3AMHA

Crystal structure of cellulase 12a from thermotoga maritima
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
256
structure length
256
Chain Sequence
MVLMTKPGTSDFVWNGIPLSMELNLWNIKEYSGSVAMKFDGEKITFDADIQNLSPKEPERYVLGYPEFYYGYKPWENHTAEGSKLPVPVSSMKSFSVEVSFDIHHEPSLPLNFAMETWLTREKYQTEASIGDVEIMVWFYFNNLTPGGEKIEEFTIPFVLNGESVEGTWELWLAEWGWDYLAFRLKDPVKKGRVKFDVRHFLDAAGKALSSSARVKDFEDLYFTVWEIGTEFGSPETKSAQFGWKFENFSIDLEVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and substrate-binding mode of cellulase 12A from Thermotoga maritima
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-glucanase
total genus 58
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2010-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3amhA00
2B46X 2DFBA 1REFA 3WX5A 1H4GA 4S2HA 5K7PA 2B45X 3AKPA 4XQWA 2QZ2A 3ZSEA 5EJ3A 4S2FA 3WR0A 2D97A 4HKWA 3WP6A 1T6GC 1BCXA 2QZ3A 3WP4A 1C5IA 2VULA 1OLRA 1AXKA 1XXNA 3VZMA 1BK1A 1HV1A 2VG9A 3AKQA 4IXLA 3WP3A 1H0BA 3AMPA 3B5LB 2JENA 1XYPA 2F6BA 1M4WA 1KS5A 1HV0A 2JICA 1XNCA 3VHOA 2DCZA 3VZLA 1H4HA 1UU6A 1REDA 3VZKA 3VL9A 1YNAA 3WQ7A 1XNKA 2DFCA 2D98A 2DCJA 4HK8A 3AKTA 1BVVA 3VZNA 1C5HA 2JEMA 1IGOA 3O7OA 4HKLA 3AMMA 2NQYA 2C1FA 3AKRA 3AKSA 4S2DA 3MFCA 1QH7A 4H7MA 1OA3A 3WQ1A 3WP5A 1NLRA 1W2UA 3VHPA 2DCYA 3VL8A 1H1AA 1ENXA 3VLBB 1QH6A 1REEA 1UKRA 3AMNA 1OA2A 3MFAA 1F5JA 1XNBA 3VGIA 2BWCA 3WQ0A 3WT3A 4XPVA 3LB9A 3WY6A 2VUJA 2B42B 1PVXA 4HKOA 3RI8A 4HK9A 2BW8A 5K9YA 2VGDA 4XQ4A 3LGRA 3AMQA 2BWAA 3EXUA 3VZJA 3WXPA 2DCKA 2NLRA 5HXVA 1XNDA 3AMHA 2BVVA 1UU4A 1H8VA 1TE1B 1UU5A 3MF6A 4NPRA 4S2GA 3M4FA 1HIXA 1OA4A 1XYNA 3VZOA 3MF9A 1OLQA 3B7MA 3RI9A 3VHNA 1XYOA 2Z79A 4XQDA 3HD8B 1KS4A
chains in the Genus database with same CATH superfamily
2B46X 2O8OA 3ACHA 2I2SA 1VIWB 3KHBA 4LPLA 4XXPA 2BV4A 3VBUA 3WCSA 3ZVXA 4Q4Y1 4K21A 2EIBA 1N1VA 3EB7A 3R4DB 1WCKA 2PLV3 4S2HA 2ENRA 5FY0A 5T5JA 3ZYJB 2DU1A 3AZZA 4W6XA 3S6PA 1AUYA 1SFNA 1S0JA 3LEMA 1LOAA 3OGGA 4W6WA 5HI0A 4Z8BA 3H8UA 1Z7S1 2HWB3 1LEDA 2JECA 2KD7A 3ELNA 3IMNA 2OA2A 3LDBA 4B4RA 4LKEA 1NCQA 1A8MA 1SLIA 3N36A 4NJ4A 5LA1A 1PIV2 1GWMA 2R042 2CWMA 5HPOA 1S0GA 3HWJA 5FPLA 3Q8FA 5F5AA 3CDZB 3VKNA 1UZYA 3ROUA 5A6XA 5JCTA 1H2KA 5T50A 5KHKA 2YGMA 2QQKA 2VCBA 3DPRA 4NPMA 4RA0A 3DUIA 3O1MA 2JB8A 5FZ6A 2X8KA 3SLIA 1NY72 5IHRA 2GC2A 2VZ3A 1XNCA 1VBA3 3VZLA 3SEEA 2C6SA 4ES9A 4WVZA 2ZMLA 4FPYA 4Q8LA 3HPNA 3CJIC 1GKBA 3WCRA 1W2AX 2WAOA 4AHZA 4QDQA 2VQUA 2RR13 4HK8A 1ZBA3 4QX1A 1C5HA 4FPJA 4YZ3A 1WLCA 2ZX1A 3B94A 2VZSA 2X5IA 1ZNPA 3B3QE 2R073 3E5XA 4GKXA 3I4IA 5EFUA 4IEUA 4CEYB 1MS9A 1Y7BA 3AKRA 4XUOA 2R062 1O8SA 1PM4A 1V6NA 1W9TA 3BU0A 4QHZA 2YBSA 2R7EB 5C8WA 2CDPA 1R083 2VO5A 4M4PA 2VAUA 2ADEA 3KS7A 1D2QA 1Q5OA 3SCHA 4R9AA 4D69A 1OQDA 4ATFA 2HEWF 4AVBA 1UZWA 1WMEA 1GZTA 3BALA 4KI5M 1JZ8A 1W2UA 4MADA 3KD4A 4MGZE 5FO8B 5KHJA 3RJ2X 1H1AA 1KEXA 3K46A 4BQWA 4OHYA 1DYKA 4KBZA 2BQPA 2WRAA 2PA7A 3LKJA 1REEA 1RUJ2 4QKDA 4Q4W2 1F5JA 1XNBA 1CPMA 2XH6A 3WNLA 1PO23 2XGXA 3WF3A 1VBC2 3PUIA 2P34A 2A75A 5HXMA 1JODA 1LGNA 3FHQA 2R32A 2AEZA 2RS51 2B42B 3ZYPA 1PVXA 1UW8A 4D0QA 1MQTA 2MEV1 3J8F1 4AQSA 3KV9A 2QNKA 1RHI2 3WF4A 2XOMA 1UIJA 3CLPA 4W65A 1W3VA 1BZWA 3CJIB 4K8RB 3FHAA 1VBE2 4GULA 2QBXA 3H1MA 1FNYA 3EXUA 5G05L 3M3EA 4BQYA 1RUC2 4BXSV 4A7ZA 4Q27A 1F4AA 3JCIA 4XBQA 5AC93 5L9BA 1OH4A 1POQA 4BCUA 3H3UA 1W06A 1GZ9A 1DP0A 3CNAA 4D8MA 2A3WA 4NPRA 3PU3A 1R093 5FMDA 5T5LA 1V6JA 1RB8G 1JN2P 5F8PA 4MGIE 2A7AA 4FCAA 1JZ7A 1S0IA 2RS33 4JKLA 3PVBB 2B5HA 3RYPA 4QXHA 1REFA 4PLMA 2Z4FA 5HCBA 1G9AA 3THDA 3AKPA 3IZOA 3C7OA 1CGPA 2P4EA 2B7YA 3HQUA 2YY1A 4QPGC 5L19A 4A2UA 1AX1A 2OVUA 3N9NA 4KNCA 4FPHA 2AZ5A 3WP4A 4DUXA 3IIAA 1C5IA 1RJ7A 2VZUA 3SC7X 2UWAA 2RJKA 3H3ZA 2HWD1 2UY8A 3GCWA 5IUQA 2CY6A 1SQ4A 1UD1A 1W99A 1U5YA 3LEGA 4PIXA 3SKVA 2G9ZA 1RUG3 3K51A 3AKQA 3I2KA 2JE8A 1JYCA 2WS92 3VKLA 2XBO1 4CDQA 1T2XA 2R16A 2F6BA 2ZEXA 1M4WA 2P37A 2ZGSA 1KGYA 1W8OA 5FPAA 5JPNB 3FJSA 3WW4A 5KXEA 2W1QA 5ACA1 1RUF3 4MHUA 1EAH1 4NWWA 3RMXA 3VZKA 4R9CA 3MLJA 2BBAA 2GMMA 1L7RA 1PK6B 1XNKA 2ARBA 4P9JA 4XDPA 4D7SA 4IV3C 3VZNA 5FZEA 4E4SA 2ZGNA 2E9QA 3I3MA 5EYYA 4NHLA 3FC0A 2CAUA 3AMMA 4LEJA 3OCPA 4JDOA 1I9RA 1BLZA 3CIHA 1ZRCA 3I3QA 2NYYA 2EXHA 3GZEA 5ABJC 1QKQA 1J3QA 4OLLA 4U36A 3WZ1A 4F8AA 2OW4A 3N7KA 1MS0A 1OOPB 5ANNA 4ZXKA 2XJQA 2ETEA 1PGSA 3ACFA 5FZGA 4RL7A 4CP1A 4G4FA 4Q0QA 4LE3A 1GP4A 3ILFA 1VBC3 5CFDC 1AR81 1FOD2 2AUYA 2PAEA 3H0OA 3ETPA 5FY1A 4BQ2A 4YG0A 3E5UA 1XQNA 4QQPA 4PCRA 4EWDA 5LRRA 3ZN5A 2DCYA 2O8QA 1X9PA 4XOGA 2VQ0A 5J09A 1VBB1 2DUOA 5FK7A 4IETA 4JAAA 3GNEA 1D4M2 5SV5A 3LPGA 4AF9A 1NCRA 2Q5TA 3P5BA 4IL7A 3WT3A 3ZR5A 5K0UA 2XG3A 4CP2A 1HKDA 3A7QA 3N4MA 3ZFFC 1D4M1 1FV3A 1RUF2 5F37A 1X33A 4XABA 3ZN6A 2JKBA 4LKDA 4YVWB 2WZEA 5FZKA 4Q4V3 3WW2A 2WNVA 5FZ0A 2UWBA 1LHUA 4XURA 3MV11 2A6ZA 4AHWA 4IE4A 5E88A 2RVAA 1Y9MA 3HBZA 3LOBA 5J7MA 3G6JB 5HCFA 3H8XA 4M3CB 3VKOA 1V00A 3ASIA 4XFGA 5FXWA 3ZXDA 4AAXA 4TZDA 2K46A 1XE7A 4NVPA 1AYN1 1OBNA 5DZEA 1H6YA 4N8MA 1IHMA 5C7GA 1LR5A 2FMYA 4LK7A 4RS5A 3T2TA 3K3OA 2HBTA 3MW3A 4IW3A 2BNMA 2Z79A 4JCKA 1LAJA 1AZDA 5FY5A 2E31A 