5LEJA

The transcriptional regulator prfa from listeria monocytogenes in complex with a 30-bp operator prfa-box motif
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
236
structure length
236
Chain Sequence
b'NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Listeriolysin regulatory protein
publication title Structural basis for glutathione-mediated activation of the virulence regulatory protein PrfA in Listeria.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Transcription
total genus 69
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5lejA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5lejA01
2FNPA 1Z91A 4AD9A 3LAPA 2Z2SB 2O61A 1U2WA 4YIFA 1OD5A 3I4PA 4XBFA 4EGZA 5K8SA 2CWEA 3H92A 1KA8A 4HQEA 2V1DA 4G94A 4IEXA 4CICA 3VFZA 3WW4A 4MTEA 4XFBA 3T8RA 2F4PA 3F8BA 5FCCA 1SD4A 4NHJA 3NEUA 4MGIE 1A04A 4PIZA 5I0TA 1IN6A 1QZYA 2NS0A 3MEXA 4S05A 2G7HA 1JE8A 4AWXB 3EQEA 1YLFA 1QZZA 3ZMVA 1LKNA 2V1XA 1Z6TA 2HWVA 1RZ4A 2Z69A 4FAGA 3LQRA 2BYVE 4EM2A 5J48A 1DGRA 2E7WA 3FMQA 3VODA 3GEZA 4L9NA 2CAUA 4M73A 4M74A 4RB1A 4FX0A 2EA2A 2LKPA 2P7CB 3F8FA 4IHTA 5IT9K 4O9EA 3R0AA 3NJZA 3ISPA 1PDNC 5ICCA 1F1ZA 3IRQA 4ASNA 3BDDA 1J3QA 5I0SA 4WVZA 1FYLA 1F4KA 4L2NA 2MH2A 3HRTA 2UYAA 2EFOA 2VOPA 3CEWA 3KE2A 2EA4A 2LDUA 4QXKA 4ENMA 4ENKA 2VE9A 2QQAA 1SD6A 3I7DA 4I0AA 1SD5A 2EJRA 1V4RA 3K1PA 5BY5A 1FPQA 1BC8C 4MGRA 4BAYA 4EROA 3RKXA 3V8LA 1MGTA 1YW9A 1LDKB 2ZXJA 4G6QA 3LA2A 2XKPA 4LA2A 5L3DA 3KEOA 1Z1DA 2G9WA 5FD5A 2D5HA 1IN7A 1UIJA 4IRIA 1O3RA 1ZG1A 1SFUA 4Q47A 4IESA 2HJIA 5I8TA 2JZYA 2IA0A 3ELNA 4KMFA 2RDPA 1UHMA 2MA3A 2K4JA 3EYYA 1FP2A 1SFNA 4UHTA 2FE3A 3Q5FA 4N9IA 1Z9CA 5F1RA 1QBJA 2Z9OA 1FX7A 2GA2A 2PFWA 2NRAC 1XSVA 2HKXA 2VONA 1S6LA 1USSA 4ORFA 2KRFA 3RYRA 4I0BA 3ZMZA 2PN6A 3QPHA 1GHCA 2OZUA 1E2XA 1ON1A 2E1NA 4LFUA 2ETEA 4K8FA 4JQFA 2YX7A 4KDPA 4D7SA 4KWKA 4WCGA 2HKOA 2Z99A 4HVRA 4BHCA 4IEYA 1JGSA 2MLKA 2EFPA 1FP1D 1XCVA 1RI7A 3K69A 4BIFA 5L3EA 2HEOA 1BC7C 2VE8A 2EVXA 3JTHA 1XCBA 1XD7A 4Q4ZF 1HW5A 2MD5A 4O9GA 2LSOA 4KMUX 1TW3A 2NNYA 4AQ6A 5HDKA 5K5QA 1U5TC 3ECOA 3R0JA 3GZ6A 2QBYB 2R7FA 3TOAA 4HSJA 1MJ9A 3MQ0A 2OAZA 2YSRA 2VN2A 2CW0F 4YFNF 4EMSA 3M3IA 4BYYA 4AIHA 3BY6A 3K1MA 4HYEA 3CUQA 2Q30A 4B29A 5K1YA 3L2CA 1IW7F 5LHHA 1U5TB 3HYIA 1JXSA 5KHKA 4WBBA 2ISZA 1SMYF 3DQVC 4HOBA 2IP2A 1UPIA 4MTDA 1EY2A 5CU1A 4P9FA 4LLLA 3RI4A 2P6TA 1USTA 4CXFA 2QJVA 2PHDA 1QGPA 4U7BA 1FLIA 5C6CA 4G7HF 3KP7A 3C3WA 4OIOF 2CYYA 4S04A 4MZUA 1ZRRA 1SEFA 2RNJA 3D5LA 3B73A 2A68F 2VT2A 4ZYDA 2V6CA 5F64A 1WWXA 3P9IA 3EQLF 4MX3A 4ESBA 5AIPA 1LDJA 4M6YA 3KP2A 4IETA 1B4AA 4XFFA 4QGMA 1Q43A 5F6FA 1ZARA 4HF2A 1J3RA 3GF2A 2PYTA 1GVJA 3PLQA 4B8XA 5L3BA 4KU7A 3NSTA 1I27A 1KU3A 4Z07A 2QZ8A 3KP6A 3RYKA 3J80Z 3LA3A 1CGPA 4YYOA 4A5NA 5CLSA 3U9GA 1CF7B 3SXYA 4U0YA 3TO6A 3RZZA 2XAJA 1QO0D 1LJ9A 2XAGA 3I54A 3WGIA 2KJCA 3ABUA 4Z82A 1XSDA 3ETQA 4KA4A 5FGMA 5HOOA 1ZAOA 1XGNA 2GH2A 3IDCB 2JTVA 1H9GA 1P4AA 1VJ2A 1XSXA 2A3SA 2KJBA 3H50A 3BALA 4IEPA 3FXQA 2VBXA 3KFWX 2GWRA 1F9NA 5AIQA 1JUHA 2OYZA 1XDUA 3MYXA 2H94A 1W5TA 1F5TA 1K79A 3DN7A 5BPIA 5J8FA 3V7RA 5JHUA 2QDRA 3KP3A 3V7SA 3BWGA 2J5OA 1YO5C 2Q0OA 4YARA 1EP0A 4J1WA 3M8EA 1O7FA 2P7VB 2WFPA 3OV8A 5AVPA 1G3YA 4ZYHA 3S7EA 5DDGA 4XFCA 2HYFA 1R23A 2DQRA 3DKWA 5CVRA 2G7UA 4HF0A 1SQ4A 3F6OA 2O8QA 2UY8A 3CL1A 2FBKA 5FO5A 3CLOA 3ULQB 2BEOA 3HHHA 2O0YA 3WW3A 1P4WA 2HS5A 3SHRA 2KIMA 2PLYA 1IPJA 3HTUA 3LAGA 5DYMA 1HKTA 3H1WA 4QGNA 2FA5A 2B8MA 2XAQA 3DPTA 3C1DA 3GVAA 