2VNRA

Family 51 carbohydrate binding module from a family 98 glycoside hydrolase produced by clostridium perfringens.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
172
structure length
172
Chain Sequence
SRDVYLSDLDWLNATHGDDTKSKIVQKNHPFTPGNNNQSTKISLKMEDGSISEFEKGLGTIAGSPSTITYDISGAGVTKFFSYLGIDRSANPINEQYAKVDKIEVVVDGKVIYSTINQFPNGLTYETPAIKVDLNIPENAKRLQLKSYAGEKTWGDEVVYADAKFTAKGDFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CPE0329
publication title Divergent Modes of Glycan Recognition by a New Family of Carbohydrate-Binding Modules
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
total genus 39
structure length 172
sequence length 172
ec nomenclature ec 3.2.1.-:
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08305 NPCBM NPCBM/NEW2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1060 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vnrA00
2VMHA 2YGLA 2YGMA 2VNRA 2VMIA 2VNOA 2VMGA 2VNGA
chains in the Genus database with same CATH superfamily
1LRHA 4QPIA 5EIYB 4TYSA 1DGLA 1O5LA 3R05A 1VRH1 2BP6A 3IMMA 3ZKUA 3CJIC 3LDKA 1NZCA 2RS32 2VCAA 1RUC1 3JBG3 1ZZ8A 3OJBA 3POEA 4MGYE 3C7FA 4EN6B 4UYBA 4YGDA 2O8QA 3DEMA 3ETPA 1PGSA 2QQWA 1DGWX 1W03A 2I07B 2D44A 3Q8AA 4B4RA 4A7YA 1V9U1 4DB5A 4COVA 4AI3A 1SBDA 2JX9A 4CZSA 3JUUA 3HAGA 1IG0A 4JAAA 3R4SA 3VKFC 4QPIC 5A7SA 1AR92 2ZGOA 5IAXA 1BK1A 3ZYRA 3WNOA 3MI8A 2VZ1A 3C7GA 4Q4W2 2C5DA 3HIFA 2QDNA 3ZFEB 4QAWA 2QKDA 4AQSA 1X33A 1RB8G 1QJZA 3H7JA 2DF7A 2ZKLA 1BBT3 4X8PA 3S7IA 3OSDA 3D0JA 3B02A 1XU1A 5BNPA 4KWUA 2VOXA 5KXEA 4BK4A 4GKXA 3CQOA 2ZX0A 3L2HA 2ZCWA 2ILMA 3OGGA 4AI2A 4P9GA 1FNYA 1O3QA 3AP7A 1CPMA 3HJRA 3ZKYA 1R1ZA 5A3WA 2J1AA 4LBQA 4Q4Y3 3WDUA 1XB9A 3M2MA 5FPBA 5JSRA 3J7NA 1R081 5FZOB 2IC1A 5F8PA 2B9VA 4YZ5A 1RUH1 5LBBA 4BU2A 2H6BA 2J1EA 5BNPC 4C0BA 2Y60A 3OEBA 3T0AA 4XJAA 3V0BB 3HQXA 1GQPA 1OMIA 3V64A 3FUOA 4WV8A 5GLVA 3VZKA 1W9SA 4FPLA 4AQTA 4Y5TA 1KITA 3K75B 4ET7A 4R9AA 4LT5A 1QQP3 1S0JA 4CCKA 1F2NA 5FK8A 3IIAA 3NJVA 4GWIA 1N1TA 1CAXB 4ZONA 3MPBA 3EMRA 2XMLA 2X5IA 5FZMA 1S0EA 4TLFA 3I3BA 3HWJA 3VKLA 5IATA 3N7JA 1RUE3 5C3PA 3WF4A 3AYCA 1JYXA 1DIWA 2VOVA 5L7OB 1Z7S1 4IEUA 1QJU2 1Q8OA 3GBFA 1Z0HA 4AK3A 3IDCB 2FDJA 4GWMA 4GWJA 4P00B 1VBE2 2WWJA 5FOJB 1ACCA 4NPLA 1MZFA 4UW3A 1JYVA 4JGZA 5FCCA 3JD71 1W2OA 1MS8A 5M0TA 2JENA 2JG8A 4UFLA 1HJGA 2V5YA 1LU1A 4GIQA 4XBLA 3MFAA 4ZS2A 2VGDA 2XB6C 4P5HA 1CESA 1YCIA 1E57A 2ZOEB 4YVSB 4MGIE 1RL3A 1AVBA 4N90A 3V56A 2ZKNA 4RA0A 3HNBM 4DUVA 3TB0A 3WLUA 5ACA1 2HWE1 2W1WA 4GULA 4JGZC 3RYRA 5CIRA 2XONA 2ZAAA 5FZ0A 4OMCA 1W0PA 2JG8C 1HKDA 2B9UA 1QY4A 4QB6A 2ZHLA 1SZBA 3BOPA 4OMDA 4AG4A 1RUI2 2JDNA 3KV6A 4O65A 2AREA 4GXLA 1N3QA 1AHSA 1OXCA 2NPIA 1BK0A 3WD5A 4AI1A 2W39A 4JKLA 1YQCA 4QD2A 5CYYA 2XJPA 5K0UA 4IXLA 1KDMA 3LAGA 3ZYHA 1FMD3 4ISRA 1YUDA 2MHFA 4AHWA 1BVP1 2P37A 4Q4V2 1NE4A 5L9BA 2J1SA 3N7KA 3IZOA 2B5HA 4J6GA 4TXWA 5EQUA 1RUJ1 4CP0A 2DURA 3BU0A 5IVJA 2WS92 3SC7X 2MEV2 3T2PA 4HFSA 1NXMA 2GMMA 4XF9A 5A32B 4LA3A 4IE0A 4Q0QA 5DQ0A 5KWRA 3BPZA 3SCFA 4A7ZA 1PMJX 1UX7A 2VQUA 4L92A 4AEKA 5GLWA 1NQJA 4D7YA 2JDUA 5K0UC 1RUC3 3DL3A 2YC4A 4QKDA 3ZM8A 1QNWA 1Z78A 2JIJA 5J7MA 1C8M2 5JWPA 2EAAA 1PGW1 1V6LA 1OQ1A 2VNGA 4CE8A 4CCLA 3FBMA 5KHGA 1Q8QA 2UWCA 1V9U3 2WZR1 1Q8SA 2ARAA 4H3WA 1XNAA 2QJVA 3AJYA 2TUNA 4GH4A 1QJY2 4LIUA 2Y38A 3PMSA 1SG3A 3BB6A 3EB7A 1PO11 3WCRA 5IK5A 2VNVA 4HSLA 3AMQA 1SEFA 1M06G 5A7OA 4DXRA 1Q5OA 2D6PA 1PHMA 4IE5A 1RUD2 3KWVA 1DCSA 2R042 4W6XA 2ZGQA 1X50A 1DZTA 4EQVA 4QU1A 2GALA 3I97A 4R4XA 4HPKB 4IETA 3R6SA 1IHMA 3RG0A 1R093 2OW4A 3ENRA 1LHWA 1H2KA 2OIIA 1S4CA 3ABZA 4YG0A 5FBZA 3PURA 4A3ZA 1N1YA 1H6XA 3IPVB 1UWWA 4DO0A 1OPMA 4GH4C 4QT6A 3ZXAC 1HLCA 3HQUA 3RZZA 1LGCA 3SCGA 1QJFA 4V1PA 1LECA 2RE9A 4H7MA 3ZN6B 5I0DA 2W91A 4CDQB 1RUOA 1KS4A 3WNMA 1RUH3 3OOXA 4QGMA 1ND2B 2PLV1 3MIHA 1O3SA 5BNNB 2B8MA 1W3VA 4Q4W1 1C1LA 3EQEA 4L99A 3OD4A 1T6GC 4HONA 2WT1A 2ET7A 2WQZC 4R9CA 3UKVA 3TN92 3ZFEA 2RDNA 4QXCA 4Q0VA 4JTOA 5CEHA 3AP5A 3SQOA 2WL1A 4J1XA 1LCLA 4XTPA 1CZVA 1CIWA 4PDWB 4CCCA 5DZFA 1GP5A 3HVDA 4YW5A 1LGBA 1YIPA 1F31A 4QB1A 4YVWA 1YQ5A 1JTZX 4K8FA 1DYPA 1UU4A 4OHWA 3NJYA 3LPGA 5GJ6A 2D6LX 3T0BA 5EYXA 3E5UA 2WO7A 1S0BA 3VHPA 1DLCA 2A6ZA 3ZXJA 5F3CA 3CMGA 5FZ7A 5LA0A 1K42A 2RJKA 3RJRA 1GLHA 2EIGA 3ZFEC 4ASLA 2VH9A 5IW0A 3ZYPA 2C4XA 4UXAA 2W52A 2WN3A 1YXWA 1HRV2 3JD73 2CY6A 2VR4A 3NNJA 4FOVA 4LNVA 5A7NA 4AGVA 2WRAA 4W50A 4CUGA 4NHMA 4Z92B 3BUCA 5DAXA 2XQXA 4UF0A 3B9CA 4YVWC 3VDDB 1GWKA 2HBUA 2W3JA 5K9YA 1GOHA 4PLNA 2DCZA 2VMGA 1D7PM 4CU7A 1UZZA 1XNCA 4NWVA 1RINA 5EZWA 1LU2A 3AJZA 3AZWA 3VD5A 4ARYA 4AFAA 4FOQA 4YG3A 1XNKA 2VMDA 5EPAA 1CAXA 1LHOA 3GCXA 3P6BA 4CXYA 1QJU1 1JH5A 2YU1A 3HNYM 5ACA3 2J1VA 1XU2A 2R32A 3DXTA 4AVTA 5L7OA 4YGBA 5AFBA 4D3WA 4RHV2 3ILNA 4YG6A 4BQ5A 5AC92 5DABA 3EBRA 4RQPB 2VW0A 2ETEA 3E6CC 3A7QA 3PJQA 4P14A 3BN6A 2WYFA 2VJXA 1XE0A 1HX6A 2V72A 2VTFA 2Q0AA 2W87A 3MFCA 3ECQA 3LEGA 3HT2A 4WVVA 3RI8A 4DXTA 1O4ZA 2ID4A 3GJBA 3WG2A 4A6SA 2YGLA 4LKDA 1GP4A 4P9LA 1W8TA 2Q1MA 4XJ8A 4LQRA 5IVCA 4AI8A 5FYMA 3ZDSA 4BM8A 4ZPIA 3JU9A 4Y5Z0 2XDVA 5L7OC 4YVSA 3AMMA 2D43A 