1GNZA

Lectin i-b4 from griffonia simplicifolia (gs i-b4)metal free form
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
236
structure length
236
Chain Sequence
SVSFTFPNFWSDVEDSIIFQGDANTTAGTLQLCKTNQYGTPLQWSAGRALYSDPVQLWDNKTESVASFYTEFTFFLKITGNGPADGLAFFLAPPDSDVKDAGEYLGLFNKSTATQPSKNQVVAVEFDTWTNPNFPEPSYRHIGINVNSIVSVATKRWEDSDIFSGKIATARISYDGSAEILTVVLSYPDGSDYILSHSVDMRQNLPESVRVGISASTGNNQFLTVYILSWRFSSNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Isolectins I-A and I-B of Griffonia (Bandeiraea) Simplicifolia. Crystal Structure of Metal-Free Gs I-B(4) and Molecular Basis for Metal Binding and Monosaccharide Specificity.
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords GSI-B4 ISOLECTIN
total genus 50
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2001-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1gnzA00
5DZGA 1IS4A 3USUB 1SLLA 1WCSA 3FUQA 2ZMLA 3SISA 4F83A 2DVGA 5KXBA 1I3HA 4XJZA 4PCRA 2E7TA 2WSVA 3AYAA 4WVVA 5GLZA 3TB0A 1HKDA 5SV8A 2ZGPA 2VW1A 4R9BA 2GMMA 1AVBA 2BQPA 1O4YA 2A3YA 2D3RA 1QOSA 3AZWA 2FMDA 2DUOA 3IN9A 1LHOA 2DVAA 2GALA 4XMAA 2DURA 5F5QA 2YXSA 4HL0A 4GWNA 3ASIA 2UWBA 4Y1VA 4BM8A 2EIGA 5FREA 1G9AA 2GN3A 2ZHKA 3PVOA 2A6VA 4YLZA 3FFZA 3WDUA 4Q8LA 5CNAA 1GKBA 1W0OA 2G4IA 3IKWA 1LULA 3M3EA 3I8TA 1CQ9A 1YYNA 1RITA 5IK8A 1V6OA 1F31A 1GICA 4Q1PA 5IK5A 1N1TA 3N7LA 1LU2A 4Y1YA 2D44A 3WDWA 3WLUA 4AGVA 5T5OA 2ZGNA 1N1YA 4M00A 1BQPA 1GZWA 3WG3A 2PHWA 3PJQA 4GKYA 3ZXLA 2E7QA 3ZPYA 4M3CB 1DFQA 2AH2A 1N1VA 5H9QA 4FOQA 2ARXA 2C5DA 4YZ2A 1YI7A 5CA6A 4LBNA 2A5ZA 4M3CA 1GANA 1QKQA 1LENA 4YZ5A 4XYXA 4K1ZA 4FPGA 4WVWA 4XBNA 1ULEA 2GDFA 3M2MA 1VLNA 4ZKTB 3WOGA 1SLBA 1BXHA 1C57A 1D0HA 2CTVA 2WJSA 1A8DA 2AREA 3R4UA 1CPMA 1DQ1A 1YRZA 4YM2A 2WLQA 2A6XA 3OGGA 5GM0A 1V6NA 1OFSA 1GBGA 1W6PB 4FPJA 2WKKA 5GLUA 4AVSA 1QDCA 3OJBA 1S0DA 3SH3A 4Q27A 3AYCA 4XE9A 1LHUA 5JLVA 5EYXA 1N1SA 3AJZA 4IQPA 4YM0A 1GZ9A 4LBQB 1A78A 4WV8A 4YW4A 1GSLA 4FOVA 4CZSA 4P9YA 2DUPA 3RQ0A 3VKNA 2EXJA 4FVVA 2A3WA 1KRIA 3PMEA 2ZHMA 2JD4A 3WV6A 4TYSA 3ILRA 1XQNA 3A0NA 1W0PA 2WNEA 3FUOA 2D6MA 4AGRA 2D6PA 1MS1A 4NOTA 5T5PA 2W39A 2OW4A 2V5YA 2ZKNA 4YGEA 2LTNA 4YZ1A 2D6OX 2ZHLA 4LBMA 3POSA 3ENRA 2NZ9A 3POYA 3T2TA 1MS9A 1FV3A 1WW7A 3OBRA 4FOWA 1MS8A 1VALA 3O5SA 3OY8A 2DUQA 3ZXJA 4P14A 4C1WA 1LU1A 1FAYA 1GZWB 1V00A 2DV9A 4XBLA 4CRQA 4M01A 4SLIA 1FATA 2AGSA 5DZEA 3HN1A 3LSEA 2NN8A 1V6MA 1BYHA 3AXEA 4AWDA 1DLLA 2OVUA 2JE9A 2CY6A 3R05A 3N36A 1LECA 1UKGA 2GNBA 2AYHA 5CAZA 1KJRA 5T50A 3WDVA 3DUIA 3IPVA 3AP5A 3AP7A 3OYWA 4DRVA 5DUVA 5EWSA 1O4ZA 2A3XA 3BIWE 3OBTA 1SLIA 2AUYA 3OYWB 3WNXA 3V0BB 1FNZA 4DS0A 3O12A 1DHKB 2CWSA 4RL7A 3WUCA 2ZACA 4Y1XA 2A75A 2D6KA 2ZMNA 3AYEA 5L73A 5HCBA 3VV1A 1GNHA 3WCSA 3APBA 5GZEA 3ZYPA 1CVNA 3RMXA 1WW5A 1JHNA 2WT1A 2XG3A 4ISQA 4K1YA 1W6MB 1SCSA 2PHTA 3B9CA 2W68A 2ZGUA 4L8QA 2VU9A 2EALA 5HCAA 2ZHNA 3BTAA 4FPHA 1JOJA 2NMNA 1DYPA 1FX5A 1W6NA 4XXAA 3T1MA 1PZ9A 3FLRA 3SH4A 4YW5A 3WG1A 4UW5A 1V6KA 2JECA 4Y26A 4Q26A 1MS5A 3BODA 1SBFA 1DIWA 2GMPA 1AX2A 1LTEA 4YG3A 5CB7A 4TZDA 1N3OA 2GN7A 1VAVA 4FPKA 1QNWA 4YG0A 1W6OA 1NXD1 4JCKA 3I4IA 1MZ6A 4ATEA 3ZXKA 1QNYA 4WZFA 5DXDA 2PHUA 3ZSLA 5GALA 4JRAA 4GALA 4R9DA 1HQLA 1LOEA 2D6NA 3WDYA 4YFWA 1KDKA 2NMOA 4R9AA 1ULGA 2D43A 2YMZA 4BQ1A 2E6VA 4XBQA 2P2KA 1AXYA 2NYYA 3H0OA 3TAYA 4XJ9A 3NWKA 4GXLA 3UJQA 4LBQD 1MS0A 2ZGOA 4XDQA 3ZSMA 1YIFA 3RMYA 3N3HA 3ZYRA 1ENRA 2GNMA 2ZAAA 3V65A 1G86A 1CIWA 3IM0A 4GWMA 3WG2A 4Q8KA 1WBFA 5GJ6A 1H30A 2ENRA 3CNAA 3QLQA 3ZSJA 4ATFA 1S0BA 3ZXFA 1LOBA 1GLHA 4W65A 3POWA 1JBCA 1R1ZA 1IOAA 4LBKA 1LODA 5GLWA 1S1AA 3VKFC 5E8AA 2ZMKA 1SBDA 4XJUA 1CJPA 2UU8A 1WW4A 1MZ5A 4M3CF 1FNYA 4RA0A 2ES3A 1JUIA 1CONA 2D3SA 5E88A 2GNDA 2D3PA 1GV9A 2A6YA 3Q9OA 1AX0A 2DVDA 4FQZA 4K21A 4Q2FA 2E51A 2VXRA 4CTEA 1MR5A 3RRDA 1S0IA 1X50A 3AP4A 5IT6A 1WLWA 4BMBA 1ULFA 3FBYA 1KDMA 4P9WA 1IS6A 4YG6A 2DWRA 4U36A 1Q8PA 1QMJA 4FPLA 1G9DA 1DZQA 5E89A 1JXNA 1LCLA 1URXA 2JDZA 2YV8A 3AJYA 1GYKA 3B00A 1ULCA 1Q8QA 2DVBA 1PZ8A 1A3KA 1H9PA 3FLTA 1W6NB 1RINA 1W6MA 2UWCA 3HR9A 3MW4A 4YM3A 1V6LA 4DQAA 1DGLA 5BYNA 5GZGA 3AK0A 3AX4A 5GZDA 3OPZA 3AXDA 5DG2A 2NP0A 3MW2A 5DUXA 2ZGRA 4XHBA 4Y22A 4YZ4A 3N35A 4XHXA 1KITA 4AVVA 1S0CA 4Q1RA 1CN1A 2YROA 4GKXA 4PF5A 2PHRA 4ITCA 5EXOA 4I30A 4Y24A 4FP2A 3NV2A 2DU1A 1TEIA 1VAMA 2DTWA 3BOPA 3W58A 2VW2A 2ERFA 2ZGMA 2KM2A 2JKBA 3MPPG 5JMCA 1IKPA 1MVQA 3SH5A 3JU9A 3A4UA 4XJ8A 4GA9A 4YGDA 3HMYA 4YM1A 5CBLA 4FPEA 4YW3A 2JE7A 4LBJA 1AJKA 2Z42A 1CPNA 1SCRA 3DGTA 2WQZC 4C1XA 1IS3A 1WLDA 5JDBA 2DU0A 5KXDA 1IKQA 1LGNA 3T1LA 4M3CE 2ZGKA 1BZWA 2ZGSA 4AYUA 4DRRA 3O0VA 3NV3A 3FLPA 1Q56A 3PVNA 3B01A 3M1HA 1LOFC 1JYCA 2TEPA 5DZFA 4R9CA 4YW1A 3WDTA 3ZVXA 1PZ7A 1SLAA 1W6QA 3M3CA 2ZZJA 1DQ4A 4Y20B 4FPFA 4XOGA 5DUUA 3WHUA 1UAIA 3O0XA 1G7YA 2A6WA 1LJ7A 1UN1A 4XMIA 1G8WA 1ULDA 3LSDA 2VW0A 2ZGLA 3V64A 1UX6A 4XZPA 3WUDA 3IMNA 4FP3A 3VKMA 3KM5A 5IK4A 1W6PA 3SITA 3WHTA 1B09A 1SFYA 2WT0A 3WZ1A 5H9SA 1Q8SA 3GALA 5JOWA 1FYUA 1HQWA 2R0FA 1OQ1A 4FQ4A 5KXEA 1HLCA 1Z0HA 2GNTA 4UW4A 4AGGA 1LOAA 4UW6A 4XIKA 1WD4A 1LHNA 1JW6A 1KQRA 2PHFA 3INAA 2PELA 2A71A 4P9XA 1DQ6A 