5FZ1A

Crystal structure of the catalytic domain of human jarid1b in complex with maybridge fragment 2,4-dichloro-n-pyridin-3-ylbenzamide (e48115b) (ligand modelled based on pandda event map)
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
462
structure length
454
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDGIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with E48115B
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B, LYSINE-SPECIFIC DEMETHYLASE
total genus 141
structure length 454
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fz1A01
5FZLA 2GP5A 3LDBA 5FY8A 4QX7A 5A3WA 3PU8A 4C8DA 2YBPA 5F37A 5F5AA 5FZKA 3N9QA 3PU3A 4HONA 5F3CA 5FP4A 5FWEA 2WWUA 4QXCA 5FYTA 5FYCA 5FZ1A 4BXFA 5FPVA 5FZHA 5IVEA 3OPTA 5A3TA 5FPBA 5E6HA 5F2WA 5FXVA 2VD7A 4LITA 4LIUA 5FJHA 5FYHA 3ZLIA 5FP3A 5FZGA 5KR7A 3KV5A 5A7WB 5IVBA 5FZAA 3AVSA 4AAPA 4DIQA 5FXXA 5FYUA 5LY2A 2Q8DA 3AVRA 4CSWA 4TN7A 4IGOA 4EZHA 4BU2A 4CCOA 3RVHA 5A3PA 5IVVA 5F39A 4Y3OA 5A7OA 4D6RA 5FZMA 4CCMA 4CCKA 4DO0A 4CCLA 5FZEA 4V2VA 4Y4RA 3KV6A 3N9PA 4QWNA 2WWJA 3PUAA 4CCNA 3KV4A 3ZPOA 3N9OA 3N9LA 5FZOA 5A3NA 2YU1A 3K3NA 5FPAA 5IVYA 3NJYA 2XXZA 3K2OA 5F3EA 5FYMA 3OPWA 5FY7A 4HOOA 5FZ4A 4GD4A 5A7SA 3LD8A 5LY1A 2XDVA 3N9MA 5FY4A 3KVAA 3N9NA 5FYYA 2YU2A 5IVJA 5FBJA 5FY9A 2Q8CA 5FP8A 5A1FA 4URAA 5FZCA 2OQ7A 5FPUA 5FZOB 5A7PA 3PUQA 5FYZA 2OQ6A 2OT7A 5A7QA 5FWJA 2OS2A 5FZ6A 2P5BA 2PXJA 5FZFA 4D6QA 2GP3A 5F5IA 5FYIA 2Q8EA 3PURA 2YBSA 3PTRB 4QX8A 5F3GA 5IVFA 4EZ4A 5IW0A 3AL6A 5A1LA 3AL5A 4UF0B 5IVCA 5FZDA 4ASKA 3K3OA 5FXWA 4NUBA 4AI9A 4EYUA 4QXBA 5FZ0A 4IGQA 3U78A 4GJYA 2YPDA 5FP9A 5F2SA 5A7NA 5A7WA 4QXHA 5ISLA 2OX0A 5CEHA 5FY1A 4IGPA 4CUGA 4CCJA 4LIVA 5FYVA 4GJZA 5FY0A 5FZ7A 4Y33A 5K4LA 2XUEA 4QU1A 5F5CA 5LW9A 4LXLA 5F3IA 5FYBA 5FJKA 4UF0A 3PDQA 5F32A 5FP7A 3KV9A 5FUPA 5FYSA 5FZ9A 5ANQA 5FZ3A 3PUSA 3U4SA 3DXUA 4E4HA 5FPLA 5FV3A 4XDPA 2W2IA 3DXTA 3UYJA 5LWBA 5FXZA 5FZ8A 4GAZA 5FZIA 5FZBA 5FUNA 2XMLA 5IWFA 1VRBA 5FY5A 3KVBA 5A80A 4D6SA 4V2WA 2YBKA 4BISA 4XDOA
chains in the Genus database with same CATH superfamily
4GMP0 3ZO0B 5LEKA 3RG0A 1O4TA 2WZR2 4UFMA 3UJQA 4KNCA 5JI7A 1AJOA 2WO1A 4A4AA 4MGYE 1DP0A 3IT8A 1VBA3 1AXZA 1K45A 1S2KA 2V5YA 4KGGA 2VUCA 1N47A 1H2LA 1QXPA 2XL9A 3VB9A 1APNA 1L7RA 3GJBA 4A6SA 2EALA 4MGSA 1JYWA 3I49A 2W87A 1UXZA 2WN2A 2R1DA 2SLIA 2NP0A 2Z42A 1LOAA 4MGQA 4DY5A 2GN3A 2PQQA 2LTNA 2W1WA 1Q8SA 2WN3A 1JUIA 3WDWA 4C1WA 2G9GA 4RN5A 3V65A 3SXWA 3T0DA 3ZSEA 1NUKA 1ZRRA 4CYDA 1O5LA 3WCRA 3O0XA 2W9XA 2JD9A 3RYPA 1C3HA 3D3AA 1JHNA 1FAYA 1K5MC 4XYXA 1W0PA 3AP9A 4OVEA 1DBNA 1UWWA 2DU0A 5A7OA 3U75A 3ZFFB 4META 4W50A 3USUB 4JGYB 2OXBA 5CKNA 3MUY1 5FZEA 1CAUA 1YQ8A 2V72A 4UFHA 3VDDB 2RS11 4LKSA 4MXWA 4XF3A 1K12A 3BYWA 4AFAA 1OPMA 4OHXA 1IPJA 1NCQA 1QH7A 2JICA 4RD7A 2ZXQA 5M0TA 2GC1A 1OSGA 3JBG1 3M4FA 4JGZB 1Q8PA 3WHTA 1WLDA 3CDZB 1AR91 1HX6A 1QJEA 3N35A 4N8MA 5A7SA 1VP6A 5FREA 2RM21 5ABJC 2WNVC 1UMHA 2NQYA 1RUC2 4P5YA 1RUG2 3R0RA 3SCGA 4DMIA 2P37A 3EHKA 5F6LB 4RR3B 4K1ZA 3RJ2X 1IQDC 5I91A 3MUZ1 1OKOA 4DRVA 2J1TA 1OT5A 3VV1A 1HRI3 2WUHA 4CDQC 1VBE1 2PMWB 4PCRA 2A73B 1QIQA 2E53A 1JZ7A 4GQ7A 3ZYIB 1PNFA 4YG6A 5FZFA 4I3PA 2R0HA 1RVF1 4Y24A 2E51A 1GNZA 3KF3A 5LRRA 5KXCA 1AR63 1Q5OA 5FQ0A 1OA3A 3T2PA 1DF0A 2NMNA 1ND3B 4PDWB 1DZRA 1MQTC 3LB9A 3TBDA 4AFBA 4AI9A 1OQEA 2RS52 4R8HA 1SBDA 2PHFA 5CFCB 2P3JA 1DQ6A 3OBTA 5JPMB 2GNTA 1DGWX 3N7LA 2PHUA 4WM7B 1PZ9A 1TME3 3KZ4C 1WLWA 1NQDA 5DMYA 3SH3A 1JZ4A 1H6YA 1UKRA 4LO4B 5AC93 2BNOA 4CRQA 2IC1A 5FK7A 2P17A 3BGAA 3RGBA 1G9FA 4V1PA 3U07A 4QX1A 4XQWA 2D3RA 3FC0A 4BYYA 1UZVA 1SFYA 1DYOA 3NV4A 2H0BA 1R082 4OUMA 1NOVA 4IEZA 5CIRA 2X5IA 2LROA 3MW2A 4MSVA 3VL9A 1F15A 5A6YA 2GH2A 1UQXA 4FFFA 1UO9A 1HQLA 3ALQA 3K75B 1XXNA 4LHNA 4XF1A 3UK9A 2EAKA 1RGSA 5EJ3A 4Q26A 2Y26A 1HXS3 3O1OA 2XR4A 3AXEA 3VDAA 1EY2A 1OKQA 1AR83 5EV7A 2Y34A 1UL9A 3B93A 1ND2C 2RDRA 5J09A 4FPJA 4YZ1A 2JXAA 1XNTA 1MZ5A 1C8M1 4LORA 2I07B 2EA7A 3WSOA 2ES3A 2D98A 1G9CA 2R061 3C7EA 1ULCA 5LCWL 1W0OA 2VH9A 3DPRB 5D8AC 5H9QA 1MS3A 2HH9A 4Q4Y1 3LE0A 3V0AB 5FYUA 2QJVA 2Y8KA 1LHUA 2VU9A 3RZKA 4HT1T 4IV3B 1LGCA 4L97A 3DL3A 3VBHC 1TMF2 5H9PA 2OPWA 4AHWA 4NHXA 4P9GA 4RGGA 2K2SA 1LESA 2WS91 5JWPA 3VZMA 5EWSA 5FKBA 1US2A 2VCMA 1SLTA 1CR7A 2HWD3 3MO4A 3VD7A 2BNNA 3UV9A 4B1MA 3A7QA 4YLZA 1UCXA 1GYKA 5A3NA 3NVCA 2WO2A 2VG9A 4IW3A 1WW7A 2ZABA 2JB8A 4LLOA 4NJ4A 2VQAA 2VW1A 4OULA 1ULFA 4K20A 4YM2A 2IXHA 3MFAA 2OKXA 5FZ4A 3OUHA 4N43A 3HVDA 4QPGC 2QQJA 2DTYA 3THCA 4DPNA 1RUOA 2DYCA 4P9LA 5CVRA 3IKWA 2ZHNA 5A1FA 2E7QA 2VOVA 1IQAA 5FZOB 3WT3A 2GMEA 5F8PA 1C8M2 3HWJA 1RUJ1 1VBE3 5A32B 4EE2A 1VBC1 4RFRB 4RQPC 4UFKA 1SBEA 1TMF3 2RDNA 2FHRA 2E31A 3HEIA 1GWMA 5I0UA 1JU3A 4RR3A 4C91A 3P1IA 2ZKNA 2DVBA 5IVFA 5CAZA 2ARCA 3AL5A 4G9SB 1FMD3 2DUOA 2OUHA 2FBEA 4ASLA 3UGHA 3I2FA 2VNGA 4CDXB 4QXBA 1H1MA 2Q1ZB 3KGLA 4XFIA 1SFPA 1PO13 1O7FA 4TLFA 1AYN2 4XACA 2D5FA 5EXOA 5FP9A 1FPN1 1N1SA 3MIFA 4L8QA 3T2TA 3WD5A 5JOYA 1TNFA 3NRUA 4AVSA 3WQ1A 4OYUA 4LQRA 2VUJA 4W4ZA 1RL3A 3AKTA 5FZ7A 2VZ3A 4L0PA 1LR5A 1W8UA 2A3XA 5F5CA 4B4PA 2UY9A 4XFAA 2VCAA 4Y22A 3AKSA 1ENQA 5JZGC 1RXFA 5BXXA 1QU0A 1W6MB 5GZGA 4PLNA 2W94A 1JYVA 3EMRA 1W8OA 2ZKLA 3PJQA 4ET7A 5C9AB 1ENXA 2OPKA 2G4IA 3FE5A 4NN0A 1MVEA 2ZGTA 2VOXA 4ORFA 3ZXEA 2F4PA 4D69A 1W2OA 5J7MA 3H8OA 2XMLA 4AL9A 1T6BX 2B4KA 1S0IA 3QACA 4YG0A 1MQTA 1HW5A 1WMFA 4E4SA 1ACCA 3WNOA 2HLEA 3OGRA 4C8DA 4CPBD 4QX7A 3WDVA 4XEZA 4AVCA 3VZNA 4EV0A 4FPCA 2W47A 4UW6A 1MS9A 2HWC3 3H1MA 3JD72 2ZGLA 4JKKA 4DXSA 2IZWA 4R4XA 5BUVA 4AVAA 4EQVA 1AR72 2VULA 4LR4A 5FP3A 3ZYBA 3OSDA 2WNUB 4GWNA 3X29B 1RUH2 4EN6B 2J1UA 1LEDA 4HPKA 3S57A 1M06G 2PHXA 2RJKA 5GJ6A 4LHKA 2TNFA 1VBD3 5ACA3 2BWCA 2H6BA 5EQUA 4PLMA 2O8QA 3S7IA 3ACGA 3AKRA 2ZGRA 3ACLA 3CZJA 3IDAA 3PIGA 3Q8AA 5IFTA 1HRI2 5C8CC 4C90A 1PM4A 2BPA2 4QB2A 3S5AA 3U37A 3ZOIA 1BHGA 3WR0A 4QB1A 3SHRA 4YM3A 4Q27A 4S2GA 2W1UA 1RUJ3 4XAEA 3VKMA 4FXKB 1B35A 1W6NB 2O14A 3OCPA 4INDA 5FYMA 4H3WA 3I3BA 1C1LA 1BXHA 2DUPA 1RHI1 4QQ2A 2R30A 5T52A 1R092 1V9U1 2J1AA 2P4EA 3ILFA 2ORXA 4IEYA 5E89A 5GLTA 1A8MA 1SLIA 3ZN5A 2EXIA 5K9YA 3RZGA 3DKQA 4CP9B 1XYPA 1BVVA 2VE1A 5E1RA 2WZR3 1OBNA 4E2SA 3GZEA 3ME2A 4ES9A 1A8DA 4FPHA 4XW3A 1KS5A 4I0BA 4B1LA 1WW5A 2Q8EA 2YBSA 2RM22 3NV3A 2DUQA 2VCBA 4QDSA 4LUKA 1Q56A 1IS6A 4PBOA 3W59A 3OD4A 2MEV1 2E32A 4YW3A 1W6OA 3VHOA 4I01A 3WCSA 3WDUA 4BA6A 2JKXA 5FIXA 3RZJA 4QXHA 1X8EA 3FFZA 4AHXA 1XU2A 1TZOA 3WQBA 1JZ8A 3VBFA 1EV13 2Y33A 4AGVA 1AYN1 2QZ2A 4QU1A 2ZMLA 4LT5A 3NAPA 1W6MA 3POIA 5EP9A 2DCJA 2YDEA 5HV4A 4S2FA 1NCRC 1YEWA 4BM8A 1D4M3 3LFIA 4QQHA 4DXZA 3PDQA 3I3MA 2FQPA 2JDAA 5J3UA 2WLPA 5JMCA 2ZHLA 2D93A 2VCCA 5JDBA 4PIZA 4H2AA 5HI0A 5FV3A 1QQP2 2DCZA 4COYA 5LK5A 4I2OA 2Q30A 5L73A 4LBJA 5FZ8A 2P3IA 4XVHA 2YMZA 5IYYA 1XNDA 2ZZJA 1YRZA 4QGNA 4JGYA 4DUWA 1YO8A 1ZRIA 4N9HA 2WJSA 4KMQA 1DZTA 3ZSMA 1NQJA 4I09A 1J59A 1DYPA 2D40A 3LDBA 1ZZ7A 2WL1A 1Q3EA 5F5AA 1JBCA 3AZZA 3WW1A 4CUBA 2MHFA 3PU3A 1XE7A 1I5ZA 1VRH2 3JBG3 1X9PA 2XHNA 4R9BA 4AYUA 4YGEA 4FAGA 5FZ1A 4CDUB 1YIPA 3B94A 2GC0A 3LA7A 1PVC1 3M1HA 1XRUA 1V6MA 4YW4A 5GALA 3APBA 3E6CC 1MZFA 3HAGA 5FXVA 1QJU1 4RGAA 2OA2A 4IEQA 4DIQA 4DEQA 3HN1A 3KT7A 1QJX3 3RYRA 3FN9A 1ZA4A 3PVEA 2RS32 2Q8DA 4MUVA 1OQ1A 2CHHA 4B4RA 2JX9A 3OBZA 3M3OA 2WNEA 2ZS6B 5EPAA 4A7ZA 5A70A 3CIHA 1GBGA 4CCOA 1QMJA 1XNAA 4Q0QA 4Q1PA 1GWKA 4XC9A 5IJRA 1RUD1 2HBUA 3AB0A 1JXNA 3W9AA 3KV6A 4Q4V2 1DHKB 2TEPA 1RUH1 4XZPA 3QCWA 3N9LA 3SITA 4B7KA 1Z7S1 3O1SA 1QOSA 3ZFGC 5HCHA 3VBUA 1AX2A 2QQMA 2QQIA 2XDVA 4PIYA 5FY4A 4CDWA 3KMHA 1BBT2 3B01A 2WAOA 1V00A 4JGZA 4Z07A 3VL8A 3I59A 2ZTNA 1AXYA 2DDUA 3FLPA 4SBVA 3ZYGA 5FZCA 2OQ7A 2WAAA 4S2DA 5FPUA 5JCTA 4TZDA 3MHZA 1R091 4P14A 2Y38A 1LENA 1XU1A 2TBVA 3OYWB 4GIQA 4LA2A 2LW8A 4Q0SA 2D6MA 2QE3A 5DG2A 4Q8LA 1AXKA 1QEXA 2JD4A 5DAQA 5JUVA 2Z69A 4AFMA 3WF2A 3AJYA 2AEYA 4FFGA 3CBNA 4WZCA 3E5QA 3Q8FA 3WQ7A 4MZUA 4DXRA 2OZJA 3FBMA 4LTAA 4UF0B 2ZGMA 5F9TA 5KHIA 1ODNA 4ASKA 2WBKA 1X8MA 4FBFA 2DBIA 2GNMA 4QPWA 2YPDA 3MEPA 2R043 2D97A 5JR7B 4QD2A 1WBFA 2A71A 5ISLA 2OX0A 2FCUA 1H6XA 1FV3A 3U1XA 4KGQA 3T1LA 3D0JA 2R49A 4CP2A 2BERA 3J26N 3H3UA 1UY3A 1C5HA 1KS4A 3J8F3 3AMHA 1W99A 3VHPA 4A3ZA 1S2EA 1CZTA 1HKDA 4QMAA 4OUEA 2PHRA 5DZGA 5FYBA 4UF0A 2JG9B 4YZ3A 4K8RB 4OI4A 5J48A 3CHXA 2C0ZA 1QKQA 1RVF3 1W0NA 4AVBA 1S1AA 1V6IA 1S0DA 2ERFA 4GWMA 3J4UH 1PGW2 3LEIA 4HKOA 3DXTA 1W04A 3KWVA 3EXUA 3WF1A 3UYJA 3O12A 4BQ2A 3R4SA 4BIFA 3B02A 3OYWA 5FZIA 1VB4A 1E5IA 5A3UA 5FAXA 1OF3A 3LSDA 4N90A 4NO4A 1KDKA 5C5TA 4YM0A 2EVXA 2Y6HA 3PUHA 2DWRA 1QXRA 4WZFA 5CFDA 3JD71 1MS4A 5FY8A 1UF2C 5FQ0B 3GZAA 5FZKA 3D4KA 3IZOA 4LHLA 4Z92B 3B9CA 1RUE1 4QXCA 5DUUA 5FPVA 3N4MA 3H3ZA 4QGLA 3VBFB 1Q8VA 2R32A 2R071 4QPIB 3VBSA 1W2UA 2EICA 2ARXA 1DU3D 1GOGA 1JU4A 1YXWA 3FLRA 2A6ZA 3H3LA 5IK5A 4IESA 4C0HA 2A6XA 5FMOL 3BUCA 5LZ6A 2Z79A 3ZN6A 2A6WA 4FOVA 2XQRA 5JXGA 3O1UA 3Q8CA 4BMEA 4N43C 4BU2A 1FPN2 1VAVA 1DGRA 3ZYRA 3J8F1 1CAXA 3GXUA 1AJKA 4YW7A 3T1MA 3I4IA 3VBSB 1RINA 1YJKA 3ZSKA 1XB9A 1KD7A 1TQ5A 5DPNA 4KU8A 5GZDA 1OA4A 2E26A 5FPAA 5IVYA 4WVMB 3TEXA 4DZGA 2IXLA 4YRDA 5B4XA 4D94A 5HCAA 2BOIA 1F35A 4XUPA 1XC6A 1XYNA 5J96B 1GQGA 2GZWA 2JG9A 1IS4A 2XVKA 4R9DA 5BNPC 3M3IA 