4YGCA 5C9AA 2ERFA 2Q1FA 2RJ2A 4JRLA 4XCBA 2LALA 2E32A 4HT1T 3OEBA 5FUIA 4XQWA 1W6NA 3QACA 4NO4A 4COYA 3OPZA 1DQ4A 2GMPA 2IWGB 4QWNA 5J37A 3JD73 5IVBA 4W8JA 3M1HA 3MIEA 4IV3A 4CRQA 4HLTA 3NV3A 1KDKA 1W6QA 3LSEA 4LBOA 3DL3A 3HIFA 4V1PA 2OZ6A 2UU8A 4GJZA 1KDMA 1D4M3 4M3CF 4CE8A 2YHJA 1VMHA 3ZFFB 3MI8A 5IAXA 2ILMA 3TNQA 4HPKB 2P17A 4BB3A 3DEMA 5C3RA 1X8MA 3JBG1 4DQAA 5GLTA 3WP3A 1R1ZA 3AMPA 4LBQB 2Q1ZB 1PO13 1X36A 1EYBA 3UJOA 1LB2A 2CGNA 5CFDA 4Z2AA 2BERA 2FCVA 1YQCA 1H4HA 1UU6A 3AYEA 1GZWA 1RUH2 3FHIB 2WWJA 3WDTA 4B29A 5K0UB 1NKGA 3IIIA 4OULA 4BISA 3V56A 5J3UA 1ZZ8A 4BQ1A 1ND3C 3ACIA 3K77A 3N7MA 1QF3A 1ULPA 1FYUA 5A7PA 2D6PA 1Q8VA 5B4XA 1GP6A 4MXWA 4PI2A 3WDVA 5FPUA 2QQIA 4QPIC 2ZHLA 1B09A 3NJZA 4NAMA 1ENQA 4EN8B 3J8F2 4CXYA 4XJZA 5TSWA 2C1FA 2UWCA 3AM2A 1DQ5A 1BJQA 4HETA 2JDAA 2X53S 4AHYA 4UAPA 4N43A 2VBBA 4ONUA 3VBSB 2E26A 4Y5Z0 3ZDVA 1QH7A 5LCWL 1R1A1 1PK6C 4UWDA 3AXEA 4EZHA 1LGCA 3IKWA 4GXLA 3HT2A 3MO4A 2VW2A 1LTEA 1MS8A 2YUEA 3MYXA 4E8CA 5L36A 2RE9A 3AZXA 4AXOA 2QQNA 1OI6A 3PL0A 4Q26A 4AFBA 4LK6A 2CV6A 1PO12 1QH6A 4EWAA 1AR83 5CFDB 2EALA 1F2NA 1NX9A 4NIGA 4LO5B 5A6ZA 2BRTA 2ID4A 2QKDA 3VD5A 2WNUA 4P9LA 3NAPA 5C9AC 2YC0A 4ZONA 5F3GA 1UY1A 3MIGA 2BOIA 4CCLA 4QM8A 5IVJA 5F5CA 4GALA 2D3SA 2V09A 3VD9A 3LGRA 4AEMA 1C1FA 2BWAA 2SLIA 3RYRA 3GGLA 4GA9A 4R4ZA 1B35C 2HYKA 2Q8OA 3O1OA 5HCAA 4NR1A 2OXBA 2YU1A 1XC6A 2WT1A 3ZIXA 3AJYA 1FPN1 1Y9GA 2JDYA 2FDFA 3NSTA 1RUI2 4JX0A 4UFKA 3RI9A 3W20A 2Q30A 4ZY9A 3H8RA 2CL2A 1F31A 4D6QA 3ZSJA 4IEYA 4M0NA 5F9TA 5EQUA 3JQWA 2XQRA 2VTXJ 4Q4X2 4I3PA 4LHSA 4NIIA 4AI9A 1VRBA 3V65A 4WZFA 5CNAA 2PLV2 1UXXX 1NCQC 1RUE1 2JXAA 4XUNA 3AC0A 4K3UA 4HKWA 4PF1A 3EMRA 4F3JA 3BI3A 4N43B 3VBSA 1TMF2 1E5IA 2BGPA 2RMU2 5FREA 4ZU5A 2C9AA 4Q4V2 1V70A 2VD7A 4V2VA 3SMHA 4CSWA 3I59A 1AL22 1EUTA 1UXZA 3CQOA 2V5YA 4QXCA 1OF4A 4HANA 1QOTA 2V4AA 4E8DA 2YPDA 4FFHA 3VUOA 2R041 3RJRA 1AX0A 4FT8A 3O0VA 2HYXA 4YGEA 4BMBA 2WFF2 1NUKA 1PK6A 2VOKA 2DBNA 3SEPA 4EN9B 5IVEA 5FLIA 2E6VA 5JVVA 3JBG3 1JZ2A 1CAVA 1R082 5GZFA 5CFCC 4MGQA 2WNOA 5DPNA 5FZ1A 5JI9A 1PO11 5C9AB 1JZ5A 4DS0A 3DN7A 5DN2A 3VL9A 1Q8SA 2UY9A 1WLDA 3I7DA 4FBFA 5JZGA 4YG6A 2A70A 2DFCA 1BEV3 3J7MA 3U75A 3WNMA 2XQXA 1YQ2A 3I2GA 1DLLA 4UBGA 3NAPC 4AGVA 2IXLA 3SNMA 3I2IA 3OGVA 2LS6A 3B69A 1DG6A 4SBVA 1QJY3 1PIV1 2NQYA 3VBRB 1UNBA 2PMWB 2VMIA 3ZFEB 4WZCA 3GZUC 3HN3A 4HVRA 5KC5A 1VBE1 1RUE3 5JIUA 4L2NA 3ILRA 4SLIA 1AJOA 1AF9A 3AFKA 2AENA 4UFHA 4X6QB 1D0HA 4Z82A 4BE3A 3VDDA 3J4UH 1SLCA 5FYTA 5DUXA 4OI0A 4XHBA 4QHOA 2HWE3 1DZRA 1ULFA 2IUWA 2WIIB 4CVUA 2WUHA 1QQP2 1ZRIA 3SQOA 1IS3A 3CZJA 4BLIA 5LZ6A 2UYAA 4NWVA 1VLNA 1R1A3 2B9VA 3KGZA 5FJKA 5FTTC 3U4SA 2ZGUA 2VOWA 1OKQA 4DNYA 1RUH1 4YM2A 4D94A 3H1WA 4CDWB 3VDDB 1V6OA 1FNZA 1MQTC 1BHGA 1DGRN 1GOHA 1HRV3 1US2A 2SBAA 4OZOA 4TLFA 4XFCA 4Q0VA 1RUOA 1RHI1 2BBVA 4JGZB 4ZU4A 5DG1A 4JC1A 2P3KA 3TBDA 3ES4A 1YFWA 4M3CA 5H9QA 2W08A 4HN1A 3TEYA 4LKFA 4ZKTB 4O65A 1W6QB 4XQ4A 5M0TA 2WYSA 5JOXA 3MIBA 3PUSA 1GYKA 2WR9A 3H9AA 1UWWA 2EAKA 2VNOA 4ISQA 1FPN2 2VUCA 3KLSA 5L9RA 4HG6B 4KWUA 4CXWA 1KFXL 1GQGA 1NQJA 4I2OA 3IDAA 3RMYA 1CZVA 4YVWA 4CUBA 1J59A 3MICA 3L2YA 1PX4A 3OUIA 1XSRA 4FTBA 2AACA 2I45A 5GZDA 1O5UA 1OA4A 4LO4B 4UI9L 1GSLA 2R6QA 3MGUA 1YJLA 2W5FA 3BU7A 1IS6A 1VAMA 1X7NA 5A7WB 3KHCA 1C8M2 3POWA 1RXFA 3KVAA 1QNYA 4RHV1 3WG3A 4QPGA 3LCPA 1KS4A 4D7YA 4ZXEA 4CEWC 1HXS1 2P6HA 3GALA 1Q8QA 2WZ8A 2ZEYA 2LRPA 5F6KA 1AR63 2OKXA 4N9HA 2HBUA 4S2FA 4P08A 3UT0A 3NJYA 3VBHB 5FPVA 1JXNA 4FP2A 5FO9B 1UY2A 4Q0UA 1T6GC 5C3SA 3KSCA 4RFT0 4B3NA 4AVSA 4FI9A 5GJ6A 5CB7A 2A6VA 2IVJA 4UFLA 5LA2A 4AK3A 4YRDA 1K12A 1OLRA 4CPBA 3KV6A 4B7EA 2Z5WA 4QAWA 1UOJA 1XSQA 2GALA 3PVNA 4CP9A 1ZA4A 2BFUS 1QJY2 5FMBA 1Q43A 1WMFA 4NMIA 4IEZA 3UV9A 1C8M1 3VDDC 4FSJA 2J22A 1D7PM 4D7TA 2VM9A 1NYWA 5T55A 1Y3TA 2BFUL 2XLGA 2WBKA 3VD4A 4M01A 5A7OA 2QE3A 3OD0A 1EUUA 2VXJA 5AVAA 3S5AA 2A6YA 1WLTA 1UOGA 5LATA 3BN6A 1VAVA 4RSUA 5D8AA 3ST7A 3BTXA 1ASJ3 3B9CA 5CADA 1YIPA 2P3YA 5GALA 1OOPA 4RHV3 3U1XA 2IXHA 4FOWA 1IZ3A 5FZ9A 1PMHX 4HKLA 4JZRA 2ZX0A 2P6CA 2WFF3 4L8QA 3TYJA 3MV01 2A5ZA 1V6MA 3PHMA 1BK0A 3B9IA 1AR61 2ARCA 3U10A 4URAA 4MGSA 3W5MA 2Y0OA 3CZUA 3RS6A 2PQSA 4Q4Y3 4AVAA 4BIFA 3RYKA 3MFCA 5FUNA 4XAAA 4KMQA 2Y6LA 1H30A 5KXCA 3WHTA 5FPXA 4NPLA 2WA3A 2ZMKA 4L97A 3T08A 1JMUB 2QDNA 2JDZA 1NLRA 2A71A 3DECA 2D6OX 4A45A 5B2GB 3I49A 4FFIA 2QQLA 4A3XA 4PLNA 5BUVA 5CFCB 3LEKA 1ENXA 2ZBJA 4H55A 4RGAA 4LXLA 2W94A 3MFAA 3IDCB 5JIAA 4CDQB 1GWLA 5LEJA 1H1IA 3LB9A 2WNVC 3NNFA 4CEWA 4BQ5A 1GNYA 2D3RA 4JGYC 1WW6A 3ZFGA 5K4LA 4MOAA 5KXDA 3FN9A 4XJUA 2ARXA 5ABJA 2QQJA 2KXLA 4RN5A 4UBHA 1LHVA 3MHZA 2BW8A 2FDJA 4Y26A 4HOOA 2VGDA 3WDUA 3T0AA 1JU3A 3ZFGB 4HSLA 4MO3M 4CEWB 3VD3A 4YZ1A 1HN1A 3WHUA 3BTZA 4GJYA 1TME3 1U12A 4WM7B 1LESA 1YRZA 2GAUA 3H50A 5FO7B 4KG8A 3WG2A 1D4VB 1LCLA 4IESA 3VZOA 1G9BA 2VVFA 3RWKX 4LBJA 1EPZA 3RQ0A 2RDSA 4BOWA 2JIJA 2HWF2 3L9JT 3IPVA 3LDKA 2ORZA 5IW0A 3POEA 2XHKA 4TXWA 1QIQA 1R081 3CKHA 1W8HA 3FUQA 5FAXA 3LPFA 1RINA 4GWJA 4YW2A 1XRUA 1R64A 1ULDA 3WUDA 3ZKUA 1MPXA 2AEYA 2IZWA 5FZHA 1HXS2 3OD4A 1UMZA 2D97A 1FMD2 