5LEJA

The transcriptional regulator prfa from listeria monocytogenes in complex with a 30-bp operator prfa-box motif
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
236
structure length
236
Chain Sequence
NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for glutathione-mediated activation of the virulence regulatory protein PrfA in Listeria.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Transcription
molecule keywords Listeriolysin regulatory protein
total genus 69
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5lejA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5lejA01
5CLSA 2HQNA 3ABTA 5FD6A 2EV6A 2P7CB 1ODDA 3HHHA 3TKYA 1ZLKA 2D93A 2JZYA 4XF9A 3JSPA 5FFZA 4Y17A 2Y0OA 4XF4A 4GCVA 3P9KA 5I0TA 5BY5A 2A68F 1HSJA 4UVAA 4JVAA 2A3SA 2D1VA 1O4TA 2IRFG 4ENNA 2QNKA 4M6YA 2DTRA 3HRSA 3T1BA 3JZVA 2CO5A 1R1TA 3KP3A 2BNNA 2Y0MA 1ZVFA 1BN5A 4Q0VA 4XF1A 2IXIA 3MDPA 4RB2C 2HJIA 2CG4A 2AS5F 1P92A 4G7ZF 1AOYA 5ILVA 1XRUA 3HUGA 5JCTA 3KP4A 2KIMA 3OCPA 4GYIA 1KU3A 2OA2A 1XN7A 2LDUA 2HYFA 3H50A 2P5LC 2FNPA 2P5VA 1U78A 1IRGA 3H7YA 5TRDA 1R1VA 3IWFA 5DUKA 4BIFA 2ISYA 2JTVA 3OOPA 4JBAA 4O5VA 2AXLA 1ZHFA 3QRFF 4ENMA 2OYZA 1SD6A 3UKVA 5E16A 2FOKA 4XFIA 1DPRA 5BUVA 4QMAA 2DK8A 2JSCA 1MGTA 4AIKA 2DLLA 3KP5A 2K4JA 2DW4A 4KMUX 3TO6A 2EFQA 3F22A 3CLPA 1YFWA 3FMSA 4MH0E 1G6NA 4JTOA 1ZZ6A 5E8GA 2VOPA 2VT2A 4IHTA 3C3WA 5DD4A 4Q4ZF 1QBJA 4E2GA 3HRUA 4B8XA 3BB6A 2EFPA 4D7TA 5JSRA 4KWJA 3WE3A 4KUMA 1IZ1A 3MAJA 4HOBA 2MPFA 3TOBA 4WX9A 1FP2A 3MYXA 1QZYA 3ES4A 2PA7A 2WWYA 4Q0UA 3K9TA 1CAUB 3LAGA 3LAPA 1YLLA 5E1ZB 1X82A 2PG4A 5J6XA 3CUOA 3MEXA 5IT9K 2FXAA 4IEXA 4IEYA 1RI7A 4A2UA 3PQJA 2EV5A 3NL1A 4IRIA 4QXKA 4G94A 4OMYA 1FBUA 3P9CA 4P9FA 5HLGA 3KCCA 1LKNA 2RGVA 3H1MA 3PVBB 3VODA 2DU9A 3DV8A 3F8FA 3TNQA 3L2HA 3I59B 3HIFA 5C6CA 4XLPF 2XAHA 2PFWA 2HEOA 2DAOA 3TQNA 1SD7A 2V1XA 2Q0OA 3O6BB 3C7JA 2IVMA 2YX7A 2IJLA 1P6RA 2B8MA 1BBYA 1IN7A 1FYLA 5LGTA 4XETA 3TDUC 2Q2EA 4MEYF 3RJPA 1QPMA 2VN2A 4CICA 2B5HA 3GX4X 1C0WA 1SFNA 3VHRA 5BV6A 5ILSA 3MFKA 3NJZA 1KYZA 1SFEA 2E1NA 2QZ8A 2IXKA 3JSOA 4CXFA 1FZPB 5CVUA 3Q9SA 4HMZA 4DNCA 4BHBA 2MBFA 3WGGA 4G6QA 3GBFA 1USSA 2ETEA 3LZZA 2ZCWA 1S8NA 1ZZBA 4P9GA 4AQ2A 1ULYA 2F2EA 2VC1A 3HSFA 3H8UA 1CX4A 4B29A 1H9GA 1YW7A 1ZRFA 3LWFA 1STZA 5E18F 4RB3C 4EWDA 2MC3A 1AWCA 4G6DA 1ZRDA 1UPIA 4L9TA 3VOEA 2W84A 4HBLA 4LGWA 5EFUA 3RYPA 3M1EA 1NE6A 4N9HA 3BJAA 5L3CA 3V4GA 4EROA 1F4KA 5FPXA 3I0TA 2GU9A 4BHPA 1X3UA 2ELHA 2ACJA 1ZX5A 3RDIA 2V6CA 4E2SA 3FFQA 3ZDSA 3QP6A 3HTUA 4LFUA 4WBBA 4QWQA 4PGGA 3M70A 1IPKA 1U12A 3D0SA 2DQRA 5H20A 2FF4A 4EQQA 2NAZA 2LNBA 1EH6A 4ZYEA 5CVVA 4XEZA 4EWEA 1UW8A 1XDUA 2IXJA 4OOIA 2PMHA 4HV5A 1R5GA 3QP5A 3R0JA 2CSOA 1UHMA 1ON1A 2XAQA 5L3EA 1K7AA 2CW0F 2XHKA 5JFRA 1J0RA 3RPUA 2YX4A 4ZYGA 1H9TA 3GXOA 4PCQA 3WE2A 3C18A 3GFJA 3PFIA 4LA2A 3M8EA 3K0LA 4ZU5A 4N0BA 4OIQF 1RNLA 3EO6A 3M9AA 1T2KA 3COAC 2QYOA 3RKWA 4HVQA 2Y75A 1U3EM 1J1LA 3BZ6A 2LF7A 5F6FA 4A12A 5HDKA 1ZYRF 2PHLA 4RB0A 4LLOA 1HW2A 2PMUA 2CQKA 4HDUA 3IKTA 5ERIA 5D1IA 4Q47A 1JHHA 4ESJA 3ELNA 5JVTA 1U6GA 4J1WA 4F8AA 2FNAA 3L09A 4META 2LSOA 1I6XA 2ZXJA 3Q9VA 4P5OA 1UB9A 2JT1A 3ZP5A 2O3FA 1QO0D 3WTSC 4F7ZA 2VODA 1W7PA 1O3TA 4LG0B 4ZZDA 3REOA 1WLTA 5FLJA 3R61A 1KU7A 4IEZA 2JRTA 3CO6C 3RTRA 2V09A 2F5EA 1IXSB 2GWRA 1UIJA 5LHGA 1BI2A 1MJAA 4ON0A 4RB1A 1FX7A 2ZBKA 2L02A 3IWZA 4UXNA 3FJSA 1X8EA 2ZMEA 3J80K 5CJ9A 4MTEA 5KK1A 1RZ4A 4EM1A 2W57A 4UV8A 5BQTA 3GO5A 1J3RA 1CAWA 2MD5A 1HW5A 1OYIA 2PYTA 3JAMK 2OQGA 4EVIA 3U10A 1ZARA 1DDNA 5I8TA 3E5QA 1ZZ8A 2QDRA 3R6SA 5CVJA 4PDKA 4UBHA 2PQ8A 3LSTA 4ENKA 3FM3A 4LJZF 3V7RA 3VB2A 1NE4A 2RDPA 4HX8A 1G3WA 3I71A 2XAFA 3FM5A 5HLHA 3LA7A 2K0GA 2HKXA 3KP6A 4YYOA 1MJ9A 1L0OC 4OIOF 3G3ZA 1FSHA 1W5TA 5CU1A 1G3YA 4L5JA 3S0MA 1SMTA 4L11A 1Q5OA 2F5DA 4LUKA 4HV6A 1FWZA 2UYBA 4UNOA 4I01A 4MUVA 1L3LA 2RN7A 2XIGA 1SQ4A 3DKWA 2HQRA 3P7NA 1ON2A 3C1DA 1CAVB 3BPXA 4B09A 2ISZA 4KFCA 1USTA 4KICA 5ICCA 3KFWX 2FBIA 5HS9A 1BJAA 1OPCA 4RGRA 3IDBB 2KKOA 4HA8A 4M6XA 4MEXF 2FSWA 1GQGA 4AIJA 1ZGAA 5HDGA 4LA3A 5LLQA 3E5XA 5DDGA 1WQ2A 3BDDA 1T38A 3WTVC 4KMFA 2K4BA 1OI6A 5K5RA 3BWGA 4BH9A 2EFOA 3U2RA 1J59A 1U2WA 4QM9A 1PDNC 3BALA 1XDSA 1B59A 4L9JA 4HYEA 5DUIA 1K78B 4EGYA 3E3VA 4LK1F 2GZWA 5FLXZ 3KE2A 3FHIB 3RYKA 1SD5A 2ZNYA 3D0JA 3CO2A 1NHAA 1XCVA 4ESBA 3HT2A 4P96A 5C8WA 4L2NA 3LA3A 3F8MA 4ASNA 3RKYA 3D82A 1QNTA 2M87A 3ISPA 4AQ6A 4I7HA 5LHIA 2BYVE 4EJWA 4MGIE 4KN4X 4A6DA 2F5FA 4P9UA 2GQQA 2L01A 1REPC 2Y48A 4HX7A 3OD0A 1JGSA 2GIVA 2ZNZA 2B9UA 3FHZA 1W7PB 4LG0A 3ABUA 5DCMB 3S2WA 4YIIA 4LLLA 1J58A 5D5WB 3FX3A 3EETA 4ZZLA 4KT5C 4QGNA 4YARA 2D5HA 1TQIA 4AD9A 1G3TA 1CAXA 1BIBA 3WTXC 5D5UB 2Z2SB 2BNMA 1O5LA 5LRSA 1PMIA 4KL1A 4R52A 2WV0A 4WCGA 2P17A 5KVRA 3WTYC 2MH9A 1BC8C 4A6EA 5JR3A 3HRTA 1I27A 1EV7A 1ZG1A 1FP1D 5HLIA 3IHUA 4KU7A 4MGZE 2Z33A 4XSZF 2YU3A 2TDXA 3WODF 2IW5A 1EH7A 5K5QA 4GXOA 1QGPA 1QQIA 3SXYA 1PUEE 3SZPA 2O8QA 3D5LA 1GXQA 3BP8A 3IKVA 3ELKA 3WTWC 3HOTA 3ES1A 2BV6A 5I0SA 1FYKA 3QOPA 3K69A 2EFWA 2FU4A 2M30A 4Q0SA 3EDPA 4XFCA 3F72A 2STWA 3CJNA 3KETA 