3I5UA 1YHFA 1O3SA 3CDHA 4ZU5A 3Q9VA 2HFHA 1XE7A 2A69F 2OA4A 2A6EF 5D5WB 5ICEA 5LEKA 2QENA 1T39A 4Y15A 1YFYA 4YNIA 1TNSA 2N7GA 1V3FA 1FOKA 1YFUA 4IEQA 3ZMTA 3GFIA 3J80K 2HOEA 3JZVA 2XL7A 5CVVA 5JCTA 4HN0A 2PI0A 3IDBB 4I02A 2E9QA 4XEZA 5E1WA 2P6SA 2XASA 2R7DA 3MDPA 3WW2A 3VOEA 1WKMA 5HDNA 2A61A 3G73A 1TNTA 2E1CA 4MNUA 3C18A 1U3EM 2BV6A 2O6GE 2H0VA 4HV6A 3IL2A 3BZ6A 1T98A 2Q1ZB 2BE5F 1GQHA 4UBGA 3HTSB 2OZ6A 2FBHA 3ES1A 2IXJA 4CHUA 3WODF 4PJYA 3U10A 3TKYA 3GUDA 2H27A 4HBLA 5HLHA 4OMYA 2A07F 4TV7A 4ZYGA 4UBHA 3RIRA 2JPCA 3S0MA 5L3CA 3I53A 4AVPA 1ZVFA 5I8YA 5FDBA 4IRGA 4XSXF 1D3YA 1ZGJA 1R7JA 2GQQA 4UV9A 1YW7A 4X6RB 4GYIA 5J7MA 4QM9A 1CAWB 3V7CA 5J8CA 1LB2A 2Y0OA 2ET1A 3O6BB 1PMIA 2FF4A 3D0SA 4U0VA 4KL1A 5FFXA 3I71A 3QPTA 1ZG3A 1O7LA 3KLNA 2IXHA 5LGUA 1K78A 4FT8A 4R8HA 1PUEE 4L5JA 3KMHA 2RV8A 3WU0A 2EA7A 4XF9A 4I01A 3SZPA 5FQ0B 5TJJA 3E6MA 1J7KA 1DPRA 1DPUA 3PNAA 2ISYA 2ZFWA 1EH8A 3TDUC 4DQ2A 2MPFA 5EZWA 5A2QZ 2FOKA 3M7GA 1CAUB 2AXLA 3WTSC 5DV5A 2M45A 3OOPA 4EVIA 4XSZF 3R4KA 2FEZA 4ZH4F 4M9SA 5D1IA 2L4MA 3F8NA 3O2PE 4WXDA 3BJ6A 5C8WA 3ZN1A 1X3UA 4HW0A 5JSRA 3QU3A 2PAEA 3HRMA 3W6KB 3BPVA 2GU9A 4NQWA 4Q0VA 2ZKLA 2L54A 2M8EA 3P7NA 2D45A 1P2FA 4ON0A 1ULYA 1OFNA 1Q5OA 4IEUA 3ERED 3BJAA 2RKHA 2W57A 2Z3YA 5HLIA 3CLPA 3E6CC 2HTJA 1X8EA 3IIAA 1R22A 2L3DA 3QOPA 5HLGA 1H1MA 4EWAA 5BPXA 5TRDA 1YFHA 3FM5A 2XROA 2IVMA 3PQKA 4WX9A 1U6GA 1TQ5A 4KN4X 1G3TA 2KIUA 5FLXZ 1J9IA 4KWJA 3TNQA 2CAVA 3D82A 2IXKA 1H9TA 3S2WA 1OYWA 2OPKA 5D6EA 4EJOA 3WTYC 1ZHFA 1ZRCA 5CVJA 5I0RA 3WTTC 3F8CA 4MGZE 3CJNA 1I1SA 5E20A 1QQIA 1FY7A 1YWKA 2EFNA 4IHSA 1RUNA 4TLFA 2FXAA 1SFXA 2P5LC 2PMUA 3U2RA 1UB9A 1NZCA 1B6AA 3GLXA 2ETHA 3OD0A 3ZPLA 1XGSA 2YR2A 4MUVA 2VODA 2IW5A 4HDVA 4O3MA 3J81Z 3LAJA 1CX4A 2HTSA 2EB7A 5ILSA 2P8TA 3UKTA 4HA8A 2HDCA 5A2QK 4KNYA 3VHRA 4A6DA 2K02A 5DUIA 3MZHA 4OIPF 4G6DA 5JFRA 1D5VA 4ZZLA 2K27A 4XF1A 3EYIA 1G3WA 5E8GA 4I7HA 2M1BA 1O3TA 3WE3A 2XAHA 4Y17A 4L9VA 5HS8A 3UKNA 4U88A 4HV5A 4GGGA 4M6XA 1MDMA 1OKRA 4U7DA 1OPCA 1QXRA 5HI0A 3MCZA 3DPLC 1OMIA 4AIKA 4HVOA 2ADUA 5L3GA 1YW8A 2PBIA 2DK5A 4G8XA 1MKMA 1YQAA 4LB6B 4CDGA 1KQ0A 2CQKA 2IPQX 4Q0PA 4QWQA 3HSRA 4BQAA 2VBYA 3GO5A 4F7ZA 3HUGA 2QVOA 1W5SA 2PFBA 2VECA 1XGMA 5FFZA 5FLXK 4XLNF 4ZU7A 2OA2A 4A0ZA 3LQQA 4U0WA 3L09A 3KZZA 4LUMA 2Y75A 3G3ZA 4J1XA 2BNMA 3FFQA 1ZZBA 2IXLA 4X6QB 3M8FA 1HSJA 2UYBA 5FPXA 1LNWA 4EM0B 1DP7P 3FHZA 2QCSB 1FSHA 3BOQA 1QXJA 3H7JA 4R1HA 3MZYA 1R1VA 1WLTA 4MGYE 2DFIA 1R36A 3GFJA 3HSFA 5LBQA 1W7PB 2JT1A 3J81K 1MJBA 4LLGF 2VT3A 1B9MA 1TW2A 4LK1F 2GAUA 1B9NA 2Y48A 2BNNA 3SXWA 3CUQB 4EWDA 5BMZA 4IF4A 1D8JA 4LJZF 3V8KA 2CO5A 2NNNA 2CGPA 2LNBA 3H7YA 2KKOA 2FQ3A 2K86A 4G9YA 5EEHA 1BBYA 2KXLA 4CZZA 1IF1A 4EJWA 5FB2A 1XRUA 1J0RA 4PGGA 3L00A 4A12A 1IXCA 1LVAA 4OINF 1ZG5A 4UXNA 2D5FA 3M70A 2D93A 2GIVA 2VQAA 3RPQA 3IKVA 1LR5A 4IEOA 5KHJA 2CV6A 1JHHA 2PMHA 3LWCA 4OIQF 2DBBA 3V4GA 2JPBA 1W4MA 4A6EA 4XLPF 3DL3A 1CAXA 3GYDA 2EV5A 4QX5A 3SCGA 1BI3A 3DEUA 1U5TA 4L11A 1DUXC 4A2UA 4Q48A 3WTVC 3F72A 2GZWA 4AIJA 1V70A 5E1ZB 3ABTA 4Q0QA 1B59A 3B02A 2P5VA 5K5OA 2EAAA 1WSUA 2NAZA 1AOYA 3FMRA 1FSEA 3FZ3A 4A0XA 5D4RA 5E8IA 1JHFA 4LLOA 1WI9A 2HQNA 4RAZA 5CJ9A 1ZLJA 3L9FA 4UVBA 4EJTA 1DZTA 3K0LA 3PFIA 1UCRA 5FLJA 2OQGA 2XUBA 3U11A 2GXGA 3MFKA 1IN5A 3BCWA 1R1UA 3JAMZ 4JVAA 3TO9A 5H20A 5CYVA 4KWLA 2CG4A 3VB2A 1H1IA 2GC0A 2CFXA 4JV4A 2RQPA 4OIRF 3ZMDA 4E2QA 5DCMB 1TQMA 5LEJA 3ECHA 1HW2A 4QM8A 4RB3C 1DZRA 1EV7A 1TBXA 4FAHA 3SCHA 4NB5A 1IN8A 1FYMA 