3AMHA

Crystal structure of cellulase 12a from thermotoga maritima
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
256
structure length
256
Chain Sequence
MVLMTKPGTSDFVWNGIPLSMELNLWNIKEYSGSVAMKFDGEKITFDADIQNLSPKEPERYVLGYPEFYYGYKPWENHTAEGSKLPVPVSSMKSFSVEVSFDIHHEPSLPLNFAMETWLTREKYQTEASIGDVEIMVWFYFNNLTPGGEKIEEFTIPFVLNGESVEGTWELWLAEWGWDYLAFRLKDPVKKGRVKFDVRHFLDAAGKALSSSARVKDFEDLYFTVWEIGTEFGSPETKSAQFGWKFENFSIDLEVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-glucanase
publication title Crystal structure and substrate-binding mode of cellulase 12A from Thermotoga maritima
pubmed doi rcsb
source organism Thermotoga maritima
total genus 58
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2010-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3amhA00
1H0BA 2JENA 1H4GA 3VL9A 2JEMA 4XPVA 3VZKA 3WQ7A 3M4FA 3VHNA 2QZ3A 2D98A 3WR0A 1BCXA 1BVVA 3AKTA 4IXLA 1XYPA 1REFA 3VZLA 3WQ0A 3WX5A 3AKQA 1TE1B 1H1AA 2VULA 3LB9A 3B7MA 1HV1A 3B5LB 1XXNA 2BWAA 1OA2A 1UKRA 2VGDA 2C1FA 2DFBA 1REDA 4HK8A 3WY6A 1F5JA 4NPRA 4S2FA 2BVVA 1T6GC 3WP5A 2QZ2A 1PVXA 2BWCA 1UU4A 2DCYA 1XYNA 3RI8A 3WP6A 5EJ3A 1UU5A 3WP3A 3AMNA 2F6BA 2BW8A 3HD8B 3VHPA 3AKPA 3VL8A 1NLRA 3AMMA 3VZOA 4H7MA 3AKRA 3VZMA 3VLBB 3MFAA 1KS5A 1C5HA 1XNBA 4S2GA 1XNCA 2DFCA 1XYOA 3AMHA 1QH6A 2B46X 1XNDA 4S2DA 3EXUA 4XQ4A 3VZJA 3RI9A 3MF9A 3WXPA 1KS4A 4XQWA 3AKSA 2NLRA 1OA4A 4XQDA 1REEA 5HXVA 1HV0A 1QH7A 1OA3A 2DCZA 3VHOA 3WP4A 2DCJA 3LGRA 3VZNA 4HKLA 3VGIA 1OLRA 1UU6A 1OLQA 1YNAA 3WQ1A 4S2HA 3WT3A 2DCKA 1IGOA 1ENXA 5K9YA 2D97A 3O7OA 1HIXA 3MFCA 1H4HA 1M4WA 1XNKA 2NQYA 3MF6A 1W2UA 3AMPA 1C5IA 2JICA 5K7PA 4HKOA 3ZSEA 4HK9A 2VG9A 1BK1A 2B42B 1H8VA 2VUJA 3AMQA 4HKWA 2B45X 1AXKA 2Z79A
chains in the Genus database with same CATH superfamily
2AUYA 2HEYF 1JS9A 1H0BA 2ORXA 4GA9A 1LOGA 3UJQA 1JTZX 2GAUA 4KNCA 2RVAA 2H6BA 5B2GB 5EV7A 1COV1 2FHRA 3DKWA 2EAAA 4IV3C 4XHBA 4CE8A 1HX6A 4RA0A 4IXLA 4P9IA 1ZBA1 5FMOL 3VZLA 1UOJA 4PLMA 3H8OA 1PGL1 1Q8OA 1Q8QA 1QXJA 5IVYA 1JUIA 2ZJCA 5T54A 2XWJB 4AQSA 1TE1B 3PUQA 1H1AA 1EAH2 4M4PA 1SFNA 2FBEA 4AVVA 5HBAA 4ONUA 1QQP3 3C3VA 4YGDA 5DG2A 1S0JA 2EXHA 4KWLA 2R0HA 4A45A 1VBA3 3A0NA 2ZOEB 2D5HA 2VOXA 3ZYBA 5EQUA 3GBFA 4PI2A 2P2KA 4L92A 3Q9OA 1Z0HA 4D7YA 4HT1T 4I09A 4LPLA 4LKEA 2RMU2 4S2FA 3I2FA 1T6GC 3SISA 5IVVA 4WM7C 3I54A 3JD73 1KJRA 3HQUA 2JIJA 1YFUA 5FZ1A 2PN5A 2JKXA 2E63A 3DXUA 3OYWB 5F8PA 4DUXA 5JWPA 2FD8A 5A3TA 5C6CA 1GFF2 3NNJA 4IEWA 2ERFA 4UFMA 3ZOIA 1YI9A 2R061 2JD9A 4WV8A 4C1XA 2PLV2 4LLFA 5I0UA 5I8SA 5FOBB 3LSEA 4MG2A 1X8EA 3PVOA 3AKRA 4C90A 1VALA 4GQ7A 4HSLA 2P5BA 4GZ9A 5H9SA 1EP0A 2VVEA 4D6SA 1G9BA 1RUJ3 1K12A 3HR9A 4YGEA 1RVF2 4XABA 5I0RA 3M3QA 3GDBA 5FYHA 5BPXA 2YG0A 2ZXQA 3RZHA 3WW2A 3TEZA 2ZAHA 4XQ4A 1QQP2 1S4CA 2P3KA 2RJKA 2Y0IA 4OZOA 4RQPB 2ENRA 2F4LA 3POSA 4DO0A 1PM4A 2WJSA 4N9HA 4EN6B 4MGTA 1D7PM 2WS91 3NV4A 4RFRB 4NMIA 2HWD3 3HJRA 3J4UH 5BV6A 3IDBB 1YFWA 4BDVB 1UY2A 4CDWA 5A33A 2VZRA 4BWOA 1R091 3VDCA 4ITCA 5ABJB 1FOD3 1AX0A 1V9U3 1VBC1 2GC3A 4XURA 3JD72 3T2QA 4BHPA 5K9YA 1EPZA 2ZGTA 4FP3A 1F35A 1WCKA 4QX1A 2PHTA 3GZEA 3GGLA 1CJDA 2XKOA 3OGSA 4Q4Y1 4XEZA 3IPVB 4AVTA 3WLUA 1K5MA 4UFHA 3TNQA 4PIYA 3LDRA 3U14A 3NKGA 3RJ2X 4DS0A 4Y22A 5BNOB 2DCKA 5BNPB 1V6OA 3F95A 5FY0A 3SEPA 3OBAA 4AVBA 1W9TA 2JG8B 1QY4A 3HPNA 4EN9B 3MLKA 1ULGA 1UY3A 5DQ0A 1C57A 2E7QA 1WMDA 1FXZA 2FDJA 5F3GA 3ZSMA 1GU3A 2C5DA 1SFPA 5CKMA 1ZNPA 3VKLA 1N1SA 2R16A 3ST7A 3WZ1A 4D6RA 4CDWC 3KVBA 2FDGA 2E6VA 2CU5A 2ZGPA 5DDJ1 1LNSA 4CU7A 1D2SA 4XMAA 1C8M2 1UO9A 2J1VA 1LESA 3V64A 4QB1A 1AL0G 2WZR2 2VBDA 1CJPA 4OLLA 1APNA 2AACA 4Q27A 5FYSA 3ZXAC 4DUWA 1G9AA 5B4XA 5DZFA 1IHMA 2RM23 5A6YA 4K8FA 1W9FA 1PO21 2TBVA 4HSJA 3K46A 3TBDA 1K5MC 5C4WB 1OFSA 4XFHA 4COVA 3EB7A 3ORJA 2AGSA 2WZEA 4JGYA 1ONAA 1OD3A 1V6LA 3PHMA 4NAOA 4K7JA 1OOPB 3W5MA 3ZXKA 1QJZA 1OKOA 1O4TA 4LHKA 4XJWA 4Q26A 2TNFA 4XFFA 1CONA 4E9KA 2YZ4A 3LWCA 1RJ8A 4TZDA 1OBNA 3R0RA 1UY0A 3C2UA 4LNVA 1GNHA 1HQLA 1W6NB 4FI9A 5ACA1 3NV2A 2VGDA 5GM0A 2C1FA 3HWJA 3VBUA 5K4LA 2YU1A 3ZO0B 5KXDA 2P1BA 5F2SA 5IVEA 1RUI1 2ZGMA 1PGW2 1W05A 2E9QA 3ES1A 3M2MA 5F5CA 5FO7B 5A6XA 1LJ7A 4Y20B 1F15A 5E6HA 2P37A 3LQCA 4FO9A 2BUKA 2GZWA 4JGYC 2NN8A 5L9RA 2PYTA 3N9MA 2FDFA 1HRV1 3A22A 3AXDA 2RHPA 1BBT3 4DXTA 2CYFA 5IVCA 2WT0A 3ACIA 2DBNA 3ILFA 1AR93 1EV12 3WF1A 3MPPG 3AP9A 5FUIA 1Y9MA 2P3IA 2RS33 3VZMA 2XVGA 1LHUA 2XL7A 1KS5A 3J8F1 3IDCB 3VBUC 4KWKA 2R041 4J1XA 5J1XA 4DIQA 2YPDA 5IK7A 1BKZA 2WT2A 3F2ZA 4Q0SA 1W2AX 3WDUA 2VCBA 4FPGA 4GWMA 3Q8BA 2J22A 1XU2A 5C9AB 1BEV1 3RNSA 3OYWA 5H9RA 5JR7B 1VE0A 4BJ0A 1L7LA 4NHMA 3VBRB 2BGOA 4IGPA 3OGGA 2HWE1 4OVEA 3T4HB 1CX4A 3THDA 1VB4A 4QXCA 1CPNA 4IEZA 4CDQB 4DUVA 5FO9B 4OHWA 3KCCA 3WF4A 4Q4W1 4YM3A 1ZRCA 3CJIB 4ZHNA 4FPJA 2D6MA 1OLQA 2E7TA 3VDAA 1SCRA 5FKCA 2ORZA 3BKZA 4JRAA 2SBAA 5EHDA 2GP3A 2QJVA 5JPMB 1WBFA 2WDBA 3N35A 4DINB 3KSCA 4XZPA 1UOFA 2VZQA 2E53A 2GP5A 3OD4A 4KG0A 4LOTA 2VBPA 5JSPA 4CVUA 2RS32 1H4HA 1UQXA 1XNKA 5FZ6A 4NWVA 3FHQA 5DUUA 5ABJA 2XB6C 3VBHB 3HBZA 1NG0A 5FYVA 1YJKA 3O1RA 5LA2A 2JDAA 1QDCA 1KEXA 4DY5A 4KG8A 1XC6A 2VUJA 4BZ4A 