1LRHA 2QM3A 2MLKA 1ZG3A 1HSTA 2BGCA 4EMSA 3U1DA 4IEWA 3OGJA 4IEQA 2XKOA 4OFGA 2CWEA 5D4RA 4KIGA 5FO5A 4Y15A 2E1CA 4NQWA 1ZRRA 1UIKA 1Q1HA 4XBFA 1TW3A 1KU9A 4HF0A 1FT9A 1FY7A 1UHWA 4ONUA 2ZKZA 2PQQA 2YPRA 2DPUA 1SEFA 2KXLA 2DT5A 3JAMZ 1G3SA 1YW8A 5I91A 4K2EA 2GA1A 4D7SA 1TQPA 1MDMB 2D1HA 4G7HF 4QGLA 4CYDA 3K1MA 1Y9QA 3LQQA 3H1WA 4BHCA 1BI1A 3GUDA 1CAWB 3GZ5A 4H7LA 4I98B 1O3SA 1MDMA 3F6OA 4YFNF 1S3JA 4AVCA 3ST7A 1FYMA 4TV7A 2PI0A 1XMAA 2RNJA 4OMZA 4BXUA 2VE9A 2QQAA 4R8HA 5ICFA 2O8XA 2QQBA 4EGZA 3HHGA 3NVCA 1UCXA 2OAZA 4O9GA 1F5TA 4IJAA 5H6QA 3ZN1A 1FPQA 3IRRA 2JPCA 2KRFA 1V4RA 2KIFA 5AIQA 4XFAA 1WRJA 1OKRA 3DPTA 1HBXG 4BAYA 2FMYA 5L3DA 4KNYA 2IP2A 4MGYE 2A6HF 1RUOA 1W5SA 3F23A 3CEWA 2X4HA 1O5UA 4OIRF 3CLOA 1ZG5A 1IAWA 3CUQA 5LRRA 1RL3A 5CVIA 2XASA 5BS6A 2BEOA 3HT1A 1U8RA 4U7DA 1YYVA 4OINF 2RKHA 2D40A 2V1UA 5DYMA 2DPDA 2CAUA 1X7NA 1Z7UA 4LB6B 1J3QA 3C3VA 5I8YA 3V8JA 3SXWA 2ZFWA 4U7BA 2FMLA 1NYWA 1O7FA 2OU2A 5L3GA 4HN0A 3DQVC 4AIHA 2FQPA 2K9ZA 2XVCA 4OIPF 4HW0A 2L54A 4XRFA 2VOOA 4J1XA 5D5VB 2P8TA 2LKPA 3SHFA 4S05A 3WTUC 2H09A 3L2CA 3U9GA 1D8JA 1LJ9A 1FBQA 4KIBA 3NKTA 2X0LA 3ZMSA 3DFGA 3FMQA 5A2QZ 3ZPLA 4IERA 1MD0A 3T5XA 2VT3A 3F8CA 4Z2YA 2Q1ZB 1JE8A 4P55A 4Q0QA 1EPZA 4A0ZA 5D5XB 2XGXA 2A07F 3E97A 3H9AA 2W25A 4LEJA 2PTMA 2OA4A 1S7OA 3GLXA 4UBGA 3VEPA 3H3ZA 4I2OA 4O9EA 1B4AA 2EAAA 2H0VA 1T6SA 5LGUA 1FXZA 2XLFA 2EVXA 3DXJF 2HWVA 4N9IA 2WFPA 3IBMA 4HX4A 1TQ5A 2E7WA 4LTAA 4EJVA 4XSXF 3BU7A 5BOXA 4Z07A 4CGZA 5FB2A 1I5ZA 1ZNPA 1IXCA 4JQFA 4RS8A 3IC7A 1J2XA 4Y13A 5FLXK 4HLTA 3EHKA 4U0WA 4PGHA 1P2FA 3G7DA 3I64A 2VBWA 2XL7A 2R7FA 3FMRA 3GW2A 3I5UA 4L0ZB 4I3PA 3RYRA 5L3BA 3SFZA 4YRDA 3L9FA 3RPQA 4RGXA 2Q0AA 1SFXA 2FBKA 5FQ0A 3BROA 1XGSA 1MKMA 2DO7A 4LULA 3F8NA 1OFNA 2XV4S 1YFUA 1PP8F 2H6BA 5K8SA 4GULA 2VONA 1J7KA 1RC6A 4MNUA 1LDJA 3FWEA 4HN1A 1KQ8A 2P4WA 2QWWA 1CAVA 3WTTC 2HFHA 4UXAA 2H27A 4IXAA 4LK0F 5JSOA 4R1HA 3GVAA 1XE7A 2M1BA 3DEUA 1QXJA 2D5FA 4YSFA 5E20A 1MZBA 2NNNA 3IIAA 5FD5A 1QXRA 2OBPA 2M45A 4XLNF 1TTYA 4PJYA 5T3NA 4L9VA 1H0MA 5K5OA 5I8SA 1XGNA 5D8LB 1UFMA 3PQKA 3E6DA 5AIPA 4AVAA 2PN6A 2HTJA 5E1RA 3FZVA 5LEKA 3QU3A 4U0VA 2J5OA 3ULQB 1CAXB 1F9NA 4HSJA 2RV8A 1XSDA 1DZTA 3M3IA 2DQLA 1QWRA 5J8FA 4CO8A 5CADA 1ZREA 4KIFA 2RQPA 3WTZA 1PM7A 3AAFA 5F1RA 3EQEA 2O03A 4TLFA 2QQ9A 1LNWA 1HKTA 3V7CA 1FC3A 3BJ6A 4HAMA 5I0RA 1IUYA 1FNNA 1EP0A 1ZZ7A 4PIZA 4U88A 3DPLC 2N7GA 2L4MA 3KP7A 4HSLA 2G7UA 3ZQ7A 1DZRA 2XL9A 3DP7A 4YNIA 1YIOA 5AONA 1YQAA 2NRAC 3GYHX 2GXBA 3USSA 3V8KA 3KMHA 2R3SA 1T0FA 5A2QK 2EJRA 4LLGF 3MQ0A 2PLYA 2W85A 2EFNA 4M73A 1FOKA 4PIYA 4FX4A 2PHDA 4AWXB 2GC1A 3S7EA 1LDKB 2GC3A 1R7JA 5JR7B 4KWLA 3N4MA 2UWMA 3WU1B 5D4SA 2Z69A 2Z9OA 3IL2A 1ZRCA 2IXCA 4EWAA 4IHSA 1TW2A 2MLGA 4NVPA 1NXMA 3QU6A 2M5WA 2MHFA 1R22A 3FE5A 4WXDA 1YHFA 4LMYA 4ORFA 1Q3EA 3L00A 4YFKF 3DN7A 3WW1A 1R23A 3E6MA 5BPXA 4XFFA 2ADUA 3ZMVA 1Y3TA 1Z9CA 5FLHA 2IA0A 3BOQA 5LEJA 4ZYHA 3BCWA 5F64A 4MV2A 3CUQB 4L0YB 4R79A 4O3MA 5FCCA 2ATFA 2OQRA 2BNOA 5D6FA 2QLZA 1FBSA 2R7DA 5JSPA 1TQMA 4I09A 2B0LA 3FXUA 4ZYDA 1PP7U 4YIFA 2G9WA 4CZZA 4DINB 2L4AA 3J7AO 3NEUA 2OZJA 1I1GA 4OLLA 3I7DA 1OR7A 3HYIA 4ESFA 3JW4A 1R00A 2LF8A 3UKNA 4FBFA 3KSCA 3E6BA 2UXXA 1G4DA 1EY2A 4XF0A 1H1MA 2VBXA 4QGMA 1IW7F 1E2XA 2P7VB 4L18B 3P9IA 2ET7A 1RGSA 3ZMUA 2XLGA 4U0YA 4IPAA 3NQOA 3ML6A 1SAXA 3TO9A 1HW1A 4WXCA 5JAXA 1XGMA 3LQRA 2V9VA 4GO1A 1LEAA 1O7LA 1NZCA 3T8RA 3WW4A 4S04A 2P5KA 1WGPA 3TOAA 5ILUA 4L9NA 3L7WA 3SMHA 3SZTA 4A5MA 2BE5F 4GYGA 1ZN2A 2V79A 1KYWA 1Z1DA 4IVNA 4ZU7A 5HVQC 1GQHA 3EUHA 3JTGA 3ECOA 4M71A 4IEVA 3GZ6A 2K02A 4WF2A 2YR2A 1FSEA 1CGPA 4RAYA 1RTVA 2IPQX 1WA4A 3N97A 4D0PA 3H1YA 5CVRA 5AVPA 1IN4A 2GC0A 3BPVA 4MGRA 2ZKLA 5H6RA 3R4KA 1B6AA 4EJOA 3RZZA 3K1NA 3V7SA 5FQ0B 1DUXC 3J81K 2QVSB 3FZ3A 2Q30A 1HQCA 5LHHA 1R36A 2VXZA 3QPHA 5D6EA 3HTSB 3GWZA 5EEGA 5BMZA 2C0ZA 2FQ3A 3UKTA 1JUHA 5FGMA 3SQNA 2VC0A 2QBYA 4FHTA 1KA8A 2OZ6A 4ETSA 1JXSA 2OD5A 1HKQA 4JTNA 4X6QB 4AVBA 6PAXA 4HVOA 4EJTA 4PIXA 1YFHA 4BYYA 3EJKA 5LGNA 1GHCA 2W24A 4YG2F 4WZCA 4XFHA 2Z99A 5LBQA 1K78A 5DV5A 2ESNA 3F3XA 4GGGA 2ZMEB 5CYVA 3KP2A 2Q8KA 4UVBA 3ETQA 3EQLF 1XD7A 3FXQA 1BC7C 5L3FA 5DEQA 5IT9Z 2BBYA 3OF1A 3SCGA 5E8IA 3O2PE 4CHUA 2CFXA 1W7PD 3DL3A 1KGSA 1P4XA 2EA2A 1K6OA 3LAJA 4OU0A 1J5YA 3ECHA 1KU2A 1O57A 1Z6TA 4ZU4A 2KJCA 2HDCA 2IC1A 2A5YB 1Z91A 3LFKA 1XSXA 4FAGA 3CL1A 1UCRA 4UV9A 2FBHA 4HZFA 2XRNA 2PAEA 2D2WA 5HDNA 2QCSB 3E5UA 3M7GA 4KWKA 1J9IA 2VBYA 3KZZA 3QPTA 5FDBA 4A0XA 2CV6A 2F4PA 3B73A 2PAMA 3I58A 1YG2A 2HYGD 4KYWA 1QZZA 4ZH4F 4EM0B 1R1UA 2P6TA 4HF1A 4RGUA 2EB7A 4UVCA 4WWCA 1S7AA 3WU0A 1S6LA 2Z5UA 4IETA 2PFBA 3ZMZA 2EA7A 4IRHA 2K86A 4FAHA 2G7HA 2NS0A 5JHUA 1VTNC 1YS7A 3QACA 3GFIA 4JK1X 1RUNA 1E17A 3BY6A 2NYXA 4WVZA 1W4MA 2Q4SA 4FX0A 1R58A 1LR5A 5KHGA 3SHRA 1LEBA 2XROA 5FLIA 2GH2A 1UD1A 1CF7B 1P4WA 2PEXA 2WC2A 1ONVA 1YLFA 2IT0A 4IEOA 1IN6A 1CAUA 5J7MA 2I45A 1X8MA 2COMA 2P6SA 1YO5C 1V3FA 2QENA 1XGOA 2XAJA 4E2QA 1LVAA 1HXDA 2VBZA 1LQ1A 3KGZA 1TNSA 3HQXA 1EH8A 1BM9A 2O61A 3ZMDA 4HDVA 3WW2A 3QAHA 3NW4A 3LA2A 2VECA 3EBRA 2EK5A 3MWMA 