5LEJA

The transcriptional regulator prfa from listeria monocytogenes in complex with a 30-bp operator prfa-box motif
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
236
structure length
236
Chain Sequence
NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Listeriolysin regulatory protein
publication title Structural basis for glutathione-mediated activation of the virulence regulatory protein PrfA in Listeria.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Transcription
total genus 69
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5lejA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5lejA01
2V6CA 1X82A 1SMYF 1UHMA 5CADA 4LGWA 1BIAA 1MDMA 3WW2A 2DPDA 4IRIA 1YHFA 1CX4A 2O1QA 2O03A 2O8QA 3SXWA 3GF2A 3KP3A 3MAJA 3F8MA 4ZU7A 4L5JA 1IF1A 1J2XA 1XCBA 3HRTA 2FQPA 4O6JA 4HX7A 2P7VB 2O8XA 1O3QA 3WGHA 2A5YB 5DDGA 2NS0A 3NEUA 3F72A 4KL1A 4IEPA 4BHBA 4O5VA 2XKPA 3WW1A 5I91A 4Y13A 4EGZA 1CAXB 2V09A 3FXUA 4XFAA 3HYIA 1SFXA 5LEJA 2OZJA 3M3IA 3FF5A 2ZXJA 3F8BA 4EVIA 2D1HA 2AS5F 3FMQA 5K1YA 3WODF 3I4PA 2A69F 2JPBA 5J8FA 4RS8A 1TBXA 3T1BA 4OIQF 3SMHA 5FFXA 1J9IA 2OU2A 3EYIA 1IXRC 3T5XA 2C0ZA 1Y0UA 4Y15A 2HYFA 3LA3A 2DAOA 1FX7A 4Q5SF 3P9IA 4A5MA 3CO2A 3M7GA 4CGZA 4NHJA 1TQ5A 3ML6A 1FP1D 1OKRA 2OZUA 4UVAA 4FX0A 4OLLA 2RKHA 5LBQA 1XGNA 2XRNA 2O0YA 2NYXA 5JR3A 4HBLA 1RIOH 3DL3A 5D1IA 2BNNA 3K1PA 1NXMA 2VE9A 3CJXA 3CLOA 3K0LA 3RKXA 1EH6A 1J5YA 3EDPA 2E7XA 3PQJA 1KQ0A 3UKTA 2VXZA 5ERIA 1UPIA 4AIJA 3P7NA 4F8AA 4XSXF 2H94A 2NAZA 1IN8A 1E17A 3LQRA 2IW5A 1ZZ9A 5LGTA 1XN7A 4MGKE 4KFCA 2HOEA 1QWRA 4GULA 4U7BA 3NSTA 1MJ9A 4I09A 4QX5A 3H3UA 4PCQA 3L7WA 3EQLF 1R5GA 3FE5A 1ZZBA 1SD5A 3O3KA 3HQXA 4L9NA 4Q0PA 2HZTA 4Y17A 2VBWA 3BY6A 2VOPA 1ULYA 5D4RA 5DUIA 4P96A 1XGSA 2QYOA 5DCMB 3Q5FA 5DV5A 1PUEE 3L2HA 3LSTA 3MYXA 4EQQA 2ISZA 1V4RA 4FX4A 4M9ZA 3AAFA 3CUQA 4U7DA 3OGJA 3HIFA 4M9XA 4G6DA 1UD1A 4UBGA 3FJSA 1O3RA 1H0MA 2EB7A 3ZN1A 1R23A 2FF4A 3OD0A 1Q5OA 5HS8A 1XGOA 1SD6A 2BEOA 3CTAA 2FBIA 2VPVA 5HI0A 1QXRA 3GW2A 3C18A 4A0ZA 3VHRA 3SCFA 3IWZA 1KYWA 1U5TA 3KMHA 4I3PA 1H1IA 1TNSA 5EZWA 2EFOA 1O5LA 4RGXA 4IEQA 4M73A 2FE3A 4OU0A 1W7PD 4HX8A 4EJWA 4IETA 4L2NA 2QVOA 1IN4A 4OIRF 5ICGA 1KU9A 1SD7A 2VODA 4MV2A 5CVIA 3HRSA 1T0FA 2I45A 5KHKA 1WGPA 2M5WA 2KJBA 4A12A 2KIFA 4XF4A 3F21A 1FY7A 5KHJA 5E1RA 5HLGA 3E6BA 1UB9A 1MD0A 2ZMEB 1FI2A 1OR7A 1NE4A 3WTYC 2NNYA 2D1VA 3T8RA 2QWWA 1ZHFA 3J80Z 4P9GA 2O6GE 4QGLA 3B02A 4M74A 1ZLKA 2DCTA 3SXYA 1RI7A 2K86A 4J1WA 5HDNA 3VFZA 2CWEA 1YS6A 2GWRA 3TGNA 3PFIA 3OV8A 1DPRA 4KU8A 3U11A 4S04A 1U2WA 2V79A 1FYKA 3USSA 3P9CA 3TKYA 4Q48A 1UHWA 2BBYA 3KZYA 4MGRA 2P6TA 1HQCA 2ETHA 3SZTA 4JV4A 4KUMA 2E9QA 2FNPA 2VBXA 4I0BA 1TW2A 1IRGA 1NE6A 2EWNA 3F3XA 2HJIA 1D8KA 4IXAA 2FSWA 2JZYA 1LR5A 2XAFA 1TLHB 3DEUA 4ETSA 3QRFF 5ICFA 1I5ZA 3FFQA 2FNAA 2LNBA 2VECA 3BWGA 4ZYEA 1OYIA 1LKNA 3ULQB 1YLLA 2GXGA 2QVSB 4M71A 1IXCA 4HQMA 3I58A 4RGUA 5L3DA 2PAMA 2HDCA 5DD8A 1ON2A 2IVMA 4XBFA 1LB2A 3L9FA 4O9EA 2MA3A 4Q0VA 3H7JA 4G94A 5D6EA 3QU6A 2F5FA 2GQQA 1CAUB 3VOEA 2VONA 4QM8A 2L4AA 4I01A 3V7SA 1FBQA 2ESNA 4HYEA 4JVAA 3CL1A 4HVRA 3RPUA 4KU7A 4ZH4F 4P9FA 1HW1A 4MNUA 4EM1A 1BIBA 2V1XA 3TNQA 1K6OA 1EV7A 4J1XA 2DLLA 4HF0A 3TDZC 4TV7A 2XLFA 1Z05A 2D5HA 5IT9K 3NQOA 4MGIE 3EO6A 5FD6A 3I54A 3BCWA 3H50A 3F8CA 3ROUA 3SQNA 1CAVA 3FHIB 1RL3A 5FO5A 3QOPA 1TNTA 2XVCA 4MHGA 3TO6A 1Q1HA 3QU3A 5A2QZ 1XDUA 2Q1ZB 4HAMA 4X6QB 3EHKA 4YSFA 3M9AA 3PNAA 1F1ZA 4ENNA 4LB6B 2V1DA 4HSLA 4B09A 4LG0A 3H9AA 1YUDA 1K78A 3R0JA 3CJNA 2D40A 4YG2F 1YYVA 4H7LA 3LZZA 5LRRA 1OPCA 2F5EA 1G3YA 2DFIA 3FMRA 2PMHA 4EJOA 2HTJA 1D8JA 1E2XA 3VB2A 2EVXA 5LHIA 3UKNA 3U10A 2W57A 1U5TC 1UFMA 3F6OA 3U9GA 2IA0A 4ZZLA 1ZGJA 4RGRA 2E1CA 4MEYF 2FA5A 2JTVA 1HKTA 5ICEA 1J58A 2DK5A 3U2RA 3IRRA 3G73A 2IA1A 2EV6A 4N9HA 3IRQA 4Q47A 4IRHA 3WG9A 5E1WA 2KIMA 1ZLJA 4AVAA 2CO5A 1LDJA 2EA7A 4Q0UA 3S7IA 2IT0A 3HTUA 3ZQ7A 5BMZA 2HKOA 1J3QA 2HQNA 1FPQA 3CLPA 4KWLA 3TQNA 4JTNA 2XUBA 2Y0MA 4MGYE 4HBNA 2HYGD 1CGPA 3ELKA 5EEHA 4TLFA 1HXDA 1GQHA 1XSVA 5HVQC 2CV6A 4IPAA 4U0VA 4OIOF 3GO5A 2ZO4A 2IXKA 3V4GA 1ZAOA 1LNWA 2W24A 3SHRA 5LHGA 1UCXA 2DBBA 3TOBA 3J80K 1HSTA 1T38A 2UWMA 5D8LB 3E3VA 4WF2A 1UW8A 5KBFA 4JQFA 4IF4A 1Z91A 4CXFA 2ZBKA 3F8NA 4ESBA 1IPJA 4MQ9F 1CAWA 2XV4S 4MEXF 4AIKA 5E16A 4YFKF 3CEWA 5DCFA 3ABUA 1FT9A 5BQTA 1STZA 3ELNA 2V1UA 4XFHA 2YPRA 3UKVA 3IHUA 4HLYA 3ZP5A 2X4HA 5ILSA 2L4MA 1DP7P 1YFUA 4QM9A 2VBZA 2QNKA 1BC8C 5I8TA 1OMIA 2EFQA 3F22A 3BJOA 3RDIA 2VN2A 3H7YA 2Y48A 4EMSA 3WTXC 5FQ0A 1SAXA 1R5HA 4ON0A 1XGMA 2DPUA 2WFPA 4A6DA 4HLTA 4PGHA 2PN6A 1IPKA 4BHCA 1W7PA 5H6QA 1IN7A 1G3WA 4CO8A 5CLSA 2STTA 3IKVA 1FLIA 1W5SA 5JI6A 2Z33A 4ENMA 2XROA 1JE8A 1HSJA 1FBSA 3EYYA 1L3LA 2F2EA 4Z2YA 4HDUA 3BALA 3ZMDA 3ZMTA 1NYWA 1RUNA 3JAMZ 1WRJA 4IJAA 1U3EM 3GWZA 4Z82A 4WXCA 2K4BA 3HUGA 4KDPA 2RVCA 1OD5A 1YLFA 1A04A 4KT5C 2Q8KA 4R8HA 3F8FA 5LHHA 2XL7A 3E6MA 3LOIA 2PA7A 5ILUA 4HOBA 3P9KA 1J7KA 2JT1A 3GFIA 5I0TA 3RYRA 1IAWA 5A2QK 4IHTA 4AQ2A 1UIJA 4IEVA 3MZYA 3JZVA 3TDUC 5JAXA 1Z7UA 1YWKA 2W85A 4YIFA 1R7JA 4XLNF 1XMAA 3M70A 2QZ8A 5H6RA 