1GV9A 1X9TA 4XDPA 2BQPA 5T55A 4Z1VA 5FUPA 3K51A 1RUJ3 3DPRB 1LNSA 4YW4A 4HK9A 2ZBJA 1AF9A 1RUI1 2UURA 1SLLA 3MIFA 2XXZA 2ARBA 1IG3A 1HW5A 4DMIA 2WFF1 2EAKA 4KWKA 1RUF2 2IWGB 3S6PA 3CF6E 5A6YA 5C8WA 3LA2A 3MLKA 4YLZA 4KU8A 4ARXA 4H7LA 3O0XA 2WNUB 3M3IA 2Y0IA 4YVSC 2ZEXA 4P02B 3UGHA 4Q29A 4BLIA 2B46X 2WZR3 3VDBA 4XUQA 2V5DA 4Q4V1 3POIA 3AK0A 2CGNA 3POYA 4QPWA 3ZXLA 2GC2A 1UXXX 4TWTA 3DXUA 2FMYA 1PO13 3AYDA 3TNPB 1YRZA 2IFRA 5A1AA 4F7ZA 1HRI2 2FD8A 1JS9A 2MEV1 3AP9A 4L9BA 4IE7A 1WMEA 1O4YA 3IB3A 2BDRA 4IEPA 2Y34A 2G9GA 1U5IA 4LO7A 3N9OA 5A32A 4V2WA 1HQLA 1WUVA 3SKJE 2W46A 3W20A 4JC1A 3DV8A 1UMZA 2R071 3OTFA 4H55A 4Q4X2 4I02A 3C3VA 1JZ5A 5LW9A 1MQTA 2K0GA 5JAXA 5FZLA 4NE9A 1U0AA 1UYPA 1HIXA 1DBNA 1QJY1 2GZWA 4IEXA 4OUSA 1KDKA 4GZ9A 4G3YC 5JOWA 2BNMA 5LCWL 1AR93 2D3PA 2W08A 2TBVA 3KVBA 4QQ2A 1JZ4A 1MEC1 2PLV3 1AUYA 1PZ7A 3OD0A 2WKKA 4P9IA 4Q4W3 4M00A 4BMEA 5FMBA 3E97A 4Y5SA 5DXDA 4NRPA 1WCUA 1I5PA 2RHPA 5GLUA 4D0QA 4DEVA 2EIBA 5DAVA 4HETA 1LESA 4QMAA 2P3IA 4X6RB 3K3NA 2IVIB 1OA2A 1CN1A 4LORA 4RD7A 3T30A 3K77A 5JZGB 4HPKA 2Y64A 4IDZA 1CZSA 1LOEA 2YPJA 1PO22 3MICA 2QQLA 3IPVA 1C5IA 3M1HA 5JXJA 5ANQA 1CD3G 1DGRA 3OBTA 4LLFA 4XJZA 5HI0A 3C7HA 2OQ7A 4LBKA 5DDJ2 1EV12 1VAKA 2OXBA 2D7FA 2XOMA 5SV5A 5F5QA 1EYBA 5L9RA 4DZGA 4CDQA 4DFSA 1SFYA 4PLMA 3BODA 1ND2A 1WW4A 3H3ZA 4EWDA 5BNNA 5C7GA 5DAWA 3RYKA 1AXYA 1DP0A 4XCAA 3TN91 4CDWB 2V73A 5IVEA 3UKTA 4DEQA 2D6MA 4OFGA 4FP2A 4BQ4A 3H1MA 4ES9A 4FPEA 3TEXA 3APBA 3VKOA 4HSJA 2OUHA 1G6NA 3IKWA 1A6CA 2AYHA 2VMEA 5C5TA 4P9YA 4D69A 4E8CA 3PIGA 3RZHA 4PDWA 3CZJA 4CDQC 2W68A 4IEYA 2JEMA 5C3OA 4KWJA 1D4M2 1GKBA 1ND2C 1A3KA 1F5FA 3I3QA 1QJU3 1WWYA 4XACA 5BNNC 4PF5A 3I2DA 4RFT0 1NY71 5BY5A 4B7KA 1H30A 1PK6B 2VULA 1VBE3 4MV2A 3ASIA 2G9ZA 2E7QA 1BMV2 4YSFA 3A0KA 4BJ0A 2ZGKA 4QX3A 3WG3A 2ORZA 1RVF2 1J1LA 1ENQA 1G9FA 5JR2A 1O4TA 5F6LB 3NNLA 4R52A 5FYYA 2CU5A 4IQPA 2ZGLA 3POJA 4PDWC 1QOOA 3CLPA 4XHBA 3TNQA 1RJ7A 1W8UA 1XNBA 3CU7A 1JZ8A 3VDDA 3AKTA 4QX5A 1LOAA 1LOCA 1RMU2 3I2JA 5FY1A 1D4VB 2EXIA 4AFDA 3KVAA 3AFKA 3JBG1 5A3LA 3MYXA 3ON7A 4P9XA 4F8AA 4DUXA 4XFCA 3WDVA 3RS6A 5AC91 5FYVA 5IUQA 1RUI3 4ES8A 3U78A 4FXGB 1XYPA 1T2XA 2W95A 5LBCA 5J36A 3CIHA 3VDDC 3WCSA 2CNAA 4RQPA 4K21A 2BNNA 3KM5A 3IT8A 4Y3OA 3HN3A 4LBMA 4Z8BA 3N9MA 3UETA 4WZFA 4FPCA 3VBUA 1CAVB 1U12A 1H9PA 2D98A 2JWPA 1TVGA 3M4FA 4PQ9A 4W4ZA 2AR6A 1XQNA 4WZCA 3CKHA 1FX5A 1HB4A 2CAUA 3USSA 2CYFA 4FOYA 1DGWA 2JDKA 4Q4V3 1LHVA 4K8RB 1BBT1 1W2AX 4Y24A 2ZMKA 5A70A 2YC0A 2E9QA 3MW2A 1QOSA 2MEV3 3OCPA 4IV3B 3WNLA 3ZYGA 1DZQA 4OHYA 1EP0A 1S2KA 4RQPC 3O0WA 4RR3B 3DPRA 4TLGA 2FZ2A 4XFBA 3B7MA 3GNEA 4AI9A 1RUF1 3IAQA 3VD9A 2EICA 4IESA 1ULFA 4HBNA 4QHBA 5FY5A 3LSDA 4SBVA 3NNFA 1AJKA 4JQTA 3WNXA 4NROA 3RYPA 3VDAA 2R073 3A4UA 3HNMA 3ILFA 3CZUA 3Q8BA 4M01A 3BI3A 4XJWA 3WV6A 4ASKA 2WNUA 1GZTA 1ONAA 2UY9A 3VL8A 1JYCA 1XXNA 5FXWA 1QJY3 1REDA 1MR5A 4HL0A 3ELNA 3MF9A 3H9AA 1CPNA 5G05L 5JVVA 1YFUA 5EYYA 5A1FA 1HRI1 1Y7BA 3DPRC 4XMIA 4QHZA 2Q8DA 2VZPA 1NT0A 2RR12 1RUD3 2XKPA 4LLOA 3TRSB 5AVAA 3PUSA 5KHIA 1ULCA 5T5LA 3WDXA 5CG8A 1H0BA 2W1QA 3VBSB 4J1WA 4YWAA 2F4PA 4AVCA 1EUUA 5GALA 5JLVA 2WNUC 1AXZA 1BXHA 1RUE1 5A6QA 1XNDA 3A22A 3FMGA 1C1FA 1GOFA 2PAMA 2Z2SB 2OT7A 3R4DB 3PUIA 4AFMA 1ZZ7A 2DVGA 5I93A 4GJYA 1D2QA 3NRUA 4M3CB 3PU3A 1CX1A 4BWOA 4LIVA 4OQ9A 1UOGA 1OA4A 4OI4A 3OBZA 2VCCA 2VMFA 4YRDA 1H2MA 3VL9A 2PYTA 2H6CA 3LEMA 2A1XA 5DG2A 1G9BA 2KA3A 4P9JA 2WBKA 2VZUA 1ZBE2 1GZ9A 3G6JB 3KHBA 3TN93 1Q8VA 2BJSA 2GC1A 2X10A 2YU2A 4FPJA 2DCYA 2IVJA 4L11A 4E4DX 2XBO2 1WLTA 3FN9A 3CL1A 4CCOA 3N35A 1HQNA 1W2UA 5A6XA 2X29A 3H50A 1I6XA 4UT5A 2A7AA 4S2HA 5JZGA 2K9ZA 4LK6A 2WWUA 4QM8A 1F5JA 1Y9MA 2WLPA 3OUHA 4EN8B 2DDUA 3D0SA 2RJ2A 4JVAA 5LK7B 1KJLA 5JR7B 5DDJ1 2NP0A 1EV11 1LKNA 4LTAA 5CNAA 4PIZA 4V2VA 4AFCA 5FKCA 1XBFA 1HQWA 5FMOL 4TN7A 2YPDA 5GLZA 3LEKA 1GR3A 2P17A 1POV0 1SQ4A 2ZX1A 3OPWA 4XDQA 3LDRA 1QWRA 4HKOA 1G7YA 4IW3A 4HXCA 5LASA 1F9KA 4Q8LA 1FATA 4QGLA 1W0NA 2BTVC 1VP6A 5CKQA 2J1RA 2PXJA 4FOWA 3WVJA 4DINB 5JZGC 2V09A 2X8KA 4NPRA 2XJUA 1UMHA 3SH4A 3WXPA 4ZZ8A 2JDAA 1OUSA 3RJ2X 3WDTA 4CDWA 1PGL1 2R062 2DTWA 3ZR5A 5BUVA 5FZ1A 1AXKA 3G7DA 3TOJA 4TSVA 3VLBB 4QPYA 4R4ZA 3D8CA 1B09A 4CVUA 3VZOA 4C1XA 5JSOA 4D94A 3I3DA 2VUDA 3T2QA 4LMFA 1S1AA 3HQRA 1D4M1 5IVVA 1QXRA 4RGKA 1R1A2 4XXPA 2WC2A 2ZACA 4J25A 4LBJA 3B9IA 2ZJCA 2LUWA 4Q0PA 5FLJA 1NYWA 2RV9A 2P1BA 3MF6A 4KG8A 1ENRA 3KF3A 5JI7A 3T3YA 2WN2A 1REFA 1DQ1A 4RHV3 3I2FA 3T09A 5AC93 5IFPA 3M3QA 2RS11 1BEV2 4UBGA 1PK6A 2WZ8A 4CDWC 3KCXA 2CSGA 3OBRA 5F7UA 3KB5A 2A5ZA 1UYYA 4HN0A 5DPNA 4Y1XA 3LB9A 5FFOC 2FHRA 2JKXA 5DN2A 4O7XA 5E6HA 2J7MA 2ZZJA 3U75A 4AW7A 2QQNA 4BQXA 1IPKA 3ORJA 2JJ6A 5D2AA 3MZHA 1HV0A 2HYKA 2D40A 4K1YA 4OYUA 3V0BA 2XR4A 1XOYA 4INDA 2DFCA 2QQIA 1JZ2A 1PK6C 1R091 2J42A 2WNOA 1NCRB 2ZHMA 3BVCA 1A78A 2VW1A 3VBFB 5LBEA 2VQ0A 2VOWA 3FHIB 3RRDA 4LJHA 3IDBB 5FO7B 1RUF3 5F3GA 3KF5A 1N1VA 5FZAA 4FAGA 5C9AB 1VAVA 3T1LA 5A7QA 1VPHA 1I9RA 1HXS2 2O8OA 1QU0A 3B5LB 3B3QE 3IN9A 1GICA 4XIOA 4P9WA 4LO4B 3NO8A 1JOJA 1X8EA 5FZHA 1SBEA 1CAVA 4EN7B 4KMQA 1MZ6A 3P5BA 1XYOA 3THDA 3GM8A 3ZX7A 1OI6A 