4E4DX 1OVPA 5FYMA 2RG4A 3CLPA 1QEXA 3J7NA 4QQOA 1W0OA 2OX0A 5BNPA 4UI9L 4X8NA 5BNOA 2VR4A 4LA3A 4MX3A 4QGNA 2W08A 4L97A 3AM2A 1AVBA 4PQ9A 4WM8B 2JD4A 1SG3A 2JG8A 2W2IA 4IDZA 4O65A 2JWPA 1FATA 4B4QA 4AI1A 2LALA 5LW9A 1O7FA 1NY71 5JZGA 5LB6A 3ZYRA 1QJY1 3OPZA 3AP5A 5GLTA 3TNPB 5C71A 1VBE1 1O59A 1AL22 1DU3D 2WN3A 1R082 2Z2SB 4ASLA 5ABJC 3WD5A 4FQ4A 1SDDB 1CAUB 3RWNA 3RZKA 1W28A 2VPVA 3WV6A 1QWRA 5L9VA 2ZZJA 2WIIB 1OMIA 1SLBA 4COUA 4CP1A 4UBGA 1MVQA 1UF2C 2DFBA 1ZX5A 3BVCA 3PUHA 3E1F1 4WVWA 1LGBA 3RG0A 5BNPC 5BNOC 1DZTA 3GZTB 3BGAA 2VL4A 4ZU7A 2QZ2A 3B3QE 1JYVA 1IS4A 2JG8C 1JOPA 3H1MA 3RI8A 2A6XA 3FC0A 5JZGC 1AUYA 4KBBA 1ZRFA 1L7RA 2GMPA 4HFSA 4CP9A 1BJQA 2WZ8A 2WFF2 3O0XA 3HD8B 4EE2A 1ULPA 4P14A 4EWEA 1SFYA 3NRUA 5IK4A 3AMMA 5CIRA 4JGZB 4LXLA 5F39A 1OI6A 4GD4A 1KJLA 3VLBB 3DGTA 1R64A 5EYYA 5KXCA 4IE4A 3N9OA 2YY1A 1XNBA 4O7XA 1PHMA 1ZBE3 2OPWA 5FKBA 3KHBA 4BCUA 4YW3A 1UY1A 3I3BA 1MZ5A 2JDPA 5DUWA 3HBKA 1XNDA 3IN9A 3KF3A 2ZAAA 5E88A 3KGLA 4META 5JAXA 2CWMA 4QKNA 2QTWB 3K77A 4HZFA 1A8DA 3OEAA 1FPN1 4ZU5A 5DAVA 2VOWA 4TN7A 5CU1A 1O3RA 2DTWA 4PQQA 3POBA 4NIDA 3SNMA 4TLFA 1FX5A 1F2NA 1D4M1 1JW6A 2IC1A 2MHFA 2ZGLA 3IIIA 4IV1B 4XF3A 4XW3A 4DPNA 2WN2A 3MIFA 1AYN2 4IEYA 1D0GA 2VW2A 4LBQB 5FZCA 4L8QA 5FYIA 4XIOA 4FPYA 3LA3A 2IXHA 1Y9QA 3ETPA 3INAA 3JU9A 1UZYA 3PUAA 3PL0A 2IUWA 2CSGA 2JDUA 3LZZA 4IE7A 2JKBA 4JAAA 3VBFB 1CGPA 3O7OA 4JDMA 4FPKA 4FBFA 3RFRA 4NIIA 2EICA 1M4WA 3VBRA 2HWF1 2HYXA 3JQWA 3L2HA 4CDQA 2AENA 1ZBE2 3FMGA 2GC2A 1UYPA 1HLCA 1PVC1 3CJIA 3OGVA 2CDOA 1WW6A 2OW4A 4LIUA 1GZCA 1RUH3 2E33A 3N9LA 4FFHA 4J25A 1FMD1 3WUDA 4WVZA 3PLQA 1KDMA 5LBCA 2D40A 1HN0A 5A7NA 2EALA 1DCSA 1UAIA 1UIKA 2XBO3 3T0DA 2DV9A 2YFUA 2VOVA 2BJSA 2D93A 3POFA 2WINB 2PHLA 4MXWB 1ZZ8A 1RITA 3AKTA 3PJQA 1VRBA 4AHZA 2IVJA 2X10A 4D8MA 3WX5A 2QQMA 3VBRC 4AGRA 1C1FA 4CXWA 2LRPA 4QDQA 4CDQC 2ILMA 1GP4A 4C91A 5FZEA 4K3UA 5FBJA 3CJIC 5CNAA 2PHXA 3WCRA 3LA2A 2OIIA 4XFGA 1XXNA 1JOBA 3DECA 2RS13 2GDFA 1Q43A 2WNVA 1GZWA 2W87A 3LOBA 2GH2A 1STMA 3VDBA 1CZVA 1UOGA 4KU7A 2YC0A 1LKNA 1ODNA 2ZMKA 3WP5A 2BZDA 3TYJA 4I3PA 2DCYA 5L9BA 2E32A 2PELA 4I3GA 2XH6A 1MQTB 2GH8A 2V72A 2ET1A 1GZ9A 3LIGA 1Y7BA 2VOKA 3AP4A 4QDRA 1CX1A 1TVGA 1RXGA 5HI0A 2CV6A 2V5DA 1TQ5A 3O1VA 5T55A 4NHLA 5IVFA 5EYXA 1ZZ9A 2VZTA 4B8EA 1JN2P 1CESA 3K3OA 5BXXA 5JXIA 1YC61 1IQAA 2ARCA 2B8MA 4G3YC 4BK5A 4E4SA 3KGZA 2C9AA 2WKKA 1W6PB 4Y1YA 3MBWA 1Z7S3 2WNVC 3GBGA 3AZWA 5FUNA 2WZPP 4BQYA 1XYOA 1EUUA 1ULDA 1YHFA 4XCBA 1HRI2 3KZ4C 5FZ7A 5KHHA 5LBBA 1A34A 1DZQA 2D7FA 3HNYM 4W65A 2GALA 3T1LA 2XUEA 5LRRA 4EV0A 2B7YA 4BOWA 2VQ0A 4ES8A 3PUIA 2RS12 4A3ZA 3J7LA 5IFPA 3CKHA 3T4VA 4CDUB 2ZX3A 2HLEA 1J1LA 3WP4A 3W20A 4GAZA 3RZGA 4R9BA 1W8FA 2WUHA 3LEMA 1VRH1 4WVVA 3WHTA 3U4SA 1O3TA 5JOXA 2VCAA 2DVBA 2ZX0A 2A5ZA 1YNAA 4OUEA 1DF0A 1S2EA 1X82A 2WA4A 4EJRA 2W1SA 4MXVA 3OBZA 4QX0A 3DV8A 3CF6E 1DYPA 2XJVA 1YQCA 4HXCA 4UW4A 1FV2A 2ZA9A 3TB0A 2D97A 1ULEA 1LOAA 4B3NA 2VZ3A 1MS3A 4AI0A 1RTVA 3AZZA 4KWUA 3P5BA 5AVAA 1BLZA 1BXHA 3AMPA 4BQ4A 4QHZA 1GQGA 5FPUA 4PLNA 4Y1XA 1W8UA 4FTSA 5FQ0B 4QQPA 3VKOA 1BK1A 4CCKA 5FMOS 4LBQA 3WQ7A 2A3XA 4XMIA 1X36A 5L7OB 1EAH1 1T2XA 1OKQA 4CUBA 1JYIA 1TG7A 1DHKB 3M70A 1I1EA 1SACA 2IXIA 4I0BA 5FRAA 2FCUA 1LOBA 1VBB3 2KXLA 4QU1A 5JVVA 4CTEA 2ZGRA 4CPBD 2W47A 3B94A 3SH4A 1OPOA 1Q3EA 1AR81 2VC9A 4RS5A 4CEYA 3G6JB 2XLGA 2DUPA 3R4DB 2RMU1 1LECA 4L99A 2VD7A 2A71A 1IPSA 1UW8A 4XXAA 2BBVA 1UIJA 1UXZA 2A1XA 4LKFA 2W91A 5BUVA 2FMDA 2RDNA 3D82A 3FJSA 1U5IA 3OUJA 1H2NA 5J09A 3HAGA 1S0IA 3EHKA 4KI5M 4YW4A 3O1UA 2O8QA 5A3PA 1VLNA 1MS9A 2YGMA 1IS5A 2PAKA 2Q8CA 4CCMA 4YG6A 2PLV1 1REDA 4AF9A 1XE8A 4MXWA 4AI2A 2J1SA 1J3QA 2VU9A 4LLOA 3WVJA 2FDIA 2OT7A 5LEKA 4ZKTB 4C1WA 1S0BA 1AYM1 1ZRRA 2CGNA 1HXS3 2AH2A 2GNBA 1RVF1 4RS5C 4CEYC 5C5UA 3EMRA 4LO8A 1OUSA 2XHNA 2P3JA 3PMSA 5LBEA 3WW4A 4CCDA 4NIHA 2JDMA 2GN3A 3GNEA 5TSWA 4XUPA 2RJ2A 4PDWB 3AJYA 5FZFA 1C3HA 4EN8B 3ZYJB 1I5PA 3IT8A 3M3OA 2DFCA 4P9YA 5KHGA 2WC2A 4PBPA 3G7DA 1VAKA 1MQTA 2QE3A 2GNDA 3L9JT 1QJU2 3I4IA 1QOSA 1AX2A 4PLOA 4S2DA 2RDQA 4Y5TA 5A7SA 1UWWA 3QLQA 1NUKA 4XBLA 1MVEA 1YCIA 1W8ZA 2V4VA 4BA6A 5C7GA 3O1OA 4MADA 3UK9A 3D6EA 4U2AA 2YDEA 4H14A 1ASJ2 3PMEA 4A7YA 4AYUA 1S2BA 2A6YA 1NLSA 2VZVA 2WO3A 3GHMA 3BYWA 3DF0A 3KD4A 4Y3OA 2AEZA 2ZGNA 3BIEA 2OYZA 2XOMA 2ZTNA 2PAMA 4LE3A 4R9DA 3V65A 1HXS2 3WQBA 3A0KA 5A7PA 1UL9A 3T2OA 4LTAA 1G86A 1U5YA 1BYHA 3E6DA 3PJYA 4PHZA 5FJKA 4Y4RA 3IAPA 4DXZA 5IAXA 3POJA 1RHI2 1LEMA 5A7WA 3B69A 1C8M1 1LOCA 1OUXA 2Y6FA 1ALYA 1I5ZA 4NROA 2WZR1 3KV4A 1RIRA 1TEIA 1MQTC 1W9WA 1ENXA 2R073 2ARAA 5DUVA 1NCRB 1BVP1 4HN0A 1YIFA 4XC9A 1SHWB 5G04L 4CDUA 5F32A 2O8OA 4KH9A 1NQDA 2RJLA 4GALA 2N7GA 1LU2A 3A4UA 1WLTA 4M0HA 4ARXA 2CAUA 2WWJA 3W59A 5D2AA 3KS7A 1SQ4A 1PX4A 1WW7A 2BOJA 2CL2A 4QT6A 3ZSEA 1ZA7A 5CAZA 2MEV3 2W1WA 1CWPA 1DG6A 4J1WA 4A6OA 5JOWA 1H9WA 2WWUA 1U12A 2NP0A 2EVXA 2B39A 5CA6A 1VAVA 4QXHA 3ZM8A 1XQNA 5FZ4A 4GWNA 4D69A 2IXLA 2EXIA 3VHNA 1UXXX 3VKMA 3FLTA 5LA0A 3USSA 5FK7A 1W39A 4B1MA 2JDYA 2Y6LA 3J7MA 2JG9B 3WDVA 2DVFA 2C0ZA 4YVWB 4CDUC 2W9XA 1JU4A 3N7KA 4MGKE 4ASKA 4MUVA 5FQ0A 