4LG0B 1NE4A 3O14A 3RTRA 3CF6E 1XDSA 1J58A 3USSA 1R5HA 4HDUA 2DLLA 3HOSA 2ZCWA 3P9KA 4OFGA 2Z5UA 4YFKF 5ILUA 3NRVA 5CVUA 4LB5A 1KU9A 3HSEA 2VBZA 4N0BA 2V9VA 5E18F 2C6YA 5KHHA 1KQ8A 1W7PD 1SMTA 2F5CA 4KN7X 2STTA 2DT5A 3ES4A 1SAXA 5FPZA 5K5RA 1T6SA 4ENNA 1KU7A 4EV0A 1L3JA 4AVCA 4XFAA 1T38A 3HHGA 3ZDSA 2XRNA 4MQ9F 2EV6A 4EGYA 3WTWC 1YFWA 3S7IA 1C0WA 5I8SA 1U8RA 2XIGA 1L0OC 4DINB 2MHFA 3FF5A 1EPZA 1ZYRF 3WGHA 3TQNA 3HT2A 4HZFA 2UXNA 3E97A 1ZNPA 5H6RA 4LK0F 3I59B 4PCQA 1X7NA 3FX3A 1UFMA 3BJOA 1NE6A 2STWA 2OU2A 2W24A 3T0YA 1IAWA 3IWFA 3GWZA 3JAMK 4HN1A 4P55A 3BPZA 3D0JA 2UXXA 3GZ5A 1FZPB 2VC0A 2DPDA 5JSOA 4BH9A 1J75A 4KT5C 5CADA 2VBWA 3K1NA 1E17A 1Z05A 3R61A 4XETA 2RN7A 2HYGD 1XE8A 2PA7A 3TGNA 2MH9A 2F5DA 2ZJ2A 1H0MA 5BUVA 1FC3A 2CSOA 4PZJA 3ROUA 2EFQA 1TLHB 1S29A 2RC4A 5JSPA 2WWYA 4RS8A 2DU9A 4IEWA 1QNTA 4EQQA 3DV8A 3WTZA 2ZMEB 4RB2C 2BGCA 1WGPA 3M9AA 3FXRA 2ACJA 2OQRA 5JVTA 1KQ9A 4PGHA 2JSCA 1J1LA 4KU8A 3T1BA 4AVBA 1TTYA 2FMYA 2ZO4A 4HF1A 4RAYA 1Y3TA 3FE5A 3OGJA 3GYHX 2DPUA 1ZZCA 3WGGA 3KLOA 1S3JA 3I64A 3RPUA 4OMZA 3SHFA 1K78B 1FBSA 1AWCA 1Y9QA 4HAMA 3I58A 3OF1A 3KZYA 2LF8A 5D5XB 1R58A 2ESNA 5DD8A 3HT1A 2GA1A 1CAVA 3T5XA 3L7WA 3KGLA 1HBXG 4OLLA 4AXOA 2A6HF 1PP8F 5BS6A 4BHPA 1IXSB 4HX7A 1J59A 4I2OA 3RKYA 1FI2A 3FJSA 1BM9A 4LA3A 1CAWA 3N97A 1ZREA 5IT9Z 1WQ2A 1XGOA 4GULA 1RNLA 4LMYA 2PHLA 2HGCA 2YX4A 3JSPA 2P4WA 1BI2A 4HMZA 2H6BA 2KIFA 1BI1A 1IRFA 1OI6A 2HR3A 2IXCA 4Z2YA 2FU4A 4QGLA 5IT3A 1QWRA 2VC1A 3F21A 4GO1A 2FQPA 4R52A 2F2EA 2B0LA 3GFLA 3COAC 3WU1B 2A5YB 1KU2A 1XN7A 1IN4A 3DP7A 1CAUA 3WW1A 2O3FA 2ZNZA 3CTAA 4BXUA 1L3LA 2NYXA 4H7LA 3LZZA 4CYDA 1HKQA 2UWMA 3CUOA 4IJAA 2E7XA 4PIYA 1EH7A 1OYIA 2HZTA 1YUDA 4JK1X 4A0YA 3RYPA 4BHBA 2B9UA 2M5WA 2QLZA 5D5VB 4UV8A 1PP7U 5BOXA 4EJVA 4P9UA 2XGXA 2QQ9A 3REOA 3ZQ7A 4D0PA 2MLGA 3VEPA 2MNGA 4WXHA 4M71A 3GBFA 2LF7A 1Z7UA 5D8LB 2UY9A 2XV4S 4RD7A 5ED4A 2F5FA 1I1GA 3R6SA 4KUMA 1R5GA 3H8UA 1SD7A 2IA2A 1XMAA 1YS6A 3NL1A 4L9TA 3K9TA 2H6CA 1S8NA 4KIFA 2M30A 4LTAA 4HX4A 4MHGA 3ELKA 5KK1A 1XMKA 5J6XA 2DW4A 4KYWA 2R3SA 3P9CA 4FHTA 2V79A 1FBUA 3KCCA 3N4MA 1ZRDA 2L4AA 3RDIA 3E6BA 5H6QA 5LLQA 3JTGA 2YU3A 1MD0A 2V1UA 1MJAA 1RGSA 2ZBKA 3BU7A 4XF0A 2X0LA 3QU6A 5ICFA 3NVCA 1YG2A 2FMLA 2DO7A 2BNOA 1MDMB 4P9GA 4ETSA 3U1DA 1S7OA 2TDXA 4G7OF 1ZZ7A 2D1VA 3MPBA 3SZTA 3EDPA 1FT9A 3FZVA 5KVRA 1ZH5A 1LDDA 2GC2A 1BJAA 4FBFA 1YYVA 4L9JA 3CO6C 4BNCA 1P6RA 5KBFA 5LGTA 1LQ1A 3KP5A 5FLIA 3I0TA 1HSTA 4LEJA 4NVPA 2DI3A 1FXZA 2JRTA 1T2KA 3R60A 3M1EA 3PVBB 5BPDA 3BP8A 2O8XA 3HQXA 5FLHA 4I09A 1NHAA 4LULA 1GXPA 2IRFG 2B5HA 3LA7A 4ZU4A 5JR3A 5AONA 3C7JA 3ML6A 4B09A 4PIXA 1IZ1A 3RNSA 4M72A 4UVCA 1EH6A 2Y0MA 3OCPA 4ESFA 1Q3EA 1O5LA 4HBNA 2XKOA 3HIFA 1T0FA 3LOIA 2GC1A 1YFXA 3EHKA 4OOIA 2GXBA 3IKTA 6PAXA 5KHIA 5ERIA 2IXIA 2WV0A 2VPVA 3QACA 4YIIA 5L3FA 4RGXA 4Q0UA 3MWMA 4FX4A 1Y0UA 2PAKA 4MV2A 3ST7A 4KIBA 4AQ2A 3CUQC 3KP4A 4DNCA 3E5XA 4EJUA 4HVQA 4XFIA 3F8MA 4IVNA 2FSWA 3H3UA 3IHUA 1YTYA 4EWEA 3J7AO 4HQMA 3CO7C 1P4XA 1HKSA 4I98B 1DDNA 4P96A 1WRJA 2XHKA 4YSFA 3CO2A 1RUOA 2K7LA 2W85A 5LRRA 3TOBA 4RGUA 3IWZA 2HQRA 3NQOA 4EM1A 2XL9A 4LD5A 2OZJA 5CVIA 3F6VA 1HQCA 1X82A 1J2XA 4PDKA 4L0ZB 1RC6A 2XLGA 1UIKA 1W7PA 2XLFA 3GXOA 4K2EA 2EFWA 5E16A 2O03A 3DF8A 3H1MA 3EJKA 2IJLA 2QBYA 1CAXB 2QM3A 1LEBA 3DXJF 1O4TA 2ET7A 5J3UA 2DCTA 1K6OA 2MBFA 4ENJA 4JBAA 5LGNA 4RGSA 2ATFA 5D4SA 1ZLKA 4UVAA 2C0ZA 2H09A 1ZN2A 3LWFA 2GC3A 3FHIB 4AVAA 2O1QA 4UXAA 5HDGA 4I3PA 2L02A 3ACLA 3C3VA 1OR7A 