5LEJA

The transcriptional regulator prfa from listeria monocytogenes in complex with a 30-bp operator prfa-box motif
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
236
structure length
236
Chain Sequence
NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Listeriolysin regulatory protein
publication title Structural basis for glutathione-mediated activation of the virulence regulatory protein PrfA in Listeria.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Transcription
total genus 69
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5lejA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5lejA01
2G7UA 3F8NA 5CVRA 4JTNA 3IKVA 4IPAA 1TQ5A 2X0LA 1MGTA 4MQVA 2HYGD 3TOBA 1CGPA 2VC1A 3O14A 4Q0PA 4EV0A 3ZMSA 3M8EA 2A3SA 2VBXA 3BP8A 3RPUA 3H50A 3KMHA 1ZHFA 3F6VA 3QACA 3WTWC 3FHIB 3V8JA 2ZNYA 4LULA 3RYPA 5AIPA 1ON2A 1LDJA 1YQAA 4O3MA 3QU6A 4HN0A 2O6GE 4XFHA 4OLLA 2OYZA 5HVQC 2EVXA 1XDUA 5HS9A 1R58A 3CO6C 2GH2A 2MPFA 5H6RA 3K1NA 3GXOA 1ZLJA 2Z99A 5BPDA 1U2WA 3HHHA 2E7XA 3ROUA 4U0VA 4XSXF 2WV0A 1U6GA 2GWRA 1YFXA 2IA0A 1P4AA 2VPVA 3RIRA 3CDHA 3FM3A 5J48A 2DI3A 1YW7A 3NSTA 3GFIA 2UY8A 3PNAA 3GF2A 3D0SA 2GAUA 3JAMK 1FBSA 4A6DA 2VC0A 4IEXA 2WC2A 2BGCA 2XKPA 3HYIA 2GA2A 3H8UA 2XV4S 4KIBA 2PAEA 3PLQA 4EWEA 1BM9A 3JZVA 1H0MA 4XEZA 1XGNA 2P7VB 2L02A 1B1BA 3GFMA 1T38A 2I45A 4IVNA 3H1MA 3NEUA 2FMLA 1SD5A 1BC8C 4HAMA 3VFZA 3V7SA 5D5VB 4G94A 4AXOA 2JZYA 5ICCA 3CEWA 4XF0A 3COAC 4A0YA 3ZMVA 2IJLA 2XUBA 3SCFA 4U7DA 3CTAA 2Z69A 4JV4A 2CAUA 4IEYA 5I93A 1R22A 2GIVA 3QP5A 4AD9A 1O57A 4LG0A 1YFHA 4OIOF 2CW0F 3PQKA 5E8GA 4H7LA 1J75A 1XGMA 2P5KA 5HLIA 4LFUA 4ZH4F 4JK1X 4QMAA 5E1XA 4OOIA 4U7BA 4MGZE 2XIGA 1TW3A 2MD5A 1HW5A 5FGMA 3FFQA 2PI0A 2PHLA 4HSJA 5DD8A 3FZ3A 3M7GA 4AQ2A 4ONUA 1RUNA 3VODA 4BHCA 1R00A 1CF7B 4R1HA 3QPTA 1ZZ8A 2DLLA 3GFJA 3NQOA 4Z07A 3T8RA 1BIBA 4LB5A 2RN7A 2F5FA 2L4AA 3E5UA 5JI6A 4M9SA 1L3JA 1SD4A 3HIFA 4EGYA 5CVVA 4A6EA 3IBMA 1IN4A 2R7DA 4ZYEA 4PGHA 2FQ3A 2IXKA 3ZQ7A 4EM0B 5AONA 2A69F 4RAZA 4UXAA 4F8AA 1T2KA 2ISZA 1RL3A 3TNPB 1YO5C 4L5JA 2DT5A 4MHGA 1SAXA 4B09A 3IDBB 3D82A 2PAKA 4XFIA 1VTNC 3L7WA 3EQLF 1JE8A 5DYMA 4HLXA 1FC3A 4LEJA 4UUVA 2B0LA 2WFPA 1S7AA 2E7WA 5HI0A 1NYWA 1ZAOA 5J7MA 3GX4X 1J1LA 5AIQA 1FT9A 4QM8A 2H27A 3S2WA 3BJAA 2EA7A 3F21A 4IEOA 5K8SA 1XD7A 1Y0UA 4WCGA 4Q0VA 1ZARA 1EY2A 5KBFA 2Z3YA 5CLSA 4I7HA 1DGWA 2DPUA 2VBZA 4HLTA 2ET1A 1KYWA 3F8BA 6PAXA 5D5WB 4WF2A 4J1WA 4ZYDA 2OBPA 2OA4A 3ML6A 4OIQF 1JHFA 2UXNA 3UKTA 1ZRCA 2OD5A 3WTSC 1LR5A 2IXIA 4XFGA 3EDPA 5JFRA 4R52A 3MFKA 4XF9A 1DPRA 2P5VA 3JTHA 1SMYF 3LOIA 1D8KA 3SHFA 3ZP5A 3TKYA 2CFXA 2HKOA 2YX4A 5DEQA 2HJIA 3BALA 5KVRA 2QQAA 2X4HA 1YS6A 4MGRA 1YLFA 4M73A 4QX5A 3MQ0A 4M74A 4ENNA 3ZPLA 2Q0OA 2QENA 1WKMA 2LDUA 3FHZA 4BXUA 3IWZA 4G8XA 4M72A 1IN7A 1VR3A 4IEUA 4L2NA 2M5WA 2VN2A 3H3ZA 1P6RA 5T3NA 1PP7U 1BBYA 1WRJA 1SFUA 3ETQA 3OTFA 1KU9A 3ABUA 4N0BA 2OZ6A 2ZJ2A 2EFPA 2CV6A 1ZVFA 2PAMA 3EQEA 3B02A 2PQQA 4OIRF 2HOEA 2PHDA 3RZZA 4LK0F 5D5XB 4HOBA 1WGPA 1C0WA 4UXNA 1O3TA 3RKYA 1ZZBA 3I4PA 3USSA 4YFXF 4HYEA 2PMHA 2EV0A 1PMIA 4EJWA 4WWCA 3L00A 4AVCA 3ISPA 4YFNF 5LGTA 1XE7A 1OFNA 2A07F 1OYYA 3M3IA 1HKSA 2HFHA 1J9IA 3SFZA 4GXOA 2QBYB 2VOOA 3I54A 5L3DA 2MH2A 2O03A 5L3CA 1HW2A 3EHKA 1TBXA 2HTJA 3SHRA 1USSA 4PGGA 2QWWA 4M6XA 2VXZA 4ESJA 4AIKA 2HTSA 3P7NA 1DZTA 2R7FA 2ZMEB 3MZYA 2C0ZA 5AVPA 4RB2C 5ICGA 4IEPA 2KXLA 2PA7A 1WI9A 1TTYA 3KETA 1YFWA 4HLYA 1JHHA 2KIUA 2W84A 3V4GA 2VQAA 4MX3A 2MLGA 2VBYA 3P9KA 2IA1A 1R7JA 3KP3A 4HF0A 5I91A 4OMZA 1ODDA 4HF2A 3H3UA 4N9HA 1MZBA 4ZZLA 5F1RA 3GFLA 4HA8A 1UIKA 4EGZA 3WG9A 3E3VA 1QQIA 2B5HA 2JPBA 1J58A 4ZZDA 1XN7A 1FSHA 1RTVA 2Z5UA 3CL1A 5E18F 3SXYA 4E2SA 5HDNA 2STWA 3J81K 1V4RA 2IC1A 5TRDA 2EK5A 5I0TA 4CO8A 3I58A 2Z9OA 2O3FA 3T5XA 2XAHA 1O3RA 4BIFA 5LRSA 4HQMA 4Y17A 2F2EA 1ONVA 1H9TA 1Z91A 4AIHA 2BBYA 3KEQA 4CXFA 4Z2YA 5KHIA 1TLHB 5ILVA 4MZUA 3CJXA 3JW4A 2HGCA 3HOTA 4QGNA 1YUDA 3RYRA 4O6JA 4AQ6A 2QYOA 2FQPA 2QCSB 3EO6A 5DCMA 2AXLA 2P8TA 1ZRRA 4K8FA 2F4PA 2JTVA 1W5SA 5D8LB 1BN5A 4KWLA 4UHTA 4WX9A 2ETEA 1GVJA 4HBNA 4ZU7A 5KHKA 3J80K 4I0AA 1KQ8A 4D7TA 3HSFA 3SCHA 3BOQA 5BY5A 4BAYA 5K5QA 5D5UB 1P2FA 2JSCA 3ULQB 4AIJA 1IN6A 3SZTA 3RNSA 4HDVA 1EV7A 3DXJF 1UIJA 2K86A 1IAWA 5FD5A 2N7GA 1T6SA 4DINB 3F6OA 4ETSA 1RGSA 1A04A 3GVAA 5FLXZ 2DCTA 2IXCA 3TGNA 4I02A 1QPMA 5CADA 4UVAA 1ZGJA 5HLGA 2DAOA 4Q0SA 2DW4A 4F7ZA 4FT8A 2K02A 3DL3A 3RYKA 5C6CA 5JSRA 2RC4A 1NZCA 4Q47A 1XGOA 3I59A 3E5QA 4LB6B 3IKTA 4P9GA 5CJ9A 3TO7A 1U5TA 2W85A 3CUOA 1FNNA 3JSPA 3WU1B 1ZREA 4ENJA 1QGPA 1SD7A 4UVBA 3IRQA 4RGRA 1LVAA 3OD0A 3T0YA 2QNKA 1S7OA 3WU0A 3U1DA 2XAGA 1X82A 2CWEA 3H1YA 2GC1A 2LKPA 3EYYA 2EFNA 1FYMA 5IT9Z 2RQPA 3L2CA 1J2XA 1ZN2A 3ES1A 2M87A 2H94A 2K7LA 4UV8A 1ZZ7A 1K7AA 5A2QK 5FDBA 1SMTA 2FMYA 4XETA 5L3EA 2IXJA 4PJYA 2VT2A 2XHKA 4G9YA 3CLOA 4IEVA 3FMQA 1QNTA 3WW3A 4AVBA 2IP2A 2ZKLA 1T0FA 5I8TA 2HS5A 4JVAA 3RKXA 2Z33A 3RPQA 3FZVA 4ZYHA 4IRHA 1CAXA 4P9UA 3LWCA 3GW2A 2FEZA 3M8FA 1UW8A 4IESA 1P4XA 2ESHA 2FF4A 4META 2VONA 3LAJA 4EJVA 2NNNA 3W6JB 3W6KB 3DN7A 2H6BA 2DFIA 2FXAA 