5FZ1A

Crystal structure of the catalytic domain of human jarid1b in complex with maybridge fragment 2,4-dichloro-n-pyridin-3-ylbenzamide (e48115b) (ligand modelled based on pandda event map)
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
462
structure length
454
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDGIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B, LYSINE-SPECIFIC DEMETHYLASE
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with E48115B
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 141
structure length 454
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fz1A01
5A80A 2GP5A 4AAPA 3NJYA 5A7WA 3AL5A 4DIQA 2VD7A 2GP3A 5IVVA 2YU2A 5FP7A 2OQ6A 4CCKA 2XMLA 4LXLA 4UF0B 5FZ0A 5FZ4A 5F3GA 4LIVA 4EZ4A 3U4SA 5F39A 4NUBA 5FZOB 5IVFA 4QXCA 5FXXA 5IVJA 5A1LA 5E6HA 3DXTA 4DO0A 5FY9A 3PTRB 4URAA 5LW9A 5FZCA 3LDBA 4Y3OA 4D6QA 3N9OA 5A3TA 4E4HA 4ASKA 1VRBA 5K4LA 4Y33A 3U78A 4BXFA 5A3PA 4Y4RA 3PUAA 3PU3A 4HONA 2YU1A 4QX8A 5FYBA 5FJKA 5FZHA 5ANQA 5IVEA 3K3NA 4TN7A 3N9MA 5FZ9A 5A7PA 3RVHA 4V2VA 4CCJA 5F5CA 5FPVA 4QX7A 3AVRA 2XDVA 3K3OA 5FYYA 2P5BA 2YPDA 5A3NA 3OPWA 4BISA 5FZMA 5F37A 5FPLA 3OPTA 4IGQA 5FY8A 2OQ7A 4UF0A 5FYSA 5A7QA 5FZIA 3KV6A 2Q8CA 5FWEA 2WWJA 2Q8DA 4EYUA 2OT7A 4HOOA 2YBPA 4EZHA 5KR7A 4XDPA 5A7NA 2YBKA 2PXJA 4CCLA 2YBSA 4QU1A 4LITA 5FY5A 4V2WA 3KVAA 5IVCA 5FV3A 5FZ6A 5FP3A 4D6SA 5FZGA 5FY7A 5FBJA 4CUGA 5FZ1A 5FZDA 5CEHA 5FZFA 5FZLA 4QXHA 3AVSA 5F5AA 5LY2A 5FXVA 5FY0A 5FZEA 3UYJA 4D6RA 3PDQA 5FZAA 5A7WB 5FYMA 2OS2A 4GD4A 5FWJA 5FZOA 5FP8A 5A7OA 2WWUA 4IGOA 3N9NA 2XUEA 5FYCA 5FYUA 4CCNA 5IWFA 5IW0A 3KVBA 5F3EA 3KV9A 5F3CA 3LD8A 3KV4A 5FPUA 3PU8A 2XXZA 5LWBA 3KV5A 5FYIA 5FYVA 3AL6A 5FZ3A 5A3WA 5FPAA 5FYZA 5A1FA 5F32A 2Q8EA 5FY4A 4LIUA 2OX0A 3N9LA 3PUSA 4CSWA 5FUPA 4CCOA 5FXZA 5FXWA 5IVBA 2W2IA 3N9QA 5FZBA 4BU2A 4GJYA 5FP9A 5FYTA 4AI9A 3N9PA 3ZPOA 3PUQA 3DXUA 4GAZA 4CCMA 4GJZA 5FY1A 5LY1A 3PURA 5FUNA 5FZKA 5F2WA 5FYHA 5FPBA 4XDOA 3ZLIA 5F3IA 5F2SA 5A7SA 5FZ7A 4C8DA 4IGPA 5FZ8A 5ISLA 5IVYA 5FP4A 5F5IA 5FJHA 4QXBA 4QWNA 3K2OA
chains in the Genus database with same CATH superfamily
1UZVA 2GP5A 3NJYA 3KWVA 1ZZBA 4YG3A 4YZ5A 1G8WA 1V00A 3DECA 3IIIA 4UOJA 2ZX4A 4KGQA 1AXKA 1WA6X 3M1HA 3OTFA 1YXWA 3PIGA 5CNAA 4FVVA 3WQ1A 2XBO3 1UYYA 1X9PA 2R6QA 1GP5A 2X5IA 3OGSA 4PF5A 3U4SA 3APBA 3RSJA 2BDRA 3I3MA 4E4ZA 3LDRA 4GWJA 4IE0A 2EALA 2EIBA 1BJQA 3C7OA 5IATA 1UX7A 3NWKA 5BV6A 2VL4A 4D6QA 2XL7A 3TEWA 4Z07A 3ZYIB 1TG7A 4NRPA 4Y4RA 3VBFC 1SLIA 5CG8A 1UKRA 1AR93 4WBBA 2B5HA 1QXPA 3UJOA 3ZXFA 5M0TA 3AX4A 3WG4A 3JCIA 1BCXA 3N9MA 4DXRA 5CKNA 3ZO0B 3WNOA 1BHGA 4BQ1A 4NE9A 5J3UA 4PF1A 1XNDA 2WNEA 4XAEA 1YI9A 3S5QA 4K9SA 1RUF1 3I8TA 1CGPA 1QJU1 1S55A 2UYBA 1UQXA 4EQVA 1NXD1 2E31A 1V9U3 2AZ5A 3I4IA 3J7HA 4L92A 1XNKA 2VUDA 2OVUA 1W6NB 2V72A 4MGQA 4N8MA 5T5PA 3VBRB 3GM8A 4JGYA 5FY8A 4FP2A 2GNMA 4YLZA 2HWF1 1SHWB 2ARAA 2HKXA 2R043 1DQ4A 4QPIA 4CTEA 1YCIA 1OKQA 4S2HA 1XJAA 3SH4A 1BK1A 4PI2A 1DU3D 1ZZ8A 4Q0SA 1FOD3 3WT3A 5LA1A 1QQP2 2WWJA 1QDOA 2ZGUA 1QOSA 2WT0A 2JIGA 4L8QA 4IV3B 2Q8DA 3VBRA 4AHXA 2VVEA 1HB2A 4QDRA 5C71A 3MIBA 3T3YA 4D0QA 1MEC2 5DZGA 1PM7A 2MEV3 4AVCA 3HEIA 3RFRA 3UKVA 4LO6B 3T2OA 5C3RA 2YC4A 2UY9A 1GZ9A 1LOBA 4LR4A 1VB2A 3WDXA 1VBB2 5E1RA 4AQTA 4XAAA 3I54A 1V6KA 4OMCA 2XLAA 1KRIA 1HB4A 3WDWA 2RDSA 4XFFA 3RZGA 1OPMA 3OYWA 2JIJA 4EN0A 2VOTA 4PCRA 5FCCA 3WV6A 3T4HB 1Y4WA 3ASIA 1US3A 2OPKA 2ZKNA 2QCSB 4AQ2A 4COVA 5HCBA 2C24A 2P4EA 4S2GA 2HWC2 3V0AA 3ETPA 1F5FA 4CUAA 4GAZA 1UCXA 1US2A 1LGBA 5LK7B 2VCAA 1N3QA 1OVSA 1YQCA 5CFCA 5FPBA 3EB7A 1SFNA 5BNNC 3TNQA 4Q0QA 5F3IA 2QQOA 3VDAA 4Q4X1 4A6SA 4BA6A 1N3OA 2V4VA 4WM7A 3EBRA 4WVVA 1RHI2 2HWD3 3HNMA 4QHBA 1C1FA 1W0PA 1FX5A 2WAAA 2HEWF 4AFMA 2GP3A 2D44A 5LASA 2JG8B 5FO9B 4IE4A 1CVNA 2R7EB 3F95A 4JGZC 3PJYA 1GOGA 2DU1A 2WNUA 3CL1A 5GLWA 3KT1A 3O0WA 4XIKA 2XBO2 5FRAA 2QNKA 3LAGA 3E1F1 2YHJA 3NNLA 3V56A 1XE7A 4P5YA 3N7LA 3HBKA 4DINB 4E4SA 5B4NA 1WUVA 3A23A 3IPVB 2YXSA 3FX3A 1JYTA 3QBQA 4LBOA 3U37A 5K4LA 1GWMA 3ZFEA 4EE2A 1LOAA 2Q1ZB 2QQVA 4LMFA 3WNXA 1CPMA 3ZKUA 5FLIA 4AI0A 1FPN3 2EIGA 2PHFA 2JDMA 1IS5A 1G9BA 4X6RB 1CAUA 1Q3EA 4QPWA 4IEOA 3WF3A 4KWJA 2VZTA 1B09A 2RVAA 4N53B 5DUUA 5FIXA 4JQTA 4KU7A 1SLTA 3KCXA 3GF6A 3WP3A 5FYYA 4BXSV 1J84A 1GBGA 4YPJA 4FT8A 2BTVC 1SEFA 3ZSJA 4BQYA 4IW3A 3WDUA 2W92A 4Q2FA 5DPNA 1V9U2 4AFAA 4M4PA 2UYAA 4BMBA 5A32A 2A6ZA 2QZ2A 1UY4A 3W21A 5CFDA 1MQTB 1PGW1 3JD72 1QJEA 2Q8CA 4FOYA 2YG0A 2R042 3H7YA 3B93A 2J1UA 2E26A 4MZUA 3B69A 2ZX0A 2VQTA 4CEYA 2DCJA 2DF7A 2OT7A 1FOD2 2CTVA 2VXJA 4CDXA 2G1MA 2YBSA 5FLJA 1FMD1 4DRVA 2OKXA 4YFZA 2GNBA 3HWJA 4MUVA 3RS6A 1QJU3 4R4ZA 5EHDA 3ZPYA 4QU2A 3EHKA 2I45A 1I9RA 4CXXA 2C9KA 5IK4A 4ASLA 3CBNA 4PIYA 4MX3A 1SFYA 3PMSA 2WWUA 4ZONA 4M00A 3BPSA 1G9AA 4W4ZA 5F3EA 3ECQA 5FREA 1PX4A 1PIV2 5F8PA 5F3CA 3UESA 1I1EA 3O1RA 3LIHA 4IESA 2P6CA 1M06G 3WQ0A 1W2AX 2D6OX 1C28A 1U5YA 2OX0A 4RD7A 3VL8A 5FPXA 5DMYA 2QQWA 2CU5A 3H3ZA 4CDQB 4B3NA 3B00A 5FYTA 3BTZA 4AEMA 1HQWA 3KQ4B 4MO3M 4QDQA 2BYVE 3DUIA 4OHVA 2VZVA 5LY1A 1SQ4A 3FHAA 4HVOA 2VCCA 2VTFA 5IK8A 5B2GB 2WZPP 3S57A 3FHQA 5F2SA 5FZ7A 4CDWA 2RHPA 1YFYA 3FL7A 4C1WA 5IVYA 1UZ0A 1LESA 3ACFA 5FJHA 3K4AA 1DQ5A 2HBTA 4FPLA 3U1XA 2YU2A 1QH7A 2RDRA 4MGKE 3N7JA 2Q5TA 4LO7A 1VJ2A 3MLJA 1S0JA 2IWGB 1HIXA 1LU1A 2JDPA 2KD7A 3M4FA 4HKWA 2VAUA 4I01A 4XF9A 1W6OB 2HWD2 3H50A 2CHHA 4H7LA 1GP6A 1QH6A 3JB4C 4QHOA 2XHNA 1H8TB 2RJ2A 1S0IA 1Y3TA 5JXJA 3AKPA 3BUCA 1YJKA 3THPA 4CEWB 2JDUA 5K9YA 1S2BA 1LHOA 3R4DB 3ZMNA 1F8VA 1H2NA 2VTXA 4AVTA 4XEZA 5KHIA 3EYPA 2WT1A 4UT5A 5LW9A 2TNFA 3L2YA 1GSLA 3I3EA 2D43A 5A3TA 1M4WA 3U78A 4COYA 4V1PA 2J1TA 1V6JA 3PU3A 1GICA 1NUKA 2FMYA 2RG4A 4Q4X3 1UAIA 2Q30A 3LB9A 2WQZC 3ITQA 3AP4A 4K21A 4QGNA 5C7GA 2HEYF 1FPN2 3A21A 2WN3A 2ZEWA 2A73B 1Q8VA 4MGYE 4HKLA 4ZZ8A 1WZXA 4PT6A 4XOGA 1WW6A 1ULEA 2PAEA 3HD8B 5JSOA 1EAH1 5JSRA 3W58A 2AC1A 3LGRA 1HLCA 3QH7A 3IWZA 2QBXA 2F17A 1K5MC 4CPBD 3GZTB 3WUCA 2WO1A 3AMNA 4W6WA 4AFBA 4AFCA 1OD3A 3O1UA 5CBLA 3LDKA 2WO2A 2W5FA 4XMIA 3FLTA 4GZ9A 5HBAA 3IKWA 5T3NA 1JZ3A 5C5UA 3LOIA 3VUOA 2C9AA 4HN0A 4EZHA 3AP6A 4LT5A 1YIFA 4IETA 1GQHA 4LQRA 1T6BX 1BKZA 5GLZA 2QTWB 4K40A 1LB2A 4JZRA 1O3RA 3HJRA 3LQCA 2W91A 4IEPA 3RGBA 4V2WA 4YM1A 4IEVA 4XJZA 2WN2A 3MPPG 4UXAA 2VNVA 2DVGA 4Y26A 5FZ6A 2V5DA 5DZEA 5BNOB 1RUF2 1POV0 3ACIA 4U2AA 4YZ2A 2C1FA 5LY2A 1QJU2 1WA4A 2GMEA 4I3PA 3UYJA 2GDFA 3VBOA 5GLTA 3ZXDA 3ZYRA 4HVQA 5L7OB 1VP6A 3IN9A 4CDUA 3VBUC 2A3XA 3FN9A 5LB6A 2CL2A 3RI8A 1ACCA 1LR5A 4DUXA 2HWF2 2LUWA 2QFEA 5A3WA 1DFQA 3H8XA 2WS91 3T0AA 4XHXA 3VL9A 4Q4W1 1IG3A 1WMEA 3AK0A 4XF3A 1IS4A 4KBZA 3NKTA 3SCFA 1QDCA 5L73A 1S2KA 3IDAA 2XPJA 1FMD3 2RS31 4XUTA 1V6NA 3I3DA 4WZCA 2J1SA 3A4UA 3J4UH 3VN4A 4Z2AA 3K51A 4BQ5A 4N53A 1H9WA 2WNVC 3MBWA 4LE4A 3QH6A 4MHRA 5LA2A 5FYHA 1FV3A 5AVPA 4B7EA 4H2AA 3U0ZA 3VDBA 1AR81 1GWKA 1UY2A 3LKJA 5C9AB 2PHXA 5EXOA 5HV4A 2W1WA 2YGMA 3VZLA 5T54A 4OHWA 5JIAA 4DIQA 4J1XA 2VQ0A 5D1IA 3MDPA 4AR2A 2IXKA 2V73A 2ZX2A 4QX2A 2ZX3A 2E53A 3RQ0A 3WUDA 5BNNB 3WHUA 4YGDA 2PHTA 3O0XA 2SLIA 4YVSB 5FOJB 3N36A 4LO8A 5FZOB 5K0UA 5IVFA 3W5NA 4MVTA 3TNPB 2GN7A 4UW6A 5LBFA 4EN6B 2W95A 4QPGC 1UOBA 3ST7A 1PVXA 5DQ0A 1ASJ1 3N35A 2JJ6A 1W6QB 2W46A 1LGNA 4JGZB 3N4MA 3OBAA 4XQDA 5IJRA 2CY6A 3WCRA 4COWA 4E4HA 2P37A 3O14A 4P9WA 2BGPA 5ABJC 3MICA 3UGFA 5FYBA 2DVFA 3AKSA 2KR2A 1YQ2A 1HB1A 2I74A 4UYBA 1UD1A 2JDAA 1W0OA 4Q4X2 1YFXA 3ENRA 3MIGA 5CYYA 3SITA 1AR73 5GM0A 5EP9A 3MW2A 4MSVA 5HPOA 1P8JA 1RXFA 3HQUA 4BLIA 2R061 1HN0A 3WR0A 5I0TA 3ZFGB 1OURA 1T2XA 2K9ZA 4SLIA 1G7YA 2ZGLA 4ATEA 1BEV1 5FZMA 2VBDA 4KNCA 3VZKA 1LGCA 4LOSA 1O8SA 5FMOS 3LZZA 4Y20A 3POBA 4IE7A 4D7YA 2RDNA 2XJSA 1MZ5A 4R9CA 2DUQA 5FMBA 4JVAA 4BQ3A 4PIXA 2VULA 3M3OA 1W3XA 5GZDA 4OULA 3W9AA 3KQRA 1UOJA 2CSGA 4CXYA 5T5JA 5ACA1 4IE5A 2WWSA 3D4KA 4CP9A 4YSFA 4Q4V3 1TMF1 3CO2A 2BRTA 1XXNA 1SZBA 3R0RA 5FPZA 3WDYA 1CIYA 4HSLA 1POQA 3GBGA 4YW7A 3ZSKA 1GOFA 2PTMA 3KVAA 4GULA 4GA9A 2DTWA 4CPBA 4EN8B 1C5IA 2VOWA 3LEIA 1H8TA 5FZFA 5JZGC 5F5AA 5FY0A 1EAH3 2YMZA 4PDWC 4CEWA 5C70A 3NNMA 1DGRA 5FWJA 2JE7A 3CKHA 3N9NA 1CZVA 1GFF2 3SQOA 1URXA 4C90A 5T50A 4Y5Z0 2K2SA 3N3HA 4LJHA 2XXZA 4IEXA 4S2FA 3MW3A 1UPSA 2X5IB 1W8ZA 2HWC1 1PGW2 2O0OA 4CRQA 1DLLA 4BPZA 3OBRA 2ILMA 5HCHA 3WF4A 1NCQC 1IQAA 4Q8LA 2W2IA 2GH2A 4KWUA 1LNSA 2ZHKA 3AKRA 5EIYB 1RMU1 4ZU5A 2CWSA 2WAOA 4M4RA 1UU6A 3DXUA 1O7FA 4WVZA 2BU9A 2O14A 1SPPB 3OUJA 4HSJA 5FZKA 4AK3A 2BQPA 4RS5C 3VBFA 5A3MA 2MNGA 4P9XA 2PAMA 3NL1A 1LEMA 5ISLA 1W9WA 2R16A 4QXBA 5SV5A 3I2OA 4LTAA 4Z8BA 3Q9OA 1JZ6A 4IDZA 2VO5A 1QJZA 1SCRA 1S0DA 4G4FA 5KHJA 1XSRA 3AXDA 1U5ZA 4JRLA 4ZKTB 4KU8A 3KSCA 3PHMA 5A3UA 4C0HA 4JGYB 1Y9QA 4LIVA 2J1RA 1R091 4QPIB 3M7AA 2YFUA 2UWCA 2VU9A 5IVJA 1X50A 1OLQA 2GAUA 2RS33 4OUEA 1CN1A 3ZXLA 1W8UA 3WEZA 4CUCA 2Y6HA 3K4ZA 1UX6A 4NAOA 4P9JA 4PBOA 2BGOA 3S7IA 5A1AA 2A1XA 1FXZA 2E6VA 2JWPA 3MIFA 3O12A 4ASKA 3J9SA 5A3PA 4DUVA 3GZAA 4J25A 1COV1 2IFWA 1ZZ6A 1WCKA 5ANQA 1NCRC 3K3NA 1PK6C 2J1VA 1R1A1 2K46A 1W2OA 3ZXKA 2XJRA 4IEUA 4JRAA 2IUWA 1NAEA 1UYXA 3O1PA 5L9BA 1EYBA 1JODA 2AEYA 1CAWB 2XDVA 4LLFA 3SCGA 3MO4A 3U07A 5FMOL 1XRUA 2YPDA 4TLFA 5A3NA 3RZLA 3LFIA 4YW1A 2Y0OA 5F37A 1Q8OA 2ORXA 2XR4A 