1AUYA 2YU2A 1B35C 4K21A 4QPYA 1NA1A 4CEYB 2BJSA 4C1XA 1W6NA 2YC4A 1OUSA 2BGCA 4FVVA 3V56A 2O1QA 4BCUA 3RZHA 1UOJA 4GALA 1VB2A 4ASMB 4RHV1 3PIJA 2PAMA 1LHVA 4LOSA 3SLIA 1F2NA 3D82A 3WNXA 2GP3A 2PHWA 1JOJA 5L7OC 2AZ5A 2VNOA 3JUUA 4CXYA 1DGWA 1SDWA 4TLGA 3C7HA 3PURA 3GBGA 1SG3A 1CN1A 2RG4A 5HCFA 1IOAA 1V6NA 2QUOA 4Y1YA 1YI7A 3K3OA 1R081 3NL1A 4K3UA 4QU2A 4A6OA 1AL21 1FOD2 2JG8B 2ARAA 4IGQA 2VZPA 4KQ7A 5GLZA 1GUIA 3TOJA 3IB3A 4KU7A 3ZIXA 1FPN3 2CTVA 1HRI1 2ZGOA 1CJDA 3I2OA 2BQPA 2VOWA 4FOWA 4TWTA 5FYVA 3ZIWA 4YZ2A 2VVFA 4OUSA 5K7PA 4I3GA 4P9XA 1IHMA 5FYSA 5FZ9A 2XOMA 2BZDA 5J36A 4X8PA 1F9KA 4E4HA 3BVCA 2W2IA 1D4M2 4IE4A 3CKHA 5JIAA 2ZX3A 1SZBA 2VMGA 4AEDA 4GZ9A 5EJZB 4TTGA 4NIDA 2OZ6A 2NMOA 3HBKA 5FUNA 4AOCA 4YW1A 5A80A 4W6YA 4RHV2 3TYJA 5I8YA 1YQCA 5J98B 3AZVA 5CU1A 1ONAA 3AMNA 3ACHA 2VBPA 1ASJ3 2X09A 1H9PA 5FLIA 2BEOA 3WUCA 3TN92 4ZXEA 3A0KA 2VOTA 3AC0A 3CQOA 3ZFFC 4YARA 3ILNA 1RUJ2 4NPLA 5BNOA 1PK6B 2G1MA 3DYPA 4QPGA 3VDDC 5A3TA 5IVEA 5FPBA 3AP5A 4G3YC 4BHPA 1RYYA 4AHYA 4OHYA 2VQ0A 2V09A 4XE9A 1JN2P 5FZAA 1CQ9A 2GALA 2R041 3GJAA 1VBD2 5ACA2 3WG1A 1YIFA 2FD8A 3J8F2 3PUIA 4XJWA 2UY8A 1YWKA 4DUXA 3BCWA 3HPNA 2WQ8A 4FPGA 1H8TC 5BY5A 1FMD1 5LASA 3GALA 4IEPA 3ROUA 4HPKB 1GWLA 1WW4A 4FPFA 2NN8A 4RR3C 3UJOA 4MXVA 4A7KA 5T5JA 4D6RA 1C1FA 4Y5Z0 4COVA 1O5UA 2AREA 2JJ6A 2VMIA 3AKPA 3BOPA 3NJVA 1Q43A 1VBB3 2W1QA 4XCBA 4M3CF 5DQ0A 3R6SA 1VBC3 3KV4A 5A6QA 5DUXA 4XIOA 3SMHA 2ZOEB 2D6LX 1POV1 4W8JA 3BI3A 2VZUA 4QX3A 4YVWC 4CP9A 1IKPA 2VZ1A 3NJYA 5JZGA 3ST7A 1SDDB 3AMPA 1ND3C 4HOOA 1CAWB 2HWE1 2JWPA 2XLAA 4XPVA 3N9MA 2B9VA 3QH7A 2WA3A 1WW6A 1NCQC 1MS5A 1ZBE1 2XGXA 4B4QA 3NNLA 4I30A 2VXJA 5FRAA 1VRH1 2JDYA 1KFXL 4TXWA 2BGPA 3EO6A 2G19A 3OGJA 2P6CA 1WLTA 2D5HA 2XVGA 3Q8BA 5A7QA 4YYOA 2RV9A 3UKNA 1KJLA 2FDIA 1IG3A 3OG2A 3BPSA 4HSLA 5ERLA 2VZOA 4NIAA 4QHOA 2IVJA 3HQXA 4Y5SA 1AR73 3HOBA 1QOTA 1AYM2 4XTMA 2WRAA 4BQ5A 1FOD1 4EZ4A 4W6WA 3AL6A 3IDEA 3AYEA 3PHMA 4FFHA 4FI9A 5IVCA 2ZBJA 5FXWA 4NUBA 3TAYA 5FTTC 5JSPA 2WA4A 4PI2A 5FZ0A 4RS5B 3BPZA 1ZZ9A 1BQPA 3BU7A 2Y0IA 1JOBA 3FWEA 4D3WA 4PQ9A 1COV2 2E63A 4K9SA 2WS92 2WO7A 3ZXGA 3Q8EA 2YHJA 1I5PA 2WKKA 3LA2A 5K4LA 4AW7A 5I0TA 1FMD2 4CU8A 3WF3A 3O1TA 2R7EB 1H8TA 2D7FA 4BJ0A 3I3QA 5FPZA 3KV9A 3C7FA 5DAPA 1XJAA 3PUSA 5FZ3A 4ZPIA 1J84A 1ULOA 1BK1A 2Q1MA 1W8TA 3KGZA 3H50A 3IDBB 5FPLA 1AF9A 1RUI3 4YVSB 4AAXA 3FUQA 2XBO1 1CD3G 1W3VA 3PTYA 2ZEXA 1W39A 4QQOA 1LULA 2YXSA 1YYNA 5K0UC 1FV2A 3VUOA 4D6SA 3ETPA 4V2WA 1AHSA 4XUNA 1UPIA 1MACA 3TN91 5LB6A 3NO8A 1DQ0A 3LEMA 2HWC1 3ON7A 1H8VA 4O7XA 3ZXDA 3NMBA 3S7EA 1UAIA 2C24A 3VBRB 1E5HA 5EHDA 1Z78A 2C9KA 2HEVF 2P34A 3ZKYA 1W9WA 2XLGA 4LBLA 4FQZA 4M0NA 4MV2A 5DUVA 4A2UA 5JPNB 3LOBA 3KCCA 2J1RA 3KCYA 2WYSA 1ENRA 3AM2A 3NNFA 1N1VA 4IETA 4MYEA 5FZHA 3SCHA 3TRSB 1OOPB 1RJ8A 3H1YA 1W06A 3BU0A 1YQ2A 4ZZ5A 4LLFA 1VBB1 3NQHA 2JIGA 2P1BA 4LIUA 3RI9A 2BYVE 2OUJA 4XETA 5CZKA 3UKTA 5A32A 5IFPA 1TME1 4ARXA 4XFGA 2OYZA 4ARYA 2XHKA 3AKQA 4AAPA 4WV8A 5FXXA 2PAKA 3NJZA 3OUIA 2JENA 2Y6JA 3SQOA 4QPGB 4NIHA 1CPNA 2ZGNA 3MV01 5LY2A 1W90A 4A44A 5DZEA 5BNOB 1WMDA 1WLCA 3IWZA 4AI0A 1YFYA 2B5HA 5LK7B 1LRHA 4ZS3A 4P08A 2CWMA 2HWF3 3O14A 2JDMA 3M3QA 5CA6A 4RGKA 3VZLA 2CV6A 5FDBA 2CWSA 2WNOA 4KL1A 4V2VA 3WDTA 4LA3A 3WY6A 4EN9B 4CCNA 5CNAA 3AP4A 1NXD1 2PLV2 1UIKA 1YQ5A 2FMYA 3MICA 3AYCA 1J1TA 2XXZA 4Q29A 2BOJA 1BVP1 2RMU3 3HQUA 3OPWA 3WHUA 1W8NA 3HNBM 4ZXKA 3NWKA 2EIGA 1YQ6A 4JC1A 5LBFA 3R4DB 4QKDA 4RL7A 3PJYA 4CU6A 1I9RA 1GQPA 1A3KA 1NCRA 3BTXA 3I2IA 1RJ7A 4LOTA 1POV3 4MGIE 5J37A 3I54A 4LKEA 2OS2A 4E4DX 1R093 4IEUA 3S30A 1FX5A 1PM7A 3IPVA 1ULDA 4XJZA 1O4YA 3NW4A 3MIGA 4COWA 4C0BA 3NKGA 2HBTA 3B5LB 3ZXLA 1MZEA 4LPLA 2VBDA 4NRQA 4OLLA 2KA3A 4JTNA 4EROA 4LBQD 1VBD1 5FZDA 5ACA1 4YFZA 1AR93 4DS0A 4QB6A 3QOPA 5GLWA 3KSCA 1GFF2 4BQ1A 1Z7S3 2C5DA 1TME2 2XG3A 3P3NA 4B3NA 5C7GA 4QQPA 4YZ5A 2RR12 3WF0A 2VTXA 1Y43B 2ZGSA 1PO21 3DN7A 3N7MA 5BNNC 3KT1A 4Q4V1 4HVOA 3ZXAC 4FPLA 1OH4A 3F95A 5DZFA 1BEV3 2XJTA 1R1A1 1O8PA 4NPRA 5APAA 5H9RA 4HKWA 4IDZA 4E2GA 3L9JT 1R1ZA 4CEWA 3E5UA 4GMP1 3JCIA 2SBAA 1DZQA 4RA0A 4B29A 4CXXA 3FHIB 1ZVFA 4BK4A 1Z7S2 1XE8A 2Q8OA 4MG2A 2WFF1 4Q0UA 1YI9A 1QJU3 2A7AA 1CJPA 2JDKA 4FO9A 1SMVA 4Q2FA 2VZQA 3POGA 4Y20A 3JQWA 4JDOA 3JZVA 1ND2A 2B7YA 2K9ZA 1YFXA 1VBC2 2VTXJ 4LO5B 1BYHA 2X5IB 2H6CA 4CDWC 3ASIA 1SHWB 4GKXA 2RS53 4PF1A 4LNVA 2NZ9A 4LHSA 3LIGA 3W20A 5FUIA 1ZRFA 2TUNA 4XTPA 4BXFA 3DKWA 5ANNA 2DCTA 1CWPA 4LULA 1XQNA 5E6HA 4GXLA 4QX5A 2VD7A 4LITA 3WNPA 4AXOA 3JXSA 4JTOA 1H30A 4AVTA 2ZAAA 3VBHA 4K7JA 3P6BA 1AL0G 2RR13 5FR3A 3WNNA 1SPPA 1UYYA 3PVOA 3AVRA 4A7YA 1DFQA 3CLPA 1MVQA 2PHDA 3FJSA 3NAPB 4XUTA 4CVUA 2B39A 5IAXA 2PLV3 4XJAA 3A0NA 2FCVA 3M8LA 1IS3A 4W6XA 4Y3OA 3TN93 5EYXA 3MYXA 3CF6E 1AYN3 1EUUA 2YZ4A 3DPRA 2HYKA 2JKBA 4QWNA 1TMF1 3ZR6A 2HWF2 1QXJA 1D0HA 1EUTA 1KFUL 4FOQA 4BIOA 2V4AA 3BIWE 2CGPA 3MLKA 3K3NA 1LTEA 2YC0A 5FMDA 1U0AA 4ATFA 1AZDA 1V70A 3B9IA 4LJHA 3RWNA 1UY4A 1DCSA 1QWRA 4GH4B 2UURA 4L2NA 5CG8A 4NIGA 4O61A 1VBE2 4NROA 1ALYA 2ADEA 5FBJA 2VBBA 2AENA 1YHFA 3MPPG 1UZ0A 3JQXA 2QQVA 3BTAA 4GB31 3JU9A 5H9SA 4QKFA 5GKAC 4GKYA 1RUC1 1F4AA 2W52A 3B3QE 4R52A 2BFUL 4UI9L 2PYTA 3J7MA 5C3SA 5F5IA 5JLVA 4A42A 2UYAA 4CTEA 1F31A 2CAVA 5JOWA 4IV1A 4ZHNA 1LOGA 4QHZA 1WGPA 4GWIA 5IW0A 3ZXFA 3O1PA 1V6OA 3CU7A 1CPMA 1EP0A 3NV1A 4UFIA 1H0BA 4EYUA 2ZAHA 2WQ4A 4OHVA 3LDRA 2QTWB 5DAXA 4HK9A 1PHMA 1W6QA 2JDHA 3ZYPA 3MIHA 4XDQA 3AK0A 5LATA 2QQNA 1W9TA 1RUF2 3POWA 2WABA 4LBQB 1W2NA 5T5LA 5AVPA 1RUD2 3WINE 4YVSA 1JYNA 2P2KA 2VMHA 4CCJA 4LIVA 1LOCA 1OQDA 3T2QA 4OCTA 1GQHA 1GSLA 2WLQA 3SH4A 1VAKA 2EAAA 3CZUA 4CEWB 4WM8B 1RITA 3ZFEB 1W05A 2PA7A 5LW9A 3MLLA 2FDKA 3RPQA 3I59B 3CJIC 1JZ5A 5FP7A 3VBUC 3HT1A 4KG8A 3HN3A 2RS51 3PLQA 3GF6A 5L36A 4PDWC 4J1XA 3MF9A 3A23A 4IL7A 4XDPA 2QQOA 1AX0A 5T3NA 3KB5A 4RYDA 4MXWB 1AVBA 1GLHA 1D7PM 1YFWA 2GH8A 1S4CA 4XIKA 1X50A 4BXSV 1SEFA 3VDDA 2WWSA 2WDBA 1QJFA 3ATGA 3I8TA 4X6RB 1JODA 1PGL1 1NX9A 4AEDB 3ZFFA 1PK6A 5LBEA 2IVIB 1VBA1 1ST8A 4MLOA 3VLBB 1FXZA 1AYM3 4GMP3 4N53C 4NE9A 5F37A 2HEWF 2IXJA 2QQUA 3IMMA 4LE3A 3T3YA 4CU9A 4DQAA 1ASJ1 5FWEA 1VMJA 3TB0A 3ACIA 1HB3A 4AFDA 2FZ2A 2XJUA 3NNJA 4AI3A 5KHJA 5IK7A 4M00A 4CUAA 2MEV2 3VHNA 3NKTA 4HL0A 4YNIA 3H42B 1K5JA 1I3HA 3TEWA 4HZFA 2A3YA 1NA1C 3WLUA 2IXKA 3ES1A 1O6UA 2WS93 1H2KA 1PIV2 3AXDA 5A7WB 1COV3 4CDQB 4JV4A 2CSGA 3NNMA 1Z0HA 2XKOA 1SFNA 2C26A 3CO2A 3KQRA 3MIDA 3NV2A 3WNMA 2C4XA 1POQA 3ZN4A 4JAAA 3ZYFA 4AHZA 1BJQA 2D44A 4AVVA 1BEV1 5ABJA 1NE6A 1UN1A 1QNYA 4QT6A 3I97A 3HMYA 5FMCA 3V64A 1IGOA 4Y4RA 3OOXA 3T09A 5EZWA 1X82A 3PUAA 2DU1A 2DBNA 4CDQA 1JI6A 2JG8A 3MGUA 2WFF2 3HQRA 4CA9A 1LHOA 4IEVA 3TWIA 1BCXA 1TVGA 4LBOA 1Y7BA 3CJIA 1W9FA 4LK6A 2PHLA 4JQTA 1VE0A 5CFDC 2Z4FA 3I2HA 1D4M1 3D0SA 1K5MA 4Z2WA 5GM0A 3A21A 2G9FA 3QD6A 1GR3A 1DDLA 4KWKA 3D8CA 1EAH1 4IE0A 2DV9A 4URAA 2DF7A 3UL2A 4MOAA 2XONA 4P02B 4H7LA 2WSUA 3PUQA 1JH5A 2OQ6A 1E5RA 1RUC3 1GKBA 3S6PA 3VKNA 3AX4A 4NHYA 2FDJA 2GNBA 2RHPA 3PVBB 1UY0A 1V0AA 4FQ4A 3WW2A 4I0WB 1YUDA 1ULGA 1VBB2 1HN1A 3H7JA 2ZEWA 2DVGA 3LDKA 4FSJA 2R042 4JRLA 2BWAA 5C6CA 1RC6A 4KWUA 3VBOC 2RJ2A 4S2HA 1MEC2 5D21A 1OD3A 4H14A 2VQTA 4AWDA 4GJYA 2XPJA 2QQPA 1PIV1 1PMIA 2VO5A 1K3IA 2ZPXA 2D43A 2YUEA 3ES4A 3KCXA 3WW3A 1DG6A 1ENSA 1SQ4A 2NM1A 5CEHA 1WBLA 1Y4WA 4D7YA 1OXCA 2IFRA 2J7MA 2R063 3NJXA 1JZ6A 4RQPB 1E57A 4WVZA 4Y33A 4EWEA 1ZBE3 1PGL2 3RQ0A 4IUGA 5DXDA 2ZMKA 2ZGKA 3ITQA 4M3CB 2IXIA 4P9IA 1W9SA 2XJVA 2YFUA 5AVAA 3WZ1A 4AQ2A 2W39A 1BLZA 4AZZA 1HJFA 1W6PA 1HB1A 4FP2A 4WM8A 3UESA 3ZFEA 1JYIA 1MS0A 4PJYA 2YFZA 1XNCA 2C9AA 3CJXA 3RSJA 5F7UA 2BBAA 1CESA 3HBZA 1H9WA 3POBA 5A6XA 2Y6GA 3MW3A 3H8RA 3H8UA 2B8MA 1X36A 1ZBA2 3MF6A 2KR2A 2ZHMA 3S0MA 5T50A 1XNKA 1W3XA 4HK8A 4YW6A 1QJY1 2QQLA 3O1RA 4O9EA 1W8FA 4NVPA 1K5MB 1RMU1 4CPBA 5JZGB 4FTEA 2VNRA 4AG4A 2WWUA 2CL2A 1NYWA 4QGMA 4XHBA 2QCSB 3H0OA 1HXS1 1UOBA 1OLME 4NPMA 5C9AC 1MEC1 2R073 3OGGA 5FJHA 4O65A 3J7LA 2ZMNA 2R0FA 2X53S 4FP3A 4J6GA 4MADA 1REEA 4R4ZA 3SNMA 2KXLA 5B2GB 1F8VA 4PDWA 4XJ9A 4E4ZA 1PMHX 5ABJB 1GOFA 4EN7B 2FDGA 2XLFA 3A22A 1GP4A 4JVAA 1STMA 4M3CA 5GZFA 4CZSA 5A3PA 2NYYA 5F39A 5CISA 1OFSA 3ZMNA 2W91A 5FZMA 4CCMA 4QKBA 4CUCA 1W2TA 1HDKA 1N1YA 1EAH2 2GNDA 1HRV3 3M3CA 3UNPA 1PGW1 4XCAA 3V0BA 4MHRA 2HWE2 1U5ZA 1LU1A 2J1EA 1QHDA 3K46A 1XYOA 4X6QB 4ES8A 1V9U2 1IS5A 1JHJA 4LO7A 5HCBA 5B4NA 5F3EA 4BQYA 1UIJA 3LEKA 3WOGA 3VDBA 1WCDJ 2ID4A 4XUOA 1V9U3 4OMCA 2W68A 1MPXA 2XBO2 2BTVC 2ET7A 1O8SA 1R1A3 3IPVB 4COZA 2Q8CA 5CFCC 3ZMOA 3OBRA 3FZ3A 4WVMA 1ZRCA 4WM7C 2XKPA 2YC2A 1CAUB 3LPFA 3EB7A 5CADA 5FZ6A 4SLIA 4D6QA 1EV12 5FLHA 4OI0A 2W95A 1CAVB 3AP6A 5FYIA 2IFWA 5CG9A 4WVVA 1LAJA 2Y6LA 5F3GA 1IPSA 3WF4A 3QBQA 2BNMA 4Q0VA 1J3PA 3URFA 5BNPA 3VDCA 1RTVA 1C28A 1DLCA 1WA6X 2D6PA 2L9LA 2W1SA 3E6DA 3E1F1 2VY0A 1X7NA 4Q5OA 3RI8A 2R072 4AEMA 4XF4A 4YVWA 1NZCA 2DVAA 1O3RA 4Q4W2 5JOXA 3GM8A 2P3KA 3W5NA 1GOHA 5D8AA 5IUQA 4DUVA 3UETA 2JB4A 3HNYM 3I3DA 1RUNA 1JZ3A 4AI2A 2J42A 4YW2A 3VGIA 1F5JA 4GJZA 2XJSA 4NWWA 5I8SA 2Q0AA 5BNQA 2CNAA 4UOJA 1JTZX 4NOTA 4DOUA 2EXKA 3GHNA 2PN5A 4U36A 3ZYHA 3THPA 4LE4A 4OZXA 3SH5A 1D2QA 2A70A 1ULEA 1WUVA 5DDJ3 4N7IA 3H8XA 1G6NA 5D8AB 5C3RA 2YPJA 4D8MA 2BV4A 4XJ8A 4NRMA 3U4XA 