5LEJA

The transcriptional regulator prfa from listeria monocytogenes in complex with a 30-bp operator prfa-box motif
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
236
structure length
236
Chain Sequence
NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for glutathione-mediated activation of the virulence regulatory protein PrfA in Listeria.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Transcription
molecule keywords Listeriolysin regulatory protein
total genus 69
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5lejA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5lejA01
5FLHA 4EJTA 3BDDA 4G7OF 5JFRA 4IEOA 5LHGA 2GH2A 4KMUX 4AVAA 1FY7A 4IHTA 1ZG1A 2M5WA 3FMSA 3DL3A 2BE5F 1TBXA 3KEQA 3TDUC 2PHLA 1OPCA 4G9YA 4XFGA 3MQ0A 1BI2A 1XGNA 1ZZBA 3FHIB 3EDPA 3E5QA 2HZTA 5LGTA 1GQGA 4L0ZB 2FSWA 1G6NA 4OIPF 4KICA 4M74A 1CAVA 2OZJA 3O3KA 3RIRA 2GC3A 3E97A 3H50A 3EYYA 3KZYA 2PFWA 5KVRA 3TQNA 4LUKA 2K4BA 2R3SA 1RGSA 4QGLA 4XFBA 3I7DA 1F4KA 2UYBA 2K86A 2PEXA 1O3RA 4U88A 4IEWA 1IRFA 4ORFA 4GYGA 4HV6A 2HQRA 5D8KB 4UUVA 4OOIA 1S29A 5FLIA 1FLIA 2ZKZA 5E1XA 1PP8F 4GXOA 3F6OA 4L2NA 1RC6A 3NW4A 2CV6A 4F8AA 1DPRA 2D2WA 3CTAA 2FNPA 1JHHA 1S7OA 3WTVC 2EA7A 3CUQC 1ZLJA 2HDCA 1CAWA 2FMLA 4LULA 4G7HF 1UD1A 3GX4X 3WU1B 1LB2A 2B8MA 3ZN1A 3V7CA 1X8EA 2GAUA 3E5UA 4HMZA 3CO6C 1E17A 3I0TA 2IA0A 3LQQA 2MHFA 3S7IA 4Y17A 1HBXG 3FXUA 1RTVA 3MFKA 2LSOA 1UIJA 2EFPA 4L5JA 2CG4A 3RPQA 4NB5A 3VOEA 4XLNF 4QMAA 1ZREA 4IEPA 3U1DA 2I45A 3WGGA 3LOIA 2BEOA 5J8CA 2H6BA 3E6DA 2ZJ2A 2XUBA 1GQHA 1SMTA 5DD4A 2NNYA 2GC1A 5D5WB 4IEYA 2OU2A 3IRQA 2HTJA 4I01A 1HQCA 2IRFG 1JGSA 3TNPB 2L3DA 1YYVA 4QWQA 4MGKE 4E2GA 5KHKA 1FP1D 1QXJA 4E2QA 2HOEA 3OV8A 5CVJA 1BM9A 4EMSA 4WXCA 1CAWB 3VHRA 1SD4A 1ZLKA 1F5TA 2MBFA 4OLLA 2PAEA 5HVQC 1C0WA 1HW5A 4LG0B 2ISYA 2STWA 2DCTA 5I8YA 4QLCU 4HF1A 2BNOA 1J0RA 4EM0B 3OTFA 4LMYA 2X0LA 2XHKA 2RDPA 3HSEA 5HI0A 1MJBA 4KT5C 2ATFA 4EWEA 4MQVA 4IEZA 3P9CA 4KA4A 2YX4A 5AONA 4LD5A 3GLXA 1Z7UA 4XF3A 3K0LA 1TW3A 1FSEA 1Y9QA 4OINF 3HTUA 1Z91A 4BAYA 2P17A 3JAMZ 5FLJA 2PAMA 2JPCA 2BNNA 2PQ8A 5AIQA 3RI4A 4N0BA 4MH0E 1SFUA 5LLQA 4LB5A 3M9AA 3DF8A 2XV4S 3FMRA 2EV5A 4Z07A 2KIFA 1J3PA 3E5XA 1L0OC 4UV9A 3PVBB 5JSRA 1Z9CA 4AQ2A 4OU0A 4GULA 2DI3A 1OFNA 1Q43A 2Z5UA 2XRNA 3D82A 5BUVA 4KWLA 2EVXA 1ZRRA 1Z1DA 3U9GA 1XSVA 5I8TA 1BI1A 1R5GA 5LEKA 3BJ6A 1NYWA 3EJKA 2RV8A 2CWEA 4ESBA 3TO7A 4ZYDA 1KU9A 4WBBA 1ZZ8A 2PN6A 2VOPA 1SD5A 3HRMA 3GZ6A 4QM8A 4HSLA 1NE4A 1U5TC 2EFWA 1IN7A 3I59B 5ED4A 3UKTA 4PCQA 1KQ8A 4DINB 2XAFA 4QX5A 4FAHA 1WWXA 3RYPA 3U10A 4YNIA 2QVOA 4KN7X 2P7CB 1BOAA 4HVOA 1U6GA 1MD0A 1D8KA 4Q4ZF 3O14A 3NVCA 1EYBA 3U2RA 3GFJA 3SCGA 3EQEA 3DEUA 3IC7A 4RAZA 2VODA 4X6RB 3QU3A 3CDHA 3BB6A 4ESJA 2E1CA 1FYKA 5JI6A 2E7XA 4LLLA 1R1VA 2Q0AA 4J1WA 3N4MA 2UZKA 5E1WA 3O2PE 2ETHA 5EEHA 3I54A 3BALA 3HRTA 3ZMVA 4QGMA 5E20A 3R0JA 1Q3EA 2WC2A 2NAZA 2V1DA 4YG2F 5JR7B 2XROA 3EYIA 1X8MA 3NQOA 2RNJA 4A6DA 4D7TA 3D0JA 4HZFA 4IETA 3LA3A 1P6RA 1KQ9A 3WW3A 5BMZA 2O1QA 2XASA 4BQAA 3KLNA 2K02A 2LF8A 3L2CA 1BC7C 4JTOA 3I59A 4MGZE 4LK1F 2PQQA 2DLLA 5KHIA 1NZCA 3L00A 1I1SA 1QNTA 3ZP5A 3NJZA 3LAGA 4EGZA 1T0FA 5I0UA 1SFEA 1O5LA 5DCMA 3GBFA 2N7GA 3R6SA 2H09A 4ZU5A 3RJPA 5KHHA 4XRFA 2EFNA 5DV5A 4YIFA 5D1IA 3V8KA 2K0GA 1R22A 1NHAA 3DQVC 2XAHA 2ET1A 2QBYB 2PA7A 4I0BA 1YIOA 3VB2A 2VQAA 2KXLA 4HLTA 2P8TA 4JQFA 2W24A 3PNAA 4IVNA 3KP3A 1XE8A 2W85A 2L4AA 2A61A 4TV7A 2GWRA 3ROUA 4ZYGA 1U3EM 4UVBA 3S2WA 3KP2A 1ZVFA 5FCCA 1R1UA 4ON0A 5L3EA 3NSTA 1J9IA 4G94A 5ICEA 4HLXA 2FE3A 2BNMA 3LWCA 2PMUA 2CAUA 2JZYA 3IIAA 4TLFA 4A0ZA 3T8TA 4HN1A 3MPBA 5FFXA 4DNCA 2FA5A 3RYRA 4MX3A 4AIKA 4EROA 4PDKA 1CAUA 4HQMA 2V1XA 1U5TA 1YS6A 4R8HA 3CLPA 3MYXA 2EWNA 2Z69A 4M72A 1ZZ7A 2ETEA 1KQ0A 1YS7A 3LFKA 3IKVA 2X4HA 4M9ZA 5DEQA 2K27A 3O6BB 3PQKA 1RNLA 3T0YA 3ST7A 1FYMA 5HLGA 3ETQA 3ES4A 4XF9A 5CADA 1IN8A 2DAOA 4RB1A 3K1NA 4NVPA 3QU6A 1Z6RA 2PG4A 1O3QA 5A2QK 5I0TA 2QBYA 1H0MA 5KHGA 4BIFA 3NEUA 3BWGA 4ESFA 3NKTA 5J3UA 4XETA 1U2WA 3CEWA 1HXDA 2FQ3A 1LDKB 1R7JA 1G3SA 4J1XA 3PQJA 3RTRA 1HW2A 1J5YA 3EO6A 2R7FA 1USSA 4KIGA 2NS0A 2EFQA 2ZFWA 1BJAA 4RGSA 3KMHA 1PDNC 3E6CC 5LRRA 3CO2A 5F64A 5T3NA 5FDBA 3SZTA 4I98B 2W57A 3R61A 2DQRA 4FX0A 1ZG5A 3R0AA 1UCRA 1G3WA 5CVRA 3F21A 3SCFA 5ILVA 1ZZCA 4MGYE 4RAYA 4M6YA 2XKOA 4EJVA 2K7LA 2ESHA 2QQ9A 1SAXA 3JZVA 1EV7A 3TGNA 1FC3A 2VE9A 5ILUA 2V9VA 2RC4A 1JE8A 2MPFA 1H1MA 3MZYA 3G7DA 2CGPA 3FXRA 3I4PA 1XDSA 1P4WA 3MCZA 3KFWX 4I09A 3I71A 3V4GA 4EVIA 4EM1A 2QENA 1A04A 3GEZA 2KRFA 5TJJA 1PP7U 4WK8F 1XRUA 3TOBA 4H7LA 1O7FA 1XDUA 4M71A 3ZQ7A 3TNQA 5E1RA 2OD5A 3MEXA 2EAAA 3WGIA 1FPQA 2O03A 1T2KA 5CJ9A 4ENKA 3OCPA 3DV8A 2Q1ZB 4YFNF 3FMQA 1RUNA 2EA4A 1KGSA 1F1ZA 4IXAA 3V8JA 4HYEA 5C8WA 4O9GA 3FX3A 4BHBA 3LAJA 3FWEA 3WTTC 3F8BA 4AVCA 2YX7A 5JCTA 1YLLA 2ELHA 1WKMA 2P6SA 1OR7A 2OZUA 4Q0PA 3F8NA 1NXMA 1UPIA 1AOYA 1MJ9A 2Z2SB 5JVTA 4AIJA 3FE5A 4M73A 4EJOA 1MDMA 2VPVA 1PMIA 3AAFA 1GVJA 2L02A 1JHFA 2DU9A 3ELKA 3K2ZA 3H3UA 2ZKLA 3BY6A 1B9MA 1ONVA 2FBHA 2WFPA 3FHZA 4WXDA 1ZARA 2GXGA 5FFZA 5HDGA 4R1HA 5DUIA 3SMHA 