5CU1A 3I5UA 3JSOA 4R79A 4XFFA 3QP6A 3WW4A 1RGSA 1BI2A 3M8FA 4XFIA 3HOTA 3RKWA 1L0OC 2L54A 5FDBA 1R36A 2RN7A 3PLQA 2Q4SA 3B73A 3WE2A 1TQMA 3H1WA 2D5FA 3F23A 5FLIA 5AONA 3RKYA 3TNPB 2DT5A 1IW7F 2QQ9A 5ED4A 3BROA 5D5XB 2IXHA 4HF2A 4META 1T2KA 2Q2EA 1FOKA 5I0SA 5D6FA 1SEFA 1YG2A 4YRDA 4AVCA 2HQRA 5E17F 3ST7A 1TQIA 1ONVA 2ET1A 5LRSA 2QBYA 2XGXA 1B4AA 4E70A 2RC4A 4IVNA 3C1DA 4P55A 2PTMA 3DXJF 4AIHA 3TO9A 4ORFA 1BJAA 5IT9Z 1WA4A 3MEXA 2NNNA 3LAPA 1F5TA 4LULA 1I1SA 3WTVC 2R7DA 4P9UA 3R4KA 3HSRA 2FOKA 3LWFA 3KEOA 1QQIA 4GYIA 1VR3A 4D0PA 2H27A 3DF8A 4HX4A 4RAYA 4HF1A 4O3MA 4WZCA 1KYZA 4EWEA 2OYZA 2DI3A 3OF1A 1UIKA 3ZMZA 4RB0A 2K02A 4LB5A 2XASA 2K0GA 1G3SA 3E5QA 3EJKA 3ES4A 1P6RA 3FZ3A 1USTA 5BPXA 1VP6A 3R6SA 1XB4A 3J7AO 4BH9A 1O7LA 1CF7B 5CJ9A 2VC0A 1PP8F 2PFBA 1XRUA 2A6EF 3QACA 4LA2A 5BPDA 2IJLA 1BBYA 2M45A 4HMZA 5L3GA 5JCTA 3ACLA 4XFGA 4MGZE 1WI9A 1ZZ6A 1FBUA 4ONUA 4WBBA 4OIPF 4UHTA 4EROA 2P6SA 3JSPA 4KIBA 1SFUA 2RV8A 4JK1X 2PHLA 5J3UA 3WU0A 4CYDA 1FYMA 1H9TA 4P5OA 3LFKA 4KN4X 3GZ5A 2UY8A 4UV9A 5J7MA 5E1ZB 2OAZA 2LKPA 4RAZA 4NQWA 4ASNA 3C3WA 5D8KB 5FD5A 5BY5A 1YFWA 3BB6A 1ZRRA 3H3ZA 1CAXA 2Z2SB 3JAMK 3S0MA 2FMYA 2A3SA 2CGPA 1K79A 3LA7A 2FQ3A 4A0XA 4AVBA 4LMYA 4BXUA 5FLHA 3EUHA 4UXNA 3M8EA 1KA8A 2L01A 4WXDA 5T3NA 1WQ2A 1IXSB 5CYVA 4HSJA 1WSUA 1MJAA 1XDSA 1F4KA 4GYGA 2R3SA 2OZ6A 1Z6RA 4IEYA 1X8EA 2QQAA 2EA4A 4LLLA 1Q43A 3O6BB 4X6RB 1MZBA 4YYOA 5D4SA 4U0YA 5H20A 4IEUA 4L9TA 3KLNA 1W5TA 2LSOA 2ZNZA 2Q0OA 3IC7A 4IRGA 2FMLA 4AXOA 2G7UA 4KNYA 5HOOA 2GC2A 4LK0F 2OA2A 4HLXA 4A2UA 2XAGA 3RPQA 3RZZA 3WTUC 1NHAA 4IHSA 5AVPA 2QLZA 4BQAA 4H0EA 2PI0A 4PGGA 4YFXF 3E6CC 2BV6A 4L0ZB 3S2WA 4L0YB 2P5VA 4MUVA 1P4AA 3IL2A 4I02A 2A61A 4YFNF 5AIQA 4PIXA 2GC0A 5F6FA 4AWXB 4IEOA 3KE2A 2DQRA 3MPBA 4JBAA 2IP2A 1ZVFA 1ZZCA 2DU9A 4HW0A 3E6DA 3LAJA 1EPZA 2HFHA 5D5UB 3HOSA 4QMAA 3RYPA 5BOXA 4G7HF 3MWMA 2QENA 4IEZA 1ZN2A 5JFRA 5J6XA 3KP6A 4EM0B 5FLXK 4ESFA 4PZJA 1MDMB 2Z5UA 3BPZA 1ZYRF 4OOIA 2A6HF 3C7JA 1ZNPA 4HVOA 4E2SA 1XD7A 1D5VA 4M72A 2P7CB 3I0TA 4IEWA 2EJRA 3SCHA 3MQ0A 2QDRA 3ZMUA 2PMUA 3D0JA 1H1MA 5DCMA 3FZVA 4KMUX 3ERED 1RZ4A 4KICA 3WTTC 3CUQC 3WTSC 1ZG5A 3O14A 2D45A 1YTYA 4LTAA 4NVPA 2ADUA 1PP7U 1AOYA 1Z1DA 5F64A 5K5QA 3LWCA 3E5UA 2ZNYA 1HKSA 4M6YA 4MZUA 1RC6A 2XLAA 3E97A 3I59B 2M8EA 3CO7C 4L11A 4CZZA 3M1EA 1VJ2A 3Q9SA 3WTWC 4Q4ZF 3KP4A 2XL9A 2VQAA 1ZREA 2HTSA 3H92A 2MC3A 3IWFA 1PMIA 1LDDA 4HN0A 4EJTA 3MDPA 1EH7A 1ODDA 1LVAA 3DKWA 2YU3A 5KHIA 3KCCA 3EQEA 3KGZA 2W25A 5DYMA 2XHKA 2XAQA 2OQRA 4ZYHA 3I64A 4EWDA 2ELHA 5BXXA 1YFYA 2V9VA 2DW4A 5FPZA 5JVTA 1IRFA 1P4XA 2VT3A 5E8IA 3T8TA 4XFCA 2KKOA 1BI3A 3NJZA 3ETQA 2G9WA 1Y3TA 5DD4A 4L5IA 2XAHA 2ZMEA 1G3TA 2RDPA 2KIUA 1EYBA 2MNGA 1T6SA 1R22A 3BU7A 5LLQA 2GU9A 5KHHA 3ZMSA 4R1HA 4PIZA 1OYYA 3R0AA 2O61A 4QGNA 1DZRA 1H9GA 5JSOA 1T98A 3D0SA 4RGSA 1QBJA 1J3RA 4G6QA 4R52A 3R60A 1O3TA 5HS7A 5E8GA 2CAVA 1PM7A 2UXNA 5HLIA 2GH2A 4Z07A 2UY9A 4G7OF 1TW3A 2D2WA 2RQPA 2K9ZA 2ISYA 2P5KA 2ZKLA 4I0AA 2PHDA 4AQ6A 2CW0F 1DGRA 1ZARA 2UXXA 3LAGA 2OA4A 2YX7A 2WWYA 1ON1A 2RNJA 1P92A 1GXQA 3ZN0A 2EA2A 3O2PE 2IA2A 5TRDA 4FBFA 2BNOA 3RNSA 1S7AA 2C6YA 3WGIA 5FLJA 3MZHA 4LUKA 4JTOA 1BOAA 2DTRA 2BGCA 2EAAA 4IESA 4YARA 2GXBA 3FXQA 1QO0D 3T0YA 3RI4A 5HDGA 1VTNC 3Q9VA 1FYLA 2QQBA 3L2CA 1U78A 1KQ9A 4XRFA 4N0BA 1KQ8A 1O5UA 5JSRA 4WX9A 2Z99A 5C8WA 2HEOA 2H6BA 4M9SA 5F1RA 4PIYA 5BPIA 1EH8A 4S05A 4G9YA 3BZ6A 3CO6C 2EV0A 3BPXA 1QZYA 3QPTA 1DGWA 4EJVA 2HWVA 2QCSB 4CICA 3SFZA 2GIVA 2OQGA 1CAUA 1DDNA 2P17A 5ICCA 1USSA 3BJAA 1KU7A 5TJJA 3TO7A 5BS6A 4EV0A 5FFZA 3LA2A 2LDUA 1Z6TA 1MGTA 2D93A 1U5TB 2CAUA 2F5DA 2DO7A 2UYBA 3KP7A 4RB3C 3JTHA 2F4PA 2GC3A 1J59A 4WCGA 3IBMA 1JGSA 3MFKA 4ZU4A 3NL1A 1QNTA 4M6XA 3DQVC 1FC3A 3RIRA 3I53A 3WU1B 4OINF 3DV8A 1LEAA 1ZZ7A 5C6CA 2HS5A 4MX3A 2FEZA 5IT3A 2K27A 4LK1F 4UBHA 2MPFA 4A0YA 4XLPF 3N4MA 3GYDA 2BYVE 3NRVA 1EY2A 4ZYGA 1PDNC 3K1NA 3EBRA 2WV0A 2JSCA 2IXLA 4IEXA 1BC7C 3H1YA 3GEZA 3GX4X 4D7SA 2EFNA 3DN7A 3I59A 3V8JA 3U0ZA 5D5WB 1MKMA 2EFWA 1FZPB 1B59A 2L02A 1C0WA 3VEPA 5FCCA 1F9NA 1B9MA 3HHGA 4GCVA 4LD5A 2PLYA 1SFEA 2PAKA 5BV6A 1DUXC 3D82A 4ZYDA 5I93A 2FXAA 1GQGA 1X8MA 3S7EA 3V8LA 1B9NA 2P4WA 4L18B 1TQPA 3PVBB 5E18F 2VT2A 1FNNA 2VC1A 1FWZA 3ECOA 2IPQX 3DPTA 4KIFA 4GGGA 1SD4A 1R1VA 4HN1A 2WTEA 1S29A 1IUYA 4XETA 2KXLA 1I6XA 2A68F 5LGUA 1ZG3A 5E1XA 3GZ6A 1ZZ8A 3EETA 3WE3A 3J81Z 3IDCB 5I8SA 3OOPA 1J3PA 5I0RA 2B5HA 3G3ZA 5E20A 3KETA 1ZGAA 2RGVA 3COAC 3K1MA 4KWJA 3FM3A 2MLKA 4WVZA 1SMTA 2Z3YA 3TOAA 5FLXZ 1ZX5A 2E7WA 5K5OA 4ENKA 5J48A 2L3DA 1J0RA 3FM5A 3DP7A 1LDKB 5KVRA 2ZCWA 3FHZA 4LUMA 3KEQA 3K69A 1Y9QA 4L9VA 2IXCA 2ESHA 5D5VB 3QP5A 4DINB 1YW8A 2P8TA 1BI0A 3SHFA 3PQKA 4MTEA 5DEQA 1B6AA 2PJPA 1V3FA 1FXZA 4LLNA 4FT8A 2LF7A 4KA4A 1O3SA 4RD7A 4E2QA 3HSEA 2GA2A 3R61A 3GYHX 4U0WA 1WLTA 1B1BA 5KHGA 1S6LA 1XMKA 2ZFWA 1ZRFA 4EWAA 2ACJA 1QZZA 1WKMA 2YX4A 2W84A 4A6EA 6PAXA 4IERA 3ISPA 4HDVA 1GVJA 2IXIA 2OD5A 4GO1A 4XEZA 4CHUA 2PAEA 1CAVB 1RNLA 1RTVA 1FSHA 2AXLA 4LJZF 2FU4A 3ECHA 5ILVA 1V70A 2B9UA 5HS9A 3BDDA 5JSPA 4LG0B 4RB1A 1ZRCA 1K78B 3L00A 3FX3A 