3OYWB 1IKPA 2P34A 5FBZA 4PHZA 1UO9A 1D0GA 1ASJ3 1Y9MA 2D6KA 1NT0A 2LRPA 2PQSA 3BI3A 2D7FA 3NW4A 3SMHA 5CADA 1PZ7A 5FOBB 3OF1A 4EWAA 1S0GA 2JICA 5F7UA 3HR9A 2Q1FA 3LPFA 3G7DA 1GWLA 2ZPXA 3ES4A 3I7DA 3JQWA 2HJIA 2B9UA 1NY71 2PMWB 4DFSA 5CFCB 2XJVA 3RYKA 4F8AA 5IVCA 2A6VA 1A8MA 4RR3C 5FP3A 1ODMA 3B9CA 5AC91 1XOYA 4XXAA 4QB6A 1B35C 4WM7B 1UL9A 2OXBA 1BEV3 4D3WA 5BNNA 1YWKA 1R64A 3DL3A 4A3XA 1PIV1 1PZ9A 1X8EA 4GWMA 5FZOA 2JDNA 5A7OA 1EAH2 2HH9A 2XJPA 1QQP3 5FYUA 4UWDA 4MV2A 5IW0A 4JC1A 2Y6JA 1AX0A 2P3JA 2WJSA 2WNUB 3P3NA 4O9GA 4YM0A 5FTTC 5HCAA 4JDNA 5IHRA 1W6QA 2EAAA 3ETQA 4JGZA 1E5HA 1PO21 2Y0IA 4A4AA 3I2FA 5FQ0A 2LS6A 3RI9A 1V6OA 2RDQA 3I2IA 4CSWA 2WT2A 1RUD1 4ARYA 1WLCA 1ULFA 4XF1A 4XJ9A 2CAVA 4E8CA 2OW4A 3VBUB 4BU2A 4GJYA 3ZFEB 1VBB3 1W06A 3KHCA 2OYZA 2Y6LA 2VNRA 4URTA 3LOBA 1LRHA 2VZOA 3PURA 3D6EA 3RWNA 2VH9A 2WABA 4AE2A 4Q29A 5B4XA 5A7SA 1WGPA 1RTVA 3FFZA 4NROA 3T2PA 2ZGPA 5J98B 1OHFA 4OZOA 5F5IA 5EJZB 2Q1MA 3ME2A 1GZTA 3R4SA 5A1LA 2HEVF 3RPQA 5JCTA 1BK0A 3I49A 1UY0A 4FCAA 2PLV1 2ZBJA 2ZGKA 2WNVB 2OQ6A 2HWC3 1MZFA 2XQRA 1ZRFA 4L9BA 2Z42A 1O3QA 4WVMB 5FZ4A 2VJXA 2WS92 3O1TA 4NUBA 1DGWX 2QKDA 4Q4W2 4MH0E 5CFDB 4HPKB 1H1IA 1RMU3 2VNOA 3H3LA 2O1QA 3WVJA 3O1SA 2DFCA 4CEYB 2RS32 1DZTA 4XJAA 3UL2A 1C57A 5LA0A 4KQ7A 2WZEA 1F9KA 3BOWA 3KGLA 4ZS2A 1XYNA 3KD4A 1W6MB 4OQ8A 3GBFA 1JXNA 2TUNA 3WF2A 3NNFA 1VPHA 1AR82 1ND3C 1BVVA 2D6LX 1AZDA 5FZ9A 1QF3A 4YG6A 3RMYA 5K7PA 5GZGA 5KBFA 4CCDA 4AEDC 2YB7A 1E5RA 3PNAA 4GH4C 1Q8QA 4RQPC 4EJRA 2ADEA 3K3OA 3NAPC 4Y1XA 5FUIA 3BB6A 2RE9A 1VAKA 3C7HA 1ZRDA 2AREA 1LEDA 2VXRA 3EXUA 4ISRA 3AP9A 4E8DA 4OVEA 4N9IA 1FV2A 5JR2A 1HV0A 3ATGA 1ASJ2 1CPNA 1LOFC 1OBNA 4TWTA 1SPPA 4IQPA 3WF1A 3J8F1 4NIIA 4HK9A 3OEBA 2FDKA 3FZ3A 3BTYA 3PMEA 4J6GA 1R1A3 2EICA 4YNIA 4XMAA 1YQ6A 4DMIA 3CZUA 4QKFA 2GN3A 2WYSA 2ZCWA 3CJIC 1F31A 5FY5A 3BOPA 1QJX1 5DG2A 3WG3A 4AVSA 4CDWB 4X8NA 5CEHA 4OI4A 4XACA 5LATA 4BE3A 4XQWA 2R062 3URFA 4K6BA 1FATA 4NN0A 1PVC1 2DCKA 4WZFA 5FZAA 5A7WB 3JD73 4ES8A 1JU3A 3LFMA 1BEV2 5FP8A 1MACA 2BGCA 4IV1C 4M3CE 1AR61 2H6CA 1YEWA 2W08A 3AJYA 4LO5B 5G05L 1W28A 3MGUA 4NHMA 4PIZA 1PMJX 1JOPA 5BNPC 3E6BA 3UJQA 5JZGB 2BNNA 3WW2A 2B45X 3M70A 3FFQA 1CR7A 4XUPA 4G3YC 1XNTA 2WZR1 3PL0A 4GMP1 5EFUA 1N1SA 3RG0A 3I2KA 5ACA2 1TMF2 1EPZA 2DV9A 1LECA 2EA7A 1RL3A 3TEZA 2RM22 1RITA 2AACA 2ES3A 2OZ6A 3H1YA 5EJ3A 3V65A 5AC93 1ZZ9A 2DU0A 5F2WA 1CAWA 3SLIA 2WUHA 1PNFA 2D93A 2NMOA 1IG0A 1OT5A 4ASMB 1NCQB 2C0ZA 1H0BA 1GP4A 2HBUA 1PIV3 1PX3A 4R9BA 3WX5A 4OQ9A 4E4DX 3DCQA 3I2HA 1AF9A 5G04L 4LE3A 3M3QA 1O6UA 2ZEYA 5AVAA 3WF0A 5JXIA 3IDCB 2ORZA 3POSA 4ZU4A 4UI9L 2R0FA 3ZYPA 2Z69A 4CXWA 3GCWA 1VB4A 2WFF1 1IPJA 5LCWL 1XU1A 3THCA 2XJUA 2IFRA 4RS5B 4H14A 1RYYA 2XMLA 2OZJA 5FO8B 4OLLA 1RUD3 4P5HA 2KXLA 4UW5A 1ZZ7A 2CDPA 4QXCA 1LOGA 3O1VA 3MFAA 3T08A 1W9YA 5LBEA 4URAA 2XB6C 1K5MA 2VECA 3Q8FA 1RMU2 3SNMA 1VRBA 2VZ3A 4Y33A 3SH3A 4R9DA 1GZCA 1GR3A 3SKVA 1RB8G 3EMRA 2PN5A 3P1IA 2LTNA 2IXLA 3A7QA 1YFWA 1GV9A 1PMHX 1CD3G 2D5FA 2X10A 1DQ2A 1YNAA 4FOQA 1L7RA 1O4TA 1POV3 3PVEA 4RGGA 4XILA 2FDJA 1IZ3A 4CCJA 4CVUA 2PLV3 3BALA 3KHBA 5LBCA 1REFA 5BXXA 4WV8A 3VBOB 4DQAA 3KCYA 3OBTA 3OPWA 3QCWA 4HL0A 1REDA 3RDIA 1NE4A 4KH9A 4CDUB 3HQRA 1W04A 2A5ZA 5IT6A 2BP6A 1VBA1 4UF0A 3R6SA 3POFA 1ZREA 1R092 3VBUA 3NNGA 2D6NA 3VZNA 3T2QA 5FZIA 4WM8C 3ZYGA 1VBD1 5C3PA 4XABA 5JR7B 2ZGMA 3AZXA 3MF9A 4OYUA 1UN1A 3I3QA 1O3TA 1UZWA 2RS51 3AZYA 4Q1RA 3SEPA 1J83A 1TQ5A 3CLPA 3IMMA 1COV2 2WQ4A 2XLFA 3FWEA 3L2HA 4K3UA 3VHOA 3USSA 2XONA 1OA3A 2GSYA 4QU1A 3HT2A 1WLDA 3S6PA 2BOJA 1I3HA 1KFXL 2FZ2A 1R1A2 4KBBA 5FLHA 5FV3A 4R52A 3ORJA 1OMIA 2WNVA 5FZ1A 4HVRA 3PJQA 5CAZA 5FZLA 1HRV2 4KG0A 2VTXJ 4WVMA 1K3IA 1TME1 2RV9A 1KFUL 1BZWA 1GZWB 4XQ4A 4HPKA 1TE1B 5IWFA 1DG6A 1F15A 1JYVA 4EV0A 1EP0A 1JHJA 4D94A 1B35B 5K0UB 3J8F3 3VKMA 2ZS6B 1XYOA 2EAKA 1W6MA 4AXOA 5C4WC 3WP4A 3DN7A 3ZR5A 2JENA 2Y6FA 1RUF3 1H2LA 5FR3A 3I2JA 4QPGA 4FTEA 4RFT0 3ZPOA 4OHXA 1GNHA 1QJX3 3A22A 1KQRA 1NY72 2FDHA 1H6XA 4QX0A 2ZGNA 3M2MA 3V0BA 4P9IA 3RYPA 2CDOA 1XNBA 4XIOA 2GMPA 4FOVA 4HZFA 3OD4A 2Q0AA 1PVC3 4C8DA 2H0BA 5ABJA 5AC92 4ORFA 2QDNA 2W9XA 2HWF3 3WQ7A 1AR63 2QJVA 3KS7A 4G9SB 2B46X 2J7MA 5IVVA 4UFJA 1PM4A 2R30A 2UWBA 1RUNA 3WW4A 3FLPA 1A8DA 5FAXA 4DXZA 4LXLA 4Y20B 4LPLA 1MPXA 1PO22 2AR6A 2W87A 2WZR3 1QY4A 1XNAA 1IS3A 3AMQA 4XUOA 5GZFA 4B29A 1O4YA 5FXXA 1N47A 2FMDA 3EJKA 2VZ1A 3HVDA 1ENSA 4SBVA 3K4DA 4ZPIA 2VOKA 1RUD2 1KD7A 3RMXA 3SISA 4AFDA 4BK4A 2GH8A 2Y34A 1IHMA 4W8JA 3IM0A 1QKQA 1SCSA 1XC6A 1PHMA 3MIHA 5DUXA 1JYNA 4CP9B 3RZJA 5EWSA 1YHFA 3PUAA 3WZ1A 3ZSLA 3FBYA 4I09A 4JTNA 3SCHA 4YM3A 4XXPA 4FQ4A 4RN5A 3I3BA 4TN7A 1AJOA 2A6XA 4QQ2A 3JBG1 3LWCA 4XZUG 1H1MA 1QXJA 5I0RA 4XFCA 1O4ZA 2CGNA 1FAYA 1UYZA 4H55A 2WFF3 4AGVA 1JMUB 5ERLA 5JXHA 4AW7A 3QACA 2J42A 2P5BA 2PLV2 5I91A 4JHZA 3P3PA 3RWKX 1HJFA 1YO8A 4GALA 5JZGA 2Q4SA 4XUQA 2C4XA 1Z0HA 2IXJA 2BOIA 2ZOEB 1VR3A 3GZEA 2GZWA 4K1YA 4PDWA 3OJBA 2IXHA 3JB8A 4QM8A 4XHBA 3VZJA 3CQOA 3Q8EA 5A6QA 1QNYA 1XBFA 2XQXA 5A7QA 2XWBB 3USUA 1W39A 2OUHA 2YV8A 3BIWE 4I02A 3ZX7A 2VG9A 1RUC1 3DPRC 2VW2A 2ET7A 4N9HA 5H9SA 4NRQA 5GALA 2W1QA 4CA9A 2P3YA 5FDBA 3B9IA 4FFIA 4FPHA 2XVLA 3CEWA 1NCQA 5CKMA 2ID4A 4BB3A 1KJLA 3RZMA 4MYEA 4C0BA 3VBFB 3GJBA 5H9PA 3FLRA 4LBQD 1GNYA 5J36A 3KT7A 1CWPA 3O5SA 2BJSA 1QXRA 1JTZX 2OUJA 3B02A 3HT1A 3Q8AA 4P14A 2P2KA 4RS5A 2HWB1 1SBEA 5FXVA 1ND2C 1LENA 1VBA3 2UY8A 3RZKA 3O1MA 4EWDA 4YGBA 3H7JA 2AGSA 3CJIB 3LD8A 1JOJA 3GALA 4NHYA 2WSVA 5D8AC 5FPAA 2BZDA 1W90A 2E32A 1D4M1 1CIWA 2VW1A 1HQLA 3WCSA 2RS53 4JKLA 4BQ4A 1OA2A 5FXWA 4H7MA 4N7IA 2VMHA 3J8F2 2FHRA 4Z2WA 3JUUA 4CP1A 3HN3A 3SC7X 5FK7A 4O7XA 3KT4A 4ZHNA 4AHWA 2R0HA 1MVEA 2ARBA 3N9PA 3CDZB 1C8M1 2PHRA 1JI6A 2C26A 1QJX2 3LA7A 4AVVA 4LOTA 2OA2A 3AYDA 1V0AA 3IDEA 1TME3 4JDMA 2VMCA 4YW3A 4LBLA 5HV0A 1NCRA 1PK6A 5A80A 3MLLA 1PVC2 1DQ1A 4ARXA 1LHUA 2VQAA 1OOPC 3E6DA 1X82A 3KB5A 3VKOA 1UYPA 1AR62 3OY8A 1Q43A 5FP7A 2JDZA 2Y6KA 1JHNA 1PGSA 3KF5A 5JVVA 1TVGA 4D8MA 4YW6A 1PO11 5FZ0A 4LHKA 2B7YA 3DV8A 2VMFA 3NJVA 3ZYHA 4R4XA 4LHNA 1JYIA 3ZYFA 4B4PA 2VW0A 3I2GA 1YIPA 2WZR2 5JMCA 4YG0A 2VUJA 3JXSA 2VPVA 2IXCA 1MS8A 2ZGSA 3C7FA 1OI6A 1WLTA 1UKGA 5L19A 1F4HA 4B4RA 2YROA 2YU1A 4HONA 1DQ6A 1ZBA1 2DVAA 2W3JA 3J7NA 1WMXA 5FJKA 4PJYA 3VDDC 4XCBA 4NPLA 4MXWA 3MYXA 1DCSA 1NE6A 1GZWA 1FNZA 1HKDA 3CIHA 3IMNA 2YDEA 5CIRA 4LA3A 5C8CC 2RS11 2VMEA 4A3ZA 1CAVA 4QXKA 1PGL1 4RR3A 4AVBA 3H9AA 1HB3A 1ULCA 1BBT1 1UPIA 2VVDA 4BISA 1B35A 1KGYA 2WFF2 2UWAA 3W59A 3S7EA 5E88A 4Q5OA 1ODNA 1RUH1 2E7AA 4IGQA 4RYDA 5CA6A 2IVIB 5IFTA 2I07B 1W9TA 1OSGA 1VMJA 5FYSA 2NZ9A 4Y5SA 5FQ0B 1XNCA 1C8NA 2R1BA 1AYN2 2JE8A 2ARXA 2NQYA 4ZZ5A 4O9EA 3WXPA 5CU1A 1D0HA 2ETEA 2DCTA 4F83A 5F5QA 1FNYA 2B9VA 3UK9A 1SG3A 2ZX1A 3HN1A 3JBG3 2PXJA 4FP3A 3VBSC 4YZ3A 2WC2A 4BCUA 1ST8A 4A7ZA 3AYCA 1JZ4A 3WDVA 3NO8A 3H1WA 3MLKA 2VGDA 4AZZA 5K8SA 1FI2A 4D6RA 2R071 5FZEA 4Z82A 3AZZA 4BQXA 4A45A 2DYCA 2E9QA 3T30A 4P08A 3M3EA 1UMIA 3WP5A 1RJ7A 4IGOA 2BUKA 1RJ8A 4Q0PA 4GMP0 3D82A 3KVBA 4J1WA 1VBA2 4FFGA 4XYXA 3WLUA 5J96B 4K20A 5F1RA 3H0OA 1RUC3 1GANA 3VBHC 1SDDB 1UY3A 2JDHA 2XG3A 1UZZA 1VBD2 2LW8A 3FMGA 3HBZA 4LBQA 4D7SA 2RM21 1RVF1 4CYDA 2G9ZA 1DBNA 3THDA 1XSQA 3N9QA 2RS52 5FZBA 5BYNA 3LCPA 1J1LA 3VV1A 5H9QA 3PUQA 5IK5A 3OSDA 1C5HA 3U75A 1VRH2 3WW3A 3UGGA 2KM2A 1ULOA 3C7EA 4DOUA 2UU8A 4XFBA 1X8MA 3ILNA 3LIGA 3QLQA 3AM2A 4GD4A 2X05A 4NPMA 1G9FA 3VGIA 3CU7A 1ND3A 5AFBA 3W5MA 3BIEA 2YC0A 1TME2 2A3YA 1PZ8A 2ARCA 3IT8A 2VCBA 4AEDA 4GH4A 4RQPA 3UKTA 3NAPA 1H6YA 3WINE 3E5QA 1TZOA 1JBCA 4LUMA 4IV3C 4NIDA 4XCAA 3DEMA 2PHDA 4LULA 2Y38A 3DXTA 4DEQA 4AQ6A 4LEJA 5FZCA 1W8HA 3P6BA 4FPEA 3SEEA 2WYFA 1WMDA 2WA4A 1LOFA 1ZNPA 1KDMA 1NLQA 4Y1VA 1ZZCA 4K1ZA 2F4LA 4B1LA 5FKBA 4MGZE 1LOCA 1UOGA 1Y43B 3CHXA 3AP5A 2ZKLA 1NQJA 1S4CA 2WS93 3CJIA 1JUIA 1OQEA 4Q4W3 1S0BA 1ENXA 4QQHA 3VD9A 2EXJA 5I0SA 1PO13 5L9RA 4LBMA 1NG0A 3LA2A 5KHHA 4OI1A 3UNPA 4P02B 1MS3A 1UU5A 4QQOA 5KHKA 3BCWA 4X6QB 4IV1A 2VM9A 2W47A 1OC1A 2F6BA 3WSOA 3KV6A 1V6LA 3OCPA 3B5LB 4DNYA 1AR83 5BNPA 2VBBA 4FPJA 4YARA 5C33A 4RSUA 1FT9A 1RXGA 3S30A 4Y5TA 4HK8A 3LEMA 1I5ZA 2YBPA 1LHWA 2QQIA 4MXVA 5JI7A 1ZA4A 2G19A 5A7NA 2YBKA 4LKFA 1E5IA 2VZQA 2Z79A 2CWMA 2PFWA 2ZTNA 4M0HA 3UETA 3WP6A 1G6NA 3HIFA 4QM9A 3ACGA 1YQ8A 3OOXA 5A3OA 1CQ9A 2RS13 1HRV1 3JBG2 1C3HA 5D2AA 4OUMA 2JG8C 2G4IA 1GYKA 1S1AA 3DPRB 1I6XA 3OGRA 4YYOA 1BBT3 1YC61 1X33A 2H6BA 4NMIA 2YFZA 3O7OA 1X36A 2EF6A 2QQNA 2LM3A 3WNLA 1AR91 1W05A 3PDQA 4RA0A 5FKCA 1RUH3 3TEYA 2DWRA 4DS0A 1STMA 1AXZA 4LORA 4W6XA 1DYOA 5FPUA 2D98A 3PU8A 1SLCA 1H30A 4ITCA 3HNBM 3NMBA 5FYZA 2WIIB 4XW3A 1CZTA 4LBKA 3ZMOA 2F4PA 1LHVA 4LIUA 4AQSA 4AYUA 4JV4A 1RUC2 1W8TA 5FXZA 3LPGA 4LBNA 2V5YA 2GC3A 1OD5A 1K5MB 1QMJA 1AHSA 3DF0A 3ZN6B 2DTYA 2RR11 3VLBB 1VAVA 2WZ8A 1DZRA 5D21A 2R063 2DURA 1EV11 1VLNA 1GQPA 3NV2A 3POYA 1SACA 2IXIA 4YGEA 1JU4A 4BIFA 5J48A 4L11A 2B42B 4OUSA 1Q8PA 2JKBA 4OCTA 4Q1PA 4YVWC 3VZOA 2R073 2V4AA 4MHUA 2D3RA 1JUHA 1OQDA 1W8FA 1LODA 3WNKA 2FDIA 2R1DA 3WDTA 3U10A 1DIWA 4N43C 4ZY9A 3OUHA 1OA4A 2ZGQA 2HWB2 4AAPA 3K75B 5T5LA 3ACHA 4IERA 1U5IA 3ZXGA 1BXHA 3T09A 1W3VA 3WG1A 2J1EA 3NNJA 4GB31 1MQTC 1OLRA 5EYXA 5ACA3 1LJ7A 2ZHLA 1TMF3 3X29B 3GGLA 4UF0B 