5I91A 2O61A 4BHCA 1IXRC 4JTNA 1QZYA 1Z05A 4RGUA 2UXNA 1O4TA 1SFNA 1EP0A 3C1DA 1MZBA 1TNSA 1F9NA 2VE8A 4A12A 2WV0A 3EHKA 4GO1A 2VONA 1YW8A 2AS5F 3GFIA 3FFQA 3FZ3A 4U7DA 2R7DA 2A07F 4I7HA 3CUQA 3DP7A 4S04A 2XAQA 5HOOA 4OIRF 1P4AA 5F6FA 2NRAC 1HKSA 4HDVA 5AVPA 4QXKA 5LBQA 2DTRA 1H9GA 2D5HA 5H6QA 3KGLA 5DD8A 4L9VA 2P6TA 2PMHA 2PI0A 2O0YA 3KP4A 3HRSA 1EH6A 1LDJA 5TRDA 3SHRA 3GFMA 1W7PB 3IDBB 3HOTA 4UHTA 1T6SA 2L01A 3R60A 1STZA 1IXSB 2IC1A 1BIBA 2MH9A 3QACA 1LNWA 3WW2A 1LDDA 3OD0A 2F5FA 3W6JB 2GQQA 4B29A 4IHSA 1ZX5A 1LKNA 2QQAA 2DO7A 3G73A 3KLOA 3V7SA 4LA2A 3KP5A 3BPZA 4HW0A 4XSXF 4BYYA 3LAPA 2IXCA 2QJVA 3F72A 5CVUA 1O5UA 2PFBA 1YO5C 5BOXA 5BPIA 4UBHA 1ZZ6A 1YFHA 1I27A 3BZ6A 3LZZA 2CFXA 3L2HA 3TO6A 3DKWA 1J59A 3CL1A 3WGHA 4RGXA 4R79A 5FD6A 5KK1A 3Q5FA 3IHUA 4RS8A 5CVVA 2BGCA 2IXLA 5I8SA 4XFFA 3DPTA 4GGGA 1Y0UA 2K9ZA 1I5ZA 1B1BA 1B4AA 3T8RA 3ULQB 2VXZA 1ZH5A 1J58A 2ZCWA 1YFWA 4CXFA 2Y0MA 4BH9A 2JT1A 3V8LA 1OMIA 1QGPA 5FD5A 2P5LC 1FNNA 3ML6A 5E1ZB 3J80K 1ZNPA 1TQMA 3WTZA 1ZYRF 4G6QA 3HT1A 3P7NA 2KJBA 1FXZA 4PIYA 1O57A 1BC8C 1VP6A 2O8QA 2HTSA 3JTGA 2OQRA 2ZBKA 1Z6TA 4HBNA 3SXYA 2A6EF 2J5PA 2M87A 1ULYA 4JK1X 3I53A 2P5KA 3WG9A 2LDUA 1FI2A 4AWXB 1MGTA 1T98A 2PBIA 3WW4A 1RIOH 3L7WA 5I0SA 2XLGA 2CW0F 1SFXA 1SEFA 2V6CA 3SFZA 4A2UA 2HS5A 3BCWA 1BIAA 1KA8A 1QZZA 3G3ZA 4Z82A 1ZAOA 4LG0A 2EK5A 3USSA 4HN0A 5DYMA 2YPRA 3SCHA 1DUXC 3FXQA 1XGMA 4LFUA 2FOKA 4OIOF 2BYVE 1TQ5A 1UIKA 2J5OA 2A68F 1ODDA 4HX4A 2ZMEB 3ZMUA 3NL1A 2O8XA 4GYIA 1O3TA 4CZZA 4Z2YA 3IRRA 5HLIA 4EJWA 1YTYA 3HSFA 2ESNA 2OPKA 5HS9A 2DK5A 1XMAA 2P4WA 1IW7F 4O9EA 1OYIA 3GWZA 1W5TA 4XF0A 3F8MA 4YARA 2Y75A 2ZNYA 3ZDSA 4BHPA 4ZU7A 1D3YA 2FXAA 4X6QB 4EWDA 1FBUA 4LLNA 3U0ZA 1ZGJA 3GVAA 4WX9A 4UBGA 3F22A 4AD9A 4U0WA 4P9GA 3HIFA 3R4KA 4WCGA 5JAXA 4ZU4A 1G3TA 2VT2A 1IN5A 2QNKA 5KHJA 3RKWA 3C3VA 2VT3A 2HYFA 4B8XA 1KU7A 2HKXA 1HKTA 2EJRA 3KEOA 2MC3A 3WTSC 2D1HA 3ABUA 4I2OA 2QWWA 2K4JA 1FWZA 3C7JA 1XD7A 5FO5A 1QBJA 3MWMA 3SHFA 3GZ5A 4Y13A 3H92A 3ZMTA 2GA2A 3F8CA 2GU9A 4JV4A 2Z99A 1J3QA 1J3RA 3T5XA 2IA1A 2COMA 1W5SA 2QVSB 2IP2A 4MHGA 4UXAA 3TKYA 1T38A 4PJYA 2RN7A 4GCVA 3HHHA 1P2FA 4HDUA 1J7KA 5D5XB 1KU3A 4AIHA 1DZRA 3RZZA 1WQ2A 1BN5A 2B0LA 5D6EA 3GXOA 4OMYA 3CO7C 2D45A 3H7YA 2OA4A 1FBQA 3COAC 4B09A 1RZ4A 1YWKA 2XIGA 2QM3A 2GA1A 4LUMA 4XLPF 1K6OA 2PTMA 1CF7B 4KU8A 1YLFA 2VC0A 4KYWA 2W25A 1VR3A 4XEZA 1ZRDA 2YR2A 4N9HA 4OIQF 4A5MA 2GC2A 2Y0OA 5BPXA 1IPKA 2JSCA 3BROA 1LEBA 1R23A 4HAMA 3CF6E 4WWCA 4ENNA 1BBYA 4AQ6A 4MZUA 5F1RA 3RDIA 2ISZA 1JUHA 2VBXA 4ZH4F 1R00A 2EB7A 2HFHA 3HRUA 4LLOA 1H1IA 2XKPA 2C0ZA 1XN7A 2QUFA 3JTHA 4HX7A 1GHCA 4RB0A 5K5OA 3BJAA 4HVRA 3OF1A 2IJLA 2DPUA 1TQIA 3M70A 1YG2A 4M6XA 3WTWC 2OBPA 3IL2A 4K2EA 1HSJA 2WTEA 3VODA 3FJSA 2QCSB 3ACLA 4XFCA 1LRHA 1RL3A 5HDKA 3HSRA 2AXLA 5K1YA 3IKTA 1HW1A 2ET7A 1SQ4A 2G7UA 4PZJA 2YU3A 4YFKF 2VOOA 5I93A 2IW5A 3LQRA 3E6BA 3RYKA 1S3JA 1YFYA 5D4RA 3RNSA 1B6AA 1YFUA 4L9JA 4O5VA 1YHFA 1TLHB 2V1UA 2E1NA 1UW8A 4YFXF 2HWVA 5E16A 1CAVB 1XE7A 2MA3A 2UXXA 3ZN0A 4IJAA 4CGZA 2E9QA 3E6MA 4D7SA 2M45A 2OA2A 4L5IA 3KGZA 3J7AO 5BY5A 1CF7A 4FT8A 1YW9A 4ZZLA 3QP6A 4L9TA 6PAXA 4BXUA 4HSJA 2Q4SA 1LQ1A 3DPLC 3SXWA 3GF2A 1MJAA 2WWYA 2UWMA 2FBKA 5L3GA 2DPDA 3I58A 4G6DA 1TQPA 1IZ1A 3WW1A 2JTVA 2MLGA 1YUDA 1J75A 2KKOA 4IEVA 2ZO4A 1RUOA 4LA3A 5LEJA 2FEZA 1UHMA 1S7AA 4UVAA 1U78A 4KN4X 2H6CA 3KE2A 4KUMA 5D8LB 1W4MA 4KL1A 5CYVA 4D0PA 4IPAA 1DP7P 4META 2RGVA 5DUKA 2E7WA 1R58A 4H0EA 4HA8A 2RVCA 5J6XA 1ON1A 2G9WA 3C3WA 4MV2A 3B73A 1U5TB 2RQPA 4IRIA 1XSXA 3KSCA 4O3MA 1V70A 5BQTA 2VBZA 3LA7A 1USTA 5L3DA 2GC0A 3E3VA 1I1GA 4FBFA 4HQEA 2XAGA 3KCCA 2EA2A 3WE2A 5K5RA 5FQ0B 3HQXA 3VFZA 1T39A 1YQAA 1FSHA 3UKVA 4E2SA 3KP7A 4FAGA 2D1VA 3H1YA 4EWAA 4AVPA 4HLYA 1VTNC 4Q47A 4U7BA 1U8RA 4YRDA 4KWJA 3T1BA 4HF2A 5ICFA 1UHWA 3V7RA 1R1TA 2IXKA 5CLSA 3ECHA 3OGJA 4WXHA 4EQQA 4P55A 3RKXA 2LNBA 4EM2A 3VEPA 4NQWA 2P7VB 4IEQA 3CUOA 3FM3A 3ZMDA 1XB4A 3CJXA 2Q2EA 3IDCB 4LJZF 2DT5A 4PGGA 3K69A 4L18B 2A5YB 3IWZA 3P9IA 4MTEA 4UVCA 4P9UA 5D5UB 2B5HA 1EPZA 4K8FA 3J80Z 4RGRA 5BXXA 1B9NA 1CGPA 3PLQA 1WLTA 3DFGA 5HS8A 4N9IA 4CHUA 2RKHA 3OOPA 3SQNA 4UNOA 4CO8A 3M7GA 3F8FA 2PAKA 2D5FA 4ONUA 2CSOA 4YYOA 1J1LA 3BU7A 2QQBA 4BNCA 4ENJA 1O7LA 1D8JA 2CQKA 4U0VA 4XBFA 5HDNA 2PHDA 2ZMEA 3IWFA 2H27A 1IAWA 3ELNA 1X82A 3H1MA 4M9XA 4I0AA 3H3ZA 2XAJA 1R36A 2PLYA 4OFGA 3K1MA 1IN6A 1XGSA 1V4RA 3RKYA 3IBMA 1DZTA 1PM7A 1G3YA 2OZ6A 3GFLA 2A3SA 4KU7A 3RPUA 3ZPLA 2DQLA 1BI0A 3HTSB 2ZNZA 2FQPA 2UYAA 1U12A 1IPJA 3K9TA 3TDZC 3F23A 1R5HA 5FB2A 3MAJA 3WODF 4R52A 5IT3A 3HYIA 4LGWA 1ZRCA 4HX8A 5L3CA 4LEJA 2PJPA 5LGNA 4YIIA 1SMYF 4RB2C 3KP6A 3QOPA 3QRFF 4CDGA 3QAHA 5FQ0A 1ZG3A 5FLXK 2D93A 2EFOA 3B02A 1RI7A 4LLGF 4MUVA 2VN2A 5LHIA 2A6HF 2EV0A 2KIMA 3ABTA 1FT9A 2FRHA 3Q9VA 3K1PA 1IXCA 4A5NA 3GYDA 3C18A 1FYLA 4IRHA 3FF5A 4IESA 4CICA 1QPMA 4Q0QA 4MQ9F 4KIBA 4WF2A 2ZXJA 1KYWA 4P96A 5CVIA 1XGOA 4ZZDA 5J48A 1WGPA 2F4PA 3CUQB 2LF7A 4PIZA 2IT0A 1UCXA 2EV6A 4LK0F 1S8NA 4EV0A 1LEAA 5HLHA 4P9FA 1X3UA 2FBIA 4ASNA 2YSRA 3I64A 2XL7A 5DCMB 3M8EA 2G7HA 1EH7A 4XFHA 