5LEJA

The transcriptional regulator prfa from listeria monocytogenes in complex with a 30-bp operator prfa-box motif
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
236
structure length
236
Chain Sequence
NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Listeriolysin regulatory protein
publication title Structural basis for glutathione-mediated activation of the virulence regulatory protein PrfA in Listeria.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
total genus 69
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5lejA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5lejA01
4HZFA 2UY8A 3Q9SA 4YSFA 1QPMA 1L3JA 4IRIA 4KWLA 4RAYA 3S7IA 1ZZ9A 3D82A 1K79A 1ZVFA 4IXAA 3EETA 3O6BB 2QQBA 5L3GA 3UKNA 3MAJA 2YR2A 1BIAA 3K0LA 2OAZA 4RGXA 3M8EA 5J48A 2PQ8A 4EM0B 5LHGA 5E18F 1LKNA 2KRFA 1WGPA 5E8IA 2IRFG 1XSDA 1KA8A 2GWRA 3KP4A 3TKYA 4YARA 3LAGA 2ZKZA 1ZG5A 4ENNA 2O1QA 3Q9VA 1UPIA 3M1EA 4HF0A 4E2SA 3FZ3A 3CEWA 3GYHX 2MD5A 4MV2A 3WE2A 4EM2A 3L09A 4L9JA 4K2EA 3GFIA 2ISYA 3T8TA 4IVNA 5EEHA 2O0YA 3NSTA 3K1PA 5DD4A 1O5UA 3H8UA 3HUGA 1TLHB 3FJSA 2JRTA 4M71A 4LULA 1WI9A 3COAC 5I91A 5ILVA 3FX3A 1RNLA 5ICFA 3U1DA 5FLIA 1ZG3A 4HSJA 5CLSA 2FQ3A 2VT3A 1LEBA 4N9HA 3T0YA 4WVZA 2F5DA 1MDMB 4JQFA 2OU2A 4U0VA 3GZ6A 1OR7A 2D5HA 3EQLF 2P7VB 4MNUA 1MKMA 5H6QA 4IEYA 2GXBA 3BDDA 5HS8A 4XSXF 3NVCA 4JVAA 1HBXG 4XF9A 2VBYA 1GXPA 1X8MA 5KHJA 1VTNC 4DNCA 3CL1A 4EQQA 2CYYA 4G7HF 3IWFA 4HN1A 2GXGA 2QCSB 2P5VA 3CO6C 5AVPA 5LGNA 5FLHA 3LA3A 5LHHA 4XFHA 1OD5A 4CHUA 2HYFA 1WLTA 4RB3C 1KU3A 5LGTA 3KGZA 4HLXA 1X8EA 2J5OA 1HKSA 1MJ9A 3ECHA 3DKWA 2O03A 1FZPB 3H1MA 1EY2A 4IJAA 4IRGA 1Z05A 2MA3A 2STTA 4Z07A 5I8SA 1XCBA 1YUDA 3K69A 5BUVA 2A07F 3SCGA 4LMYA 1CAUA 3GBFA 5HDGA 4WK8F 3JAMZ 4KIFA 3VEPA 4OOIA 2Z33A 3HQXA 4ZZLA 2M30A 1RUNA 4UVAA 2K02A 3KZYA 4GO1A 3LSTA 3TO9A 1TW3A 2RV8A 4ZYHA 1IN8A 1XGMA 1Z7UA 4RS8A 4I98B 4AVBA 4PZJA 1KU2A 2ETHA 4KA4A 4M9SA 2P7CB 4U88A 2BBYA 2AS5F 2STWA 2CSOA 4H0EA 1MGTA 3RTRA 4I0BA 4O9EA 1WQ2A 5CVUA 2IXCA 4IEPA 5FFXA 1YWKA 3WW1A 4XEZA 3LOIA 5D6FA 5KHHA 1IRFA 4EJWA 1CX4A 2JPBA 1PM7A 5FGMA 3V7RA 3VODA 1IPJA 1UW8A 4A5MA 3F22A 2CO5A 1FBQA 4L5JA 2GQQA 4MTDA 1R00A 3MQ0A 2FMYA 2P6TA 5JR3A 4G94A 5CVJA 2A61A 5DYMA 3UKTA 5JHUA 1KU9A 4AVAA 1JXSA 2DFIA 1J9IA 1XE7A 2QLZA 1T2KA 2LDUA 2VBXA 1RTVA 4I0AA 1MD0A 2HFHA 3HT1A 4L0ZB 4A12A 2IC1A 4LD5A 1L3LA 1DPUA 3VB2A 3GO5A 3QP6A 1RIOH 3VFZA 3I71A 3IRRA 3P9CA 1I27A 2JT1A 3KFWX 1R22A 1S3JA 3KP7A 3L7WA 4R8HA 4IRHA 2EA2A 2UY9A 5KHGA 1IN6A 1V70A 2OD5A 2M5WA 4D7TA 3E6MA 3ABUA 2QBYA 5E17F 2NAZA 3MWMA 2D2WA 3DPTA 5C8WA 4HAMA 5FLJA 2DQLA 3ACLA 3ES4A 3F8BA 1R7JA 3JAMK 2O8QA 4F7ZA 3L9FA 3EQEA 4EWAA 3M70A 4WXHA 2HS5A 1ZRRA 2FEZA 2D93A 2QQ9A 1OPCA 5AONA 3I7DA 3E6CC 4AQ6A 1TQMA 4H7LA 3WU0A 3S0MA 2PFWA 3BPXA 5KVRA 4LTAA 4FHTA 1LQ1A 5I0RA 2HOEA 1H9GA 2ZCWA 4EM1A 4P5OA 4ASNA 2F4PA 5FCCA 4UBHA 1CAVB 2OQRA 2L4AA 4MQ9F 2MNGA 4MQVA 3CDHA 3V7SA 1PUEE 2DCTA 5CVRA 4XFBA 1W7PB 2ZFWA 2YU3A 4OIRF 3QP5A 4QX5A 1YG2A 3VOEA 2UWMA 3FHIB 1JHHA 4AIKA 3ULQB 1CGPA 2X0LA 1HKQA 5AIQA 4Y13A 4ZYEA 1Z91A 1I5ZA 3FXUA 3NEUA 1KU7A 3K2ZA 4LFUA 2CWEA 2F2EA 4I7HA 1ON2A 5L3DA 1IN7A 4YFNF 5I0UA 4HA8A 4IEOA 1XSVA 2GZWA 1XN7A 4A2UA 3M8FA 5LRSA 2Q30A 4F8AA 2A6EF 4UNOA 2V1UA 1NE6A 1B1BA 4WF2A 2RDPA 1F1ZA 2FRHA 3LWCA 1P6RA 1D8KA 1R58A 1YLFA 3I53A 5FD6A 1W5TA 1YHFA 5KK1A 4KWKA 3OF1A 3K1MA 1IXSB 3KCCA 1IXRC 1FP2A 2MBFA 1YTYA 2M45A 5KHIA 3SMHA 2DW4A 3F23A 1F9NA 3S7EA 4KN4X 1W7PD 4A6DA 1KYZA 2YX4A 4IERA 4EJUA 2A3SA 1LJ9A 4GCVA 2PHDA 2WFPA 2NS0A 3GEZA 3LQQA 3NQOA 1S7AA 1H9TA 2ISZA 2WV0A 3M7GA 3SXYA 1GHCA 3WTWC 2BEOA 3FM3A 1UB9A 3TOBA 5E1WA 2RC4A 2BNMA 3WU1B 3ELNA 2COMA 3DV8A 2WC2A 4FBFA 4HV6A 3T8RA 3R0JA 2IJLA 4ZZDA 2HJIA 2Q0AA 2MH2A 4IPAA 3BPZA 4L11A 3F8FA 1Y0UA 2QM3A 3DQVC 5DCMA 3CO2A 1MJAA 4TV7A 4ZU5A 1RUOA 2NNYA 5LGUA 3V8JA 4RD7A 3HOTA 4YFXF 2A5YB 2X4HA 3RI4A 2IXJA 3CUOA 2C0ZA 5BY5A 3SXWA 2EFPA 4G8XA 2CQKA 3E97A 3IL2A 2EV6A 2K0GA 2UYBA 3LQRA 1OYYA 2PLYA 1G3YA 2H6BA 3J7AO 2BNOA 4IETA 1YIOA 4A6EA 1FBSA 3P9IA 1UHWA 2BE5F 1CF7B 3H50A 3FZVA 4QMAA 4KU7A 3P7NA 4KT5C 4B09A 2ET7A 2K7LA 1QGPA 1YO5C 1BN5A 5HS9A 3QAHA 2EFOA 4WXDA 3F8CA 1BI0A 2VBWA 3J81K 1LRHA 1FY7A 1ZGAA 3K9TA 5HS7A 2IXIA 2PAEA 2VONA 4WXCA 5D5XB 4RB2C 1FP1D 5L3BA 4RGRA 2ELHA 4ENMA 5E1XA 1JE8A 1AWCA 2ESNA 2CGPA 2VECA 5HVQC 1SFUA 2D1VA 4M6YA 3PVBB 1YW9A 1ZRCA 1OI6A 2EA4A 2R3SA 5I8YA 4YRDA 4B29A 1J75A 2V9VA 4QM8A 4HDUA 1JGSA 4UV8A 3ERED 4A0ZA 2FE3A 1T38A 4U0WA 3TDZC 3F72A 4HX7A 3CTAA 1X7NA 5J6XA 2W85A 1Q43A 1IN4A 2PAMA 4MHGA 3JTHA 2Z99A 2RQPA 2OPKA 3LAJA 3FE5A 3J80Z 1I6XA 1TNTA 3E5QA 3KP3A 3ISPA 4OIPF 5CU1A 1ZRDA 4P9UA 1YFHA 3GVAA 5BXXA 2HKXA 4I09A 2RVCA 2HWVA 2RGVA 1QO0D 4QLCU 4MH0E 3M3IA 1GVJA 2MH9A 3LA2A 1O3QA 4ORFA 1S7OA 2MLGA 4N9IA 3ABTA 4P55A 2PTMA 1JHFA 1SFNA 3BJAA 3SZTA 3BCWA 2PN6A 1O4TA 4HYEA 1IW7F 4L2NA 4RGSA 5DV5A 4JTNA 4J1WA 5D5UB 1J5YA 3U9GA 3PLQA 3H9AA 2FA5A 4ESJA 2GA1A 4Z82A 4KIGA 1FLIA 1WSUA 4L18B 1FYKA 5ICGA 3IC7A 1BI3A 2WTEA 2E7XA 3BY6A 3TGNA 2FU4A 2G7UA 2YX7A 2HZTA 5BPXA 1XSXA 1W5SA 