TNPB 4CDQB 1XYOA 2CGOA 1PHMA 5LB6A 5JXHA 5FQ0A 2EXIA 4GWIA 4L92A 3WY6A 2QQWA 1DIWA 4ATFA 4BQXA 3WF2A 3CQOA 3RNSA 5FO9B 1XE0A 3CJIC 4HSLA 3RQ0A 2WWSA 3LOIA 4CXYA 5FZCA 3MUY1 5EYXA 3VZJA 4BJ0A 4AXOA 2JE8A 4LHSA 2XGXA 3KGLA 5DZGA 3OPTA 2GC1A 3ROUA 3O1TA 2O0OA 3J8F2 4XF4A 4RQPC 5JMOA 1ULDA 4XZUG 3AP4A 1K42A 1BQPA 3ZOIA 1WA4A 5FXXA 1V6LA 4FPKA 2XOMA 2LRPA 1W9FA 4YZ3A 3UJOA 3J7HA 3ELNA 3AL6A 1UX6A 1KEXA 1HRI3 1FT9A 4B29A 4A3XA 5IATA 5FZLA 1NQDA 2BOIA 5LWBA 4Q4X2 2CGNA 5FZOB 3VBUC 4P5YA 2RG4A 3ZXJA 2NN8A 3MFAA 1UMZA 1GV9A 1ST8A 4R9CA 5JPNB 2Z69A 2GC0A 2DVBA 2FMDA 1RUH2 2ZGTA 3NJVA 2Y6FA 4F3JA 4HN1A 3RGBA 4YVWC 2QQPA 2ENRA 3PUHA 3KQRA 1ZBA2 1QU0A 1VBA1 5FY9A 5CKNA 4PIXA 5FXVA 2JXAA 1RUE1 1H8TA 1LU2A 4QPIC 4TZDA 1AJKA 2Y60A 5BNPA 4JTNA 5FYCA 4P02B 4Z1VA 5LCWL 4CP9B 1XJAA 3BI3A 1YC61 3MEPA 5DZFA 4CYDA 4AF9A 5JUVA 1IG3A 1HN1A 2VM9A 5FPAA 1S0CA 1X8EA 1C8M2 4KWUA 3ITQA 4AZZA 3TEWA 4R52A 4FPCA 1G9BA 4YLZA 2DVDA 2I74A 1AX1A 2JIGA 2WR9A 4ZXKA 4CEYC 3O1SA 1NCQA 3RG0A 3W5NA 1BCXA 3BIWE 5FYYA 1MVQA 4Y26A 1UW8A 1N47A 3J4UH 2RDQA 1JTZX 5FY5A 2BPA2 1POV3 1UZZA 2XJUA 2PLV1 3H7JA 3MICA 4CCDA 5IJRA 1G9AA 4XQWA 1KD7A 1Z7S1 4CCNA 5CG8A 1QY4A 3MW4A 4AVTA 5CA6A 1OUXA 2BVBA 1AXKA 5A6QA 1ZA7A 3IM0A 1N3OA 3JB8A 2B5HA 5T50A 5KC5A 3POJA 1UKGA 2NPIA 5CISA 5GLVA 2JENA 1RUG3 3O1PA 1FNYA 2CWSA 2PHLA 1H6XA 3ZFEC 3BKZA 1R083 1DCSA 1AF9A 5B4XA 3WF1A 5FY4A 3BN6A 4MGYE 4E8DA 1C28A 3MLLA 5FPBA 4P9YA 4CSWA 1QJFA 1RTVA 2HBTA 2ET7A 4DY3A 1PVC2 2VZTA 3AYAA 4URTA 2RDRA 4XCBA 2WLQA 1QEXA 1QJX3 1VB2A 4W6XA 4N7UA 4IEYA 1EY2A 5C4WB 4AG4A 3VUOA 2E33A 2PQQA 2W47A 5FWJA 5JOWA 4MGTA 5FAXA 1OLQA 2B46X 1W8WA 1JH5A 3M1HA 4QKBA 2CNAA 5T5JA 4BQ4A 4XURA 5FJKA 1YYNA 2IUWA 3U11A 3HN3A 2JX9A 1UOFA 1MZ6A 4AVAA 1MS4A 3WQBA 2VNGA 3RS6A 3S7EA 2H6BA 3FUOA 4YZ2A 3IDEA 4NOTA 2OUJA 2XJSA 1COV2 3ECQA 2D6LX 1XQNA 1ND3A 3QH6A 1X7NA 3P1IA 3SC7X 2XH6A 1CJPA 1GICA 4UW6A 4Y20A 5DZEA 3HQUA 5FZ4A 1OBNA 3ZXKA 4WVWA 5FDBA 1WLTA 4I0AA 5GLUA 3BUCA 1UF2C 2E32A 3WNXA 5FPUA 1G7YA 2JD9A 4YGDA 1S0BA 3ACLA 4JVAA 3I49A 1W2AX 4D6RA 3WCSA 1J58A 4Y1YA 2Q0AA 2R1BA 4YVSA 3E5UA 3WX5A 3LPGA 4MVTA 4CDXA 1O3QA 3A23A 1D0HA 3WNPA 3WDXA 4FOWA 4GALA 4GB32 1DZQA 5FP7A 4QPGA 1Q8OA 2PELA 1HXS2 1SBEA 3VDDA 2BW8A 4ES8A 4P5HA 1YRZA 2IC1A 3EXUA 2JD4A 2OW4A 2YY1A 3C2UA 3GBFA 3ACIA 5J3UA 1Q8SA 2ZJCA 1Q5OA 1LAJA 1OKQA 1WCDJ 1PO22 4PF5A 1POV1 4PHZA 1MPXA 3IDCB 4GMP3 5JXJA 4AFBA 5JOZA 4QX3A 5C70A 5F5IA 5FYVA 3HBKA 1YXWA 4Y1VA 5CEHA 2QQLA 1J3PA 2ID4A 4S2DA 2A75A 1UX7A 4LTAA 3AZVA 4OQ9A 4D6SA 5FKCA 2HH9A 3PUSA 1W9TA 1RUG1 3POIA 4YW5A 3WW4A 3K48A 3PUQA 2CU5A 1R081 3IAQA 4V2VA 1GBGA 3LIGA 3OUHA 3UGGA 3WDUA 2VBDA 1ULGA 5KHIA 5LA0A 4LUKA 2A5ZA 4QHOA 4E4DX 3GZTB 2HWF3 4GIQA 3RSJA 1LENA 2Y8KA 1VBD3 1OT5A 1W8NA 1QJX1 1SFNA 3V0BB 2OZJA 3WCRA 4IE6A 4EWEA 3OEBA 1MQTA 1PK6B 1K3IA 4KWLA 3OYWB 4MSVA 3TN92 2VTXJ 5DDJ3 1EAH2 4MX3A 3DYPA 4BQ1A 4LO4B 3O1MA 1O5LA 4FPJA 4Y5TA 5D2AA 3KT4A 2G19A 3SKJE 2JG8B 2F4LA 5K0UB 5FZ7A 1ND2B 3UKNA 5CBLA 5K8SA 1RUJ2 4PDWA 2AUYA 3JXSA 2VZVA 3WUCA 2ZHLA 1FPN3 1Q8PA 2VG9A 3UKVA 1HB3A 3KV4A 5J98B 5I8SA 4XHXA 1UY0A 2GMPA 1BBT3 4IV1B 2VOTA 3I3QA 4OCTA 4NJ4A 4ARYA 2I2SA 4CP2A 5JSRA 5F2SA 1RUC2 2ZS6B 4DY5A 1DG6A 4Y1XA 5IK7A 2BBVA 4D7TA 1DQ0A 4WM8A 4ZS3A 3OGGA 3ZXLA 2NQYA 4UFKA 2Z79A 4E2SA 1H0BA 2E31A 4O65A 3U1XA 2IVIB 1B09A 3VBHC 2A6WA 1E57A 1OOPA 4XILA 3GBWA 1GZWB 5F3GA 5GKAC 4ZXEA 2D6MA 4IL7A 5C8CC 2J1EA 2XDVA 1DGRN 3LPFA 3CJIA 3LKJA 4LE3A 3E6BA 1QDCA 3A4UA 4Q2FA 3ZIXA 2W52A 1WD3A 4NHKA 2WYSA 4LO6B 1CAXB 1CZVA 2XKOA 1GUIA 1DP0A 4XFIA 4OI1A 4BCUA 1JW6A 5I0SA 3BB6A 1WMFA 4GMP1 1MZEA 1EV12 2QQIA 3MIDA 1GANA 4RQPA 5CNAA 2BV4A 3T0BA 3ZSJA 4KWJA 4QKDA 5FXZA 5FZFA 3X29B 1FOD2 3SH3A 4ORFA 3N9NA 4QX0A 5IVYA 2FHRA 2DVGA 4CCLA 2R042 2YC0A 1YIPA 2RMU3 4CP0A 5H9PA 3N7KA 3PTYA 4URAA 1XE7A 2EF6A 3KHBA 4ISQA 4JC1A 4A7ZA 4IEPA 3VKLA 3AM2A 2G9FA 5EZWA 5CFCC 3FX3A 2HWC3 2E51A 1LB2A 2QKDA 3ES1A 4GH4C 4NWVA 3GBGA 1W6QB 5FOJB 2HWF1 1AVBA 2GMEA 2VTXA 4JDOA 5C3RA 1VBD1 5C5UA 1V6MA 2GN3A 4QT6A 3S57A 1GQHA 4Z82A 1GP5A 5A32B 2OKXA 4XQDA 1EUTA 4RL7A 5H9RA 5J96B 3K77A 3CU7A 4QPIA 4QHBA 5I91A 2Y6KA 4GD4A 5DDJ1 4ASKA 5IUQA 1OFNA 1UMHA 4AFMA 2Y64A 1BXHA 1ENRA 1RIRA 4JGZB 4AI3A 3FZ3A 1OURA 3POBA 5A7NA 2Y38A 3PU3A 4ZU5A 1CAUA 1FPN1 3AXDA 2WT1A 2W1QA 4W50A 3B3QE 1V9U2 4MH0E 3SMHA 1B35C 1W6MA 3PJYA 4L11A 4AI2A 1OVPA 4D7YA 4HANA 3PMEA 3VD4A 1BBT1 5A7WA 4QB6A 4MOAA 2WA3A 1XPWA 2RS33 4N7IA 4QDRA 4XJZA 3ZXAC 5C9AC 1UOJA 4Y22A 2F4PA 2WWJA 3NNLA 1H1MA 4DUVA 1JYTA 3J7NA 4QXHA 2CTVA 4BXSV 1S2EA 5T5LA 5FZGA 4BPZA 3WLUA 4QD2A 4ZKTB 5I93A 3ZFEA 3POGA 1ULEA 1FMD3 1D0GA 4A41A 4PBPA 3ST7A 3WG3A 5T3NA 1QXJA 4FP2A 4JTOA 1A3KA 1NY71 2Z4FA 4EV0A 4AGVA 5LASA 5C6CA 1HJFA 2E53A 2IXJA 1UCXA 3HIFA 2HWD3 2WNEA 4QPWA 1RMU2 4TXWA 3ETQA 2WNUC 1NA1B 4J1WA 2OXBA 4IERA 5CYYA 4HVOA 2QDNA 1H2KA 2UWAA 