2SLIA 1G9BA 4XIOA 2Q5TA 2EXIA 4ISRA 1V6IA 1CESA 3ILNA 5JVVA 1F5FA 4BPZA 2P3JA 3OY8B 3UK9A 2C9AA 2EXKA 3VKLA 1G9FA 1C4RA 1LEDA 1ONAA 4HANA 5JOYA 5KXCA 1WLCA 1DQ5A 2R0HA 2ZBJA 1C1FA 3AZVA 2VUAA 3USUA 4ASMB 1QU0A 1BJQA 1CR7A 2VY0A 2PHXA 3AYDA 1V6JA 4Z8BA 3RG0A 5H9RA 1AF9A 1F9KA 2R49A 3UJOA 4XJWA 2DTYA 3ZXEA 1SBEA 1QF3A 2HYKA 2UWAA 5T5JA 3B3QE 1I1EA 1LOCA 4BMEA 3WG4A 4LBQA 2A6ZA 3N7MA 3MW3A 2P3KA 4ZXKA 5AVAA 2W08A 3D5OA 3LCPA 1ENQA 1UPSA 5DG1A 3AP6A 1MACA 5T55A 1AX1A 2E53A 2XB6C 1D2SA 4FPOB 5DUWA 4BLIA 2W52A 1DYKA 2SBAA 1NLSA 1WW6A 1OKQA 1N3PA 3V0BA 1AXZA 1Q8VA 2D7FA 3MEPA 3WVJA 1WBLA 1IS5A 2CYFA 4XJAA 1W6QB 1WD3A 3M3OA 4XTPA 2DVFA 1ZM1A 2JJ6A 4YW2A 1AZDA 5FRAA 2AR6A 3SNMA 4D69A 3U4XA 1S0GA 3A0KA 1W6OB 2OUJA 1GNZA 2DYCA 3AZYA 3PVEA 4BLJA 2RHPA 4Y22B 1J1TA 2YY1A 1SACA 3L2YA 2B7YA 1LHVA 1LOGA 4NO4A 5GZCA 1C1LA 1EPWA 5GZFA 2R16A 1QGLA 1LOFA 1MVEA 4YGBA 4Y1UA 3V0AB 4KBBA 1LGCA 3AZXA 3GNEA 3QCWA 5HCFA 1YXWA 1YO8A 4FPCA 1BKZA 2OUHA 5GLTA 4PBOA 3NV1A 4PBPA 3WDXA 1UZYA 3UL2A 1QDOA 5T5LA 1SLTA 2P34A 3WCRA 3ZSKA 2GMEA 2UURA 1S0EA 2CL2A 2A70A 1LESA 3O0WA 5IK7A 4H55A 1LGBA 1QOOA 3JUUA 4MYEA 2R1DA 3AZZA 4JC1A 4U2AA 2CWMA 3VUOA 1DQ2A 4FPYA 4LBOA 1MS4A 3AFKA 2LALA 4FOYA 1DQ0A 5IUQA 1LEMA 4UW3A 1S0JA 3N7KA 4LBLA 5T52A 3D6EA 4PQ9A 1H9WA 4YGCA 1ENSA 2WT2A 5H9PA 5T54A 4AVTA 4XXPA 2VH9A 2ZGTA 1G9CA 1N3QA 1S0FA 3N7JA 3M3QA 4YZ3A 3C2UA 3VKOA 5EYYA 5GLVA 2ZGQA 2FHRA 2NM1A 1Z78A 4BOWA 1AXKA 3IPVB 3KQRA 4Y20A 1DBNA 2CNAA 4Y1ZA 2YZ4A 4YFZA 5JOXA 1N47A 1UZZA 2P3IA 1WUVA 1ZA4A 5JOZA 2ARBA 1HDKA 4OZXA 3RS6A 4XTMA 3RSJA 1AJOA 1RIRA 2P37A 1QOTA 2ZA9A 3NV4A 4K20A 1VIWB 4DPNA 3ATGA 3B69A 3R4SA 1JYIA 2D6LX 3AP9A 1Q8OA 1FV2A 2WSUA 1U0AA 2ZABA 1JN2P 2EAKA 4XILA 2A7AA 1APNA 2I2SA 1UL9A 3ILFA 2EXHA 1GZCA 1SLCA 3D4KA 2R1BA 3SLIA 5LK5A 1UMZA 3V0AA 5F9TA 1LHWA 2EF6A 1MS3A 2H0BA 2AENA 4DFSA 1Y7BA 2V73A 3W59A 1KJLA
chains in the Genus database with same CATH superfamily
2K2SA 5LBEA 1IS4A 3O1PA 3D0JA 5KXBA 1I3HA 3EBRA 5KWRA 4DXTA 3AYAA 3T2QA 3TB0A 2RV9A 5FK8A 2WFPA 5SV8A 4OHZA 2ZGPA 4NIHA 1QJY3 2VW1A 2BVVA 1AVBA 2HWF3 1GOFA 1HQNA 1O4YA 5J37A 2A3YA 3G7DA 3HIFA 4CEWB 2IXCA 4Q0PA 3EB7A 5C9AA 5C8WA 2QQVA 5F5CA 5JZGA 3S5AA 3HQRA 3WW3A 2F4LA 2X29A 3K77A 4LO4B 1CX1A 4JGYA 5F6LB 4XCAA 5F5QA 1NLQA 2C1FA 3O1SA 2YXSA 4E9KA 2VZSA 4LXLA 2UWBA 1D7PM 3I3EA 5FY8A 5IHRA 4KH9A 4D3WA 4BM8A 1G9AA 2GN3A 4YLZA 3BB6A 3I97A 4XQDA 4DINB 2WFF1 3WDUA 5A1LA 4JGYB 4QXBA 4FTEA 4MHRA 3OPTA 3SCHA 1OUSA 1LULA 4B8EA 5FPAA 3LAGA 3I8TA 2RDSA 1RITA 1RUH1 1V6OA 1AHSA 3GBGA 2E26A 3VBRA 3WDWA 4GB32 2XHKA 2ZGNA 4M00A 2BBAA 3WQBA 1VBB2 1SQ4A 4BQXA 4GKYA 3I59B 4NRPA 2E7QA 2RMU1 1DFQA 2VZRA 4QPIA 1QQP1 4FOQA 1XE7A 2LS6A 4BE3A 1QJFA 4KG0A 4YZ2A 3H8RA 4M3CA 2Y8KA 4JKKA 3PNAA 1GANA 4AQ2A 3X29B 4FPGA 4XBNA 3J8F1 1COV1 5FPVA 4QX1A 1OA4A 4V2VA 3WOGA 1BXHA 1LR5A 2WZR2 3N9MA 1X8EA 3FE5A 5A6XA 3UKNA 2AREA 2HWC1 1HN1A 3AVRA 4JGZC 3LZZA 4OHWA 2PN5A 4CCNA 3TRSB 3KT1A 1GBGA 2VTFA 5GKAC 2E63A 1AYM2 2YDEA 1KFXL 2WKKA 5CIRA 4HVQA 4OMDA 1XJAA 2OQ7A 4AVSA 4EWEA 3VDBA 4XE9A 3AYCA 4P9GA 1TQ5A 3WW4A 4CU7A 4Q4W2 3FL7A 2J1EA 2AEZA 2ZPXA 2BFUS 3AJZA 3KD4A 4IQPA 5F7UA 3HEIA 2P1BA 1A78A 4QQLA 4WV8A 5IATA 3GBFA 4CZSA 1GSLA 1JYNA 1RUH2 2Y60A 4P00B 3VZMA 4AHYA 5KBFA 2PYTA 1HB4A 4FVVA 5EJ3A 1VBB3 2WC2A 3VHOA 4AEMA 4M0HA 4Z1VA 5JMOA 4AFDA 3WV6A 4I0BA 1CZTA 2WWJA 2XOMA 1YWKA 1W0PA 3NNGA 4Y4YA 4MUVA 1VP6A 4OVEA 2OW4A 3E1F1 2V5YA 3K48A 4AHZA 4BB3A 5C8CA 4OUEA 4H14A 1UYZA 4PIZA 2D6OX 5FK7A 1H2NA 2BERA 2B5HA 4FTSA 3ENRA 4QQ2A 2ZKLA 5FYSA 1ZBA3 2NZ9A 5ABJC 4QB6A 3RZKA 1XNBA 2IXLA 1UQXA 2I45A 4MG2A 4WZCA 3T30A 1WW7A 3HT2A 4PIYA 1FT9A 1E5SA 2YPJA 1VBE1 4D7TA 1MS8A 4A6OA 3O5SA 1I9RA 1VR3A 2DUQA 2GC1A 2R30A 4Z82A 3ZXJA 2XJQA 5JIUA 4JAAA 4XPVA 2W92A 4WM7A 3WNMA 3M7AA 5CFDB 5AC91 4N53A 3VDDA 2C9KA 1L7RA 3WNKA 1AR71 3I2JA 5FPXA 5JUVA 4HN0A 1FATA 1O5UA 3B7MA 4AE2A 2B46X 2OPKA 4AWDA 3LQCA 3LGRA 3HAGA 1DLLA 2R6QA 4HONA 3ALQA 4D0QA 1HB3A 2J42A 4PLNA 3E6CC 5EIYB 3N9PA 3R05A 5ACA2 5FZHA 1LECA 2PAKA 2AYHA 3ETQA 2PLV3 3AP5A 5FYBA 3OYWA 4COUA 4DRVA 3ZFEC 1WA4A 2B4KA 4LK6A 1VMHA 3N9OA 2JIJA 5A33A 3OYWB 3IDBB 4R4ZA 4XUNA 3WNXA 3AM2A 3ZIWA 1FNZA 4GJYA 2HWD2 4RL7A 3WSOA 2A75A 1JH5A 3S57A 2D6KA 3KCYA 4W4ZA 5HCBA 5GZEA 3RMXA 1I5ZA 3WD5A 4E4SA 4AOCA 2JENA 2BW8A 2W68A 5D8AA 5M0TA 1YLLA 1RVF2 3VBUA 5C3SA 4QPWA 5JCTA 4HK9A 3T1MA 2IVJA 1PZ9A 3FLRA 4YW5A 1V6KA 2JECA 1TE1B 4EE2A 2YHJA 3BODA 3H42B 3KCXA 3POGA 1OLMA 4AEKA 3UNPA 1POV0 2GMPA 5AC92 5ACA3 1BVP1 4LUKA 4YG3A 1N3OA 5JWPA 1Y9GA 1A34A 3JCIA 1D2QA 1GQPA 2QDRA 4LITA 4RHV3 3JXSA 4RSUA 1MZ6A 4GB33 4QPIB 5DAVA 3VBRC 2Y38A 3ZXKA 4ATEA 3I59A 3LWCA 4GALA 5GALA 4AI2A 3NAPB 4RQPB 1LOEA 1RUC2 4E2GA 1K5MB 3WDYA 1NA1A 4FFHA 4YFWA 1KDKA 2QQUA 4BJ0A 3J26N 1ZZ9A 2E6VA 4CUCA 3ZIXA 1C5HA 3BN6A 3JBG2 1T6BX 1OHFA 2RR13 3VBHB 3EJKA 1QJU1 4GXLA 3UJQA 4LBQD 3ZSMA 5E16A 1AL22 1JOBA 3ZYRA 1ENRA 4GIQA 1W99A 1Y4WA 1G86A 1CIWA 1RHI1 4JGYC 4XURA 2HWE1 4A41A 3KZ4C 4KWKA 3WG2A 1NUKA 5GJ6A 4Q8KA 1WMFA 2ZXQA 3H8UA 1GUIA 1M06G 1W06A 2ENRA 1W2AX 3ZSJA 4CDUA 1S0BA 3J9SA 5FXWA 3ZXFA 1GLHA 1OPOA 2EA7A 3OGVA 