1XD7A 2EA7A 1IAWA 3R6SA 3DEUA 4QM9A 4KMFA 4O5VA 1RGSA 3DL3A 2DPDA 4Q5SF 4WX9A 4LA3A 3E5XA 3F6OA 6PAXA 1QY4A 3FMRA 1Q5OA 5E20A 4HQEA 4A5NA 3BPVA 3IIAA 3G3ZA 5FB2A 2V09A 2DAOA 4L9NA 1EYBA 4BQAA 4O9GA 2OZJA 3JTGA 5EFUA 2Z2SB 2ZMEB 3FMQA 3OGJA 5JFRA 1B9NA 3F8MA 4BYYA 1U78A 1NXMA 4GULA 5JSPA 1R5HA 4LLGF 4WBBA 3BJ6A 2XAHA 4XLPF 4OMZA 4M9XA 4ZU7A 4GXOA 3CLOA 5TJJA 4IESA 4EVIA 5D5VB 2MLKA 3RYRA 4META 3FXQA 3EUHA 3M9AA 4OMYA 2PHLA 4IEQA 4M9ZA 5E16A 4I3PA 1GQHA 4ESFA 3L00A 3H7YA 5LLQA 3J80K 1YW7A 2C6YA 4OFGA 2KIMA 1ON1A 4UXAA 3CUQB 4PGHA 4XETA 2RNJA 1P92A 4KYWA 1UFMA 4BIFA 2B0LA 4MGRA 2Y0MA 4UUVA 4YYOA 3HTUA 3L2CA 2IXLA 3TNQA 2QYOA 5A2QZ 4MGIE 2ETEA 4AXOA 4ON0A 2PFBA 3GF2A 1R1UA 3ZP5A 4M72A 2ESHA 1PDNC 3V7CA 3ZN0A 4HN0A 3JZVA 3OTFA 2Z5UA 1Z6RA 2L3DA 5LBQA 3OV8A 2DLLA 4PGGA 4HDVA 4Q29A 3H1WA 5FDBA 5K5RA 4OIOF 2VODA 3I59B 4KMUX 1TBXA 5CVIA 3O2PE 3L2HA 1ZZ7A 3T5XA 3BP8A 2IA2A 5HLGA 4UBGA 4Z2YA 1STZA 2G9WA 4R1HA 4XRFA 2VE9A 1NZCA 3ETQA 3KSCA 4EV0A 1XGSA 3HRUA 2K9ZA 4HLTA 2LF8A 2P5LC 2V1XA 1SD5A 1EP0A 3I54A 1HSTA 2QVOA 1S29A 3O14A 3MCZA 3F6VA 2GA2A 1EPZA 3W6KB 4LA2A 5HDKA 4KN7X 1GQGA 3BU7A 2OA4A 2ET1A 2QWWA 2Z9OA 2XROA 4YNIA 3PNAA 4MEYF 1XDUA 2EVXA 1MJBA 3KZZA 3ES1A 3P9KA 1O5LA 4AQ2A 2GC2A 2ATFA 2HGCA 3ZQ7A 2FNAA 1LDDA 2XHKA 2GC0A 1SEFA 2LNBA 4XFAA 3QPHA 4XF4A 3F3XA 5D5WB 1MDMA 5E8GA 4Q0PA 3WGGA 1WRJA 4CXFA 3D5LA 1USSA 1IF1A 1LB2A 4ZU4A 2XLAA 5HLHA 1U12A 3H7JA 1VJ2A 2MPFA 2MC3A 3JSOA 1U5TB 4E70A 1YW8A 1HW1A 1ZRFA 4O3MA 3R0AA 4NVPA 4HX4A 4QWQA 4LK1F 3V8LA 2RKHA 1X3UA 2DI3A 4EJOA 1UD1A 1CAXA 5CJ9A 1FXZA 4RB0A 2KJCA 4HF1A 1QXJA 3I0TA 5FPZA 1IZ1A 2UXXA 2IPQX 5A2QK 5LHIA 4U7DA 3HYIA 3DF8A 4KDPA 3RYPA 4S04A 1J2XA 2W24A 4LEJA 1FSEA 1UIKA 4WZCA 4JTOA 1D5VA 2EK5A 4KIBA 2EJRA 1XRUA 2PMHA 2W57A 2PG4A 2FSWA 1S8NA 1ZZBA 4HF2A 2VN2A 1QWRA 1J59A 2ZBKA 2ACJA 2IW5A 2XAFA 2AXLA 4WWCA 4MTEA 2QNKA 2M8EA 3KP6A 2XAJA 4YFKF 2KKOA 1QZYA 3U11A 1SFXA 1PP8F 3GXOA 3U0ZA 2O6GE 2XASA 3WTYC 1UHMA 1ZLKA 1D8JA 1O3RA 3RPQA 4BHPA 1Z6TA 5BQTA 3N97A 4XFGA 4KU8A 1W4MA 3B73A 4ZH4F 5BV6A 4PIYA 4X6RB 4XFFA 3HSRA 2EAAA 1E2XA 5D8KB 2FOKA 2CAUA 3GUDA 4G6QA 2R7DA 4LG0B 3GLXA 4NHJA 4J1XA 3SCFA 4JBAA 3KEQA 2XUBA 2EFQA 4XBFA 2D40A 1KYWA 4ESBA 1K78B 5FLXZ 4KNYA 1XGOA 2V6CA 1QNTA 2XIGA 1USTA 1B6AA 1K6OA 1VR3A 1RI7A 3LFKA 3ZPLA 5EZWA 3HRSA 3F8NA 3IDBB 5D8LB 2OA2A 1Z1DA 4UVCA 3IKTA 4P9GA 4EROA 5FQ0B 3KP2A 2IA1A 4Q47A 4HV5A 1CAWB 1BC7C 5IT9Z 1R36A 3KMHA 2IA0A 4IEZA 4YIFA 3TOAA 5BOXA 3TO6A 5L3EA 1FNNA 3RKWA 4CDGA 4QXKA 5DCFA 3I5UA 3IHUA 2H94A 3IWZA 1HW2A 3BROA 3F21A 2B9UA 3AAFA 4JV4A 5DUKA 4HVQA 3DN7A 2H27A 4M74A 3ECOA 4OIQF 1LVAA 4ONUA 4MGZE 4BHCA 3GWZA 3WTZA 1SQ4A 2FBIA 2VT2A 4EMSA 3RKYA 4LLOA 2DTRA 2ZKLA 1ZG1A 5ED4A 2O8XA 5BPDA 5J7MA 3HTSB 3MDPA 4P96A 2P17A 2O61A 3EJKA 2PEXA 1P4WA 4UVBA 4KFCA 4AD9A 1ZGJA 4CO8A 3EO6A 2FBKA 4GYGA 2HYGD 1FBUA 4Y15A 3SZPA 1G3SA 2VOOA 5J8FA 2DQRA 1R1VA 3MYXA 3ZDSA 5JSRA 3KLNA 4HVRA 4HSLA 5DUIA 4OLLA 3WE3A 3OCPA 1FYLA 1YS7A 1OYIA 1TW2A 1EH8A 1X82A 2R7FA 3U2RA 2VBZA 4Q48A 4IEXA 4CYDA 2EV0A 3D0JA 4BHBA 5FLXK 3I58A 2PBIA 2EB7A 4HQMA 2GAUA 4Q0QA 5K5QA 4FX4A 4KICA 4AVPA 3ZMSA 1BI1A 1A04A 5F64A 3H92A 2XKOA 2KXLA 3PFIA 4ZYGA 2J5PA 1P2FA 5K5OA 1YLLA 1VP6A 3FHZA 1OKRA 2QJVA 4O6JA 5IT9K 4I02A 1NYWA 3E3VA 2MHFA 3NJZA 3ZMZA 3QU3A 4LLLA 1U6GA 4QGLA 1SMYF 1XE8A 4FT8A 1HXDA 2GIVA 4PIZA 3IRQA 2QQAA 2IVMA 3ELKA 4MUVA 3JSPA 5HLIA 1FX7A 1F5TA 3RDIA 3RJPA 2OZ6A 2ZJ2A 1CAUB 3H3UA 4G9YA 4ZYDA 4CICA 2QUFA 3PQJA 2D5FA 3E6DA 1JUHA 1MZBA 1KQ0A 2IT0A 3FWEA 5H20A 1B4AA 4A0YA 2DO7A 3MPBA 2LKPA 2ZNZA 3SQNA 1WWXA 2A6HF 2N7GA 1DZRA 1ZARA 1FWZA 1P4XA 2DPUA 2HTJA 1BM9A 3DP7A 5IT3A 3HRTA 4LLNA 1J3QA 4UXNA 2LF7A 1BJAA 2HDCA 2VPVA 4EWDA 2EV5A 1O7FA 2DU9A 3UKVA 1O7LA 2CW0F 3HHHA 1OYWA 2FF4A 1H1MA 5CYVA 4YIIA 5BS6A 4UV9A 1XCVA 3OOPA 5BMZA 5KHKA 4M6XA 2W25A 4Q0SA 2D1HA 5E1RA 2PA7A 2OZUA 4FX0A 1CF7A 3HIFA 3KE2A 3IDCB 2NYXA 3WW4A 4LB5A 1RL3A 4HOBA 4OU0A 3WTSC 2B8MA 2PMUA 4R52A 4XFCA 2FBHA 1OFNA 2UZKA 4HX8A 1J0RA 1REPC 3KETA 2K4JA 3MEXA 1KQ9A 1BC8C 3HT2A 2PAKA 2E9QA 4L0YB 3QOPA 3WTXC 2WWYA 4EGZA 1TQPA 1SAXA 1B59A 4U7BA 4FAGA 3NL1A 4CGZA 1Y9QA 3CF6E 3WW3A 1LEAA 2OQGA 2P4WA 2Z3YA 4XF3A 3NRVA 1QXRA 2H0VA 1T0FA 3O3KA 1YFXA 1PMIA 3ML6A 3WODF 3SHRA 3LAPA 3CUQC 2K4BA 5DEQA 1CAXB 2Q8KA 1H1IA 5CADA 2FQPA 2ZO4A 2QBYB 4EWEA 3RZZA 2BYVE 4DINB 4Y17A 5BPIA 1G4DA 3SHFA 2JZYA 3WGIA 1R5GA 1DPRA 4HBLA 3GX4X 3C7JA 1OMIA 2K27A 2F5EA 2G7HA 1AOYA 2A69F 3FM5A 5I8TA 1ZLJA 1IRGA 4IF4A 3G73A 2UXNA 1U3EM 3C3WA 4AVCA 3KGLA 2JTVA 1ZNPA 3CJXA 4IHSA 3BALA 2JSCA 3SFZA 2QENA 3ZMTA 5LEKA 1V4RA 2GH2A 3GFJA 2UYAA 1IXCA 2XLFA 4KUMA 2P6SA 3MFKA 3WTVC 3FFQA 4U0YA 2DT5A 2DBBA 3R4KA 3IBMA 3CLPA 4XF1A 2I45A 1S6LA 5ICEA 5JR7B 4BNCA 1FPQA 3IKVA 2H09A 4Q0VA 1ZHFA 3FMSA 2XKPA 5JVTA 3HRMA 1XMKA 1DZTA 1XMAA 1J3RA 5J3UA 5TRDA 4KL1A 3DPLC 1TQIA 1UIJA 3I4PA 2BNNA 5KBFA 3USSA 2B5HA 4EGYA 4AIJA 3H1YA 3G7DA 4B8XA 5JI6A 1KGSA 2Y75A 2EWNA 2ADUA 4XF0A 2VC0A 1ZZ6A 2KIUA 1XDSA 1J3PA 1ZH5A 1Q1HA 1YFWA 3C3VA 2XL7A 4OINF 2VE8A 5JCTA 1TQ5A 5HDNA 3HOSA 4FAHA 1I1GA 2E7WA 1TTYA 