3GHNA 3CBNA 3DV8A 3B7MA 2XQRA 4FOQA 4MO3M 4BMBA 4XFHA 4YPJA 1OFSA 3OJBA 3ILNA 1F9KA 2JG9A 2RMU1 2NP0A 4G3YC 1G86A 1BK0A 1VR3A 1PX4A 4FPHA 1ZZBA 1CAVA 2OVUA 4L9BA 3DL3A 4NIAA 3BPZA 5LW9A 2A70A 4UFMA 1JZ7A 1A6CA 1H30A 1K5MC 2BERA 2GNBA 2HWB2 4N90A 4LO7A 3WT3A 3K4AA 5FBJA 1J59A 3H50A 2W87A 4MG2A 3ZM8A 4CEWA 2XLGA 2GC2A 4H7LA 4IDZA 4IE7A 3ZR6A 4R4XA 1TZOA 5ABJB 1RJ8A 3FHIB 2Y33A 4HFSA 3NWKA 2DBNA 5ISLA 4CU9A 3DPRB 4P9LA 1QXPA 2X5IB 5T5OA 4RS5B 2XJRA 3JD73 4UFIA 4BK5A 5L9VA 4P9IA 5JZGB 1LCLA 3ZFGC 3ZLIA 4AGRA 5FKBA 2LM3A 5LK7B 2D97A 2RDSA 3IZOA 4OHZA 1HV1A 1BLZA 4E4ZA 5EFUA 3ZMOA 3AMPA 1QWRA 4EN6B 2J42A 1OD5A 4N53B 4ET7A 1DQ1A 3M3CA 2AR6A 1YFYA 2P3YA 4FCAA 2X05A 3ZFFC 2WT2A 1ZZ6A 2MEV3 4Q5OA 2J1RA 2RS31 1UL9A 2D44A 3VDCA 4AI8A 1LKNA 2W9XA 3SNMA 4ZY9A 5I0DA 4YGCA 4KG0A 2WSVA 3WG2A 4OHYA 4GWMA 5L19A 4RD7A 2NMNA 3B93A 3O1UA 4PI0A 4S2FA 1AYM2 4NHMA 5FV3A 3FUQA 4LIUA 1OC1A 4YM0A 5CKQA 4YFWA 3CF6E 1W6NA 2BFUS 1NXD1 2DTYA 2YHJA 4DZGA 1WA6X 4CCCA 4Y4RA 5K4LA 2YBKA 1VBC2 1W0PA 4WZFA 2WZR2 3RZLA 2J7MA 2O14A 1Y9QA 4UBHA 1OKOA 3R4UA 1CONA 3I2IA 3ZSEA 4BH9A 5FQ0B 3LA7A 1O8PA 3CJXA 4FOVA 3N9PA 4HL0A 2BYVE 2JDNA 4TLGA 3ZYPA 1OA2A 1FI2A 2BRTA 1CGPA 1YJLA 4OI0A 5FMDA 2A71A 4A6SA 2V4VA 4O9GA 1JYWA 3EQEA 3U75A 1C5HA 2GP3A 4RR3B 5GLTA 5J48A 3MO4A 2J1UA 5E16A 3B00A 3DYMA 4META 2HEVF 1AR93 1H8TC 1CESA 3M3EA 4ITCA 4LA2A 4Q4V3 3I2DA 5L9BA 2W68A 3RYRA 1MVEA 3OGVA 4EN7B 3WOGA 3DF0A 4CA9A 2RM23 1ASJ3 2BUKA 3RZJA 1H2MA 4W4ZA 3AMHA 2WO3A 5EJ1B 1SG3A 1U12A 1L7RA 1WBLA 3RFRA 2VVFA 3E97A 4DIQA 2FDIA 5BV6A 1SLLA 3IDBB 3IT8A 2ZZJA 1IQDC 1LHVA 3JD71 1NCQC 5FP4A 3ZYJB 4HVQA 2PHWA 2WRAA 3B01A 3MIBA 2ZGNA 1GWMA 1JYNA 1N1SA 1NLQA 4LHNA 4ARXA 4RFT0 2FDJA 3T2PA 3LDKA 4XJUA 4DQAA 5F9TA 4XXPA 2GC3A 4GKYA 2WJSA 3VGIA 3SCGA 2VJXA 3K2OA 3T1MA 2JE9A 3H3UA 4JGYC 4IEWA 1Q8QA 2VMIA 3PU8A 1W0OA 4BHPA 5BNPB 2V72A 2QVSB 3KT1A 4O7XA 3UESA 1YLLA 1ACCA 4AHYA 4R9AA 1PGSA 2MEV1 1OXCA 3T2OA 3V0AA 3LDRA 1XYPA 2YBSA 5FP9A 4RHV2 1QJU2 1AL22 1TMF2 1LECA 3F95A 4QGLA 4YARA 5GZCA 1NG0A 2XJPA 4NO4A 4CDUC 3M7AA 1DQ5A 1Y4WA 4R9BA 4AEKA 4I02A 1NCRC 3IDAA 3OEAA 1XU2A 2R16A 4EQVA 1XSRA 1KJLA 5LRRA 4HPKB 3KCCA 1E5IA 1WLCA 1AXYA 2V5DA 2HEYF 5DAVA 4AQ6A 1G9CA 1PIV1 3CEWA 3T0DA 1OMIA 4TSVA 2LROA 4NRQA 1S55A 1YO8A 3AMMA 5JIUA 2XXZA 3POYA 4J6GA 1OI6A 3FMGA 1KFUL 1WW4A 3SXWA 4AGGA 3RZGA 5A70A 3DN7A 2R072 4JKKA 3IIAA 2FCVA 1NOVA 2YPDA 5DABA 4NHLA 3MPPG 4MXWA 1ZBE3 2BNMA 2XVKA 3LF7A 3OUIA 1BMV1 3MDPA 3MFCA 2FDGA 5DG2A 4ZZ8A 5JR7B 5AC92 3Q8BA 3T0AA 2BQPA 5JPMB 2WA4A 1MS0A 2RS12 3T08A 4OQ8A 5C3QA 3BU0A 1AR91 3NNGA 4EWAA 2PHRA 3O7OA 4Q4V1 1B35A 3GDBA 4Q4Y3 3NJXA 5ACA3 2RM21 5FCCA 1ASJ1 2KM2A 1XC6A 2D43A 2NZ9A 5B4NA 1HDKA 1N1VA 4BQ5A 1D2SA 3N7JA 5C9AA 2DUOA 4L0PA 1D4M2 1GOHA 4Q0PA 3VZKA 4AEDC 3MIEA 2D5HA 3RMXA 3I3EA 3O1OA 4JHTA 4AI1A 4YM3A 2WS92 1LOEA 4C1WA 1ND3B 4XFAA 5C8WA 2CSGA 3OTFA 3FFZA 4Y20B 1U5YA 5BY5A 4WM7B 2ZX3A 3VBFC 1JN2P 1QNYA 4CE8A 3RZMA 3GZUC 3MW3A 2DFBA 2ZMKA 1JBCA 3P5BA 3SCHA 2O8QA 1WGPA 4COUA 5A6ZA 5E89A 5BYNA 2FDKA 4Q26A 1EUUA 1RITA 3MGUA 2XJTA 3BVCA 4M3CE 5LATA 4YVSB 3KHCA 2ZTNA 2WNUA 4CDXB 2OQ7A 2QZ3A 2IXHA 3JBG2 4DXRA 3H8XA 1MS9A 4Z8BA 1UQXA 3W21A 4QPGB 1R092 5KWRA 4N43C 1IG0A 2A3XA 2EAKA 3VHRA 1HQLA 1YFXA 3VDDB 4AAPA 4CXWA 3USUB 1H6YA 1HV0A 2TBVA 1MACA 5FZ9A 5IVFA 1SFPA 2ZZQA 4N9IA 1JU4A 1OF3A 3WHUA 1YJKA 3OGJA 3NKGA 4MLOA 3IMNA 4EWDA 2WNVA 4A6OA 4A44A 3FBMA 4OUMA 2OT7A 2BDRA 3MIHA 2VMDA 4FFGA 1OH3A 2NM1A 1LHNA 2A7AA 1X82A 1POQA 2JWPA 2ZPXA 3U10A 1AYN2 1ZZ9A 3LEIA 5IW0A 3NAPB 4PDWC 3Q8AA 2F6BA 4OFGA 3RYKA 4GKXA 2YYOA 4NROA 4B7KA 4XJ8A 1KXGA 3DUIA 5KBFA 1ZBE1 5IT6A 4HXCA 1PNGA 2QNKA 4EN9B 1UIKA 1VBB2 1VE0A 4XJWA 5KC6A 3CIHA 3V64A 2VZSA 1QOOA 1US3A 1VMHA 4Q0QA 4NR1A 4R4ZA 4XDPA 1WCSA 2UYBA 3M3IA 2YC2A 1MQTB 2P17A 1KS4A 4HKOA 4UWDA 4DOUA 5D8AC 1ZRDA 4Q4Y1 5ACA1 1CN1A 3ZFFA 1S0IA 2XUEA 4D0QA 3MF6A 2W95A 2J1VA 3ATGA 2VZRA 4K3UA 1OOPC 3AK0A 2HWE2 5FXWA 5LK5A 2WO2A 1TNRA 1W39A 1W6PA 4FQZA 1ZVFA 4UAPA 2B4KA 4FPFA 1YQ5A 4K40A 2C9AA 1UYPA 5I0UA 4HETA 3AXEA 4A4AA 2WO7A 2BBAA 3WVJA 4RFRB 2XQXA 5EYYA 3KVBA 5C71A 4IGPA 4BLIA 4QGMA 5GLWA 2Q4SA 5IWFA 4BK4A 4QX5A 1SCSA 5IFPA 1BHGA 1UU6A 4NHXA 4W6YA 4GJYA 1REEA 3OSDA 2XLFA 4HKWA 4FAGA 3SLIA 1WMDA 5LA2A 5FZ0A 4WM8B 3NV4A 3ZYIB 2EXKA 2ZKLA 3ZN4A 4RYDA 3VDAA 1ZRFA 4QX2A 1QJY2 3WW3A 4CPBD 3N35A 4Q4W3 3WF0A 3WQ1A 3AMQA 1XXNA 4HT1T 4MGSA 3KF3A 3D82A 2Q8OA 1IPKA 1SHWB 1ZRRA 1ALYA 2N7GA 3O5SA 3R0RA 3AZXA 4IV3A 1RUD3 2WWUA 4KBZA 4ZPIA 1PGL1 2ZGLA 3WG1A 3LQCA 4QQLA 3S6PA 2FDFA 2R49A 1SZBA 1UKRA 1V6JA 5FK7A 3CO2A 5CFDA 4LLFA 1F5JA 3TYJA 1UO9A 4RQPB 4DUXA 2XWBB 2VUAA 2RJ2A 1GOFA 1FX5A 1HX6A 3J7MA 2J1SA 5JVVA 1D4VB 3D5OA 4Q0VA 5FYTA 2E7AA 2PXJA 5F39A 3O0WA 4UW5A 1KS5A 2B39A 3H9AA 4KL1A 4BLJA 5HXMA 3KLSA 5ANNA 3DKWA 4ONUA 2P3IA 1LEMA 3W59A 2WO1A 3CMGA 3TNQA 3VBUB 4COYA 1F5FA 