2K7LA 4FT8A 3I53A 2WTEA 4HLXA 3O14A 5BPDA 1EYBA 1H1IA 5IT3A 1DGRA 1S29A 4X6RB 4M72A 4EJUA 4HLYA 1OD5A 3ACLA 2HGCA 2DCTA 3MCZA 1B9NA 4HQMA 2FEZA 3PNAA 1BI3A 2D45A 1YTYA 2PAKA 1OYWA 4Z82A 5KHIA 3PLQA 1IRFA 3KGLA 1Z05A 4A5NA 1CF7A 2C6YA 4RD7A 1LDDA 1JHFA 5EEHA 3OTFA 1ZZCA 2CAVA 5FFXA 1BIAA 5J8CA 3LWCA 3H7JA 1RIOH 3NSTA 3GFLA 3ROUA 2QVOA 4G7OF 5ICEA 5I93A 2E9QA 4IEUA 3W6JB 3I59A 4NHJA 3TNPB 3W6KB 3WG9A 4MQVA 3KLOA 3R0AA 1O3RA 1DP7P 2XLAA 2OPKA 1ZLJA 1GVJA 4A0YA 2EV0A 3LOIA 2GAUA 4M74A 1WSUA 3EYIA 2VQAA 5E17F 1SFUA 4O6JA 2DFIA 2DBBA 4RAZA 4MX3A 5J48A 4IF4A 3GEZA 4G8XA 3E6CC 4BQAA 5E1WA 1VJ2A 4RGSA 4CDGA 1B9MA 1D8KA 1WI9A 2K27A 2PBIA 2O6GE 4NB5A 4YFXF 4M9SA 1TLHB 1L3JA 1ZGJA 2STTA 2HKOA 1OYYA 1XE8A 3HSRA 5I0UA 2ZJ2A 2IXLA 1O3QA 2IXHA 5HS7A 2HR3A 1B1BA 1FLIA 4IESA 3CF6E 3J80Z 3MPBA 2GXGA 3CTAA 4MGKE 2KIUA 1IN8A 1ZAOA 1BOAA 4EV0A 3T8TA 2HZTA 3NRVA 1V70A 1T39A 5ED4A 3IDCB 2JPBA 3ZMTA 3B02A 3IRQA 2ESHA 4MTDA 4PZJA 3HSEA 4IRGA 1ZZ9A 5EZWA 3RNSA 3F21A 4XFGA 2O1QA 3HOSA 2EA4A 3EYYA 1YFXA 1WWXA 1Z6RA 5KHHA 1GXPA 1WKMA 4HF2A 4I02A 1VP6A 2ETHA 3FXRA 3Q5FA 1D3YA 4AVPA 2HOEA 3RKXA 4IEPA 1A04A 3J81Z 2E7XA 3R60A 3RIRA 2F5CA 4LLNA 3TGNA 1XB4A 3CDHA 2MA3A 4E70A 1K79A 2ZO4A 3GFMA 2H94A 3M8FA 3O3KA 3H3UA 2XAGA 1QY4A 4Q0PA 4KU8A 3K2ZA 2HTSA 4ENJA 3KEOA 2IA2A 1IF1A 2UYAA 3KLNA 3WGHA 1U5TB 4AXOA 4HBNA 2XKPA 3I4PA 2HS5A 2UXNA 2ET1A 2H6CA 3MZHA 3CO7C 4MHGA 4Q29A 4HVRA 2DI3A 5TJJA 2RVCA 2L3DA 1IPJA 1T98A 3I54A 5HOOA 4XFBA 3S7IA 4KA4A 4M9ZA 4WK8F 3RI4A 4EM2A 3ZN0A 5HS8A 2FA5A 2GC2A 2EWNA 4LD5A 5HI0A 4BNCA 3GYDA 2DK5A 3BPZA 4I0BA 3H92A 3K1PA 4Q48A 4L5IA 3HRMA 4Q5SF 2VPVA 3CUQC 2QUFA 1TNTA 2KJBA 1YW9A 1P4AA 4UUVA 4MQ9F 2OZUA 1IN5A 1U5TC 1VR3A 5KHJA 5ICGA 2PJPA 1R5HA 1MJBA 1XCBA 1ZH5A 4QX5A 4KN7X 1FI2A 3OV8A 3FF5A 2UY8A 4QM8A 4I0AA 4JV4A 4H0EA 2QBYB 1Y0UA 5DD8A 4HQEA 3SCHA 3F6VA 2GA2A 4QLCU 3G73A 3U11A 2CYYA 3KZYA 3VFZA 2Z3YA 1SD4A 1DGWA 2FRHA 2UZKA 2A69F 4M9XA 1TBXA 2UY9A 3WW3A 1Q43A 2QJVA 4XF3A 2CGPA 3JTHA 1DPUA 4LB5A 1XMKA 4LUMA 4KDPA 2O0YA 2MH2A 5BPIA 1XSVA 3SCFA 4MZUA 5J3UA 5JI6A 3F8BA 3V8LA 4K8FA 5K1YA 1D5VA 1YFYA 1BI0A 1SMYF 5DCMA 2IA1A 1KQ9A 4UHTA 1LB2A 3ERED 1U5TA 5BXXA 1YS6A 2MNGA 1I1SA 1F1ZA 5KHKA 2A61A 1J75A 2XUBA 3U0ZA 5D8KB 3BJOA 2A6EF 3DF8A 2NNYA 1YUDA 5E1XA 1IXRC 3TO7A 1KQ0A 3WGIA 3GF2A 4DQ2A 5FPZA 1HKSA 3MZYA 5DCFA 1OMIA 2VE8A 1J3PA 3T0YA 2RC4A 4G9YA 3CJXA 1YWKA 3TDZC 2V1DA 2FE3A 2YSRA 4WXHA 2M8EA 2J5PA 3KEQA 5KBFA
chains in the Genus database with same CATH superfamily
2WZ8A 3V64A 2W94A 1MNDA 2GOMA 3CJRB 2VQ0A 3AYEA 2EV6A 3ZKYA 3ZSEA 3HHHA 4JHTA 1ZLKA 4XZUG 2JZYA 2YYOA 5FFZA 1HRV3 2A68F 1A8DA 4BY1J 1LPQA 3FXMA 2J1SA 3VUOA 2QNKA 1OH3A 1UHSA 4G3YC 3T1BA 2ZA9A 2I07B 3SDBA 5CFDC 4QX3A 2LK2A 1DFQA 1IKQA 4RB2C 4AHWA 1AOYA 1VAVA 1SBFA 3KP4A 2C6SA 2EF6A 2KIMA 1F4AA 4FO9A 5F5IA 3OCPA 1E3HA 1YJWI 1VPHA 2JDAA 1KU3A 4LK7A 2OA2A 4OZOA 4C0HA 2HYFA 3WSOA 5KAIC 3NV1A 1WCDJ 2KA3A 3LOBA 2XWJB 1R1VA 2VZOA 4CEYC 1TG7A 1BLZA 5DUKA 2X09A 1A36A 1QQP2 5H9SA 2JTVA 4J19A 4EE2A 4M3CE 5LA0A 3OS2A 3K77A 1FV3A 2LM3A 3PUAA 2FOKA 1HRI2 2XVGA 2CMPA 2HWD2 4QMAA 1POV0 4GALA 3IH3A 3POGA 4AIKA 3ZLIA 3ZQHA 2DW4A 3S16J 1R093 4CXXA 3F22A 2RVAA 2VTXA 4LIVA 1YFWA 5C4WC 3TEZA 3NAUA 4MH0E 1NQJA 3OYAA 1G6NA 4JTOA 2Y30A 5E8GA 3DLAA 1Y4WA 2VT2A 1LULA 5JLXA 3OB8A 1UOBA 3VLBB 3CCUI 4Q4ZF 1GP6A 3HRUA 1P8JA 1JUIA 4WM8C 1F36A 4DXZA 1VQNI 2ILMA 4PJ0C 3ECQA 3OL3A 5EJZB 1QGLA 2ZGKA 3TOBA 4WX9A 1K61A 1H6YA 3MYXA 1I3HA 4QB2A 2M2EA 5J1YA 2PA7A 1G7YA 4R9CA 3K9TA 3ZXGA 2CH0A 3ACIA 4MFDA 5TISC 1YLLA 3ZXLA 4QPGC 2QE3A 1QPIA 4ISRA 2JX9A 1YJNI 2DA7A 5HODA 3ZQIA 3AVRA 5FWJA 5M5WJ 5IP6A 4DRVA 3MEXA 3H5NA 1RI7A 4A2UA 3I3EA 1W5CC 3O12A 3DECA 1RKTA 4IRIA 1TWHJ 1FBUA 1LKNA 4CZCA 4Q2FA 4IQPA 3TNQA 1JJ6C 3L2HA 4XUTA 5C6CA 2Y64A 4NR1A 4XDOA 1WLCA 3POYA 2DAOA 5GZDA 2V1XA 1DCSA 1HJGA 4DUWA 1VBC3 2TCTA 2WKKA 2ZGPA 2YX7A 3C7OA 1O59A 4XETA 4H4KC 4QX8A 4AW7A 1QPMA 3GX4X 1SFNA 5BV6A 3PSIA 3MFKA 1SFEA 2DVFA 2QSGX 3JSOA 4XVHA 2VR4A 1GWMA 5LWBA 1FZPB 5CVUA 3H5RA 4DNCA 4BXXJ 1L7LA 4XJAA 2MBFA 3WGGA 1FMD2 4IDZA 2ZCWA 4UOJA 1X1BA 4UF0B 4AOCA 1W8FA 4LNVA 4PBPA 3H8RA 3H8UA 1R1A2 2VVEA 5HXVA 2JDUA 1CX4A 1PZ7A 1S1AA 1PX4A 3H42B 3OYKA 4C3HJ 3QYEA 1FOXA 1YW7A 2RDNA 4LITA 2GN3A 4IE6A 2FDHA 3C7EA 5CYYA 2BW3B 5EFUA 1POGA 2P3KA 4A7KA 5FOBB 5F0FA 5L3CA 3V4GA 3MF6A 4CA0A 1MNEA 5FPXA 1X1CA 2GU9A 3FBIB 1X3UA 3OOUA 2ACJA 2LYCA 5H9PA 2KFDA 5GAEJ 1M4WA 4NO4A 5FYZA 3ZDSA 3HTUA 2F4LA 2GLOA 1ETVA 4LFUA 3VDAA 4PGGA 4JKLA 4GWNA 2ZGOA 5H20A 4QIWN 4EQQA 4E7IA 4PDWB 1RUC1 4ZZ5A 2WQ4A 4HV5A 2RR11 3UJOA 5L3EA 2YS9A 1K7AA 2CW0F 1BJQA 3IAM2 1YX5A 3BKZA 1V6OA 5FKNA 4QXBA 2G1MA 4INDA 2OVUA 2VD7A 1R1A3 1TZOA 1OJLA 1V6KA 3EO6A 1OOPA 2B9SA 3CP2A 2QYOA 3O0VA 3GBGA 5F6LB 1U3EM 2LF7A 4A12A 1ZYRF 1PGW1 3SH3A 2XDVA 2WINB 2CQKA 5F7UA 3IKTA 1BOBA 1E3PA 4HKOA 4UFLA 1OCOH 4Q47A 4UW3A 4LXLA 1R71A 2Q1FA 3FBNB 1U6GA 1C8M3 4J1WA 4XQWA 2FNAA 2ZXJA 5KAFC 3Q9VA 2DT6A 2VUAA 4P5OA 3THCA 4Y1UA 5IUQA 2XQXA 4GFBA 1D7PM 3P1IA 1D2QA 3VZLA 4P9XA 2JVGA 2JRTA 1EF4A 5JOYA 2X6WA 5J98B 1BI2A 1MJAA 