4QKBA 2BRTA 2QNKA 1AYM2 4U36A 1DQ6A 1OURA 2DVBA 4GA9A 3WQ1A 3U11A 1HRI3 3CJXA 5CA6A 3CHXA 2YC2A 4QX0A 1ZA7A 4BQ1A 4YM1A 4BOWA 3ACGA 5FDBA 2YMZA 3W9AA 5FYHA 5HXMA 3MV11 3SMHA 2RVAA 5A1LA 1BZWA 3QH6A 4IV3A 2VY0A 1NCQB 2TNFA 5FRAA 4RR3A 3WOGA 2VVDA 2QDRA 4AF9A 2RM22 3L2YA 2HJIA 3N9PA 1GZWB 1O3TA 4Q27A 3OGVA 3ZYFA 1QHDA 1TE1B 4FQZA 4GJZA 4Q4X3 4UW5A 1LEMA 1NLQA 1WBFA 3N7MA 4OZOA 5JDBA 1KRIA 4FFHA 3M7AA 1ZBA2 5A7PA 4FQ4A 1PVXA 2MPFA 1OH3A 2FDKA 4BE3A 2PHFA 3I4IA 3LFMA 4KNCA 4XF0A 5T5PA 1VB4A 1LJ7A 2RR11 2VXJA 2XQRA 4IV3C 3DKWA 1LOBA 4L2NA 4B1LA 3WT3A 3BTYA 3FZ3A 4RR3C 1YIFA 2F17A 1OVPA 3OEAA 4DY3A 3BTXA 4IGOA 1UZWA 1HDKA 2E26A 5H9SA 4BYYA 4E4ZA 4F83A 1W6NB 1SLBA 4E9KA 1JN2P 3TBDA 3VBSA 4UW4A 3ETQA 2FBEA 2XKOA 2DVAA 3M8LA 2R1DA 3NQHA 1CWPA 3GBWA 3D82A 3QOPA 1V6MA 1ZVFA 2GP5A 4QU2A 4NWWA 4BH9A 1H2NA 2CL2A 4N9HA 4LUKA 4Z07A 1WLWA 4JGYB 5DDJ3 1EV13 4QXHA 1MS4A 3UKNA 5HCAA 1TMF2 4M3CA 2BU9A 1DFQA 5BPXA 4O61A 5JXGA 1QDCA 4A7KA 1PM4A 3I7DA 4MVTA 1RXFA 4QXKA 4JHTA 4YGCA 2IXJA 3VBSC 2W92A 4IEOA 4I0WB 1DZRA 4I3PA 4KGQA 2ZXQA 1QIQA 1FOD2 2W0XA 2HEVF 4FPFA 2WT2A 2AH2A 1U5YA 4M4PA 5T52A 1PX4A 4AAXA 4FXKB 4MYEA 1Y9GA 4K40A 1BKZA 1OLME 4LKFA 2VUJA 3K3OA 1ZZCA 5FREA 2VTXJ 2TEPA 1BQPA 2LROA 1AL22 2BFUS 2GH2A 1AX1A 2VZ3A 3FLPA 4NHKA 4XFGA 1D4M3 3USUB 2CV6A 2N7GA 2BFUL 2CAVA 2YG0A 1VBB2 3AFGA 5D1IA 2ZA9A 2E32A 2J22A 5KC6A 3O5SA 1QJEA 1YI7A 1FAYA 3VN4A 1BHGA 5ERLA 3RSJA 2LTNA 2IXIA 2R1BA 3OG2A 4OLLA 4W6YA 4XDOA 4CCDA 3AZYA 1UYXA 4PJYA 5I91A 1I5ZA 2RS13 4JDNA 4JDOA 5F2SA 3HBKA 5FZKA 1H8TB 1W9TA 2BOIA 4AYUA 1QF3A 2C24A 3WUDA 1APNA 2VAUA 2A71A 1XJAA 1VB2A 2BVVA 3OYWB 4MZUA 5JIAA 1W05A 4HVOA 1AZDA 5F37A 4Q8KA 3KV9A 2HWD1 1NXD1 3RVHA 4CU8A 1RMU3 1S55A 2E53A 5FK7A 4RS5B 3SISA 1WW7A 4XC9A 1C28A 2PHWA 1J59A 3WF3A 2RS31 3AMPA 2C6SA 4LOSA 4OCTA 1DYOA 2ZABA 4CPBD 3WNNA 2C1FA 4EE2A 5L19A 3AKRA 1BEV1 3LE0A 4G4FA 4A6OA 1SLCA 2GNBA 3FHQA 5JPMB 5LA2A 1V6IA 5EXOA 4A45A 4C90A 3RZMA 5T50A 3KD4A 5J96B 4OHVA 5K4LA 3SH5A 1W28A 4MX3A 4UOJA 3LPFA 3JB4C 1AR91 1PVC2 3KZ4C 4AR2A 3THPA 1WA4A 1E5SA 1UCXA 4Q5OA 1LULA 5D8AB 5DAPA 3D4KA 5JOXA 3BTAA 1O3RA 5H9PA 1MZ5A 3GDBA 5FUNA 2B39A 4NHXA 4CUBA 2A73B 4NO4A 3KGLA 4QX2A 1ZRFA 1JW6A 1IS6A 1OBNA 3K4DA 3OBAA 5FY9A 2D3RA 4Y4RA 4CEWB 4XILA 4ZU5A 5A3PA 3TAYA 4AVVA 3RZGA 1OF4A 1O8PA 3AL6A 1NCRA 3C2UA 3Q8FA 2O14A 3CDZB 4FPGA 3VV1A 4YFZA 3EJKA 4RFRB 5EWSA 1ZZ6A 3VBFA 1S0IA 3SNMA 4LITA 3GHMA 3GZEA 4EYUA 1H6YA 4XETA 1SHWB 4QHOA 5A3OA 5F9TA 2W94A 2ET1A 3C8XA 5JOZA 3VBRB 5C9AA 3VZLA 4S2FA 5LK5A 5LWBA 5FZOA 2UU8A 3WW4A 3QCWA 2ERFA 4LO5B 1OFNA 5HCBA 1K5MB 3VKMA 1NCRC 2EXJA 2C26A 5FY8A 3O7OA 2RR13 2QUOA 3OPTA 3DYPA 1AYN2 1NE6A 4BLJA 1YQ2A 3VBFC 1TZOA 4Q1PA 3SLIA 3VKNA 4KBBA 4XQWA 4AL9A 3K2OA 5B4XA 2DVFA 3ROUA 5LBFA 2XLAA 1AJOA 2DVDA 2Z42A 5KBFA 5C9AC 3H3UA 3VBHB 1UXZA 3ZIWA 1ULGA 3P3PA 2VTXA 1NCQA 4XFHA 1SLIA 3J8F2 3T2TA 5C6CA 2ZTNA 1PM7A 2XJVA 3UGGA 3PTYA 2VL4A 4EV0A 3NVCA 1GZWA 4SLIA 3WG4A 1HB3A 1VBE1 3AZXA 3RNSA 2BPA2 1D0HA 2QQMA 5H9RA 1UY3A 2PFWA 4OI1A 1ASJ2 2IXKA 1MS5A 1LB2A 1COV2 2AACA 4LEJA 2AUYA 2GDFA 5FP4A 4CA9A 2JECA 4I0AA 3NJZA 1ZBE3 2MNGA 2R6QA 3UV9A 1NCQC 1UYZA 2W1UA 2DUOA 3W21A 3NKTA 1UZYA 3AVSA 1VJ2A 4OULA 4QKFA 2XBO3 1UY1A 4EZ4A 1ZZBA 2BBAA 4UFHA 1CAUB 5FLHA 2WABA 3TEZA 4QQOA 4A41A 4COZA 1IZ3A 1CONA 5SV8A 3LSEA 3AP6A 1Q56A 3AVRA 3KMHA 3QD6A 3ZOIA 4D6SA 1O59A 5AFEA 4IUGA 2P6CA 1B35B 5FR3A 3UK9A 4M3CE 5I0SA 2W1SA 3IDEA 3J9SA 3P1IA 2OYZA 5F1RA 2ZEYA 4RGGA 4XPVA 4AHYA 5DMYA 1RGSA 1POV1 2GNDA 3QH7A 4JGYA 4MO3M 4Z2AA 5CFDB 1PNFA 3MW3A 4Y22B 1PZ9A 1UIJA 4PIYA 5LATA 4BQ3A 2B7YA 1QXJA 2C9AA 1SPPB 1VBC2 4JV4A 4JKKA 1VR3A 4GB32 2WZPP 1WGPA 2CDPA 4UAPA 2FQPA 4K3UA 3D3AA 4YW3A 4XABA 3WNKA 3CEWA 4QKNA 1ENXA 2R063 4JZRA 5C33A 3MEPA 3ZDVA 4BA6A 4AEMA 1MZEA 3AP4A 2FDHA 2WS91 5JXHA 1LOFA 2HWD3 1V6OA 3NV2A 3PUHA 4JGYC 3ZSLA 2UWAA 1CJDA 1WLDA 4H14A 4MHUA 1R1A3 3GZUC 2YHJA 1R64A 3AB0A 2NN8A 2RS33 3USUA 3O1MA 4XQ4A 1QH6A 4DXZA 4I2OA 2ADDA 1C8M1 5LA1A 5J1XA 2AENA 5EJZB 5JUVA 1TME2 1BEV3 4YFWA 3PVNA 1SLAA 3MBWA 5FPUA 1UW8A 3VD3A 4H2AA 2C0ZA 4LKSA 4JRLA 3FFQA 1VBD2 3FWEA 4MXWB 4WM7B 1EPZA 4XBQA 3DUIA 1LOFC 1OOPB 1H8TA 1K12A 1JUHA 2V4AA 1UPIA 4AZZA 2R0HA 2ZMNA 1ZM1A 3WP5A 4IERA 2WA3A 5J3UA 5CADA 2EXKA 4ATFA 1DQ5A 1NZIA 4NIHA 1OA3A 1RUD1 1H1IA 2R041 3KCCA 2LALA 1DGRN 4BZ4A 3W5NA 3I3MA 2G1MA 1QKQA 3AXEA 1OH4A 4N43B 2D6OX 4QB2A 2XL9A 4RS5A 4XHXA 4COYA 1GU3A 1YEWA 1TNFA 2GNMA 2YB7A 2BVBA 3VD7A 1STMA 5LRRA 1W2NA 1W8ZA 5A3TA 1J3QA 3LZZA 1LOGA 1H8TC 3Q9OA 4MADA 1AR72 5F5IA 5C4WB 2GH8A 3LWCA 3NAPB 3GBGA 3I59B 3R4UA 5DAQA 1RJ8A 2R16A 1ULOA 1DQ4A 2G9FA 3POBA 1HXS3 3BYWA 4XF4A 3UYJA 3BTZA 4RS5C 4XUTA 2RS52 1GP6A 2Y6JA 3ZN6A 3N7LA 4CXWA 3T2OA 3UJOA 2CHHA 5D8AA 1YLLA 3OUJA 1AYM3 5FPAA 2Z69A 2WQ4A 4NAOA 3M3OA 3K48A 5EHDA 5FZBA 2VZQA 1JHNA 1OFSA 4R9BA 1H9WA 4FPKA 3RGBA 5J09A 1JUIA 1UF2C 1SACA 1H8VA 2HWC2 2EIEA 2XUMA 4ITCA 4CEWA 2VBBA 1SFNA 4D7TA 4AVSA 3J7HA 5IAVA 3C7OA 3HEIA 5FKBA 2E63A 2RM23 1JZ6A 2RDSA 4QDQA 4ZZ5A 5D8AC 4WVMB 5FZ3A 2KR2A 4N8MA 3AM2A 1ZBA3 1IOAA 2CGOA 3NNMA 2PELA 1SDWA 3VBRA 4A44A 1W6MB 2JB4A 1MACA 3EO6A 