3LA3A 2QQPA 3Q9OA 1MACA 3ZXFA 1Z78A 4HMZA 1O7FA 3N9QA 2ZX2A 4R9DA 2Y34A 4LO8A 1MQTB 2VULA 1ND2B 3A22A 1NLQA 3C2UA 4G3YC 4UW4A 1EP0A 4UXAA 4ATEA 2KA3A 3HNBM 2RMU1 3BODA 4XC9A 1G8WA 3VBOC 1BK1A 3E1F1 3GZTB 2QQWA 2OPWA 2TNFA 3F2ZA 1OFSA 4XVHA 3BTAA 5JSRA 4IE5A 3J8F3 4MUVA 4YVSB 3VDAA 2HLEA 1Q8OA 2RR12 4CCDA 5A33B 3C3VA 1CESA 2UYBA 4GZ9A 1CR7A 4RFRB 5DDJ1 5CKNA 1HV0A 1QJU2 5FY8A 2Q8DA 2DCZA 2EIEA 4Q4X1 1A3KA 1BXHA 1UF2C 4IE0A 2XR4A 3RRDA 4IEVA 5BPXA 1YC61 4XTPA 4QPIA 1Y43B 4WM8B 1V9U3 4Y1VA 3Q8EA 1B35B 4E4ZA 2DCJA 1BVVA 2HWC2 3PMEA 2PN5A 1HDKA 2V5DA 1FX5A 3LAGA 3ES1A 2E33A 4JGYA 1ACCA 5T5PA 4ARXA 1W6PA 3WSOA 3UGHA 5JXIA 5A3MA 1POV1 4RR3B 3C8XA 1UYYA 5FLJA 3IAPA 5DZFA 3LIGA 5I8YA 2IC1A 2W2IA 2ZKLA 4XZPA 1LULA 4N53C 1SPPA 5FUPA 2W46A 1IG3A 2TUNA 4NOTA 4OUEA 1UZVA 1GV9A 2PTMA 4IDZA 4P5HA 4FAHA 4AFCA 3ZM8A 4WVMB 2VXRA 1N47A 3SISA 2HWE1 2WNUC 3LWCA 1NE4A 1H2NA 5A3UA 3VL8A 1NXD1 3KZ4C 1WW4A 1GFF2 5FZFA 5FZAA 1UKRA 4ES8A 3RZGA 4D6SA 4CA9A 1RXGA 3WF2A 2VY0A 1PZ9A 3HOBA 3THCA 3TEXA 5H9RA 3AP5A 3POIA 4COUA 4H7LA 4K8FA 3MIHA 2RJLA 4MLOA 3ZYHA 1B35A 2ATFA 4CCEA 2AYHA 4YFZA 5KWRA 1KFUL 1TNFA 2AREA 4LQRA 5F1RA 1OQEA 5EZWA 2VTXA 1KITA 3U37A 5ACA3 4OMCA 2YB7A 4CTEA 2XMLA 4OZXA 2WN3A 1TNRA 3NNMA 5HXVA 4C8DA 5A1FA 5IFTA 1LOFA 1OF3A 3JUUA 5EIYB 4AI3A 2GN3A 3UJQA 2WDBA 4YW6A 2GC0A 3GDBA 1DYOA 1NA1C 5FYHA 3NMBA 4C90A 1W28A 3I3EA 1GU3A 1WW5A 2VNGA 4A44A 3PUQA 4URTA 1E5SA 1OLQA 5F32A 3GF6A 1OLME 3FBMA 4XUQA 1G9DA 1O4YA 3GZAA 4QXBA 1HJFA 1I1EA 3OBTA 2Y6KA 4DRVA 3KM5A 1W3XA 3B00A 1MVQA 4DZGA 1QXJA 2P1BA 1QOOA 2YC2A 2ZMNA 4GH4A 3VBSC 4Z92B 2ZABA 1US3A 1MEC2 4AOCA 5HV4A 4AI1A 1O8PA 5A80A 4XF3A 5C3QA 4UW5A 3BPSA 3K3NA 2XJVA 3S30A 3GHNA 2TEPA 4FOVA 3VBRA 1ZM1A 4NHXA 1BMV1 4KGQA 4JTOA 5JOYA 1CPNA 4NHYA 1RUC1 1BBT2 2WWSA 1YCIA 2W92A 5FZDA 1JZ6A 2HEVF 3JB4C 2VOVA 2ZGQA 2GP3A 2QDRA 4XACA 2Y8KA 2VBDA 3NJVA 4XF9A 1UPSA 5FZ4A 1W39A 1CX1A 1XNAA 4EQVA 2NP0A 3HNYM 4PT6A 1C1LA 1VAKA 2GNBA 3D0JA 5CFCA 3O1RA 3MZHA 1TME2 1HV1A 2VG9A 3M3CA 3MDPA 2VR4A 4KG0A 1LGBA 4AQ6A 4DXRA 2JENA 1VBA1 1KS5A 5GLZA 4YPJA 2VMFA 3I97A 5CIRA 3OY8A 3LF7A 1HB2A 1QEXA 5F39A 3BOPA 4LBNA 4Y1XA 4A6OA 5FXZA 1DHKB 1O4ZA 2H6CA 4DUWA 1HQWA 1N3QA 4AZZA 1OHFA 2OQ6A 2XHNA 4BPZA 1V0AA 1VMJA 3O7OA 1FPN3 3N7JA 1AYM1 1ND3B 3K2OA 1A34A 4YG3A 1Z0HA 1ZX5A 3PMSA 2FDKA 4GKYA 4KU8A 3ZO0B 2EF6A 1QJX1 1I3HA 2FZ2A 1OVPA 2BZDA 1U5IA 1ZZ6A 1IKPA 1CD3G 1L7LA 1W8UA 5A1LA 4Y1YA 5LK7B 1ZBE3 2RG4A 3F95A 2GNMA 2EIDA 3LIHA 5BY5A 1YFYA 1LOFC 1YQ6A 2XXZA 4FXKB 1PMJX 1S0FA 3WINE 3T3YA 3VHPA 1E5RA 1Y4WA 1NA1A 4A41A 1AR93 3IMMA 5FR3A 4O61A 2VE1A 4ISRA 2XUEA 4LTAA 4K6BA 3WF0A 1JHNA 1YQ8A 3V0AB 2VUAA 3KV4A 3RZLA 1JBCA 4RHV2 1LOGA 2VMDA 4A7YA 1CX4A 4PIYA 1QMJA 2BDRA 1JYXA 2VUJA 5F3EA 3VD7A 5C8CA 2RS32 3BIWE 4WM8A 3USSA 2JDNA 5JSPA 4ZPIA 4PBOA 1XOYA 5D1IA 3PJQA 4YVWC 4AEDC 2FDHA 2F17A 1W6MB 1W9WA 2A73B 1LENA 2OUJA 1H1MA 1R092 2PAMA 3EBRA 4OYUA 5GLVA 4LHLA 3WXPA 3DXTA 4QPGB 1ZZBA 1UYXA 2FCUA 2VZPA 2J1AA 1ULOA 2BVVA 3VB9A 3AZVA 3NO8A 5CG8A 1W6NB 4EROA 2X29A 5LB6A 3VBUC 4PI0A 3E6DA 5IYYA 3D6EA 1I6XA 4JQRA 4EYUA 2G9FA 1WBLA 2PAKA 4AI0A 4C0BA 3HD8B 4JV4A 2JD9A 4UT5A 1NT0A 1G7YA 4BH9A 3POFA 1AR92 4OI2A 4QX7A 4HPKA 4N90A 3M7AA 1X82A 5H9SA 1RUNA 2ZGTA 1XE8A 3ZSMA 3M3IA 2O14A 4QB2A 1DZQA 1A78A 5F6LB 4HVQA 5I0TA 3IPVB 2IXJA 1V6LA 2WFPA 1AHSA 4YVSA 1D2SA 2OQ7A 2BJSA 2W95A 1J1LA 2JWPA 1LU2A 3DPRC 1IQAA 2PYTA 3J26N 5FYYA 2ZXQA 3CU7A 3KCCA 3IB3A 1K3IA 2H0BA 2WLQA 5FLHA 1O3RA 1MZFA 2WQ4A 1VB4A 2P3IA 3ZMOA 1ZZCA 2EXKA 1H8TB 1H6XA 2C4XA 3KQ4B 4OVEA 4PHZA 1QDOA 1X50A 1SMVA 2ZOEB 4TLGA 5LY2A 4IV1B 4AAPA 3K75B 5C5TA 1NA1B 1ONAA 1PGW2 1AR73 2L9LA 3SXWA 1XYPA 5D8AC 2YFUA 4YNIA 5JPMB 5ISLA 3R05A 2J1VA 3TB0A 1LJ7A 4B7KA 4UF0B 4EN6B 2VZQA 1CZSA 2W1UA 4N53B 1GWKA 4XFFA 4Q4Y2 1J83A 3WW1A 3WW3A 1CAUA 1OD5A 3I54A 5FZMA 4CU9A 5ABJB 3KCYA 1KRIA 4Q4W1 3WQ7A 2CGOA 1WZXA 3O0WA 2J42A 4LLOA 4ASLA 3S57A 3Q8BA 2IXCA 2B39A 3URFA 1VBD2 3JB8A 4XIKA 3TRSB 5GZEA 2YDEA 4EN0A 5JZGB 1HX6A 1WUVA 4WM8C 4ZS3A 4AQTA 4A7KA 1SCSA 2AC1A 2D40A 3V0AA 5C3PA 3TN91 5A3LA 1S1AA 3INAA 3OGSA 2D6MA 2HWE2 4QXKA 4TYSA 4Y24A 2DUQA 4YW7A 2WNUB 3E97A 2D6KA 2DTWA 3B93A 2BEOA 3M8LA 1DQ6A 5DAVA 4Y3OA 5FY4A 3WQ1A 3SITA 4G9SB 5EXOA 1KD7A 2XVGA 2QQVA 3ETQA 1GNHA 4L99A 3MPBA 2HH9A 4BQXA 4I30A 5I0DA 5LRSA 1DQ2A 1WBFA 3OOXA 2RS53 4F7ZA 3M3OA 5FIXA 4FOQA 2LM3A 4KGGA 3WQ0A 3AZWA 1MS1A 5A3WA 4LMFA 3WY6A 1ULGA 2HWC1 2ZEWA 4CP0A 2FD8A 2WT0A 1MZ5A 2ZGKA 5C5UA 1JYWA 2IXKA 4OHXA 3O5SA 1CWPA 2RS13 5KBFA 1WCSA 3AP6A 3ZYBA 4YYOA 1XB9A 1QXPA 4PQ9A 1ENRA 1PGL1 4P9GA 4XDOA 4Y5SA 1AX2A 2DU0A 1LKNA 2HJIA 3BGAA 1RMU1 1W9FA 3AP7A 4B1LA 5C6CA 4QU1A 5GM0A 1LHNA 2ZJCA 1AYN3 2JX9A 4QQ2A 2BGOA 1LHWA 3BPZA 2RS12 1OQ1A 2ZHMA 3AX4A 3MF9A 3POYA 4OCTA 3HR9A 4NIHA 4IQPA 4M4RA 5KR7A 2JIGA 4FVVA 2RR11 5D2AA 5KHHA 3ZFGC 2DFBA 5EPAA 4R8HA 2Y60A 5D8AB 1HRI2 2WC2A 2VOXA 1ZBA2 3ZSEA 4XETA 1KXGA 4C1WA 1QGLA 4XYXA 1CONA 3NQHA 3GXUA 4QKBA 3JU9A 5FZ3A 2BP6A 4JGZA 5A6QA 2K0GA 3FLRA 1VALA 2QZ3A 2UURA 2JDKA 2Y33A 4XCAA 4I01A 4CCMA 4E2QA 4FO9A 3W58A 2JG8A 2VQAA 4CDQC 1HRV2 1VJ2A 4LLFA 