4D6SA 4RB1A 3K46A 3FJSA 1VQOI 3S57A 1LHNA 4S2HA 4MO3M 1VQ4I 2LTPA 5H2FC 3A0BC 4XKWA 1UN1A 1W36D 5EZGA 1RZ4A 4EM1A 1VIWB 1CAWA 4YM1A 1PVXA 1REDA 2VCMA 1HIXA 1UPSA 5FXVA 4CP2A 2BBVA 1H2LA 2OQGA 4EVIA 1VQKI 3Q9OA 3T2QA 4LO5B 3DEWA 3E5QA 4UUTA 3R6SA 5C9AB 3N05A 5M0TA 4RA2A 2K9LA 1PVC1 1SBDA 3LIGA 1MS4A 5FZMA 1NX9A 3W20A 4XORA 1NE4A 4N53A 4HX8A 2XAFA 3G4SI 2FDIA 4BQNA 4RGAA 1PNFA 3G3ZA 2VCBA 4K1ZA 2M34A 1F31A 1Q5OA 2KM2A 3KHBA 3VBFC 5FTTC 5FZBA 2Y6HA 4KMQA 4I01A 1UMIA 1WCQA 3CZJA 4MXWB 3ME2A 1K83J 3IV5A 2HQRA 3IUOA 1PVEA 2HWD1 3PSFA 4HNTA 2ISZA 1FPN1 3H9QA 4Q4Y2 2FBIA 2VMCA 4HA8A 4OAZA 1AVBA 4AIJA 4XILA 4XBQA 5LLQA 2CQNA 3HQRA 2KP6A 4ZJZA 1T38A 4ITVA 2L7KA 1SLLA 3BUCA 5K5RA 3BWGA 3VL9A 3VN4A 4BH9A 2XVKA 5T55A 4E7LA 1WLWA 5E79C 3TL4X 1YI2I 5L7OC 3U2RA 2BV4A 4XIKA 3LSMA 4II2A 4QM9A 4WVWA 1KGYA 1XDSA 1GANA 1YITI 3H36A 1W8NA 2P81A 3FHIB 4XONA 3RYKA 4M3CB 2R073 3CO2A 2XBO1 3T4HB 2WWSA 3HT2A 2VQGA 4P96A 1VMFA 4HETA 3O5SA 3D82A 3KF5A 5TGTA 4BGDA 3N36A 4LO8A 4F83A 4A6DA 2F5FA 2L01A 1UWWA 1WMEA 4UFJA 3OD0A 1AL22 4XLHA 2WNOA 5IK5A 4DZJA 1RUD1 5J1XA 3O7OA 4LG0A 3VHOA 1H2MA 4NOTA 4HG2A 4HEA2 4Q4V1 5D5WB 2WS92 3B6AA 4RGKA 1VQ7I 2LTNA 1TQIA 2VL8A 4AD9A 1G3TA 4IOCF 2ZAHA 1BIBA 4LHSA 5D5UB 2Z2SB 4NIDA 1HQWA 4N4NB 2E51A 5A33A 4YGCA 4P5HA 1YC61 2F17A 3VBOA 1O6UA 2EICA 4RS5B 2LS6A 2M0CA 5CFCC 3I4MJ 1Y9GA 5HLIA 4KU7A 1N3QA 4MGZE 2TDXA 2IW5A 3G1LA 2AEZA 1W03A 5DXDA 3OYEA 3SZPA 2H8WA 4RQPC 3C7HA 1MBGA 2X6XA 4B44A 5E89A 3EPZA 1W39A 4Q8KA 5A3LA 2R1BA 5FKCA 1W36C 1S0EA 1JT0A 5CG9A 1WGXA 2FU4A 3VDDA 2ADDA 1W6NA 4XMYA 2YPJA 3F72A 5FREA 2STWA 3CJNA 4HT1T 1GOHA 3KETA 3R4UA 4PK4A 4RN5A 1JHJA 2MLKA 4BXSV 1HSTA 2BGCA 5CB7A 1AYN2 2FD5A 3OGJA 1BR4A 2XKOA 5D4RA 2VAUA 2WNEA 2JUCA 2E1CA 4NQWA 5AC92 4FQGA 4TN7A 1ZRRA 5FIXA 5K7FA 1KU9A 1FY7A 2ORXA 2YPRA 2VW1A 2HWF1 3L2UA 1ETYA 2CTVA 4CEYA 1PGL1 2IGNA 4K2EA 2GA1A 1TQPA 2D1HA 1US2A 1YNAA 4BHCA 1S0JA 4KG0A 3NQHA 5EHDA 1J84A 4I98B 4BDZA 1N1SA 5HNFA 4AVCA 1JYXA 5FRMA 5ERLA 5A7SA 3QH7A 2NOJB 4OMZA 4BXUA 2WS91 3VBRB 2QQAA 4R8HA 2O8XA 2QQBA 4V2FA 4XZPA 1JZ2A 3FXLA 1NG0A 3A4UA 4IJAA 5H6QA 1UKRA 3ZN1A 3ZR6A 4NWWA 1L7RA 2Q8CA 2M3AA 2KIFA 5AIQA 3WUCA 4XFAA 1FX5A 3DCFA 5D2AA 2A6HF 2D3RA 1J1TA 4CPBA 5JMCA 2VPLA 1UYXA 4XQFA 3IAPA 3CUQA 4B4QA 4NC6A 3LE0A 1RL3A 2WNVB 2O5RA 2TNFA 2X5IA 3HT1A 2VLAA 1U8RA 4OINF 3AVSA 4RQPA 5DYMA 1X7NA 1J3QA 2ZHMA 3C3VA 3V8JA 3SXWA 3VD4A 1RUF1 2R0QC 3ZFEC 3GXUA 2FMLA 2EH3A 5FMOL 5L3GA 1AR91 1IV6A 1AR72 3DQVC 4AIHA 2K9ZA 3I3BA 1UY1A 1UYYA 4HW0A 1OA3A 3PVOA 4CEYB 3KT4A 1QJU1 2JB4A 4XRFA 4RR3C 2LKPA 1N77A 2XUEA 2OTJI 1FBQA 4KIBA 1COV1 5A70A 1HF0A 4HNUA 3NKTA 2X0LA 3ZMSA 3DFGA 3N7JA 3ZPLA 1MD0A 5KXBA 4PFPA 4CU7A 2VT3A 3F8CA 2HNHA 4Z2YA 3MBWA 1OCCH 4COYA 1XTAA 1RR8C 5D5XB 3I4NJ 2A07F 1AL0G 5JIAA 2W1WA 4UBGA 4CU8A 4AFBA 3BLYA 1WJCA 2XLFA 4JX6A 4Q4X1 1I39A 5CNAA 3DXJF 2WFPA 2E26A 1F5JA 4LTAA 4XSXF 3BU7A 1DG6A 3BIEA 5IVFA 3GLLA 3H9JA 1IXCA 2EXKA 2P6CA 3EYPA 3RZLA 4XJUA 2A6ZA 4RS5A 3EHKA 1GP4A 4PGHA 3I64A 1OOPB 4I30A 2XVLA 5J96B 4L0ZB 4I3PA 3U37A 3OL4A 1MMNA 1ZBE2 3WQ1A 4YRDA 2L9SA 1SFXA 2FBKA 5JMOA 4RMNA 5FQ0A 1DBNA 3RSNA 2H0BA 1HN0A 2YU9J 3ZM8A 5KHDA 3H5AA 3F8NA 3QYBA 1YFUA 1PP8F 4GD4A 1HN1A 1OPOA 2VONA 4L99A 5FP8A 2D6NA 1RC6A 1LDJA 2VJ4A 3FWEA 3OY8A 2JD9A 4NIGA 4HN1A 1KQ8A 2QWWA 3VZKA 4YVSA 4AQTA 4UXAA 4IXAA 4LBLA 4CA9A 2IBDA 4W1UA 3S8PA 4R1HA 3GVAA 5B3SH 3VKNA 2JWTA 1GR3A 4Y5SA 3SJMA 2M0MA 2BXZA 2NNNA 5FD5A 3R05A 2NVQJ 4XLNF 1TTYA 1AUYA 5K5OA 1AF9A 1XGNA 1ST8A 3TN91 1R9TJ 2GNDA 4AVAA 2PN6A 5A1LA 5DPNA 5L19A 5LEKA 3QU3A 3GTOJ 1Z67A 2VKEA 2B4KA 5LA1A 3ULQB 1CAXB 3O1SA 1ZELA 4N53B 2HYXA 2IS4A 2KZVA 3KM5A 1AKHA 5CADA 1SC7A 1XNTA 4YZ3A 2DA2A 4A7ZA 2QQ9A 2VU9A 4HAMA 3BJ6A 3V0BA 1IZ3A 4PIZA 3J7MA 4KITB 4N43B 5BNPB 3AL6A 2QQJA 2QQ8A 2G7UA 2JG9A 2XL9A 5IVCA 3FHAA 4YG3A 3SEPA 1YIOA 3MIHA 3GYHX 4IHWA 4DNYA 3BZCA 2NS8A 3V8KA 3DXUA 3OIQA 3ZYHA 3BG5A 5AC93 1W1WE 3MQ0A 4WM8A 3RZOJ 1SVMA 2GC1A 1JYWA 2J1VA 1LDKB 4E6KG 3N9LA 2GC3A 3BTXA 1H2NA 3WU1B 1Z78A 4M3EA 2PHRA 1P7IA 1A78A 4XW3A 1BBT1 3UK9A 4NRQA 3AZVA 1MR5A 4NVPA 4DY3A 2LY9A 2MHFA 2P4EA 3FE5A 2B42B 3SQOA 4B1LA 1H9WA 4YFKF 3OOXA 5DG1A 2GDFA 3NWTA 5FZ6A 3WW1A 5BPXA 2ERFA 4G6TB 1Z9CA 5FLHA 2WB1A 2IA0A 4Y22B 2ZMKA 2IFWA 2ZX3A 4DW6A 2MEV3 1AYM3 2CV2A 1LODA 2JG9C 2HQAA 2X53S 5CKQA 1Z77A 2YUSA 3PIOF 1ND3C 2JG8C 4R79A 5FCCA 2ATFA 3WLUA 5D6FA 1LOFA 1FBSA 3MW2A 4PHZA 3RWNA 2YU1A 3FXUA 4JGZC 1PO11 4ZXKA 4QPIA 4CCEA 2G9WA 4GZ9A 1RMU3 3AMMA 3OBTA 1OR7A 2L5QA 2VMDA 3JW4A 3H0DA 4QU1A 1R00A 2LF8A 2IFRA 2BW8A 5GZCA 3KSCA 5A7NA 3WZ1A 4BA6A 4G4FA 3ZN6B 3CJIC 4XF0A 4QGMA 4OHXA 4LLFA 1IW7F 2P7VB 1ETKA 2R7WA 2HWF2 3LFMA 2XLGA 4IPAA 3JUUA 1SAXA 5FLMJ 4DIQA 3TO9A 3SNMA 1HW1A 3PL0A 5LBBA 4FASD 3JD73 3NAPC 1STMA 3CCVI 1HB4A 5GLWA 2VZ1A 3M8LA 3DYPA 1W0TA 4IHXA 2LY1A 3SMHA 3K4MA 3SZTA 3KCXA 2QEXI 4GYGA 3WF3A 4F52A 1FMWA 4A41A 2ZXQA 1ORKA 4MXVA 4ZU7A 5HVQC 5C3SA 1VNDA 3LSPA 3JTGA 4M71A 3GZ6A 3T0BA 3IZOA 2BHZA 1QJFA 3V42A 1H0BA 3VBHB 3M3OA 4O65A 1V9U3 5A6QA 2ZKNA 1RTVA 2EIBA 1XU2A 4D0PA 2Y69H 3H1YA 4CCCA 5GM0A 