1MJBA 2ZJ2A 3RTRA 4QGMA 4YNIA 2KJCA 3HT1A 1QPMA 5HLHA 3GLXA 2PQ8A 1LEBA 2GC1A 2MD5A 2HR3A 1KU3A 4BIFA 3BJ6A 2WC2A 2F5CA 4AD9A 4XFBA 5L3EA 1YS7A 1L3JA 2E1NA 1S8NA 3WGGA 4ZZDA 4HZFA 3OCPA 2JRTA 4Q29A 3I7DA 1WWXA 4I7HA 4KWKA 4OMYA 3N97A 5LGNA 3WTZA 5AIPA 1JHFA 4UVBA 1XSDA 2MH9A 4QLCU 4E2GA 2OBPA 5KK1A 3C3VA 1I27A 2XKOA 4XF1A 1TTYA 1KU2A 2CFXA 2XIGA 3HHHA 4QXKA 4LA3A 5K5RA 2GAUA 2PYTA 1ZRDA 1S3JA 3K9TA 3D5LA 5L3FA 4U88A 4LLGF 4KIGA 1P4WA 3KZZA 3MCZA 3LQQA 1DZTA 4OMZA 2P5LC 3FMSA 4RB2C 4ESJA 1OFNA 2IC1A 2UZKA 1RUOA 1U8RA 2CQKA 4K2EA 3GUDA 2VOOA 4DQ2A 2IRFG 3DFGA 1J75A 2HKXA 1OI6A 4UUVA 1S7OA 4OFGA 5I8YA 4G7ZF 3H1MA 1XSXA 4YIIA 3ZMVA 2UYAA 2VBYA 3GFMA 2ATFA 2XAJA 1FP2A 2BNMA 4EJUA 1YQAA 5CVRA 1CAWB 4BYYA 1QY4A 1YIOA 1JUHA 4UXAA 3JW4A 2A07F 2Y0OA 5FB2A 3HRUA 4MQVA 2MLGA 3F6VA 1HW2A 2IXJA 2OPKA 3GXOA 1ZG1A 1SFNA 1Q3EA 2CYYA 1O7FA 1OYWA 2YR2A 1D3YA 1I1GA 3KP2A 1KGSA 1YFXA 3REOA 2J5PA 3J81K 2H09A 4UVCA 4G8XA 2HGCA 3ES1A 3V7CA 4UV8A 5FQ0B 1XE7A 4Q0SA 3KFWX 2DQLA 2FBKA 2MBFA 3HT2A 5CVJA 5FGMA 3RYKA 1SQ4A 4LLOA 3SZPA 2Q30A 1IZ1A 1YW7A 1W7PB 1HKQA 3RJPA 4XSZF 2PG4A 4PDKA 1J1LA 5CVVA 1U6GA 4FAHA 3DPLC 1X3UA 2PBIA 2X0LA 5J8CA 4QWQA 2CG4A 2PEXA 1R1UA 2H6CA 1AWCA 3IDBB 2FBHA 5FPXA 2GZWA 1NZCA 4FAGA 3HTSB 1X7NA 1LQ1A 3HSFA 4Q0QA 4CDGA 3W6KB 3BPVA 3KLOA 2PQQA 4PJYA 2VE8A 4D7TA 1QXJA 2FRHA 4HVQA 2R7FA 4B8XA 2Y75A 4FHTA 4UNOA 1YFHA 5JR7B 4L9JA 3GVAA 1LJ9A 3K2ZA 3V8KA 4EM2A 3WW3A 4DNCA 1W4MA 3CDHA 1CF7A 2TDXA 3BP8A 1JHHA 2M87A 4BHPA 1IN5A 2ZKZA 2N7GA 1YW9A 4K8FA 4KN7X 3NW4A 4F7ZA 1FSEA 1BN5A 2EFPA 4I98B 3I71A 1XCVA 4EGYA 1DPUA 4HQEA 3CF6E 4XF3A 3NKTA 4XF0A 1BM9A 2PFWA 3OTFA 1G6NA 2BE5F 2QUFA 5L3CA 4WXHA 3QPHA 1BI1A 2M1BA 3VODA 1O57A 2MH2A 1HBXG 1XE8A 2Z9OA 3U1DA 3NVCA 2G7HA 2K7LA 4ENJA 3FXRA 3ABTA 1K7AA 3E5XA 1P2FA 2ETEA 5EFUA 4A5NA 1QGPA 2CSOA 1EP0A 3V7RA 2NRAC 5LEKA 3H8UA 3ZDSA 3KP5A 1IN6A 2MHFA 5L3BA 4NB5A 4ZU5A 4BAYA 4MH0E 2H0VA 2COMA 1ZH5A 4O9GA 2STWA 1GXPA 1GHCA 3IIAA 2GA1A 1JXSA 4HV6A 4XF9A 2JPCA 2O3FA 2YSRA 4WWCA 2DK8A 3ZPLA 2QBYB 5JHUA 2Q0AA 2Z69A 1T39A 4I2OA 2K4JA 3G7DA 3L09A 2EV5A 2KRFA 1REPC 5K8SA 4GXOA 4N9IA 4LEJA 4MTDA 1R00A 1UCRA 4AVPA 2J5OA 3CUOA 1G4DA 5I0UA 3W6JB 3GBFA 5EEGA 2ET7A 2B8MA 4WK8F 2EK5A 3IKTA 3KSCA 1R1TA 2M30A 5CVUA 2QJVA 3QAHA 2LF8A 1YO5C 3SCGA 4HA8A 4HV5A 1LRHA 4LFUA 4BNCA 3CUQB 1HW5A 3JTGA 1Z9CA 4KMFA 3GFJA 5HDKA 4B29A 4KYWA 5BUVA 2B0LA 2XLGA 3GFLA 3FWEA 1U12A 3HRMA 1R58A 3BOQA 1O4TA 2QM3A 3KGLA 5DUKA
chains in the Genus database with same CATH superfamily
1AX1A 4H3WA 2C24A 1SMVA 2OTLI 4AVTA 1BR1A 4LGWA 1ZBE2 1PZ8A 1W0OA 1WCDJ 3KZ4C 5DQ0A 3WW2A 4ITCA 1FOD2 2LC2A 4CE8A 3KP3A 3MAJA 2HLEA 1D1BA 3M2MA 2WS93 1IF1A 1VRBA 1SLBA 1J2XA 4K21A 4MGTA 5FJHA 2ZGLA 2NS0A 2BZTA 4D7YA 4O5VA 2XKPA 2CWMA 2ZGNA 1VRH3 3HOWJ 4IGQA 5I91A 5C5UA 4Y13A 1Y7BA 3DPRB 1Q8PA 3QH7A 4ZY9A 4GJYA 2JG9C 2W95A 2R1BA 2GNBA 2ZXJA 2DDBA 3J7AY 4AWDA 2D1HA 2FD5A 2WAQN 2AS5F 3RWNA 4L8QA 4QDRA 4B3AA 3I4PA 5GLTA 5D8AB 2A69F 1DQ5A 4XMYA 2V72A 4RS8A 1C28A 3OPZA 3T1BA 2ECBA 3ZYGA 2XOMA 1SFOJ 3F95A 2ZACA 1IXRC 2JDZA 2C0ZA 3A0KA 2HWF1 4ET7A 2ZJQF 1K5MA 2X5IA 1WA6X 5FFOC 3P9IA 4NOTA 2XPUA 3GALA 5HCFA 2WT1A 3KPHA 2TBVA 2JIJA 3ML6A 2RVAA 1IQAA 2YB7A 1RUH3 5CKQA 3LSKA 4FX0A 3KHBA 1YHQI 3VBOA 1QQP2 2WNUA 4YVSA 2ZGKA 1OA3A 2BNNA 4CU6A 2VE9A 5A3NA 1EH6A 1N1TA 3EDPA 3G6JB 1PYVA 2QSGX 3PQJA 2GM4A 3OG2A 4QAWA 5ERIA 4PFOA 2BRTA 1NCRB 5C8CB 2H94A 1QOOA 2ZGUA 5LGTA 2W0XA 4MGKE 5DS9A 1TMF1 4UUSB 1ZA4A 1MJ9A 5LBBA 2V9KA 2NVTJ 1LHWA 3EQLF 2WAOA 5F5QA 4BIOA 1UU4A 1V9U1 3O3KA 4OI2A 1NA1B 1W9FA 2DBNA 2HZTA 2K2SA 2VBWA 4UFKA 3BR6A 2VQLA 1TVGA 4P96A 3V0BB 4CUBA 4XDQA 1VBA1 1MQTC 4HPKA 2I5UA 1WH7A 2XF5A 1DP3A 5C44J 5DM6F 3Q5FA 5DV5A 1NG0A 2DDAA 2DCEA 2WSVA 1V4RA 4M9ZA 5GLVA 4BZ4A 5B3SH 4MGSA 4Z1VA 3M3QA 3MI8A 4AVZA 3J8F1 3HIFA 4FI9A 2BWCA 4LKEA 5FYVA 3GCXA 3VD5A 3PNVA 1SD6A 1W3XA 2HPIA 3AXEA 3GNEA 2I8DA 1UXXX 2D3RA 3GHMA 3AX4A 1PO21 2AEZA 4IE6A 3SCFA 1Y4WA 5M3FJ 4XAEA 4DXRA 3KMHA 1VQ5I 1H1IA 1TNSA 2W08A 4RGXA 2PLV2 2QA4I 4HX8A 4EJWA 1A78A 4FPOB 3IAPA 4BQWA 4L2NA 2X29A 2QVOA 5EJZB 1IN4A 2VODA 1SD7A 4TZDA 3HRSA 1T0FA 5EXOA 2I45A 3WHCA 1RVF2 2ZXHA 3D4KA 3CCUI 2W4SA 1W8HA 3EPZA 4AI2A 3ASOH 3S17J 2UU8A 3W58A 1UB9A 1MD0A 4QPIB 5FKLA 1MS3A 3DYOA 2F4LA 1NE4A 4NHLA 2D1VA 1WKYA 2VU9A 4FQZA 4N43A 1UL9A 3J7LA 4DZGA 3OR2C 5JZGA 1G9BA 2NN8A 2W1SA 4QSHA 3VFZA 3B9CA 3OV8A 4KU8A 2JECA 2V79A 1E3HA 1L7LA 3TKYA 1C8M2 4Q48A 1QJX3 2X5IC 3KZYA 1K5MC 2P6TA 4JGYA 3SZTA 4QKBA 4KUMA 2VBXA 4I0BA 3CZUA 4B1LA 4L92A 2EWNA 5JXIA 1RUC3 3KIOA 2DUOA 4OYUA 1G8WA 3CMMA 5JIAA 3TOJA 1EPWA 2WNUC 1LR5A 2XAFA 1PK6B 1TLHB 3DEUA 3PUAA 4ETSA 4LJHA 5ICFA 1I5ZA 3FFQA 2FNAA 2VECA 2X8KA 3GXUA 2Y69H 4UW5A 4XK4A 3THTA 2JA8J 3R4UA 1YQCA 2OQ7A 1IXCA 1SFPA 2UWAA 3PVOA 1FMD1 3ON7A 5DD8A 3WY6A 4CCNA 4XL9A 4RHV2 5CNAA 4XBFA 4O9EA 2ZEXA 3O0VA 1W6PB 2XWBB 3AKRA 3QU6A 1UY1A 2GQQA 3VOEA 1QNYA 4F52A 2VNRA 1XYOA 2L4AA 3V7SA 2KZGA 2ESNA 1WVRA 1HRI1 1AR91 1SANA 4AHXA 4KU7A 1MEC1 4HF0A 1NKGA 3TDZC 3FXMA 3ASIA 1Z05A 2MW8A 1MMGA 5A7WB 1DYPA 3AKQA 5FD6A 3M4OJ 1DF0A 