4META 2RM23 2P1BA 1NX9A 1RVF3 1D4M2 1XE8A 3BODA 2ATFA 3SXWA 1APNA 1GU3A 1VMHA 5E6HA 2BWAA 4BQWA 5FY9A 3PTRB 5JWPA 1OOPB 3WY6A 4E2QA 3LDBA 5DDJ1 2AEZA 4WM8A 4FPYA 3AYEA 2G9FA 2JE9A 1L7QA 2Y8KA 1C8M2 1KJRA 2Z2SB 4QD2A 2JB4A 2VCMA 3OEAA 3VD4A 2C5DA 3NQHA 4F7ZA 2FCUA 2VMDA 2ZEXA 4AEJA 4EROA 4Y1UA 5C8WA 3BVCA 2BV4A 5F5CA 3SH5A 2DUOA 1SLLA 3ZOIA 1QOTA 5FPVA 2WLPA 3MUY1 2WA3A 4FXKB 1F5JA 2ENRA 4NWVA 1DYKA 5JAXA 3TN92 3HQXA 4COZA 4UW3A 1WLWA 4DRRA 3AMMA 1ZYBA 1QIQA 2VMGA 3BYWA 3NKGA 3VDDB 3FHIB 3T1LA 4BK5A 1S0EA 4JDOA 1PO12 1GLHA 2BFUL 4LA2A 1O8PA 3KGZA 4CDQC 1W9SA 4Y22B 4NIGA 1T6GC 5C8CB 3WNMA 3J7MA 2DCZA 5JI9A 2VVFA 4ES9A 4IEQA 4GXLA 2X53S 1RUE1 2CAUA 2P17A 4JHTA 4M3CA 1O91A 2YC2A 4XFAA 4QPGB 5BY5A 5C4WA 5I8TA 1ZBA2 4IE6A 1AL0G 5I0DA 2Y60A 2A71A 4LKEA 3V0BB 2BBAA 3NSTA 4QB1A 1DF0A 1OLMA 3BTAA 1TEIA 2TBVA 4KGGA 4IUGA 2Q8OA 4BWOA 5ABJB 4CU9A 3WNPA 1W8NA 3QD6A 4EWEA 5A7WA 2RS12 4Q0UA 1HQNA 1R093 1PGL2 1QGLA 1XU2A 2LROA 1BBT2 2BW8A 4YFWA 5FYMA 3ZXEA 1D4VB 1W03A 3B3QE 4XBLA 3AXEA 1O59A 3B01A 3VBSB 1U0AA 1VBC1 4GKXA 2WDBA 5GLVA 5LEJA 1RUH2 2ERFA 1VIWB 4FFHA 5GLUA 3VKFC 3ZSMA 2HLEA 3ON7A 3MI8A 1BLZA 2RMU1 1N3PA 4Y1ZA 5DAXA 5HXMA 1COV3 1X7NA 2PAKA 5F32A 3ZFFC 4LKSA 4XE9A 4FSJA 2E51A 3EQEA 5T52A 2BPA2 2FCVA 1RUG1 2ZAHA 2ZGOA 4CP0A 2A7AA 2Y6GA 4COUA 1HRV3 4TZDA 1NOVA 4BIOA 1AJKA 1VAMA 4IEYA 5L36A 3VBHB 1XPWA 1KDKA 1ZX5A 4XDOA 4YRDA 4Q27A 2ET1A 3GDBA 3FC0A 3CZJA 5FP4A 4DEVA 3MV11 1JZ5A 2AYHA 2QDRA 3G6JB 2R072 4QWNA 4RGAA 1WCUA 3AL5A 1AVBA 1U5XA 3GZUC 1W0NA 4ET7A 1G9DA 2HWE1 3SHRA 1OLME 1GNZA 1WW4A 3JZVA 1AL21 2ADDA 4PDWB 3E5XA 4EZ4A 2D6PA 2A75A 2JB8A 4NPRA 3H8OA 4XUNA 3USUB 3HMYA 2BVBA 2RR13 1GUIA 2D40A 2XWJB 3PVBB 4DO0A 1RVF2 4XZPA 5FO7B 2TEPA 5CVRA 1U12A 2ZZJA 1EV13 2YGLA 1VE0A 4FPGA 2P6HA 4ZU7A 5IK7A 1EPWA 5T5OA 1IKQA 1KS5A 5EV7A 1S0FA 1WCDJ 1QJY1 3DPRA 5BNOC 5F9TA 1RINA 4X8PA 5J37A 5IVEA 4HBNA 5A33A 4MGIE 3N7MA 4QX1A 4MLOA 2PA7A 5L7OC 3ZVXA 2JEMA 3F2ZA 4RL7A 4MADA 1MZ6A 4A6OA 1PO23 1ZVFA 3GNEA 4BZ4A 1RIRA 4GB33 3WG2A 4LNVA 2JG9C 4AI1A 3FBMA 3MIDA 1L7LA 4XF4A 4I2OA 1W99A 4GIQA 2XHKA 2VQUA 4AEKA 1QNWA 4W65A 1ND2A 1AYN1 4XFHA 1N1VA 1XE0A 4JCKA 3JQXA 4QKBA 1AYM1 3ZN6A 4HG6B 4YM2A 3E5UA 4DPNA 5DUWA 2VMIA 2FDFA 5DDJ3 5D8AA 3EO6A 4A44A 5IYYA 2W1SA 1I5PA 1YYNA 4XJ8A 4CZSA 3OG2A 2NPIA 1WW5A 2EIEA 3AZWA 1YQ5A 2YZ4A 5J1XA 5C9AC 4GWNA 5FMDA 5C5TA 4CCLA 3INAA 1HXS1 2W52A 5DZFA 1RC6A 1DGRN 3ZN5A 1H4HA 3Q8CA 4QKDA 4D69A 1GMMA 5FY7A 4CUGA 5FZDA 4FTBA 2CV6A 3LA3A 4QXHA 1NCRB 2CYFA 1PK6B 2GMMA 2B8MA 4YVSC 1ENQA 1BYHA 4KG8A 4LUKA 5FYCA 3OY8B 2OIIA 1K42A 3SKJE 3THTA 3AB0A 4NAMA 4MG2A 1OOPA 2ZAAA 3ES1A 3J26N 5FYIA 2VBPA 5FYVA 2D97A 3ROUA 2VZUA 1CJDA 1RUE3 4QB2A 3O1OA 4L97A 5I0UA 3N9LA 4ATFA 5JOZA 1JW6A 1XYPA 4CCOA 1YUDA 2R49A 1AX2A 4M0NA 4QAWA 1VBE1 4JKMA 3ZYJB 5IVBA 3UKNA 2E33A 3NV1A 2ZHMA 1VRH1 3H42B 2ZHNA 2EXIA 5TSWA 4Q0VA 5JOXA 2FBEA 5FK8A 4FFFA 1ONAA 3U4XA 2ZZQA 5A3LA 1JS9A 3KM5A 3DYPA 4ZS3A 3U11A 4DXSA 4MXWB 2G9GA 3ZFGC 1XB9A 5DXDA 1DHKB 1MS1A 3VDDA 3JU9A 2XOMA 4AL9A 3K2OA 2NYYA 1NZCA 4LO4B 4DY5A 1VBC3 5JSPA 1AR92 3ZSEA 5KHGA 4HMZA 1CAVB 3VHNA 1MVQA 3FUOA 1RUI1 3PVNA 4RR3B 5EJ1B 3GCXA 4FQZA 2RMU3 2QQJA 4Y22A 5C8CA 2D6MA 2X8KA 4PBPA 4HXCA 3T4VA 2PELA 1E5SA 4YVWB 4ZXEA 1NQDA 4FBFA 3VD3A 5JXGA 1CAXB 2JD4A 1H4GA 1EUTA 5E8AA 4I30A 1ZM1A 2WINB 1BMV1 1IOAA 1RUG3 1W6PA 4Z1VA 4HFSA 4N43B 2DUPA 3VHRA 1IPKA 4L99A 3VKLA 4B7KA 4N7UA 2VNGA 3ABZA 5KXBA 2RR12 5KXCA 5LZ6A 1ULGA 4AI8A 4LK7A 1DLCA 2DDUA 4TXWA 2W1UA 1EV12 1N1YA 4AI2A 1NA1C 1IPSA 5HCFA 1ALYA 4JAAA 4ONUA 3VZMA 4OHYA 3WNNA 1PMIA 3DKQA 1SBDA 1MS0A 1RGSA 1W9FA 3RVHA 4UBGA 3VBSA 4GWIA 3RYRA 1UXXX 3AP7A 1DGWA 3D3AA 2HWE3 3AVRA 4PLMA 5JLVA 1AL23 3RJRA 1YI7A 5CG9A 5I8SA 2MEV2 5JPMB 2X5IC 5E89A 4GB32 4GMP3 1QEXA 1QOOA 3PUHA 5FMCA 2YUEA 3CF6E 2QZ3A 5CZKA 2AENA 3E6CC 5EQUA 4YZ1A 5KC5A 4K8RB 4OFGA 1UXZA 2GU9A 3HOBA 4AHYA 2LALA 4TSVA 1J58A 4IEZA 4QPYA 2ZABA 1OH4A 2VUCA 3IAQA 2QE3A 4LBQB 3MFCA 4QX5A 4O65A 5BUVA 4OMDA 1QJY3 4AGGA 4I0BA 1A3KA 3LSEA 1V6MA 1W2TA 2VZSA 2XLGA 3K48A 5DDJ2 3VBHA 3OUIA 4ZXKA 5JOWA 2BNOA 1OF4A 4XJUA 3ZDSA 5A6ZA 5C3SA 4CU8A 4NO4A 1REEA 1LAJA 2BERA 1OVPA 4KMQA 5SV8A 4BH9A 5T55A 1HDKA 4E9KA 4KL1A 1ZBE1 3VDCA 5J09A 3ALQA 5J7MA 3UGHA 4RGKA 4HKOA 3OD0A 3HPNA 5FBJA 4BHPA 1EUUA 3DYMA 1KXGA 3BN6A 2VC9A 2YPJA 3DKWA 3GHNA 4R8HA 1ND3B 2JDYA 2Y26A 4NHKA 4A7YA 4FPCA 3KLSA 2W0XA 3KZ4C 4JGYC 4IXLA 1AYN3 2NM1A 2PHLA 4L2NA 4QPIC 1AYM3 3N7KA 1E57A 3WQBA 1W6NA 4GH4B 4RQPB 4AEDB 1J1TA 2P3KA 4CCNA 4BMEA 3NAPB 4XBQA 3FE5A 1AR71 3R4UA 4HT1T 5FZ3A 2XL9A 3WD5A 4JTOA 2VR4A 4Q26A 1SDWA 2VY0A 2Q8EA 4E27A 2PHWA 1ULDA 4TTGA 5FUPA 5A6XA 1UNBA 3C7GA 1RUE2 4AOCA 4C1XA 4IV3A 4LK6A 3ZDVA 2W94A 2YY1A 1JZ8A 1HXS3 4NIAA 2DCYA 3GYDA 4RHV1 5F6KA 1VMFA 1RUJ1 5DAWA 3ILRA 3ZKYA 3RZZA 1Q5OA 1S0CA 3A0KA 3AZVA 3M3IA 3P5BA 2WNOA 4PQQA 4EN9B 1JYWA 3DGTA 2XUMA 2ZGRA 4P9GA 2XJQA 4WVWA 5FUNA 1YLLA 3ZFFB 5JPNB 3AFGA 2B4KA 4R9AA 1AUYA 3MEPA 5FZ8A 2I2SA 5C3QA 4FXGB 1WCSA 2XVGA 4MGSA 5FFOC 5A6YA 4Q4V1 5CISA 1HN1A 3ZR6A 2VD7A 1H9PA 1LCLA 1VBD3 1VBC2 4XFGA 1H2MA 4EN7B 1DDLA 1CONA 1H8VA 1FYUA 4DZGA 2RMU2 4LBJA 2BNMA 4Q4Y1 4BYYA 4BDVB 2RJKA 1GOHA 1BVP1 1VBE3 4IV1B 4OZXA 2UURA 1VRH3 1F4AA 2ZGTA 2A6YA 4KWLA 5L9VA 5LRRA 1RUG2 1LU2A 1XQNA 4NR1A 2PQQA 1LOEA 4PLOA 5BNPB 1OF3A 3N9OA 5CFCC 3H1MA 3TYJA 4CUBA 3MW4A 3D0SA 2ZMLA 1HJGA 4DUWA 2BBVA 5C6CA 2GC0A 2IZWA 3GJAA 1PNGA 3AFKA 4QX8A 3VD7A 2HYKA 4NRMA 4DY3A 4WM7C 3MZHA 5FZHA 1CX1A 4PI0A 2XKPA 1Z7S1 4QQPA 4N90A 5DG1A 3LEGA 5A7PA 5DAQA 4QT6A 3TN91 1J3PA 2WFPA 1RUI3 3KCCA 4BOWA 3TB0A 1UU4A 4I0AA 1R081 4QX7A 2WNUC 1KITA 3IIAA 5EYYA 2JG8A 2BWCA 4K7JA 2HWE2 3J7LA 3IB3A 2QQMA 3QOPA 5IAXA 1AL22 1Z78A 2WBKA 3S5AA 4XVHA 4A2UA 4U36A 1HW5A 5IUQA 3ZFEC 1SLBA 4BQ2A 5FWEA 5KWRA 2E7TA 2GALA 3TOJA 3IPVA 3OGVA 2JG9B 1GKBA 4YWAA 2FD8A 2N7GA 4HOOA 4XC9A 1QJY2 1G9CA 1Y7BA 2R32A 1S2EA 2FZ1A 4AGRA 4HANA 2ZXQA 3LF7A 4NIHA 4E2SA 3PIJA 2NLRA 4Y4YA 1OUSA 1HRI1 4BLJA 4JKKA 1UF2C 3UT0A 1J59A 4YVWA 3AVSA 1CAXA 2BVVA 2E7QA 2OS2A 2XH6A 3AKTA 5JIUA 4LHSA 1DP0A 2XUEA 2GC1A 4N43A 1YRZA 5CFDC 3B7MA 1SBFA 1WBFA 2E63A 2EIDA 4F3JA 3KV5A 1AYM2 3I97A 3M3CA 4QGMA 4CEYC 1MQTA 1WD4A 1JH5A 3AKQA 3T1MA 3ZYBA 2H0VA 4Y1YA 1CJPA 3I59B 1AX1A 3L9JT 3RRDA 1NLSA 4CE8A 3ZXAC 1YJLA 4CDXC 1OPOA 1V70A 2WKKA 1ZBE3 1ZRCA 4WM8B 4ISQA 4AWDA 1WW7A 3AJZA 1HXS2 2JDKA 1D7PM 2Y33A 2ZEZA 3KMHA 4GJZA 4NJ4A 1WCQA 1CZSA 3D8CA 2AUYA 2QQKA 5DN2A 3NVCA 3NJZA 3VB9A 4C91A 2JECA 4IGPA 2WO7A 4HLTA 5LRSA 1EY2A 4XURA 1DQ0A 1WMFA 3AMHA 4P9LA 3AMPA 3C2UA 1WWYA 1D2QA 1WKYA 2O8QA 3D0JA 3OBZA 4AHZA 4Q8KA 5IFPA 3H8RA 3ELNA 2L9LA 4QDSA 4B1MA 2CGOA 2D3PA 2OPWA 3VHPA 3TRSB 2FDGA 2EXKA 4CCKA 4HN1A 2JX9A 2KA3A 5F3GA 3T2TA 3POEA 4QQLA 3BGAA 5F39A 4NHXA 2DVDA 3LSDA 3IBMA 5EZWA 1J3RA 1LTEA 2MPFA 1MS4A 1NLRA 2NMNA 3NV3A 1RUJ3 2VZRA 2WR9A 1VBE2 4RHV3 3CMGA 4CDQA 2ZA9A 1QQP1 3Q8BA 3H8UA 4RFRB 1SLAA 2VUAA 3OPZA 4M3CB 1MS5A 2VZPA 5A70A 1Y9GA 2HWB3 3HAGA 1L3JA 3OGGA 4GKYA 4XTMA 4CDWC 5C4WB 3MHZA 1MEC1 1W8WA 2P3IA 3VBRC 1WD3A 4OHZA 3ZIXA 5JOYA 4FI9A 5EPAA 3M8LA 5GJ6A 4BM8A 5JMOA 5LBBA 5GZEA 1UZYA 3POGA 3IAPA 1VBB1 3NV4A 4DXTA 4CU6A 1D4M3 4IEWA 1RUI2 5KC6A 2C6SA 1W6OA 4Q4Y3 1KEXA 1NA1B 1OUXA 4UFMA 5FPLA 3T0DA 3FUQA 1CX4A 1N1TA 1MS9A 3GHMA 1IQDC 2DFBA 2DVBA 3BU7A 4KI5M 4LLOA 1OH3A 2IVJA 3TBDA 1BMV2 1C8M3 2A70A 2HYXA 2RJLA 2PYTA 4INDA 1AXYA 3W20A 1C4RA 4YW4A 5GKAC 2QQLA 4P00B 5HXVA 3BPZA 2VE1A 5LK5A 1NYWA 4FTSA 4W50A 1UW8A 3ZFFA 4EYUA 3LE0A 4NWWA 1UIJA 1NXMA 3PLQA 1Z7S3 4FPFA 4UAPA 5I8YA 4XDPA 2NN8A 4UW4A 5CKQA 4UBHA 3TN93 4NVPA 3IZOA 3NRUA 1HX6A 2X29A 4XPVA 4XTPA 1R083 2BEOA 4I0WB 1ZA7A 4D6SA 1OXCA 5FZGA 3FJSA 1FMD2 1VALA 5IAVA 4CU7A 1RHI1 1UMHA 4A7KA 3K77A 3RZHA 5C3OA 2O8OA 4XJWA 2ZACA 1TNFA 2XJTA 2WLQA 4CCCA 3RJ2X 5HI0A 2EXHA 3R05A 1H1AA 4P9YA 1X9TA 2SBAA 3I2DA 1C1LA 1NZIA 2BFUS 3MUZ1 2W39A 1A6CA 3B94A 1SFPA 1ZRIA 1H2KA 5F6LB 2XKOA 1W2NA 1ZBA3 4AF9A 3PVOA 1GQGA 2XBO1 3ZM8A 5BPXA 2B39A 2Z5WA 1O3SA 3PUSA 4JX0A 1ENRA 2JD9A 2Y64A 4AI3A 2YYOA 4A41A 4B4QA 3AC0A 1SMVA 5APAA 1A34A 1QJFA 3NJXA 2QQUA 3A0NA 4CCMA 1HRI3 4UFLA 1ZBE2 1Q56A 1CESA 1DZQA 3T0BA 2FCTA 4FPKA 2VOVA 3ZLIA 4FAGA 2WSUA 3VBOC 1DYPA 3PUIA 5A33B 5LEKA 5BNOA 4PQ9A 2J22A 4AI9A 2GNDA 4Y24A 2X09A 4CDUC 3KF3A 3ZIWA 5DAPA 2WQ8A 1K45A 4FO9A 4DB5A 5L7OA 4FPOB 4CP2A 2PHUA 2WO3A 4XFIA 2ZMKA 4QMAA 4XETA 4QGLA 4MGTA 3POJA 1AR72 1F2NA 1ND2B 1G86A 2J1AA 2JG9A 2XVKA 1KS4A 4YW2A 2ZJCA 1V9U1 3POIA 2MHFA 3E97A 4OI2A 3JD71 5D8AB 4CCEA 3ZN4A 5AFEA 1JYCA 2IC1A 4A42A 1LULA 1D2SA 2R041 3MPBA 4YGCA 1JN2P 4N53C 5JUVA 4Y3OA 4LHLA 4RHV2 4K8FA 4BXFA 1RUJ2 1UY1A 4FOWA 1IS6A 5BNQA 2JXAA 4BJ0A 1FOD1 4E2GA 3VKNA 3C3VA 1JOBA 1MR5A 4XF0A 2D5HA 1V6IA 2W68A 3MIEA 1QHDA 3V0AB 2Z4FA 1HV1A 4UFIA 4M3CF 5JDBA 5KXDA 5C9AA 3POWA 4V2VA 5H9RA 3TAYA 1OQ1A 4HETA 4JQRA 3V64A 4AVAA 2MEV1 4Q4V2 3WOGA 4D7TA 4FAHA 1RUOA 3D5OA 1JYXA 3LEKA 1OFSA 2CGPA 4Z92B 2D3SA 3O0VA 2QUOA 3PTYA 3RNSA 3BTXA 2FQPA 2VOXA 3U14A 5K0UC 1A78A 3GXUA 4OI0A 3MV01 3I59A 3OPTA 4QHZA 2OQ7A 3OGJA 4Q4Y2 4YVSA 4KWKA 2AH2A 2ZMNA 4W6YA 5KXEA 1DGLA 5ANNA 4IL7A 4LKDA 1W2UA 1O5LA 3HNYM 5CB7A 3WHTA 4B8EA 1MEC3 1QWRA 4O61A 4XDQA 3H3UA 5DABA 3OB8A 5KR7A 3VD5A 1LKNA 1UMZA 4GQ7A 3C8XA 1Z7S2 4LITA 2JKXA 2EVXA 1BQPA 1YFUA 4UFHA 2GNTA 3IDBB 5GZCA 1LHNA 2GC2A 4H3WA 2DBIA 3S0MA 4L0PA 1R082 2WRAA 2XGXA 3AYAA 4NOTA 4TLGA 1Q8SA 5DAVA 5LA9A 3ZFGA 1OKOA 1CAUB 4YW5A 2WL1A 4NHLA 2K0GA 2HWD1 1QU0A 2QVSB 3GBWA 3MF6A 3TWIA 2A3WA 1K5JA 1NKGA 1JZ2A 3KV9A 3BKZA 1R1ZA 3ACLA 5I93A 3KV4A 1POV1 4XBNA 3TEXA 3ILFA 4M01A 3ZXJA 5LWBA 3AL6A 3CNAA 5A1FA 3BU0A 1W6PB 5FY4A 1F35A 3UV9A 5E16A 2V09A 1ZRRA 1O5UA 3CJXA 4QKNA 3WW1A 4AAXA 2QQPA 5A32B 1OFNA 1J3QA 1TNRA 1UWWA 2NP0A 1UOFA 4S2DA 1WBLA 2CNAA 1W8OA 5FP9A 1ULPA 2A6WA 5DUVA 4YZ4A 4I3GA 1IGOA 5FY1A 1H8TC 1K12A 2DBNA 4MOAA 1JZ7A 1HRI2 1RHI3 3DYOA 4CEWC 4AG4A 4UFKA 1UIKA 4TYSA 1NA1A 3K46A 4QX3A 1FPN1 1MZEA 4CDXB 4PLNA