2RKHA 3PQJA 3KLOA 3E97A 1J7KA 4OIPF 2ISYA 3IDCB 1KQ0A 3H7YA 2E1NA 1JXSA 2EJRA 5I0UA 3E6DA 1EP0A 3HT1A 2V1DA 2P17A 4IRGA 2BE5F 1QZYA 4L0ZB 4ENMA 3NKTA 1W7PB 4RGUA 5LHIA 5DV5A 2KRFA 3KZYA 1B9MA 4FX4A 1I5ZA 4JBAA 5FB2A 4PCQA 2PLYA 2OQRA 3G7DA 2NRAC 5L3BA 2PN6A 1MDMA 2IW5A 5BV6A 3CO2A 3T1BA 1RNLA 4UV9A 4IF4A 1YS7A 2C6YA 1MD0A 3BWGA 1IUYA 1UCRA 2FBHA 3QP6A 5EEGA 1Q5OA 5TJJA 3UKVA 2O1QA 1FY7A 2XAJA 2IRFG 2D5HA 1ZG1A 1LQ1A 2GXBA 1XB4A 2L3DA 4KNYA 1R1UA 2ZXJA 5E20A 2D5FA 3FX3A 2H0VA 2P6TA 4IERA 3SQNA 3GLXA 1X7NA 2ATFA 4IXAA 2L54A 1XCBA 4KUMA 3GUDA 2K9ZA 1CAUB 4L5IA 4HX4A 4S04A 5K1YA 1XSVA 1TQMA 3EYIA 5D8KB 3IHUA 2FE3A 3R6SA 2KJBA 3EJKA 3NRVA 4MQ9F 1U5TB 5E8IA 4MH0E 4A12A 4Y15A 3H92A 3P9IA 2QVSB 1Z1DA 4GO1A 3WW2A 2ZO4A 2ET7A 1J3QA 3D0JA 1B9NA 1FYLA 5EFUA 2D1VA 1MJAA 3R60A 1TQIA 5C8WA 1SFXA 2IVMA 4HN1A 3LQRA 4QXKA 3HOSA 2H09A 2V1UA 4LLGF 3HTSB 4FX0A 4PIYA 1UFMA 2EAAA 1ZYRF 3BPZA 1FSEA 2GC2A 1MJ9A 5BS6A 4WXDA 1RC6A 5ILUA 4LMYA 5BUVA 4HBLA 2D1HA 1HSTA 4Q29A 4AVAA 3G3ZA 1OMIA 1UHWA 2Y48A 1IXCA 3GO5A 5HLHA 1OD5A 2HKXA 5LHHA 4YNIA 2G7HA 3JAMZ 1OI6A 1FWZA 3ACLA 2A61A 2ZNZA 1X3UA 1Z7UA 3WGGA 2QVOA 2D2WA 1I1SA 4HQEA 2B8MA 4MEYF 3VEPA 5BQTA 4MGIE 5FQ0A 1V70A 3LA2A 5D1IA 3KE2A 3GZ6A 1WSUA 2DTRA 2VBWA 2BV6A 4G6QA 3RTRA 1YTYA 1FBQA 4KT5C 4A2UA 5CVJA 5HDKA 1QXRA 4LUKA 1TQPA 3QU3A 4XLNF 2BNNA 4YYOA 4XFFA 1QY4A 3V8KA 3MZHA 4GCVA 5ICEA 5F6FA 4MV2A 1UD1A 3SMHA 2RVCA 4U0YA 1KGSA 1OPCA 1MDMB 1CAVA 4XSZF 2HZTA 1R5HA 1MKMA 2OU2A 2D45A 1KA8A 1FXZA 3ELNA 2G9WA 3ES4A 2GZWA 2LF8A 1X8MA 2XVCA 3U9GA 1UB9A 4HF1A 3BJOA 2A5YB 4Q4ZF 2PQ8A 4ASNA 4LG0B 4R8HA 4EJOA 3EUHA 3WE3A 3QRFF 4I2OA 5D4SA 3FJSA 4XFAA 1DGRA 4XBFA 3E6CC 1PUEE 3J7AO 1ZGAA 2HDCA 1T39A 4FAGA 3KFWX 1U78A 2TDXA 2RGVA 3FMSA 1FZPB 4QGMA 4G7HF 2DQRA 5FO5A 5FLJA 1QXJA 2V1XA 1SEFA 3WTTC 1IPJA 1PM7A 2XROA 2MNGA 4R79A 1H1MA 2CGPA 3IWFA 2IPQX 5CVIA 3L9FA 1IW7F 5J8CA 1O5UA 4O9GA 3BU7A 4Q0UA 2V79A 2RNJA 4UBHA 1FBUA 2DBBA 3F8MA 3U11A 2P7CB 1JGSA 2QQBA 3GYDA 2OAZA 3C3VA 4RGSA 5KK1A 1SQ4A 1U5TC 3MYXA 4KN4X 5JSOA 3LQQA 4HVRA 4TLFA 1QWRA 4RD7A 2NYXA 3GYHX 1YIOA 3LAGA 1TNSA 1DDNA 3B73A 5EEHA 3OGJA 3HRUA 1FYKA 4IEWA 1R1VA 1WQ2A 1Y3TA 5DDGA 3SZPA 1I27A 4A0ZA 4KU7A 5EZWA 1Q3EA 4PZJA 3I71A 4HX7A 3K1PA 1L3LA 1S29A 3EETA 4JQFA 4U0WA 4D0PA 1W5TA 3MAJA 4EWAA 1QO0D 2EFQA 5FQ0B 4IHTA 1ULYA 5ILSA 1EYBA 4UNOA 5F64A 1YYVA 4NVPA 4AVPA 1WLTA 3RDIA 3H7JA 3CJNA 3KGLA 1IXSB 4Y13A 3TDUC 2UY9A 3FXRA 2O61A 3JSOA 2BYVE 3EBRA 1HKQA 3M70A 2KIFA 2QZ8A 4UBGA 2LNBA 4I01A 3BPXA 2IA2A 2CYYA 4KIFA 4BH9A 2K0GA 2GXGA 1CAVB 2MA3A 3F22A 5KHHA 1YLLA 1GHCA 1K79A 1PDNC 2L01A 1SFNA 4CICA 1Q1HA 1LDDA 4GULA 1F9NA 4GGGA 2O0YA 3I5UA 3CUQA 5FFZA 1Z6RA 5H6QA 2EA2A 3IIAA 4ENKA 1FP1D 4KL1A 3C18A 2ZFWA 3WTVC 2STTA 3KP5A 4OMYA 3HSEA 3REOA 4CGZA 4HDUA 4XFBA 3WGHA 5DUIA 4MEXF 1XSXA 2V6CA 2PTMA 4AWXB 4OU0A 5LGUA 4EJUA 3FM5A 5H20A 2E1CA 1ZRFA 3HRTA 4DQ2A 2H6CA 5FCCA 2QUFA 3R0AA 2JRTA 1BIAA 3TOAA 4MTDA 4LJZF 4NHJA 4FHTA 2IXLA 2QM3A 2PFBA 2W57A 3IRRA 1STZA 4A5MA 1IPKA 2IXHA 1KYZA 1BI3A 2FNAA 2VOPA 2Q4SA 1P92A 3HRMA 1P4WA 5J3UA 5LEJA 3GZ5A 4ZU4A 2M30A 1UPIA 4RS8A 4CHUA 3MCZA 4IEZA 2YSRA 1LEAA 5E1WA 3K69A 2Q0AA 1UCXA 2UYAA 5E1RA 1LDKB 5FLHA 1LB2A 1SD6A 5HOOA 5DUKA 3RKWA 4A0XA 1RUOA 1E17A 3D5LA 3SCGA 3WTZA 1U12A 5JCTA 1YW9A 3HT2A 3ZMTA 5HS8A 1OR7A 1DZRA 3V8LA 3LA3A 3CLPA 5LLQA 1KU2A 3K0LA 1GQGA 1YHFA 2DO7A 2KKOA 2PEXA 4HVOA 4I3PA 3S7IA 5E16A 1I6XA 3WTYC 3QOPA 3CF6E 4HW0A 3H9AA 3TNQA 4B29A 5J8FA 3J81Z 3U2RA 1O3SA 2Q30A 3HHGA 2HQNA 4N9IA 3TO6A 3K9TA 5BOXA 2Q8KA 4X6RB 3F8CA 3Q9VA 2XAFA 1G3WA 1R36A 3U10A 3UKNA 3ZN0A 2Y0OA 1XRUA 2VE8A 4QGLA 3DKWA 3OCPA 3BPVA 3JTGA 2EV6A 1TW2A 2L4MA 2OA2A 3R61A 4FAHA 4EM2A 3IC7A 3K1MA 1D5VA 1OYWA 2MC3A 4ZU5A 1ZRDA 4KYWA 3CUQB 4HV6A 3SXWA 1WA4A 2MH9A 1OYIA 3I0TA 4P5OA 2R3SA 2M8EA 5BPIA 5HS7A 1G4DA 4D7SA 2F5CA 5JR3A 1O3QA 3J80Z 2FBIA 3DFGA 4G7ZF 5DCMB 2F5EA 1G6NA 5CYVA 3M1EA 1IN5A 2NNYA 2KIMA 3BDDA 4IETA 2XAQA 1KU3A 4Q48A 1DUXC 3C1DA 1GXPA 4MUVA 3HRSA 1O5LA 3F23A 3S7EA 2XLAA 1V3FA 1H1IA 1RI7A 4PIZA 1E2XA 2UZKA 1F4KA 4WVZA 3FXUA 1RZ4A 4U88A 3DV8A 4WZCA 5D4RA 3O2PE 2K4JA 3ZMUA 4RAYA 4EWDA 3KP7A 4IJAA 1S8NA 1LNWA 3E5XA 5JHUA 5E1ZB 2PYTA 5ED4A 2PMUA 4CZZA 3KEOA 4NQWA 3MPBA 3ABTA 3T8TA 1J0RA 2UWMA 1J3RA 1LEBA 4O9EA 1XGSA 2HWVA 4J1XA 1U8RA 3BB6A 2VODA 5D6FA 4X6QB 5JVTA 1XDSA 2VECA 3KCCA 2RV8A 4EJTA 3IL2A 4HV5A 3ECOA 2XRNA 1CX4A 4BYYA 3PVBB 2IT0A 1X8EA 2HEOA 1LJ9A 2A68F 1W4MA 4K2EA 4QWQA 5JR7B 3BJ6A 5KHJA 1AWCA 4Z82A 1R1TA 3I59B 2FU4A 4GYIA 3ZMZA 3QPHA 4LLNA 2PG4A 3TO9A 3H1WA 5LBQA 4E2GA 4M9XA 4PIXA 2E9QA 4UVCA 5LHGA 5A2QZ 2QLZA 5I0SA 5IT3A 4M71A 3BROA 2XKOA 1J59A 1DP7P 1YG2A 1YFUA 1FPQA 2DQLA 4IHSA 2XL9A 2COMA 4KFCA 1F5TA 1ZX5A 3M9AA 2BNMA 4XF3A 4HZFA 2QJVA 1B6AA 2WWYA 3V7RA 4LD5A 4G7OF 4RB1A 4BQAA 1REPC 3WGIA 4YFKF 2EWNA 2EV5A 5FLIA 3WW1A 1VJ2A 2QBYA 1EH8A 1U3EM 4ZYGA 3ERED 5ICFA 2W25A 4XF4A 4LTAA 1K6OA 3U0ZA 4HSLA 2M45A 1CAXB 4YIIA 4EMSA 1VP6A 4HVQA 2ETHA 3NW4A 3WW4A 1Y9QA 4S05A 4NB5A 4YSFA 5CU1A 3S0MA 2ZMEA 4YRDA 2W24A 3R4KA 3WTUC 3BY6A 2HQRA 3HUGA 4PDKA 3WODF 