3I2JA 4FPGA 3VL9A 3SQNA 4JDOA 3FHIB 1S7EA 1IKPA 3T1LA 5FO5A 4YFZA 4BDVB 1TNTA 3J4UH 2YGMA 4R4ZA 1XDUA 4HAMA 3EHKA 5FZHA 4XNFA 3MHZA 3ZXDA 4B7KA 4HSLA 2HWC1 1MVQA 3LFMA 1WW5A 1K78A 1AJKA 4P9YA 2Z5WA 4YG2F 2QQIA 1E0EA 3LZZA 1G3YA 2DFIA 1E2XA 3WU2C 2D6NA 1JZ4A 3UKNA 3IKWA 2Q5TA 4MEYF 2RDRA 2JTVA 1J58A 4OVEA 3C7FA 5F27A 3VBUA 3IRRA 2VL4A 2D6OX 4N9HA 2EV6A 2E2JJ 4KJZA 4IRHA 3IH3A 2KIMA 3VYUB 5CG8A 4AVAA 1T0FC 3J7MA 3NJVA 3MEPA 3BQZA 4QTRA 4XJ9A 1P8JA 2HKOA 3KYCB 4XLHA 2XUBA 4FTBA 4OCTA 2JXAA 5FY9A 4CCDA 4QQPA 3WX5A 3UNPA 2XJUA 2ENRA 3IAM2 5FOJB 1HXDA 2WAAA 3N9MA 4N43C 5EGOA 1AR83 1WJEA 1RIRA 4PJNA 3OOUA 3PUQA 5JZGC 2IXKA 1W0NA 2YS9A 5J1YA 2ZTNA 3ETPA 3S2DJ 2DBBA 3J80K 3RZGA 4GMP0 2V5DA 2Z42A 3ZVXA 2DV9A 4HFSA 4JGYC 2DT7B 5LBFA 4WF2A 4W4ZA 1WJAA 5FZAA 2OV7A 3LIHA 4G4FA 1Z91A 2JWTA 3VDDA 3F8NA 2B4KA 1I3QJ 3HOXJ 4NPLA 1A36A 5DCFA 1H2KA 1R4NB 4Q4W3 3P5BA 2ZB9A 3UKVA 3ZP5A 5ILSA 3CJIA 1YFUA 4CRQA 2VBZA 4XR6A 3P5JA 2EFQA 2ICWG 3RDIA 1X1AA 1QZEA 2VN2A 1Q8SA 4PJMA 4GQ7A 1XGMA 1J09A 3BYWA 5BNPA 1HLVA 1PGW2 1ZTRA 3EXUA 3I2HA 3OGRA 4PGHA 3NNLA 2P5BA 3A7QA 1YJKA 4CO8A 1UAAA 4LBQA 2STTA 5FKNA 3AG2H 3IKVA 4IQJA 2LREA 1Y56A 1JI8A 2Z33A 1HXS1 3T2QA 1WCQA 2LTNA 3USUB 1MMSA 3NV3A 3O1RA 3T4VA 1RUE1 1L3LA 2O14A 4XUPA 1S0GA 4IHWA 5FR3A 3HOYJ 1NYWA 3HNMA 3JAMZ 1U3EM 4E7SA 4Z82A 3LSJA 1LHUA 1SBFA 1K5JA 3JBG3 3G6EI 3HUGA 3LL7A 4KDPA 1OD5A 2RS32 2XH6A 2W1QA 5FMCA 3OUIA 1A04A 4MADA 2DN0A 1JT0A 3F8FA 5LHHA 3LOIA 1C57A 2ZGTA 2WQZC 2JT1A 1BEV3 1S0DA 2XGEA 5I0TA 1RC9A 3O12A 2C6SA 1UIJA 3IH2A 5FZ3A 1IKQA 1P9QC 3MZYA 3MD2A 3JZVA 1L7RA 3CCYA 3TEWA 1FOYA 2W85A 1LPQA 4KBBA 1XMAA 1HIXA 1LE8B 5H6RA 2XG3A 2BJSA 1MS4A 4MGQA 3AFKA 3WW4A 4NJ4A 5LB6A 1FNYA 1RGSA 1BI2A 4XHBA 3M8FA 4AM3A 2DJNA 3RKWA 2JD4A 1XNAA 4WZFA 4LR4A 3B73A 3F23A 3RJRA 5FLIA 4EE2A 3AYCA 2QQ9A 5ED4A 4DUXA 3BROA 4B47A 5F5IA 5FY0A 4META 4JDMA 3WNPA 2V26A 1H8TA 2Y6HA 3PURA 2VO5A 3HEFA 1MS0A 4AI1A 4CYCA 3AMMA 5LA2A 5E17F 4F3QA 3ST7A 1TQIA 3H9QA 4E70A 2NVUB 4G3YC 4AFMA 2PTMA 3DXJF 2BU9A 2HWF2 1VBC1 2X48A 5KWRA 5GZGA 2DTZA 1AYM2 4LHLA 4CZSA 3LAPA 2Y0IA 3RZJA 3WTVC 2WRAA 1H8VA 5DAVA 2VTXA 2VJXA 2FOKA 1KZHA 3VDDC 2WA0A 2WLPA 1QQIA 3N05A 3NNJA 1WBLA 4HX4A 4RAYA 4HF1A 3P1IA 3ZYRA 4WZCA 1KYZA 2P2KA 1COV3 4EWEA 2OYZA 2E5NA 3ZMZA 1YJNI 4RB0A 1ETXA 1TME3 2C9KA 4YELA 3LSDA 2XASA 1LGCA 1G3SA 3EJKA 4AI0A 1P6RA 1RUI1 2VH9A 4E4ZA 3IV5A 3MIGA 4XBQA 1CZSA 5FZFA 4CP9A 1ND2A 3CCRI 1TZLA 1ZGWA 1CF7B 2HVRA 5F5AA 4QXHA 1NLSA 2JA5J 1MZEA 3BG5A 3WNMA 2JG9B 1VZ0A 4GMP1 2BTVC 5BPDA 3IPVB 3BLYA 2M45A 4DXTA 4OZOA 1I50J 3X29B 1FATA 4LHSA 3VB9A 3RSNA 5CB7A 3CDZB 1NY71 3BTZA 1CIYA 4KIBA 3TAYA 4Y4RA 3NV2A 1RYYA 3WU0A 4RAGA 1FYMA 2C4XA 5DUVA 5A7SA 4KN4X 3GZ5A 4L9BA 5J7MA 4BGDA 2EIBA 4HXCA 3O8GA 2OAZA 4L5EA 4RAZA 3PIGA 5FLVA 1HX6A 2AH2A 3AP6A 2GN7A 3IAQA 2OXBA 4MO7A 1Q8QA 1ZRRA 1FPN3 4JCKA 2A3SA 4XCBA 1K79A 3D1NI 2WNEA 2LKXA 4AVBA 3B9IA 5FZ8A 1R49A 4HKOA 5T3NA 1TEIA 1IXSB 1RUD3 2VZVA 3RWKX 2EF6A 1WSUA 1GWLA 2WWJA 2R3SA 4OAZA 1X8EA 5IHRA 4YGDA 4B3NA 3O6BB 4X6RB 1IJWC 1XPWA 3KLNA 2VMIA 5JOWA 1ENXA 1IS3A 3R05A 4BE3A 3K4KA 4AXOA 3ZMNA 5LY1A 4DOZA 3VLBB 3RPQA 1VMHA 5DABA 1V6IA 1W5CC 4L0YB 4P08A 3TN93 5FPLA 2W1WA 4HK8A 1H8TC 1PUFA 1SLCA 1YCIA 2KA3A 4BA6A 5F6FA 1MQTB 3OPWA 1SACA 5K7ZA 4IEOA 2DQRA 2G9ZA 2D6LX 4FP3A 1QA6A 1AR62 1RKTA 5M5XJ 3SKVA 1UMZA 3BG3A 3KCXA 1GANA 2CNAA 3UKGA 2HOTA 4LBJA 2HFHA 5D5UB 1PNFA 1WUVA 5BOXA 1LEMA 2PHRA 4HSTA 3TP3A 2IS6A 2HPMA 4BUPA 1OQEA 3AFGA 3KP6A 5FLXK 4CCLA 3A4CA 1CVNA 3UGGA 4C1XA 5JVVA 4XW3A 3PSFA 2Q8EA 3JRHA 4PZJA 2A6XA 3BPZA 4YM3A 4OOIA 3C7JA 3HKZA 3BQYA 3ZXEA 2B42B 3BG7A 3MUZ1 2QDRA 2DA4A 3ZMUA 1TZOA 4W50A 4E8DA 2ELKA 5DCMA 3FZVA 4A3LJ 4BK4A 1RZ4A 2R0FA 3BG9A 4EQVA 3CUQC 3WTSC 3K70C 1OF4A 1FMD2 2R071 3H9GA 2ADUA 1AOYA 3CCQI 5K5QA 4UFMA 3MN2A 3DCFA 1ND2C 2WQ4A 1HCRA 3FC0A 2ZFUA 3E5UA 2ZNYA 4ASLA 3CNAA 5EP9A 3CO7C 4CZZA 4E7IA 2BY1A 3S15J 4TN7A 1AR92 1FOXA 3KP4A 5A7QA 3SISA 1MEC2 1ZQ3P 4LMFA 2CQNA 1PMHX 4BBRJ 2BWAA 5J36A 5KHIA 2YU3A 2FCTA 5DYMA 2XAQA 1XTAA 4P00B 1RINA 3HBKA 2ELJA 3LDRA 1ENRA 3E0JB 5LATA 2X5IB 1K5MB 2GLOA 5T52A 5EQUA 1HB1A 4CXWA 2V9VA 2DW4A 3B6CA 1I3HA 2V6EA 4DFSA 2WO2A 3NJZA 3QLQA 2P3YA 2JUGA 3VD3A 4BY7J 2HEVF 1OKQA 3MICA 3KEYA 4H4KC 3JB8A 4MXVA 2WNUB 2JVHA 3KT4A 2ZMEA 2ZJRF 2RDPA 3WDUA 2MNGA 1T6SA 4FFIA 1R22A 2MD0A 4A69C 4P9IA 3BU7A 5FMOS 5LLQA 1H9GA 3D0SA 3A4UA 2VVFA 3H3LA 4RGSA 1ZBE3 1FX5A 1J3RA 2IXSA 1FOD3 1ULFA 2CAVA 3BTXA 4RBOA 1JH5A 3VZJA 3O0WA 1RJ8A 2D2WA 4DYRA 4RN5A 2EXHA 1VQ4I 1IG0A 2ADEA 2YZ4A 3OB8A 5C7GA 3PVEA 4BDYA 1NH3A 4R9BA 1Z3XA 2WWYA 2O7OA 1W6NA 3O2PE 2IA2A 5TRDA 2BNOA 2WZ8A 2VQUA 4JTOA 2BGCA 3J7YJ 1HA8A 1JYTA 4HPKB 2WNVA 4BQ3A 1UO9A 4AFCA 2JN6A 1KQ8A 2VQGA 1X2NA 1DU0A 2H6BA 5FXZA 5BYNA 2EV0A 5FPVA 3QPTA 5LASA 3S1QJ 1QRYA 4EJVA 2JRMA 2QCSB 1FMWA 3K7AJ 1R9TJ 2JD9A 2Q8CA 3RMYA 5TJJA 3MGUA 2R6QA 4CUAA 2LDUA 3CZJA 2JVGA 2BY2A 3S2HJ 1GV5A 3NWTA 4UW4A 2GC3A 4MSVA 1J59A 1QQP3 3IBMA 3AFHA 3SDGA 1PVC2 3CHXA 3SH3A 3N3HA 2G9GA 4AYBN 4ZU4A 1QNTA 1S0CA 3N7KA 3RQ4A 3RIRA 3RG0A 5C6CA 2X1CA 1JHNA 4XICA 