5J36A 3W5MA 4DMIA 3SH4A 3SHRA 1CAWA 5FY8A 4EE2A 4U36A 3K3NA 4AK3A 4FXGB 3QBQA 1J3RA 2P6HA 1HQNA 4AVBA 5F3IA 3VZNA 3GZEA 4YVWB 1QHDA 1QMJA 4FFFA 5F3EA 5JI9A 1D7PM 4AVCA 1VMFA 4JGYA 3BTZA 2E7QA 2WAOA 4QPIB 2DTWA 3VB9A 1CD3G 1Y9GA 4GXLA 3M4FA 4AAXA 4CUCA 5FZEA 1LHOA 5HBAA 1JZ3A 4LQRA 3JU9A 1XNKA 2VMGA 1IHMA 1HB1A 5A1AA 3HBZA 3IPVA 3ZPYA 5GZFA 3OOXA 1CAUB 1OPMA 5IK5A 4CEYB 4CDUA 1GZCA 4B1MA 2CGPA 1W6MB 3VZMA 5FYHA 4UBGA 3RMYA 4IEVA 1NCRA 4I3GA 5A7WB 1S1AA 1XNDA 3NO8A 3AP6A 5GZEA 5A7PA 5C3SA 4XPVA 3DXUA 4I2OA 1TG7A 4ZS2A 1OVSA 3T2QA 5BNQA 1AR72 3I4IA 3WP6A 1YQ8A 4IE4A 5FO7B 4NPLA 2JG9C 4XDQA 4FT8A 4YSFA 5JLVA 4Q4W1 3RRDA 2Q8DA 1AZDA 2VUDA 4DINB 1MR5A 3POFA 1HRI1 1NAEA 3D6EA 1ZZ7A 4YW3A 2GNTA 4B4QA 3SCFA 4UW4A 3ZFEB 4JHZA 4AVSA 1F8VA 2AREA 4OLLA 1RUD1 3WZ1A 5CIRA 4B4RA 3ENRA 3KB5A 1VALA 2VNVA 3ZVXA 5BPXA 1YEWA 1Q43A 4NUBA 3LFIA 2UWBA 1GKBA 2W39A 2VZOA 2WQ8A 3N3HA 1DYKA 4FOYA 4CEWC 1OLMA 1QIQA 3N4MA 3NRUA 2OQ6A 3ZXDA 1W05A 2EICA 3I2JA 1VBA2 4P9XA 4LJHA 1AL0G 1RUE2 2VCMA 4M3CF 1NX9A 1OPOA 5BNNC 2QQJA 3Q8EA 3M70A 1KJRA 5FZ1A 1U5ZA 4FTBA 2UU8A 3BOPA 3ZN6B 4I0WB 3BIEA 1CIWA 4QX7A 3VBOC 1O6UA 2V4AA 4OUEA 4TLFA 1QJEA 1V6OA 4AEDA 2VAUA 1P8JA 3MLKA 1RHI3 1GP4A 4PJYA 4LT5A 4WVZA 2PHDA 2EAAA 1VAMA 1PGW2 1WW7A 4XFBA 3T09A 4FBFA 3LIHA 1W8UA 5KHHA 5AVPA 4P9GA 2ORXA 2C5DA 3P3NA 1YNAA 4QQ2A 3VBFA 3O14A 3C8XA 3I2OA 2PLV2 2B42B 4DPNA 2P6CA 5JOYA 4KH9A 1Z7S2 2KD7A 2QDRA 1XE8A 1JYCA 1G6NA 5E8AA 4CCOA 4EN8B 2OIIA 3PVEA 4OMCA 5DUWA 1VBE3 3WNOA 4HVRA 1R1A3 5LEJA 4XUNA 2VZUA 3N9QA 3P3PA 3VBRA 5IAXA 4L8QA 4A7YA 4N43A 1I5PA 2VMEA 1Z0HA 3WP4A 1IPSA 4K1YA 1GSLA 3C3VA 2AEZA 4IEXA 5F6LB 3VKMA 4OMDA 5CAZA 2XVGA 4MGKE 3PMSA 4LBMA 4IE5A 4OZXA 5CVRA 2LUWA 2Q8EA 1IQAA 4XW3A 5JR2A 4JX0A 5HCAA 2BOJA 3C7HA 3PJQA 1XU1A 3KV6A 3I3MA 1JU3A 2BFUL 1ODMA 3B5LB 2QQUA 5T52A 3WDVA 2HBUA 4X6RB 3RYPA 3JZVA 1V0AA 2CDPA 2CAVA 2I45A 4K8FA 1WKYA 1Q56A 2XUMA 1PO13 1AR63 4GQ7A 4UOJA 2PQSA 1SLCA 4FPOB 4XETA 3EJKA 3VKOA 2L9LA 5TSWA 3PLQA 4Y24A 5FYZA 5FUIA 3R4DB 2DCKA 4PCRA 2W3JA 3HOBA 4AQ2A 3K46A 1L7LA 3AZWA 1ULOA 3DEMA 5DAPA 3WW2A 2BJSA 2VW2A 5FYIA 4D3WA 1X33A 2P3KA 3AVRA 5DAWA 1HRV3 2D3RA 4Z07A 4KGQA 1T2XA 4COWA 1WZXA 3AMNA 3EB7A 5M0TA 1NLSA 1ZX5A 4FPGA 5D8AA 2YMZA 1H9WA 1OA4A 2BNNA 4XIOA 3ZN5A 3QD6A 2DYCA 2BGCA 1W6OA 4JAAA 4E4HA 1W2NA 1JUIA 2QJVA 5A3OA 2F17A 1WMEA 3ME2A 1UU4A 1HB2A 1RHI1 2OPWA 3LCPA 4OI2A 5I0TA 1H2LA 4PIYA 3KSCA 1GQPA 1FAYA 5JSOA 2NLRA 4HLTA 4QU1A 2BEOA 2OZ6A 3GCWA 2GP5A 1MEC3 1RUF2 2RJLA 3MV11 3H42B 5BUVA 1H2NA 2ET1A 2ZEYA 4N9HA 2XBO2 3OF1A 4OULA 2LW8A 4FPYA 4XMIA 4PLNA 5EP9A 4A42A 3EMRA 1VBE1 2YZ4A 4Y5SA 1IS4A 1R1A1 4QXBA 4WZCA 3SEEA 3SKVA 1LESA 1RUG2 2Y34A 3DCQA 5FUPA 2R7EB 5FZOA 3VBHB 2YPJA 3WP3A 1JHNA 2VQ0A 2SLIA 4ZU4A 5C8CB 1R082 2R062 3ZR5A 1JZ6A 4BB3A 3OD0A 1HW5A 5FPXA 5JAXA 2G4IA 3WEZA 3HT2A 2ZGRA 1ULCA 1V70A 4TN7A 5E6HA 1BYHA 2J22A 4BU2A 2ZMNA 5F2WA 1MS8A 4L2NA 3KV9A 1HKDA 4CP9A 1KDKA 2ARCA 5DAQA 1CIYA 3ACGA 2KA3A 4QPYA 5FUNA 4WVMA 3ZXFA 1PO11 1VLNA 1AR61 5J37A 1J84A 1YUDA 1PMJX 2UY9A 1I6XA 1G9DA 1W04A 3AYDA 1Y43B 2AZ5A 4KU7A 2B7YA 4M0HA 4COVA 1BK1A 1UXZA 2JDUA 3RI9A 2H6CA 4XMAA 5FJHA 4QX1A 1GMMA 2GAUA 1IKQA 2R0HA 2OYZA 1LOCA 4LNVA 5CFCB 1AJOA 1UY2A 1ZZ8A 4BE3A 5I0RA 1F35A 1W0NA 4GH4B 3ZMNA 4AHWA 2NMOA 1O59A 3HPNA 3OY8B 2GNDA 1APNA 1HRV1 2VOXA 3K75B 1W3XA 3LWCA 3A0NA 2YG0A 3POWA 4XVHA 3ZYRA 5JSPA 3H1WA 4C0HA 3R6SA 3ZSLA 3M8LA 2XHNA 1WWYA 5EWSA 3KVAA 4MXWB 3OGSA 1YFUA 2IFRA 2AGSA 1SBFA 4LXLA 4B8EA 1IS3A 2WAAA 2VNOA 3CZUA 5L73A 4MGQA 4OHWA 1W3VA 1YI7A 4OI4A 3VZOA 2X8KA 2D6PA 2JIJA 3ACFA 3WG4A 2EALA 1CZSA 4LO8A 3E5XA 5FY0A 2G1MA 5A3TA 1B35B 1AR83 5FZ8A 1SLBA 1T6GC 3ETPA 1UY3A 4IGOA 1REDA 1A8DA 2H0BA 4O61A 4HK8A 1AL23 4JV4A 5JDBA 1QQP3 1IOAA 2RS52 3ZDSA 1MEC1 5C9AB 4RN5A 3ZSMA 4RGAA 3PL0A 1K5JA 2PHXA 2V09A 4XIKA 3HWJA 1RJ7A 3MZHA 1D2QA 1LHUA 4OVEA 4A7KA 1CR7A 2WC2A 2CYFA 2GNMA 3WQ0A 1EYBA 3LZZA 5ERLA 3W9AA 5EIYB 2WNVC 3VBSC 5GM0A 4E2GA 1GOGA 4R8HA 1CQ9A 1W2UA 2HWC1 3IB3A 3QH7A 4BDVB 3TEZA 3SEPA 5IYYA 1BEV3 2B45X 2GSYA 1X50A 2W94A 2YUEA 3ZKYA 4BZ4A 1O3RA 1Q3EA 5DN2A 1I3HA 4NIHA 3IKWA 3N9MA 4Y4YA 5BXXA 2WNUB 1IS5A 1VBD2 2XONA 5FLJA 5FZKA 3WV6A 4AI0A 3MW2A 3BTXA 2CHHA 4CP1A 1O7FA 3PVNA 4HOOA 2W08A 5A3UA 4Y33A 2ZEWA 4N8MA 5IFTA 3NNFA 5DDJ2 2XJVA 1J3QA 5FREA 4Q8KA 4UFJA 5BNNA 1PZ8A 5GZGA 3LAGA 3ZYFA 2PAKA 3BTYA 3FLPA 4EZHA 1W06A 2P1BA 3VBOA 5KR7A 3HMYA 3CL1A 1H4HA 1EPZA 1XNBA 2YU2A 1K5MB 4PLOA 4Q1PA 3U78A 1FPN2 3O12A 3LEGA 4LR4A 1H1AA 3IWZA 4H2AA 5IVEA 2CV6A 3E6CC 2WQ4A 1RVF3 3GYDA 3H8UA 1MZ5A 5LRSA 5A3WA 1BBT2 1JZ4A 3KT7A 4AFAA 2HYKA 1XNTA 3RVHA 2TUNA 3VKFC 2ZCWA 5CADA 4C91A 1JYXA 2WS93 4QQHA 4AQSA 4XZPA 4PI2A 4IETA 2OA2A 2VR4A 4KG8A 2CY6A 3WXPA 4DEQA 1CPMA 3ZFGB 4AOCA 1DFQA 1OUSA 2O8OA 4LBQD 1KFXL 3M3OA 4BYYA 2BWCA 2XLAA 5SV8A 5CU1A 1ZA4A 3KF5A 2RR13 4LKEA 2C6SA 5FY1A 