5LEJA

The transcriptional regulator prfa from listeria monocytogenes in complex with a 30-bp operator prfa-box motif
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
236
structure length
236
Chain Sequence
NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for glutathione-mediated activation of the virulence regulatory protein PrfA in Listeria.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Transcription
molecule keywords Listeriolysin regulatory protein
total genus 69
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5lejA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5lejA01
4HLTA 1W4MA 4MH0E 1AWCA 4LGWA 1Z6TA 3E6MA 1I5ZA 4KYWA 4HV6A 2MLGA 2E9QA 2I45A 3KP7A 5FD5A 1SD6A 4AXOA 3ZMVA 3F23A 1Z05A 4LMYA 4AVPA 3ROUA 3O2PE 1IW7F 1T0FA 2EK5A 4U88A 3DXJF 1KQ8A 2ZMEA 5HDKA 5DEQA 4KA4A 5LHIA 4I02A 1BIAA 2L01A 2OPKA 3CEWA 2VN2A 1R58A 4F8AA 3BPZA 1G3SA 1LDJA 2VQAA 3JAMK 2PG4A 1R1TA 3P9KA 3HHGA 4PIXA 3HRTA 2K0GA 1O7FA 3KP6A 4KMFA 5BV6A 1H1IA 2YU3A 4MQ9F 4YARA 3C18A 3NW4A 4A0YA 2IXCA 2RKHA 1BI0A 3RKYA 4MGKE 2OA4A 1H9TA 4MZUA 4A5MA 4IERA 2WTEA 1DPRA 5CVVA 3V8KA 1NXMA 3H1YA 1XE8A 4L9NA 3H50A 4Q0QA 1BI2A 3V7RA 5D6FA 4YRDA 5J7MA 1SFEA 2H27A 2GAUA 2E7WA 5LBQA 5F64A 1LNWA 1T39A 4GO1A 3FMRA 4G7OF 5JAXA 3AAFA 1TW3A 3Q9SA 4MEYF 4G6QA 2F2EA 3RDIA 4ENJA 4LA2A 3OTFA 3I0TA 5J3UA 3RKXA 3MZHA 1Z6RA 3SCGA 4UVAA 3L2HA 5HVQC 2IA2A 4CXFA 4IEZA 2VOOA 1XN7A 3HSRA 2D45A 4A2UA 1DZTA 2PFWA 4HN0A 2UZKA 2PAKA 5AIPA 4QXKA 4IEQA 4EROA 4I3PA 3HIFA 3HT2A 3V4GA 1IXCA 5D4SA 1E2XA 1UHWA 4WXHA 3EQEA 2Q30A 4A12A 2LSOA 3S2WA 3RNSA 2CQKA 4HAMA 1ZZ6A 3FX3A 2XAGA 3E6BA 2EFWA 2VOPA 1CAXA 1ZRRA 3ULQB 1Z1DA 3HOTA 3WW4A 4Y17A 4XFCA 3ERED 3GYDA 3KZZA 5TRDA 3GFLA 4HMZA 1BI3A 3E5XA 4JK1X 1JUHA 4JV4A 2GH2A 4XETA 1UCRA 2FMYA 1BBYA 3I4PA 3ZMDA 3QP5A 3RJPA 1PM7A 5DV5A 1FWZA 3BROA 5C8WA 4M9ZA 4LJZF 3T1BA 3H7YA 3G73A 5HLGA 2B9UA 2RV8A 1I6XA 4ON0A 1GQGA 2W24A 4UNOA 3ML6A 4KT5C 1FP1D 1YW7A 2XLFA 3NJZA 3ECOA 4HV5A 2GXBA 2BGCA 1STZA 2M8EA 3FXRA 3IWZA 3V8LA 2MH9A 2MHFA 3FWEA 3G3ZA 3KZYA 4MNUA 2YR2A 5D6EA 2NNYA 2EAAA 2V1XA 4L0ZB 2VECA 2V9VA 4K8FA 5I0UA 4IESA 4XF9A 3EQLF 2V79A 2QJVA 3LZZA 1J58A 2KJBA 3CTAA 1DP7P 2CWEA 2IW5A 2Q1ZB 3KP2A 1WGPA 1CAVA 2DFIA 4ESJA 5LHHA 2Q0AA 3RYRA 3Q9VA 1ZG1A 5FO5A 1GXQA 2CAVA 4D0PA 5EZWA 2HFHA 2ZO4A 2MBFA 1Z91A 4P9FA 2D1VA 5LEJA 3FZ3A 3S7IA 3RKWA 2FNAA 4M74A 1FXZA 4MTDA 4Y15A 5F6FA 3V7CA 3IIAA 4Q48A 1BC8C 2VC1A 2DO7A 1EV7A 1J5YA 3IRQA 4RB2C 2LF8A 4N9HA 2OZ6A 4D7SA 2BV6A 3M70A 1NE4A 1ZVFA 3BALA 1J3QA 5BUVA 1WKMA 2VC0A 4KN4X 2WFPA 1QXRA 4GCVA 3NVCA 3WTWC 4BAYA 2M45A 4HDUA 1CAVB 1EPZA 2R3SA 1RUNA 1USSA 2EFNA 5HS9A 4H7LA 4RB1A 2CG4A 1K79A 2D5HA 4HBNA 1TQIA 2ZXJA 1KU3A 3LAPA 3C7JA 1PP8F 1R7JA 1XCVA 3E3VA 4HX4A 1E17A 3QP6A 3R0JA 1D8JA 2MNGA 2ZJ2A 1YUDA 5AVPA 4CYDA 1YFUA 5JFRA 4P5OA 5L3DA 2MA3A 2EJRA 4YFNF 2M5WA 1XRUA 4XSXF 3F6VA 2Q0OA 2VONA 4WWCA 2ESHA 1UW8A 3ZMZA 2DQLA 2IA1A 2FQ3A 2E1CA 4Q5SF 2NNNA 1RL3A 3IC7A 1FOKA 2RQPA 3LQRA 4IRHA 3CLOA 5HI0A 3SHFA 1YW8A 3ACLA 1JHHA 2PQ8A 1ZG3A 2HYFA 2NS0A 3IWFA 3KGLA 3WW1A 1MGTA 5KHIA 2UXNA 4EWEA 1B4AA 3HTSB 2P5KA 4OOIA 4XRFA 1Z7UA 3J7AO 4LTAA 1ZG5A 2D1HA 2F4PA 1QPMA 1QQIA 2FXAA 1XGNA 4ZYGA 3EETA 5E16A 4A6EA 5FLIA 2W25A 2JTVA 5E18F 2IVMA 4I0BA 5I93A 1MDMA 5FGMA 1K78B 1KU9A 3C3VA 4QGNA 3O3KA 4RGUA 1S8NA 2KXLA 4RGXA 3CUQB 4Y13A 3HRMA 4ESBA 3MYXA 3LAJA 3WW3A 1GVJA 1BJAA 4ASNA 1LVAA 1U5TA 3D5LA 3F72A 1X8MA 2VODA 4TLFA 2EA4A 2Q8KA 2O1QA 4XEZA 1O7LA 3FZVA 1IPKA 4IXAA 4IHSA 5EFUA 3BDDA 4RGSA 4KNYA 4HQEA 3CUOA 2MD5A 2Z9OA 4WXDA 4MGIE 4MHGA 4F7ZA 2VBZA 4LLOA 3UKNA 3BOQA 1ON2A 3VFZA 3U10A 1XDUA 2OQGA 5FPXA 3USSA 2HZTA 2FF4A 4LK1F 1FBUA 3K9TA 1SMYF 3MCZA 4Q0UA 1EP0A 4IRIA 1YFWA 3IBMA 4IEOA 1YTYA 1P92A 3MPBA 3ZMTA 3IKVA 1F9NA 2P7CB 4IVNA 3LSTA 5KK1A 1MJ9A 5JI6A 1HSJA 1CF7A 3HQXA 5K5QA 2YX7A 3RYPA 4X6QB 2ET7A 3NSTA 3EDPA 1SEFA 1SFXA 2FSWA 2ELHA 1KYZA 2HKXA 1ZX5A 1YS7A 5J48A 2FOKA 5JSOA 2H94A 3WGGA 6PAXA 2HR3A 4BXUA 2HTSA 3GEZA 1YLFA 3LOIA 2QBYA 3T0YA 5H6RA 3DQVC 1EH7A 2L54A 1ZGAA 5AIQA 5I91A 1Z9CA 4E70A 1MZBA 3H3UA 4RAYA 3FJSA 3TO9A 1ZRDA 3ES4A 5DCMA 3L00A 1QGPA 3MZYA 2H6CA 1ZN2A 4EMSA 4DQ2A 1U8RA 1J2XA 4IETA 5FD6A 3WTVC 3NKTA 4FAHA 3COAC 1SQ4A 3OD0A 1B6AA 5HS8A 1J1LA 1FC3A 4I98B 4HX8A 3VOEA 2XGXA 5HDGA 2G7UA 4AVAA 2XLAA 3O14A 5ILVA 3MFKA 3LWFA 4LA3A 5D1IA 2XAQA 5K1YA 1CAXB 4OFGA 4CZZA 3NEUA 4HVRA 3GZ6A 1T6SA 1S7AA 1C0WA 5CYVA 4ESFA 2GC0A 3PVBB 5HLIA 5HOOA 3D0JA 1BOAA 3HUGA 2OZJA 2O8QA 3GLXA 4L18B 1QZZA 1W7PA 5CLSA 4N9IA 4LK0F 1KQ0A 5ILUA 3GO5A 2A6EF 2IXJA 4OIOF 4K2EA 4ENKA 2BNMA 3L9FA 2NRAC 3P9IA 5CVJA 3RPUA 5E20A 2CYYA 4GGGA 4Q4ZF 1V70A 3I5UA 5ICCA 3VODA 2KIFA 1ZRCA 4QGMA 3LA7A 1YLLA 3TO7A 2Z99A 4XF4A 3BJOA 3HYIA 5K5OA 4YSFA 2UYBA 5ICEA 1KU7A 3I71A 4MQVA 1I27A 3W6JB 4B29A 5JR3A 1Y0UA 2VT3A 1MD0A 1PP7U 2IC1A 4O9EA 2WWYA 1MJAA 2UY8A 4G7HF 1DGRA 2COMA 4EVIA 4RB0A 3F8NA 2M1BA 1U5TC 4G8XA 2UXXA 2EB7A 3F21A 4FX0A 1TBXA 4G7ZF 2BYVE 2QWWA 3F8FA 2P5VA 4HLYA 1XGSA 1JE8A 3R61A 1D5VA 4XFBA 1RC6A 1G3WA 4KDPA 2EFQA 1IPJA 4ZH4F 3I64A 4M73A 5I0SA 