1GNZA

Lectin i-b4 from griffonia simplicifolia (gs i-b4)metal free form
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
236
structure length
236
Chain Sequence
SVSFTFPNFWSDVEDSIIFQGDANTTAGTLQLCKTNQYGTPLQWSAGRALYSDPVQLWDNKTESVASFYTEFTFFLKITGNGPADGLAFFLAPPDSDVKDAGEYLGLFNKSTATQPSKNQVVAVEFDTWTNPNFPEPSYRHIGINVNSIVSVATKRWEDSDIFSGKIATARISYDGSAEILTVVLSYPDGSDYILSHSVDMRQNLPESVRVGISASTGNNQFLTVYILSWRFSSNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords GSI-B4 ISOLECTIN
publication title Isolectins I-A and I-B of Griffonia (Bandeiraea) Simplicifolia. Crystal Structure of Metal-Free Gs I-B(4) and Molecular Basis for Metal Binding and Monosaccharide Specificity.
pubmed doi rcsb
total genus 50
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2001-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1gnzA00
3AYCA 2WT1A 1HDKA 4Y1YA 4UW6A 1WCSA 1ENSA 4IQPA 1CONA 1HQWA 3AJYA 4Y1VA 1PZ9A 1YI7A 2NM1A 2OVUA 2YXSA 2ZA9A 3B01A 4DS0A 4XJ9A 3SNMA 1U0AA 1FX5A 2D6PA 2WSUA 5DZEA 1A78A 1C1FA 1Q56A 3WDXA 4YG0A 4OZXA 3ILNA 2JJ6A 1JBCA 3VKOA 2TEPA 4FQZA 3SH4A 3WLUA 1BJQA 1IKPA 4YFWA 1QDCA 1I1EA 4DRVA 1LOFC 5H9SA 4FP3A 1BZWA 3HN1A 1A3KA 2ES3A 3AP9A 4XE9A 3WDVA 1WW5A 4M3CF 2H0BA 3MW2A 5JOZA 2ERFA 1N47A 4FQ4A 1SLAA 2A6WA 3BTAA 1DFQA 1GZ9A 1V6JA 4XOGA 4Q26A 1LHVA 3ENRA 1QDOA 1Q8QA 2A3YA 4YG6A 4ATEA 4JC1A 4FOYA 3ZSMA 1V00A 3U4XA 2DTWA 2HYKA 1W6MB 3B3QE 2VH9A 4XTMA 1ULEA 4YLZA 3L2YA 4YZ4A 5T5LA 4BOWA 1DYKA 3A0NA 5T5JA 2D6NA 4YW5A 4LBQB 1ULCA 2E7TA 5JOWA 4WVVA 2PELA 4YGBA 3O0XA 1KJLA 3B00A 3OGGA 4XJUA 3TAYA 2GN7A 5CAZA 2YMZA 1W6MA 4R9BA 2R1DA 2WT0A 2ZGPA 4Q8LA 3AK0A 3AXEA 2YY1A 1NLSA 5BYNA 2CL2A 3O0VA 2JKBA 5JDBA 5IK5A 2JECA 5E89A 5GLZA 3WVJA 4AGRA 4Z8BA 4TYSA 3POSA 1AJKA 4FPCA 1AX2A 1VAVA 1YXWA 2A6YA 1BKZA 1GLHA 4BQ1A 3USUA 3GALA 1GSLA 2D6LX 5E88A 1WUVA 3SLIA 1DZQA 2VU9A 4FOQA 3WOGA 3KQRA 4GA9A 4XILA 3B9CA 4LBKA 3IPVB 1KDKA 3UK9A 2LALA 1JOJA 1MVEA 1QNWA 1AX1A 2ZABA 1LU1A 1AZDA 1DYPA 1LJ7A 2OUHA 2PHXA 4FPGA 4YGDA 3CNAA 1OKQA 2D43A 3MW3A 4ISQA 5EXOA 1VIWB 1LGBA 1SBDA 1S0GA 2NYYA 5JOXA 3AZXA 4AYUA 4NO4A 1IS6A 5GZFA 4Y1XA 1YO8A 3W58A 4LBNA 1KJRA 1APNA 2E51A 3ZSJA 3OYWB 2I2SA 3JU9A 5HCBA 3KM5A 1MS0A 2NMNA 4JRAA 3SITA 3WG1A 2D6KA 3O5SA 1S0EA 3FUOA 2DVDA 2EALA 2ZHNA 2WQZC 3O12A 4Q8KA 1QKQA 2R0HA 2A71A 4BMEA 2V5YA 3M1HA 1RIRA 2A7AA 4ZXKA 1WLDA 3ZXKA 1O4ZA 1EPWA 2OUJA 2NMOA 3H0OA 1BYHA 1Z0HA 5T5OA 3ZSKA 3V0AB 2BQPA 4XIKA 2WLQA 4YFZA 4FPJA 5JOYA 3FBYA 1ZA4A 1W0PA 3D5OA 1DQ0A 1SLIA 3N3HA 1MZ5A 1FNYA 4FPLA 2W68A 4DQAA 2SBAA 5T5PA 1S0DA 2XG3A 2E7QA 4XJAA 1Y7BA 4YZ5A 1SACA 3FUQA 3MEPA 2W39A 3V65A 3ILFA 4P9WA 1FV3A 2GN3A 1QNYA 2KM2A 1SLBA 1LOCA 2VW2A 2GDFA 3BIWE 4GKYA 4AWDA 2AR6A 4WV8A 1N3OA 2DUPA 5KXDA 1GZCA 4CZSA 2AGSA 1WD3A 2DU0A 1LOFA 1JN2P 4XJWA 5KXBA 1S0JA 2D3SA 2ZMKA 1W6QA 3PJQA 3POWA 3RRDA 3C2UA 3AX4A 5IK8A 1IS3A 2PHFA 1DHKB 1N1VA 1VAMA 3M3QA 4R9DA 2WSVA 4YGEA 4RA0A 1DGLA 2D3PA 3I4IA 4Y20A 1V6LA 4Y22B 1IOAA 5DXDA 2EAKA 3UJOA 5HCAA 5H9RA 5H9PA 3FFZA 2WNEA 2ZHLA 2VW0A 4PF5A 4BLIA 4YW3A 4U36A 4YZ2A 1V6NA 2GMPA 1F31A 4XIOA 1GBGA 4Y22A 5IK7A 1SBEA 1V6IA 2CWMA 4FPFA 1UN1A 2YZ4A 5L73A 2GMEA 1PZ7A 4ATFA 2ZGRA 1ENRA 4C1WA 4FVVA 2UWBA 1WBFA 2D3RA 5FRAA 4AVSA 2WT2A 2ZHKA 1HKDA 2AREA 4PCRA 1DIWA 1LOAA 1N3QA 1AXKA 2EXJA 2NN8A 2R49A 2VUAA 4YM2A 4PBOA 1LESA 1YRZA 3AZWA 4YG3A 1FATA 1UZZA 3ZYRA 3D4KA 3ZXLA 3AYEA 4Q1RA 4F83A 4XBLA 4P9XA 1MS4A 2Q5TA 2GNDA 5GLWA 5GALA 1AJOA 3OY8B 5KXCA 1CR7A 1WW6A 4WZFA 5FREA 4YZ3A 1TEIA 2D6OX 3WDTA 3M3CA 5EYYA 2DU1A 1GYKA 2P3JA 4FOVA 4XXAA 4Y24A 5EYXA 1ENQA 3RQ0A 3USUB 2E6VA 2NZ9A 2A75A 1GKBA 4XTPA 4Y1ZA 3A4UA 2C9AA 1S1AA 3OY8A 5GZGA 3R4SA 1C57A 1FNZA 2UURA 3OBTA 2A5ZA 3OJBA 3PVOA 5GZEA 2UWCA 5DG2A 5DUUA 1AXYA 5DUXA 1ZM1A 2PHUA 3INAA 1LHWA 1LULA 3N35A 2ZKNA 1IS4A 1B09A 2ZGLA 2ZGQA 3V0BA 4K20A 5DG1A 1KDMA 2D44A 4Q1PA 4YGCA 2ZAAA 2W08A 4RL7A 3NV4A 1G9DA 1S0BA 1C4RA 5GLTA 3WCRA 1LHOA 3BODA 4AGVA 2VY0A 4DPNA 2G4IA 3UL2A 1LU2A 1C1LA 2AH2A 1UZYA 1UL9A 3WDYA 4Q27A 3R05A 3V64A 3WG4A 5F9TA 3VKNA 1LGNA 3ZXFA 4XJZA 1DLLA 1LHUA 4M00A 1RITA 1CN1A 3NV1A 1MZ6A 1W6PA 4PBPA 3SISA 3WCSA 1N1TA 2UU8A 4DRRA 3DUIA 2ZMNA 1IKQA 5GLUA 2GMMA 4XHBA 5IK4A 2E53A 2C5DA 3DGTA 3N7KA 2PHTA 4K1YA 1OQ1A 4L8QA 1JHNA 4CTEA 3N7JA 4LBMA 4I30A 4W65A 3VKLA 1S0IA 4K21A 1H9WA 1WD4A 2DTYA 1SBFA 4XBNA 1RINA 5T52A 2NP0A 1WW4A 1LOBA 4XZPA 4Y26A 5CBLA 1WW7A 1QOTA 3AYDA 3RMXA 2V73A 2P3IA 1H9PA 1KITA 1LODA 2EF6A 1ONAA 1BQPA 1YYNA 1AF9A 2PHRA 2AYHA 4ISRA 5KXEA 2P34A 4AVTA 4AVVA 1W6QB 3VKMA 1SFYA 3WV6A 2DVAA 2ZACA 1J1TA 1S0FA 3MPPG 2GNMA 2JE7A 4Y20B 2Z42A 4XYXA 3M2MA 2P37A 3N7MA 1DBNA 3IM0A 4Q2FA 4NOTA 1F9KA 2ZBJA 5GM0A 1CPNA 2A6ZA 1JW6A 2DUOA 5E8AA 1LHNA 3PMEA 4FPYA 1QU0A 5GLVA 5GJ6A 1DQ2A 2JDZA 4FP2A 3AZYA 1MVQA 1GANA 2EIGA 3HMYA 3ZXEA 4LBQD 1JXNA 1NXD1 4SLIA 5T55A 3ZPYA 1MS3A 4K1ZA 2JD4A 3ZXJA 2XB6C 1GZWA 1SLTA 2WKKA 1JYCA 1CJPA 1N3PA 2DVGA 4YW2A 1SCSA 3WDWA 1LOGA 2A6VA 4M01A 3NV3A 3NWKA 4HL0A 3WHTA 3WUDA 2DYCA 1V6OA 3RMYA 5GZCA 3Q9OA 3AFKA 4AGGA 2EXIA 2B7YA 1V6MA 2OW4A 1D2SA 1VALA 4ZKTB 1W6NA 4WVWA 1G9FA 3AP6A 3BOPA 1JYIA 2D6MA 1ULFA 