3KB5A 5DABA 5FBZA 1PGW1 5IATA 5J37A 1RUG3 3U11A 1PMIA 3NVCA 3FWEA 5FY1A 5C8WA 2ZHMA 3KVAA 3I2KA 4JVAA 3P1IA 4Y5Z0 5L7OA 3NAPB 1AHSA 2HYKA 4YG0A 1GMMA 2ADDA 1AR61 4I02A 5FR3A 1X33A 2W68A 4ZXEA 4K8RB 1F4AA 1FNYA 2JDHA 2XKPA 3HNBM 1OQ1A 4JZRA 4M00A 4CEWB 1F5JA 4GWJA 4DNYA 2CGOA 3OF1A 2D6KA 3POIA 1NYWA 1EV11 5FWEA 4BIFA 5FDBA 4QPIA 1OQDA 1W06A 3WP6A 4U36A 3IB3A 1IQDC 2KA3A 3C7HA 2P3YA 2QQWA 1CAWA 3MYXA 4G4FA 4LBJA 2NMOA 2J42A 1WLDA 4NVPA 4IEVA 1OH3A 3HT1A 3ALQA 1FI2A 5KHJA 1CAXA 3ZXDA 1WBLA 2DTYA 3LE0A 4GB33 2QQOA 4BMEA 4NO4A 4X6QB 5L7OC 1MACA 3LPFA 3QH7A 2VE1A 4BB3A 5D8AB 4M4RA 4Q4X3 4MGQA 3N4MA 2ATFA 4LBLA 2QCSB 2Q5TA 1RUG2 5SV8A 3NV1A 3HT2A 4QAWA 3U37A 3IDEA 5C5TA 3O14A 3HVDA 5FJHA 2EIBA 4LK6A 4QDSA 4QPIC 3UGHA 2W1QA 1PIV3 3B02A 4BLIA 2B9VA 5I93A 4NWWA 3EBRA 1LHVA 5FZMA 2RS51 2WLQA 3MUY1 4M3CF 4XXPA 1DQ4A 1JHNA 3DL3A 3T08A 1LOEA 1PO13 2ES3A 3MUZ1 4NJ4A 1OSGA 4V2VA 1R1A3 1IZ3A 3WG3A 1OXCA 3AVRA 2ZMLA 2O1QA 3W5NA 1AJKA 1AR71 3NNGA 1UU6A 4A6SA 2IWGB 4HVQA 4YYOA 1DQ1A 4AQ6A 3AL6A 1OFNA 1WD4A 2QQVA 3MV11 5FIXA 3UKTA 3CZJA 5A6QA 5LK5A 2YV8A 4QPGB 5DAXA 5KWRA 2WNUA 5FPZA 4DY3A 5JI9A 2LUWA 4GB32 5A3OA 2Q8DA 4BQXA 4E2GA 2YPJA 3LF7A 4FXKB 3LEKA 3NWKA 1HJGA 2J1EA 1VBA2 3DPRB 5FY9A 2WR9A 5FXVA 4E2SA 1W0PA 1C5IA 3FX3A 2VW0A 2IFRA 3K4DA 4N43A 4ZY9A 1AF9A 4LHLA 1QHDA 1CZSA 2B42B 1VIWB 4IE0A 1ZZCA 4QKDA 3GJAA 4XUQA 4OHZA 1J3PA 2OUJA 5F37A 4GIQA 5JPNB 1AL21 1JYNA 3DYOA 1X50A 2XXZA 1R081 3TEYA 3DYPA 1TME3 1XSQA 1WZXA 4UF0B 5A6ZA 5EZWA 2BNMA 5KHIA 5HV4A 3VDDB 2VUDA 2VVDA 2BV4A 3SQOA 2R30A 2WA3A 5KXEA 2VNVA 2ZBJA 2OKXA 2WNUC 3GCWA 2LS6A 4AHWA 1O5LA 1BVVA 5C8CB 1LENA 1WMFA 4W8JA 2Z42A 5DMYA 4AFDA 3THPA 3BI3A 2VQUA 2VMHA 3JBG3 1GQPA 2FCVA 3VKNA 1ZZ6A 1RUJ2 3MW3A 3NNLA 4QU2A 4BISA 2W94A 3E5QA 4COZA 4OI2A 4YZ2A 4LT5A 4N43C 5FZOB 3C8XA 2I45A 5FP8A 4AEJA 3O0VA 3AP7A 3KHCA 1TMF3 1W9YA 4OMCA 2WFF1 1N3PA 1YYNA 2YB7A 1DQ0A 3MW4A 4Q4V1 3CBNA 1S1AA 2GN7A 1VP6A 3POWA 1W8TA 4BM8A 2HWD2 3V0BA 4H2AA 1RUD3 1RMU1 3Q8CA 3LSDA 4NPLA 3SXWA 5CG8A 2ET7A 2QQPA 4SLIA 5FYTA 4AFAA 1NE4A 2JG9A 4LUMA 4YVWA 5FFOC 5CEHA 4XJAA 3RMXA 1FOD2 3WSOA 1NX9A 1V9U2 3SH3A 3UNPA 3TN93 2XG3A 3MI8A 3IWZA 1NA1B 4QXKA 4ISQA 4ORFA 5L36A 3O1SA 1SMVA 5IAVA 1TME2 1DFQA 1POV1 3PVBB 1F8VA 5FYZA 1RUF3 1N47A 1XBFA 3O1TA 3IMMA 5IHRA 3NV3A 2PHWA 1POQA 2B4KA 4MLOA 3I2IA 4QQ2A 4Z92B 3W21A 4X6RB 2PHUA 3H50A 4CEWA 1NCQB 5CKNA 4QB2A 1G7YA 2Q30A 4MSVA 1JZ5A 4GJYA 5HV0A 1W3XA 1XNCA 2DVAA 1CVNA 2BU9A 2VXRA 2ZKNA 4AWDA 4GULA 3BTZA 2WNEA 1IKPA 2GC0A 3O1PA 2VY0A 4AI8A 3SLIA 3RPQA 3ZMNA 1COV3 1AYN1 3VBOB 2JB8A 2RR11 2HEWF 2JG9C 4YVWC 5HCBA 1ULFA 3H0OA 4JKMA 2A3YA 3ENRA 1ZBA3 3VB9A 4FPHA 3ELNA 3L2YA 4Q8KA 3QCWA 3S5QA 1RUD2 2RM22 4LO5B 3KT7A 2Z69A 4FP2A 2X5IB 2BTVC 2YC4A 4OUSA 4AQ2A 1NKGA 4B4PA 5A3WA 1DLLA 4HKLA 3AL5A 2HBUA 2QQUA 1GOHA 1J59A 5FZGA 1JZ7A 3TN92 4YW6A 1ZBE1 3I3MA 2BFUL 4CEWC 4N7UA 1K42A 1UYYA 3BTAA 4YZ5A 1SDWA 1W2TA 2WAAA 3KWVA 3T1MA 2JECA 4W6XA 2WO1A 1IOAA 3H3ZA 4UW3A 5I8TA 3PTRB 3I3EA 4YRDA 3P3PA 4UW5A 2Y33A 2VH9A 3UT0A 4Z2AA 2EIEA 3OD0A 1AZDA 4OQ9A 4YZ4A 4WZFA 5GLZA 2ZHKA 4YG3A 3CMGA 2UWCA 5K8SA 1QGLA 2R063 4M0NA 4QHOA 4HKWA 4JKLA 1COV2 1ND2B 1JUHA 3H3LA 3URFA 1WCDJ 5AFBA 3ZSLA 1K3IA 1BMV2 1ZBA2 4JRLA 4OCTA 5GZFA 1ULCA 3LOIA 1IG3A 2EA7A 3GHNA 5EPAA 5CB7A 4F83A 4INDA 5FY7A 4RQPA 4ZS3A 1BBT2 2O0OA 1TNRA 4XZUG 3SCFA 3H42B 1AR92 5T5LA 1U5XA 2PHFA 1QXRA 5KC5A 3ZVXA 5F3CA 5A7QA 3WNMA 3ITQA 1V6JA 2Q8EA 1R093 2E26A 4JC1A 5LCWL 1HJFA 1UX7A 5HCAA 3D5OA 4UF0A 2YHJA 4JDNA 3ZFEB 3E6CC 3C7OA 5DUXA 2VM9A 4XF9A 5GJ6A 2ZKLA 3IPVA 5EXOA 3KT1A 1POV0 3VDDA 4AGVA 3GBWA 5ANQA 5DAWA 4Q4Y3 4BMBA 4P00B 1GQHA 1NZIA 3SH5A 5C8CA 3KV9A 1WGPA 4Z82A 4XAEA 5BNNB 1YLLA 3K75B 4RQPC 2YROA 3ZMOA 2R062 4CUGA 1JYCA 3D0JA 4AI9A 2Y6GA 4YW2A 4XOGA 2P34A 3ROUA 1HRI1 4W50A 4BXFA 4C8DA 1W8HA 5DXDA 1IS6A 2HWB1 5LA9A 2AEYA 5F3EA 3O1MA 4DRVA 1XE7A 3LKJA 4HMZA 4L2NA 1JI6A 1YUDA 4MO3M 5LASA 3M3CA 5DDJ3 2NYYA 3VZOA 5IVJA 3NJYA 3AZYA 1G8WA 1OQEA 4UFLA 4ZU4A 3VDDC 2X29A 3AMHA 3SEEA 5C4WA 3NJXA 3ABZA 3GM8A 2B46X 2KR2A 1PO23 5C8CC 2QUOA 1IKQA 1PNGA 3FL7A 1NA1A 1WD3A 3ZIWA 5LY1A 2WQ8A 4GJZA 5J36A 1OOPA 3LDKA 3H7JA 1LR5A 4PBOA 1YWKA 2ZGSA 1OA4A 3LD8A 5FPXA 1WLCA 2XQXA 3S7EA 3VHOA 3WF2A 4CP2A 3BPZA 1SLTA 2A70A 3VZNA 2VOTA 1NCQA 2OVUA 1E57A 3ACFA 1W6NA 5ERLA 5FP7A 5J98B 2IZWA 2VZ1A 1OT5A 4UWDA 1F9KA 4IE6A 1PZ7A 3CQOA 2QVSB 4FPOB 3GZAA 4L0PA 3AVSA 4ZZ5A 4M3CB 3VV1A 1OLMA 1NXD1 2XMLA 4DZGA 3O12A 5A1LA 1DIWA 4WVMB 1WWYA 5C4WC 4QPWA 4Y20A 4NIGA 1RUI3 2XJPA 4LO7A 2DCTA 2MPFA 3BB6A 1NA1C 5AC91 1FT9A 4YFWA 2UWAA 2X8KA 1HB1A 1OOPC 5DN2A 4PT6A 4XFBA 5F3IA 3I2GA 4UFIA 2RV9A 3OUIA 3TEXA 3WNNA 3B9CA 2DUQA 1HRV3 2W52A 4IESA 1PGL2 3QBQA 1NLQA 4NN0A 2X5IA 4XVHA 4YGBA 3ZKYA 4AEDB 5KR7A 1YFYA 3IMNA 4CA9A 1PO22 4AE2A 1NCQC 1VBD1 3VD7A 3ACHA 4EZHA 2PQQA 4XCAA 1W04A 2QBXA 2CDPA 3W58A 3FBMA 3J26N 3ZDSA 5LK7B 1G9CA 1CPMA 3FHIB 2W92A 3VZKA 3H7YA 4HANA 3IZOA 4OYUA 3WNOA 5C9AA 3N9PA 4ZONA 2LROA 1BCXA 1RUC1 1ZZ7A 3K4AA 1X7NA 1BEV3 4E8CA 4KGGA 2XJUA 3ACGA 4MGYE 1K45A 2W3JA 1JODA 2UY9A 1QF3A 5CFDB 3AKQA 4MHUA 1UPIA 