3K4ZA 4FFGA 5GM0A 4CUAA 2AZ5A 1WZXA 2VECA 1HRV1 1U5ZA 2DU0A 2WNVB 3DN7A 3PU8A 5F32A 2VPVA 1N1SA 3B69A 4CEWC 1JYNA 3AKQA 1AYN1 1JBCA 2VU9A 4GWNA 1K5MA 5LRSA 4E4HA 5T54A 2P6HA 5KXCA 5F39A 2XVKA 3MDPA 2ENRA 1RUG2 3MLLA 4BMBA 5FIXA 3U10A 2R30A 1BVVA 1IS3A 3LIHA 4I01A 1JZ7A 2P5BA 5I8TA 2ZGMA 1K5JA 1REEA 1VRH2 1W6OB 3E1F1 4OHZA 3VBRC 3OUIA 3VBHA 2LS6A 5GZGA 2GC3A 3BPSA 4KQ7A 3KT1A 2BBVA 3MIDA 1A8MA 1O6UA 3RDIA 1XC6A 1UQXA 3S30A 1K5MC 2AC1A 4RHV1 1GWMA 3D6EA 1V9U2 1COV1 1TMF3 2GN3A 4FI9A 3ZXGA 4A4AA 4W8JA 1OD5A 2V4VA 4KWLA 4JQRA 1DLLA 1POV3 4NRQA 5BV6A 4S2DA 2RMU2 4XE9A 1URXA 4Y33A 4OI2A 4MHRA 4NN0A 3I3EA 2X09A 3NV3A 5LY2A 3SCHA 1YYNA 4CP9B 3IBMA 4CU6A 1SCRA 4OQ8A 1KJRA 3VBHC 1O7FA 1W8OA 5FQ0B 4WBBA 5CBLA 1FOD3 3F95A 4D8MA 3IM0A 3GXUA 3POWA 3I54A 2FZ1A 3E6BA 4R8HA 1UOBA 4B4PA 2SBAA 2WUHA 1UZ0A 3KLSA 4YZ1A 5HV4A 4COWA 3HT1A 4F3JA 5DUWA 3TEYA 1CAUA 3ZO0B 2YYOA 4AEDB 1JHJA 2WS93 1KXGA 1VBA2 5C8CB 1JMUB 1AL23 1YO8A 4CXXA 2I74A 3H8OA 4PBOA 1IS4A 2NZ9A 2XJTA 4DIQA 1VBB3 2Y6KA 5J37A 4DXSA 1UN1A 2WO2A 3OGRA 1B35A 1W8NA 1UIKA 1XE8A 3U4SA 3ZFGB 3ZPOA 1W99A 1R082 3NV1A 5JIUA 3AKPA 2XWJB 1C8M3 1VBC1 4OUMA 3WP4A 3LOIA 5CFDA 1BCXA 4CYDA 3AL5A 2YGMA 3LD8A 2H0VA 4IGQA 4LHNA 2ZS6B 4Y22A 4YARA 1SPPA 4Q26A 1ZRRA 4URAA 1JU3A 3AMNA 3ZIXA 4DY5A 4M3CF 5JI9A 3PVOA 3E6DA 2XJSA 2F4LA 1A34A 1KS5A 1H2LA 4GKYA 4K1ZA 4URTA 1B35C 2X05A 2X5IB 2HWB2 5IHRA 1SMVA 2VXRA 3WX5A 2KXLA 1Y4WA 2E7AA 3AZZA 2R043 4B7EA 2WSUA 3I49A 4CP2A 1GMMA 3BGAA 4B1MA 4NMIA 1KD7A 5CFDC 2QE3A 5FO9B 1YWKA 1ULEA 1S0GA 2OZ6A 3MLJA 1PIV2 3TYJA 4PCRA 4YYOA 4Q1RA 2IFWA 1TME1 3O1SA 1Z7S2 5E1RA 1K3IA 4HT1T 3VBOB 4Q4X1 2JDMA 4XZUG 2PHUA 1GQGA 1H1MA 1VBD1 4NIIA 5CISA 3WQ0A 2XVGA 3WF1A 3PHMA 4MG2A 3N9NA 4YZ4A 3B01A 2FCUA 4IL7A 2NMNA 5FTTC 2JDPA 5FXVA 2JE8A 1XSQA 1PVC3 1PZ8A 4FTEA 4WM7A 4UFMA 1E5HA 1X8MA 4XURA 3THTA 1W39A 1UU5A 4Q2FA 5IYYA 4XCBA 3ZLIA 1V70A 1UD1A 1O8SA 4ATEA 1CAWB 2RJLA 3LA3A 4E8DA 4PHZA 3HMYA 4FPYA 3H7YA 5CVRA 2PAEA 1HN0A 3E5QA 2WZEA 4BQ2A 4Y26A 3I2GA 3MIBA 1Q3EA 2ATFA 1YFYA 2WINB 3KSCA 4N43A 1Q43A 2JE9A 4LBNA 2HWE2 3LIGA 1AR71 3C7EA 3S5AA 3FUQA 1PO21 2YFUA 1AR82 4MGZE 4WM7C 3RWNA 3SXWA 1OOPC 1P8JA 2VOTA 3DKQA 5C4WA 4AQ2A 4D6QA 2E31A 3AYEA 1OLMA 1GYKA 4YNIA 1JODA 3I59A 5FXZA 3RZJA 4M4RA 5FAXA 3URFA 1X82A 4DRVA 1YQ8A 2RS51 3WP6A 3DF0A 4OVEA 2OPWA 3MUZ1 3THCA 3PVBB 4FCAA 4QPGB 4DOUA 3T1MA 5C3QA 3MW4A 5K8SA 3KS7A 4LUMA 4N43C 3DYMA 1PMIA 3KQRA 3EHKA 2XJQA 1QH7A 1UAIA 2IXCA 1XRUA 1UPSA 1HRV3 1W2TA 3PVEA 3H1WA 5ABJB 3DCQA 4EN9B 3GGLA 1AYN3 3ZXFA 3O14A 2HWC1 3NSTA 4CU9A 5A6ZA 5C4WC 2W5FA 4CTEA 2SLIA 5FPLA 1JOPA 1RUJ2 2JD4A 3NAPC 2RG4A 1HV1A 2VZOA 5EJ3A 5L36A 1UL9A 3AZVA 3VHOA 2QZ3A 2HEWF 2WA4A 2E6VA 4XAEA 5FZGA 5GZEA 4A3XA 4E27A 3J8F3 5IFTA 1NOVA 2YUEA 2Q8EA 4JRAA 5A7WB 1VMHA 1ZRIA 2O0OA 2ZX4A 3DYOA 4FFIA 5E16A 5F3IA 1ODMA 4BIOA 5JCTA 2D93A 4LHKA 5IT6A 2A3XA 2VNRA 3PUQA 4WVMA 1BMV1 4OZXA 3NNGA 3Q8EA 4EROA 2JICA 1RVF1 1COV3 1LEDA 3FBYA 4XUNA 5KC5A 5A3NA 2FCTA 2LRPA 1W6MA 3L9JT 2ZEWA 5J98B 3U07A 1OSGA 5HXVA 5G04L 2WNVA 2DV9A 4XFFA 1PO12 1ZX5A 5IJRA 1OPOA 4GQ7A 4MGTA 5L9VA 2FMDA 1UMIA 5DUVA 1RMU1 1AX0A 2VZVA 3VD4A 1G9CA 2XG3A 4S2GA 2RDQA 1IKPA 3JXSA 2HEYF 2D5FA 3CBNA 3S57A 4WVWA 1W6OA 3DECA 4Y1UA 4CEYB 1S0CA 3JB8A 2XVLA 1NA1B 2VM9A 4A2UA 1N3OA 4ASMB 5A3UA 2BWCA 1W9YA 1WMDA 2WNVC 4UWDA 2E51A 1US2A 2AGSA 5FOBB 2RMU1 4XJ9A 4C0HA 4QWNA 5E8AA 3JQXA 4MGSA 1X36A 1UNBA 3BOWA 1VBC3 2PLV2 3CNAA 1GQHA 2ADEA 4GB33 1C4RA 2JXAA 2XHNA 1CJPA 1V0AA 5FMCA 1W9WA 5FZ6A 4E4SA 2GNTA 1CVNA 4CP9A 1WMXA 1UY4A 2ZGRA 3FX3A 4NJ4A 2Q8OA 4CCMA 5A33B 3BIWE 3B93A 3ZXKA 5FQ0A 3O1OA 1ULDA 1NX9A 4QGNA 3ZYJB 3I2HA 4YM3A 1XYNA 3OB8A 2VBPA 4YW2A 1VBA1 4AXOA 3S0MA 4YVWB 2JG9B 3S7EA 3OPZA 3WF2A 4NAMA 1US3A 4N53B 3O1TA 1GUIA 2VMHA 3HPNA 4JHZA 3SEPA 1WW6A 4AEDA 5ISLA 1ND3B 5C8CA 4RGAA 2B42B 3O1VA 4XFAA 1Y9QA 4LA2A 1NUKA 2NLRA 4PT6A 2QQOA 1NQDA 3TWIA 4DNYA 2L9LA 1CX4A 3ACIA 3JCIA 3ZMNA 1ODNA 5IWFA 1TME3 3WHTA 3ZFGA 2JDZA 1RITA 1FPN2 4MOAA 3VZNA 1MVQA 3JQWA 5FYBA 4JTNA 1VBD3 3OY8B 4L97A 1ENSA 5FZ8A 3T08A 3VHRA 4AHXA 5DZGA 5FPXA 4UF0B 3U4XA 3NL1A 1L3JA 2OPKA 2GSYA 1DG6A 1UKRA 3WW3A 1F4HA 1SDDB 1RTVA 2HH9A 3KGZA 4AEDC 1JYTA 3MHZA 2HWB1 5C8CC 5FP7A 3A21A 1F35A 4X8NA 4N7IA 4NOTA 4I3GA 5B4NA 1G8WA 4BHPA 2CDOA 2EVXA 3UT0A 3ZFGC 1PIV1 4Z82A 1KFUL 5EFUA 4P5YA 2YBKA 4XQDA 2OZJA 1WA6X 5FP8A 3FJSA 4CPBA 4EJRA 2XPJA 1VRBA 1AR73 1YHFA 4JKMA 2WDBA 1PO23 2PTMA 3SKVA 5IK8A 2WAAA 2FDFA 4AE2A 3VBOA 5FYTA 3SH3A 1XSRA 2VOKA 3GF6A 4XEZA 4ZU4A 4BXSV 4ZY9A 2QZ2A 4BPZA 2P3JA 3O1RA 4Z2WA 4GMP0 2X5IC 2JIGA 1TNRA 2RS53 5JOYA 5KXDA 4XF3A 2KD7A 4PI2A 3W59A 1IGOA 5IVBA 2R7EB 2WFPA 2CWMA 1ZBE1 1QGLA 2OVUA 3CO2A 1FYUA 4ISQA 2ZZQA 4LXLA 5FP9A 2P3KA 2VZRA 1CAWA 2DWRA 3FE5A 3WG1A 4X6QB 2K46A 4AEJA 2XBO1 3U37A 4LE4A 3VBOC 2HWC3 5HV0A 4M0NA 4TTGA 4FO9A 1AR81 3MGUA 3WDYA 4NR1A 1YC61 1S2BA 5FJHA 2VCBA 3HN1A 1JYIA 3UGFA 5FYZA 1IPJA 4LBQD 2VC9A 5FPZA 2WFF2 2Z4FA 3INAA 4PQQA 4HVRA 4ONUA 3ZYIB 2AEZA 2X53S 2J1UA 3MIGA 3WINE 4G9SB 3KV5A 1RIRA 2XH6A 4NVPA 5F2WA 5LY1A 1YNAA 4LPLA 3V0AB 1ST8A 1DF0A 2VQAA 4HANA 4CP1A 1QDOA 4QPGA 1W04A 