4Q4X3 5IWFA 2WZR1 4QQLA 1A34A 1CIWA 2YGMA 2JIJA 1IZ3A 4YFWA 4CDUA 4NRPA 1WCKA 4UWDA 3AYDA 1DGRN 1C57A 1Y3TA 2QFEA 1OLRA 2QQKA 3K51A 4BB3A 2YROA 4Z2AA 2P6HA 2QDNA 4R9CA 3SKVA 5JXJA 1WKYA 1UX6A 4AI1A 5IK8A 2VZTA 5JR2A 4FPEA 4CE8A 1XPWA 2X05A 1QGLA 3OPTA 4HKLA 1UY1A 4MH0E 5C70A 3V0AA 4Q0PA 1MEC3 1XSQA 1O4ZA 4UW5A 3KS7A 4YVWB 5IK4A 1W03A 2CGOA 2NLRA 1BBT3 1NG0A 2DCKA 2HWB3 4IQPA 3POEA 3IBMA 4LKDA 1SLCA 5IHRA 2HKXA 1ZA7A 4HMZA 1OVSA 1RMU3 5DN2A 5F5QA 3ZDVA 4BZ4A 2A6YA 3DGTA 2JE8A 4GH4A 4XF9A 1VPHA 3JD73 3LIHA 4N9IA 2DFBA 1ZRDA 2WZEA 4QM9A 2D6KA 1RUF1 3RDIA 4HVQA 5KC6A 2MPFA 2BP6A 2PTMA 1P8JA 3VD3A 5FLJA 4HBNA 2RE9A 1CAXB 1RXGA 2QVSB 4BMBA 2ZX0A 4E2QA 1X33A 1W6OB 1FT9A 1WZXA 2ZACA 4HN0A 3K2OA 2RS33 2MEV3 3H7YA 4BOWA 1ZYBA 4ZY9A 3FHQA 2E33A 3HJRA 1LB2A 1LU2A 1NE4A 4K6BA 4RS5C 2ZGQA 3WUDA 3VD9A 1NKGA 2A6VA 4TYSA 5FP8A 2DVFA 4BQ3A 2OVUA 4J1WA 1QH6A 2CYFA 4E27A 5T55A 3MV11 2RDSA 5JIUA 1S0FA 4LBQA 4BPZA 3GNEA 2P5BA 4QXKA 2BFUS 5BPXA 3FL7A 1PO22 3H1WA 3L2YA 1VJ2A 3WP4A 1S2BA 3WDYA 2VW2A 3VD5A 2LM3A 4XBQA 4XUQA 5FKCA 1MS1A 3VKOA 3WXPA 3U11A 4IV1B 2CGNA 1WCQA 4UFLA 2DFCA 2V5DA 2XJRA 4YVSC 2I2SA 5HV0A 5EIYB 2F4LA 3LAGA 3DYOA 3LGRA 3THTA 5A6ZA 1QJX2 1QQP3 5LRSA 5C4WC 5K0UB 2R16A 1T2XA 2I45A 3AYAA 4XURA 3UT0A 4BLIA 1FNZA 5FOBB 4CUGA 5HXVA 1ZM1A 1QOOA 4BQXA 2CDOA 4IE6A 1W6PB 1GV9A 4XQDA 1RUF3 4ITCA 5KXBA 5CFCA 3VBRC 1UPSA 1S0GA 1C8M3 5F6KA 1NLRA 3LZZA 4LXLA 3RYKA 2GMPA 5FJKA 1VMFA 4P9WA 4JZRA 3D5OA 5FUPA 1LOFC 2BVBA 2JECA 3JBG2 3KM5A 1CX4A 3U4SA 4F3JA 4Q4W1 4RQPA 1GP5A 1OOPC 4FTBA 3E97A 1G9AA 3DUIA 3T30A 1N3QA 2BRTA 4B7EA 2PHTA 4XFBA 4P9JA 4Q1RA 1GZCA 2WNUC 1ULPA 2AGSA 2WINB 3KLSA 1S0BA 3AMQA 2W08A 1UU4A 3SEPA 4HLTA 5BNOC 5FZLA 2RM23 5J1XA 4AQSA 2HWD2 1LOFA 1OF4A 3IM0A 2N7GA 3T0AA 1N1TA 4BLJA 3EJKA 4L9BA 3FFQA 4PLOA 3ZXJA 5FP4A 1SLLA 2QKDA 2WIIB 5C8CB 2C6SA 2GU9A 4ZS2A 2VPVA 3KD4A 5FYCA 1I1EA 1OLMA 1DLLA 1YFUA 2D3PA 4Q4Y2 1KRIA 5I0DA 4CU7A 2FZ1A 3PNAA 3VHRA 2F6BA 1UU5A 3S5QA 3KV5A 4OMDA 4X8NA 3GGLA 2AC1A 4J25A 5C9AA 4HN1A 3USUA 5JVVA 1D0GA 2VGDA 4LEJA 2VOKA 3BB6A 4OI1A 4UYBA 4PBPA 4TN7A 1RUE2 2XL7A 2Y0OA 3RJRA 1LECA 1QJX1 4AEJA 2J1VA 5FO8B 3MIEA 4PI0A 1R64A 3KHCA 1HJGA 1UW8A 2Z5WA 1AR82 2AYHA 5KHGA 3VBFC 3LSEA 1PVC3 3G6JB 1PX3A 4QPIC 3W58A 5FZOA 4Y5TA 2JDZA 2VECA 3CL1A 3OB8A 4JKLA 1C4RA 3E6BA 3PMEA 5JXIA 3PMSA 2PQSA 1YCIA 4MGZE 4DINB 2H0VA 2XVLA 1KJRA 3LD8A 1ZZ6A 1NLQA 3N36A 3OEBA 5A3LA 4L92A 4PF5A 5FYYA 5CKQA 4EWDA 3I2KA 1Y9GA 1J83A 1RB8G 4M0HA 1KEXA 2RDQA 1EV11 1UMIA 2WR9A 1UMZA 1POV0 1UYPA 2XWBB 3ETQA 4FTSA 4JRAA 4BE3A 1PX4A 4JGYC 2RS13 3SCFA 1HQWA 2HWC2 4F7ZA 3VBSC 4Y26A 3N7KA 5AC92 5GZEA 1OMIA 1GMMA 1QJU2 1NCRB 2QQWA 2WSVA 3VBOA 4Z8BA 4JDMA 3T08A 4AK3A 1LHWA 2QNKA 4JGZC 1XNBA 5A1LA 3FLTA 5C8CA 1OHFA 5HXMA 1OLQA 3OD0A 4QX2A 2GC3A 1S0JA 2WNVB 4ISRA 5BNPB 4JHZA 2I74A 4M4PA 3U78A 4L99A 5A7NA 4CEYC 3WP3A 1L7QA 1RUH3 4FPYA 3W5MA 1BEV2 3L2HA 4YW5A 3H9AA 1GZ9A 3LPGA 5FY1A 3WG3A 2VC9A 2ZA9A 3I2JA 1ZZCA 3M2MA 2VJXA 1ZZBA 2WT1A 3OUJA 4E9KA 2X5IC 4JHTA 4XAAA 4D7TA 2K46A 3LA3A 4LUMA 3GYDA 1UU6A 3ZN6B 4H7MA 3OJBA 1AR92 1QDCA 1FYUA 2XB6C 3MZHA 1V6LA 4KBZA 1UKGA 3DXUA 1MQTB 1GNYA 4P5HA 3ZYJB 3PL0A 1PO12 1LEMA 5E16A 4MO3M 2AUYA 4ZU5A 1UZZA 1UZWA 3D6EA 4QDQA 2EIDA 4DNYA 2JE7A 3ZXKA 2YG0A 4FPKA 3J9SA 2ATFA 3F2ZA 3N3HA 4IEXA 3QLQA 3RWKX 3K4AA 5DG1A 1MS8A 4XBNA 1NAEA 1N3PA 1C5IA 3NNGA 3WP6A 1F4HA 2RS31 2UYBA 2E7TA 1QJY3 1LCLA 5CKMA 4FFIA 4XILA 1CAWA 5FK8A 2ZX4A 1OVPA 2BVVA 2MNGA 3IN9A 1OFNA 4O9GA 2RMU2 3RFRA 3LWCA 5C5UA 4UAPA 3DEMA 1IKQA 2Y6FA 3C3VA 5GLVA 1U5XA 4DY3A 5FZGA 1NT0A 4CP1A 1RUI1 2RS12 1RUE3 1GANA 4P9YA 4JQRA 1TG7A 5KHHA 3AJZA 4CSWA 2B42B 5FOJB 1URXA 1J58A 1PVXA 4LO8A 2VQUA 2CY6A 2WZ8A 4GWJA 1SLAA 4KWLA 4CP0A 4DFSA 1ND2B 1COV1 2YY1A 4BQ4A 4CCLA 1QJZA 4E8DA 2QZ3A 1PK6C 1UOFA 4Q4X1 3ZX7A 3VN4A 5BV6A 2GC2A 1EYBA 2B9UA 2VAUA 4IE7A 1G9DA 1QQP1 2ZGUA 2VZRA 3GHMA 5F1RA 4XFHA 4E8CA 1GU3A 2YU1A 4XFCA 3DPRC 1QY4A 3BODA 4IERA 5JSRA 1FATA 5IATA 4CCCA 3POJA 5EYYA 5CYYA 2VMCA 1UNBA 3VZKA 1JYTA 3MBWA 2ORZA 1AYM1 3OTFA 4LK7A 2Q5TA 1TE1B 4NAMA 2JEMA 5FCCA 1BZWA 3OGVA 5EFUA 1SCSA 5T54A 1SLBA 4IV3C 2UWCA 4HETA 5GZCA 4DEVA 2PELA 4UFJA 3VKLA 3VBHB 3TNPB 5JSOA 4AGRA 2CAUA 3UGGA 4ONUA 1EPWA 5A7PA 1DYKA 4W65A 4AI8A 4Y4YA 5I8TA 2G9ZA 3OY8B 4KWJA 3GZTB 3POFA 4IXLA 3WEZA 4DRRA 5FFOC 1VMHA 4WM8C 2EIBA 3ZFEC 4EN8B 1L7LA 3AZYA 3DECA 2A3WA 5DUWA 2JG9C 2AACA 3VBUB 4AFCA 1G9BA 1RUI2 2GSYA 2WQZC 2WYFA 4Y22B 4XMAA 4IV3A 3BALA 4NHLA 1QNWA 2HYXA 4URTA 5LA2A 4OHWA 1VLNA 1CVNA 3RMXA 2YGLA 5JI9A 1NCQB 3NSTA 4F83A 2BDRA 1LOEA 1D4VB 4XOGA 4DB5A 2D6NA 1LGNA 4B8EA 1QF3A 5JOZA 3AZWA 4AEDC 1VIWB 3BN6A 3OPZA 4G4FA 4MGTA 2K0GA 2C1FA 4QDRA 4Y1VA 4UW3A 2WNVA 2A75A 1R083 2Y60A 3KT4A 4KH9A 2YV8A 3C2UA 5LEJA 1SBFA 4N53B 3THDA 3Q9OA 1W9YA 4AEKA 3BKZA 4QAWA 1CX1A 5F3IA 1ZX5A 4QHBA 3UGFA 1WMEA 1GNHA 4QM8A 5ANQA 5K8SA 3WVJA 2BGOA 5A33A 3BTZA 1RHI2 2XJQA 2XUMA 3VD4A 3FX3A 4XZUG 4CDXC 4Z1VA 4YGCA 2FDFA 3ORJA 1HXS2 4ATEA 4D7SA 3N7JA 1QJY2 5I93A 3KVBA 1OOPA 1T6GC 2YBKA 3MW4A 3OEAA 5L9BA 1J3RA 1ZREA 2VVDA 2VMEA 2VUDA 5IVBA 4RFT0 1DIWA 2YYOA 5A3WA 3PU8A 5DABA 2YBPA 1N3OA 4N43B 1LOBA 3IMNA 1Q8OA 3FMGA 1UXXX 3O5SA 4XJUA 3WNLA 5C8WA 1HQNA 3HD8B 4FT8A 2AR6A 1DQ2A 5E88A 1DGLA 3LF7A 1HRV1 1AL22 3CEWA 4ZU4A 1PO23 2EXJA 4HSJA 1UY2A 5FYHA 1RUG3 5IT6A 2WT0A 1V6KA 4Y1ZA 2J22A 2V4VA 5DDJ1 5T5OA 1IG0A 2VUAA 2WT2A 4K8FA 4UXAA 4OFGA 1H4HA 2DURA 2IXCA 2UWBA 2W3JA 4OZOA 3RZZA 3TNQA 3K48A 3DF0A 5HBAA 3O1VA 1O91A 1VR3A 2XWJB 4LMFA 3OF1A 1UOGA 1A6CA 4YWAA 4DXTA 4GA9A 2ADDA 5G05L 2Q4SA 3HR9A 3M70A 3EBRA 2X29A 4H55A 1O59A 4U2AA 1UYZA 3W21A 3EQEA 2O8OA 4YZ4A 5IVVA 2WFPA 4DO0A 1AR62 1LODA 1H1AA 2VTFA 4RSUA 3N9PA 1HN0A 1CIYA 1LKNA 4FPOB 5KXEA 5LA1A 2CDPA 3IIAA 1OURA 3RS6A 4FOYA 1WD3A 1CGPA 4YGDA 3O7OA 4RS5A 4ZU7A 4QKNA 3M3EA 1O3SA 1XE0A 3ENRA 3T4VA 2E6VA 4LBKA 3O0WA 4K40A 4KI5M 3A4UA 4UBHA 2JG8C 2LS6A 4NR1A 3ZSLA 1DQ1A 3OY8A 4PQQA 3WP5A 5AC91 1ASJ2 4CCDA 3MLJA 1RMU2 2OIIA 3TEYA 5FWJA 3V0BB 3U14A 1VBA2 4RHV3 3GBFA 2GMMA 2QDRA 1L3JA 1U12A 2HWD1 3LEGA 1M4WA 1HIXA 1LHNA 3HNMA 5E8AA 3ZM8A 5C3OA 1H1IA 1W6QB 3KQ4B 2AH2A 4JX0A 4QX8A 4AE2A 4BQWA 2P3YA 3VBRA 1AX1A 1H2MA 2W92A 3WG4A 1PVC2 4Q8KA 3LFMA 4CXWA 4IEWA 1UD1A 1OUXA 2D3SA 1WWYA 2DCYA 4GULA 1O3TA 1NY71 1KITA 1WCUA 2FCTA 3K4DA 4BK5A 2EIEA 1G8WA 3LKJA 2ZEZA 4OQ9A 4IGPA 4Z82A 3ZKUA 5DAWA 3ZPYA 4Q4X2 4XFFA 3SKJE 2XUEA 2IWGB 4CEYA 1XSRA 2EF6A 2JE9A 3OBAA 5SV5A 3U0ZA 5GLUA 5LA9A 2KD7A 3JB8A 5FBZA 1JW6A 3I3EA 4FXGB 1FOD3 5F32A 5D1IA 2Z2SB 5IAVA 2Q1FA 4JKMA 5CB7A 1PMJX 1DQ5A 1BMV2 2GDFA 2J1SA 4YM1A 4A45A 4Q4Y3 1WA4A 4Y1UA 3VZOA 5HPOA 1LNSA 5LA0A 5LWBA 2KM2A 4WM7A 1KDMA 4GAZA 3B69A 5FZBA 2OW4A 5AFBA 1SCRA 1VRBA 5FMOS 1EPZA 3TEZA 1W8ZA 1JOPA 2IUWA 2XBO3 3BOWA 2ETEA 4XDOA 1S0CA 1ND3A 4UBGA 2BBVA 2CU5A 1OH3A 2E9QA 2GP5A 3ABZA 4Q4W3 3MPBA 1H8TB 2F17A 3WV6A 3N9QA 5G04L 4GB32 2ZGPA 4BDVB 3FBYA 1IPKA 5D2AA 1UYXA 4PHZA 5C71A 3C8XA 4PIXA 1SPPB 4KBBA 2ENRA 3FHAA 1Y9QA 3LCPA 1LJ7A 3T2OA 3ZSJA 3VKFC 4AGGA 1ODMA 5F2WA 3LQCA 4CCEA 1OC1A 1J3QA 4F8AA 1JUHA 3EYPA 4FCAA 2HWF1 5L9RA 1YNAA 4YSFA 1YJLA 2XJPA 2W46A 2W5FA 3I7DA 1BK0A 1PNGA 2ZX1A 1Q8QA 1S0EA 4IGOA 5FMBA 5L19A 4CDWB 3JB4C 5A3MA 1JYXA 2X10A 5JXHA 1R1A2 5DAVA 1NLSA 2A1XA 2JDNA 4HG6B 3RRDA 4CCKA 4FAHA 1RUG1 4UW4A 2GAUA 2WC2A 1C8NA 3CMGA 4CDUC 1KGYA 1V6JA 2WWJA 3PVNA 3UKVA 3B7MA 5BYNA 4Y20B 4M01A 3WQ0A 5A33B 1PO11 1U5YA 2NPIA 2ZCWA 3K4ZA 1REDA 1BKZA 1EAH3 3WW4A 1OPOA 5FY7A 5LY1A 4XF0A 1GZTA 3KVAA 3INAA 3N9NA 3GZUC 4A3XA 5C3QA 3NAPC 1RIRA 2WZPP 5FY9A 5IVJA 4JDNA 1E5SA 3POSA 3RZMA 2WNUA 3MIBA 5FYZA 2OT7A 5K0UA 2XQXA 1Y9MA 1W8HA 3T0BA 2LRPA 4LO6B 1CZSA 1JS9A 2VMFA 3AMMA 4XABA 3RNSA 5KHKA 2B46X 2UU8A 3IAPA 1U5IA 1W2AX 4YG3A 3G7DA 1REFA 4MVTA 3ZFGB 2V73A 3BIEA 1ZBE2 3WX5A 4AQ6A 5EJ1B 5L7OA 1XOYA 1CZVA 1MR5A 1RVF2 2RMU1 2R062 3I2GA 1GZWA 4GH4C 4I02A 4AF9A 4YGBA 4BWOA 4EN0A 4N53A 5F2SA 5TSWA 5KBFA 2FDHA 3SISA 2JDUA 1ZBA3 3C7GA 4HVRA 1YC61 4A41A 1UX7A 2R1BA 2BU9A 4EJRA 4EWAA 5C33A 3BTYA 5C3PA 1G86A 3ZR5A 1VAMA 5CBLA 4IEOA 5I0SA 3SEEA 2A5ZA 2LALA 2ZHKA 5FPXA 3WDXA 3QH6A 2HWB2 4R9AA 1VALA 2B45X 3GCXA 3I2DA 4LKFA 2YB7A 3O1MA 1WMXA 1OI6A 2R6QA 1H2NA 2XH6A 1GP6A 5BNNA 4QPIA 4XBLA 5JMOA 3RZLA 3VZJA 3O0VA 5FO9B 3FUOA 1TEIA 1TNRA 2VMDA 4WBBA 1X9TA 3J7NA 4BH9A 3E5XA 2VW0A 2ZJCA 1A78A 5A3OA 1HB4A 2FMDA 4CEWC 3P5BA 1G7YA 3LOIA 5KC5A 4P00B 3MDPA 2ZX2A 1H4GA 1KXGA 4HONA 5LBBA 5F3CA 3T4HB 1PZ7A 1W8WA 2AEZA 3CJIB 5FYTA 2ZEYA 1JYCA 4XXPA 1PZ8A 4COUA 2WO3A 4XMIA 2VM9A 5DDJ2 5I0RA 2VZVA 2PFWA 2HJIA 2O0OA 3ELNA 2EXHA 3ZLIA 5C4WA 3ZVXA 5KR7A 1NY72 2VNVA 3AVSA 2RVAA 1FNYA 1KQRA 2DTWA 3AFGA 3DYMA 2PLV1 4JCKA 3WG2A 1AL23 4D0QA 5AFEA 2LUWA 3KF5A 3MI8A 5T5PA 1GICA 1JZ2A 4WVWA 1AR81 4EZHA 2RR11 3RVHA 3HIFA 4MHUA 2DVDA 4LBMA 4M3CE 1BBT1 5L9VA 3POYA 2VR4A 5LBCA 2W0XA 3M7AA 1J1LA 4ISQA 2WFF3 2Y64A 1BMV1 3DCQA 1LGBA 3ZPOA 3N9OA 2ET1A 1NA1B 3IAQA 3DV8A 2BUKA 4MGKE 3MFCA 4HANA 4NHMA 4Y1XA 1HB2A 1MZ6A 4GD4A 2E7AA 4IV1C 1CONA 1RHI3 1AR61 3AZXA 4M4RA 5KWRA 1HLCA 3ZDSA 1O3QA 4UT5A 1HV0A 3SC7X 4QX0A 5C4WB 4Q4V3 3HT2A 3OGSA 4K1YA 1PGSA 4NIIA 1S55A 1FI2A 3AP7A 3WNKA 4NHKA 3R4UA 2RJLA 5BNNB 1XBFA 4I0AA 1ZBA1 2PXJA 1PIV3 3GCWA 2BW8A 4OQ8A 4GB33 3GDBA 5FO7B 2VXRA 3AFKA 2HEYF 3PTRB 3ILRA 5KXDA 1UZYA 4YPJA 3J7HA 2ARBA 4PT6A 4XXAA 4TSVA 3CNAA 2HWE3 5CFDB 2VL4A 1SACA 3C7OA 2VZSA 3RMYA 1HRV2 1AR71 1CAVA 1US3A 2D6OX 1W28A 4OI2A 3U10A 1B35B 4XHXA 2GN7A 2X8KA 1I6XA 5A7WA 1JMUB 1ZZ8A 4ZZ8A 5SV8A 5A1AA 3B00A 3IIIA 1NXMA 4AR2A 1OD5A 1B09A 4ZONA 4OHZA 1VRH3 5FY0A 4KG0A 2ZZQA 5JAXA 3K77A 1YLLA 4LBNA 5L7OB 1NZIA 1DQ4A 2ILMA 4MX3A 4NWVA 3ACFA 4CDXA 4L11A 1ZNPA 3ZFGA 4ZKTB 1D2SA 2UWAA 3KHBA 3USSA 4XQ4A 3R05A 2JDPA 3ECQA 1WCSA 4HFSA 2PAEA 4AQTA 2HWB1 3VBOB 4N7UA 4IE5A 5FXZA 2Y6KA 3GBWA 2VVEA 4NMIA 1K42A 2QBXA 4NAOA 5FY5A 1HV1A 1QDOA 3IDCB 1RUD3 1GZWB 1WD4A 1F5FA 4HXCA 3P3PA 1OA2A 4BISA