3TO7A 5I93A 2PJPA 3EETA 4ONUA 3K2ZA 1ZRFA 3ZN0A 2COMA 2AS5F 2Z33A 3UKVA 2QUFA 2ZNYA 1ZZ9A 1VR3A 1ZZ6A 1YS7A 1U12A 1IPKA 2DTRA 2PQ8A 3QAHA 4RB0A 5EEGA 4JTNA 1J5YA 3IRRA 3HOTA 3U0ZA 3SFZA 4MEYF 2QNKA 4Q5SF 1U78A 3E3VA 3H1YA 5BV6A 3E5UA 4IPAA 3NW4A 3WE2A 4CGZA 1BOAA 1OYYA 3QP5A 1R00A 4WK8F 4D7TA 2UZKA 3KGZA 3LSTA 1BIAA 5E1XA 2WC2A 4HLYA 3MAJA 5DEQA 1CF7A 1B1BA 5JAXA 1DGWA 2ELHA 2X4HA 4L18B 2OBPA 1VP6A 4XF3A 2Q2EA 1YIOA 1FWZA 1ODDA 1LEAA 2PG4A 1G4DA 3WTXC 1Q1HA 3WTUC 2M87A 4HLTA 4G7ZF 3BB6A 1FNNA 4LLNA 1MZBA 5EFUA 1XB4A 5DCMA 1QY4A 2Q8KA 4LGWA 4Q0SA 2ESHA 3RKWA 4E2SA 1P92A 3FXUA 1FBQA 5D5UB 2QQBA 2MC3A 3V8JA 4UUVA 4XFHA 4OU0A 4LG0A 2W25A 1J3PA 2XAFA 3EO6A 3LFKA 4M9XA 1X8MA 2PAMA 2DQLA 4WWCA 2EV0A 1Z6RA 1TQIA 3H9AA 2PEXA 3EBRA 4N9HA 3HRSA 1LRHA 4CO8A 3E5QA 1RTVA 3GW2A 3SMHA 3GFMA 3KEQA 4WZCA 1G3SA 1NXMA 5HS9A 3SCFA 4E70A 1EYBA 2PQQA 2PTMA 1RIOH 2YPRA 1IRGA 2XLAA 5FD6A 2WTEA 1KGSA 4KICA 1KYZA 2L01A 4YFXF 4WF2A 5D8KB 1I5ZA 4JTOA 4Q29A 2XVCA 1O5UA 2ZKZA 3T8TA 1PM7A 1ZX5A 4H0EA 2DK8A 4HLXA 2IC1A 3SQNA 3JW4A 1D8KA 5BXXA 2W84A 5DD4A 1K7AA 4LUKA 2IT0A 4O5VA 1ONVA 5JI6A 4MH0E 2BBYA 3IC7A 3I59A 5HVQC 1QPMA 4P5OA 5E1RA 1VTNC 5ILVA 4XRFA 2OD5A 1SFEA 4L0YB 1ON2A 2D1HA 1G6NA 3DFGA 3F3XA 1O57A 2I45A 2EWNA 2QVSB 2FRHA 1BN5A 2K0GA 5T3NA 3GX4X 1BIBA 5DUKA 3FWEA 3QP6A 4A5MA 3BPXA 2FBIA 5ICGA 2Q4SA 4KFCA 4XF4A 2P5KA 4IEVA 1REPC 1TQPA 4ZZDA 3ZP5A 2J5PA 5LRSA 1IUYA 2F5EA 4HX8A 3Q9SA 4UNOA 4HSLA 3FMSA 1R1TA 3W6JB 3L2HA 3WG9A 3FM3A 3O3KA 3QRFF 5HS7A 4YRDA 1CAVB 5I0UA 2QWWA 4META 1UW8A 4Y13A 1HXDA 1ZGAA 4YG2F 3EUHA 5I91A 2ZMEA 4R79A 1UD1A 3BROA 4O6JA 1UHWA 3ZMSA 2K9ZA 2P17A 4ZYEA 1UCXA 1I6XA 4IRHA 3AAFA 1YLLA 3F22A 2VXZA 3HRUA 3CJXA 2K4BA 3ZMUA 4GYGA 4IEZA 4ESJA 1S7AA 4E2GA 1WA4A 4QMAA 4GCVA 2QYOA 5D6FA 3PQJA 1ZZ8A 1BI0A 4WXCA 4F8AA 4IXAA 2IA1A 4KIGA 1IXRC 5LHGA 3JSOA 2D40A 3KSCA 4MGKE 3TNPB 5DCFA 1FYKA 5FQ0A 1O3QA 2V09A 2D2WA 5E17F 1HW1A 4GXOA 1RL3A 3KETA 4M9ZA 2Q0AA 3G7DA 2VOOA 2RGVA 5KHGA 3RJPA 1GQGA 3TDZC 3F23A 3NKTA 3E6DA 4QLCU 4MEXF 3H3ZA 1STZA 4XFGA 1KYWA 5JR7B 3OTFA 5BQTA 1NYWA 2EK5A 5LHIA 4L5IA 1GXQA 2DAOA 2FNAA 2RVCA 3IBMA 4RGRA 4IERA 4MQVA
chains in the Genus database with same CATH superfamily
4AD9A 2O61A 3K70C 2C6SA 2TBVA 1E5SA 3I4PA 3H92A 1KA8A 4BQ4A 2V1DA 4G94A 2BU9A 4RFT0 3VFZA 4DYCA 3AP6A 5LCWL 3VDBA 3T8RA 1HRI1 2F4PA 4AVZA 4BK5A 3PUAA 3HBKA 4MGIE 2YBKA 3WHTA 2NS0A 2HNHA 3MEXA 1XS9A 3DTKA 2E2JJ 4BIOA 4E7LA 3T08A 4NRPA 5J37A 3I97A 5L9BA 3SJMA 1RZ4A 1W06A 4A3JJ 4ZY9A 4L97A 1DQ6A 3E0JB 3VODA 3OS1A 2Y34A 4M73A 4TYSA 3FLRA 4XONA 2P7CB 4O9EA 4TN7A 3B9IA 4MADA 2L9SA 2M7BA 3WP3A 1C4RA 1FATA 4L2NA 3N7JA 3OYNA 2MH2A 3H35A 2VOPA 3K75B 3WG1A 1JYNA 1I9RA 5IVYA 4ENMA 2I8DA 2YGLA 2QQAA 1OKOA 5F32A 1NG7A 3I7DA 2ZXHA 2VJXA 2D98A 5SV8A 1TVGA 4RS5C 2EJRA 1VBE2 3K1PA 5BY5A 5DPNA 2OUMA 1Y9GA 2Y9ZA 3D1NI 2RS12 4MGRA 2X09A 4AYBN 4HSRA 3RKXA 1YJLA 4Y5SA 4AZZA 5EXOA 3I2OA 1LDKB 4LA2A 2P2KA 3S17J 1Z1DA 2LTNA 2XQXA 2D5HA 4IRIA 1ZG1A 1CD3G 3LEMA 2NVQJ 3O1MA 1VRH3 1TZOA 3M3EA 2HJIA 2JZYA 2IA0A 2PHTA 3ELNA 3ECQA 3CESA 4K1ZA 2RS51 3A03A 2JG9C 4BACA 1SFNA 2W5FA 2P6HA 4YGEA 5EYYA 4UHTA 3SLIA 1Z9CA 5F1RA 3FBIB 1QBJA 3QWLA 2PFWA 4M01A 1XSVA 4AFAA 4AFDA 3KCXA 2HKXA 5FXXA 3ZMZA 3QPHA 4Y7NJ 2OZUA 1VFCA 2V9PA 3PJYA 3CZUA 4JQFA 3S8PA 2TUNA 5JXGA 4WCGA 4IEYA 1JGSA 1PMJX 5ABJC 1XCVA 1QJU2 4ZONA 1PO21 1RI7A 5DXDA 2HEOA 1AL22 4OI4A 4XUNA 5B5EC 3H42B 4OULA 2WAEA 2EVXA 3JTHA 5F0CA 2WL1A 4DXRA 1XD7A 2MD5A 1A34A 5EIYB 