1GP6A 2A3YA 1FMD1 3PNAA 4LK7A 2MPFA 1SPPA 1ZYBA 2VMCA 3LD8A 1S0JA 2WT0A 4JZRA 1JI6A 3AKTA 4C8DA 3KV5A 3OBAA 5DMYA 2BNOA 1JXNA 5A3NA 1AR81 4FSJA 1NY72 2NYYA 3DECA 2IZWA 3EO6A 2WFF3 3AP5A 3FN9A 2HWD1 3H8RA 3CNAA 3ZFFB 3HN1A 2QFEA 3V0BA 2XMLA 1AL21 4KU8A 4DFSA 3AKQA 1QQP1 1S2KA 2VY0A 3E5QA 3OYWA 2QBXA 3D4KA 1PM7A 3NNMA 1E5RA 4IV3C 2PN5A 4AR2A 2ZX4A 2VQTA 2E26A 3WR0A 2JG8A 1LNSA 3H8OA 2RMU2 4ZONA 4F7ZA 5CFDC 3ORJA 3GXUA 2GMMA 2VGDA 5C7GA 3AKPA 5JWPA 3ASIA 2Q1MA 4CPBA 1HQWA 3I2KA 3CHXA 4IV1A 1BEV1 3D3AA 1VRH3 3ZYGA 4DXTA 2IXKA 4NAOA 1LGCA 2KXLA 4S2HA 5A80A 5KXCA 4RSUA 2W5FA 3OCPA 3Q8CA 5HCBA 4FTEA 2ARXA 4X8PA 5F7UA 2DWRA 4FTSA 2XG3A 1TME2 1VBB3 4LLOA 4UF0A 4DEVA 1GZWA 3AVSA 3GF6A 4FVVA 3APBA 3BGAA 3G7DA 3WF4A 4D8MA 2WABA 5DUUA 2VZQA 1H8TB 3HJRA 4Q0SA 2X29A 1CAXA 4AQTA 3IIIA 1SLIA 5FZIA 2EXHA 2HWE3 1DZTA 1RVF1 4LOSA 1NE4A 4PT6A 5FWEA 2HLEA 5J09A 2RS32 1SLTA 2WS91 1OSGA 2ADDA 2ZXQA 1O4YA 1E5SA 3T1LA 1NCQB 3AZYA 1DGLA 3PHMA 1G9FA 1CAWB 3VHPA 3J8F3 2A73B 2D6NA 4XAEA 4E2QA 4QX8A 3QCWA 1SCRA 2RR11 3T4HB 4BM8A 3AYEA 2IWGB 3I97A 2Y6HA 3C7GA 1W9WA 2XVLA 4JGYB 2E6VA 1RUNA 3HQXA 1W6QA 3J9SA 2WFF1 1O8SA 4JDNA 2A6YA 4FAHA 1AXZA 1S0EA 4QB1A 4QU2A 2A3WA 2ZGOA 4Q4X3 4XCAA 1XOYA 2PHUA 5EPAA 4AEJA 4Z92B 5FP8A 2VOKA 4M01A 4XUOA 4C1XA 1L7QA 1WUVA 3NL1A 3MUZ1 2D7FA 4YW7A 3AFGA 3I2HA 3NV1A 4CTEA 1RUH3 1RUI2 3FFQA 4LHLA 2JB4A 5A6XA 5IVBA 3I59A 3BPSA 3L2YA 3N9LA 4CDUB 1JOJA 4WVVA 2FMYA 3ZXEA 1X9PA 2Z42A 4UYBA 4YZ5A 1UZWA 3PTRB 4XABA 1NCRB 5BNOC 1ZBA3 1TEIA 3EHKA 3K3OA 2OS2A 4B7EA 1UOGA 5FTTC 4HN0A 5DAXA 5KXBA 4CDWC 1VRH1 3VHNA 3JQWA 2P37A 1JS9A 1C8M3 2JDYA 5JCTA 4QXKA 4XE9A 1QH7A 2BWAA 2K9ZA 1JYIA 3GCXA 1UYYA 3UT0A 1ULPA 1V6NA 3GHMA 3U4SA 2RE9A 2WZEA 2YV8A 2XL9A 2VQUA 2JEMA 3DXTA 2Y6LA 4Y1UA 5H9SA 3TOJA 3THDA 1VBB1 2B9VA 2VQAA 3OG2A 3W20A 3JD72 1WW6A 3IN9A 3T4VA 3MIGA 3SITA 1UPSA 1NZIA 3A0KA 2XL7A 1A78A 3OB8A 3TB0A 4AEMA 3GALA 4P00B 4BQ3A 4H7MA 5FY7A 3J26N 1O4ZA 4XUPA 4JKMA 4MV2A 3MYXA 2ZGSA 1ENQA 1JMUB 3LDBA 1U5IA 2VO5A 4BISA 4MADA 5FPZA 3ZDVA 2GALA 4E27A 1PMIA 2HWE1 2YDEA 3AZZA 3G6JB 3KCYA 1UZ0A 1W2TA 5EJZB 4LHKA 4YFZA 5HXVA 3IAPA 2MEV2 2R6QA 4H55A 4XF0A 4FFIA 5DUXA 3VBRC 5FP3A 3H3LA 4I30A 4AEDB 5E88A 2C4XA 2GN7A 4XBNA 4AWDA 2PAEA 1C8NA 1PVC3 1YQ6A 2RJKA 3J8F1 4IUGA 4PIZA 1URXA 2JJ6A 2VULA 1AR73 3RDIA 2HKXA 4KGGA 2J1TA 4WBBA 1ODNA 2ZGQA 3VBFB 4QWNA 4BA6A 1OF4A 3KMHA 3VBSA 1FXZA 3LB9A 5L7OC 3PVOA 2I07B 5FZ6A 4LO5B 1PIV2 5FPLA 3ON7A 4Q4X1 1F2NA 1R64A 5ABJA 2EIEA 3GZAA 1LOFA 3WINE 2ORZA 1COV3 2RDNA 3DPRA 3FJSA 1OD3A 2EIGA 1RUH1 1BVVA 1W9SA 2KR2A 3LEMA 4N43B 2YXSA 2DF7A 3UYJA 5JIAA 2W1WA 5A7QA 1ZBA1 3KGZA 2UYAA 1DDLA 1SMVA 3KCXA 1W90A 1LRHA 2GH2A 5FZMA 3SQOA 3U0ZA 2FQPA 1US2A 2WQZC 2ZEZA 4N53A 4CDQC 1ZM1A 1PZ7A 3BTAA 3TRSB 5K9YA 2WIIB 3B94A 4YGEA 1AR92 3HAGA 1C8M1 3O1VA 5EHDA 1KDMA 1LODA 3KD4A 4GB33 1DZRA 2RM22 1HXS3 4AHXA 1NZCA 3WSOA 5FYBA 3DYOA 3WDYA 3WF3A 4PDWB 1IS6A 3AB0A 1I9RA 1IZ3A 2JKBA 4GZ9A 1PO23 5F37A 5GLZA 2ZGUA 4INDA 1GZTA 1AHSA 3AJYA 1LEDA 3V65A 3VZLA 4X8NA 4A3ZA 1YQ2A 3N9OA 1GYKA 3VLBB 3J7LA 4YWAA 2D6KA 1V00A 5JXIA 3E6DA 4YW4A 1Q8VA 1CPNA 5D8AB 5L36A 2AYHA 4MGZE 1GR3A 5FYUA 1SQ4A 4JQTA 3MLJA 4XYXA 2QTWB 1W6OB 1OOPB 1GLHA 4KBBA 4IE0A 1H1IA 1X9TA 5HV0A 3DKQA 3WNMA 1VJ2A 5FZ3A 3D0JA 3OUJA 4IEOA 4CZSA 1OQDA 3CJIB 2VTFA 1GWLA 2D3SA 3TBDA 1PVC1 1VB4A 2HEWF 2UWCA 4I3PA 4L99A 2IXIA 1FNZA 2D93A 2Z2SB 4RR3A 3VKNA 5I8YA 3VN4A 4K8RB 2SBAA 4YM2A 1YCIA 5LEKA 1AR71 4AYUA 4KNCA 4MHRA 4HZFA 1STMA 3BU7A 4MXVA 2E7TA 3TN93 4BIOA 2ZEXA 1WCQA 1EAH3 4V2WA 3NV2A 5A3MA 5LA9A 1ZRIA 5JOXA 4XAAA 5KHKA 4YRDA 4XOGA 3BYWA 4CU8A 1RUJ3 1G8WA 2CWMA 3A22A 4LUMA 1F4AA 5FK8A 1O5UA 5A33A 1UY1A 1HN0A 1COV1 2D5FA 4WV8A 1HIXA 4UFHA 1EPWA 1ONAA 2P4EA 3JB4C 4R9DA 4ZU7A 3GGLA 5LA1A 1I5ZA 1UU5A 5L9RA 2JICA 3B02A 3NW4A 4UXAA 1ZBE2 5IK8A 1RUC3 4LBOA 1YQCA 4SLIA 4Z2AA 2C0ZA 4MHUA 3UETA 3RJRA 4V1PA 4FFHA 4JRAA 3IBMA 2PFWA 1J1LA 4XF1A 3CLPA 4G9SB 4NMIA 2Q5TA 2A6XA 1RC6A 4WVMB 4GB31 5GJ6A 4DRRA 2G9ZA 4Q4Y2 4E4SA 5ACA2 4BOWA 1HXS1 4KWKA 1BVP1 3LFMA 5C33A 3FHQA 2ZHKA 4PQQA 2ZAAA 1AX0A 4X6QB 2LS6A 1PGW1 4XUTA 1CJDA 1UXXX 1PO21 3GJAA 3BALA 3INAA 3C7EA 2JDZA 3NMBA 4M0NA 2QQMA 4G4FA 4IGQA 2VCAA 1EV13 4HPKA 1YI9A 4NN0A 3UJQA 1RUF3 2PAMA 3RPQA 4LBLA 3H3ZA 5C4WC 5AVAA 1YWKA 2WN3A 1FOD3 1LU1A 1XRUA 4FP3A 2XBO3 3WQ7A 4Y22B 2R043 5EQUA 1S0GA 2CDOA 1UZYA 1ZNPA 2DCYA 1NQJA 3LGRA 3MPBA 1UYXA 3P6BA 4RA0A 2MHFA 4ASLA 2WSUA 2B8MA 3FLTA 1FV2A 3H0OA 2R063 4XFGA 1H4GA 5LBBA 2HYXA 3OBRA 4K6BA 3HVDA 1F15A 5JXGA 2VZ1A 4QAWA 2FCUA 3PIJA 5CB7A 1UYZA 4EN0A 4QGNA 5LY2A 2WN2A 2W1UA 3WDTA 5CG9A 3KM5A 2C26A 1PGL2 4LK6A 4QQPA 2P3JA 5BNOA 2AH2A 3RZHA 2YGMA 1QJZA 4TTGA 2XJQA 1UAIA 1ZZCA 2ZMLA 5AFEA 2C24A 3TN91 5F1RA 4YW2A 1XSQA 1EAH1 4M3CA 2JDHA 4CDWA 4A45A 4F83A 1C1LA 2JG9B 3QACA 4NIGA 2RV9A 1RUJ1 2X10A 2QQNA 3ABZA 4ISRA 