1IN4A 4KBZA 4MGRA 1IJWC 3R4KA 1Z3YA 3HR9A 1MBJA 4DY5A 3BQYA 5CQGA 2X48A 2XC7A 2VZVA 3A01B 5FUNA 2QVSB 4JCKA 3A22A 1W6MA 2R7OA 1JMUB 3OYDA 5BMZA 4K20A 3HBZA 2FQ3A 3AKSA 1JUHA 2QBYA 3X29B 3HOWJ 3ZPOA 2OZ6A 3FN9A 1R49A 4X6QB 3H9GA 1YOVB 2NVUB 4AVBA 5CFCA 1NUKA 4PIXA 3K4NA 2ELJA 1GHCA 5FYMA 2QQPA 1BW6A 4OI2A 4UFIA 4AYBA 4XFHA 5LBQA 5DV5A 2R32A 2YHJA 4YPJA 1G8XA 2PHWA 4L8QA 2AYHA 2ADEA 4OVEA 5FROA 1ERDA 3BODA 5IT9Z 5IY5H 2BBYA 5A80A 5FXWA 5E8IA 3CCYA 4A3CJ 1RUI1 4J25A 1W7PD 1H8TA 4CYCB 4OU0A 3H3VK 1J5YA 4QX0A 4NWVA 1V6MA 3ECHA 1H89C 1O57A 1JZ5A 3VBHC 3KD4A 2HDCA 2IC1A 2X85A 2A5YB 2AC1A 1X9PA 1JKOC 1WH5A 4BY7J 5DQ0A 1ULEA 1AR62 3E5UA 3NMBA 3M7GA 2DJIA 3O1RA 3HBLA 2W1UA 2JA6J 4A69C 4A0XA 3KVBA 2MG4A 2HYGD 2LMDA 4ZH4F 4CP9A 2P6TA 1XNKA 2JUGA 2EB7A 2BOJA 3WU0A 4IETA 1VBB1 1SDDB 2JKXA 3AYCA 2PN5A 1VQ9I 3PTYA 4LBJA 1YS7A 2NQYA 3FL7A 5GZEA 5C3PA 1E17A 1RUE2 4LBKA 4MGQA 4FX0A 5FO7B 1PM4A 1LR5A 5KHGA 5FLIA 1A5JA 4PI2A 1U0AA 3N35A 3DKYA 3UYJA 1MH3A 3BOWA 3HPNA 3KLSA 4R4XA 3UGFA 1TVGA 2I45A 4COUA 1X8MA 4KGQA 1YO5C 2QENA 1XGOA 2ZX0A 2VBZA 4QPQA 1S2EA 3CMAI 1IS5A 4PJNA 2O61A 3RI8A 1XJAA 5E3MA 2VECA 2EK5A 1H1IA 1D4VB 3MO4A 1RUC2 4KQ7A 2CUJA 1SANA 5FJHA 4M72A 1ULDA 3PL8A 4RHV1 1POQA 3CQOA 4ZS2A 1IDYA 3ZFFA 3MCZA 5FY1A 1QKQA 1B9NA 5L7OB 4B3NA 4X8PA 1G9AA 4A42A 1OYWA 3CU7A 1WCSA 4Z82A 3U75A 4CDUC 3A03A 3PLQA 1X9TA 2C6YA 3ZQQA 1CF7A 4RD7A 1X1PA 3HXLA 3AL0C 1S55A 1TNRA 3OTFA 5FFXA 3OYFA 2CQXA 2A3YA 1DGWX 3NV2A 5FZOB 4G7OF 4M4RA 2BFUL 1H30A 3W6KB 2XONA 4MQVA 1YXWA 1VI0A 2VC9A 4OUEA 2RNGA 1WUVA 2XLAA 1PGW2 5FPLA 5JHFA 2KLOA 4A0YA 4RFT0 1LOAA 4Z2WA 3LOIA 4FOWA 4M74A 3EYIA 4QX1A 4K7JA 4HPKA 5E17F 4Y1XA 1AR71 3Q8BA 4O6JA 4XN3A 2VY0A 2D6KA 2LKXA 1NT0A 1Y56A 4GKYA 3ZFGA 3F2ZA 1UMQA 1SCRA 4BQAA 3VDDC 1GOFA 1VJ2A 1RITA 2QZ2A 4KI5M 1D8KA 1OLQA 4E8CA 1OF3A 2K27A 4PF1A 1VBA2 4KG8A 1GNZA 5FK7A 1WD3A 1YI7A 4M9SA 1TLHB 3LEGA 3ORJA 5K9YA 2NVXJ 4AL9A 2HWC2 3BYWA 1Z7S2 4PJLA 2YZ4A 1X58A 4F91B 2Y6FA 3OYGA 4DYCA 1DDLA 2D7FA 2IXHA 1XPXA 2HR3A 5GZGA 5FYTA 2IVJA 5DDJ3 4DXRA 3CTAA 3CLQA 1MVQA 3K6GA 4L97A 2PMZA 5L9BA 5IAVA 2JD4A 2X6OA 1QHHD 2ZC2A 4J6GA 5BNNC 4JX0A 2RDSA 3HSEA 4XKCA 1MH4A 4XFGA 3HOSA 3B93A 1YFXA 2J1EA 2W9XA 4GH4C 4LT5A 4IO9F 1W2OA 2Y26A 3FXRA 1AL21 2HOEA 5ACA2 2A70A 2K9SA 3FK6A 2OJED 4B47A 3ZQLA 4IEPA 4Q1RA 3DCQA 4D6RA 5JR2A 3RIRA 2DT7B 4LLNA 2OX0A 1MS0A 1YYNA 5C33A 1ENRA 5FKBA 2MA3A 2L9LA 2HWB3 4Q0PA 4KU8A 2OTLI 3ASNH 1B72B 1ZYBA 3WGHA 2R1DA 3IN9A 2VZSA 1WI3A 5CEHA 4U36A 2CU7A 1V6NA 1SDWA 2WAFA 2PXJA 4MHGA 3M3CA 1W2TA 1GOGA 2VZPA 1MMDA 1Q1VA 4YVWC 2L3DA 4DEVA 4XFBA 4ARXA 4D5CA 4E9KA 1XX5A 2W46A 2VZRA 4WVMA 5IATA 1QNYA 2YV8A 5FZ8A 4DB5A 2ZXIA 1DQ6A 1WW6A 2QBXA 3SFIA 1JUSA 2RG4A 1RESA 2WZR3 2D97A 4BNCA 1ULCA 4YZ4A 1QU0A 2JDNA 4YWAA 3H92A 1YQ6A 4COVA 3K1PA 2DDAA 2KJBA 5FZ7A 4UUVA 4BDVB 3JR9A 2OZUA 1IN5A 3VWBA 1VRH1 2PJPA 3GALA 2E7QA 1S0CA 2V7FA 3BIWE 1MJBA 3O1PA 3H3LA 4GB33 4AC0A 1RR7A 1UY4A 4LPLA 2M9HA 1RYYA 1DHKB 2ZJQF 4LBOA 2WZPP 4DGWB 4CEWC 1B35B 4AIDA 1QF3A 5IVYA 3THDA 4FPEA 1EAH1 2EQRA 3F6VA 1UG0A 5DN2A 3QD6A 3AKZA 2Z3YA 4FPYA 2PHUA 4M9XA 1FOD2 2UY9A 3OS1A 2CHHA 2CGPA 5LY1A 3JBG3 4LB5A 1UYZA 1WBLA 1KDKA 2O0YA 1BBT2 1YEWA 3FBMA 3INAA 4XOTA 4K8FA 4H55A 1I3AA 3ZX7A 4E4HA 1SMYF 3UL2A 1QJX1 1GFF2 4C2MJ 1U5TA 1YS6A 1NLQA 2AGSA 1I1SA 3GNEA 3GCWA 5FZKA 1J75A 4HRIA 4FTEA 2XUBA 1B8IB 3DF8A 5BNQA 2F6BA 4JRLA 4BZ4A 2ZX1A 3ZSJA 5FPZA 2E5ZA 3CF5F 2YU2A 3WQ7A 2FMDA 3N9QA 2HPIA 2NS7A 4IHVA 1J3PA 5BNNA 1QJZA 2RC4A 4G9YA 2BWAA 3FISA 2E1OA 2OQ6A 2M8EA 2J5PA 3KEQA 1GNYA 2EIJH 4L92A 4MXWA 5CLSA 5FZCA 2HQNA 1D1CA 3ABTA 1OBNA 4WVMB 1ULPA 1MEC3 3TKYA 2FX0A 3RSJA 1KZHA 2V1NA 5IOYA 4GMP0 3ZMOA 5BNOB 1A8MA 3W6VA 4D0QA 5C71A 2WT2A 4LE4A 1HRI1 4JVAA 2A3SA 2D1VA 2IRFG 4ENNA 2DTRA 4E7JA 5FY4A 1H6XA 3HRSA 2BVBA 4BJ5C 1R1TA 1RUH2 1BN5A 2Y31A 1VB4A 1GQPA 2VNOA 2RMU2 1HQLA 1LHOA 1IG3A 3HJEA 4XABA 4Y5TA 5C44J 1C1LA 3MDPA 2JSPA 3OYWA 4AAPA 3M3YJ 2CG4A 4XLFA 1EV13 2AS5F 1KFUL 1UF2C 1AR61 4G7ZF 2CU5A 1HA8A 4XRMA 3TWIA 1DF0A 4XICA 2OPTA 4ES9A 1OD3A 2R043 4QT6A 4GYIA 2PLV3 1ENXA 1XN7A 1K6YA 3H50A 2B7YA 2P5LC 5FZIA 4PSWA 1U78A 5TRDA 1TWGJ 5HXMA 1OQYA 1TME3 3ABLH 4BIFA 1JGGA 3VBFB 3OUHA 4JBAA 4YW2A 2E32A 2FOWA 1QJY3 3QRFF 2YXSA 5C4WB 5HV4A 1SD6A 1SVLA 1DPRA 4H7MA 2KMUA 4XOPA 2P2KA 4MG2A 4LG3A 3K4DA 3CLPA 3TW6A 4EYUA 3JB8A 5LW9A 4OHYA 5FBZA 1VBE1 3ZFEA 1ZZ6A 3N9OA 2KRHA 1F8VA 4IHTA 2OC6A 5DD4A 5ABJA 1QBJA 2NLRA 1O8PA 1PK6C 5A3NA 4C2TA 2RMU3 1ZGWA 1ACCA 1FOWA 4PQQA 4B8XA 3T2OA 3BB6A 2EFPA 1XQNA 4D7TA 5JSRA 4KWJA 3WE3A 2EIGA 4ZDLA 4AF9A 3MAJA 3KQ4B 3OPTA 3ZDVA 1AHSA 3ES4A 1K5MB 5B5EC 1CAUB 2W92A 2GALA 2LY2A 1S0FA 5E1ZB 4XXPA 1ENQA 3VD9A 3C2UA 3FXOA 3T1MA 2PG4A 4ATFA 5T5JA 2V4AA 4V2GA 2X1EA 2EV5A 5M5XJ 2RM21 4OMYA 4Y4RA 2RGVA 4LJHA 4JDNA 3PVBB 2BVLA 3VODA 1CPNA 5IVBA 3AZZA 3I59B 2QFEA 2H1LA 2RS13 5FAXA 4CCKA 3HGGA 3BQZA 2JJ7A 5IP7J 3CZUA 2WO2A 4QB6A 3PVNA 4XYXA 2WT1A 2OXBA 4D1QA 4UT5A 2YBPA 3I2IA 1NH3A 2IVMA 2WQ8A 4CCJA 2OS2A 4YZ5A 1FYLA 5LGTA 3DLLF 2Q2EA 2Z4FA 5FY7A 5ILSA 1COV2 2HDDA 3P6BA 2VTXJ 4XHBA 