5DUVA 3QCWA 3FLRA 3IKWA 1HLCA 3AJZA 1LOEA 4HANA 3T1MA 1N1YA 3LCPA 4DFSA 1FV2A 1OFSA 3OPZA 4XBQA 4BM8A 1BXHA 3HR9A 2CYFA 3WUCA 5SV8A 3RG0A 4M3CE 1MS5A 1MR5A 2CNAA 1QOOA 2GNTA 4FPEA 3W59A 1DQ4A 1Z78A 4H55A 3AP4A 2ZGUA 4LBLA 5CA6A 5DZGA 3M3EA 3T1LA 3UJQA 3PVEA 1AXZA 2LTNA 5CNAA 1WLCA 4P14A 4R9AA 3M3OA 4XHXA 5DUWA 4UW5A 1X50A 3RSJA 1ULDA 3T2TA 3LSEA 2R16A 1QMJA 2SLIA 1SCRA 2CWSA 4PQ9A 5LK5A 5CB7A 3V0BB 2EXHA 4TZDA 1DQ5A 1CPMA 1FYUA 4XJ8A 3GNEA 3VKFC 1DQ1A 1AVBA 2P3KA 2WJSA 3B69A 3AP7A 2CTVA 2ZGOA 3AYAA 4KBBA 5EWSA 5T50A 3ASIA 1F5FA 3FLTA 3LSDA 5HCFA 4FOWA 1HQLA 2GALA 3SH3A 1QOSA 1D0HA 2ZZJA 5AVAA 3MW4A 5JMCA 1LEDA 5IUQA 1A8DA 1CVNA 1UMZA 1W6PB 4GALA 3D6EA 4LBQA 4ITCA 1FAYA 1LENA 1LGCA 2ENRA 3O0WA 1G9CA 3N7LA 1DQ6A 1JUIA 2GNBA 3A0KA 4YM0A 4CRQA 3PVNA 2DUQA 3ATGA 1G8WA 4UW3A 2PHWA 1Q8PA 2ZGTA 3VV1A 3IMNA 3ILRA 3ZSLA 1G9AA 4D69A 4GWNA 3VUOA 2AUYA 2JE9A 3I8TA 4GKXA 3OBRA 1G7YA 5H9QA 2ZGKA 2W52A 1G86A 2DVFA 1LCLA 1UPSA 3WZ1A 2ZMLA 1I3HA 5GZDA 4FPHA 1N1SA 1MS1A 2FHRA 3APBA 1SLLA 2AENA 5JVVA 1MS9A 3RS6A 1XQNA 3IPVA 2YROA 4GWMA 4XMIA 2R0FA 1Q8VA 4GXLA 4M3CB 1WLWA 4JCKA 2VW1A 2DWRA 3WDUA 2ZHMA 4P9YA 4LBJA 1MACA 3AZVA 3SH5A 1URXA 2FMDA 3NV2A 2ARXA 3QLQA 5JLVA 4XXPA 3AZZA 1ULGA 3ZVXA 4BMBA 3AXDA 4YW1A 4ASMB 2DURA 3AP5A 3WG3A 2P2KA 1KQRA 5T54A 4C1XA 4XDQA 1GV9A 2EXKA 3OYWA 1QF3A 4M3CA 1O4YA 1Q8OA 3ZYPA 1UX6A 4MYEA 1S0CA 1MS8A 1SLCA 1UAIA 4YM1A 1Q8SA 1KRIA 4FPOB 1W6OB 5DZFA 1YIFA 5F5QA 4UW4A 2A3WA 3IN9A 1LEMA 2RHPA 1WBLA 2ZGMA 1W0OA 1LTEA 1CESA 2A70A 1QGLA 2UWAA 3R4UA 1GNHA 2ZGNA 3POYA 1GZWB 4XMAA 1UKGA 4YZ1A 1H30A 1W6OA 4YM3A 1G9BA 2DV9A 1PZ8A 4FPKA 3V0AA 4LBOA 1GICA 4R9CA 3WNXA 2R1BA 3TB0A 3JUUA 4BLJA 2ZGSA 1V6KA 2ARBA 3N36A 2A3XA 2DVBA 5IT6A 4BPZA 2A6XA 3FLPA 1IS5A 3WG2A 1W6NB 2D7FA 1CQ9A 3WHUA 1R1ZA 4U2AA 2VXRA 4YW4A 1AX0A 1VLNA 2CY6A 2YV8A 1GNZA 1CIWA 1LECA 4Y1UA
chains in the Genus database with same CATH superfamily
4OMCA 4N9IA 4E4DX 2Y0OA 1ND2A 3UGGA 1ENSA 1O5LA 4HXCA 4AI3A 2OVUA 3I3EA 2P5BA 2WZEA 3TEYA 1WKYA 4XJ9A 3SNMA 2JG9B 5FPUA 2D6PA 2XWJB 2J1UA 3FHQA 4Q4W1 1UU4A 3K75B 4QX5A 4TWTA 1GUIA 5K9YA 3HN1A 1NLRA 4XAEA 2ES3A 2VQTA 1NCQC 1PO12 3H1YA 4CEWB 2TBVA 3FFQA 4KGQA 3IDBB 1YQ2A 4IDZA 4TSVA 4ZS2A 5AC93 1CWPA 4FQ4A 1SLAA 5AC91 2PLV3 2ZEZA 1GZ9A 4XOGA 2PLV1 5BNOB 4J1XA 4BCUA 2H6CA 1Q8QA 5FV3A 3ACHA 1GU3A 4FOYA 4JC1A 5L9BA 4AQSA 1RUJ2 2HYKA 1GP4A 3W21A 2QJVA 4N43C 2VH9A 4XTMA 1TG7A 4QPIC 4YLZA 4YZ4A 4QX2A 3ACIA 3WINE 3ZDVA 1PIV2 4QB6A 5T5JA 1QJFA 4YW5A 2VMFA 5JOWA 4WVVA 3I59B 1AYM1 1YIPA 2W46A 2HWF2 4LHKA 3ZYIB 4XDOA 2OXBA 1H2MA 5CAZA 2R1DA 3VBUC 4ZU7A 4UFIA 4V2WA 3B9IA 4CP9A 5C9AC 4BIOA 5J1XA 2JKBA 4LR4A 5K4LA 4B7KA 1HB3A 1ODMA 4CUCA 1RUI2 5E89A 3WVJA 1P8JA 3POSA 5CEHA 3T2QA 1AX2A 2A6YA 5FZ9A 1GLHA 1HRI2 4BQ1A 4JGYA 3MLJA 3GALA 5FZ4A 1O4TA 1GSLA 2D6LX 1D4M1 2OIIA 3OG2A 4IV3C 5A3UA 4GA9A 1IHMA 2VM9A 2VG9A 3AKRA 2ZEXA 1KDKA 1NAEA 2ADEA 3IPVB 2W1WA 1MVEA 4LBKA 4QX3A 2VCMA 2ZABA 3HQUA 1LU1A 4UXAA 1X9PA 1X8MA 4FPGA 2B9UA 3FE5A 4IEOA 1RXGA 3WF2A 3ZFFC 4B4RA 4JDNA 2YBKA 1VBC2 4I0BA 4IV1B 5EXOA 1LGBA 5EQUA 2NYYA 2XHNA 2VTXJ 4AYUA 3TYJA 3U1XA 1OURA 1YO8A 2XVLA 5FQ0A 3K2OA 2VZQA 4IESA 4QXCA 3VDBA 1IPSA 5J98B 2X29A 1EYBA 3JU9A 4L97A 3MBWA 4PJYA 5HCBA 1POQA 1CAUB 4MVTA 1LR5A 4ORFA 3WQ7A 3WG1A 5C3PA 3O5SA 3URFA 4O9GA 2E32A 4GH4B 4LK6A 3O1TA 2D40A 2RG4A 3POIA 2OX0A 1OD5A 2X09A 5G04L 5DDJ2 4BMEA 1QJU3 4B4PA 2XQRA 3HWJA 5A3MA 3ZXKA 1EPWA 2NMOA 3RPQA 4MSVA 4FPJA 4A7KA 2YHJA 3FBYA 2EAAA 1UIJA 1IG0A 1CAXB 1GP6A 2RDNA 3D5OA 3N3HA 1MZ5A 1FNYA 5LY2A 3I3QA 5CZKA 1S0DA 4XUTA 4XF3A 4YZ5A 1Y7BA 5FP3A 1NY72 4CDUC 3ILFA 3KCYA 1H2NA 3UGFA 1QNYA 3SXWA 3ZFEC 1CGPA 4RD7A 1LB2A 5FPZA 3BIWE 2GDFA 4AWDA 4CUBA 3MO4A 2JENA 1HJFA 4CCMA 4WV8A 5C4WC 4QM8A 1HV1A 4IETA 4CZSA 2WNVC 4XVHA 1ND3B 1TNFA 3D0JA 5FY8A 3WEZA 2VNOA 3ZYJB 2JX9A 2ZMKA 3FC0A 3S5AA 1W6QA 1NCQA 3KV5A 3RRDA 1FOD1 4LHNA 5IK8A 4LO8A 3RZHA 4JV4A 4BA6A 3O1PA 4NIGA 2P17A 2WSVA 4B8EA 3I4IA 4Q4W2 3TNPB 3ZXGA 4Y22B 1QJY2 4HK9A 5LB6A 1Y9QA 3THDA 4HT1T 2ARCA 4XFBA 4KWLA 2C6SA 5ABJB 5H9PA 3JQWA 2WNEA 1NA1A 2PAMA 4N43A 4Q0QA 5HV4A 4QPIA 4S2GA 4YW3A 3VBHC 5A3NA 2UY9A 4XIOA 3AL5A 3PL0A 2FDFA 2I74A 1DYOA 3GCXA 3VBSB 2CWMA 4I01A 2IFRA 4FPFA 3ZPOA 4W50A 2JEMA 1RUG3 5L73A 4HVQA 4Z82A 1RUG1 1ENRA 4YW7A 1H8TB 3VBUA 4AEMA 2RE9A 2X8KA 3LB9A 4LHSA 3PHMA 3U4SA 5C9AA 2IXLA 1AYM2 2P1BA 4PCRA 3EJKA 4JDOA 1W2UA 5FMCA 1LOAA 1N3QA 1PM4A 2D97A 3T3YA 5F2WA 1AUYA 3AL6A 5E16A 1YRZA 5FYBA 4YG3A 3AKTA 4G4FA 5FP4A 3ZYRA 4DUVA 4E4SA 4D7YA 3E6CC 2RMU3 1RJ8A 1SZBA 4RQPC 4XBLA 2RMU1 5ANQA 3T0AA 1OH4A 1OQEA 2JG8A 4XURA 4IV3A 1ZZ9A 2D5HA 4QWNA 3OY8B 1CR7A 1W8WA 1DF0A 1Y3TA 3G6JB 3ABZA 2D6OX 4NJ4A 2XBO3 3M3CA 3BPZA 4CXYA 2XBO1 1D4VB 1R64A 1D4M2 3ZFFA 2E6VA 4JTNA 1GKBA 1F15A 4P02B 3WR0A 4DY3A 1T6GC 2ZPXA 3JD73 5F8PA 3R4SA 1C57A 2UURA 3JD71 3LZZA 4IGPA 4XQWA 2A5ZA 3PVOA 4GJYA 3VGIA 5D21A 5DG2A 5LWBA 1AXYA 5D2AA 1WLTA 1LHWA 1SFNA 1GOFA 3N35A 4BOWA 3MV01 5AFEA 2ZKNA 1BMV2 1IS4A 3AVSA 4AW7A 4FXKB 1US3A 4PDWB 2XUMA 4B1MA 5LCWL 3V0BA 1QY4A 3VBFB 2ADDA 2JG9C 3OF1A 4K20A 4XFIA 2FCVA 4FFIA 4YGCA 2H6BA 2NPIA 