4AEKA 4TTGA 3KT1A 5IK5A 1Z7S2 1NZCA 1GZWB 4IGOA 3GJAA 4IXLA 3C7GA 4ZZ8A 5FYUA 1IOAA 3LQCA 3P6BA 5L9VA 1ZVFA 1YFXA 3ZKYA 4QMAA 1C4RA 5FMOL 1H9PA 2GH2A 3VHOA 3U4XA 2YV8A 4QGMA 2YGLA 5DAXA 3H42B 1AR71 4TWTA 5LA0A 3GM8A 3QCWA 4RGKA 4DINB 4K7JA 2RM23 4UFMA 2DCTA 3K4AA 1E57A 3LOIA 4QM9A 2YMZA 1Q8PA 2OS2A 3FMGA 1JOBA 1W0PA 4N53A 2EIGA 4AVCA 2QTWB 4ZU7A 4C1XA 2WNVB 3I2HA 2VVEA 1TZOA 3I8TA 1YYNA 4LHNA 4BA6A 1PMIA 3AFGA 1JOJA 2Y6JA 4Y33A 3RZKA 3WG1A 4UYBA 2FHRA 5E89A 5F5QA 5J48A 1DF0A 4DEVA 2A6XA 2VTFA 2Q8EA 2XLAA 1RL3A 1QOSA 5JR7B 2QQOA 2H6BA 1FMD3 2VECA 1N1TA 1NQDA 2JG8B 1J84A 4Q0SA 5BNNB 1W90A 5IK7A 1F8VA 3DYPA 4IEXA 3QOPA 5L7OA 1MR5A 1BQPA 2KM2A 4QX3A 4FPKA 4QKFA 3T1MA 4META 4FPOB 3HEIA 5K8SA 3FLTA 1JYTA 5JUVA 3HVDA 3VGIA 5HBAA 1FXZA 4LOSA 3HNMA 4Q5OA 3W5NA 3UNPA 3GHMA 5LA9A 4E27A 5L7OB 1QJFA 3GYDA 5IK8A 3THTA 2RMU3 5DUWA 3DGTA 1RUJ1 1IPJA 4MHRA 1RUD3 2DYCA 2Y26A 5A7QA 4AR2A 4CDWA 4KWJA 4K1YA 4LBMA 2Z42A 3LSDA 5EYXA 1FT9A 1Q56A 3OYWA 2VH9A 4CEYA 3B01A 3RFRA 4CDXC 5DAQA 3SH3A 4JGZC 2PHUA 4Q4X3 1G9FA 2RS11 4AGRA 1F4HA 5IVYA 2E7TA 2JG8C 1HJGA 1TE1B 2VOTA 5C71A 1K5MC 2PHXA 1ODNA 3T30A 3FBYA 4I0BA 4GH4C 3UYJA 1YHFA 1RMU2 4B8EA 4J25A 1UKGA 2OZJA 1W6MA 4ORFA 4Y22A 3X29B 3O1UA 3IDEA 4GWIA 1OC1A 4HZFA 2DVBA 2PHFA 2ZA9A 2ZS6B 4AI8A 5T5OA 5FZOB 1JS9A 4PDWC 5CYYA 2VPVA 3UESA 2G9GA 1GZCA 4FFFA 1UY0A 3S0MA 2X10A 4MYEA 1TMF1 3LE0A 2B45X 4BDVB 5CA6A 1I5ZA 3LDRA 4FPCA 3VBHC 1TVGA 3J7HA 5EWSA 4UW6A 4N9IA 4INDA 2WKKA 4XFAA 2YROA 3OTFA 3NAPB 4XJAA 2VNRA 3CO2A 4E4DX 2PLV1 5FMOS 2NM1A 3IN9A 5FWEA 1GANA 2ZGRA 1DIWA 3GBFA 5I0SA 3VDBA 4BHPA 1S2KA 4BQ4A 2OX0A 4L11A 1O3TA 1PZ8A 5FZIA 1MVEA 1PGW1 3A0KA 4ITCA 5JLVA 3RZHA 1K5JA 4QB6A 1VBA2 1DDLA 4AL9A 4FTEA 5EHDA 1QWRA 2B8MA 1H0BA 1DU3D 1W8WA 3H3LA 4LA3A 4NRPA 3AVRA 4KH9A 1GMMA 1WCQA 2WA4A 3S5QA 2R30A 1ND3A 3MUY1 3T09A 1GOFA 4CCCA 1OUSA 1PZ7A 1SBDA 4Z1VA 2DURA 4Q1PA 4YZ4A 5CBLA 5FY9A 2C0ZA 1REDA 3DCQA 2YBKA 2XUMA 3VBRC 4ZS2A 3NKTA 1XNTA 4GAZA 3UGGA 5SV8A 5JR2A 2W9XA 3ECQA 2D98A 4NE9A 3ZX7A 2PXJA 4N43C 5DG2A 1EAH2 1S2EA 2FMDA 2TBVA 5T54A 1HB4A 3AYAA 3W9AA 4BK5A 3CEWA 1VBE3 2O0OA 2XLFA 2WO3A 4OHWA 5CU1A 5D21A 3ZYIB 2J1UA 2NPIA 1SCRA 2GC1A 4YWAA 2WO1A 4IEOA 5FZ7A 3T2OA 2DF7A 3WOGA 2WQ8A 2X5IC 4AEJA 1H2MA 1ZZ9A 2KR2A 2YZ4A 4DRRA 1VRH2 2NMNA 5B4NA 3LZZA 5BYNA 1PO22 3DKWA 4H3WA 2CDOA 4DOUA 1UO9A 4GWNA 4YM3A 1AYN2 2WABA 5FYIA 1RIRA 3PTRB 5C8CC 3JZVA 3MBWA 2PHDA 3O12A 5E1RA 2WO7A 3ZFEC 2R0HA 1CZTA 1CAWA 4AEDA 1URXA 3NNJA 4LKSA 1OMIA 2PQQA 3ZR6A 5BNPB 1UMIA 5IFPA 1T6BX 3OY8B 4QX0A 1RVF3 2DVAA 4ZHNA 2P3JA 4HBNA 4H14A 2VZ1A 4FPLA 4DB5A 3EYPA 1DGRA 1SG3A 2JD4A 1WGPA 2R063 2CNAA 5FPBA 3T0DA 3D8CA 1C28A 4CCNA 3KT7A 5A7SA 2XKPA 4UOJA 5C3OA 2MEV3 1V9U1 4CCJA 2GN7A 2WS93 5C4WB 1VRH1 3OG2A 4RS5B 3T2PA 4LUKA 2XDVA 4Q2FA 4TN7A 1SDDB 5C33A 4RQPA 3IAQA 5L73A 3SCGA 1ZRFA 5FOJB 1JYIA 3AL5A 2ADDA 5DMYA 2GDFA 1PVC1 2ZAAA 4P02B 3WEZA 4DXSA 1K45A 4MH0E 2DWRA 5LASA 2VCAA 3UK9A 1J3RA 3IBMA 4N7IA 4QB1A 1VBC1 4MGYE 2DV9A 3WX5A 4BM8A 2ZCWA 1YXWA 4GMP1 2EXJA 2VVDA 2BNNA 4YVSC 2X05A 3T4HB 4AFMA 2PHLA 1S0EA 1YFUA 4C91A 3NRUA 2VU9A 1YQ5A 5CZKA 1BCXA 4IEWA 3HT1A 1RVF2 4QT6A 5FKBA 4E9KA 3BVCA 3FE5A 5KHGA 4HSJA 3LFMA 2XL7A 4LBQA 2Q8CA 3EJKA 4XFIA 4WVMA 4CPBD 2ORXA 5A32B 2R061 4QD2A 4Q4V1 1AXKA 3PUHA 4FFGA 5DDJ2 3VZMA 5BNNA 1DGLA 1LU1A 3A21A 3TOJA 2DVFA 2IXIA 1C8NA 1XU1A 3N3HA 3ZXKA 1WLWA 3N9MA 4HVOA 1GBGA 1HLCA 2BNOA 2D93A 4FPGA 4XFBA 1VRH3 3PTYA 4MG2A 5IVVA 5FK8A 3ORJA 4CXXA 3I3BA 2MPFA 4YLZA 5DUUA 1VBB2 3LA2A 1RJ8A 2WZR3 5J98B 5LWBA 3ZN6B 4Y1ZA 1OPMA 2W68A 2YC4A 4GB33 4A42A 3CBNA 1ASJ1 5BNOA 2XB6C 3WNOA 3ZFEA 3ACLA 1IQDC 3P1IA 2VCCA 3D0SA 3UKVA 1K5MB 1W8TA 4LBKA 1LODA 4WV8A 1IGOA 1EAH3 1UOBA 3TN92 4WM7C 4YGBA 3ZSLA 2R0FA 4L0PA 5AFBA 4A4AA 2JDUA 2EAAA 4FQZA 2CU5A 1NE6A 2ZKNA 3OUHA 4XE9A 4QKNA 4XILA 3NV2A 5CAZA 1WWYA 1TG7A 3PUAA 3VDCA 3AL6A 3C7EA 3J7NA 3JD71 4D3WA 1ZREA 4GB32 5A3PA 4Q8KA 1W9YA 5LK5A 1OVSA 1RUH3 2BTVC 3VN4A 2VUDA 1L3JA 3AP9A 1JOPA 1ZZ7A 1OUXA 4XUTA 3E6CC 3HAGA 1GNZA 1UAIA 3KGLA 1QXRA 2ZX3A 4MGKE 4QPYA 1CN1A 1RUG2 4B4QA 5ACA2 1PVC2 4FTSA 3POBA 3MUZ1 5FDBA 2YBPA 4J6GA 3AK0A 4YZ5A 1W6OB 3FX3A 2D5FA 4LIVA 4EJRA 1N3OA 1W0OA 4XPVA 3FWEA 4AWDA 2ET7A 1MZEA 3WNKA 5A1AA 2XONA 1DYPA 2W52A 1W8NA 1KJRA 1AYM2 3U78A 4WBBA 3UGFA 1GQHA 2ZEZA 4CU8A 5I8SA 1LECA 5FP7A 5K9YA 1W8ZA 1XBFA 1XU2A 3E6BA 1BMV2 5K0UC 4HL0A 3VZJA 3NL1A 4XMAA 3PVEA 4E2SA 3PJYA 2XVKA 1H8TC 2ET1A 3ACGA 4QQOA 2RDNA 3AMHA 2VMCA 4QQHA 4XFHA 4AVVA 3AYCA 3AXDA 3WQBA 3WNNA 1GP5A 1LOCA 3KVBA 2VBPA 3Q8CA 3PIJA 1ZA7A 1YEWA 3ITQA 5JOZA 1AYM3 4M3CE 4PDWB 4LJHA 1SACA 4OHZA 1NLSA 3SCFA 5JXHA 4OQ9A 4QDSA 1GQPA 1VP6A 1S0CA 4L9BA 5JXGA 3I59B 3EO6A 5AC92 1PVC3 2CGPA 4R52A 3R4UA 3FFZA 1H4GA 5FPZA 1CAXA 2QZ2A 3U0ZA 1V6IA 5BXXA 1MS3A 2W87A 1C57A 2Y38A 3DYOA 1ULCA 5F3CA 1HN0A 3D5OA 4M00A 1CJPA 3MLLA 4QX8A 4XIOA 1AR91 5LBCA 1BKZA 3ZXGA 3I3DA 5JAXA 2BGCA 4EE2A 3TEWA 3A0NA 1ZRDA 4BWOA 5FP8A 1D0GA 1OPOA 3ILNA 4J1WA 4QHBA 5ERLA 4Y5TA 2VZVA 4KU7A 1XE0A 4DY5A 5CISA 1JW6A 2DUPA 4FXGB 4KQ7A 5J96B 3K4DA 1UIKA 1V6KA 1RITA 3DKQA 4JQTA 3FLPA 2QUOA 