3EYIA 5D4RA 5F1RA 2FMLA 5ILUA 1PP7U 3BJOA 4YG2F 2DK8A 3RNSA 1BBYA 5L3CA 1U5TC 3LA7A 1EH6A 2XLGA 1HW5A 3I64A 2L4MA 4EJTA 3LWFA 4K8FA 1RZ4A 2V1DA 3RYKA 2ZMEA 4IEUA 4I01A 1DGWA 1QQIA 2E1NA 1O3TA 4HLYA 4GGGA 4R79A 2JPCA 2XGXA 3KEOA 3RKXA 4N0BA 5I0SA 2PQQA 3W6JB 3HSEA 1U2WA 1UCRA 2PI0A 1IPKA 1SD7A 1RC6A 2HR3A 1BIBA 2LSOA 1C0WA 5AIPA 4L5IA 3KP5A 3GZ5A 4BH9A 4P9FA 2HQNA 3TQNA 1T39A 1FT9A 5I93A 2W84A 4X6QB 3CUQA 2HKOA 1Q3EA 4ETSA 3JW4A 2QZ8A 5EEGA 2NRAC 1T98A 3SCHA 3K1NA 3ZMDA 5DCMB 4AWXB 2F5FA 1IN5A 2QVSB 3HSFA 2O3FA 4JK1X 1NE4A 2Q1ZB 4LK0F 3VHRA 3EDPA 4DQ2A 1D3YA 4LUKA 3EYYA 1SFEA 3ZN1A 3DXJF 3R60A 5ICCA 3QU6A 2ZXJA 3RPUA 4ENJA 3I59A 4HBNA 4IEWA 3TNPB 3GFLA 1DGRA 3WW2A 5DD8A 4GYIA 3CO7C 4CZZA 4MGKE 1IUYA 2HTSA 3MZYA 2XRNA 5C6CA 3FXRA 3ZMVA 2XAQA 2Q0OA 1WKMA 1SD4A 3CJNA 5LRRA 3V8KA 4UHTA 3WGHA 2K86A 1P4AA 5ILSA 1G6NA 1BOAA 5F6FA 2YPRA 4G7ZF 1ZREA 1LNWA 1NHAA 4HMZA 3QRFF 1T6SA 2VXZA 2XV4S 2KIFA 4PIXA 2Q4SA 2IXHA 4PDKA 2OBPA 3DFGA 1FSHA 3OD0A 4L9TA 3BOQA 5FO5A 1LR5A 2P5KA 4HW0A 3TDUC 5D1IA 3NKTA 3EBRA 1FYMA 2Z69A 4QGNA 4E2GA 3J81Z 3N4MA 1YS6A 3BB6A 4EJVA 1XGNA 3BZ6A 2EFWA 4KWJA 3C18A 2HQRA 2CAVA 5H6RA 4XSZF 3GW2A 4D7SA 2GU9A 3REOA 5D6EA 4LUMA 2M87A 1U5TA 1XB4A 1ULYA 5D4SA 2XVCA 2XAGA 5K8SA 1J7KA 2KJBA 4NB5A 5FD5A 3GFMA 3TO7A 4TLFA 1H0MA 1SD6A 3BWGA 5I0TA 2DK5A 5JAXA 4RB1A 2L01A 4G6DA 1DUXC 1R1TA 3RIRA 3T1BA 1Y3TA 1WA4A 2M1BA 3NW4A 2BV6A 1J1LA 4IHTA 3PQKA 5E1ZB 1YYVA 2NNNA 2VQAA 5FFZA 3WTTC 1YFUA 3B02A 4XFIA 5HOOA 3QPTA 2RN7A 2FXAA 1O57A 3D0SA 1ODDA 1UCXA 3U10A 4ENKA 1HKTA 1YFYA 2Q2EA 2XL9A 2TDXA 5LEJA 1ZAOA 4MGYE 1G3WA 5HI0A 1YQAA 2IP2A 3Q5FA 1GXQA 2H6CA 4PJYA 1SMTA 4XLNF 4MEXF 1LDKB 1V3FA 2L02A 4LB6B 2PYTA 4QGMA 1EH7A 1CAVA 1BI2A 1G3TA 5FPXA 5CVVA 2IXKA 1I1SA 1U8RA 4I2OA 3E6BA 1J58A 1W7PA 4BXUA 2OYZA 1TNSA 3S2WA 4HVOA 3ROUA 5L3FA 3GYDA 4MX3A 4RGUA 1Z9CA 2GC3A 4IEVA 2P8TA 2PJPA 3KLOA 4AIHA 2F5CA 1EV7A 3HHGA 2ZNYA 3QACA 2CFXA 1QBJA 1DP7P 4G7OF 5T3NA 1ZN2A 1K7AA 3WTUC 5K1YA 4MZUA 3EHKA 3FF5A 2QDRA 3C1DA 4L9VA 4Q4ZF 4LG0A 1KQ8A 1B9MA 2E1CA 4RAZA 1DDNA 5DDGA 1F4KA 2V79A 4A0XA 1HSJA 1R23A 2D45A 4Q0UA 3MZHA 2CG4A 3ZMUA 2A68F 1K78A 2L54A 1ZX5A 4LJZF 4LGWA 4PCQA 1E17A 1ZZ8A 2VC1A 4WCGA 3H3ZA 2VOPA 2Y48A 2Y0OA 1FC3A 1FI2A 2GC1A 3E5UA 1ONVA 1LDJA 1HQCA 4BAYA 2HEOA 3WG9A 1FOKA 2EFNA 4M73A 2YSRA 1ZZCA 5FQ0A 5ERIA 3V4GA 2BGCA 4E2QA 2FNPA 4D0PA 5J8CA 4NQWA 3R61A 4S05A 1CAWA 1O3SA 1QZZA 3ST7A 1ZYRF 2CV6A 3LZZA 5JSOA 1L0OC
chains in the Genus database with same CATH superfamily
1UMHA 3Q9SA 4YSFA 4NPMA 5AC92 2X05A 1C3HA 1GOHA 4IRIA 3I55I 2OTLI 3DWLE 2F6BA 5FKCA 4JDMA 3TYJA 1K79A 1RUC2 1ZVFA 4KNCA 5L3GA 2Q8EA 2P81A 4XLEA 2OAZA 4NN0A 1OQEA 1BEV1 3NV2A 2PQ8A 4EM0B 5LHGA 4QHOA 3ZN6A 4FPCA 1QJEA 1XSDA 3APBA 3VBUC 1LGNA 1BXHA 4CXYA 5J4YA 1HRI3 3Q9VA 3K4NA 1F2NA 4N53B 1I5PA 5KNLA 2CNAA 3CEWA 1UOBA 5TGTA 1RUE2 3L09A 1HN0A 4JX4A 2O0YA 2VMFA 5F37A 2WNVB 4EZ4A 1TZLA 4PJMA 3L9JT 1QJU3 4QDRA 2FZ2A 5T5JA 2JRTA 5FK7A 1BR1A 3KM5A 2DA5A 1RINA 3MF6A 5I91A 4K6BA 4TSVA 1RNLA 5ICFA 3BKZA 1L7LA 1S0BA 5FLIA 4HSJA 3WR0A 5L73A 4WVZA 1N1TA 5TSWA 4A3LJ 1MDMB 4PJNA 4JQFA 1W6QB 2D5HA 2VJ5A 5KXEA 4MNUA 5H6QA 3J8F3 3M3CA 4C0HA 2W87A 2GXBA 1RUH1 1X1DA 2CUEA 4XF9A 3GCWA 5FWEA 1YEWA 5KHJA 1KFUL 4DNCA 4EQQA 2HQAA 4KITB 1LVKA 4G7HF 4TTGA 4M4RA 2GXGA 2LRPA 3CO6C 1TG7A 5LGNA 4XDOA 2N8GA 2VZUA 4DO0A 3PO2J 4IV3C 1KU3A 5LGTA 1OCTC 5F8PA 3TP3A 3D8CA 1X8EA 4HK8A 3A21A 3ATGA 1EY2A 5L9RA 4ES9A 2STTA 1GWMA 4GB32 4IGQA 1GT0C 4OHZA 1FPN2 1QA6A 2A07F 3IMNA 4BLIA 3GBFA 1OCZH 5BNOA 2V9KA 2X85A 3OY9A 4KIFA 1M1EB 2CV0A 4OOIA 4ZZLA 5SV5A 2VOKA 2XHNA 3DCFA 3EPZA 2K02A 4GO1A 2E7AA 3OGSA 3LSTA 1TW3A 1G9CA 4BY7J 1K6YA 4ZYHA 1S2KA 4FQZA 1W1WE 4ARYA 3MGUA 1OD3A 2LYCA 1BBT1 4RS8A 2VZ1A 1TWHJ 2CTVA 1OT5A 2CQXA 4M9SA 2P7CB 2Y0SN 4U88A 2BBYA 2FD8A 3BYWA 2M9HA 1SZBA 1WCMJ 3RTRA 3W21A 1ZTRA 1OOPC 5CVUA 2VKVA 5FFXA 4GWJA 3ACHA 4XEZA 5D6FA 1IRFA 1JKQC 2JPBA 2DCZA 5BNGA 2R32A 5FGMA 3QCWA 2KD7A 2C9AA 3MHZA 3ZXKA 2CO5A 3KZ4C 3UGHA 4A3MJ 4MTDA 1E5RA 1BHGA 1RYYA 2VBBA 5DYMA 4CP9B 2JA7J 3F9KA 4AHXA 2MD0A 1KU9A 1JXSA 1S0DA 1VQ9I 1ODMA 1TWCJ 2VBXA 5DUWA 4CUAA 3FMGA 4A12A 2IC1A 1R082 2XDVA 3QP6A 4OMDA 4PF5A 4EYUA 2D44A 2JT1A 3KFWX 5DAVA 4R8HA 5A3WA 4LNVA 2EA2A 4UFIA 2CYFA 1RHI1 5FZ7A 2M5WA 3HOWJ 3J7MA 4FOYA 1CX1A 3ABUA 3TEWA 3IH2A 2VLAA 1DLLA 4BDYA 2R49A 1HF0A 2AC1A 2CS3A 2E1OA 4BK5A 3ES4A 2HWE1 1R7JA 3JAMK 3HG9A 2O8QA 3L9FA 1VBC2 1S55A 3M70A 4CVUA 5JXJA 1Q1VA 3POIA 4UY8I 5EEAA 2WZEA 1Y43B 1ZRRA 1JKPC 3USUB 3BU0A 1YO8A 4LE3A 5FYMA 5AC91 1I3AA 3HEFA 1SLIA 1EKEA 4FPYA 1I50J 3M3EA 2W1UA 3ZLIA 3BPXA 5IW0A 4CDXA 2E32A 3RZHA 1X33A 1HC8A 1H9GA 1RUC1 2D3SA 3FXJA 4IOCF 4RR3A 4XNFA 2RVAA 2L4AA 3WDTA 5FY8A 2R7TA 2DCTA 1LOFA 2ZFWA 5FUPA 2Y6GA 5JXHA 3DKYA 4NHKA 1P8JA 3FHIB 1ETXA 1HJFA 1CGPA 2X0LA 5J96B 5AIQA 1X9PA 1D4VB 3AYCA 1GNZA 2JWTA 1RUE1 3D1NI 1TME3 2ADDA 1KU7A 2CU7A 2EAKA 4OUSA 4IZZA 5L3DA 1IN7A 4YFNF 4HA8A 2EQRA 5J36A 1DHKB 5HV0A 2GZWA 1XN7A 3M8FA 1DGRM 2G4IA 1B1BA 2RDPA 1R58A 1D8KA 3I53A 4PDWA 5CAZA 3GBWA 3R4DB 1HRI2 2B9VA 4F92B 2MW8A 