1W8TA 4HMZA 3EUAA 3AL0B 5JI9A 3W5NA 4AQ2A 4P9GA 5CAZA 1TME2 2VGDA 3WNMA 2XJVA 3W3CA 3OGRA 4ZHNA 5C3RA 2WSVA 1E0EA 1BEV1 2V9KA 1ZRFA 1STZA 1ZRDA 1UPIA 3VOEA 3ZFFC 4BMBA 2W7NA 3MKZA 4ZY9A 1NE6A 4GMP3 4W97A 4NIHA 5J47A 2VMEA 1F4KA 4EROA 4IE7A 2DURA 2GNTA 2ELHA 3NWSA 5K0UA 4M0HA 3QP6A 4GQ7A 2XJQA 3GZEA 4XLAA 5FY9A 4NHXA 1U12A 1JYNA 2AXTC 2ORZA 2Z5WA 5J4YA 4EWEA 4OOIA 1GBGA 2PMHA 1R5GA 3CCSI 5FWEA 1ND3A 2CSOA 5SV5A 4B8EA 2UURA 3GZAA 4AVTA 2XAQA 4II3A 5A7QA 5B4NA 2DCEA 1J0RA 5JFRA 3MW4A 2KISA 1H9TA 3UR3C 3C18A 2HU9A 2LVSA 3WG7H 3I2JA 4LA2A 3K0LA 4A6SA 1BR1A 3VBUA 5FKOA 3U1KA 1R092 1A6IA 4OIQF 2EXJA 1RNLA 2AO9A 3M9AA 1T2KA 2JICA 1FPN2 4DYRA 4Q4Y1 3COAC 4M3DA 3TBIA 3URFA 1FAYA 3ON7A 2ES3A 1UXXX 3A1YA 2WNUA 3IDEA 1J1LA 5HDKA 4RB0A 5E3OA 1T6BX 2PELA 5F04A 1F9KA 3LEMA 2PMUA 1UMHA 4HDUA 1VAKA 5C8CA 4OI4A 5ERIA 1X3ZB 5JLWA 1VBD2 2NVTJ 4Y20A 1S2KA 2LSOA 2JT1A 1RJ8A 3S17J 2O3FA 1N3PA 1BL0A 3K2AA 3WTSC 4E7KA 2VODA 4LG0B 2ME6A 1Y8RB 4YVWA 2Y6JA 3A7QA 1KFXL 3Q0UA 1PUFA 2P34A 3CO6C 3KCYA 2NM1A 1LESA 2FCVA 5GZFA 2NXNB 4AGRA 3MIEA 4C91A 4ON0A 1FX7A 3SITA 1RHI3 3USUA 3GMEA 2MYSA 4A3MJ 2ZMEA 3TP3A 5CJ9A 3Q8CA 4MTEA 3QQAA 3DPRA 3GO5A 1HKDA 2HEVF 2W5FA 3B69A 3BTZA 1JU4A 3BTJA 1B09A 2MD5A 3BR5A 1HW5A 4YW6A 1LENA 3CMGA 4TLGA 2RS31 3U10A 1DDNA 3ZYGA 2K40A 4B7EA 5CVJA 1MZEA 4ENKA 3FM3A 3T2PA 2VXDA 3V7RA 3VB2A 3UESA 1RIRA 1G3WA 3I71A 2W0XA 2K0GA 2HKXA 4YYOA 5A7WA 3WNNA 1ODMA 1TZLA 5FXXA 1T08B 1G3YA 3MLLA 3S0MA 1SMTA 2DCKA 3VB9A 2BDRA 4HV6A 2VB6A 2JENA 4S2GA 3T2TA 3WNLA 4SBVA 4OQ8A 3IP4B 2DFCA 2XIGA 4FTSA 3LEIA 3AYDA 3C1DA 2DDBA 2LFBA 4B09A 4KFCA 1DYOA 3ZYJB 4KICA 3KFWX 5HS9A 1OPCA 2KKOA 4MEXF 2JA7J 4FOYA 1UU5A 2GMPA 3VKFC 4KT6A 1W0UA 3BDDA 2BBAA 1YJKA 1RUG2 2CWMA 2IZWA 4S2FA 3W2VA 4IE4A 1OI6A 2CFOA 4YIRX 2WB1N 2Y0SA 1IG0A 1PGL2 2DFHA 1FMD3 2E7AA 3BALA 2OCEA 1B59A 2OUMA 4HYEA 2DVGA 4EGYA 4LE3A 4QQLA 5GLUA 4L9BA 3KE2A 4Q5OA 1SD5A 4XMAA 3VBSB 4IOAF 1NHAA 3GGLA 1OLMA 4FQ4A 1XCVA 1RKWA 4PLNA 5C8WA 3C2GA 3LA3A 1GV2A 4DEQA 3RKYA 3SISA 2M87A 1W9WA 5DDJ2 1DQ5A 1LHVA 1ZR4A 5IYYA 4KN4X 5IVJA 4UW6A 4UFHA 4GJZA 2CW8A 4HX7A 4XL9A 2RS32 2ZNZA 3FHZA 4YIIA 1J58A 3SLIA 3S2DJ 3RRDA 4CE8A 3WDVA 4QTRA 2G19A 1WWYA 3EETA 4KT5C 2UWAA 1R082 1CJDA 2HVQA 1O5LA 3ZQFA 5LRSA 4KL1A 5ANQA 1CN1A 4GH4B 3OSGA 1APNA 5KVRA 3GTPJ 3WTYC 1CPMA 4JQRA 3THTA 4A6EA 3NKGA 1ASJ1 1I27A 3VBOC 3ERMA 1SACA 4XSZF 1C8M2 5FYHA 4JP0A 4GXOA 5CKMA 1QJU2 2BPA2 4OHVA 2CDOA 3H0OA 4BEHB 1EV12 3WTWC 1GXQA 3BP8A 4A7YA 3ES1A 3L1PA 2BV6A 4N43C 1SLIA 5I0SA 5LD2C 3MV11 4QX2A 2EIDA 3K69A 2VJIA 5J1UA 4MHRA 3CHXA 1N75A 1F15A 3GDBA 4AK3A 4ZC3A 3AMPA 2X51A 2WNUB 1ZG3A 2RDQA 3NV4A 5FZ0A 1C28A 3S15J 4P00B 1YHQI 4N8MA 4G9SB 3QPLA 3HUGB 4KIGA 2DF7A 3WQ0A 5C4WA 4Y15A 1NG7A 1TEIA 1UIKA 1UX6A 4XBFA 5FO8B 4NBQA 1FT9A 4D69A 2DUOA 4Z1VA 1SEFA 2LH9A 1JUPA 2A71A 1R6RA 2PX9A 1SHWB 1UZWA 3CKHA 1YW8A 1Q8SA 4C3JJ 3AYAA 3IMNA 2G0EA 3K4KA 1LEMA 4G7HF 5CIRA 1OURA 4QGLA 4CYDA 1Y9QA 2YC2A 3LQQA 2OUHA 5A32B 1BI1A 4BQ1A 2HWE1 5ABJB 1WHUA 3GTQJ 1JH5A 1K4SA 1VBB2 1RXGA 1MDMA 1S3JA 3B5LB 4COWA 2OIIA 2L9VA 1FYMA 4R9AA 2CJJA 1BK0A 3CJIB 1XMAA 5H9QA 4A3KJ 4ITCA 1ODNA 2VE9A 2TUNA 3NVCA 1UCXA 3TOJA 2RM22 1S7EA 2KRFA 1V4RA 3VDCA 3S1QJ 3J8F3 3MW3A 4BE0A 1V00A 2ENRA 4BAYA 2IP2A 3V65A 2J1UA 2ZGMA 2ZXHA 1ZG5A 1IAWA 5LRRA 1MNMC 5DAPA 5BS6A 2BEOA 4AG4A 5GLTA 2FDKA 1YYVA 2RKHA 4V19K 2CAUA 1REFA 4LB6B 3BN6A 2ZFWA 3AMNA 2X29A 5E6HA 1YIFA 4AI8A 2HOAA 1O7FA 2OU2A 4JGYB 4W6XA 5LBFA 4TSVA 2FQPA 2EINH 2L54A 2K46A 3PUBA 2VH9A 1W28A 1EUTA 1GLHA 4UW5A 3SHFA 5EGOB 1Z7S1 1JZ4A 1V6IA 3U9GA 4AEDA 1JYVA 1ZBE3 3WOGA 2XG3A 1G9BA 3GHMA 5JPMB 2Y9YA 3KHCA 4LBMA 1H8TB 4MLOA 3CCJI 1N1VA 1GVDA 2JRMA 2Q1ZB 1JYTA 1OCTC 2CV1A 4Q0QA 1EPZA 4A0ZA 5CKTA 3E97A 3NARA 2K9QA 3H9AA 3WINE 2YDEA 1W6OA 2PTMA 1ZBA3 2OA4A 3GLXA 3M8JA 4I2OA 1IKPA 1SLCA 4AHYA 4NNJA 2JE9A 5A7PA 3JRAA 2H0VA 5LGUA 2AREA 3UNGC 1DQ4A 1RUD2 1VAMA 4N9IA 1TQ5A 4NIAA 2E7WA 2G9FA 4EJVA 5C4JJ 4CGZA 1I5ZA 1ZNPA 3POEA 3JRGA 1J2XA 5FLXK 3QBQA 4HLTA 2ELKA 2QQIA 4Q26A 1G9FA 3G7DA 4UUSA 4IHYA 3O1MA 3I5UA 2I10A 2R063 4XRSA 3NAPA 1C1FA 2UWCA 1VQMI 3RYRA 3BTYA 3MI8A 3L9FA 3RPQA 2Q0AA 4PLOA 3WF1A 1OCPA 5F5CA 4X0GA 1DIWA 2ZZJA 2O0OA 2VKHA 3SH4A 3BROA 4YW1A 2P3IA 1GWLA 2J1AA 2GM4A 1ALYA 3ZYFA 1MKMA 4QDRA 1LOBA 5B2GB 1OFNA 2XV4S 3W21A 1US3A 1QZEA 2DWRA 3KQRA 3QODA 1HLVA 4UB8C 4Q4W1 2ZGNA 4DFSA 2H6BA 5T5PA 3USUB 5K8SA 2E6VA 2WLPA 1J7KA 3O1OA 1XC5A 2C9KA 1RUH3 1C5IA 2P4WA 1SCSA 3T08A 1CAVA 3WTTC 2ZBJA 2CUZA 2A6XA 2DCYA 4LK0F 5JSOA 3DEUA 3KEYA 5DUUA 3AKPA 5GTIC 3IIAA 2YB7A 1QXRA 3LSHA 5LBCA 2HLEA 5IK7A 2FQ4A 1H0MA 5D8LB 1MBKA 3E6DA 4M4PA 2LR8A 5DM7F 1JUMA 2HTJA 3FZVA 2QQLA 1Y7BA 4PBOA 4U0VA 1WH7A 2FDGA 4YW7A 2A3WA 2VJXA 2RV8A 3O0WA 1XSDA 4IQJA 4EZ4A 2AENA 3M3IA 4OQ9A 1QWRA 5J8FA 1QDOA 1ZREA 4CUGA 3CF2A 2RQPA 1PM7A 5F1RA 3EQEA 4CP9B 1E57A 5JIUA 3VZOA 1UU4A 1FC3A 5I0RA 2XJTA 1IUYA 2UU8A 5FPBA 1FNNA 1EP0A 4U88A 2X5IC 1W8ZA 3GTMJ 2L4MA 3ZQ7A 3ZYPA 1AYM2 3VDXA 1YQAA 5LY2A 4DQAA 2BTVC 1C8NA 5A7OA 1U5XA 1T0FA 5A2QK 3MFCA 2EJRA 4LLGF 1WPKA 2BP6A 3LMMA 3HOBA 3R4SA 