4XDOA 5HCFA 4MGIE 4L97A 1W8FA 5KXDA 1V9U3 1F4HA 1CAVB 1DLCA 2H0VA 4AE2A 1X8MA 4C90A 3AP7A 1FV3A 3FHAA 1XNAA 2VW1A 4UT5A 3HR9A 1RUC1 4WM7A 2VC9A 2GH8A 2VXJA 5F5QA 3SISA 2OUHA 1DF0A 2DCTA 5FOBB 4CEWB 3NJYA 1LTEA 1IKPA 1UWWA 2DUQA 3AJZA 4PQ9A 2DV9A 1MS1A 2AENA 4RGGA 3LSEA 2VUCA 4QM9A 2K46A 1WBFA 4W8JA 3VL8A 2E63A 3VL9A 3RZKA 1F31A 1QGLA 3WW1A 5BNNB 2VUJA 1OQEA 5C5TA 1O3TA 1LR5A 4XBLA 4XUQA 5FR3A 1TNFA 3ACHA 2AACA 2K2SA 4QKNA 3USUA 3VBOB 2BZDA 2JDMA 4FI9A 3UNPA 4PBOA 5A1FA 3I3DA 2VMHA 4QDQA 2VPVA 4DUWA 2FZ2A 1RMU3 1BZWA 1S4CA 2V73A 1Y3TA 1EV11 2RS53 2WBKA 4DXSA 1RUF1 5T55A 5FZBA 2VW0A 1FOD1 2DU0A 1LOBA 1PK6C 4OHXA 4M4RA 5HPOA 2V5YA 2XBO1 5A7OA 2R041 2DUPA 2BGOA 1KGYA 4GWNA 2PTMA 2Y6GA 4XFFA 5L7OA 5KXEA 4ZZ5A 4RGKA 4U2AA 1YFWA 1DYPA 3AP9A 3NKTA 4IEQA 4LBQA 5FMOS 3T3YA 1RUOA 4YNIA 2JG8C 5CZKA 5K0UC 1ND2C 3NAPA 4COZA 2P5BA 3RI8A 4EZ4A 2R061 2QCSB 4JQRA 1W6NB 1RB8G 4Q4W2 2VBBA 2ZHMA 1WW5A 2VL4A 2E9QA 4BIFA 2HWB3 1HRI2 4OUSA 4C0BA 3N7LA 1SPPB 3AFKA 1JZ5A 1I1EA 4AW7A 1RUD2 4IV1C 3OPWA 4MUVA 4BQYA 3LA3A 2JDPA 2YFZA 3CDZB 5T5PA 5FO8B 1LOGA 1A34A 1JZ2A 4FPLA 4BQ2A 1RYYA 5ANQA 1PZ9A 1W8TA 4CDQA 3BODA 1ZREA 3ZO0B 2A6VA 1CZTA 1GNHA 5G04L 5FMBA 1SBDA 3FL7A 1QF3A 2VZPA 1PM4A 1CWPA 4LKDA 1DGRA 3THPA 3T30A 4EYUA 5FMCA 1V9U1 5E1RA 2BU9A 1C1FA 1FYUA 1XB9A 4GULA 5F5CA 4EJRA 1QXRA 3M3QA 4PF1A 2P2KA 2GU9A 2VMFA 4E9KA 4OYUA 4KMQA 1LHWA 4XC9A 4YYOA 4DS0A 3RWKX 4DB5A 3N36A 2ZKNA 3B9CA 3B9IA 1LGNA 1DBNA 2PHFA 2VXRA 3WNKA 2D6OX 5A3PA 2QQOA 1AYM3 3HNBM 1VRBA 1KQRA 4BMEA 4OHVA 3KWVA 5CKMA 1RINA 3POSA 2ZAHA 3ILRA 4UF0B 4J25A 2EXJA 1UZVA 3W58A 1REFA 5F6KA 2WYFA 3O1RA 3I8TA 3VDBA 4QM8A 1VBC3 2MNGA 2XWJB 2EVXA 2WUHA 2CAUA 2WZR3 2QQVA 2FZ1A 3DGTA 4DO0A 3NJZA 4KI5M 2D3PA 3N7MA 1RMU1 2RHPA 2VOWA 1DQ2A 3H1MA 5H9QA 2WZ8A 4HSJA 1QOTA 2JDKA 1DQ4A 1Z78A 2RS51 1GZ9A 3OGRA 2DURA 1V6IA 3CZJA 3LSDA 1AUYA 4LBJA 1JUHA 1LGBA 5DPNA 1DGWA 3V0AB 4YG6A 2ERFA 4QHZA 4JCKA 3OPZA 1QJX2 2R0FA 3IMMA 4IEZA 4YG3A 3JQXA 1LOAA 5LBCA 1SEFA 1GQGA 2IVJA 2Z5WA 3FWEA 3KQ4B 4QB2A 1UPIA 3E1F1 4K21A 4CUBA 3HNMA 4JGZC 5A6YA 3WNNA 4TWTA 5FLHA 2HWB1 4HKLA 3VBUA 1Y7BA 2YFUA 2YU1A 2DVAA 5IVJA 1WCKA 2C1FA 2YGLA 3ZPOA 4YGBA 3GM8A 4B1LA 3NQHA 1QOSA 1YHFA 4HG6B 3I3BA 2ZA9A 4YVWA 3UKTA 5APAA 1N1TA 3NNJA 4J1XA 4K9SA 5FPVA 3ZSKA 2R30A 1TME3 3U07A 4CCKA 2VVEA 2Y6JA 4NPMA 4Q27A 1GFF2 3AKRA 3FE5A 4H3WA 4QMAA 2VCCA 5EJ3A 2ZX1A 4ASMB 5GALA 1RXFA 3I59B 1HLCA 2LALA 3A7QA 5DG1A 4Z2WA 3L2HA 1QDOA 3ZIWA 4ATEA 1JYVA 4M00A 2XR4A 2W92A 1J83A 4NE9A 4CEYA 2JE7A 2TNFA 3VHOA 3LE0A 2BGPA 1POV0 3CKHA 1JOBA 2DFCA 3RZZA 4YZ1A 1RHI2 1SACA 3C7OA 1NA1C 4CCMA 5HI0A 1V6KA 2O1QA 4RHV3 2K0GA 2QE3A 1QJU3 1TMF3 2VECA 3KZ4C 5C4WA 3ZYBA 2BTVC 3VD9A 3WNLA 5FZHA 1AYM1 2AEYA 1J1TA 4H14A 5FYMA 3AKSA 3LOBA 2ES3A 3BOWA 3RWNA 2Q1FA 2VOVA 1GWKA 3I7DA 1VBC1 5GZDA 1VBE2 2WZR1 1R1A2 4LE4A 3ZKUA 1KITA 3HNYM 3NSTA 2D98A 2W1SA 1DGWX 3AL5A 3R4SA 5LBFA 4CVUA 1XNCA 2R073 2XB6C 4O9EA 5LY1A 1OQ1A 1O3SA 2OX0A 2ATFA 2HWF2 4HBNA 1DQ6A 1RUI3 5ABJC 1LOFC 3DPRC 3USSA 2X5IC 3WD5A 5HCHA 4RS5C 3GJBA 4I0BA 2OPKA 3FC0A 4IQPA 4BWOA 1K12A 2XHKA 3D8CA 1N1YA 2UY8A 4LA3A 4XF9A 4CU7A 5AC93 5JZGC 3PUAA 1U5XA 3ZN6A 4XBQA 2RS13 1DLLA 1PO12 1AR62 4MYEA 1O4TA 3OBZA 1RGSA 2XKPA 2ARBA 4CCJA 2X53S 4ES9A 4N53C 3A21A 2WNVB 4P08A 3VBSB 5F3CA 2WKKA 1W03A 2UURA 1Y9MA 2QQKA 2GZWA 5FFOC 1OHFA 3TEXA 3V56A 3VV1A 4CRQA 5C3PA 1SFYA 3D0SA 4UI9L 4KQ7A 1D4M3 2PMWB 1N3QA 4JDMA 3VD5A 5FBZA 3BCWA 1TME1 2JECA 1HJGA 1WCUA 3I2FA 1QNWA 1HRV2 4GWJA 5AFBA 1H8VA 3GNEA 4LKSA 3PURA 1NXMA 4P9WA 5F5AA 1JZ8A 2FDHA 1GNZA 1L3JA 3U37A 5IVCA 4TYSA 4XJAA 1CVNA 3ILFA 1FATA 2YBPA 2TEPA 2Q8CA 4YW6A 2A1XA 1UY4A 1W9YA 2FCTA 4GMP0 4AFDA 3JBG3 1U0AA 2W0XA 4RHV1 1R093 1QJU1 1TMF1 2CL2A 5FZDA 2VBPA 1PK6A 2W46A 3K51A 3QOPA 1VMJA 2VH9A 3MHZA 4UFLA 1W6PB 1MEC2 4D94A 2G9GA 4QXCA 4CCEA 1EP0A 4RR3C 3U4XA 5K0UA 1ND2A 2JKXA 1NKGA 3C7FA 5D1IA 1QH6A 1H9PA 2ZBJA 2ZOEB 1JODA 4LMFA 1KRIA 2BP6A 1RL3A 1PIV3 5IHRA 4B4PA 1SDWA 4Q29A 2W91A 3URFA 2R32A 4QDSA 1BKZA 2W2IA 1AYN3 2HWC2 2EA7A 3L9JT 3WDWA 4LULA 4B3NA 2R071 5FIXA 1OA3A 2EIBA 2WNOA 5KHJA 4LITA 1RUI1 1IPJA 1MS3A 4Y5Z0 4AVVA 1SLAA 4NIDA 1XYNA 3NV3A 2J1AA 4E8CA 2ARAA 4IV3B 4AHZA 5AC91 4GAZA 4S2GA 2IXLA 4YW1A 5FRAA 5DUVA 3SH5A 2RS11 1WLDA 1A8MA 3MIFA 4DNYA 5CFDB 1MS5A 4FO9A 4CUAA 1PNFA 3F2ZA 4CU6A 1QKQA 4IESA 4LORA 4XTMA 2JDAA 3MV01 4XACA 5BNPC 2LTNA 4K1ZA 4AI9A 1VP6A 3POEA 1DYOA 2WLPA 2Y26A 2QUOA 3THTA 5FZAA 1D4M1 3ZX7A 4QKFA 3ALQA 1ZRCA 5A33B 1W28A 1K45A 1M06G 3HD8B 5LZ6A 5F32A 4K20A 3HEIA 4UW3A 5IAVA 5A1LA 4NAMA 3WUDA 2HJIA 1GNYA 2VCBA 1T6BX 3TEYA 1TVGA 5FYSA 3VBHA 1PMHX 2DCJA 2Y0IA 2ZX0A 3I54A 3TWIA 3JCIA 5HV4A 5T54A 2WINB 1C3HA 1R1ZA 1VPHA 2WZPP 3MBWA 4GJZA 1ENSA 5C8CA 5K7PA 1HB4A 5DXDA 2FD8A 1DU3D 4Y3OA 1VAKA 3O0XA 1FMD2 1QJY3 4FQ4A 4GA9A 4CXXA 4P14A 2YC4A 4IEUA 4CUGA 3JBG1 1AR82 1DHKB 