4AHWA 1R1ZA 2OS2A 4LBKA 5GLWA 1QXJA 2WS91 2VTXA 2XWJB 3P3PA 4Q4W1 4XCBA 1CJPA 1TME3 2UU8A 2D93A 4RHV2 1PO11 1BMV1 5A1AA 5T3NA 5J7MA 2ZTNA 3KMHA 3MF9A 4RA0A 5FYYA 3JD73 4CDWA 2GNDA 1F4HA 2A6YA 3Q9OA 2BOIA 2DVDA 3I2OA 1RUF1 1W9YA 4Q2FA 4XDPA 3BGAA 4JTOA 5D2AA 5BV6A 3PL0A 2Q8CA 1OVSA 1S0IA 1X50A 4K8FA 4TLFA 3ZN6B 1RUD3 2Y34A 2YYOA 1IS6A 3FBYA 4P9WA 4QX8A 1QMJA 1LCLA 1URXA 2XGXA 4S2DA 4CEYB 1Q8QA 4AAPA 1PNGA 3VBUB 1A3KA 1UY2A 3H1WA 2MNGA 1C5IA 1OLQA 2UWCA 3H3LA 3LDBA 4YM3A 1NKGA 1GP6A 1OLRA 5GZGA 2WZR3 1Z7S1 3TYJA 5DG2A 2HWD3 4N43C 2VG9A 3OBAA 1JZ8A 4OHXA 1BBT1 2X53S 3O1TA 4XHBA 2RS51 2O14A 1F4AA 1ND3A 4C0BA 4CCOA 2W1SA 1S0CA 5A7SA 1XE8A 3VZOA 3LA2A 2NLRA 2AC1A 3HNYM 5FZFA 4LIUA 2PHRA 1R1A3 4PF5A 4RR3A 2YBPA 5FYCA 2P5BA 5L7OA 3BOPA 2JDUA 3TEXA 4I3GA 4LO6B 3ZO0B 4AR2A 1GWLA 5C9AB 3M3IA 5JMCA 1JZ2A 2B8MA 1WCDJ 2JWPA 5LRSA 1FPN3 4NPRA 3A4UA 1BEV2 4YGDA 3HMYA 3ZOIA 4LMFA 5F3GA 5FJHA 1AYM1 4FPEA 4AL9A 3K46A 1C8NA 4N53B 3VDDB 4IV3A 2HWB2 3I3MA 1VBB1 3PVBB 1HRI2 4A42A 3BUCA 1OT5A 2WQZC 4C1XA 5KXDA 2WAAA 4QDSA 5FTTC 1LGNA 3T1LA 1ND3C 5KC6A 1PVXA 1X8MA 1DU3D 5FP3A 4DRRA 4AYUA 1ND2C 2J7MA 4FAHA 4LTAA 4HN1A 3OBZA 4A7ZA 2R042 4N43A 4C91A 4YW1A 1OPMA 4QD2A 3CO2A 3HPNA 1CJDA 1HXS1 1SLAA 3ZVXA 3WP4A 3TEWA 3I2GA 4Y4RA 4CDXA 2ZZJA 1Z7S2 4Y20B 4XOGA 3WHUA 5A3PA 1GNYA 4A3XA 5IVJA 1TNFA 4A6SA 1JI6A 1C28A 1G8WA 3MF6A 2VW0A 4AHXA 2PA7A 5LEJA 1UX6A 2ZEWA 4S2HA 1IG0A 3GGLA 1A6CA 4N8MA 3GZTB 5JZGB 5AC93 5DAXA 5FP7A 3G6JB 2EIEA 3SITA 1SMVA 2CGPA 1WCUA 1GFF2 4LUMA 3VBFA 5CFDC 1EUTA 4JHZA 2Z69A 3WHTA 1ZRCA 2JD9A 1OFNA 2JIGA 4ET7A 1QH6A 1PMJX 5CG8A 3EXUA 2V4AA 2BV4A 1HQWA 1PMHX 5CZKA 1E57A 4EWAA 2CU5A 5A7WB 1Z0HA 2GNTA 4AGGA 3MPBA 4MXVA 2DCYA 1AR63 1RUE2 1KQRA 1PX4A 5FXVA 3INAA 2PELA 4XFBA 1DQ6A 2SLIA 5ABJB 4XIOA 4EN7B 4ISRA 5JVVA 2VZUA 4PDWB 2P3JA 3OY8B 5FZCA 3MGUA 4H7MA 4WM7B 1U5YA 2VOXA 2HLEA 2I74A 5F3IA 3ABZA 5F8PA 2Q1FA 2Y6FA 5FZKA 5FOJB 3AZVA 2HWB3 4WM8A 4ASMB 3PIGA 1QU0A 1BJQA 2VCCA 4UYBA 1DYOA 4QKNA 4Z8BA 1XYOA 3RG0A 1VPHA 2R49A 5H9RA 3UJOA 3J8F2 4XJWA 4AK3A 2HYKA 2UWAA 1IGOA 4YWAA 5T5JA 5FY1A 2Q8OA 2WWUA 1S4CA 3RWNA 4LT5A 4UI9L 5K0UA 1RUG3 4BMEA 3N7MA 1AR92 3ST7A 4BQ3A 3MW3A 1A8MA 4QMAA 5AVAA 5CKNA 3D5OA 1UU4A 1J83A 1UMHA 1UPSA 4KWLA 1MACA 1XRUA 3WW1A 4XUQA 3C8XA 2W52A 3WQ7A 3FWEA 3CJXA 3K4AA 1HW5A 1W05A 5JR2A 1QXPA 1D4M3 4AFCA 1RUG1 2D7FA 1RUI2 4OYUA 1L7QA 3QBQA 2CYFA 1IS5A 1WBLA 3A23A 3M3OA 4UFHA 2WO7A 4PT6A 3AMHA 5FRAA 1NXMA 3CBNA 1XBFA 2VULA 4HOOA 3VBUC 5A3UA 1VBA1 3U4XA 3A0KA 1W6OB 5FWJA 2OUJA 1GNZA 4D7SA 1AYN1 1UW8A 1ZNPA 4Q4Y3 4P02B 3KF5A 2B7YA 3VBOC 1LOGA 3LB9A 1D4M1 4BQ5A 2PTMA 2MEV1 1K5MA 1R093 2XVGA 3TEYA 4DY3A 2RS12 3KGZA 3QCWA 5BUVA 4ZS2A 5FO8B 4MGKE 5FYIA 2DCKA 2Q1MA 4I09A 5FUIA 2OUHA 1NZIA 1UXZA 3HQXA 4RGAA 2J1SA 5FR3A 2B42B 3ZYJB 1TZOA 3WCRA 3OF1A 1DGRA 2XQXA 4LR4A 4Q4W3 2GMEA 2UURA 1WLTA 2VQAA 2OZJA 2K46A 5IK7A 1F2NA 4D94A 4J1WA 4H55A 1JODA 4HKLA 3AB0A 3JUUA 3PDQA 4KMQA 5FZ7A 5CVRA 4LBOA 4RR3B 1MS4A 2XXZA 3VD7A 3PUAA 3AKTA 4BCUA 2HEVF 3N7KA 4LBLA 4IE7A 4Y5TA 2WRAA 5JI7A 1PIV2 2FCVA 1H9WA 1LB2A 4YGCA 1ZVFA 2IXHA 2RJ2A 2VZQA 2RM23 3ES1A 2K0GA 2E31A 2JG9C 1G9CA 3TN91 2HWE2 3POFA 4CEWC 2VQTA 3CZUA 4GULA 2RS32 3ES4A 4DEQA 4CE8A 4HK8A 3UKVA 4CDUB 4FFGA 3MUZ1 1Z78A 4BOWA 4KBZA 1V0AA 2FDKA 1VB4A 3GHNA 2LW8A 2OIIA 5JZGC 1NCQA 4GD4A 1E5HA 4HZFA 1N47A 5DAQA 5JXHA 4PLOA 1X9TA 1Y9MA 4B7EA 2WDBA 4L99A 1QWRA 1ZA4A 2R063 2WWSA 5JOZA 4R52A 2YFUA 4JHTA 4PF1A 1YQ8A 2P37A 2WNUC 4XF0A 5IWFA 3MBWA 3ATGA 4KL1A 1OH3A 1JYIA 1FV2A 2ZABA 1UYXA 1VAKA 2VZOA 2W46A 5CFDA 1T2XA 5JSRA 5A3TA 4DUVA 4MX3A 2W5FA 4IEVA 2D40A 3FZ3A 2R1BA 1UMZA 2XKOA 5F9TA 3ZFFA 1UYYA 2H0BA 5C3PA 1PMIA 1YQ5A 4UXAA 5FP8A 3RZHA 1TMF2 1KJLA 2ZAHA 5DZGA 2XBO2 1MEC2 1SLLA 5A3MA 3SISA 1R083 1VE0A 2VQ0A 4OQ9A 2IXKA 3CMGA 5GLZA 3WR0A 2PFWA 1HKDA 5HV0A 3B93A 4PDWA 4BISA 2PAEA 2BQPA 3WP5A 2E7AA 1DGRN 2HWC2 1QOSA 5EP9A 2FMDA 3IN9A 5C71A 1UPIA 2RS31 1UZWA 2RVAA 5G04L 2GALA 5L7OB 4QM9A 2UYBA 3H1MA 4X8NA 2G19A 1CIYA 2QTWB 3ASIA 4S2GA 3NQHA 3ZKYA 5IVFA 2J1VA 4LNVA 2ZHKA 3PVOA 4XACA 2A6VA 3DF0A 3VD4A 2BUKA 2BP6A 3O1MA 1ASJ2 1GU3A 5CNAA 2Y26A 4Q4X2 2KXLA 3IKWA 1YIPA 2VOKA 4WVZA 3ZDVA 5IK8A 4Q1PA 2WO3A 4LO7A 3ZFGC 1LU2A 2QFEA 2D44A 2VM9A 3MLKA 5FPZA 3ZKUA 4AGVA 5FYZA 1BQPA 1GZWA 3WG3A 4HKWA 3ZYIB 1VMJA 2HKXA 2Q0AA 2G9GA 2IXJA 5DPNA 2MPFA 1N1VA 3GZEA 5L19A 4MHUA 4NPMA 3GJBA 3ACFA 2B9UA 3LF7A 2MEV2 2W9XA 3OD0A 2FDIA 1U5ZA 4YZ5A 1JU3A 4WVWA 4ZS3A 2CSGA 3UV9A 1JUHA 2RM21 4BWOA 2CHHA 2GDFA 3MLJA 5C70A 4QXKA 3B94A 4IV1B 2EAAA 1W8WA 4LE3A 4ZKTB 4CP0A 3PURA 4L0PA 2C26A 3OB8A 2XBO1 4LQRA 4IGPA 5A33B 3UGFA 1R092 1DQ1A 4MGTA 3U4SA 4CEYC 4YM2A 2O8OA 4Q4Y2 1O8SA 5A3LA 3JZVA 4OI1A 5GM0A 2QDNA 4L97A 3CKHA 2O0OA 4ZZ5A 5FMCA 5FAXA 5GLUA 1NOVA 1C8M3 5JSPA 1BLZA 2N7GA 4Q27A 2JDAA 5B4XA 1LHUA 1UY3A 2J1TA 1TMF3 1N1SA 3IDEA 5ANNA 3A22A 3N9LA 4RYDA 5EHDA 1UO9A 4XFIA 4LBQB 4HSJA 2FDGA 2WABA 4HMZA 1BK0A 4FOVA 2VPVA 4NWWA 3VKNA 3LEKA 2ADDA 4EJRA 1TG7A 4AEDC 1KRIA 2W2IA 4TYSA 2JX9A 1XQNA 2ARAA 4Z2AA 1UZVA 1K45A 3A0NA 4QHZA 3FUOA 1HB1A 2BNMA 3GXUA 4MVTA 4Q4X3 4COYA 2D6PA 5DQ0A 5FZMA 