1FOKA 4FX4A 4IL7A 1LE8A 3I2HA 2K9NA 1LGCA 5J4VA 4BJ0A 2F6CA 3ITQA 4KWLA 2UWMA 5IVEA 4OULA 2Z69A 3B6CA 1TE1B 5F27A 1TW2A 5EYXA 3THPA 2MLGA 3QU6A 1HX6A 5FZLA 1R22A 1RVF2 4LMYA 1Q3EA 4AUXA 4IZZA 4DJAA 4ISQA 3V56A 3A23A 1RPWA 5HCAA 1PMHX 3RZJA 3DN7A 3MKWB 5DG2A 3IMMA 3E6MA 4XFFA 1W05A 1WJEA 1OUSA 2RHPA 2ZGLA 5LEJA 4EN9B 5F64A 2V72A 4MV2A 3LDRA 2BXYA 5IT6A 1VQ5I 1U5IA 2RDRA 2R7DA 1RUI2 2DU0A 1TQMA 3KYDB 4YIFA 2EZHA 4NHYA 3ASIA 4ZPIA 4DINB 3J7AO 5A3OA 3NEUA 1I1GA 2K9MA 4CDWB 4AFMA 4CU9A 3UKNA 4IKFA 2WN2A 2UXXA 4IGOA 4A6OA 1BCXA 2VBXA 4OWRB 1R081 2J42A 3P9IA 4QDQA 5IYDJ 5L7OA 4CDXC 1GYKA 1CIYA 3ZFFB 3OYWB 4Y4YA 4BEHA 4PI0A 5K0UC 1HLCA 5GTHC 2V9VA 5AFEA 1UKGA 4GO1A 1O7LA 2UWBA 3AX4A 3TOAA 3K4JA 2R5YB 3MFAA 2IGMA 3WX5A 3L7WA 1A6CA 4CYCA 3WU2C 4BE3A 2VVFA 3I97A 1KYWA 1GQHA 2CL2A 3EUHA 5APAA 4D8MA 1WMFA 4BQQA 1UOGA 4NC7A 2K02A 1OUXA 1WW5A 1CGPA 3NJXA 1BHGA 1QA6A 4RAYA 1UX7A 5CVRA 1LCLA 5AVPA 2O9LA 5FMCA 5H6RA 3CC4I 2LRDA 3VYSB 2NP0A 3FZ3A 4DS0A 5DZFA 5D6EA 4AVVA 2ZFUA 3HTSB 5B4XA 1WKYA 4RYDA 1NA1B 5FGMA 3W59A 3SQNA 2VC0A 2VUCA 1JXSA 4ETSA 1AZDA 2OD5A 1HKQA 1UZVA 1IRXA 5FZDA 2HWC3 1ND3B 4HVOA 1Y1VJ 4W65A 2IAIA 4BYYA 3TAYA 1S72I 2HOTA 2W24A 1WJAA 4U87A 2K3PA 5GAHJ 2BFUS 2C4XA 1KJRA 5EEAA 4RGGA 2Z42A 1T0FC 4LBQD 5L3FA 4YVSC 2LLKA 3GZUC 3W2WA 2QF7A 3HOVJ 4QXHA 3O2PE 4A3BJ 1PUFB 2DMNA 3M1HA 3BR6A 3LAJA 2XUMA 2ZAAA 1MS3A 2LREA 2L7ZA 2PJRA 4LBQB 3MHZA 4AI9A 1Z91A 2MD0A 4XPVA 2VZ3A 4HZFA 2WFF2 1V5EA 2PAEA 1Z3XA 2R7SA 2VBYA 3KZZA 3RQ4A 3HJRA 1ACIA 5FDBA 1VBC1 2P37A 3B73A 3FIWA 1QZZA 3S1NJ 2M7AA 2RJKA 4I0WB 2DTYA 1YRNB 4HF1A 4RGUA 4BK4A 4WWCA 1FOYA 3IM0A 2R16A 2AQEA 2Z5UA 2PFBA 3ZMZA 1W6PB 5JHUA 4MYEA 5EXOA 3TEWA 1W9TA 3GFIA 1KITA 4JK1X 3HOUJ 4WVZA 3I49A 4UYBA 5LBEA 1W4MA 1UO9A 2Q4SA 2YC4A 1WW4A 5BNOC 4ZTJA 4FPCA 3SHRA 1LEBA 1W9YA 3FHNA 1MQTB 2PEXA 1ZM1A 2AZ5A 3BCBA 1JOJA 1YLFA 2IT0A 3O1VA 2E63A 1IN6A 3WNOA 2ZEXA 2ZPXA 4LORA 1DLCA 3QWLA 2COMA 1GWKA 4PQ9A 1HXDA 3K48A 1TNSA 1Y9MA 4D94A 3DKQA 3DF0A 5BNPC 3JREA 3ZMDA 4HDVA 3LA2A 2QGUA 3S1MJ 1LGNA 1W3VA 1D0YA 2WTEA 4HLXA 5IT3A 1DGRA 1F4HA 1OD5A 4HLYA 1HXS1 2GIZA 4XAEA 4YEJA 3VZMA 2HGCA 4AFAA 2P0WA 1PZ8A 1YTYA 3SEZA 2BWCA 2PAKA 2HI3A 1OLRA 3VZJA 2YGLA 4A5NA 4B4PA 3AXDA 2DOEA 2ZSHB 1ZZCA 2CAVA 1BIAA 5J8CA 3LWCA 2F4MB 3ACFA 2XAUA 3D3AA 2RR13 3T0AA 1JI8A 3TYJA 3TNPB 3W5MA 3WG9A 3CMMA 5C70A 5IOZA 1BA5A 3AMHA 1T6GC 2D6OX 3RJRA 4FFFA 1GVJA 1GKBA 4ASLA 2VQAA 1G59A 1MS9A 2DFIA 2DBBA 4MX3A 3F0CA 2Y34A 3RKQA 4G8XA 3JRDA 1XPWA 4CCLA 2O14A 4RGSA 4A45A 1IGNA 1QJEA 5J09A 1LU1A 1WI9A 1F35A 2L2OA 2XF7A 1W6PA 2X8KA 1QOTA 1HRV2 3I2FA 4MVTA 1L3JA 1WJDA 4F55A 5DM6F 3S5QA 3HSRA 1OPMA 2WY8Q 1O3QA 1LFUP 5LATA 3J80Z 4AQSA 2GXGA 4F93B 2KIUA 1PK6B 1ZAOA 1SVOA 2A6TA 1MVEA 1V6JA 4AGGA 1CESA 1XNCA 3T8TA 1V6LA 2HZTA 4RQPB 1KS4A 2VUJA 4PSXA 1GT0C 5IJRA 3IRQA 4MTDA 4A3EJ 4D6QA 2IGOA 2VQUA 5FRNA 2KD7A 4IRGA 2FBEA 3F21A 1J09A 2O1QA 4QQHA 2EA4A 1IRZA 1WWXA 1GXPA 4P9IA 2VKVA 2R6QA 4HF2A 4I02A 2BU9A 2DA1A 4M3FA 2OUJA 3VDBA 3CESA 4IX7A 1SZBA 2GP3A 1A04A 2HVRA 3J81Z 2E7XA 3ZSLA 1BXHA 3TGNA 1LTEA 3MKYB 3U1XA 3N7MA 4E70A 1SMVA 2ZO4A 3J7AY 1T56A 2XH6A 3H3UA 4NHMA 4QDSA 2F5VA 2PMWB 5JXIA 5HCFA 1AR83 2HTSA 2IA2A 2UYAA 3WNXA 4AXOA 4HBNA 1PVC3 1C5HA 2XKPA 1VQ6I 2VOTA 2HS5A 2UXNA 5F2WA 1LEDA 3OR2C 1NCQC 1OA4A 5CFCB 4HVRA 2DI3A 4OI1A 1MMSA 1MZFA 3T3YA 4M9ZA 4WK8F 4EM2A 5FOJB 2W08A 5K7PA 2FA5A 2B39A 5EDNA 3OG2A 5HI0A 1WJBA 1XXNA 3O1UA 2DK5A 3BPZA 4CDWC 2VCAA 4Q48A 1KDMA 2HWD3 3G1MA 2C26A 1IPSA 5IWFA 2VPVA 4LKSA 4DRRA 1POV1 3CUQC 4EJRA 1TNTA 1SAUA 4JKMA 4MQ9F 1U5TC 1VR3A 2DVBA 2W87A 2JEMA 2DN0A 1XS9A 1PO21 3U4SA 2LBFB 3F95A 3FC0A 1LHWA 2DTWA 4HK9A 1O91A 3RGBA 4RBOA 2DYCA 4AFCA 3FLRA 4YVWB 2ZGQA 4H2AA 3W2AA 4I0AA 5GPAA 4H0EA 5DS9A 4QKDA 1BYHA 3JRFA 3G73A 4WVVA 2YBKA 3KZYA 4AI2A 4GH4A 1TWAJ 3NV3A 2VZQA 4C9YA 1BZWA 1WA6X 3KB5A 4FFGA 5FBJA 1SD4A 4J01A 1DGWA 2FRHA 2PHXA 4IV3A 1S2BA 1TBXA 3CNAA 2QJVA 3RPUD 1LGBA 1V5FA 1DPUA 1NCRB 1AYN1 2ZMLA 3FLTA 4NN0A 1XSVA 5J3UA 4IL6C 2CGOA 4MADA 1D5VA 1YFYA 4COZA 1RUE1 3KVAA 1RUD3 2Y0IA 1RUF2 1RUG1 4B1MA 4CVUA 5E3LA 3AM2A 4Q4V3 2UUZA 1ITYA 3ZR8X 3L2YA 1F1ZA 2XB5A 4C2UA 2W95A 5D8KB 4WM7C 3BJOA 2WYFA 2NNYA 4LO4B 2DMTA 2HVSA 2C1FA 3WGIA 3GF2A 4Y24A 5FY0A 3VGIA 1R4NB 2RV9A 1HKSA 3IKWA 2WYSA 1PJRA 3A01A 3T0YA 4DZGA 3C7GA 1WCKA 1V55H 2V1DA 2FE3A 4NRPA 1NAEA 3QCWA 2HZDA 3GTJJ 2P7CB 1IQAA 4LOTA 5FY5A 2Y0OA 4BCUA 4XF4A 3AFKA 3H8OA 4GCVA 5BY5A 5TSWA 1CZVA 2W00A 2K3FA 3WP5A 2Y0SN 3MIGA 4C30A 1NQDA 2KT0A 2BNNA 2Y0MA 4A93J 1B35A 4Q0VA 2G4IA 4XF1A 2IXIA 4ANJA 2XPVA 5HLTA 2HJIA 1UOJA 2HWF3 4NPMA 5ILVA 4CTEA 3CCRI 5F32A 1DZQA 3J7ZI 3PUIA 1BVP1 5EP9A 2R072 1GZWA 3CDZB 3A4CA 2XSJC 3HWJA 4M3GA 1XSQA 4IV1C 2P5BA 1RUJ3 3PDQA 1JTXA 3IWFA 5DAWA 2ISYA 5JOXA 5FP9A 3CCEI 3OOPA 3UV9A 5ACA3 2OYZA 4ENMA 2WS93 3UKVA 1VBD1 2V4JC 2ZEYA 3U78A 2X1DA 4YM0A 3D5SC 2DK8A 2XWBB 3U4XA 2JSCA 1MGTA 3KP5A 4KMUX 1UL9A 5IFPA 4IV3C 1D4M1 3FMSA 1VQPI 4XQDA 4DZPA 2LBFA 1PIV1 3C3WA 1T8IA 2VMHA 4E2GA 1PIV2 4NHLA 1UZZA 5H9RA 4FSJA 2TRTA 5K7HA 1C3HA 2RS51 1C57A 1RUF3 3FMGA 5F0CA 