chains in the Genus database with same CATH topology
5A80A 2GP5A 4AAPA 3NJYA 5A7WA 3AL5A 4DIQA 2VD7A 2GP3A 5IVVA 2YU2A 5FP7A 2OQ6A 4CCKA 2XMLA 4LXLA 4UF0B 5FZ0A 5FZ4A 5F3GA 4LIVA 4EZ4A 3U4SA 5F39A 4NUBA 5FZOB 5IVFA 4QXCA 5FXXA 5IVJA 5A1LA 5E6HA 3DXTA 4DO0A 5FY9A 3PTRB 4URAA 5LW9A 5FZCA 3LDBA 4Y3OA 4D6QA 3N9OA 5A3TA 4E4HA 4ASKA 1VRBA 5K4LA 4Y33A 3U78A 4BXFA 5A3PA 4Y4RA 3PUAA 3PU3A 4HONA 2YU1A 4QX8A 5FYBA 5FJKA 5FZHA 5ANQA 5IVEA 3K3NA 4TN7A 3N9MA 5FZ9A 5A7PA 3RVHA 4V2VA 4CCJA 5F5CA 5FPVA 4QX7A 3AVRA 2XDVA 3K3OA 5FYYA 2P5BA 2YPDA 5A3NA 3OPWA 4BISA 5FZMA 5F37A 5FPLA 3OPTA 4IGQA 5FY8A 2OQ7A 4UF0A 5FYSA 5A7QA 5FZIA 3KV6A 2Q8CA 5FWEA 2WWJA 2Q8DA 4EYUA 2OT7A 4HOOA 2YBPA 4EZHA 5KR7A 4XDPA 5A7NA 2YBKA 2PXJA 4CCLA 2YBSA 4QU1A 4LITA 5FY5A 4V2WA 3KVAA 5IVCA 5FV3A 5FZ6A 5FP3A 4D6SA 5FZGA 5FY7A 5FBJA 4CUGA 5FZ1A 5FZDA 5CEHA 5FZFA 5FZLA 4QXHA 3AVSA 5F5AA 5LY2A 5FXVA 5FY0A 5FZEA 3UYJA 4D6RA 3PDQA 5FZAA 5A7WB 5FYMA 2OS2A 4GD4A 5FWJA 5FZOA 5FP8A 5A7OA 2WWUA 4IGOA 3N9NA 2XUEA 5FYCA 5FYUA 4CCNA 5IWFA 5IW0A 3KVBA 5F3EA 3KV9A 5F3CA 3LD8A 3KV4A 5FPUA 3PU8A 2XXZA 5LWBA 3KV5A 5FYIA 5FYVA 3AL6A 5FZ3A 5A3WA 5FPAA 5FYZA 5A1FA 5F32A 2Q8EA 5FY4A 4LIUA 2OX0A 3N9LA 3PUSA 4CSWA 5FUPA 4CCOA 5FXZA 5FXWA 5IVBA 2W2IA 3N9QA 5FZBA 4BU2A 4GJYA 5FP9A 5FYTA 4AI9A 3N9PA 3ZPOA 3PUQA 3DXUA 4GAZA 4CCMA 4GJZA 5FY1A 5LY1A 3PURA 5FUNA 5FZKA 5F2WA 5FYHA 5FPBA 4XDOA 3ZLIA 5F3IA 5F2SA 5A7SA 5FZ7A 4C8DA 4IGPA 5FZ8A 5ISLA 5IVYA 5FP4A 5F5IA 5FJHA 4QXBA 4QWNA 3K2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A80 A;  2GP5 A;  4AAP A;  3NJY A;  5A7W A;  3AL5 A;  4DIQ A;  2VD7 A;  2GP3 A;  5IVV A;  2YU2 A;  5FP7 A;  2OQ6 A;  4CCK A;  2XML A;  4LXL A;  4UF0 B;  5FZ0 A;  5FZ4 A;  5F3G A;  4LIV A;  4EZ4 A;  3U4S A;  5F39 A;  4NUB A;  5FZO B;  5IVF A;  4QXC A;  5FXX A;  5IVJ A;  5A1L A;  5E6H A;  3DXT A;  4DO0 A;  5FY9 A;  3PTR B;  4URA A;  5LW9 A;  5FZC A;  3LDB A;  4Y3O A;  4D6Q A;  3N9O A;  5A3T A;  4E4H A;  4ASK A;  1VRB A;  5K4L A;  4Y33 A;  3U78 A;  4BXF A;  5A3P A;  4Y4R A;  3PUA A;  3PU3 A;  4HON A;  2YU1 A;  4QX8 A;  5FYB A;  5FJK A;  5FZH A;  5ANQ A;  5IVE A;  3K3N A;  4TN7 A;  3N9M A;  5FZ9 A;  5A7P A;  3RVH A;  4V2V A;  4CCJ A;  5F5C A;  5FPV A;  4QX7 A;  3AVR A;  2XDV A;  3K3O A;  5FYY A;  2P5B A;  2YPD A;  5A3N A;  3OPW A;  4BIS A;  5FZM A;  5F37 A;  5FPL A;  3OPT A;  4IGQ A;  5FY8 A;  2OQ7 A;  4UF0 A;  5FYS A;  5A7Q A;  5FZI A;  3KV6 A;  2Q8C A;  5FWE A;  2WWJ A;  2Q8D A;  4EYU A;  2OT7 A;  4HOO A;  2YBP A;  4EZH A;  5KR7 A;  4XDP A;  5A7N A;  2YBK A;  2PXJ A;  4CCL A;  2YBS A;  4QU1 A;  4LIT A;  5FY5 A;  4V2W A;  3KVA A;  5IVC A;  5FV3 A;  5FZ6 A;  5FP3 A;  4D6S A;  5FZG A;  5FY7 A;  5FBJ A;  4CUG A;  5FZ1 A;  5FZD A;  5CEH A;  5FZF A;  5FZL A;  4QXH A;  3AVS A;  5F5A A;  5LY2 A;  5FXV A;  5FY0 A;  5FZE A;  3UYJ A;  4D6R A;  3PDQ A;  5FZA A;  5A7W B;  5FYM A;  2OS2 A;  4GD4 A;  5FWJ A;  5FZO A;  5FP8 A;  5A7O A;  2WWU A;  4IGO A;  3N9N A;  2XUE A;  5FYC A;  5FYU A;  4CCN A;  5IWF A;  5IW0 A;  3KVB A;  5F3E A;  3KV9 A;  5F3C A;  3LD8 A;  3KV4 A;  5FPU A;  3PU8 A;  2XXZ A;  5LWB A;  3KV5 A;  5FYI A;  5FYV A;  3AL6 A;  5FZ3 A;  5A3W A;  5FPA A;  5FYZ A;  5A1F A;  5F32 A;  2Q8E A;  5FY4 A;  4LIU A;  2OX0 A;  3N9L A;  3PUS A;  4CSW A;  5FUP A;  4CCO A;  5FXZ A;  5FXW A;  5IVB A;  2W2I A;  3N9Q A;  5FZB A;  4BU2 A;  4GJY A;  5FP9 A;  5FYT A;  4AI9 A;  3N9P A;  3ZPO A;  3PUQ A;  3DXU A;  4GAZ A;  4CCM A;  4GJZ A;  5FY1 A;  5LY1 A;  3PUR A;  5FUN A;  5FZK A;  5F2W A;  5FYH A;  5FPB A;  4XDO A;  3ZLI A;  5F3I A;  5F2S A;  5A7S A;  5FZ7 A;  4C8D A;  4IGP A;  5FZ8 A;  5ISL A;  5IVY A;  5FP4 A;  5F5I A;  5FJH A;  4QXB A;  4QWN A;  3K2O A; 
#chains in the Genus database with same CATH topology
 1UZV A;  2GP5 A;  3NJY A;  3KWV A;  1ZZB A;  4YG3 A;  4YZ5 A;  1G8W A;  1V00 A;  3DEC A;  3III A;  4UOJ A;  2ZX4 A;  4KGQ A;  1AXK A;  1WA6 X;  3M1H A;  3OTF A;  1YXW A;  3PIG A;  5CNA A;  4FVV A;  3WQ1 A;  2XBO 3;  1UYY A;  1X9P A;  2R6Q A;  1GP5 A;  2X5I A;  3OGS A;  4PF5 A;  3U4S A;  3APB A;  3RSJ A;  2BDR A;  3I3M A;  4E4Z A;  3LDR A;  4GWJ A;  4IE0 A;  2EAL A;  2EIB A;  1BJQ A;  3C7O A;  5IAT A;  1UX7 A;  3NWK A;  5BV6 A;  2VL4 A;  4D6Q A;  2XL7 A;  3TEW A;  4Z07 A;  3ZYI B;  1TG7 A;  4NRP A;  4Y4R A;  3VBF C;  1SLI A;  5CG8 A;  1UKR A;  1AR9 3;  4WBB A;  2B5H A;  1QXP A;  3UJO A;  3ZXF A;  5M0T A;  3AX4 A;  3WG4 A;  3JCI A;  1BCX A;  3N9M A;  4DXR A;  5CKN A;  3ZO0 B;  3WNO A;  1BHG A;  4BQ1 A;  4NE9 A;  5J3U A;  4PF1 A;  1XND A;  2WNE A;  4XAE A;  1YI9 A;  3S5Q A;  4K9S A;  1RUF 1;  3I8T A;  1CGP A;  1QJU 1;  1S55 A;  2UYB A;  1UQX A;  4EQV A;  1NXD 1;  2E31 A;  1V9U 3;  2AZ5 A;  3I4I A;  3J7H A;  4L92 A;  1XNK A;  2VUD A;  2OVU A;  1W6N B;  2V72 A;  4MGQ A;  4N8M A;  5T5P A;  3VBR B;  3GM8 A;  4JGY A;  5FY8 A;  4FP2 A;  2GNM A;  4YLZ A;  2HWF 1;  1SHW B;  2ARA A;  2HKX A;  2R04 3;  1DQ4 A;  4QPI A;  4CTE A;  1YCI A;  1OKQ A;  4S2H A;  1XJA A;  3SH4 A;  1BK1 A;  4PI2 A;  1DU3 D;  1ZZ8 A;  4Q0S A;  1FOD 3;  3WT3 A;  5LA1 A;  1QQP 2;  2WWJ A;  1QDO A;  2ZGU A;  1QOS A;  2WT0 A;  2JIG A;  4L8Q A;  4IV3 B;  2Q8D A;  3VBR A;  4AHX A;  2VVE A;  1HB2 A;  4QDR A;  5C71 A;  3MIB A;  3T3Y A;  4D0Q A;  1MEC 2;  5DZG A;  1PM7 A;  2MEV 3;  4AVC A;  3HEI A;  3RFR A;  3UKV A;  4LO6 B;  3T2O A;  5C3R A;  2YC4 A;  2UY9 A;  1GZ9 A;  1LOB A;  4LR4 A;  1VB2 A;  3WDX A;  1VBB 2;  5E1R A;  4AQT A;  4XAA A;  3I54 A;  1V6K A;  4OMC A;  2XLA A;  1KRI A;  1HB4 A;  3WDW A;  2RDS A;  4XFF A;  3RZG A;  1OPM A;  3OYW A;  2JIJ A;  4EN0 A;  2VOT A;  4PCR A;  5FCC A;  3WV6 A;  3T4H B;  1Y4W A;  3ASI A;  1US3 A;  2OPK A;  2ZKN A;  2QCS B;  4AQ2 A;  4COV A;  5HCB A;  2C24 A;  2P4E A;  4S2G A;  2HWC 2;  3V0A A;  3ETP A;  1F5F A;  4CUA A;  4GAZ A;  1UCX A;  1US2 A;  1LGB A;  5LK7 B;  2VCA A;  1N3Q A;  1OVS A;  1YQC A;  5CFC A;  5FPB A;  3EB7 A;  1SFN A;  5BNN C;  3TNQ A;  4Q0Q A;  5F3I A;  2QQO A;  3VDA A;  4Q4X 1;  4A6S A;  4BA6 A;  1N3O A;  2V4V A;  4WM7 A;  3EBR A;  4WVV A;  1RHI 2;  2HWD 3;  3HNM A;  4QHB A;  1C1F A;  1W0P A;  1FX5 A;  2WAA A;  2HEW F;  4AFM A;  2GP3 A;  2D44 A;  5LAS A;  2JG8 B;  5FO9 B;  4IE4 A;  1CVN A;  2R7E B;  3F95 A;  4JGZ C;  3PJY A;  1GOG A;  2DU1 A;  2WNU A;  3CL1 A;  5GLW A;  3KT1 A;  3O0W A;  4XIK A;  2XBO 2;  5FRA A;  2QNK A;  3LAG A;  3E1F 1;  2YHJ A;  3NNL A;  3V56 A;  1XE7 A;  4P5Y A;  3N7L A;  3HBK A;  4DIN B;  4E4S A;  5B4N A;  1WUV A;  3A23 A;  3IPV B;  2YXS A;  3FX3 A;  1JYT A;  3QBQ A;  4LBO A;  3U37 A;  5K4L A;  1GWM A;  3ZFE A;  4EE2 A;  1LOA A;  2Q1Z B;  2QQV A;  4LMF A;  3WNX A;  1CPM A;  3ZKU A;  5FLI A;  4AI0 A;  1FPN 3;  2EIG A;  2PHF A;  2JDM A;  1IS5 A;  1G9B A;  4X6R B;  1CAU A;  1Q3E A;  4QPW A;  4IEO A;  3WF3 A;  4KWJ A;  2VZT A;  1B09 A;  2RVA A;  4N53 B;  5DUU A;  5FIX A;  4JQT A;  4KU7 A;  1SLT A;  3KCX A;  3GF6 A;  3WP3 A;  5FYY A;  4BXS V;  1J84 A;  1GBG A;  4YPJ A;  4FT8 A;  2BTV C;  1SEF A;  3ZSJ A;  4BQY A;  4IW3 A;  3WDU A;  2W92 A;  4Q2F A;  5DPN A;  1V9U 2;  4AFA A;  4M4P A;  2UYA A;  4BMB A;  5A32 A;  2A6Z A;  2QZ2 A;  1UY4 A;  3W21 A;  5CFD A;  1MQT B;  1PGW 1;  3JD7 2;  1QJE A;  2Q8C A;  4FOY A;  2YG0 A;  2R04 2;  3H7Y A;  3B93 A;  2J1U A;  2E26 A;  4MZU A;  3B69 A;  2ZX0 A;  2VQT A;  4CEY A;  2DCJ A;  2DF7 A;  2OT7 A;  1FOD 2;  2CTV A;  2VXJ A;  4CDX A;  2G1M A;  2YBS A;  5FLJ A;  1FMD 1;  4DRV A;  2OKX A;  4YFZ A;  2GNB A;  3HWJ A;  4MUV A;  3RS6 A;  1QJU 3;  4R4Z A;  5EHD A;  3ZPY A;  4QU2 A;  3EHK A;  2I45 A;  1I9R A;  4CXX A;  2C9K A;  5IK4 A;  4ASL A;  3CBN A;  4PIY A;  4MX3 A;  1SFY A;  3PMS A;  2WWU A;  4ZON A;  4M00 A;  3BPS A;  1G9A A;  4W4Z A;  5F3E A;  3ECQ A;  5FRE A;  1PX4 A;  1PIV 2;  5F8P A;  5F3C A;  3UES A;  1I1E A;  3O1R A;  3LIH A;  4IES A;  2P6C A;  1M06 G;  3WQ0 A;  1W2A X;  2D6O X;  1C28 A;  1U5Y A;  2OX0 A;  4RD7 A;  3VL8 A;  5FPX A;  5DMY A;  2QQW A;  2CU5 A;  3H3Z A;  4CDQ B;  4B3N A;  3B00 A;  5FYT A;  3BTZ A;  4AEM A;  1HQW A;  3KQ4 B;  4MO3 M;  4QDQ A;  2BYV E;  3DUI A;  4OHV A;  2VZV A;  5LY1 A;  1SQ4 A;  3FHA A;  4HVO A;  2VCC A;  2VTF A;  5IK8 A;  5B2G B;  2WZP P;  3S57 A;  3FHQ A;  5F2S A;  5FZ7 A;  4CDW A;  2RHP A;  1YFY A;  3FL7 A;  4C1W A;  5IVY A;  1UZ0 A;  1LES A;  3ACF A;  5FJH A;  3K4A A;  1DQ5 A;  2HBT A;  4FPL A;  3U1X A;  2YU2 A;  1QH7 A;  2RDR A;  4MGK E;  3N7J A;  2Q5T A;  4LO7 A;  1VJ2 A;  3MLJ A;  1S0J A;  2IWG B;  1HIX A;  1LU1 A;  2JDP A;  2KD7 A;  3M4F A;  4HKW A;  2VAU A;  4I01 A;  4XF9 A;  1W6O B;  2HWD 2;  3H50 A;  2CHH A;  4H7L A;  1GP6 A;  1QH6 A;  3JB4 C;  4QHO A;  2XHN A;  1H8T B;  2RJ2 A;  1S0I A;  1Y3T A;  5JXJ A;  3AKP A;  3BUC A;  1YJK A;  3THP A;  4CEW B;  2JDU A;  5K9Y A;  1S2B A;  1LHO A;  3R4D B;  3ZMN A;  1F8V A;  1H2N A;  2VTX A;  4AVT A;  4XEZ A;  5KHI A;  3EYP A;  2WT1 A;  4UT5 A;  5LW9 A;  2TNF A;  3L2Y A;  1GSL A;  3I3E A;  2D43 A;  5A3T A;  1M4W A;  3U78 A;  4COY A;  4V1P A;  2J1T A;  1V6J A;  3PU3 A;  1GIC A;  1NUK A;  2FMY A;  2RG4 A;  4Q4X 3;  1UAI A;  2Q30 A;  3LB9 A;  2WQZ C;  3ITQ A;  3AP4 A;  4K21 A;  4QGN A;  5C7G A;  2HEY F;  1FPN 2;  3A21 A;  2WN3 A;  2ZEW A;  2A73 B;  1Q8V A;  4MGY E;  4HKL A;  4ZZ8 A;  1WZX A;  4PT6 A;  4XOG A;  1WW6 A;  1ULE A;  2PAE A;  3HD8 B;  5JSO A;  1EAH 1;  5JSR A;  3W58 A;  2AC1 A;  3LGR A;  1HLC A;  3QH7 A;  3IWZ A;  2QBX A;  2F17 A;  1K5M C;  4CPB D;  3GZT B;  3WUC A;  2WO1 A;  3AMN A;  4W6W A;  4AFB A;  4AFC A;  1OD3 A;  3O1U A;  5CBL A;  3LDK A;  2WO2 A;  2W5F A;  4XMI A;  3FLT A;  4GZ9 A;  5HBA A;  3IKW A;  5T3N A;  1JZ3 A;  5C5U A;  3LOI A;  3VUO A;  2C9A A;  4HN0 A;  4EZH A;  3AP6 A;  4LT5 A;  1YIF A;  4IET A;  1GQH A;  4LQR A;  1T6B X;  1BKZ A;  5GLZ A;  2QTW B;  4K40 A;  1LB2 A;  4JZR A;  1O3R A;  3HJR A;  3LQC A;  2W91 A;  4IEP A;  3RGB A;  4V2W A;  4YM1 A;  4IEV A;  4XJZ A;  2WN2 A;  3MPP G;  4UXA A;  2VNV A;  2DVG A;  4Y26 A;  5FZ6 A;  2V5D A;  5DZE A;  5BNO B;  1RUF 2;  1POV 0;  3ACI A;  4U2A A;  4YZ2 A;  2C1F A;  5LY2 A;  1QJU 2;  1WA4 A;  2GME A;  4I3P A;  3UYJ A;  2GDF A;  3VBO A;  5GLT A;  3ZXD A;  3ZYR A;  4HVQ A;  5L7O B;  1VP6 A;  3IN9 A;  4CDU A;  3VBU C;  2A3X A;  3FN9 A;  5LB6 A;  2CL2 A;  3RI8 A;  1ACC A;  1LR5 A;  4DUX A;  2HWF 2;  2LUW A;  2QFE A;  5A3W A;  1DFQ A;  3H8X A;  2WS9 1;  3T0A A;  4XHX A;  3VL9 A;  4Q4W 1;  1IG3 A;  1WME A;  3AK0 A;  4XF3 A;  1IS4 A;  4KBZ A;  3NKT A;  3SCF A;  1QDC A;  5L73 A;  1S2K A;  3IDA A;  2XPJ A;  1FMD 3;  2RS3 1;  4XUT A;  1V6N A;  3I3D A;  4WZC A;  2J1S A;  3A4U A;  3J4U H;  3VN4 A;  4Z2A A;  3K51 A;  4BQ5 A;  4N53 A;  1H9W A;  2WNV C;  3MBW A;  4LE4 A;  3QH6 A;  4MHR A;  5LA2 A;  5FYH A;  1FV3 A;  5AVP A;  4B7E A;  4H2A A;  3U0Z A;  3VDB A;  1AR8 1;  1GWK A;  1UY2 A;  3LKJ A;  5C9A B;  2PHX A;  5EXO A;  5HV4 A;  2W1W A;  2YGM A;  3VZL A;  5T54 A;  4OHW A;  5JIA A;  4DIQ A;  4J1X A;  2VQ0 A;  5D1I A;  3MDP A;  4AR2 A;  2IXK A;  2V73 A;  2ZX2 A;  4QX2 A;  2ZX3 A;  2E53 A;  3RQ0 A;  3WUD A;  5BNN B;  3WHU A;  4YGD A;  2PHT A;  3O0X A;  2SLI A;  4YVS B;  5FOJ B;  3N36 A;  4LO8 A;  5FZO B;  5K0U A;  5IVF A;  3W5N A;  4MVT A;  3TNP B;  2GN7 A;  4UW6 A;  5LBF A;  4EN6 B;  2W95 A;  4QPG C;  1UOB A;  3ST7 A;  1PVX A;  5DQ0 A;  1ASJ 1;  3N35 A;  2JJ6 A;  1W6Q B;  2W46 A;  1LGN A;  4JGZ B;  3N4M A;  3OBA A;  4XQD A;  5IJR A;  2CY6 A;  3WCR A;  4COW A;  4E4H A;  2P37 A;  3O14 A;  4P9W A;  2BGP A;  5ABJ C;  3MIC A;  3UGF A;  5FYB A;  2DVF A;  3AKS A;  2KR2 A;  1YQ2 A;  1HB1 A;  2I74 A;  4UYB A;  1UD1 A;  2JDA A;  1W0O A;  4Q4X 2;  1YFX A;  3ENR A;  3MIG A;  5CYY A;  3SIT A;  1AR7 3;  5GM0 A;  5EP9 A;  3MW2 A;  4MSV A;  5HPO A;  1P8J A;  1RXF A;  3HQU A;  4BLI A;  2R06 1;  1HN0 A;  3WR0 A;  5I0T A;  3ZFG B;  1OUR A;  1T2X A;  2K9Z A;  4SLI A;  1G7Y A;  2ZGL A;  4ATE A;  1BEV 1;  5FZM A;  2VBD A;  4KNC A;  3VZK A;  1LGC A;  4LOS A;  1O8S A;  5FMO S;  3LZZ A;  4Y20 A;  3POB A;  4IE7 A;  4D7Y A;  2RDN A;  2XJS A;  1MZ5 A;  4R9C A;  2DUQ A;  5FMB A;  4JVA A;  4BQ3 A;  4PIX A;  2VUL A;  3M3O A;  1W3X A;  5GZD A;  4OUL A;  3W9A A;  3KQR A;  1UOJ A;  2CSG A;  4CXY A;  5T5J A;  5ACA 1;  4IE5 A;  2WWS A;  3D4K A;  4CP9 A;  4YSF A;  4Q4V 3;  1TMF 1;  3CO2 A;  2BRT A;  1XXN A;  1SZB A;  3R0R A;  5FPZ A;  3WDY A;  1CIY A;  4HSL A;  1POQ A;  3GBG A;  4YW7 A;  3ZSK A;  1GOF A;  2PTM A;  3KVA A;  4GUL A;  4GA9 A;  2DTW A;  4CPB A;  4EN8 B;  1C5I A;  2VOW A;  3LEI A;  1H8T A;  5FZF A;  5JZG C;  5F5A A;  5FY0 A;  1EAH 3;  2YMZ A;  4PDW C;  4CEW A;  5C70 A;  3NNM A;  1DGR A;  5FWJ A;  2JE7 A;  3CKH A;  3N9N A;  1CZV A;  1GFF 2;  3SQO A;  1URX A;  4C90 A;  5T50 A;  4Y5Z 0;  2K2S A;  3N3H A;  4LJH A;  2XXZ A;  4IEX A;  4S2F A;  3MW3 A;  1UPS A;  2X5I B;  1W8Z A;  2HWC 1;  1PGW 2;  2O0O A;  4CRQ A;  1DLL A;  4BPZ A;  3OBR A;  2ILM A;  5HCH A;  3WF4 A;  1NCQ C;  1IQA A;  4Q8L A;  2W2I A;  2GH2 A;  4KWU A;  1LNS A;  2ZHK A;  3AKR A;  5EIY B;  1RMU 1;  4ZU5 A;  2CWS A;  2WAO A;  4M4R A;  1UU6 A;  3DXU A;  1O7F A;  4WVZ A;  2BU9 A;  2O14 A;  1SPP B;  3OUJ A;  4HSJ A;  5FZK A;  4AK3 A;  2BQP A;  4RS5 C;  3VBF A;  5A3M A;  2MNG A;  4P9X A;  2PAM A;  3NL1 A;  1LEM A;  5ISL A;  1W9W A;  2R16 A;  4QXB A;  5SV5 A;  3I2O A;  4LTA A;  4Z8B A;  3Q9O A;  1JZ6 A;  4IDZ A;  2VO5 A;  1QJZ A;  1SCR A;  1S0D A;  4G4F A;  5KHJ A;  1XSR A;  3AXD A;  1U5Z A;  4JRL A;  4ZKT B;  4KU8 A;  3KSC A;  3PHM A;  5A3U A;  4C0H A;  4JGY B;  1Y9Q A;  4LIV A;  2J1R A;  1R09 1;  4QPI B;  3M7A A;  2YFU A;  2UWC A;  2VU9 A;  5IVJ A;  1X50 A;  1OLQ A;  2GAU A;  2RS3 3;  4OUE A;  1CN1 A;  3ZXL A;  1W8U A;  3WEZ A;  4CUC A;  2Y6H A;  3K4Z A;  1UX6 A;  4NAO A;  4P9J A;  4PBO A;  2BGO A;  3S7I A;  5A1A A;  2A1X A;  1FXZ A;  2E6V A;  2JWP A;  3MIF A;  3O12 A;  4ASK A;  3J9S A;  5A3P A;  4DUV A;  3GZA A;  4J25 A;  1COV 1;  2IFW A;  1ZZ6 A;  1WCK A;  5ANQ A;  1NCR C;  3K3N A;  1PK6 C;  2J1V A;  1R1A 1;  2K46 A;  1W2O A;  3ZXK A;  2XJR A;  4IEU A;  4JRA A;  2IUW A;  1NAE A;  1UYX A;  3O1P A;  5L9B A;  1EYB A;  1JOD A;  2AEY A;  1CAW B;  2XDV A;  4LLF A;  3SCG A;  3MO4 A;  3U07 A;  5FMO L;  1XRU A;  2YPD A;  4TLF A;  5A3N A;  3RZL A;  3LFI A;  4YW1 A;  2Y0O A;  5F37 A;  1Q8O A;  2ORX A;  2XR4 A;  3OYW B;  1IKP A;  2P34 A;  5FBZ A;  4PHZ A;  1UO9 A;  1D0G A;  1ASJ 3;  1Y9M A;  2D6K A;  1NT0 A;  2LRP A;  2PQS A;  3BI3 A;  2D7F A;  3NW4 A;  3SMH A;  5CAD A;  1PZ7 A;  5FOB B;  3OF1 A;  4EWA A;  1S0G A;  2JIC A;  5F7U A;  3HR9 A;  2Q1F A;  3LPF A;  3G7D A;  1GWL A;  2ZPX A;  3ES4 A;  3I7D A;  3JQW A;  2HJI A;  2B9U A;  1NY7 1;  2PMW B;  4DFS A;  5CFC B;  2XJV A;  3RYK A;  4F8A A;  5IVC A;  2A6V A;  1A8M A;  4RR3 C;  5FP3 A;  1ODM A;  3B9C A;  5AC9 1;  1XOY A;  4XXA A;  4QB6 A;  1B35 C;  4WM7 B;  1UL9 A;  2OXB A;  1BEV 3;  4D3W A;  5BNN A;  1YWK A;  1R64 A;  3DL3 A;  4A3X A;  1PIV 1;  1PZ9 A;  1X8E A;  4GWM A;  5FZO A;  2JDN A;  5A7O A;  1EAH 2;  2HH9 A;  2XJP A;  1QQP 3;  5FYU A;  4UWD A;  4MV2 A;  5IW0 A;  4JC1 A;  2Y6J A;  1AX0 A;  2P3J A;  2WJS A;  2WNU B;  3P3N A;  4O9G A;  4YM0 A;  5FTT C;  5HCA A;  4JDN A;  5IHR A;  1W6Q A;  2EAA A;  3ETQ A;  4JGZ A;  1E5H A;  1PO2 1;  2Y0I A;  4A4A A;  3I2F A;  5FQ0 A;  2LS6 A;  3RI9 A;  1V6O A;  2RDQ A;  3I2I A;  4CSW A;  2WT2 A;  1RUD 1;  4ARY A;  1WLC A;  1ULF A;  4XF1 A;  4XJ9 A;  2CAV A;  4E8C A;  2OW4 A;  3VBU B;  4BU2 A;  4GJY A;  3ZFE B;  1VBB 3;  1W06 A;  3KHC A;  2OYZ A;  2Y6L A;  2VNR A;  4URT A;  3LOB A;  1LRH A;  2VZO A;  3PUR A;  3D6E A;  3RWN A;  2VH9 A;  2WAB A;  4AE2 A;  4Q29 A;  5B4X A;  5A7S A;  1WGP A;  1RTV A;  3FFZ A;  4NRO A;  3T2P A;  2ZGP A;  5J98 B;  1OHF A;  4OZO A;  5F5I A;  5EJZ B;  2Q1M A;  3ME2 A;  1GZT A;  3R4S A;  5A1L A;  2HEV F;  3RPQ A;  5JCT A;  1BK0 A;  3I49 A;  1UY0 A;  4FCA A;  2PLV 1;  2ZBJ A;  2ZGK A;  2WNV B;  2OQ6 A;  2HWC 3;  1MZF A;  2XQR A;  1ZRF A;  4L9B A;  2Z42 A;  1O3Q A;  4WVM B;  5FZ4 A;  2VJX A;  2WS9 2;  3O1T A;  4NUB A;  1DGW X;  2QKD A;  4Q4W 2;  4MH0 E;  5CFD B;  4HPK B;  1H1I A;  1RMU 3;  2VNO A;  3H3L A;  2O1Q A;  3WVJ A;  3O1S A;  2DFC A;  4CEY B;  2RS3 2;  1DZT A;  4XJA A;  3UL2 A;  1C57 A;  5LA0 A;  4KQ7 A;  2WZE A;  1F9K A;  3BOW A;  3KGL A;  4ZS2 A;  1XYN A;  3KD4 A;  1W6M B;  4OQ8 A;  3GBF A;  1JXN A;  2TUN A;  3WF2 A;  3NNF A;  1VPH A;  1AR8 2;  1ND3 C;  1BVV A;  2D6L X;  1AZD A;  5FZ9 A;  1QF3 A;  4YG6 A;  3RMY A;  5K7P A;  5GZG A;  5KBF A;  4CCD A;  4AED C;  2YB7 A;  1E5R A;  3PNA A;  4GH4 C;  1Q8Q A;  4RQP C;  4EJR A;  2ADE A;  3K3O A;  3NAP C;  4Y1X A;  5FUI A;  3BB6 A;  2RE9 A;  1VAK A;  3C7H A;  1ZRD A;  2ARE A;  1LED A;  2VXR A;  3EXU A;  4ISR A;  3AP9 A;  4E8D A;  4OVE A;  4N9I A;  1FV2 A;  5JR2 A;  1HV0 A;  3ATG A;  1ASJ 2;  1CPN A;  1LOF C;  1OBN A;  4TWT A;  1SPP A;  4IQP A;  3WF1 A;  3J8F 1;  4NII A;  4HK9 A;  3OEB A;  2FDK A;  3FZ3 A;  3BTY A;  3PME A;  4J6G A;  1R1A 3;  2EIC A;  4YNI A;  4XMA A;  1YQ6 A;  4DMI A;  3CZU A;  4QKF A;  2GN3 A;  2WYS A;  2ZCW A;  3CJI C;  1F31 A;  5FY5 A;  3BOP A;  1QJX 1;  5DG2 A;  3WG3 A;  4AVS A;  4CDW B;  4X8N A;  5CEH A;  4OI4 A;  4XAC A;  5LAT A;  4BE3 A;  4XQW A;  2R06 2;  3URF A;  4K6B A;  1FAT A;  4NN0 A;  1PVC 1;  2DCK A;  4WZF A;  5FZA A;  5A7W B;  3JD7 3;  4ES8 A;  1JU3 A;  3LFM A;  1BEV 2;  5FP8 A;  1MAC A;  2BGC A;  4IV1 C;  4M3C E;  1AR6 1;  2H6C A;  1YEW A;  2W08 A;  3AJY A;  4LO5 B;  5G05 L;  1W28 A;  3MGU A;  4NHM A;  4PIZ A;  1PMJ X;  1JOP A;  5BNP C;  3E6B A;  3UJQ A;  5JZG B;  2BNN A;  3WW2 A;  2B45 X;  3M70 A;  3FFQ A;  1CR7 A;  4XUP A;  4G3Y C;  