5T5PA 2W39A 2YBSA 5J3UA 4XFHA 4IE4A 4XAAA 3CF6E 1H1IA 4RGGA 3PJYA 2XVLA 2WIIB 1WMXA 5FIXA 2AACA 4LOTA 3T2TA 1EV11 1MS9A 2BYVE 4CP9B 1FV3A 3LA7A 2JG9A 2VR4A 3LEGA 4FOWA 1NY71 3OY8A 4C1WA 2HWC3 1RGSA 4IEXA 4P9JA 4COWA 2W1WA 1QJX2 4AVCA 5LATA 4J6GA 4CCKA 1IG3A 1PVC1 2VBBA 1NG0A 3FJSA 5KHJA 1GZWB 1V00A 3URFA 2R071 2WA4A 4IXLA 4META 2A1XA 4M01A 4RGKA 1BCXA 2WNOA 2C24A 3HN1A 5EZWA 1MEC3 1P8JA 3VBSB 1W90A 4NR1A 3MIFA 3RZZA 2JE9A 4IEYA 2CY6A 1OD5A 1KJRA 3ITQA 5I91A 1RHI3 2Y0IA 4PJYA 1QJY1 1EUUA 5FY0A 2GSYA 1C8M2 3SMHA 5EWSA 1O4ZA 1W2NA 3O7OA 3OBTA 1COV3 1RUJ2 1YJLA 1PK6B 2BGCA 2JG8B 5D8AC 2EIDA 4A3ZA 1SG3A 4DS0A 2CWSA 4E27A 3NJZA 4Y1XA 1K5MC 3VZNA 3FBMA 2ZMNA 1ZBE2 1VBA2 2ZCWA 4OHVA 3ZN6A 4EN8B 4OQ8A 3ZYPA 3U11A 2WT1A 2XG3A 4S2FA 5ISLA 1W6MB 3B9CA 3SEEA 2ZEXA 2ZGUA 4L8QA 4NMIA 5BNPA 2ZX3A 1DYPA 1SFPA 4XXAA 3SH4A 5FZOA 4LJHA 1DIWA 4P9IA 2D5HA 4YVSA 4CXXA 4TZDA 1QJX1 1UXXX 3DPRB 3ZDSA 4FPKA 1ZZCA 5J98B 1NT0A 4JCKA 3EMRA 1RL3A 3ZSLA 4P5HA 5FZEA 1HQLA 3CU7A 1NX9A 2Q8DA 2D6NA 4XABA 1NCRB 3VHPA 5K0UC 3U0ZA 4BK4A 2QZ2A 4QPGC 1ULGA 2YMZA 4EZHA 5L7OC 2GC0A 1QJX3 2V09A 2VQUA 1AXYA 2YGLA 1VRH2 2NYYA 2ZS6B 2EICA 3H0OA 3PUSA 4Q4Y1 1MS0A 1WA6X 5E1RA 1YIFA 3RMYA 2DF7A 5C9AC 1DLCA 2ET1A 2GNMA 2RJKA 2ZAAA 3U75A 3I54A 3W20A 3BTYA 4LKSA 1FXZA 2WQ8A 2XJTA 2CDOA 1WBFA 3LEIA 4AVBA 5C8CC 1PGW1 3ACHA 1Y3TA 3QLQA 4SBVA 3C7EA 3ZN4A 1LOBA 1DDLA 3GZAA 3S30A 1HRV1 1JBCA 1ULOA 3K2OA 3U78A 2OQ6A 5JSOA 3ZXGA 1NA1C 4FFFA 3FC0A 4CPBA 5E8AA 4CXYA 1SBDA 1RXGA 2P6CA 3K75B 4EROA 3AMQA 3J7HA 4M3CF 1R082 1FNYA 1ZZ6A 4EN6B 5C6CA 1JUIA 4Q0SA 5E88A 2DFBA 2R073 3B9IA 2H6BA 4CDXB 4LPLA 3S7EA 2IZWA 4FQZA 4B4QA 2BVBA 2Y33A 2E51A 4BZ4A 4CTEA 5FYUA 3AP4A 4PIXA 2Y64A 1OQEA 4CCDA 4YG6A 1HN0A 2B39A 3TEZA 1BMV2 4HETA 1EPZA 2JDZA 3AJYA 3KV4A 4UFLA 1GYKA 2JDHA 4RFRB 4MLOA 2DVBA 1K3IA 3LE0A 5IJRA 5LB6A 1TME2 1UKRA 3POEA 1W6NB 1RINA 5F32A 1HV0A 2UY8A 4DXZA 4YVWA 1RMU3 4NN0A 4CCCA 1COV2 1VMFA 1XB9A 2DCJA 3NSTA 2XONA 3MW2A 2VNVA 2O1QA 4Y22A 3N9QA 4CVUA 1XPWA 4YZ4A 1O91A 5BNOA 1W8OA 3KHBA 3PUQA 1ODMA 1JYVA 3ACIA 2X10A 4NHYA 5FBJA 1OSGA 3W5NA 1PK6C 5CKMA 2BNNA 4I30A 3PUIA 3EQEA 2CGOA 4FP2A 4LHKA 4QU2A 3ZR5A 5ACA1 1C8M1 3J7LA 1VB2A 4QXCA 5FZ6A 1IKPA 1MVQA 5FZGA 3SH5A 1XNKA 1RUC1 3RZJA 3USSA 4MADA 4P9LA 4FSJA 4GA9A 2CGNA 4DMIA 3K51A 4YM1A 3MZHA 2E33A 3VBSC 2PQSA 4GH4B 4AXOA 3HWJA 4PHZA 5FLJA 1VBD1 3VD3A 1AJKA 2Z42A 1ASJ3 3ZYGA 4QQPA 5C4WC 1OMIA 1CPNA 2PAMA 1SCRA 4K9SA 2ZEYA 2VMEA 5BNQA 3IDCB 5JDBA 2DU0A 2NQYA 3OD4A 2ZGKA 1BZWA 3ME2A 5C4WB 2FDFA 4OFGA 2RM22 4JDOA 3K3NA 2RS13 3WDTA 1PZ7A 4CDQC 1W6QA 1YHFA 2VZ1A 3R0RA 3GJAA 1GMMA 2BZDA 4ZZ8A 3W5MA 1FOD2 5B2GB 4FPFA 5FPUA 5HV4A 4PDWC 1UAIA 1EV13 3O0XA 4OI2A 4ONUA 1H0BA 4Z92B 3SKVA 5FQ0B 1ULDA 3QH7A 2J22A 4LLFA 2ZGLA 4NHLA 3V64A 1RUI3 4XZPA 2XDVA 2XLAA 3VN4A 2AEYA 5LBBA 4FP3A 3KM5A 2PLV2 2QQIA 4Q0QA 2BWCA 1HRI3 1NAEA 1D4VB 1QQP2 1RJ7A 4GZ9A 4LKDA 5IVBA 1B09A 1SFYA 3JB8A 3DYMA 3LDRA 3WZ1A 3JD72 3MFAA 1FMD3 5FLHA 5H9SA 2BFUL 1H2LA 5JOWA 4K8RB 5KXEA 1AR93 1HLCA 4Y5Z0 1YFUA 4XIKA 4UOJA 1AL21 3BU0A 3KLSA 4WM7C 3U37A 2RE9A 2VE1A 3THDA 1H8TB 4XFFA 1UOJA 1HRV2 4IEWA 4CP9A 4O61A 4B1MA 4Q4V3 1CD3G 4IDZA 2QE3A 2KD7A 1H1AA 1F5FA 3RJ2X 4YSFA 4IL7A 4XF1A 3LPGA 3P1IA 3DN7A 3VKLA 1J1LA 1C4RA 2WA3A 4HANA 3DKQA 5KXCA 3SHRA 1WLCA 3MLLA 2ZBJA 2VUAA 4B4RA 2VBDA 2CV6A 2VY0A 1V6JA 3LFMA 1U5IA 2XLFA 1AR73 3NJVA 1F9KA 3ZSEA 3ZXEA 4IV3B 5IFPA 1J84A 3B3QE 4GWJA 4PQQA 1LOCA 2G1MA 2XMLA 1DCSA 3I2HA 2A6ZA 4Q5OA 5FYMA 3WG4A 3BCWA 4ZXKA 1HJGA 2W08A 4RQPC 1IPSA 1W8UA 5DG1A 3VHNA 4NIGA 2XB6C 1D2SA 2PLV1 4AVAA 1CAUA 4QB2A 4XF4A 2SBAA 5BNOB 2YB7A 1WW6A 5I8SA 1OKQA 3WQ0A 1N3PA 3T08A 4ES9A 3C3VA 4NWVA 4XVHA 4TLGA 4XEZA 4WVMB 1CX4A 1OVPA 2BDRA 3Q8CA 4XJAA 5ANQA 4YW2A 4XTPA 3RFRA 1MQTB 3AL5A 3QOPA 1AZDA 5C5UA 1H2MA 1S0GA 4E8DA 5FYTA 3GDBA 3AZYA 4YVWC 4BLJA 3MO4A 4MSVA 3VBOA 3HNBM 1SACA 2Z79A 3J7MA 1I5PA 1LHVA 4NO4A 3D3AA 5F37A 1GR3A 1EPWA 1OF3A 4CCMA 5GZCA 2YFZA 1RB8G 1LOFA 2BU9A 2WZEA 2Y0OA 1H2KA 4QKBA 1LGCA 5FZOB 4CYDA 5FZ9A 4TTGA 3V0AB 3U1XA 1YXWA 2R043 2WNVB 4FPCA 1EP0A 5I93A 4W6YA 1LAJA 2VMIA 5A32B 3PTRB 1D4M2 3NMBA 5GLTA 4PBOA 4EWDA 4YRDA 5FMBA 1REDA 2XHNA 4QU1A 4UBGA 1UZYA 2HWE3 5T5LA 2P34A 4Q29A 4XF9A 2GP5A 3THTA 1S0EA 2CL2A 5K8SA 3N4MA 2FDHA 4G9SB 3DXTA 1LGBA 1QOOA 4MYEA 1ZZBA 2R1DA 4U2AA 4DB5A 4OHYA 1XNTA 4JDNA 3VHRA 3VUOA 5IUQA 3AFKA 2FQPA 3MI8A 4YW7A 3P3NA 1LEMA 4MGZE 4UW3A 4MGYE 1ST8A 1S0JA 1FMD1 2PQQA 4N53C 3VDDC 4TWTA 5F5AA 1US3A 4KQ7A 4WM8C 5DAPA 3HNMA 1E5RA 1XC6A 4XXPA 2ZGTA 4HXCA 1N3QA 1S0FA 3J4UH 3VKOA 3MV01 5EYYA 1SPPA 2WL1A 5GLVA 4AQSA 4FBFA 1WCKA 2FHRA 1ALYA 5BNOC 2VECA 2NM1A 1ZBA2 5IVEA 3IPVB 2CNAA 1AUYA 1JZ6A 3KV5A 5A3OA 2JDMA 2BRTA 2CAUA 5C3RA 5I0SA 1VBC1 4HPKB 4KNCA 1LKNA 4CP1A 1PM7A 2XJRA 2VGDA 2VOTA 4N7UA 3NNFA 3CJIB 1W8FA 4XUPA 4XTMA 5LY1A 2ZA9A 2JG9B 2VNOA 2VCAA 3NV4A 1VIWB 3H8XA 4N43B 3JD71 3KWVA 3B69A 4JGZB 2HWD1 3ACGA 3AP9A 1YNAA 4YVSB 2LROA 4P5YA 2I2SA 5HXVA 1OOPA 3UKTA 5LK5A 2VVEA 3NNLA 1RUOA 3I49A 2EF6A 1MS3A 2AENA 1WWYA 1Y7BA 3OEBA 2JDNA 1BEV1 5F5IA 2ID4A 3USUB 1WCSA 2YG0A 2ZMLA 1S2BA 2DVGA 4LE4A 3MDPA 