2ZAAA 4QPWA 3I2OA 1C4RA 2BWCA 5EFUA 4ZZ8A 2X5IB 4CA9A 4WM7B 1BHGA 2VY0A 3MFCA 3T2PA 4DPNA 5IVCA 3S0MA 1C1LA 1LU2A 1SG3A 2R062 5FYVA 4AAPA 4FAHA 3WDYA 4A7YA 4E2QA 4N53B 3WG4A 3SEEA 4PI0A 1PX4A 3VKNA 3ZXFA 1NG0A 3CZJA 2PAEA 3LPGA 3NV1A 4FFFA 3H42B 2J7MA 4LOTA 3IAQA 1N1TA 4PLNA 5B2GB 4DRRA 1OHFA 3E97A 5A3PA 4IEQA 1RMU3 4OI4A 2JIGA 1RMU1 1JTZX 3NJVA 1IKQA 1RJ7A 4ONUA 3VBRA 2RR12 4NIHA 2YDEA 3THPA 3ZFEA 3RYPA 4WVMB 2YGMA 2E9QA 4RR3C 3LDRA 4MADA 1OQ1A 4L8QA 1JHNA 3RVHA 1UY0A 4EN6B 3ME2A 5C8CA 3AVRA 4HKOA 4CTEA 1HW5A 1MPXA 5FPLA 4LBMA 4AVBA 4RYDA 3VKLA 5IAXA 4K21A 2RS11 4Y4YA 4HSLA 4Y26A 2YG0A 4CUAA 4QXHA 1WW7A 4NHMA 3AYDA 3PJYA 3WNLA 2ZS6B 3IIIA 3IZOA 1OFNA 1O3TA 5A3LA 4G9SB 1JOPA 3OGRA 4ISRA 4AEDB 4EWAA 5LY1A 2QQIA 3OBAA 4OHXA 1FOD2 4AVVA 5A3OA 3VKMA 1UO9A 3LFMA 3VBHA 3CEWA 1W2AX 4NVPA 2DVAA 2XH6A 3KGLA 4TLGA 1J1TA 2HEYF 5BNNB 4UOJA 4XYXA 4QU1A 2HWB2 2JKXA 2P37A 3T4HB 1DBNA 2WRAA 3IM0A 1CPNA 2A6ZA 3C7HA 2DUOA 4H7MA 5E8AA 3I54A 4EN0A 1LAJA 2RDSA 1DGRA 3RGBA 2ZOEB 3MDPA 1PGL1 1AYN3 4GWJA 4IV1C 2HWC3 1OPOA 2QZ3A 1AYN1 2K0GA 3AKQA 5F5AA 2HWC1 5FZIA 5JSRA 4C0BA 3K4DA 1H6XA 4Q4Y2 1GOHA 3DKQA 4LBQD 2BUKA 5HXMA 4K40A 3H7JA 1MS3A 4ES8A 1RUF1 4D3WA 2Y6KA 2XB6C 1GZWA 2GSYA 3BVCA 5I0UA 1E5IA 2PYTA 1D7PM 1CJPA 2DVGA 2QBXA 1LOGA 4JDMA 2A6VA 2B39A 4GH4C 2MHFA 3WW1A 2PA7A 5IK5A 2DYCA 3TN92 3AFKA 3D3AA 3UNPA 5APAA 4AE2A 3ITQA 2OW4A 1J58A 2WO2A 3RFRA 4QAWA 1WCKA 4NIDA 3WNKA 1NQJA 3HAGA 1PNGA 4RFT0 2ORZA 3BOPA 3DL3A 1ULFA 1QQP3 5DUVA 3JXSA 3AJZA 3LE0A 1OLMA 1SPPB 1KEXA 4HANA 4DEVA 1ZYBA 1VBB2 2VMCA 3LCPA 4A42A 2N7GA 1S2KA 4URAA 2F4LA 2EVXA 3MIFA 4CCJA 2DF7A 3RG0A 4A6OA 1OA2A 2DDUA 1PMHX 1ZNPA 1MR5A 2CNAA 3O1VA 2W1SA 1QJEA 4HMZA 3AP4A 4LBLA 2JG9A 4TXWA 2XJSA 3WW4A 4ZPIA 1K45A 2R043 3J26N 4H7LA 4KU7A 4P9IA 2R041 5HXVA 1Y4WA 1WLCA 4L99A 3POEA 4XUOA 1XNCA 1ND3C 1VR3A 2YUEA 3RSJA 3D0SA 3RJRA 4PQ9A 5CB7A 1ZBE3 3HQRA 1VBE2 1ZBE1 1FYUA 1CPMA 1OOPB 1RUH3 3F95A 3GNEA 3IIAA 4LEJA 4XJ8A 3I2HA 1FXZA 1RUH1 3IT8A 3B69A 5I8SA 3RJ2X 2CTVA 3GJAA 2JXAA 1F5FA 1Q3EA 5A1FA 1B35C 1OUSA 5A6ZA 4JHTA 1O91A 4DMIA 5CADA 1HQLA 1QWRA 3FX3A 4LJHA 2VZ1A 4MGKE 5ABJC 5JSOA 1R083 5C3QA 4RR3A 4QPGB 2GP5A 1W6PB 4GALA 5C5UA 3AM2A 3I59A 1FAYA 1LENA 3VBSC 2ENRA 2OZJA 4UFKA 3LFIA 4N8MA 3PTRB 5IW0A 1IG3A 1G9CA 1DQ6A 4JVAA 4UW3A 5FJKA 1VBD3 2FBEA 1K5JA 1H8TC 1Q8PA 2WZR2 2ZGTA 3ZSLA 1F8VA 4D69A 2DBNA 4GWNA 1RXFA 3I8TA 2K2SA 3GHMA 3K4AA 4GKXA 3HD8B 5H9QA 2LROA 4B3NA 1OA4A 4AVAA 5KHIA 4CSWA 2BFUL 2RS12 1UMHA 1UPSA 3WF1A 5FLHA 2BNNA 4COVA 3WZ1A 2ZMLA 2VNGA 5FO8B 3CDZB 2HWD3 4FPHA 1MS1A 3APBA 1SLLA 1JZ2A 2AENA 1AR62 1JMUB 1OI6A 2EIBA 3IPVA 1XNDA 2YROA 3OUIA 3OTFA 2E26A 1U12A 4XMIA 3GZUC 4N7UA 2RJLA 4BK4A 1CJDA 2VW1A 2GC3A 5DAWA 4YVSB 1PHMA 4P9YA 1MACA 3AZVA 3ETPA 4IV1A 4TN7A 1BK0A 1W2OA 3NV2A 1JZ7A 1O5UA 5D1IA 2J1AA 1UOFA 2DURA 1SDDB 1H1IA 2Q8OA 3U37A 4XDQA 1XU1A 1QF3A 1O4YA 1TME3 4CU6A 2Y8KA 1CAUA 3Q8BA 2VQ0A 3BKZA 4OHWA 4Y5TA 2JICA 4YM1A 5HCHA 2IXKA 4GH4A 4NR1A 1VP6A 4FPOB 5GKAC 3UKNA 1NE6A 3ETQA 3IN9A 4PDWC 2XVKA 3CJXA 1WBLA 3OOXA 4NRMA 3CJIA 3POFA 5KBFA 1RUF2 1CESA 3PUIA 4EJRA 4UFHA 4ZY9A 3EQEA 2X5IC 4WM7C 3VDCA 3AMNA 1O8SA 1R092 4EWDA 4COZA 4AI0A 1UY3A 1UXXX 2BERA 4NROA 4N53C 1H2KA 4P00B 1NX9A 1UQXA 2DV9A 1PZ8A 3NJXA 1PMJX 3SCGA 3I2FA 1NZCA 3LOIA 1CAXA 3HEIA 3LA2A 3N36A 2YYOA 2LS6A 4QDRA 4UF0B 3ZXDA 4AFBA 1IS5A 4XFHA 1PX3A 4NPLA 5FUIA 2QNKA 5DAXA 5C6CA 4L0PA 4U2AA 3I2KA 4Z1VA 1JU3A 1VLNA 3WQ0A 1QXJA 4L2NA 1NQDA 5L19A 3IMMA 4F8AA 2BGPA 4COYA 3W5NA 4B7EA 4UW6A 1WCSA 3VHRA 2AEYA 4A7ZA 3I7DA 1PZ9A 1ND3A 2QZ2A 4LIUA 4Q4V2 2YXSA 2ZA9A 4HOOA 4CYDA 1H4HA 4BK5A 1RUD3 3SMHA 1YEWA 3J7NA 1H2LA 3H50A 3VZMA 1RUD1 4E9KA 4DUWA 1WCQA 3ILNA 3ZSEA 3OD4A 3A7QA 2TEPA 4FQZA 2Y6JA 4QHZA 4OUSA 1B35A 2W1QA 4YFWA 4AEDC 3S5QA 3LGRA 4K9SA 5FYHA 5ABJA 5BV6A 3ALQA 1A3KA 2WYSA 4XABA 4XACA 1WW5A 1YQ5A 1S2BA 2WWUA 1ZBA2 1N47A 2EIDA 2YC2A 4LUKA 3BTAA 2CU5A 1DFQA 4LLFA 1V6JA 5M0TA 5FXVA 3VBSA 4ATEA 1LHVA 1WMFA 1QDOA 5F37A 4OMDA 1VBA1 3I3BA 4YWAA 4OQ9A 3U4XA 4ASLA 4Q4X2 5C70A 1PO13 3J7MA 1JZ6A 3OPTA 3K46A 5JIAA 1PO11 2JDAA 3L2YA 1O7FA 4LITA 2A73B 3GHNA 5T5LA 2DCYA 5F6LB 3TBDA 1OLQA 1ULCA 3KVBA 1GWKA 4LBQB 3PIJA 4CXXA 1KJLA 3SQOA 5LBEA 4QGNA 2F17A 2HKXA 1BEV1 1MQTB 1YQCA 1RUJ3 2GN7A 2Y0IA 1W6MA 4MXWA 3TAYA 4Q8LA 3AK0A 4X8PA 2Y34A 3AXEA 2YY1A 1NLSA 1NZIA 4IE6A 3VHNA 3BPSA 4LA3A 2JWPA 1PIV3 2BP6A 3GJBA 2ZX2A 1PIV1 4MG2A 4FCAA 4Q5OA 3WP5A 5A70A 2HWF3 2VUDA 1UOJA 3HJRA 4JZRA 2HWF1 2VUCA 3MPBA 3BTYA 1AJKA 4FPCA 1ZRIA 5DPNA 2XR4A 4BIFA 3JB8A 4RFRB 4V2VA 1PGSA 5FP9A 1VMFA 4CE8A 3WOGA 1JYVA 2QDRA 4XILA 2QQOA 2YU1A 2W9XA 1JOJA 1RUI3 4HN0A 1QNWA 1HB2A 4BDVB 1AZDA 1RUI1 1V9U1 2ZX0A 2OUHA 3LIHA 1HRI3 1EY2A 4UFLA 4Q0SA 3MW3A 1SBDA 4ZU5A 4PDWA 4NWWA 1IS6A 4ET7A 2BBVA 3I2JA 3CMGA 1QH7A 2XKPA 2C1FA 3OYWB 1FI2A 3AMQA 1W2TA 2X5IA 4WM7A 4XF1A 2VBPA 3UKVA 2GU9A 4QQHA 2D6KA 1AL21 3AC0A 3ZYBA 4DB5A 4N53A 1VBC1 1XOYA 1QJX2 3H1MA 2BNOA 5FY0A 4XFFA 2BV4A 4YNIA 4Q8KA 1OOPC 5JXIA 3I2GA 2R0HA 3WW2A 2ARAA 4K8FA 3T08A 3M1HA 4L92A 2FDHA 4P9GA 1RIRA 2A7AA 3VD3A 4XETA 1BVP1 2VZ3A 1O4ZA 2WABA 2RM21 5KHGA 