1TNTA 2B9UA 4KWKA 4RD7A 4RB3C 3GYHX 1QQIA 4O6JA 2IXIA 4HBLA 3ERED 2CAVA 1CAUB 1ZRFA 5EFUA 2VBWA 5LGUA 3JSOA 2F5CA 2GZWA 3J81K 2P5VA 5C6CA 1ZGAA 4HF0A 2Z33A 2ACJA 3CJNA 3I5UA 2HEOA 5J8FA 5L3BA 3MDPA 2M8EA 3N97A 1MDMB 4MNUA 3HUGA 2O6GE 4Q0VA 3EQLF 3ZMZA 1Q5OA 3HHGA 3MZHA 3BPVA 1GXQA 3REOA 4IF4A 4ETSA 2FMYA 5BS6A 4KDPA 4AXOA 1XCBA 1K78B 5ERIA 3SZPA 5K8SA 2VECA 3LSTA 2LKPA 2MLKA 1OD5A 5ICCA 1FBSA 3WTYC 1FOKA 2QZ8A 4A0XA 1S6LA 2STTA 4IEXA 4KNYA 3BP8A 5K5QA 3H9AA 3TOAA 4DQ2A 1IUYA 5FLXZ 1L3JA 2UY8A 5FPZA 2QLZA 1W7PD 1K7AA 2JPBA 3FZVA 1SD7A 2L54A 1L3LA 4KIFA 2XLFA 4HV5A 3WU0A 1FP2A 1GXPA 2HR3A 2Z9OA 4L9NA 2F2EA 2L4MA 2HKOA 2KIUA 5JR3A 1EH8A 4G8XA 5LRSA 1OI6A 2DBBA 5H20A 2OQGA 4YSFA 2M1BA 3LWFA 1XSDA 2BV6A 1D5VA 5JHUA 5FPXA 2GXBA 1B59A 2DK8A 2VC1A 2Z3YA 1NE6A 1WI9A 3BJOA 2IXHA 3F6VA 1HSTA 5BPDA 2QDRA 5E17F 5HS7A 4A0YA 3H8UA 1XMKA 4AVBA 1AWCA 3ISPA 4XFIA 1IN4A 3JAMK 4IEUA 1K78A 4PGHA 2NNNA 2IA2A 3LA2A 3PFIA 1HKQA 4FX4A 4G7ZF 1J2XA 1I6XA 5J7MA 1BI3A 2H94A 1G4DA 1WRJA 2F5DA 4UV8A 4ENMA 1E2XA 5H6RA 3BPXA 1QXRA 3QP5A 4MEYF 2HYGD 2XLAA 4Q0UA 1QY4A 4M9SA 4PIXA 2VBYA 3DN7A 1Y3TA 3U11A 3J81Z 1H9TA 1LVAA 2Q30A 1QWRA 3HOSA 2OAZA 2IVMA 2XVCA 3Q9SA 3H7JA 2C6YA 3D0SA 4E70A 3S0MA 4IERA 5KBFA 4ZYEA 3HT2A 2MD5A 4L11A 1YW7A 2M30A 1VJ2A 3D5LA 3EUHA 4MEXF 5JSPA 3L09A 5CU1A 2CO5A 4Y15A 4P5OA 1OYWA 1MKMA 1DGRA 1DDNA 2IXJA 1ZZ9A 5A2QZ 1Q1HA 5FGMA 1DPUA 2MNGA 2XL9A 4Q29A 1SD6A 5DCFA 4LTAA 4Q5SF 5I0RA 4XF4A 3GW2A 1OKRA 4ZYHA 4KFCA 4NHJA 1KU2A 4EGYA 1CAXB 5JSOA 2MH2A 2O3FA 1LR5A 1DGWA 1PUEE 2FF4A 1ON2A 2A69F 2OYZA 2HJIA 2H0VA 4HOBA 4S05A 4UXNA 2DFIA 5E18F 1ZHFA 2W84A 4IRGA 2TDXA 5D4SA 3W6KB 3WTUC 1X7NA 3JW4A 3M1EA 2XGXA 2QYOA 1EY2A 4JBAA 3ZMSA 5DDGA 1LJ9A 5D6FA 1XCVA 5EEGA 1V3FA 2F5EA 4FHTA 3TO9A 5E8IA 1O3SA 4EJUA 2KJCA 1TW2A 3WE3A 1CX4A 4QM9A 5IT9Z 4I02A 4A6EA 3QPTA 1REPC 3S7EA 1P92A 2FU4A 3F3XA 1FX7A 5EZWA 2NYXA 5LHHA 4OMZA 3BOQA 1UFMA 1UB9A 1QO0D 2IPQX 4CYDA 2HQNA 3QPHA 4XSZF 1CAXA 2JRTA 4L0YB 5IT9K 3NRVA 1FZPB 3M8FA 3EETA 5ICGA 4XF1A 2V79A 3M3IA 3ECOA 3JSPA 2DW4A 1IRGA 2CYYA 4I3PA 4Q48A 3P9KA 2BBYA 1KYZA 1YFXA 3GO5A 1WA4A 3KETA 5BV6A 1K79A 3GUDA 5E8GA 1P4XA 4KMFA 4U0YA 3L9FA 4Q0SA 4WVZA 5L3FA 3UKNA 4F7ZA 1ZN2A 1TTYA 2ADUA 3ES1A 4WZCA 3FM5A 2V09A 1JXSA 3DXJF 3H1WA 2UY9A 5AIPA 3EBRA 4JVAA 2Y48A 4QGNA 4MGRA 1IF1A 1W7PA 5D5VB 2Q0OA 3KZZA 2GIVA 4LB6B 5ILSA 3WTXC 3CLOA 4HVQA 2D40A 1WSUA 2Q8KA 2HGCA 4MGIE 4XFAA 4MTDA 2PYTA 1OYYA 2FNAA
chains in the Genus database with same CATH superfamily
1X1DA 1MQTB 4YW3A 1W8HA 3CIHA 4K6BA 3UYJA 3ZVXA 3MIBA 2P34A 4NBQA 2EINH 4IHTA 1Y9GA 4GA9A 2M5WA 3PO3J 1A6QA 3FMSA 1AXZA 4BE2A 1UZWA 3KEQA 5F3GA 1DLCA 1BI2A 3FHIB 3UK9A 2WZ8A 4E4SA 1GQGA 2HWE2 3VZKA 3PUHA 4TYSA 1G6NA 4M3BA 1VRH2 5DUVA 3AKTA 4IV3B 1W8ZA 4J6GA 2OZJA 3RIRA 2GC3A 3E97A 3EYYA 2ZHLA 1J09A 1Z7S1 3GTMJ 1HRV1 4Y24A 3C2GA 1VMFA 3K70C 2R3SA 1RGSA 2CW7A 1MMGA 2K86A 2PEXA 1BA5A 3A01A 3FLTA 4RYDA 1S29A 3RCOA 5FO9B 1D5YA 5FLIA 2OUMA 1PP8F 4L2NA 4FP2A 4F8AA 3CTAA 4COUA 2PLV3 1CAWA 4DOZA 2D6KA 2R7OA 2AQEA 1AJKA 1AR73 4G7HF 5D8AC 2DF7A 2A75A 5JMOA 4RR3A 4NHKA 3CESA 1HQLA 3WU1B 4GB32 3S3OA 3ZN1A 2GAUA 1P9QC 5FLVA 5FZOA 1RUF1 1E17A 3MW4A 3I0TA 5J4VA 2VPRA 2MHFA 3S7IA 3BR6A 1CIWA 4RR3C 2RR13 5JR2A 2EILH 2EFPA 4BY1J 5FRMA 2X85A 2CG4A 4L5JA 4NB5A 3B93A 4COYA 3VOEA 2I5UA 3APBA 4ZDLA 1H0BA 2I45A 5L7OB 5FY4A 1PX3A 5FTTC 3K4CA 4PJLA 2JDNA 2N8GA 3IDAA 2V26A 4XKWA 1GQHA 3FC0A 5DD4A 3ZLIA 3OR1C 3N7LA 5FYUA 4IEYA 5A32A 3WDUA 4AI2A 5FYTA 1ITYA 2BVMA 1OBNA 1JGSA 5FROA 4RA2A 4E2GA 1FP1D 3MLKA 3AVSA 3I2HA 1JYVA 3LE0A 4NOTA 1PGL2 1RINA 1IOAA 4WM8C 5JLWA 1SD4A 1F5TA 2DWRA 4OLLA 3NV4A 4XC9A 5GZCA 2PAEA 3WP5A 2QQJA 5HVQC 1CZVA 1C0WA 4HT1T 5GTHC 4CU6A 1HW5A 2QQIA 5JZGC 3VUOA 1E5HA 3L9JT 2DCKA 5EYXA 3U4XA 2W92A 4QQOA 3PL0A 1WGXA 1OCCH 1G59A 4XQDA 4EM0B 2DN0A 3AZWA 4LMYA 2X0LA 4M01A 2WL1A 1MJBA 5GZEA 5FMOL 4DZPA 2MG4A 2DYSH 2HLEA 4CXYA 3L1PA 3ZXDA 3LPFA 5AONA 2KZVA 1Z7UA 3K0LA 4Z92B 2ZX2A 3S2HJ 2QF7A 4CSWA 5M5YJ 2ZJRF 1AR93 2EIGA 1VMHA 2BNNA 1FMD1 1W6NB 4QPIC 1WH7A 2WA3A 3HBKA 4L0PA 2PLV1 1SFUA 1OHFA 3GHMA 4D94A 5FZOB 2RREA 1T6BX 2WZR3 3Q8AA 4AQ2A 4OU0A 3ZFGB 4DYRA 1S7EA 4EN8B 2GM4A 3JRDA 4D1QA 3D82A 3POJA 3PNTA 2EVXA 1Z1DA 2XDVA 3O7OA 3HAGA 3ASNH 4FOYA 2W7NA 2RJ2A 4BM8A 1SMVA 3AP4A 5JLXA 4FFFA 2RV8A 4QHBA 2NMOA 4H4KC 3TO7A 4CXXA 2DV9A 4IX7A 1ZK8A 1HDDC 1ZZ8A 1DQ6A 2JB4A 4XXAA 1IN7A 5ED4A 3UKTA 2CWMA 2XSDC 4FPKA 5L36A 1RMU3 2DVGA 1MACA 4HVOA 1U6GA 4XICA 3A23A 3O14A 3NVCA 1EYBA 3OY8B 3SCGA 3EQEA 2VODA 4ASKA 1DYOA 2O14A 3CZ6A 2E1CA 5JLVA 4JX4A 4NO4A 3ESWB 2W94A 2Y6HA 1LECA 1F8VA 3ENRA 3WG7H 2UZKA 2QSGX 3O8GA 2R042 1KS4A 1WCQA 1LU2A 4R4XA 2VCCA 2X5IA 3R0JA 1VBC2 2NAZA 2CFOA 1KRIA 3L2VA 3EYIA 4B3XA 3KHBA 4OZXA 3JUUA 4IUGA 4HZFA 5J09A 1P6RA 2C5DA 2VE1A 2K3PA 3FBYA 4BMBA 5AFEA 1UOGA 2RNGA 5FAXA 4URAA 2JENA 3K2AA 1BC7C 1FMD2 4X6AJ 3K48A 1NZCA 1TEIA 1QJZA 1QQP1 5EYRA 4R4ZA 3LAGA 4ASLA 2WB1A 2N7GA 3WLUA 4A3EJ 1B35B 1Q8SA 1T08B 4YIFA 2HEWF 3V8KA 5DAWA 3BR0A 4GDFA 4YM3A 1NHAA 3URFA 4DXTA 3B7MA 4HLTA 4JQFA 3PNAA 1W0OA 1XE8A 