1ZRDA 3MYXA 4GQ7A 2E7TA 3FX3A 1Z7S3 5FLIA 4R9BA 4LEJA 2GMMA 2HJIA 3SCFA 3TOJA 2D3RA 4CDQA 4AEDB 5A7WA 2HWB1 1MZFA 4UFKA 3UYJA 3LIHA 4O9GA 4ARYA 4XFCA 2DVAA 3AKSA 3OEAA 2FCUA 2CDPA 3RVHA 2DURA 1DZRA 4CU6A 4GB31 1PGSA 5FY9A 4HL0A 3RNSA 3C7FA 3LD8A 1UX7A 2EIGA 4NIIA 1OURA 4NUBA 2VCMA 3M70A 2C4XA 5FY5A 3FFZA 2VZ3A 4IUGA 4BXFA 3TWIA 1GKBA 1RUI1 3BYWA 1W0OA 4BU2A 1RUF2 3NW4A 1RUG2 2WBKA 3M3EA 5FUNA 1M4WA 1DF0A 2RDNA 4R4XA 1GICA 1ZZ8A 2VMCA 3O14A 2BTVC 3N7LA 4Y1YA 3VBHC 3WLUA 1O3QA 3RGBA 1OD3A 4ASKA 2Y6GA 1RC6A 2R062 3PJQA 3WP6A 3ZXLA 2AH2A 3H1YA 1R1A2 3JQWA 4B3NA 5A6ZA 2C5DA 5CA6A 1W04A 5EV7A 4LBNA 2A5ZA 3RPQA 2QQOA 3DL3A 3E5UA 1QKQA 1LENA 4IEUA 2ZX1A 4XYXA 3GBWA 3GM8A 4K1ZA 1I6XA 4FCAA 5FCCA 1ULEA 1AL23 2VCBA 2P4EA 2VOVA 2WS93 5F3EA 4ES8A 2BWAA 3M2MA 3UESA 1VLNA 1SLBA 1C57A 5FO9B 1D0HA 2CTVA 4FT8A 2WJSA 1A8DA 1J3RA 5LCWL 3CZJA 4FO9A 1RXFA 3R4UA 3ZFGB 3R6SA 2A6XA 2ZX0A 2XKPA 4OUMA 2UY9A 2WLPA 4JKMA 1JZ7A 1W6PB 3AKPA 4FPJA 3VDAA 3WP3A 5G05L 3WF3A 2JDPA 3BI3A 1S0DA 2H0VA 2WO2A 4I01A 3SH3A 2OA2A 3BU7A 5JLVA 5EYXA 3SEPA 3EHKA 2F6BA 4Y33A 4DXRA 5L36A 4YM0A 1GZ9A 1RTVA 4YNIA 1ODNA 1L3JA 1JZ4A 2VBPA 2VUJA 4ZU7A 4P9YA 5FZIA 2ET7A 3KS7A 1CAWA 1H6YA 2EXJA 4O9EA 2A3WA 2BOJA 4MH0E 3RQ0A 4CPBD 3PMEA 4BQ2A 3VD9A 3HQUA 3N9NA 4QPGB 1AR82 1PM4A 3OGJA 2RS52 1FPN2 5EJ1B 2FMYA 3D0SA 4AI8A 4AGRA 2D6MA 4IEPA 3K4DA 1W8TA 3LDKA 4CDUC 4XUOA 1KEXA 2ZKNA 3JBG1 2XR4A 3R4DB 4YGEA 2LTNA 2IWGB 1UD1A 3S7IA 3I3DA 1XOYA 2VTXJ 1H8TA 2H6CA 3WX5A 3POYA 1PX3A 4O65A 3OBRA 5FP4A 4MV2A 4YPJA 4HVOA 1UY4A 4Q4V2 3JBG3 1LU1A 3OCPA 4EN0A 2AZ5A 1RUE3 4QPGA 1AR62 5CFCA 2DV9A 4XBLA 1MPXA 2XL9A 2WYFA 4QX5A 4KGGA 4XF3A 4SLIA 4AI0A 2AGSA 1AR83 3ZYHA 2RDQA 1CWPA 1V6MA 1BYHA 3VBFB 1PO12 4EN9B 2P6HA 5FY4A 4B29A 2OVUA 4LLOA 3SKJE 1QQP3 1UMIA 3BIEA 4XW3A 4LOSA 3N36A 2GNBA 5FDBA 5T50A 5FZ4A 1UU5A 5LBCA 3T0BA 3WDVA 3RYPA 3AKQA 4IGQA 3T4VA 2A3XA 1O3SA 3BIWE 4ZU4A 4A2UA 1SLIA 5IVVA 3AMNA 3GCXA 1UNBA 3WUCA 2ZACA 3VZJA 3D8CA 1W9WA 1NCRC 5C3QA 3KGLA 2VUDA 1GNHA 4AI1A 1FOD3 3APBA 1HJFA 1OBNA 2BGOA 1WW5A 1REEA 4FI9A 3VL9A 4ISQA 4AFBA 1W3VA 1W2UA 2WR9A 1W8ZA 2VU9A 3EO6A 4YVWB 1B35C 3QD6A 4GMP3 4IE5A 4DIQA 4GMP0 4B4PA 1FX5A 1RUH3 1W6NA 1ZA7A 2YBKA 3OOXA 1IQAA 3PUHA 4ZU5A 4ARXA 5KHHA 1ZYBA 2VVFA 3D82A 5ERLA 1W2OA 2ADEA 3ZFFC 3POIA 1AX2A 1AR61 5CB7A 1VAVA 1QNWA 1W6OA 2R061 4GMP1 1S55A 2FZ1A 3WF1A 3I4IA 3O1VA 1J58A 5DXDA 2PHUA 4R9DA 1US2A 1GWMA 3UGHA 1JMUB 3VD5A 4XDOA 4HT1T 4KG8A 4R9AA 1HB2A 3TN93 4AAXA 2X5IC 5JXGA 3MV11 4KWUA 3MFCA 4LHNA 3HT1A 3NWKA 1NCQC 5BPXA 4MXWA 4D7YA 4XDQA 2WS92 3IB3A 4OMCA 4PLMA 4EZ4A 3C7GA 1JZ3A 2LUWA 5LY2A 2A73B 2W91A 5FV3A 3POBA 5A7PA 4E2QA 2VZTA 4MXWB 4ATFA 3FN9A 4K6BA 2D5FA 2WZPP 3WEZA 1W9FA 3GF6A 1RUC3 3OUIA 3VKFC 3IT8A 2WINB 4BQYA 4XJUA 3BPSA 4CSWA 1V70A 4HKOA 4JV4A 4OCTA 1CONA 5KHGA 1Q43A 3TBDA 3WT3A 3NRUA 2VZPA 1B35B 2VMHA 5BNNA 3IBMA 2Q30A 1EAH2 4DO0A 2Q4SA 1XNAA 3RRDA 5IT6A 3POJA 4IERA 1ULFA 1KDMA 3A21A 1NE4A 1J59A 1RVF3 1Q8PA 4MZUA 4U36A 1DZQA 5E89A 1JXNA 3E5QA 2YV8A 2RS11 1ULCA 3ZFFB 1GP4A 4GH4C 4NVPA 4BYYA 4ZPIA 4WVMA 4CDXC 3ECQA 3HR9A 2JEMA 1BBT2 3ZFEB 4JGZA 1V6LA 3T2PA 1PVC2 3ZX7A 4AI3A 4DQAA 5DDJ1 5BYNA 3S0MA 4QQHA 3KF3A 3OPZA 5FWEA 1RVF1 1WKYA 3NVCA 4IEQA 1ND2A 5I0RA 1NY72 4UT5A 1PO22 3PU3A 3H7JA 4GJZA 5DUXA 3VGIA 3GZUC 1WZXA 4UF0B 4I0WB 4XAEA 4A4AA 4MO3M 1XNCA 1V9U1 3NO8A 5C33A 4B1LA 4Q1RA 2YROA 4GKXA 2VC9A 3DV8A 3NAPC 4NE9A 4ITCA 2WYSA 5EXOA 4QPIC 2X5IA 3RZLA 2F4PA 3NV2A 2VMGA 1PO13 2DU1A 2TBVA 3L2HA 5CKQA 2VW2A 5E6HA 4RQPA 2KM2A 2JKBA 3ZPOA 2QQLA 4QB1A 3JU9A 2EIBA 2XQRA 5F2WA 2WN3A 3FHIB 4D8MA 3BALA 4H7LA 5CBLA 3MHZA 4N9HA 2JE7A 5F1RA 4W6XA 1RUD1 1W2TA 5JAXA 5FZ3A 5LA0A 1O6UA 1OUXA 3WXPA 1VBE2 3DGTA 3WNLA 2BPA2 4DUWA 1WLDA 4KU7A 4AZZA 4QX3A 3B02A 4HLTA 1IKQA 5A3NA 4M3CE 5IAVA 3AC0A 3OSDA 4BXSV 3O0VA 3IDAA 2XJUA 2YU2A 3FLPA 1YQCA 3MIDA 3NV3A 4ZY9A 3B01A 3RI8A 4FAGA 5HBAA 1LOFC 5JXIA 2FD8A 4L11A 4R9CA 1IPKA 4UFJA 2GAUA 1AYN2 1TVGA 3BPZA 2Y6KA 1YFWA 1JYTA 1YC61 2FCTA 2RS53 1J3PA 2OKXA 1QXRA 3HBKA 1LJ7A 1S2EA 1PO21 1UN1A 4GH4A 2V4VA 1GOHA 4XMIA 1TMF1 3LSDA 1AL0G 5LA1A 3CDZB 3WUDA 4P08A 3VBFC 1VRH1 4QX0A 1RUE1 3V56A 3VKMA 3AMMA 2G9ZA 1CZSA 2DDUA 1LRHA 4COVA 3RDIA 1WMDA 3IMMA 3WY6A 2OX0A 4CUBA 1UY0A 3P5BA 5FPBA 3FHAA 3RZGA 3ROUA 2ZEZA 4IEOA 4L2NA 1AYM3 1C3HA 2WT0A 4JTNA 3BKZA 1PGW2 2GC3A 4QAWA 4BA6A 1XSRA 2WNUA 1LHNA 1JW6A 1K12A 2Z2SB 1W03A 2YC2A 2A71A 4P9XA 1G9BA 2Q5TA 2WZR1 2HEWF 1V6IA 5J09A 1CESA 1OOPB 5AFEA 2JB8A 5LASA 1G6NA 4BPZA 3Q8BA 1OLME 3UK9A 2C9AA 3VZKA 1G9FA 1LEDA 5C8CB 1W28A 4D6RA 2ORZA 2IFRA 2R0HA 5A1FA 1CR7A 5IYYA 3QH6A 4AF9A 2VMDA 1O7FA 3AYDA 4YW6A 5IVCA 2R32A 4MGIE 4TSVA 2DTYA 3KVAA 3WQ1A 5K9YA 2ILMA 1I1EA 3PTYA 5CYYA 1E5IA 2XVKA 3KT4A 4LBQA 3IIIA 4NHKA 4FTBA 3PHMA 1ACCA 5JIAA 3I2DA 3VLBB 5FMDA 5HPOA 4UBHA 1K5JA 3AP6A 1AX1A 2E53A 4QT6A 2WN2A 5DUWA 1PK6A 2E9QA 2OZ6A 3HOBA 5FZLA 3DPRC 3RJRA 5CISA 3NJYA 4HG6B 3V0BA 1AXZA 1Q8VA 5L9VA 3HD8B 1UIKA 4CDQB 2GP3A 1F35A 4LHLA 3V65A 3SXWA 2DVFA 2VZVA 3LOIA 1ZRRA 2AR6A 4IETA 4XUTA 3FFQA 1ZREA 3PVEA 4NIAA 4RS5C 4DZGA 1YCIA 3HVDA 1J1TA 3LKJA 3L2YA 4RD7A 