3ZXJA 1HRV1 2XL9A 5JMCA 2VQTA 5BNOB 1ND2A 3UL2A 3RPQA 2XBO3 2JDMA 5I0UA 3OSDA 5FZ8A 3NNGA 1WW7A 1OOPC 3RDIA 5JWPA 3JXSA 2EXIA 4W4ZA 4YM0A 4MGTA 1UOFA 5IT6A 1GUIA 2OT7A 4LE4A 2VZRA 3KT4A 4U2AA 1BBT3 4BQ3A 1UX6A 2D44A 4W50A 5CVRA 2WZR1 4XZUG 3WF1A 2ZAHA 2WQZC 4NN0A 1JI6A 3U07A 2RS52 3PVOA 3FUOA 4PQQA 1POV3 3USUB 3WVJA 2O1QA 1AL21 4XF4A 1P8JA 2BVBA 3IM0A 4NRQA 4YFWA 3A4UA 1UY3A 1QY4A 3HMYA 1UZ0A 3OBAA 3C7HA 2CYFA 2WL1A 5GKAC 1PGL2 1DCSA 4YW3A 1KJLA 5J1XA 1UMHA 2D6LX 4CUCA 5JDBA 4BJ0A 4R9BA 5JOWA 2Z2SB 2DDUA 3R0RA 4CDUA 3VBFA 1JZ4A 2OUHA 4DXTA 1DQ1A 1YUDA 3MW2A 5F5IA 5E16A 4JRAA 3THPA 2ES3A 5FJHA 4QU2A 4K1ZA 4JDNA 1O4TA 1Z7S3 1FOD1 2HWB1 3LEIA 4KL1A 4CDWC 2CAVA 1OA2A 2W0XA 3NV1A 4RR3C 1VB2A 2J7MA 1OFNA 2R043 1SEFA 2Z69A 2ZACA 3L2HA 4IERA 2GNTA 4CUGA 2G1MA 3SHRA 4CDXA 2HWB2 2R1DA 4KWLA 1UZZA 4C0HA 1OXCA 2JDPA 4RQPB 1FATA 4HKOA 3ZLIA 1OH3A 4IV3B 3WLUA 4UFIA 4JKKA 1VE0A 3AMQA 3B02A 5FV3A 3M3QA 1K5MA 1PX3A 1HRI3 1BEV1 4PIZA 5FMCA 1WCUA 1BBT1 1DLCA 2DCKA 2VC9A 2VL4A 2XJUA 2VZOA 3PNAA 5JXJA 1IS5A 3GBWA 3APBA 3GCXA 1UX7A 3RZJA 1UU5A 2C24A 1AVBA 2J1RA 3R4SA 3VHRA 2GH8A 5AVPA 5FP9A 1HIXA 3VV1A 2D43A 2LUWA 1FV2A 4AYUA 3C7FA 1RTVA 2JDHA 3IDBB 4ASMB 2X09A 2LTNA 5FQ0A 3GBGA 3ZMNA 3ENRA 3CMGA 5CEHA 3QH6A 1W0NA 1YI9A 2YU2A 3IT8A 3ALQA 1ND2C 1NY71 4NROA 1WCDJ 1J58A 1VPHA 2XWJB 4AE2A 1W2NA 3J7LA 1QNWA 4LO7A 4COWA 3WUCA 3T0BA 4X8PA 2CTVA 1CIWA 2BOJA 5AFEA 4UFJA 5EV7A 4OFGA 3KV5A 1LNSA 1O3QA 2PHRA 1FOD3 4CEYC 2VW1A 1RUC3 3G7DA 4LULA 4AFDA 1MEC1 5FZBA 3VBOA 3QBQA 1O59A 1SBEA 1WA6X 1RHI3 5DUVA 2VJXA 3DPRB 1RUD2 3WDWA 1SLLA 5H9PA 1EPWA 4LBLA 1HQNA 4J1XA 2HKXA 3PDQA 1H9WA 1ZRRA 1MZ6A 5APAA 5J36A 2I74A 1AXZA 2ZTNA 1IPSA 2GU9A 4B1MA 2GSYA 4FOYA 3NW4A 3JQXA 4YZ2A 3T2QA 4MVTA 4P14A 2QJVA 3POGA 1NCQB 1RUJ3 2XJPA 3A23A 5C70A 2B4KA 3LFIA 4OHVA 2C26A 2W3JA 4I09A 4PDWA 3UKTA 1W2TA 3KQRA 3AYDA 2E7AA 3CJXA 3OJBA 5JMOA 1SZBA 2FZ1A 1STMA 2IFRA 3MEPA 4QGNA 2Y0IA 2JKXA 5FZOA 4JKMA 4QDRA 1S55A 1PHMA 3DV8A 1IKQA 2DVDA 4V2WA 2YPJA 4K20A 1AR62 4EWEA 2DBIA 1EV12 1FAYA 1HXS3 1W05A 3W59A 2LROA 2JB4A 3BKZA 2R072 5JZGC 4XEZA 3MPPG 1YLLA 1JHJA 3DYMA 1VR3A 3AB0A 2XVLA 5FYVA 5A3NA 2ZGLA 3N9OA 4BU2A 1WMXA 4LUMA 2GNDA 3OGRA 3O1TA 2RM22 2J1SA 4QGLA 1W03A 1PM7A 2C9KA 4CZSA 1OA3A 3ATGA 4EZ4A 3N9PA 2AGSA 3ME2A 1UYPA 4XJ8A 4AHXA 4Y20B 3QD6A 1PNGA 1YJKA 1SLTA 2W1WA 1WD4A 3DF0A 3NWKA 3M70A 3OF1A 3AMNA 2VMGA 4HXCA 5IK4A 3OEAA 2PFWA 1SFPA 1YI7A 4IV1C 4PF5A 5G04L 1APNA 4GD4A 1LEMA 1OURA 1ALYA 3E5QA 3Q8AA 4QPWA 3TEZA 4DMIA 3ZXEA 5FXVA 4QX2A 3UKNA 4CCKA 5JSOA 5IVFA 1U5ZA 1OKOA 2QQMA 4LIUA 4RQPC 5FKCA 1DQ0A 5FYCA 2MHFA 1W6OA 5LBFA 1ENSA 2P5BA 2V73A 2RM21 1R1A2 5JI7A 4COZA 3NNLA 3D3AA 1G9CA 4XTMA 1QQP3 4X8NA 3S7IA 1LOBA 1UU4A 1GICA 3PU8A 3SH4A 5IATA 1GLHA 4DIQA 3O1PA 1YO8A 4XMIA 1V9U2 5DZGA 4O9EA 1TEIA 4MX3A 1FI2A 2RV9A 2WT2A 1HB1A 4FAGA 4WVWA 3ON7A 1KQRA 4A3ZA 2HEYF 3AZYA 1HB3A 4LHKA 4MZUA 1QDCA 2G19A 4NHKA 4WVVA 1N1YA 3OPWA 4HFSA 4OI1A 3U14A 5A32A 1FMD1 4GMP0 2HWF1 1I5PA 4F83A 1RGSA 5DXDA 3GJBA 4XUPA 2H0VA 4IE7A 3WR0A 3SH5A 4ZZ5A 5A3TA 2LW8A 2J1EA 2GP5A 1J1TA 2AH2A 5DAPA 1WD3A 2XKOA 1S4CA 1VBD1 1WKYA 1NAEA 3JBG2 3NV4A 4K9SA 2B9UA 2XBO2 4XBLA 3ZPOA 5I8TA 1XXNA 5FWJA 2VCMA 1X9TA 1RUD1 1WA4A 2JG9A 2WSUA 2XJSA 3V0BB 1UN1A 3BCWA 1N3PA 4H2AA 5FZLA 4LITA 3KCXA 4XXAA 5BNOC 1TQ5A 1Q3EA 1OD3A 1ZBE2 1QQP1 1TME1 2JICA 5FQ0B 2FDGA 2YYOA 3ZYRA 5AC91 2P2KA 1VMFA 1E5HA 3K48A 3P3NA 3ABZA 4JGYB 5F2SA 4LBQD 3FZ3A 3MIFA 5FYZA 1MS5A 2D6NA 4IV1A 4DXZA 1OT5A 2Q4SA 1YIFA 1COV1 1IG0A 3MLKA 2JEMA 3OBZA 3EQEA 4P9WA 3T1LA 5CKMA 1QJX3 1SLAA 1DGWX 4OMDA 2VW0A 2RS31 4CU6A 2D5HA 3O1VA 1NOVA 2HWD2 3S7EA 3SKJE 3I2OA 1SLBA 1COV2 2QVSB 1AXYA 1PIV3 5BNNC 1H2LA 1CIYA 4Z2WA 4DO0A 4NRMA 5FFOC 2E51A 4OQ8A 3H8OA 1CAWB 1A8DA 2A6WA 3TAYA 4FQ4A 4H7MA 5FOBB 2EA7A 2GZWA 2CHHA 4JTNA 2GC3A 3UETA 1CJDA 1EY2A 4N7UA 3RWNA 3ZOIA 3AP4A 5FXXA 3BYWA 2ZGPA 4QX5A 5BNQA 4LNVA 1DZTA 3JD72 4NAOA 3RG0A 4E4HA 4MV2A 4AW7A 3CHXA 2HWD3 1AR72 3ZN4A 4IGQA 2OPKA 4K40A 3VBFB 2RDQA 2BWCA 1BYHA 2HWC3 2ZGMA 1CVNA 2E63A 1RUG1 4LA2A 4Y4RA 1CAVB 4NIDA 4Q1RA 4KWKA 4WM7A 3O1SA 3LA7A 1RYYA 3ZXAC 1W2OA 1O91A 1XPWA 2W1SA 2Y64A 2ZHNA 4HK9A 3RI8A 4QQLA 5F2WA 2XWBB 1QJU3 4XF1A 2WLPA 2XPJA 1HW5A 4IUGA 1RUF1 2Q1MA 4XW3A 1J3PA 1JH5A 1XNDA 2Y6HA 1UPIA 2YG0A 4W6YA 3PIGA 1O3SA 1YWKA 4YW1A 4OUMA 1H8VA 1UL9A 3AVSA 4LORA 2XJRA 2AR6A 2J1TA 3WDYA 3ZDSA 4CYDA 5IVCA 1CAXB 3BIEA 3O14A 4Z07A 1U0AA 2VNVA 2G4IA 4XJ9A 2A3XA 3B7MA 3PLQA 3V64A 3H7YA 3QH7A 2JG9C 2NMOA 2PHTA 4CUAA 1XYOA 2BPA2 1JYNA 1CAUB 5LBBA 4MXVA 1ZYBA 4X6RB 4BMEA 2XJTA 2RHPA 4ARYA 3O0XA 1ULEA 4TSVA 5IJRA 4AQ2A 1GR3A 2I07B 1UYZA 1W8FA 3NJXA 5EJ3A 3BUCA 4BK4A 2JE9A 3BOWA 1JUIA 1QJZA 3USUA 1F35A 3WP6A 4BXFA 3RGBA 1W9SA 1F15A 2WZR2 1H8TA 1VBB3 2HWF3 1PNFA 5DQ0A 5DAWA 4COVA 4ASKA 5I93A 1W04A 3ZSKA 1S0BA 3H1YA 1DBNA 1DGWA 2FBEA 2QFEA 2DVGA 2VMEA 4P00B 4CCOA 1RVF1 5FP3A 2D7FA 3OUJA 4P5YA 1VBD3 4GWMA 2EVXA 1QJU1 3WNPA 4XDQA 2E53A 2NN8A 3K4ZA 1F5FA 3B5LB 3H7JA 1OLMA 4XF0A 2K2SA 4R4XA 4MSVA 5A3OA 4RD7A 1C8M3 4DY3A 2WO2A 2WS91 1ODMA 4EN7B 1QHDA 5GZCA 5KC6A 5FYBA 3KB5A 