4P96A 5DCFA 2O8QA 5L3FA 5DD4A 1RIOH 4LA2A 4WBBA 4L9TA 4EVIA 1ZLKA 2J5OA 3WE2A 2QDRA 3GBFA 2BNOA 3C7JA 4KICA 1KQ9A 4L9VA 4P55A 1CAWA 2YPRA 3R0JA 3FE5A 2ZKZA 1BI1A 4ORFA 4KWKA 5JAXA 4M6YA 3TQNA 5BXXA 1NE4A 2MHFA 4KA4A 3CUQC 3VHRA 2Y75A 1Q43A 2HR3A 2NAZA 1ZG3A 1KU7A 2M1BA 2YR2A 1ZZ6A 2GU9A 1K78A 3DP7A 3HQXA 1IRFA 2PBIA 4L0YB 1XMAA 3KSCA 1YW8A 3I64A 3DQVC 4IRIA 1G3TA 3NJZA 3KP6A 2EB7A 2EFOA 3VB2A 1Z05A 2VT3A 4I98B 2Y0MA 3V7CA 2P5LC 4YG2F 2XLGA 1IF1A 3FF5A 1GXQA 1B4AA 2V09A 1G3YA 1LKNA 5K5RA 2RDPA 4BHPA 5KHGA 3ZN1A 2OQGA 3C3WA 1YFYA 1IN8A 2P6SA 1ON1A 5FD6A 3ST7A 2XGXA 3HSRA 4MTEA 4Q5SF 4LA3A 1USTA 4A5NA 3Q5FA 1HXDA 3RI4A 3DPTA 3PFIA 2FSWA 2PJPA 1XE8A 1XCVA 4B8XA 4XF1A 4LLLA 3BZ6A 1BI0A 4M9ZA 3QAHA 5JSPA 3KP2A 1IRGA 1FI2A 4TV7A 4LGWA 5BMZA 4MGKE 1EH7A 4KU8A 2DPDA 5LEKA 3OF1A 4EROA 3MWMA 2CG4A 5L3GA 4RB0A 2CO5A 2FBKA 4ESBA 2MBFA 4Q0QA 3E6MA 3OV8A 4E2QA 1O7FA 1FX7A 2Q1ZB 3CO7C 1JUHA 4XFCA 2DK8A 2YU3A 3LWFA 4KWJA 2K4BA 4O5VA 2A6EF 4MGYE 1GQHA 5I0RA 4I0BA 2JPCA 3LZZA 2QQ9A 3ECHA 2F5DA 1FLIA 1HW1A 4HX8A 1IXRC 2B9UA 4WK8F 1ZNPA 3HTUA 4EQQA 2CQKA 2ADUA 2D40A 3GEZA 1F1ZA 4LUMA 1BJAA 5ERIA 3L2HA 1J3PA 3E6BA 2D93A 2XASA 4MNUA 1S6LA 3MEXA 5FFXA 1UHMA 4IEQA 1HQCA 2FRHA 5FLXK 2WTEA 5FPZA 1ZH5A 1Z9CA 1O7LA 2GA1A 3DPLC 3L09A 4OFGA 3NL1A 3DEUA 3TDZC 1ZZ9A 4ON0A 1XSDA 4L18B 4P9FA 1CAWB 1W7PD 2O8XA 4DNCA 4XRFA 3LFKA 4BHBA 5LRRA 4KMUX 1SFEA 1TNTA 3GWZA 2JT1A 3VOEA 2DU9A 3O6BB 2ZBKA 4KMFA 4WXHA 2OPKA 2A6HF 3KP4A 2XL7A 3DF8A 4KN7X 1HBXG 3FXQA 1WWXA 1AOYA 1NE6A 4OINF 1K78B 5HDGA 3OOPA 3FMRA 2VE9A 4QM9A 3MDPA 2OZUA 2GC0A 2ACJA 4YARA 3Q9SA 3ZMDA 4FBFA 4LK1F 1T98A 4KDPA 1EH6A 5IT9K 1G3SA 4E70A 1LRHA 3AAFA 3N97A 4CYDA 2FA5A 4G6DA 1H9GA 1D3YA 1BC7C 1HSJA 2V9VA 3I7DA 3ZDSA 1BOAA 3LSTA 2FNPA 3NVCA 1R23A 1I1GA 2CSOA 2HYFA 1PP8F 1OKRA 4XLPF 1QBJA 2EA4A 5CVUA 1J5YA 3G73A 1DPUA 3FWEA 1S3JA 1R5GA 1HKTA 1EPZA 1L0OC 2ELHA 2NS0A 3I53A 1B59A 1O4TA 3N4MA 2KJCA 4I09A 3P9CA 3KLNA 1W7PA 2BEOA 2MLKA 1XMKA 4GYGA 4H0EA 1ZG5A 2AS5F 2XLFA 5BPXA 1FP2A 2K27A 5D6EA 2EFWA 4LLOA 4CDGA 5I8SA 5LGNA 1ZZCA 3K2ZA 2UXXA 4L9NA 5E17F 3KGZA 2J5PA 5I8YA 3KZZA 2UYBA 2CAVA 4JTOA 1QZZA 1D8JA 3BCWA 5FPXA 2LF7A 2DK5A 3O3KA 1YWKA 1Z6TA 4YIFA 4RGXA 2FOKA 3WTXC 4QLCU 5J6XA 3RJPA 1IZ1A 2LSOA 3F72A 2OZJA 2Q2EA 3F3XA 3LA7A 4L11A 4RB3C 2PFWA 1FOKA 2GC3A 4EM1A 1CAUA 1BI2A 4L9JA 4BNCA 2ESNA 4HMZA 2GQQA 3LAPA 1NXMA 1CF7A 2Z2SB 1NHAA 1MJBA 5K5OA 2YX7A 3F8FA 4KIGA 4WXCA 4ESFA 2ZCWA 3ELKA 2P4WA
chains in the Genus database with same CATH superfamily
4RHV2 4JTNA 3VL8A 1ETQA 1TQ5A 1O4XA 3O14A 3M8EA 4M01A 3KMHA 2Z5WA 1W6OB 2ZGKA 2HI3A 2HQ5A 2CUEA 3HOZJ 4LULA 2FUG2 4IOAF 1AU7A 4CUCA 4Q4Y2 1U5ZA 1YQ5A 3RYPA 3DTKA 4KBZA 5A1AA 1YQAA 2ELKA 4O3MA 3WQ0A 4XFHA 5LB6A 5FZKA 2EVXA 4BA6A 1ZA4A 3IH2A 2IBDA 3CO6C 3HQRA 2A3WA 3GXOA 4QPIA 4CDXC 3H5RA 4FVVA 1RUD1 2BVBA 1U2WA 1YIFA 2FOWA 2E7XA 1SFKA 2DFFA 3LFMA 1HV1A 4N53A 4U0VA 1HDPA 1ZKGA 2WV0A 1VMFA 1ZA7A 2EIDA 5K9YA 5C3QA 4LBQD 4QPGC 5IJRA 3P6BA 3CDHA 5B5EC 3FM3A 5J48A 2ZMNA 3NSTA 2OTLI 2UY8A 5CEHA 2NS8A 1QJX3 1S0JA 4PLMA 5E3MA 3NWTA 1VQ8I 2X6OA 4IEXA 2WC2A 2BGCA 2XKPA 2GA2A 1JZ3A 3S1NJ 2RMU3 2PAEA 3WVJA 3A2KA 1BM9A 2DN0A 1V6KA 2L02A 3EYPA 3GFMA 1V54H 4IVNA 2DWRA 2HPIA 2Y33A 2HWE3 3JRHA 1NCQB 2A5WA 2Z1DA 3COAC 2F48A 4XRSG 4F55A 3DBRB 2IJLA 2XUBA 3SCFA 2Z69A 4JV4A 4BZ4A 4IQPA 3QP5A 4BEHA 5KNLA 2BZDA 3TEYA 1WD4A 1O57A 1G59A 4LG0A 1YFHA 4OIOF 5BNPC 1X1PA 5FKCA 3BIEA 2HWF3 3A22A 4JK1X 5E1XA 5F27A 3HR9A 2XIGA 1RESA 5EZHA 5FY4A 1VI0A 1VBB3 4BHCA 4R1HA 1H9PA 1HQWA 1AR92 1ZZ8A 2MG4A 2HXIA 1W8UA 4Z07A 2GLOA 3POBA 3RWKX 1QNWA 4QPQA 3MLJA 1L3JA 1Y39A 1SD4A 3HIFA 4EGYA 4R9CA 1MBHA 4A6EA 1IN4A 4PGHA 4NWWA 2L5QA 1HF0A 1JYCA 5CYYA 3LSKA 4EM0B 5LK7B 5AONA 2A69F 4UXAA 1W04A 4HG6B 4KI5M 1CWPA 1AL22 1RL3A 5HCFA 1Z7LA 3NV2A 1D0YA 1VQMI 3ON7A 1FTTA 1QDCA 2R7QA 5L7OA 4XFIA 3L7WA 2A6YA 1HOMA 4HLXA 1UPSA 2B0LA 4BY7J 1ZAOA 4AFMA 3GX4X 3ZSLA 4NC7A 2FZ1A 2DMNA 4QM8A 1ND2C 1PIV2 3S2WA 3JBG1 1LEDA 3I2JA 2Y6GA 1EY2A 2A6ZA 4OHZA 5CLSA 4I7HA 5KHDA 2DPUA 1W8WA 2GNMA 3FK6A 1WW4A 1AKHA 3OY9A 5F5IA 3MMYB 3OYWB 5D5WB 4WF2A 1JHFA 5EG0B 2UXNA 4ZKTB 1UWWA 1ZRCA 1LR5A 2ZHKA 2IXIA 2K3FA 3EDPA 4XF9A 3MFKA 4HKOA 3LOIA 1N3OA 1LGNA 1HJGA 2X4HA 1YS6A 4QB2A 5A3NA 2E34A 4JYKA 4A44A 3IKWA 3G1LA 3IWZA 1IN7A 3NAPA 4IEUA 2Y0SA 3RJRA 4RFT0 1SFUA 5FO9B 1TWCJ 3LIGA 4Y1YA 3WP5A 1VBE3 3ABUA 4N0BA 3GHMA 3CJQB 3EB7A 3IAPA 2ZMLA 2PAMA 2OZ6A 1NCQC 3EQEA 3O1SA 1GZWB 2Q8OA 1T33A 4OIRF 5LBCA 2PHDA 1SFPA 3RZZA 2YPJA 5J37A 2DF7A 5D5XB 1DQ0A 2OTJI 2Q8DA 5DAVA 1ZZBA 3PIJA 4UI9L 4XIDA 4EJWA 4WWCA 3L00A 3MBWA 1JZ2A 2CRGA 2JSPA 3FLRA 4YFNF 4FPGA 2A07F 3WEZA 1HKSA 1AR63 1J9IA 2QBYB 2VOOA 3I54A 5A6XA 1XNKA 2O03A 1HW2A 1BK0A 5D21A 5FY1A 3U14A 2HTJA 1V55H 2M0MA 3D6EA 4D9JA 3S1MJ 5IK7A 1C3HA 1DZTA 3QOEA 5DM6F 3MZYA 3BTYA 1KQRA 2C0ZA 4Y26A 1OKQA 5ICGA 4IEPA 2VO5A 4PLOA 3H0GJ 5JLWA 3N9PA 4CRQA 2P34A 1WI9A 1TTYA 4LBLA 4Z1VA 3POGA 1S4CA 2ORXA 4Y1ZA 5A80A 3G71I 2I5UA 4N43B 2KIUA 1P7IA 3POYA 2W84A 3V4GA 4MX3A 2MLGA 2LYCA 3P3PA 2IA1A 1R7JA 4V2GA 3UGFA 3VYUB 3H3UA 1MZBA 