chains in the Genus database with same CATH topology
5FZLA 2GP5A 3LDBA 5FY8A 4QX7A 5A3WA 3PU8A 4C8DA 2YBPA 5F37A 5F5AA 5FZKA 3N9QA 3PU3A 4HONA 5F3CA 5FP4A 5FWEA 2WWUA 4QXCA 5FYTA 5FYCA 5FZ1A 4BXFA 5FPVA 5FZHA 5IVEA 3OPTA 5A3TA 5FPBA 5E6HA 5F2WA 5FXVA 2VD7A 4LITA 4LIUA 5FJHA 5FYHA 3ZLIA 5FP3A 5FZGA 5KR7A 3KV5A 5A7WB 5IVBA 5FZAA 3AVSA 4AAPA 4DIQA 5FXXA 5FYUA 5LY2A 2Q8DA 3AVRA 4CSWA 4TN7A 4IGOA 4EZHA 4BU2A 4CCOA 3RVHA 5A3PA 5IVVA 5F39A 4Y3OA 5A7OA 4D6RA 5FZMA 4CCMA 4CCKA 4DO0A 4CCLA 5FZEA 4V2VA 4Y4RA 3KV6A 3N9PA 4QWNA 2WWJA 3PUAA 4CCNA 3KV4A 3ZPOA 3N9OA 3N9LA 5FZOA 5A3NA 2YU1A 3K3NA 5FPAA 5IVYA 3NJYA 2XXZA 3K2OA 5F3EA 5FYMA 3OPWA 5FY7A 4HOOA 5FZ4A 4GD4A 5A7SA 3LD8A 5LY1A 2XDVA 3N9MA 5FY4A 3KVAA 3N9NA 5FYYA 2YU2A 5IVJA 5FBJA 5FY9A 2Q8CA 5FP8A 5A1FA 4URAA 5FZCA 2OQ7A 5FPUA 5FZOB 5A7PA 3PUQA 5FYZA 2OQ6A 2OT7A 5A7QA 5FWJA 2OS2A 5FZ6A 2P5BA 2PXJA 5FZFA 4D6QA 2GP3A 5F5IA 5FYIA 2Q8EA 3PURA 2YBSA 3PTRB 4QX8A 5F3GA 5IVFA 4EZ4A 5IW0A 3AL6A 5A1LA 3AL5A 4UF0B 5IVCA 5FZDA 4ASKA 3K3OA 5FXWA 4NUBA 4AI9A 4EYUA 4QXBA 5FZ0A 4IGQA 3U78A 4GJYA 2YPDA 5FP9A 5F2SA 5A7NA 5A7WA 4QXHA 5ISLA 2OX0A 5CEHA 5FY1A 4IGPA 4CUGA 4CCJA 4LIVA 5FYVA 4GJZA 5FY0A 5FZ7A 4Y33A 5K4LA 2XUEA 4QU1A 5F5CA 5LW9A 4LXLA 5F3IA 5FYBA 5FJKA 4UF0A 3PDQA 5F32A 5FP7A 3KV9A 5FUPA 5FYSA 5FZ9A 5ANQA 5FZ3A 3PUSA 3U4SA 3DXUA 4E4HA 5FPLA 5FV3A 4XDPA 2W2IA 3DXTA 3UYJA 5LWBA 5FXZA 5FZ8A 4GAZA 5FZIA 5FZBA 5FUNA 2XMLA 5IWFA 1VRBA 5FY5A 3KVBA 5A80A 4D6SA 4V2WA 2YBKA 4BISA 4XDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FZL A;  2GP5 A;  3LDB A;  5FY8 A;  4QX7 A;  5A3W A;  3PU8 A;  4C8D A;  2YBP A;  5F37 A;  5F5A A;  5FZK A;  3N9Q A;  3PU3 A;  4HON A;  5F3C A;  5FP4 A;  5FWE A;  2WWU A;  4QXC A;  5FYT A;  5FYC A;  5FZ1 A;  4BXF A;  5FPV A;  5FZH A;  5IVE A;  3OPT A;  5A3T A;  5FPB A;  5E6H A;  5F2W A;  5FXV A;  2VD7 A;  4LIT A;  4LIU A;  5FJH A;  5FYH A;  3ZLI A;  5FP3 A;  5FZG A;  5KR7 A;  3KV5 A;  5A7W B;  5IVB A;  5FZA A;  3AVS A;  4AAP A;  4DIQ A;  5FXX A;  5FYU A;  5LY2 A;  2Q8D A;  3AVR A;  4CSW A;  4TN7 A;  4IGO A;  4EZH A;  4BU2 A;  4CCO A;  3RVH A;  5A3P A;  5IVV A;  5F39 A;  4Y3O A;  5A7O A;  4D6R A;  5FZM A;  4CCM A;  4CCK A;  4DO0 A;  4CCL A;  5FZE A;  4V2V A;  4Y4R A;  3KV6 A;  3N9P A;  4QWN A;  2WWJ A;  3PUA A;  4CCN A;  3KV4 A;  3ZPO A;  3N9O A;  3N9L A;  5FZO A;  5A3N A;  2YU1 A;  3K3N A;  5FPA A;  5IVY A;  3NJY A;  2XXZ A;  3K2O A;  5F3E A;  5FYM A;  3OPW A;  5FY7 A;  4HOO A;  5FZ4 A;  4GD4 A;  5A7S A;  3LD8 A;  5LY1 A;  2XDV A;  3N9M A;  5FY4 A;  3KVA A;  3N9N A;  5FYY A;  2YU2 A;  5IVJ A;  5FBJ A;  5FY9 A;  2Q8C A;  5FP8 A;  5A1F A;  4URA A;  5FZC A;  2OQ7 A;  5FPU A;  5FZO B;  5A7P A;  3PUQ A;  5FYZ A;  2OQ6 A;  2OT7 A;  5A7Q A;  5FWJ A;  2OS2 A;  5FZ6 A;  2P5B A;  2PXJ A;  5FZF A;  4D6Q A;  2GP3 A;  5F5I A;  5FYI A;  2Q8E A;  3PUR A;  2YBS A;  3PTR B;  4QX8 A;  5F3G A;  5IVF A;  4EZ4 A;  5IW0 A;  3AL6 A;  5A1L A;  3AL5 A;  4UF0 B;  5IVC A;  5FZD A;  4ASK A;  3K3O A;  5FXW A;  4NUB A;  4AI9 A;  4EYU A;  4QXB A;  5FZ0 A;  4IGQ A;  3U78 A;  4GJY A;  2YPD A;  5FP9 A;  5F2S A;  5A7N A;  5A7W A;  4QXH A;  5ISL A;  2OX0 A;  5CEH A;  5FY1 A;  4IGP A;  4CUG A;  4CCJ A;  4LIV A;  5FYV A;  4GJZ A;  5FY0 A;  5FZ7 A;  4Y33 A;  5K4L A;  2XUE A;  4QU1 A;  5F5C A;  5LW9 A;  4LXL A;  5F3I A;  5FYB A;  5FJK A;  4UF0 A;  3PDQ A;  5F32 A;  5FP7 A;  3KV9 A;  5FUP A;  5FYS A;  5FZ9 A;  5ANQ A;  5FZ3 A;  3PUS A;  3U4S A;  3DXU A;  4E4H A;  5FPL A;  5FV3 A;  4XDP A;  2W2I A;  3DXT A;  3UYJ A;  5LWB A;  5FXZ A;  5FZ8 A;  4GAZ A;  5FZI A;  5FZB A;  5FUN A;  2XML A;  5IWF A;  1VRB A;  5FY5 A;  3KVB A;  5A80 A;  4D6S A;  4V2W A;  2YBK A;  4BIS A;  4XDO A; 
#chains in the Genus database with same CATH topology
 4GMP 0;  3ZO0 B;  5LEK A;  3RG0 A;  1O4T A;  2WZR 2;  4UFM A;  3UJQ A;  4KNC A;  5JI7 A;  1AJO A;  2WO1 A;  4A4A A;  4MGY E;  1DP0 A;  3IT8 A;  1VBA 3;  1AXZ A;  1K45 A;  1S2K A;  2V5Y A;  4KGG A;  2VUC A;  1N47 A;  1H2L A;  1QXP A;  2XL9 A;  3VB9 A;  1APN A;  1L7R A;  3GJB A;  4A6S A;  2EAL A;  4MGS A;  1JYW A;  3I49 A;  2W87 A;  1UXZ A;  2WN2 A;  2R1D A;  2SLI A;  2NP0 A;  2Z42 A;  1LOA A;  4MGQ A;  4DY5 A;  2GN3 A;  2PQQ A;  2LTN A;  2W1W A;  1Q8S A;  2WN3 A;  1JUI A;  3WDW A;  4C1W A;  2G9G A;  4RN5 A;  3V65 A;  3SXW A;  3T0D A;  3ZSE A;  1NUK A;  1ZRR A;  4CYD A;  1O5L A;  3WCR A;  3O0X A;  2W9X A;  2JD9 A;  3RYP A;  1C3H A;  3D3A A;  1JHN A;  1FAY A;  1K5M C;  4XYX A;  1W0P A;  3AP9 A;  4OVE A;  1DBN A;  1UWW A;  2DU0 A;  5A7O A;  3U75 A;  3ZFF B;  4MET A;  4W50 A;  3USU B;  4JGY B;  2OXB A;  5CKN A;  3MUY 1;  5FZE A;  1CAU A;  1YQ8 A;  2V72 A;  4UFH A;  3VDD B;  2RS1 1;  4LKS A;  4MXW A;  4XF3 A;  1K12 A;  3BYW A;  4AFA A;  1OPM A;  4OHX A;  1IPJ A;  1NCQ A;  1QH7 A;  2JIC A;  4RD7 A;  2ZXQ A;  5M0T A;  2GC1 A;  1OSG A;  3JBG 1;  3M4F A;  4JGZ B;  1Q8P A;  3WHT A;  1WLD A;  3CDZ B;  1AR9 1;  1HX6 A;  1QJE A;  3N35 A;  4N8M A;  5A7S A;  1VP6 A;  5FRE A;  2RM2 1;  5ABJ C;  2WNV C;  1UMH A;  2NQY A;  1RUC 2;  4P5Y A;  1RUG 2;  3R0R A;  3SCG A;  4DMI A;  2P37 A;  3EHK A;  5F6L B;  4RR3 B;  4K1Z A;  3RJ2 X;  1IQD C;  5I91 A;  3MUZ 1;  1OKO A;  4DRV A;  2J1T A;  1OT5 A;  3VV1 A;  1HRI 3;  2WUH A;  4CDQ C;  1VBE 1;  2PMW B;  4PCR A;  2A73 B;  1QIQ A;  2E53 A;  1JZ7 A;  4GQ7 A;  3ZYI B;  1PNF A;  4YG6 A;  5FZF A;  4I3P A;  2R0H A;  1RVF 1;  4Y24 A;  2E51 A;  1GNZ A;  3KF3 A;  5LRR A;  5KXC A;  1AR6 3;  1Q5O A;  5FQ0 A;  1OA3 A;  3T2P A;  1DF0 A;  2NMN A;  1ND3 B;  4PDW B;  1DZR A;  1MQT C;  3LB9 A;  3TBD A;  4AFB A;  4AI9 A;  1OQE A;  2RS5 2;  4R8H A;  1SBD A;  2PHF A;  5CFC B;  2P3J A;  1DQ6 A;  3OBT A;  5JPM B;  2GNT A;  1DGW X;  3N7L A;  2PHU A;  4WM7 B;  1PZ9 A;  1TME 3;  3KZ4 C;  1WLW A;  1NQD A;  5DMY A;  3SH3 A;  1JZ4 A;  1H6Y A;  1UKR A;  4LO4 B;  5AC9 3;  2BNO A;  4CRQ A;  2IC1 A;  5FK7 A;  2P17 A;  3BGA A;  3RGB A;  1G9F A;  4V1P A;  3U07 A;  4QX1 A;  4XQW A;  2D3R A;  3FC0 A;  4BYY A;  1UZV A;  1SFY A;  1DYO A;  3NV4 A;  2H0B A;  1R08 2;  4OUM A;  1NOV A;  4IEZ A;  5CIR A;  2X5I A;  2LRO A;  3MW2 A;  4MSV A;  3VL9 A;  1F15 A;  5A6Y A;  2GH2 A;  1UQX A;  4FFF A;  1UO9 A;  1HQL A;  3ALQ A;  3K75 B;  1XXN A;  4LHN A;  4XF1 A;  3UK9 A;  2EAK A;  1RGS A;  5EJ3 A;  4Q26 A;  2Y26 A;  1HXS 3;  3O1O A;  2XR4 A;  3AXE A;  3VDA A;  1EY2 A;  1OKQ A;  1AR8 3;  5EV7 A;  2Y34 A;  1UL9 A;  3B93 A;  1ND2 C;  2RDR A;  5J09 A;  4FPJ A;  4YZ1 A;  2JXA A;  1XNT A;  1MZ5 A;  1C8M 1;  4LOR A;  2I07 B;  2EA7 A;  3WSO A;  2ES3 A;  2D98 A;  1G9C A;  2R06 1;  3C7E A;  1ULC A;  5LCW L;  1W0O A;  2VH9 A;  3DPR B;  5D8A C;  5H9Q A;  1MS3 A;  2HH9 A;  4Q4Y 1;  3LE0 A;  3V0A B;  5FYU A;  2QJV A;  2Y8K A;  1LHU A;  2VU9 A;  3RZK A;  4HT1 T;  4IV3 B;  1LGC A;  4L97 A;  3DL3 A;  3VBH C;  1TMF 2;  5H9P A;  2OPW A;  4AHW A;  4NHX A;  4P9G A;  4RGG A;  2K2S A;  1LES A;  2WS9 1;  5JWP A;  3VZM A;  5EWS A;  5FKB A;  1US2 A;  2VCM A;  1SLT A;  1CR7 A;  2HWD 3;  3MO4 A;  3VD7 A;  2BNN A;  3UV9 A;  4B1M A;  3A7Q A;  4YLZ A;  1UCX A;  1GYK A;  5A3N A;  3NVC A;  2WO2 A;  2VG9 A;  4IW3 A;  1WW7 A;  2ZAB A;  2JB8 A;  4LLO A;  4NJ4 A;  2VQA A;  2VW1 A;  4OUL A;  1ULF A;  4K20 A;  4YM2 A;  2IXH A;  3MFA A;  2OKX A;  5FZ4 A;  3OUH A;  4N43 A;  3HVD A;  4QPG C;  2QQJ A;  2DTY A;  3THC A;  4DPN A;  1RUO A;  2DYC A;  4P9L A;  5CVR A;  3IKW A;  2ZHN A;  5A1F A;  2E7Q A;  2VOV A;  1IQA A;  5FZO B;  3WT3 A;  2GME A;  5F8P A;  1C8M 2;  3HWJ A;  1RUJ 1;  1VBE 3;  5A32 B;  4EE2 A;  1VBC 1;  4RFR B;  4RQP C;  4UFK A;  1SBE A;  1TMF 3;  2RDN A;  2FHR A;  2E31 A;  3HEI A;  1GWM A;  5I0U A;  1JU3 A;  4RR3 A;  4C91 A;  3P1I A;  2ZKN A;  2DVB A;  5IVF A;  5CAZ A;  2ARC A;  3AL5 A;  4G9S B;  1FMD 3;  2DUO A;  2OUH A;  2FBE A;  4ASL A;  3UGH A;  3I2F A;  2VNG A;  4CDX B;  4QXB A;  1H1M A;  2Q1Z B;  3KGL A;  4XFI A;  1SFP A;  1PO1 3;  1O7F A;  4TLF A;  1AYN 2;  4XAC A;  2D5F A;  5EXO A;  5FP9 A;  1FPN 1;  1N1S A;  3MIF A;  4L8Q A;  3T2T A;  3WD5 A;  5JOY A;  1TNF A;  3NRU A;  4AVS A;  3WQ1 A;  4OYU A;  4LQR A;  2VUJ A;  4W4Z A;  1RL3 A;  3AKT A;  5FZ7 A;  2VZ3 A;  4L0P A;  1LR5 A;  1W8U A;  2A3X A;  5F5C A;  4B4P A;  2UY9 A;  4XFA A;  2VCA A;  4Y22 A;  3AKS A;  1ENQ A;  5JZG C;  1RXF A;  5BXX A;  1QU0 A;  1W6M B;  5GZG A;  4PLN A;  2W94 A;  1JYV A;  3EMR A;  1W8O A;  2ZKL A;  3PJQ A;  4ET7 A;  5C9A B;  1ENX A;  2OPK A;  2G4I A;  3FE5 A;  4NN0 A;  1MVE A;  