1XNT A;  2WZR 1;  3PL0 A;  4GMP 1;  5EFU A;  1N1S A;  3RG0 A;  3I2K A;  5ACA 2;  1TMF 2;  1EPZ A;  2DV9 A;  1LEC A;  2EA7 A;  1RL3 A;  3TEZ A;  2RM2 2;  1RIT A;  2AAC A;  2ES3 A;  2OZ6 A;  3H1Y A;  5EJ3 A;  3V65 A;  5AC9 3;  1ZZ9 A;  2DU0 A;  5F2W A;  1CAW A;  3SLI A;  2WUH A;  1PNF A;  2D93 A;  2NMO A;  1IG0 A;  1OT5 A;  4ASM B;  1NCQ B;  2C0Z A;  1H0B A;  1GP4 A;  2HBU A;  1PIV 3;  1PX3 A;  4R9B A;  3WX5 A;  4OQ9 A;  4E4D X;  3DCQ A;  3I2H A;  1AF9 A;  5G04 L;  4LE3 A;  3M3Q A;  1O6U A;  2ZEY A;  5AVA A;  3WF0 A;  5JXI A;  3IDC B;  2ORZ A;  3POS A;  4ZU4 A;  4UI9 L;  2R0F A;  3ZYP A;  2Z69 A;  4CXW A;  3GCW A;  1VB4 A;  2WFF 1;  1IPJ A;  5LCW L;  1XU1 A;  3THC A;  2XJU A;  2IFR A;  4RS5 B;  4H14 A;  1RYY A;  2XML A;  2OZJ A;  5FO8 B;  4OLL A;  1RUD 3;  4P5H A;  2KXL A;  4UW5 A;  1ZZ7 A;  2CDP A;  4QXC A;  1LOG A;  3O1V A;  3MFA A;  3T08 A;  1W9Y A;  5LBE A;  4URA A;  2XB6 C;  1K5M A;  2VEC A;  3Q8F A;  1RMU 2;  3SNM A;  1VRB A;  2VZ3 A;  4Y33 A;  3SH3 A;  4R9D A;  1GZC A;  1GR3 A;  3SKV A;  1RB8 G;  3EMR A;  2PN5 A;  3P1I A;  2LTN A;  2IXL A;  3A7Q A;  1YFW A;  1GV9 A;  1PMH X;  1CD3 G;  2D5F A;  2X10 A;  1DQ2 A;  1YNA A;  4FOQ A;  1L7R A;  1O4T A;  1POV 3;  3PVE A;  4RGG A;  4XIL A;  2FDJ A;  1IZ3 A;  4CCJ A;  4CVU A;  2PLV 3;  3BAL A;  3KHB A;  5LBC A;  1REF A;  5BXX A;  4WV8 A;  3VBO B;  4DQA A;  3KCY A;  3OBT A;  3OPW A;  3QCW A;  4HL0 A;  1RED A;  3RDI A;  1NE4 A;  4KH9 A;  4CDU B;  3HQR A;  1W04 A;  2A5Z A;  5IT6 A;  2BP6 A;  1VBA 1;  4UF0 A;  3R6S A;  3POF A;  1ZRE A;  1R09 2;  3VBU A;  3NNG A;  2D6N A;  3VZN A;  3T2Q A;  5FZI A;  4WM8 C;  3ZYG A;  1VBD 1;  5C3P A;  4XAB A;  5JR7 B;  2ZGM A;  3AZX A;  3MF9 A;  4OYU A;  1UN1 A;  3I3Q A;  1O3T A;  1UZW A;  2RS5 1;  3AZY A;  4Q1R A;  3SEP A;  1J83 A;  1TQ5 A;  3CLP A;  3IMM A;  1COV 2;  2WQ4 A;  2XLF A;  3FWE A;  3L2H A;  4K3U A;  3VHO A;  3USS A;  2XON A;  1OA3 A;  2GSY A;  4QU1 A;  3HT2 A;  1WLD A;  3S6P A;  2BOJ A;  1I3H A;  1KFX L;  2FZ2 A;  1R1A 2;  4KBB A;  5FLH A;  5FV3 A;  4R52 A;  3ORJ A;  1OMI A;  2WNV A;  5FZ1 A;  4HVR A;  3PJQ A;  5CAZ A;  5FZL A;  1HRV 2;  4KG0 A;  2VTX J;  4WVM A;  1K3I A;  1TME 1;  2RV9 A;  1KFU L;  1BZW A;  1GZW B;  4XQ4 A;  4HPK A;  1TE1 B;  5IWF A;  1DG6 A;  1F15 A;  1JYV A;  4EV0 A;  1EP0 A;  1JHJ A;  4D94 A;  1B35 B;  5K0U B;  3J8F 3;  3VKM A;  2ZS6 B;  1XYO A;  2EAK A;  1W6M A;  4AXO A;  5C4W C;  3WP4 A;  3DN7 A;  3ZR5 A;  2JEN A;  2Y6F A;  1RUF 3;  1H2L A;  5FR3 A;  3I2J A;  4QPG A;  4FTE A;  4RFT 0;  3ZPO A;  4OHX A;  1GNH A;  1QJX 3;  3A22 A;  1KQR A;  1NY7 2;  2FDH A;  1H6X A;  4QX0 A;  2ZGN A;  3M2M A;  3V0B A;  4P9I A;  3RYP A;  2CDO A;  1XNB A;  4XIO A;  2GMP A;  4FOV A;  4HZF A;  3OD4 A;  2Q0A A;  1PVC 3;  4C8D A;  2H0B A;  5ABJ A;  5AC9 2;  4ORF A;  2QDN A;  2W9X A;  2HWF 3;  3WQ7 A;  1AR6 3;  2QJV A;  3KS7 A;  4G9S B;  2B46 X;  2J7M A;  5IVV A;  4UFJ A;  1PM4 A;  2R30 A;  2UWB A;  1RUN A;  3WW4 A;  3FLP A;  1A8D A;  5FAX A;  4DXZ A;  4LXL A;  4Y20 B;  4LPL A;  1MPX A;  1PO2 2;  2AR6 A;  2W87 A;  2WZR 3;  1QY4 A;  1XNA A;  1IS3 A;  3AMQ A;  4XUO A;  5GZF A;  4B29 A;  1O4Y A;  5FXX A;  1N47 A;  2FMD A;  3EJK A;  2VZ1 A;  3HVD A;  1ENS A;  4SBV A;  3K4D A;  4ZPI A;  2VOK A;  1RUD 2;  1KD7 A;  3RMX A;  3SIS A;  4AFD A;  4BK4 A;  2GH8 A;  2Y34 A;  1IHM A;  4W8J A;  3IM0 A;  1QKQ A;  1SCS A;  1XC6 A;  1PHM A;  3MIH A;  5DUX A;  1JYN A;  4CP9 B;  3RZJ A;  5EWS A;  1YHF A;  3PUA A;  3WZ1 A;  3ZSL A;  3FBY A;  4I09 A;  4JTN A;  3SCH A;  4YM3 A;  4XXP A;  4FQ4 A;  4RN5 A;  3I3B A;  4TN7 A;  1AJO A;  2A6X A;  4QQ2 A;  3JBG 1;  3LWC A;  4XZU G;  1H1M A;  1QXJ A;  5I0R A;  4XFC A;  1O4Z A;  2CGN A;  1FAY A;  1UYZ A;  4H55 A;  2WFF 3;  4AGV A;  1JMU B;  5ERL A;  5JXH A;  4AW7 A;  3QAC A;  2J42 A;  2P5B A;  2PLV 2;  5I91 A;  4JHZ A;  3P3P A;  3RWK X;  1HJF A;  1YO8 A;  4GAL A;  5JZG A;  2Q4S A;  4XUQ A;  2C4X A;  1Z0H A;  2IXJ A;  2BOI A;  2ZOE B;  1VR3 A;  3GZE A;  2GZW A;  4K1Y A;  4PDW A;  3OJB A;  2IXH A;  3JB8 A;  4QM8 A;  4XHB A;  3VZJ A;  3CQO A;  3Q8E A;  5A6Q A;  1QNY A;  1XBF A;  2XQX A;  5A7Q A;  2XWB B;  3USU A;  1W39 A;  2OUH A;  2YV8 A;  3BIW E;  4I02 A;  3ZX7 A;  2VG9 A;  1RUC 1;  3DPR C;  2VW2 A;  2ET7 A;  4N9H A;  5H9S A;  4NRQ A;  5GAL A;  2W1Q A;  4CA9 A;  2P3Y A;  5FDB A;  3B9I A;  4FFI A;  4FPH A;  2XVL A;  3CEW A;  1NCQ A;  5CKM A;  2ID4 A;  4BB3 A;  1KJL A;  3RZM A;  4MYE A;  4C0B A;  3VBF B;  3GJB A;  5H9P A;  3FLR A;  4LBQ D;  1GNY A;  5J36 A;  3KT7 A;  1CWP A;  3O5S A;  2BJS A;  1QXR A;  1JTZ X;  2OUJ A;  3B02 A;  3HT1 A;  3Q8A A;  4P14 A;  2P2K A;  4RS5 A;  2HWB 1;  1SBE A;  5FXV A;  1ND2 C;  1LEN A;  1VBA 3;  2UY8 A;  3RZK A;  3O1M A;  4EWD A;  4YGB A;  3H7J A;  2AGS A;  3CJI B;  3LD8 A;  1JOJ A;  3GAL A;  4NHY A;  2WSV A;  5D8A C;  5FPA A;  2BZD A;  1W90 A;  2E32 A;  1D4M 1;  1CIW A;  2VW1 A;  1HQL A;  3WCS A;  2RS5 3;  4JKL A;  4BQ4 A;  1OA2 A;  5FXW A;  4H7M A;  4N7I A;  2VMH A;  3J8F 2;  2FHR A;  4Z2W A;  3JUU A;  4CP1 A;  3HN3 A;  3SC7 X;  5FK7 A;  4O7X A;  3KT4 A;  4ZHN A;  4AHW A;  2R0H A;  1MVE A;  2ARB A;  3N9P A;  3CDZ B;  1C8M 1;  2PHR A;  1JI6 A;  2C26 A;  1QJX 2;  3LA7 A;  4AVV A;  4LOT A;  2OA2 A;  3AYD A;  1V0A A;  3IDE A;  1TME 3;  4JDM A;  2VMC A;  4YW3 A;  4LBL A;  5HV0 A;  1NCR A;  1PK6 A;  5A80 A;  3MLL A;  1PVC 2;  1DQ1 A;  4ARX A;  1LHU A;  2VQA A;  1OOP C;  3E6D A;  1X82 A;  3KB5 A;  3VKO A;  1UYP A;  1AR6 2;  3OY8 A;  1Q43 A;  5FP7 A;  2JDZ A;  2Y6K A;  1JHN A;  1PGS A;  3KF5 A;  5JVV A;  1TVG A;  4D8M A;  4YW6 A;  1PO1 1;  5FZ0 A;  4LHK A;  2B7Y A;  3DV8 A;  2VMF A;  3NJV A;  3ZYH A;  4R4X A;  4LHN A;  1JYI A;  3ZYF A;  4B4P A;  2VW0 A;  3I2G A;  1YIP A;  2WZR 2;  5JMC A;  4YG0 A;  2VUJ A;  3JXS A;  2VPV A;  2IXC A;  1MS8 A;  2ZGS A;  3C7F A;  1OI6 A;  1WLT A;  1UKG A;  5L19 A;  1F4H A;  4B4R A;  2YRO A;  2YU1 A;  4HON A;  1DQ6 A;  1ZBA 1;  2DVA A;  2W3J A;  3J7N A;  1WMX A;  5FJK A;  4PJY A;  3VDD C;  4XCB A;  4NPL A;  4MXW A;  3MYX A;  1DCS A;  1NE6 A;  1GZW A;  1FNZ A;  1HKD A;  3CIH A;  3IMN A;  2YDE A;  5CIR A;  4LA3 A;  5C8C C;  2RS1 1;  2VME A;  4A3Z A;  1CAV A;  4QXK A;  1PGL 1;  4RR3 A;  4AVB A;  3H9A A;  1HB3 A;  1ULC A;  1BBT 1;  1UPI A;  2VVD A;  4BIS A;  1B35 A;  1KGY A;  2WFF 2;  2UWA A;  3W59 A;  3S7E A;  5E88 A;  4Q5O A;  1ODN A;  1RUH 1;  2E7A A;  4IGQ A;  4RYD A;  5CA6 A;  2IVI B;  5IFT A;  2I07 B;  1W9T A;  1OSG A;  1VMJ A;  5FYS A;  2NZ9 A;  4Y5S A;  5FQ0 B;  1XNC A;  1C8N A;  2R1B A;  1AYN 2;  2JE8 A;  2ARX A;  2NQY A;  4ZZ5 A;  4O9E A;  3WXP A;  5CU1 A;  1D0H A;  2ETE A;  2DCT A;  4F83 A;  5F5Q A;  1FNY A;  2B9V A;  3UK9 A;  1SG3 A;  2ZX1 A;  3HN1 A;  3JBG 3;  2PXJ A;  4FP3 A;  3VBS C;  4YZ3 A;  2WC2 A;  4BCU A;  1ST8 A;  4A7Z A;  3AYC A;  1JZ4 A;  3WDV A;  3NO8 A;  3H1W A;  3MLK A;  2VGD A;  4AZZ A;  5K8S A;  1FI2 A;  4D6R A;  2R07 1;  5FZE A;  4Z82 A;  3AZZ A;  4BQX A;  4A45 A;  2DYC A;  2E9Q A;  3T30 A;  4P08 A;  3M3E A;  1UMI A;  3WP5 A;  1RJ7 A;  4IGO A;  2BUK A;  1RJ8 A;  4Q0P A;  4GMP 0;  3D82 A;  3KVB A;  4J1W A;  1VBA 2;  4FFG A;  4XYX A;  3WLU A;  5J96 B;  4K20 A;  5F1R A;  3H0O A;  1RUC 3;  1GAN A;  3VBH C;  1SDD B;  1UY3 A;  2JDH A;  2XG3 A;  1UZZ A;  1VBD 2;  2LW8 A;  3FMG A;  3HBZ A;  4LBQ A;  4D7S A;  2RM2 1;  1RVF 1;  4CYD A;  2G9Z A;  1DBN A;  3THD A;  1XSQ A;  3N9Q A;  2RS5 2;  5FZB A;  5BYN A;  3LCP A;  1J1L A;  3VV1 A;  5H9Q A;  3PUQ A;  5IK5 A;  3OSD A;  1C5H A;  3U75 A;  1VRH 2;  3WW3 A;  3UGG A;  2KM2 A;  1ULO A;  3C7E A;  4DOU A;  2UU8 A;  4XFB A;  1X8M A;  3ILN A;  3LIG A;  3QLQ A;  3AM2 A;  4GD4 A;  2X05 A;  4NPM A;  1G9F A;  3VGI A;  3CU7 A;  1ND3 A;  5AFB A;  3W5M A;  3BIE A;  2YC0 A;  1TME 2;  2A3Y A;  1PZ8 A;  2ARC A;  3IT8 A;  2VCB A;  4AED A;  4GH4 A;  4RQP A;  3UKT A;  3NAP A;  1H6Y A;  3WIN E;  3E5Q A;  1TZO A;  1JBC A;  4LUM A;  4IV3 C;  4NID A;  4XCA A;  3DEM A;  2PHD A;  4LUL A;  2Y38 A;  3DXT A;  4DEQ A;  4AQ6 A;  4LEJ A;  5FZC A;  1W8H A;  3P6B A;  4FPE A;  3SEE A;  2WYF A;  1WMD A;  2WA4 A;  1LOF A;  1ZNP A;  1KDM A;  1NLQ A;  4Y1V A;  1ZZC A;  4K1Z A;  2F4L A;  4B1L A;  5FKB A;  4MGZ E;  1LOC A;  1UOG A;  1Y43 B;  3CHX A;  3AP5 A;  2ZKL A;  1NQJ A;  1S4C A;  2WS9 3;  3CJI A;  1JUI A;  1OQE A;  4Q4W 3;  1S0B A;  1ENX A;  4QQH A;  3VD9 A;  2EXJ A;  5I0S A;  1PO1 3;  5L9R A;  4LBM A;  1NG0 A;  3LA2 A;  5KHH A;  4OI1 A;  3UNP A;  4P02 B;  1MS3 A;  1UU5 A;  4QQO A;  5KHK A;  3BCW A;  4X6Q B;  4IV1 A;  2VM9 A;  2W47 A;  1OC1 A;  2F6B A;  3WSO A;  3KV6 A;  1V6L A;  3OCP A;  3B5L B;  4DNY A;  1AR8 3;  5BNP A;  2VBB A;  4FPJ A;  4YAR A;  5C33 A;  4RSU A;  1FT9 A;  1RXG A;  3S30 A;  4Y5T A;  4HK8 A;  3LEM A;  1I5Z A;  2YBP A;  1LHW A;  2QQI A;  4MXV A;  5JI7 A;  1ZA4 A;  2G19 A;  5A7N A;  2YBK A;  4LKF A;  1E5I A;  2VZQ A;  2Z79 A;  2CWM A;  2PFW A;  2ZTN A;  4M0H A;  3UET A;  3WP6 A;  1G6N A;  3HIF A;  4QM9 A;  3ACG A;  1YQ8 A;  3OOX A;  5A3O A;  1CQ9 A;  2RS1 3;  1HRV 1;  3JBG 2;  1C3H A;  5D2A A;  4OUM A;  2JG8 C;  2G4I A;  1GYK A;  1S1A A;  3DPR B;  1I6X A;  3OGR A;  