5HCHA 3K7AJ 1R093 3GFLA 4A6OA 5T5JA 3SH4A 2NMNA 5AC91 4AHXA 1SMVA 5IP6A 2OF7A 1RTVA 4ZZ8A 4QX0A 3S6PA 4XW3A 3CHXA 4E2SA 2L7FP 5F7UA 1OQDA 4W65A 3G6JB 2IC1A 3I55I 4A7YA 4XMAA 4RGAA 4JGYB 2K9LA 3JRCA 4Y52J 1PO11 1W0OA 5LRSA 4Y17A 3VL9A 1QQP1 2BBYA 3KEQA 4CXFA 4OUEA 4Y5SA 1VQ6I 3B01A 1W2TA 1OH3A 1UXZA 5ILVA 4IV3A 3I2HA 2RS32 5EYRA 2VZVA 2R0FA 1YUDA 1W6NB 3RYRA 1JN2P 3SZGA 5FJKA 1ZRRA 4K8FA 3GTPJ 1ZBE2 4MOAA 2JTVA 2HXOA 1S72I 4KWLA 3SITA 4WX9A 3K4CA 4QSHA 3GNEA 4A42A 4GQ7A 4COVA 5LCWL 3J80K 3HSFA 3GALA 3SCHA 5BY5A 3K4JA 1BBT3 4MIMA 1XQNA 2OC6A 4PJ0C 4UUTA 4DZJA 1PZ8A 1T08B 3KV5A 2K86A 1IAWA 3QCWA 5FP8A 3K2AA 3FHQA 1GUIA 4DINB 2R061 3F6OA 1RUG3 1LTEA 3ZFEB 2X10A 5BYNA 5F2WA 2W52A 3A23A 3PMSA 4RM3A 4BE1A 3AFGA 2CQQA 2OUJA 3VBHA 2VASA 2WA0A 4BQXA 2RDQA 4UVAA 1TG7A 2L7ZA 3ACFA 3LEKA 5DZGA 3RSNA 2QKLB 2F17A 4AIDA 5DXDA 4W50A 4FT8A 3DL3A 3RYKA 3ZGKA 4PJMA 2RC4A 1TC3C 3HOUJ 4LXLA 1NZCA 1XGOA 1GZTA 4UT5A 1U5TA 2W85A 2ZX3A 3DXUA 3VWBA 2PX9A 3M4OJ 4QQHA 2KQRA 3IRQA 4CEWB 2ZPXA 5B1BH 3WNLA 1X82A 4XDQA 3KS7A 2CWEA 3H1YA 2LKPA 3P3NA 5F6KA 5CFCB 3L2CA 3OSFA 1U5XA 1KONA 2M87A 2XF5A 4B8EA 1IKQA 4UV8A 2VQ0A 3BTXA 1JMUB 4DEVA 4LBMA 1UU6A 1GKBA 4WM8A 2IVJA 4XJAA 2HWC3 4F3QA 1T0FA 2WNOA 4JVAA 3M3YJ 2Z33A 1ULCA 4MGQA 1QOSA 2E5ZA 2WNVA 1GZCA 3ZCOA 2B7EA 3M8FA 1GP5A 1U9NA 4N8MA 2FF4A 5CKTA 2VONA 4D69A 2NNNA 5B4XA 1KRIA 2O8KA 1X3WB 3W6KB 2Y6KA 2H6BA 2ZOEB 3CDZB 3B5LB 3PQJA 3E97A 4XQWA 4S2FA 3EPZA 4UWDA 4JGYC 1RUI1 3H7YA 2EJRA 3E6DA 2V1DA 2P17A 3ZDVA 1QZYA 2JEMA 4L0ZB 2E63A 4ENMA 3ZRGA 3RVHA 5LHIA 5E3LA 2FD5A 3KZYA 1B9MA 4A7ZA 4JBAA 1YIPA 2NYYA 3C7OA 2PN6A 3CO2A 3CCVI 1COV3 1H8TA 2EICA 1WJAA 3OYAA 2E2HJ 3KZIC 1YS7A 3FISA 3Q0WA 1OLMA 1VB4A 1AJOA 2CGNA 2FBHA 5EEGA 5J4VA 2EPFA 3ZM8A 1ZG1A 1CONA 2VCMA 1W3VA 2DBNA 2DYSH 1H1AA 1G9AA 3E0JB 1IS6A 3PMEA 1XB9A 1BVVA 3AJYA 2Y9ZA 5FYIA 2DFHA 4IERA 4M4PA 3M3EA 4LBNA 3ZKYA 2HVQA 3SQNA 4YIRX 3GLXA 5JDBA 5C5TA 3GUDA 2K9ZA 3PJYA 4HX4A 2ZJCA 4BLIA 1U0JA 2DA4A 5ABJB 3UGHA 1QMJA 5FWEA 3VZOA 4GH4A 5D8KB 4WM7C 4ARXA 3ZFEC 2YGLA 2ZACA 3PUHA 2KJBA 1C8NA 4MQ9F 4MH0E 2X51A 2RHPA 4NHMA 2WT1A 3U4XA 3K4ZA 3PIPF 4ASKA 2QGUA 2ADEA 2KT0A 1FYLA 3BG7A 5LW9A 5A1LA 4BLJA 5CKNA 3HOSA 2V1UA 1QJU1 4LLGF 4PIYA 3W2AA 3N9NA 3USUA 2M7BA 3TEZA 2H8RA 4QX8A 4P08A 3QBQA 3X29B 1A6QA 4CEWC 5GJ6A 3MF9A 3HNYM 4DOZA 4AEDB 1YCIA 2I8DA 3ZSEA 4CTEA 2ZKNA 1E3HA 3H9JA 2Y48A 3MVPA 3HWJA 1GVDA 4N7IA 3GCWA 2BXYA 4FE4A 1W06A 5CFCC 3JXSA 4AEKA 4PBOA 4OVEA 4O61A 1GZ9A 1X3UA 4UF0B 1GBGA 1H4GA 4XBQA 5FO8B 1SLIA 1IC8A 2B8MA 2CQ7A 4MGIE 1VRH2 5K7PA 3GZ6A 3RZMA 4LO4B 5FP7A 4LOCA 1A8DA 2G9FA 2GSYA 4HSRA 1OF4A 4KQ7A 2UWCA 4KT5C 1VFCA 4A2UA 4OQ8A 2VLAA 3DLLF 5HDKA 3HDDA 2Z42A 3PFYA 2BNNA 4G6TB 4A93J 1CZVA 2ZGOA 2RMU1 3V8KA 3J7LA 3LKJA 5ICEA 2F4MB 4HNVA 4Q8LA 2WS92 2ZGSA 1VAVA 1MDMB 4QPGA 4XSZF 3CCSI 2NVQJ 2LY1A 3N36A 3HN3A 1SANA 4FISA 1L7LA 3VBUB 3CDLA 3ES4A 1ETWA 1AYN2 2FDGA 1W6MB 1O59A 2I74A 2W82A 1X8MA 3U9GA 1MS5A 3WF3A 2CW7A 2HEYF 2KM2A 4WVWA 2PQ8A 4MGSA 1OVPA 3NAUA 2R4GA 4CEYC 2FDHA 3WE3A 3QRFF 2DYRH 5D4SA 3CC4I 1QJX2 4XACA 2VBPA 1OKOA 3I2OA 1DGRA 2P5BA 4W6YA 5ANNA 4FAGA 2GMPA 4FPJA 3AP6A 2RGVA 3FMSA 3FDYA 1WLDA 2ME6A 1VBB1 4Y4YA 1FOD1 1GP4A 5FO5A 2WAAA 5LBBA 1QXJA 1LHOA 2V1XA 3OGVA 1IPJA 1PM7A 2R93J 4QWNA 3ABLH 2XROA 2MNGA 3S15J 4R79A 2WAEA 1VLNA 3IWFA 4IL7A 2VZSA 1UYYA 2V79A 3K6GA 4PSWA 3QPLA 5IUQA 3ZQHA 1HN0A 2J1RA 2DBBA 5ABJC 3OS1A 3HGGA 2ZGRA 1QU3A 1JGSA 2QQJA 1V00A 2PN5A 3GYDA 3C3VA 1H4HA 2ID3A 3MYXA 4CCEA 4HVRA 4ATEA 1EUTA 1MH3A 1YIOA 1K83J 1ZBA3 5EEHA 3OGJA 3N9OA 3HRUA 1XOYA 2QQOA 1Y3TA 2R5ZA 1C8M2 3SZPA 4KU7A 4IL6C 5E3NA 2WV1A 4PZJA 3I71A 2WN2A 4HX7A 5FLMJ 3B93A 3EETA 3UK9A 4DJAA 4JQFA 2E7QA 3ZSMA 1W5TA 4OYUA 1BEV2 3OGRA 1E3OC 4EWAA 3SH3A 4COWA 1GV9A 4OHYA 2IGNA 3Q0VA 2J1VA 5FQ0B 4IHTA 2D6NA 2HWD2 4JX6A 2BVVA 2EXIA 1W8ZA 2LD5A 1WMXA 1WLTA 4AEDC 4XTPA 3L2VA 1W9WA 1P9QC 3BTCA 4RL7A 1ORKA 2PLV3 3OY8A 3OBRA 5IWFA 3FXRA 3JSOA 2BYVE 2YC4A 2JDZA 1QOOA 1ENHA 4S2HA 1ND2A 4Q4W3 3BPXA 1JYXA 4PUSA 3SEZA 2HOSA 2VTXJ 3KIOA 4E4DX 1YLLA 3ONQA 3FBNB 2JENA 2L01A 2X9DA 4A3JJ 1EKEA 4GULA 1UYXA 1QRYA 1Z6RA 1Q56A 3RZOJ 1JU4A 3U1XA 2CV1A 2IWGB 2STTA 1M4WA 4OMYA 4MVTA 4HDUA 4XFBA 1AXYA 5DUIA 1RJ8A 1AHDP 2JDNA 5HCBA 1VBE1 4AI9A 4Q4X2 5LGUA 2P6CA 1R083 3VBUC 4XMYA 5H20A 3C7GA 2JRTA 5J4YA 2RV9A 4FHTA 2IXLA 1HB2A 4BQWA 2QM3A 4RHV1 2RJ2A 3TN93 3Q8EA 1STZA 4NIDA 4PI0A 1KYZA 4N7UA 1BI3A 2FD8A 2JE9A 2GBYA 2VOPA 1V9U3 2ZXWH 3K70C 1J1TA 2EQRA 5FYBA 1JJ8C 1JXNA 4RS8A 3PM1A 3ZOIA 1LHVA 2D3RA 4P9LA 4JGZB 2OCCH 2CDPA 1Z67A 2YSRA 4Q4Y1 2P4EA 3UNPA 1NCQA 5E1WA 2EILH 1AR61 3K69A 4H14A 5FLVA 3S2HJ 2R7VA 2UYAA 5E1RA 4LKFA 2DDUA 5DUKA 2Y2ZA 3DPRB 1E17A 3D5LA 3CNAA 3WTZA 1H89C 1E5SA 1U12A 1YW9A 5IK4A 2KISA 2W9XA 2VNGA 5CG8A 3GTGJ 4B3AA 1X2MA 1XU1A 1SDDB 2LK2A 4IE7A 3LA3A 2W68A 4IW3A 3AMPA 2CUJA 2PEXA 3QOPA 4HW0A 4AE2A 5GZCA 3HXLA 3H9AA 2A70A 2JDPA 4N9IA 2ZXIA 3TO6A 4FFIA 5BOXA 2Q8KA 5FZ7A 3F8CA 3M4FA 4P9JA 4FI9A 3ZXAC 3Q9VA 1R36A 4YG3A 1VBC3 2XVLA 3HKZN 4IGOA 4YGEA 4DMIA 4QGLA 3BPVA 2C24A 4BOWA 3ILNA 4C1WA 3GZTB 