3K1MA 2GNDA 1IXSB 2QTWB 4CDQC 1YTYA 4IE5A 3M2MA 2C6SA 3F23A 4MADA 4A6DA 1KYZA 4EJUA 5EJCA 5IP6A 1G86A 1QJU2 3H0GJ 3JRCA 5T5LA 2JQ7A 3HC7A 3M7GA 2ZEYA 3SXYA 1GHCA 3M3OA 2DMQA 2MYSA 2D98A 2BEOA 3SJMA 1V6OA 1F8VA 4UFKA 4XUTA 4HK9A 5E1WA 2RC4A 1FJLA 3WU1B 4HV6A 3T8RA 3K70D 3R0JA 3PVNA 5ANQA 3HN1A 4GB31 3J8F2 2WDBA 3HNMA 1FPN1 3EXUA 4IPAA 3BPZA 2D6MA 2ME6A 1RUOA 3AFHA 4EATA 3K10A 3I97A 2JXAA 2P37A 1PYVA 3VDDA 1U5YA 2IXJA 5JXGA 2A5ZA 3CNAA 3BTYA 2EFPA 3O1VA 4XOPA 4G8XA 3LSRA 1F5JA 3E97A 3IL2A 2EV6A 3KD4A 4XM3A 1W03A 3KPHA 2UYBA 2PLYA 2BNOA 1ENQA 4ZYAA 1SBDA 4N8MA 4AE2A 3LE0A 5CIRA 2AEZA 4BXFA 1LJ7A 4X8PA 2PHXA 1DFQA 4B09A 2ET7A 3BOPA 2VMCA 1BN5A 4XJUA 3RSJA 5HS9A 2FHRA 5FP7A 4M3FA 2VG9A 1WZXA 3NV3A 4XRSA 2CU5A 3F8CA 4MXWA 3THPA 2VBWA 2J1UA 1XNKA 3GBGA 1FY7A 5B1AH 4HKWA 3OGGA 4NAMA 1RR7A 4OAZA 4WXCA 3TEDA 4RGRA 3OOXA 4ENMA 1AWCA 2XMLA 4NOTA 2CGPA 4Y1VA 4K20A 3ZGKA 1ZRCA 3M8LA 5HCHA 2EA4A 2M4KA 5I8YA 2C24A 3SKVA 2EICA 3I3BA 4AEDB 2FJ1A 1QNWA 2LALA 2MFZA 4AGVA 4HDUA 1US2A 5CA6A 3SFIA 4P9WA 3H5NA 4LR4A 4MO7A 1R081 1GVDA 1MMGA 2FE3A 4OI2A 4B1MA 1T38A 3F72A 4EQVA 3AZVA 4HX7A 1XX5A 4NC6A 1HB4A 3NAPC 1V5GA 4NPRA 1IN4A 3AP5A 4E7HA 5J1RA 2Z99A 2BFUS 1POGA 3KWVA 1NLQA 5FBZA 1Z7LA 2K46A 3HM5A 1ORKA 1I9RA 5CU1A 3HBKA 4C2UA 1GR3A 4P9UA 1JYTA 1YFHA 1UMIA 4I09A 4AZZA 1IDZA 2RGVA 3OPTA 2NPIA 1ALYA 4D6QA 1UG2A 1HQLA 1VBC1 3K4JA 1MZFA 1ULCA 4ORFA 3ZSJA 4P55A 1WW5A 2DA3A 1DYPA 3GTOJ 5LZ6A 2PN6A 3U1KA 4CU7A 3PHMA 2BQPA 4G3YC 2JDUA 3J26N 2DDUA 3ZCOA 4GALA 2FA5A 2Y69H 4Z82A 4KIGA 3OSGA 1WSUA 4L18B 4YVWA 5DDJ3 4FP2A 3CJIA 2WTEA 4DZPA 2O9LA 2BZTA 3SDBA 1H9WA 2P3KA 2G7UA 1DQ0A 1NA1C 5BPXA 2DFFA 3VKFC 2IS2A 4ISRA 4QM9A 4KMFA 5DZEA 4CCJA 3ILRA 1ZELA 2E34A 2E2JJ 3S5AA 1QY4A 3ME2A 2XC7A 4BQQA 3FMRA 2EIJH 1Q5OA 3NQHA 1MS3A 1XTAA 1FOWA 3FKJA 2OZJA 3ABZA 1OVPA 2DUPA 4CEYA 2Z2SB 1ETWA 1BCXA 1HQNA 3MW3A 5JFRA 1YIJI 3F8MA 4GULA 4UW3A 5IFPA 2DMNA 1R5HA 2XGEA 3LOBA 3BJ6A 5BNNA 3L2UA 3AL0B 4ZU7A 5TJJA 2Y9ZA 4D69A 1IPSA 3OWTA 5EZGA 2MLKA 2V4AA 5F39A 2A70A 5JVVA 1RXGA 4OMYA 1HRI1 4FPLA 2FQ4A 4M9ZA 5E16A 5LD2C 2YPDA 4IEJA 4I3PA 2J1EA 1JZ7A 3POFA 4PGHA 3JXSA 4MG2A 1DU3D 1UFMA 1TME2 2B0LA 5L36A 2R7VA 4UUVA 4QX3A 2QFEA 3POWA 2MABA 1QJU1 2VPRA 1UWWA 1OPMA 1M4WA 3AZZA 5F0CA 1B72B 4GKYA 5LA2A 3OV8A 4XUPA 3VZLA 5C3PA 1GZCA 4OIOF 3J8F1 2A7AA 3PJYA 1M06G 4M3GA 1RUI2 3O2PE 3L2HA 3HPNA 2W47A 4D0QA 2IA2A 3D3AA 3THCA 4Z2YA 3TN93 1STZA 2Z16A 1UN1A 2K9ZA 1XGSA 4LBQA 4HLTA 2YB7A 2WNUA 3ZXFA 1XC6A 5LBBA 2HOTA 2QVOA 4YM0A 1S29A 4OUEA 3KYLA 2R5ZA 3AFGA 3AXDA 3F6VA 2VMHA 1EPZA 4MFEA 4AI1A 1G9AA 4LA2A 2K2SA 5FZFA 3GZUC 4A44A 3BU7A 1MW7A 4GA9A 2OS2A 1QHHD 3PNAA 1XDUA 2EVXA 5CQGA 2GNMA 2QSGX 3JQWA 3U4SA 3HBZA 3P9KA 2PMZA 2GC2A 2EALA 1WUVA 3ZQ7A 2XRLA 1DQ5A 2GC0A 2ZPXA 3QPHA 5A6YA 3F3XA 2Y2ZA 5DG2A 4DGWB 2WO7A 2CV1A 1VQNI 1U5IA 2I10A 3B3QE 2JDPA 2ZMLA 1JZ6A 1ZR2A 2ZZQA 2HNHA 3H7JA 4XONA 1UOFA 4M0NA 2MPFA 3CQZJ 4E70A 5FMCA 1ZRFA 1HW1A 3T0DA 4O3MA 1NCRC 3O1PA 4HX4A 2DBIA 3BCBA 3WZ1A 4QWQA 1QH6A 5DUUA 4E7LA 3U75A 5CJ9A 3DBHB 4RB0A 2KJCA 2WYSA 3FBMA 2QSFX 1QXJA 5FPZA 5A2QK 4AFAA 4L8QA 1TEIA 2W24A 1YHQI 2HDDA 5J1YA 1AHSA 4UF0A 1D5VA 4CXXA 5F2WA 3JBG3 2Q2EB 4FPEA 2PG4A 1OA2A 4N4OB 1S8NA 1XG1A 1AKHA 1VRBA 1QWRA 1XSRA 1YQ5A 1K45A 2ACJA 3LIHA 5IAVA 3ACFA 2HYKA 3TW7A 4X8NA 1OCCH 2HBUA 4YFKF 1ENSA 2KKOA 4PFOA 1HN1A 4BQ4A 3U0ZA 2PXJA 3DPUA 1UHMA 2V4JC 4BHPA 3KCYA 1Z6TA 5BQTA 4E8DA 1JI8A 2ZMNA 4XFGA 4KU8A 1W4MA 3UGGA 1G8WA 3LPFA 2FUG2 4ZH4F 4AVVA 3MFCA 4PIYA 2ZGPA 1GUIA 2EAAA 4HT1T 1G9DA 1W8OA 5D8KB 3HN3A 3IV5A 1BVP1 1S0GA 3P1IA 4ZDLA 2CRGA 4RA2A 1KS4A 2A05A 1OF4A 1FTZA 1EAH3 3AMNA 5ABJC 3HXLA 1K78B 1YI7A 3K7AJ 3VD7A 5KHDA 5FLXZ 3FFZA 2NLRA 4ISQA 1ETKA 4KNYA 3VYSB 4U2AA 2HPIA 1QNTA 3BG5A 2XIGA 5FMDA 2VJIA 1USTA 3KT1A 1RPWA 3OYKA 1RI7A 1ZM1A 2YY1A 5EZWA 3HRSA 3IDBB 2YBSA 5DDJ2 4BQ5A 4P9GA 4YG0A 3UKGA 1Y1VJ 2H8RA 1LGBA 4NQWB 4HV5A 1CAWB 4DUXA 3KV9A 5IT9Z 3WG1A 3KMHA 3PMSA 3TO6A 2VR4A 5D8AC 2OUJA 4CDGA 2R073 5DCFA 4A3CJ 4R9AA 4LT5A 4CDQB 2H94A 3IWZA 3VKLA 3LSGA 5DMYA 4JV4A 4CCMA 3DN7A 4N43A 1TWGJ 1V55H 5KXCA 4MGZE 4NIGA 2BW8A 4BHCA 1UJ8A 3GWZA 4IHWA 2QF7A 1TME1 1ND3A 5GPAA 3GF6A 4QQHA 2ZGQA 4P96A 4UB6C 4AYBA 2P17A 3IAPA 3PO3J 1P4WA 4KQ7A 1ZGJA 2E7TA 2W5FA 1US3A 1H8AC 3JUUA 1FBUA 3ZFEA 1H89C 2P1BA 5GLWA 4M3CF 2RS33 2BOLA 4Q1RA 2DQRA 1RUI1 3M1CA 4CDUB 2BY0A 4XACA 5JSRA 4IDZA 3FBIB 3KLNA 3MEPA 2WA3A 3HUGB 1RXFA 3WE3A 4HNTA 2VKEA 1QH7A 5FZAA 1YS7A 1EH8A 3UT0A 3U2RA 3RQIA 3CF2A 1FOD3 3DU6A 2YGLA 4IEXA 4CYDA 3PIGA 3D0JA 4R4ZA 5FZHA 3G1MA 4AI8A 3I58A 4HQMA 1LHNA 3I2JA 1IUFA 4NIIA 1GFF2 1VQOI 4MGSA 3OYEA 2KPMA 3ZMSA 4CP0A 1PX4A 1JH5A 3ZN4A 3P3NA 2LTNA 1QDCA 2VNGA 1AL23 3TN92 2LR8A 4ZYGA 5FJ8J 5K5OA 1YLLA 4C2TA 3PNVA 1OKRA 4BL0B 2FX0A 1QDOA 2R93J 1NYWA 3BR6A 2AGSA 5HLTA 2QUOA 2EZKA 5A32B 4LLLA 1W28A 4RSUA 1HXDA 4C30A 4MUVA 1VIWB 3LPGA 3LSEA 1W3VA 2WRAA 2UWAA 4NUBA 4XXPA 2CDOA 4YELA 3ZQLA 2JA6J 1JUHA 1G2HA 4JZRA 3KYCB 4C1WA 3I2OA 1KQ0A 1Z7S3 3WUCA 1A6CA 1B4AA 2A71A 3MPBA 4QKFA 1WPKA 4Q5OA 5CFCC 2X09A 5BYNA 4QTRA 2A6HF 1ZARA 2HTJA 