1CAXA 5GZFA 4BDVB 2PHLA 1ZZ7A 2R16A 4QM8A 4YGBA 1MVEA 5D1IA 4C0HA 1D0GA 3AZXA 3GNEA 5HCFA 1YO8A 2JXAA 4I2OA 3ZFEA 5FBZA 4XFAA 4OZOA 4EYUA 2OPWA 1H4HA 2C0ZA 4XETA 5A7OA 2JG8C 4PBPA 5D8AB 1O8PA 2HBUA 3WDXA 4XQ4A 1DGWX 1Q5OA 1SLTA 2B45X 3ZSKA 4DUXA 2WFF3 2HH9A 2QZ3A 3E5XA 5A6YA 1VRH3 1OOPC 2J1RA 3O0WA 2QKDA 4ZXEA 1PIV1 3ORJA 5BNNB 2QNKA 2CWMA 1DQ2A 3OPWA 5LRRA 4FOYA 1DQ0A 4DNYA 5T52A 4COZA 2RMU3 4RN5A 4AG4A 1W8HA 3S5QA 3D6EA 4N9IA 1NQJA 5A3WA 1L7LA 1FI2A 1POQA 1W8NA 5LA9A 4C90A 1FOD1 5H9PA 5T54A 4AVTA 2ATFA 4LULA 4Q4V1 1KS5A 4YZ3A 1VJ2A 3M3QA 3LPFA 1QJU3 5F2SA 4X6RB 1F8VA 1SDWA 3KQRA 3LFIA 4Y20A 2YZ4A 1HV1A 3S6PA 4AI9A 4YFZA 3DYPA 1HRV3 3TN92 4QWNA 5FOBB 2VOWA 5LA2A 1UZZA 2P3IA 1STMA 2JICA 5FXXA 4URAA 5IAXA 2HWF2 4XFGA 4AFAA 4E4DX 2ARBA 1ZBA1 3MIGA 1HDKA 3JB4C 4OZXA 3RS6A 4AFMA 5L9BA 5CG9A 1AJOA 5EQUA 1QOTA 4DPNA 1UZ0A 3R4SA 2DBNA 2BBVA 2D6LX 2WSUA 4AEDA 1U0AA 1JN2P 4JQRA 2VXJA 1UL9A 1S2KA 2RR11 2QQJA 2WNVC 4YVSC 4LKFA 4QGLA 5C5TA 3WF4A 3KV6A 4QGNA 5KHIA 3ACLA 1LNSA 2WNVA 4DFSA 3RZMA 2XJSA 2V73A 3I3BA 4CDWC 1X36A 3Q8FA 3AVSA 4F83A 3FUQA 2VL4A 3ELNA 5DAWA 1OQDA 4XJZA 4PCRA 3CLPA 3AMPA 2ARCA 2WSVA 4WVVA 5BY5A 3CEWA 3E6DA 1UF2C 5DDJ2 1R64A 1ZBE3 3DEMA 1CAWB 2Z4FA 4D6SA 5JXJA 1ND3B 2WO1A 4X6QB 2OT7A 1CGPA 3AZWA 4J1XA 1VBD2 1NYWA 2DUOA 2WNUB 1LHOA 5JR7B 4QKDA 1XU2A 1W39A 2R041 2B9VA 4XMAA 5FZBA 4GWNA 4L92A 3GYDA 3TNQA 1VBC3 5F39A 5DMYA 1NE6A 4QHBA 4Y1VA 1XE0A 5FREA 4CP2A 3BOWA 1UYPA 2W47A 3IIAA 4UF0A 4Q8LA 2XUMA 4IV3C 4ZONA 5F3CA 2DCZA 2G4IA 5FZ8A 3ZFGA 2RMU2 1CQ9A 3RWKX 1YYNA 3THPA 1F31A 5IK5A 3VBHA 1N1TA 3NL1A 1ASJ1 1XYNA 1AR72 5T5OA 1N1YA 2IFWA 5FMOL 1NLRA 3T2OA 3ZLIA 4EQVA 2PHWA 4LKEA 4NRQA 3ZPYA 1JZ5A 4M3CB 5H9QA 1OI6A 5K0UB 2FDJA 2ARXA 3NAPA 1YI7A 2GH8A 4RR3C 4CDWB 4F8AA 2VO5A 4IW3A 4K40A 5J36A 3NKTA 4YYOA 1QEXA 1GWKA 3ZMOA 3WINE 5C7GA 2XPJA 3W21A 1KGYA 2HEYF 2VVDA 3PMSA 3DKWA 3ZYBA 4NIDA 1RYYA 4QDQA 1RUJ1 3UGGA 1BK1A 4Y5SA 4UWDA 4DEVA 4AQTA 4MOAA 1CPMA 1YRZA 3T09A 2I07B 2MHFA 2WLQA 4FXGB 3GCWA 3OGGA 1QY4A 1V6NA 1JHJA 1OFSA 2E32A 4Q0VA 1JS9A 1GQGA 2VNRA 4INDA 5EPAA 2BJSA 3MUY1 4IE6A 1FMD2 1QIQA 2QVSB 2Y6HA 1RUJ3 1QDCA 1YJKA 3OJBA 4DOUA 3H3ZA 5I0TA 1O3RA 1Y9QA 1TME1 2VUCA 5I0DA 1H8VA 2VAUA 4YW4A 4M0NA 1YFXA 2DUPA 1AR91 3NJXA 4TXWA 1JTZX 4HVRA 2WZ8A 2ZHMA 2JD4A 3TNPB 3ILRA 2O8QA 4BIOA 1EV12 2HWF1 3O1RA 1ULPA 4QDRA 4CEYA 1H6XA 2WNEA 4BK5A 1X7NA 1PHMA 4AW7A 1MS1A 4LIVA 4NOTA 4LA3A 1NQDA 4XQWA 5KHKA 3DECA 1HXS2 5A32A 3H8OA 4YZ1A 3K3OA 2QQNA 2ZHLA 1UOFA 1VBC2 2QCSB 4LBMA 3WNPA 5IFTA 1GOGA 1SDDB 5KR7A 5ABJA 2P17A 1REFA 4JX0A 2JE8A 1VALA 4IESA 2K9ZA 2W1UA 4P14A 1RMU1 1ZRFA 1UWWA 5AVPA 4IGOA 4BIFA 1MQTA 5IW0A 4CCEA 4NAMA 1FAYA 3ZR6A 3AL6A 2X5IB 1VRBA 3LA3A 1O59A 3KHCA 3VB9A 2X09A 3OUHA 3VL8A 4CRQA 5L9RA 5DZEA 2Y6JA 1R081 2V5DA 2NN8A 3LSEA 4CA9A 3AXEA 3U14A 3CJIA 5A80A 3KB5A 3ZYFA 2J1AA 4LA2A 2ETEA 2JB4A 4NRMA 4A7KA 3BTXA 4YARA 2BEOA 3SCGA 2KR2A 2W94A 1EAH1 1UKGA 3KT7A 5CAZA 4N90A 3DUIA 3IPVA 1GP5A 2JG8A 3AP7A 3CQOA 4OLLA 2R072 5DUVA 2HBTA 1YI9A 4K3UA 2AUYA 4LK7A 4Y3OA 5HI0A 3V0BB 3O12A 1DHKB 2QBXA 2EVXA 5K4LA 4IV1C 4R8HA 1OA2A 1QJY2 1DGWA 3AYEA 3DCQA 5FJKA 5L73A 3GHMA 4NPLA 3VV1A 2X8KA 3WCSA 1CVNA 4G3YC 1OKOA 1JHNA 1NZCA 4CU9A 3T4HB 3NNJA 4Z2WA 4IV1A 2PHTA 1SCSA 2VJXA 4FXKB 4K1YA 4Q0UA 2YPDA 4JVAA 4CUGA 2EALA 5HCAA 2ZHNA 2ZOEB 3BTAA 4FPHA 5FPLA 5HXMA 1JOJA 2NMNA 3O1OA 2QQKA 1W9SA 1IPJA 1XXNA 3C7HA 4UW5A 1F5JA 4Y26A 3WG1A 3LIGA 4Q26A 1MS5A 1OC1A 2XWBB 1SBFA 4W50A 1BVVA 1LTEA 5C4WA 2LM3A 5LZ6A 2GN7A 3CJIC 2VMFA 4UAPA 4YG0A 5FQ0A 2Q1ZB 1NXD1 1HIXA 2W87A 5FKBA 2QQPA 1QNYA 4WZFA 1KS4A 3WW2A 4JRAA 1YUDA 5FUPA 4J25A 5I8YA 5TSWA 2XLGA 1OA3A 2NMOA 4NROA 2QUOA 1J3QA 2D43A 5LWBA 2GH2A 4I02A 2DFCA 1MQTC 4BQ1A 4XBQA 2P2KA 3OTFA 1MZEA 2WQ4A 3TAYA 3U10A 1UU6A 1V9U2 4XJ9A 4CUAA 5JPMB 1XU1A 4ORFA 2R7EB 2ZGOA 1XSQA 3CHXA 4PI2A 3I2FA 4CCLA 1KFUL 3N3HA 4CXWA 4AQ6A 2KA3A 4HPKA 5A7QA 3DXUA 1T6GC 3IM0A 4GWMA 4IE0A 3WF0A 2YC4A 4RFT0 2PXJA 1X82A 4PI0A 1H30A 1HXS3 1SEFA 3CNAA 3ETPA 5FYVA 4EV0A 3ZXDA 5JI9A 1JYXA 1SPPB 2JKXA 3IAPA 3H3UA 4W65A 3POWA 3T0DA 1SZBA 1IOAA 1LODA 1CAVA 1S1AA 3MIEA 2W95A 2ZMKA 3OGSA 3WNOA 5KC5A 1OF4A 1Q3EA 4V1PA 1FPN1 1WW4A 1MZ5A 3F95A 4QKFA 1AR81 3MICA 2ES3A 4UFMA 2OXBA 2D3SA 2D3PA 1XNDA 1GV9A 3WF2A 1RUD2 1AX0A 1DG6A 4K21A 5BNNC 2VXRA 4E4ZA 1MR5A 1POV1 3CL1A 4ASLA 2XJVA 1WLWA 4BMBA 2HYXA 1UIJA 3M8LA 4JRLA 4UFIA 4V2WA 2DWRA 4W6WA 4FPLA 5FZAA 1G9DA 3T0AA 3BTZA 1B35A 4GAZA 3B00A 3T3YA 4DY5A 1TNRA 1PZ8A 5BNPB 1K42A 1RMU2 1H9PA 4AEJA 2YGMA 3FLTA 5DN2A 1W6MA 5D21A 3MW4A 5FXZA 1ZBE1 1DGLA 3OGRA 3I7DA 3AK0A 3AX4A 3UT0A 5GZDA 1JYWA 2RJLA 3ZXAC 3AFGA 3AXDA 4URTA 2NP0A 5LW9A 4N7IA 3OUJA 3I2IA 2ZGRA 3VBOB 5EJZB 1CZVA 1RHI2 3KV9A 4JZRA 1QJU2 3N35A 4XHXA 5EFUA 1KITA 1R091 2MEV3 2RS33 4FFIA 1CN1A 4AVVA 4CEWA 3B5LB 1MEC1 4Y24A 5CFCB 5K7PA 1IQDC 1TEIA 1VAMA 1QH7A 2DTWA 3W58A 4E2SA 2D98A 2ERFA 2ZGMA 3MPPG 3P6BA 2PMWB 1ENXA 3VBSA 1IZ3A 3Q8EA 2L9LA 5I0UA 3KQ4B 4XJ8A 1QJZA 2V72A 4QX7A 5CFCC 2WUHA 1F15A 4YW3A 3IAQA 2FBEA 2YU1A 4LBJA 4F3JA 3FHQA 3PLQA 3NKGA 5I8TA 4JQTA 2ZZQA 1IS3A 4MGSA 3SQOA 1YEWA 2GC2A 4X8PA 