1G8XA 4DXSA 4ZU5A 2DXIA 4E4HA 4Q2FA 3SXWA 4DYCA 1WA4A 1W9FA 1YEWA 5EHDA 2W1WA 3I0TA 3V0BB 2Y30A 2AYHA 3VGIA 5HS7A 3LSGA 1QGLA 3BTZA 3I3LA 3DKYA 2WYSA 2F5CA 1WFXA 3J80Z 3CESA 3MF6A 5A70A 2F5EA 1IN5A 4M0HA 1D4M2 2X85A 4IETA 2J42A 3IP4B 1KU3A 3RFRA 4Q48A 5FZOB 1C28A 1GXPA 3HRSA 1AR91 2VUDA 3BCAA 3OYWA 1G9BA 1RI7A 4PIZA 4BQ5A 2UZKA 1UL9A 1U5YA 4G3YC 2LRDA 5EG0A 4FPFA 4IJAA 1S0IA 3V64A 1PNFA 3GBWA 2F6CA 4YGBA 2A05A 5JHUA 2X53S 4CZZA 3FIWA 3H8XA 2QQNA 4EN6B 3X2QH 1AL21 4Z2WA 4HEA2 3MPBA 2MW8A 1ZTRA 4KGQA 1GOGA 4J1XA 4Y7NJ 1Z77A 3Q3SA 3BB6A 3NWKA 4L5EA 1XDSA 2VECA 2YPDA 1MS8A 2Y9YA 2DV9A 4A3FJ 4HV5A 3ECOA 2PMZN 1CX4A 1OURA 2IT0A 1X8EA 3A01A 4K2EA 2XQRA 4QWQA 5JR7B 2BVLA 1AWCA 1PIV1 1QJY2 5FZFA 5H9QA 4JGZC 3QPHA 4LLNA 2Y26A 2OKXA 4FETA 2AH2A 1MNMC 3TO9A 5LBQA 3JRGA 4E2GA 2HBTA 3WF0A 1GNZA 2QLZA 1YQ8A 3DPRC 5IT3A 1YG2A 3A4CA 4DBRA 2ZGLA 4P5YA 4IHSA 4QXHA 1F5TA 2NN8A 1D4VB 1FV2A 4CP9B 4RAFA 1A5JA 5AFEA 1IKPA 3D8CA 5IPAA 2EV5A 3WW1A 2QBYA 1U3EM 4I99C 4ZYGA 5HNHA 3HG9A 2HWC1 4XF4A 1XNDA 1K6OA 4OMDA 3U0ZA 4PLNA 2MSYA 4YIIA 5CB7A 2ETHA 2VG9A 1Y9QA 3ETPA 4YSFA 1Y1VJ 2WO1A 4BGDA 5FPVA 1OLQA 4AFCA 4A3CJ 4YRDA 4BQ4A 3WTUC 1LNSA 3BY6A 4LO8A 2O8QA 2CW8A 4EVIA 3OS2A 2VZPA 1ZLKA 3G2BA 3GBFA 5FPLA 2RR12 4L9VA 2CU7A 3DU6A 2F5VA 1TT0A 3ASIA 4NHYA 3PTRB 2ZKZA 2VE1A 4M6YA 5CKQA 5GAGJ 3TQNA 1UELB 3O5SA 4YLZA 1Y8QB 1IS4A 4BE2A 2R072 1JZ6A 3VHRA 4K8RB 2R1DA 1Q43A 2HR3A 2QQLA 3DP7A 1COV1 3HNMA 3T30A 3I64A 3NJZA 1G3TA 5FWJA 2AACA 1YJ9I 4A3LJ 1D2SA 3OYCA 3LPGA 3VBOC 2E33A 1MH4A 4JGYA 4RLFA 4CU8A 5K0UB 2P5LC 3DYOA 4YG2F 1I5PA 2XLGA 4BXFA 1R9TJ 1RR7A 4BHPA 5FYTA 2L9SA 3JR9A 4YFWA 2JIJA 3C3WA 1IN8A 2P6SA 1ON1A 5FD6A 4XJZA 5FR3A 4IGPA 1SAUA 4LA3A 4A5NA 1PMJX 1VBA3 2VTFA 1W6NA 3DPTA 4CCDA 1UO9A 2VUJA 2FSWA 3FBIB 2EIEA 1XE8A 4XMIA 5FUPA 1BI0A 4M9ZA 4HPKA 3KP2A 3CDIA 1SBFA 1FI2A 1EH7A 3A03A 3OF1A 1WW5A 1WZ2A 1ZR4A 1PHMA 2M9HA 2MBFA 2I10A 4URTA 4XNFA 1PZ7A 2LKSA 4F93B 1JUHA 4XFCA 2WLPA 4AI2A 2JMWA 4WM7A 2A6EF 2JVGA 1IQAA 4Q1PA 3ZFEA 2JPCA 3ECHA 2F5DA 4PQQA 1GT0C 3B69A 4OAZA 3ZQCA 2B9UA 2VULA 3TOJA 1IS5A 4EQQA 2ADUA 3J8F3 1F1ZA 3M3QA 1ETKA 2ERFA 2YBKA 5M3FJ 4AI3A 3E6BA 5KWRA 2AEZA 1UHMA 3OGSA 4QX1A 4Z92B 5FLXK 3B94A 2WTEA 1NQDA 3CMGA 3PNTA 3L2WA 2RS31 2VY0A 1SLCA 1LOBA 1ZH5A 2DDBA 3DPLC 4LLFA 3O1MA 1K5MB 4XN0A 3PUIA 4M3GA 4ON0A 1RUH2 4L18B 4P9FA 1HV0A 2LY9A 1ZBE1 4YM0A 1PVC2 4SBVA 1LULA 1W7PD 2O8XA 4XRFA 4PBPA 5LRRA 4Q1RA 1TNTA 5FXWA 1JI6A 1W36D 2ZBKA 2HWB3 4WXHA 1YX5A 5A1FA 3FKJA 4H55A 5CFCA 3FXQA 5EYXA 1AOYA 4ITVA 2OPTA 1K78B 2VQTA 3ABMH 1YO8A 4HG2A 5HDGA 1IQDC 1W0NA 3FMRA 3OOUA 5FMOL 2OZUA 2XJUA 2GC0A 2ACJA 3BTAA 4DPNA 4OCTA 3D5OA 4NOTA 2NXNB 2W08A 1RVF2 2R7SA 2EXKA 3ERMA 1VMHA 4W4ZA 5BNQA 4D7NA 2BERA 3AAFA 4CYDA 2FA5A 1T95A 5G04L 1YRNA 5LFAA 4XTMA 1MBGA 1HSJA 2V9VA 4Y3OA 2HQAA 2CQXA 2ZAAA 3I7DA 3MIDA 1FPN2 1BOAA 2FNPA 4TXWA 1I1GA 4UW5A 3T08A 2WT2A 3HBKA 1OKRA 3KWVA 4A41A 2EA4A 4CA0A 3FWEA 1HX6A 3QLQA 5K0UC 3AVRA 2ELHA 4QXBA 2NS0A 4KG8A 4EEFG 1B59A 1O4TA 2E51A 4HONA 3N4MA 2KJCA 2GM4A 2MLKA 4CA9A 3UESA 4CEYA 5BPXA 3BR5A 4LLOA 5FZAA 5I8SA 5LGNA 3WD5A 3K2ZA 3TW7A 2UXXA 3P5JA 4A69C 5E17F 4ZXEA 2J5PA 3KZZA 1QJEA 2E2IJ 5EZGA 1ST8A 1XNTA 2CAVA 3BCWA 5FKOA 3IMNA 5FPXA 3OG2A 4F52A 2P3JA 3WUCA 4QLCU 1ZBA1 1EAH2 1TE1B 1EV12 3VKMA 4HANA 3OUJA 1IZ1A 3DBHB 2PELA 1ZGWA 4L11A 4RB3C 1BL0A 4YELA 1B09A 3VDCA 1BJZA 4UW4A 4MGTA 4BISA 1Q8OA 5FO7B 1FMWA 1PVEA 2GC3A 4L9JA 1JZ8A 5ABJA 3LGRA 1K42A 2BW3A 5HPOA 2HOAA 3OYEA 5LY1A 2AREA 1H8VA 1OPMA 1YQCA 3Q8CA 4MHRA 4CU7A 1CF7A 4NIGA 1JKOC 4V1PA 2YX7A 3K4MA 4KIGA 4XDOA 3AKQA 2A6TA 5KC5A 1MMDA 5GZEA 3ZFFB 3ELKA 4GMP3 3ZSKA 5IYYA 1JI8A 2P4WA 1IGOA 5ISLA 3F8NA 3U4SA 4AVSA 4RGKA 4IPAA 3VZMA 2X0LA 1MGTA 5IOZA 4BMEA 4A3MJ 1NA1B 3ZMSA 2VBXA 3RG0A 3KT7A 3F6VA 1NY72 1QPIA 1Z3YA 1PK6B 3H0OA 3GJAA 1YXWA 1W5CC 2RAEA 3WINE 1DG6A 4Q4W1 1ON2A 5DQ0A 1K5MC 1LEMA 3QU6A 3RZDJ 1AF9A 4HN0A 2O6GE 4UFLA 2PHRA 4DIQA 1CR7A 3IH4A 5M5YJ 4M3CB 5LA1A 2CQNA 1XDUA 2GH2A 4PCRA 3K1NA 1T2XA 3DEEA 4QDQA 1RETA 3ROUA 1US3A 1S55A 4XSXF 1JHNA 1U6GA 1YFXA 2IA0A 1P4AA 4GXLA 2JUCA 1TWGJ 1STMA 4C2UA 1YW7A 4IUGA 4XBNA 4QQ2A 3PNAA 2GAUA 1REDA 2DVDA 4NRQA 3GM8A 3JAMK 1FOXA 1FBSA 1FMD3 2VJ4A 2VC0A 1AR83 3ZMOA 3TN91 1GQPA 4XABA 3NWSA 5IVYA 1K61A 4JDNA 2BWAA 2P7VB 2D3SA 1T38A 5A32B 2I45A 3MFCA 1SD5A 1KFUL 3POFA 4TN7A 4HAMA 4LBOA 4LO6B 5JPMB 3HOVJ 3CEWA 4XF0A 4A0YA 4QKFA 4F91B 4BJ5C 3ZMVA 3LSEA 3VBUA 1V6NA 3SKJE 3S32A 1GWMA 3U37A 4OWRB 3ZVXA 4IEYA 2SBAA 5I93A 1S0EA 1R22A 3OYDA 2JA7J 2RS12 2VKEA 2DTZA 5KXEA 1UG2A 4H7LA 5FV3A 1J75A 2WQ4A 4LFUA 4QMAA 1JZ5A 4FPOB 1H6YA 4I6ZA 3LDRA 2D6MA 4U7BA 4MGZE 1V6JA 1TW3A 1HW5A 1S0GA 1CIWA 2X5IB 2PHLA 4TTGA 4HSJA 5DD8A 3FZ3A 4ISRA 1VRH1 3MI8A 4AQ2A 2DOFA 2GDFA 3VODA 3VBFC 3FL7A 3QPTA 1GSLA 3NQOA 3T8RA 1BIBA 4LB5A 2RN7A 4CCOA 2F5FA 4ZXKA 3E5UA 2Q8EA 1X58A 5K7ZA 4ZYEA 4ZDOA 1WPKA 2IXKA 1W9SA 3ZQ7A 1S7EA 1RHI3 5CPRB 3KCYA 4F8AA 3DBLB 1T2KA 4AU7A 2ISZA 2V26A 4LOTA 1YO5C 4L5JA 3LSRA 4GDFA 2YFZA 5LBFA 3IDBB 4FOYA 1PGL2 1AYN1 5EJCA 4FQGA 3WOGA 2VJIA 4OI4A 2JWPA 3J7ZI 3CCUI 1XE0A 2L9NA 5FZIA 1NA1C 2X09A 5ACA3 1S7AA 5HI0A 2BOIA 1CVNA 5J7MA 2H1KA 1ODNA 2E31A 1PK6C 2VGDA 2M4KA 3C7HA 3VKNA 5FPUA 3DXTA 3WG7H 4C90A 4WCGA 4Q0VA 1RMU3 1NUKA 1NKGA 4BY1J 5M0TA 4Q8KA 1KYWA 2Y60A 1BZWA 2OBPA 2OA4A 3AKTA 3I2IA 1V5EA 1Z21A 4CP2A 2OD5A 1FAYA 3K77A 3ZR8X 2DMQA 2W3JA 1SMYF 2ARXA 2JE7A 1RUC2 2JG8B 1W28A 3BG3A 2RM22 1ACIA 4R4XA 3MIFA 2QQAA 2EALA 1YLFA 1N1TA 3MQ0A 2D6KA 4Q27A 4IHXA 3BR2A 4M74A 4ENNA 2Q0OA 5E3OA 4AVZA 1WKMA 4PJJA 3FHZA 2GIZA 4BXUA 4BJ0A 3PURA 2YUSA 4BEHB 1C8M1 2M5WA 4E4ZA 2LKXA 4FPYA 1WJCA 3H3ZA 1P6RA 1WRJA 3B6AA 3CCEI 3OTFA 1KU9A 3OBAA 5FMDA 3OD4A 5FYHA 2PHXA 1UQXA 1G2HA 2PQQA 3VDDB 4AI8A 4LK0F 3CKHA 1DQ5A 4HOBA 1B35C 1TMF2 2P3IA 1AX0A 2B63J 4UXNA 3RKYA 1UKGA 4YM1A 4CXWA 1ALYA 4OHVA 3I4PA 4LO7A 3USSA 4YZ3A 4YFXF 4HYEA 3GCXA 1W05A 2IGKA 2EV0A 1MBEA 1OR7C 2JA2A 2J1AA 4RN5A 2W39A 1JT6A 1WH5A 2X5IC 2O7OA 1OFNA 1OYYA 3C7EA 5GZDA 3M3IA 5A3PA 3SFZA 3HKZA 4DXZA 3BZCA 4XUTA 4GB32 4P02B 3BT9A 1NCRA 2W7NA 3EHKA 1TBXA 5JI9A 1A36A 4PGGA 4XJWA 3WP4A 2VXZA 3DPRA 4ESJA 2HTSA 2EAKA 2R7FA 3CF2A 4CUAA 3PNVA 3O0XA 2VQHA 4M3CE 1YFWA 1WZXA 4RGGA 3OR1C 1J09A 4PJNA 1V6OA 4Q4X1 2VQAA 3P9KA 1MR5A 1LOEA 4LITA 5C9AA 3F2ZA 3BN6A 4HF2A 1ODDA 3POIA 1SEUA 3HBLA 1UIKA 1AKHB 3WG9A 3E3VA 3LMMA 5F5CA 3LFIA 2GALA 2KIQA 1QQIA 2B5HA 4ZZDA 4ZS2A 3K75B 3CL1A 1WD3A 3M07A 3R4DB 4CO8A 1Y8RB 2AGSA 4AI1A 3KLSA 3BI3A 2W2IA 3CMAI 5F0CA 2XAHA 1O3RA 3HNBM 3WV6A 4NC6A 3EUKL 1DF0A 1LVKA 2WL1A 1H9TA 1X3ZB 1OQEA 1RUD3 4GKYA 2QCOA 3A4UA 2PMZA 4J19A 1TLHB 3NAPB 4XJ9A 2HPMA 3CJXA 4QQOA 3DCQA 3ACHA 2HGCA 4COUA 3HOTA 3QH7A 5F1JA 2JG8C 4EQVA 3JCIA 1VBA1 2VVDA 1G9FA 5DN2A 2QYOA 1Y9GA 2QCSB 1ETOA 3EO6A 2PHFA 2P8TA 2F4PA 3K51A 2J1TA 1OCOH 3VBOA 3DYMA 4AFAA 1W5SA 5F5QA 4NHLA 5DABA 1BN5A 1OQYA 1WGXA 5A7PA 1ULFA 1YI7A 4UFKA 4BACA 4HBNA 5KHKA 1AYM2 3BOQA 1H9WA 5JR2A 4BAYA 5D5UB 4COYA 3Q8FA 4HDVA 3AYEA 4CZSA 3UETA 1I9RA 5DUUA 1BXHA 1T6SA 2DODA 1UN1A 1E5IA 1H88C 4S2GA 4HT1T 3VDDC 1A04A 1F43A 3FK7A 5FLXZ 2WADA 4IGQA 3MKYB 1R1A2 2DMUA 2VKHA 1PMHX 2AENA 5HLGA 4K7JA 2DAOA 3I2DA 1WCDJ 1F5FA 2DFEA 4F7ZA 5JSRA 2Y0IA 2RJLA 3MICA 1LU1A 4Q47A 1BMV1 5GTHC 1GU3A 2CYFA 2WFF2 5L73A 3WF4A 3DEWA 5LASA 4X6AJ 3JSPA 3N7MA 4ENJA 1D4M1 1VAMA 3HL2A 2WO7A 4RGRA 1FIAA 2WAOA 2ZGNA 1VBD2 4PQ9A 3WU0A 3I4NJ 3ZLIA 5JMCA 2GC1A 1G7YA 2HWB1 1FYMA 1J2XA 1ZN2A 4FTSA 1ZELA 4ES8A 3ITQA 1ZZ7A 4LIVA 4AUXA 2D6LX 2VT2A 4G9YA 3CLOA 3FMQA 4AVBA 1FV3A 4BQ2A 4XLHA 4YG0A 4R9DA 4LORA 1QVUA 1BW5A 1QNYA 2HS5A 1UAIA 2WLQA 3MKZA 3FZVA 1REFA 1R64A 4ZYHA 4IRHA 1IPSA 4FASD 1W8OA 2FDKA 2LW8A 3AKZA 3LEMA 3O0VA 4XR6A 5K7FA 1ULGA 2ESHA 2B42B 3CP2A 4META 1C1FA 2UUZA 2JA5J 1NK2P 3BG9A 1RR8C 4IV3B 2RKHA 3JBG3 2BHYA 2XBO2 1QJY1 1VQ7I 3IDCB 5I0UA 3HT1A 2BE5F 5J36A 1A6IA 3NKTA 4LMFA 2VH9A 5DV5A 4K6BA 3ZR5A 2KRFA 4M6VA 4RS5B 4FX4A 1I5ZA 2NZ9A 3G7DA 2NRAC 2WRAA 3LB9A 3B3QE 5BV6A 4IV1B 3T1BA 1RNLA 1OUSA 3TEDA 4UV9A 3A7QA 2ZTNA 3MW4A 1IUYA 2PHWA 1UCRA 3QP6A 2D98A 1Q8PA 3UKVA 2O1QA 5L36A 5FZBA 2EZIA 2GXBA 3R05A 1XB4A 4KNYA 5FZMA 5K0UA 2D5FA 3VYTB 5H9RA 5BNNC 2ATFA 2M34A 4IXAA 1CESA 1NLRA 4KUMA 5DDJ2 5FKBA 1JZ7A 1CAUB 2HH9A 5FXVA 5K1YA 2RDSA 1X19A 5KXDA 4XOPA 3HOBA 1HRI2 5LA9A 3EJKA 3PHMA 3NRVA 1U5TB 2RR11 2X6XA 2WZR2 4B3XA 3IDAA 2NLRA 1RIRA 2XB6C 4XAAA 2QVSB 4GO1A 2VUAA 3WW2A 2ZO4A 5T52A 5E88A 1B9NA 2LR8A 2D1VA 1DYOA 1SPPB 3R60A 4AGGA 2R071 4DZGA 4C2TA 1MS1A 3DUIA 3GBGA 1SFOJ 3LQRA 5J1YA 2FMDA 3O1TA 1RUF2 3K48A 4AC0A 5ANQA 2VMGA 1H0BA 3T0AA 1ZYRF 3FHNA 4XLEA 1WH7A 2VIXA 1FSEA 2X6YA 2GC2A 2IS6A 1MJ9A 4E7LA 1GR3A 5BS6A 3W58A 1RC6A 5ILUA 1LOAA 1HSTA 5FYYA 4AVAA 4RA2A 3SYTA 2WNEA 3VBSB 2LBFB 5HBAA 4WM8B 1BR1A 3CMMA 4OMCA 3GO5A 5HLHA 1OD5A 2HKXA 3RRDA 4CCJA 4Y5Z0 2DVBA 3I3MA 3JAMZ 2ZJPF 3ZYGA 2VQUA 5GP9A 4NR1A 1FWZA 2HLEA 4GJYA 2A61A 1JOPA 2ZNZA 4LK6A 4AVTA 2D2WA 5J47A 1I1SA 1HXS2 4HQEA 5BQTA 4WVVA 4D6SA 3OWTA 3MV11 2EF6A 2VQCA 4UB8C 1K5MA 1WSUA 3OOXA 3BCBA 4KNCA 2CGOA 1Q8SA 5F3CA 1YTYA 3VKLA 4AGVA 1FMD1 3MIBA 3UV9A 3NMBA 4LUKA 1TQPA 3QU3A 4XLNF 4YYOA 4AI0A 1APLC 1KDMA 4XFFA 4S2DA 4GCVA 2QKMB 3VBRB 3SMHA 4GZ9A 4U0YA 1W2OA 4W6XA 4HOOA 5AC93 1KGSA 2JECA 2YBPA 1CAVA 2BY1A 4KITB 1FEXA 3W59A 3K46A 3ELNA 2G9WA 1REEA 2DMPA 4JKKA 3ZIXA 2LF8A 2XPWA 2XVCA 3RZGA 4FPKA 1UB9A 5TSWA 4HF1A 3BJOA 4M3BA 1AR72 1ASJ2 1PO13 1U8BA 2V9PA 3N35A 4A3DJ 4RS5C 2WQ8A 1I6HJ 2R041 1W90A 4EJOA 1QQP3 3WG2A 4IV1C 4I2OA 3ZPYA 4XFAA 3NO8A 3J7AO 3E6CC 2C1FA 1ZGAA 4LBQB 2GP3A 2HDCA 2QTWB 4IXLA 1IRZA 1WW7A 3VD3A 1F2NA 2V4VA 3WU2C 2VZQA 4RLQA 2VMHA 5IVCA 3A0NA 3S5AA 5EEAA 4NHXA 2DQRA 1W6QB 1RUH1 1TNFA 3V42A 1S5LC 3PDQA 3JD72 1H1MA 4XLFA 1GOHA 1G9DA 3L9FA 1IW7F 1O5UA 1W3XA 3BU7A 5EYYA 1FBUA 3I2FA 1R49A 3ZN6A 2A6VA 4Q4V2 1BW6A 3NV3A 5F37A 2QQBA 4F92B 2R063 1U5TC 4GKXA 2VNVA 1QA6A 5FMBA 2VM9A 2X6WA 3ZFGB 1XNAA 4TLFA 3VBFA 2JD4A 3GYHX 2VTXA 1JYWA 1W03A 3B73A 2ZABA 3GHNA 1BR4A 2RS52 4KJZA 4A0ZA 2W1OA 1UU4A 5EZWA 5EWSA 2MC4A 1XNBA 3QYBA 4Y5TA 1S29A 4L0PA 2VW2A 2MEV2 4LBJA 4U0WA 4D0PA 5B3SH 2CS3A 5GADJ 1FPN1 3MAJA 1QO0D 3WF1A 5C5UA 1Q8VA 4NNJA 1XS9A 1RMU1 4CDQC 1VF9A 1C57A 1UU5A 1DGWX 3H42B 4B7EA 