1JYTA 1POV0 3ZSKA 1BYHA 1XRUA 1ZA4A 4QPGC 1DQ0A 5DDJ3 5FZOB 1HQNA 1VAKA 2SBAA 4GIQA 5T5PA 1K3IA 2E7QA 5FKBA 4LT5A 1SACA 1XE0A 3MEPA 4J25A 3S30A 3V65A 3QOPA 1SEFA 1FV3A 1W9FA 2GN3A 2RS52 3KZ4C 1RC6A 1VMJA 2VW2A 5F32A 2R6QA 2AEZA 2DUPA 3LQCA 2AGSA 2P6CA 2VMHA 2VXJA 2VL4A 4QQPA 1JN2P 1TQ5A 2LUWA 2RJ2A 4HN1A 1NY71 4UAPA 3C7GA 5B4NA 1J3QA 3PJQA 2FQPA 1H0BA 1IS3A 4BE3A 1DHKB 3E5QA 1NCRB 2VO5A 1VAMA 3M3QA 1NUKA 4R9DA 4YGEA 1DGLA 1V6LA 1UY4A 3GF6A 3LEMA 4E8CA 2XLFA 2XJQA 1FPN2 5IVVA 4I3PA 2WWSA 3CF6E 3FFZA 2Q1ZB 2ZHLA 4PF5A 4YVSC 4U36A 3POJA 1Z7S2 3MICA 4Q4W3 1XE8A 5IK7A 4UBHA 1QJY3 1X9TA 1QJY1 1VBA2 4E4ZA 5AFBA 3ZDSA 4N90A 4BXFA 2ZGRA 1A34A 2HYXA 3NNFA 4QDSA 5BXXA 1ZZ6A 1IQAA 2UWBA 1WBFA 4FVVA 5FFOC 1EV12 4ZHNA 1AR82 1XNBA 4BJ0A 1ASJ2 4KWJA 2R49A 4BU2A 1BEV2 1AR72 4FFGA 1QXPA 2GH8A 2DFCA 3DYMA 4R4XA 4ES9A 5LEJA 2VOWA 3NNGA 4DEQA 2W95A 4Q1RA 4A3XA 4F83A 1O3RA 4YPJA 2FDJA 3CL1A 1AYM3 4W4ZA 1MZEA 1SPPA 2NLRA 4XCAA 5GALA 4OHYA 4WZFA 4YZ3A 1EAH1 3Q8FA 3H8UA 4CDXB 1S2EA 1GFF2 5LA2A 1GYKA 4FOVA 3RQ0A 1KS5A 3GDBA 2NZ9A 4QX1A 3J7LA 3FWEA 2GZWA 2CDPA 2BTVC 2VZVA 3A4UA 1PM7A 2V09A 3OSDA 1E57A 2I07B 1V9U2 3KWVA 3T4VA 5CFDB 1W8NA 1ZZ7A 2PMWB 2XLGA 3KV4A 5GZEA 2UWCA 5TSWA 5DUUA 2BJSA 5C71A 3IDEA 2A1XA 1D4M3 5FY4A 1LULA 1WZXA 4CDWB 4OUEA 3H1WA 3NAPB 2ZGQA 3MIDA 2J1VA 1OOPA 1KDMA 2D44A 4Q1PA 3T0DA 4RL7A 3NV4A 3RI9A 4AZZA 3BODA 4AGVA 5IFTA 3DPRB 4FBFA 4OLLA 1AL22 2Y26A 2G4IA 2AH2A 1UL9A 4Q27A 1REFA 1CAVB 4O65A 1BMV1 1DLLA 3FMGA 4QPGA 1CN1A 1MZ6A 1W6PA 2EA7A 5F6KA 4IE5A 5L9RA 3X29B 5IATA 1T2XA 4CCKA 2E63A 5A7QA 2JD9A 2RM22 4MGYE 1I9RA 1C8M2 2R063 3GGLA 3H3LA 3P6BA 3JQXA 2GMMA 4XF9A 2R061 5GLUA 3VDDB 3C7EA 1I5ZA 4HG6B 5I0DA 5IK4A 2VE1A 1STMA 2XXZA 3N7KA 4IE0A 4WZCA 4AOCA 1IZ3A 4LO7A 5FYMA 2IVJA 4OZOA 2BU9A 1UNBA 2RR13 3HPNA 1MQTC 4LUMA 5HI0A 2RR11 4P5YA 5F7UA 2IXJA 4XBNA 2NP0A 1WW4A 1LOBA 4M4PA 4QDQA 1ENXA 2PFWA 1Q5OA 5JSPA 2VCAA 1TVGA 4IGQA 1H9PA 1KITA 1L7RA 1ONAA 1BQPA 2PHRA 1AF9A 2MPFA 3PUAA 2R32A 3KLSA 3MIGA 4XUQA 2PQSA 2GC1A 3BN6A 2X05A 4D8MA 2VZOA 2UY8A 4YVSA 5FYYA 1SFYA 4I09A 2QTWB 2IC1A 3RZGA 1W8FA 4Y20B 3HNYM 5FPVA 4PLMA 4S2FA 3I97A 2Y33A 1H1MA 1RUC1 1FT9A 4ZONA 1UXZA 3RWKX 3JB4C 1FOD3 1JW6A 3J8F2 1OXCA 5IVJA 2BVVA 2KD7A 3PMEA 4FPYA 3E5UA 1QU0A 1RGSA 2IUWA 2K46A 3HNMA 5KWRA 5GJ6A 1DQ2A 2JDZA 1RTVA 1W9WA 4FP2A 1MVQA 4EN8B 1GANA 4X6QB 2EIGA 2HWB3 2G1MA 2HWB1 4SLIA 3VHOA 2VZPA 3EBRA 1JYXA 1SLTA 1WGPA 3TNQA 3TEZA 1N3PA 4JHZA 3WDWA 3KV6A 3WQ1A 3AKSA 3UT0A 4M01A 4LKDA 2J1TA 1UW8A 3NV3A 4LE3A 4W6XA 3RMYA 2I45A 3Q9OA 4Q4Y3 5DABA 5FZBA 5K8SA 2HH9A 1YWKA 3PU3A 2Q0AA 4GQ7A 4Q4Y1 3PUSA 2B7YA 2CGNA 4IEVA 5FY9A 1Y9GA 3H7YA 4PT6A 3H8RA 4Z92B 3AP6A 3KHCA 4XFAA 1G6NA 3QCWA 2AC1A 3FLRA 4KWUA 1HLCA 3DECA 3AFGA 3ZM8A 5FCCA 1EAH2 1LOEA 3T09A 3TN93 1ZRRA 5I0RA 2BYVE 2O8OA 4MUVA 3TN91 4BM8A 5LBCA 5FR3A 3WUCA 2ET7A 5FY1A 5SV8A 2W0XA 3AMMA 1JZ3A 4NHLA 2VECA 1W2NA 4HPKA 1JH5A 1DQ4A 1Z78A 4H55A 4AEJA 1VBB3 5DZGA 4HKWA 1VBB1 1QXRA 3HVDA 3BI3A 3PVEA 2VBBA 1L7LA 1QIQA 2LTNA 5A7PA 5FZEA 3BU0A 2OZ6A 4IEXA 3U75A 4AHWA 2CGPA 1X50A 4O61A 2W87A 3LDBA 1WMXA 4QKBA 5FYTA 3THCA 4PLOA 2RVAA 2PHLA 4B1LA 1WWYA 1ZVFA 4PIZA 4OYUA 1DQ5A 2PHDA 3WQBA 1NCRC 4CU9A 1AVBA 1XC6A 4KBBA 2ZGOA 3ZYHA 4CDQB 4QT6A 4E8DA 4OFGA 3ST7A 4AI9A 1W8HA 1RHI2 3FLTA 3VHPA 1GP5A 1SMVA 5HCFA 3I49A 2P6HA 4FOWA 4DZGA 2GALA 1YFYA 5FZ8A 3A23A 3SH3A 4AEKA 2ZZJA 5AVAA 3MW4A 1VBE3 5JMCA 1UZVA 1GOGA 1UMZA 1CVNA 1VBE1 1Y9MA 2QCSB 4NE9A 1ZA7A 3KCXA 4AQ6A 3BUCA 4LBQA 1UIKA 4HZFA 2VUJA 5FZ3A 1DU3D 3O0WA 5IVYA 4CEYB 5FYCA 4DUXA 3PLQA 2WL1A 1PGW1 5IHRA 1MQTA 1JUIA 4YM0A 4CRQA 4CEWC 2BFUS 4KQ7A 1GWLA 4RS5B 2PHWA 2QQLA 5FP8A 5FZGA 5A33B 3ILRA 2H0VA 5FJHA 3MGUA 4JAAA 4D7TA 3VUOA 5J7MA 3OBRA 5FZDA 4A45A 1G7YA 5F1RA 5JMOA 1A8MA 2FMYA 3B93A 4D6SA 1X36A 2W52A 4JX0A 5FZ6A 5DMYA 4CDUA 2DVFA 5F3IA 3NNMA 2MEV2 4AFMA 1ACCA 4G3YC 1I3HA 2YBPA 5J96B 2WZR3 5I8YA 5GZDA 3O1SA 1BBT2 2WZR1 5ANNA 2FHRA 5C4WA 1US2A 3ZMOA 4K8RB 3VD4A 5JVVA 2WNVA 4D94A 1MS9A 5FYZA 1XQNA 4IEUA 2RS13 3E6BA 5A6YA 4E27A 4CDXC 3VL9A 4PIYA 1WLWA 4JCKA 4AR2A 4DY5A 3ZKYA 5JWPA 2DCKA 2FMDA 5FPBA 2HJIA 3AZZA 1AR63 2JIJA 1RUC2 1WCUA 3KT7A 3R6SA 1JYWA 1AR61 1Q43A 3WG3A 4LLOA 4MH0E 1KQRA 4C1XA 4GZ9A 5CFDC 3OYWA 4I2OA 4M3CA 1Q8OA 4XDPA 3E5XA 1UX6A 4AF9A 5JXGA 5IVBA 4CDWC 3WNOA 4GMP0 4OI0A 3TEWA 5DZFA 2RDQA 1H4GA 3NAPC 2A3WA 3OUHA 3WNPA 1W0OA 5FY7A 3RDIA 1GNYA 3P1IA 3H3UA 3OUJA 4AG4A 3VDAA 3DPRC 3POYA 4I3GA 4XMAA 3QH6A 3KGZA 1W6OA 3JZVA 1U5IA 4FPKA 1DG6A 5FIXA 2B8MA 2WAAA 3WSOA 5E6HA 2ZGSA 1RUF3 2ARBA 5FZOA 2KA3A 3HT2A 2OT7A 2DVBA 3OPWA 5IT6A 4O7XA 3FLPA 4RQPA 5IAVA 1W06A 4ZS3A 4ZZ5A 3OD0A 2B9VA 1R093 3POGA 3VDDC 1R091 2XMLA 3N9NA 1XYOA 2VXRA 2K9ZA 2CY6A 3NKGA 2YV8A 1GNZA 4XF4A 5A7WA 1YJKA 3I2DA 5BY5A 2ZCWA 5JAXA 3AYCA 4IQPA 1HQWA 1PK6B 3H9AA 3LF7A 1YI7A 2NM1A 5F3EA 4DS0A 2XJVA 1KD7A 1TE1B 2QQUA 1U0AA 3GBGA 1E5SA 1NCRA 1Q56A 3PIGA 3KSCA 3WDXA 2XPJA 1JBCA 4GD4A 4LTAA 3SH4A 1BJQA 1IKPA 5FKCA 2BPA2 1BVVA 4QM9A 5FZ7A 1QDCA 4Q4V3 5H9SA 4FP3A 4Q4V1 2WDBA 4KL1A 4IW3A 1D2QA 3AP9A 3PMSA 1AR92 4XE9A 4M3CF 2H0BA 2ERFA 4R8HA 3ZN4A 5CISA 