3O0VA 3WHTA 1JOPA 3AYCA 5A32A 1R091 1XBFA 4I01A 2HWD2 4K7JA 4NHYA 3PIGA 4FPEA 4D69A 5JMCA 4HONA 4F8AA 2GDFA 1QQP2 3IPVB 2FBEA 3S0MA 5B2GB 1UIJA 2ZGKA 5SV5A 1UN1A 4QQOA 5EV7A 5F8PA 4JKLA 4LBNA 3ZXGA 4M4PA 1W8ZA 2BVVA 4JGZA 4OZOA 2ZGMA 3ES4A 1E5HA 3S5AA 1UNBA 1LJ7A 3B69A 4AFCA 5CFCA 1NLRA 4XHBA 3NVCA 2DBIA 4GH4A 3RJ2X 4BQWA 3PVBB 4ZHNA 1AYN1 1PX3A 3OY8A 2X09A 1BEV2 3FBYA 4W6WA 3KS7A 4P9JA 3H1YA 2Q1ZB 2VU9A 4HK9A 2C9KA 2DCZA 4LEJA 3LA2A 1NUKA 4IXLA 5JI7A 1X36A 2VZ3A 4MZUA 2IFWA 1ND3C 3Q8FA 1RXGA 2RVAA 2XPJA 4LBKA 3MI8A 3PDQA 4WM7C 2PYTA 4LKFA 1S0FA 1SDDB 4XXAA 5G05L 4DXZA 5BNOB 5C3OA 1N3PA 3M2MA 2WDBA 4D7SA 3UK9A 2ILMA 2JB8A 3K4DA 4M3CB 4CDWB 3EBRA 3S5QA 2ETEA 4YVSC 5FLIA 4CDXC 1NA1A 3S30A 1LULA
chains in the Genus database with same CATH topology
1WD4A 4XFCA 1NYWA 4FXKB 1RVF2 2D40A 4QPGC 2Y0OA 4XF3A 3VDDC 2DU1A 1C5IA 2WL1A 3MF9A 4YM1A 4Q1RA 3OD4A 2QZ2A 4I09A 4XTPA 2RR12 1WLWA 1QJY1 2R1DA 4PLMA 5KHGA 1YIFA 4NWWA 1AX2A 1IGOA 1VAVA 3WP5A 5EXOA 1S2BA 4EROA 2WFF2 3NAPC 4SBVA 3OBTA 3R05A 1S0DA 1UD1A 2YROA 4DRVA 5IK4A 1BJQA 2X5IA 3QLQA 3VBRB 1O91A 4RS5A 1NE6A 5JZGA 2VVDA 4Q8LA 4YZ4A 2ZHNA 2Q30A 3HT1A 1C57A 1ULFA 3AX4A 1BMV2 3JUUA 5FMOL 2ZACA 1MQTC 1VBA3 2VNRA 1TQ5A 2PHTA 2P34A 4XQ4A 1RUE3 1K5MA 1OLRA 1PVXA 1TE1B 5I8TA 4YG0A 1M4WA 5L7OB 3FLRA 4LBQB 4Q4V2 1VRH2 5A3LA 4NPRA 4JRLA 2ZGPA 1ASJ2 1C4RA 2IXCA 2ZABA 4W65A 4A2UA 4Q0UA 1MZFA 3TAYA 2DVFA 3H7YA 2A6ZA 3ZFGA 4Y1ZA 4HMZA 2WFPA 1VIWB 3UV9A 1CX4A 4XJ9A 3UL2A 1ENXA 5J7MA 4XEZA 3S7IA 2PLV3 3Q9OA 2ZX2A 1Z7S3 2PA7A 4NVPA 4WM8C 3T2TA 2B9UA 3TNPB 4CDQB 1XYOA 2CGOA 1PHMA 5FQ0A 2EXIA 4L92A 3WY6A 1DIWA 4ATFA 3RNSA 5FO9B 3CJIC 4HSLA 3RQ0A 2WWSA 3LOIA 5EYXA 3VZJA 4AXOA 2XGXA 3KGLA 5DZGA 2GC1A 3ROUA 2O0OA 3J8F2 4XF4A 4RQPC 1ULDA 3AP4A 1BQPA 1WA4A 1V6LA 4FPKA 4YZ3A 3UJOA 3ELNA 1UX6A 1HRI3 1FT9A 4B29A 4A3XA 1NQDA 4Q4X2 2CGNA 3VBUC 3ZXJA 2NN8A 3MFAA 1UMZA 1GV9A 4R9CA 5JPNB 2Z69A 2GC0A 2DVBA 2FMDA 1RUH2 2ZGTA 4F3JA 4HN1A 2QQPA 4YVWC 2ENRA 3KQRA 1ZBA2 1QU0A 1VBA1 4PIXA 2JXAA 1RUE1 1H8TA 1LU2A 4QPIC 4TZDA 1AJKA 5BNPA 4JTNA 4Z1VA 3MEPA 5DZFA 4CYDA 4AF9A 1S0CA 1X8EA 1C8M2 4R52A 4FPCA 1G9BA 4YLZA 2DVDA 2I74A 1AX1A 4ZXKA 4CEYC 1NCQA 3RG0A 1BCXA 3BIWE 1MVQA 4Y26A 1UW8A 1N47A 3J4UH 2BPA2 1JTZX 1POV3 1UZZA 2XJUA 2PLV1 3H7JA 3MICA 1G9AA 4XQWA 1KD7A 1Z7S1 5CG8A 1QY4A 3MW4A 4AVTA 5CA6A 2BVBA 1AXKA 5KC5A 3IM0A 1N3OA 3JB8A 2B5HA 5T50A 1UKGA 2NPIA 5GLVA 2JENA 1RUG3 1FNYA 2CWSA 2PHLA 3ZFEC 1R083 1AF9A 4MGYE 1C28A 3MLLA 4P9YA 1RTVA 4DY3A 2ET7A 1PVC2 3AYAA 4URTA 2WLQA 1QJX3 1VB2A 4W6XA 4N7UA 4IEYA 1EY2A 5C4WB 4AG4A 3VUOA 2PQQA 5JOWA 5FAXA 1OLQA 2B46X 3M1HA 1JH5A 5T5JA 2CNAA 1YYNA 3U11A 2JX9A 1MZ6A 4AVAA 1MS4A 2VNGA 3RS6A 3S7EA 2H6BA 3FUOA 4YZ2A 3IDEA 4NOTA 2OUJA 2XJSA 1COV2 3ECQA 2D6LX 1XQNA 1ND3A 3QH6A 1X7NA 2XH6A 1CJPA 1GICA 4UW6A 4Y20A 5DZEA 3ZXKA 4WVWA 5FDBA 1WLTA 4I0AA 5GLUA 1UF2C 3WNXA 1G7YA 4YGDA 1S0BA 3ACLA 4JVAA 3WCSA 1J58A 4Y1YA 2Q0AA 2R1BA 4YVSA 3E5UA 3WX5A 4MVTA 4CDXA 1O3QA 1D0HA 3WDXA 4FOWA 4GALA 4GB32 1DZQA 4QPGA 1Q8OA 2PELA 1HXS2 1SBEA 3VDDA 2BW8A 4ES8A 4P5HA 1YRZA 2IC1A 3EXUA 2JD4A 2OW4A 2YY1A 3C2UA 3GBFA 5J3UA 1Q8SA 2ZJCA 1Q5OA 1OKQA 1WCDJ 1PO22 4PF5A 1POV1 3IDCB 4GMP3 4AFBA 5JOZA 1YXWA 4Y1VA 1J3PA 4S2DA 2A75A 4LTAA 3AZVA 1RUG1 4YW5A 3WW4A 3K48A 1R081 1GBGA 3WDUA 1ULGA 5KHIA 4LUKA 2A5ZA 4E4DX 3GZTB 2HWF3 4GIQA 3RSJA 1LENA 1VBD3 1QJX1 1SFNA 3V0BB 2OZJA 3WCRA 1MQTA 1PK6B 4KWLA 3OYWB 4MSVA 3TN92 5DDJ3 1EAH2 4MX3A 4BQ1A 4LO4B 1O5LA 4FPJA 3KT4A 2JG8B 5K0UB 5CBLA 1ND2B 3UKNA 5K8SA 1RUJ2 4PDWA 2AUYA 3WUCA 2ZHLA 1FPN3 1Q8PA 2VG9A 3UKVA 5J98B 5I8SA 4XHXA 2GMPA 1BBT3 4IV1B 2I2SA 4CP2A 5JSRA 1RUC2 2ZS6B 4DY5A 1DG6A 4Y1XA 5IK7A 2BBVA 4D7TA 1DQ0A 4WM8A 3OGGA 3ZXLA 2NQYA 2Z79A 4E2SA 1H0BA 1B09A 3VBHC 2A6WA 1E57A 1OOPA 4XILA 3GBWA 1GZWB 5GKAC 2D6MA 4IL7A 5C8CC 4LE3A 1DGRN 3CJIA 3LKJA 3E6BA 1QDCA 3A4UA 4Q2FA 3ZIXA 2W52A 1WD3A 4NHKA 4LO6B 1CAXB 2XKOA 4OI1A 4BCUA 4XFIA 5I0SA 1JW6A 3BB6A 1WMFA 4GMP1 1MZEA 1EV12 3MIDA 4RQPA 1GANA 5CNAA 3ZSJA 4KWJA 3X29B 1FOD2 3SH3A 4ORFA 2FHRA 2DVGA 2R042 2YC0A 1YIPA 2RMU3 4CP0A 5H9PA 3N7KA 3PTYA 1XE7A 2EF6A 4A7ZA 4ISQA 4JC1A 4IEPA 3VKLA 3AM2A 2G9FA 5EZWA 5CFCC 3FX3A 2HWC3 2E51A 1LB2A 2QKDA 3ES1A 4GH4C 4NWVA 3GBGA 1W6QB 5FOJB 2HWF1 1AVBA 2GMEA 4JDOA 1VBD1 1V6MA 2GN3A 4QT6A 1GQHA 4Z82A 5A32B 4XQDA 4RL7A 5H9RA 5J96B 3CU7A 4QPIA 4QHBA 5I91A 5DDJ1 5IUQA 1OFNA 4AFMA 1BXHA 1ENRA 1RIRA 4JGZB 4AI3A 3FZ3A 2Y38A 4ZU5A 1CAUA 1FPN1 3AXDA 2WT1A 3SMHA 3B3QE 1V9U2 4MH0E 1B35C 1W6MA 3PJYA 4L11A 4AI2A 4D7YA 4HANA 3PMEA 1BBT1 2WA3A 2RS33 4N7IA 4XJZA 3ZXAC 5C9AC 4Y22A 2F4PA 1H1MA 2CTVA 5T5LA 4BPZA 3WLUA 4QD2A 4ZKTB 5I93A 3ZFEA 1ULEA 1FMD3 1D0GA 4PBPA 3ST7A 3WG3A 5T3NA 1QXJA 4FP2A 4JTOA 1A3KA 1NY71 4EV0A 4AGVA 5C6CA 3HIFA 2E53A 2IXJA 1UCXA 2HWD3 2WNEA 1RMU2 3ETQA 2WNUC 1NA1B 4J1WA 4IERA 4HVOA 2QDNA 1H2KA 2UWAA 