1RUNA 2TNFA 2ZGSA 5FZ1A 1Q56A 1WCQA 3PVNA 4JDMA 3M1HA 5A7NA 3VZLA 3ZN5A 1JYCA 2TEPA 5DZFA 2W3JA 3KSCA 3M3CA 1WMEA 3VDCA 1DQ4A 1UY1A 4WBBA 5DUUA 1G7YA 2A6WA 4BHPA 3QACA 3Q8AA 1QHDA 4XZUG 2JDKA 3IZOA 3NNMA 2P3YA 4MGQA 1EYBA 4QQOA 4A7YA 2BNOA 4QPYA 3IMNA 4RS5B 4TN7A 1H1MA 2JDYA 3F2ZA 3THCA 4OI0A 2LRPA 5AFBA 5IK4A 1W6PA 4QGMA 4I0AA 2Q8EA 2CAVA 1X9PA 1NCQB 2ZX4A 1R1A1 1HX6A 3MIHA 3RYKA 5LK7B 2XUEA 3KVBA 1NA1B 2IVIB 3FMGA 1Q8SA 2XL7A 3GALA 1FYUA 2R0FA 1JU4A 1OQ1A 1QJEA 1U12A 3PIJA 4FQ4A 4KGQA 1PGL2 4UW4A 1LOAA 4UW6A 1WD4A 1VBA3 2PHFA 3H9AA 3J8F3 3H50A 3E6BA 1AYN3 3ZM8A 2OYZA 2EXIA 3KCCA 2Y6LA 5J1XA 2PHDA 3ILNA 5BXXA 1H4GA 3K4ZA 4F7ZA 2EXKA 4WM8B 5IVYA 4ZHNA 1ONAA 5JOYA 3EYPA 4Z07A 4QXHA 1V9U3 2NPIA 5FZDA 1WGPA 1DQ5A 1CAVB 1C1FA 4KU8A 1VBE3 3USUA 2DBIA 3PU8A 5A70A 2PHXA 3C7OA 4KWJA 1X33A 1PIV3 2GU9A 2D97A 2IUWA 1O5LA 1AF9A 3E97A 4QHOA 1GZTA 3MIBA 5FYHA 3SC7X 1O3TA 4A44A 1SBEA 1QF3A 1XYPA 3HJRA 4I3PA 1W3XA 4G4FA 2YUEA 3AKRA 3O1UA 4L9BA 2P3KA 4Q4X1 5FY7A 3I3QA 3LCPA 2J1UA 1ENQA 3HBZA 5T55A 3VBRB 4NHXA 1W9TA 4D6QA 4BLIA 4FPOB 2X05A 4A45A 3RYRA 2ZJCA 1DYKA 2WFF2 3WNNA 1EAH3 1NLSA 4BQWA 2F17A 4RHV1 5FP9A 5A6QA 5B4NA 4BH9A 3MEPA 2Z5WA 5C3OA 4M4RA 4OUSA 3WVJA 1W6QB 1WD3A 2RG4A 1CAUB 2JJ6A 1ZM1A 4D69A 5BNPC 2XJPA 3SNMA 4IEZA 4DXSA 3BVCA 1UOBA 4E4HA 2G9FA 1ND2B 5HCHA 2DYCA 4LO8A 3LEMA 2RHPA 1PVC3 4RS5A 1KD7A 4Y22B 2YY1A 5JPNB 3OG2A 1SFNA 4O7XA 1U5XA 4K7JA 1C1LA 4OULA 1NCRA 1QGLA 1YQ6A 4HSLA 4KBBA 3J7NA 4Y1UA 4KI5M 5FMOS 5CEHA 3LOBA 2XBO3 2ORXA 2IC1A 3L9JT 4NAOA 5LEKA 1BKZA 5FKCA 2UYAA 1RJ8A 3NV1A 3DPRA 4NJ4A 1PNFA 2WAOA 4NHMA 3UL2A 2C6SA 2QJVA 1YQ2A 1QDOA 2TUNA 4LORA 1Y43B 2RR12 2A70A 1LESA 2IXIA 3U07A 3AZZA 4JC1A 3ZMNA 4FPYA 1SHWB 2XH6A 2LALA 5SV5A 1BEV3 5CU1A 4LHSA 1CAXB 4JKLA 4E8CA 1JOPA 2BGPA 1BHGA 1RUF3 4PQ9A 3I2KA 2ZX2A 4XC9A 1ENSA 5J48A 4BQ4A 4QX2A 2WT2A 3CIHA 3W9AA 2W1QA 5DABA 1ZX5A 1DZTA 1GQHA 2VH9A 3N7JA 1UCXA 3C2UA 4LO5B 2ZGQA 2RDRA 1EY2A 1H8TC 1AXKA 5JOXA 1DBNA 1VBD3 1DP0A 4Y1ZA 4GWIA 1YFYA 1PO23 4HBNA 1WUVA 2YC0A 3HN3A 4H3WA 3UETA 5LBFA 3RSJA 1RIRA 4K20A 4CU8A 5DDJ3 1HRI1 1BBT3 4CCJA 1OXCA 2VNGA 3JQXA 3RI9A 1KXGA 2QQMA 3ON7A 5FO7B 3DYOA 1Q8OA 4C8DA 4OI4A 2EAKA 4XILA 3M4FA 2A7AA 1PGL1 1APNA 5FZ0A 4W8JA 5CADA 4B7KA 1UOGA 3ILFA 1IHMA 1W0NA 5APAA 2EXHA 1GZCA 1SLCA 5F6KA 3D4KA 3IWZA 5FFOC 3SLIA 2GZWA 1O4TA 2W0XA 2VD7A 3A7QA 1ZRIA 1OH4A 2QQWA 3V0AA 1LHWA 2FZ2A 1POV3 5J96B 4H2AA 4M4PA 3POSA 2DCTA 3W59A 4HFSA 3H7YA
chains in the Genus database with same CATH topology
2K2SA 1IS4A 3D0JA 5KXBA 1I3HA 3EBRA 5KWRA 3AYAA 3TB0A 2WFPA 5SV8A 4OHZA 2ZGPA 1QJY3 2VW1A 2BVVA 1AVBA 2HWF3 1HQNA 1O4YA 5J37A 2A3YA 3G7DA 3HIFA 4CEWB 2IXCA 4Q0PA 5C8WA 5JZGA 3WW3A 2X29A 4LO4B 4JGYA 5F6LB 5F5QA 2C1FA 2YXSA 4E9KA 2UWBA 4KH9A 4D3WA 4BM8A 1G9AA 2GN3A 4YLZA 3BB6A 4DINB 4XQDA 2WFF1 3WDUA 4JGYB 4FTEA 3SCHA 4B8EA 1LULA 3LAGA 3I8TA 1RITA 1RUH1 1V6OA 1AHSA 3GBGA 3VBRA 3WDWA 4GB32 2XHKA 2ZGNA 4M00A 1VBB2 1SQ4A 4GKYA 3I59B 2E7QA 2RMU1 1DFQA 4QPIA 1QQP1 4FOQA 1XE7A 4BE3A 4KG0A 4YZ2A 4M3CA 4AQ2A 3PNAA 1GANA 3X29B 4FPGA 4XBNA 3J8F1 1COV1 1OA4A 3WOGA 1BXHA 1LR5A 2WZR2 1X8EA 3FE5A 3UKNA 2AREA 2HWC1 4JGZC 4OHWA 3LZZA 2PN5A 3TRSB 3KT1A 1GBGA 5GKAC 2E63A 1AYM2 2YDEA 1KFXL 2WKKA 5CIRA 4HVQA 4EWEA 4AVSA 4XE9A 3AYCA 4P9GA 1TQ5A 3WW4A 5FQ0A 4Q4W2 3KD4A 2ZPXA 3AJZA 2BFUS 4IQPA 1A78A 4QQLA 4WV8A 3GBFA 4CZSA 1GSLA 1RUH2 3VZMA 4AHYA 5KBFA 2PYTA 4FVVA 5EJ3A 1VBB3 2WC2A 3VHOA 4AEMA 4M0HA 4Z1VA 4AFDA 3WV6A 4I0BA 1YWKA 1W0PA 4Y4YA 4MUVA 1VP6A 4OVEA 2OW4A 3K48A 2V5YA 4AHZA 5C8CA 4H14A 4PIZA 2D6OX 1H2NA 2B5HA 4FTSA 3ENRA 4QQ2A 2ZKLA 5ABJC 1ZBA3 2NZ9A 1XNBA 2IXLA 2I45A 4WZCA 1WW7A 3HT2A 4PIYA 1FT9A 2YPJA 1VBE1 4D7TA 1MS8A 3O5SA 1I9RA 1VR3A 2DUQA 2GC1A 2R30A 4Z82A 3ZXJA 2XJQA 5JIUA 4JAAA 4XPVA 4WM7A 3M7AA 5CFDB 5AC91 4N53A 3VDDA 1AR71 5FPXA 4HN0A 1FATA 1O5UA 3B7MA 4AE2A 2B46X 2OPKA 4AWDA 3LGRA 3HAGA 1DLLA 2R6QA 3ALQA 4PLNA 3E6CC 3R05A 5ACA2 1LECA 2PAKA 2AYHA 3ETQA 2PLV3 3AP5A 3OYWA 4COUA 4DRVA 3ZFEC 1WA4A 5A33A 3OYWB 3IDBB 4R4ZA 3WNXA 3ZIWA 3AM2A 1FNZA 2HWD2 4RL7A 2A75A 1JH5A 2D6KA 3KCYA 5HCBA 5GZEA 3RMXA 1I5ZA 3WD5A 4E4SA 2JENA 2BW8A 2W68A 5D8AA 1YLLA 1RVF2 3VBUA 5JCTA 4HK9A 3T1MA 1PZ9A 3FLRA 4YW5A 1V6KA 2JECA 1TE1B 2YHJA 3BODA 4AEKA 3KCXA 1POV0 2GMPA 5AC92 5ACA3 1BVP1 4LUKA 4YG3A 1N3OA 5JWPA 3JCIA 1D2QA 2QDRA 4RHV3 4RSUA 1MZ6A 4GB33 4QPIB 3ZXKA 3VBRC 2Y38A 4ATEA 3I59A 3LWCA 4GALA 5GALA 4AI2A 3NAPB 4RQPB 1LOEA 1RUC2 4E2GA 1K5MB 3WDYA 1NA1A 4YFWA 1KDKA 3J26N 1ZZ9A 2E6VA 3ZIXA 1C5HA 3JBG2 1OHFA 2RR13 3VBHB 3EJKA 1QJU1 4GXLA 3UJQA 4LBQD 3ZSMA 5E16A 1AL22 3ZYRA 1ENRA 4GIQA 5C9AA 1G86A 1CIWA 1RHI1 4JGYC 2HWE1 3KZ4C 4KWKA 3WG2A 4Q8KA 5GJ6A 1WMFA 3H8UA 1M06G 2ENRA 3ZSJA 4CDUA 1S0BA 3J9SA 3ZXFA 1GLHA 1OPOA 2EA7A 4AHWA 1R1ZA 4LBKA 5GLWA 1QXJA 2WS91 2XWJB 3P3PA 4Q4W1 1CJPA 1TME3 2UU8A 2D93A 4RHV2 1PO11 1BMV1 5T3NA 5J7MA 2ZTNA 3KMHA 3MF9A 4RA0A 3JD73 4CDWA 2GNDA 2A6YA 3Q9OA 2DVDA 1RUF1 4Q2FA 4JTOA 5BV6A 1S0IA 1X50A 4K8FA 4TLFA 3ZN6B 1RUD3 2YYOA 3FBYA 1IS6A 4P9WA 1QMJA 1LCLA 1URXA 2XGXA 4S2DA 4CEYB 1Q8QA 1PNGA 3VBUB 1A3KA 3H1WA 2MNGA 1C5IA 1OLQA 2UWCA 