2ID4A 1QJZA 1BLZA 2CHHA 4AXOA 4CEWA 2DTWA 4HKLA 1OC1A 2WWJA 3ELNA 2JDMA 1UY2A 1OVSA 4M0HA 2VQAA 5ERLA 2R30A 5EZWA 1DYKA 4CP9B 1ZBA3 2D6NA 4IL7A 1ZBA1 2E7TA 4YGBA 2PELA 3HN3A 5AVPA 3O0XA 2ZXQA 3MFAA 1PGW2 2FDIA 1K42A 1W9SA 5HV0A 3B00A 5CFCB 4UFMA 3N9OA 2O8QA 2BOIA 2YMZA 2Z69A 3DV8A 4Q4X3 4LNVA 2WT0A 2ZGPA 2VTFA 4QMAA 4R9BA 2ZEWA 3DN7A 4Q4X1 3EMRA 4MGQA 5BYNA 2CL2A 4RHV2 4M0NA 5A3WA 1XU2A 3EO6A 3U11A 2W1UA 3ZN5A 1SHWB 4FO9A 5GLZA 4AGRA 4Z8BA 5LA1A 5A7NA 4JRLA 4CDXA 1WMDA 2YGLA 4LO5B 2WO7A 3FHIB 4TYSA 4E2GA 2TNFA 3ZFGB 5A1AA 3S7EA 5E88A 5FYUA 1JUHA 3BALA 2XJUA 3SLIA 2VU9A 3B94A 4FOQA 4E2SA 3KQRA 2QDNA 3B9CA 4XFGA 4UT5A 3LEIA 3UK9A 1TMF2 4NIAA 3K51A 1AX1A 4IEWA 1YHFA 1LJ7A 2PHXA 4MZUA 3CNAA 1OKQA 4XUNA 4CDWA 4ISQA 1VIWB 3DYOA 5JOXA 4CVUA 5I91A 3NAPA 3AZXA 4Z07A 4NO4A 5ACA2 2C26A 3NMBA 4XCBA 4LQRA 3WY6A 4LBNA 1KJRA 1APNA 2E51A 2I2SA 2WN2A 3DPRA 3CQOA 5F3GA 3T0BA 4Y3OA 2Z5WA 4EE2A 4EN7B 1CX1A 3MI8A 4RGGA 4RN5A 2XDVA 4AK3A 3FUOA 1WA6X 1HX6A 2EALA 4K7JA 1CAVA 1W39A 4KWKA 4NIIA 2IZWA 2NQYA 5CKMA 2OA2A 1QKQA 4QXKA 3BU7A 2A71A 4JKLA 3HQXA 1OKOA 4BQ2A 3PUHA 4I02A 4CDQC 3VZKA 1WLDA 3LIGA 2IXCA 1JI6A 1BCXA 2OUJA 3VDDA 1QJX3 1Z0HA 5T5OA 5J3UA 4QQ2A 4XIKA 1QJX1 1D0GA 3VBFC 4CCDA 2QQPA 2XOMA 5FLJA 5JOYA 3BIEA 1ULPA 1SLIA 3WP4A 4MGIE 2W68A 3CKHA 2WLPA 1HJGA 2DCJA 2XG3A 5FYSA 2GP3A 2BRTA 3S7IA 2WO1A 4ASKA 4CEYC 2V72A 2W39A 3MYXA 4HFSA 3E1F1 5KC6A 5FYIA 4RS5C 1SLBA 1COV2 3GM8A 1LOCA 3VBOB 2RJKA 3M3IA 5KC5A 2FZ1A 5KXDA 1UY1A 4JTOA 5CIRA 5FAXA 3LWCA 1OF4A 1W0NA 4XJWA 5F5IA 5C5TA 2D3SA 4P9LA 5T3NA 2QQWA 2RS53 2R072 2J22A 1NA1B 3C2UA 5JCTA 3AX4A 2RS51 4QPIB 4RGKA 1N1VA 2D3PA 4Y20A 1J3RA 2XQXA 5DXDA 2EAKA 3UJOA 4LMFA 4BWOA 1EP0A 3KS7A 1E5RA 4MGSA 2Y38A 1UZ0A 5J36A 2VW0A 5F5CA 5FZ0A 4CU8A 4IGOA 2GMPA 3NVCA 3RZZA 1V70A 1F31A 1DP0A 3U10A 4Y22A 1SBEA 4FTEA 1V6IA 4BQYA 1J59A 2QKDA 4BYYA 1FPN3 2WC2A 1UX7A 2ZX1A 2GMEA 1FPN1 4I0AA 1PZ7A 2XJTA 1RVF2 2YBSA 3SKJE 5FRAA 4BQWA 2D3RA 3P3NA 4MX3A 3BYWA 1AL0G 1SDWA 1UYYA 1YJLA 1Z7S3 2G9FA 2WT2A 5A1LA 5BNNC 2JG8B 1Z7S1 2EXJA 1POV3 1AXKA 4YM2A 2VUAA 2PAKA 4XQDA 1POV1 1VBA3 4QU2A 3W5MA 5F2SA 2WYFA 1LESA 4I0WB 4QX8A 1MZFA 1XE7A 5C3RA 1FATA 1H8TA 1UZZA 2VD7A 4ARXA 5FOBB 3D4KA 3ZXLA 1C8NA 1KGYA 1EV13 3O14A 4P9XA 1AR83 4HETA 3KT1A 5JI9A 1EV11 4XPVA 4LKEA 1AR81 2Q5TA 1ASJ3 4NPMA 1AJOA 1T6BX 4UFJA 1ASJ1 2HWE2 1BEV3 1AR73 2VPVA 4B4QA 2QQNA 1TEIA 1AR71 2XVGA 4UWDA 1VRH2 3WDTA 4KH9A 2DU1A 2P3JA 4XXAA 4KNCA 5EYXA 4Y24A 3USUB 5LW9A 5DN2A 4UI9L 2A75A 5A7OA 4Y1ZA 2VZRA 2YFZA 1S1AA 5JIUA 1W8UA 3OY8A 4WM8B 4MGTA 1J1LA 2QVSB 5FXXA 1W04A 3OBTA 2O1QA 4URTA 4EZ4A 3OJBA 2YPDA 1PVC2 2VOKA 2PHUA 2WFF1 3INAA 4OHZA 2XHKA 1MEC1 1H8VA 1PK6C 4LXLA 4MO3M 1NXMA 2ZGLA 1B09A 3PDQA 4QKNA 2F4PA 2YU2A 2UYAA 1VBD2 1OPMA 1V9U3 5IYYA 2W08A 4KU8A 1HIXA 3OEAA 5GLTA 3WCRA 4CDQA 3ZN6B 4CCEA 5L36A 2HBTA 3UL2A 2KXLA 2XKOA 5A7SA 2Y6FA 2HLEA 4CP0A 2WZ8A 1HB1A 3VBRB 5F9TA 1LGNA 4LOSA 3VBFA 4BH9A 1KFXL 3ACGA 1LHUA 3KD4A 1OLME 3JCIA 3ZR5A 5K0UB 4F7ZA 5CG9A 4ZU4A 4PBPA 1YQ8A 2WA4A 3JBG2 3R4DB 5FUPA 5BPXA 1YC61 2UU8A 3WCSA 5JZGB 5C8CB 2Y6HA 1AL23 1GWMA 1VBC3 5EV7A 5KHHA 3ZMNA 1C5IA 3WXPA 4RS5A 2E53A 2ZKLA 2XLAA 2C5DA 3DGTA 3KVAA 5A33A 2CAVA 3ZXAC 1RUE2 5FK7A 5BNPB 3N7JA 2RM23 1OMIA 3K77A 1JZ4A 1C8M3 4AFAA 4W65A 5CFCC 1C8M1 3CIHA 1YFUA 5LBBA 1RUOA 5CKQA 2BZDA 1TME2 1SBFA 4WVMA 4XZPA 4Q0VA 1UZWA 4EROA 2Z2SB 1HB4A 3RMXA 4TTGA 1QEXA 2CSGA 4W6WA 3SHRA 1HXS2 2Q30A 3VB9A 3UYJA 1W90A 2AYHA 2OQ6A 5KXEA 4LKSA 2VZUA 2P34A 4QB2A 2Y6LA 4AVTA 1VJ2A 3O1OA 1R1A2 3AMPA 2DCTA 4KGGA 2Q4SA 3ACFA 3GXUA 3ZFGC 2ZACA 4A2UA 3GZAA 4AI2A 4IE7A 3MPPG 2YPJA 2Z42A 3M2MA 4QGLA 4AEDA 2IXIA 3N7MA 4A3ZA 5DAPA 1C28A 1ZRCA 3K3NA 2RDRA 2ZBJA 2D5FA 3VL8A 3W9AA 5AC92 5A32B 5CKNA 3LA7A 1LHNA 4WVZA 3ZYFA 4YSFA 4NHKA 5KHJA 5BNNA 3B5LB 2D98A 4HK8A 3Q8EA 1DDLA 3CU7A 2XGXA 5SV5A 3BTXA 3ZXEA 2WO3A 1NXD1 3ZPYA 4DIQA 2Y64A 1DCSA 3DF0A 2WR9A 3EXUA 4TLFA 2Q8DA 1O3QA 1VB2A 2ETEA 3OBZA 1J84A 2GAUA 1K5MB 4GB32 2WFPA 2WKKA 3J8F1 1F35A 2XONA 3J7HA 4Z2WA 5FWJA 4YW2A 1SCSA 4HL0A 5GZCA 2RS32 4PI2A 3WHTA 3WUDA 1V6OA 4LA2A 1WMEA 1JYIA 4H2AA 1PO22 2J1EA 3N9MA 1D2SA 4OVEA 2EICA 4QKFA 3VZLA 1JODA 4ZKTB 3ZR6A 3BOWA 4WVWA 4D6RA 2D6MA 3J4UH 1QHDA 3IKWA 3PNAA 1BK1A 3VN4A 1N1YA 2YC0A 3PU8A 4DFSA 5C3SA 2VTXA 5L9VA 2VCCA 4XBQA 1OUXA 5C3OA 3HR9A 2C9KA 3MLKA 4XUPA 2J1SA 4NRQA 4FTBA 2D93A 1CIYA 2VNRA 2GH2A 1PK6A 3AB0A 2VOXA 1SQ4A 1NE4A 2E31A 4HVOA 3UESA 3W59A 5BNOC 4S2DA 1EAH3 3K4ZA 5A3TA 5CA6A 1OD3A 3M3EA 3G7DA 2RV9A 3IDAA 1O6UA 3MUY1 4K6BA 5FUNA 1HV0A 3VBOC 3QACA 5F3CA 2WFF2 1S4CA 4TZDA 4ARYA 5FLIA 1MEC2 5CNAA 5B4XA 4P14A 4XHXA 2ZX3A 1GZTA 3T2TA 1M06G 2R16A 1QMJA 2SLIA 3DYPA 2CWSA 5LK5A 3A22A 3KB5A 2JDUA 2EXHA 1NA1C 3VKFC 4RR3B 2W3JA 4OHVA 4WBBA 3ROUA 2WJSA 3HT1A 5T50A 3AYAA 1XJAA 1YCIA 3P5BA 2ORXA 5EIYB 1WCDJ 4E4HA 3KHBA 4YRDA 3LSDA 1OT5A 2OYZA 4LO6B 1FMD2 1QOSA 3LKJA 4CPBA 3O1UA 1UOBA 3O7OA 3WD5A 3I3MA 1O3SA 1LNSA 2P3YA 1UCXA 3SKVA 1XYNA 4OQ8A 3RNSA 1XB9A 3D6EA 2HEWF 2XJPA 4ITCA 3MHZA 1LGCA 1RHI3 2WS92 4XAAA 5C33A 5CFCA 1RHI1 3MZHA 3N7LA 3A0KA 2DUQA 3WF0A 1G8WA 5FO7B 3VV1A 4CP2A 1G9AA 