2ZGT A;  2VOX A;  4ORF A;  3ZXE A;  2F4P A;  4D69 A;  1W2O A;  5J7M A;  3H8O A;  2XML A;  4AL9 A;  1T6B X;  2B4K A;  1S0I A;  3QAC A;  4YG0 A;  1MQT A;  1HW5 A;  1WMF A;  4E4S A;  1ACC A;  3WNO A;  2HLE A;  3OGR A;  4C8D A;  4CPB D;  4QX7 A;  3WDV A;  4XEZ A;  4AVC A;  3VZN A;  4EV0 A;  4FPC A;  2W47 A;  4UW6 A;  1MS9 A;  2HWC 3;  3H1M A;  3JD7 2;  2ZGL A;  4JKK A;  4DXS A;  2IZW A;  4R4X A;  5BUV A;  4AVA A;  4EQV A;  1AR7 2;  2VUL A;  4LR4 A;  5FP3 A;  3ZYB A;  3OSD A;  2WNU B;  4GWN A;  3X29 B;  1RUH 2;  4EN6 B;  2J1U A;  1LED A;  4HPK A;  3S57 A;  1M06 G;  2PHX A;  2RJK A;  5GJ6 A;  4LHK A;  2TNF A;  1VBD 3;  5ACA 3;  2BWC A;  2H6B A;  5EQU A;  4PLM A;  2O8Q A;  3S7I A;  3ACG A;  3AKR A;  2ZGR A;  3ACL A;  3CZJ A;  3IDA A;  3PIG A;  3Q8A A;  5IFT A;  1HRI 2;  5C8C C;  4C90 A;  1PM4 A;  2BPA 2;  4QB2 A;  3S5A A;  3U37 A;  3ZOI A;  1BHG A;  3WR0 A;  4QB1 A;  3SHR A;  4YM3 A;  4Q27 A;  4S2G A;  2W1U A;  1RUJ 3;  4XAE A;  3VKM A;  4FXK B;  1B35 A;  1W6N B;  2O14 A;  3OCP A;  4IND A;  5FYM A;  4H3W A;  3I3B A;  1C1L A;  1BXH A;  2DUP A;  1RHI 1;  4QQ2 A;  2R30 A;  5T52 A;  1R09 2;  1V9U 1;  2J1A A;  2P4E A;  3ILF A;  2ORX A;  4IEY A;  5E89 A;  5GLT A;  1A8M A;  1SLI A;  3ZN5 A;  2EXI A;  5K9Y A;  3RZG A;  3DKQ A;  4CP9 B;  1XYP A;  1BVV A;  2VE1 A;  5E1R A;  2WZR 3;  1OBN A;  4E2S A;  3GZE A;  3ME2 A;  4ES9 A;  1A8D A;  4FPH A;  4XW3 A;  1KS5 A;  4I0B A;  4B1L A;  1WW5 A;  2Q8E A;  2YBS A;  2RM2 2;  3NV3 A;  2DUQ A;  2VCB A;  4QDS A;  4LUK A;  1Q56 A;  1IS6 A;  4PBO A;  3W59 A;  3OD4 A;  2MEV 1;  2E32 A;  4YW3 A;  1W6O A;  3VHO A;  4I01 A;  3WCS A;  3WDU A;  4BA6 A;  2JKX A;  5FIX A;  3RZJ A;  4QXH A;  1X8E A;  3FFZ A;  4AHX A;  1XU2 A;  1TZO A;  3WQB A;  1JZ8 A;  3VBF A;  1EV1 3;  2Y33 A;  4AGV A;  1AYN 1;  2QZ2 A;  4QU1 A;  2ZML A;  4LT5 A;  3NAP A;  1W6M A;  3POI A;  5EP9 A;  2DCJ A;  2YDE A;  5HV4 A;  4S2F A;  1NCR C;  1YEW A;  4BM8 A;  1D4M 3;  3LFI A;  4QQH A;  4DXZ A;  3PDQ A;  3I3M A;  2FQP A;  2JDA A;  5J3U A;  2WLP A;  5JMC A;  2ZHL A;  2D93 A;  2VCC A;  5JDB A;  4PIZ A;  4H2A A;  5HI0 A;  5FV3 A;  1QQP 2;  2DCZ A;  4COY A;  5LK5 A;  4I2O A;  2Q30 A;  5L73 A;  4LBJ A;  5FZ8 A;  2P3I A;  4XVH A;  2YMZ A;  5IYY A;  1XND A;  2ZZJ A;  1YRZ A;  4QGN A;  4JGY A;  4DUW A;  1YO8 A;  1ZRI A;  4N9H A;  2WJS A;  4KMQ A;  1DZT A;  3ZSM A;  1NQJ A;  4I09 A;  1J59 A;  1DYP A;  2D40 A;  3LDB A;  1ZZ7 A;  2WL1 A;  1Q3E A;  5F5A A;  1JBC A;  3AZZ A;  3WW1 A;  4CUB A;  2MHF A;  3PU3 A;  1XE7 A;  1I5Z A;  1VRH 2;  3JBG 3;  1X9P A;  2XHN A;  4R9B A;  4AYU A;  4YGE A;  4FAG A;  5FZ1 A;  4CDU B;  1YIP A;  3B94 A;  2GC0 A;  3LA7 A;  1PVC 1;  3M1H A;  1XRU A;  1V6M A;  4YW4 A;  5GAL A;  3APB A;  3E6C C;  1MZF A;  3HAG A;  5FXV A;  1QJU 1;  4RGA A;  2OA2 A;  4IEQ A;  4DIQ A;  4DEQ A;  3HN1 A;  3KT7 A;  1QJX 3;  3RYR A;  3FN9 A;  1ZA4 A;  3PVE A;  2RS3 2;  2Q8D A;  4MUV A;  1OQ1 A;  2CHH A;  4B4R A;  2JX9 A;  3OBZ A;  3M3O A;  2WNE A;  2ZS6 B;  5EPA A;  4A7Z A;  5A70 A;  3CIH A;  1GBG A;  4CCO A;  1QMJ A;  1XNA A;  4Q0Q A;  4Q1P A;  1GWK A;  4XC9 A;  5IJR A;  1RUD 1;  2HBU A;  3AB0 A;  1JXN A;  3W9A A;  3KV6 A;  4Q4V 2;  1DHK B;  2TEP A;  1RUH 1;  4XZP A;  3QCW A;  3N9L A;  3SIT A;  4B7K A;  1Z7S 1;  3O1S A;  1QOS A;  3ZFG C;  5HCH A;  3VBU A;  1AX2 A;  2QQM A;  2QQI A;  2XDV A;  4PIY A;  5FY4 A;  4CDW A;  3KMH A;  1BBT 2;  3B01 A;  2WAO A;  1V00 A;  4JGZ A;  4Z07 A;  3VL8 A;  3I59 A;  2ZTN A;  1AXY A;  2DDU A;  3FLP A;  4SBV A;  3ZYG A;  5FZC A;  2OQ7 A;  2WAA A;  4S2D A;  5FPU A;  5JCT A;  4TZD A;  3MHZ A;  1R09 1;  4P14 A;  2Y38 A;  1LEN A;  1XU1 A;  2TBV A;  3OYW B;  4GIQ A;  4LA2 A;  2LW8 A;  4Q0S A;  2D6M A;  2QE3 A;  5DG2 A;  4Q8L A;  1AXK A;  1QEX A;  2JD4 A;  5DAQ A;  5JUV A;  2Z69 A;  4AFM A;  3WF2 A;  3AJY A;  2AEY A;  4FFG A;  3CBN A;  4WZC A;  3E5Q A;  3Q8F A;  3WQ7 A;  4MZU A;  4DXR A;  2OZJ A;  3FBM A;  4LTA A;  4UF0 B;  2ZGM A;  5F9T A;  5KHI A;  1ODN A;  4ASK A;  2WBK A;  1X8M A;  4FBF A;  2DBI A;  2GNM A;  4QPW A;  2YPD A;  3MEP A;  2R04 3;  2D97 A;  5JR7 B;  4QD2 A;  1WBF A;  2A71 A;  5ISL A;  2OX0 A;  2FCU A;  1H6X A;  1FV3 A;  3U1X A;  4KGQ A;  3T1L A;  3D0J A;  2R49 A;  4CP2 A;  2BER A;  3J26 N;  3H3U A;  1UY3 A;  1C5H A;  1KS4 A;  3J8F 3;  3AMH A;  1W99 A;  3VHP A;  4A3Z A;  1S2E A;  1CZT A;  1HKD A;  4QMA A;  4OUE A;  2PHR A;  5DZG A;  5FYB A;  4UF0 A;  2JG9 B;  4YZ3 A;  4K8R B;  4OI4 A;  5J48 A;  3CHX A;  2C0Z A;  1QKQ A;  1RVF 3;  1W0N A;  4AVB A;  1S1A A;  1V6I A;  1S0D A;  2ERF A;  4GWM A;  3J4U H;  1PGW 2;  3LEI A;  4HKO A;  3DXT A;  1W04 A;  3KWV A;  3EXU A;  3WF1 A;  3UYJ A;  3O12 A;  4BQ2 A;  3R4S A;  4BIF A;  3B02 A;  3OYW A;  5FZI A;  1VB4 A;  1E5I A;  5A3U A;  5FAX A;  1OF3 A;  3LSD A;  4N90 A;  4NO4 A;  1KDK A;  5C5T A;  4YM0 A;  2EVX A;  2Y6H A;  3PUH A;  2DWR A;  1QXR A;  4WZF A;  5CFD A;  3JD7 1;  1MS4 A;  5FY8 A;  1UF2 C;  5FQ0 B;  3GZA A;  5FZK A;  3D4K A;  3IZO A;  4LHL A;  4Z92 B;  3B9C A;  1RUE 1;  4QXC A;  5DUU A;  5FPV A;  3N4M A;  3H3Z A;  4QGL A;  3VBF B;  1Q8V A;  2R32 A;  2R07 1;  4QPI B;  3VBS A;  1W2U A;  2EIC A;  2ARX A;  1DU3 D;  1GOG A;  1JU4 A;  1YXW A;  3FLR A;  2A6Z A;  3H3L A;  5IK5 A;  4IES A;  4C0H A;  2A6X A;  5FMO L;  3BUC A;  5LZ6 A;  2Z79 A;  3ZN6 A;  2A6W A;  4FOV A;  2XQR A;  5JXG A;  3O1U A;  3Q8C A;  4BME A;  4N43 C;  4BU2 A;  1FPN 2;  1VAV A;  1DGR A;  3ZYR A;  3J8F 1;  1CAX A;  3GXU A;  1AJK A;  4YW7 A;  3T1M A;  3I4I A;  3VBS B;  1RIN A;  1YJK A;  3ZSK A;  1XB9 A;  1KD7 A;  1TQ5 A;  5DPN A;  4KU8 A;  5GZD A;  1OA4 A;  2E26 A;  5FPA A;  5IVY A;  4WVM B;  3TEX A;  4DZG A;  2IXL A;  4YRD A;  5B4X A;  4D94 A;  5HCA A;  2BOI A;  1F35 A;  4XUP A;  1XC6 A;  1XYN A;  5J96 B;  1GQG A;  2GZW A;  2JG9 A;  1IS4 A;  2XVK A;  4R9D A;  5BNP C;  3M3I A;  1AUY A;  2YU2 A;  1B35 C;  4K21 A;  4QPY A;  1NA1 A;  4CEY B;  2BJS A;  4C1X A;  1W6N A;  2YC4 A;  1OUS A;  2BGC A;  4FVV A;  3V56 A;  2O1Q A;  4BCU A;  3RZH A;  1UOJ A;  4GAL A;  1VB2 A;  4ASM B;  4RHV 1;  3PIJ A;  2PAM A;  1LHV A;  4LOS A;  3SLI A;  1F2N A;  3D82 A;  3WNX A;  2GP3 A;  2PHW A;  1JOJ A;  5L7O C;  2AZ5 A;  2VNO A;  3JUU A;  4CXY A;  1DGW A;  1SDW A;  4TLG A;  3C7H A;  3PUR A;  3GBG A;  1SG3 A;  1CN1 A;  2RG4 A;  5HCF A;  1IOA A;  1V6N A;  2QUO A;  4Y1Y A;  1YI7 A;  3K3O A;  1R08 1;  3NL1 A;  4K3U A;  4QU2 A;  4A6O A;  1AL2 1;  1FOD 2;  2JG8 B;  2ARA A;  4IGQ A;  2VZP A;  4KQ7 A;  5GLZ A;  1GUI A;  3TOJ A;  3IB3 A;  4KU7 A;  3ZIX A;  1FPN 3;  2CTV A;  1HRI 1;  2ZGO A;  1CJD A;  3I2O A;  2BQP A;  2VOW A;  4FOW A;  4TWT A;  5FYV A;  3ZIW A;  4YZ2 A;  2VVF A;  4OUS A;  5K7P A;  4I3G A;  4P9X A;  1IHM A;  5FYS A;  5FZ9 A;  2XOM A;  2BZD A;  5J36 A;  4X8P A;  1F9K A;  4E4H A;  3BVC A;  2W2I A;  1D4M 2;  4IE4 A;  3CKH A;  5JIA A;  2ZX3 A;  1SZB A;  2VMG A;  4AED A;  4GZ9 A;  5EJZ B;  4TTG A;  4NID A;  2OZ6 A;  2NMO A;  3HBK A;  5FUN A;  4AOC A;  4YW1 A;  5A80 A;  4W6Y A;  4RHV 2;  3TYJ A;  5I8Y A;  1YQC A;  5J98 B;  3AZV A;  5CU1 A;  1ONA A;  3AMN A;  3ACH A;  2VBP A;  1ASJ 3;  2X09 A;  1H9P A;  5FLI A;  2BEO A;  3WUC A;  3TN9 2;  4ZXE A;  3A0K A;  2VOT A;  3AC0 A;  3CQO A;  3ZFF C;  4YAR A;  3ILN A;  1RUJ 2;  4NPL A;  5BNO A;  1PK6 B;  2G1M A;  3DYP A;  4QPG A;  3VDD C;  5A3T A;  5IVE A;  5FPB A;  3AP5 A;  4G3Y C;  4BHP A;  1RYY A;  4AHY A;  4OHY A;  2VQ0 A;  2V09 A;  4XE9 A;  1JN2 P;  5FZA A;  1CQ9 A;  2GAL A;  2R04 1;  3GJA A;  1VBD 2;  5ACA 2;  3WG1 A;  1YIF A;  2FD8 A;  3J8F 2;  3PUI A;  4XJW A;  2UY8 A;  1YWK A;  4DUX A;  3BCW A;  3HPN A;  2WQ8 A;  4FPG A;  1H8T C;  5BY5 A;  1FMD 1;  5LAS A;  3GAL A;  4IEP A;  3ROU A;  4HPK B;  1GWL A;  1WW4 A;  4FPF A;  2NN8 A;  4RR3 C;  3UJO A;  4MXV A;  4A7K A;  5T5J A;  4D6R A;  1C1F A;  4Y5Z 0;  4COV A;  1O5U A;  2ARE A;  2JJ6 A;  2VMI A;  3AKP A;  3BOP A;  3NJV A;  1Q43 A;  1VBB 3;  2W1Q A;  4XCB A;  4M3C F;  5DQ0 A;  3R6S A;  1VBC 3;  3KV4 A;  5A6Q A;  5DUX A;  4XIO A;  3SMH A;  2ZOE B;  2D6L X;  1POV 1;  4W8J A;  3BI3 A;  2VZU A;  4QX3 A;  4YVW C;  4CP9 A;  1IKP A;  2VZ1 A;  3NJY A;  5JZG A;  3ST7 A;  1SDD B;  3AMP A;  1ND3 C;  4HOO A;  1CAW B;  2HWE 1;  2JWP A;  2XLA A;  4XPV A;  3N9M A;  2B9V A;  3QH7 A;  2WA3 A;  1WW6 A;  1NCQ C;  1MS5 A;  1ZBE 1;  2XGX A;  4B4Q A;  3NNL A;  4I30 A;  2VXJ A;  5FRA A;  1VRH 1;  2JDY A;  1KFX L;  4TXW A;  2BGP A;  3EO6 A;  2G19 A;  3OGJ A;  2P6C A;  1WLT A;  2D5H A;  2XVG A;  3Q8B A;  5A7Q A;  4YYO A;  2RV9 A;  3UKN A;  1KJL A;  2FDI A;  1IG3 A;  3OG2 A;  3BPS A;  4HSL A;  5ERL A;  2VZO A;  4NIA A;  4QHO A;  2IVJ A;  3HQX A;  4Y5S A;  1AR7 3;  3HOB A;  1QOT A;  1AYM 2;  4XTM A;  2WRA A;  4BQ5 A;  1FOD 1;  4EZ4 A;  4W6W A;  3AL6 A;  3IDE A;  3AYE A;  3PHM A;  4FFH A;  4FI9 A;  5IVC A;  2ZBJ A;  5FXW A;  4NUB A;  3TAY A;  5FTT C;  5JSP A;  2WA4 A;  4PI2 A;  5FZ0 A;  4RS5 B;  3BPZ A;  1ZZ9 A;  1BQP A;  3BU7 A;  2Y0I A;  1JOB A;  3FWE A;  4D3W A;  4PQ9 A;  1COV 2;  2E63 A;  4K9S A;  2WS9 2;  2WO7 A;  3ZXG A;  3Q8E A;  2YHJ A;  1I5P A;  2WKK A;  3LA2 A;  5K4L A;  4AW7 A;  5I0T A;  1FMD 