3ACHA 2W85A 3RZHA 1LODA 3ROUA 2Y0IA 4JRAA 2LM3A 2DTZA 1JZ6A 3HUGB 4UVBA 1F36A 5FCCA 4MXVA 4X0GA 1CESA 1DGLA 1WI3A 2BBAA 1AKHA 1L7RA 4HLXA 1ETVA 3EB7A 4XR6A 2DJIA 2BNMA 1X33A 5FMDA 3T08A 2CAUA 3WVJA 5HXMA 1WVRA 1AUYA 1W5CC 3DXTA 2DMUA 3MPBA 4Q4X1 2R16A 3BZKA 3ZQHA 2XBO3 3DPRC 2V1XA 1U5TA 1YS6A 4R8HA 3PSFA 4AOCA 4M72A 3LFKA 1AR92 3NV2A 2X4HA 4M9ZA 1HB1A 3MHZA 2K27A 3O6BB 5C3OA 3PQKA 3R4SA 1D4VB 3T0YA 4A7ZA 1Q8VA 3ES4A 5C7GA 1Y8QB 1SCSA 2DAOA 4PK4A 4NVPA 3SH4A 3BC8A 3AFHA 1G86A 1H2MA 4FE7A 1G3SA 2A71A 4FXGB 3RTRA 1MNEA 1XMXA 1N1YA 4AAPA 3CU7A 2HWE3 1UG2A 3HQUA 2EFQA 2F6CA 1CR7A 3FK6A 1PDNC 1OCPA 2YG0A 2R5ZB 5FDBA 5GLVA 2DFBA 3SZTA 4OMDA 4JAAA 3ZPYA 4IHYA 2ZJCA 4YVWB 1UCRA 1YQ2A 4AQSA 5CVRA 3BUCA 3SCFA 5ILVA 4MGYE 2K3FA 4CDXC 3VBRC 4M6YA 4DY3A 1PZ9A 1K83J 1TME3 4HG6B 3I3MA 1SAXA 2CRGA 3O1PA 2ZX4A 3O0WA 4Y5Z0 3TGNA 4ZTJA 5A33A 4XJZA 3H0OA 3PU3A 4CXWA 3AB0A 5F37A 2OVUA 2RC4A 3PO2J 4W6YA 2VZVA 3MZYA 2Y8KA 2CGPA 3FXRA 4K1ZA 1XDSA 1OVSA 4DYCA 4YZ3A 3I71A 1I39A 1BBT2 3AX4A 2KRFA 2E26A 3BR2A 3RKQA 4WK8F 1XRUA 2W5FA 1MEC1 5L9RA 1CX1A 3K3NA 3GZAA 2OD5A 2RS13 3WCRA 3OS0A 1GZWA 3FKJA 1OSGA 4L99A 1IRXA 1H2KA 2TUNA 2DVDA 1US2A 2CJJA 3ZXGA 4Q4Y1 1ZR4A 2EA4A 4IXAA 3F95A 4HYEA 3RZGA 5C8WA 4FSJA 3FX3A 3F8BA 3VBUC 2ORZA 3ZFFB 2ELHA 4QPGC 1W6MA 1V6OA 4S2HA 4Q0PA 3P5BA 3L2YA 1VBE2 4MHRA 1N78A 1MDMA 1XG1A 2JE9A 2DU9A 4R9BA 3MO4A 3BYWA 4XW3A 3BY6A 2R7RA 3FBIB 5FJHA 4Q1RA 1LOFC 5LA0A 2Y6KA 1DYKA 3SMHA 4IGQA 1BW5A 1QZYA 2WKKA 1O4TA 5FZ0A 2ZEYA 1PGW1 2GIZA 5FIXA 2CUFA 5CKNA 1D1AA 1ZR2A 2WV0A 2VONA 1RXGA 3AL6A 3ZYJB 3FFQA 5EPAA 4BACA 3HKZN 2XAQA 4OIRF 4Q2FA 4KWUA 2HWB1 1DG6A 1JKOC 3GM8A 1H9GA 2JICA 1W28A 4XRSA 2Q5TA 2P6TA 5GAGJ 3ZXAC 3HG9A 3ABLH 3KP4A 1BMV2 2VQLA 2XUMA 3W3CA 5BYNA 3I8TA 3HOTA 3H35A 1QVUA 4UHTA 1T6SA 2L01A 3MKLA 3ONQA 2VNOA 2IC1A 1V6NA 1IO2A 3QACA 5IYDJ 1LNWA 2DVFA 1Z3XA 1G9BA 2W3JA 3VDDC 4EYUA 4IHSA 1ZBE2 2VL8A 3CLQA 4P9JA 3BLYA 3V7SA 4LA2A 3ZMOA 2J22A 2VJXA 2IXCA 4V2WA 1D1CA 2FOWA 1JOJA 1ZZ6A 1X1PA 3ZXFA 3CMAI 3LZZA 3PUSA 3OBTA 3DKWA 1PNFA 2CSGA 3AXEA 3PHMA 3SITA 3ZOBA 5FD6A 1I9RA 2HXIA 5H9PA 3IHUA 5CVVA 2B39A 3OS1A 2IXLA 1Q8QA 5FKKA 3ECQA 3IAQA 4YW7A 2GDFA 5EG0A 4P1WA 3I2IA 1E3OC 4K1YA 2EF6A 1PGL1 1XYPA 4V1PA 4PJJA 4ISRA 1V55H 4YPJA 1OMIA 4YGBA 4HK8A 2ZGKA 4A93J 3HT1A 5IY5H 2CUEA 3K77A 1PMHX 5DABA 1I1EA 1FXZA 5GJ6A 4E7ZA 1W8OA 2H8RA 2JVHA 3C8XA 2O8QA 4E9KA 3JTGA 2ZBKA 2Y6GA 3MD2A 3HD8B 4AI0A 4JK1X 5JVVA 5IFTA 2D6LX 2E60A 2P5KA 4DOUA 1MGTA 1GOGA 1D0ZA 2DODA 5F04A 4BEHB 1GV9A 4W6XA 4FASD 2TBVA 2CW0F 2VMEA 1F9KA 1SEFA 1WJBA 2HS5A 5EDNA 2HZDA 4GWIA 3K2OA 3G3ZA 1ERDA 4IKFA 4Z82A 1KEXA 3IAPA 1ETYA 1I3QJ 1UNBA 3IB3A 1SLAA 1ZAOA 1L7QA 1S9HA 4XKCA 4B47A 1FMVA 3USSA 2JG9B 5DUUA 1PNGA 4FOVA 3GF6A 4CDWB 1DUXC 4LFUA 1VF9A 3CCEI 1BCXA 1GZCA 3ZMUA 2ZMEB 2O8XA 4C3JJ 3ZXLA 5HLIA 2OS2A 3NJVA 3VYTB 4PT6A 4Q4Y3 1Y7BA 1IW7F 1OYIA 1RUF2 4A3IJ 3F8MA 4YARA 2ZC2A 4X8NA 1F2NA 3I2DA 4E4ZA 4LLNA 3BTZA 3G2BA 1ZELA 4UBGA 3F22A 4TXWA 4AD9A 2B46X 5JAXA 2AYHA 1G3TA 2R5ZA 5BNNB 1CVNA 3FKIJ 1PVC3 1E5RA 2HYFA 3Q0VA 4LORA 1HKTA 1KFUL 2EZKA 5D8AB 1FWZA 4AM3A 5FO5A 3WF4A 2J1RA 2GA2A 3F8CA 4JV4A 4MFEA 2Z99A 1J3RA 1M4WA 2QVSB 4MHGA 3HM5A 1ASJ3 4E27A 5DDJ1 4AEJA 2VOXA 1K3IA 4HETA 2EICA 4PJYA 1PK6A 4GCVA 5FK8A 4EN0A 4HDUA 2E33A 1KU3A 4TLGA 1DZRA 3RZZA 3PVNA 1MNDA 3ABMH 3GXOA 1UJ8A 5LBCA 2WWJA 4CDQA 3HXLA 1HJGA 2K9MA 3NJXA 1IDYA 4B09A 2QM3A 2IS1A 1COV3 5A6ZA 4I99C 2R7ZJ 2W25A 2YUEA 1ZRDA 3JREA 3K10A 1EV11 4GQ7A 1WMFA 5BPXA 1JN2P 4M0NA 4D8MA 1IPKA 2L9RA 3OYMA 2JSCA 5HLTA 1LEBA 1R23A 4DEVA 4HAMA 1JOPA 5F3IA 2KISA 1LHUA 1BBYA 3AP6A 4ATFA 4AQ6A 3DEMA 1E5SA 5IP6A 2WWSA 4MZUA 3OUIA 2YGMA 3PUAA 2NLRA 2DCEA 4BB3A 2ZX0A 1TZLA 2Y6FA 4IE6A 1L7LA 4Y20B 4Q4V1 1JUHA 4NE9A 2EB7A 2HFHA 4LO8A 4LLOA 5CG9A 3NV3A 1H1IA 1HA8A 3THCA 4RB0A 2RQQA 2L9VA 3BJAA 5K5OA 1UMIA 4CP2A 2RS12 1TQIA 4NJ4A 2I07B 5FYCA 1N3QA 4CZSA 2V72A 1FYUA 2HPIA 4M6XA 4PBOA 3N7MA 3QODA 3LDRA 1HSJA 3VODA 3ACLA 3USUB 3DPUA 4XFCA 1RL3A 3AKSA 3HSRA 2KM2A 3IKTA 4IHWA 4JGYB 3DYMA 4M3CA 2F4MB 2RDNA 1OLQA 1Z3YA 2IW5A 1S3JA 3VBOC 1B6AA 4M3DA 1YHFA 2GLOA 1TLHB 4JOMA 1IC8A 4YFXF 3RVHA 5E16A 1MBGA 1MH4A 2MA3A 2VZRA 5FZ4A 2F5VA 5FZLA 1XSRA 3BPSA 3SISA 1ETWA 3PUIA 4D7SA 2WLQA 5JIUA 1HXS1 4IV1C 4QAWA 2OA2A 4L5IA 3KGZA 3J7AO 1ZQ3P 5FUPA 5BY5A 1LU1A 1MMDA 5JIAA 2PMWB 3WDXA 2W39A 2HWC2 3QP6A 4L9TA 3HOZJ 1B8IB 3CF5F 1YO8A 2VQGA 2RV9A 3I4IA 3S6PA 3LDBA 4L92A 2DPDA 1QHGA 4GWNA 3JD73 1IZ1A 3WW1A 1MIJA 2JTVA 2VASA 1W05A 4G9SB 1VI0A 2ECBA 2ZO4A 1JI8A 4LA3A 5LEJA 1T56A 3GHNA 2IGOA 1U78A 3LB9A 1W8TA 2QEXI 3SNMA 1S2KA 1MZ5A 5D8LB 1W4MA 5CYVA 1AYM1 1IV6A 1WLCA 3J7MA 3POWA 2NYYA 1AYN3 1RVF2 1R58A 3CP2A 2RVCA 3EPZA 4I0WB 1ON1A 2XJTA 4BL0B 2W91A 4O3MA 2WSVA 2A6TA 2VBZA 3QYBA 3LA7A 1JJ6C 1D2QA 5A3TA 1ALYA 5K7PA 4XBQA 3E3VA 1I1GA 3VZJA 4HQEA 2DTYA 2EA2A 5FQ0B 2DA7A 1GP4A 1T39A 3AJZA 3T30A 2VZUA 3MZ8A 1POV1 2PXJA 2D1VA 3H1YA 4AVPA 1YEWA 1U8RA 4LXLA 4KWJA 5ICFA 1UHWA 4RSUA 2QQKA 3ECHA 3OGJA 4WXHA 4Y1ZA 4P55A 3RKXA 2LNBA 2W0XA 3OR2C 2VCAA 2P7VB 4IEQA 2WQZC 1XB4A 4XZUG 3H9GA 