2BGPA 5CFCA 1STMA 1GBGA 3NRVA 1ZBA1 1C4RA 4O7XA 4P9XA 4FVVA 1EUUA 4ZYGA 4Q1PA 1PDNC 2B7EA 2CH0A 3EBRA 5FUNA 2OPTA 2DU1A 4IEXA 4UYBA 5KXEA 3HWJA 1RESA 2NS7A 1U0AA 4LBLA 4C30A 3LKJA 4D7SA 3I59A 4N43B 3VKMA 5D5WB 1MKMA 1HXS2 3WDVA 2WS91 3T2PA 1ACIA 3ZXFA 2YBSA 3H5NA 1BYHA 3OL3A 3CC2I 1B9MA 3HHGA 5JZGB 4LD5A 1T8IA 2PLYA 2YPDA 1UMQA 4XJZA 3D82A 3H5RA 1GQGA 1X8MA 4IDZA 3V8LA 4BU2A 4RFRB 2VC1A 2YFUA 1VRH1 1OFCX 1KJRA 4JGYB 1IGNA 4OQ8A 4NO4A 1SD4A 4HN1A 5HXVA 1UX6A 1IUYA 3VN4A 4ZZ5A 2KXLA 2XBO1 1AZDA 2VUJA 3LSEA 5ANQA 1W2OA 3J81Z 2ZMEC 5ACA2 1J3PA 3QYEA 4MFDA 1BL0A 4QQ2A 4CDUA 2VZUA 3COAC 5IJRA 4AUXA 3FM3A 2MLKA 3SH4A 5CG9A 4ISRA 5FLXZ 1UHSA 2E7WA 4YW4A 4XRSG 5H9RA 5J48A 3FM5A 3DP7A 1AL0G 2DUPA 3W59A 2WA4A 4LUMA 3KEQA 4MYEA 3ZGKA 5E88A 2RM21 3CCJI 5FZEA 2NS8A 1VI0A 2P8TA 2YU9J 4NIHA 1RVF3 2PJPA 1N75A 3NJYA 3WF4A 1O3SA 4RD7A 1HDPA 3A03A 3HSEA 3AP7A 3OOXA 1S6LA 1XMKA 2ZFWA 5A7OA 1WKMA 2YX4A 2W84A 3V0AA 2A6YA 2WNVC 4HNTA 1AXYA 1YO8A 4LBNA 1POV1 1URXA 2VXJA 2WWUA 3PUIA 4LO5B 4JRLA 4Y24A 3HBLA 2VUAA 2W39A 5H9PA 2BERA 3DXUA 4A6SA 3AMPA 4TLGA 5BNQA 2BUKA 1K78B 2ZX1A 4QU2A 1MJBA 2CUJA 3E7LA 1JHJA 4NRPA 3KZIC 4D0QA 2M9HA 3O1PA 2VW0A 2VOWA 4D6QA 3S30A 4BDZA 3PVNA 3GZAA 4AD9A 3ZSKA 5LBEA 1L3JA 1RUJ2 4QPQA 4RFT0 1QPIA 3T4HB 4ZZDA 4M3DA 4BQYA 3SDBA 3OCPA 4BY1J 3KCYA 3ZQHA 4E7HA 2HQAA 1WWXA 5CFCC 4KWKA 3N97A 5DZFA 4GB32 4BK5A 5LGNA 1JHFA 1XSDA 2MH9A 4QLCU 2JENA 4RHV3 1BK1A 3RS6A 1E57A 2CFXA 3HHHA 4QXKA 4Y1VA 2I74A 3JXSA 5K5RA 1VBE3 1FTTA 5JR2A 2CUFA 4BE1A 1ZRDA 2R042 1S3JA 4RLQA 3ABMH 3LSMA 5EGOB 3K9TA 3W9AA 3D5LA 3LFIA 1OLME 2P81A 4KIGA 3KZZA 2FDJA 4RQPA 1E3PA 2GDFA 3LQQA 3B7MA 2IBDA 2LMDA 1SG3A 2PXJA 1R082 1JT6A 4YLZA 1KFXL 4D1QA 4ZTJA 2UZKA 3U4XA 2RR12 2VQ0A 1OHFA 4Y5SA 5H9SA 2VOOA 2IRFG 3DFGA 2X53S 2HKXA 4UUVA 5I8YA 4BE0A 1XSXA 2VBYA 1BR4A 2NZ9A 2XAJA 1FP2A 1Z21A 4DY3A 3VDDB 1YQAA 4HPQA 5CVRA 4BYYA 2A07F 1E5SA 3LNQA 4F83A 1K61A 2MLGA 3H0GJ 1HW2A 2OPKA 2IXJA 4CDUC 1KDKA 1MZ6A 2DTWA 1KGSA 5K4LA 1X2MA 1HRV2 4AEDA 1QHHD 4XQFA 2LVSA 3KFWX 4OZXA 2DQLA 5JHFA 3ZYIB 5IP6A 2JE7A 3ZYFA 1RUC1 3LFUA 1EKEA 4LLOA 4QKDA 5FXVA 3QPLA 1IZ1A 4AU7A 1HKQA 4COVA 1WMFA 3OGSA 1J1LA 4A3CJ 1UOJA 2X0LA 5J8CA 4LBQB 4AHWA 4RA0A 2CG4A 1C1FA 3IDBB 2FBHA 2PQSA 4A6OA 2Q1MA 4CDGA 3WUDA 3H35A 3BPVA 1VQLI 3GZNB 1HB4A 2R7FA 2ZAHA 2ZKNA 5GLUA 3HUGB 3CQOA 3FISA 4FHTA 3T2TA 5JR7B 4L9JA 4BJ0A 1W4MA 2RHPA 2VQHA 4ZTFA 4X1EA 1QOTA 4BHPA 1K4SA 1IN5A 1VBD3 3CJQB 1HLCA 4W1UA 1F43A 4V2VA 3H8OA 3VHOA 3LMMA 5A3TA 4KN7X 3NW4A 4DRVA 3ZSJA 5FOBB 3FK7A 4BXSV 4ZZ8A 2EAKA 3J7ZI 1XCVA 1DPUA 2W48A 4XF0A 2JDAA 3VBSA 3BTAA 3CIHA 3QPHA 4XUQA 2M1BA 3VODA 1O57A 1HBXG 1XE8A 2Z9OA 5A33A 2DVBA 1G59A 2UV1A 1ODNA 2WO7A 4Y1YA 2P34A 1P2FA 2ETEA 5FKCA 5EFUA 4JX4A 4A5NA 5IYBJ 2H8RA 3V7RA 2CRGA 3S14J 1IRZA 1MNEA 1IN6A 1UJ8A 4KISA 3MVPA 4NB5A 3HL2A 4MH0E 1UZZA 3HEIA 2H0VA 2COMA 2YC4A 2ZGMA 4UF0B 5F37A 1H8TB 1GHCA 3FMGA 1W03A 2RQQA 3IN9A 5J1UA 4XF9A 2JPCA 2P0WA 2PX9A 5IVCA 4CYCB 4RQPC 4CUCA 2H1KA 4XPVA 1GQPA 1KD7A 2ZXWH 4CA9A 3FXOA 3LE0A 3TP0A 2EV5A 2WT0A 4XMAA 4J25A 2YYOA 2VUDA 1QOSA 2CU5A 2KHMA 1OCTC 3PHMA 1UG2A 4D5CA 5K8SA 4PQQA 5E79C 4MTDA 1RUG2 1R00A 3K77A 1GV2A 3PM1A 1OJLA 1G4DA 3AKSA 1XSRA 3N35A 2RMU1 1M4WA 4IEJA 4WK8F 1MIJA 1TP4A 5JMOA 5JWPA 2M30A 3LPGA 5CVUA 4JX5A 4M4PA 2QJVA 3QAHA 1YO5C 1CQ9A 2R062 3CUQB 1XNBA 2YMZA 5A6XA 1WHUA 2R4GA 4AEDC 4CDXA 1UY3A 1OA2A 4B29A 4CP9B 1ND2B 3L2YA 3N9OA 1KEXA 2B0LA 1EJ9A 5BUVA 4LXLA 3BR0A 5ABJA 3FWEA 4YIRX 1S1AA 3ZYHA 1W2TA 5DDJ2 5DZGA 3BOQA 2XGCA 3KGLA 2YFZA 3GZEA 5F1RA 1N47A 1BZWA 1S2BA 4LLFA 1W2UA 1SPPA 1X82A 5F1JA 1JKRC 5CADA 4Q4W1 3MBWA 2WLQA 1CX4A 3SXWA 3GF2A 3RPUD 1XCBA 1ACCA 4O6JA 2P7VB 2O8XA 2LUWA 2A5YB 1FV3A 3PL8A 2LW8A 3P3NA 4IEPA 5F0FA 5TSWA 4BE2A 3GBGA 2YV8A 4EGZA 4XAAA 3FXUA 2LS6A 2TUNA 1WD4A 4XFAA 1SFXA 2HWF3 5LEJA 2OZJA 1EV12 4CPBD 4F91B 3B94A 1AYM3 3O7OA 1S0JA 4EVIA 1X58A 3WDXA 5F7UA 4BJ5C 5K1YA 2ZGSA 3VBSC 2JPBA 5J8FA 1YRNA 3ZQQA 4OIQF 2WN2A 3SMHA 3WSOA 1MBHA 1HV0A 1G2HA 4GWMA 3T5XA 5J47A 3KYDB 4Y15A 1LFUP 1UWWA 3LA3A 4DZPA 2LRPA 2DAOA 2JJ7A 2YU2A 5JPMB 4A5MA 3CO2A 4LHKA 2E51A 3AKZA 4Z2WA 2X6XA 1OKRA 2OIIA 3FXJA 3KYLA 4K20A 4OLLA 2OVUA 3DBRB 4YZ5A 5FYYA 3TBIA 2O0YA 4OHWA 3DL3A 5D1IA 2CUZA 3OS0A 1PUFB 1QNWA 1WJDA 2ME6A 1FV2A 3ZMOA 3K1PA 1NXMA 3CLOA 3RKXA 3BC8A 5GJ6A 2E7XA 5IK8A 5AC92 1V9U3 1KQ0A 3POEA 1TWGJ 4COUA 3FUQA 2VXZA 2LOOA 1N1SA 1UPIA 2M4GA 4AIJA 2WADA 1YYNA 1D4VB 4XSXF 3I55I 3WT3A 4LBKA 2OUMA 2GMPA 1E17A 3OR1C 1UZYA 3LQRA 5IFPA 1XN7A 1PO12 1EAH1 1QWRA 4GULA 3W2AA 2DA3A 3LCPA 1R5GA 4DEVA 1ZZBA 1SD5A 2CHHA 4L9NA 3EUKL 3MPPG 2BGOA 4ZXKA 4Y17A 2JA6J 3JCIA 1XSQA 1YOVB 1MNMC 2DCKA 2X09A 1OC1A 4HKWA 5DCMB 2X05A 5J1RA 1PZ9A 3A22A 3L2HA 3ZFEA 3LSTA 3KT7A 3L2WA 1JTZX 4CDXC 1WLDA 5T5PA 1A6QA 4U7DA 2E31A 2D6MA 2J42A 4XC9A 3AMQA 5FYCA 2E60A 3DWLE 4M9XA 4G6DA 5FZBA 5ABJC 1UD1A 2VJ4A 2RM22 1S0BA 3ZN1A 1R23A 3CCVI 3BTCA 1BCXA 1Q5OA 2YBPA 1XGOA 4LKSA 4XYXA 1WBFA 2FBIA 2VPVA 4ITVA 3KWVA 3PUFA 1QXRA 1COV1 3KD4A 2E32A 4X0GA 3C2BA 2ARCA 3IWZA 1KYWA 1TME1 1FEXA 4RS5A 4B3XA 2H8WA 