1X9PA 1TW3A 1N1SA 3ABZA 3R0JA 4H2AA 5DTDA 3TOAA 1GU3A 4R9CA 3NKGA 3NO8A 1PK6C 4EMSA 4BYYA 4AIHA 4RHV2 1Z0XA 3CUQA 5K1YA 1YQCA 4DB5A 1EAH3 3HYIA 1JXSA 4KG8A 4CDXC 3IV5A 1KD7A 2ISZA 1SMYF 2R042 4HOBA 1UX7A 5FJKA 1YJKA 2PN5A 1GNZA 4R4XA 1EV13 4MTDA 3FC0A 5GJ6A 3RI4A 4FE7A 4NN0A 1OURA 4IDZA 2QJVA 5LWBA 1QJFA 5FZ3A 4GH4A 1GWKA 4XQFA 1OQDA 2D6PA 3J7NA 1QDCA 4OIOF 2K9SA 2CYYA 4MZUA 1MMDA 2YG0A 3KHBA 1SEFA 1WW7A 2RNJA 5CEHA 4CUCA 2VT2A 2FBEA 2CU5A 2V6CA 3P9IA 4UUSA 4XQDA 3EQLF 3VDCA 4IETA 4C9YA 2LKSA 2VUDA 1UYZA 5IHRA 1ZARA 4UF0B 1W8TA 4J00A 4HF2A 4XW3A 5KAFC 1WVRA 2PYTA 4IL6C 5CKMA 4KU7A 1ETYA 5HCAA 3S1MJ 4XQ4A 3KP6A 3I3MA 3RYKA 3J80Z 2WFF2 1CGPA 2DF7A 4LBQB 3RZZA 1LJ9A 3I54A 2E36A 5F0FA 2GMPA 4Z82A 4ZKTB 1XSDA 1Z7S1 2B4KA 3I9V2 4NIDA 4BM8A 1Y43B 1XGNA 1HLCA 2W92A 1R1A3 2KJBA 2FX0A 3H50A 1PVXA 4AU7A 1LFBA 2VBXA 3MIEA 4QX0A 2GWRA 1AX1A 1XDUA 4Z92B 1ENHA 3MYXA 4BPZA 1ZA7A 2HYJA 3BC8A 1R092 3NJVA 2QDRA 2BOJA 3DKYA 2X1DA 1YO5C 4YARA 2XJTA 1HB4A 4J1WA 1QQP3 3MO4A 2WFPA 4OAZA 3HOBA 4XFCA 1JZ4A 1R23A 2DQRA 1W6OA 3DKWA 3NMBA 4HNUA 2CW8A 3LPFA 1VQKI 2HYXA 2X48A 2GNMA 3CL1A 2ZGKA 3ALQA 1UO9A 1AHDP 2WNVA 1RUI1 1E3OC 1T08B 5FO5A 3ULQB 1HLVA 3OD4A 1QZEA 1DYOA 2O0YA 3WW3A 2TEPA 1P4WA 4WM7B 5K0UB 1FTTA 2W3JA 5FO7B 2DFHA 2H8RA 4G4FA 4QU2A 4QU1A 3I5UA 3RMYA 1O3SA 4WM8A 2NLRA 3VL9A 2A69F 2OA4A 1W90A 4DUXA 2G0EA 4LK7A 5ICEA 5CFCA 4M0NA 2W48A 4XACA 1T39A 4Y15A 1YFYA 1TNSA 3L2UA 3LMMA 4IEQA 3G6EI 2YGMA 3IKWA 1V9U1 4EN6B 1MVQA 1Q1VA 1AX2A 3DWLE 4D8MA 2VCMA 2XL7A 5JCTA 2PI0A 1W2UA 2IS2A 4S2DA 3NQHA 4A3DJ 3A1YA 2NVUB 5K7ZA 1ND3A 3DPRB 3AG2H 3FBMA 2XPJA 5KXEA 3IM0A 3U4XA 3LCPA 4X6AJ 3ABLH 5IAXA 4D7NA 3C18A 1U3EM 4CCKA 3KHCA 1V55H 3IL2A 1T98A 4XLFA 1A6QA 2R063 4AI8A 2VKHA 4M4PA 1RUE1 2RJLA 5T5JA 5T54A 4CHUA 4PJYA 4Q27A 1TZLA 5FZBA 3OSDA 4B1MA 2PLV1 3M2MA 3JU9A 1UELB 3LFUA 5HLHA 4OMYA 2A07F 2YU9J 4JDMA 1LE8A 3IMNA 5IUQA 2V4VA 4RR3C 4Q4W1 2XF7A 2O14A 3S0MA 2KPMA 4WVMB 1ZVFA 5JWPA 1US2A 2ADEA 2HWE1 3QPLA 4XSXF 1DZQA 1FPN1 3T4VA 3SEQA 3OYWB 2AH2A 4E4SA 1VRBA 1JZ7A 3ZVXA 4TWTA 3J7LA 1R5ID 1LB2A 2C9KA 2JE8A 2Y0OA 3O6BB 5E6HA 4FXGB 3QPTA 3KLNA 3AMNA 2GMMA 5CKTA 4FPEA 5C5TA 3WU0A 2ADDA 1JOBA 1DPUA 3PNAA 4GWJA 1EH8A 2BGPA 4B4PA 2MPFA 4GQ7A 5EZWA 3PDQA 4AVVA 3M7GA 3UL2A 3WTSC 3ZSMA 5DV5A 1KDKA 3HOYJ 2XJPA 2FEZA 1QHDA 3F8NA 2RG4A 2V26A 4K40A 4O61A 1OCPA 4LKSA 1ETQA 2JVGA 2PXJA 3NV3A 1X3UA 1HJGA 5JSRA 2PAEA 4RN5A 3W6KB 3J7HA 3VKMA 3NJXA 4NMIA 4EJRA 2QQWA 5ACA2 1OOPA 3U75A 4ON0A 1HV0A 1ULYA 1PO11 1RXFA 1LENA 5IVJA 2BWAA 3ERED 4LG3A 3BJAA 1VAMA 4ATEA 3BTXA 2Z3YA 2W57A 2XB5A 2TCTA 1X8EA 2HTJA 1RUC1 1CWPA 2WA4A 1R22A 2ORZA 3QOPA 4IQJA 5HLGA 4R4ZA 3USUA 3CCUI 5TRDA 1YFHA 4XJAA 2DA7A 1TT0A 3FM5A 4WX9A 1TQ5A 3CMGA 1J9IA 2P5BA 4RDUA 2WWSA 2CH0A 2M8GX 2IXKA 3MW3A 1OYWA 2DT7B 4RM2A 3WTYC 1ZHFA 3B00A 3N3HA 1TMF2 3O1UA 3J4UH 3WTTC 3F8CA 5FY5A 1CZTA 1FY7A 4DZGA 4CU6A 4X1EA 3OB8A 3N36A 4TLFA 2FXAA 2WO1A 1NZCA 5LY1A 4ASKA 3OD0A 2R7RA 1XGSA 1VBC1 2KD7A 2L9LA 5JZGB 3OYLA 2IW5A 3CP8A 4HDVA 5FO9B 3J81Z 1NCQB 2BOLA 2EB7A 1BR4A 5ILSA 3UKTA 5A2QK 3EB7A 1W28A 3WOGA 2P34A 4A45A 3ZYGA 5CFDA 3ZRGA 1KDMA 5JFRA 2K27A 3PMSA 5JUVA 5E8GA 4I7HA 1O3TA 4XM3A 3WE3A 4Y17A 5HS8A 1WD3A 3N9MA 5CBLA 4QPIB 1MDMA 4E7KA 4U7DA 4BDZA 1OPCA 2DOFA 3ZSLA 4AEJA 3MCZA 4QQLA 2P81A 1IGOA 4MXWB 1LHUA 3WHCA 1W05A 5IY5H 1YW8A 2X1EA 4CH7A 3BG7A 3CJTB 2I07B 1DGRM 2PBIA 1F9KA 1V6JA 4CDGA 1XSQA 1KQ0A 3GTKJ 4AI0A 4B1LA 4QWQA 4FOQA 3HUGA 2KRHA 1JI6A 1WBLA 