4PGGA 1DFQA 2EZHA 4CRQA 4L18B 1D4M2 3VWBA 3HMYA 4KG0A 2A5YB 2P81A 1YCIA 4CEYA 5D5UB 2J42A 3OY9A 3HGGA 4YW5A 3J80Z 1S0BA 3ZFGA 1NY72 1X50A 1SFPA 4XOTA 4B1LA 1DGRN 4HKOA 2M2EA 5C8CB 4XK4A 3CMMA 3UR3C 2HQAA 1UZ0A 2LKSA 2PAKA 4BQXA 4HSTA 3BU7A 3LIGA 1WPKA 3OEAA 1O7LA 1D8JA 2ZXHA 5HDNA 2H27A 1LOFA 5ACA3 3ELNA 4TTGA 1WW6A 3VD4A 3J7HA 3H1MA 3IKWA 4I0AA 3I55I 3H3ZA 2C1FA 1IN6A 1MS3A 4C1XA 1PM7A 3VKOA 3GFLA 2DQLA 3HTSB 3JQXA 1Y39A 3TDZC 3P3PA 1VLNA 3WODF 1VAKA 4N4NB 5LATA 5BNNA 4QKFA 3ZXEA 2P6CA 4HX8A 4AK3A 4NROA 2AACA 5LGNA 4YIIA 1V6LA 1NXD1 2J1EA 2QDNA 3PM1A 1VNDA 5FQ0A 3AM2A 1RI7A 4MUVA 2KLOA 1S0CA 2E71A 5LHIA 2LRDA 2DOAA 2EV0A 1COV2 5ANQA 3THDA 2FDJA 1FT9A 3BR5A 3Q9VA 1PVEA 2XVGA 3CHXA 2RG4A 4FTBA 3C18A 4F3JA 2DMTA 2HOTA 2ZGPA 4IESA 3OS2A 3RJRA 4Q0QA 4PI2A 4MQ9F 5CNAA 3T3YA 2XQXA 4RHV2 4GMP3 4XZPA 2JA8J 4P96A 1DQ5A 5CVIA 2MEV1 2VTXJ 4PIZA 4YGEA 2EV6A 1S8NA 5F6LB 1LEAA 5HLHA 5G05L 4P9FA 5HBAA 3C2UA 4ASNA 3I64A 2XL7A 1NA1C 4AQTA 2R062 1QQIA 1GMMA 2Z1DA 2UWCA 2EIBA 4A4AA 4W1UA 1LE8A 5CZKA 1CAUB 4CZCA 4KISA 1A8MA 3AYCA 3PIJA 1S1AA 1ULFA 1QJX2 4BDYA 2P5VA 1FOD1 2NP0A 1JKQC 2FDKA 3KEYA 5L3BA 4JQTA 3S30A 3VBOA 4URTA 1RKTA 2O6GE 2EH3A 1Q5OA 5C44J 3KQ4B 3HOUJ 4IF4A 2VBBA 5ERIA 4XYXA 5K8SA 4HANA 3O0XA 3ZCOA 3V56A 4MGQA 5ICCA 1G8XA 3OOXA 2QZ8A 2STTA 4IV1B 2CQ7A 3MGUA 2WNUA 4Q5OA 5HCBA 3TN91 4BQ1A 1V6MA 3N35A 2L54A 3VDCA 1DP3A 4HV5A 5F5AA 2HYXA 3WY6A 4PLOA 4S2DA 2X6OA 1C8M1 1LOBA 2KIUA 3OGVA 1EH8A 1OA2A 3B3QE 3R0RA 4YSFA 1AKHB 1HN1A 4LE4A 1SACA 3CJIC 4OHXA 1VALA 3O1OA 4OI1A 3MV01 2HYKA 3ISPA 2RR11 3DWLE 4LKDA 1ZBA2 3ZSKA 1ST8A 5A80A 1IN4A 4FOWA 2G9GA 4C91A 4MGSA 4EE2A 3FXOA 5A1FA 2JRMA 2WABA 2QQNA 5H6RA 5GM0A 3BPXA 2Z16A 3T2QA 3WG2A 2GNBA 3AC0A 4YVSA 4M9SA 3DN7A 5F0CA 2JDKA 1D0XA 1TC3C 4FPHA 3U11A 1H9TA 1H6XA 3MIGA 2L0KA 5FMBA 3HOSA 2E1OA 4WM8B 2VMHA 3LSEA 3HT2A 2MD5A 4L11A 3LPGA 3C2HA 2M30A 1V5FA 2RM21 5JSPA 4MIMA 2CO5A 4P5OA 3MMYB 3WT3A 2WO3A 2WNEA 4LBNA 5HV4A 5A2QZ 4QX8A 1DPUA 2VY0A 1SD6A 2KIQA 2UU8A 3WHCA 2VJJA 2ZKNA 4XF4A 3GW2A 3IIIA 1SBFA 1CAXB 5B1AH 4YGDA 1VBA1 1EAH1 2FF4A 1MQTA 5T50A 1ON2A 4NR1A 2OYZA 5FPAA 1B72B 4XTPA 3BTCA 4UXNA 3A01B 1RUJ2 1C8M2 5IT6A 5A3WA 2WS91 4IHVA 1HRI3 1UMHA 2W84A 2EIJH 3ZN6B 2KPMA 4IRGA 2VPLA 2LYCA 2OPWA 3M1EA 1OCTC 1FNYA 2JE7A 2CNAA 4JBAA 3WQ7A 5LY1A 3ZMSA 1OC1A 5DDGA 3IMNA 2EIKH 3GTLJ 3ZYHA 5H9RA 4COVA 2HVRA 1ORKA 3ZFEC 3TEYA 5J98B 1TW2A 1GZ9A 4Q4X2 4QM9A 2E51A 5IT9Z 4M6VA 1S0DA 3FN9A 1G2HA 1P92A 1J84A 5JWPA 3FXMA 4XRMA 1Y43B 3HPGA 4M00A 4ES9A 1NCRC 2WAFA 3BOQA 2QFEA 1UFMA 1UB9A 1QO0D 3JBG3 2IPQX 1UKRA 2X48A 2HQNA 3QPHA 1OPOA 4XSZF 4N43A 3U37A 1LHOA 3ZQIA 3NRVA 3M8FA 5FBZA 1QNWA 4XF1A 2VZ3A 3VPRA 5H9QA 1IRGA 1OLMA 4A3XA 4I3PA 3S5QA 2ENRA 3M3QA 2E2JJ 1K79A 4X8PA 1NLRA 4KMFA 4U0YA 2OTJI 4XUOA 5L3FA 1XNBA 3UKNA 3VHPA 4BU2A 4DS0A 1UG0A 3VB9A 5DS9A 3BQYA 3ES1A 4AW7A 1POV3 5LBBA 2V09A 4HPKA 2UY9A 3EBRA 5FY0A 2RMU3 4JGZB 4QGNA 1DQ2A 1V00A 2EXIA 4Y33A 1O6UA 5ILSA 3CLOA 1WW5A 2D40A 1WSUA 2Q8KA 2HGCA 4MGIE 2KRCA 1UWWA 1VAVA 3KIOA 2PYTA 4YWAA 5FLHA 2HWF3 4AYBN 1OT5A 4YIRX 1LENA 4Y22A 4IEOA 3FMGA 5DN2A 3AMMA 4AVAA 1D0YA 2JD4A 4RS5A 3NAPC 4CDUC 2KR2A 3DL3A 2BE5F 4CP0A 1OPCA 4XFGA 1XGNA 5F5CA 1ZZBA 3EDPA 2NVTJ 1DQ4A 5CEHA 2HZTA 2VU9A 4Y1VA 4FTSA 4OYUA 4L0ZB 2Y6JA 3BG9A 4F93B 3QLQA 4N90A 4Q1PA 3KCXA 3RQ0A 2WNOA 3SDBA 3AMPA 3GCMA 3H50A 2JMWA 3KZYA 5KVRA 5IK4A 3U07A 2O8OA 1WW7A 5AVAA 4XFBA 3I7DA 1UF2C 1F4KA 3MLJA 4E6KG 1O3RA 2ZXQA 4HV6A 1MS0A 2XJRA 4P14A 5FYZA 2KDZA 5E1XA 2WZPP 1YQ8A 1UKGA 1ULCA 1DPRA 1AA7A 3AL5A 1AXKA 1P7IA 3LEKA 4LO6B 3UKGA 1TE1B 4DXSA 3A4CA 2HDCA 4OQ9A 2D6NA 3I2JA 4LULA 1A6IA 1BEV1 5LK5A 1LB2A 2B8MA 1W6OB 3V7CA 3DYOA 2WJSA 4AGVA 2IA0A 3I49A 2JUGA 2QCOA 4UFLA 4Y17A 1IS6A 2WNUC 2LSOA 1VBD3 2LFBA 4OUEA 3RPQA 3L2RA 5FZCA 5FZGA 3U1DA 3VBSB 1AR72 1MW7A 1VZ0A 3WGGA 3ZOIA 3TB0A 1M1EB 2ZJ2A 3B9CA 4GXLA 2GC1A 3TAYA 4OI0A 1I5PA 3N9OA 3DYPA 4XJ8A 5FZBA 1YIFA 1DQ0A 2DOFA 2X5IB 5KHKA 1EF4A 1QXJA 4GRIA 2HOEA 3I56I 4I76A 4AE2A 1JU3A 3IH3A 1F4HA 2ZZJA 3W2VA 3VHRA 4BQQA 4IO9F 1PVC2 2WY8Q 1R71A 4HKLA 5C3SA 5E8AA 5J47A 2FZ2A 3G71I 2HWC1 2ISYA 1R49A 4W50A 2DCTA 1OF3A 4QHOA 1LPQA 3QQAA 2A73B 1VBE1 1MMNA 1XX5A 1MVEA 4MG2A 4ARXA 1OCZH 5FZ3A 3CQZJ 5AFBA 4Z2WA 1RUI3 1WA6X 2ATFA 5B1BH 2J1SA 3OIPA 1LGNA 1GVDA 2YX4A 2LK2A 1LOEA 3GLXA 1ZBE1 1Z91A 1OKQA 5A7SA 2D43A 4IE0A 4D6RA 3G1LA 4PF5A 1TME1 3V0AB 1OFCX 4NQWB 1CWPA 2JPCA 4CCJA 5BNPA 1U5YA 2QQOA 1TL8A 1QA6A 1PO23 3CJQB 3M9AA 3DF8A 2JA7J 2EV5A 4Z07A 3S32A 4UT5A 3E5XA 5JSRA 3JRGA 2DI3A 4ZZ8A 3VDAA 2GN3A 3K4JA 2Z5UA 3H5NA 5LWBA 4XN0A 1KDKA 1XSVA 3VBSA 4WVVA 1WMEA 2LBFB 4UF0A 2P3YA 5LEKA 3DTKA 1NYWA 1H4HA 1OPMA 4F92B 1UY2A 2W00A 1SD5A 3HRMA 1LKXA 1R4NB 4QM8A 2RVAA 3WNPA 4V2FA 3S15J 5E3MA 3WG4A 1OQEA 4H7MA 4DINB 2XOMA 4FAHA 1QJY2 2CDPA 1MZ6A 1VPHA 2VO5A 4YNIA 1PVXA 5F32A 1TNRA 4E4HA 1D8KA 2Y60A 3LSHA 1NQJA 1N1TA 3DEUA 4XQFA 3CJRB 1NKGA 2HVQA 2EALA 3RZDJ 1AL21 5CFCC 4EATA 5LZ6A 3J7LA 5GPCA 2ZHKA 2K85A 1OOPC 3AMHA 1AYN1 3OGGA 3FISA 2ZMNA 3DPRA 2V73A 4Q4W1 3K6GA 1FOXA 1XNCA 1OQDA 1R1ZA 3FHNA 