1W5TA 2QQ9A 2UY9A 5L3BA 4RB3C 4E2QA 4IEXA 2P6TA 2VPVA 4XLPF 1HQCA 2A6HF 4HSLA 2JSCA 4OINF 2BE5F 3LFKA 2MH2A 4I2OA 5BPXA 3JTHA 2H09A 1U6GA 4FX4A 1XE7A 5C6CA 1JXSA 4GYGA 3E6DA 2OAZA 1X8EA 1YFYA 3ZN0A 3CJNA 4N0BA 5BPIA 1S6LA 4YIFA 3H7JA 3DFGA 2XL9A 3N4MA 3QACA 1R00A 3C1DA 3KEOA 1RTVA 5T3NA 2J5OA 2VXZA 4P9UA 4O9GA 4BHPA 4EJWA 2GA1A 3ECHA 1B1BA 4FAGA 4LLNA 2YPRA 4KU8A 3Q5FA 5CVUA 1Q3EA 2GZWA 1OYIA 1TQPA 3ES1A 4ETSA 2F5EA 2K4JA 5L3EA 4O6JA 4LUMA 1ZZ9A 3WTSC 4U0WA 4CDGA 5IT9K 5ERIA 3J80K 4UVCA 4R52A 3GF2A 3RI4A 3HOSA 2G7HA 1OYYA 3GUDA 2DPDA 4XFHA 3MEXA 5BOXA 4O5VA 3FM3A 1P4XA 4Q47A 4WX9A 1ON1A 2EA7A 3IL2A 1RNLA 5BXXA 4H0EA 1P6RA 5HDNA 2ZFWA 1J59A 1FYLA 4LD5A 4I09A 2CFXA 2H6BA 3GBFA 5I8SA 1G4DA 1FBQA 2NYXA 3F8CA 3GZ5A 3MAJA 5AONA 5KHHA 2F5CA 1EH6A 2ZBKA 4IPAA 2W57A 3SCHA 2ZKLA 2PMUA 2CW0F 3R6SA 2XRNA 3H3ZA 3DP7A 4L2NA 1IN4A 1SFNA 2XHKA 1Q1HA 4KL1A 3M3IA 5LGTA 1ULYA 2M30A 3GVAA 4RAZA 4PJYA 3K1MA 1ZRFA 1DPUA 4QM8A 3SCFA 4DINB 2OA2A 2VBWA 1FBSA 2EVXA 1IN6A 2DU9A 3FE5A 4ZU4A 4UV9A 1ZZBA 1U12A 2EWNA 2EFOA 4IEWA 2PFBA 2OQRA 4AVBA 3P9CA 3PQJA 1FPQA 2K86A 2FBKA 3IHUA 3E97A 1L3LA 2ZKZA 1HW1A 1R5HA 5DCMB 5IT9Z 1EYBA 2ZNYA 4BHBA 2PHDA 1V3FA 4L5IA 2L3DA 2FRHA 2XAJA 2D5FA 1O4TA 1J9IA 1SMTA 5FFXA 2C0ZA 3WTZA 2RNJA 2PQQA 4UHTA 4BQAA 4XFAA 4HVQA 3OF1A 5E1ZB 4AQ2A 1IAWA 4KUMA 5ICGA 2Z33A 1YFXA 2P7VB 4HQMA 2HQRA 4EM1A 1LB2A 3QU6A 2V09A 3WTUC 4M71A 3JSPA 1J0RA 3REOA 2R7DA 3KMHA 2FBIA 5BPDA 1RZ4A 5FQ0A 1KU2A 2VE9A 1R1UA 1ZAOA 3HRSA 4LULA 3T8TA 1RIOH 5HLHA 4BIFA 1F5TA 2UWMA 1KYWA 3K0LA 4EWAA 1XSDA 1D3YA 1Y9QA 2GQQA 1PDNC 2OU2A 5JR7B 5JSRA 2Q4SA 3JAMZ 2CV6A 5L3FA 1IUYA 1T38A 3KETA 1FT9A 1GHCA 2FEZA 2JPBA 2GWRA 3TDUC 1U78A 1ZARA 4OIPF 3V7SA 2XKOA 4XLNF 2A68F 4KIBA 3ST7A 2HGCA 3HSFA 1S29A 4B8XA 2EV0A 2VT2A 1NE6A 3UKVA 5LGUA 3LA2A 4HZFA 2XROA 3NL1A 4MGZE 5FB2A 3BP8A 3QPHA 4ZU5A 3BJ6A 4QGLA 5JHUA 3SQNA 3DN7A 1G6NA 2VBYA 4ONUA 3W6KB 1UD1A 1UFMA 4M9XA 3GFJA 4HW0A 2ZMEB 3U11A 5KVRA 1Y3TA 2G9WA 1DUXC 2DT5A 4OMYA 5FLHA 3OOPA 2DI3A 2L4MA 1TQ5A 1IN5A 4TV7A 3K2ZA 3F8BA 4LEJA 2FU4A 3SXWA 1RI7A 1BN5A 4MGRA 1R36A 1JGSA 2PYTA 1FYKA 3I7DA 3PQKA 4PIZA 1LRHA 2IJLA 4ENNA 1XB4A 3EYYA 1CAWB 1VJ2A 1UHMA 3WGHA 1K78A 2K27A 4EGZA 4UXAA 3KP5A 1FLIA 3RPQA 2FE3A 1A04A 2H0VA 1CGPA 1IXSB 2HYGD 4KWKA 5KHGA 4EM0B 4X6RB 1B9NA 3WTTC 2PN6A 3BB6A 3T8RA 1EY2A 3FM5A 1O5LA 3GFMA 3H1WA 3ZMUA 1GXPA 2TDXA 5H20A 3E5UA 3FXQA 5DDGA 4IEVA 4MV2A 3CO6C 1XCBA 4PCQA 2HTJA 2B5HA 4QX5A 2FBHA 4Q0VA 1U2WA 3MDPA 3FFQA 2Y48A 1DDNA 3CUQA 3H92A 4HOBA 1WLTA 2C6YA 2QQBA 4HX7A 3RTRA 5BQTA 4AWXB 3BPXA 4JTNA 3WE3A 1XGOA 4JVAA 5D5VB 1ZYRF 3JSOA 3TNPB 2XLGA 1SD5A 5E8GA 3BPVA 3CJXA 4XFFA 4S04A 1O3SA 3EHKA 2DTRA 4L9VA 4MEXF 4OMZA 1CF7B 5I8YA 5DD4A 3I54A 5I0TA 4AIKA 5KBFA 2PTMA 1I1GA 4GXOA 4HSJA 3PLQA 2PLYA 1IN7A 3O6BB 1FZPB 1OFNA 1SFUA 1QBJA 3ZN1A 3H8UA 5D5XB 3F6OA 5K5RA 2D40A 2V1UA 4U7DA 2X4HA 3EYIA 4NQWA 3KGZA 3GWZA 5D8KB 5ICFA 4P9GA 2HWVA 2L02A 1ZLJA 4D7TA 4EWDA 4MGYE 3KP3A 1YG2A 2E7XA 2IXKA 3PNAA 3K1PA 1UPIA 2YSRA 1PUEE 5DUIA 1OI6A 4QLCU 3U0ZA 5D5WB 3TOAA 4YIIA 2LDUA 2JZYA 1UIJA 2E1NA 4P96A 3I58A 1MDMB 1S3JA 3TGNA 4OIQF 3CLPA 3LWCA 2RN7A 2Y0OA 1BC7C 4KMUX 2FQPA 1MJBA 1Q43A 1G3YA 3WW2A 2O0YA 4U7BA 1TNTA 3D82A 4YG2F 3UKTA 2Z5UA 5FFZA 3RYKA 3U9GA 2FNPA 2F5DA 3TOBA 4ZYDA 3KEQA 5LGNA 1W7PD 4LUKA 4KIGA 4R1HA 5A2QZ 1J3PA 4ZU7A 1SAXA 3DEUA 5BMZA 1YFHA 5KHJA 2QLZA 3M7GA 2B8MA 5CJ9A 3WU1B 2D2WA 2J5PA 3VB2A 5CU1A 2AXLA 3TKYA 1YQAA 5L3CA 1WRJA 3WTYC 1YW9A 5E1WA 2N7GA 4EV0A 3ZQ7A 4A0ZA 4IEPA 3CL1A 1NHAA 1H0MA 1LJ9A 2A61A 4UVBA 1YWKA 2Z2SB 4IHTA 1WWXA 1JHFA 5EEGA 4G94A 1HW5A 1TTYA 3BU7A 3EUHA 3J80Z 3U2RA 1I1SA 2K4BA 3B73A 2EV6A 3KP4A 4KN7X 3JZVA 3OGJA 1BIBA 2BBYA 1XGMA 1FSHA 3BY6A 4YYOA 3MWMA 4UXNA 3G7DA 4EJVA 2O3FA 4WBBA 2O8XA 2HOEA 1G3TA 4HBLA 1WQ2A 2GXGA 4I7HA 4UBHA 2A5YB 3HT1A 4KU7A 1HKTA 1R5GA 3DPTA 4XSZF 4UV8A 1OPCA 1R1VA 3FMSA 1B9MA 5FCCA 4M6YA 5FQ0B 4QM9A 2GU9A 1U5TB 5FLXK 2QVSB 4WVZA 5BY5A 2UYAA 2W85A 4CICA 2ZCWA 5J8CA 2ACJA 1H1MA 1YHFA 2XKPA 3R4KA 2ISYA 5L3GA 2PI0A 5JSPA 4M72A 1YS6A 2O6GE 2MLKA 2XAHA 4G6DA 4EM2A 1VTNC 1CX4A 3SHRA 3L2CA 1ZZ7A 4ZZLA 2AS5F 4LFUA 5JCTA 2QM3A 1SD7A 5LEKA 3E5QA 4A6DA 1F4KA 1P4AA 4M6XA 2FMLA 5LRSA 2HEOA 2IRFG 4BNCA 3GFIA 4UUVA 2XASA 4RGRA 4PGGA 3ZPLA 5DUKA 4FBFA 1HBXG 1EH8A 2JT1A 1X7NA 3EBRA 5DCFA 1O3RA 1ZREA 1H9GA 3M8FA 2XVCA 2P4WA 4KWJA 3WODF 3M1EA 2HDCA 4A0XA 4LG0B 3ZDSA 4PZJA 4JQFA 2JRTA 5J8FA 2PJPA 3QPTA 5HS7A 5FLXZ 1IZ1A 4LB6B 2BNNA 5JVTA 1QWRA 2A3SA 1LDKB 2CAUA 2DPUA 4Z82A 1FI2A 3ELKA 3MQ0A 4U0VA 5CADA 1AOYA 2MC3A 2DQRA 3CUQC 3TNQA 2K9ZA 3KCCA 4I0AA 3EJKA 3I59A 2W84A 4NHJA 4LG0A 2EV5A 1T2KA 4EQQA 2IXHA 1FX7A 1IN8A 1XMAA 2R7FA 2CSOA 2ZNZA 4Q0PA 1HSTA 4U0YA 5LLQA 1ZHFA 2YX4A 2STTA 2ESNA 2QVOA 4KICA 4ENMA 2QUFA 1WSUA 1XDSA 1OMIA 2OBPA 1XD7A 2PMHA 4FHTA 3OV8A 5DYMA 1K6OA 3FXUA 2HKOA 4XFGA 5H6QA 3SZTA 4PDKA 1FY7A 4PIYA 2WC2A 3L7WA 1ONVA 1OYWA 1ZZ8A 1T98A 5E8IA 4ZZDA 4S05A 4ZYHA 2KIMA 2Z3YA 2QDRA 5D4RA 1PMIA 5ED4A 2STWA 3HTUA 1J3RA 1R23A 5ILSA 1KQ9A 3FF5A 4LLLA 1LDDA 4UBGA 2RC4A 3CDHA 3M9AA 4JBAA 