2;  4CU8 A;  3WF3 A;  3O1T A;  2R7E B;  1H8T A;  2D7F A;  4BJ0 A;  3I3Q A;  5FPZ A;  3KV9 A;  3C7F A;  5DAP A;  1XJA A;  3PUS A;  5FZ3 A;  4ZPI A;  1J84 A;  1ULO A;  1BK1 A;  2Q1M A;  1W8T A;  3KGZ A;  3H50 A;  3IDB B;  5FPL A;  1AF9 A;  1RUI 3;  4YVS B;  4AAX A;  3FUQ A;  2XBO 1;  1CD3 G;  1W3V A;  3PTY A;  2ZEX A;  1W39 A;  4QQO A;  1LUL A;  2YXS A;  1YYN A;  5K0U C;  1FV2 A;  3VUO A;  4D6S A;  3ETP A;  4V2W A;  1AHS A;  4XUN A;  1UPI A;  1MAC A;  3TN9 1;  5LB6 A;  3NO8 A;  1DQ0 A;  3LEM A;  2HWC 1;  3ON7 A;  1H8V A;  4O7X A;  3ZXD A;  3NMB A;  3S7E A;  1UAI A;  2C24 A;  3VBR B;  1E5H A;  5EHD A;  1Z78 A;  2C9K A;  2HEV F;  2P34 A;  3ZKY A;  1W9W A;  2XLG A;  4LBL A;  4FQZ A;  4M0N A;  4MV2 A;  5DUV A;  4A2U A;  5JPN B;  3LOB A;  3KCC A;  2J1R A;  3KCY A;  2WYS A;  1ENR A;  3AM2 A;  3NNF A;  1N1V A;  4IET A;  4MYE A;  5FZH A;  3SCH A;  3TRS B;  1OOP B;  1RJ8 A;  3H1Y A;  1W06 A;  3BU0 A;  1YQ2 A;  4ZZ5 A;  4LLF A;  1VBB 1;  3NQH A;  2JIG A;  2P1B A;  4LIU A;  3RI9 A;  2BYV E;  2OUJ A;  4XET A;  5CZK A;  3UKT A;  5A32 A;  5IFP A;  1TME 1;  4ARX A;  4XFG A;  2OYZ A;  4ARY A;  2XHK A;  3AKQ A;  4AAP A;  4WV8 A;  5FXX A;  2PAK A;  3NJZ A;  3OUI A;  2JEN A;  2Y6J A;  3SQO A;  4QPG B;  4NIH A;  1CPN A;  2ZGN A;  3MV0 1;  5LY2 A;  1W90 A;  4A44 A;  5DZE A;  5BNO B;  1WMD A;  1WLC A;  3IWZ A;  4AI0 A;  1YFY A;  2B5H A;  5LK7 B;  1LRH A;  4ZS3 A;  4P08 A;  2CWM A;  2HWF 3;  3O14 A;  2JDM A;  3M3Q A;  5CA6 A;  4RGK A;  3VZL A;  2CV6 A;  5FDB A;  2CWS A;  2WNO A;  4KL1 A;  4V2V A;  3WDT A;  4LA3 A;  3WY6 A;  4EN9 B;  4CCN A;  5CNA A;  3AP4 A;  1NXD 1;  2PLV 2;  1UIK A;  1YQ5 A;  2FMY A;  3MIC A;  3AYC A;  1J1T A;  2XXZ A;  4Q29 A;  2BOJ A;  1BVP 1;  2RMU 3;  3HQU A;  3OPW A;  3WHU A;  1W8N A;  3HNB M;  4ZXK A;  3NWK A;  2EIG A;  1YQ6 A;  4JC1 A;  5LBF A;  3R4D B;  4QKD A;  4RL7 A;  3PJY A;  4CU6 A;  1I9R A;  1GQP A;  1A3K A;  1NCR A;  3BTX A;  3I2I A;  1RJ7 A;  4LOT A;  1POV 3;  4MGI E;  5J37 A;  3I54 A;  4LKE A;  2OS2 A;  4E4D X;  1R09 3;  4IEU A;  3S30 A;  1FX5 A;  1PM7 A;  3IPV A;  1ULD A;  4XJZ A;  1O4Y A;  3NW4 A;  3MIG A;  4COW A;  4C0B A;  3NKG A;  2HBT A;  3B5L B;  3ZXL A;  1MZE A;  4LPL A;  2VBD A;  4NRQ A;  4OLL A;  2KA3 A;  4JTN A;  4ERO A;  4LBQ D;  1VBD 1;  5FZD A;  5ACA 1;  4YFZ A;  1AR9 3;  4DS0 A;  4QB6 A;  3QOP A;  5GLW A;  3KSC A;  1GFF 2;  4BQ1 A;  1Z7S 3;  2C5D A;  1TME 2;  2XG3 A;  3P3N A;  4B3N A;  5C7G A;  4QQP A;  4YZ5 A;  2RR1 2;  3WF0 A;  2VTX A;  1Y43 B;  2ZGS A;  1PO2 1;  3DN7 A;  3N7M A;  5BNN C;  3KT1 A;  4Q4V 1;  4HVO A;  3ZXA C;  4FPL A;  1OH4 A;  3F95 A;  5DZF A;  1BEV 3;  2XJT A;  1R1A 1;  1O8P A;  4NPR A;  5APA A;  5H9R A;  4HKW A;  4IDZ A;  4E2G A;  3L9J T;  1R1Z A;  4CEW A;  3E5U A;  4GMP 1;  3JCI A;  2SBA A;  1DZQ A;  4RA0 A;  4B29 A;  4CXX A;  3FHI B;  1ZVF A;  4BK4 A;  1Z7S 2;  1XE8 A;  2Q8O A;  4MG2 A;  2WFF 1;  4Q0U A;  1YI9 A;  1QJU 3;  2A7A A;  1CJP A;  2JDK A;  4FO9 A;  1SMV A;  4Q2F A;  2VZQ A;  3POG A;  4Y20 A;  3JQW A;  4JDO A;  3JZV A;  1ND2 A;  2B7Y A;  2K9Z A;  1YFX A;  1VBC 2;  2VTX J;  4LO5 B;  1BYH A;  2X5I B;  2H6C A;  4CDW C;  3ASI A;  1SHW B;  4GKX A;  2RS5 3;  4PF1 A;  4LNV A;  2NZ9 A;  4LHS A;  3LIG A;  3W20 A;  5FUI A;  1ZRF A;  2TUN A;  4XTP A;  4BXF A;  3DKW A;  5ANN A;  2DCT A;  1CWP A;  4LUL A;  1XQN A;  5E6H A;  4GXL A;  4QX5 A;  2VD7 A;  4LIT A;  3WNP A;  4AXO A;  3JXS A;  4JTO A;  1H30 A;  4AVT A;  2ZAA A;  3VBH A;  4K7J A;  3P6B A;  1AL0 G;  2RR1 3;  5FR3 A;  3WNN A;  1SPP A;  1UYY A;  3PVO A;  3AVR A;  4A7Y A;  1DFQ A;  3CLP A;  1MVQ A;  2PHD A;  3FJS A;  3NAP B;  4XUT A;  4CVU A;  2B39 A;  5IAX A;  2PLV 3;  4XJA A;  3A0N A;  2FCV A;  3M8L A;  1IS3 A;  4W6X A;  4Y3O A;  3TN9 3;  5EYX A;  3MYX A;  3CF6 E;  1AYN 3;  1EUU A;  2YZ4 A;  3DPR A;  2HYK A;  2JKB A;  4QWN A;  1TMF 1;  3ZR6 A;  2HWF 2;  1QXJ A;  1D0H A;  1EUT A;  1KFU L;  4FOQ A;  4BIO A;  2V4A A;  3BIW E;  2CGP A;  3MLK A;  3K3N A;  1LTE A;  2YC0 A;  5FMD A;  1U0A A;  4ATF A;  1AZD A;  1V70 A;  3B9I A;  4LJH A;  3RWN A;  1UY4 A;  1DCS A;  1QWR A;  4GH4 B;  2UUR A;  4L2N A;  5CG8 A;  4NIG A;  4O61 A;  1VBE 2;  4NRO A;  1ALY A;  2ADE A;  5FBJ A;  2VBB A;  2AEN A;  1YHF A;  3MPP G;  1UZ0 A;  3JQX A;  2QQV A;  3BTA A;  4GB3 1;  3JU9 A;  5H9S A;  4QKF A;  5GKA C;  4GKY A;  1RUC 1;  1F4A A;  2W52 A;  3B3Q E;  4R52 A;  2BFU L;  4UI9 L;  2PYT A;  3J7M A;  5C3S A;  5F5I A;  5JLV A;  4A42 A;  2UYA A;  4CTE A;  1F31 A;  2CAV A;  5JOW A;  4IV1 A;  4ZHN A;  1LOG A;  4QHZ A;  1WGP A;  4GWI A;  5IW0 A;  3ZXF A;  3O1P A;  1V6O A;  3CU7 A;  1CPM A;  1EP0 A;  3NV1 A;  4UFI A;  1H0B A;  4EYU A;  2ZAH A;  2WQ4 A;  4OHV A;  3LDR A;  2QTW B;  5DAX A;  4HK9 A;  1PHM A;  1W6Q A;  2JDH A;  3ZYP A;  3MIH A;  4XDQ A;  3AK0 A;  5LAT A;  2QQN A;  1W9T A;  1RUF 2;  3POW A;  2WAB A;  4LBQ B;  1W2N A;  5T5L A;  5AVP A;  1RUD 2;  3WIN E;  4YVS A;  1JYN A;  2P2K A;  2VMH A;  4CCJ A;  4LIV A;  1LOC A;  1OQD A;  3T2Q A;  4OCT A;  1GQH A;  1GSL A;  2WLQ A;  3SH4 A;  1VAK A;  2EAA A;  3CZU A;  4CEW B;  4WM8 B;  1RIT A;  3ZFE B;  1W05 A;  2PA7 A;  5LW9 A;  3MLL A;  2FDK A;  3RPQ A;  3I59 B;  3CJI C;  1JZ5 A;  5FP7 A;  3VBU C;  3HT1 A;  4KG8 A;  3HN3 A;  2RS5 1;  3PLQ A;  3GF6 A;  5L36 A;  4PDW C;  4J1X A;  3MF9 A;  3A23 A;  4IL7 A;  4XDP A;  2QQO A;  1AX0 A;  5T3N A;  3KB5 A;  4RYD A;  4MXW B;  1AVB A;  1GLH A;  1D7P M;  1YFW A;  2GH8 A;  1S4C A;  4XIK A;  1X50 A;  4BXS V;  1SEF A;  3VDD A;  2WWS A;  2WDB A;  1QJF A;  3ATG A;  3I8T A;  4X6R B;  1JOD A;  1PGL 1;  1NX9 A;  4AED B;  3ZFF A;  1PK6 A;  5LBE A;  2IVI B;  1VBA 1;  1ST8 A;  4MLO A;  3VLB B;  1FXZ A;  1AYM 3;  4GMP 3;  4N53 C;  4NE9 A;  5F37 A;  2HEW F;  2IXJ A;  2QQU A;  3IMM A;  4LE3 A;  3T3Y A;  4CU9 A;  4DQA A;  1ASJ 1;  5FWE A;  1VMJ A;  3TB0 A;  3ACI A;  1HB3 A;  4AFD A;  2FZ2 A;  2XJU A;  3NNJ A;  4AI3 A;  5KHJ A;  5IK7 A;  4M00 A;  4CUA A;  2MEV 2;  3VHN A;  3NKT A;  4HL0 A;  4YNI A;  3H42 B;  1K5J A;  1I3H A;  3TEW A;  4HZF A;  2A3Y A;  1NA1 C;  3WLU A;  2IXK A;  3ES1 A;  1O6U A;  2WS9 3;  1H2K A;  1PIV 2;  3AXD A;  5A7W B;  1COV 3;  4CDQ B;  4JV4 A;  2CSG A;  3NNM A;  1Z0H A;  2XKO A;  1SFN A;  2C26 A;  3CO2 A;  3KQR A;  3MID A;  3NV2 A;  3WNM A;  2C4X A;  1POQ A;  3ZN4 A;  4JAA A;  3ZYF A;  4AHZ A;  1BJQ A;  2D44 A;  4AVV A;  1BEV 1;  5ABJ A;  1NE6 A;  1UN1 A;  1QNY A;  4QT6 A;  3I97 A;  3HMY A;  5FMC A;  3V64 A;  1IGO A;  4Y4R A;  3OOX A;  3T09 A;  5EZW A;  1X82 A;  3PUA A;  2DU1 A;  2DBN A;  4CDQ A;  1JI6 A;  2JG8 A;  3MGU A;  2WFF 2;  3HQR A;  4CA9 A;  1LHO A;  4IEV A;  3TWI A;  1BCX A;  1TVG A;  4LBO A;  1Y7B A;  3CJI A;  1W9F A;  4LK6 A;  2PHL A;  4JQT A;  1VE0 A;  5CFD C;  2Z4F A;  3I2H A;  1D4M 1;  3D0S A;  1K5M A;  4Z2W A;  5GM0 A;  3A21 A;  2G9F A;  3QD6 A;  1GR3 A;  1DDL A;  4KWK A;  3D8C A;  1EAH 1;  4IE0 A;  2DV9 A;  4URA A;  2DF7 A;  3UL2 A;  4MOA A;  2XON A;  4P02 B;  4H7L A;  2WSU A;  3PUQ A;  1JH5 A;  2OQ6 A;  1E5R A;  1RUC 3;  1GKB A;  3S6P A;  3VKN A;  3AX4 A;  4NHY A;  2FDJ A;  2GNB A;  2RHP A;  3PVB B;  1UY0 A;  1V0A A;  4FQ4 A;  3WW2 A;  4I0W B;  1YUD A;  1ULG A;  1VBB 2;  1HN1 A;  3H7J A;  2ZEW A;  2DVG A;  3LDK A;  4FSJ A;  2R04 2;  4JRL A;  2BWA A;  5C6C A;  1RC6 A;  4KWU A;  3VBO C;  2RJ2 A;  4S2H A;  1MEC 2;  5D21 A;  1OD3 A;  4H14 A;  2VQT A;  4AWD A;  4GJY A;  2XPJ A;  2QQP A;  1PIV 1;  1PMI A;  2VO5 A;  1K3I A;  2ZPX A;  2D43 A;  2YUE A;  3ES4 A;  3KCX A;  3WW3 A;  1DG6 A;  1ENS A;  1SQ4 A;  2NM1 A;  5CEH A;  1WBL A;  1Y4W A;  4D7Y A;  1OXC A;  2IFR A;  2J7M A;  2R06 3;  3NJX A;  1JZ6 A;  4RQP B;  1E57 A;  4WVZ A;  4Y33 A;  4EWE A;  1ZBE 3;  1PGL 2;  3RQ0 A;  4IUG A;  5DXD A;  2ZMK A;  2ZGK A;  3ITQ A;  4M3C B;  2IXI A;  4P9I A;  1W9S A;  2XJV A;  2YFU A;  5AVA A;  3WZ1 A;  4AQ2 A;  2W39 A;  1BLZ A;  4AZZ A;  1HJF A;  1W6P A;  1HB1 A;  4FP2 A;  4WM8 A;  3UES A;  3ZFE A;  1JYI A;  1MS0 A;  4PJY A;  2YFZ A;  1XNC A;  2C9A A;  3CJX A;  3RSJ A;  5F7U A;  2BBA A;  1CES A;  3HBZ A;  1H9W A;  3POB A;  5A6X A;  2Y6G A;  3MW3 A;  3H8R A;  3H8U A;  2B8M A;  1X36 A;  1ZBA 2;  3MF6 A;  2KR2 A;  2ZHM A;  3S0M A;  5T50 A;  1XNK A;  1W3X A;  4HK8 A;  4YW6 A;  1QJY 1;  2QQL A;  3O1R A;  4O9E A;  1W8F A;  4NVP A;  1K5M B;  1RMU 1;  4CPB A;  5JZG B;  4FTE A;  2VNR A;  4AG4 A;  2WWU A;  2CL2 A;  1NYW A;  4QGM A;  4XHB A;  2QCS B;  3H0O A;  1HXS 1;  1UOB A;  1OLM E;  4NPM A;  5C9A C;  1MEC 1;  2R07 3;  3OGG A;  5FJH A;  4O65 A;  3J7L A;  2ZMN A;  2R0F A;  2X53 S;  4FP3 A;  4J6G A;  4MAD A;  1REE A;  4R4Z A;  3SNM A;  2KXL A;  5B2G B;  1F8V A;  4PDW A;  4XJ9 A;  4E4Z A;  1PMH X;  5ABJ B;  1GOF A;  4EN7 B;  2FDG A;  2XLF A;  3A22 A;  1GP4 A;  4JVA A;  1STM A;  4M3C A;  5GZF A;  4CZS A;  5A3P A;  2NYY A;  5F39 A;  5CIS A;  1OFS A;  3ZMN A;  2W91 A;  5FZM A;  4CCM A;  4QKB A;  4CUC A;  1W2T A;  1HDK A;  1N1Y A;  1EAH 2;  2GND A;  1HRV 3;  3M3C A;  3UNP A;  1PGW 1;  4XCA A;  3V0B A;  4MHR A;  2HWE 2;  1U5Z A;  1LU1 A;  2J1E A;  1QHD A;  3K46 A;  1XYO A;  4X6Q B;  4ES8 A;  1V9U 2;  1IS5 A;  1JHJ A;  4LO7 A;  5HCB