3GHNA 3DV8A 3B7MA 4FOQA 4BMBA 4XFHA 1OFSA 3OJBA 3ILNA 1F9KA 2JG9A 2RMU1 2NP0A 4G3YC 1G86A 1VR3A 4FPHA 1ZZBA 1CAVA 2OVUA 4L9BA 3DL3A 3BPZA 2A70A 1A6CA 1H30A 1K5MC 2GNBA 2HWB2 4N90A 4LO7A 3WT3A 1J59A 3H50A 4CEWA 2XLGA 2GC2A 4H7LA 4R4XA 5ABJB 1RJ8A 3FHIB 4HFSA 3NWKA 3DPRB 4P9LA 1QXPA 2X5IB 5T5OA 4RS5B 2XJRA 3JD73 4P9IA 5JZGB 1LCLA 3ZFGC 4AGRA 2LM3A 5LK7B 2D97A 4OHZA 1HV1A 4E4ZA 5EFUA 3ZMOA 3AMPA 1QWRA 4EN6B 1OD5A 4N53B 1DQ1A 3M3CA 2AR6A 1YFYA 4FCAA 3ZFFC 2WT2A 1ZZ6A 2MEV3 2RS31 1UL9A 2D44A 4AI8A 1LKNA 3SNMA 4YGCA 4KG0A 2WSVA 3WG2A 4OHYA 4GWMA 5L19A 4RD7A 2NMNA 3B93A 4S2FA 1AYM2 4NHMA 3FUQA 4YM0A 4YFWA 3CF6E 1W6NA 2BFUS 1NXD1 2DTYA 2YHJA 4DZGA 1VBC2 1W0PA 4WZFA 2WZR2 4UBHA 1Y9QA 3R4UA 1CONA 3ZSEA 4BH9A 5FQ0B 3LA7A 3CJXA 4FOVA 4HL0A 2BYVE 3ZYPA 1OA2A 1FI2A 1CGPA 1YJLA 4OI0A 2A71A 4O9GA 3EQEA 1C5HA 4RR3B 5GLTA 5J48A 5E16A 3B00A 4META 2HEVF 1AR93 1H8TC 1CESA 3M3EA 4ITCA 4LA2A 4Q4V3 3I2DA 2W68A 3RYRA 1MVEA 4EN7B 3WOGA 3DF0A 2RM23 1ASJ3 2BUKA 1H2MA 3AMHA 1U12A 1WBLA 2VVFA 3E97A 5BV6A 1SLLA 3IDBB 3IT8A 2ZZJA 1LHVA 3JD71 1NCQC 3ZYJB 4HVQA 2PHWA 3B01A 3MIBA 2ZGNA 1N1SA 4LHNA 4RFT0 4XJUA 4DQAA 5F9TA 4XXPA 2GC3A 4GKYA 2WJSA 3VGIA 3SCGA 3T1MA 2JE9A 3H3UA 4JGYC 4IEWA 1Q8QA 2VMIA 4BHPA 1W0OA 5BNPB 2QVSB 3KT1A 1YLLA 4AHYA 4R9AA 1PGSA 2MEV1 3V0AA 1XYPA 4RHV2 1QJU2 1AL22 1TMF2 1LECA 4QGLA 4YARA 5GZCA 1NG0A 2XJPA 4NO4A 4CDUC 3M7AA 1DQ5A 4R9BA 4AEKA 4I02A 1NCRC 1XU2A 2R16A 1KJLA 5LRRA 4HPKB 3KCCA 1WLCA 1AXYA 2HEYF 4AQ6A 1G9CA 1PIV1 3CEWA 1OMIA 4TSVA 1S55A 1YO8A 3AMMA 5JIUA 3POYA 4J6GA 1OI6A 3FMGA 1KFUL 1WW4A 3SXWA 4AGGA 3DN7A 2R072 3IIAA 1NOVA 4NHLA 3MPPG 4MXWA 1ZBE3 2BNMA 2XVKA 1BMV1 3MDPA 3MFCA 5DG2A 5JR7B 5AC92 5JPMB 2BQPA 2WA4A 1MS0A 2RS12 1AR91 4EWAA 2PHRA 3O7OA 4Q4V1 1B35A 4Q4Y3 5ACA3 2RM21 5FCCA 1ASJ1 2KM2A 2D43A 2NZ9A 1HDKA 1N1VA 1D2SA 3N7JA 5C9AA 2DUOA 1D4M2 4Q0PA 3VZKA 4AEDC 3MIEA 2D5HA 3RMXA 4AI1A 4YM3A 2WS92 1LOEA 4C1WA 1ND3B 4XFAA 5C8WA 3OTFA 3FFZA 4Y20B 1U5YA 5BY5A 4WM7B 2ZX3A 3VBFC 1JN2P 1QNYA 3GZUC 3MW3A 2DFBA 2ZMKA 1JBCA 3SCHA 2O8QA 1WGPA 4COUA 5E89A 5BYNA 4Q26A 1RITA 3MGUA 2XJTA 4M3CE 4YVSB 2ZTNA 2WNUA 4CDXB 2QZ3A 2IXHA 3JBG2 1MS9A 4Z8BA 4QPGB 1R092 5KWRA 4N43C 2A3XA 2EAKA 3VHRA 1HQLA 1YFXA 3VDDB 3USUB 1HV0A 2TBVA 1MACA 2ZZQA 4N9IA 3WHUA 1YJKA 3OGJA 3NKGA 4MLOA 3IMNA 4EWDA 2WNVA 3FBMA 4OUMA 3MIHA 2NM1A 1LHNA 2A7AA 1X82A 2ZPXA 3U10A 1AYN2 1ZZ9A 3NAPB 4PDWC 2F6BA 4OFGA 3RYKA 4GKXA 2YYOA 4B7KA 5KBFA 4XJ8A 1KXGA 3DUIA 1ZBE1 5IT6A 1PNGA 2QNKA 4EN9B 1UIKA 1VBB2 4XJWA 5KC6A 3V64A 1QOOA 4Q0QA 4NR1A 4R4ZA 1WCSA 2UYBA 3M3IA 1MQTB 2P17A 1KS4A 4HKOA 4DOUA 5D8AC 1ZRDA 4Q4Y1 5ACA1 1CN1A 3ZFFA 1S0IA 3MF6A 3ATGA 4K3UA 1OOPC 3AK0A 2HWE2 5LK5A 1TNRA 1W39A 1W6PA 4FQZA 1ZVFA 4FPFA 4K40A 2C9AA 5I0UA 4HETA 3AXEA 3WVJA 5EYYA 4BLIA 4QGMA 5GLWA 2Q4SA 4QX5A 1SCSA 4W6YA 1UU6A 1REEA 2XLFA 4HKWA 4FAGA 3SLIA 1WMDA 4WM8B 3NV4A 3ZYIB 2EXKA 2ZKLA 3ZN4A 1ZRFA 1QJY2 3WW3A 3N35A 4Q4W3 3WQ1A 3AMQA 1XXNA 4HT1T 3D82A 2Q8OA 1IPKA 1ZRRA 2N7GA 1ALYA 3O5SA 3R0RA 4M0NA 3AZXA 4IV3A 1RUD3 1PGL1 2ZGLA 3WG1A 4QQLA 3S6PA 2R49A 1UKRA 1V6JA 5CFDA 3CO2A 3TYJA 4LLFA 1F5JA 4RQPB 2XWBB 2VUAA 1FX5A 1HX6A 5JVVA 1D4VB 3D5OA 4Q0VA 2E7AA 3O0WA 4UW5A 1KS5A 2B39A 3H9AA 4KL1A 4BLJA 3KLSA 3DKWA 4ONUA 2P3IA 1LEMA 3W59A 3TNQA 3VBUB 4COYA 1F5FA 5J36A 4DMIA 3SH4A 3SHRA 1CAWA 4U36A 4AK3A 4FXGB 3QBQA 1J3RA 4AVBA 1HQNA 3VZNA 4YVWB 1QHDA 1QMJA 5JI9A 4AVCA 4JGYA 2E7QA 4QPIB 2DTWA 1CD3G 4GXLA 3M4FA 1LHOA 5HBAA 3JU9A 1XNKA 2VMGA 1IHMA 3HBZA 3IPVA 3ZPYA 5GZFA 1CAUB 1OPMA 5IK5A 4CEYB 4CDUA 1GZCA 2CGPA 1W6MB 3VZMA 4UBGA 3RMYA 4IEVA 1NCRA 4I3GA 1S1AA 1XNDA 3NO8A 3AP6A 5GZEA 4XPVA 4I2OA 5BNQA 1AR72 3I4IA 3WP6A 5FO7B 2JG9C 4XDQA 4FT8A 4YSFA 5JLVA 4Q4W1 3RRDA 1AZDA 4DINB 1MR5A 1HRI1 3D6EA 1ZZ7A 4YW3A 2GNTA 4B4QA 3SCFA 4UW4A 3ZFEB 1F8VA 4AVSA 2AREA 4OLLA 1RUD1 3WZ1A 5CIRA 4B4RA 3ENRA 3KB5A 1VALA 3ZVXA 5BPXA 1Q43A 2UWBA 1GKBA 2W39A 4CEWC 3N3HA 1DYKA 4FOYA 3N4MA 3ZXDA 1VBA2 4P9XA 1AL0G 1RUE2 4M3CF 1OPOA 5BNNC 3M70A 1KJRA 1U5ZA 4FTBA 2UU8A 3BOPA 3ZN6B 4I0WB 1CIWA 3VBOC 4TLFA 1V6OA 4AEDA 3MLKA 1RHI3 4PJYA 4LT5A 4WVZA 2PHDA 2EAAA 1VAMA 1PGW2 1WW7A 4XFBA 4FBFA 5KHHA 5AVPA 4P9GA 3VBFA 2C5DA 3P3NA 1YNAA 4QQ2A 3O14A 2PLV2 2B42B 4DPNA 5JOYA 4KH9A 1Z7S2 2QDRA 1XE8A 1JYCA 1G6NA 5E8AA 4EN8B 2OIIA 3PVEA 5DUWA 1VBE3 4HVRA 1R1A3 5LEJA 3P3PA 3VBRA 4L8QA 4A7YA 4N43A 1Z0HA 3WP4A 4K1YA 1GSLA 3C3VA 4IEXA 5F6LB 3VKMA 5CAZA 2XVGA 4MGKE 3PMSA 4LBMA 4OZXA 5CVRA 2LUWA 1IQAA 4XW3A 5HCAA 3PJQA 1XU1A 3B5LB 2BFUL 5T52A 3WDVA 4X6RB 3RYPA 3JZVA 4K8FA 2CAVA 2I45A 1Q56A 2XUMA 1PO13 1AR63 4GQ7A 1SLCA 4FPOB 4XETA 3EJKA 3VKOA 5TSWA 3PLQA 4Y24A 3R4DB 2DCKA 4PCRA 4AQ2A 3AZWA 3WW2A 2VW2A 4D3WA 1X33A 2P3KA 1HRV3 2D3RA 4Z07A 4KGQA 4COWA 3AMNA 1NLSA 1ZX5A 4FPGA 5D8AA 2YMZA 1H9WA 1OA4A 2BNNA 4XIOA 3ZN5A 3QD6A 2DYCA 2BGCA 1W6OA 4JAAA 1JUIA 2QJVA 1WMEA 3ME2A 