5IVYA 1EAH2 4EWAA 5FY0A 4HVQA 1RVF3 2VG9A 3ACLA 3LKJA 5JMOA 4B8EA 2WIIB 1POQA 2IXLA 3H3LA 4XVHA 2Y33A 4D6RA 5ABJA 2R061 1RUG3 1E5RA 2HWF2 2QFEA 1DQ0A 1VALA 5J48A 1C5HA 4UFJA 5LEJA 1ZNPA 2PHRA 2Y6FA 4E2SA 4OI0A 4HMZA 2BWAA 2Z5WA 5H9QA 1VRH3 5CAZA 4LR4A 1R1A1 3O1UA 4QPGC 1MQTB 2LM3A 1DYKA 4AVAA 4CDUB 4ZKTB 2QQJA 2R072 4XMAA 2Q5TA 2HKXA 3BCWA 5HBAA 2W47A 5A7WA 5BNOB 2D97A 3O12A 3Q8CA 5ABJC 1JOBA 4IV1B 2JDHA 3QLQA 5FUIA 2XJRA 2UY8A 1HJFA 1CZTA 1AX2A 2RMU3 1BLZA 4Q0UA 5FZ9A 1UX6A 5FY4A 2VBDA 3E5XA 3LQCA 1MEC2 2VO5A 4AI0A 1GNZA 2A6WA 3ST7A 3ILRA 4L8QA 3WUCA 2YDEA 1W6PB 1I1EA 2FDIA 5CZKA 1WBLA 3RPQA 4LO8A 2ORXA 2WAOA 4AGRA 1RHI2 3IIIA 4GAZA 4FFFA 2NM1A 4IEQA 1VBA3 2VQTA 1CQ9A 2ZHKA 3EXUA 4PIXA 5FZ4A 5GZDA 1L7LA 2QCSB 3KV4A 2CGPA 5BXXA 1IS5A 2FDGA 3ZN5A 3ZPYA 4CEYA 2Q4SA 3O1PA 4NIDA 1CR7A 1WCQA 1RYYA 2GU9A 4XAAA 1NA1A 2LW8A 5EJ1B 1R083 4AAPA 4BIFA 1IQAA 2DUQA 1ZA4A 1F8VA 2D5HA 4XUOA 4KL1A 1HXS1 1SCSA 2ZPXA 2D3SA 2WSVA 2VD7A 3N9LA 2NMOA 1F15A 2I45A 4HZFA 3ACHA 1GANA 4W65A 3UESA 4PF1A 3LF7A 3PTRB 3FL7A 1WW5A 1U5XA 2WO1A 4Y1VA 4XJUA 3LGRA 1MS1A 1AYM1 3AX4A 3AYAA 5ANNA 1VMFA 4CEYC 1XE7A 5EP9A 5A33A 1GSLA 2HWB3 3GHNA 1NA1C 2C9KA 1IKQA 1OF3A 2XL7A 4LHSA 5L73A 4HOOA 1V00A 4UFIA 4O9GA 1KGYA 4XW3A 2FCVA 1AR62 1W6QB 1YFXA 1D0GA 2EALA 2JG9A 1WCKA 3ALQA 3RZKA 4N53A 1PIV3 2RM21 4I0BA 3UNPA 1ND3A 2CWSA 4IEZA 1Z7S3 2ZX3A 3N36A 1FPN1 1MVEA 1XNTA 3H1YA 3IDAA 1NY72 4CCNA 1FXZA 2B4KA 1ZBA1 2IXHA 4Y1ZA 2Y0OA 2DCKA 1XPWA 1LGNA 3WP3A 5IK7A 4K6BA 5KXBA 1TQ5A 1UKGA 1LAJA 5DZEA 3LFIA 2DCTA 5FPVA 5CFCB 4ZXKA 3OY8A 2G4IA 4LHLA 2ZGPA 2PQSA 2VZTA 4IEWA 1QJX2 1W3XA 2JG9C 2DBIA 5KR7A 2EIDA 3AKSA 2R0FA 4N53C 1Y3TA 4Y4YA 2QTWB 4META 1ND3C 1K45A 2UYAA 4D7SA 5HPOA 3N4MA 1L7RA 4NIGA 5FO8B 4YM0A 2YZ4A 3IWZA 3PNAA 2IZWA 4O9EA 4LOTA 1H1AA 4W6WA 4C91A 3PL0A 2ARXA 2AEYA 3HBZA 1J84A 2HWE3 3QBQA 4L0PA 4AQ6A 4TZDA 3JBG2 1YFWA 2YBSA 1AR83 1LTEA 1W6NA 4PLOA 5FZIA 2VUCA 2OS2A 2A75A 2CTVA 2KM2A 4NHLA 1VMJA 3H42B 4CDXB 1JI6A 2UYBA 3VBUB 2JE7A 2A70A 1TMF1 2GMPA 3U0ZA 4XOGA 1V6NA 4KG0A 1JYWA 1NLRA 1OQDA 2VVEA 2YXSA 4I30A 5E89A 5FP3A 5FWEA 5I0TA 1BYHA 5T5JA 2WT0A 4LBOA 4LK7A 2PN5A 4RN5A 1S0FA 1TG7A 3FHAA 4XUPA 3VGIA 3X29B 5I0RA 1FOD1 3ZFFB 4B29A 2WQ8A 2BOJA 5FYCA 5D21A 2JD9A 2XWBB 4U2AA 1W9FA 1BBT2 1QEXA 2HYXA 3D5OA 5LEKA 4MSVA 1UO9A 5DG1A 3VDCA 2PQQA 5GLTA 5FV3A 2GN7A 3ZSEA 2ES3A 3H8XA 1V6JA 4FTBA 1AL21 4XIKA 4HN1A 1H4GA 3M70A 1GFF2 1OKOA 2BNOA 3PLQA 1VBB1 3B00A 4Q0SA 3WSOA 1C57A 3VZMA 3ZXEA 1FV2A 4NHYA 4Q4Y2 4YW6A 5KHKA 3ZN4A 4YZ2A 2ZMLA 4QDRA 4LBLA 4LULA 1J3RA 1WD3A 2QQPA 3ZSMA 1AL0G 4EWEA 2VZSA 1EAH1 5KHHA 3BU7A 2PHLA 1IPSA 3GCWA 3RFRA 1Q8PA 3V0AA 3PUAA 3JZVA 1V6KA 5E88A 4FSJA 4QQHA 4AGGA 2HWF1 1PMHX 1SLTA 3FLTA 2B45X 4B3NA 2Q1FA 4NIAA 2ZGTA 2DU1A 5K7PA 2VNOA 4ZXEA 1RXGA 3T0DA 2YV8A 1QQP2 5FY7A 3ZSKA 3LOBA 4QX1A 5CB7A 1OLQA 1YI9A 3OYWA 4YGEA 1JXNA 2PHDA 4WM8B 2NQYA 1DHKB 2Q8CA 1VE0A 1RUE2 1W90A 3IAPA 3ZXDA 4XFIA 4A42A 4FBFA 2W2IA 1N47A 3ES1A 4UFKA 4CDUA 2OKXA 3SHRA 3GALA 1CGPA 4AHZA 5BNOA 4AVBA 5GKAC 3ZYBA 4EN0A 5F5CA 4IV1A 2ZGUA 5IK4A 5JSPA 2R49A 3I8TA 1YJKA 4BK5A 1CIYA 2A3YA 1PVC1 3ITQA 1C8NA 5FMDA 4Y20B 3H8UA 4BQYA 2H0BA 2GMEA 4BB3A 5C5UA 5GZCA 2F6BA 4JX0A 5CKNA 3GZAA 2OQ6A 2W9XA 4DQAA 2DUPA 1RHI1 1ZRDA 1RC6A 1MQTC 2DCJA 2E33A 2EXHA 3NJXA 4IEVA 4BISA 4CDUC 1G9AA 4FT8A 3AMHA 5CU1A 1GZCA 1W6PA 4YW7A 3V65A 1J83A 5C3SA 1GBGA 5FZCA 4I09A 3W58A 3M3CA 5FZDA 1OUXA 1QNYA 2BUKA 2JKBA 5BNOC 3K46A 1W8WA 4HLTA 5LZ6A 5C70A 1O91A 2WNEA 4FP3A 4IV1C 5FLIA 2VMCA 1OKQA 4DPNA 5A3MA 2D6KA 4MXVA 2WR9A 3FLRA 5I0UA 3WQ7A 5A80A 2ZGNA 3IMNA 3NKGA 1YJLA 4RSUA 2Y6GA 4OHXA 5TSWA 4BXFA 1JZ3A 4FVVA 3RZLA 4IE6A 1FPN3 4ZS3A 3J4UH 1M4WA 2HBTA 3CJIB 3DGTA 5FJKA 3T4VA 3PIJA 3PDQA 3MPPG 3RQ0A 3J26N 4E2GA 2RDRA 3FFZA 1TEIA 4MH0E 4C8DA 1KEXA 4QX7A 1FT9A 3TEWA 5B2GB 2BGPA 1FMD2 1OD3A 2P2KA 2Y8KA 4NPMA 1W8HA 1W8FA 3VUOA 2P4EA 1PGL2 1FI2A 4QX8A 2GP3A 4HKWA 4PBPA 1AR61 1QXPA 4QPIB 1WD4A 1T6BX 4KGGA 4MUVA 1UOFA 4FPHA 1LR5A 3OF1A 2UWBA 2P3YA 4KBZA 3J7LA 2WO3A 3R0RA 2E7TA 3WDWA 1GNYA 1W6QA 4BQWA 3LA7A 3J8F1 1G9DA 3GZTB 1PX3A 2ZGSA 3ATGA 2JDYA 3KHCA 5JPNB 1RUC2 3UJQA 1VLNA 2PHXA 2VMIA 1LHUA 3WF0A 5JMCA 1X9PA 1MS3A 3GYDA 3WY6A 2RS12 5FYIA 3WQBA 1DDLA 1LHNA 3ZMOA 1ASJ1 1QJX1 1DQ2A 4GMP1 3VHNA 5FWJA 2ZX2A 4QM9A 3PMEA 2BERA 2QVSB 2Z79A 3HD8B 4FPOB 4XF1A 5CFCA 5GZFA 2YFZA 3U14A 2IUWA 1WCSA 2BEOA 4WVZA 1W0OA 3RWKX 3NW4A 3WR0A 5BYNA 5APAA 1MPXA 2YBPA 2D6NA 2Q30A 3A23A 5BNPB 2PAKA 1OQEA 2ZHNA 1SFPA 4YM2A 3KQ4B 1C3HA 2VCMA 1R092 5C3RA 2WLQA 2A3WA 2A6VA 4ZHNA 2I2SA 4DS0A 4CCJA 2QBXA 5CFCC 4IE4A 4LBQB 4XBNA 4LKEA 1I3HA 3W5MA 2WFF3 2YROA 1FNZA 1A8DA 3A0NA 1L7QA 1PNGA 2QQKA 2YY1A 3HR9A 2K2SA 3NMBA 4QQPA 4YW1A 3ZSJA 3AXDA 3NV4A 4CDXA 3N9QA 2BYVE 1J58A 1EY2A 4MLOA 2PHTA 4BCUA 4QXBA 3O0VA 3SITA 3OGJA 1RUH2 3OGSA 5CKMA 1EAH3 5JXIA 5T5OA 2BGCA 3P3NA 3ACFA 4GB31 3VZJA 4CSWA 4EZHA 1GWLA 3K4AA 3B94A 3WHUA 4CUCA 1KQRA 2HWF3 3MIEA 3N3HA 4XZPA 2VVFA 3WW2A 3ZFFA 3QACA 2HLEA 4AOCA 4JCKA 2VE1A 2PMWB 1FV3A 3PJYA 2GAUA 2ARCA 3ZVXA 4AFBA 4FAHA 4AWDA 3H0OA 3KCYA 3F2ZA 4GD4A 4CDXC 1E5IA 5DUXA 2BV4A 3VBUC 