A;  5B4N A;  5F3E A;  4BQY A;  1UIJ A;  3LEK A;  3WOG A;  3VDB A;  1WCD J;  2ID4 A;  4XUO A;  1V9U 3;  4OMC A;  2W68 A;  1MPX A;  2XBO 2;  2BTV C;  2ET7 A;  1O8S A;  1R1A 3;  3IPV B;  4COZ A;  2Q8C A;  5CFC C;  3ZMO A;  3OBR A;  3FZ3 A;  4WVM A;  1ZRC A;  4WM7 C;  2XKP A;  2YC2 A;  1CAU B;  3LPF A;  3EB7 A;  5CAD A;  5FZ6 A;  4SLI A;  4D6Q A;  1EV1 2;  5FLH A;  4OI0 A;  2W95 A;  1CAV B;  3AP6 A;  5FYI A;  2IFW A;  5CG9 A;  4WVV A;  1LAJ A;  2Y6L A;  5F3G A;  1IPS A;  3WF4 A;  3QBQ A;  2BNM A;  4Q0V A;  1J3P A;  3URF A;  5BNP A;  3VDC A;  1RTV A;  1C28 A;  1DLC A;  1WA6 X;  2D6P A;  2L9L A;  2W1S A;  3E6D A;  3E1F 1;  2VY0 A;  1X7N A;  4Q5O A;  3RI8 A;  2R07 2;  4AEM A;  4XF4 A;  4YVW A;  1NZC A;  2DVA A;  1O3R A;  4Q4W 2;  5JOX A;  3GM8 A;  2P3K A;  3W5N A;  1GOH A;  5D8A A;  5IUQ A;  4DUV A;  3UET A;  2JB4 A;  3HNY M;  3I3D A;  1RUN A;  1JZ3 A;  4AI2 A;  2J42 A;  4YW2 A;  3VGI A;  1F5J A;  4GJZ A;  2XJS A;  4NWW A;  5I8S A;  2Q0A A;  5BNQ A;  2CNA A;  4UOJ A;  1JTZ X;  4NOT A;  4DOU A;  2EXK A;  3GHN A;  2PN5 A;  4U36 A;  3ZYH A;  3THP A;  4LE4 A;  4OZX A;  3SH5 A;  1D2Q A;  2A70 A;  1ULE A;  1WUV A;  5DDJ 3;  4N7I A;  3H8X A;  1G6N A;  5D8A B;  5C3R A;  2YPJ A;  4D8M A;  2BV4 A;  4XJ8 A;  4NRM A;  3U4X A;  4Q4X 3;  5IWF A;  2WZR 1;  4QQL A;  1A34 A;  1CIW A;  2YGM A;  2JIJ A;  1IZ3 A;  4YFW A;  4CDU A;  4NRP A;  1WCK A;  4UWD A;  3AYD A;  1DGR N;  1C57 A;  1Y3T A;  2QFE A;  1OLR A;  2QQK A;  3K51 A;  4BB3 A;  2YRO A;  4Z2A A;  2P6H A;  2QDN A;  4R9C A;  3SKV A;  5JXJ A;  1WKY A;  1UX6 A;  4AI1 A;  5IK8 A;  2VZT A;  5JR2 A;  4FPE A;  4CE8 A;  1XPW A;  2X05 A;  1QGL A;  3OPT A;  4HKL A;  1UY1 A;  4MH0 E;  5C70 A;  3V0A A;  4Q0P A;  1MEC 3;  1XSQ A;  1O4Z A;  4UW5 A;  3KS7 A;  4YVW B;  5IK4 A;  1W03 A;  2CGO A;  2NLR A;  1BBT 3;  1NG0 A;  2DCK A;  2HWB 3;  4IQP A;  3POE A;  3IBM A;  4LKD A;  1SLC A;  5IHR A;  2HKX A;  1ZA7 A;  4HMZ A;  1OVS A;  1RMU 3;  5DN2 A;  5F5Q A;  3ZDV A;  4BZ4 A;  2A6Y A;  3DGT A;  2JE8 A;  4GH4 A;  4XF9 A;  1VPH A;  3JD7 3;  3LIH A;  4N9I A;  2DFB A;  1ZRD A;  2WZE A;  4QM9 A;  2D6K A;  1RUF 1;  3RDI A;  4HVQ A;  5KC6 A;  2MPF A;  2BP6 A;  2PTM A;  1P8J A;  3VD3 A;  5FLJ A;  4HBN A;  2RE9 A;  1CAX B;  1RXG A;  2QVS B;  4BMB A;  2ZX0 A;  4E2Q A;  1X33 A;  1W6O B;  1FT9 A;  1WZX A;  2ZAC A;  4HN0 A;  3K2O A;  2RS3 3;  2MEV 3;  3H7Y A;  4BOW A;  1ZYB A;  4ZY9 A;  3FHQ A;  2E33 A;  3HJR A;  1LB2 A;  1LU2 A;  1NE4 A;  4K6B A;  4RS5 C;  2ZGQ A;  3WUD A;  3VD9 A;  1NKG A;  2A6V A;  4TYS A;  5FP8 A;  2DVF A;  4BQ3 A;  2OVU A;  4J1W A;  1QH6 A;  2CYF A;  4E27 A;  5T55 A;  3MV1 1;  2RDS A;  5JIU A;  1S0F A;  4LBQ A;  4BPZ A;  3GNE A;  2P5B A;  4QXK A;  2BFU S;  5BPX A;  3FL7 A;  1PO2 2;  3H1W A;  3L2Y A;  1VJ2 A;  3WP4 A;  1S2B A;  3WDY A;  2VW2 A;  3VD5 A;  2LM3 A;  4XBQ A;  4XUQ A;  5FKC A;  1MS1 A;  3VKO A;  3WXP A;  3U11 A;  4IV1 B;  2CGN A;  1WCQ A;  4UFL A;  2DFC A;  2V5D A;  2XJR A;  4YVS C;  2I2S A;  5HV0 A;  5EIY B;  2F4L A;  3LAG A;  3DYO A;  3LGR A;  3THT A;  5A6Z A;  1QJX 2;  1QQP 3;  5LRS A;  5C4W C;  5K0U B;  2R16 A;  1T2X A;  2I45 A;  3AYA A;  4XUR A;  3UT0 A;  4BLI A;  1FNZ A;  5FOB B;  4CUG A;  5HXV A;  1ZM1 A;  1QOO A;  4BQX A;  2CDO A;  4IE6 A;  1W6P B;  1GV9 A;  4XQD A;  1RUF 3;  4ITC A;  5KXB A;  5CFC A;  3VBR C;  1UPS A;  1S0G A;  1C8M 3;  5F6K A;  1NLR A;  3LZZ A;  4LXL A;  3RYK A;  2GMP A;  5FJK A;  1VMF A;  4P9W A;  4JZR A;  3D5O A;  5FUP A;  1LOF C;  2BVB A;  2JEC A;  3JBG 2;  3KM5 A;  1CX4 A;  3U4S A;  4F3J A;  4Q4W 1;  4RQP A;  1GP5 A;  1OOP C;  4FTB A;  3E97 A;  1G9A A;  3DUI A;  3T30 A;  1N3Q A;  2BRT A;  4B7E A;  2PHT A;  4XFB A;  4P9J A;  4Q1R A;  1GZC A;  2WNU C;  1ULP A;  2AGS A;  2WIN B;  3KLS A;  1S0B A;  3AMQ A;  2W08 A;  1UU4 A;  3SEP A;  4HLT A;  5BNO C;  5FZL A;  2RM2 3;  5J1X A;  4AQS A;  2HWD 2;  1LOF A;  1OF4 A;  3IM0 A;  2N7G A;  3T0A A;  1N1T A;  4BLJ A;  3EJK A;  4L9B A;  3FFQ A;  4PLO A;  3ZXJ A;  5FP4 A;  1SLL A;  2QKD A;  2WII B;  5C8C B;  2C6S A;  2GU9 A;  4ZS2 A;  2VPV A;  3KD4 A;  5FYC A;  1I1E A;  1OLM A;  1DLL A;  1YFU A;  2D3P A;  4Q4Y 2;  1KRI A;  5I0D A;  4CU7 A;  2FZ1 A;  3PNA A;  3VHR A;  2F6B A;  1UU5 A;  3S5Q A;  3KV5 A;  4OMD A;  4X8N A;  3GGL A;  2AC1 A;  4J25 A;  5C9A A;  4HN1 A;  3USU A;  5JVV A;  1D0G A;  2VGD A;  4LEJ A;  2VOK A;  3BB6 A;  4OI1 A;  4UYB A;  4PBP A;  4TN7 A;  1RUE 2;  2XL7 A;  2Y0O A;  3RJR A;  1LEC A;  1QJX 1;  4AEJ A;  2J1V A;  5FO8 B;  3MIE A;  4PI0 A;  1R64 A;  3KHC A;  1HJG A;  1UW8 A;  2Z5W A;  1AR8 2;  2AYH A;  5KHG A;  3VBF C;  3LSE A;  1PVC 3;  3G6J B;  1PX3 A;  4QPI C;  3W58 A;  5FZO A;  4Y5T A;  2JDZ A;  2VEC A;  3CL1 A;  3OB8 A;  4JKL A;  1C4R A;  3E6B A;  3PME A;  5JXI A;  3PMS A;  2PQS A;  1YCI A;  4MGZ E;  4DIN B;  2H0V A;  2XVL A;  1KJR A;  3LD8 A;  1ZZ6 A;  1NLQ A;  3N36 A;  3OEB A;  5A3L A;  4L92 A;  4PF5 A;  5FYY A;  5CKQ A;  4EWD A;  3I2K A;  1Y9G A;  1J83 A;  1RB8 G;  4M0H A;  1KEX A;  2RDQ A;  1EV1 1;  1UMI A;  2WR9 A;  1UMZ A;  1POV 0;  1UYP A;  2XWB B;  3ETQ A;  4FTS A;  4JRA A;  4BE3 A;  1PX4 A;  4JGY C;  2RS1 3;  3SCF A;  1HQW A;  2HWC 2;  4F7Z A;  3VBS C;  4Y26 A;  3N7K A;  5AC9 2;  5GZE A;  1OMI A;  1GMM A;  1QJU 2;  1NCR B;  2QQW A;  2WSV A;  3VBO A;  4Z8B A;  4JDM A;  3T08 A;  4AK3 A;  1LHW A;  2QNK A;  4JGZ C;  1XNB A;  5A1L A;  3FLT A;  5C8C A;  1OHF A;  5HXM A;  1OLQ A;  3OD0 A;  4QX2 A;  2GC3 A;  1S0J A;  2WNV B;  4ISR A;  5BNP B;  4JHZ A;  2I74 A;  4M4P A;  3U78 A;  4L99 A;  5A7N A;  4CEY C;  3WP3 A;  1L7Q A;  1RUH 3;  4FPY A;  3W5M A;  1BEV 2;  3L2H A;  4YW5 A;  3H9A A;  1GZ9 A;  3LPG A;  5FY1 A;  3WG3 A;  2VC9 A;  2ZA9 A;  3I2J A;  1ZZC A;  3M2M A;  2VJX A;  1ZZB A;  2WT1 A;  3OUJ A;  4E9K A;  2X5I C;  4JHT A;  4XAA A;  4D7T A;  2K46 A;  3LA3 A;  4LUM A;  3GYD A;  1UU6 A;  3ZN6 B;  4H7M A;  3OJB A;  1AR9 2;  1QDC A;  1FYU A;  2XB6 C;  3MZH A;  1V6L A;  4KBZ A;  1UKG A;  3DXU A;  1MQT B;  1GNY A;  4P5H A;  3ZYJ B;  3PL0 A;  1PO1 2;  1LEM A;  5E16 A;  4MO3 M;  2AUY A;  4ZU5 A;  1UZZ A;  1UZW A;  3D6E A;  4QDQ A;  2EID A;  4DNY A;  2JE7 A;  3ZXK A;  2YG0 A;  4FPK A;  3J9S A;  2ATF A;  3F2Z A;  3N3H A;  4IEX A;  3QLQ A;  3RWK X;  3K4A A;  5DG1 A;  1MS8 A;  4XBN A;  1NAE A;  1N3P A;  1C5I A;  3NNG A;  3WP6 A;  1F4H A;  2RS3 1;  2UYB A;  2E7T A;  1QJY 3;  1LCL A;  5CKM A;  4FFI A;  4XIL A;  1CAW A;  5FK8 A;  2ZX4 A;  1OVP A;  2BVV A;  2MNG A;  3IN9 A;  1OFN A;  4O9G A;  2RMU 2;  3RFR A;  3LWC A;  5C5U A;  4UAP A;  3DEM A;  1IKQ A;  2Y6F A;  3C3V A;  5GLV A;  1U5X A;  4DY3 A;  5FZG A;  1NT0 A;  4CP1 A;  1RUI 1;  2RS1 2;  1RUE 3;  1GAN A;  4P9Y A;  4JQR A;  1TG7 A;  5KHH A;  3AJZ A;  4CSW A;  2B42 B;  5FOJ B;  1URX A;  1J58 A;  1PVX A;  4LO8 A;  2VQU A;  2CY6 A;  2WZ8 A;  4GWJ A;  1SLA A;  4KWL A;  4CP0 A;  4DFS A;  1ND2 B;  1COV 1;  2YY1 A;  4BQ4 A;  4CCL A;  1QJZ A;  4E8D A;  2QZ3 A;  1PK6 C;  1UOF A;  4Q4X 1;  3ZX7 A;  3VN4 A;  5BV6 A;  2GC2 A;  1EYB A;  2B9U A;  2VAU A;  4IE7 A;  1G9D A;  1QQP 1;  2ZGU A;  2VZR A;  3GHM A;  5F1R A;  4XFH A;  4E8C A;  1GU3 A;  2YU1 A;  4XFC A;  3DPR C;  1QY4 A;  3BOD A;  4IER A;  5JSR A;  1FAT A;  5IAT A;  4CCC A;  3POJ A;  5EYY A;  5CYY A;  2VMC A;  1UNB A;  3VZK A;  1JYT A;  3MBW A;  2ORZ A;  1AYM 1;  3OTF A;  4LK7 A;  2Q5T A;  1TE1 B;  4NAM A;  2JEM A;  5FCC A;  1BZW A;  3OGV A;  5EFU A;  1SCS A;  5T54 A;  1SLB A;  4IV3 C;  2UWC A;  4HET A;  5GZC A;  4DEV A;  2PEL A;  4UFJ A;  3VKL A;  3VBH B;  3TNP B;  5JSO A;  4AGR A;  2CAU A;  3UGG A;  4ONU A;  1EPW A;  5A7P A;  1DYK A;  4W65 A;  4AI8 A;  4Y4Y A;  5I8T A;  2G9Z A;  3OY8 B;  4KWJ A;  3GZT B;  3POF A;  4IXL A;  3WEZ A;  4DRR A;  5FFO C;  1VMH A;  4WM8 C;  2EIB A;  3ZFE C;  4EN8 B;  1L7L A;  3AZY A;  3DEC A;  2A3W A;  5DUW A;  2JG9 C;  2AAC A;  3VBU B;  4AFC A;  1G9B A;  1RUI 2;  2GSY A;  2WQZ C;  2WYF A;  4Y22 B;  4XMA A;  4IV3 A;  3BAL A;  4NHL A;  1QNW A;  2HYX A;  4URT A;  5LA2 A;  4OHW A;  1VLN A;  1CVN A;  3RMX A;  2YGL A;  5JI9 A;  1NCQ B;  3NST A;  4F83 A;  2BDR A;  1LOE A;  1D4V B;  4XOG A;  4DB5 A;  2D6N A;  1LGN A;  4B8E A;  1QF3 A;  5JOZ A;  3AZW A;  4AED C;  1VIW B;  3BN6 A;  3OPZ A;  4G4F A;  4MGT A;  2K0G A;  2C1F A;  4QDR A;  4Y1V A;  4UW3 A;  2WNV A;  2A75 A;  1R08 3;  2Y60 A;  3KT4 A;  4KH9 A;  2YV8 A;  3C2U A;  5LEJ A;  1SBF A;  4N53 B;  3THD A;  3Q9O A;  1W9Y A;  4AEK A;  3BKZ A;  4QAW A;  1CX1 A;  5F3I A;  1ZX5 A;  4QHB A;  3UGF A;  1WME A;  1GNH A;  4QM8 A;  5ANQ A;  5K8S A;  3WVJ A;  2BGO A;  5A33 A;  3BTZ A;  1RHI 2;  2XJQ A;  2XUM A;  3VD4 A;  3FX3 A;  4XZU G;  4CDX C;  4Z1V A;  4YGC A;  2FDF A;  3ORJ A;  1HXS 2;  4ATE A;  4D7S A;  3N7J A;  1QJY 2;  5I93 A;  3KVB A;  1OOP A;  1T6G C;  2YBK A;  3MW4 A;  3OEA A;  5L9B A;  1J3R A;  1ZRE A;  2VVD A;  2VME A;  2VUD A;  5IVB A;  4RFT 0;  1DIW A;  2YYO A;  5A3W A;  3PU8 A;  5DAB A;  2YBP A;  1N3O A;  4N43 B;  1LOB A;  3IMN A;  1Q8O A;  3FMG A;  1UXX X;  3O5S A;  4XJU A;  3WNL A;  5C8W A;  1HQN A;  3HD8 B;  4FT8 A;  2AR6 A;  1DQ2 A;  5E88 A;  1DGL A;  3LF7 A;  1HRV 1;  1AL2 2;  