1UU4A 1RHI1 3LCPA 4OI2A 5I0TA 1H2LA 4PIYA 3KSCA 1FAYA 5JSOA 2NLRA 4HLTA 2BEOA 2OZ6A 1MEC3 1RUF2 2RJLA 5BUVA 1H2NA 2ET1A 4N9HA 2XBO2 3OF1A 4OULA 4FPYA 4XMIA 4PLNA 1VBE1 2YZ4A 1IS4A 1R1A1 4WZCA 3VBHB 1LESA 1RUG2 3WP3A 2YPJA 1JHNA 2VQ0A 2SLIA 4ZU4A 5C8CB 1R082 2R062 3OD0A 1HW5A 5FPXA 5JAXA 2G4IA 3HT2A 2ZGRA 1ULCA 1V70A 1BYHA 2ZMNA 1MS8A 4L2NA 1HKDA 1KDKA 2KA3A 4QPYA 3ZXFA 4WVMA 1PO11 1VLNA 1AR61 5J37A 1YUDA 2UY9A 1I6XA 1G9DA 3AYDA 1Y43B 2AZ5A 4KU7A 2B7YA 4M0HA 4COVA 1BK1A 1JYIA 3RI9A 2H6CA 4XMAA 2GAUA 1IKQA 2R0HA 2OYZA 1LOCA 4LNVA 5CFCB 1AJOA 1ZZ8A 4BE3A 5I0RA 4GH4B 3ZMNA 4AHWA 2NMOA 3OY8B 2GNDA 1APNA 1HRV1 2VOXA 3ZYRA 3LWCA 3POWA 3A0NA 5JSPA 3H1WA 4C0HA 3R6SA 3ZSLA 3M8LA 5EWSA 4MXWB 1YFUA 2IFRA 2AGSA 1SBFA 4B8EA 1IS3A 2VNOA 5L73A 4OHWA 1YI7A 4OI4A 3VZOA 2X8KA 2D6PA 3WG4A 2EALA 4LO8A 3E5XA 1B35B 1AR83 1SLBA 1T6GC 1REDA 1A8DA 2H0BA 4HK8A 1AL23 4JV4A 5JDBA 1QQP3 1IOAA 2RS52 3ZDSA 1MEC1 5C9AB 3ZSMA 4RGAA 4XIKA 2PHXA 2V09A 3HWJA 1RJ7A 3MZHA 1D2QA 1LHUA 4OVEA 4A7KA 1CR7A 2WC2A 2CYFA 2GNMA 3WQ0A 1EYBA 3LZZA 3W9AA 2WNVC 3VBSC 5GM0A 4E2GA 4R8HA 1CQ9A 1W2UA 2HWC1 3QH7A 1BEV3 2B45X 2GSYA 1X50A 2YUEA 4BZ4A 1O3RA 1Q3EA 1I3HA 3IKWA 4Y4YA 5BXXA 2WNUB 1IS5A 1VBD2 5FLJA 3WV6A 4AI0A 3MW2A 4CP1A 1O7FA 3PVNA 2W08A 5DDJ2 2XJVA 1J3QA 5FREA 4Q8KA 5BNNA 1PZ8A 5GZGA 3LAGA 2PAKA 3FLPA 3VBOA 3HMYA 3CL1A 1H4HA 1EPZA 1XNBA 1K5MB 4PLOA 4Q1PA 1FPN2 3O12A 4LR4A 3E6CC 1H1AA 3IWZA 2CV6A 2WQ4A 1RVF3 3GYDA 3H8UA 1MZ5A 5LRSA 1BBT2 3KT7A 4AFAA 2HYKA 2TUNA 3VKFC 2ZCWA 5CADA 4C91A 2WS93 4QQHA 4AQSA 4XZPA 4IETA 2OA2A 3WXPA 4KG8A 2CY6A 1CPMA 3ZFGB 1DFQA 2O8OA 4LBQD 1KFXL 3M3OA 4BYYA 2BWCA 2XLAA 5SV8A 5CU1A 1ZA4A 4EWEA 2RR13 2A3YA 1FMD1 3PNAA 2MPFA 1ZYBA 1S0JA 2WT0A 3AKTA 2BNOA 1JXNA 1AR81 4FSJA 1NY72 2NYYA 2IZWA 3EO6A 2WFF3 3AP5A 2HWD1 3CNAA 3ZFFB 3HN1A 2QFEA 3V0BA 4KU8A 1AL21 4DFSA 3AKQA 1QQP1 1S2KA 2VY0A 3E5QA 3OYWA 3D4KA 1PM7A 4IV3C 2PN5A 2ZX4A 3WR0A 2JG8A 2RMU2 4F7ZA 5CFDC 2GMMA 2VGDA 3AKPA 5JWPA 3ASIA 2Q1MA 1HQWA 4IV1A 3ZYGA 1BEV1 1VRH3 2IXKA 1LGCA 2KXLA 4S2HA 5KXCA 4RSUA 3OCPA 5HCBA 4FTEA 2ARXA 4X8PA 2DWRA 4FTSA 2XG3A 1TME2 1VBB3 4LLOA 1GZWA 3GF6A 4FVVA 3APBA 3G7DA 5DUUA 1H8TB 4Q0SA 2X29A 1CAXA 4AQTA 1SLIA 2EXHA 2HWE3 1DZTA 1RVF1 1NE4A 5J09A 2RS32 1SLTA 2WS91 1OSGA 1O4YA 3T1LA 1NCQB 3AZYA 1DGLA 3PHMA 1G9FA 1CAWB 3VHPA 3J8F3 2A73B 2D6NA 4E2QA 3QCWA 1SCRA 2RR11 4BM8A 3AYEA 2IWGB 2XVLA 4JGYB 2E6VA 1RUNA 3HQXA 1W6QA 3J9SA 2WFF1 4JDNA 4FAHA 2A6YA 1AXZA 1S0EA 4QU2A 2A3WA 2ZGOA 4Q4X3 2PHUA 4AEJA 4Z92B 2VOKA 4M01A 4C1XA 1WUVA 3NL1A 2D7FA 3AFGA 3NV1A 4CTEA 1RUH3 1RUI2 3FFQA 4LHLA 3I59A 3L2YA 4CDUB 1JOJA 4WVVA 2FMYA 3ZXEA 4YZ5A 2Z42A 5BNOC 1NCRB 1ZBA3 1TEIA 3EHKA 4B7EA 5FTTC 4HN0A 5KXBA 4CDWC 1VRH1 3VHNA 3JQWA 2P37A 1C8M3 5JCTA 4QXKA 4XE9A 1QH7A 2BWAA 2K9ZA 1V6NA 3GHMA 2RE9A 5H9SA 2YV8A 2XL9A 4Y1UA 2JEMA 3TOJA 5LEKA 1VBB1 2VQAA 3JD72 1WW6A 3IN9A 3MIGA 3SITA 1UPSA 3A0KA 2XL7A 1A78A 3TB0A 4AEMA 3GALA 4H7MA 3J26N 1O4ZA 4MV2A 3MYXA 2ZGSA 1ENQA 1U5IA 5FPZA 2GALA 4E27A 1PMIA 2HWE1 2YDEA 3AZZA 3G6JB 3KCYA 4LHKA 4YFZA 5HXVA 2MEV2 2R6QA 4H55A 4XF0A 5DUXA 3VBRC 4I30A 4AEDB 5E88A 2GN7A 4XBNA 4AWDA 2PAEA 1C8NA 1PVC3 2RJKA 3J8F1 4PIZA 1URXA 2JJ6A 2VULA 1AR73 3RDIA 2HKXA 4KGGA 3VBFB 4WBBA 2ZGQA 4BA6A 3KMHA 3VBSA 1FXZA 3LB9A 5L7OC 3PVOA 2I07B 4LO5B 1PIV2 4Q4X1 1F2NA 5ABJA 3GZAA 1LOFA 3WINE 1COV3 3DPRA 3FJSA 2EIGA 1RUH1 1BVVA 4N43B 2YXSA 2DF7A 5JIAA 1ZBA1 3KGZA 2UYAA 1DDLA 1SMVA 3KCXA 2GH2A 1LRHA 3U0ZA 2FQPA 2WQZC 4N53A 4CDQC 1ZM1A 1PZ7A 3BTAA 3TRSB 5K9YA 2WIIB 3B94A 4YGEA 1AR92 3HAGA 1C8M1 1KDMA 1LODA 3KD4A 4GB33 1DZRA 2RM22 1HXS3 4AHXA 1NZCA 3WDYA 4PDWB 1IS6A 3AB0A 1I9RA 1IZ3A 2JKBA 1PO23 5GLZA 2ZGUA 4INDA 1AHSA 3AJYA 1LEDA 3V65A 3VZLA 4X8NA 1GYKA 3VLBB 2D6KA 1V00A 3E6DA 4YW4A 1Q8VA 1CPNA 5D8AB 5L36A 2AYHA 4MGZE 1GR3A 1SQ4A 3MLJA 4XYXA 1W6OB 1OOPB 1GLHA 4KBBA 1H1IA 1VJ2A 4CZSA 3D0JA 4IEOA 1OQDA 3CJIB 2D3SA 3TBDA 1PVC1 1VB4A 2HEWF 2UWCA 4I3PA 4L99A 2IXIA 1FNZA 2D93A 2Z2SB 4RR3A 3VKNA 5I8YA 3VN4A 2SBAA 4YM2A 1YCIA 1AR71 4AYUA 4KNCA 4HZFA 3BU7A 4MXVA 2E7TA 3TN93 4BIOA 1EAH3 3NV2A 5A3MA 5JOXA 5KHKA 4YRDA 4XOGA 1RUJ3 1G8WA 2CWMA 4LUMA 5A33A 1O5UA 2D5FA 1COV1 4WV8A 1HIXA 1EPWA 1ONAA 3JB4C 4R9DA 4ZU7A 1I5ZA 1UU5A 2JICA 3B02A 3NW4A 4UXAA 1ZBE2 5IK8A 1RUC3 4LBOA 4SLIA 2C0ZA 3RJRA 4V1PA 4JRAA 3IBMA 2PFWA 1J1LA 4XF1A 3CLPA 4G9SB 2Q5TA 2A6XA 1RC6A 4WVMB 4GB31 5GJ6A 4DRRA 4Q4Y2 4E4SA 5ACA2 4BOWA 1HXS1 4KWKA 1BVP1 5C33A 2ZHKA 2ZAAA 1AX0A 4X6QB 1PGW1 1CJDA 1PO21 3BALA 3INAA 2JDZA 4G4FA 3UJQA 1EV13 4HPKA 1YI9A 4NN0A 1RUF3 2PAMA 3RPQA 4LBLA 3H3ZA 5C4WC 5AVAA 1YWKA 1FOD3 1LU1A 1XRUA 4FP3A 2XBO3 3WQ7A 4Y22B 2R043 1S0GA 1UZYA 1ZNPA 2DCYA 1NQJA 3LGRA 3MPBA 4RA0A 2MHFA 4ASLA 2WSUA 2B8MA 3FLTA 1FV2A 3H0OA 2R063 4XFGA 1H4GA 3OBRA 4K6BA 5CB7A 4EN0A 4QGNA 3WDTA 5CG9A 3KM5A 1PGL2 4QQPA 2P3JA 5BNOA 2AH2A 2YGMA 1QJZA