5I0SA 2JDNA 2VULA 2BNOA 3S0MA 1ND2A 2X5IC 2HWE3 2J1TA 3DEMA 4Q5OA 5FZ3A 3UGFA 1Y3TA 2PMWB 4ARYA 4Q4W3 1UKRA 2XLAA 2OXBA 5FMCA 3MHZA 2VTFA 5IK5A 4YLZA 5EWSA 3I49A 4KQ7A 3WY6A 4XHXA 5GLVA 1WLWA 2G9FA 4PF1A 5E16A 1PVXA 4YGCA 5FY4A 4I0AA 5C9AC 3DN7A 2A6WA 2XDVA 4RSUA 3CIHA 4P08A 1Y9GA 5CYYA 4RHV3 2FCTA 1IG0A 3ES4A 4QGLA 1JU3A 4NPMA 3RYRA 3VBHA 3U07A 5C3OA 3T30A 3ZYGA 2I2SA 3B93A 3U78A 1QJU1 2VW1A 3K4ZA 1GANA 4XJ9A 2Q8OA 1H1MA 1YO8A 3ZFEA 1B35B 1MEC3 1ND2C 1JXNA 2WWSA 1S55A 3QACA 5IYYA 2R1DA 2R6QA 3MICA 1C1LA 1W6QB 3FFZA 3MFAA 4FT8A 1GICA 3R6SA 4LO4B 1ASJ1 3ILRA 5CZKA 2X05A 4WM8A 5HCHA 1CZTA 1PK6B 1DZRA 2ZX4A 1OLME 4OI4A 4P9XA 1GP5A 4FOVA 4QQHA 5FMBA 3VBSB 1HXS1 2RE9A 1A8MA 4LK7A 4MGSA 3S6PA 3WDTA 4IEQA 3WXPA 3CZUA 2UWBA 1KS4A 4GMP1 5APAA 2V73A 4LKSA 5E8AA 3TAYA 1QJY3 1RHI1 1RUH2 1U5ZA 2Q1ZB 4OHXA 4RGAA 3WNLA 3ZFFB 5FZHA 3UKVA 4E27A 4KBZA 1VBE3 3VBHC 1CAUA 1LHOA 2AYHA 2D3PA 2XBO2 3LGRA 5F1RA 1L7QA 3ZFEC 3I2OA 4Q29A 4JHZA 3LEIA 2OQ7A 4RD7A 4A42A 1FV3A 4RHV2 4AAPA 5IFTA 5FPVA 3A23A 2A7AA 4TWTA 4BQWA 3UKNA 4CCJA 4Y26A 4YW1A 4WM8C 2XL9A 4S2HA 4LQRA 5IW0A 1DQ5A 4EQVA 2EXJA 1MEC2 2E51A 1SEFA 1GR3A 5LY2A 2F17A 2YMZA 1D2QA 4PIXA 4NIAA 5DAQA 3NSTA 5FZ0A 1UN1A 4B4RA 1WW5A 1GSLA 2W5FA 4AEMA 1XB9A 4LBNA 4KL1A 5CFCB 1XJAA 2WABA 3ATGA 3DUIA 4DEVA 4JGZA 2VCCA 1KRIA 4B1LA 4M3CA 4D6QA 2DVGA 5LA1A 4COWA 4MYEA 1F5FA 4QQLA 4E8DA 5JOZA 5LZ6A 2DU1A 4YVSB 1GNZA 1QJY2 3RYPA 1DYKA 2KM2A 4E4HA 1MZ6A 1ENRA 4NHKA 4QKBA 3HEIA 3EJKA 2QZ3A 3KCXA 4JQTA 1Q8SA 1MZEA 3I59B 3NMBA 2C24A 4V1PA 1UNBA 5BYNA 2WT1A 2DWRA 2DYCA 2Z4FA 4AEDA 1XNAA 1KGYA 5FYYA 1Z7S2 2XWBB 5FOJB 3MLLA 5AVPA 4Q0QA 1QKQA 2QDRA 1QJX3 5T50A 2WL1A 4IW3A 4IV1A 4XDQA 4BH9A 1D4M3 4JGZC 3BUCA 1JHJA 1OA2A 2P6CA 5LATA 3BIWE 3HMYA 3OJBA 1UZVA 2A75A 4RGKA 4X8PA 2ZHNA 5IWFA 4ATFA 3J9SA 3I3DA 3MIDA 2YC2A 1UPSA 3E5XA 3AZXA 4HN1A 3VBFA 5A32B 2L9LA 5GKAC 1OC1A 4LBMA 5CISA 5CFDA 1RL3A 2RDRA 4BQ3A 4ES9A 1RUG1 2QQIA 4LEJA 4NHXA 2HWF3 4AEDC 2EIGA 2F6BA 3ZR5A 2JB4A 1URXA 2VMCA 3ZR6A 1PVC3 1T6BX 1W2OA 4IV1C 4GMP0 2VNGA 3CJXA 5FZAA 4FFFA 1GBGA 1UCXA 3SKJE 1FMD3 1J3RA 4KWJA 4W6YA 1N1TA 4Y33A 4A7ZA 3RZLA 1NQJA 1EUTA 4V2WA 1KFXL 5JUVA 1EY2A 3T2PA 1QJX2 3BALA 3LEGA 4WM7B 2B5HA 3VBFC 1Y43B 4BE3A 5M0TA 1CR7A 5CFDC 1NE6A 1OH4A 1UMIA 4XQDA 1REEA 5HXVA 1HV0A 3T0BA 5LRSA 1B35A 3N7LA 1IPJA 4GB31 1QQP1 2WBKA 4QX2A 1X8MA 4N53B 3H8XA 4CYDA 3H8UA 1DYOA 1VBB2 1W6QA 1VBA1 3WNPA 1JYWA 3VD4A 1ZVFA 3AYEA 1OLRA 2D6OX 3CU7A 4H3WA 5ANNA 1HQNA 4M3CE 4OI1A 1MS0A 3KQ4B 5CBLA 1ZZBA 4LMFA 3VBSA 2HWF2 5F5QA 1IS3A 3H8RA 2W0XA 3I2DA 4PCRA 1C4RA 2P6HA 3JD71 5JOYA 2V5YA 1V6KA 4XBNA 1S0EA 4N9IA 4QB6A 2D3RA 4AVSA 1CAVB 1X9TA 4EWAA 1FMD2 3LFMA 4ZS2A 2VVFA 3FFQA 1OD5A 2LW8A 1B35C 2JICA 2AC1A 2WYFA 1LU1A 3SCGA 3ZPYA 2ID4A 3LA7A 4QWNA 5FREA 4XFAA 5F6KA 5FCCA 4BPZA 3OB8A 1QOOA 2VZUA 2B45X 1W6OB 2G9ZA 2VXJA 3TRSB 1W6PA 4P9JA 3WHUA 4EN7B 2ETEA 5F9TA 1SBFA 1RUJ1 2Q1FA 3APBA 3K48A 4AI3A 4MGIE 4XIKA 2JENA 2JEMA 3W9AA 2ZS6B 4J6GA 3AZVA 5T52A 3WW3A 2ZACA 3VBSC 2GMMA 4OZXA 4XBQA 5FTTC 4F8AA 3ZXEA 5J7MA 4K20A 4XUTA 5T3NA 3WR0A 4URAA 1O8PA 1ZYBA 4OHYA 3RRDA 1OPMA 2K2SA 2HWD1 2GNTA 3WQ0A 4AFMA 5EJZB 4COYA 3M7AA 3VD9A 5A3LA 5CFCA 3RZMA 1GWKA 1TZOA 5FZKA 1SLAA 3MIGA 1DLCA 1FOD1 2JE7A 4IGOA 1V9U1 4PI0A 1JYXA 5A33B 2XJQA 3B5LB 1FNZA 2CGPA 4OI0A 1JBCA 2WRAA 3WW1A 2IXKA 4A2UA 3LDBA 4B7KA 1Q56A 5FZDA 1ULOA 4HBNA 2GSYA 2XVLA 4LBQD 4NR1A 1ZA4A 2D43A 4HK8A 1QNYA 2XUMA 3O5SA 4AFCA 4Q2FA 2HH9A 2CY6A 3I59A 1US3A 2JE8A 3C7EA 3POGA 4YNIA 1K5MB 4K6BA 4A7KA 2NZ9A 4RL7A 1VR3A 2TUNA 4LR4A 3Q8FA 3LPGA 2F4PA 2XGXA 5C3SA 5JXHA 4BIOA 3WINE 1Q8VA 3H3UA 4I01A 2HWC3 2G1MA 5CFCC 1NXMA 4M01A 1E5SA 1LGCA 3AJZA 4JCKA 2BRTA 1O8SA 3I2HA 2Y34A 1H2MA 3V56A 2R072 1X9PA 1DQ6A 4NE9A 4XF0A 4BQ5A 1RUNA 5J96B 1RUD1 2RM21 5I91A 1C5HA 4UYBA 4AR2A 1EAH3 5IT6A 2AZ5A 1G6NA 2K46A 4CCCA 3WNXA 2YFZA 1W3VA 2MEV2 1I6XA 4HETA 1Q8PA 2BFUS 4JDOA 4R9CA 1AR83 4EZ4A 3AKSA 1UKGA 2RMU3 4R9AA 3I97A 3T09A 4IEOA 3NQHA 2VMFA 4BXSV 3RS6A 4ZZ8A 5JMCA 4D3WA 1ZRIA 5FZBA 2PAEA 1BHGA 1NAEA 3FUQA 3BOPA 2HKXA 4AL9A 5L19A 3B01A 3C7GA 1GNYA 3NO8A 2HJIA 3JCIA 4CCLA 3VBUB 4WM7A 2HWC2 3BTYA 2H0BA 3MW2A 2PLV3 4P9WA 3UGGA 2J7MA 3KMHA 1Q5OA 1BMV1 3SCHA 1AYM3 2WSVA 3ZFGB 4HVOA 4CCOA 1SLIA 4IE5A 4XAAA 1SZBA 1RVF3 3DKQA 3T3YA 2NQYA 2ZABA 4N53A 4MGZE 4ET7A 1BBT1 4FTEA 3BU0A 4Q8LA 1S0FA 4QXBA 2VG9A 1RB8G 5A70A 5ISLA 2BP6A 1AR91 2VAUA 3AMQA 3KV6A 4UBHA 4XJUA 2PXJA 2RS31 2VUAA 3POEA 4O61A 3J7HA 2R1BA 4PDWA 4RGGA 5A80A 1GP6A 3BPSA 2CWSA 1AR82 1QU0A 3MIHA 3ECQA 5JDBA 2JJ6A 1CIWA 3USUB 3VL9A 4XPVA 2WAOA 3I3QA 2ARBA 4D7SA 3ON7A 3M4FA 5F5AA 4HOOA 2ZGUA 3S7IA 1CAVA 1W8NA 3DXTA 3IM0A 4LO6B 1F31A 1S0DA 4WZCA 2LTNA 3SHRA 1UY4A 2Z5WA 2WNOA 3ACLA 2MNGA 4N53C 4JKKA 4Q4X2 1W6OA 1VMHA 4R8HA 3AFGA 3NJVA 1HV1A 1D0HA 1O5UA 4Q0VA 4JQRA 4Z2WA 2ZCWA 3WCSA 5F6LB 1RC6A 2XHKA 4UT5A 4JHTA 3ZDVA 1AYM2 1LOFA 1RXFA 4PDWC 1O3SA 1PIV2 3FUOA 1O3QA 3OCPA 1ZRDA 4YW5A 3ZKUA 3WDWA 2BPA2 2CHHA 4CUCA 1JH5A 1B09A 4XTMA 1PO12 1W90A 5CKQA 4AVAA 1C8M3 3RVHA 3D4KA 2QKDA 1MZFA 1NCRA 2D6LX 1EYBA 2YXSA 3ILNA 4JV4A 2QNKA 2WZR3 4K1ZA 