4LB5A 4JTOA 2K02A 2A69F 3FHIB 4L11A 1KGSA 2B0LA 3F8MA 3CO7C 2F5FA 2ADUA 1J7KA 1USTA 2ETEA 1WI9A 1CAWA 1TQMA 3R60A 1YO5C 5K8SA 3TO6A 2EA2A 2QNKA 5D8LB 1TW2A 2IXLA 1Q5OA 3JW4A 4EGYA 2EFPA 2NAZA 4Z07A 3ELNA 2QBYB 3LAGA 2OZUA 5BS6A 1TLHB 3QU3A 1RGSA 2DBBA 2X0LA 3SZPA 2PHLA 2DK5A 4EJTA 3DF8A 4XBFA 1FNNA 3SFZA 3U1DA 4B09A 4HVOA 2V6CA 3IDBB 4IF4A 5A2QK 1HKSA 1YIOA 5KHKA 2XL7A 3CO2A 2PAEA 1XSXA 1CAUA 4XFIA 4R8HA 5IT3A 4RS8A 4MTEA 3T5XA 2XIGA 2DW4A 3HSEA 3GYHX 5DD8A 4E2GA 2LF7A 4HA8A 1UCXA 3K1NA 3IRRA 1GQHA 2RGVA 3PFIA 3ZMSA 2HQNA 4L0YB 2IPQX 4MUVA 3WG9A 1OR7A 3DL3A 1SD4A 4L9TA 1REPC 4EJOA 2VE8A 3QOPA 2O61A 1S7OA 4CHUA 1ZGJA 1IF1A 3LA3A 4P55A 5E1XA 3JTGA 5E1RA 1P4WA 1VR3A 3ISPA 3RIRA 3BWGA 1UIKA 4G9YA 2LNBA 2QZ8A 1ODDA 4ORFA 3D0SA 4O3MA 1ZNPA 3OCPA 1QZYA 4WXCA 2GC3A 1CAUB 2GA2A 3WU0A 1X3UA 4DNCA 5D5UB 1X82A 2KRFA 5E17F 2M87A 5F1RA 4AQ6A 4AVCA 3VEPA 3BJAA 5CVRA 3ZP5A 2DCTA 4QMAA 2QYOA 1W7PB 4YNIA 4META 3N97A 1LEAA 4PGHA 3DKWA 1LEBA 5I0RA 2IT0A 4WF2A 2BEOA 4WZCA 2Y0MA 3NRVA 4L5JA 1O5UA 2IP2A 3TQNA 3HRUA 3ABUA 2LKPA 4AD9A 1DZRA 2PEXA 4IRGA 3F3XA 3H1MA 4HF1A 3WGIA 3FMQA 4YFKF 4BHCA 3J81Z 2KJCA 4AIHA 4EJUA 3P7NA 1KA8A 2DAOA 1ZLKA 3I59B 1L3JA 3F22A 4RD7A 4NB5A 4E2SA 4OIRF 1P2FA 3WE2A 4R79A 3HHHA 2GC1A 3K69A 2PA7A 2RVCA 1LKNA 2WV0A 5EEHA 2D93A 3KFWX 1HKQA 3KLOA 4HF2A 4A5NA 1HW2A 4IEYA 2DLLA 3L09A 2PAMA 2QQAA 3GXOA 4Z2YA 2ET1A 2L4AA 2OYZA 4XF0A 2P17A 3SXYA 4MX3A 4HDVA 2ISZA 3GX4X 4XF3A 1MKMA 2KKOA 1DGWA 4QWQA 1LR5A 3ETQA 4CGZA 2IA0A 4HF0A 4HLXA 4NVPA 4OLLA 2RDPA 1IRFA 4KFCA 3E6CC 1O57A 2O03A 1W5SA 3DV8A 2MPFA 1QY4A 1BM9A 4L9JA 2CGPA 1YYVA 5CVIA 3IDCB 3S0MA 1VP6A 1FSEA 1LQ1A 2JPCA 2OD5A 2P8TA 2K7LA 3QRFF 5FLJA 2XAFA 2V1DA 1XMKA 2CO5A 4HYEA 1IRGA 2QCSB 3QAHA 5FDBA 4WCGA 2Q2EA 2PBIA 4GYIA 2BNOA 3B02A 2HJIA 4J1XA 3LQQA 2QENA 1OD5A 3KE2A 1ZH5A 1ZZCA 2Z69A 4IEUA 4M9SA 1V4RA 3M8EA 4CO8A 3DPLC 1QXJA 4LLGF 2P5LC 2A07F 4GULA 1O3QA 3S7EA 3KLNA 3V8JA 4IJAA 1U3EM 4J1WA 2Y75A 1F1ZA 1K7AA 3TDZC 5I8TA 1L0OC 2KIUA 3EO6A 3H9AA 4HN1A 4I01A 1NZCA 4WK8F 1FP2A 2DK8A 4FT8A 1IXRC 3C3WA 1NYWA 4BH9A 4KWLA 3KSCA 2P6SA 3BZ6A 1J75A 4Q0SA 4ZYEA 1RUOA 1OKRA 5LRRA 3WTXC 3FHZA 3VHRA 2GIVA 3GW2A 3SMHA 1R22A 1D8KA 3I53A 1HXDA 1UB9A 1FYMA 4BYYA 3IKTA 5FPZA 3RZZA 1BI1A 5TJJA 5LHGA 4AIJA 2ATFA 2FA5A 3R0AA 1XSVA 4KIFA 3J81K 4OU0A 2IXIA 1B59A 4YFXF 2XV4S 1QO0D 1QNTA 2GC2A 2XUBA 3BCWA 4Q29A 4XF1A 3NQOA 5J6XA 3CF6E 2ETHA 2HS5A 2VBXA 1TNSA 1WA4A 1O3TA 3ABTA
chains in the Genus database with same CATH superfamily
4HLTA 3VBRC 1AWCA 4LGWA 3E6MA 4KYWA 2MLGA 1D4VB 4QX8A 1SAUA 1KZHA 3TRSB 1NG7A 4HNVA 4JGYA 1M06G 3ZMVA 4LMYA 2YGMA 4RBOA 2ZMEA 5HDKA 5DEQA 1VB2A 4AIDA 1OKQA 4I02A 3LNQA 1RUE3 1DDLA 5D8AC 2DOEA 2VN2A 1WJEA 1R58A 3DECA 3BPZA 1G3SA 1GKBA 3OL3A 3P9KA 1RKTA 3HHGA 3IH4A 5FJKA 5IVYA 3HRTA 2K0GA 1W6NA 1H1IA 3C18A 4B4CA 4FASD 4ASLA 2HPMA 4Y1ZA 2QQVA 2WNVC 4CDWA 4ZYAA 4DBQA 1H9TA 4IERA 4XDQA 2DVGA 1DYPA 1BL0A 1NXMA 3H1YA 4Q0QA 2B9VA 1OH3A 4YRDA 4CCJA 2HBTA 5J7MA 4BMBA 1FOYA 4JYKA 5L73A 2L9SA 3CMYA 5JAXA 1W6NB 2WWUA 1QHHD 1E0EA 4CEWB 4YVWC 5L7OB 3H8RA 4HG2A 4G6QA 3OY8B 3GBGA 4OHVA 2R7VA 4LA2A 4P5YA 4PLOA 3RKXA 3MZHA 4OULA 3HAGA 2EH3A 3POEA 2VQUA 1YQ8A 3L2HA 5HVQC 4CXFA 3INAA 4IEZA 5J1YA 1XN7A 3HSRA 5HLTA 1JZ8A 1ENQA 2D45A 3AX4A 3SEPA 1DZTA 3AG2H 5DABA 1GV2A 2TRTA 1XNKA 2DV9A 3WDUA 5D4SA 1E2XA 2RS51 4A3CJ 1PUFB 4WXHA 1DG6A 3KT7A 2WDBA 1H0BA 4NRQA 5FFOC 4Y1UA 4A12A 3QWLA 4AEDA 4B43A 4IW3A 3ZXFA 1W05A 3MIDA 4BY7J 2CQKA 4ES9A 5FR3A 5FP8A 3B5LB 2AGSA 4NC6A 3E6BA 1IG3A 4D7NA 1ZRRA 1Z1DA 4N53C 4XFCA 3GYDA 5TRDA 2GOMA 3M2MA 2HPIA 3T2OA 1BI3A 1MZ6A 4QXHA 4PSWA 4JK1X 1JUHA 4FPOB 4PJNA 5L9RA 5C70A 2FMYA 2AXTC 1MZEA 4IX7A 1SLTA 3BROA 1R64A 4G3YC 5JI9A 4M9ZA 3NJVA 3ZMNA 3FHNA 1XJAA 4AOCA 4DYQA 3HD8B 2JMWA 3I56I 4PQ9A 2RV8A 2AREA 4A4AA 1WI3A 1XU2A 5EG0B 4UNOA 4XK4A 4CP1A 4KT5C 1FP1D 2WQ4A 1YW7A 5A32A 1W06A 1UX6A 1AVBA 2BGCA 4NAOA 1STZA 1PIV1 3FXRA 1A3KA 3FWEA 2K9QA 4BJ5C 4Q4X2 5D6EA 2V1XA 2KZVA 2NXNB 2RQQA 3K3OA 1RR8C 4D9JA 1MNEA 1LHVA 3DEWA 2KDZA 4XL9A 2ME6A 4XF9A 2V79A 4BGDA 1D0ZA 5JMCA 1KS4A 2J1RA 4FQGA 2CWEA 2IW5A 5FRAA 3WP4A 2TNFA 5FMBA 2R7SA 4XBQA 3CJTB 3WP6A 2DFIA 4ESJA 2IXSA 3JRGA 1ND3C 2M7AA 3FXMA 2Q0AA 3RYRA 3T4VA 3Q9VA 1C8NA 3PO3J 3D6EA 3EPZA 5FO5A 1KGYA 3E0JB 5EZWA 4YIRX 2QCOA 4XCBA 4BXXJ 5CFCB 2QFEA 5DDJ1 4MTDA 4Y15A 3FLRA 2B46X 4ZZ8A 2PHXA 2HWF3 1BC8C 3NWTA 5IT6A 4ES8A 1KITA 1STMA 1OUXA 1FOD3 2PX9A 3I3DA 1PZ9A 4N9HA 1C1FA 2JA2A 5HCHA 3W3CA 3VKFC 5BUVA 2C6SA 1WKMA 3THPA 2MABA 4A6OA 5FREA 1QXRA 4GFBA 4GMP1 5EF6A 1GWMA 4K1ZA 2M45A 3H9QA 2W91A 5DM7F 4HG6B 4HDUA 2RS32 1USSA 3B94A 2DURA 3WINE 1TQIA 1UOGA 2DOFA 3LAPA 3C7JA 3Q8BA 1R7JA 1XCVA 3E3VA 4HX4A 2D5VA 4RHV1 3QP6A 3R0JA 2X6XA 3OIPA 4TYSA 4EN9B 2BGOA 3OBRA 1CONA 1JT0A 1K6YA 3KVBA 2NS7A 1W3XA 1GR3A 1YJKA 4YFNF 5C5UA 4Z6YA 3GZEA 4AVVA 5GALA 2VUJA 2ESHA 1D1AA 3LSEA 3ILNA 3W58A 2NNNA 1CZTA 2VZSA 3MLKA 3CC2I 5BYNA 3WSOA 1RJ8A 2DODA 5HI0A 1JHHA 2EIKH 3IWFA 2ARXA 3IAS2 1HXS2 4FP3A 3HTSB 2P5KA 4OOIA 5F3CA 5FRNA 1HJFA 1RETA 1OURA 1X3WB 1JI6A 4LTAA 3WNMA 3ENRA 