4DY3A 3SJMA 2DCYA 3DGTA 3HD8B 1TME3 4AVPA 3VBSC 2H0BA 1MQTC 3RDIA 3WX5A 1HLCA 3KGLA 4QIWN 4CUBA 1K3IA 4RQPB 1NA1A 1W8NA 5DTDA 4B48A 3S1QJ 4L9BA 3IAS2 1HKQA 3M70A 2QZ8A 1PK6A 3A0BC 4KIFA 4XKCA 5FOJB 3T0BA 3RZKA 5GTIC 4XIOA 3F22A 1UMIA 3VKFC 4O65A 1GHCA 5ACA2 1K79A 3B6CA 3S93A 3ZQIA 3L1PA 1OPOA 2O0YA 1TWFJ 3I5UA 3CUQA 5FFZA 2EXJA 1PX4A 2DUQA 3IIAA 4KL1A 1FNZA 2ZFWA 3VBRC 2VXJA 2ENRA 3WGHA 4PDWB 3PO2J 2YMZA 4JOMA 1GANA 3OIQA 2OUMA 1OF3A 4AWXB 4NN0A 3FM5A 4E7JA 1ZRFA 3IT8A 2QUFA 1RUI3 2X1EA 2QF7A 4MTDA 3CU7A 4A3ZA 4AQSA 2BUKA 4ZHNA 3E7LA 2R7RA 4A3KJ 2PFBA 2W57A 1P8JA 1AL0G 2FNAA 1P92A 1MEC2 3KB5A 5J3UA 1J83A 1NY71 3GZ5A 3OYFA 1JYTA 3LQCA 3VD7A 1DLCA 1LUJB 2I2SA 4A3BJ 1DCSA 4URAA 1QVTA 3CIHA 4R4ZA 2QDNA 3WCSA 4IQ4A 3H36A 5ERLA 3HB9A 1MACA 2ZB9A 5FLHA 2MFZA 1SD6A 3AZYA 1B35A 2K40A 1NK3P 4QX7A 4QT6A 2R5ZB 3FUQA 3I3DA 3ZMTA 5HS8A 1OR7A 3JB8A 5C4XJ 3CLPA 5F5AA 3KHCA 1KU2A 3OL4A 1H2MA 2VJJA 2X5IA 2DO7A 4N4OB 3ZXLA 2CWSA 5E16A 2X8KA 2W48A 3ZFGC 4ARYA 2OPWA 2IUWA 5C33A 3KV6A 5J8FA 4E4SA 3ILFA 4CSWA 3U2RA 3S2DJ 3GZUC 2Q30A 3JB4C 3LDKA 2W92A 4DXTA 2HQNA 2YZ4A 2YFUA 4XCBA 3K9TA 4LKEA 5D8AB 4AEJA 4QQPA 3OY8B 2NVYJ 2JKBA 1QJU3 5APAA 2XAFA 3UKNA 1ND2B 3AMHA 3AG3H 4NRPA 2JDKA 2DUPA 2G19A 2EINH 3DKWA 2EV6A 1TW2A 5FKKA 3H9QA 4FOQA 3AZWA 3V56A 3R61A 3L9JT 3W2WA 5JLXA 1D5VA 5A33B 5CAZA 1PZ9A 4RQPC 4HV6A 2RS11 1EJ9A 2XF7A 1JGGA 1OYIA 1OLME 2R3SA 1V6MA 2M8EA 3ZX7A 1O3QA 1WLCA 1ACCA 4BCUA 4G7ZF 5CYVA 1G6NA 5A3OA 3U78A 2NNYA 2JA6J 2VPLA 1S0DA 2BZTA 5CFDA 3H35A 1DUXC 4QKNA 3C1DA 1MPXA 3FXMA 3S7EA 5J1RA 2XLAA 2JDUA 2DTWA 1IDYA 5FYZA 2YY1A 4C0HA 3FXUA 3DV8A 4B4CA 1IRXA 3ZMUA 4FQZA 2KL4A 4JHTA 2KRCA 5DM7F 4PDWC 1WA6X 2KRHA 3VD4A 2FX0A 3THCA 5E1ZB 4FP2A 2PMUA 2JG8A 3ABTA 2M0CA 2UWMA 1MSFC 2BY3A 1LEBA 1J3RA 3NV4A 1XGSA 2HWVA 3EXUA 1HRV3 1U8RA 4ZDPA 3HBZA 2VODA 1PGL1 4E7SA 1Q1VA 4EJTA 3SNMA 1WCKA 2A75A 1GFF2 1SACA 3WF2A 4K1YA 3PVBB 3T0DA 1W4MA 2G0EA 2CY6A 5KHJA 3I59B 2NVXJ 1K6YA 2VZTA 4TSVA 5FP3A 2PG4A 4A3EJ 2EIGA 3H1WA 1X4PA 1QZEA 3VDDA 4LHLA 5C7GA 5SV5A 4I30A 1FOD3 1KD7A 1HB3A 2R92J 1PO21 4J6GA 2ELJA 1JKRC 3VZKA 2XL9A 3VDAA 3ZYPA 3M9AA 2BNMA 3POWA 4BJTA 1K12A 1B6AA 1D1CA 2WWYA 4B7KA 2O9LA 5FPBA 4NIIA 4UW6A 1RUC1 4BQAA 1POGA 3WGIA 2RM21 4YFKF 4PF1A 3G6EI 3ERED 3IUOA 2J1UA 2W25A 2KZVA 4LTAA 5DS9A 2EXHA 4HSTA 4ZZ5A 4QAWA 1POV3 1CAXB 1VP6A 1UOFA 4HVQA 1AJKA 2L2OA 3WW4A 2O14A 3N3HA 2CJJA 3S17J 5D8AC 5FXZA 2C26A 3S0MA 4BQ1A 4NWVA 2W24A 1S0FA 2HQRA 3HUGA 4PDKA 4P96A 3MN2A 4ZONA 5L3FA 1WMEA 1RIOH 5IT6A 2Q1MA 3O1UA 3I49A 1QDOA 2DA3A 1KJLA 1XSRA 5LATA 2QDRA 2BNOA 4AYBN 5IK5A 4XQ4A 2VPRA 4MHUA 2G9ZA 4IO9F 2BY2A 4DQAA 1G8WA 2JXAA 4KMQA 3ZXGA 4Y1XA 5J1XA 3JRIA 4GALA 4ORFA 4CU9A 3A1YA 4NDLA 5BXXA 2MHFA 1CD3G 4XYXA 2Y75A 5DAQA 2M1BA 1JJ6C 1ZZ6A 4BB3A 3ZSJA 4L0YB 2DCJA 1DP3A 3FN9A 2NP0A 1ERDA 1EF4A 2EFOA 3UGGA 4JCKA 3VB2A 1Z05A 3D3AA 1GWLA 4X1EA 2VT3A 4LG3A 3ORJA 4GB31 2LY2A 2XWBB 2GP5A 1IF1A 3TWIA 4AWDA 1GXQA 1B4AA 3OYIA 1LKNA 1IUFA 5KHGA 2OQGA 3ZQFA 3ST7A 4MTEA 3O0WA 3BR1A 4Q5SF 3A01B 2ME0A 4PFPA 2DFCA 4UUSB 3PFIA 3S5QA 2PJPA 4B8XA 1T56A 4KH9A 4XF1A 2BU9A 4LLLA 5F32A 3FBYA 2HVRA 2JRMA 2VZOA 1W8FA 3ENRA 4L97A 1OHFA 4EROA 2R7OA 5IFPA 2W47A 3VLBB 4RHV3 4YFZA 4B1MA 5BNNA 2CO5A 4JP0A 2FBKA 1XC6A 2FCUA 3OV8A 2JE8A 2RDNA 4RDUA 3WHUA 1KZHA 3ZXJA 2DK8A 2YU3A 3LWFA 2K4BA 1F4HA 4HK9A 3TB0A 1W6PA 1GQHA 1DQ2A 4Q4Y3 1T8IA 1HW1A 1A6CA 4D6RA 4AVVA 5FBJA 4XC9A 4KGGA 2E2JJ 1XC5A 4BXSV 2D40A 4CP1A 2PQSA 5HV0A 3GEZA 3WY6A 3WDYA 4MNUA 3MEXA 1CIYA 3WT3A 1QHDA 3WG1A 4IEQA 3R4SA 3PVNA 3G4SI 2YGMA 4EZHA 2GA1A 3MUY1 5A7SA 3URFA 5T54A 3DEUA 3TDZC 2WINB 3C2HA 1XSDA 2C4XA 3OEAA 1WLWA 1WJFA 4DNCA 2X29A 4D5FA 4BHBA 1SFEA 2ID4A 3C2GA 4XE9A 3GWZA 1WVRA 2DU9A 2BWCA 3O6BB 2L0KA 3KP4A 2R49A 5E6HA 4N90A 3DF8A 1OFCX 3J26N 1DP0A 3WQ7A 2XVGA 2IGOA 4XBLA 2AUYA 3Q9OA 1XYPA 2VE9A 3GXUA 2Y6FA 3ZMDA 4LK1F 5IOYA 1Z7S2 4CPBD 3KV4A 2QSFX 2YBSA 3K4LA 2B4KA 1EH6A 5IT9K 2RJKA 1MZEA 2WYFA 1R1A1 2WO2A 1YQ2A 1UHSA 1H9GA 4QPWA 3EUAA 2CSOA 4OZOA 2HYFA 1A8MA 3OIPA 3VZLA 1QBJA 5B4NA 2CMPA 5CVUA 3IIIA 2WFF1 1J5YA 3G73A 1DPUA 3BTIA 1HKTA 2GNTA 2QUOA 3CMEI 3PL8A 3W3CA 4HPKB 3RCOA 2VOVA 3P9CA 5BNGA 1YI9A 3HQUA 1AR93 1VBD1 4RS5A 4BDYA 3ZQQA 2XPVA 1FP2A 4IV1A 3HPHA 1YJWI 4K40A 4FO9A 4E9KA 2ZBJA 2CUFA 2AHQA 4JTOA 3HEFA 1S0CA 5CA6A 4WM7B 1AL23 1YWKA 1WI3A 4YIFA 3PUFA 4RGXA 2VJXA 3WSOA 2J1SA 1OLRA 5GLTA 4XRMA 3THDA 2WR9A 2Y69H 4XUOA 4B4QA 3F3XA 2HEVF 3LA7A 4JQTA 2HDWA 3ASNH 2XG3A 1BR2A 1MIJA 3CCMI 1CAUA 2J1EA 3G1MA 1YNAA 4INDA 1F9KA 5CIRA 4II3A 1ENSA 2X1CA 4AM3A 2WQZC 2QEXI 1PIV3 1NXMA 2WT0A 1K5JA 1NHAA 2NVUB 1MJBA 2XBO1 1UAAA 4YVSA 3F8FA 4WXCA 1LODA 4BXXJ 1TME1 1WHUA 1MVEA 1A78A 5C3SA 5C8CA 1UXXX 2XSJC 2W5FA 3IKVA 2QQWA 4GD4A 2HYGD 3TOBA 2VC1A 4JX4A 4EV0A 5M5WJ 5GALA 1ZHFA 1SPPA 1UKRA 2WIIB 3V8JA 3HJEA 2YU2A 1XYNA 1OLTA 1T6BX 5J96B 5EQUA 1LDJA 1QOTA 4DRRA 2FBEA 5HVQC 4CDQA 1RUE2 4KISA 5HS9A 1R58A 2G9GA 2MPFA 3VBSA 2LBFA 4M00A 1MQTA 3J7MA 2Z99A 5L9VA 3HHHA 2X1DA 4LIUA 3MGUA 2OS2A 2BFUS 2LFBA 5DAWA 2FCVA 3JU9A 1YRNB 5DDJ1 2VPVA 3RIRA 3QH6A 5FZDA 