1R1A2 5EJ3A 4AFBA 1AJOA 3MEPA 2W46A 2Q4SA 4XACA 4XYXA 3THCA 2QQKA 1J58A 2CNAA 5FXZA 2J1AA 1I9RA 4YSFA 2I74A 4CU9A 1PMJX 2Y8KA 2YGLA 3AKPA 3DCQA 4TYSA 1H6XA 1NLRA 5IK8A 4JTNA 4BLJA 1RJ7A 2XJRA 2ZX1A 4NRPA 3VHRA 3NNMA 4MVTA 1LOFC 3H9AA 4Q0UA 4LA2A 4FVVA 3WF0A 4ISRA 2Q0AA 1H9PA 4R52A 2VQAA 3UYJA 2JXAA 2HEVF 1D4VB 3ZSJA 4LUKA 1ZREA 4LBOA 1SCSA 1SLLA 1YQ5A 3ETQA 1NCRC 3MF9A 4RYDA 1MS1A 5JIAA 2NMNA 1DQ2A 3D0SA 4QGMA 5JZGB 4XFCA 3ZXLA 3K3NA 4FAGA 2D44A 1OF4A 2ARXA 5FXWA 4EROA 4Q1RA 3A21A 3U4XA 3HOBA 1UD1A 3NAPA 4Y1ZA 5JSOA 2DDUA 4LITA 3GXUA 3VGIA 3WG2A 2W1UA 1RUE3 2TEPA 1W99A 2Y0OA 2UYAA 2VMGA 3CO2A 3K2OA 3MIBA 1AR63 2JDKA 2NPIA 3KQRA 4XF1A 1RINA 3WDXA 1TNFA 2A3WA 2ZEWA 3JBG2 1GZTA 2PFWA 4XUOA 4Z07A 3RSJA 3OEBA 3NL1A 2G4IA 3TOJA 1O6UA 1EV13 5I8YA 1BZWA 2VBBA 2BERA 2ZEZA 4IEPA 3MFCA 4AQTA 5JLVA 3S30A 1TMF2 3GALA 2BQPA 2BVBA 4NRMA 2CTVA 4QHBA 2R7EB 3V0AB 2OQ6A 3AX4A 4CP9B 4DQAA 1GKBA 1WMXA 4HKOA 1H2LA 5BNQA 3NAPC 2Y26A 2CAVA 1P8JA 3WNKA 2EAKA 1W0NA 3RDIA 5K0UB 3M8LA 5D8AA 3OY8B 4ASMB 2IXCA 3MGUA 4N7IA 5A3NA 3UESA 2Y6KA 3MPBA 4QD2A 3SITA 2X09A 4XDPA 2FZ1A 3BU7A 3ZFGA 3ZYPA 1RUF2 3JXSA 1YRZA 2YU2A 1XYPA 5JMOA 5EJ1B 3UETA 4XUNA 4QMAA 3EQEA 1RUE2 2X53S 4K40A 1AR62 1LGNA 2EIDA 2RS53 3T0AA 1CQ9A 4CCEA 4HVRA 3B7MA 4W6WA 1JOJA 4AW7A 4IEUA 3WEZA 2GMEA 4LE4A 3USUA 4YWAA 2Y6JA 2VECA 5DZEA 1AR73 3MV01 4OUMA 4YZ1A 3GCXA 1XOYA 5D8AC 3LCPA 3WDYA 1PX3A 3VKFC 5LEJA 4QPGA 4AHXA 2PTMA 3N36A 4NPRA 3WOGA 1HDKA 1WUVA 4URTA 4C0BA 3ZFGC 4FTBA 2BYVE 1O4YA 3EO6A 4LULA 4QPYA 2WO7A 3D8CA 3DPRA 4GH4B 3WP3A 4DMIA 3MZHA 5JI7A 1ENSA 2WS93 5D1IA 4MZUA 4FQZA 4HL0A 4YZ3A 5FP3A 3TWIA 4WBBA 1G9DA 3QOPA 4JTOA 2D3SA 1RUH1 1ST8A 3PVNA 1GWMA 1DBNA 1VBC3 3ME2A 3Q8EA 1MR5A 2PA7A 1AL23 4K21A 1NT0A 1R083 4S2GA 2XBO1 3PTYA 2RS52 1QH6A 1UZZA 2PQSA 2Y60A 3M3EA 4QPGC 5L73A 4A44A 4DXRA 5C3QA 2FZ2A 1E5RA 2KD7A 3VZJA 2ZGOA 4RHV1 5GALA 3ZXJA 4EYUA 2VMEA 4CU8A 4XQWA 3DPRC 2BNNA 1AR72 4XETA 5GZDA 1HN1A 2ZMNA 1QH7A 1FAYA 1R1ZA 4DOUA 3ZSKA 2V09A 1DGRA 1MEC1 1OA3A 1OVSA 2DCZA 2JE9A 5FZOA 2Y38A 4QX7A 3KV5A 3RYKA 4Y24A 2BDRA 3MO4A 1H30A 3DYMA 4KU8A 4UOJA 2RS11 3N7JA 2OPKA 3BODA 5E1RA 4AVCA 5CVRA 2ZHLA 2WFF3 2VQTA 2WNVB 4JX0A 4Q4V3 4QX3A 5FLJA 1GZWB 2WS92 4LHSA 4CCNA 5I0DA 1LEDA 1RMU3 3FE5A 3WT3A 1YI7A 1H8TB 1PNFA 3SMHA 3E5UA 5FYBA 3S57A 1R092 2DU0A 2OUHA 1ND3B 3VUOA 1VBC2 2ZX2A 1KITA 1CN1A 5FPLA 3O0WA 1WMEA 1XNTA 2ADEA 2J1UA 3AYAA 4A41A 4BU2A 1POV3 1BK0A 4Q4Y2 2XPJA 2YYOA 4XJZA 4LBKA 4MH0E 1A78A 1DGWA 3NNFA 1PGSA 1VJ2A 1Z7S1 3FLPA 5FYCA 3TEWA 2ZEXA 5JIUA 1KFUL 1H4GA 5ACA3 3ZN5A 1MS4A 4IUGA 2Q1MA 1W8OA 3VBOA 2VZSA 1W2NA 3JB8A 3NW4A 2BOIA 4Q1PA 5GZGA 1W9SA 3PUSA 1AYN3 3VD3A 2RR13 1UZWA 4CDXB 4DFSA 1VAMA 5DDJ2 2G9GA 3V0AA 1SBEA 3ZLIA 2VJXA 1LULA 5EP9A 3U0ZA 4AOCA 4GWIA 3EYPA 4Q4V2 4I30A 5GLWA 3S5AA 4CU6A 3MIEA 2E31A 3LB9A 2BBAA 1RMU2 3HQXA 5K0UA 1UZ0A 3N7MA 3OY8A 2E7AA 4HLTA 4MOAA 3ZPOA 4E2QA 5C33A 2ZGKA 4OFGA 3BCWA 4C0HA 3ZN4A 4YM2A 1DGLA 3LFIA 2ZEYA 3J8F3 4P5HA 4UXAA 2BVVA 1G9FA 2R043 5F5IA 1GLHA 1YQ8A 5FAXA 3VBOC 2XJSA 2C26A 2OZ6A 2D6PA 5FXXA 2OZJA 2PHDA 5DG1A 4BQ1A 2DURA 2K9ZA 3Q8AA 1HW5A 5F2WA 4D94A 5FZ8A 1JZ2A 5ACA2 1QJX1 3P3NA 1XRUA 4AEKA 3PIGA 1S0CA 5G05L 3I7DA 3SC7X 5K0UC 4UW6A 1RUI2 2VNRA 2DUOA 3R05A 3IDAA 4IGQA 1UYZA 2RR12 3OBTA 4LORA 5T5OA 3UV9A 1LCLA 3FN9A 4NOTA 2QFEA 2A6VA 3AB0A 4E4ZA 1XE0A 1VBB1 4OMDA 3HN1A 4TSVA 3N3HA 1HRV2 4LJHA 1WW4A 4D0QA 4O9GA 4GH4A 4FAHA 1HB2A 4YM1A 3RI9A 1H1IA 1KDKA 1UMHA 1CIYA 5DPNA 3KM5A 5IUQA 3RWKX 4DB5A 1YFXA 1C28A 2O14A 2NLRA 4RS5B 3OGJA 4CEYB 1US2A 4L9BA 4DRRA 1KQRA 1N3QA 5FP9A 4FPFA 4TTGA 3KCYA 4TXWA 1V70A 3J8F2 4H7LA 1F4HA 3PNAA 5IJRA 3IBMA 2R042 4QX8A 1Y4WA 2UY8A 3RZJA 3BTXA 4FFIA 3A7QA 1GV9A 5A1FA 4AHYA 5FYUA 1BEV2 3BN6A 2C4XA 2PHRA 3HQRA 3U1XA 1UOBA 3T2TA 2C9KA 4CPBA 1GOGA 1RGSA 4MHRA 1NOVA 5BNNA 1SPPB 1AX1A 3MLJA 3RZZA 2I07B 4P9GA 4AZZA 3M3IA 1IGOA 2OS2A 3OBRA 2HWE2 2VO5A 1EPWA 4GH4C 4XTPA 3AYCA 3WUCA 3HNMA 1JMUB 3OOXA 4FOQA 4Q4W2 2YBPA 5CADA 1HRI3 1UX6A 3WG1A 1W2UA 1QOTA 1GUIA 2HWB3 3OPTA 4HK9A 4AXOA 2VTXJ 4EN0A 1QNWA 4W4ZA 2WFPA 4G9SB 2FQPA 3ZXGA 4ZXKA 2DBIA 5FK8A 1YIPA 1C8NA 4Z1VA 1M06G 4XF4A 1KXGA 1LTEA 1W6MB 4BQ2A 1H8TA 4GKXA 4ZPIA 2FDKA 4FCAA 1WA6X 4OQ8A 3RQ0A 1ENQA 1MS5A 5FY8A 5BNNC 2ZGQA 1ND3A 3GYDA 4NHYA 1WA4A 2D98A 4FPEA 1V00A 4FOWA 4NAMA 5EFUA 3ZYIB 4CSWA 3CEWA 1N1VA 1O4ZA 2XJTA 3FBYA 3IKWA 4R4ZA 4CXXA 3H1WA 1J84A 5T5PA 3JQXA 2Y64A 3ZX7A 1VMFA 1VMJA 5HXMA 4IERA 1KD7A 2BEOA 4H55A 3JB4C 2XVKA 4IEXA 1GYKA 5C70A 4B7EA 1FYUA 3ZIXA 4RR3B 1OURA 4QM8A 4YW7A 1V6NA 2VZOA 1NY72 3ASIA 5E89A 1YEWA 4WVMA 4KMQA 4AG4A 4CXYA 3KLSA 4QKFA 4YPJA 4P5YA 5BY5A 1ODMA 1H8TC 3K51A 2HWB2 1VBE2 3OPWA 5A7WB 2R071 4NRQA 4CDXA 2R49A 1ND3C 4DEQA 2WYSA 1QDOA 4LIVA 3M1HA 4K9SA 4QM9A 3QD6A 5HCFA 1UU5A 5LBFA 4BYYA 5AC93 1LB2A 1V6MA 1QJEA 1NZCA 5AFEA 1E5IA 3E97A 2VUCA 1FPN3 1HQWA 2MEV1 2GU9A 2DF7A 1YJLA 3CDZB 5FLHA 2XLFA 1H6YA 3VL8A 3ZN6B 5JCTA 4SBVA 3PURA 5FZIA 5A3UA 3JUUA 4A3XA 5KBFA 1VBD3 1LRHA 1VB2A 2C6SA 3FHAA 5FPBA 2R0FA 2K0GA 4P9LA 5IVBA 1N3OA 4TLGA 2J1RA 3X29B 2QQJA 3B00A 1XPWA 3CHXA 4CDXC 2WQZC 