1ST8A 3DXUA 3K3OA 4XC9A 2V5DA 2JG8C 1QH6A 4NHYA 4IXLA 3M70A 4KBZA 2ZGKA 2L9LA 3RI8A 3U14A 4FFHA 1HRV2 3ECQA 3VZOA 4AQTA 4EQVA 5JPNB 1LCLA 4HLTA 4LPLA 1X82A 4K3UA 2PN5A 3ZFGA 3C8XA 1N1SA 3VZJA 3ZO0B 2VULA 4MGZE 1W99A 5FXWA 4Q0PA 4CXWA 5KR7A 2WQ8A 3L2HA 2Q1FA 2QQJA 2Z79A 1KFUL 3GCWA 4J1WA 3RZMA 3NRUA 2R0FA 4AHXA 5JPMB 2MEV3 1Q8VA 3KMHA 1IGOA 2MEV1 2DWRA 5C7GA 3MV11 4L9BA 1BBT3 3CZUA 3SH5A 3QLQA 5JLVA 1BBT1 4RGAA 5IJRA 2E7AA 4XXPA 1ULGA 3ZVXA 4BMBA 4WM8C 1C5HA 1IPJA 3ZIXA 4ASMB 5CG8A 4SBVA 2OPWA 5F39A 2UYBA 1ZRDA 2P2KA 5T54A 3CJIB 1GV9A 2EXKA 2B5HA 2WNUB 4QHOA 3NL1A 3ZYPA 4NMIA 1S0CA 1MS8A 1QJU1 1XSRA 4OCTA 2VVDA 4C0HA 4COUA 1UAIA 2GC0A 5EP9A 2QQKA 5CYYA 5F5QA 1RUC3 1IPKA 3Q8AA 4COWA 1VRBA 2ZGMA 2WN3A 1UYPA 5IVFA 4GJZA 2LW8A 2ZZQA 1QGLA 3R4UA 5FZAA 1GNHA 2ZGNA 3NNLA 5FMBA 1UKGA 3MIHA 3KQ4B 4CPBD 5JR7B 2B46X 4D0QA 1HN1A 4A4AA 3VBRC 2FD8A 1GICA 4PHZA 4R9CA 5K0UC 4BLJA 3H8XA 2XL7A 1V6KA 5JZGC 1ULOA 2Y60A 5C8CC 4NAMA 3KCCA 1KXGA 1W6NB 2D7FA 3WG2A 5L7OB 2FDKA 2BNMA 1CQ9A 1R1ZA 4Q29A 4CUGA 5BNOA 4YW4A 1AX0A 4YW6A 3UETA 2QUOA 1LECA 1OF3A 4IUGA 4QD2A 1AHSA 3VBOA 4UF0A 2AACA 2WT1A 1HDKA 1Y43B 4Y1YA 1CONA 3AJYA 4Y1VA 5BNPC 2B45X 5K7PA 1B35B 3B01A 5FZFA 2OPKA 3NSTA 3GBWA 3BTZA 1F4HA 3M7AA 3OGJA 4D6QA 5IVEA 1FX5A 2WSUA 5DZEA 1A78A 1C1FA 3HBZA 3LEGA 4YG0A 4AI8A 3CBNA 4OZXA 2JJ6A 1REDA 4KI5M 2PLV2 3Q8CA 3VKOA 3WLUA 4KMQA 3NJYA 1J83A 1I1EA 3ACLA 4DRVA 1LOFC 4YYOA 2ZEYA 1A6CA 1BZWA 3WF4A 4D7SA 5JUVA 2JDPA 2DBIA 2PQQA 1UMIA 1YLLA 3WDVA 3WNMA 4W8JA 2KR2A 3MW2A 5JOZA 3CHXA 4Y5Z0 2ZX4A 4YVWB 2EIEA 4MOAA 2FCTA 1DZTA 2A6WA 2QE3A 4GMP3 5DAVA 3RWNA 4INDA 1J3PA 3AMHA 1CX4A 4GMP1 4Q26A 3ENRA 4YG6A 1X33A 3SC7X 2A3YA 3THTA 3USSA 3MLLA 3ZSMA 3O1MA 1V00A 4MXWB 1JZ8A 4JQRA 5FBZA 4RSUA 1AR93 1W6MB 3B3QE 5FP7A 1ULEA 1AR91 1W03A 4X8NA 1CZSA 3A0NA 2QFEA 4KG0A 4JKMA 2FCUA 3N9PA 3OGGA 1RL3A 2XJRA 4XJUA 2XL9A 3SEPA 1M4WA 3K48A 5FZLA 4GAZA 1K5MC 1H1AA 1PVXA 3R0RA 3EB7A 1F2NA 3O0VA 3DKWA 5JDBA 1XBFA 4LHLA 3WP6A 3I2IA 4EZHA 2JECA 4EV0A 3WF3A 1ODNA 3LD8A 4AFCA 4AGGA 1VAVA 1YXWA 1U5YA 1BKZA 4MHRA 4XEZA 3H3ZA 3NNJA 3USUA 3QBQA 2OS2A 1WUVA 3IWZA 4RHV3 5EJ3A 2VVEA 3KF5A 1XXNA 1DZQA 4RHV1 4WM8A 2VOVA 5JI7A 4BQ5A 3C3VA 4QQLA 4A44A 2HBUA 2LALA 4BQXA 3WW3A 4KG8A 3ZKUA 1NOVA 1DYPA 4CCLA 3A21A 4S2HA 4P08A 5FXZA 4QX7A 4YGDA 1W28A 2WNOA 2D43A 5BNQA 1S0GA 2GC2A 1NT0A 4YARA 1ZZBA 4Y5SA 5GZFA 4Y1XA 2VZTA 5E1RA 3W58A 3I3DA 1TMF3 3ZSJA 1TMF1 1GQPA 1QJU2 3KM5A 4LK7A 1MS0A 2NMNA 4PF1A 3ZN6A 4JRAA 3SITA 2BWAA 4NN0A 2C24A 3WT3A 4CCNA 1UF2C 1S0EA 4HBNA 2DVDA 5FZHA 1UPIA 2ZHNA 5ACA3 2WQZC 2VAUA 3O12A 5K0UA 5ACA1 4JGZB 5JZGA 2VC9A 1UD1A 2V5YA 4FTSA 2B42B 2BOJA 4V1PA 4ZXKA 3CLPA 1IQDC 3HBKA 2W91A 2DFBA 1WA4A 5EJZB 3V56A 1H6YA 3H0OA 3V0AB 2BQPA 5I93A 2WLQA 4OI1A 4YFZA 1W0PA 4IE4A 4FPLA 1X7NA 5A6QA 4DQAA 4EN9B 3ZOIA 1DGWX 2G9GA 5BNPA 4XJAA 3IBMA 1JZ5A 1CZVA 4H14A 2Y6GA 3FUQA 5LBFA 1CAWB 2W94A 4FI9A 3PTYA 4P9WA 4BXSV 2KM2A 1YNAA 1F4AA 1JU4A 5D8AB 2FDGA 2VMDA 4GKYA 4AL9A 2AR6A 2WAOA 1N3OA 1ND2B 2WZPP 1PMIA 5LRSA 5FMDA 1REEA 3OCPA 1GZCA 4DINB 1WD3A 2DU0A 4LE4A 1LOFA 3DXTA 4NWVA 1UWWA 5KXBA 1S0JA 2VNVA 4LULA 2WBKA 3POWA 1COV3 2PTMA 1HN0A 2PHFA 1COV1 1OLRA 1I6XA 4RA0A 4QPYA 4CU7A 1IOAA 5FO9B 4XQ4A 3VD9A 1TNRA 1ZZ8A 2Q8EA 4P5HA 5HCAA 3NJZA 2Q1MA 1TZOA 5H9RA 4IEPA 5ISLA 1RUG2 5CVRA 5FPXA 5A32A 2VOTA 4BLIA 2R073 3U0ZA 2VMGA 3N9LA 4XF0A 4YZ2A 1V6NA 2R071 3VLBB 1GBGA 2ILMA 2VMIA 2DCZA 3IDCB 3RYKA 1UN1A 2YZ4A 4W6YA 3CJIC 1YFWA 2WNUC 3U78A 2V4VA 3LPFA 3M8LA 3VD7A 4ATFA 1UYXA 1K5MA 4C1WA 5LEKA 2RMU2 4L11A 4AVSA 3WP3A 2O0OA 1ALYA 2ZHKA 1HKDA 2AREA 4BISA 1DIWA 1QQP1 4C8DA 1DLCA 2NN8A 1L3JA 4PBOA 4OI2A 4DXTA 3RZLA 1YFXA 4NHXA 5FMOS 3BCWA 3AZWA 2QQVA 2CV6A 2XBO2 3ON7A 3OGSA 4O9EA 1RVF3 5LRRA 5LK7B 3CO2A 3TWIA 3AYEA 1RVF1 1V0AA 3DCQA 1VE0A 1MS4A 2BGOA 4H3WA 4MV2A 2GNDA 5GLWA 1XNAA 3JD72 3IB3A 5KXCA 1WW6A 3FHAA 5FREA 3MIEA 3LEKA 3FL7A 4M4RA 4NUBA 4BQ4A 2AZ5A 3B7MA 5EYYA 4F3JA 3ES1A 4JGYB 1ENQA 3NW4A 4AAXA 1JYNA 4JQTA 3MF6A 5L7OC 4XTPA 1CD3G 3VZNA 3NQHA 2C9AA 3ZYGA 2FZ2A 3FJSA 5GZGA 2TUNA 3BB6A 4DNYA 1FNZA 2HWE3 1W8ZA 3POBA 5J48A 5JR2A 2HWE1 1XNKA 4LORA 1VRH3 5DUXA 3FZ3A 1ZM1A 1VRH1 2W2IA 2BDRA 2W5FA 2OKXA 3ZIWA 1U5XA 3OB8A 1W3VA 1UKRA 5EHDA 3QH7A 2VR4A 3FN9A 5CFDA 5DG1A 3SCHA 5FQ0B 1G9DA 4R52A 2BGCA 1DGRN 1R081 1S0BA 3WX5A 1PVC3 1LHOA 2YC4A 4LKFA 1PVC1 3S6PA 1RMU2 1S55A 3MF9A 5FZCA 4DOUA 1UZYA 2J1RA 2R7EB 3QD6A 4XFCA 5LATA 3R05A 3V64A 1XNTA 5FDBA 3KT4A 5LA0A 4XJZA 4M00A 4OULA 1RITA 5LA9A 1VBD1 5I0TA 2JB8A 3NO8A 2IXHA 3SISA 4YVWC 4BHPA 3DUIA 5FZ1A 2ZMNA 1OQDA 4P9JA 2IVIB 4BB3A 5C8WA 1JHJA 4XHBA 2XUEA 3E6DA 4J6GA 2E33A 2PHTA 2X10A 2YFUA 4K1YA 1YI9A 1C3HA 5JXJA 3JBG3 1O8PA 3PURA 2HWD1 3ORJA 3JBG1 4AHZA 3OEBA 5LZ6A 1JOBA 3HIFA 2QQMA 4I30A 1S0IA 4UYBA 4JKKA 1H9WA 1WD4A 2DTYA 5T52A 3UGHA 1RINA 3GBFA 2HEVF 2ZAHA 5CBLA 1QOTA 2V73A 1RUE3 2P3IA 2JDKA 1LODA 2EF6A 3TEXA 5FWEA 1RUE1 1YYNA 1LKNA 2ZTNA 5A6XA 1ZX5A 2WUHA 5DQ0A 4DXSA 1E5HA 2G9ZA 1GQHA 1UU5A 1RB8G 2Z4FA 3PUQA 1W6QB 1NCQB 4META 2Q8CA 1TME1 1PGL2 3WV6A 1RYYA 4A41A 1AYN2 1S0FA 5IFPA 2GNMA 2HWC2 2JE7A 1EUUA 2C4XA 