1ZG5A 2JA8J 3MIHA 3V0AB 3MIGA 4YWAA 1QPMA 3AP4A 3OIQA 5LBFA 3HGGA 2V73A 5FLIA 2Q8CA 4AL9A 5E18F 2HLEA 1K78B 4QGNA 3C3VA 5B2GB 1RHI1 1MZFA 1R081 1MS8A 3DYOA 4RGXA 4M3EA 2DWRA 4Y13A 3HRMA 3AYCA 3F2ZA 3T1MA 3KV5A 3KQRA 1VMJA 3F72A 2EA4A 5HCBA 4BJTA 1D1CA 1O7LA 3FZVA 3A03A 1IPKA 4IXAA 1EPWA 2QZ3A 2FMDA 4RGSA 4QB6A 1MS1A 2Z9OA 3DBLB 4F7ZA 2VBZA 3SFIA 3UKNA 5DUWA 2ZACA 2FCUA 3A4UA 5FPXA 1DGRM 1WLWA 2HZTA 3VZLA 3K9TA 1YJ9I 1SMYF 3MCZA 1QNWA 4Q0UA 4IRIA 1A35A 3SEEA 1VQ7I 3PTRB 1LU1A 1VNDA 2Y34A 4PK4A 2XMLA 1YRNA 1T33A 1HSJA 3M7AA 2RDSA 2HWB1 1FNYA 3DXTA 5GPAA 4DW6A 1N3QA 3DPRC 4JZRA 3CCEI 1S4CA 2VL8A 6PAXA 3FFZA 2HR3A 4PFPA 3I8TA 3K70C 4V1PA 1PO23 3LOIA 2ARAA 2AUYA 2QBYA 3T0YA 4M3GA 4RS5C 2JB8A 3DQVC 1RPWA 4ITVA 1Z9CA 1Y1WJ 3GM8A 4N8MA 3I4MJ 2ZMEC 3CCQI 3FJSA 1ZRDA 3ES4A 3Q0WA 2J7MA 4AHZA 4DQ2A 3UNPA 3AVSA 5FJHA 3S5QA 1JBCA 4Y33A 1R083 1WMEA 1E3PA 1LNSA 1OR7C 1UY4A 2WYFA 1FC3A 4C1XA 2VULA 2XGXA 3NNFA 3ZFGC 4AVAA 1DYOA 4Q5OA 5D1IA 2KMUA 2XAQA 2E32A 1COV2 1WVRA 1QOTA 2BRTA 1QU3A 1S7AA 1S9HA 2TUNA 3HXLA 3ABLH 4JHTA 1LGBA 2WO3A 4GRIA 1B35C 5KC5A 1H88C 1W90A 4Y4YA 3GLXA 1WBFA 4Q4W2 3BR2A 1DYKA 2DCZA 4CCDA 4N9IA 4LK0F 1KQ0A 4NIDA 2VCAA 2IXJA 1MVQA 1BA5A 5I0DA 5K0UB 1EV11 2LKSA 4F52A 3L9FA 5CVJA 1X4OA 1ETYA 4K6BA 3WG7H 4Q4ZF 3I5UA 3QODA 5BNNC 3VODA 3O7OA 2KIFA 5A3UA 2HWF2 1YLLA 1I6HJ 2A5WA 1Y9MA 5A3WA 1PVC1 2UYBA 4CDXB 2I74A 3ZXKA 3I71A 4MQVA 1I27A 1DP3A 1FX5A 1WMDA 1TP4A 1X1DA 1E5IA 3APBA 4XHBA 2VT3A 1CD3G 3BU0A 4AR2A 1WKYA 4V2FA 4N43A 4EVIA 3MF9A 3RFRA 1QJEA 2M1BA 4G8XA 2UXXA 2EB7A 2X53S 2HWD3 4FX0A 4G7ZF 4BE1A 1QU0A 4YG3A 2QWWA 1V6KA 2NMNA 4JX6A 4BL0B 4QTRA 4LBOA 1XGSA 1JE8A 3R61A 5IOYA 2MGQA 2BW8A 3ASIA 4M73A 3GJAA 1XB9A 3LEKA 1OA2A 1W5TA 1QZEA 2JSPA 4RB3C 4E2QA 4IEXA 3MKLA 3RZOJ 5M5XJ 3W59A 1HQCA 2KQRA 2VZUA 4URAA 4OINF 4ZZ5A 2MH2A 4XUPA 4RLFA 3MN2A 3E6DA 2OAZA 3VD3A 1X8EA 1SFKA 4CYCA 3I2KA 3MIFA 1EV12 1D2SA 3CJNA 4N0BA 4OYUA 3W5NA 3ZIWA 3DFGA 1TME3 3NWSA 5FLMJ 4QQ2A 4Q2FA 3KEOA 5T3NA 2I5UA 2BP6A 3DCQA 4XKBA 4LHKA 1E3HA 2CRGA 1F31A 2KL4A 4LOSA 3Q8FA 1FPN3 3PUBA 2OQ7A 1ACIA 3WQ0A 4YM3A 1YIPA 1OYIA 2DCYA 4IOCF 4RR3B 2D3RA 3KLSA 4FTBA 4QQLA 2N8GA 5F08A 3RKQA 1FOXA 2Y9ZA 3CIHA 4LUMA 4JQRA 4B3NA 3HQUA 5L9VA 3GF2A 3RI4A 3HOSA 2G7HA 1OYYA 4XFHA 3WXPA 1BBT1 1D0GA 2BY2A 1IG7A 3RZJA 1GZTA 4WX9A 2DUQA 1ON1A 3SDGA 4AEJA 5ACA2 1P6RA 3PTYA 3CJRB 1R6RA 3BCAA 2ZOEB 2X05A 1LOFA 2BWAA 2K9LA 1RYYA 3GBFA 5GZGA 1G4DA 1OQEA 5AONA 4CP9A 1EH6A 2ZBKA 2QEXI 3SCHA 3AKTA 5F6KA 4AEMA 3I2DA 2LTNA 1Q1HA 1QH7A 1ULYA 4Q1PA 4UFHA 3ZN6B 3GVAA 2V26A 4HRIA 1OCRH 1MMSA 4DINB 2VBWA 3SQOA 2EVXA 3FE5A 2HWB3 5EYRA 5IVVA 2EAKA 4IEWA 2WAQN 2B42B 4AVBA 1ENSA 2Z5WA 1UZZA 3PQJA 1ZBA3 3QOEA 2ZX1A 1GOGA 4IV1C 5TISC 5DCMB 2ZNYA 4JC1A 4ZPIA 5FY7A 2PHDA 4L5IA 3D3AA 3L2VA 1MH4A 4UOJA 1C8M1 2LY9A 1MNDA 4CUGA 3THTA 3WTZA 3VWBA 3BYWA 4BQAA 1N77A 3OF1A 1IAWA 2VUCA 5ICGA 1YFXA 4B4PA 4HQMA 3SDBA 1UU4A 4M71A 3REOA 3AM2A 4NIHA 1VQ9I 5F7UA 4FPJA 4K9SA 4QU2A 3AL5A 3BQZA 3ZPYA 2VC9A 1YE9A 1VRH2 1YRNB 2D43A 5HLHA 4M4PA 1UZWA 1JYIA 4NDLA 4EWAA 1RR7A 1QJY1 1D3YA 2VB6A 1VBA2 3I2HA 3VGIA 2GQQA 3PJRA 3B01A 2OU2A 1GLHA 1P9QC 4XOPA 1SZBA 4FOVA 3I3LA 2JPBA 2CL2A 4NE9A 1A6CA 4OIPF 3V7SA 4BU2A 3OYWA 3O1RA 3MHZA 3H0GJ 2E51A 2DMTA 2HGCA 3DTIA 2VQCA 2XAUA 2EV0A 2KP6A 1S0JA 1J1TA 2A3XA 4HZFA 3IH2A 3VYSB 1NCQC 2KR2A 4QGLA 1G6NA 2ENRA 3USUB 2H8RA 4ONUA 2Y0SA 1WJAA 3ZQIA 1UFMA 3GFJA 2BY0A 4QKFA 4HW0A 2R073 2ZMEB 3IPVB 1WW6A 3JBG1 3OYWB 1DUXC 3WNLA 5DM6F 4S2DA 3L2RA 1IN5A 4W8JA 3K2ZA 4FFGA 3QYBA 4AYBA 4LMFA 3RQIA 5JWPA 1RI7A 1KQRA 1BN5A 1R36A 2V6EA 1FV3A 2IS2A 3PQKA 5E89A 4J25A 3S17J 3TMOA 3VHOA 2IS6A 4AFAA 1WCKA 2JDKA 2HYKA 1IS6A 1PK6A 1CAWB 2CU5A 4FFHA 3WGHA 4XQFA 1K78A 1UN1A 1R082 2FE3A 1KS5A 3OYIA 3MVPA 1PGW2 4KWKA 4TSVA 4YW7A 2JN6A 2XBO2 4GB32 1RUG1 4YW5A 3WT3A 4BS9A 3T8RA 3L2WA 1O5LA 1GXPA 2VOKA 2I2SA 5FMOS 2R7ZJ 1DHKB 4IEVA 1XCBA 3L1PA 1W9WA 2B5HA 4OHWA 1SACA 3RMXA 2WY8Q 3T3YA 5FZ7A 1MH3A 2QF7A 2JG8C 4G9SB 2KIQA 1DDNA 1OKOA 4YVWA 5DQ0A 3ZDVA 4KH9A 3RTRA 1DP0A 4QHBA 3OSGA 2WZR3 5BQTA 3G1OA 4JTNA 1PX4A 1XGOA 4JVAA 4BK5A 4KI5M 4AI3A 3JSOA 1PO11 5J47A 3TYJA 4XFFA 3ZXGA 1AR72 2QA4I 1YI9A 1CF7B 1WH7A 1FPN2 5I8YA 5DD4A 3I54A 3UETA 4IV1B 4AIKA 1N47A 2PTMA 1I1GA 3C7HA 4NHMA 4GXOA 4HSJA 5GZFA 3MEPA 5E6HA 1FMD2 1IN7A 1OFNA 2VZTA 1QBJA 3CCVI 2EICA 4JCKA 2BXZA 4M00A 3F6OA 1H6XA 1U8BA 4DUWA 5B4XA 3H9JA 2V1UA 4U7DA 4AYBN 2VKHA 2WBMA 4K7JA 4BZ4A 2DDUA 2HWVA 2L02A 3UKGA 3GTGJ 2VZOA 4L99A 1P7IA 2VH9A 3KP3A 1ETVA 4AQSA 2WNEA 4JRLA 5D2AA 3PNAA 4E27A 4C3JJ 2QQPA 1UPIA 2E1MC 5FZCA 4QLCU 3U0ZA 3TOAA 3MIEA 2DA6A 1S3JA 5A32B 4QU1A 4OIQF 1A5JA 1JXNA 3HWJA 2AEYA 1N75A 3C7GA 2FQPA 2RV9A 2QQUA 4YGEA 5F04A 4UF0A 2A73B 1G3YA 5FO9B 4CP0A 4U7BA 4RR3C 2Z4FA 1F15A 1NZIA 3UKTA 2Z5UA 2FNPA 4Q4Y1 5LGNA 1FV2A 2P3IA 2FUG2 3IV5A 2DCJA 4ZU7A 3VZJA 3WEZA 4RQPA 5BMZA 4DMIA 3N9PA 5KHJA 5CJ9A 4XTMA 4AW7A 1H30A 2D2WA 2J5PA 3VB2A 2AXLA 3ZFEB 2W3JA 2QKLB 5E1WA 1RUF2 4EV0A 4A0ZA 1RUC3 4IEPA 2R0QC 3CL1A 3KCXA 4RFRB 4XUTA 3C2HA 1H0MA 1LJ9A 4HOOA 4XMAA 1X33A 3OGRA 2EXJA 