2E19A 4M73A 1W7PD 4QPYA 3ZSLA 4RM2A 2EIMH 2CDPA 3PNTA 1BKZA 3GTQJ 5CVIA 3CP8A 3EB7A 3IH4A 1U5XA 1WGPA 1AR63 4K1YA 2KJBA 2E71A 3O1VA 2WZR2 2LRDA 5E89A 5KHJA 2DU0A 4XUOA 2UUZA 5HLGA 3RGBA 1OLTA 2ZMEB 1FI2A 3OYCA 2X6WA 3ZIXA 3T8RA 2QWWA 4P9GA 2QGUA 4AFBA 3B02A 1IC8A 5GAGJ 1UKGA 3ME2A 1ZLKA 5IK4A 2ZHLA 4J1WA 1SAUA 3AL6A 2E6VA 3L2VA 3PFIA 1QEXA 5B1AH 3USSA 4DEQA 2WAEA 2X85A 5DXDA 2JK3A 4QX1A 3JU9A 2NMNA 2BXZA 1U5IA 3POBA 4JV4A 3I9V2 2M7AA 1WW4A 4BPZA 1FMD3 1GSLA 3WF2A 2HJIA 3T08A 3RZLA 3SFIA 3BG6A 5JDBA 1DU6A 2E2HJ 2LNBA 2XJSA 3BIEA 1ZM1A 2WNVB 3BWGA 1HRI3 4ZYEA 5IYDJ 5C9AA 1AR93 3WG7H 2GXGA 3M8LA 4O61A 4M71A 1D0XA 1A35A 1MEC3 5IT6A 5KC5A 1YE9A 4A7KA 2XJQA 4E9KA 4KI5M 4RGUA 4C9YA 1WCUA 5L3DA 2JIGA 3PL0A 1ON2A 4E7LA 1LOAA 1NCRA 3WNXA 3L9FA 2QQWA 2MA3A 2WZEA 4Y7NJ 3PU8A 4GKYA 4G94A 3IM0A 3RVHA 3NARA 4AHZA 2VONA 3TRSB 1WGXA 1YI2I 3TN91 4HYEA 5GZEA 3RPUA 4Y1ZA 4ZH4F 4P9FA 5SV5A 1KGYA 4MNUA 4EM1A 1BIBA 2V1XA 1YI9A 3TNQA 3VYTB 1DHKB 2AGSA 3EO6A 2JDYA 4UFIA 3H50A 1GNYA 4OUEA 3F8CA 1RRJA 4GWJA 3ZFEC 3X2QH 3BOWA 1YX3A 2DA5A 3HZJA 2WN3A 5FKKA 2XVCA 4OQ9A 2FDFA 1W9YA 5DN2A 5CFCB 5A2QZ 4X6QB 3G1OA 2VCMA 3VUOA 3I3MA 4GKXA 3PFYA 2DMPA 1YUDA 1CX1A 5F9TA 2B45X 4II3A 1HKDA 5LRRA 2QQ8A 3PU3A 2FUG2 4GWNA 4BQ5A 3FMRA 2EVXA 3VB2A 5LHIA 3FLRA 3KLSA 2CV1A 2IA0A 4RS5C 2QKDA 5JPNB 1ZGJA 2E1CA 4JAAA 2FA5A 1HKTA 2LY2A 1RKWA 3G73A 1JKQC 3WG9A 4LKFA 3Q0VA 5FK7A 3RCOA 1YQ2A 2EA7A 4Q0UA 1V6JA 4C90A 4XMIA 1GZCA 2IT0A 2IAIA 4ZYAA 4YM2A 2WAFA 2HQNA 5FV3A 2K5CA 2ZXQA 1FPQA 5TISC 2GSYA 3AZYA 3AC0A 4MGYE 4CP2A 1D2SA 3K4CA 2W47A 2D3SA 4PI0A 1GQHA 4CDUB 4FXGB 1VBB2 1V6NA 3OJBA 4BCUA 3ZXJA 3OD4A 4OIOF 3GO5A 2ZO4A 3WUCA 2NOJB 3V4GA 2FZ2A 1H8AC 3U1XA 2KIQA 4NMIA 3SHRA 4LE3A 4INDA 1IG3A 4Z8BA 5LHGA 4M3CA 2XDVA 1HSTA 2AR6A 1AL21 1PVC3 1XOYA 5GADJ 1PX3A 1TC3C 3CP2A 3BKZA 4XKWA 4KITB 2TRTA 4CCOA 1ND3A 2IGOA 1BVVA 3S3OA 4JQFA 4IF4A 1ZK8A 4MEXF 1HQLA 2ARAA 2ECCA 4CVUA 3A0HC 2W92A 5E16A 4YFKF 5A1FA 5IK7A 3GJBA 1RUF2 4BQXA 2VQTA 1U9NA 5IY5H 3TW6A 5BQTA 3M8JA 1STZA 2DCYA 3V0AB 1FOD1 4F55A 4XFHA 2YPRA 1VF9A 1DP7P 5C9AC 4Q26A 2QNKA 1HXS3 3F0CA 1BC8C 5I8TA 1OMIA 3N7MA 2VJJA 2A05A 4DRRA 4AFAA 1JUSA 3WTXC 5FQ0A 1SAXA 2BVLA 2QQOA 3WDYA 1W3VA 2KLOA 2BFUS 4R9AA 1F36A 2V4AA 4HLTA 4NHKA 1IPKA 1W7PA 1G3WA 3H9JA 3RJ2X 3P6BA 2XJVA 4DB5A 5KNLA 2XMLA 1JE8A 1AF9A 4FETA 2DURA 2ZGRA 1VQMI 1APLC 3ENRA 2F2EA 3R0RA 4H7MA 1GP4A 3PO2J 4HDUA 3AM2A 5A3MA 3BALA 2YXSA 2KDOA 1RUNA 1WRJA 1VFCA 5FO8B 4XBNA 5HPOA 3AYDA 5C4WC 1US3A 4HONA 2K4BA 4LPLA 2JE9A 3IIIA 3LEIA 1HQNA 2QZ2A 3WCSA 1YLFA 4AOCA 1B8IA 3MIFA 2Q8KA 4R8HA 4WVVA 1QKQA 1ENHA 3VWBA 5GZCA 3UR3C 3TBDA 4QHOA 4GJZA 3AJZA 4MFEA 3GFIA 1O4YA 5DPNA 1GOGA 2QSHX 4NPMA 4IEVA 3TDUC 4N4OB 1Z0HA 4RQPB 1YWKA 4PT6A 1XXNA 1R7JA 3M70A 5CU1A 2Y6LA 3FXLA 2BY3A 1H2MA 4R79A 4HT1T 4XFFA 1YJWI 1YXWA 2DYRH 2FX0A 4XFIA 2EIGA 1ASJ2 2L54A 5FDBA 2RS11 2RN7A 5J4YA 3WE2A 1ALYA 2JDKA 1GP5A 3TNPB 1S2KA 3HOBA 1VBC3 3TEZA 1QDCA 3JD71 2I10A 4HF2A 3BGAA 1BJZA 5I0SA 3P3PA 1SEFA 4AVCA 2BOJA 3I3LA 1W9TA 1GKBA 4AEDB 2QBYA 2XGXA 1UY0A 3CCMI 5A80A 4IVNA 2PJRA 3C1DA 4P55A 2C9AA 3MLLA 4EN0A 5LA9A 3ZYPA 4PUSA 1HC8A 3UNGC 4ORFA 3MMYB 1BJAA 1JUPA 1WA4A 3MEXA 2PHFA 3WINE 2BBVA 4PFPA 1RUI3 4MLOA 1YIPA 1OCOH 5M5WJ 1UYZA 1ND3C 3R4KA 3ZKYA 3A0BC 2P3IA 2BFUL 3HSRA 3G71I 3AZXA 3KEOA 1F5FA 2CS3A 2H27A 2ID4A 1JS9A 4QX2A 5EYXA 3VKOA 3O1MA 3OF1A 1UIKA 4E4SA 4XKCA 1I5PA 3QQAA 2X1DA 2PLV1 4EN9B 5FZ9A 2DFFA 3ZOIA 5BPXA 3UGHA 1VP6A 4C91A 4WM7C 3J7AO 2DYSH 1O7LA 1X4OA 4V2GA 1TNFA 2HWB2 2VC0A 1RVF1 1R083 3RQ0A 2EZHA 1XRUA 3QODA 5J98B 2A6EF 1ORKA 3QACA 2RR13 4YFWA 3FFZA 2IJLA 1BBYA 1W9SA 4BXFA 3VV1A 5L3GA 1F9KA 2FOWA 4FPHA 4GD4A 2A70A 1ZZ6A 3VBSB 4ONUA 1C5HA 2G0EA 2IUWA 2ZGPA 2P6SA 1SFUA 1D2QA 2P37A 2WKKA 3POGA 2QUOA 5A33B 4CYDA 1SVMA 4JOMA 4P5OA 2ME0A 3KVBA 3GBWA 2O0OA 4UV9A 2OS2A 2LKPA 4NQWA 1GZTA 5D8KB 5FD5A 1C8M1 1W8NA 2ZEZA 1YFWA 3ALQA 3BB6A 5FRNA 1MMAA 3RZDJ 1JZ5A 1CAXA 1KRIA 1YC61 4HNVA 4UW3A 1Z7LA 2CGPA 2FQ3A 1OT5A 2E1MC 3WLUA 4LMYA 2Y9YA 5B4XA 2YC2A 1VAVA 1WQ2A 4R9DA 3JRFA 4FPCA 4HSJA 3N7LA 1XDSA 1LHVA 2ZJPF 4V1PA 2W5FA 2DMNA 4YW6A 1Q43A 1VQPI 4YYOA 1MSFC 5D4SA 4AGRA 4U0YA 1XE0A 4QPWA 4AZZA 4L9TA 4RSUA 4YG6A 3UYJA 1W5TA 2LSOA 5A3PA 1WD3A 2G7UA 2XVKA 4LK0F 4RHV1 1B09A 3D5SC 4HLXA 4OI1A 1MACA 3WTUC 2GH8A 3RZZA 4A44A 4IHSA 1UY4A 4L0ZB 2MG4A 4NBQA 3K4ZA 2P5VA 3I2GA 1AYN1 4I02A 2A61A 2DTYA 2GC0A 4AWXB 3KE2A 2B46X 4P9JA 2VKDA 2J1VA 2IP2A 1ZVFA 4IKFA 2QSFX 4HW0A 4H14A 2EPFA 2R93J 4CDXB 1TNRA 1Z7S2 3K3OA 1EPZA 1N25A 3LOBA 5ABJB 1BOBA 4XOPA 1UXZA 4CCKA 4D5FA 2XF6A 1AX0A 4HRIA 2R073 4IEZA 1ETOA 1SPPB 4EM0B 3ESWB 3N9QA 3MLJA 5FBZA 1H0BA 1X1DA 3VYSB 1R092 1ZYRF 1D5VA 3POJA 1OBNA 4XDPA 2M8GX 4IEWA 4IXLA 2EJRA 3MQ0A 4LBOA 2GMEA 3D0JA 3ERED 3FBIB 4KICA 3WTTC 2B9SA 3I2DA 2D45A 4A3XA 2DA7A 4WV8A 3J9SA 1Z1DA 5F64A 2VPLA 4CDQC 2IGNA 4N8MA 4C2MJ 1RC6A 5F2WA 3S5QA 1AR71 2EICA 4E7JA 1A31A 4YZ4A 1BW6A 3POIA 4D6SA 4LIUA 4A3DJ 4P14A 1BQPA 1ZREA 1RUG3 4NAOA 2MC3A 4EEFG 3BN6A 3WF3A 1YRNB 2FBEA 3MDPA 1LVAA 3SEZA 3V56A 3EMRA 3KCCA 3KGZA 2ZHMA 2OQRA 