2JG9A 3OBRA 1BJAA 2H0BA 2HDCA 2VPVA 2EV5A 2DU9A 5EJZB 5A33A 4CEWC 4YIIA 3Q8AA 3ZQQA 4UV9A 2RR13 4IE4A 5E1RA 4FISA 3VUOA 2ZC2A 4XYXA 1EJ9A 1CF7A 4LOTA 2ZABA 3WW4A 2Y31A 1RITA 5H2FC 3H8RA 1XYPA 2WR9A 5BNPB 4YG6A 3JBG2 2YC2A 3GCXA 1T33A 3ZX7A 1J0RA 1REPC 1GLHA 3MEXA 1QOSA 3J4UH 4F3JA 4RAFA 2PAKA 4BMBA 2E9QA 4L0YB 3QOPA 5B66C 4CCEA 3DXTA 3TEXA 3WTXC 2WWYA 4EGZA 1SAXA 1RKWA 4U7BA 4CGZA 1Y9QA 2CUJA 4RFRB 2P4WA 4QHBA 3KCXA 2W7NA 4RM3A 1BK1A 5LA9A 1AXKA 1W6NB 3JRBA 3ML6A 2JB8A 2BUKA 3IH3A 3SHRA 2PX9A 4R9DA 3V0BB 1UXZA 5FV3A 3IKWA 2X6XA 1XE0A 2QBYB 3RZZA 2BYVE 5DDJ1 1PIV3 2L7ZA 2NS7A 3BQZA 4KBZA 1DPRA 1ETOA 1SFOJ 3G4SI 3ZPYA 1EAH2 3OS1A 3CCVI 2AREA 3VBOB 1A35A 4HETA 1OLQA 3TBIA 1G9BA 1TZOA 3C3WA 4Y52J 4OQ9A 3VBFA 3DBRB 2JSCA 1OQYA 2GMMA 4LO7A 1DU6A 4RR3C 1K5MA 2YFUA 3L2RA 2P6SA 2OTJI 5C4WC 2DT5A 4M3DA 2RM23 4MYEA 1VLNA 3R4KA 4XF1A 2E36A 1OJLA 2HBTA 3W20A 3IKVA 4BXXJ 3VD9A 2RS53 1QRYA 1ZHFA 3DF0A 2R072 5CFDC 4B3NA 4G12A 3VBHB 3B01A 5J3UA 3IDAA 4D94A 3DPLC 3AKZA 4B1RA 2WNVA 3USSA 4AIJA 3BTXA 5JI6A 3CC7I 2QKDA 4UW5A 4J01A 2KIUA 1XDSA 4MGTA 5GADJ 2YU2A 3J9SA 5F6LB 2BBAA 4GMP3 1I1GA 1TTYA 5F1RA 3LQCA 4I76A 5ILUA 3BJOA 4YG2F 5EYXA 2BXYA 3LA7A 1HW5A 4QU1A 4P9YA 4JKKA 3CDIA 4OHYA 2ZMEA 2IWGB 4IEUA 1NUKA 4I01A 3AG2H 2RS32 2E1NA 2KQRA 4GGGA 4R79A 1ETYA 5K0UB 3E7LA 3W6JB 1U2WA 3TN91 4NRMA 1JU4A 1UCRA 2MGQA 2W1OA 2PI0A 1IPKA 2HR3A 4QPOA 2BU9A 4ZDOA 3CLQA 5AIPA 2W9XA 4L5IA 1GU3A 2WQ4A 4ES8A 2R7SA 1FOD2 3MO4A 4CDWB 4DMIA 3VKMA 2VJXA 5I93A 2DFCA 2RQQA 3C2GA 5DM6F 1FYUA 2VXRA 1F5FA 3LKJA 1VBB3 4XCBA 3SC7X 4BIOA 5HCFA 3LSDA 3S2DJ 3SCHA 3L2QA 1NLRA 1L7RA 4YWAA 1AL22 3HOBA 3CBNA 5ERLA 3CCSI 2LROA 3BR5A 2E51A 4LUKA 4Y3OA 1WCUA 3HPHA 3TNPB 5K7PA 3WW2A 2D3PA 5DD8A 3F95A 4CCOA 2PHFA 4CZZA 3K2OA 5F5CA 1Y6IA 3VBSB 1IUYA 3MZYA 3T1MA 3ZMVA 4JC1A 1C4RA 3MIFA 3V8KA 5ISLA 1X19A 4W4ZA 3DTEA 1V6JA 2XB6C 2YHJA 3LSMA 3K3OA 5F6FA 4G7ZF 2ID4A 4HMZA 4QX0A 3IB3A 3HB9A 4Z1VA 2VXZA 1N78A 2JDNA 1IV8A 4PHZA 1TNRA 1ULDA 2OBPA 1MQTC 3DFGA 2X29A 1Z7S2 3OD4A 1FSHA 1WD3A 3BOQA 2ZXWH 3VDBA 2Y60A 2L9LA 2VULA 5FZ4A 1W8ZA 3BR2A 3G6EI 3JBG1 2HU9A 5JLWA 4GQ7A 3OPZA 3AYEA 3CP2A 1WMDA 1XGNA 4B4PA 3T2OA 1GUUA 4V2WA 3FBNB 1UZCA 5IYBJ 2CFOA 3A4UA 3WQ7A 3REOA 5FK8A 2M87A 2RR12 4RDUA 1U5TA 4BJTA 1ULYA 2NYYA 1A6QA 1CJDA 1NOVA 2HQ5A 2EXIA 3SITA 4NB5A 5FD5A 3NV1A 2WBMA 4PUSA 4BY1J 3X2QH 3DECA 5LA1A 1R093 5T5OA 3MLKA 2DK5A 3TWIA 1A8MA 2WA4A 1DUXC 1ACIA 3RIRA 2E2IJ 1Y3TA 3NW4A 3Q8FA 4YGCA 4IHTA 2E6VA 4RL7A 2VQAA 2VCCA 3QPTA 2OIIA 2FXAA 2IVJA 1HRV3 1ODDA 1EAH1 1UCXA 1ULFA 2E5ZA 1YFYA 4MGYE 2ZXIA 1Y8RB 2H6CA 4PJYA 4PCRA 4YVWC 4COZA 4XLNF 4XTPA 1OH3A 4MEXF 4RYDA 1V3FA 4LB6B 5EF6A 2EXJA 4QGMA 1G3TA 5FPXA 3HMYA 1UZ0A 4ARXA 2IXKA 1I1SA 1NZIA 1PIV2 5H9SA 4CSWA 3ACGA 4BXUA 5IK5A 4LKFA 4JRAA 4II2A 3S2WA 2XSDC 3M1HA 2P8TA 4AVSA 3KLOA 1R9TJ 2F5CA 5FZDA 2CV2A 4CU8A 2R071 1OR7C 4B43A 1F4AA 4FXKB 1DP7P 1A78A 1H8TC 5T3NA 1K7AA 3NJXA 4MHRA 4CEYC 3FF5A 2QDRA 3OPWA 4LG0A 3TMOA 2ZMKA 4RAZA 5C33A 2NVYJ 3DPRB 1UO9A 4UFHA 5KAIC 3R05A 4DQAA 2XGDA 2CG4A 1AYN3 4DW6A 1XU2A 1AVBA 2CSGA 2RM22 5JI9A 1IO2A 1B8IA 1ZX5A 1MS1A 3H8OA 3AL6A 2RS52 1E17A 4D1QA 2ORXA 2F5VA 2Y48A 1FI2A 2XJQA 4GH4C 4LBLA 4DYRA 1OXCA 2RS31 3ZFGA 3CCLI 3GGLA 1BYHA 4LOSA 2BGCA 4D0PA 3PJQA 2WT1A 1O3SA 3P5BA 3R0RA 5JSOA 5J47A 3BR1A 4AEJA 2CGNA 1FOD1 3VYUB 3G6JB 4NNJA 4QIWN 4KWLA 2LUWA 5C5TA 4E4SA 3D82A 3BIWE 2VVDA 4IXAA 3O6BB 2QQBA 3UKNA 3URFA 3MAJA 2X5IC 1BIAA 4RGXA 4AM3A 4QQ2A 5LW9A 4QPIA 4K3UA 1PGSA 1W04A 5E18F 2F4OB 2KRFA 2IRFG 3NNJA 2ZZJA 1KA8A 2GWRA 1LOGA 1AL21 1HJGA 3ZYBA 3LAGA 1PGL2 1ZG5A 1XYOA 1UPIA 3M1EA 3VBRA 3CMMA 4FO9A 2KZVA 4BM8A 4DRVA 4MV2A 5F0HA 3CQOA 1NG0A 2KP6A 2JEMA 4NWVA 4K2EA 2ISYA 3T8TA 3AMHA 3K1PA 1W0OA 1VBB2 2VMGA 3DEWA 1TLHB 3K4DA 1WI9A 3COAC 1LUJB 3QH6A 1BJZA 5FMOL 2R7XA 2PHWA 3U1DA 4V1PA 2VTXA 3ZVXA 2L7FP 1LEBA 4N9HA 3T0YA 2QDNA 1Z7S1 4U0VA 3GZ6A 2P7VB 5FKMA 1PUFB 3M4OJ 4Y4YA 4JGZC 2AEYA 3ZFFA 4YEJA 3NVCA 4JVAA 5CZKA 3WNPA 3V0AA 1GXPA 4AEDA 5F5IA 3CL1A 2YC0A 2YV8A 2BXZA 4AQSA 4HN1A 2QCSB 4DJAA 2P5VA 3A0BC 4AHWA 3A1YA 5LHHA 1MSEC 4LK6A 2KT0A 1WLTA 3KGZA 4HLXA 1OH4A 1UOJA 5A7SA 2RR11 3H1MA 5A6QA 1G7YA 4NIDA 4Z07A 5I8SA 3H3VK 2ZTNA 2CWMA 1POV3 2ZX3A 4W1UA 5BUVA 1YOVB 4LMYA 1CAUA 3CF5F 5HDGA 3UJQA 3ZKUA 3WY6A 3BC8A 2B4KA 4RAGA 1YXWA 3KT4A 4RS5C 4DIQA 4DFSA 2R0QC 3AJZA 3UJOA 1HV0A 1AR93 1BW6A 2ZS6B 3TO9A 4TN7A 4IHVA 3L2YA 1IN8A 3I56I 4FE7A 4F93B 1XGMA 3HGGA 1Z7UA 2A73B 4AVBA 4PZJA 4CU9A 2ARXA 2ETHA 4C3JJ 1S9HA 1T08B 3PU8A 2AS5F 1R092 2B45X 2CSOA 2GH8A 4JRLA 1W6OA 1WQ2A 2IXCA 2ZSIB 5DQ0A 4BISA 5TISC 3LOIA 5KHHA 1VQ5I 1PIV1 5CG8A 4D5CA 2ZA9A 5A3OA 3V7RA 1IS5A 1IPJA 1UW8A 3F22A 1K61A 1LEDA 3DYMA 1XPWA 4FFFA 1FBQA 2ZGLA 2GQQA 2Y6LA 1HRV2 4IW3A 2FMYA 5JR3A 1UAAA 5F9TA 5CVJA 1JZ3A 2OW4A 1DLCA 5FR3A 3UKTA 1WW6A 2WB1A 1J9IA 2LVSA 3ZR8X 4E4HA 2UU8A 1AJOA 3C7EA 2WSUA 4FPGA 1RTVA 2PLV3 3FXOA 2HFHA 4F91B 5C3EJ 3IAS2 4DPNA 4XMAA 1RIOH 3IRRA 3P9CA 1I27A 3PSIA 5DAXA 2RM21 1HX6A 3LEIA 1IN6A 3CDLA 2OD5A 1PZ7A 2RS51 4N43C 3WDUA 5HXMA 1K83J 2D3RA 1UU4A 2D2WA 4DY3A 