2ZPXA 5FLIA 4AAXA 4AGGA 4YARA 2WLPA 1RUC3 3R4UA 4IV3B 1HKDA 4I2OA 2HWC1 1JZ8A 3ZYFA 2BGPA 1YQ6A 3IIAA 5KC6A 5C3PA 5FZ9A 3AK0A 3N9QA 1ZM1A 3AC0A 3P6BA 3I2JA 3B9IA 4KGQA 2P17A 2UYBA 2SLIA 5CG9A 1GOFA 4LKDA 3NKTA 3HIFA 4OHVA 3AXEA 3LAGA 4R4XA 4L11A 4XE9A 1L3JA 5FZLA 4CP0A 2H6CA 2VMDA 4HPKB 3IAQA 3I8TA 5AC92 4XDOA 2JX9A 2EXKA 2VTXA 4XFIA 1OHFA 1WCQA 2WO2A 3WF3A 3WG4A 4Y4YA 3WQ1A 4B29A 1FPN2 4XJ8A 4LOSA 5F7UA 5C3RA 2YBKA 1DGWX 2HBTA 2VCMA 2P4EA 3E6BA 3NJZA 4QPIB 1PZ8A 1SLCA 5FUPA 1J1TA 3VN4A 1V6IA 5I0TA 1D4M2 2AREA 2UU8A 1PMHX 1VBD2 3GF6A 4QX5A 5A1AA 1QXPA 3MF6A 1U0AA 1CAWB 1VPHA 2NM1A 3PVEA 4RN5A 5SV5A 1MPXA 3SKVA 1QJU3 5K7PA 2FDHA 2XONA 1WCSA 1LODA 1ACCA 1CAXB 4LHNA 4CUAA 1MS8A 4UFJA 1AXKA 1N1YA 1RUC2 2V4AA 2Z79A 5J3UA 1PK6A 4Q4X1 1SPPA 1JYTA 1QMJA 1ASJ3 3OSDA 2VMIA 2ZZQA 1JZ4A 4N90A 3KT4A 2D6NA 2FMYA 3RJRA 1PIV1 1RUOA 1QJFA 3UL2A 1PVC2 3R4SA 1Z78A 2DVDA 2BGCA 3OTFA 1REFA 3ZFFA 4Y1VA 5JXJA 4GMP3 3PIJA 4IL7A 4FOYA 4O9EA 1RHI3 1PO11 5JSRA 2WQ4A 3D3AA 2IXJA 1IPKA 3KF5A 4I0WB 1DDLA 3JZVA 2EF6A 1R1A1 2XR4A 3C7FA 3FLRA 5FO8B 1QIQA 5H9PA 1XU1A 5T5JA 4P02B 2BWAA 4UAPA 3THTA 3PU8A 1W6MA 2A6ZA 2JIGA 1HB4A 3FZ3A 1XSRA 3HN3A 4DXSA 2H0VA 4HG6B 1GWLA 5HPOA 1A3KA 1PK6C 1H2KA 2QDNA 2G19A 3OGRA 3CL1A 1HB3A 2R32A 4FSJA 2QQLA 2IVIB 2W39A 3AFKA 2BWCA 1PZ9A 1UU4A 4EWDA 1XYNA 2WNUB 4FPLA 1RYYA 4IETA 2Y6HA 1OF3A 5KXBA 1CD3G 4MV2A 4PIZA 1LHNA 3ZFFC 1LHWA 3BOWA 4PJYA 3AMNA 2YUEA 1JZ6A 2BW8A 1UMZA 1W8WA 3VHPA 2OA2A 3OG2A 5A7OA 5DAPA 2JDZA 4RR3A 2QQNA 5J48A 4N43B 4CDWB 4AK3A 5GZCA 1VRH3 3GZUC 4H7MA 5FP4A 1J83A 4YVSA 1TME1 4FFGA 2B9UA 1DP0A 1V0AA 5EIYB 5JXGA 3RMYA 2XQRA 5D21A 2YBSA 3ZYHA 3H1YA 5FY5A 3VD5A 5FPAA 3EXUA 2GNMA 1AXYA 4Y5SA 1S0GA 4Q0PA 1JZ3A 3RGBA 1UYXA 1O91A 4Y22B 1DGRN 1WCUA 3U75A 3JBG1 5H9QA 1YQ2A 4A4AA 5GLUA 5A3MA 4K1YA 3AYDA 1S2KA 3ZN6A 2DCJA 5DZGA 3ZXFA 4F3JA 4F7ZA 3MDPA 5FV3A 2LM3A 2GC1A 4ATEA 4FXGB 4UFKA 2WSUA 4RR3C 1TMF1 4N8MA 1WKYA 3LIHA 4XILA 4HONA 1LAJA 1AXZA 4CRQA 3PDQA 4YVSC 5GZEA 3OUHA 2IFWA 1BQPA 4GXLA 3PU3A 2W95A 4IQPA 1A6CA 1K5JA 1I3HA 3GJBA 4YM0A 5KHKA 4RFT0 5A32A 3V0BB 3QH6A 4FPCA 3N9NA 2RDSA 4IV3A 4D7TA 1PM7A 3CNAA 1W03A 3U10A 5FWJA 3UJOA 2A73B 4BK4A 2AR6A 3TN91 5LWBA 1HIXA 1VRH2 1E5HA 4JGYB 2VZPA 4GKYA 3AP6A 4OULA 2UURA 1RUF1 4PF5A 4Z8BA 5JR2A 5B4NA 1YXWA 5FMDA 2VNOA 4YFZA 4HPKA 1H8VA 1RUE1 3POYA 4NUBA 2D5FA 1SBDA 4Y1UA 4CZSA
chains in the Genus database with same CATH topology
2AUYA 2HEYF 1H0BA 4GA9A 1LOGA 3UJQA 1JTZX 2GAUA 4KNCA 2H6BA 5B2GB 5EV7A 1COV1 2FHRA 3DKWA 2EAAA 4IV3C 4XHBA 1HX6A 4RA0A 4IXLA 4P9IA 1ZBA1 5FMOL 3VZLA 4PLMA 1Q8OA 1Q8QA 1QXJA 5T54A 1JUIA 2ZJCA 4AQSA 2XWJB 1TE1B 1H1AA 1EAH2 1SFNA 2FBEA 4AVVA 5HBAA 4ONUA 1QQP3 3C3VA 4YGDA 5DG2A 1S0JA 2EXHA 4KWLA 2R0HA 1VBA3 3A0NA 2ZOEB 2D5HA 2VOXA 3GBFA 2P2KA 4L92A 3Q9OA 1Z0HA 4D7YA 4HT1T 4I09A 2RMU2 4S2FA 3SISA 1T6GC 4WM7C 3I54A 3JD73 1KJRA 1YFUA 2PN5A 2E63A 3OYWB 5JWPA 5C6CA 1GFF2 4IEWA 2ERFA 1YI9A 2R061 4WV8A 4C1XA 2PLV2 4LLFA 5I0UA 5I8SA 5FOBB 3LSEA 1X8EA 3PVOA 3AKRA 1VALA 4GQ7A 4HSLA 1G9BA 5H9SA 1EP0A 2VVEA 1RUJ3 3HR9A 4YGEA 1RVF2 5I0RA 3M3QA 5BPXA 3WW2A 2ZAHA 4XQ4A 1QQP2 2P3KA 2RJKA 2Y0IA 4RQPB 2ENRA 3POSA 2WJSA 4N9HA 4EN6B 2WS91 3NV4A 2HWD3 3J4UH 5BV6A 3IDBB 1YFWA 4CDWA 5A33A 4BWOA 1R091 4ITCA 5ABJB 1FOD3 1AX0A 1V9U3 1VBC1 2GC3A 3JD72 4BHPA 1EPZA 2ZGTA 4FP3A 1WCKA 2PHTA 1CJDA 2XKOA 4Q4Y1 4XEZA 3IPVB 4AVTA 3WLUA 1K5MA 3TNQA 4PIYA 4DS0A 5BNPB 3NKGA 3RJ2X 5BNOB 4Y22A 2DCKA 1V6OA 4AVBA 4EN9B 2JG8B 1QY4A 3MLKA 1ULGA 1C57A 2E7QA 1WMDA 1FXZA 3ZSMA 2C5DA 3VKLA 1ZNPA 3WZ1A 1N1SA 2R16A 3ST7A 4CDWC 2E6VA 2ZGPA 5DDJ1 1D2SA 4XMAA 1C8M2 1LESA 3V64A 1AL0G 2WZR2 1CJPA 4OLLA 1APNA 1G9AA 4Q27A 3ZXAC 5DZFA 1IHMA 2RM23 4K8FA 1PO21 2TBVA 4HSJA 3TBDA 1K5MC 5C4WB 1OFSA 4XFHA 4COVA 2AGSA 4JGYA 1ONAA 1V6LA 3PHMA 4K7JA 1OOPB 3ZXKA 1QJZA 1O4TA 4LHKA 4XJWA 4Q26A 2TNFA 4XFFA 1CONA 4E9KA 2YZ4A 3LWCA 1RJ8A 4TZDA 3R0RA 3C2UA 4LNVA 1GNHA 1HQLA 1W6NB 5ACA1 3NV2A 2VGDA 5GM0A 2C1FA 3HWJA 3VBUA 3ZO0B 5KXDA 1RUI1 2ZGMA 1PGW2 2E9QA 3M2MA 3ES1A 5FO7B 1LJ7A 4Y20B 2P37A 4FO9A 2BUKA 2GZWA 4JGYC 2NN8A 2PYTA 1HRV1 3AXDA 2RHPA 1BBT3 2CYFA 2WT0A 3ILFA 1AR93 1EV12 3MPPG 3AP9A 2P3IA 2RS33 3VZMA 2XVGA 1LHUA 2XL7A 1KS5A 3J8F1 3IDCB 3VBUC 4KWKA 2R041 4J1XA 5IK7A 1BKZA 2WT2A 4Q0SA 3WDUA 4FPGA 4GWMA 1XU2A 5C9AB 1BEV1 3RNSA 3OYWA 5H9RA 5JR7B 4NHMA 3VBRB 3OGGA 2HWE1 4OVEA 1CX4A 4CDQB 1VB4A 1CPNA 4IEZA 5FO9B 4OHWA 3KCCA 4YM3A 4Q4W1 1ZRCA 3CJIB 4FPJA 2D6MA 1OLQA 2E7TA 1SCRA 4JRAA 2SBAA 5JPMB 2QJVA 1WBFA 3N35A 4DINB 3KSCA 4XZPA 2E53A 3OD4A 4KG0A 5JSPA 2RS32 1H4HA 1XNKA 4NWVA 5DUUA 5ABJA 2XB6C 3VBHB 3HBZA 1NG0A 1YJKA 1QDCA 4DY5A 4KG8A 2VUJA 4BZ4A 3CLPA 4QQOA 1W0OA 5BNPA 5BNOA 4X8NA 4LA3A 4MX3A 4QGNA 2W08A 4L97A 3AM2A 1AVBA 4PQ9A 4WM8B 2JD4A 4B4QA 2JG8A 1FATA 4AI1A 2LALA 1O7FA 1NY71 5JZGA 3ZYRA 1QJY1 3OPZA 3AP5A 5GLTA 3TNPB 1VBE1 1AL22 1DU3D 1R082 2Z2SB 4ASLA 5ABJC 3WD5A 4FQ4A 3RWNA 1CAUB 2VPVA 3WV6A 1QWRA 2ZZJA 2WIIB 1OMIA 1SLBA 4COUA 4CP1A 4UBGA 1MVQA 1UF2C 2DFBA 1ZX5A 4WVWA 1LGBA 3RG0A 5BNPC 5BNOC 1DZTA 3GZTB 4ZU7A 2QZ2A 3B3QE 1IS4A 2JG8C 3H1MA 3RI8A 2A6XA 