1RMU2 4ZYHA 3I64A 4YPJA 4EWDA 2ELHA 3G2BA 5BXXA 3VBRA 5JVTA 1IRFA 2VT3A 5E8IA 3T8TA 2MABA 3FLTA 4XFCA 1BI3A 1DBNA 4IO9F 3ETQA 4BWOA 3ORJA 2RE9A 1YNAA 2HQ5A 1WJFA 2D6PA 5DD4A 4PSXA 1W8OA 1EYBA 2KIUA 5DDJ3 4XJ8A 2LM3A 4QHZA 1X1CA 1WCSA 1NAEA 2GU9A 5KHHA 3ZMSA 5GPAA 2ZBJA 4AK3A 1OYYA 3R0AA 2O61A 1DZRA 1O4XA 4GH4A 1T98A 4C3IJ 1QBJA 5FY8A 2E26A 5FTTC 1O3TA 5HS7A 3HGYA 5HLIA 2GH2A 3MO4A 1OCCH 3LEKA 3K4MA 3WG4A 1AHSA 2ZA9A 3CMYA 2ZKLA 5GTHC 5HXMA 1DQ6A 3CJRB 3BZCA 5B66C 2M4KA 1PGW1 4IOAF 2K46A 3GZTB 1IS5A 2EA2A 1OVSA 1K3IA 3MZHA 4JDNA 4RAFA 2EAAA 3AKPA 4IESA 4YARA 2GXBA 5HDGA 2QQBA 3L2CA 1Y43B 1KQ9A 4G12A 4N0BA 4XDOA 5C33A 4WX9A 1U8BA 3ZFEB 5FIXA 1ULDA 2VVDA 4AHYA 5BPIA 1UQXA 1EH8A 4G9YA 3BZ6A 3CO6C 4BL0B 1GNZA 4NR1A 3BPXA 1AL22 4A3MJ 4LE4A 4EATA 2HWVA 2RS31 1A3KA 3VDAA 2GIVA 1HB3A 2OQGA 1AX2A 1N3QA 3BJAA 4XABA 1KU7A 2EIEA 3ZRGA 1GZWA 1LVKA 3HGGA 3LA2A 1ZBA3 2JQ7A 4Y5Z0 4XZPA 2CAUA 2F5DA 5FZKA 2DO7A 4RS5B 3ACGA 4WCGA 3G1MA 1JGSA 4S0HB 2RDSA 3GTPJ 1VLNA 3I53A 4SBVA 1H30A 5AC93 5IT3A 1YX5A 4A0YA 3GYDA 2BYVE 3IMMA 1EY2A 2DFCA 1B35A 3K1NA 3HKZN 4PF5A 3H1YA 3AG3H 4FPLA 1X4PA 1PO13 3GX4X 5IOYA 1UZWA 3OYFA 3IDAA 2EFNA 4LO6B 3U0ZA 3SZGA 1H2NA 3JQXA 5A32A 2EFWA 1W1WE 2XBO3 3RZHA 1XU1A 3LSGA 1D0HA 5FJ8J 3PJRA 1SFEA 3GZUC 5F32A 5FMBA 2VLAA 4UW6A 3WNOA 2BHYA 4ZYDA 3S7EA 4B4RA 1JUMA 4EN8B 4L18B 3PVBB 3KT1A 2VT2A 4PBPA 1QHGA 2Y6GA 1W2AX 3VBRC 3R4SA 2HVSA 2WTEA 1S29A 1MBJA 3BR1A 4XETA 1AYM1 4AAPA 1I6XA 2A68F 5LGUA 1ZG3A 3GZ6A 1Y1WJ 1AUYA 4ZXEA 1LU1A 2RM23 4IE7A 1WLCA 5I0RA 2B5HA 1GT0C 1UMHA 5E20A 3KETA 3WDTA 2VZ1A 2RGVA 4GH4C 4XBLA 5C9AB 2WR9A 4B7EA 5B2GB 2GBYA 1ZX5A 2VW1A 4ENKA 2ZSIB 3CKHA 5F04A 2XJPA 2LBFA 3HPNA 1LDKB 1W8UA 2BPA2 4BQ2A 1MBGA 1EA3A 3K69A 1Y9QA 4QQHA 3AZZA 4QDSA 1POV3 4DNYA 5L9VA 2RS12 1MBFA 1YW8A 3C7HA 1V5GA 5APAA 4MTEA 1FXZA 5FBJA 4IV3A 4FT8A 4KA4A 1YEWA 4E2QA 3JD72 2IFRA 4U0WA 1WLTA 4CA0A 3ZCOA 2E7TA 2JDPA 4XHXA 4EWAA 2ACJA 1QZZA 1W6QB 1N1VA 1ETQA 4IL6C 1GVJA 1RUH2 2JMWA 2PHXA 4GDFA 5C4WB 2WFF1 1N77A 1ITYA 3ECQA 4FOWA 2LP0A 5HV4A 2B9UA 2EIDA 3BDDA 2IS4A 3L00A 2WNOA 1JZ8A 3D5RC 2ZJ2A 5HODA 5DAXA 5L9RA 2WL1A 2KJCA 3HT1A 1QJU2 3B00A 1G9DA 3HNBM 3OYWA 5IP9J 5FY5A 3GLXA 3J26N 2GC1A 2MD5A 2HR3A 4J01A 1LJ7A 4PCRA 1KU3A 1Q8VA 4UAPA 2F4IA 2NLRA 1T2XA 2XPJA 3BI3A 1YS7A 3PMSA 5C3RA 2E1NA 3CQZJ 2R7XA 1NG6A 3WGGA 5FROA 2R0QC 2CMPA 2ZPXA 4Q29A 4LBQD 4Q27A 4CH7A 3ZQIA 4OMCA 2IVJA 1KQRA 5AFBA 4I7HA 3VHPA 2WBKA 3ZQLA 3AXDA 2R7OA 1B72A 1B35C 4E2GA 2LG4A 3OYHA 1F4AA 3MIHA 4Q4Y1 2NVYJ 1GDTA 1NK2P 3FHQA 4NN0A 2Y64A 2VUCA 2VXRA 3VKLA 1R6RA 5F3EA 1K45A 4ZHNA 5JOXA 2DFHA 5L3FA 5B1BH 4LLGF 3MCZA 4NIDA 1AR61 4RB2C 4ESJA 1H4GA 4M3CB 5KXDA 3LF7A 4JHZA 2IC1A 1RUOA 2WYFA 2ID3A 4K2EA 5EJCA 4DQ2A 1J75A 1OI6A 3RI9A 4OFGA 1S7OA 5A70A 4NWWA 3H1MA 3ZMVA 4YIIA 5FZ1A 3GFMA 1ND3B 4YG0A 2VNGA 3LSRA 1QY4A 3MKWB 5IAXA 2W7NA 1KS4A 2Y0OA 2RREA 3HRUA 3KV9A 1H89C 3E1SA 1JKPC 1TT5B 1ZG1A 1SFNA 1MS1A 1Q3EA 4C2UA 2DOAA 2YR2A 1IQDC 2ZEYA 2P6CA 1I1GA 2Z1DA 2UWBA 2J5PA 3KF5A 3ABLH 4YG3A 4UVCA 2HGCA 4WM7B 3ES1A 1XYNA 5FQ0B 2MBFA 5FYMA 3PIJA 3SZPA 2VZTA 4UFHA 1YW7A 1W7PB 3HPHA 3WCRA 4XSZF 1RR8C 4XJAA 2PG4A 4PDKA 4MIMA 1LEDA 1IRXA 4IV3C 4FAHA 2PBIA 2YPJA 4RMNA 4YW3A 2DOEA 1JJ8C 2PEXA 2AREA 1AYN2 5GP9A 1K4TA 2KQRA 2L0KA 1UOFA 1QJX2 1GUIA 4LKDA 2CSGA 3WEZA 2GZWA 1NZCA 4FOQA 4FAGA 3HTSB 2XSJC 3OPTA 2VIXA 3HSFA 4Q0QA 4BEHA 2J1TA 3N9NA 2A3YA 3H8XA 2FRHA 5FZMA 1VBB3 2A75A 2EQRA 3B69A 2JG8A 3K48A 3JRGA 5IWFA 1YFHA 2X10A 1LJ9A 3V8KA 4EM2A 1VQ6I 4DW6A 2HDDA 4QPGA 1B8IB 2ZOEB 3BP8A 1BJQA 2AEYA 2KPMA 2FDGA 1LENA 4YW1A 2E1MB 1FSEA 1BN5A 3K70D 4LT5A 3S16J 4EGYA 4HQEA 1ZKGA 1X1PA 3DU5A 2PFWA 4IQPA 3OTFA 4WXHA 1LESA 3NWKA 1BI1A 2HH9A 2R7SA 3ACIA 2MH2A 2XVLA 1A8DA 3U1DA 1QU3A 1Y9MA 2G7HA 3OL4A 4ENJA 3FXRA 3ABTA 3ERMA 1YQ5A 5M3MJ 2KR2A 1QGPA 1RJ7A 5J09A 5LEKA 1NQDA 2QQJA 3ZXSA 3H8UA 1V6KA 3VL8A 2Y8KA 1IDZA 1AR72 4NHMA 5L3BA 3I2FA 5DMYA 3HBZA 3VZNA 1OVPA 5FZ0A 2VOXA 4ATFA 5JLVA 4UI9L 2GA1A 3ZDVA 4M3FA 5DG2A 1KXGA 4D8MA 1ZR4A 4LO4B 4ES8A 2O3FA 3HMYA 4HOOA 4WWCA 5IVYA 5L7OA 2RMU3 3ZPLA 5GZDA 1S2EA 5A1LA 5HLTA 2QBYB 1AJOA 2Q0AA 2PJRB 1T39A 1YIJI 1FAYA 4BS9A 3L09A 5EWSA 2O9LA 1BK0A 1OCZH 3CMGA 4BKXA 4N9IA 1VMFA 2Y34A 2OUJA 1UCRA 5EIYB 2J5OA 5H9QA 4IX7A 3GBFA 2DMQA 2AENA 2Y0SA 3ILFA 4KGQA 5FYBA 3K46A 1W36D 1ULOA 3IKTA 2R5YA 1XG1A 5F3CA 3A23A 2CQ7A 2LF8A 4HA8A 4LFUA 1V55H 2EXKA 1PVC1 2VPRA 2EZIA 1JU3A 5IAVA 1UX7A 5LA0A 4CDQB 1RHI2 1HF0A 1U12A 1VB2A 5F3GA 3WZ1A 3Q8AA 5GALA 5BNNA 1MZFA 1PGL1 1O4TA 2QM3A 3KM5A 1Z77A 3T09A 2ZGOA 3ZSMA 2V6CA 4FQ4A 2Z16A 1SMYF 1UHMA 2V5YA 3VZMA 4A3JJ 1MDMA 4L97A 2ZAAA 1E5HA 2DPDA 2O1QA 1JGGA 1XJAA 2GOXB 2A5WA 1WWYA 2R16A 2K9QA 2M7BA 4L5JA 4ZU7A 2JSPA 2RV9A 3IZOA 2HWD2 5G04L 2YDEA 3MF9A 1R71A 4J6GA 4XCAA 4HX7A 2DCZA 1U9OA 5E3OA 1F31A 2Y38A 4NQWB 3RMXA 1CWPA 2JG8C 5HCBA 4QPGC 3PTRB 3WW1A 4Q4V1 3H0DA 1CAXB 3ACHA 3L9JT 1V6LA 1X36A 4I30A 5EJ3A 3SLIA 1JN2P 3F8BA 5FLMJ 1S0FA 4ES9A 3QH6A 5ACA1 3WODF 2J22A 3THDA 3GM8A 5C70A 4Y20A 3D6EA 5GZFA 1C8NA 5FFXA 3FHAA 4A3GJ 1GZ9A 2IS1A 3DPUA 3LSIA 5IP7J 