2JUCA 2L9LA 3PIJA 4G94A 2JE7A 3DU5A 1TTYA 2UUZA 3EUHA 3J80Z 4PCRA 4LJHA 1EF4A 3SKJE 3B73A 2EV6A 4D6QA 3VB9A 4YZ2A 4D0QA 1BXHA 1TWAJ 3FUQA 1JOBA 2BBYA 3BY6A 1XPWA 1O6UA 4HBLA 4I7HA 2DFHA 5FXZA 4Z2WA 1SCRA 3CKHA 4UV8A 1OPCA 3FMSA 4XLAA 2O9LA 4Y24A 3UR3C 2ID6A 2GSYA 4RHV2 4LG3A 1LU2A 4WVZA 4CCLA 3T09A 3DPRB 3JQWA 2G1MA 1TWCJ 2BY1A 2JD9A 3BOWA 5F3IA 3WU2C 4A42A 5F8PA 1I1EA 4TN7A 2MLKA 5E79C 1GICA 2WSUA 4EM2A 2DT6A 4F3JA 3FLTA 3ZXJA 5JCTA 4OVEA 4K1YA 4B3AA 5LEKA 2X85A 4M6XA 2FMLA 5FZBA 2AH2A 1ND2A 2JRMA 5FUPA 5JXJA 1MBEA 2IVJA 1ETOA 3SH5A 1V6IA 1XYPA 1M4WA 1D4M1 2JDPA 3POGA 1ZREA 3M8FA 2VW1A 2WLQA 2D6PA 2L0KA 3WODF 3M1EA 4XICA 5DAQA 2AO9A 4OMCA 1VBC1 2JRTA 2LTPA 2JVHA 1MS4A 2XUMA 5F6LB 4BQWA 1IO2A 5HS7A 1HOMA 4NPMA 2JG8A 2LH9A 5JVTA 1QWRA 2ECBA 2DPUA 2V1NA 3MQ0A 1QJX2 2D7FA 5CADA 1W5CC 5FZ8A 1Y43B 3DKXA 3TNQA 1RUG3 2HVSA 2ZJCA 4GWNA 4I0AA 3EJKA 2NZ9A 4RFT0 3GZTB 2IXHA 1T8IA 1FX7A 1JN2P 3HVDA 1VB4A 2MEV1 1MBJA 3DGTA 2ZNZA 1WH5A 1BCXA 1W6PA 5LLQA 3P5BA 2ESNA 2VQTA 2DN0A 4S2FA 2PMHA 5KXCA 5DYMA 4DO0A 3W5MA 3CMGA 2HXOA 5H6QA 4KBBA 2P1BA 1OYWA 4ZZDA 4S05A 3A7QA 5FKBA 4ZYHA 5JXHA 3N7JA 1GUUA 4M3CF 1RUE2 3LIHA 1QJU1 5ED4A 2MFZA 2STWA 1J3RA 2GNBA 4ARXA 3JCIA 3VDAA 1R23A 1KQ9A 2R7WA 4LLLA 4BQOA 4UFMA 3SEQA 4JBAA 4BQQA 2DA4A 4BE0A 1W2UA 4L11A 2VR4A 4UW6A 2ADUA 5EYYA 1USTA 1TME1 4FE7A 5FZOA 1CAWA 1MBHA 1YO5C 2X10A 3TO6A 5HBAA 3S16J 1DCSA 1ENHA 1GZCA 2GNDA 1UU6A 2UWBA 3GTLJ 3CJQB 3ZYFA 4BEHB 3AL0B 1Q5OA 3GZUC 2CJJA 2NAZA 2ZMLA 2JDUA 4Z07A 2E36A 4MGTA 2QBYB 5LY1A 3LAGA 1COV3 3HBKA 5BS6A 1RGSA 4BACA 4NIAA 4EJTA 2XVGA 4IV1A 3GALA 4RR3A 2PMZA 3OG2A 1FNNA 3SFZA 4DRRA 4HVOA 5C8CB 4IF4A 2L9NA 1HKSA 3S1MJ 1NUKA 2ARCA 2JENA 3CO2A 1XSXA 4MTEA 3ASOH 4XONA 2XQXA 5DD8A 3P6BA 1HC8A 2HWC1 3IRRA 2Y0SN 3VBUA 1GQHA 2JKXA 2KRCA 4A3XA 3LSIA 4NO4A 4DPNA 4LT5A 2QQMA 5EP9A 1SD4A 4L9TA 4NMIA 4LBJA 1D0HA 5EWSA 2RM23 2O61A 3BIWE 4CHUA 2BVVA 2PLV3 1IF1A 2HVRA 3HM5A 5E1XA 1ERDA 1F2NA 2DMQA 2OF7A 4V2VA 1RUC1 4DY5A 4G9YA 1H8TC 2QZ8A 4WM8A 2PLV2 5HV0A 4E7SA 3OCPA 3CU7A 4X6AJ 3EYPA 1W8HA 1QPIA 5JXGA 2WS91 3IP4B 2JG8B 3ZFEC 3HR9A 2YPDA 4GQ7A 1CWPA 1AR61 5FZEA 5E17F 3WCSA 3ZYBA 2WA4A 3VEPA 1LPQA 3BJAA 3CCSI 2TEPA 3IPVA 1UY1A 1SHWB 3VKLA 4PLNA 4OQ9A 4Q4V2 5C3PA 5T50A 2YBSA 3WDWA 1IS5A 1SANA 1MIJA 1WGXA 3TQNA 1OC1A 2W1WA 3HRUA 1L7QA 2ZX4A 3RRDA 1SVOA 3ILRA 4FPFA 1DZRA 2OIIA 2ZGLA 3OEAA 3WGIA 1SVMA 2WZR1 3DYMA 2CY6A 2WINB 1ZRIA 1A34A 3F22A 4XKWA 1JKRC 3MV01 1PHMA 2FX0A 5LA2A 2PA7A 2RVCA 1LKNA 2COBA 3M3CA 2WV0A 5EEHA 3WDVA 2D93A 2RS52 3KFWX 3UYJA 3KLOA 2NMOA 4A5NA 3L09A 1RRJA 1R093 2P17A 1UYXA 2MG4A 4MX3A 2ISZA 4M3CB 1MKMA 2KKOA 4PJ0C 2ILMA 3J7LA 3AK0A 2G0EA 3AFHA 1REEA 5L9BA 5IVJA 3E6CC 3UL2A 1O57A 4A3JJ 5FZAA 3OY8A 4GJZA 1W5SA 3VZKA 5A3LA 5BNPB 5CVIA 2A3YA 4NIIA 4JRAA 1G86A 1VP6A 1T6GC 3M3OA 1FSEA 2LY1A 5LASA 1LQ1A 2JPCA 2WL1A 2F6CA 1JU3A 1W2NA 4UFLA 3BVCA 4DB5A 2CO5A 5DG2A 1L7RA 5FKCA 5AC92 3J7NA 4AK3A 2QCSB 4CDUA 5CG8A 1DF0A 3J7YJ 2DVFA 2Q2EA 4PHZA 4YVSA 4GYIA 2RREA 2BNOA 1XQNA 1OD5A 5L36A 2VJJA 4M9SA 3DPLC 1QXJA 5A3PA 2P5LC 4KGGA 1DQ0A 2G4IA 3DU6A 2VZQA 3S7EA 3KLNA 3V8JA 1OCCH 1RUE1 3POBA 1U3EM 5F0HA 2SBAA 2WT0A 1W0OA 1F1ZA 4C1WA 3TDZC 2KIUA 4HN1A 1UZVA 4NJ4A 1BEV2 1T08B 1Z21A 3BT9A 2Y30A 5LZ6A 4FT8A 2E5NA 1ENRA 4BH9A 3GGLA 4KWLA 4LHNA 1N3PA 2L7ZA 3QPSA 1QVUA 1GWKA 4QPWA 3RMYA 3WG2A 4DYCA 5J1RA 1LHUA 3CJIC 3U37A 1OKRA 5EZGA 3RZMA 3GW2A 2WO1A 1D8KA 3I53A 3CF5F 1UJ8A 1WLDA 1JODA 2HWE3 1FYMA 3I9V2 3IKTA 4BM8A 1MVEA 3NV4A 1BI1A 5TJJA 2JD4A 2D6LX 3OBZA 3O1TA 1OF4A 4OU0A 3ECQA 2XV4S 1QO0D 4RGKA 3L9JT 2XUBA 3VHPA 3BUCA 1F5FA 1S7EA 4P9WA 3K4MA 1JYNA 2VBXA 3ZR6A 1PMIA 3X29B 1W4MA 4MH0E 4NHYA 2ZHLA 1Z6TA 2ES3A 5SV8A 4HPQA 5CKTA 2JICA 3A2KA 1ZM1A 2E9QA 2VY0A 5C33A 4N4OB 3KP7A 1I9RA 4PJLA 3E1SA 4B7KA 3ZSMA 2H0BA 3AYAA 4BY1J 5FZLA 1T6BX 2HWC3 5CFDA 4HONA 4KA4A 4GB33 4KISA 2B7EA 1BIAA 2L01A 3J7HA 4EATA 4P08A 2VQAA 3JAMK 1R1TA 1PZ7A 1RMU3 5BNPC 3HQRA 4PIXA 3KP6A 2PLV1 1X19A 4MQ9F 4YARA 3RWNA 1OCOH 1AR83 2WS92 2YYOA 1HDKA 3RKYA 2OA4A 4YW4A 4A5MA 1CN1A 1GWLA 1JTXA 4E7KA 2ZTNA 2WNUC 4YFZA 2EXHA 3V8KA 4A45A 1XE8A 3HN1A 1SLBA 2XJUA 1BI2A 5HCAA 2VUMJ 1AZDA 3JU9A 1N3OA 2E7WA 1LNWA 5GJ6A 2CGOA 3FN9A 1RUJ2 4NWWA 3MI8A 1LECA 4BWOA 3J7MA 3AAFA 1TW3A 3OBAA 4MEYF 3ACGA 3L2YA 4PUSA 2FHRA 3IUOA 1IQAA 4E7HA 3AKSA 3FHQA 1REDA 4UVAA 3LFUA 2VPRA 2VOOA 4X8PA 3PIGA 4RA0A 5KR7A 4NBQA 3ON7A 3OGGA 4HN0A 1OVSA 4QXKA 1AKHA 3W20A 4QSHA 2WNUA 1G8XA 1ETKA 4H3WA 3DBHB 4O65A 2JIJA 1GFF2 2Q30A 1Z3YA 1TEIA 4LKFA 3RNSA 4HAMA 2H1LA 4XJUA 2XAGA 1YEWA 1CAXA 2DF7A 3RPUD 3ERED 2C24A 3PIPF 3A0NA 4K20A 3GFLA 1RKWA 5HPOA 1VQPI 1FOD1 4HKLA 4XLHA 1XNTA 1JYVA 4CPBD 5F0FA 4DIQA 5C71A 3I4PA 2FZ1A 3ZMDA 3Q8CA 1PM7A 1FWZA 5JIAA 4XN0A 5KXBA 2Y6KA 3ZYIB 2VZ1A 3T1BA 2VBPA 1YX5A 3J7AY 2B9UA 3VKNA 1HRI1 3O1OA 2KRHA 1UXXX 2W24A 2MEV3 1Q8OA 3CJIA 4UW5A 4NROA 1TNRA 3ECOA 2GXBA 2MH9A 2MHFA 1MW7A 1E3OC 1QEXA 1NLSA 4MNUA 2EAAA 3SISA 2W95A 1RXGA 1O4XA 1VBB1 2QQ8A 1V6MA 2VECA 3MIBA 4PBPA 5FWEA 1OLQA 4BB3A 2RS13 1GVDA 4KJZA 1VMHA 2XOMA 5FZ4A 2PMWB 2QJVA 