4U36A 1IKQA 5DG1A 3ACLA 2HPMA 2F4IA 4K1ZA 4F7ZA 3EQEA 4IV3A 4Q4W3 4V2FA 4KGQA 3PURA 2QQ9A 1YJ9I 4QPGB 5AONA 1GV5A 3I7DA 1RMU3 1AYN2 1AF9A 2SLIA 1SPPA 4GMP1 4ZS2A 4H7LA 2XXZA 3ZO0B 4ZTFA 1PNFA 4LO4B 1PVEA 3S0MA 5LBCA 5KVRA 4CH7A 2JIGA 4HG6B 3KF3A 4Z6YA 2P3IA 2A6XA 1CONA 3ZKYA 3K4LA 3IAM2 4P5OA 2EXKA 1XNCA 4WM8C 2OQRA 2MNGA 4MQVA 4ZONA 5F3CA 2G9GA 5CVRA 2W52A 4OIRF 3QP5A 5JR2A 4QX5A 3HVDA 2X48A 3VOEA 4C1XA 4DYCA 1OLMA 1PGL1 4RFT0 1FV2A 1JZ8A 4DOZA 2Y6KA 5IK8A 5FKBA 4ZYEA 1I5ZA 3S93A 5M5YJ 3O1OA 4CUCA 2ADEA 4WM7C 1NX9A 1UG0A 4GWMA 1OOPA 2DA6A 1ON2A 1VBB1 2H8WA 2DODA 2HVRA 2JMWA 2NZ9A 2VJ4A 5E8AA 1N47A 1XSVA 3S17J 2WLPA 4GMP0 3UNPA 2LD5A 4UNOA 3LCPA 3ERMA 1NE6A 1YITI 1F1ZA 4ASMB 4B4RA 1YLFA 5IPAA 1YHFA 5HCAA 3MUZ1 5A7OA 5KK1A 5JWPA 2ZB9A 2JDYA 1KXGA 1MH4A 2A3XA 3KYDB 5GM0A 1W6PB 2VVEA 2G0EA 1TT0A 3S7EA 4AAPA 2R5YB 4QX7A 2YX4A 4A45A 2A3SA 3CCQI 3Q8EA 5FFOC 1LJ9A 2PHDA 5GLUA 5ACA3 3GEZA 4JX0A 3LQQA 5FYZA 1H9TA 1V5FA 3WTWC 3QPSA 4KISA 2O8OA 3K4ZA 3IPVB 5EV7A 3JD73 2BNMA 3DV8A 4BQ1A 5CEHA 1ZA4A 3KIOA 5DXDA 4ZZDA 2HJIA 4L11A 3ITQA 1JOJA 1UNBA 1WW7A 3C7FA 3F8FA 5C71A 5DCMA 3NARA 1MJAA 5HNHA 4TV7A 1BKZA 4COWA 4Z2AA 2RS13 5J1XA 3ZYJB 2ZJQF 2NNYA 1YCIA 3MF9A 1YRZA 4II3A 1H6XA 1LE8B 1IZ3A 3CUOA 3UGFA 3ZYRA 3VV1A 2CQKA 4JGYC 1WJCA 4A7ZA 3LL7A 2AO9A 4AVZA 2VIXA 1G3YA 2H6BA 2BP6A 4IETA 4A6EA 2HYXA 1UHWA 2BE5F 4PJLA 4KU7A 3Q8BA 1AL0G 1D0GA 1K3IA 1R091 2WL1A 3O0XA 1YO5C 2DCYA 2WLQA 4BEHB 4DNYA 3OYAA 4OWRB 1IRZA 3KLSA 3DKXA 3OYWA 3KV6A 1YJNI 1XNTA 1PK6B 1BI0A 2TUNA 2BY2A 2FD5A 1FMD3 5HS7A 3K9TA 2PAEA 2IXIA 4N90A 5D5XB 4RB2C 3O5SA 3DTKA 1AR92 2ELHA 5DAPA 3BLYA 4EN0A 5HVQC 1HRV1 4M6YA 1T95A 2R3SA 4ZKTB 3H0OA 4YRDA 3E1F1 5AFEA 3WDVA 4QM8A 3HPGA 5DZFA 3PU3A 1A6IA 3HR9A 4A0ZA 4I6ZA 1GP6A 2IFRA 4LBJA 3CTAA 2K9QA 3A03A 4YRVA 1Q43A 4MHGA 2DOAA 2RQPA 2WKKA 3GLLA 2OPKA 4I99C 4CDQA 5FRAA 5CKQA 3FE5A 1X1PA 3AXEA 4YZ3A 3PUBA 1LAJA 3KP3A 1PX3A 3SNMA 4DXTA 2K9SA 1ZRDA 2BVMA 2HKXA 2BERA 2K5CA 2WIIB 5IVEA 3WG3A 4R4XA 5B3SH 2PLV2 4UFLA 4QLCU 1JOPA 4LIUA 2BTVC 5F04A 2DFEA 4FE4A 5FZ3A 5LASA 1W2UA 2JE9A 3ABTA 2NMOA 4XCAA 1EPWA 5T54A 1X9TA 3SYTA 1AYN1 4HYEA 3N7LA 4L2NA 5DV5A 4N53C 1T56A 2YG0A 5FY7A 5EHDA 4JTNA 4J1WA 2ELJA 5D5UB 4H3WA 1SDDB 3PLQA 3H9AA 3L2WA 2L9NA 2WNVC 5ICGA 1J1TA 3ILFA 2G1MA 1GZWA 5F0FA 2FU4A 2CHHA 2ZGMA 1W5SA 3O1TA 1XD7A 1LPQA 4FFGA 4Q4W2 4O5VA 1RGSA 1CWPA 2DT7B 3DL3A 4Q5SF 1JHNA 3F6OA 1RMU2 2VKDA 3WLUA 5E20A 4LBMA 3B6CA 4A5NA 3BPVA 2OUHA 4HEA2 5FB2A 2V09A 3LD8A 2Z42A 4O9GA 3JTGA 1CN1A 3WHBA 5FWJA 3MKZA 4EN7B 1AX0A 4Y5SA 3IAQA 4DY5A 5JSPA 4BYYA 2LC2A 4LLGF 4HSRA 4WBBA 2V73A 4OMZA 4M9XA 5FTTC 5F27A 3CLOA 5L7OC 1IDYA 4XQFA 4COVA 1KITA 2GALA 2A3YA 4META 3FXQA 1E3HA 4IEQA 5FMOS 2YDEA 2Z1DA 4AL9A 5FMBA 4ESFA 3L00A 2ARBA 5LLQA 3J80K 1IG7A 1YW7A 2KIMA 4CCLA 3RZJA 3CUQB 1ZGWA 4YPJA 4MGRA 2Y0MA 1EUTA 3TNQA 1W2AX 3I4IA 3QD6A 3KT7A 4BLJA 2PFBA 1R1UA 3ZP5A 3NAPA 1TWAJ 3V7CA 4A41A 2VZVA 3LIGA 1GP4A 4HOOA 4MLOA 4UUSA 3VL8A 4P9LA 4QT6A 4PGGA 4OI1A 4A69C 5EGOA 3T1LA 5FDBA 5K5RA 4XXAA 2VODA 3I59B 3AVSA 1TBXA 4P00B 1KZHA 1G9FA 3T5XA 2G9WA 4ZDPA 2B7EA 4IKFA 3OIOA 3HRUA 4BQYA 1MS0A 2XONA 2P5LC 2A6YA 1FTTA 1SD5A 1GOGA 3HQRA 1EP0A 5ACA2 3I54A 3S30A 2O8KA 4NPLA 3O14A 2G9FA 3ZYIB 3OBZA 4FPJA 4CUBA 3JD72 2Z9OA 5EYRA 1DZQA 1MJBA 2CWSA 2VD7A 3LFIA 2VUMJ 2EF6A 1S5LC 1POV1 2GMEA 4YZ4A 2RS12 2FNAA 2IGNA 1NA1A 2KLOA 1LDDA 4ZXKA 3WP6A 2VCMA 3WNKA 4XJWA 5C3SA 1YI9A 2WNEA 5D5WB 1J84A 3V56A 1W90A 3WCRA 1WRJA 3D5LA 1AU7A 3K4MA 1SVMA 1LB2A 1AR91 1EA3A 4P5YA 2XLAA 1U12A 3T2TA 1VJ2A 1LU1A 2PJRA 1W6NA 2E53A 1YW8A 2K9MA 1RETA 2GLOA 3V0BA 3V8LA 2DI3A 4EJOA 4AIDA 3VWBA 2LFBA 5CYYA 5C5UA 5B5EC 4I3GA 4HF1A 1YRNA 3I0TA 1HLCA 2V26A 2VO5A 1IZ1A 3ON7A 4NIAA 3LSJA 4BU2A 3N9MA 4HNUA 5LHIA 3CMGA 4XDPA 3GJBA 1K4SA 4QKNA 3M3YJ 1FMD2 2W0XA 5JOWA 5M0TA 4RHV3 3GTLJ 1MBFA 4C3IJ 2RREA 5FYSA 4L5EA 2EZIA 4YZ1A 4JTOA 4KIBA 1UYZA 5FJHA 2PN5A 3NKGA 2DJIA 4HKLA 1W8UA 5JZGB 3SEPA 4CU6A 2ZX4A 1RUG2 2F48A 4IE7A 1J59A 2ZBKA 5FYVA 2AXLA 2KL4A 2NVQJ 4MTEA 4LMFA 4P14A 2PLV1 1C57A 1T6BX 2DCKA 1DQUA 3W2WA 2BBVA 2XOMA 1H9PA 1QU3A 5LFAA 1QZYA 1SFXA 2GN7A 3GXOA 2JECA 3O1RA 2O6GE 3ZR6A 5J3LA 2RG4A 3WTYC 1ZLKA 1D8JA 1O3RA 5FROA 3RPQA 1SDWA 2RDQA 5EG0A 1MZ5A 2HWD3 4X0GA 1VMFA 2DUOA 5HBAA 3N9QA 4FETA 1PVXA 1IS6A 3A0KA 4CPBD 4AEMA 3GUDA 3K4AA 4ET7A 1XSQA 3CU7A 5C3OA 4YVSB 1IGOA 2QQNA 1K4TA 3GLXA 4XW3A 4RMNA 1NQJA 4JQRA 4JBAA 4NC7A 3KEQA 1QHDA 3H36A 3RZMA 2EFQA 4Q4W1 5FP4A 3PUIA 1KYWA 5A80A 1RMU1 1XGOA 3OEAA 5C9AB 1DGRN 2YGMA 1JTZX 1K6OA 2ZGUA 4JOMA 4N7IA 4YZ5A 2GBYA 4UVCA 2QEXI 3IKTA 2V72A 5GJ6A 5FQ0B 4QD2A 4M3CB 1BC7C 4A93J 5KXBA 5DS9A 1F9KA 2Y6FA 3LB9A 4Q2FA 1XXNA 5CKNA 2HH9A 3ESWB 4PFPA 3U07A 1NCRA 3F21A 4HVQA 2H27A 3VLBB 2XPVA 2JRMA 4OIQF 4ONUA 1W36C 2W1QA 4MIMA 4A3DJ 2WAFA 2WAQA 1XYNA 1SQ4A 3GTGJ 2FBIA 1ZG1A 2O8XA 5BPDA 1YJLA 2UV1A 3EUAA 2VQLA 4XUQA 1HIXA 3ZN5A 2PEXA 5GPCA 3RZOJ 4AD9A 4BGDA 4Y1YA 5A3LA 1MS9A 3BR0A 5EJ1B 3N9NA 2HYGD 3BPSA 4Y15A 2VTFA 5FZOA 1G3SA 1W8FA 3VBSA 2VOOA 1X50A 3ZDSA 5DUIA 2DN0A 2DOFA 2FDKA 1A36A 1FYLA 