3ZR6A 2DBNA 1GNHA 1HB2A 4KH9A 3I2OA 4GALA 5LB6A 4Q4Y1 3VB9A 1ZREA 3WEZA 5F3EA 4JDMA 1UU6A 4XYXA 4LE3A 1NKGA 3MUY1 4YZ3A 2NYYA 4K9SA 4UW6A 3U1XA 1ALYA 1VIWB 2XGXA 4JGZB 3ZFFC 4BDVB 3POGA 5FBJA 2JG8B 4B4QA 2Y26A 2Y6LA 2A6XA 3NWKA 4LO6B 3BALA 2J1TA 3JD72 1SBFA 1MEC3 4PI0A 4KI5M 5FYSA 5I8SA 3BIEA 4MXWA 4N9IA 3WW1A 1QQP1 1OOPA 1OVSA 2OX0A 4DRRA 5KHJA 5I8YA 3T4HB 1RHI3 1HB1A 1OT5A 4UBHA 3S5QA 3AC0A 2DFBA 4IGPA 5BNQA 3MO4A 4COUA 2GC0A 2EF6A 1EUTA 1MS0A 4WM8A 1F4AA 1WMFA 1EPWA 4XTMA 3SEEA 5ACA2 2QQUA 4QDSA 1N3PA 5EV7A 5F6KA 4CRQA 4DUWA 2A6YA 4N7UA 3MV01 4RL7A 2EA7A 2Q1ZB 2VW2A 1RUNA 2OUJA 3NAPA 3POSA 4QQLA 2VUAA 4K7JA 2DTYA 4K20A 4P08A 3KT4A 1ULPA 5T3NA 1D2SA 1NAEA 5K0UB 2BGOA 3WNPA 1OHFA 1IQDC 1QMJA 3HOBA 4Y1YA 4C1WA 5C71A 2BW8A 4Y20A 4R9DA 4OUEA 4WM8C 5FZEA 5HCHA 4NUBA 5F5AA 1VAMA 2WYSA 2BZDA 4HKLA 3RI9A 3UL2A 1UZVA 5FXXA 5CG9A 3I2IA 1OC1A 2ZEZA 2XLFA 3RMXA 1J3PA 3POFA 1AR63 3RMYA 1S2EA 1UY0A 5DUUA 1H4HA 3FC0A 5AVPA 4KU7A 4YPJA 1NLSA 1X7NA 3ME2A 4HK8A 4ORFA 5FMOS 1LODA 1LENA 2P34A 1OLRA 1WKYA 2OA2A 3J7MA 5HCFA 3WZ1A 1ZYBA 3EYPA 4NRMA 2O1QA 4MGQA 1Y43B 3BKZA 4M0HA 2G19A 4UI9L 1UOJA 2JB8A 2ZAHA 3I2KA 2WWSA 4XXAA 3CJIA 3GJAA 1PGW2 1BJQA 1O5UA 1YQ6A 1ZZ9A 1UY2A 4GH4B 1KFXL 1FMD1 1ASJ3 1G86A 1QJX3 4GMP3 4MGKE 2WZR2 4RYDA 1HN1A 1WLCA 2XUEA 3LDBA 2Y6HA 1JU4A 2WJSA 5FYUA 3H8RA 4HG6B 1NG0A 4ZU7A 4CCEA 4FTSA 1S0DA 5IVFA 2XHKA 1MS9A 1DU3D 1RUG1 3M3EA 1WCDJ 1GOGA 3LEIA 2DYCA 4E2QA 1QOTA 2HWD2 2PA7A 2QQVA 3LCPA 1ZRCA 1J1TA 5FZFA 3KT7A 2XLGA 5LA9A 3ES4A 1W06A
chains in the Genus database with same CATH topology
1LRHA 4QPIA 4TYSA 1DGLA 1O5LA 3R05A 1VRH1 3CJIC 1NZCA 2RS32 3JBG3 1RUC1 3OJBA 1ZZ8A 4MGYE 4EN6B 4YGDA 2O8QA 1PGSA 1DGWX 2I07B 2D44A 4B4RA 4A7YA 1V9U1 4DB5A 4AI3A 1SBDA 2JX9A 4CZSA 3JUUA 3HAGA 4JAAA 3R4SA 3VKFC 4QPIC 1AR92 2ZGOA 1BK1A 3ZYRA 3MI8A 4Q4W2 2C5DA 3HIFA 2QDNA 3ZFEB 4AQSA 2QKDA 1RB8G 1X33A 1QJZA 3H7JA 2DF7A 2ZKLA 1BBT3 4X8PA 3S7IA 5BNPA 3D0JA 3B02A 1XU1A 2VOXA 5KXEA 4GKXA 2ZX0A 3L2HA 2ZCWA 2ILMA 3OGGA 4AI2A 4P9GA 1FNYA 1O3QA 3AP7A 1CPMA 1R1ZA 4LBQA 4Q4Y3 3WDUA 3M2MA 5JSRA 1R081 2IC1A 4YZ5A 1RUH1 2H6BA 5BNPC 4C0BA 4XJAA 3V0BB 3HQXA 1OMIA 3V64A 3FUOA 4WV8A 5GLVA 3VZKA 4FPLA 4AQTA 1KITA 4LT5A 4R9AA 1QQP3 1S0JA 1F2NA 3IIAA 1N1TA 1CAXB 3MPBA 2X5IA 1S0EA 4TLFA 3HWJA 3VKLA 3N7JA 1RUE3 3AYCA 1DIWA 2VOVA 5L7OB 1Z7S1 4IEUA 1QJU2 1Q8OA 3GBFA 1Z0HA 4AK3A 3IDCB 4GWMA 5FOJB 1VBE2 1MZFA 4UW3A 4JGZA 5FCCA 3JD71 1MS8A 2JENA 2JG8A 2V5YA 1LU1A 4GIQA 4XBLA 3MFAA 2VGDA 2XB6C 4P5HA 1CESA 1YCIA 1E57A 2ZOEB 4YVSB 4MGIE 1RL3A 1AVBA 4N90A 3V56A 2ZKNA 4RA0A 3TB0A 3WLUA 5ACA1 2HWE1 4JGZC 4GULA 3RYRA 5CIRA 2ZAAA 1W0PA 2JG8C 1HKDA 2B9UA 1QY4A 2ZHLA 4AG4A 3BOPA 1RUI2 2AREA 4GXLA 1N3QA 1AHSA 3WD5A 2NPIA 4AI1A 2W39A 4QD2A 2XJPA 5K0UA 4IXLA 1KDMA 3LAGA 1FMD3 4ISRA 1YUDA 2MHFA 4AHWA 1BVP1 2P37A 4Q4V2 1NE4A 3N7KA 4J6GA 2B5HA 1RUJ1 4CP0A 2DURA 2WS92 2MEV2 4HFSA 1NXMA 2GMMA 4XF9A 5A32B 4LA3A 4Q0QA 5KWRA 3BPZA 3SCFA 4A7ZA 4AEKA 4L92A 5GLWA 1NQJA 4D7YA 5K0UC 1RUC3 3DL3A 1QNWA 1Z78A 5J7MA 1C8M2 5JWPA 2EAAA 1PGW1 1V6LA 1OQ1A 2VNGA 3FBMA 5KHGA 1Q8QA 2UWCA 1V9U3 2WZR1 1Q8SA 4H3WA 2QJVA 3AJYA 2TUNA 4GH4A 1QJY2 2Y38A 3PMSA 3BB6A 1PO11 3WCRA 5IK5A 4HSLA 3AMQA 1SEFA 1M06G 1Q5OA 2D6PA 1PHMA 1RUD2 2R042 4W6XA 2ZGQA 1X50A 1DZTA 2GALA 4R4XA 4HPKB 4IETA 3R6SA 1IHMA 3RG0A 1R093 2OW4A 3ENRA 1LHWA 1H2KA 2OIIA 4YG0A 5FBZA 1N1YA 3IPVB 1OPMA 4GH4C 4QT6A 3ZXAC 1HLCA 3RZZA 1LGCA 3SCGA 4V1PA 1LECA 2RE9A 4H7MA 3ZN6B 1RUOA 4CDQB 1KS4A 1RUH3 4QGMA 1ND2B 2PLV1 3MIHA 1O3SA 5BNNB 2B8MA 4Q4W1 1C1LA 3EQEA 4L99A 3OD4A 1T6GC 2WT1A 2ET7A 2WQZC 4R9CA 3UKVA 3TN92 3ZFEA 4Q0VA 4JTOA 3AP5A 2WL1A 4J1XA 1LCLA 4XTPA 4PDWB 1CIWA 5DZFA 4YW5A 1LGBA 1YIPA 1F31A 4YVWA 1JTZX 4K8FA 1DYPA 1UU4A 4OHWA 5GJ6A 2D6LX 5EYXA 3E5UA 3VHPA 1S0BA 2A6ZA 3ZXJA 2RJKA 3RJRA 1GLHA 2EIGA 3ZFEC 4ASLA 2VH9A 3ZYPA 4UXAA 2W52A 1YXWA 1HRV2 3JD73 2CY6A 4FOVA 4LNVA 1ZRDA 4AGVA 4Z92B 4NHMA 3B9CA 4YVWC 3VDDB 5K9YA 4PLNA 2DCZA 2VMGA 1UZZA 1XNCA 4NWVA 1RINA 5EZWA 1LU2A 3AJZA 3AZWA 4AFAA 4FOQA 4YG3A 1XNKA 1CAXA 1LHOA 1QJU1 1JH5A 5ACA3 1XU2A 2R32A 4AVTA 5L7OA 4YGBA 5AFBA 4D3WA 4RHV2 3ILNA 4YG6A 5AC92 3EBRA 4RQPB 2VW0A 2ETEA 3E6CC 3PJQA 4P14A 1HX6A 2Q0AA 3MFCA 4WVVA 3ECQA 3RI8A 3HT2A 1O4ZA 3WG2A 2YGLA 4P9LA 2Q1MA 4XJ8A 4AI8A 4BM8A 3ZDSA 3JU9A 4Y5Z0 5L7OC 4YVSA 3AMMA 2D43A 1GV9A 2BQPA 5T55A 4Z1VA 3K51A 1RUJ3 3DPRB 4YW4A 4HK9A 2ZBJA 1AF9A 1RUI1 2UURA 1SLLA 3MIFA 2ARBA 4DMIA 1HW5A 2WFF1 2EAKA 4KWKA 1RUF2 2IWGB 3S6PA 3CF6E 5C8WA 3LA2A 3MLKA 4YLZA 4KU8A 4H7LA 3O0XA 2WNUB 3M3IA 2Y0IA 4YVSC 4Q29A 4BLIA 2B46X 2WZR3 4Q4V1 3POYA 3AK0A 2CGNA 3ZXLA 2GC2A 4TWTA 2FMYA 1PO13 3AYDA 3TNPB 1YRZA 2IFRA 4F7ZA 1HRI2 2MEV1 3AP9A 4L9BA 1WMEA 1O4YA 4IEPA 2G9GA 1U5IA 4LO7A 5A32A 1HQLA 1WUVA 4JC1A 3DV8A 1UMZA 2R071 3OTFA 4H55A 4Q4X2 4I02A 3C3VA 1MQTA 2K0GA 5JAXA 1U0AA 1HIXA 1DBNA 1QJY1 2GZWA 4IEXA 4OUSA 1KDKA 4G3YC 5JOWA 2BNMA 1AR93 2D3PA 2W08A 2TBVA 4QQ2A 1MEC1 2PLV3 1AUYA 1PZ7A 3OD0A 2WKKA 4P9IA 4Q4W3 4M00A 4BMEA 3E97A 5DXDA 2RHPA 5GLUA 4HETA 1LESA 4QMAA 2P3IA 4X6RB 1OA2A 1CN1A 4RD7A 5JZGB 4HPKA 1LOEA 2YPJA 1PO22 3MICA 3IPVA 