4YYO A;  1BBT 3;  1YC6 1;  1X33 A;  2H6B A;  4NMI A;  2YFZ A;  3O7O A;  1X36 A;  2EF6 A;  2QQN A;  2LM3 A;  3WNL A;  1AR9 1;  1W05 A;  3PDQ A;  4RA0 A;  5FKC A;  1RUH 3;  3TEY A;  2DWR A;  4DS0 A;  1STM A;  1AXZ A;  4LOR A;  4W6X A;  1DYO A;  5FPU A;  2D98 A;  3PU8 A;  1SLC A;  1H30 A;  4ITC A;  3HNB M;  3NMB A;  5FYZ A;  2WII B;  4XW3 A;  1CZT A;  4LBK A;  3ZMO A;  2F4P A;  1LHV A;  4LIU A;  4AQS A;  4AYU A;  4JV4 A;  1RUC 2;  1W8T A;  5FXZ A;  3LPG A;  4LBN A;  2V5Y A;  2GC3 A;  1OD5 A;  1K5M B;  1QMJ A;  1AHS A;  3DF0 A;  3ZN6 B;  2DTY A;  2RR1 1;  3VLB B;  1VAV A;  2WZ8 A;  1DZR A;  5D21 A;  2R06 3;  2DUR A;  1EV1 1;  1VLN A;  1GQP A;  3NV2 A;  3POY A;  1SAC A;  2IXI A;  4YGE A;  1JU4 A;  4BIF A;  5J48 A;  4L11 A;  2B42 B;  4OUS A;  1Q8P A;  2JKB A;  4OCT A;  4Q1P A;  4YVW C;  3VZO A;  2R07 3;  2V4A A;  4MHU A;  2D3R A;  1JUH A;  1OQD A;  1W8F A;  1LOD A;  3WNK A;  2FDI A;  2R1D A;  3WDT A;  3U10 A;  1DIW A;  4N43 C;  4ZY9 A;  3OUH A;  1OA4 A;  2ZGQ A;  2HWB 2;  4AAP A;  3K75 B;  5T5L A;  3ACH A;  4IER A;  1U5I A;  3ZXG A;  1BXH A;  3T09 A;  1W3V A;  3WG1 A;  2J1E A;  3NNJ A;  4GB3 1;  1MQT C;  1OLR A;  5EYX A;  5ACA 3;  1LJ7 A;  2ZHL A;  1TMF 3;  3X29 B;  3GGL A;  4UF0 B;  4MET A;  2RM2 3;  2P1B A;  1NX9 A;  1RVF 3;  1D4M 2;  1XE8 A;  3BOD A;  2ATF A;  3SXW A;  1APN A;  1GU3 A;  1VMH A;  5E6H A;  2BWA A;  4BQW A;  5FY9 A;  3PTR B;  5JWP A;  1OOP B;  3WY6 A;  4E2Q A;  3LDB A;  5DDJ 1;  2AEZ A;  4WM8 A;  4FPY A;  3AYE A;  2G9F A;  2JE9 A;  1L7Q A;  2Y8K A;  1C8M 2;  1KJR A;  2Z2S B;  4QD2 A;  2JB4 A;  2VCM A;  3OEA A;  3VD4 A;  2C5D A;  3NQH A;  4F7Z A;  2FCU A;  2VMD A;  2ZEX A;  4AEJ A;  4ERO A;  4Y1U A;  5C8W A;  3BVC A;  2BV4 A;  5F5C A;  3SH5 A;  2DUO A;  1SLL A;  3ZOI A;  1QOT A;  5FPV A;  2WLP A;  3MUY 1;  2WA3 A;  4FXK B;  1F5J A;  2ENR A;  4NWV A;  1DYK A;  5JAX A;  3TN9 2;  3HQX A;  4COZ A;  4UW3 A;  1WLW A;  4DRR A;  3AMM A;  1ZYB A;  1QIQ A;  2VMG A;  3BYW A;  3NKG A;  3VDD B;  3FHI B;  3T1L A;  4BK5 A;  1S0E A;  4JDO A;  1PO1 2;  1GLH A;  2BFU L;  4LA2 A;  1O8P A;  3KGZ A;  4CDQ C;  1W9S A;  4Y22 B;  4NIG A;  1T6G C;  5C8C B;  3WNM A;  3J7M A;  2DCZ A;  5JI9 A;  2VVF A;  4ES9 A;  4IEQ A;  4GXL A;  2X53 S;  1RUE 1;  2CAU A;  2P17 A;  4JHT A;  4M3C A;  1O91 A;  2YC2 A;  4XFA A;  4QPG B;  5BY5 A;  5C4W A;  5I8T A;  1ZBA 2;  4IE6 A;  1AL0 G;  5I0D A;  2Y60 A;  2A71 A;  4LKE A;  3V0B B;  2BBA A;  3NST A;  4QB1 A;  1DF0 A;  1OLM A;  3BTA A;  1TEI A;  2TBV A;  4KGG A;  4IUG A;  2Q8O A;  4BWO A;  5ABJ B;  4CU9 A;  3WNP A;  1W8N A;  3QD6 A;  4EWE A;  5A7W A;  2RS1 2;  4Q0U A;  1HQN A;  1R09 3;  1PGL 2;  1QGL A;  1XU2 A;  2LRO A;  1BBT 2;  2BW8 A;  4YFW A;  5FYM A;  3ZXE A;  1D4V B;  1W03 A;  3B3Q E;  4XBL A;  3AXE A;  1O59 A;  3B01 A;  3VBS B;  1U0A A;  1VBC 1;  4GKX A;  2WDB A;  5GLV A;  5LEJ A;  1RUH 2;  2ERF A;  1VIW B;  4FFH A;  5GLU A;  3VKF C;  3ZSM A;  2HLE A;  3ON7 A;  3MI8 A;  1BLZ A;  2RMU 1;  1N3P A;  4Y1Z A;  5DAX A;  5HXM A;  1COV 3;  1X7N A;  2PAK A;  5F32 A;  3ZFF C;  4LKS A;  4XE9 A;  4FSJ A;  2E51 A;  3EQE A;  5T52 A;  2BPA 2;  2FCV A;  1RUG 1;  2ZAH A;  2ZGO A;  4CP0 A;  2A7A A;  2Y6G A;  4COU A;  1HRV 3;  4TZD A;  1NOV A;  4BIO A;  1AJK A;  1VAM A;  4IEY A;  5L36 A;  3VBH B;  1XPW A;  1KDK A;  1ZX5 A;  4XDO A;  4YRD A;  4Q27 A;  2ET1 A;  3GDB A;  3FC0 A;  3CZJ A;  5FP4 A;  4DEV A;  3MV1 1;  1JZ5 A;  2AYH A;  2QDR A;  3G6J B;  2R07 2;  4QWN A;  4RGA A;  1WCU A;  3AL5 A;  1AVB A;  1U5X A;  3GZU C;  1W0N A;  4ET7 A;  1G9D A;  2HWE 1;  3SHR A;  1OLM E;  1GNZ A;  1WW4 A;  3JZV A;  1AL2 1;  2ADD A;  4PDW B;  3E5X A;  4EZ4 A;  2D6P A;  2A75 A;  2JB8 A;  4NPR A;  3H8O A;  4XUN A;  3USU B;  3HMY A;  2BVB A;  2RR1 3;  1GUI A;  2D40 A;  2XWJ B;  3PVB B;  4DO0 A;  1RVF 2;  4XZP A;  5FO7 B;  2TEP A;  5CVR A;  1U12 A;  2ZZJ A;  1EV1 3;  2YGL A;  1VE0 A;  4FPG A;  2P6H A;  4ZU7 A;  5IK7 A;  1EPW A;  5T5O A;  1IKQ A;  1KS5 A;  5EV7 A;  1S0F A;  1WCD J;  1QJY 1;  3DPR A;  5BNO C;  5F9T A;  1RIN A;  4X8P A;  5J37 A;  5IVE A;  4HBN A;  5A33 A;  4MGI E;  3N7M A;  4QX1 A;  4MLO A;  2PA7 A;  5L7O C;  3ZVX A;  2JEM A;  3F2Z A;  4RL7 A;  4MAD A;  1MZ6 A;  4A6O A;  1PO2 3;  1ZVF A;  3GNE A;  4BZ4 A;  1RIR A;  4GB3 3;  3WG2 A;  4LNV A;  2JG9 C;  4AI1 A;  3FBM A;  3MID A;  1L7L A;  4XF4 A;  4I2O A;  1W99 A;  4GIQ A;  2XHK A;  2VQU A;  4AEK A;  1QNW A;  4W65 A;  1ND2 A;  1AYN 1;  4XFH A;  1N1V A;  1XE0 A;  4JCK A;  3JQX A;  4QKB A;  1AYM 1;  3ZN6 A;  4HG6 B;  4YM2 A;  3E5U A;  4DPN A;  5DUW A;  2VMI A;  2FDF A;  5DDJ 3;  5D8A A;  3EO6 A;  4A44 A;  5IYY A;  2W1S A;  1I5P A;  1YYN A;  4XJ8 A;  4CZS A;  3OG2 A;  2NPI A;  1WW5 A;  2EIE A;  3AZW A;  1YQ5 A;  2YZ4 A;  5J1X A;  5C9A C;  4GWN A;  5FMD A;  5C5T A;  4CCL A;  3INA A;  1HXS 1;  2W52 A;  5DZF A;  1RC6 A;  1DGR N;  3ZN5 A;  1H4H A;  3Q8C A;  4QKD A;  4D69 A;  1GMM A;  5FY7 A;  4CUG A;  5FZD A;  4FTB A;  2CV6 A;  3LA3 A;  4QXH A;  1NCR B;  2CYF A;  1PK6 B;  2GMM A;  2B8M A;  4YVS C;  1ENQ A;  1BYH A;  4KG8 A;  4LUK A;  5FYC A;  3OY8 B;  2OII A;  1K42 A;  3SKJ E;  3THT A;  3AB0 A;  4NAM A;  4MG2 A;  1OOP A;  2ZAA A;  3ES1 A;  3J26 N;  5FYI A;  2VBP A;  5FYV A;  2D97 A;  3ROU A;  2VZU A;  1CJD A;  1RUE 3;  4QB2 A;  3O1O A;  4L97 A;  5I0U A;  3N9L A;  4ATF A;  5JOZ A;  1JW6 A;  1XYP A;  4CCO A;  1YUD A;  2R49 A;  1AX2 A;  4M0N A;  4QAW A;  1VBE 1;  4JKM A;  3ZYJ B;  5IVB A;  3UKN A;  2E33 A;  3NV1 A;  2ZHM A;  1VRH 1;  3H42 B;  2ZHN A;  2EXI A;  5TSW A;  4Q0V A;  5JOX A;  2FBE A;  5FK8 A;  4FFF A;  1ONA A;  3U4X A;  2ZZQ A;  5A3L A;  1JS9 A;  3KM5 A;  3DYP A;  4ZS3 A;  3U11 A;  4DXS A;  4MXW B;  2G9G A;  3ZFG C;  1XB9 A;  5DXD A;  1DHK B;  1MS1 A;  3VDD A;  3JU9 A;  2XOM A;  4AL9 A;  3K2O A;  2NYY A;  1NZC A;  4LO4 B;  4DY5 A;  1VBC 3;  5JSP A;  1AR9 2;  3ZSE A;  5KHG A;  4HMZ A;  1CAV B;  3VHN A;  1MVQ A;  3FUO A;  1RUI 1;  3PVN A;  4RR3 B;  5EJ1 B;  3GCX A;  4FQZ A;  2RMU 3;  2QQJ A;  4Y22 A;  5C8C A;  2D6M A;  2X8K A;  4PBP A;  4HXC A;  3T4V A;  2PEL A;  1E5S A;  4YVW B;  4ZXE A;  1NQD A;  4FBF A;  3VD3 A;  5JXG A;  1CAX B;  2JD4 A;  1H4G A;  1EUT A;  5E8A A;  4I30 A;  1ZM1 A;  2WIN B;  1BMV 1;  1IOA A;  1RUG 3;  1W6P A;  4Z1V A;  4HFS A;  4N43 B;  2DUP A;  3VHR A;  1IPK A;  4L99 A;  3VKL A;  4B7K A;  4N7U A;  2VNG A;  3ABZ A;  5KXB A;  2RR1 2;  5KXC A;  5LZ6 A;  1ULG A;  4AI8 A;  4LK7 A;  1DLC A;  2DDU A;  4TXW A;  2W1U A;  1EV1 2;  1N1Y A;  4AI2 A;  1NA1 C;  1IPS A;  5HCF A;  1ALY A;  4JAA A;  4ONU A;  3VZM A;  4OHY A;  3WNN A;  1PMI A;  3DKQ A;  1SBD A;  1MS0 A;  1RGS A;  1W9F A;  3RVH A;  4UBG A;  3VBS A;  4GWI A;  3RYR A;  1UXX X;  3AP7 A;  1DGW A;  3D3A A;  2HWE 3;  3AVR A;  4PLM A;  5JLV A;  1AL2 3;  3RJR A;  1YI7 A;  5CG9 A;  5I8S A;  2MEV 2;  5JPM B;  2X5I C;  5E89 A;  4GB3 2;  4GMP 3;  1QEX A;  1QOO A;  3PUH A;  5FMC A;  2YUE A;  3CF6 E;  2QZ3 A;  5CZK A;  2AEN A;  3E6C C;  5EQU A;  4YZ1 A;  5KC5 A;  4K8R B;  4OFG A;  1UXZ A;  2GU9 A;  3HOB A;  4AHY A;  2LAL A;  4TSV A;  1J58 A;  4IEZ A;  4QPY A;  2ZAB A;  1OH4 A;  2VUC A;  3IAQ A;  2QE3 A;  4LBQ B;  3MFC A;  4QX5 A;  4O65 A;  5BUV A;  4OMD A;  1QJY 3;  4AGG A;  4I0B A;  1A3K A;  3LSE A;  1V6M A;  1W2T A;  2VZS A;  2XLG A;  3K48 A;  5DDJ 2;  3VBH A;  3OUI A;  4ZXK A;  5JOW A;  2BNO A;  1OF4 A;  4XJU A;  3ZDS A;  5A6Z A;  5C3S A;  4CU8 A;  4NO4 A;  1REE A;  1LAJ A;  2BER A;  1OVP A;  4KMQ A;  5SV8 A;  4BH9 A;  5T55 A;  1HDK A;  4E9K A;  4KL1 A;  1ZBE 1;  3VDC A;  5J09 A;  3ALQ A;  5J7M A;  3UGH A;  4RGK A;  4HKO A;  3OD0 A;  3HPN A;  5FBJ A;  4BHP A;  1EUU A;  3DYM A;  1KXG A;  3BN6 A;  2VC9 A;  2YPJ A;  3DKW A;  3GHN A;  4R8H A;  1ND3 B;  2JDY A;  2Y26 A;  4NHK A;  4A7Y A;  4FPC A;  3KLS A;  2W0X A;  3KZ4 C;  4JGY C;  4IXL A;  1AYN 3;  2NM1 A;  2PHL A;  4L2N A;  4QPI C;  1AYM 3;  3N7K A;  1E57 A;  3WQB A;  1W6N A;  4GH4 B;  4RQP B;  4AED B;  1J1T A;  2P3K A;  4CCN A;  4BME A;  3NAP B;  4XBQ A;  3FE5 A;  1AR7 1;  3R4U A;  4HT1 T;  5FZ3 A;  2XL9 A;  3WD5 A;  4JTO A;  2VR4 A;  4Q26 A;  1SDW A;  2VY0 A;  2Q8E A;  4E27 A;  2PHW A;  1ULD A;  4TTG A;  5FUP A;  5A6X A;  1UNB A;  3C7G A;  1RUE 2;  4AOC A;  4C1X A;  4IV3 A;  4LK6 A;  3ZDV A;  2W94 A;  2YY1 A;  1JZ8 A;  1HXS 3;  4NIA A;  2DCY A;  3GYD A;  4RHV 1;  5F6K A;  1VMF A;  1RUJ 1;  5DAW A;  3ILR A;  3ZKY A;  3RZZ A;  1Q5O A;  1S0C A;  3A0K A;  3AZV A;  3M3I A;  3P5B A;  2WNO A;  4PQQ A;  4EN9 B;  1JYW A;  3DGT A;  2XUM A;  2ZGR A;  4P9G A;  2XJQ A;  4WVW A;  5FUN A;  1YLL A;  3ZFF B;  5JPN B;  3AFG A;  2B4K A;  4R9A A;  1AUY A;  3MEP A;  5FZ8 A;  2I2S A;  5C3Q A;  4FXG B;  1WCS A;  2XVG A;  4MGS A;  5FFO C;  5A6Y A;  4Q4V 1;  5CIS A;  1HN1 A;  3ZR6 A;  2VD7 A;  1H9P A;  1LCL A;  1VBD 3;  1VBC 2;  4XFG A;  1H2M A;  4EN7 B;  1DDL A;  1CON A;  1H8V A;  1FYU A;  4DZG A;  2RMU 2;  4LBJ A;  2BNM A;  4Q4Y 1;  4BYY A;  4BDV B;  2RJK A;  1GOH A;  1BVP 1;  1VBE 3;  4IV1 B;  4OZX A;  2UUR A;  1VRH 3;  1F4A A;  2ZGT A;  2A6Y A;  4KWL A;  5L9V A;  5LRR A;  1RUG 2;  1LU2 A;  1XQN A;  4NR1 A;  2PQQ A;  1LOE A;  4PLO A;  5BNP