4DO0A 1HXS3 3DEMA 4C91A 3AKPA 2IWGB 2ET1A 1W8OA 1HXS1 2J42A 4Q2FA 2WNUA 4NOTA 4B29A 1F9KA 1W8TA 2WINB 5GM0A 1R1A3 3W20A 2BBAA 2JB4A 3B02A 4AQ2A 4CCCA 1R1A1 4N43B 2VBDA 5J37A 3TRSB 4XW3A 5GLVA 3FBMA 3T30A 3AZYA 4BZ4A 3OGVA 2ATFA 3H8OA 2VCBA 3HMYA 1XPWA 1JXNA 5T55A 1NKGA 3RYRA 4EWEA 2W92A 4K1ZA 4DXRA 2JD4A 5A80A 3ZXJA 4CCOA 2VQUA 2YB7A 1NLQA 2O14A 1JYCA 4MLOA 1OH3A 2VVFA 3VBUB 1UYZA 3M4FA 1QQP2 5C9AB 2CAUA 3P3PA 3NWKA 1ZREA 3U07A 1GQGA 2BW8A 1XYPA 4HVRA 2EXIA 4UBGA 4JGZC 1KS4A 1V6MA 4FSJA 1W3XA 4BQ3A 2P4EA 3IAPA 4GB33 1VALA 2VGDA 1W6NA 4Y33A 1G9FA 4GB31 1VB4A 5LASA 2LM3A 1NYWA 4DXZA 1OBNA 5FBJA 5HPOA 5L7OA 3GZEA 5FOJB 4HPKB 4IV3B 4N7IA 1VPHA 2RS33 3KV9A 4IERA 3T1MA 2RS31 3C7FA 4LO4B 5I8TA 1FV2A 3VD5A 1OFSA 1PO23 3OPZA 2R042 1BXHA 1PO21 3EHKA 2C0ZA 2CYFA 5FTTC 2WIIB 3ES4A 4M3CE 1MS5A 1I5PA 3ZFFB 4N9HA 1QOOA 1GR3A 2GNTA 4FPEA 4QGMA 5FMOL 2VJXA 1ZBE2 2ZGUA 5D8AC 1PNFA 3T1LA 1RUH2 3UJQA 1ZZCA 1AXZA 5G05L 4HONA 1U5ZA 1ND2C 4R9AA 3GYDA 3M3OA 5DUWA 4UW5A 3LA3A 3T2OA 4NAOA 5CU1A 1ULDA 1DGWA 1W9YA 3LSEA 3NKTA 3KF3A 4IEYA 1SCRA 2BVBA 3V0BB 1R082 3TOJA 4YVWA 2JDYA 2WFF3 1DQ1A 2P3KA 2CGOA 3AP7A 1MEC3 1OSGA 1X8EA 1O59A 3D8CA 4FXGB 4Q0UA 5EWSA 3ASIA 3WNNA 2XWBB 5DAQA 2PXJA 2BEOA 2MNGA 2V4AA 1D0HA 3N4MA 5JXHA 1RUJ1 1LEDA 5IUQA 5EJ1B 1A8DA 1ZRFA 1DZRA 4IEZA 4EYUA 2IFWA 4LIVA 4QQOA 3F2ZA 4CDUB 5FZMA 1W9TA 1K12A 2GNBA 1FMD3 3PVNA 2VMEA 3ATGA 3L9JT 4QKDA 1FMD1 3ZFEB 4AVCA 3IMNA 2HWD2 1YUDA 1VMHA 3RZJA 2AUYA 2JE9A 5C4WB 3S57A 2F6BA 2WNVB 3LOBA 4CEYA 2WS93 4R4ZA 4GWIA 1G86A 2WQ4A 1OVPA 2WS91 2JE8A 2X53S 4XZUG 1CZTA 1LRHA 4C90A 3LDKA 4FT8A 5IWFA 4MHUA 3HOBA 2JDHA 3UV9A 1HRI1 5I0SA 1JS9A 2W47A 3RS6A 1HRV3 1L7QA 3MUZ1 1HRV1 4GWMA 5BUVA 4AI1A 3BGAA 4GXLA 4M3CB 5EPAA 3WDUA 2ZHMA 4JGYC 1W05A 4LBJA 5FZKA 3VBHB 5FPAA 3UKTA 1URXA 2VZSA 3D82A 2ARXA 3EYPA 4QX0A 2JDNA 3HNBM 3AXDA 3GZTB 4YW1A 2OQ7A 4GULA 4MXVA 3AP5A 3N9QA 4QXBA 5J09A 1YQ6A 4X6RB 4Y4RA 1OA3A 5HBAA 4MYEA 1RUNA 4A6SA 1XSQA 1F5JA 2LRPA 3O1RA 3RZKA 1SLCA 4PIXA 1Q8SA 1KRIA 1W6OB 4NRPA 1YIFA 4QB1A 4UW4A 1LEMA 2RHPA 2WA3A 4AHYA 3C7OA 1LTEA 1UOGA 4JGZA 2A70A 4OUMA 2UWAA 5FY5A 3LAGA 5DDJ1 1GZWB 4YZ1A 4RQPB 1H30A 4QHBA 1UU6A 1SFPA 2CDOA 4HSJA 3ZLIA 4YM3A 4Z2AA 1G9BA 3MIBA 3V0AA 5FK8A 4LBOA 3J9SA 2R1BA 3TB0A 1EPZA 3JUUA 3WNXA 5A7WB 5KHKA 2A3XA 3J8F3 4ZXEA 4BPZA 2A6XA 3PVBB 1EUTA 4NPRA 3SCFA 4AFDA 4FAGA 1CAWA 4PQQA 3WHUA 1GMMA 2ZJCA 2G19A 4CP1A 5D8AA 1CIWA 1RUD2 3ZX7A 2B4KA 4Y1UA
chains in the Genus database with same CATH topology
4N9IA 4E4DX 2Y0OA 1ND2A 1ENSA 1O5LA 4AI3A 2OVUA 4XJ9A 3SNMA 2JG9B 2D6PA 2XWJB 4Q4W1 1UU4A 4QX5A 4TWTA 5K9YA 3HN1A 1NLRA 4CEWB 2ES3A 1NCQC 1PO12 3H1YA 2TBVA 3FFQA 4KGQA 3IDBB 4TSVA 5AC93 4FQ4A 1SLAA 5AC91 2PLV3 1GZ9A 4XOGA 2PLV1 4J1XA 4BCUA 2H6CA 1Q8QA 4JC1A 4FOYA 4AQSA 1RUJ2 2HYKA 2QJVA 4N43C 2VH9A 4XTMA 4QPIC 4YLZA 4YZ4A 3WINE 1PIV2 5T5JA 4YW5A 5JOWA 4WVVA 3I59B 1AYM1 1YIPA 2HWF2 4LHKA 3ZYIB 1H2MA 5CAZA 2R1DA 3VBUC 4ZU7A 3B9IA 5C9AC 4BIOA 2JKBA 4LR4A 4B7KA 1RUI2 5E89A 3WVJA 3POSA 1AX2A 2A6YA 1GLHA 1HRI2 4BQ1A 4JGYA 3MLJA 3GALA 1O4TA 1GSLA 2D6LX 1D4M1 2OIIA 4IV3C 4GA9A 1IHMA 2VG9A 3AKRA 3IPVB 1KDKA 4LBKA 1MVEA 4UXAA 2ZABA 1LU1A 1X8MA 4FPGA 2B9UA 3FE5A 4IEOA 3ZFFC 4B4RA 4JDNA 4I0BA 1VBC2 4IV1B 5EXOA 1LGBA 2NYYA 4AYUA 3TYJA 1YO8A 2XVLA 5FQ0A 4IESA 5J98B 2X29A 1EYBA 3JU9A 4L97A 4PJYA 5HCBA 1CAUB 4MVTA 1LR5A 4ORFA 3WQ7A 3WG1A 3O5SA 3URFA 4O9GA 4GH4B 2D40A 1OD5A 5DDJ2 4BMEA 1QJU3 4B4PA 3HWJA 5A3MA 3ZXKA 1EPWA 2NMOA 3RPQA 4MSVA 4FPJA 4A7KA 2YHJA 3FBYA 2EAAA 1UIJA 3D5OA 1CAXB 3N3HA 1MZ5A 1FNYA 1S0DA 4YZ5A 4XF3A 1Y7BA 1NY72 4CDUC 3ILFA 3KCYA 1H2NA 1QNYA 3SXWA 3ZFEC 1CGPA 4RD7A 1LB2A 5FPZA 3BIWE 2GDFA 4AWDA 2JENA 4WV8A 5C4WC 4QM8A 1HV1A 4IETA 4CZSA 2WNVC 1ND3B 1TNFA 3D0JA 3ZYJB 2VNOA 2JX9A 2ZMKA 3FC0A 1W6QA 1NCQA 3RRDA 1FOD1 4LHNA 5IK8A 4LO8A 4JV4A 4BA6A 2P17A 2WSVA 4B8EA 3I4IA 4Q4W2 3TNPB 3ZXGA 4Y22B 1QJY2 4HK9A 1Y9QA 4HT1T 4XFBA 4KWLA 5ABJB 5H9PA 3JQWA 2WNEA 1NA1A 2PAMA 4N43A 4Q0QA 4QPIA 4S2GA 4YW3A 3VBHC 2UY9A 4XIOA 2I74A 3VBSB 2CWMA 4I01A 2IFRA 4FPFA 2JEMA 1RUG3 5L73A 4Z82A 1RUG1 1ENRA 1H8TB 3VBUA 4AEMA 2RE9A 2X8KA 3LB9A 3PHMA 5C9AA 2IXLA 1AYM2 4PCRA 3EJKA 4JDOA 1W2UA 1LOAA 1N3QA 2D97A 1AUYA 5E16A 1YRZA 4YG3A 3AKTA 4G4FA 3ZYRA 4E4SA 4D7YA 3E6CC 2RMU3 1RJ8A 4RQPC 4AHZA 4XBLA 2RMU1 1OQEA 2JG8A 4IV3A 1ZZ9A 2D5HA 3OY8B 1CR7A 1DF0A 1Y3TA 3G6JB 2D6OX 2XBO3 3M3CA 3BPZA 2XBO1 1D4VB 1D4M2 3ZFFA 2E6VA 4JTNA 1GKBA 3WR0A 4DY3A 1T6GC 2ZPXA 3JD73 3R4SA 1C57A 2UURA 3JD71 3LZZA 4XQWA 2A5ZA 3PVOA 3VGIA 5DG2A 1AXYA 1WLTA 1LHWA 1SFNA 3N35A 5AFEA 2ZKNA 1BMV2 1IS4A 4AW7A 4FXKB 4PDWB 2XUMA 3V0BA 1QY4A 3VBFB 4XFIA 2JG9C 3OF1A 4K20A 4YGCA 2H6BA 2NPIA 2ZAAA 1C4RA 2BWCA 5EFUA 2X5IB 4WM7B 3MFCA 2VY0A 4DPNA 3S0MA 1C1LA 1LU2A 2R062 4FAHA 3WDYA 4A7YA 4E2QA 4N53B 3WG4A 3VKNA 3ZXFA 1NG0A 2PAEA 3NV1A 4PLNA 1N1TA 5B2GB 4DRRA 1OHFA 3E97A 4IEQA 1RMU3 4OI4A 1RMU1 1JTZX 1IKQA 1RJ7A 4ONUA 3VBRA 2RR12 2YDEA 3THPA 3ZFEA 3RYPA 4WVMB 2YGMA 2E9QA 4RR3C 1OQ1A 4L8QA 1JHNA 4EN6B 5C8CA 3ME2A 4HKOA 4CTEA 1HW5A 4LBMA 4AVBA 3VKLA 4K21A 2RS11 4Y4YA 4HSLA 4Y26A 1WW7A 4NHMA 3AYDA 