2BOIA 1W5SA 2PFBA 1OQ1A 3MPPG 3WF3A 1FMD3 1W6MA 2KMUA 5FFZA 1VBB3 2VU9A 1VAVA 1JODA 4MO3M 2OA2A 2NQYA 4U0WA 4L5EA 2XONA 3L1PA 2BNMA 4JYKA 1D1BA 1UYPA 2KQRA 4BJ6C 4XE9A 1W8FA 3PTRB 2WLPA 1ZZBA 1ZKGA 4X6QB 3HEIA 1HSJA 3PNTA 3X2QH 1LNWA 1UMIA 2QCSB 5TISC 3LKJA 3H7JA 4R1HA 3BG9A 2R5ZB 3FXLA 3DUIA 3GFJA 5DABA 2YUSA 3ACHA 5LBQA 3ZR6A 2ZHKA 4LLGF 2J1AA 1B9NA 2BNNA 3IH2A 1XB9A 2Y6JA 2E2HJ 5BMZA 3POFA 2ZEWA 1K5MA 5IT6A 3V8KA 5FYUA 2LS6A 2CO5A 2CGPA 1AR91 2KKOA 2FQ3A 1QGLA 2KXLA 2KLOA 1IF1A 1BYHA 5FB2A 2GXAA 1IOAA 2K5CA 1XRUA 2E7QA 5CZKA 1LVAA 4OINF 4E7ZA 4XRSA 4DMIA 2HEWF 2D93A 2GIVA 5JIAA 1MBHA 4IEOA 4U36A 3LWCA 1Y8QB 4OIQF 4IW3A 4S0HB 2VLAA 1BI3A 3BT9A 1U5TA 3WU2C 2O8KA 1GT0C 1FOXA 1MNDA 3PSIA 3M8JA 5M3MJ 5KCMA 3ABTA 4Q0QA 1OKQA 3B02A 2ZSIB 4URTA 2ZGOA 1GZWB 4IV3B 2NAZA 1W36D 1SLLA 1FSEA 5CB7A 3MKYB 1RYYA 2H1LA 5FYVA 3ZMNA 4CP9B 4K1YA 3WNNA 3TBIA 3SH5A 1HQNA 4RAZA 1ZLJA 2CQNA 4Q26A 4A7YA 2ZMNA 2OQGA 2P6CA 3U11A 1YQ8A 3TEWA 5GZFA 4YELA 3MFKA 1R1UA 3JAMZ 4AHYA 1K12A 5FRMA 5A80A 3B9CA 3VLBB 4A6OA 5T50A 2CG4A 1H1IA 2CFXA 2W39A 2RQPA 3ZMDA 4AAXA 1IS4A 1JJ8C 3Q0UA 2J22A 3ECHA 1NY71 4RB3C 3H3VK 1N75A 1WLCA 4FAHA 2QSFX 2DVDA 3I2FA 1QOOA 3OYIA 4LG0B 4FASD 1O4XA 3ZN5A 4YG6A 1A5JA 3RTRA 2WN3A 3CF6E 5FZIA 1H6XA 4BQQA 4MFEA 4HDUA 2B63J 2WKKA 5CVUA 4WM7C 1OUXA 5K0UC 3S57A 3HSEA 4ATFA 4N0BA 4NAMA 1MH4A 5KHHA 5DM7F 1KQ8A 1W7PD 1SMTA 2STTA 5FPZA 1TNFA 5GTIC 2LD5A 1FIPA 1T6SA 3WG7H 5DG1A 3MIDA 4EV0A 1OJLA 1L3JA 2O0OA 2H0BA 4AVCA 1VBD3 2NMOA 4XFAA 1T38A 1X33A 2V73A 4MQ9F 4DGWB 2EV6A 1ETOA 3WTWC 1YFWA 1LECA 1LKXA 1UZWA 1U8RA 1GV5A 2L5QA 1RUH3 4M3EA 5IFTA 1UXZA 2WNEA 1ZYRF 2HQAA 3J7ZI 2NS7A 3DPRC 2ME0A 2NXNB 3LDBA 2K9NA 3IH4A 2B42B 2ZGNA 2OU2A 2AC1A 1QOSA 3GWZA 3NV1A 3BPZA 5AFEA 5CNAA 1NLQA 3HKZA 5JSOA 4BH9A 4KT5C 3FHNA 1RB8G 1HRV2 3G1OA 3MMYB 4YVSA 2E7TA 5FYSA 3OYAA 5ERLA 2HYGD 2PA7A 4CU9A 2QSHX 5BUVA 4PZJA 2EFQA 3WNXA 1DQ0A 1TLHB 2O8OA 1S29A 2RMU3 3G71I 2HBTA 2V72A 3D5OA 1GP4A 4RS8A 2ME6A 5GZEA 1QNTA 4EQQA 3DV8A 3WTZA 4CDUB 3PVEA 1W6QA 5JVTA 2IS1A 3T3YA 3H9GA 4B8EA 2B9SA 4KU8A 1XNBA 1HV1A 4CCEA 2ZO4A 5T5OA 1Y3TA 3ON7A 2AZ5A 1WH7A 2OC6A 1AYN2 4IQPA 4A3FJ 2YHJA 3I64A 2BQPA 3RPUA 4OMZA 4O65A 4LO6B 2BY1A 1AWCA 4JRAA 2Y2ZA 2QTWB 4JX6A 4Q8LA 2J1RA 1O6UA 4LBMA 4HAMA 3NNGA 3FFZA 3BLYA 1F4HA 1T2XA 4A3KJ 2M34A 2CDPA 1TT5B 4FCYA 4CUAA 5LD2C 1IS5A 2I10A 3HOXJ 2FUG2 4BHPA 2IGKA 2DCKA 1A3KA 5APAA 1FI2A 1IRXA 1R083 2ZA9A 4LA3A 1HDPA 3N97A 3I2HA 2RS11 3NNMA 3L2QA 5IT9Z 1ULCA 1IPSA 1RNLA 4PFOA 5JDBA 5FRNA 2ECBA 3DCFA 2P4WA 4RMNA 3IN9A 3KV6A 4NQWB 1EAH2 2KIFA 1BI1A 4PK4A 4RL7A 1SLTA 2F4IA 2HR3A 1K6YA 2FU4A 4OVEA 5IT3A 2DMPA 3FISA 5CAZA 3SC7X 2HWD1 2F2EA 4IE0A 5C7GA 4OI1A 1QDOA 2RDNA 1CAUA 2ZNZA 1L3LA 3LZZA 5A32B 4CYDA 5J1YA 1C8NA 2E7XA 1OVPA 2A6VA 3PVNA 4JX0A 5F5IA 4A0YA 1TG7A 2PJRB 2M5WA 2QLZA 1D0ZA 3DBRB 3K46A 4DOZA 1PP7U 5BOXA 2G9GA 3PM1A 2QQ9A 3ZQ7A 5FPLA 2M3AA 3KLSA 1S7EA 5C4WC 4FXKB 3PIJA 4IEJA 1FX5A 2MNGA 5C3PA 2YUEA 1MBGA 1PUFB 4C3HJ 2KR2A 2VASA 3BG3A 5JZGC 3D5SC 4N7UA 4RD7A 3LSMA 5ED4A 1F36A 3AZYA 1R5GA 3H8UA 3FKIJ 5J1XA 2IA2A 5FYTA 2XR4A 2K3PA 4KIFA 4XN3A 1VQ4I 3OY8B 1XMKA 2DW4A 1KFXL 2V79A 3KCCA 2CNAA 2RR11 5LLQA 3JTGA 2UWBA 4A3CJ 4RHV1 2YU3A 2ZBKA 4QPIC 2R1BA 3CU7A 3QU6A 3NVCA 2WR9A 1X9TA 4XQWA 2VUMJ 1N47A 2DO7A 2R041 3U1DA 1GBGA 3OEAA 4LBNA 2D1VA 1AU7A 2HVSA 3SZTA 2Q5TA 3MPBA 3KT4A 1JYXA 5KVRA 1E3PA 1QQP2 2Q8OA 4BXSV 3CO6C 4EZ4A 5J1RA 3IAM2 1GVDA 3M4OJ 5KBFA 3VBSB 2B45X 5IOZA 1WZ2A 2JRTA 