4D6RA 3BZCA 1J58A 2KJBA 4EE2A 2DTZA 2Q8EA 4RM3A 1QHDA 3T0DA 1WD3A 1VBB2 2BDRA 2RM22 5GAHJ 5IATA 2JG9C 1CZSA 2OS2A 4XUQA 2CAVA 1VAMA 2MBFA 5LEJA 4AQTA 4QWNA 1Y39A 3S7IA 3BIEA 2FNAA 4M74A 2M4GA 1JU4A 3V7CA 1HN0A 2WAFA 2A6WA 2B9SA 1J5YA 3IRQA 4RB2C 2LF8A 4A69C 3HPNA 2BV6A 2I10A 3M70A 1YCIA 2VC0A 4GMP0 4IUGA 2WFPA 1Q8QA 5A1FA 3NVCA 4XQDA 3IAM2 5FZOB 4AYUA 2DU0A 1CAVB 1UZCA 4H7LA 4RB1A 4HBNA 4BJ6C 1NCQA 1ND3B 2ZXJA 3OUHA 1W3VA 2J1EA 5FPUA 3N9MA 4KGQA 1E17A 4LK6A 1D8JA 1MZ5A 2HWC2 5AVPA 4CE8A 1YFUA 5JFRA 2R5YB 1LTEA 1A6IA 1K12A 3UGGA 5FYSA 2F6BA 2W94A 2M5WA 1XRUA 4IO9F 4MSVA 4ITCA 4XSXF 3F6VA 2Q0OA 2VONA 1H6YA 3A0KA 3ZMZA 4CU8A 1MEC1 2A75A 2YDEA 2DQLA 2IA1A 2FDIA 5LATA 2NQYA 1G9BA 3IC7A 2RQPA 5FKKA 1FOKA 4IRHA 1NOVA 3CLOA 4CYCB 5E88A 3RZHA 3SHFA 1YW8A 4FSJA 5APAA 4B1LA 1R49A 1MR5A 4AUXA 2TBVA 4EWEA 4XRFA 1JGGA 1QA6A 5IYCJ 2D1HA 2F4PA 4YRVA 1RUJ3 2FXAA 3S93A 4EEFG 4ZYGA 4BQNA 5E16A 4A6EA 5EYXA 5A1LA 3JD73 2W25A 2JTVA 4B7EA 4LQRA 2XF6A 1MDMA 1S0FA 4EN7B 4ZTFA 2P6CA 3CMAI 2W0XA 2R5ZB 1VRH3 3CUQB 2UU8A 3AKQA 3MYXA 5C4JJ 1K5JA 3D5LA 2GN3A 4AVTA 2WAOA 3RQ4A 1NKGA 3MKZA 4C2UA 4IHSA 1D4M2 3SKVA 3AC0A 4UB8C 3PDQA 4WXDA 4LBMA 4MHGA 4LLOA 3BOQA 3HKZA 3HJEA 3ZQHA 2EF6A 1XC6A 5IVCA 2V5YA 5CA6A 2IBDA 4LORA 3USSA 1T0FC 2FF4A 4A44A 2R071 1EP0A 4IEOA 1P92A 3MPBA 3ZMTA 3IKVA 1OLRA 2GIZA 1O4ZA 1RITA 4AEDC 5KK1A 4A7YA 3DYPA 1SFOJ 5JI6A 3I55I 3HQXA 1NQJA 2VXDA 1V9U3 3NSTA 5FUNA 5DXDA 5JHFA 2FOKA 1XOYA 5JSOA 3CZUA 3WGGA 1ND2C 3AZVA 2BZDA 2OW4A 2ADEA 4QX7A 3OYBA 2OUMA 3W9AA 1JT6A 2X1CA 3R4DB 5HXMA 2AEZA 3PURA 4Y52J 5H6RA 3OR2C 4JGZB 4WZFA 1EH7A 2X6OA 1MZBA 3H3UA 2HWE2 1W0NA 5DCMA 5JOYA 5LA0A 2V7FA 3MZYA 2H6CA 4EMSA 4JHZA 3S8PA 3OYGA 1ALYA 5IP6A 3BI3A 2VQHA 4IETA 2DYSH 1OVPA 5CISA 3WTVC 4I3GA 3H0OA 5BNPA 3COAC 1OLMA 1SQ4A 2DFEA 3J8F1 1J1LA 4I98B 2YG0A 1BW6A 3O14A 5ILVA 1SDDB 3D4KA 4LA3A 1NLQA 5FUIA 2CDOA 4HVRA 3GZ6A 3MW4A 1T6SA 4XW3A 5CYVA 2GC0A 3OSFA 5JUVA 3D0JA 1NCRA 3HUGA 3R4SA 4C2TA 2YROA 3MLLA 2D6OX 2O8QA 1D7PM 1QZZA 1J83A 1KEXA 1W6OA 2PHFA 3O0VA 5FP7A 2A6EF 3NJXA 4ENKA 4NNJA 1S72I 1TWFJ 2NRAC 3P9IA 3RPUA 2NPIA 1W36D 2XGEA 5ICCA 5A6XA 1ZRCA 4QGMA 5FYIA 3TO7A 2Z99A 2WZPP 1BOBA 2DCKA 3BJOA 4YSFA 2XUEA 1KU7A 4IGQA 1W9TA 2ORXA 2VMIA 1E57A 2DOAA 1PP7U 5EJ3A 4UFIA 4W50A 4PJJA 4XCAA 2XGDA 1X1CA 2COMA 3G4SI 2M9HA 5FZKA 3VZMA 3I97A 2VOTA 4QXBA 1P7JA 2BYVE 1JKQC 4YZ5A 5IVFA 3LOBA 4MFEA 2M0MA 3BTJA 4HLYA 4N7IA 4LO8A 3VYUB 1D5VA 4XFBA 1RC6A 1G3WA 2EFQA 2LYCA 4ZH4F 1MS3A 5F1JA 2MSYA 1ZBE1 2GP3A 3FXLA 3O5SA 2VPVA 3WHCA 2BE5F 3T1LA 3AKRA 4LBNA 1SBDA 1AHDP 2E2JJ 3VYRB 2H09A 1BYHA 4FX4A 2G9GA 5A7WA 1A31A 3I49A 1Z0HA 1TWGJ 3IH3A 3A1YA 4IE5A 2EXKA 4YIFA 2XRLA 3H7JA 2XL9A 2A7AA 2HOAA 2WBKA 5IWFA 2X8KA 1XG1A 5HV4A 2JVGA 2VXZA 4P02B 3IT8A 5F5AA 1U0AA 1RUI3 4FAGA 4LLNA 3W2VA 2YPRA 3Q5FA 1C8M3 3PUSA 4WM8C 3ES1A 3GDBA 3NRUA 2ELKA 1NCQB 4O6JA 2WN2A 3WTSC 2IZWA 3TEZA 2F4LA 4CDGA 5IY5H 2RDNA 3GUDA 2DPDA 2DFBA 5BOXA 4LBQD 5EJZB 4V19K 1KONA 2BW3A 5TGTA 1AR91 2EA7A 3OS1A 4EZ4A 1RNLA 1I50J 5HDNA 5J40A 4C0BA 2GP5A 2ZFWA 1J59A 1FYLA 3MD2A 4I09A 1NXD1 4Y5Z0 4B3XA 4AC0A 3PUQA 5IAXA 2NYXA 4NHKA 2F5CA 2HEVF 2RHPA 2UURA 4HL0A 3DP7A 4L2NA 2YFUA 4RLQA 1SFNA 3RZDJ 5H9QA 5LBEA 3CMMA 4V2GA 3M3IA 4RGAA 4ZONA 5C7GA 4Y20A 1ZA7A 2M30A 3K1MA 4YELA 1IN6A 2DU9A 1UO9A 1UY0A 4E4DX 1ZZBA 3IB3A 1U12A 3WDYA 2EFOA 1TVGA 4YVSC 1HDPA 4GIQA 2ZJPF 3FIWA 3PUAA 2ZHMA 2FD8A 4XNFA 2M0CA 1Y4WA 1FPQA 3IHUA 1MBFA 3NAPB 2VZPA 1AL22 1EYBA 2W1OA 4CCOA 4NN0A 3J7ZI 4BHBA 1BVVA 1V3FA 3LF7A 2XAJA 2R30A 2VJ5A 1O4TA 3KD4A 4ASMB 4DUVA 3ZVXA 3R4UA 5FFXA 1JYXA 5C4WC 3ZFFA 4MFDA 2JEMA 4F91B 2WAEA 3AP6A 2R49A 2Z33A 3I4IA 2P7VB 4OHYA 2CUZA 5FKLA 3T4HB 3WTUC 3JSPA 2R7DA 5FZFA 3N9LA 2FBIA 1RUF3 1OCPA 2XB0X 1C28A 5H9RA 5FQ0A 1LOFC 2DMUA 3MKWB 4IHWA 1ULOA 3T8TA 5GAGJ 3GTOJ 4DRVA 2UWMA 3K0LA 1MEC3 3WG4A 3AJYA 1JHJA 1XSDA 4G12A 1Y9QA 3BZKA 2GOXB 1T56A 1HXS1 5JR7B 1HB2A 2Q4SA 1K5MC 1FMD1 4JDNA 2CV0A 1IUYA 3KETA 2KD7A 4HT1T 3B6CA 1U78A 3NO8A 2MD0A 5E3OA 2OCCH 1GZWA 2DBIA 2XKOA 2X48A 3ST7A 3H1CA 2RDRA 1S29A 5GLWA 2VT2A 4HK8A 2JJ7A 3UKVA 1H9WA 3J9SA 1UNBA 3ZR5A 1QOSA 2BOIA 3QPHA 5JLVA 4ZU5A 3BJ6A 4U36A 3DN7A 3OPTA 2VBYA 2VTXA 4BA6A 3W6KB 5JVGF 2RR13 1Z77A 2E6VA 4FCAA 5JLXA 1LVKA 3T2TA 4MG2A 1HDDC 4OMYA 3IMMA 3K4ZA 1RIRA 2VLAA 3T2PA 5CQGA 1TQ5A 3HOWJ 4UFKA 4BLIA 2FU4A 3SXWA 3VD7A 3PUFA 3KF3A 3TBIA 1JGSA 1ITYA 2OKXA 4BMEA 3AKZA 1G59A 1HF0A 4JQTA 4A3IJ 4IHVA 4D6SA 4ENNA 2R0HA 3T0AA 2P81A 3VKOA 1UPSA 2EIDA 3DF0A 1OPMA 4UXAA 3HOYJ 1IXSB 3HC7A 2HYGD 2QKDA 1DGLA 5KHGA 2HDDA 2BOJA 2AZ5A 3WTTC 3BG7A 2Q8DA 2VG9A 2PN6A 2CS3A 2BY3A 1MMNA 3ZMUA 1EAH2 2JG9B 2TDXA 1APLC 5H20A 3FXQA 3LEGA 2X5IB 4OUEA 4PCQA 3VDDC 4QX5A 1U2WA 2JQ7A 3HZJA 1JYCA 3KT4A 5BNNA 2PHRA 1BR1A 3ILFA 4F55A 3CUQA 1ODMA 2YUEA 4HOBA 2K85A 1VBA1 2C6YA 4L0PA 3CCMI 2FZ2A 3POIA 4AWXB 1VRH1 3WE3A 4MXVA 2EIEA 1AX0A 5D5VB 3TNPB 2CGNA 5T5OA 3BPVA 2PQSA 2DTRA 3ZXDA 1YQ5A 1MMDA 5I0TA 5SV5A 1AKHB 1SLLA 5FY1A 1Q1VA 3FMGA 2YB7A 2RR12 4BLJA 4YGCA 1H2MA 3LDBA 2XPUA 4XMIA 2PLYA 3O6BB 1FZPB 1SFUA 4C3HJ 2Y6HA 2VOXA 