2R1BA 4CP9B 4E2GA 4FPFA 4JHTA 4I3GA 3OYWB 1NCRC 3KF3A 4O9GA 1QJX2 5T3NA 4I0WB 4PLOA 1UCXA 5LEKA 4AG4A 3CF6E 2K9ZA 3J9SA 2MNGA 3POSA 2F4LA 3D82A 3TNPB 3ZYGA 4CDUC 2CWSA 1M06G 4P9YA 3RZZA 1WMDA 4Y20A 2FCTA 4DEQA 3FFQA 3M2MA 4GMP3 4IEPA 4LOTA 1Y9QA 4XJWA 5I91A 3HBKA 4O7XA 2ZZJA 4Y22B 3CL1A 5FRAA 1POV0 2Q0AA 2D3PA 4RR3A 1RUI3 2JG9B 4JVAA 4MXWB 3WP5A 2Y6GA 3ZXLA 3WDXA 1W6PB 2WAAA 3DXUA 1O5LA 1UY4A 2GMEA 1L7QA 3ZIWA 3KF5A 1NZIA 4GQ7A 5FBZA 5LW9A 5HV0A 1PO21 1EV13 1LHOA 4PJYA 5IAVA 4CDUB 4RS5C 3ZPYA 4Q0PA 2NZ9A 5IWFA 4BYYA 4QPIB 3VBOB 1JZ3A 1IPKA 4HONA 4YGDA 2DTYA 1LOEA 1G86A 2WWUA 4OI4A 1RUE2 2IVIB 1C3HA 2W91A 5ANQA 2JJ6A 1RMU3 1QU0A 2A3YA 1SDWA 3P3PA 5A7WA 1GOGA 1SHWB 4LT5A 4IGPA 3ZFFA 3HQRA 2BU9A 3OPTA 4Y1UA 4GB31 4NHMA 5EJZB 3VBFC 2VMHA 4Y4YA 1UQXA 2EICA 4DPNA 1AR82 2WINB 1R091 3V0BA 3MF6A 1BEV2 5C8CB 4EV0A 4FPEA 4S2GA 5EJ1B 4UF0A 1XYNA 3R6SA 4P9XA 3BB6A 3HQXA 5E6HA 4AGGA 4JDMA 2A1XA 5KXBA 4AI2A 2QCSB 3IWZA 3I2FA 5C4WC 3I2JA 1ZBE1 2CSGA 1A6CA 3HN1A 2ZPXA 1RUI1 3BTYA 4DFSA 1NCRB 5K7PA 3QLQA 4RGGA 2WNEA 4XAEA 3KMHA 5CKQA 5GLWA 4ET7A 3NVCA 4XBNA 1CQ9A 2C5DA 3TN93 1JU4A 1JTZX 4LR4A 2BUKA 4LO6B 1F9KA 2V72A 5E8AA 4CDXB 1N1SA 3VBUB 3VKMA 5BNPC 4NUBA 1JYVA 2YFZA 1HQLA 4AVTA 1O6UA 3HJRA 1AL0G 4D6RA 3RNSA 2WN2A 5F7UA 5A70A 5LY1A 2WZPP 3N7LA 5I0RA 2W39A 3OB8A 3RVHA 2YXSA 4AEDB 2WYFA 4JHZA 2X5IB 5BV6A 2QQUA 3LD8A 5DDJ3 5GZGA 4IE6A 4L92A 1HRI1 5A7NA 4P9IA 2ZGOA 4RYDA 1AJKA 5A6YA 1YNAA 1IS4A 1BVP1 3NKGA 4I0AA 5EP9A 5A33A 2R071 4CU7A 5CG9A 3AKTA 5FYSA 3MIDA 1RC6A 2OIIA 1SPPB 3AJZA 4FP3A 1COV3 4KBBA 2ARAA 1ASJ2 4AFAA 4I02A 3VKFC 2PHWA 2PELA 4UW3A 3AKSA 2ZZQA 4IEQA 4S2DA 3POJA 5DABA 1JUHA 5FBJA 4NIAA 3RSJA 5L7OC 1MS4A 4BLJA 2FDIA 3WG4A 4A6SA 5FZCA 4YW5A 3FL7A 1SFYA 3WD5A 1NG0A 4GH4B 1MEC3 3OGJA 3VLBB 3CJIA 4GIQA 3TWIA 1ST8A 2IFWA 2ZHKA 3U11A 1DFQA 2MEV2 5C4WA 4BIOA 4YARA 2V4VA 1NXMA 4YM1A 3WNXA 5FY7A 2BYVE 1EV11 4PBPA 1X8EA 3N35A 3N9LA 1S2BA 5FP4A 4DUVA 2W47A 3WV6A 5LBEA 1K42A 3D4KA 5HCHA 5KHIA 4Q4W3 4Q29A 1U5XA 2WSVA 4HN0A 2ZX4A 3MW4A 3RZMA 2N7GA 2RDRA 2WJSA 3PURA 5GLUA 5T52A 2NLRA 3ZYFA 4OUSA 5BNPA 3I2DA 4XHXA 4YW4A 2OYZA 5FCCA 1XJAA 4B4PA 2R49A 3EHKA 4YSFA 3T4VA 2FQPA 3M4FA 5FYMA 2JE7A 1G6NA 3KWVA 5F3IA 1AL23 1OSGA 1QJY1 1S0DA 2VZTA 2E7QA 3W21A 1SBFA 3VHNA 2WFF1 4BZ4A 2F4PA 1TMF3 1ZBA1 1QJEA 2Y6FA 3OBRA 4XQDA 3VBHA 1LRHA 4M0HA
chains in the Genus database with same CATH topology
2B46X 2O8OA 2I2SA 1VIWB 3ZVXA 4XXPA 3VBUA 3WCSA 4Q4Y1 4K21A 4S2HA 1N1VA 3R4DB 5T5JA 1WCKA 2PLV3 3ZYJB 2ENRA 2DU1A 3AZZA 4W6XA 3S6PA 1AUYA 1SFNA 1S0JA 3OGGA 1LOAA 4W6WA 5HI0A 4Z8BA 3H8UA 1Z7S1 2HWB3 1LEDA 2JECA 3IMNA 3ELNA 2OA2A 4B4RA 1NCQA 1A8MA 1SLIA 3N36A 1PIV2 2R042 2CWMA 1S0GA 3HWJA 3VKNA 5JCTA 1UZYA 3ROUA 1H2KA 5T50A 5KHKA 2YGMA 3DPRA 4RA0A 3DUIA 2X8KA 3SLIA 1NY72 2GC2A 1XNCA 1VBA3 3VZLA 4ES9A 4WVZA 2ZMLA 4FPYA 4Q8LA 3CJIC 1GKBA 3WCRA 4AHZA 4HK8A 2RR13 1ZBA3 4YZ3A 1C5HA 4FPJA 1WLCA 2ZX1A 3B94A 2X5IA 1ZNPA 3B3QE 2R073 3E5XA 4GKXA 3I4IA 5EFUA 4IEUA 4CEYB 1MS9A 1Y7BA 3AKRA 2R062 1V6NA 5C8WA 1R083 3KS7A 1D2QA 1Q5OA 3SCHA 4R9AA 4D69A 1OQDA 4ATFA 2HEWF 4AVBA 3BALA 1WMEA 1W2UA 4MGZE 3KD4A 5FO8B 5KHJA 3RJ2X 1H1AA 4OHYA 1DYKA 2BQPA 2PA7A 3LKJA 1REEA 1RUJ2 4Q4W2 1F5JA 1XNBA 1CPMA 2XH6A 1PO23 2XGXA 1VBC2 2P34A 2A75A 1LGNA 2R32A 2RS51 2B42B 3ZYPA 1PVXA 1UW8A 1MQTA 2MEV1 3J8F1 4AQSA 2QNKA 1RHI2 3ZDSA 1UIJA 3CLPA 4W65A 1BZWA 3CJIB 1ZRCA 1VBE2 4GULA 3H1MA 1FNYA 3EXUA 3M3EA 1RUC2 4A7ZA 4Q27A 3JCIA 4XBQA 5AC93 4BCUA 3H3UA 1GZ9A 3CNAA 2A3WA 4NPRA 1R093 5T5LA 1V6JA 1RB8G 1JN2P 4MGIE 2A7AA 4FCAA 1S0IA 2RS33 3PVBB 2B5HA 3RYPA 1REFA 4PLMA 5HCBA 1G9AA 3AKPA 1CGPA 2B7YA 2YY1A 4QPGC 5L19A 4A2UA 1AX1A 2OVUA 4KNCA 4FPHA 2AZ5A 3WP4A 3IIAA 1C5IA 1RJ7A 2UWAA 2RJKA 3H3ZA 2HWD1 2UY8A 5IUQA 2CY6A 1SQ4A 1UD1A 1U5YA 4PIXA 1RUG3 3K51A 3AKQA 1JYCA 2WS92 3VKLA 2XBO1 4CDQA 2R16A 2F6BA 1M4WA 2P37A 2ZGSA 5JPNB 3FJSA 3WW4A 5KXEA 5ACA1 1RUF3 4NWWA 1EAH1 3RMXA 3VZKA 4R9CA 3MLJA 2GMMA 1PK6B 1XNKA 2ARBA 4P9JA 4D7SA 4IV3C 3VZNA 4E4SA 2ZGNA 2E9QA 5EYYA 4NHLA 3FC0A 2CAUA 3AMMA 4LEJA 3OCPA 4JDOA 1I9RA 2NYYA 2EXHA 5ABJC 1QKQA 1J3QA 4OLLA 4U36A 3WZ1A 4F8AA 2OW4A 3N7KA 1MS0A 1OOPB 4ZXKA 2XJQA 2ETEA 1PGSA 4RL7A 4CP1A 4G4FA 4Q0QA 4LE3A 3ILFA 1VBC3 5CFDC 1AR81 1FOD2 2AUYA 2PAEA 3H0OA 4YG0A 3E5UA 1XQNA 4QQPA 4PCRA 4EWDA 5LRRA 3ZN5A 2DCYA 2O8QA 4XOGA 2VQ0A 5J09A 1VBB1 2DUOA 4IETA 4JAAA 3GNEA 1D4M2 5SV5A 4AF9A 1NCRA 2Q5TA 3WT3A 4IL7A 5K0UA 2XG3A 4CP2A 1HKDA 3N4MA 3ZFFC 1D4M1 1FV3A 1RUF2 1X33A 3ZN6A 2JKBA 4YVWB 4Q4V3 3WW2A 2WNVA 2UWBA 1LHUA 2A6ZA 4AHWA 5E88A 3HBZA 3LOBA 5J7MA 3G6JB 5HCFA 4M3CB 3VKOA 1V00A 3ASIA 4XFGA 3ZXDA 4TZDA 1XE7A 4NVPA 1AYN1 5DZEA 1IHMA 1LR5A 2FMYA 4RS5A 3T2TA 3MW3A 2BNMA 2Z79A 4JCKA 1AZDA 4YGCA 5C9AA 2ERFA 4JRLA 2LALA 4HT1T 4XQWA 1W6NA 3QACA 4NO4A 4COYA 3OPZA 1DQ4A 2GMPA 2IWGB 5J37A 3JD73 3M1HA 3MIEA 4IV3A 4CRQA 4HLTA 3NV3A 1KDKA 1W6QA 3LSEA 4LBOA 3DL3A 3HIFA 4V1PA 2OZ6A 2UU8A 1KDMA 1D4M3 4M3CF 2YHJA 3ZFFB 3MI8A 2ILMA 3TNQA 4HPKB 2P17A 1X8MA 3JBG1 4DQAA 5GLTA 3WP3A 1R1ZA 3AMPA 4LBQB 2Q1ZB 1PO13 1X36A 1EYBA 3UJOA 1LB2A 2CGNA 