1YC61 2GIZA 1UZZA 5ACA1 2HVQA 1X82A 1OA4A 2W92A 2VBZA 1JXNA 4Q48A 3A23A 3ZXDA 1LKXA 2BV4A 1QGLA 4OHVA 3H3LA 2X10A 2EV0A 1UKRA 5GTIC 3JD71 5F5QA 4COYA 2EB7A 2GAUA 4A6OA 5K5QA 4FX4A 5CPRB 4AEDC 1BI1A 5K4LA 2TBVA 2VKHA 4BQXA 2RS11 1ZA7A 5JVGF 5FY5A 3HKZN 1WVRA 4Q26A 3FHZA 5ABJA 2VY0A 3NNLA 3T0AA 4I02A 3NJZA 2DU1A 2QSHX 1SLBA 3GZAA 2I2SA 4QGLA 4QWNA 2X6YA 4BDZA 3VHPA 5D2AA 3MUY1 1SLLA 4R9BA 2C1FA 1BJQA 2QQAA 3WP3A 4TXWA 3SDGA 5HLIA 1FX7A 3RJPA 1LCLA 3H3UA 5BNOB 1XS9A 5HV4A 1HDKA 3PQJA 2D5FA 4MOAA 1WLWA 5GZEA 5D8AA 3DLAA 1Y0NA 4XK4A 5H20A 4A0YA 3Q3SA 1FMD1 2GP5A 2KHMA 1NG7A 2GMPA 1DGWX 2N7GA 1DZRA 2ID6A 1SG3A 2W3JA 2DMUA 4E6KG 2E31A 4C3HJ 5IT3A 1RUG1 2DVGA 1J3QA 3HQUA 1NXD1 1PZ9A 4EWDA 2DFBA 3B5LB 2DA4A 4P1WA 5H9PA 1O7FA 3CZUA 2XF5A 2E33A 5CYVA 2D6PA 4H55A 5BS6A 5LWBA 3OG2A 2W94A 2R7QA 4Q0SA 2OZUA 3T4HB 3ZMNA 1W2OA 4YIRX 3KE2A 4RHV2 1JZ5A 3BI3A 3M4FA 4HOBA 4ZS3A 3QYFA 2E71A 2B8MA 3B9CA 3A0HC 3NWKA 4JP0A 4XFCA 1OLRA 3H5AA 3NRUA 4XBLA 2K4JA 3H9GA 4W50A 3BTZA 3DPRA 4I30A 3AL0C 2YROA 2VUCA 1TQPA 1B59A 1JYCA 4FAGA 3CF6E 4NR1A 3R4UA 1NKGA 1LEAA 2JDHA 2E1MB 2OQGA 1RUJ3 2AUYA 2PHTA 2H0VA 4Y33A 2L7KA 3ASIA 1YFXA 4Z92B 5A6ZA 5HCBA 3KV4A 3MIBA 3LAPA 1LEMA 3NAUA 2HWD2 2QBXA 3EMRA 1CAXB 3M3QA 3WNXA 1H1IA 5CADA 2ZO4A 4EWEA 4UFJA 2RMU3 1CIYA 4CRQA 5BPIA 1G4DA 4L92A 3HL2A 2JZYA 3WGIA 5L7OB 5FP8A 5FKLA 4M3EA 2HWF3 1WFXA 1OMIA 1ZYBA 4IX7A 1GKBA 2YFZA 3LDRA 1AOYA 4PLOA 1Y9MA 3VGIA 5I8TA 1ZLJA 1IRGA 3G73A 3FHAA 2UXNA 2WNOA 4AVCA 3KGLA 1JW6A 2FCTA 4CA9A 3CJXA 5IP7J 5A1FA 4CDXB 3K4CA 1OFSA 1AUYA 4PQ9A 2QENA 2VC9A 5LEKA 4UT5A 1FATA 2GH2A 4GAZA 3S1NJ 3GFJA 2IUWA 1IXCA 4WVMB 3MFKA 3WTVC 4U0YA 4FFHA 3AG4H 1OKQA 2B7YA 2DFHA 2Y38A 5JR7B 1JUPA 4NROA 4Q27A 3Q0UA 3HOZJ 4Q0VA 5K7ZA 5CFCA 5JVTA 3HRMA 3WQBA 1WMEA 5CG9A 3TRSB 3VD3A 3CC2I 3C2HA 1J3RA 2W2IA 5HPOA 4XUOA 4KL1A 1UIJA 3I4PA 1O4ZA 2BNNA 5KBFA 2B5HA 1HB2A 3G7DA 4P9IA 3GTPJ 3MIGA 1HLVA 3S8PA 3D4KA 3I3LA 3OY8A 1IC8A 1KGSA 4YW5A 3WG2A 3S15J 3PIJA 4CEWA 5GZGA 3MKYB 2R7OA 1MVEA 4BPZA 1Q1HA 1UX6A 2XL7A 1V0AA 5JCTA 1TQ5A 3HOSA 1VQ8I 2FDFA 3EYIA 5D4RA 2FMLA 5L9BA 4PSXA 2XLGA 4PDWB 3WDWA 2L4MA 1E57A 1LU2A 1RZ4A 2V1DA 3CMAI 1F15A 4FTBA 4PJJA 4DXRA 1JYVA 1JI6A 4RBOA 3JR9A 3K3NA 2JPCA 5A3TA 3HEIA 1MMDA 5GTHC 1UYYA 2PQQA 4M6VA 4BOWA 1PO13 1DG6A 2QQUA 2E26A 2D43A 1SD7A 4K8RB 4JDOA 2V9PA 1RC6A 3FN9A 2LSOA 1C0WA 4BH9A 4A3BJ 4P9FA 2HQNA 3I2HA 3TQNA 1T39A 2OV7A 1FOXA 3NJVA 5A7PA 3ZM8A 1SHWB 5DABA 2BOJA 4XQWA 1B35B 1YE9A 3DEMA 2HKOA 3I8TA 4ETSA 3C7OA 4JHZA 1DYKA 2QZ8A 2COBA 2X1DA 5EEGA 5FZ0A 5M3MJ 2WA0A 1LODA 2QVSB 4DBRA 3HSFA 2O3FA 2HXIA 4Y20A 4A42A 3VDDB 1FAYA 1UPSA 3PM1A 3W5NA 1VRH3 5ICCA 3QU6A 2AENA 3MVPA 4CZCA 5E89A 2QQPA 2XJUA 2JUCA 2QE3A 4AR2A 2XWJB 1NH3A 2XAQA 1IG0A 2Q0OA 2WS93 1QHGA 1PM4A 5C4WA 1BOAA 4A3XA 3S5QA 4QSHA 1W2NA 1ZREA 3G1OA 3POBA 2D6LX 2XV4S 2OF7A 2Q1FA 4PIXA 3T30A 4PDKA 1KD7A 4MXWB 3OYHA 5CFDA 1VAVA 3OD0A 3ASNH 2GXAA 1C8NA 5KXDA 4L9TA 4URTA 5FO5A 4RHV1 5JLXA 4IQPA 2DJNA 5D1IA 4BXSV 1GANA 3EBRA 4FASD 3OYJA 1FYMA 2W91A 2YUSA 2Z69A 4QGNA 4XOTA 3WU2C 4E7JA 3J81Z 1NT0A 1W9FA 3BB6A 4B8EA 2EFWA 2KFDA 4JX6A 2CAVA 1XJAA 3GW2A 4D7SA 2R6QA 2QQKA 3WOGA 5GALA 4LUMA 4W65A 4W6XA 4SLIA 1XB4A 3GMEA 5K8SA 1J7KA 1RUI3 2O14A 3GFMA 1VBD3 4TLFA 3ABMH 1T6GC 1VQLI 1W5CC 5C4XJ 2IFWA 1C5IA 1OPOA 3PUQA 5GZFA 4RB1A 2HWD1 3KQ4B 2JB4A 5DTDA 1OURA 4DXSA 2JDKA 1Q8VA 2LRDA 5GLVA 2BV6A 1KDKA 2DUQA 1XPXA 5FFZA 3WTTC 4W97A 1O57A 4BK4A 3U10A 1N3PA 1O4XA 1RUJ2 4K7JA 1LHOA 1VNDA 3DLLF 1A8DA 1G3WA 1YQAA 1FOYA 1GXQA 1MMNA 4CDUC 1LDKB 1VZ0A 2L02A 4E4DX 2PYTA 1BI2A 3O8GA 1X1BA 3CJIB 2FDIA 2RMU2 3DYOA 1L7QA 2EIEA 3E6BA 3GZNB 2WO2A 1SVOA 4HFSA 1TNSA 4HVOA 3ROUA 2HWF2 5L3FA 3GYDA 1X4OA 2GC3A 4AU7A 4IEVA 4H14A 3W58A 1DF0A 5B2GB 3QACA 4XZPA 4FSJA 1KS5A 2CFXA 1UY1A 4Y24A 2EIDA 5F1JA 3J7HA 4F83A 2XVKA 3WTUC 1D0YA 1ZBA3 3EHKA 4L9VA 4Q4ZF 1DDNA 1PHMA 5DDGA 3AP7A 4QXCA 4A0XA 4XRSG 4Q0UA 5BNNB 1MQTA 1STMA 1R64A 2L54A 1WJEA 1W36D 4PCQA 1C8M3 4LOCA 4WCGA 4HPQA 4HPKA 1W6PA 1LDJA 2LOOA 3IM0A 3UETA 1FOKA 1NCQB 2R5YA 2XQRA 1XQNA 4XIOA 5J8CA 2NS8A 3R61A 3Q0WA 4S05A 4RM2A 3U4XA 5F6KA 2X6OA 3OYMA 3ST7A 2JSPA 1H8VA 4AFBA 4IHXA 3MBWA 4OCTA 4HZFA 4A3IJ 2UY8A 3DKQA 3WUDA 1MBJA 1QPMA 4FTSA 5C8CC 3L2VA 3DGTA 4RAYA 3S7IA 1ZZ9A 4Q8LA 1DDLA 3EETA 2NP0A 3T2QA 2VOWA 5J48A 3AYAA 5FYYA 4IXLA 3LNQA 1D0XA 1PO12 4LBQB 5A6XA 3KP4A 3TKYA 3WNOA 2WNUB 4ZZ5A 3C7GA 1X2MA 3CESA 3BTAA 3VZOA 2JKBA 2DVFA 4Q4V3 4CYCA 3FHNA 1OUSA 2BVBA 3AL5A 1D0HA 1AA7A 5F5AA 5BNPC 2MD5A 4L9JA 2WSVA 3GFIA 4IVNA 2A6ZA 4XC9A 5EEHA 3NSTA 4YLZA 3JCUC 4IL7A 4QPYA 3BTCA 3FJSA 2JJ6A 1D0ZA 4M71A 3HJRA 1T8IA 1WMFA 1FMWA 2IS4A 2ARCA 5ILVA 3FX3A 3CJTB 5IK4A 1ZG3A 4LJHA 5CLSA 4K40A 1LFPA 1ERDA 3TB0A 1OR7A 1SANA 3EQLF 1VRH2 3K46A 2V5YA 2VNRA 1MKMA 2HOSA 1H8TA 2ZX2A 1BR4A 1H4GA 1AR73 2HYJA 1QIQA 4IEYA 1D4M3 2VBYA 1VTNC 4FTHA 2MG4A 2EINH 2WS92 2BJSA 3IWFA 2E63A 2P6CA 1ZRIA 5AVPA 2R7WA 2PMWB 3LA3A 2P3JA 2YMZA 1OD5A 4CHUA 2HYFA 1LECA 3VZJA 3VSLA 3LSPA 1K12A 2D97A 1HKSA 1MJ9A 3ECHA 1H88C 1W6MA 1GMMA 3VBOC 2JD9A 2M4GA 1H2NA 2LTPA 3VL9A 