4XR6A 1IZ1A 3BTCA 4HOBA 1QZYA 3PUSA 2WWYA 5T5LA 1QJU3 4D7MA 3RFRA 2PHTA 3LAGA 4NHKA 2LALA 2E53A 2MABA 3OUIA 1X82A 5ANNA 4NROA 1QQP3 4TWTA 5J6XA 3CUOA 4QKNA 5JVVA 2FXAA 4IEXA 3S2HJ 5JWPA 4IEYA 5F8PA 3NL1A 4QXKA 2LUWA 1FOD1 3G2BA 4P9FA 5HLGA 1YRZA 3KCCA 3E1SA 1AXKA 3F8FA 3DV8A 1CONA 5A3PA 3HIFA 2BGPA 2A6WA 2XAHA 4XIOA 5EYYA 3K4BA 1OFCX 2Q0OA 3O6BB 1FJLA 5FUIA 3C7JA 4RLQA 1P6RA 4BISA 4CH7A 2B8MA 2ZEZA 1BBYA 3C8XA 3TDUC 4MEYF 2WAAA 2JDHA 1W6QA 3RJPA 4CICA 1C0WA 2JDKA 1AX1A 1W3XA 4XM3A 5JOWA 4UUSB 2QZ8A 3MF9A 1S0DA 2IXKA 4CXFA 4FVVA 2PMZN 2IUWA 3K3OA 4BHBA 2CUEA 3GBFA 1USSA 1GZTA 3C2HA 3HAGA 2F2EA 1WLDA 3CCQI 3HKZN 4FTBA 3HSFA 1EAH2 2W39A 1RUJ2 5JI7A 1PO12 5G04L 2E31A 1GLNA 2X5IB 5EQUA 4HSRA 2JG8B 1H9GA 1AXYA 2CQ7A 4V2WA 3LWFA 5E18F 2L7FP 4EWDA 1AWCA 1CJPA 3KF3A 4L9TA 1F43A 3AZYA 4HBLA 1HQNA 2VOKA 2X9DA 4LGWA 3EMRA 4Y20B 4LIUA 3RYPA 3M1EA 4N9HA 3LSDA 2C24A 2A5WA 5FZEA 3B01A 4PUSA 3I0TA 4C0BA 2WUHA 3PU3A 1TMF3 5J40A 4CEWA 3FFQA 1ZR2A 1VBA1 3GZNB 1W8UA 3T09A 2WA0A 2A7AA 4WBBA 4B3AA 2AH2A 1NXD1 1LOEA 1CQ9A 2DQRA 2VQHA 2Y60A 2FF4A 2NAZA 1FTTA 1FEXA 1RXFA 1DP0A 2OT7A 2XPUA 1UW8A 3KWVA 2IXJA 2HYKA 4Q4W2 5A3UA 3QP5A 3R0JA 4HONA 3S6PA 2L0KA 4DBRA 2Y9ZA 1UHMA 1OC1A 4Z6YA 5KXCA 4GXLA 2YC0A 3JCIA 5FZGA 1WJ5A 4RR3A 2YX4A 4B1RA 4ZYGA 3GXOA 4PCQA 4K9SA 3GFJA 3PFIA 4P14A 1XB9A 2WY7Q 2GNBA 3VBFA 3BG9A 1I50J 4ZU5A 4N43A 4X8NA 1UAAA 1RVF1 4OYUA 3RKWA 3ATGA 4N7IA 4HVQA 1RHI2 3RZDJ 2Y75A 3G1OA 2WAOA 3BZ6A 5F6FA 2E35A 2PHLA 4LLOA 1K12A 4DO0A 3ZXFA 5D21A 3WCSA 3EXUA 1AA7A 2RE9A 3CDLA 4D9JA 1JHHA 2QQUA 3RMXA 4ESJA 1BW5A 4ABZA 4MOAA 4META 2BVMA 1I6XA 1UB9A 2P3YA 5EJ3A 2Y8KA 4W6YA 1O3TA 1E5HA 3TEYA 4XXAA 5FLJA 3R61A 2MEV1 1AYM1 1KU7A 4IEZA 4CXWA 2LKSA 3RTRA 3HNYM 4ZDOA 5KBFA 3DEEA 3KIOA 1IXSB 2GWRA 5LHGA 1FIPA 3VV1A 3IWZA 3G6EI 2E36A 1X8EA 3LDKA 4DXSA 1PO13 2W2IA 3J80K 3QH6A 5FZ4A 5KK1A 4JGYA 1SEUA 3B9CA 1MSEC 2W57A 2D5VA 1RMU1 2VVDA 5BQTA 1YQ8A 3ABZA 3S30A 3RS6A 4RAFA 1A31A 5GPCA 1MS5A 2PYTA 3PURA 5FXZA 1A34A 4HSTA 4A3JJ 2QQNA 1XYNA 2QDRA 1SFKA 2DFEA 1YIPA 2H1KA 4K1YA 4PDKA 2R5YA 4UBHA 2PQ8A 1U9NA 1I3QJ 5CISA 5EG0A 4QHBA 3BG3A 3FM5A 5HLHA 4XKVA 4JAAA 4YFWA 5KXDA 4KNCA 3KP6A 1R1ZA 2ZGRA 2WWJA 4OIOF 3AP6A 1FSHA 5HBAA 4B4RA 5CU1A 4P1WA 4FI9A 4PF5A 1FWZA 4AVZA 2UYBA 2PHFA 3PHMA 4UNOA 1PHMA 2RN7A 2VMIA 1SQ4A 4FPHA 2VBDA 3DKWA 4M3BA 1ON2A 4XJZA 1H9PA 1BJAA 4RGRA 1ETOA 3AG1H 4M6XA 3RVHA 2FSWA 5HDGA 4LA3A 3E5XA 2XSDC 1B72A 4A3FJ 1WQ2A 1W2NA 4XJ9A 4KMFA 2K4BA 3ZXEA 4ES8A 2O7OA 1ZA7A 4FFIA 4XDQA 1LVKA 1A35A 5J3LA 1J59A 4CDXB 1PDNC 3MICA 2LOOA 1OF4A 4XBNA 3E3VA 3ZOIA 4LK1F 5FLXZ 5HNHA 4L5EA 5FV3A 5FFOC 3D0JA 5EIYB 2E33A 3W9AA 1OT5A 3ZN6A 5JVGF 2HDWA 4ESBA 1JHNA 3F8MA 4ASNA 2WQZC 3DPUA 3VD5A 3ISPA 4GRIA 1ZQ3P 4AQ6A 1IDZA 3GM8A 3WF4A 4I7HA 3KV9A 3I2DA 5LHIA 1W0NA 2F4IA 3BC8A 3LSRA 2L9NA 4EJWA 2RQQA 5FYBA 4P9UA 2GMEA 2HPMA 2WAQN 2Y48A 2RJLA 1JGSA 2GIVA 5KC6A 3N9PA 1W7PB 3ABUA 4LLLA 4BBSJ 2FUG2 4KWUA 4QD2A 3MKLA 4W4ZA 3CJIA 2Z1DA 4AHXA 4ET7A 2VG9A 1R64A 2WAEA 3MIBA 2ZHKA 2VMFA 4YARA 1BK1A 2D5HA 3PTRB 1YI9A 1CAXA 2WFF1 3VBSC 3VD7A 2BNMA 2DXIA 2QSHX 2P17A 3MIFA 3LIHA 2WNVC 3HRTA 1DP3A 1EV7A 5C3EJ 4QPYA 3IHUA 4FISA 2HXOA 2Z33A 5M3MJ 2YU3A 1EH7A 5K5QA 1QGPA 1QQIA 3SXYA 4PDWC 3HL2A 3D5LA 3IKVA 4NC8A 3ELKA 3HOTA 3WNPA 5FR3A 3AP4A 2CS3A 2EFWA 1HRV1 1MEC2 3EDPA 4XFCA 1XOYA 3PMSA 4NE9A 1AU7A 5GALA 1AJOA 1LRHA 4TZDA 2O8KA 4ZDPA 3L2RA 4IEQA 4QPOA 4OFGA 4IV3B 1TL8A 4XC9A 4GIQA 1VBE2 5FO5A 1BVVA 2ZHLA 3M7AA 3LEKA 1TW3A 4HF0A 5LFAA 1UHWA 4ONUA 2PQQA 5LA9A 2VOXA 2DPUA 1OCZH 2DMQA 2DT5A 3JAMZ 2WZEA 5GLVA 5FMDA 2CSGA 4CEWB 3CMEI 5SV8A 4BQWA 3FFZA 4IV1A 5IP9J 3IT8A 3K1MA 4DBQA 2YUEA 3H1WA 1DQ1A 3GUDA 3X2QH 1HXS2 1M06G 1N1TA 2QQOA 5KXEA 1O3SA 3FXJA 3F6OA 2VUMJ 4YFNF 2E2IJ 1OISA 2DMUA 4YZ2A 2V6EA 1SBEA 3ZN4A 3ST7A 4XLEA 2ZOEB 4TV7A 1QOSA 2PI0A 2RNJA 5ICFA 4EGZA 3OPZA 4O9GA 4CRQA 1F5TA 1U9OA 2ZTNA 3NNGA 5GP9A 1FPQA 2M4KA 1PGSA 1WRJA 1R091 4GWJA 1OKRA 3DPTA 2FMYA 5L3DA 4MGYE 1RUOA 3ZSKA 1W5SA 3F23A 2HBTA 3CEWA 2X4HA 5FPAA 1O5UA 1NA1A 1W6OB 4OIRF 3FXKA 4M6VA 2DODA 2K5CA 5CVIA 1UMZA 4RS5C 3CQZJ 1XNBA 3ZIXA 3HOYJ 2WA4A 2XQRA 2DPDA 1JTZX 3WF2A 5I8YA 3LOCA 4A3LJ 1GU3A 1AR73 3VD3A 4U7BA 4RAGA 1NYWA 2HEWF 4MGSA 4HN0A 3Q3SA 1AXZA 1H2KA 4H3WA 5CFDB 2VOOA 4J1XA 1XNDA 4LMFA 5D5VB 3OBZA 3I2KA 2V5DA 4S05A 2H09A 3L2CA 4B4CA 1D8JA 2R30A 4XCBA 1NG6A 2D6MA 2ZX2A 5IYBJ 3K10A 1FATA 3T5XA 2X1CA 2WADA 3DWLE 3CC7I 4Q8LA 1YCIA 4A3GJ 3BR1A 2XF6A 1JE8A 3DGTA 5FYCA 2LP0A 5DDJ1 1NCQB 4FPGA 1D0GA 2DDUA 4BLJA 4OHWA 3GTGJ 3ZO0B 5A1FA 1B4AA 2EAAA 5DZEA 1T6SA 3AZXA 2VKDA 2EVXA 5C3OA 4PFOA 2HWVA 1ZBA2 4LHLA 4C8DA 5BOXA 4CCOA 3LFUA 2BZDA 4RS8A 3IC7A 4Y33A 1Y1WJ 1YRNA 4TTGA 4BS9A 1OLME 2VPRA 3VBHA 1P2FA 1JOPA 2XL7A 2R7FA 3GW2A 3FUQA 9ANTA 3NWKA 1U8BA 2R5ZB 5C9AC 4CCNA 2NZ9A 4RGXA 1VF9A 2MFZA 1UAIA 2ID6A 4CDXA 3MIDA 1XBFA 1AHDP 2R93J 4XCAA 3LSJA 1XGSA 2HOSA 2OQ7A 3WG1A 2DO7A 3V0AB 1QVTA 2EBIA 1QMJA 1MBFA 2ZX4A 3E1F1 5JUVA 2AACA 2VJ5A 4GULA 4LKDA 2XR4A 2WBKA 3K2OA 1VQLI 4RM3A 2RS12 5AFBA 1MQTC 4GAZA 2HFHA 4UY8I 1MMAA 2H27A 3EUHC 4JRAA