5CFDA 1H4HA 1UU6A 3AYEA 1GZWA 1RUH2 3FHIB 4B29A 3WDTA 5K0UB 4OULA 3V56A 5J3UA 1ZZ8A 4BQ1A 1ND3C 3N7MA 1QF3A 1FYUA 2D6PA 1Q8VA 3WDVA 4MXWA 4QPIC 2ZHLA 1B09A 3NJZA 1ENQA 4EN8B 3J8F2 4XJZA 5TSWA 2C1FA 2UWCA 3AM2A 1DQ5A 1BJQA 4HETA 2X53S 4AHYA 4N43A 4ONUA 3VBSB 4Y5Z0 1QH7A 1R1A1 1PK6C 3AXEA 1LGCA 3IKWA 4GXLA 3HT2A 2VW2A 1LTEA 1MS8A 2YUEA 3MYXA 5L36A 2RE9A 3AZXA 4AXOA 5I8TA 1OI6A 4Q26A 4AFBA 4EWAA 2CV6A 1PO12 1QH6A 5CFDB 1AR83 2EALA 1F2NA 4LO5B 2QKDA 2WNUA 4P9LA 3NAPA 5C9AC 2YC0A 3MIGA 4QM8A 4GALA 2D3SA 2V09A 3LGRA 4AEMA 1C1FA 2BWAA 2SLIA 3RYRA 4GA9A 4R4ZA 1B35C 2HYKA 2Q8OA 5HCAA 4NR1A 2WT1A 3ZIXA 3AJYA 1FPN1 3NSTA 1RUI2 3RI9A 2Q30A 2CL2A 1F31A 3ZSJA 4IEYA 4M0NA 5F9TA 3JQWA 4Q4X2 4I3PA 3V65A 4WZFA 5CNAA 2PLV2 1NCQC 1RUE1 2JXAA 4K3UA 4HKWA 4F3JA 4N43B 3VBSA 1TMF2 2RMU2 5FREA 4ZU5A 2C9AA 4Q4V2 1V70A 3SMHA 3I59A 1AL22 2V5YA 4HANA 1QOTA 3VUOA 2R041 3RJRA 1AX0A 4FT8A 3O0VA 4YGEA 4BMBA 2WFF2 2VOKA 1PK6A 4EN9B 5FLIA 2E6VA 5JVVA 3JBG3 1CAVA 1R082 5GZFA 5CFCC 5JI9A 1PO11 5C9AB 4DS0A 3DN7A 3VL9A 1Q8SA 2UY9A 1WLDA 3I7DA 4FBFA 5JZGA 4YG6A 2A70A 2DFCA 1BEV3 1DLLA 4UBGA 3NAPC 4AGVA 2IXLA 3SNMA 3B69A 4SBVA 1DG6A 1QJY3 1PIV1 2NQYA 3VBRB 2VMIA 3ZFEB 4WZCA 3GZUC 5KC5A 4HVRA 1VBE1 1RUE3 5JIUA 4L2NA 3ILRA 4SLIA 1AJOA 1AF9A 3AFKA 2AENA 4X6QB 4Z82A 1D0HA 4BE3A 3VDDA 3J4UH 1SLCA 5DUXA 4OI0A 4XHBA 2HWE3 1DZRA 1ULFA 2WIIB 1QQP2 4BLIA 1IS3A 2UYAA 4NWVA 1VLNA 1R1A3 3KGZA 5FTTC 2ZGUA 2VOWA 1OKQA 4DNYA 1RUH1 4YM2A 4D94A 3H1WA 4CDWB 3VDDB 1FNZA 1V6OA 2SBAA 1MQTC 1DGRN 1HRV3 4TLFA 4XFCA 4Q0VA 1RUOA 1RHI1 2BBVA 4JGZB 4ZU4A 5DG1A 4JC1A 2P3KA 3TBDA 3ES4A 1YFWA 4M3CA 5H9QA 2W08A 4HN1A 4ZKTB 1W6QB 4XQ4A 5JOXA 3MIBA 1GYKA 3H9AA 2EAKA 2VNOA 4ISQA 1FPN2 3KLSA 1KFXL 1GQGA 1NQJA 4I2OA 3RMYA 4YVWA 1J59A 3MICA 3L2YA 4FTBA 2I45A 5GZDA 1O5UA 1OA4A 4LO4B 1GSLA 2R6QA 3MGUA 1YJLA 3BU7A 1IS6A 1VAMA 1X7NA 1C8M2 3POWA 4CEWC 1QNYA 4RHV1 3WG3A 4QPGA 3LCPA 1KS4A 4D7YA 1HXS1 3GALA 1Q8QA 5F6KA 1AR63 4N9HA 4S2FA 3VBHB 1JXNA 4FP2A 5FO9B 4Q0UA 1T6GC 3KSCA 4RFT0 4B3NA 4AVSA 5GJ6A 5CB7A 2A6VA 4AK3A 4YRDA 1OLRA 4B7EA 2Z5WA 2GALA 3PVNA 1ZA4A 2BFUS 1QJY2 1Q43A 1WMFA 4IEZA 3UV9A 1C8M1 3VDDC 4FSJA 4D7TA 1NYWA 5T55A 1Y3TA 2BFUL 2XLGA 4M01A 2QE3A 3OD0A 5AVAA 2A6YA 1WLTA 3ST7A 4RSUA 1VAVA 5D8AA 1ASJ3 3B9CA 5CADA 1YIPA 5GALA 1OOPA 4RHV3 2IXHA 4FOWA 1IZ3A 4HKLA 3TYJA 2ZX0A 2WFF3 4L8QA 2A5ZA 1V6MA 3PHMA 3B9IA 1AR61 3U10A 2Y0OA 3RS6A 4Q4Y3 4AVAA 4BIFA 3RYKA 3MFCA 1H30A 5KXCA 3WHTA 5FPXA 2WA3A 2ZMKA 4L97A 5B2GB 2QDNA 2JDZA 1NLRA 2A71A 2D6OX 5BUVA 4A3XA 4PLNA 5CFCB 1ENXA 2ZBJA 4H55A 4RGAA 4CDQB 3MFAA 3IDCB 5JIAA 5LEJA 1H1IA 3LB9A 2WNVC 4CEWA 2D3RA 4JGYC 1WW6A 3ZFGA 5KXDA 4XJUA 2ARXA 5ABJA 2KXLA 4UBHA 4Y26A 1LHVA 2BW8A 3WDUA 2VGDA 3ZFGB 4HSLA 4CEWB 3WHUA 1TME3 1U12A 4WM7B 1LESA 1YRZA 2GAUA 3H50A 5FO7B 4KG8A 3WG2A 1D4VB 1LCLA 4IESA 3VZOA 1G9BA 2VVFA 4LBJA 1EPZA 3RQ0A 4BOWA 2HWF2 3L9JT 3IPVA 2XHKA 1R081 3FUQA 5FAXA 1RINA 4YW2A 1XRUA 1ULDA 3WUDA 2IZWA 1HXS2 3OD4A 1UMZA 2D97A 1FMD2 3LA3A 2QQPA 3Q9OA 1MACA 3ZXFA 1Z78A 4HMZA 1O7FA 2ZX2A 4R9DA 4LO8A 1MQTB 2VULA 1ND2B 3C2UA 4G3YC 4UW4A 4ATEA 4UXAA 1EP0A 2KA3A 2RMU1 3BODA 1G8WA 3VBOC 1BK1A 3GZTB 2TNFA 5JSRA 1OFSA 3BTAA 3J8F3 4MUVA 4YVSB 1Q8OA 2RR12 5A33B 3C3VA 2UYBA 1CESA 1CR7A 5DDJ1 1HV0A 1QJU2 2DCZA 4Q4X1 1A3KA 1BXHA 1UF2C 3RRDA 4IEVA 5BPXA 4XTPA 4QPIA 1Y43B 4WM8B 1V9U3 4Y1VA 1B35B 4E4ZA 2DCJA 1BVVA 2HWC2 3PMEA 2PN5A 1HDKA 1FX5A 3LAGA 3ES1A 4JGYA 5T5PA 1W6PA 5A3MA 1POV1 4RR3B 5FLJA 5DZFA 5I8YA 2IC1A 2ZKLA 4XZPA 1LULA 4N53C 4NOTA 2TUNA 4P5HA 2PTMA 1GV9A 4FAHA 4AFCA 4WVMB 2VXRA 1N47A 3SISA 2HWE1 2WNUC 3LWCA 1NE4A 1H2NA 3VL8A 1NXD1 3KZ4C 1WW4A 1GFF2 1UKRA 4ES8A 2VY0A 1PZ9A 5H9RA 3AP5A 4COUA 4H7LA 4K8FA 3MIHA 2RJLA 4MLOA 1B35A 2ATFA 2AYHA 4YFZA 5KWRA 1KFUL 1TNFA 2AREA 5F1RA 1OQEA 5EZWA 1KITA 5ACA3 4CTEA 4OZXA 1TNRA 5HXVA 1LOFA 3JUUA 4AI3A 2GN3A 3UJQA 4C90A 2GC0A 1NA1C 1WW5A 2VNGA 4URTA 1OLQA 3GF6A 3FBMA 1G9DA 1O4YA 3GZAA 1I1EA 3OBTA 4DRVA 3KM5A 3B00A 4DZGA 1MVQA 1QXJA 1QOOA 2ZMNA 4GH4A 3VBSC 4Z92B 2ZABA 1MEC2 4AI1A 4XF3A 4UW5A 3VBRA 3S30A 2XJVA 3GHNA 2TEPA 4FOVA 1ZM1A 1BMV1 4KGQA 4JTOA 5JOYA 1CPNA 1RUC1 1BBT2 2WWSA 1YCIA 2HEVF 3JB4C 2VOVA 2ZGQA 2QDRA 4XF9A 1UPSA 1W39A 2NP0A 1C1LA 1VAKA 2GNBA 3D0JA 5CFCA 3MZHA 1TME2 1HV1A 2VG9A 3M3CA 3MDPA 4AQ6A 4KG0A 1LGBA 2JENA 1VBA1 1KS5A 5GLZA 5CIRA 3OY8A 3BOPA 4LBNA 4Y1XA 1DHKB 1O4ZA 2H6CA 1HQWA 1N3QA 1OHFA 4BPZA 3O7OA 1FPN3 3N7JA 1AYM1 1ND3B 4YG3A 1Z0HA 1ZX5A 3PMSA 4GKYA 4KU8A 3ZO0B 2EF6A 1QJX1 1I3HA 2FZ2A 1U5IA 1ZZ6A 1IKPA 1CD3G 4Y1YA 5LK7B 1ZBE3 2GNMA 5BY5A 1YFYA 1LOFC 4FXKB 1S0FA 3WINE 3VHPA 1NA1A 1AR93 4ISRA 4LTAA 4K6BA 3V0AB 1JHNA 2VUAA 1JBCA 4RHV2 1LOGA 4A7YA 1CX4A 4PIYA 1QMJA 2VUJA 5C8CA 2RS32 3BIWE 4WM8A 3USSA 5JSPA 4PBOA 4YVWC 5D1IA 3PJQA 4AEDC 1W6MB 2A73B 1LENA 2OUJA 1H1MA 1R092 2PAMA 3EBRA 5GLVA 4LHLA 3WXPA 4QPGB 1ZZBA 2BVVA 3AZVA 3NO8A 5CG8A 1W6NB 4EROA 2X29A 3VBUC 3E6DA 3D6EA 1I6XA 4JQRA 2G9FA 1WBLA 2PAKA 4AI0A 4C0BA 3HD8B 4JV4A 1G7YA 4BH9A 1AR92 4OI2A 4HPKA 4N90A 3M7AA 1X82A 5H9SA 1RUNA 2ZGTA 1XE8A 3ZSMA 3M3IA 1DZQA 1A78A 5F6LB 4HVQA 5I0TA 3IPVB 