3FC0A 5JZGC 1AUYA 4KBBA 1ZRFA 2GMPA 4HFSA 1BJQA 2WFF2 3O0XA 3HD8B 4P14A 4EWEA 1SFYA 5IK4A 3AMMA 5CIRA 4JGZB 1OI6A 1KJLA 3VLBB 3DGTA 5KXCA 5EYYA 2YY1A 1XNBA 1PHMA 1ZBE3 4BCUA 4YW3A 1MZ5A 5DUWA 1XNDA 3IN9A 2ZAAA 5E88A 3KGLA 4META 5JAXA 2CWMA 4HZFA 1A8DA 1FPN1 4ZU5A 2VOWA 5CU1A 1O3RA 2DTWA 3SNMA 4TLFA 1FX5A 1F2NA 1D4M1 1JW6A 2IC1A 2MHFA 2ZGLA 4IV1B 4XF3A 4XW3A 4DPNA 3MIFA 1AYN2 4IEYA 1D0GA 2VW2A 4LBQB 4L8QA 4XIOA 4FPYA 3LA3A 2IXHA 1Y9QA 3INAA 3JU9A 1UZYA 3LZZA 1CGPA 4JAAA 3VBFB 2JKBA 3O7OA 4JDMA 4FPKA 4FBFA 1M4WA 3VBRA 2HWF1 3L2HA 3JQWA 4CDQA 2AENA 1ZBE2 3FMGA 2GC2A 1HLCA 1PVC1 3CJIA 2OW4A 1WW6A 1GZCA 1RUH3 3WUDA 1FMD1 4WVZA 3PLQA 1KDMA 2D40A 1UAIA 2EALA 1UIKA 2XBO3 2DV9A 2VOVA 2D93A 2WINB 2PHLA 4MXWB 1ZZ8A 1RITA 3AKTA 3PJQA 4AHZA 3WX5A 3VBRC 4AGRA 1C1FA 4CDQC 2ILMA 4C91A 4K3UA 3CJIC 5CNAA 2PHXA 3WCRA 3LA2A 2OIIA 4XFGA 1XXNA 2RS13 2GDFA 1Q43A 2WNVA 1GZWA 3LOBA 2GH2A 4KU7A 2YC0A 1LKNA 2ZMKA 3WP5A 3TYJA 4I3PA 2DCYA 2PELA 4I3GA 2XH6A 1MQTB 2GH8A 2ET1A 1GZ9A 1Y7BA 2VOKA 3AP4A 5HI0A 2CV6A 1TQ5A 5T55A 4NHLA 5EYXA 1ZZ9A 4B8EA 1JN2P 1CESA 5BXXA 1IQAA 2B8MA 4G3YC 4E4SA 3KGZA 2C9AA 2WKKA 1W6PB 4Y1YA 1Z7S3 2WNVC 3GBGA 3AZWA 2WZPP 1XYOA 1ULDA 1YHFA 1HRI2 3KZ4C 5KHHA 1DZQA 2D7FA 4W65A 2GALA 3T1LA 5LRRA 4EV0A 2B7YA 4BOWA 2VQ0A 4ES8A 2RS12 4CDUB 2ZX3A 1J1LA 3WP4A 4R9BA 4WVVA 1VRH1 3WHTA 1O3TA 5JOXA 2ZX0A 2DVBA 2A5ZA 1YNAA 1DF0A 1X82A 2WA4A 4EJRA 4MXVA 3DV8A 3CF6E 1DYPA 2XJVA 4UW4A 1FV2A 2ZA9A 3TB0A 2D97A 1ULEA 1LOAA 4B3NA 1MS3A 4AI0A 1RTVA 3AZZA 5AVAA 1BXHA 3AMPA 1GQGA 4PLNA 4Y1XA 4FTSA 5FQ0B 4QQPA 3VKOA 1BK1A 5FMOS 4LBQA 3WQ7A 2A3XA 4XMIA 1X36A 5L7OB 1EAH1 1OKQA 1JYIA 1DHKB 3M70A 1I1EA 1SACA 2IXIA 4I0BA 5FRAA 5JVVA 1LOBA 1VBB3 2KXLA 4CTEA 2ZGRA 3B94A 3SH4A 1OPOA 1Q3EA 1AR81 4RS5A 4CEYA 3G6JB 2XLGA 2DUPA 3R4DB 2RMU1 1LECA 4L99A 2A71A 1UW8A 4XXAA 2BBVA 1UIJA 5BUVA 2FMDA 3D82A 3FJSA 1U5IA 5J09A 1H2NA 3HAGA 1S0IA 3EHKA 4YW4A 2O8QA 1VLNA 1MS9A 2YGMA 1IS5A 2PAKA 4YG6A 2PLV1 1REDA 4AF9A 1XE8A 4MXWA 4AI2A 1J3QA 2VU9A 4LLOA 3WVJA 5LEKA 4ZKTB 4C1WA 1S0BA 1AYM1 1ZRRA 2CGNA 1HXS3 2AH2A 2GNBA 1RVF1 4RS5C 4CEYC 4LO8A 2P3JA 3PMSA 3WW4A 2GN3A 3GNEA 5TSWA 4PDWB 3AJYA 1C3HA 4EN8B 3ZYJB 4P9YA 3IT8A 3M3OA 2DFCA 5KHGA 2WC2A 4PBPA 3G7DA 1VAKA 1MQTA 2QE3A 2GNDA 3L9JT 1QJU2 3I4IA 1QOSA 1AX2A 4PLOA 4S2DA 3QLQA 4XBLA 1MVEA 1YCIA 4BA6A 3UK9A 3D6EA 4U2AA 2YDEA 4H14A 1ASJ2 3PMEA 4A7YA 4AYUA 1S2BA 2A6YA 1NLSA 3KD4A 3GHMA 3DF0A 2ZGNA 2OYZA 4R9DA 2ZTNA 2PAMA 4LE3A 3V65A 4AVAA 1HXS2 5FDBA 3A0KA 1UL9A 4LTAA 1G86A 1U5YA 1BYHA 3E6DA 3PJYA 4DXZA 1RHI2 1LEMA 3B69A 1C8M1 1LOCA 1ALYA 1I5ZA 2WZR1 1RIRA 1TEIA 1MQTC 2R073 1ENXA 5DUVA 1NCRB 1BVP1 4HN0A 1YIFA 4CDUA 2O8OA 4KH9A 1NQDA 2RJLA 4GALA 2N7GA 1LU2A 3A4UA 1WLTA 4M0HA 2CAUA 3W59A 3KS7A 1SQ4A 1WW7A 4QT6A 2CL2A 5CAZA 3ZSEA 2MEV3 1DG6A 4J1WA 5JOWA 1H9WA 1U12A 2NP0A 2EVXA 2B39A 5CA6A 1VAVA 1XQNA 4GWNA 4D69A 2IXLA 2EXIA 3VHNA 3VKMA 3FLTA 3USSA 1W39A 2JG9B 3WDVA 2DVFA 2C0ZA 4YVWB 4CDUC 4MGKE 3N7KA 4MUVA 5FQ0A 3KB5A 5FBZA 1PGW1 5J37A 1RUG3 3U11A 1PMIA 3NVCA 3FWEA 5C8WA 2ZHMA 4JVAA 4Y5Z0 5L7OA 3NAPB 1AHSA 2HYKA 4YG0A 1AR61 4I02A 1X33A 2W68A 4M00A 1FNYA 2XKPA 1OQ1A 4CEWB 1F5JA 4DNYA 2CGOA 3OF1A 2D6KA 1NYWA 1EV11 4BIFA 4QPIA 1OQDA 3WP6A 4U36A 2KA3A 4LBJA 4G4FA 1CAWA 3MYXA 2NMOA 1WLDA 4NVPA 4IEVA 3HT1A 3ALQA 1FI2A 5KHJA 1CAXA 3ZXDA 1WBLA 2DTYA 4GB33 4BMEA 4NO4A 4X6QB 5L7OC 1MACA 3QH7A 5D8AB 4Q4X3 3N4MA 2ATFA 4LBLA 2QCSB 2Q5TA 1RUG2 5SV8A 3NV1A 3HT2A 3IDEA 3O14A 4QPIC 1PIV3 3B02A 4BLIA 5I93A 4NWWA 3EBRA 1LHVA 2RS51 2WLQA 4M3CF 4XXPA 1DQ4A 1JHNA 3DL3A 1LOEA 1PO13 2ES3A 1OSGA 1R1A3 1IZ3A 3WG3A 2ZMLA 2O1QA 1AJKA 1AR71 1UU6A 2IWGB 4HVQA 4YYOA 1DQ1A 4AQ6A 1OFNA 1WD4A 3UKTA 5LK5A 2YV8A 4QPGB 5KWRA 2WNUA 5FPZA 4DY3A 5JI9A 2LUWA 4GB32 4E2GA 2YPJA 4FXKB 3NWKA 1VBA2 3DPRB 4E2SA 1W0PA 1C5IA 3FX3A 2VW0A 2IFRA 4N43A 1AF9A 4LHLA 1QHDA 2B42B 4C90A 1VIWB 4OHZA 1ZZCA 5JPNB 1J3PA 2OUJA 4GIQA 1AL21 1X50A 1R081 1TME3 5EZWA 2BNMA 5KHIA 3VDDB 2VVDA 2R30A 2WA3A 5KXEA 4AHWA 2ZBJA 2WNUC 1O5LA 1BVVA 5C8CB 1LENA 1WMFA 2Z42A 4AFDA 3THPA 2VMHA 3JBG3 3VKNA 1ZZ6A 1RUJ2 3MW3A 4QU2A 4COZA 4YZ2A 1M06G 3E5QA 4OI2A 4LT5A 4N43C 2I45A 4AEJA 3O0VA 3AP7A 1TMF3 2WFF1 1N3PA 1YYNA 3MW4A 1DQ0A 4Q4V1 1S1AA 2GN7A 1VP6A 3POWA 4BM8A 3V0BA 2HWD2 1RUD3 1RMU1 5CG8A 3LSDA 3SXWA 2ET7A 2QQPA 4SLIA 4AFAA 1NE4A 2JG9A 4LUMA 4YVWA 5FFOC 4XJAA 3RMXA 1FOD2 1V9U2 3SH3A 3TN93 2XG3A 3MI8A 3IWZA 1NA1B 4QXKA 4ISQA 4ORFA 5L36A 1SMVA 1TME2 1DFQA 1POV1 3PVBB 1F8VA 1RUF3 1N47A 3NV3A 2PHWA 4Z92B 4MLOA 4QQ2A 4X6RB 2PHUA 3H50A 4CEWA 1NCQB 1G7YA 2Q30A 4MSVA 2DVAA 1XNCA 2ZKNA 1CVNA 2VXRA 4AWDA 4GULA 2WNEA 1IKPA 2GC0A 2VY0A 4AI8A 3SLIA 3RPQA 3ZMNA 1COV3 1AYN1 3VBOB 2RR11 2HEWF 2JG9C 4YVWC 5HCBA 1ULFA 3H0OA 2A3YA 3ENRA 1ZBA3 4FPHA 3ELNA 3L2YA 4Q8KA 3QCWA 1RUD2 2RM22 4LO5B 3KT7A 2Z69A 4FP2A 2X5IB 2BTVC 4OUSA 4AQ2A 4B4PA 1DLLA 4HKLA 1J59A 3TN92 1ZBE1 2BFUL 4CEWC 4N7UA 3BTAA 4YZ5A 1SDWA 3T1MA 2JECA 4W6XA 1IOAA 3H3ZA 4UW3A 4YRDA 3P3PA 4UW5A 2VH9A 3OD0A 1AZDA 4YZ4A 4WZFA 5GLZA 2ZHKA 4YG3A 2UWCA 5K8SA 1QGLA 2R063 4M0NA 4HKWA 1COV2 1ND2B 1JUHA 3URFA 1WCDJ 