4YM3A 1OLRA 5GZGA 2WZR3 1Z7S1 3TYJA 5DG2A 2HWD3 4N43C 2VG9A 4OHXA 1BBT1 2X53S 4XHBA 2RS51 1ND3A 4C0BA 1S0CA 3VZOA 1XE8A 3LA2A 2NLRA 4PF5A 2PHRA 1R1A3 4RR3A 5L7OA 3BOPA 3ZO0B 4I3GA 4LO6B 5C9AB 3M3IA 5JMCA 2B8MA 1WCDJ 5LRSA 1FPN3 4NPRA 3A4UA 1BEV2 4YGDA 3HMYA 1AYM1 4FPEA 1C8NA 4N53B 3VDDB 4IV3A 2HWB2 1VBB1 3PVBB 1HRI2 2WQZC 4C1XA 5KXDA 5FTTC 1LGNA 3T1LA 1ND3C 5KC6A 1PVXA 1X8MA 1DU3D 4DRRA 4AYUA 1ND2C 4FAHA 4LTAA 4HN1A 4A7ZA 2R042 4N43A 4C91A 4YW1A 1OPMA 4QD2A 3CO2A 1CJDA 1HXS1 1SLAA 3ZVXA 3WP4A 4CDXA 2ZZJA 1Z7S2 4Y20B 4XOGA 3WHUA 4A3XA 1TNFA 1G8WA 1C28A 3MF6A 2VW0A 4AHXA 2PA7A 5LEJA 1UX6A 4S2HA 5JZGB 1A6CA 3GZTB 5AC93 3G6JB 3SITA 1SMVA 2CGPA 1GFF2 4LUMA 3VBFA 5CFDC 3WHTA 1ZRCA 2Z69A 1OFNA 1QH6A 5CG8A 3EXUA 4EWAA 1HQWA 1E57A 1Z0HA 2GNTA 4AGGA 3MPBA 4MXVA 1AR63 1RUE2 2DCYA 1KQRA 3INAA 2PELA 4XFBA 1DQ6A 2SLIA 5ABJB 4XIOA 4EN7B 4ISRA 5JVVA 4PDWB 2P3JA 3OY8B 3MGUA 4H7MA 4WM7B 1U5YA 2VOXA 2I74A 5FOJB 3AZVA 2HWB3 4WM8A 4ASMB 1QU0A 1BJQA 4Z8BA 1XYOA 3RG0A 5H9RA 2R49A 3UJOA 3J8F2 4XJWA 4AK3A 2HYKA 2UWAA 1IGOA 5T5JA 2Q8OA 3RWNA 4LT5A 5K0UA 1RUG3 4BMEA 3N7MA 1AR92 3ST7A 3MW3A 1A8MA 4QMAA 5AVAA 3D5OA 1UU4A 1UPSA 4KWLA 1MACA 1XRUA 3WW1A 2W52A 3WQ7A 3FWEA 3CJXA 1HW5A 1QXPA 1D4M3 4AFCA 1RUG1 2D7FA 1RUI2 3QBQA 1WBLA 1IS5A 2CYFA 3M3OA 5FRAA 3AMHA 3VBUC 1NXMA 2VULA 3U4XA 1VBA1 3A0KA 1W6OB 2OUJA 1GNZA 4D7SA 1AYN1 1UW8A 1ZNPA 4Q4Y3 2B7YA 3VBOC 1LOGA 3LB9A 1D4M1 2PTMA 1R093 1K5MA 2XVGA 2MEV1 4DY3A 2RS12 3KGZA 3QCWA 5BUVA 5FO8B 4MGKE 2DCKA 2Q1MA 4I09A 2OUHA 3HQXA 4RGAA 2B42B 3ZYJB 3WCRA 3OF1A 1DGRA 4LR4A 4Q4W3 2GMEA 2UURA 1WLTA 2VQAA 2OZJA 5IK7A 1F2NA 4D94A 4J1WA 4H55A 4HKLA 3AB0A 3JUUA 5CVRA 4LBOA 4RR3B 1MS4A 3AKTA 4BCUA 2HEVF 3N7KA 4LBLA 5JI7A 1PIV2 1LB2A 1H9WA 4YGCA 1ZVFA 2IXHA 2RM23 3ES1A 2K0GA 2JG9C 1G9CA 3TN91 2HWE2 4CEWC 4GULA 2RS32 3ES4A 4HK8A 3UKVA 4CDUB 1Z78A 4BOWA 1VB4A 3GHNA 2OIIA 5JZGC 1NCQA 4HZFA 1N47A 4PLOA 4B7EA 4L99A 1QWRA 1ZA4A 2R063 2WWSA 5JOZA 4R52A 2P37A 2WNUC 4XF0A 3ATGA 4KL1A 1JYIA 1FV2A 2ZABA 1VAKA 5CFDA 5JSRA 4MX3A 4IEVA 2D40A 3FZ3A 2R1BA 1UMZA 2XKOA 5F9TA 3ZFFA 2H0BA 1PMIA 4UXAA 1TMF2 1KJLA 2ZAHA 5DZGA 2XBO2 1MEC2 1SLLA 5A3MA 3SISA 1R083 2VQ0A 2IXKA 5GLZA 3WR0A 2PFWA 1HKDA 3B93A 4PDWA 2PAEA 2BQPA 3WP5A 2E7AA 1DGRN 2HWC2 1QOSA 2FMDA 3IN9A 1UPIA 2RS31 2GALA 5L7OB 4QM9A 2UYBA 3H1MA 4X8NA 3ASIA 4S2GA 4LNVA 2ZHKA 3PVOA 2A6VA 3DF0A 2BUKA 1ASJ2 5CNAA 2Y26A 4Q4X2 2KXLA 3IKWA 1YIPA 2VOKA 4WVZA 5IK8A 4Q1PA 4LO7A 3ZFGC 1LU2A 2QFEA 2D44A 5FPZA 3MLKA 4AGVA 1BQPA 1GZWA 3WG3A 4HKWA 3ZYIB 2HKXA 2Q0AA 2G9GA 2IXJA 2MPFA 1N1VA 5L19A 2B9UA 2MEV2 3OD0A 1U5ZA 4YZ5A 4WVWA 3UV9A 1JUHA 2RM21 4BWOA 2GDFA 3MLJA 4QXKA 3B94A 4IV1B 2EAAA 4LE3A 4ZKTB 4CP0A 2XBO1 5A33B 1R092 1DQ1A 4CEYC 4YM2A 2O8OA 4Q4Y2 5A3LA 3JZVA 4OI1A 5GM0A 2QDNA 4L97A 2O0OA 5FAXA 5GLUA 1NOVA 1C8M3 5JSPA 2N7GA 4Q27A 1LHUA 1TMF3 1N1SA 3IDEA 4XFIA 4LBQB 4HSJA 4HMZA 4FOVA 2VPVA 4NWWA 3VKNA 4EJRA 4AEDC 1KRIA 4TYSA 2JX9A 1XQNA 3A0NA 3FUOA 2BNMA 4MVTA 4Q4X3 4COYA 2D6PA 5J3UA 5T5PA 2W39A 4XFHA 3CF6E 1H1IA 4RGGA 3PJYA 2XVLA 2WIIB 3T2TA 1EV11 1MS9A 2BYVE 1FV3A 3LA7A 2JG9A 4FOWA 1NY71 3OY8A 4C1WA 2HWC3 1RGSA 4IEXA 4P9JA 4COWA 1QJX2 4AVCA 4J6GA 1PVC1 1NG0A 3FJSA 5KHJA 1GZWB 1V00A 3URFA 2R071 2WA4A 4IXLA 4META 4M01A 1BCXA 3HN1A 5EZWA 1MEC3 3VBSB 4NR1A 3MIFA 3RZZA 2JE9A 4IEYA 2CY6A 1OD5A 1KJRA 5I91A 1RHI3 2Y0IA 4PJYA 1QJY1 2GSYA 1C8M2 3SMHA 5EWSA 1O4ZA 3OBTA 3O7OA 1COV3 1RUJ2 1YJLA 1PK6B 2BGCA 2JG8B 5D8AC 4DS0A 2CWSA 4E27A 3NJZA 4Y1XA 1K5MC 3VZNA 3FBMA 2ZMNA 1ZBE2 1VBA2 2ZCWA 4OHVA 3ZN6A 4EN8B 3ZYPA 3U11A 2WT1A 2XG3A 4S2FA 3B9CA 1W6MB 2ZGUA 4L8QA 5BNPA 2ZX3A 1DYPA 4XXAA 3SH4A 1DIWA 4P9IA 2D5HA 4YVSA 4TZDA 1QJX1 3ZDSA 3DPRB 4FPKA 1ZZCA 5J98B 4JCKA 3ZSLA 1RL3A 4P5HA 1HQLA 3CU7A 2D6NA 3VHPA 1NCRB 5K0UC 3U0ZA 2QZ2A 4QPGC 1ULGA 2YMZA 5L7OC 2GC0A 1QJX3 2V09A 2YGLA 1AXYA 1VRH2 2NYYA 2ZS6B 3H0OA 4Q4Y1 1MS0A 5E1RA 1YIFA 3RMYA 2DF7A 5C9AC 2GNMA 2ET1A 2ZAAA 2RJKA 3I54A 1FXZA 2XJTA 4AVBA 1WBFA 5C8CC 1PGW1 1Y3TA 3QLQA 4SBVA 3ZN4A 1LOBA 1DDLA 3GZAA 3S30A 1HRV1 1JBCA 5JSOA 3ZXGA 1NA1C 3FC0A 5E8AA 1SBDA 4EROA 3AMQA 4M3CF 1R082 1FNYA 1ZZ6A 4EN6B 1JUIA 4Q0SA 5E88A 2DFBA 2R073 3B9IA 2H6BA 4CDXB 3S7EA 2IZWA 4FQZA 4B4QA 2BVBA 4BZ4A 2E51A 4CTEA 3AP4A 4PIXA 1OQEA 4YG6A 2B39A 1BMV2 4HETA 1EPZA 3AJYA 2JDZA 1GYKA 4MLOA 2DVBA 1TME2 1UKRA 1W6NB 1RINA 1HV0A 2UY8A 4DXZA 4YVWA 1RMU3 4NN0A 1COV2 2DCJA 3NSTA 3MW2A 2O1QA 4Y22A 4YZ4A 5BNOA 1O91A 1OSGA 1PK6C 2BNNA 4I30A 3EQEA 2CGOA 4FP2A 4LHKA 4QU2A 5ACA1 1C8M1 1VB2A 1IKPA 1MVQA 3SH5A 1XNKA 1RUC1 3USSA 4P9LA 4FSJA 4GA9A 2CGNA 4DMIA 3K51A 4YM1A 3MZHA 3VBSC 4GH4B 4AXOA 3HWJA 5FLJA 1VBD1 1AJKA 2Z42A 1ASJ3 3ZYGA 4QQPA 5C4WC 1OMIA 1CPNA 2PAMA 1SCRA 4K9SA 5BNQA 3IDCB 5JDBA 2DU0A 2NQYA 3OD4A 2ZGKA 1BZWA 3ME2A 5C4WB 4OFGA 2RM22 4JDOA 2RS13 3WDTA 1PZ7A 4CDQC 1W6QA 1YHFA 3R0RA 1FOD2 5B2GB 4FPFA 4PDWC 1UAIA 1EV13 3O0XA 4OI2A 4ONUA 1H0BA 4Z92B 5FQ0B 1ULDA 3QH7A 4LLFA 2ZGLA 4NHLA 3V64A 1RUI3 4XZPA 2XLAA 3VN4A 4FP3A 3KM5A 2PLV2 4Q0QA 2BWCA 1HRI3 1D4VB 1QQP2 1RJ7A 1B09A 1SFYA 3JB8A 3WZ1A 3JD72 3MFAA 1FMD3 5FLHA 5H9SA 2BFUL 1H2LA 5JOWA 5KXEA 1AR93