2IXJA 1V6LA 2WFPA 1AHSA 4YVSA 1D2SA 3DPRC 1J1LA 1LU2A 1IQAA 2PYTA 3J26N 3CU7A 3KCCA 2H0BA 2WLQA 5FLHA 1O3RA 1MZFA 2WQ4A 1VB4A 2P3IA 3ZMOA 1ZZCA 1H8TB 2EXKA 4OVEA 4YZ1A 5GZCA 1QDOA 1X50A 1SMVA 2ZOEB 4IV1B 1NA1B 1ONAA 1PGW2 1AR73 3SXWA 1XYPA 5D8AC 4YNIA 5JPMB 3R05A 3TB0A 4B7KA 1LJ7A 4EN6B 4N53B 4XFFA 4Q4Y2 3WW1A 3WW3A 1CAUA 1OD5A 3I54A 5ABJB 3KCYA 1KRIA 4Q4W1 3WQ7A 2CGOA 3O0WA 4LLOA 4ASLA 2IXCA 2B39A 3URFA 1VBD2 3JB8A 4XIKA 3TRSB 5GZEA 2YDEA 4EN0A 5JZGB 1HX6A 1WUVA 4WM8C 4AQTA 4A7KA 1SCSA 2D40A 3V0AA 3TN91 5A3LA 1S1AA 3INAA 2D6MA 2HWE2 4QXKA 4TYSA 4Y24A 2DUQA 2WNUB 3E97A 2D6KA 2DTWA 3B93A 2BEOA 3M8LA 1DQ6A 3WQ1A 3SITA 4G9SB 5EXOA 1KD7A 2XVGA 3ETQA 1GNHA 4L99A 3MPBA 4I30A 5LRSA 1DQ2A 1WBFA 2RS53 4F7ZA 3M3OA 4FOQA 2LM3A 4KGGA 3WQ0A 3AZWA 1MS1A 3WY6A 4CP0A 1ULGA 2HWC1 2WT0A 1MZ5A 2ZGKA 2IXKA 4OHXA 3O5SA 2RS13 5KBFA 1WCSA 3AP6A 4YYOA 4PQ9A 1QXPA 1ENRA 1PGL1 4P9GA 1AX2A 2DU0A 1LKNA 2HJIA 1RMU1 3AP7A 5C6CA 5GM0A 1LHNA 2ZJCA 1AYN3 2JX9A 4QQ2A 1LHWA 3BPZA 2ZHMA 3AX4A 1OQ1A 2RS12 3MF9A 3POYA 3HR9A 4IQPA 4FVVA 2RR11 5KHHA 3ZFGC 2DFBA 4R8HA 5D8AB 1HRI2 2WC2A 2VOXA 1ZBA2 3ZSEA 4XETA 1KXGA 4C1WA 1QGLA 4XYXA 1CONA 3JU9A 4JGZA 2K0GA 3FLRA 1VALA 2QZ3A 2UURA 4I01A 4E2QA 4FO9A 3W58A 2JG8A 2VQAA 4CDQC 1HRV2 1VJ2A 4LLFA 4AEKA 3KT1A 5IK5A 1Z7S2 1NZCA 1GZWB 4IXLA 1IOAA 1ZVFA 1YFXA 4QMAA 1C4RA 5FMOL 1H9PA 2GH2A 3VHOA 3U4XA 2YV8A 4QGMA 2YGLA 1AR71 4TWTA 3QCWA 4DINB 4K7JA 2RM23 2DCTA 1E57A 3LOIA 4QM9A 2YMZA 1Q8PA 3FMGA 1W0PA 4N53A 2EIGA 4AVCA 4ZU7A 4C1XA 2WNVB 2VVEA 3I8TA 1YYNA 4LHNA 4BA6A 1PMIA 3AFGA 1JOJA 3WG1A 5E89A 2FHRA 5F5QA 5J48A 1DF0A 2A6XA 2XLAA 1RL3A 1QOSA 5JR7B 1FMD3 2H6BA 2VECA 1N1TA 1NQDA 2JG8B 4Q0SA 5BNNB 5IK7A 1F8VA 4IEXA 3QOPA 5L7OA 1MR5A 1BQPA 2KM2A 4FPKA 3T1MA 4META 4FPOB 5K8SA 3FLTA 3VGIA 5HBAA 1FXZA 3GHMA 4E27A 5L7OB 3GYDA 5IK8A 3THTA 2RMU3 5DUWA 3DGTA 1RUJ1 1IPJA 1RUD3 2DYCA 2Y26A 4CDWA 4KWJA 4K1YA 4LBMA 2Z42A 3LSDA 5EYXA 1FT9A 1Q56A 3OYWA 2VH9A 4CEYA 3B01A 4CDXC 3SH3A 4JGZC 2PHUA 4Q4X3 1G9FA 2RS11 4AGRA 2E7TA 2JG8C 1TE1B 1K5MC 2PHXA 3FBYA 4I0BA 4GH4C 4B8EA 1YHFA 1RMU2 1UKGA 2OZJA 1W6MA 4ORFA 4Y22A 3X29B 3IDEA 4HZFA 2DVBA 2PHFA 2ZA9A 2ZS6B 4AI8A 5T5OA 4PDWC 2VPVA 1GZCA 2G9GA 3S0MA 4MYEA 1TMF1 5CA6A 2B45X 1I5ZA 4FPCA 3VBHC 5EWSA 4UW6A 4N9IA 4INDA 2WKKA 4XFAA 2YROA 3OTFA 3NAPB 4XJAA 2VNRA 3CO2A 4E4DX 2PLV1 5FMOS 2NM1A 3IN9A 1GANA 2ZGRA 1DIWA 3GBFA 5I0SA 4BHPA 1S2KA 4L11A 1O3TA 1PZ8A 1MVEA 1PGW1 3A0KA 4ITCA 5JLVA 1VBA2 1DDLA 4FTEA 1QWRA 2B8MA 1H0BA 1DU3D 4LA3A 4KH9A 2WA4A 2R30A 1ND3A 1PZ7A 1SBDA 4Z1VA 2DURA 4Q1PA 4YZ4A 5CBLA 2C0ZA 1REDA 2XUMA 3VBRC 3NKTA 5SV8A 3ECQA 2D98A 3ZX7A 5DG2A 4N43C 1EAH2 2FMDA 2TBVA 5T54A 3AYAA 3W9AA 3CEWA 1VBE3 2O0OA 2XLFA 3ZYIB 4OHWA 5CU1A 2NPIA 1SCRA 2GC1A 4IEOA 3WOGA 2DF7A 2X5IC 4AEJA 1H2MA 1ZZ9A 4DRRA 2YZ4A 1VRH2 2NMNA 3LZZA 5BYNA 1PO22 3DKWA 4H3WA 4DOUA 4GWNA 4YM3A 1AYN2 1RIRA 5C8CC 3JZVA 5E1RA 2PHDA 3O12A 3ZFEC 2R0HA 1CAWA 4AEDA 1URXA 1OMIA 2PQQA 5BNPB 3OY8B 1RVF3 2DVAA 2P3JA 4HBNA 4H14A 4DB5A 4FPLA 1DGRA 2JD4A 1WGPA 2R063 2CNAA 3D8CA 1C28A 3KT7A 2XKPA 2MEV3 1V9U1 2GN7A 2WS93 5C4WB 1VRH1 4RS5B 4LUKA 4Q2FA 5C33A 4RQPA 5L73A 3SCGA 1ZRFA 5FOJB 1JYIA 2GDFA 1PVC1 2ZAAA 3UK9A 4MH0E 2DWRA 1J3RA 3IBMA 4N7IA 1VBC1 4MGYE 2DV9A 3WX5A 4BM8A 2ZCWA 1YXWA 4GMP1 2EXJA 2VVDA 2BNNA 4YVSC 4AFMA 2PHLA 1S0EA 1YFUA 4C91A 2VU9A 1BCXA 4IEWA 3HT1A 1RVF2 4QT6A 4E9KA 3FE5A 5KHGA 4HSJA 2XL7A 4LBQA 3EJKA 4XFIA 4WVMA 5A32B 2R061 4QD2A 4Q4V1 1AXKA 3VZMA 5DDJ2 5BNNA 1DGLA 1LU1A 3TOJA 2DVFA 2IXIA 1C8NA 1XU1A 3N3HA 3ZXKA 1WLWA 4HVOA 1GBGA 1HLCA 2BNOA 2D93A 4FPGA 4XFBA 1VRH3 3PTYA 2MPFA 4YLZA 5DUUA 1VBB2 3LA2A 1RJ8A 2WZR3 5J98B 3ZN6B 4Y1ZA 1OPMA 2W68A 4GB33 5BNOA 1ASJ1 2XB6C 3ZFEA 3ACLA 3D0SA 3UKVA 1K5MB 4WV8A 4LBKA 1LODA 1IGOA 1EAH3 3TN92 4WM7C 4YGBA 3ZSLA 2R0FA 5AFBA 2EAAA 4FQZA 1NE6A 2ZKNA 4XE9A 4XILA 3NV2A 5CAZA 3JD71 4D3WA 1ZREA 4GB32 4Q8KA 5LK5A 1RUH3 2BTVC 3VN4A 1L3JA 3AP9A 1ZZ7A 3E6CC 3HAGA 1GNZA 1UAIA 3KGLA 2ZX3A 1QXRA 4MGKE 4QPYA 1CN1A 1RUG2 4B4QA 5ACA2 1PVC2 4FTSA 5FDBA 4J6GA 3AK0A 4YZ5A 1W6OB 3FX3A 2D5FA 4EJRA 1N3OA 1W0OA 4XPVA 3FWEA 4AWDA 2ET7A 1MZEA 1DYPA 2W52A 1KJRA 1AYM2 4WBBA 1GQHA 5I8SA 1LECA 5K9YA 1XU2A 3E6BA 1BMV2 5K0UC 4HL0A 3VZJA 3NL1A 4XMAA 3PVEA 4E2SA 3PJYA 2XVKA 1H8TC 2ET1A 4QQOA 3AMHA 4XFHA 4QQHA 4AVVA 3AYCA 3AXDA 1LOCA 5JOZA 1AYM3 4M3CE 4PDWB 1SACA 4OHZA 1NLSA 3SCFA 1VP6A 1S0CA 4L9BA 3I59B 3EO6A 5AC92 1PVC3 2CGPA 4R52A 3R4UA 3FFZA 1H4GA 5FPZA 1CAXA 2QZ2A 3U0ZA 1V6IA 5BXXA 1MS3A 1C57A 2Y38A 1ULCA 4M00A 3D5OA 4XIOA 1CJPA 3MLLA 1AR91 1BKZA 3ZXGA 5JAXA 2BGCA 1ZRDA 3A0NA 4BWOA 1D0GA 1OPOA 3ILNA 4J1WA 4QHBA 4KU7A 4DY5A 1JW6A 2DUPA 4FXGB 4KQ7A 5J96B 1UIKA 1V6KA 1RITA 3FLPA 2QUOA 3ZXJA 1HRV1 2XL9A 5JMCA 5BNOB 1ND2A 3UL2A 3RPQA 2XBO3 5I0UA 1WW7A 1OOPC 3RDIA 5JWPA 2EXIA 4YM0A 5IT6A 4LE4A 3KT4A 4U2AA 1BBT3 1UX6A 2D44A 5CVRA 2WZR1 2ZAHA 2WQZC 4NN0A 3U07A 2RS52 3PVOA 3FUOA 3WVJA 1POV3 3USUB 2O1QA 1AL21 4XF4A 2BVBA 3IM0A 4YFWA 3A4UA 1QY4A 3HMYA 2CYFA 2WL1A 5GKAC 1PGL2 4YW3A 1KJLA 5JOWA 2D6LX 5JDBA 4R9BA 2Z2SB 3R0RA 4CDUA 3VBFA 2OUHA 1DQ1A 1YUDA 3MW2A 5E16A