1MS0A 2XGDA 3HVDA 1FOWA 3NNLA 1ONAA 4CZCA 1TWHJ 4EE2A 3PNYA 2VMEA 1HRI1 3GF2A 3D0SA 3R0RA 3PJQA 2WZR1 3RQIA 1PM4A 3DTIA 5JOWA 4KIBA 3PLQA 3FUOA 2VL4A 5C4JJ 3JZVA 4P5HA 4XEZA 1XGNA 1LGBA 2C5DA 1B1BA 3VBRA 3AVSA 4CEYB 3H1MA 1OJLA 2Q8CA 2FMLA 4OHXA 4DZPA 3DU5A 3TW6A 5D5VB 2VD7A 2VNOA 4AXOA 3IAM2 3CCJI 2K9SA 1VQ5I 4JKMA 1LHUA 3POSA 5FY8A 2JJ6A 3CTAA 2CAUA 1KS5A 4QD2A 1RPWA 4UFHA 4AD9A 1YHQI 5EGOB 2KA3A 5A7WB 3PQKA 1YX3A 1XGMA 5HLIA 5H2FC 4OOIA 2LS6A 4C3IJ 2NQYA 2BBAA 2XJRA 4LBQA 5FGMA 4D5CA 1E57A 2PI0A 1HXS1 5B1AH 2BW3B 4XQDA 3M7GA 3OMYA 2K2SA 4ONUA 4B4PA 1R00A 1CF7B 1W6QA 1UX7A 5A6YA 3HMYA 4AHWA 2L4AA 2CDOA 4XUQA 3S16J 5FOBB 5JI6A 1QKQA 3IBMA 4JQRA 2FQ3A 3AFKA 4LE4A 4RAZA 4BUPA 5K4LA 2W0XA 1MZFA 3TNPB 1PUFA 3N9QA 2DT5A 4MHGA 1SAXA 1HCRA 4B09A 1IHMA 3ZFGA 1JE8A 5DYMA 2XXZA 1FC3A 2QE3A 1MMNA 4LEJA 4UUVA 1AR71 2E7WA 1ASJ1 3QYEA 1NAEA 3ECQA 3D4KA 1J1LA 5C71A 1FT9A 2E7AA 3ZKUA 1RUJ2 1Y0NA 3NKGA 4R9BA 4IEOA 5K8SA 1XD7A 3ZQLA 2RS33 4BE0A 5SV8A 5KBFA 2Z3YA 1VIWB 1WBLA 2VXRA 3F8BA 1ZBE3 2D44A 1BYHA 6PAXA 3HPGA 4ZYDA 3ML6A 3JD71 1GWKA 4RQPA 4G4FA 3UKTA 4W8JA 3WTSC 4LHKA 2FJ1A 3AP4A 2QBXA 4R52A 5JFRA 1DPRA 2WZPP 5GLWA 3POJA 1D8KA 4NPMA 3TKYA 3WP3A 2CFXA 2HKOA 2YX4A 5DEQA 3RZJA 4Q4V1 2HJIA 3EMRA 5FYUA 4YW3A 1K4SA 3LSPA 3GZEA 5DAXA 1HRV1 4FCYA 2DBIA 4V2WA 4YW4A 2D97A 3HJRA 1VR3A 2Y64A 4L2NA 2AXTC 2VN2A 3LSIA 2VJ5A 2RS51 2P37A 5T3NA 1PP7U 1US2A 2P3KA 2WNUA 4XL9A 4XILA 1D0ZA 3ETQA 4PDWA 3DWLE 2MEV1 3GTLJ 3PL0A 5FJ8J 2ZJ2A 3QWLA 2R7WA 3B02A 1R4NB 3OIOA 4ZDLA 1K4TA 4QU1A 2RMU2 2XB5A 1SBEA 1WGPA 5HNFA 1C0WA 5FRNA 5A3LA 3GMEA 1LHNA 5EV7A 1ULEA 5B2GB 5TISC 2PMHA 1PMIA 4HKWA 2HWE2 2IAIA 3K4NA 4AVCA 1NG0A 2LTNA 2RDRA 3ISPA 1XE7A 3KF5A 3HPNA 1IG3A 1X1DA 5KAIC 2HFHA 2BRTA 2CTVA 4GXOA 5L3DA 3J4UH 1I39A 2MH2A 4ASMB 4CH7A 1ENQA 1USSA 4M6XA 2HWF2 1POV1 1U0AA 4AIKA 3OYNA 1QH7A 3H0DA 3NNJA 4PT6A 2ZMEB 1GUUA 3CQOA 4I76A 5AVPA 2KXLA 4A45A 3E1SA 2PA7A 3FXOA 3KETA 1VBB2 3J7NA 4HLYA 4LOSA 1JHHA 5FROA 3VKOA 4ZTJA 1JUMA 3SFIA 5C44J 1OOPB 4RR3B 2VBYA 3WDVA 3KP3A 1ITYA 2L9LA 4HF0A 3UNGC 5I91A 4L8QA 3VZJA 4OMZA 4HETA 2B9SA 3WHCA 1QHHD 2ZX2A 3ESWB 4N9HA 2ZSIB 1NTCA 5JXGA 4AOCA 4FPHA 2WA3A 4HA8A 1BJQA 2LRPA 2ZHLA 1TT5B 2WO3A 2KLOA 5D8AA 3AL0B 1J58A 2ZX0A 4KG0A 1XN7A 1MEC1 2J7MA 3GTJJ 5E18F 2A3YA 3SXYA 5HDNA 2STWA 2CH0A 4NAOA 2PHTA 2EK5A 5L9BA 1VMJA 2UWAA 2W1QA 3T5XA 2OJED 1WW6A 3JRBA 4KWUA 5A33A 2F2EA 2VAUA 3K4BA 2VOKA 4AIHA 4FPLA 4AZZA 5KHIA 4XOTA 3AK0A 4HNUA 4MZUA 3VHPA 3JW4A 3O8GA 2WKKA 4QHOA 2FQPA 5DG2A 2AXLA 4Y22A 5A3MA 5DPNA 2GMEA 5D8LB 3ME2A 1HQNA 4UHTA 1Z3XA 2ETEA 4C1XA 1GVJA 1X36A 2OQ6A 2QA4I 4CCCA 2WZ8A 4ZU7A 3CC2I 3JQWA 1Y43B 1DDLA 1OISA 3MKWB 4XKVA 1W39A 2RVAA 4BPZA 5A6QA 1UY3A 5K5QA 1P2FA 3ULQB 1D2QA 1MS4A 1EV7A 3DXJF 1PGW2 2ZS6B 5FD5A 4FFGA 4ETSA 2V4AA 3MPPG 1XYOA 2ECBA 2WBMA 1W8HA 1WWYA 2IXCA 4I02A 1N1VA 2QQPA 1NCRB 3OYHA 1XNCA 1ZGJA 2VW0A 5FZCA 1OH4A 4NIAA 2ICWG 3ALQA 4NC8A 2DW4A 5GPCA 1VBE2 2LC2A 1QJZA 1X9TA 2V1NA 2XAUA 3VYRB 4MSVA 3I59A 4LB6B 3TO7A 2NVTJ 1WMFA 4AYBA 2VOWA 2QZ2A 1QGPA 2DU1A 1VRH3 1ND3B 1LVAA 5C9AB 3T0YA 2QNKA 3AJZA 3CD6I 4LPLA 1S7OA 2XAGA 3O1OA 4D7YA 3NNGA 5JWPA 2ZMEC 3EYYA 5I0DA 1YQ6A 2EFNA 2IXSA 5IT9Z 2HEWF 3WNPA 4CXXA 2VMIA 3AG1H 1OT5A 2H94A 1AR62 2DCKA 2K7LA 1K7AA 5A2QK 2WS93 1SMTA 2FMYA 4XETA 5L3EA 2IXJA 4PJYA 1OOPC 4RR3C 1QNTA 3BPSA 2IP2A 3GGLA 4YGDA 3RKXA 4Y24A 3RPQA 1AYN3 1GDTA 4FP3A 1CAXA 4P9UA 1H2NA 2FEZA 2EIBA 1OCZH 5FK8A 1UY1A 1UW8A 4M3DA 1P4XA 3HZJA 3AL0C 2JQ7A 2R5YA 2YC2A 3W6JB 3VDBA 4IZZA 3DN7A 3OPTA 1MS9A 2DFIA 3KLOA 1J7KA 4YVWB 1W0UA 4OIPF 2JDHA 2W00A 5FZ1A 3WNMA 3RQ4A 1KQ0A 1R092 3MUZ1 2WWUA 1JXSA 2Z16A 4DYRA 1IZ3A 3VBOB 3GDBA 4IRGA 1W0PA 1IG0A 1W7PB 3JUUA 4LBKA 2RNGA 3GTKJ 5FB2A 3U75A 4PCQA 2PLYA 3OBZA 2ADDA 2IW5A 2TCTA 2OVUA 1RYYA 1U5IA 2Q5TA 2G4IA 2JG9A 3ZYHA 4Z8BA 4IF4A 2C6YA 1MD0A 5J40A 3BWGA 3QD6A 1LAJA 4NAMA 5TJJA 1FY7A 2XAJA 2IRFG 1RJ7A 1LQ1A 1R1UA 3ZO0B 2QSHX 4PFOA 4FE7A 4OULA 5AVAA 2JICA 3MD2A 4J25A 2Q2EB 2ZX4A 2UV1A 1DQ4A 3PU8A 3DPUA 3MFAA 1FNYA 4J01A 1XCBA 4NE9A 1C8M3 5T5PA 1UZVA 1XSVA 1AZDA 2D6OX 1DYPA 3EYIA 4DUVA 4UUSA 2YHJA 1W99A 5E8IA 1BEV3 1RXFA 4ABZA 2L9VA 4Y15A 1NLSA 3P9IA 1PVXA 1NCRC 2HWD3 1N3QA 1FTZA 2YG0A 1J3QA 2ZEZA 4DUWA 3D0JA 5JZGA 1BBT2 5KC6A 5EFUA 1MJAA 1TQIA 4U2AA 3DCFA 5C8WA 3ZXKA 4Z2AA 1RUG2 4JDMA 1UFMA 2EAAA 2E1OA 4DO0A 3BPZA 4MXWA 1PYVA 1HDDC 5FUNA 4YZ5A 3NJYA 1EPWA 1TVGA 2E5NA 2BP6A 2BW8A 5C3OA 1X1CA 3LEGA 4W97A 1F36A 2XVKA 5HXVA 3G3ZA 1ND3C 1UMHA 5C9AC 1UHWA 2W94A 4ATFA 1IXCA 4XDPA 3M8LA 4YNIA 2YC0A 1IV6A 1SC7A 3ZXDA 1JKQC 3ACLA 2JA8J 1QEXA 2LALA 1VAKA 1Z7UA 3WGGA 4GWMA 1UY4A 2QVOA 4MEYF 1ODMA 2VVFA 1SCRA 5D1IA 4NPLA 3KE2A 3TP3A 3CBNA 4IE5A 1ENRA 1SLLA 4E7KA 4Q4X3 4G6QA 3RTRA 1YYNA 1FBQA 3QODA 2C6SA 3S3MA 4CCLA 2IS2A 2A6XA 4GWIA 5IVFA 2C9AA 1KS4A 2ZGMA 2DA7A 3MZHA 5F6FA 4MV2A 1UD1A 2RVCA 2VVEA 1AX1A 2ZEXA 4P9WA 2HZTA 1R5HA 5LK5A 2OU2A 3KF3A 3N7LA 5JXHA 4HNTA 2HWC2 4YVWC 3OYKA 1FXZA 1YIJI 3HOWJ 3T1LA 5JLVA 2NOGA 5IYCJ 5FY9A 2WA4A 3IPVB 5M5XJ 2XHNA 1W36C 4XK4A 3KYLA 1XG1A 3AMMA 3FJSA 2GOXB 2B39A