2AQFA 4QDQA 3MFAA 3RMXA 3ZMVA 2W95A 2XROA 2RNJA 3TYJA 3BTAA 4RGGA 4IETA 1KQ9A 4I3GA 2Y34A 5HCHA 1ETOA 2XASA 3WQ1A 4AR2A 5IJRA 1JKRC 2J7MA 4JTOA 3I59A 2F48A 2DLLA 3TN92 4BJ5C 5F1JA 4A3JJ 1QNTA 1G9FA 3HOYJ 5CBLA 1T0FA 2WIIB 5I0UA 4XE9A 4B3AA 3GBFA 1RHI3 3R6SA 2H09A 4XQWA 4D6SA 1W0UA 4MADA 1JZ5A 2EFNA 3VN4A 4XBNA 2FDHA 3H0GJ 1VQ6I 2K0GA 4RLQA 1B8IA 4M0HA 2WO1A 3DQVC 2XAHA 2ET1A 3JR9A 2PA7A 2LBFA 5GKAC 3BIWE 1ULGA 1P7JA 3VB2A 1ZKGA 4MFDA 1GWLA 5A3PA 3CC2I 2R0HA 4IVNA 3IM0A 5CPRB 4BQWA 2R071 2R5YA 1RVF3 3OBAA 4E7SA 4LO4B 4NN0A 3D5RC 3KP2A 1ZVFA 3KX2A 4ON0A 3SKVA 2B63J 1W0TA 4Q4W3 3WG3A 4FTEA 4V19K 2JJ6A 1W6MB 1PJRA 5ICEA 4A7KA 2FE3A 2DYCA 1UYXA 3OB8A 2JZYA 4M4RA 2OUHA 2KZGA 4A0ZA 1W2OA 2AREA 5K0UA 5FFXA 2ZGUA 1XNKA 4EROA 1XNDA 1LE8B 1CAUA 4HQMA 3QBQA 4DXRA 3MYXA 2Z69A 5FZ6A 4CCKA 5GAHJ 1VAMA 1RMU1 2CGNA 2A6XA 1RNLA 3H5AA 4YVWC 3NAPB 3HKZA 4XUNA 5H2FC 3ZQCA 4XNFA 5CADA 4YM2A 4RB1A 1UYPA 3QU6A 2YYOA 4CDXB 1X3WB 1A5JA 4B7EA 2QBYA 5ABJB 5IW0A 4BIFA 1DIWA 2GMMA 2GNMA 4ESFA 2BVLA 2H1KA 3NKTA 4XETA 1U2WA 2R4GA 2FQ3A 2BXZA 1LDKB 1R7JA 3PQJA 1R1A1 2IS4A 2VOTA 3EO6A 1ND3B 2CGOA 2PQSA 2EIMH 4KIGA 1BJAA 4RGSA 3KMHA 4XCBA 3E6CC 5J40A 5LRRA 1N77A 2Z4FA 2HU9A 3S8PA 2DCJA 2W57A 2DQRA 1PO21 1G3WA 1ZZCA 1RUE2 2Y64A 2XKOA 2JDHA 5IYYA 2K7LA 5FMOS 3S3MA 1BR4A 1N25A 4K20A 4PUSA 2X29A 3ACIA 1EV7A 5T52A 3AYDA 4LQRA 1VBC1 1MEC2 3GCXA 5KAFC 2BOIA 1JE8A 3I4MJ 1K6YA 5J3LA 3ZFFC 4I09A 3OYDA 2QENA 1JOBA 4AI3A 4J01A 3GEZA 3W58A 4D0QA 1JW6A 5TJJA 1PP7U 2ERFA 1O59A 3CC7I 3IDEA 5BNNC 1AHDP 1OOPA 5LCWL 1O7FA 4M71A 3ZQ7A 4EZ4A 2EAAA 3WGIA 4AC0A 1OCOH 3WR0A 2X5IC 2ZEZA 3FMQA 1ND2C 2IBDA 5A32B 4XXPA 4BHBA 2IS6A 3LD8A 1LULA 4NHXA 3WTTC 4AVCA 2YX7A 5JCTA 3KWVA 1WKMA 2ZJQF 2Y33A 4A69C 2IWGB 1OR7A 1CJPA 2OZUA 1W99A 5HNFA 2VMIA 4OULA 2BY0A 2KL4A 2G4IA 2XF6A 1WJEA 3CCYA 5JVTA 4AIJA 3FE5A 1TG7A 4EJOA 4CCMA 1PMIA 5F2WA 3ZIWA 3PL8A 2JUCA 3AAFA 2L02A 4BQ4A 2AGSA 3K2ZA 2NZ9A 4MYEA 2L9LA 3ZX7A 2JVGA 2FBHA 2WFPA 4QXHA 4C2UA 1ZARA 1S0FA 2NN8A 2GXGA 5HDGA 4JHZA 1VBA2 3UNGC 1S0GA 3B01A 3RSNA 3QWLA 1C8NA 5I91A 4ZY9A 1F43A 2VZTA 1GP5A 5F5IA 3RZOJ 5E88A 1IXRC 4JTNA 1HXS2 4Z2AA 2UXNA 1W90A 2AEZA 1TMF1 1R082 2VNGA 1SFNA 1HC8A 3I2KA 3C1DA 4HEA2 3O8HA 1U0AA 2JG9A 4LJHA 3WP6A 2GXAA 4A12A 2FHRA 3IUOA 4EQVA 5CB7A 3FZ3A 2QQPA 2R7DA 4I7HA 3TN93 3I3LA 1XPWA 2LRPA 1WD4A 2BVVA 3H42B 1URXA 1P4AA 1HKSA 5TSWA 1AU7A 5LBQA 2R92J 3D6EA 2DTRA 3H8OA 2XB5A 2E2IJ 3FK7A 2V6EA 2D5HA 3OYIA 5DD8A 5T54A 5CG8A 2LY2A 1LTEA 2O0YA 1A36A 1FTTA 2P37A 4AL9A 1LDJA 5TRDA 3SHRA 3GFMA 1SPPB 3IDBB 4BGDA 2KA3A 4AEDA 1RESA 4Y1XA 1JT6A 4EN7B 1STZA 5FKOA 3AFGA 1BIBA 4KMQA 4AEDC 4B29A 4HONA 1IG7A 2HWF1 2HVSA 2X1DA 2QQAA 1JHNA 2DO7A 1K4SA 1REDA 4YZ4A 4IGPA 3U75A 4YVSB 2FCTA 1AR71 5CVUA 1LEDA 1SDWA 2CY6A 5BOXA 1Y56A 5BPIA 1I27A 3BZ6A 4WM8A 4RQPA 1OD3A 3L2HA 5IP7J 5DAQA 3MIHA 1LHNA 1J59A 4ZPIA 1QIQA 5E89A 4XHBA 2ZOEB 3DPTA 1Y0UA 2K9ZA 1B1BA 1E5IA 1YFWA 1FV2A 3U1KA 2E63A 2KFDA 1W36D 1QGPA 5FD5A 3K4KA 2P5LC 1QRYA 1AR62 1TMF2 3JRAA 2XGEA 1ZYRF 5A3NA 2KJBA 4MLOA 3M07A 4PI0A 4BXXJ 3M3OA 5C5TA 3HJEA 1BC8C 1VP6A 2HTSA 2CL2A 1Z6TA 3E0JB 2A6EF 3S1NJ 2ZHNA 3OG2A 4AWXB 5FP3A 4P08A 4C0HA 1RIOH 2XVLA 4IE5A 3L7WA 1EPWA 2AH2A 2JIGA 2V6CA 4A2UA 5E79C 2WT0A 1BIAA 1OQYA 3BT9A 1KA8A 1QZZA 4HL0A 1RUC1 5EZGA 1W6QB 4LHKA 3I9V2 5FXVA 5DYMA 3MPPG 4AVSA 3FXQA 5KC6A 5GAEJ 2FOKA 2BUKA 3POGA 3ZSLA 1TQ5A 3GTJJ 1GNYA 4GKYA 1BVP1 2VZPA 3S1QJ 3IRRA 1LAJA 3ILFA 4BZ4A 3HBLA 5C9AC 4JX6A 2A1XA 3GWZA 4XF0A 2WFF2 4LIUA 4IOAF 3ZDSA 1D3YA 2FXAA 4A3CJ 4G3YC 2MGQA 1MQTC 3U0ZA 4KQ7A 5FKLA 3GVAA 1Z7S2 2VD7A 4WX9A 1PHMA 4QHZA 4AEMA 1R9TJ 3R4KA 4ZU4A 2VT2A 5JHFA 3MKWB 5KHJA 4WV8A 3R4DB 2VT3A 4HKWA 3BR1A 3WTSC 2BWCA 2QWWA 2K4JA 1XQNA 4XLEA 1JJ8C 4JGZA 1QBJA 2V4JC 2DOEA 1Y9MA 2E53A 3GZ5A 4Y13A 3ZMTA 1SFKA 3SFIA 2E36A 4KT6A 3AYAA 3OYWA 3T5XA 1R6RA 4BXFA 5LFAA 2IP2A 1ND3C 1UAIA 2R041 2VJ4A 3CJTB 3TKYA 3D5OA 2LH9A 1J7KA 1IRZA 1WQ2A 2B0LA 3CO7C 2E5NA 3PURA 1S55A 2SBAA 3DKQA 4CYCA 3OGRA 4LUMA 3M2MA 4XLPF 2PTMA 1EAH3 3BOWA 1MBKA 4OWRB 2QKDA 1WJAA 1S2BA 1RUC2 3PNYA 2HQ5A 4C90A 2L7ZA 2VVEA 1Y1VJ 2PJRB 2HBUA 1ULEA 2IFRA 3V0BA 3BROA 4DMIA 2DA1A 4QQHA 3OL3A 1JTXA 4TWTA 3ALQA 1W2UA 3IPVB 1C1FA 3WNLA 3HPNA 1GV2A 1RITA 2CV1A 3AVRA 4LNVA 5SV5A 4JC1A 3MICA 2KQRA 4A3FJ 2VBXA 3L2UA 3LEMA 3HRUA 1MS4A 2W2IA 4PLMA 3PVOA 2BDRA 2XKPA 1XN7A 1MZEA 2QUOA 2A5ZA 1W6OA 4XLFA 4D9JA 4HVRA 3OF1A 4IV3A 2Q2EB 2V4AA 4ZTFA 3G1OA 2DPUA 1PIV3 1RUF3 3N9LA 1W8FA 3M70A 2UV1A 2TCTA 3AMQA 2LG4A 5EV7A 4CP9B 1YG2A 3WTWC 4GWMA 3IL2A 4K2EA 4ARYA 3ZQFA 2WTEA 4UFMA 1LRHA 3HNMA 3JU9A 4R9DA 5HDKA 4PCRA 4N53B 1HW1A 5M5WJ 1BJZA 1W04A 4XHXA 5LY2A 5B2GB 2WQ4A 1VMJA 4AFCA 3LQCA 4K8RB 4PZJA 1IJWC 4YFKF 2VOOA 4XORA 5F5QA 4E8CA 3CP8A 5I93A 3LQRA 3E6BA 1YFYA 4ZDPA 1RUJ1 4O5VA 1AL0G 1JHJA 2NVUB 1O4YA 3BIEA 3LEGA 3KVBA 4XLHA 1BKZA 3O1SA 2IGNA 4XIDA 2E9QA 4CEYB 3KYDB 2PHXA 5IOZA 2XVKA 3VBHA 3O1MA 1OKOA 1FPN3 4E7KA 4EN6B 3O1VA 1A8DA 4PFPA 2V5DA 4ZZLA 2VMCA 4DBRA 4HSJA 4XCAA 1LQ1A 3DPLC 3SXWA 2JEMA 1MJAA 1HN0A 3AJYA 3DEEA 4G6DA 4UFJA 2YHJA 2ZGSA 3N3HA 