3PJYA 2ZS6B 1OFNA 1O3TA 5A3LA 4G9SB 4ISRA 4AEDB 4EWAA 4OHXA 1FOD2 4AVVA 3VKMA 3VBHA 3CEWA 4NVPA 2DVAA 2XH6A 3KGLA 1J1TA 2HEYF 5BNNB 4XYXA 2HWB2 2P37A 1DBNA 3IM0A 1CPNA 2A6ZA 5E8AA 2DUOA 4H7MA 4EN0A 3I54A 1DGRA 2ZOEB 3MDPA 1PGL1 1AYN3 4IV1C 2HWC3 1OPOA 2QZ3A 1AYN1 2K0GA 3AKQA 2HWC1 5JSRA 4C0BA 4Q4Y2 4LBQD 2BUKA 4K40A 3H7JA 1MS3A 4ES8A 1RUF1 4D3WA 2XB6C 1GZWA 2GSYA 5I0UA 2PYTA 1CJPA 2DVGA 1LOGA 4JDMA 2A6VA 2B39A 4GH4C 2MHFA 3WW1A 2PA7A 5IK5A 2DYCA 3TN92 3AFKA 4AE2A 2OW4A 1J58A 1WCKA 1NQJA 3HAGA 1PNGA 4RFT0 3BOPA 3DL3A 1ULFA 1QQP3 5DUVA 3AJZA 4HANA 1ZYBA 1VBB2 3LCPA 2N7GA 1S2KA 2EVXA 3MIFA 2DF7A 3RG0A 1OA2A 1ZNPA 1MR5A 2CNAA 4HMZA 3AP4A 4LBLA 2JG9A 2XJSA 3WW4A 2R043 3J26N 4H7LA 4KU7A 4P9IA 2R041 5HXVA 1WLCA 4L99A 1XNCA 1ND3C 1VR3A 2YUEA 3RSJA 3D0SA 3RJRA 4PQ9A 5CB7A 1ZBE3 1VBE2 1ZBE1 1FYUA 1CPMA 1OOPB 1RUH3 3GNEA 3IIAA 4LEJA 4XJ8A 5I8SA 3RJ2X 1FXZA 1RUH1 3IT8A 3B69A 2CTVA 2JXAA 1F5FA 1Q3EA 1B35C 1O91A 4DMIA 5CADA 1HQLA 1QWRA 3FX3A 5ABJC 4MGKE 5JSOA 1R083 4RR3A 4QPGB 1W6PB 4GALA 3AM2A 3I59A 1FAYA 1LENA 3VBSC 2ENRA 2OZJA 1G9CA 1DQ6A 4JVAA 4UW3A 1VBD3 2FBEA 1Q8PA 1H8TC 2WZR2 2ZGTA 3ZSLA 1F8VA 4D69A 4GWNA 3I8TA 2K2SA 3GHMA 4GKXA 3HD8B 5H9QA 4B3NA 1OA4A 4AVAA 5KHIA 2BFUL 2RS12 1UPSA 5FLHA 2BNNA 4COVA 3WZ1A 2ZMLA 2VNGA 5FO8B 2HWD3 4FPHA 1MS1A 3APBA 1SLLA 2AENA 1AR62 1OI6A 3IPVA 1XNDA 2YROA 3OTFA 4XMIA 1U12A 3GZUC 4N7UA 2RJLA 1CJDA 2VW1A 2GC3A 4YVSB 1PHMA 4P9YA 1MACA 3AZVA 4IV1A 3NV2A 1O5UA 5D1IA 2DURA 1H1IA 2Q8OA 4XDQA 1XU1A 1QF3A 1O4YA 1TME3 1CAUA 2VQ0A 4OHWA 2JICA 4YM1A 2IXKA 4GH4A 4NR1A 1VP6A 4FPOB 5GKAC 3UKNA 1NE6A 3ETQA 3IN9A 4PDWC 2XVKA 3CJXA 1WBLA 3CJIA 5KBFA 1RUF2 1CESA 4EJRA 3EQEA 2X5IC 4WM7C 3AMNA 4EWDA 1R092 4COZA 4AI0A 5BNOB 4N53C 1H2KA 2DV9A 1PZ8A 3SCGA 1NZCA 3LOIA 1CAXA 3LA2A 3N36A 2YYOA 3ZXDA 4AFBA 1IS5A 4XFHA 2QNKA 5C6CA 4U2AA 4Z1VA 1VLNA 3WQ0A 1QXJA 4L2NA 1NQDA 5L19A 4F8AA 4COYA 4B7EA 4UW6A 1WCSA 3VHRA 4A7ZA 3I7DA 1PZ9A 1ND3A 2QZ2A 4Q4V2 2YXSA 2ZA9A 4CYDA 1H4HA 1RUD3 3SMHA 1H2LA 3H50A 3VZMA 1RUD1 4E9KA 3ILNA 3ZSEA 3OD4A 2TEPA 4FQZA 4OUSA 1B35A 4YFWA 4AEDC 3LGRA 4K9SA 5ABJA 5BV6A 3ALQA 1A3KA 1WW5A 1S2BA 1ZBA2 1N47A 4LUKA 3BTAA 1DFQA 4LLFA 1V6JA 3VBSA 4ATEA 1LHVA 1WMFA 1QDOA 1VBA1 3U4XA 4ASLA 4Q4X2 1PO13 5T5LA 5JIAA 1PO11 3L2YA 4BOWA 1O7FA 2A73B 3GHNA 2DCYA 5F6LB 3TBDA 1OLQA 1ULCA 4LBQB 1KJLA 4QGNA 2HKXA 4MXWA 1BEV1 1MQTB 2GN7A 1RUJ3 2Y0IA 3TAYA 1W6MA 4Q8LA 3AK0A 4X8PA 3AXEA 2YY1A 1NLSA 3VHNA 4LA3A 1PIV3 2ZX2A 1PIV1 4FCAA 3WP5A 2HWF3 2HWF1 3MPBA 1AJKA 4FPCA 4BIFA 3JB8A 1PGSA 3WOGA 2QDRA 4XILA 1JOJA 1RUI3 4HN0A 1QNWA 1AZDA 1RUI1 1V9U1 2ZX0A 2OUHA 1HRI3 1EY2A 4Q0SA 3MW3A 1SBDA 4ZU5A 4PDWA 4NWWA 1IS6A 2BBVA 1QH7A 2XKPA 2C1FA 3OYWB 1FI2A 3AMQA 2X5IA 4WM7A 4XF1A 3UKVA 2GU9A 4QQHA 2D6KA 1AL21 4DB5A 4N53A 1VBC1 1QJX2 3H1MA 2BNOA 4XFFA 4YNIA 4Q8KA 1OOPC 2R0HA 3WW2A 4K8FA 3M1HA 4L92A 4P9GA 1RIRA 2A7AA 4XETA 1BVP1 1O4ZA 2RM21 5KHGA 1POV0 3ZSKA 1BYHA 1XRUA 1ZA4A 4QPGC 1DQ0A 5DDJ3 1HQNA 1VAKA 2SBAA 4GIQA 5T5PA 2E7QA 4LT5A 1SACA 3MEPA 3S30A 3V65A 3QOPA 1SEFA 1FV3A 2GN3A 2RS52 3KZ4C 1RC6A 2VW2A 2R6QA 2DUPA 2AGSA 2VMHA 4QQPA 1JN2P 1TQ5A 2LUWA 4HN1A 1NY71 1J3QA 3PJQA 2FQPA 1H0BA 1IS3A 4BE3A 1DHKB 3E5QA 1NCRB 1VAMA 3M3QA 4R9DA 4YGEA 1DGLA 1V6LA 3GF6A 2XLFA 2XJQA 1FPN2 4I3PA 2WWSA 3CF6E 3FFZA 2Q1ZB 2ZHLA 4PF5A 4YVSC 4U36A 1Z7S2 3MICA 4Q4W3 1XE8A 5IK7A 4UBHA 1QJY3 1QJY1 1VBA2 4E4ZA 5AFBA 3ZDSA 4N90A 2ZGRA 5BXXA 1ZZ6A 1IQAA 2UWBA 1WBFA 4FVVA 5FFOC 1EV12 1AR82 1XNBA 1ASJ2 4KWJA 2R49A 1BEV2 1AR72 1QXPA 2GH8A 2DFCA 5LEJA 4R4XA 4ES9A 2VOWA 4Q1RA 4A3XA 4F83A 1O3RA 3CL1A 1AYM3 1MZEA 2NLRA 5GALA 4OHYA 4WZFA 4YZ3A 1EAH1 3H8UA 4CDXB 1GFF2 1GYKA 4FOVA 3RQ0A 1KS5A 2NZ9A 3FWEA 2GZWA 3A4UA 2BTVC 1PM7A 2V09A 1E57A 2I07B 1V9U2 5CFDB 1ZZ7A 2XLGA 5GZEA 5TSWA 2UWCA 5DUUA 3IDEA 1D4M3 1LULA 4CDWB 3H1WA 3NAPB 2ZGQA 3MIDA 1OOPA 1KDMA 2D44A 4Q1PA 4RL7A 3NV4A 3RI9A 3BODA 4AGVA 3DPRB 4FBFA 4OLLA 1AL22 2Y26A 2G4IA 2AH2A 1UL9A 4Q27A 1REFA 1CAVB 1BMV1 1DLLA 3FMGA 4QPGA 1CN1A 1MZ6A 1W6PA 2EA7A 5F6KA 3X29B 2E63A 2RM22 4MGYE 1I9RA 1C8M2 2R063 3ZYGA 3JQXA 2GMMA 4XF9A 2R061 5GLUA 3VDDB 1I5ZA 5IK4A 3N7KA 4WZCA 1IZ3A 4LO7A 2RR13 1MQTC 4LUMA 5HI0A 2RR11 2IXJA 4XBNA 2NP0A 1WW4A 1LOBA 1ENXA 2PFWA 1Q5OA 5JSPA 1H9PA 1KITA 1ONAA 1BQPA 2PHRA 1AF9A 2MPFA 2R32A 3KLSA 3MIGA 2GC1A 2UY8A 4YVSA 1SFYA 4I09A 2IC1A 4Y20B 4PLMA 4S2FA 1H1MA 1RUC1 1FT9A 3JB4C 1FOD3 1JW6A 3J8F2 2BVVA 3PMEA 4FPYA 3E5UA 1QU0A 1RGSA 5KWRA 5GJ6A 1DQ2A 2JDZA 1RTVA 4FP2A 1MVQA 4EN8B 1GANA 4X6QB 2EIGA 2HWB3 2HWB1 4SLIA 3VHOA 3EBRA 1SLTA 1WGPA 3TNQA 1N3PA 3WDWA 3WQ1A 3AKSA 4M01A 4W6XA 3NV3A 1UW8A 4LE3A 3RMYA 2I45A 3Q9OA 4Q4Y3 5K8SA 1YWKA 4GQ7A 2Q0AA 4Q4Y1 2B7YA 2CGNA 4IEVA 3H7YA 4Z92B 3AP6A 4XFAA 1G6NA 3QCWA 3FLRA 1HLCA 3AFGA 5FCCA 1EAH2 1LOEA 3TN93 1ZRRA 5I0RA 2BYVE 2O8OA 4MUVA 3TN91 4BM8A 3WUCA 2ET7A 5SV8A 2W0XA 3AMMA 4NHLA 2VECA 4HPKA 1JH5A 1DQ4A 1Z78A 4H55A 4AEJA 1VBB3 5DZGA 4HKWA 1VBB1 1QXRA 3PVEA 2LTNA 2CGPA 2OZ6A 4IEXA 4AHWA 1X50A 4PLOA 2PHLA 1ZVFA 4PIZA 1DQ5A 2PHDA 1NCRC 1AVBA 4KBBA 2ZGOA 4CDQB 4QT6A 4OFGA 3ST7A 1RHI2 3FLTA 3VHPA 1SMVA 5HCFA 4FOWA 4DZGA 2GALA