1C5IA 3M1HA 1CD3G 1DGRA 3OBTA 4LLFA 4XJZA 5HI0A 4LBKA 5DDJ2 1EV12 1VAKA 2D7FA 5SV5A 5F5QA 1EYBA 4DZGA 4CDQA 4DFSA 1SFYA 4PLMA 3BODA 1ND2A 1WW4A 3H3ZA 4EWDA 5BNNA 3RYKA 1AXYA 3TN91 4CDWB 2V73A 3UKTA 2D6MA 4OFGA 4FP2A 4ES9A 3H1MA 4FPEA 3APBA 3VKOA 4HSJA 2OUHA 1G6NA 3IKWA 1A6CA 2AYHA 4P9YA 4D69A 4PDWA 4CDQC 2W68A 4IEYA 2JEMA 4KWJA 1D4M2 1GKBA 1ND2C 1A3KA 1F5FA 1QJU3 5BNNC 4PF5A 3I2DA 4RFT0 1NY71 5BY5A 4B7KA 1H30A 1PK6B 2VULA 1VBE3 4MV2A 3ASIA 2E7QA 1BMV2 4YSFA 3A0KA 2ZGKA 3WG3A 1RVF2 1J1LA 1ENQA 1G9FA 1O4TA 5F6LB 4R52A 4IQPA 2ZGLA 4PDWC 1QOOA 3CLPA 4XHBA 3TNQA 1RJ7A 1XNBA 3CU7A 3VDDA 3AKTA 4QX5A 1LOAA 1LOCA 1RMU2 1D4VB 2EXIA 4AFDA 3AFKA 3JBG1 5A3LA 3MYXA 4P9XA 4F8AA 4XFCA 3WDVA 3RS6A 5AC91 5IUQA 1RUI3 4ES8A 4FXGB 1XYPA 5J36A 3VDDC 3WCSA 2CNAA 4RQPA 4K21A 2BNNA 3KM5A 3IT8A 4LBMA 4Z8BA 4WZFA 4FPCA 3VBUA 1CAVB 1U12A 1H9PA 2D98A 3M4FA 4PQ9A 4WZCA 2AR6A 1XQNA 1FX5A 2CAUA 3USSA 2CYFA 4FOYA 1DGWA 4Q4V3 1LHVA 1BBT1 4Y24A 2ZMKA 2YC0A 2E9QA 3MW2A 1QOSA 2MEV3 3OCPA 4IV3B 3ZYGA 1DZQA 4OHYA 1EP0A 1S2KA 4RQPC 3O0WA 4RR3B 3DPRA 2FZ2A 4XFBA 3B7MA 3GNEA 1RUF1 4IESA 1ULFA 4HBNA 4QHBA 3LSDA 4SBVA 1AJKA 3WNXA 3RYPA 2R073 3A4UA 3ILFA 4M01A 4XJWA 3WV6A 2WNUA 2UY9A 1ONAA 3VL8A 1JYCA 1XXNA 1QJY3 1REDA 1MR5A 4HL0A 3ELNA 3MF9A 3H9AA 1CPNA 5JVVA 1YFUA 5EYYA 1HRI1 1Y7BA 3DPRC 4XMIA 2RR12 1RUD3 2XKPA 4LLOA 3TRSB 5AVAA 5KHIA 5CG8A 1ULCA 5T5LA 3WDXA 1H0BA 3VBSB 4J1WA 2F4PA 4AVCA 5GALA 5JLVA 2WNUC 1AXZA 1BXHA 1RUE1 1XNDA 3FMGA 1C1FA 2PAMA 2Z2SB 3R4DB 4AFMA 1ZZ7A 2DVGA 5I93A 4M3CB 1D2QA 4BWOA 1OA4A 4OI4A 4YRDA 1H2MA 3VL9A 2PYTA 2H6CA 5DG2A 1G9BA 2KA3A 4P9JA 1ZBE2 1GZ9A 3G6JB 3TN93 1Q8VA 2GC1A 4FPJA 4L11A 4E4DX 2DCYA 2XBO2 1WLTA 3CL1A 3N35A 1HQNA 1W2UA 2X29A 3H50A 1I6XA 2A7AA 4S2HA 5JZGA 2K9ZA 4QM8A 1F5JA 2WLPA 4EN8B 3D0SA 5LK7B 4JVAA 1KJLA 5JR7B 5DDJ1 2NP0A 1EV11 1LKNA 4LTAA 5CNAA 4PIZA 4AFCA 1HQWA 5FMOL 5GLZA 1GR3A 2P17A 1POV0 1SQ4A 2ZX1A 4XDQA 4HKOA 1QWRA 1G7YA 1F9KA 4Q8LA 1FATA 4QGLA 2BTVC 1VP6A 4FOWA 3WVJA 5JZGC 4DINB 2V09A 2X8KA 4NPRA 2XJUA 3WXPA 3SH4A 1PGL1 3RJ2X 3WDTA 4CDWA 2R062 2DTWA 5BUVA 1AXKA 3G7DA 3TOJA 4TSVA 3VLBB 4QPYA 4R4ZA 3D8CA 1B09A 3VZOA 4C1XA 5JSOA 4D94A 1S1AA 1D4M1 1QXRA 1R1A2 4XXPA 2WC2A 2ZACA 4LBJA 3B9IA 2ZJCA 2LUWA 4Q0PA 5FLJA 1NYWA 3MF6A 4KG8A 1ENRA 5JI7A 4RHV3 1REFA 1DQ1A 5AC93 3M3QA 2RS11 1BEV2 4UBGA 1PK6A 4CDWC 3KCXA 3OBRA 3KB5A 2A5ZA 4HN0A 4Y1XA 3LB9A 5FFOC 2FHRA 2ZZJA 4AW7A 1IPKA 2JJ6A 3MZHA 1HV0A 2HYKA 2D40A 4K1YA 4INDA 2DFCA 1PK6C 1R091 2ZHMA 1NCRB 1A78A 2VW1A 3VBFB 2VQ0A 2VOWA 3FHIB 3RRDA 5FO7B 3IDBB 1RUF3 1N1VA 4FAGA 5C9AB 1VAVA 3T1LA 1I9RA 1HXS2 2O8OA 1QU0A 3B5LB 3B3QE 3IN9A 1GICA 4XIOA 4P9WA 4LO4B 3NO8A 1JOJA 1X8EA 1SBEA 1CAVA 4EN7B 1MZ6A 1XYOA 3ZX7A 1OI6A 1LB2A 2QNKA 4U36A 1AYM2 3WQ1A 1DQ6A 2DVBA 4GA9A 3U11A 1HRI3 3CJXA 5CA6A 4BQ1A 4YM1A 4BOWA 5FDBA 2YMZA 3W9AA 3SMHA 1BZWA 3QH6A 4IV3A 2VY0A 1NCQB 2TNFA 5FRAA 4RR3A 3WOGA 2VVDA 2QDRA 4AF9A 2RM22 3L2YA 2HJIA 1O3TA 1GZWB 4Q27A 1QHDA 1TE1B 4FQZA 4Q4X3 4UW5A 1LEMA 3N7MA 1WBFA 5JDBA 1KRIA 3M7AA 1ZBA2 4FQ4A 1PVXA 2MPFA 4BE3A 2PHFA 3I4IA 4XF0A 4KNCA 5T5PA 1VB4A 1LJ7A 2RR11 4IV3C 3DKWA 1LOBA 4L2NA 3WT3A 3FZ3A 4RR3C 1YIFA 4DY3A 1HDKA 5H9SA 4BYYA 4E4ZA 4F83A 1W6NB 1SLBA 4E9KA 1JN2P 3TBDA 3VBSA 4UW4A 3ETQA 2FBEA 2XKOA 2DVAA 3M8LA 2R1DA 3GBWA 3D82A 3QOPA 1V6MA 1ZVFA 4QU2A 4NWWA 4BH9A 1H2NA 2CL2A 4N9HA 4LUKA 4Z07A 1WLWA 4JGYB 5DDJ3 1EV13 3UKNA 1MS4A 5HCAA 1TMF2 4M3CA 1DFQA 5BPXA 1QDCA 4A7KA 3I7DA 4MVTA 4QXKA 4YGCA 2IXJA 3VBSC 4IEOA 4I0WB 1DZRA 4I3PA 4KGQA 1FOD2 2W0XA 2HEVF 4FPFA 2WT2A 2AH2A 1U5YA 5T52A 4FXKB 4MYEA 4K40A 1BKZA 2VUJA 1ZZCA 5FREA 4KL1A 2TEPA 1BQPA 3FLPA 1AL22 2BFUS 2GH2A 1AX1A 4NHKA 4XFGA 3USUB 3WR0A 1D4M3 4COVA 2CV6A 2N7GA 2BFUL 2CAVA 3AFGA 1VBB2 5D1IA 2ZA9A 5KC6A 3O5SA 1YI7A 1FAYA 3VN4A 3ZN4A 3RSJA 2LTNA 2IXIA 2R1BA 4OLLA 4W6YA 3AZYA 4PJYA 5I91A 1I5ZA 2RS13 4JDNA 4JDOA 1H8TB 4AYUA 1QF3A 3WUDA 1APNA 2A71A 1VB2A 2BVVA 3OYWB 4MZUA 5JIAA 4HVOA 1AZDA 4Q8KA 2HWD1 1NXD1 1RMU3 1S55A 2E53A 3SISA 4RS5B 1WW7A 1C28A 2PHWA 1J59A 2RS31 3AMPA 2ZABA 2C1FA 5L19A 3AKRA 1BEV1 4G4FA 1SLCA 2GNBA 5JPMB 1V6IA 5EXOA 4C90A 5T50A 3KD4A 5J96B 4OHVA 3SH5A 4MX3A 3JB4C 1AR91 1PVC2 3KZ4C 3THPA 1WA4A 1UCXA 1LULA 5D8AB 3D4KA 5JOXA 3BTAA 1O3RA 5H9PA 1MZ5A 2B39A 2A73B 4NO4A 3KGLA 1ZRFA 1JW6A 1IS6A 2D3RA 4CEWB 4XILA 4ZU5A 3TAYA 4AVVA 1NCRA 3C2UA 3VV1A 4FPGA 4YFZA 3EJKA 5EWSA 1ZZ6A 3VBFA 1S0IA 3SNMA 3GHMA 4XETA 5F9TA 2ET1A 5JOZA 3VBRB 5C9AA 3VZLA 4S2FA 5LK5A 2UU8A 3WW4A 3QCWA 2ERFA 4LO5B 1OFNA 5HCBA 1K5MB 3VKMA 1NCRC 2EXJA 3O7OA 2RR13 2QUOA 3V0BA 1AYN2 1NE6A 4BLJA 3VKNA 3VBFC 4Q1PA 3SLIA 4KBBA 4XQWA 2DVFA 3ROUA 2XLAA 1AJOA 2DVDA 2Z42A 5KBFA 5C9AC 3H3UA 3VBHB 3ZIWA 1ULGA 3P3PA 1NCQA 4XFHA 1SLIA 3J8F2 3T2TA 5C6CA 2ZTNA 1PM7A 2XJVA 3PTYA 4EV0A 3NVCA 1GZWA 4SLIA 3WG4A 1VBE1 3AZXA 3RNSA 2BPA2 1D0HA 5H9RA 2PFWA 4OI1A 1ASJ2 2IXKA 1MS5A 1COV2 4LEJA 2AUYA 2GDFA 2JECA 4I0AA 3NJZA 1ZBE3 2MNGA 2R6QA 3UV9A 1NCQC 2DUOA 3NKTA 1UZYA 1VJ2A 4OULA 2XBO3 1ZZBA 5FLHA 1CAUB 4QQOA 4COZA 1IZ3A 1CONA 5SV8A 3LSEA 3AP6A 1Q56A 3KMHA 3QD6A 5AFEA 1B35B 3UK9A 4M3CE 5I0SA 3IDEA 3J9SA 5F1RA 