3CEW A;  4ZU4 A;  1PO2 3;  2EXJ A;  4HSJ A;  1UY2 A;  5FYH A;  1RUG 3;  5IT6 A;  2WT0 A;  1V6K A;  4Y1Z A;  2J22 A;  2V4V A;  5DDJ 1;  5T5O A;  1IG0 A;  2VUA A;  2WT2 A;  4K8F A;  4UXA A;  4OFG A;  1H4H A;  2DUR A;  2IXC A;  2UWB A;  2W3J A;  4OZO A;  3RZZ A;  3TNQ A;  3K48 A;  3DF0 A;  5HBA A;  3O1V A;  1O91 A;  1VR3 A;  2XWJ B;  4LMF A;  3OF1 A;  1UOG A;  1A6C A;  4YWA A;  4DXT A;  4GA9 A;  2ADD A;  5G05 L;  2Q4S A;  3HR9 A;  3M70 A;  3EBR A;  2X29 A;  4H55 A;  1O59 A;  4U2A A;  1UYZ A;  3W21 A;  3EQE A;  2O8O A;  4YZ4 A;  5IVV A;  2WFP A;  4DO0 A;  1AR6 2;  1LOD A;  1H1A A;  2VTF A;  4RSU A;  3N9P A;  1HN0 A;  1CIY A;  1LKN A;  4FPO B;  5KXE A;  5LA1 A;  2CDP A;  3IIA A;  1OUR A;  3RS6 A;  4FOY A;  1WD3 A;  1CGP A;  4YGD A;  3O7O A;  4RS5 A;  4ZU7 A;  4QKN A;  3M3E A;  1O3S A;  1XE0 A;  3ENR A;  3T4V A;  2E6V A;  4LBK A;  3O0W A;  4K40 A;  4KI5 M;  3A4U A;  4UBH A;  2JG8 C;  2LS6 A;  4NR1 A;  3ZSL A;  1DQ1 A;  3OY8 A;  4PQQ A;  3WP5 A;  5AC9 1;  1ASJ 2;  4CCD A;  3MLJ A;  1RMU 2;  2OII A;  3TEY A;  5FWJ A;  3V0B B;  3U14 A;  1VBA 2;  4RHV 3;  3GBF A;  2GMM A;  2QDR A;  1L3J A;  1U12 A;  2HWD 1;  3LEG A;  1M4W A;  1HIX A;  1LHN A;  3HNM A;  5E8A A;  3ZM8 A;  5C3O A;  1H1I A;  1W6Q B;  3KQ4 B;  2AH2 A;  4JX0 A;  4QX8 A;  4AE2 A;  4BQW A;  2P3Y A;  3VBR A;  1AX1 A;  1H2M A;  2W92 A;  3WG4 A;  1PVC 2;  4Q8K A;  3LFM A;  4CXW A;  4IEW A;  1UD1 A;  1OUX A;  2D3S A;  1WWY A;  2DCY A;  4GUL A;  1O3T A;  1NY7 1;  1KIT A;  1WCU A;  2FCT A;  3K4D A;  4BK5 A;  2EIE A;  1G8W A;  3LKJ A;  2ZEZ A;  4OQ9 A;  4IGP A;  4Z82 A;  3ZKU A;  5DAW A;  3ZPY A;  4Q4X 2;  4XFF A;  3SKJ E;  2XUE A;  2IWG B;  4CEY A;  1XSR A;  2EF6 A;  2JE9 A;  3OBA A;  5SV5 A;  3U0Z A;  5GLU A;  5LA9 A;  2KD7 A;  3JB8 A;  5FBZ A;  1JW6 A;  3I3E A;  4FXG B;  1FOD 3;  5F32 A;  5D1I A;  2Z2S B;  5IAV A;  2Q1F A;  4JKM A;  5CB7 A;  1PMJ X;  1DQ5 A;  1BMV 2;  2GDF A;  2J1S A;  4YM1 A;  4A45 A;  4Q4Y 3;  1WA4 A;  4Y1U A;  3VZO A;  5HPO A;  1LNS A;  5LA0 A;  5LWB A;  2KM2 A;  4WM7 A;  1KDM A;  4GAZ A;  3B69 A;  5FZB A;  2OW4 A;  5AFB A;  1SCR A;  1VRB A;  5FMO S;  1EPZ A;  3TEZ A;  1W8Z A;  1JOP A;  2IUW A;  2XBO 3;  3BOW A;  2ETE A;  4XDO A;  1S0C A;  1ND3 A;  4UBG A;  2BBV A;  2CU5 A;  1OH3 A;  2E9Q A;  2GP5 A;  3ABZ A;  4Q4W 3;  3MPB A;  1H8T B;  2F17 A;  3WV6 A;  3N9Q A;  5G04 L;  4GB3 2;  2ZGP A;  4BDV B;  3FBY A;  1IPK A;  5D2A A;  1UYX A;  4PHZ A;  5C71 A;  3C8X A;  4PIX A;  1SPP B;  4KBB A;  2ENR A;  3FHA A;  1Y9Q A;  3LCP A;  1LJ7 A;  3T2O A;  3ZSJ A;  3VKF C;  4AGG A;  1ODM A;  5F2W A;  3LQC A;  4CCE A;  1OC1 A;  1J3Q A;  4F8A A;  1JUH A;  3EYP A;  4FCA A;  2HWF 1;  5L9R A;  1YNA A;  4YSF A;  1YJL A;  2XJP A;  2W46 A;  2W5F A;  3I7D A;  1BK0 A;  1PNG A;  2ZX1 A;  1Q8Q A;  1S0E A;  4IGO A;  5FMB A;  5L19 A;  4CDW B;  3JB4 C;  5A3M A;  1JYX A;  2X10 A;  5JXH A;  1R1A 2;  5DAV A;  1NLS A;  2A1X A;  2JDN A;  4HG6 B;  3RRD A;  4CCK A;  4FAH A;  1RUG 1;  4UW4 A;  2GAU A;  2WC2 A;  1C8N A;  3CMG A;  4CDU C;  1KGY A;  1V6J A;  2WWJ A;  3PVN A;  3UKV A;  3B7M A;  5BYN A;  4Y20 B;  4M01 A;  3WQ0 A;  5A33 B;  1PO1 1;  1U5Y A;  2NPI A;  2ZCW A;  3K4Z A;  1RED A;  1BKZ A;  1EAH 3;  3WW4 A;  1OPO A;  5FY7 A;  5LY1 A;  4XF0 A;  1GZT A;  3KVA A;  3INA A;  3N9N A;  3GZU C;  4A3X A;  5C3Q A;  3NAP C;  1RIR A;  2WZP P;  5FY9 A;  5IVJ A;  4JDN A;  1E5S A;  3POS A;  3RZM A;  2WNU A;  3MIB A;  5FYZ A;  2OT7 A;  5K0U A;  2XQX A;  1Y9M A;  1W8H A;  3T0B A;  2LRP A;  4LO6 B;  1CZS A;  1JS9 A;  2VMF A;  3AMM A;  4XAB A;  3RNS A;  5KHK A;  2B46 X;  2UU8 A;  3IAP A;  1U5I A;  1W2A X;  4YG3 A;  3G7D A;  1REF A;  4MVT A;  3ZFG B;  2V73 A;  3BIE A;  1ZBE 2;  3WX5 A;  4AQ6 A;  5EJ1 B;  5L7O A;  1XOY A;  1CZV A;  1MR5 A;  1RVF 2;  2RMU 1;  2R06 2;  3I2G A;  1GZW A;  4GH4 C;  4I02 A;  4AF9 A;  4YGB A;  4BWO A;  4EN0 A;  4N53 A;  5F2S A;  5TSW A;  5KBF A;  2FDH A;  3SIS A;  2JDU A;  1ZBA 3;  3C7G A;  4HVR A;  1YC6 1;  4A41 A;  1UX7 A;  2R1B A;  2BU9 A;  4EJR A;  4EWA A;  5C33 A;  3BTY A;  5C3P A;  1G86 A;  3ZR5 A;  1VAM A;  5CBL A;  4IEO A;  5I0S A;  3SEE A;  2A5Z A;  2LAL A;  2ZHK A;  5FPX A;  3WDX A;  3QH6 A;  2HWB 2;  4R9A A;  1VAL A;  2B45 X;  3GCX A;  3I2D A;  4LKF A;  2YB7 A;  3O1M A;  1WMX A;  1OI6 A;  2R6Q A;  1H2N A;  2XH6 A;  1GP6 A;  5BNN A;  4QPI A;  4XBL A;  5JMO A;  3RZL A;  3VZJ A;  3O0V A;  5FO9 B;  3FUO A;  1TEI A;  1TNR A;  2VMD A;  4WBB A;  1X9T A;  3J7N A;  4BH9 A;  3E5X A;  2VW0 A;  2ZJC A;  1A78 A;  5A3O A;  1HB4 A;  2FMD A;  4CEW C;  3P5B A;  1G7Y A;  3LOI A;  5KC5 A;  4P00 B;  3MDP A;  2ZX2 A;  1H4G A;  1KXG A;  4HON A;  5LBB A;  5F3C A;  3T4H B;  1PZ7 A;  1W8W A;  2AEZ A;  3CJI B;  5FYT A;  2ZEY A;  1JYC A;  4XXP A;  1PZ8 A;  4COU A;  2WO3 A;  4XMI A;  2VM9 A;  5DDJ 2;  5I0R A;  2VZV A;  2PFW A;  2HJI A;  2O0O A;  3ELN A;  2EXH A;  3ZLI A;  5C4W A;  3ZVX A;  5KR7 A;  1NY7 2;  2VNV A;  3AVS A;  2RVA A;  1FNY A;  1KQR A;  2DTW A;  3AFG A;  3DYM A;  2PLV 1;  4JCK A;  3WG2 A;  1AL2 3;  4D0Q A;  5AFE A;  2LUW A;  3KF5 A;  3MI8 A;  5T5P A;  1GIC A;  1JZ2 A;  4WVW A;  1AR8 1;  4EZH A;  2RR1 1;  3RVH A;  3HIF A;  4MHU A;  2DVD A;  4LBM A;  4M3C E;  1BBT 1;  5L9V A;  3POY A;  2VR4 A;  5LBC A;  2W0X A;  3M7A A;  1J1L A;  4ISQ A;  2WFF 3;  2Y64 A;  1BMV 1;  3DCQ A;  1LGB A;  3ZPO A;  3N9O A;  2ET1 A;  1NA1 B;  3IAQ A;  3DV8 A;  2BUK A;  4MGK E;  3MFC A;  4HAN A;  4NHM A;  4Y1X A;  1HB2 A;  1MZ6 A;  4GD4 A;  2E7A A;  4IV1 C;  1CON A;  1RHI 3;  1AR6 1;  3AZX A;  4M4R A;  5KWR A;  1HLC A;  3ZDS A;  1O3Q A;  4UT5 A;  1HV0 A;  3SC7 X;  4QX0 A;  5C4W B;  4Q4V 3;  3HT2 A;  3OGS A;  4K1Y A;  1PGS A;  4NII A;  1S55 A;  1FI2 A;  3AP7 A;  3WNK A;  4NHK A;  3R4U A;  2RJL A;  5BNN B;  1XBF A;  4I0A A;  1ZBA 1;  2PXJ A;  1PIV 3;  3GCW A;  2BW8 A;  4OQ8 A;  4GB3 3;  3GDB A;  5FO7 B;  2VXR A;  3AFK A;  2HEY F;  3PTR B;  3ILR A;  5KXD A;  1UZY A;  4YPJ A;  3J7H A;  2ARB A;  4PT6 A;  4XXA A;  4TSV A;  3CNA A;  2HWE 3;  5CFD B;  2VL4 A;  1SAC A;  3C7O A;  2VZS A;  3RMY A;  1HRV 2;  1AR7 1;  1CAV A;  1US3 A;  2D6O X;  1W28 A;  4OI2 A;  3U10 A;  1B35 B;  4XHX A;  2GN7 A;  2X8K A;  1I6X A;  5A7W A;  1JMU B;  1ZZ8 A;  4ZZ8 A;  5SV8 A;  5A1A A;  3B00 A;  3III A;  1NXM A;  4AR2 A;  1OD5 A;  1B09 A;  4ZON A;  4OHZ A;  1VRH 3;  5FY0 A;  4KG0 A;  2ZZQ A;  5JAX A;  3K77 A;  1YLL A;  4LBN A;  5L7O B;  1NZI A;  1DQ4 A;  2ILM A;  4MX3 A;  4NWV A;  3ACF A;  4CDX A;  4L11 A;  1ZNP A;  3ZFG A;  4ZKT B;  1D2S A;  2UWA A;  3KHB A;  3USS A;  4XQ4 A;  3R05 A;  2JDP A;  3ECQ A;  1WCS A;  4HFS A;  2PAE A;  4AQT A;  2HWB 1;  3VBO B;  4N7U A;  4IE5 A;  5FXZ A;  2Y6K A;  3GBW A;  2VVE A;  4NMI A;  1K42 A;  2QBX A;  4NAO A;  5FY5 A;  1HV1 A;  1QDO A;  3IDC B;  1RUD 3;  1GZW B;  1WD4 A;  1F5F A;  4HXC A;  3P3P A;  1OA2 A;  4BIS A; 
#chains in the Genus database with same CATH homology
 5FZL A;  2GP5 A;  3LDB A;  5FY8 A;  4QX7 A;  5A3W A;  3PU8 A;  4C8D A;  2YBP A;  5F37 A;  5F5A A;  5FZK A;  3N9Q A;  3PU3 A;  4HON A;  5F3C A;  5FP4 A;  5FWE A;  2WWU A;  4QXC A;  5FYT A;  5FYC A;  5FZ1 A;  4BXF A;  5FPV A;  5FZH A;  5IVE A;  3OPT A;  5A3T A;  5FPB A;  5E6H A;  5F2W A;  5FXV A;  2VD7 A;  4LIT A;  4LIU A;  5FJH A;  5FYH A;  3ZLI A;  5FP3 A;  5FZG A;  5KR7 A;  3KV5 A;  5A7W B;  5IVB A;  5FZA A;  3AVS A;  4AAP A;  4DIQ A;  5FXX A;  5FYU A;  5LY2 A;  2Q8D A;  3AVR A;  4CSW A;  4TN7 A;  4IGO A;  4EZH A;  4BU2 A;  4CCO A;  3RVH A;  5A3P A;  5IVV A;  5F39 A;  4Y3O A;  5A7O A;  4D6R A;  5FZM A;  4CCM A;  4CCK A;  4DO0 A;  4CCL A;  5FZE A;  4V2V A;  4Y4R A;  3KV6 A;  3N9P A;  4QWN A;  2WWJ A;  3PUA A;  4CCN A;  3KV4 A;  3ZPO A;  3N9O A;  3N9L A;  5FZO A;  5A3N A;  2YU1 A;  3K3N A;  5FPA A;  5IVY A;  3NJY A;  2XXZ A;  3K2O A;  5F3E A;  5FYM A;  3OPW A;  5FY7 A;  4HOO A;  5FZ4 A;  4GD4 A;  5A7S A;  3LD8 A;  5LY1 A;  2XDV A;  3N9M A;  5FY4 A;  3KVA A;  3N9N A;  5FYY A;  2YU2 A;  5IVJ A;  5FBJ A;  5FY9 A;  2Q8C A;  5FP8 A;  5A1F A;  4URA A;  5FZC A;  2OQ7 A;  5FPU A;  5FZO B;  5A7P A;  3PUQ A;  5FYZ A;  2OQ6 A;  2OT7 A;  5A7Q A;  5FWJ A;  2OS2 A;  5FZ6 A;  2P5B A;  2PXJ A;  5FZF A;  4D6Q A;  2GP3 A;  5F5I A;  5FYI A;  2Q8E A;  3PUR A;  2YBS A;  3PTR B;  4QX8 A;  5F3G A;  5IVF A;  4EZ4 A;  5IW0 A;  3AL6 A;  5A1L A;  3AL5 A;  4UF0 B;  5IVC A;  5FZD A;  4ASK A;  3K3O A;  5FXW A;  4NUB A;  4AI9 A;  4EYU A;  4QXB A;  5FZ0 A;  4IGQ A;  3U78 A;  4GJY A;  2YPD A;  5FP9 A;  5F2S A;  5A7N A;  5A7W A;  4QXH A;  5ISL A;  2OX0 A;  5CEH A;  5FY1 A;  4IGP A;  4CUG A;  4CCJ A;  4LIV A;  5FYV A;  4GJZ A;  5FY0 A;  5FZ7 A;  4Y33 A;  5K4L A;  2XUE A;  4QU1 A;  5F5C A;  5LW9 A;  4LXL A;  5F3I A;  5FYB A;  5FJK A;  4UF0 A;  3PDQ A;  5F32 A;  5FP7 A;  3KV9 A;  5FUP A;  5FYS A;  5FZ9 A;  5ANQ A;  5FZ3 A;  3PUS A;  3U4S A;  3DXU A;  4E4H A;  5FPL A;  5FV3 A;  4XDP A;  2W2I A;  3DXT A;  3UYJ A;  5LWB A;  5FXZ A;  5FZ8 A;  4GAZ A;  5FZI A;  5FZB A;  5FUN A;  2XML A;  5IWF A;  1VRB A;  5FY5 A;  3KVB A;  5A80 A;  4D6S A;  4V2W A;  2YBK A;  4BIS A;  4XDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...