3QYEA 2RJKA 1Z7S3 1DHKB 1PO13 4AFMA 3TBIA 3HGYA 4LIVA 2MLGA 3ETPA 1YUDA 1J75A 2KKOA 1RUOA 5FWEA 1OA3A 1XTAA 3UV9A 2FEZA 2DVAA 1S7AA 4UVAA 2XUEA 2H6CA 2BGPA 3LCPA 4CEYC 1RUD1 5DAXA 1RB8G 3E1F1 4IPAA 5FWJA 4Y5TA 2Z42A 2RGVA 1OLTA 1KZHA 4AYBA 3MIEA 1MVQA 4XM3A 2R7EB 1T33A 2LMDA 3OBRA 2RQPA 3ERMA 3OIQA 4IRIA 5A3OA 4QKDA 3D8CA 1YRNB 1NK2P 3H8XA 5DAVA 2GBYA 4J25A 5L3DA 4ZC3A 2GC0A 3ZYBA 3KCCA 3AP5A 3DEWA 3WE2A 1HLCA 4O65A 1LOGA 1QU0A 1JZ8A 5K7HA 3VFZA 1GFF2 4XVHA 5A70A 5FY1A 3CD6I 3KS7A 1YE9A 2A70A 4EWAA 2M34A 1VTNC 2A05A 4Q47A 4U7BA 3LIHA 3M1HA 1JS9A 1VQKI 4CA9A 3T1BA 1WJCA 4HF2A 1ZBA1 3T2OA 4V2GA 3V7RA 1HCRA 3KV6A 4EQQA 4PDWB 1WFXA 4NQWA 3EMRA 4XJAA 3CUOA 2FDIA 1Z77A 4NRMA 4MXWA 3CJXA 3IDCB 4LJZF 4WM7C 4JKMA 3GZTB 4BJ0A 2XC7A 2BP6A 3P1IA 3AZYA 4MTEA 4IXLA 3BZCA 3IZOA 2B5HA 1CN1A 2VUJA 3D3AA 4CU9A 1EPZA 4PFOA 4FP3A 3DFGA 1AHSA 4CHUA 2RKHA 4NC8A 5C4WC 3MF9A 3BG7A 2CHHA 3OOPA 3AG2H 4CO8A 4YFZA 2NVXJ 4ONUA 4YYOA 1FAYA 5IVJA 2NVYJ 3V42A 4A44A 2ZMEA 3DTEA 3IWFA 1W06A 1IAWA 3KV9A 2OC6A 4D5CA 1GICA 3GJBA 2VCMA 1R36A 1XGSA 2QQLA 1GLNA 3IBMA 1SLIA 1OUXA 1G3YA 2OZ6A 1R4MB 3ZPLA 3KT4A 5DDJ2 1BI0A 2GOMA 1EAH2 1MBFA 4IL6C 2ZNZA 4AHYA 3OY8A 4QPOA 3HZJA 1U12A 4CDUB 1BR2A 1JKPC 5C8CC 1R5HA 4BBSJ 2ZB9A 3A22A 3MAJA 4C3HJ 2YV8A 2R7VA 4LBQD 3HYIA 4BK5A 4LGWA 2GH8A 2ZHMA 2ZGLA 5B66C 1ZRCA 5J37A 4BDVB 1IKPA 2PJPA 1SMYF 1EUUA 3ZKYA 1U9OA 4BE3A 3UNPA 3QOPA 5AC91 4MO7A 1UHSA 2EFOA 3OYHA 3FL7A 1QOSA 5FJKA 2VL4A 2A6HF 2EIEA 2KIMA 2WO7A 2L5QA 4DGWB 4GKXA 1DBNA 3GYDA 1RIRA 5IYBJ 4XMAA 1XXNA 4CICA 4KIBA 4E7HA 1U5XA 3OYGA 3SH3A 4ITVA 1ULOA 4GB31 3CUQB 2LF7A 5IVCA 2IT0A 1XNAA 1H2LA 4ZS2A 1Z0HA 2X8KA 2WRAA 2G7HA 1MS8A 3ZSMA 4RD7A 2C6SA 3K4AA 5JZGA 2WN2A 1UY4A 4COWA 3NAUA 2ARXA 1JMUB 5FREA 2VBWA 5LGUA 2BGOA 4XOGA 4FFIA 4N53C 3VKFC 3DCFA 4B4RA 4K3UA 2Y9ZA 2ACJA 3I5UA 5EJ3A 3BKZA 3ZDVA 4XUQA 3OUJA 2DDAA 2PHFA 3MDPA 3MN2A 4XUTA 1SFOJ 1F5JA 4MNUA 2R7QA 3HUGA 2E7TA 4W8JA 4YW6A 5K7ZA 3HHGA 3J7YJ 5ERLA 1LFPA 2FMYA 5BS6A 4AXOA 1K78B 3S5AA 2YFUA 2LKPA 2A3YA 3JRCA 1OD5A 3WTYC 1H8TA 1UX6A 1CD3G 5FFOC 3VBUB 2NPIA 4OAYA 3H9AA 3PIGA 2ZFUA 2WO2A 1V9U1 2UY8A 4K9SA 3VDXA 5C3EJ 1W7PD 1K7AA 1UYYA 1SDDB 3GNEA 1FP2A 1GXPA 2VM9A 5E6HA 2L4MA 3TP0A 3OYKA 1MMSA 2FD5A 3LFMA 3IMMA 3NNFA 4TN7A 3I3BA 3LWFA 2XONA 2BV6A 5FPXA 3IT8A 1UZCA 1XC5A 4DXZA 4XACA 2X9DA 3CKHA 1NE6A 5M5XJ 1S4CA 1WI9A 3HR9A 3DKYA 2IXHA 3F6VA 3WZ1A 5FKCA 1HSTA 5BPDA 1K5MB 3OSGA 4QU1A 5E17F 4QB1A 3H8UA 4AVBA 2EZLA 3W6VA 3K75B 2BVBA 1Q56A 5HCFA 4XFIA 2E31A 3WU2C 5F6KA 2IXSA 3JAMK 2OX0A 5F27A 1H89C 4JGYC 4UUTA 4ZDOA 3GMEA 2ARAA 4G7ZF 3WF2A 4GMP1 3QH6A 2H94A 4YW1A 5LA2A 1WRJA 1GUUA 2WWUA 2F5DA 4UV8A 3S14J 4FO9A 1X4PA 1SVMA 1QXRA 2YBSA 3OD4A 4QX7A 2HYGD 4DJAA 3PTYA 1QY4A 4P9LA 3BU0A 2VZSA 2VBYA 2QSHX 3FBNB 5A33B 1Y3TA 2HWB2 3CJIB 2AR6A 2V1NA 4AYUA 2Q30A 1QWRA 2QZ2A 2OAZA 5FKMA 5J4YA 2IVMA 2XVCA 1RR7A 2R7XA 5A6XA 5C4XJ 5CIRA 4HSRA 1AF9A 1YW7A 3UT0A 3IH2A 1VJ2A 1PYVA 1UOFA 2B45X 3L09A 2VKDA 4AFBA 4D3WA 3W5MA 5LA1A 2ZGQA 2XGDA 4FPJA 2PHRA 2CQXA 2X09A 5FRAA 5FGMA 3WUCA 2CMPA 5C3QA 1NK3P 2PN5A 5JSOA 2IGKA 3ZYRA 2O3FA 4OHVA 1WCSA 1UOJA 1PUEE 3CF2A 4CCDA 2A69F 2PMZA 3PSIA 1PUFA 1VBC3 4XILA 4XUPA 1HF0A 5IVYA 3LF7A 3U4SA 5KXCA 3UESA 4CCCA 2HJIA 1IKQA 1RUG1 4HOBA 4LPLA 2LC2A 1FOD2 5E18F 1ZHFA 3GLLA 4BUPA 5D4SA 4CE8A 2VZQA 4NAMA 3JW4A 2QYOA 4E8DA 5FZIA 4W4ZA 1SVLA 5GLTA 5D6FA 3RSJA 3AP7A 3WNKA 5FR3A 3H36A 4DFSA 4CCOA 5E8IA 1WCUA 5J1RA 2VZOA 1O3SA 1PO11 3RI8A 4CU8A 1IGOA 4I02A 4YVSC 1REPC 2JB8A 2ZSIB 3F3XA 1FX7A 1T0FC 2QTWB 1S0IA 3W9AA 5EZWA 4QXCA 2C26A 1YC61 3TEWA 3DUIA 5LHHA 4XBLA 3HJRA 3VD5A 4L0YB 3DBRB 1FZPB 1POQA 5FZKA 4JDMA 1TMF3 2P3IA 1XNTA 1Y6IA 2P4EA 4CP1A 1VBD2 2XQRA 2QKMB 5IP9J 1YFXA 3GO5A 1WA4A 5BV6A 4OUMA 3GUDA 1P4XA 4Q0SA 3T4HB 3VYSB 4D5FA 4WVZA 2X6XA 3SEZA 4HNTA 4F7ZA 3GTOJ 3NJYA 1RR8C 2VULA 3JRFA 1ZN2A 3B94A 1BBT3 2F17A 1JXSA 2XBO2 3DXJF 4NIHA 4LK6A 5FYVA 4DW6A 4KITB 2M7BA 4IV3C 1SPPA 2V9KA 3KZZA 4MGRA 5D5VB 1WJ5A 5C9AA 5K9YA 4LB6B 2ID4A 2RS31 4BCUA 2TRTA 3OPTA 4B8EA 3M3EA 4AHWA 4FPFA 3I2FA 5CFDB 3GZUC 2GMPA 1IS4A 5JFRA 1YIPA 5LHGA 2GH2A 2JDPA 4OUSA 2WAAA 5L73A 5A1AA 4GFBA 3GTKJ 4CDWC 3LGRA 1JUIA 1TBXA 2EPFA 2PHLA 4G9YA 2HDDA 1F15A 3THTA 1UZVA 5LGTA 2WFF3 1AZDA 1C5IA 1X4OA 2FSWA 5BNPB 4OIPF 1HXS3 4JGZC 4FVVA 4A7YA 4KICA 2RM22 1N1SA 4M74A 2D7FA 1WMDA 3O3KA 1QVTA 3WQBA 3EUAA 4NIIA 2K4BA 5CFCA 2O9LA 1I3HA 3JRBA 2PJRA 4QGLA 2BFUL 5JMCA 3A4UA 4IEWA 4U88A 3GBWA 4ORFA 3PIPF 4GYGA 1RETA 1HB3A 2RAEA 4UUVA 1CPMA 1N75A 2ZKZA 4GXOA 4OI4A 3F6OA 1PO22 1RC6A 2WA4A 1BQPA 1QH6A 3WNOA 1S7OA 1ZLJA 5IOYA 4RDUA 3CBNA 2FCUA 3BTYA 2FMLA 2K9LA 4GZ9A 1UD1A 4E7IA 1WBFA 3BCBA 2RDSA 2B9VA 2AO9A 3E5UA 4HMZA 3CO6C 4S2FA 3V64A 3LQQA 4D6QA 1BK0A 1W3XA 1ASJ1 1K5JA 2LREA 1HBXG 1RTVA 4NNJA 4NIDA 3K3OA 1UIJA 4TZDA 3WNMA 4XLNF 4QMAA 1ZREA 4IEPA 4QX0A 5A7QA 2ZGNA 3ABKH 2VKHA 3VBUA 5FO8B 3LOIA 5EYYA 5J8CA 1APNA 2PHTA 4WM7A 1IV8A 2H6BA 3O5SA 1K45A 3E6DA 1PVC1 1SMTA 3HC7A 1PGSA 5IATA 2NNYA 3HOWJ 1V5EA 2YU2A 4GIQA 1XOYA 2OU2A 2HWC3 3VBFC 2VIXA 2IRFG 3TNPB 1HDKA 2L3DA 4QWQA 