3IP4B 5FREA 4IRGA 1QPIA 2DYRH 4GH4A 1H2LA 1XCBA 1W8WA 1V54H 2VQHA 3K69A 3SCGA 2WAAA 2VOVA 4ASKA 5F08A 1W05A 5A3PA 3JAMZ 1PVC2 5FZCA 3VEPA 3NNFA 2Z33A 2IS6A 2M30A 3P3PA 2RAEA 5GZDA 1W0UA 2VB6A 2PQSA 4S2HA 1V6KA 1VQKI 5DN2A 4BJ5C 4YZ2A 4QB1A 4XKWA 1RUJ1 4XJ8A 3VBHC 2X5IA 4BACA 1DQ1A 1DQ6A 1VBD2 4Y7NJ 2BY3A 2GOXB 2VQCA 3PUSA 2STWA 3A22A 4H0EA 5JDBA 1MGTA 4O9EA 4I0BA 5CB7A 1YWKA 3WW1A 3OL3A 2RMU1 3BTJA 2QQ8A 4EJWA 5ANNA 1CX4A 1EV13 3N3HA 1PM7A 5A7WA 4XMYA 3VODA 2RJ2A 1ASJ3 2HWF1 3SH4A 4A5MA 4CXWA 1QF3A 2IVIB 3AP4A 2FDGA 1Y1WJ 3ECQA 1R00A 1QOOA 2IGKA 3MQ0A 4LHSA 4G94A 2A61A 2W1WA 1GQPA 1GWKA 1WWYA 1VPHA 4BBRJ 3PFYA 4YGEA 2QLZA 2LDUA 2AACA 5K0UC 2ZJCA 3ABKH 3HT1A 2VUDA 2XH6A 4GWNA 1L3LA 1DPUA 1VAMA 3VFZA 3I71A 4FCAA 2P2KA 1R22A 1S3JA 3TL4X 2RJKA 1R1A3 5KHGA 3N35A 4OI0A 1V70A 4CDWC 4JGZA 4PT6A 4DBQA 2KR2A 3HNBM 2E5NA 2XR4A 5E17F 2NAZA 3MWMA 5FP3A 4C9YA 3DPTA 3ZMOA 4HAMA 5FLJA 2PMZN 3TEYA 1ZBA2 3Q8CA 3F8BA 1IS3A 4YFWA 1ND3B 2NOJB 4EWAA 5FZGA 2FEZA 2D93A 5IUQA 1RESA 1DP3A 4AQ6A 1WH5A 2WFF3 4Q4Y3 3BG7A 4RGAA 3CKHA 4L0PA 2VW0A 1LQ1A 1C8M2 5I0RA 4PLNA 3CMYA 1KJLA 1LULA 2HOEA 3VBSC 1IRXA 4EM1A 3ZFEB 3WCSA 3O7OA 4A3KJ 4UBHA 1ENRA 2SBAA 3B94A 5KWRA 3CDHA 4RS5A 4XUNA 3P5JA 1PUEE 4MGQA 5GLZA 4XFBA 3T08A 4XBNA 1PO11 2V6EA 1YG2A 3I2IA 3ZXLA 3Q9OA 3SKJE 4BDVB 1JU3A 4X6AJ 2UWMA 3ZSEA 1JHHA 3FXKA 2VMDA 3ULQB 1HKQA 4Y13A 1Z91A 3ALQA 2W4SA 3FXUA 1VB2A 1Q8QA 5CNAA 2V7FA 1UKGA 1BA5A 3ZXJA 1VQPI 4I7HA 3IZOA 4IEOA 5A3UA 3M07A 2VZTA 3ZQGA 4A2UA 1D1CA 5LRSA 2Q30A 4F8AA 1Y9GA 5T52A 3WEZA 4WF2A 2FRHA 1OSGA 1P6RA 4NHLA 4OAYA 5FD6A 2WYFA 5IOYA 2VAUA 1VRH1 4Q4V2 4DXZA 3HOVJ 2JE8A 4Y5Z0 1FP2A 2MBFA 5KHIA 3SMHA 2K3PA 2RV9A 4IV1C 1W9TA 1DCSA 4IERA 2C26A 1S0JA 4FOQA 2WS91 4JAAA 4NO4A 1S7AA 2WV0A 1QNYA 4CPBA 3UR3C 3TOBA 2IS1A 2P6HA 3HWJA 2COMA 4FBFA 4B3XA 3O1MA 4FPOB 4XQDA 3RGBA 2GP3A 4OI4A 2MH2A 3SH3A 1AR72 2R7RA 1U5ZA 3JU9A 1D4M2 3DQVC 4LHKA 4YW6A 1JTXA 2VCBA 2JG9B 2BWCA 2CGOA 3V8JA 3M8JA 1PVC1 4YFXF 1R4NB 2A5YB 2Q5TA 2X4HA 5FO7B 1OISA 3WX5A 2ZHMA 1MMSA 3H35A 4JKLA 5GP9A 5A33B 5IVBA 1TT5B 2R043 2YC4A 1KEXA 2K0GA 1LTEA 5BNQA 3H1CA 4DEQA 2JENA 2EXHA 3J7AO 3SEQA 1IS4A 5IJRA 1N1YA 2DV9A 3THTA 2KISA 3P9IA 1MBHA 1CF7B 4QMAA 3TAYA 1VBD1 2XGCA 4WM8A 4KT5C 4LO8A 2K7LA 4DS0A 1QGPA 3V42A 3DPRC 3W2AA 1DQ4A 4XIDA 3QAHA 4WXDA 4QQLA 4AUXA 3POGA 1S2BA 3J81K 1AR83 1ZGAA 4NRPA 1FP1D 2BGPA 3U14A 1APLC 1MNEA 2VECA 3QODA 3ZXEA 3KHCA 2D1VA 3EUHC 3PVBB 4XHXA 5F3EA 4LORA 4BB3A 4WM7A 5LK5A 2JKXA 4B29A 3MKLA 5JIUA 3JREA 3W6VA 2VXDA 1ZBE3 1RKTA 3ERED 3W5MA 4ITVA 1DP0A 2ZHNA 3TDZC 3FIWA 2IXSA 1ZK8A 5GAEJ 5J6XA 1XB9A 1EV12 3A7QA 2W85A 2CUFA 1WKYA 2PAMA 3I3DA 3JTHA 3I4MJ 5H9QA 1ASJ2 4AWDA 5CQEA 5DAWA 4B4CA 3LAJA 1I6XA 2WY7Q 2ENRA 1OHFA 1LNSA 1TNTA 3ISPA 3P6BA 4HXCA 4QQPA 4MO3M 1K5JA 3VBFB 3VZMA 3GVAA 5BXXA 5IP9J 2RVCA 1NK2P 1ZBA1 2QQLA 1K5MB 4MH0E 3M3IA 2YU1A 3LA2A 1S7OA 4QKBA 4XKCA 4N9IA 3KHBA 2PTMA 1SFNA 3FHQA 2WY8Q 3BJAA 5C8CB 1W39A 2OCEA 2XBO3 1R1A2 3ZDVA 4WZFA 1J5YA 3U9GA 4LKSA 1C8M1 1Z3YA 1WJAA 1FYKA 3LSKA 1BI3A 1SCRA 4IL6C 4JCKA 4LBNA 2A6VA 2YX7A 2R7EB 2HZTA 1XSXA 4JGYA 4UOJA 3A01B 3R6SA 3DEUA 1IAWA 4AAXA 2DPDA 4WX9A 4LA3A 6PAXA 1SFYA 3INAA 3IIAA 2WFF2 3G3ZA 4Q4Y2 5A1LA 2DAOA 1EYBA 1POQA 2K40A 4BQAA 4W6WA 5EFUA 1Z78A 3NNMA 3JRFA 2ZMEB 3FMQA 3OGJA 4NBQA 1B9NA 1U78A 2O0OA 2JDZA 3PL0A 2OCCH 4KWUA 1X1CA 4XLPF 2JDAA 4EJRA 4HSTA 4EVIA 3CCEI 5D5VB 3GCMA 5DUXA 3WHCA 2OT7A 4PF1A 3M9AA 3CC4I 4Q4V1 3OJBA 5IVFA 2A5WA 1GQHA 2Y0SA 2BW3A 3BZCA 1RRJA 3QOEA 2RNJA 1P92A 4KYWA 2Q8OA 4BIFA 4NDLA 3W59A 1MS5A 3HTUA 2IXLA 1D1AA 5A2QZ 4A3ZA 2ETEA 4AXOA 3GF2A 3FK6A 2ESHA 4M72A 4XR6A 3JZVA 3LMMA 2ID3A 4A7YA 2EIKH 5FLVA 3UL2A 2CY6A 3OTFA 2Z5UA 5LBQA 4RQPB 4HDVA 2W1SA 1V9U3 4Q29A 2W48A 4LO6B 2Z79A 1HA8A 3BCAA 2I5UA 3OS0A 1AR71 5CVIA 1D4M1 5FUIA 5IVJA 2DYCA 1GV9A 3BP8A 4UBGA 1CZSA 4XRFA 2AZ5A 2VE9A 3ETQA 3KSCA 3AJYA 2LF8A 3HOXJ 5FKKA 1JS9A 2KMUA 1D5YA 3ZSMA 2QQIA 3MCZA 1O91A 4N53A 4LK7A 2GA2A 1J83A 1C5HA 5HDKA 5AVAA 4ABZA 1S1AA 3I3MA 2OA4A 2ET1A 2QWWA 3C7HA 1AZDA 2X1CA 1CVNA 4YNIA 4NIHA 2DCEA 3KZZA 1U8BA 1AXYA 5L9VA 1TE1B 1LOBA 2ZEZA 4AQ2A 2EIBA 2HGCA 4BWOA 2XHKA 2I07B 4XF4A 2ES3A 1JHJA 1MDMA 1W6QA 1U9OA 2EPFA 3WGGA 1GLNA 3PSFA 1WGXA 4UAPA 2R042 4E8CA 5HLHA 1MSFC 2MC3A 4W6YA 1U5TB 4AFDA 4NC8A 3G2BA 3R0AA 3POYA 1X3ZB 1BR2A 3A0NA 3EYPA 2RKHA 1X3UA 5T50A 4ASLA 3RWNA 1CAXA 1SACA 1FXZA 2WZR3 1SBFA 4AG4A 5L7OA 2UXXA 2IPQX 2AYHA 4U7DA 3AKQA 4QPGC 2OPWA 3DF8A 4KDPA 1AR82 1EV11 3RYPA 4S04A 1APNA 4HANA 1P7JA 3ONQA 4FCYA 5JMCA 1ASJ1 3FC0A 1UIKA 5GKAC 1JTYA 5A1AA 1S0IA 5FZ1A 1SFPA 1XRUA 2PMHA 3KB5A 5JOYA 2BPA2 2WN2A 1ZZBA 3JRIA 4FPHA 4A3GJ 4XORA 5KR7A 3ABLH 1XNBA 3LF7A 1BW5A 3RMYA 2ME0A 4WVMA 1VMJA 3ZYHA 5IY5H 1WBLA 5JLVA 1ZBE2 1H2KA 2M8EA 4WVWA 4UYBA 2KIQA 3CDZB 1VE0A 1ND2B 1CD3G 4K21A 3U11A 1JJ6C 5IYYA 2ZFUA 4NWWA 1UL9A 1Q56A 3CJQB 1R1A1 5DUVA 1NK3P 1W9YA 4FOVA 2LY9A 1LOCA 4XIKA 4BCUA 4OULA 1JBCA 3GHNA 3T2PA 3B73A 4A4AA 5BV6A 1KRIA 4X6RB 1S0EA 4XFFA 1VI0A 5D21A 1E2XA 2FOKA 3VD4A 3CZJA 2XB0X 3SLIA 2R7DA 4LG0B 5FZEA 3VB9A 5E3MA 2XPUA