3ZXLA 2FDKA 4ARXA 3HJEA 4DBQA 2PHWA 2AYHA 2HOAA 1ETWA 1FP1D 2CGOA 3POYA 4QDQA 4UVAA 3K10A 1LU2A 2RKHA 4Q8LA 5LBQA 1XGNA 1CONA 1EAH3 4N53C 2RDQA 4NHXA 3JRIA 4PDWA 4HBLA 1NG7A 2KM2A 1AU7A 3S57A 4M3EA 5LD2C 3CJXA 4UF0A 1J5YA 1IG7A 2D7FA 5L7OC 4AL9A 2SBAA 3QCWA 4XN3A 1T33A 2HOSA 1GWKA 4F8AA 2NAZA 3C7OA 1REFA 2QEXI 1OF3A 1WW6A 2IW5A 4OUSA 4KFCA 2HOEA 1F8VA 3H5AA 3NSTA 4QX5A 3H3UA 2R49A 4S2DA 1DQ4A 1HJGA 1ZELA 3ZN4A 1WMDA 1DQUA 1V6MA 2JWPA 3HQXA 3MV11 3N9PA 4AQTA 4XIDA 3BY6A 2VOPA 1ULYA 2XGDA 5F5CA 5DUIA 4AFDA 3IMNA 1XGSA 4FXKB 4TWTA 2JKBA 4JGZA 2QYOA 5HCAA 3GTMJ 3JCUC 1WPKA 1PUEE 3MYXA 2ISZA 1RUJ1 1W0TA 3CUQA 5FAXA 3OGJA 3FJSA 1O3RA 2EALA 2EB7A 3OD0A 2FF4A 5KC6A 5BNNC 4GB31 5DUWA 3QYFA 2BEOA 4UT5A 3CTAA 3FUOA 2OJED 1IO2A 1ODMA 2UWCA 4A0ZA 4XLAA 1G9AA 1SDDB 3QPSA 3LB9A 4AVSA 1U5TA 3N36A 5EZWA 2VNOA 2R041 4DUWA 2FE3A 5LFAA 2CY6A 3OYAA 1VE0A 4IETA 1LAJA 1HB2A 1OH4A 4Q2FA 4W6YA 1JYVA 4OIRF 5ICGA 3RI8A 1KU9A 2WFF2 4MV2A 3RKQA 4PK4A 1R081 2EILH 3HJRA 5LK7B 1R4MB 3VBRB 2M5WA 5M5YJ 3JRAA 2F6BA 2JA7J 4XF4A 3ZXKA 2ZMKA 2DXIA 2CGNA 2RR11 1FY7A 1Z7S3 5E1RA 5FP3A 4H55A 3E6BA 1LOBA 2DVDA 1Z78A 1PHMA 1FYUA 4COYA 5FZGA 4KMQA 3ZQFA 2NNYA 4AI3A 2RDNA 1ZHFA 1PZ7A 3J80Z 3ZFFA 2X6YA 4KGGA 4GH4B 4QGLA 4M74A 4NPRA 2DCTA 2WINB 2FCVA 1RI7A 4WM8A 5HDNA 4PF1A 1JJ6C 2GWRA 4LBMA 4XTPA 3CCLI 1DPRA 4S04A 1X50A 1FYKA 3P9CA 2XJTA 2E63A 1HRV1 1UN1A 2ERFA 1SC7A 2BBYA 4NHYA 2ETHA 1GLNA 1IRGA 1WJBA 4ISQA 1H6XA 3F3XA 1CPNA 1VIWB 4M0HA 2VJIA 4IXAA 1HN1A 2FSWA 4Q4Y2 2NVQJ 1OUSA 4Q4X2 1U5ZA 4PDWC 3TL4X 1GUUA 3QRFF 2ZZJA 2VMEA 2R30A 5IPAA 3K4DA 5JUVA 1OYIA 1LKNA 4YZ2A 3ULQB 1YLLA 4Q5OA 1H9WA 2QVSB 1GFF2 3K3NA 1FPN2 1R64A 3W6VA 4HQMA 1WH5A 3BCBA 1T56A 2OUHA 2HDCA 4ZONA 3AB0A 3V65A 1D4M1 1LB2A 4M4RA 3H7JA 1S0EA 2F5FA 1RMU3 1W06A 2ZX0A 2ARBA 4XORA 1LFPA 1R1A2 1W0PA 4JVAA 1GZWB 1SVOA 1TWAJ 3THCA 1EV7A 2DLLA 1Q8OA 2XLFA 4AIDA 4AW7A 1V0AA 3PUSA 3NQOA 5CKNA 5FZ4A 3DXTA 2E36A 3I54A 3BCWA 2SLIA 3I2KA 4JGZC 2RNGA 4XKBA 2PMZA 1XNDA 3ROUA 3N7JA 1CAVA 4MHGA 1Q1HA 3QU3A 1T95A 3HB9A 5CFDA 4YSFA 3PNAA 1F1ZA 1B35B 2GIZA 4C1WA 1IGOA 2NYYA 2V1DA 1XC6A 3H9AA 5FY4A 3B3QE 3BR5A 1NZIA 2Q1FA 3BU0A 3CJNA 2D40A 5C3SA 3OGGA 5IYCJ 4H7LA 1Y9GA 3L2QA 2F5EA 2XSDC 3PIPF 5A32B 2HTJA 4EJOA 2WO1A 2W57A 1U5TC 4FQGA 1QXPA 3F6OA 3U9GA 4AF9A 4ZZLA 4RGRA 3PJYA 5ICEA 3GCMA 5FWJA 3U2RA 1IPSA 5F8PA 4Q47A 2GALA 5E1WA 3S7IA 3I2IA 3HTUA 1VQNI 2JA2A 4B1MA 2XUMA 1J3QA 4JTNA 5T50A 2DVGA 1RUG1 2DF7A 4D69A 4PLMA 1AL23 2HYGD 3OYBA 3BIWE 5EEHA 1XBFA 1XSVA 2CV6A 3ZFFC 3VYRB 5T5JA 4WVMA 1POV0 5FYHA 4RR3A 2R7QA 1H1AA 4WM8C 1LNWA 4RLFA 4U2AA 2W24A 2LBFB 2R061 4EN6B 3WNLA 1UCXA 1VPHA 1Y6IA 2E35A 1T38A 1RETA 1CZVA 2QCOA 2DOFA 3DLAA 5EEAA 2PHTA 1W36C 2WABA 4QD2A 5LCWL 1JUIA 3E3VA 4D3WA 5IYYA 3HPGA 3U4SA 5F08A 5DDJ1 4IV3B 4CXFA 2ZBKA 1UG0A 3DBHB 4ESBA 4MQ9F 3WHTA 4ASMB 3R4DB 3MKYB 2RJ2A 1S5LC 3SNMA 4P5YA 1PIV2 2LYCA 3DTEA 4X8NA 3AZWA 3ELNA 4JKLA 4HLYA 2L4MA 3A02A 5EJ1B 4HG6B 4QM9A 1Z67A 1ETVA 4XTMA 1P7IA 1OPMA 2Y48A 4EMSA 3W2WA 2RS52 1R5HA 4IW3A 3K51A 1AKHB 4ABZA 2DPUA 4NC8A 2A6ZA 3INAA 5D2AA 2K9SA 3M07A 4ANJA 3WG3A 3ZO0B 2OTJI 3CCSI 3VSLA 4BHCA 5GM0A 5H6QA 1IN7A 2HWE1 4GXLA 4DS0A 1JYIA 5CLSA 3OYWB 1EV11 4ENMA 2XROA 2E33A 2FMDA 2Q8OA 3FK6A 5DZEA 3EYYA 4FFGA 3WHBA 1MW7A 5DUXA 4EN7B 3FHNA 4IUGA 3ZMDA 3ZMTA 1MVEA 1SVLA 4IJAA 3DEMA 2MGQA 1MH4A 3U75A 1QVTA 2V4VA 3BTLA 5CFDC 3S6PA 2F6CA 4KT5C 1B72B 2C26A 2QE3A 1Y1VJ 1PGL2 3E6MA 1K12A 5FZOA 5ILUA 3KQRA 3P9KA 4YW7A 2KFDA 2RS13 1W28A 1IAWA 1G8XA 4IHTA 3C7GA 4PBOA 4AQ2A 3ZXGA 3CCEI 5JAXA 1OUXA 1WZXA 3JD73 1Z7UA 5EZHA 1H2LA 1MZ5A 1YQ6A 4SLIA 4YIFA 4EZHA 4XLNF 1YIFA 2W9XA 5AC91 4N90A 2QZ8A 2P3KA 1C5IA 1DQ0A 3OBAA 3WQ0A 1L0OC 4C8DA 4MHRA 3UGFA 3PLQA 4BMEA 4E7KA 1X3WB 2Q4SA 1UU5A 1PO11 4Q4V2 2D5FA 4A3EJ 5AONA 2DT6A 3RKYA 2JDNA 4XUNA 5D5XB 4YEJA 3HNYM 4HEA2 2ZS6B 4BXXJ 2Q2EA 1FOKA 3Q8EA 5IATA 1YG2A 1QJU3 3TWIA 5CKMA 4DPNA 1I1EA 1CN1A 5LRSA 4RR3C 1WI3A 1B4AA 2RC4A 3AG1H 1WFXA 2LD5A 2O8KA 1GOFA 4AIHA 1VALA 3FIWA 4HETA 5FMDA 3RRDA 1JYWA 3OUJA 3TO9A 2PLV3 1DIWA 1EUTA 2GMMA 4LULA 1SBEA 5A3UA 4XQ4A 4YVWA 4YZ3A 1WCKA 4GYIA 1VR3A 3KX2A 4D0PA 4O3MA 1I3AA 2MC4A 3GTKJ 3NV4A 2KD7A 2DI3A 1RB8G 2HBUA 4BEHB 3O5SA 2K02A 3IP4B 4LB5A 2WQ8A 3AL0C 1NUKA 3ES4A 1HDKA 2VMGA 2JG8B 4FO9A 3DYPA 3WR0A 2QKMB 3U14A 5EYYA 4IZZA 4BH9A 5A3OA 4QPGB 3A21A 3MIBA 2HYKA 2VMCA 3ZM8A 3NV1A 5E3LA 1ZYBA 2WZR1 5HBAA 2PHUA 4LA2A 1LUJB 5KR7A 1GU3A 1E3OC 3DBLB 1C8M3 4HMZA 4G9SB 5JCTA 1GICA 1AXZA 4FTSA 1W0UA 1BXHA 2LKSA 5JXGA 2VKVA 4WBBA 4C3JJ 5FPBA 3D8CA 2RV8A 2W82A 4JK1X 3QBQA 3UJOA 2DFBA 4DOUA 5E1ZB 1GVDA 2CQQA 1YI7A 1HN0A 1OKOA 1BA5A 3C3WA 4Q8KA 4DO0A 5FUIA 3H3ZA 2ORXA 2Z2SB 3JAMK 2A5ZA 2K3PA 3I49A 1H9PA 1O59A 1SHWB 4N53B 1ETKA 3JQWA 5EDNA 3QWLA 1Y8RB 3K4BA 2HDWA 4UXNA 5F0CA 3ZFGA 1KA8A 2L01A 4WXDA 3ZN6B 5CYVA 2E7QA 5L7OB 3ASNH 1MJAA 2QFEA 5L19A 4XONA 1OCPA 2OZ6A 4CCJA 4IEYA 2QQAA 1AYN3 2EA4A 4LLLA 2JKXA 4OI0A 2ZABA 2HYXA 5F6KA 3VBFA 3A01A 2VNVA 2AQEA 2M0CA 2CJJA 2Q0OA 3IC7A 1MPXA 2CQXA 4IRGA 4RGGA 5IVEA 3SH5A 2GC2A 2OA2A 5LA1A 3OYGA 3TYJA 3VBOC