3SYTA 2ZGUA 2VXRA 5F5CA 3L2VA 4Q4Y2 3B69A 3HQXA 1RJ7A 1Q8OA 3KT1A 5CIRA 5FLHA 1GXPA 4NC7A 4AI3A 2DMTA 4F91B 3KQRA 1UY3A 4B09A 3I2DA 5DAWA 3ASNH 2OQ6A 4M72A 3BTLA 3DECA 4DRRA 4QQHA 4XLHA 1Q3EA 2L9NA 1O5LA 1ENSA 1WKYA 5LK5A 3ZOBA 4FPYA 4ASMB 1P9QC 1XMXA 4I6ZA 5GZDA 2WFF1 5FZ9A 2GXBA 3IKTA 2DTWA 5ERIA 2A1XA 2ZX2A 1QHGA 3ATGA 4X8PA 5IP7J 4L99A 5L3FA 3U78A 1RUF3 1TE1B 1Y0UA 2PAKA 4MV2A 3MEPA 1ZRIA 2VVDA 4AQ2A 1NOVA 4DNCA 3E5XA 1ZR4A 1WMXA 1Q8SA 3EPZA 1JKRC 2FSWA 4JKMA 2WO2A 1OBNA 4AE2A 1KRIA 4HQMA 1Y6IA 2OPTA 2R7TA 3RWKX 1MPXA 4OHWA 3ZSEA 1HKSA 2HWC2 3CP2A 1WGXA 2CYFA 4AC0A 3CO2A 2C9AA 3POWA 5DDJ2 3ZQIA 4D6RA 1R6RA 2OZJA 1QOTA 2NS8A 4JGZA 4Y1YA 4IGPA 1S9HA 4E7HA 3WP6A 1RUD3 2VTFA 5JI9A 4XIKA 5E16A 2O03A 5I0DA 3K70D 3BUCA 1T6BX 2ZX4A 1GUIA 3OOXA 3RFRA 3CCMI 4JDOA 4XAAA 4IX7A 3MLJA 2ZGPA 4HPKA 1SVMA 4UUSB 2ET7A 2VMGA 4XJZA 1JS9A 2DCZA 5C4XJ 4ENJA 4LKFA 4YFWA 5D4SA 4ASLA 2ZJRF 1YJWI 1ZLKA 4IV3C 4E9KA 4UVAA 4FOVA 2D3PA 4AFMA 1R9TJ 4UFMA 4UXAA 3IH3A 3I55I 4FPOB 1V9U3 1OA4A 3C3VA 1OR7A 3SITA 2VE1A 3TO7A 4ONUA 2Z33A 5FAXA 5A3WA 3R0RA 3T1LA 4RLFA 2ZNYA 1VR3A 4XJWA 3ZFEC 5GM0A 4BDVB 1OLRA 2DTRA 2LYCA 1WMEA 5FKKA 4S2HA 5EEGA 5DM6F 5GAEJ 2LY2A 2DUOA 1Z77A 1FNZA 1ULFA 2Y6FA 3KPHA 2Q1MA 3BZKA 4MEYF 4Q5SF 1UG0A 4UW5A 4W8JA 3VYTB 4ARYA 3D4KA 3NW4A 1W8NA 3QP5A 1OC1A 4WK8F 4D7TA 1BIAA 3LSKA 4Q4W3 1HB2A 2ZC2A 3WUCA 5JAXA 3BIEA 4L18B 3ZYPA 1VP6A 1W6OB 2Q2EA 1YIOA 1RUJ2 2PHWA 3K4AA 3K4KA 5GAHJ 1XC6A 3AG3H 3MKZA 1G4DA 1UAIA 1MZ5A 4D3WA 1SFOJ 2QCOA 3MUZ1 5FKCA 5FY9A 4RQPA 3WDVA 4E2SA 3PNYA 1FBQA 2JEMA 3ZQHA 1F31A 2W25A 3C8XA 3GDBA 3NJYA 2XAFA 5FOJB 4MLOA 2M0CA 5FY0A 4CXYA 2WUHA 2EV0A 1JKOC 1Z6RA 1B09A 2J1UA 2VQCA 2VMCA 1RTVA 2R0FA 1LOEA 2WINB 3GFMA 3AP9A 3JRHA 2E34A 4WZCA 4GALA 1ND3B 3SCFA 4E70A 1EYBA 3HPGA 1ULEA 2PTMA 3UT0A 2YPRA 3AL0B 1IRGA 1OUSA 3EUKL 1W0PA 3TOJA 3N05A 2IWGB 3POEA 4JTOA 1O5UA 2VTXJ 1ERDA 1QNWA 5ACA1 2L2OA 4H0EA 2DK8A 3SQNA 3JW4A 5BXXA 3CKHA 1TEIA 1KEXA 5HLTA 4O5VA 2A5ZA 4XUPA 3WDXA 4CDUC 3HBLA 4M3DA 3IC7A 3O1TA 2ZTNA 1V00A 4Y1ZA 5HVQC 2DVBA 3ORJA 2IXSA 1LE8B 4XRFA 2OD5A 1ON2A 4AHWA 2CY6A 1G6NA 2VG9A 4PDWA 2WZR3 2C24A 4FOWA 5FWEA 2L7FP 1A8DA 5T3NA 1V6MA 1ENQA 3LGRA 1H2NA 2X6YA 2OCEA 5AC93 4D0QA 1IS3A 3BPXA 4XCAA 1VBB2 5ICGA 1U5XA 2Q4SA 4KFCA 1XOYA 1YXWA 3FXOA 4ZZDA 3ZP5A 2FCVA 1H4HA 1KJLA 1V5EA 1UYXA 1B72A 2VNVA 3FBYA 5JIUA 1D4M3 2QWWA 2VUAA 4BY7J 4Y13A 1HXDA 4CCJA 5I91A 2WZ8A 3DYPA 3EUHA 4HFSA 2ZMEA 2HPMA 1UD1A 3Q8BA 3BROA 3ZMSA 2RS32 1WW4A 4MG2A 2UURA 3AAFA 3F22A 2QGUA 3THTA 3VBFA 3CMEI 2L9RA 3RZLA 1P8JA 1Y1WJ 3O0VA 4IEZA 2VL4A 1S7AA 2WNUB 5C70A 5D6FA 1OCCH 4BQNA 4QPYA 3K4NA 4QHZA 1PGSA 3LFIA 4KWUA 3OYKA 5EYXA 4KIGA 3T2OA 1IXRC 1KITA 4AM3A 4Y24A 5EG0A 1S2EA 4FFIA 2D40A 1WCDJ 1W8ZA 3J7MA 2VKDA 4MGKE 3TNPB 1T8IA 3S16J 2WS93 1O3QA 2V09A 3PMEA 1FNYA 1EA3A 3USUB 1F2NA 1N1TA 3Q8CA 2RGVA 3WNPA 1GQGA 2CUJA 1YIFA 1RMU2 4BS9A 1YITI 3EYPA 2DTZA 1PZ9A 2IFWA 2N8GA 2JJ6A 4CSWA 2VQUA 1UZYA 5JR7B 1X4OA 4JX4A 1NYWA 2YMZA 2MW8A 2JWTA 1U5YA 4L5IA 2DAOA 1H8VA 3IBMA 4RGRA 5C8CB 2IVIB 2Y6GA 4MQVA 1LHWA 2VBPA 1W1WE 2XPVA 1XC5A 4IOAF 1Q8PA 1MBEA 4AGGA 4XBFA 1C8M2 2HWF1 3I49A 2I2SA 2MD0A 4IEXA 2X6OA 3V56A 4CICA 1GOHA 2DOAA 3F8BA 5FCCA 2RM23 1VB2A 2G4IA 3JRAA 4BDYA 4W6XA 1QZYA 1XG1A 3T2QA 4S05A 1JE8A 4AWXB 4N90A 1YLFA 4E4ZA 1XYNA 2VL8A 2R16A 5CFDB 4FAGA 2BYVE 4EM2A 1DGRA 5FMOS 1PHMA 4CCMA 1Y56A 2V6EA 1ODNA 4WZFA 4B48A 2Y6KA 3QYFA 1JOPA 2ZZJA 5GLTA 3NAPA 2VOTA 3ZYBA 2ID3A 3F8FA 2YS9A 