2OYZA 4RGGA 4XPVA 4AHYA 1RGSA 1POV1 2GNDA 3QH7A 4JGYA 5CFDB 1PNFA 3MW3A 4Y22B 1PZ9A 1UIJA 4PIYA 2B7YA 1QXJA 2C9AA 1VBC2 4JV4A 1VR3A 4GB32 2WZPP 1WGPA 4YW3A 2FQPA 4K3UA 3CEWA 1ENXA 2R063 5C33A 3MEPA 4BA6A 4AEMA 1MZEA 3AP4A 2WS91 1LOFA 2HWD3 1V6OA 3NV2A 4JGYC 3ZSLA 2UWAA 1CJDA 1WLDA 4H14A 1R1A3 3GZUC 2YHJA 3AB0A 2NN8A 2RS33 3USUA 4XQ4A 1QH6A 4DXZA 4I2OA 1C8M1 2AENA 1TME2 1BEV3 4YFWA 3PVNA 1SLAA 1UW8A 2C0ZA 4JRLA 3FFQA 1VBD2 3FWEA 4MXWB 4WM7B 1EPZA 4XBQA 3DUIA 1LOFC 1OOPB 1H8TA 1JUHA 1UPIA 2R0HA 2ZMNA 1ZM1A 3WP5A 4IERA 2WA3A 5CADA 2EXKA 4ATFA 1DQ5A 1OA3A 1RUD1 1H1IA 2R041 3KCCA 2LALA 1DGRN 4BZ4A 1QKQA 3AXEA 4N43B 2D6OX 4RS5A 2XL9A 4XHXA 4COYA 1TNFA 2GNMA 2BVBA 5LRRA 1J3QA 3LZZA 1LOGA 1H8TC 3Q9OA 5C4WB 1AR72 2GH8A 3LWCA 3NAPB 3GBGA 3I59B 3R4UA 1RJ8A 2R16A 1DQ4A 2G9FA 1HXS3 4XF4A 4RS5C 2RS52 3ZN6A 3N7LA 3UJOA 5D8AA 1YLLA 1AYM3 2Z69A 2WQ4A 3M3OA 3K48A 1JHNA 1OFSA 4R9BA 1H9WA 4FPKA 5J09A 1JUIA 1UF2C 1SACA 1H8VA 2HWC2 2XUMA 4ITCA 4CEWA 4D7TA 1SFNA 4AVSA 2E63A 2RM23 5D8AC 4WVMB 3AM2A 1ZBA3 1IOAA 2CGOA 2PELA 1SDWA 3VBRA 1W6MB 5GM0A 1MACA 3EO6A 2AZ5A 2VECA 1HRV1 1U5ZA 2DU0A 2WNVB 3DN7A 4CEWC 2VPVA 1N1SA 3B69A 5LRSA 3AKQA 1AYN1 1JBCA 2VU9A 4GWNA 1K5MA 5T54A 5KXCA 2XVKA 3MDPA 2ENRA 1RUG2 3MLLA 4BMBA 3U10A 2R30A 1BVVA 1IS3A 4I01A 5I8TA 2ZGMA 1REEA 1VRH2 1W6OB 4OHZA 3VBRC 3VBHA 5GZGA 2GC3A 4KQ7A 3KT1A 2BBVA 3MIDA 1A8MA 3RDIA 3S30A 1K5MC 4RHV1 3D6EA 1V9U2 1COV1 1TMF3 2GN3A 3ZXGA 1OD5A 4KWLA 4JQRA 1DLLA 1POV3 5BV6A 4S2DA 2RMU2 4XE9A 1URXA 4OI2A 4NN0A 3NV3A 3SCHA 1YYNA 3IBMA 1SCRA 1KJRA 3VBHC 1O7FA 5FQ0B 4WBBA 5CBLA 1FOD3 3IM0A 3POWA 3I54A 2FZ1A 3E6BA 4R8HA 4B4PA 2SBAA 3KLSA 4YZ1A 4COWA 3HT1A 4F3JA 5DUWA 1CAUA 3ZO0B 2YYOA 4AEDB 2WS93 1KXGA 1VBA2 5C8CB 1AL23 1YO8A 2I74A 4PBOA 1IS4A 2NZ9A 2XJTA 5J37A 1VBB3 1UN1A 1B35A 1UIKA 1XE8A 3ZFGB 1R082 3NV1A 5JIUA 3AKPA 2XWJB 1C8M3 1VBC1 4OUMA 3WP4A 3LOIA 5CFDA 1BCXA 4CYDA 2YGMA 2H0VA 4LHNA 2ZS6B 4Y22A 4YARA 4Q26A 1ZRRA 3AMNA 3ZIXA 4DY5A 4M3CF 5JI9A 3PVOA 3E6DA 2XJSA 1KS5A 1H2LA 4GKYA 4K1ZA 4URTA 1B35C 2X5IB 2HWB2 1SMVA 2VXRA 3WX5A 2KXLA 3AZZA 2E7AA 4B7EA 2R043 2WSUA 4CP2A 1KD7A 5CFDC 2QE3A 5FO9B 1YWKA 1ULEA 1S0GA 2OZ6A 3MLJA 1PIV2 3TYJA 4PCRA 4YYOA 4Q1RA 2IFWA 1TME1 1Z7S2 5E1RA 4HT1T 3VBOB 4Q4X1 2PHUA 1GQGA 1H1MA 1VBD1 3WQ0A 2XVGA 3PHMA 4YZ4A 3B01A 4IL7A 2NMNA 5FTTC 1PVC3 1PZ8A 4FTEA 4WM7A 1X8MA 3THTA 1W39A 1UU5A 4Q2FA 1V70A 1UD1A 4ATEA 1CAWB 2RJLA 3LA3A 3HMYA 4FPYA 3H7YA 5CVRA 2PAEA 3E5QA 4Y26A 3MIBA 1Q3EA 2ATFA 1YFYA 2WINB 3KSCA 4N43A 1Q43A 2JE9A 4LBNA 2HWE2 1AR71 3FUQA 1PO21 1AR82 4MGZE 4WM7C 3RWNA 3SXWA 1OOPC 4AQ2A 5C4WA 3AYEA 1GYKA 4YNIA 3I59A 5FAXA 3URFA 1X82A 4DRVA 2RS51 3WP6A 3DF0A 4OVEA 4DOUA 3PVBB 4FCAA 4QPGB 3T1MA 3MW4A 5K8SA 3KS7A 4LUMA 4N43C 1PMIA 3KQRA 3EHKA 2XJQA 1QH7A 1UAIA 2IXCA 1XRUA 1UPSA 1HRV3 5ABJB 3PVEA 3H1WA 4EN9B 1AYN3 3ZXFA 3O14A 2HWC1 3NSTA 5C4WC 4CTEA 2SLIA 1RUJ2 2JD4A 3NAPC 1HV1A 5EJ3A 1UL9A 3AZVA 3VHOA 2QZ3A 2HEWF 2WA4A 2E6VA 5GZEA 4A3XA 4E27A 3J8F3 1NOVA 2YUEA 4JRAA 2ZX4A 2O0OA 5E16A 5JCTA 4BIOA 2D93A 4LHKA 5IT6A 2A3XA 2VNRA 4WVMA 1BMV1 4OZXA 4EROA 2JICA 1RVF1 1COV3 1LEDA 3FBYA 5KC5A 1W6MA 3L9JT 5J98B 3U07A 1OSGA 5HXVA 2WNVA 2DV9A 4XFFA 1PO12 1ZX5A 1OPOA 4GQ7A 2FMDA 5DUVA 1RMU1 1AX0A 1G9CA 2XG3A 4S2GA 1IKPA 2HEYF 2D5FA 4WVWA 1W6OA 4Y1UA 4CEYB 1S0CA 3JB8A 2XVLA 1NA1B 4A2UA 1N3OA 4ASMB 2BWCA 2WNVC 1WMDA 2E51A 2AGSA 5FOBB 2RMU1 4XJ9A 4C0HA 5E8AA 3JQXA 1X36A 3BOWA 1VBC3 2PLV2 3CNAA 1GQHA 4GB33 1C4RA 2JXAA 4E4SA 1CJPA 2GNTA 1CVNA 2ZGRA 2Q8OA 3FX3A 5A33B 5FQ0A 3BIWE 3B93A 3ZXKA 1ULDA 4QGNA 3ZYJB 4YM3A 1XYNA 4AXOA 4YW2A 3S0MA 1VBA1 4YVWB 2JG9B 3S7EA 3OPZA 4N53B 2VMHA 1WW6A 4AEDA 1ND3B 5C8CA 4RGAA 2B42B 4XFAA 1Y9QA 4LA2A 2NLRA 1NQDA 3TWIA 4DNYA 1CX4A 3JCIA 3ZMNA 1TME3 3WHTA 3ZFGA 2JDZA 1RITA 1FPN2 3VZNA 1MVQA 3JQWA 4JTNA 1VBD3 3OY8B 4L97A 1ENSA 3VHRA 5FPXA 4AHXA 5DZGA 3U4XA 3NL1A 1L3JA 2OPKA 2GSYA 1DG6A 1UKRA 3WW3A 3KGZA 1RTVA 4AEDC 2HWB1 5C8CC 4X8NA 4N7IA 4NOTA 4I3GA 1G8WA 4BHPA 2EVXA 3ZFGC 1PIV1 4Z82A 1KFUL 5EFUA 4XQDA 2OZJA 3FJSA 2XPJA 4EJRA 1AR73 1YHFA 1PO23 2PTMA 5IK8A 4AE2A 3VBOA 3SH3A 2VOKA 3GF6A 4XEZA 4ZU4A 2QZ2A 4BPZA 2P3JA 4Z2WA 4GMP0 2X5IC 1TNRA 2RS53 5JOYA 5KXDA 4XF3A 3W59A 1IGOA 2WFPA 2CWMA 2OVUA 1QGLA 1ZBE1 3CO2A 1FYUA 4ISQA 2ZZQA 2P3KA 1CAWA 2DWRA 3FE5A 3WG1A 4X6QB 4AEJA 2XBO1 4LE4A 3VBOC 2HWC3 4M0NA 4FO9A 1AR81 3MGUA 3WDYA 4NR1A 1S2BA 3HN1A 1JYIA 1IPJA 4LBQD 5FPZA 2WFF2 3INAA 4HVRA 4ONUA 3ZYIB 3MIGA 2X53S 3WINE 4G9SB 1RIRA 2XH6A 4NVPA 1YNAA 3V0AB 1DF0A 2VQAA 4HANA 4CP1A 1QDOA 4QPGA 4EWAA 1EAH2 4HVQA 1RVF3 2VG9A 3ACLA 3LKJA 4B8EA 2WIIB 2IXLA 5ABJA 2R061 1RUG3 2HWF2 2QFEA 1DQ0A 1VALA 5J48A 1C5HA 5LEJA 1ZNPA 2PHRA 4OI0A 4E2SA 4HMZA 2BWAA 2Z5WA 5H9QA 1VRH3 5CAZA 4LR4A 1R1A1 4QPGC 1MQTB 2LM3A 1DYKA 4AVAA 4CDUB 4ZKTB 2R072 4XMAA 2Q5TA 2HKXA 3BCWA 5HBAA 5BNOB 2D97A 3O12A 5ABJC 4IV1B 3QLQA 2XJRA 2UY8A 1AX2A 2RMU3 4Q0UA 1UX6A 3E5XA 1MEC2 4AI0A 1GNZA 2A6WA 3ST7A 3ILRA 4L8QA 3WUCA 2YDEA 1W6PB 1I1EA 1WBLA 3RPQA 4LO8A 4AGRA 1RHI2 2NM1A 4IEQA 1VBA3 1CQ9A 2ZHKA 3EXUA 4PIXA 5GZDA 2CGPA 2QCSB 5BXXA 1IS5A 3ZN5A 3ZPYA 4CEYA 2Q4SA 1CR7A