2BPA2 1SBEA 3H8UA 4L5EA 3SH4A 3ZO0B 1I5PA 1RUD3 1GZWB 1W03A 5K5RA 5CFCA 3EYIA 2X4HA 1YQ6A 2NOGA 4UWDA 2LC2A 4AHXA 3BGAA 1B8IA 5ICFA 3ATGA 1WCUA 1QDOA 1WJBA 4DJAA 4EWDA 1Z0XA 4YZ1A 2DU1A 4D7YA 1GP5A 2DJIA 1JZ5A 3LEMA 3OYLA 1V9U1 4J01A 3K46A 4IOAF 2YSRA 3NWKA 3ZN5A 4TLGA 2WV1A 4YIIA 3UJOA 2X6YA 5DPNA 1AJOA 2A6ZA 2XJSA 4P96A 5DDJ3 2R043 5FO7B 1W9FA 2HWF1 3OIOA 4C30A 4M01A 2XPJA 4LXLA 1Y8RB 1PMHX 1K4TA 4WM7C 1UAIA 1ULPA 1MJBA 1BEV3 1QNYA 1TNTA 1YC61 3VV1A 3KEQA 2C5DA 4LUKA 5A2QZ 1FMVA 2NS8A 1SAXA 1W6OB 4GB31 4QQOA 5EPAA 3TKYA 3VYTB 5KXEA 4BK4A 3WTYC 2MEV2 4LLFA 4Y5SA 2VTXJ 1UOJA 3ZQ7A 3OR1C 5C5TA 1W36C 1QRYA 4DGWB 3RJRA 3VZOA 3VBFC 4AHWA 2VJXA 2VO5A 4CDUC 2P2KA 4CDXC 2Z2SB 5F2SA 1WWXA 2HDWA 3AMHA 5EEGA 2FCVA 1HW5A 1LOGA 3BU7A 3KZIC 4AI8A 3U2RA 2BXYA 4BKXA 4TTGA 2VOWA 4F3QA 1WZ2A 3N36A 3S3OA 2WYSA 1BIBA 3IAPA 1XGMA 5FPVA 3VBSA 4YYOA 3MWMA 3G7DA 1V5GA 2O8XA 1G3TA 1WQ2A 3HT1A 4KU7A 3FXOA 1R5GA 3DPTA 3W21A 3POJA 4AZZA 1LHWA 4XACA 4JKLA 5FQ0B 4E4ZA 1X58A 2R93J 2P5BA 1LHOA 2FDHA 3EUKL 2FCTA 5FLXK 1QJZA 2UYAA 3M4OJ 4CICA 5J8CA 3ZCOA 1XE0A 2ZHNA 4OUSA 4S2GA 5JSPA 4S2HA 4L8QA 1OISA 4G6DA 3OS0A 1VTNC 1CX4A 3SHRA 4CCEA 4ZZLA 1MMAA 3MGUA 2QTWB 2AS5F 4LFUA 1K45A 4AE2A 2XF7A 2WZ8A 5DUXA 1F4KA 4M3BA 1MPXA 4XTPA 3GFIA 3JRAA 1W8ZA 3KHCA 4UB6C 5DUKA 2D44A 4IKFA 3AP5A 1VBE1 2JT1A 3OYJA 5IK7A 1O3RA 5HCFA 1UKGA 4KWJA 2W39A 4LG0B 1HB3A 3O8HA 2PJPA 1G9CA 1VQ4I 5FLXZ 1HRV3 3GTKJ 2A3SA 1LDKB 2CAUA 4O61A 1FI2A 3ELKA 5H9PA 4U0VA 4YGBA 1NA1C 1AOYA 4KNCA 3CUQC 2L5QA 2K9ZA 4YG0A 3KCCA 2XVLA 1TWHJ 5A7NA 3NAPA 1B35A 4NHJA 2P34A 4H14A 3AVRA 4FPCA 3K6GA 4V2WA 4EQQA 3I2OA 3POFA 2R7FA 2X9DA 3AG4H 1HSTA 2MC4A 5KCMA 2VGDA 4Q0PA 1FJLA 2WN3A 2BUKA 2GNTA 2YBKA 4PQQA 5F5QA 1WD4A 1WSUA 1JUMA 1XD7A 4FHTA 4HXCA 3MPPG 1K6OA 4PDKA 2FOWA 1FY7A 1ONVA 1SCSA 1RUI2 1T98A 4ISQA 5JI7A 1HB1A 1R091 1TZOA 2R072 3HTUA 4CU6A 3HNBM 3NV3A 4ZS3A 5ILSA 4NC8A 2HBUA 4UBGA 2RC4A 3CDHA 3M9AA 4TXWA 4COYA 2K02A 2X1DA 2A69F 2VM9A 1G7YA 3FHIB 2WS93 1KGSA 2B0LA 1HKDA 1FATA 2F5FA 3LSHA 3KM5A 1R1A3 3B00A 2E35A 1LOBA 2WO2A 1YHQI 3KF5A 2LY2A 5K0UA 3VDCA 4L9BA 2EIBA 2IXLA 4XVHA 3TEYA 2EFPA 1FMD3 2AENA 1JZ2A 2YU2A 3LOCA 4Z2AA 3HKZN 3LPFA 1VLNA 2A1XA 2DBBA 3OMYA 2XQRA 1GT0C 1H2LA 3KEYA 4B09A 4AU7A 2V6CA 4DS0A 2XVKA 2RNGA 2RG4A 5FYVA 4QPYA 3VBOB 2KFDA 3HEFA 4XLCA 4RS8A 2DFFA 5EZHA 1UL9A 1JZ4A 3W6VA 1D0XA 1DQUA 3HSEA 5DUUA 3GYHX 1OCZH 1VRBA 1ZTRA 3M4FA 4HA8A 2W4SA 3BLYA 3CZ6A 1GZ9A 2RGVA 5M3MJ 4IGOA 2HQNA 1POV3 2Y31A 1OR7A 3GZAA 5C9AC 2DA5A 2WY7Q 2BW3B 2E7TA 2VPLA 1QJX1 4P55A 4UI9L 2QQOA 1P4WA 1JJ8C 5JPMB 4QX2A 3ZSLA 2JA7J 2LNBA 4ORFA 5A70A 4QHZA 1YYNA 1QZYA 2C1FA 3WP3A 5FZ6A 4XDPA 2WABA 1CAUB 5C8CC 4QKDA 1DGWY 5D5UB 1X82A 1S2EA 2M87A 3BPSA 5F1RA 3GMEA 4AVCA 2PJRB 5CVRA 2OTLI 2VBBA 2AYHA 3B9IA 3N97A 1CIWA 4AVSA 4XQWA 2DT7B 1LEBA 5I0RA 3CQOA 2IT0A 5T5PA 3U1KA 2LG4A 4WF2A 4WZCA 3ZN6A 2Y0MA 4BDYA 2XJQA 4XC9A 3DLLF 3T08A 1TNFA 5E8AA 4IRGA 2VVFA 3FMQA 3GZNB 2ID4A 3J81Z 2F17A 4AIHA 4CTEA 3P7NA 3SJMA 1FEXA 3CDIA 1GP4A 4QPIB 5K4LA 3I4NJ 4NAMA 1UMHA 1JMUB 2B39A 1ZBE2 4I99C 3B93A 3CCLI 1OQ1A 4LNVA 2QSGX 1EKEA 4BBRJ 3HUGB 2Q5TA 3KV4A 3F95A 1HKQA 1AF9A 2W1UA 3T2QA 1I3AA 2EZIA 3C2UA 4Z2YA 3WF3A 1BK1A 4CDQC 3FBYA 2DUOA 1IKQA 4XF3A 1CR7A 1C3HA 3AB0A 1DGWA 4QWQA 4W4ZA 1LR5A 2OC6A 4B44A 1CJDA 3KZ4C 1R092 4CGZA 3LB9A 5LWBA 3T30A 2LROA 4HLXA 4KFCA 1SDWA 5AVAA 3GBWA 2R1DA 3K10A 4UYBA 2ZKNA 4Y5TA 2WT2A 4CSWA 3OOXA 1YYVA 2WNUB 4QXCA 4OI1A 2NYYA 3S0MA 2W08A 3A02A 1R1A2 2OD5A 2BFUS 1SMVA 1UMQA 2K7LA 5LFAA 3QRFF 2WWJA 4CUBA 2V1DA 4Y3OA 2VCCA 4HYEA 4NRMA 1OF3A 3V64A 1IRGA 1GMMA 4H2AA 3NNMA 4BXSV 5FDBA 4WCGA 3OYMA 5ANNA 3LSGA 2QQIA 4XN3A 2HJIA 4J1XA 3WHUA 3KE2A 1ZH5A 3FISA 1ZZCA 2Z69A 1O91A 3M8EA 3B7MA 4ARYA 1BBT3 5FP3A 3THDA 2LVSA 2CW7A 1O3QA 2R7UA 4DXSA 2VQLA 1IQDC 1B8IB 4NR1A 2E1OA 5I8TA 1I3HA 3H9AA 2EQRA 1NZCA 4WK8F 5AC91 2DK8A 4E6KG 1I3QJ 3VBUC 3C3WA 1AL23 1RUH2 1W2TA 2ZXHA 1G9DA 3BZ6A 1RUOA 1UU5A 2WRAA 3WTXC 3FHZA 3VHRA 2GIVA 4JGYC 2J22A 2CHHA 4OCTA 2HEYF 3CZJA 4AGRA 1R22A 1BR2A 1QJFA 5IYYA 3KB5A 4COZA 2LR8A 2CUFA 3ZQGA 3S1NJ 1JH5A 3K4DA 2CUJA 3OY9A 4BYYA 5GTIC 5FPZA 3A01A 4GALA 2ATFA 2FA5A 3WUDA 2ELJA 3R0AA 1IHMA 1W2OA 2LP0A 4GJYA 1OH4A 3BTLA 3J81K 1AHSA 2IXIA 2O8OA 3NQOA 1W9SA 3CF6E 1AU7A 1QJY2 3LE0A 5IP7J 1PYVA 5DAXA 1BHGA 3U78A 1TNSA 3WY6A 3ZFFB 1W8FA 2D97A 1I5ZA 2JWTA 4HV6A 4ZTJA 2I45A 4F83A 5FYCA 4IV3A 4AXOA 2IVIB 1CX1A 2ZGSA 5B66C 3R05A 3F23A 1Z05A 2P3YA 3HMYA 2L7MP 4CU7A 4AVPA 1RUD1 3ROUA 3O2PE 1IW7F 2K3PA 5CPRB 1E5HA 2EK5A 3DXJF 3I3MA 2IUWA 3VHNA 4CP9B 3CEWA 3O8GA 1HA8A 1BR4A 1UMZA 4EN8B 3RWKX 3DLAA 2CQQA 2V9PA 4PDWB 1O7FA 5BV6A 2JB4A 1H8TB 3HB9A 4XDOA 4MHUA 2W2IA 3NW4A 1POGA 2GXAA 1WZXA 2RKHA 4MXWA 1AYN3 1WJCA 2FDFA 3CDZB 3POYA 1BI0A 4MGKE 4MZUA 2XSDC 2W87A 5J1UA 4BUPA 2WTEA 4L9NA 1PGSA 3CCJI 3H50A 2E60A 3PIOF 5D6FA 4XLFA 2JE9A 2GAUA 5CYYA 5LBQA 2WNOA 4Q26A 4IDZA 3CCYA 2BGPA 1LULA 2A71A 2MW8A 2Y38A 2WT1A 2EPFA 1FAYA 2K5CA 3ACHA 3OTFA 3I0TA 1ASJ3 2R5YA 1Z6RA 1DGRN 3SCGA 3ASNH 3NQHA 2XPWA 2XBO1 5FMOL 2WZEA 2IA2A 1R4MB 5IHRA 5M3FJ 