B;  1OF3 A;  3N9O A;  5CFC C;  3H1M A;  3TYJ A;  4CUB A;  3MW4 A;  3D0S A;  2ZML A;  1HJG A;  4DUW A;  2BBV A;  5C6C A;  2GC0 A;  2IZW A;  3GJA A;  1PNG A;  3AFK A;  4QX8 A;  3VD7 A;  2HYK A;  4NRM A;  4DY3 A;  4WM7 C;  3MZH A;  5FZH A;  1CX1 A;  4PI0 A;  2XKP A;  1Z7S 1;  4QQP A;  4N90 A;  5DG1 A;  3LEG A;  5A7P A;  5DAQ A;  4QT6 A;  3TN9 1;  1J3P A;  2WFP A;  1RUI 3;  3KCC A;  4BOW A;  3TB0 A;  1UU4 A;  4I0A A;  1R08 1;  4QX7 A;  2WNU C;  1KIT A;  3IIA A;  5EYY A;  2JG8 A;  2BWC A;  4K7J A;  2HWE 2;  3J7L A;  3IB3 A;  2QQM A;  3QOP A;  5IAX A;  1AL2 2;  1Z78 A;  2WBK A;  3S5A A;  4XVH A;  4A2U A;  4U36 A;  1HW5 A;  5IUQ A;  3ZFE C;  1SLB A;  4BQ2 A;  5FWE A;  5KWR A;  2E7T A;  2GAL A;  3TOJ A;  3IPV A;  3OGV A;  2JG9 B;  1GKB A;  4YWA A;  2FD8 A;  2N7G A;  4HOO A;  4XC9 A;  1QJY 2;  1G9C A;  1Y7B A;  2R32 A;  1S2E A;  2FZ1 A;  4AGR A;  4HAN A;  2ZXQ A;  3LF7 A;  4NIH A;  4E2S A;  3PIJ A;  2NLR A;  4Y4Y A;  1OUS A;  1HRI 1;  4BLJ A;  4JKK A;  1UF2 C;  3UT0 A;  1J59 A;  4YVW A;  3AVS A;  1CAX A;  2BVV A;  2E7Q A;  2OS2 A;  2XH6 A;  3AKT A;  5JIU A;  4LHS A;  1DP0 A;  2XUE A;  2GC1 A;  4N43 A;  1YRZ A;  5CFD C;  3B7M A;  1SBF A;  1WBF A;  2E63 A;  2EID A;  4F3J A;  3KV5 A;  1AYM 2;  3I97 A;  3M3C A;  4QGM A;  4CEY C;  1MQT A;  1WD4 A;  1JH5 A;  3AKQ A;  3T1M A;  3ZYB A;  2H0V A;  4Y1Y A;  1CJP A;  3I59 B;  1AX1 A;  3L9J T;  3RRD A;  1NLS A;  4CE8 A;  3ZXA C;  1YJL A;  4CDX C;  1OPO A;  1V70 A;  2WKK A;  1ZBE 3;  1ZRC A;  4WM8 B;  4ISQ A;  4AWD A;  1WW7 A;  3AJZ A;  1HXS 2;  2JDK A;  1D7P M;  2Y33 A;  2ZEZ A;  3KMH A;  4GJZ A;  4NJ4 A;  1WCQ A;  1CZS A;  3D8C A;  2AUY A;  2QQK A;  5DN2 A;  3NVC A;  3NJZ A;  3VB9 A;  4C91 A;  2JEC A;  4IGP A;  2WO7 A;  4HLT A;  5LRS A;  1EY2 A;  4XUR A;  1DQ0 A;  1WMF A;  3AMH A;  4P9L A;  3AMP A;  3C2U A;  1WWY A;  1D2Q A;  1WKY A;  2O8Q A;  3D0J A;  3OBZ A;  4AHZ A;  4Q8K A;  5IFP A;  3H8R A;  3ELN A;  2L9L A;  4QDS A;  4B1M A;  2CGO A;  2D3P A;  2OPW A;  3VHP A;  3TRS B;  2FDG A;  2EXK A;  4CCK A;  4HN1 A;  2JX9 A;  2KA3 A;  5F3G A;  3T2T A;  3POE A;  4QQL A;  3BGA A;  5F39 A;  4NHX A;  2DVD A;  3LSD A;  3IBM A;  5EZW A;  1J3R A;  1LTE A;  2MPF A;  1MS4 A;  1NLR A;  2NMN A;  3NV3 A;  1RUJ 3;  2VZR A;  2WR9 A;  1VBE 2;  4RHV 3;  3CMG A;  4CDQ A;  2ZA9 A;  1QQP 1;  3Q8B A;  3H8U A;  4RFR B;  1SLA A;  2VUA A;  3OPZ A;  4M3C B;  1MS5 A;  2VZP A;  5A70 A;  1Y9G A;  2HWB 3;  3HAG A;  1L3J A;  3OGG A;  4GKY A;  4XTM A;  4CDW C;  5C4W B;  3MHZ A;  1MEC 1;  1W8W A;  2P3I A;  3VBR C;  1WD3 A;  4OHZ A;  3ZIX A;  5JOY A;  4FI9 A;  5EPA A;  3M8L A;  5GJ6 A;  4BM8 A;  5JMO A;  5LBB A;  5GZE A;  1UZY A;  3POG A;  3IAP A;  1VBB 1;  3NV4 A;  4DXT A;  4CU6 A;  1D4M 3;  4IEW A;  1RUI 2;  5KC6 A;  2C6S A;  1W6O A;  4Q4Y 3;  1KEX A;  1NA1 B;  1OUX A;  4UFM A;  5FPL A;  3T0D A;  3FUQ A;  1CX4 A;  1N1T A;  1MS9 A;  3GHM A;  1IQD C;  2DFB A;  2DVB A;  3BU7 A;  4KI5 M;  4LLO A;  1OH3 A;  2IVJ A;  3TBD A;  1BMV 2;  1C8M 3;  2A70 A;  2HYX A;  2RJL A;  2PYT A;  4IND A;  1AXY A;  3W20 A;  1C4R A;  4YW4 A;  5GKA C;  2QQL A;  4P00 B;  5HXV A;  3BPZ A;  2VE1 A;  5LK5 A;  1NYW A;  4FTS A;  4W50 A;  1UW8 A;  3ZFF A;  4EYU A;  3LE0 A;  4NWW A;  1UIJ A;  1NXM A;  3PLQ A;  1Z7S 3;  4FPF A;  4UAP A;  5I8Y A;  4XDP A;  2NN8 A;  4UW4 A;  5CKQ A;  4UBH A;  3TN9 3;  4NVP A;  3IZO A;  3NRU A;  1HX6 A;  2X29 A;  4XPV A;  4XTP A;  1R08 3;  2BEO A;  4I0W B;  1ZA7 A;  4D6S A;  1OXC A;  5FZG A;  3FJS A;  1FMD 2;  1VAL A;  5IAV A;  4CU7 A;  1RHI 1;  1UMH A;  4A7K A;  3K77 A;  3RZH A;  5C3O A;  2O8O A;  4XJW A;  2ZAC A;  1TNF A;  2XJT A;  2WLQ A;  4CCC A;  3RJ2 X;  5HI0 A;  2EXH A;  3R05 A;  1H1A A;  4P9Y A;  1X9T A;  2SBA A;  3I2D A;  1C1L A;  1NZI A;  2BFU S;  3MUZ 1;  2W39 A;  1A6C A;  3B94 A;  1SFP A;  1ZRI A;  1H2K A;  5F6L B;  2XKO A;  1W2N A;  1ZBA 3;  4AF9 A;  3PVO A;  1GQG A;  2XBO 1;  3ZM8 A;  5BPX A;  2B39 A;  2Z5W A;  1O3S A;  3PUS A;  4JX0 A;  1ENR A;  2JD9 A;  2Y64 A;  4AI3 A;  2YYO A;  4A41 A;  4B4Q A;  3AC0 A;  1SMV A;  5APA A;  1A34 A;  1QJF A;  3NJX A;  2QQU A;  3A0N A;  4CCM A;  1HRI 3;  4UFL A;  1ZBE 2;  1Q56 A;  1CES A;  1DZQ A;  3T0B A;  2FCT A;  4FPK A;  2VOV A;  3ZLI A;  4FAG A;  2WSU A;  3VBO C;  1DYP A;  3PUI A;  5A33 B;  5LEK A;  5BNO A;  4PQ9 A;  2J22 A;  4AI9 A;  2GND A;  4Y24 A;  2X09 A;  4CDU C;  3KF3 A;  3ZIW A;  5DAP A;  2WQ8 A;  1K45 A;  4FO9 A;  4DB5 A;  5L7O A;  4FPO B;  4CP2 A;  2PHU A;  2WO3 A;  4XFI A;  2ZMK A;  4QMA A;  4XET A;  4QGL A;  4MGT A;  3POJ A;  1AR7 2;  1F2N A;  1ND2 B;  1G86 A;  2J1A A;  2JG9 A;  2XVK A;  1KS4 A;  4YW2 A;  2ZJC A;  1V9U 1;  3POI A;  2MHF A;  3E97 A;  4OI2 A;  3JD7 1;  5D8A B;  4CCE A;  3ZN4 A;  5AFE A;  1JYC A;  2IC1 A;  4A42 A;  1LUL A;  1D2S A;  2R04 1;  3MPB A;  4YGC A;  1JN2 P;  4N53 C;  5JUV A;  4Y3O A;  4LHL A;  4RHV 2;  4K8F A;  4BXF A;  1RUJ 2;  1UY1 A;  4FOW A;  1IS6 A;  5BNQ A;  2JXA A;  4BJ0 A;  1FOD 1;  4E2G A;  3VKN A;  3C3V A;  1JOB A;  1MR5 A;  4XF0 A;  2D5H A;  1V6I A;  2W68 A;  3MIE A;  1QHD A;  3V0A B;  2Z4F A;  1HV1 A;  4UFI A;  4M3C F;  5JDB A;  5KXD A;  5C9A A;  3POW A;  4V2V A;  5H9R A;  3TAY A;  1OQ1 A;  4HET A;  4JQR A;  3V64 A;  4AVA A;  2MEV 1;  4Q4V 2;  3WOG A;  4D7T A;  4FAH A;  1RUO A;  3D5O A;  1JYX A;  3LEK A;  1OFS A;  2CGP A;  4Z92 B;  2D3S A;  3O0V A;  2QUO A;  3PTY A;  3RNS A;  3BTX A;  2FQP A;  2VOX A;  3U14 A;  5K0U C;  1A78 A;  3GXU A;  4OI0 A;  3MV0 1;  3I59 A;  3OPT A;  4QHZ A;  2OQ7 A;  3OGJ A;  4Q4Y 2;  4YVS A;  4KWK A;  2AH2 A;  2ZMN A;  4W6Y A;  5KXE A;  1DGL A;  5ANN A;  4IL7 A;  4LKD A;  1W2U A;  1O5L A;  3HNY M;  5CB7 A;  3WHT A;  4B8E A;  1MEC 3;  1QWR A;  4O61 A;  4XDQ A;  3H3U A;  5DAB A;  3OB8 A;  5KR7 A;  3VD5 A;  1LKN A;  1UMZ A;  4GQ7 A;  3C8X A;  1Z7S 2;  4LIT A;  2JKX A;  2EVX A;  1BQP A;  1YFU A;  4UFH A;  2GNT A;  3IDB B;  5GZC A;  1LHN A;  2GC2 A;  4H3W A;  2DBI A;  3S0M A;  4L0P A;  1R08 2;  2WRA A;  2XGX A;  3AYA A;  4NOT A;  4TLG A;  1Q8S A;  5DAV A;  5LA9 A;  3ZFG A;  1OKO A;  1CAU B;  4YW5 A;  2WL1 A;  4NHL A;  2K0G A;  2HWD 1;  1QU0 A;  2QVS B;  3GBW A;  3MF6 A;  3TWI A;  2A3W A;  1K5J A;  1NKG A;  1JZ2 A;  3KV9 A;  3BKZ A;  1R1Z A;  3ACL A;  5I93 A;  3KV4 A;  1POV 1;  4XBN A;  3TEX A;  3ILF A;  4M01 A;  3ZXJ A;  5LWB A;  3AL6 A;  3CNA A;  5A1F A;  3BU0 A;  1W6P B;  5FY4 A;  1F35 A;  3UV9 A;  5E16 A;  2V09 A;  1ZRR A;  1O5U A;  3CJX A;  4QKN A;  3WW1 A;  4AAX A;  2QQP A;  5A32 B;  1OFN A;  1J3Q A;  1TNR A;  1UWW A;  2NP0 A;  1UOF A;  4S2D A;  1WBL A;  2CNA A;  1W8O A;  5FP9 A;  1ULP A;  2A6W A;  5DUV A;  4YZ4 A;  4I3G A;  1IGO A;  5FY1 A;  1H8T C;  1K12 A;  2DBN A;  4MOA A;  1JZ7 A;  1HRI 2;  1RHI 3;  3DYO A;  4CEW C;  4AG4 A;  4UFK A;  1UIK A;  4TYS A;  1NA1 A;  3K46 A;  4QX3 A;  1FPN 1;  1MZE A;  4CDX B;  4PLN A; 
#chains in the Genus database with same CATH homology
 5A80 A;  2GP5 A;  4AAP A;  3NJY A;  5A7W A;  3AL5 A;  4DIQ A;  2VD7 A;  2GP3 A;  5IVV A;  2YU2 A;  5FP7 A;  2OQ6 A;  4CCK A;  2XML A;  4LXL A;  4UF0 B;  5FZ0 A;  5FZ4 A;  5F3G A;  4LIV A;  4EZ4 A;  3U4S A;  5F39 A;  4NUB A;  5FZO B;  5IVF A;  4QXC A;  5FXX A;  5IVJ A;  5A1L A;  5E6H A;  3DXT A;  4DO0 A;  5FY9 A;  3PTR B;  4URA A;  5LW9 A;  5FZC A;  3LDB A;  4Y3O A;  4D6Q A;  3N9O A;  5A3T A;  4E4H A;  4ASK A;  1VRB A;  5K4L A;  4Y33 A;  3U78 A;  4BXF A;  5A3P A;  4Y4R A;  3PUA A;  3PU3 A;  4HON A;  2YU1 A;  4QX8 A;  5FYB A;  5FJK A;  5FZH A;  5ANQ A;  5IVE A;  3K3N A;  4TN7 A;  3N9M A;  5FZ9 A;  5A7P A;  3RVH A;  4V2V A;  4CCJ A;  5F5C A;  5FPV A;  4QX7 A;  3AVR A;  2XDV A;  3K3O A;  5FYY A;  2P5B A;  2YPD A;  5A3N A;  3OPW A;  4BIS A;  5FZM A;  5F37 A;  5FPL A;  3OPT A;  4IGQ A;  5FY8 A;  2OQ7 A;  4UF0 A;  5FYS A;  5A7Q A;  5FZI A;  3KV6 A;  2Q8C A;  5FWE A;  2WWJ A;  2Q8D A;  4EYU A;  2OT7 A;  4HOO A;  2YBP A;  4EZH A;  5KR7 A;  4XDP A;  5A7N A;  2YBK A;  2PXJ A;  4CCL A;  2YBS A;  4QU1 A;  4LIT A;  5FY5 A;  4V2W A;  3KVA A;  5IVC A;  5FV3 A;  5FZ6 A;  5FP3 A;  4D6S A;  5FZG A;  5FY7 A;  5FBJ A;  4CUG A;  5FZ1 A;  5FZD A;  5CEH A;  5FZF A;  5FZL A;  4QXH A;  3AVS A;  5F5A A;  5LY2 A;  5FXV A;  5FY0 A;  5FZE A;  3UYJ A;  4D6R A;  3PDQ A;  5FZA A;  5A7W B;  5FYM A;  2OS2 A;  4GD4 A;  5FWJ A;  5FZO A;  5FP8 A;  5A7O A;  2WWU A;  4IGO A;  3N9N A;  2XUE A;  5FYC A;  5FYU A;  4CCN A;  5IWF A;  5IW0 A;  3KVB A;  5F3E A;  3KV9 A;  5F3C A;  3LD8 A;  3KV4 A;  5FPU A;  3PU8 A;  2XXZ A;  5LWB A;  3KV5 A;  5FYI A;  5FYV A;  3AL6 A;  5FZ3 A;  5A3W A;  5FPA A;  5FYZ A;  5A1F A;  5F32 A;  2Q8E A;  5FY4 A;  4LIU A;  2OX0 A;  3N9L A;  3PUS A;  4CSW A;  5FUP A;  4CCO A;  5FXZ A;  5FXW A;  5IVB A;  2W2I A;  3N9Q A;  5FZB A;  4BU2 A;  4GJY A;  5FP9 A;  5FYT A;  4AI9 A;  3N9P A;  3ZPO A;  3PUQ A;  3DXU A;  4GAZ A;  4CCM A;  4GJZ A;  5FY1 A;  5LY1 A;  3PUR A;  5FUN A;  5FZK A;  5F2W A;  5FYH A;  5FPB A;  4XDO A;  3ZLI A;  5F3I A;  5F2S A;  5A7S A;  5FZ7 A;  4C8D A;  4IGP A;  5FZ8 A;  5ISL A;  5IVY A;  5FP4 A;  5F5I A;  5FJH A;  4QXB A;  4QWN A;  3K2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...