5AFBA 3ZSLA 1BMV2 1ZBA2 4JRLA 5GZFA 1ULCA 3LOIA 5CB7A 2EA7A 3GHNA 4F83A 4INDA 4RQPA 1BBT2 2O0OA 1TNRA 3SCFA 1AR92 5T5LA 1U5XA 2PHFA 1QXRA 5KC5A 3ZVXA 1V6JA 1R093 4JC1A 5HCAA 3D5OA 2YHJA 4JDNA 3ZFEB 3E6CC 5DUXA 4XF9A 5GJ6A 4AGVA 2ZKLA 3IPVA 5EXOA 3KT1A 1POV0 3VDDA 3GBWA 4BMBA 4Q4Y3 1GQHA 3SH5A 5C8CA 1WGPA 4Z82A 5BNNB 1YLLA 3ZMOA 4RQPC 2YROA 2R062 1JYCA 3D0JA 4YW2A 4XOGA 2P34A 3ROUA 1HRI1 5DXDA 1IS6A 2HWB1 4DRVA 1XE7A 3LKJA 4HMZA 4L2NA 1YUDA 3M3CA 5DDJ3 2NYYA 3VZOA 3AZYA 1G8WA 1OQEA 4ZU4A 3VDDC 2X29A 3AMHA 5C4WA 2B46X 1PO23 5C8CC 2QUOA 1IKQA 1PNGA 1NA1A 1WD3A 3ZIWA 5J36A 1OOPA 3H7JA 1LR5A 4PBOA 1YWKA 2ZGSA 1OA4A 5FPXA 1WLCA 3S7EA 3VHOA 4CP2A 3BPZA 1SLTA 2A70A 3VZNA 3T2TA 1NCQA 2OVUA 1E57A 1W6NA 5J98B 2IZWA 1F9KA 1PZ7A 2QVSB 4FPOB 3GZAA 4M3CB 3VV1A 4DZGA 1NXD1 3O12A 1DIWA 4WVMB 5C4WC 4Y20A 1RUI3 2XJPA 4LO7A 2DCTA 2MPFA 3BB6A 1NA1C 5AC91 1FT9A 4YFWA 2UWAA 2X8KA 1OOPC 4XFBA 3B9CA 2DUQA 1HRV3 2W52A 4IESA 1PGL2 3QBQA 4NN0A 4YGBA 2X5IA 4AEDB 1YFYA 3IMNA 1PO22 4AE2A 1NCQC 1VBD1 2PQQA 3W58A 3FBMA 3J26N 3ZDSA 5LK7B 1G9CA 1CPMA 3FHIB 3VZKA 3H7YA 4HANA 5C9AA 1BCXA 1RUC1 1ZZ7A 1X7NA 1BEV3 4KGGA 2XJUA 4MGYE 2UY9A 1QF3A 5CFDB 3AKQA 1UPIA 5I0SA 2VULA 2BNOA 3S0MA 1ND2A 2X5IC 2HWE3 1Y3TA 4Q4W3 1UKRA 2XLAA 5IK5A 4YLZA 5EWSA 4KQ7A 3WY6A 4XHXA 5GLVA 1WLWA 2G9FA 5E16A 1PVXA 4YGCA 4I0AA 5C9AC 3DN7A 2A6WA 4RSUA 4RHV3 3ES4A 4QGLA 3RYRA 3VBHA 3U07A 3ZYGA 2I2SA 3B93A 1QJU1 2VW1A 4XJ9A 1GANA 2Q8OA 1H1MA 1YO8A 3ZFEA 1B35B 1MEC3 1ND2C 1JXNA 2WWSA 1S55A 3QACA 2R1DA 2R6QA 3MICA 1C1LA 1W6QB 3FFZA 3MFAA 4FT8A 1GICA 3R6SA 4LO4B 1ASJ1 3ILRA 4WM8A 1PK6B 1DZRA 2ZX4A 4OI4A 4P9XA 4FOVA 4QQHA 3VBSB 1HXS1 2RE9A 1A8MA 3S6PA 3WDTA 3WXPA 4IEQA 2UWBA 1KS4A 4GMP1 2V73A 5E8AA 3TAYA 1QJY3 1RHI1 1RUH2 1U5ZA 2Q1ZB 4OHXA 4RGAA 3ZFFB 3UKVA 4E27A 3VBHC 1VBE3 1CAUA 1LHOA 2AYHA 2D3PA 2XBO2 3LGRA 5F1RA 3ZFEC 4Q29A 4RD7A 1FV3A 4RHV2 2A7AA 4TWTA 3UKNA 4Y26A 4YW1A 4WM8C 2XL9A 4S2HA 1DQ5A 2EXJA 1MEC2 2E51A 1SEFA 1GR3A 2YMZA 1D2QA 4PIXA 3NSTA 1UN1A 4B4RA 1WW5A 1GSLA 4AEMA 4LBNA 4KL1A 5CFCB 3ATGA 3DUIA 4JGZA 1KRIA 4M3CA 2DVGA 4COWA 4MYEA 1F5FA 4QQLA 5JOZA 2DU1A 4YVSB 1GNZA 1QJY2 3RYPA 1DYKA 2KM2A 1MZ6A 1ENRA 4NHKA 3EJKA 2QZ3A 3KCXA 1Q8SA 1MZEA 3I59B 4V1PA 5BYNA 2WT1A 2DWRA 2DYCA 4AEDA 1Z7S2 2XWBB 5FOJB 3MLLA 5AVPA 4Q0QA 1QKQA 2QDRA 1QJX3 5T50A 2WL1A 4XDQA 4IV1A 4BH9A 1D4M3 4JGZC 1OA2A 3BIWE 3HMYA 3OJBA 2A75A 4X8PA 2ZHNA 4ATFA 3J9SA 3MIDA 1UPSA 3E5XA 3AZXA 4HN1A 3VBFA 5A32B 5GKAC 4LBMA 5CFDA 1RL3A 4ES9A 1RUG1 4LEJA 2HWF3 4AEDC 2EIGA 2F6BA 1URXA 1PVC3 4IV1C 4GMP0 2VNGA 3CJXA 1GBGA 1UCXA 1FMD3 1J3RA 4KWJA 4W6YA 1N1TA 4A7ZA 1NQJA 1KFXL 1EY2A 1QJX2 3BALA 4WM7B 2B5HA 3VBFC 1Y43B 4BE3A 1CR7A 5CFDC 1NE6A 4XQDA 1REEA 5HXVA 1HV0A 5LRSA 1B35A 3N7LA 1IPJA 4GB31 1QQP1 1X8MA 4N53B 4CYDA 3H8UA 1VBB2 1W6QA 1VBA1 1ZVFA 3AYEA 1OLRA 2D6OX 3CU7A 4H3WA 1HQNA 4M3CE 4OI1A 1MS0A 5CBLA 1ZZBA 3VBSA 2HWF2 5F5QA 1IS3A 2W0XA 3I2DA 4PCRA 1C4RA 5JOYA 3JD71 2V5YA 1V6KA 4XBNA 1S0EA 4N9IA 2D3RA 4AVSA 1CAVB 4EWAA 1FMD2 2VVFA 3FFQA 1OD5A 1B35C 2JICA 1LU1A 3SCGA 3ZPYA 3LA7A 4BPZA 5FREA 4XFAA 5F6KA 5FCCA 1QOOA 2B45X 1W6OB 3TRSB 4EN7B 5F9TA 1W6PA 4P9JA 3WHUA 2ETEA 1SBFA 1RUJ1 3APBA 3K48A 4AI3A 4MGIE 4XIKA 2JENA 2JEMA 3W9AA 2ZS6B 4J6GA 3AZVA 5T52A 3WW3A 2ZACA 3VBSC 2GMMA 4OZXA 4XBQA 5FTTC 4F8AA 3ZXEA 5J7MA 4K20A 5T3NA 3WR0A 1ZYBA 4OHYA 3RRDA 1OPMA 2K2SA 2HWD1 2GNTA 3WQ0A 4AFMA 4COYA 3M7AA 5A3LA 5CFCA 1SLAA 3MIGA 1FOD1 2JE7A 1V9U1 2CGPA 5A33B 2XJQA 3B5LB 1FNZA 1JBCA 3WW1A 2IXKA 4A2UA 4B7KA 1Q56A 4HBNA 2GSYA 2XVLA 4LBQD 4NR1A 1ZA4A 2D43A 4HK8A 1QNYA 2XUMA 3O5SA 4AFCA 4Q2FA 2CY6A 3I59A 4YNIA 1K5MB 4K6BA 4A7KA 2NZ9A 4RL7A 1VR3A 2TUNA 4LR4A 2F4PA 2XGXA 4BIOA 3WINE 1Q8VA 3H3UA 4I01A 2HWC3 5CFCC 1NXMA 4M01A 1LGCA 3AJZA 4JCKA 1H2MA 3V56A 2R072 4XF0A 1DQ6A 1RUNA 5J96B 1RUD1 2RM21 5I91A 1C5HA 1EAH3 5IT6A 2AZ5A 1G6NA 3WNXA 2MEV2 1I6XA 4HETA 1Q8PA 2BFUS 4JDOA 4R9CA 1AR83 3AKSA 1UKGA 2RMU3 4R9AA 4IEOA 3RS6A 5JMCA 4D3WA 2PAEA 3FUQA 3BOPA 2HKXA 5L19A 3B01A 3NO8A 2HJIA 3JCIA 3VBUB 4WM7A 2HWC2 2H0BA 3MW2A 2PLV3 4P9WA 3KMHA 1Q5OA 1BMV1 3SCHA 1AYM3 2WSVA 3ZFGB 4HVOA 1SLIA 1RVF3 2NQYA 2ZABA 4N53A 4MGZE 1BBT1 4FTEA 4Q8LA 1S0FA 2VG9A 1RB8G 1AR91 3AMQA 4UBHA 4XJUA 2RS31 2VUAA 4PDWA 4RGGA 2R1BA 5JDBA 3MIHA 2CWSA 1AR82 1QU0A 3ECQA 2JJ6A 1CIWA 3USUB 3VL9A 4XPVA 4D7SA 2ARBA 3M4FA 2ZGUA 3S7IA 1CAVA 3IM0A 4LO6B 1F31A 1S0DA 4WZCA 2LTNA 3SHRA 2Z5WA 3ACLA 2MNGA 4N53C 4Q4X2 4R8HA 1W6OA 3AFGA 1HV1A 1D0HA 1O5UA 4Q0VA 4JQRA 4Z2WA 2ZCWA 3WCSA 5F6LB 1RC6A 2XHKA 1O3SA 1AYM2 1LOFA 4PDWC 1PIV2 3FUOA 1O3QA 3OCPA 1ZRDA 4YW5A 3WDWA 2BPA2 1JH5A 1B09A 4XTMA 1PO12 4E4DX 1C8M3 3D4KA 2QKDA 1MZFA 1NCRA 2YXSA 1EYBA 2D6LX 3ILNA 4JV4A 2QNKA 2WZR3 4K1ZA 1R1A2 5EJ3A 4AFBA 1AJOA 3MEPA 2Q4SA 4XYXA 1J58A 2CNAA 1I9RA 4YSFA 2I74A 2YGLA 3AKPA 4TYSA 1NLRA 5IK8A 4JTNA 4BLJA 1RJ7A 2XJRA 2ZX1A 3VHRA 4MVTA 1LOFC 3H9AA 4Q0UA 4LA2A 4FVVA 4ISRA 2Q0AA 1H9PA 4R52A 2VQAA 2JXAA 2HEVF 1D4VB 3ZSJA 4LUKA 1ZREA 4LBOA 1SCSA 1SLLA 3ETQA 3MF9A 1NCRC 1MS1A 5JIAA 2NMNA 1DQ2A 3D0SA 4QGMA 5JZGB 4XFCA 3ZXLA 4FAGA 2D44A 4EROA 2ARXA 4Q1RA 3U4XA 3NAPA