5A6QA 4A2UA 2PFWA 2QQKA 4K40A 1GANA 3KVAA 5AIPA 1EAH3 1BKZA 4EROA 2VL4A 4HPKB 4P14A 4UT5A 4I3PA 3HIFA 4LIVA 4PDWC 2HWB2 3LSDA 3HT2A 4N43C 2LALA 1C5IA 2FDJA 4XABA 3OD4A 1DGWX 2JK3A 4KMQA 2RJLA 3S2WA 3ZN4A 1XPXA 4NQWB 2A6XA 2VOPA 1IGOA 4XYXA 4J6GA 3BTYA 4GWJA 3HOTA 4NPRA 3WW4A 3QYFA 9ANTA 4Y17A 3WUCA 3KZZA 4M3FA 5F9TA 5F5IA 2BV4A 4JP0A 4EZHA 1KDKA 4HMZA 2UWCA 4JV4A 1ZR4A 1OOPA 3RSJA 1UCRA 5FZ9A 3N7LA 3J4UH 5DV5A 2IEKA 5C8WA 1YOVB 3O12A 4PDWA 1LOCA 2ZGUA 1YNAA 3M1CA 1R5ID 5FV3A 1N1YA 1OA4A 5A33A 4PF5A 3G73A 3JRCA 1GQGA 2W1QA 3ZYHA 1GV9A 1JJ6C 1R9TJ 3ML6A 3TAYA 4LR4A 1JUIA 3NJZA 4HV5A 4FI9A 1S55A 2ZGRA 1H4GA 1UKRA 3WDXA 4W6WA 2Y6LA 2HWD2 3KZYA 4A3BJ 4A3LJ 2YR2A 5FZ0A 4N53A 2E34A 2VTFA 2XJPA 3RZKA 3K2AA 4PI0A 3JR9A 4IQPA 4FQZA 2WB1N 2GLOA 4K8FA 5I0UA 1W8TA 3FKIJ 4P5HA 1B72B 3NAPC 1V6JA 2DDAA 1QQP3 3LZZA 2XHNA 2X1EA 5JZGA 1DP7P 2LREA 3TL4X 2EIJH 2Q1ZB 3KP2A 1GNZA 1DQ6A 1JS9A 4BDZA 4CH7A 3H0DA 1UYPA 3BTIA 1IOAA 1CAVA 3LGRA 2YGLA 2DCEA 4CEWA 5FJ8J 2QSHX 1X1AA 1TT0A 1Y1VJ 2BHZA 1GXQA 2P3JA 5EDNA 2HFHA 2BTVC 2ZO4A 3CCRI 1UY2A 2D1VA 1W0UA 5F27A 1G9FA 3A4CA 1V5FA 2DA2A 1VQKI 1MMGA 1ZQ3P 1DQ4A 2NVXJ 4Y1YA 1FXZA 5FXXA 1AXYA 3ALQA 4MOAA 3IIAA 4Q48A 1PGW1 3B9CA 1EV7A 3O0WA 4D7SA 5C44J 1ZVFA 2GN7A 4XLEA 2XONA 5FIXA 4KN4X 3I3QA 1WCMJ 4ET7A 4GCVA 3WTWC 5DTDA 3PNVA 4BAYA 3ZXLA 3HOZJ 1JHNA 1S0CA 1YO8A 4M0HA 4CEYC 1IV6A 1RUNA 5FKMA 1W6MB 4Z8BA 4QPGC 2WNVA 2EFNA 3GNEA 2CG4A 1K79A 1LCLA 5A1AA 4FOWA 4A3MJ 2JDNA 3ORJA 4A3ZA 2GNMA 5CIRA 2RS12 4LBKA 3S5AA 2OT7A 3PU8A 2ZJ2A 1YUDA 1SLAA 2WWSA 1VQNI 4XJWA 2EJRA 3A01B 4NUBA 5EJ1B 5FZGA 4WWCA 4J19A 1LUJB 2RS53 2FQ3A 2E1CA 4Q5SF 2HEWF 4K8RB 1RL3A 5IYBJ 4ZHNA 2Y60A 2P6HA 3VBFA 1PK6B 4FFFA 4AI9A 3ACLA 1S0EA 2PQ8A 2NS0A 4WVMB 3EMRA 3WW1A 3EXUA 5IFPA 4AWDA 1MGTA 2UXNA 4CUCA 1B4AA 3AL0C 3A23A 1GP6A 3MUZ1 1Z7UA 4LO4B 1W6MA 2Y0IA 1ODNA 3C7OA 3HL2A 3EB7A 5C3QA 2ZGTA 3QH6A 1QQIA 3PL8A 5T52A 4C90A 1XGNA 1WWYA 4U87A 1LJ7A 2QDNA 4JX5A 4I0BA 2VE1A 5FGMA 1KU9A 3VBFB 3VBHA 3O3KA 4QPIA 2OJED 1MACA 5B1AH 2KXLA 2IS4A 4ESBA 3LAJA 3WW3A 5EIYB 1BJAA 4C9YA 3C8XA 3I2JA 1LVAA 1U5TA 3VBOC 2VODA 3DWLE 3CNAA 2VVEA 2QE3A 2O1QA 4XEZA 2YMZA 4B8EA 5CG9A 2LBFB 3U4XA 3BDDA 1IDYA 2UV1A 3GTQJ 3C7FA 4MGIE 1QIQA 3TB0A 3TN92 1S0BA 3VFZA 1AL21 1O8SA 3IDAA 4YVSB 4N43B 2NM1A 2FD5A 4LK1F 5BNNB 1V5EA 5T55A 4UAPA 3U1XA 3IBMA 3URFA 4DZPA 1QDCA 2M2EA 4LO7A 3V65A 4CDWB 3RZLA 3VDDA 1PGL2 3LSTA 2VVDA 1MJ9A 1VQMI 1DBNA 1CF7A 1C8M2 2YX7A 3RYPA 4Q4V1 2VAUA 5K7PA 2ET7A 3EDPA 1Y0NA 1SEFA 2ELHA 1KYZA 1ENXA 1BK0A 4OI0A 1IUFA 4BXUA 2XSJC 3D5SC 2JDMA 2BHYA 4BBSJ 3PNYA 3H36A 2L54A 1ZGAA 3TO9A 2RJ2A 2XB5A 3VBUB 3L00A 1QGPA 1AUYA 3PVOA 4IL6C 1ZN2A 3I3BA 4UF0B 1U8RA 3NV1A 1XYNA 1J2XA 3V0AA 4QX0A 3DCFA 5FD6A 3RJ2X 4IXLA 3NKTA 3WQBA 4FAHA 4BQ2A 5BNQA 1T95A 1B6AA 5JMOA 1X3ZB 5BNOA 4II2A 5GZCA 4HX8A 3VOEA 4URTA 4UUSA 1RUF1 5K7FA 2G7UA 2Y6GA 3MFKA 1JI8A 4RQPC 1SFYA 2VMHA 4OFGA 4CZZA 3BTCA 3PVBB 5HOOA 3DXUA 4Y22A 3WNKA 1QVTA 4QPQA 4Q4Y2 2KHMA 3ZYRA 4AFBA 4L18B 2QSFX 1NY71 5DDJ2 5ILUA 1F35A 3K4BA 1K42A 4OIOF 3P1IA 4K2EA 3LPGA 2CTVA 2CYYA 2M34A 1EUUA 1V70A 1Z7S3 3LA7A 1B72A 2E2HJ 1BJQA 5IOZA 3H42B 4XF4A 2CFOA 3C2GA 4P1WA 1VAKA 2C4XA 5FYZA 3W6JB 5JR3A 1YITI 4QB1A 2IC1A 1MD0A 4AI0A 5LA9A 5FTTC 4O9EA 2WWYA 2KPMA 5F5CA 3AMPA 4W6XA 4A93J 3T0BA 4KG0A 1V6LA 4FP2A 3F8NA 1TBXA 3ZYGA 2BWCA 1XMXA 5CFCC 2XC7A 1W9YA 4Q1RA 2P5VA 4R4XA 3FKJA 1WW5A 4HKOA 3WD5A 2XDVA 2CDPA 4KDPA 5IK8A 2G9FA 5I0SA 2LS6A 2IFWA 3C2BA 5L3BA 2UY9A 2P6TA 2JDYA 4XLPF 5HNFA 4LBLA 4HSLA 4DQAA 3LFKA 4IE6A 4I2OA 3SLIA 1AYN1 2PHUA 4JGZC 3JTHA 5BPXA 1U6GA 2QQWA 1TME2 1XE7A 4LPLA 1YFYA 3ZN0A 1F9KA 3CBNA 1YI2I 4CDUB 5BPIA 4OAYA 3WF4A 2JDAA 2RDQA 1ULGA 2ZXWH 3N4MA 3QACA 4FQ4A 4BQ1A 1R00A 4FVVA 2WQ8A 1D0YA 1RTVA 3GJBA 3PJQA 1IRZA 4P9UA 4QPIC 3P3PA 2LRPA 4BHPA 4OI2A 4EJWA 3D1NI 3ECHA 1BZWA 3NV2A 4KU8A 4HETA 5CQEA 4LK7A 1W8OA 4Q27A 1TMF2 3M8JA 4MO7A 4INDA 2F5EA 4CXXA 5L3EA 4IGPA 3OUJA 1VBD2 4MXWB 5DG1A 3KYDB 5ERIA 4UVCA 1GV5A 3K4CA 3A0BC 3GCWA 4LBQA 4QPGB 4O5VA 3LEIA 3OYAA 3FM3A 4CPBA 4LKEA 4B4QA 4Q47A 4XORA 5BXXA 4H0EA 2NLRA 1Z78A 2AACA 1RC9A 2CFXA 1XNBA 4JDMA 3OL4A 4IEJA 1IG0A 1W6PB 3GZ5A 2DJNA 5KHHA 4IPAA 1CVNA 1WCSA 3DKYA 2V4JC 4YW1A 2PMUA 5LA1A 3K51A 2XRNA 5FY0A 1HIXA 5FAXA 2XPVA 4IV3C 1IN4A 4AF9A 5FZ3A 1PO21 3WV6A 5LGTA 1X1PA 5J36A 3QLQA 2V5DA 2E5ZA 3BR3A 1ZRFA 2IS1A 4QM8A 3SCFA 2GALA 2B7YA 2OA2A 1FBSA 1VBE2 2XR4A 2R7XA 3HOVJ 1GSLA 4Q8LA 2QQLA 5J3LA 1YJLA 4J00A 4OMDA 4MLOA 2PFBA 4M0NA 2OQRA 3W2WA 2J1SA 3P9CA 1K4SA 2HOTA 3SYTA 1NA1B 4A6SA 2K86A 1F43A 2WIIB 4BE3A 3VBRA 3E97A 4CXYA 1L3LA 4SLIA 1HW1A 1R5HA 5IT9Z 4GD4A 3GHMA 5DAPA 2ZGOA 1XTAA 4HEA2 1WJDA 2B45X 3BCBA 2VJ4A 2CUEA 3OPZA 1EAH1 1J9IA 1RUH1 3BR6A 4LIUA 3L2UA 5JLWA 2W5FA 4XUNA 2RNJA 1FMWA 4XFAA 2H8WA 3I2FA 4AQ2A 4EM1A 3QU6A 1VI0A 2XF5A 2VZVA 4WVWA 1GDTA 4PI2A 4DY3A 5BPDA 1VF9A 1RZ4A 3VDBA 2VE9A 1R1UA 3LSKA 3HRSA 4W97A 4LULA 1RIOH 1HX6A 4WM7B 3ZQQA 1F5TA 1S1AA 1KYWA 2LUWA 2ZAHA 4N90A 4PF1A 5M0TA 1PDNC 3N35A 4NWVA 1DFQA 3AKPA 3UJQA 4NIGA 2VKVA 4QDSA 4TZDA 4XIDA 1FT9A 3FK6A 5ABJC