4MGKE 4ITCA 3ZSJA 1K12A 3GCWA 4B1MA 3I2OA 2DCZA 4L8QA 1BM9A 3VBFA 3K7AJ 5K0UC 4EMSA 3ABZA 1LNSA 2RS11 1DQUA 2VG9A 4QD2A 2DA4A 2R0QC 2STWA 3Q8EA 1REEA 2V9PA 4QLCU 2BNOA 3OTFA 1JZ7A 3T09A 3SLIA 5HI0A 1EKEA 4XRSG 2EXKA 4KT5C 3S3NA 2MFZA 1JZ3A 5IAXA 1R1A2 4EWEA 3AKPA 5C4WA 3UGHA 3ZRGA 4IEZA 1RVF1 4XF3A 3ZQLA 1TW3A 3UGGA 1FSEA 4E7LA 1BEV2 1NUKA 1NX9A 4OINF 5FY7A 2QGUA 2WNVB 4NHMA 4BAYA 2P17A 2HOSA 5FLJA 2PQ8A 2WAEA 5AIQA 1GU3A 1QOTA 3RI4A 4N0BA 3WHBA 1UY0A 4MH0E 5LLQA 4OMCA 4CDQB 2XV4S 5GTIC 3FMRA 2KIFA 1J3PA 2XXZA 1L0OC 4UV9A 3PVBB 4RBOA 1OFNA 3CDZB 4C1WA 5KXBA 5FP9A 3U9GA 2KT0A 2V5YA 3ACGA 1GNHA 2BW3B 1BI1A 1R5GA 2XHNA 5FKBA 4LBLA 2JA2A 4CP9A 2JDMA 3B6AA 4B7KA 4ESBA 5ISLA 4ZYDA 4DQAA 2PN6A 2VI6A 1OVPA 3NAPA 4AVVA 4QKNA 4JX0A 1U5TC 2EFWA 3MUY1 2JN6A 5LK7B 5LA9A 5AC93 1GWKA 1AYN2 5C33A 1WWXA 3RYPA 2ZA9A 2OUJA 3D1NI 2QVOA 3H3VK 4KN7X 1BOAA 2CUZA 1MD0A 5DAPA 3GFJA 1UN1A 3IC7A 4RAZA 3QU3A 3CDHA 4Y52J 5A6YA 2G1MA 4LLLA 1R1VA 3G1MA 4J1WA 5L9VA 1QGLA 3SZGA 2XH6A 2V4VA 4BQYA 2HXOA 2ETHA 5EEHA 3TL4X 3O1UA 3I54A 4EJRA 4BE0A 4QB2A 2JG8B 1NZIA 4QIWN 1TME2 2V1DA 5EQUA 5IVFA 3VV1A 4YG2F 2GNTA 2M3AA 1X8MA 1RUH2 4A6DA 2QE3A 4MHUA 4D7TA 3D0JA 2QKLB 2HWE1 2O1QA 4HNVA 1KDMA 4LR4A 2LF8A 3L2CA 4ET7A 3O1TA 1OUSA 3T2TA 5LASA 1V9U2 2HOAA 5CISA 3HOVJ 3L00A 1I1SA 3WCSA 2VBPA 3ZP5A 1SFEA 4JHTA 1O5LA 5DCMA 3HOBA 5JXIA 3T0DA 4KBBA 4PJMA 3USUA 3CZJA 2E35A 4ZU5A 1QXPA 3RJPA 2ZGTA 3N9PA 5KHHA 4XRFA 5DV5A 5D1IA 1GZTA 3VDDA 1R22A 1BLZA 5C5UA 2DFEA 2VUMJ 3VZMA 3MFCA 3M7AA 1K42A 1WCKA 1JYCA 1YIOA 2VQAA 2KXLA 1H9WA 2YS9A 2RS51 1ZA4A 3IAM2 1JTZX 2W24A 4ZJZA 4LT5A 2GWRA 1OR7C 1U3EM 4CPBD 3S2WA 1UOBA 4BWOA 1R1UA 5L3EA 1B09A 2A3WA 1ULPA 2R0FA 3LWCA 3IIAA 2D5VA 3Q8BA 3CCJI 3H3LA 3FBMA 1RUG3 4D7NA 4DNCA 2FA5A 1QJX1 3KD4A 4MX3A 2CW8A 4DO0A 4WVMA 4A6SA 3CLPA 2D98A 2ETEA 1A6CA 4B48A 3IKVA 1YJLA 4NAOA 4QT6A 1V6IA 3VZOA 3BGAA 1B35A 3NQHA 4Y3OA 1VRH3 3ST7A 3ETQA 5FUNA 1TWHJ 1FJLA 5T5PA 3UJQA 4XF9A 3FDYA 1IN8A 3WNXA 3K1NA 3Q8CA 3ZXKA 1Z6RA 1O3QA 3OPZA 5A2QK 2W9XA 1H0MA 5KHGA 5GALA 1KQRA 5GZGA 2JWTA 2I10A 3CEWA 3CDIA 1HXDA 1PK6B 5FP7A 1YJNI 2XRLA 2VC9A 5T5LA 5FRNA 1UYZA 1J5YA 4RN5A 4XLAA 1OXCA 5F7UA 5JOXA 5EWSA 4P00B 2NS0A 2ZFWA 3W2AA 4B43A 4FETA 5F64A 2NM1A 1FATA 3LOCA 4I98B 2KP6A 3R61A 1AL22 1AX2A 2BZDA 3VYUB 2M4GA 2XPVA 4UAPA 5L9BA 4NHLA 4RAYA 1XYOA 1HJFA 5ABJC 2SLIA 4ANJA 3W21A 3B00A 4DEQA 4N7IA 2QQ9A 1YJ9I 3JZVA 2GMEA 3HL2A 1NQDA 4YG6A 2VE9A 2FBEA 4WZFA 2RS52 3ZYFA 5ILUA 2XJSA 3C7EA 1VQ4I 2B42B 3LNQA 1E3PA 3QPLA 1H1MA 3G7DA 4RR3B 1V9U3 4LKEA 2ID6A 3KFWX 3V4GA 1A04A 3MW2A 5GADJ 1TT0A 3TOBA 1MEC3 4H7LA 4CDUA 1XDUA 1FIPA 5E1RA 2YUSA 3MEXA 1HV0A 4CCEA 1Y1WJ 1T2KA 4ENKA 1X19A 3OCPA 4DB5A 1R5ID 3DV8A 4XN3A 2LP0A 4YFNF 3A02A 1RUNA 1J1TA 3LSPA 1W9WA 5KCMA 1K5MC 1KGSA 2WZR2 1F1ZA 2VQUA 1Q8OA 4D7MA 2R32A 1W2AX 5FK7A 1GLHA 1W8UA 4FXKB 2R072 1DLLA 3F8NA 5KR7A 3PVEA 1AOYA 1MJ9A 3O0VA 2Z2SB 4K40A 4B4CA 3CMGA 4FQGA 1RUJ3 1GVJA 2DA5A 1JHFA 1VQMI 3H3UA 1RUE1 1OA4A 2ZKLA 4AFAA 2DU0A 1B9MA 3M3YJ 1JYNA 3FHZA 4WXDA 3N9QA 4X1EA 3KB5A 1Q1VA 2XF5A 2EXJA 3FUQA 2LR8A 5DUIA 2M4KA 4A3ZA 3NNMA 4RGUA 1W6QA 3J7AY 1UZZA 1W8NA 4XLCA 1F9NA 2VE8A 1ZGWA 4II3A 5F0FA 2KDOA 2NMNA 4GO1A 3M4OJ 1YW8A 2AS5F 3GFIA 1HX6A 2JDAA 2A07F 3BQZA 3CUQA 5A7PA 1SCRA 1PM4A 4S04A 5HOOA 5FYMA 2WZEA 4HDVA 2ME0A 5AVPA 2HWD3 4QXKA 1OURA 1W2NA 4QXBA 5H6QA 3KGLA 4L9VA 4M3FA 2PMHA 1QJFA 1YX5A 3HRSA 1EH6A 4A41A 1YQ5A 2MD0A 2RDRA 1U5IA 4BY7J 1SC7A 1FV3A 3KV4A 1W3VA 2VB6A 5FMCA 3AZXA 1IXSB 1KXGA 1MS9A 2MH9A 5JPMB 3WW2A 2D97A 4CU7A 2F5FA 2GQQA 3VBOB 5D8AA 3POSA 1ZX5A 4W65A 2BY1A 2CQQA 5FZDA 4N4OB 3G73A 3ZYIB 3KP5A 4HW0A 4XSXF 4BYYA 2D3RA 2F4IA 3HEFA 4UBHA 1YFHA 2P2KA 4QPYA 2CFXA 4ES8A 1G7YA 3TO6A 1LHWA 1HKDA 4IQPA 4R79A 2H0BA 2P3KA 4RS8A 2RS32 1CIYA 4JP0A 5I8SA 4XFFA 4GGGA 2DURA 2XPUA 2LOOA 1B4AA 3ULQB 2VXZA 1ZH5A 2ZCWA 1XBFA 4ABZA 3VDDB 2Y0MA 2VTFA 4BH9A 2JT1A 3V8LA 1LOCA 3BG3A 3ZFFA 1FIAA 2VZ1A 4DBQA 1FNNA 3ML6A 3JRHA 5E1ZB 3DXUA 3WTZA 1O8SA 3WHTA 5FPVA 4CPBA 2ZMEC 5CQEA 2NS8A 2OQRA 1ULYA 1PZ8A 4ASMB 1QJEA 4XDPA 2CU7A 1T98A 3CQOA 3X2QH 1SFXA 2ZGRA 3AXDA 3NKGA 1F4AA 3SFZA 2HPMA 3BCWA 4IEJA 1DGWX 1YX3A 2V7FA 4P5HA 2Q8EA 4LG0A 2EK5A 2ZGMA 2YPRA 3OWTA 3OYWB 3SCHA 3DU5A 2WAQA 1VBE3 1X2NA 3K4LA 2M7AA 2BYVE 1UIKA 3A0BC 2J5OA 1ODDA 1D2SA 2VMGA 4HX4A 1QJU1 1O3TA 4CDXA 3H5RA 1D4M3 4Z2YA 1B72A 4PDWC 3WEZA 3GBGA 3HSFA 1ENRA 2ESNA 4M3CB 2DK5A 1XMAA 4Y4RA 4GALA 5J1XA 1W5TA 3K4BA 2HEYF 2P0WA 2ZNYA 2COBA 4ZU7A 5FOBB 5E3LA 1ZGJA 2K2SA 3VGIA 1AJOA 1YI2I 1GR3A 1W0PA 2K46A 1AR82 2YDEA 4PLNA 3BG6A 3HIFA 2FX0A 2ID3A 4GH4A 1CQTA 2G0EA 1FPN2 3K4ZA 1IN5A 2QNKA 2WAQN 3GTGJ 1QNYA 2HWD1 4B8XA 2HKXA 2EJRA 3KEOA 3JCIA 2MC3A 2DYRH 3C7OA 2D1HA 1TP4A 2DCYA 4F91B 3OYCA 3C7JA 1XD7A 2J1UA 3NARA 5C9AB 1R092 3OYEA 3H92A 1X1CA 2GU9A 2K40A 1J3QA 2VJ5A 3K46A 1W5SA 4LE3A 3WDWA 4UXAA 4AI9A 3HB9A 2J1AA 1YJKA 2VUCA 5DUWA 3HHHA 1P2FA 5D5XB 1FX5A 4LKFA 2WT1A 1SLTA 1BN5A 2R063 4OMYA 1FMWA 2JIJA 2D45A 2OA4A 1UQXA 3HDDA 4PSXA 3COAC 4ZS3A 5J36A 3PJQA 2ZS6B 1RZ4A 2GA1A 2UUZA 1K6OA 3FLRA 4KU8A 2VC0A