1UZZA 3VBSC 4O7XA 3ISPA 3OMYA 1PDNC 1F1ZA 1FAYA 3OYFA 3H8RA 3AZWA 2DBIA 3BDDA 4KT6A 2R30A 3WQ0A 1FYLA 1F4KA 3C2GA 2VZTA 5FP4A 4RLQA 2EA4A 4GAZA 3AB0A 3WHUA 3T30A 1SD6A 1A78A 3SEEA 5G05L 2DT6A 2YZ4A 1HX6A 1XJAA 1F4AA 5FZ4A 3DKXA 1QJZA 1MIJA 5FKMA 2X51A 4IE4A 3V8LA 2AXTC 2VGDA 1VBD2 1W6MB 2MYSA 1UZCA 4IHWA 3KEOA 2G9WA 1O8SA 1ZBA2 3RSJA 4BK4A 5FYYA 1IN7A 3DCQA 1YX3A 4KGGA 2WAQA 3LF7A 5I8TA 1RUH2 2J7MA 1FOD1 5CG8A 2YV8A 1FP2A 4B4RA 4LBOA 3Q5FA 1BMV1 4N9IA 3ZDVA 1H89C 4MGTA 4XN0A 1TWFJ 3DLAA 2NRAC 5F2WA 4ORFA 2KRFA 4I0BA 4LLFA 3H5AA 3O1RA 4DPNA 1IUFA 4J25A 4LFUA 2ETEA 4QQPA 4D7SA 1NLSA 4KWKA 1K5MB 1BHGA 1AR82 2HKOA 3ZN6B 1JTZX 3SKJE 2MLKA 5A6YA 2E1OA 5K7HA 3K69A 5L3EA 1BC7C 2VW0A 1L7RA 1HW5A 3K2AA 2BW8A 5IYYA 4KMUX 5BNOC 2NNYA 1JBCA 3NWSA 3GZ6A 1HXS3 4ZS2A 2QBYB 2GP3A 4CEWA 3TBDA 2OAZA 4ZZ8A 1GMMA 3M1HA 2JENA 4QPGB 2ELKA 1W2NA 2E33A 1L7LA 4YFNF 2JQ7A 1R49A 2ZABA 1VQNI 3MV01 4XUOA 3L2CA 2QA4I 1U5TB 4YM3A 5KHKA 4ES8A 3B5LB 5C3SA 4OUEA 3DQVC 2OVUA 1ND2B 1V6LA 4B1RA 2KDZA 1H8TB 1PX3A 1QGPA 4U7BA 1FLIA 5C6CA 5JOWA 4F3JA 3C3WA 3QOEA 1UMZA 2QKMB 5IVEA 1PX4A 2GOXB 2WT1A 1POV3 4ZYDA 2JRMA 5A6XA 1RJ8A 1WZXA 3DTIA 3F2ZA 4ESBA 2PHRA 5AIPA 3DGTA 2Y30A 2ENRA 1WJAA 5F6FA 2LUWA 1HRV1 1J3RA 2LVSA 3POIA 4XRSG 1QNYA 3KIOA 4B8XA 3H5RA 3CC7I 2E32A 1G9DA 4NIGA 3NSTA 4XYXA 3WF2A 4Z07A 5BNQA 5FZ7A 1VRH1 2QZ8A 2ZACA 4YYOA 3U9GA 3OSFA 3SXYA 2XAJA 2DA1A 5LK7B 2KJCA 3ABUA 2HOSA 2FCUA 4DXZA 2ZZQA 3F95A 2F48A 1ZQ3P 4KA4A 3F9KA 3CCVI 1C57A 4RA0A 2JTVA 1P4AA 4V2FA 3VHOA 1XSXA 4DUWA 3ZXSA 3AYDA 4YW7A 4IEPA 4J19A 5A7QA 1UOFA 3FXQA 5EQUA 5FPUA 4MGQA 4XOGA 1F9NA 5AIQA 2OYZA 3MI8A 2WSVA 3PO3J 2H94A 3PUFA 1K79A 2ID6A 4BJTA 2ICWG 3LDRA 2BVLA 3KP3A 2LY9A 3V7SA 2PELA 2Q0OA 3M8EA 1JJ6C 3WV6A 5AVPA 3P1IA 3S7EA 4K21A 2XVLA 1F35A 2YC0A 4Y22B 1VBE3 1NUKA 2R93J 2FBKA 1ND3C 4FQ4A 3CLOA 4BMEA 4OYUA 3UGFA 2BRTA 2BVBA 3AL0C 3S14J 5IJRA 4RA2A 3SHRA 2JDPA 1OLTA 4CUBA 2X85A 4QPOA 3H0OA 2P0WA 1JKPC 3HTUA 1BA5A 1HKTA 3H1WA 3BG6A 3VBRA 2B8MA 2XAQA 3DPTA 1EAH1 4CP1A 4OQ9A 3A23A 2QQJA 1OT5A 2B46X 1UAAA 2HFHA 5D5WB 1EV11 2ZGTA 1NLRA 2H8WA 4YNIA 4QDQA 4DEQA 4UW3A 5EGOA 5BNNB 2HOEA 1JT6A 5CVVA 4HN0A 1AR73 1QKQA 3ZLIA 5D21A 4XEZA 2JG8A 1W04A 3CIHA 1I1EA 2P6SA 2R7DA 3X29B 4ZDOA 3HPNA 1W6QB 3WW2A 1WKMA 2WA0A 3V0AB 2W1WA 3G73A 1TNTA 3U1KA 1YQ6A 2C5DA 3CLQA 2ZX1A 2O6GE 5M5XJ 3G6JB 4DYQA 1M06G 1RR7A 1QJU3 3AZXA 2AEYA 2BE5F 2ORXA 2LRPA 1B8IB 1GQHA 3HTSB 1AL23 3BQZA 2JUCA 2FBHA 3CJIC 2NVTJ 4XZUG 1BEV2 2W7NA 2AHQA 4C1XA 4M0HA 3HAGA 3B94A 4YVWB 2JICA 4ZXEA 2BPA2 2Y0SA 4LBQD 1RUF2 3RIRA 2FDIA 3I53A 4AVPA 4XMAA 3GTQJ 2QQVA 1NZIA 5FDBA 1OFSA 2WDBA 2DCEA 3EUAA 1R1A1 1ZGJA 4F55A 4RHV3 2GQQA 1PVC2 1ZA4A 2WNUC 2JIJA 1W9FA 4UV9A 1U9OA 2ZHLA 2R043 4FP3A 3ZQCA 2VMFA 4AQTA 1IV6A 2ET1A 2FF4A 4U0VA 4P00B 4OMCA 1G7YA 2ZPXA 3T1MA 5LGUA 1K78A 4FT8A 1QQP1 1PUEE 3LSRA 3RVHA 1EUUA 4P14A 4BLJA 4W65A 4BU2A 4DBRA 2RV8A 2K9MA 3MUY1 4XF9A 2QQIA 3SZPA 2X53S 2A75A 2DA5A 5TJJA 3E6MA 4FO9A 1RUD2 5A2QZ 4AF9A 2BY3A 1CAUB 2AXLA 4BOWA 1W8UA 5D8AC 1WA6X 2M45A 5BNPB 3FHAA 2A73B 2WSUA 4YW4A 1W6PB 4XSZF 3R4KA 4DBQA 1QEXA 4M9SA 5D1IA 5JHFA 1H2KA 2JA6J 3IP4B 2KIQA 2R32A 4Z6YA 2VZQA 2D3SA 3ZN1A 5F9TA 2R4GA 5E79C 5C8CC 1VF9A 3M3OA 4E8DA 1ZGWA 2ZHMA 2L54A 4CDWC 2M8EA 2J1EA 3P7NA 3QH7A 4EQVA 1OFNA 4R9DA 1Z7LA 4IEUA 5DAVA 3I2KA 5AFBA 3KT7A 2RKHA 2VUCA 1LODA 4RBOA 3OS0A 3AVRA 5HLIA 2XB6C 2R7QA 2EH3A 3LSEA 3E6CC 4QX2A 1SBEA 2BW3B 4B7KA 3AYEA 1TME3 1H1MA 4EWAA 2EIMH 4MO7A 4DXSA 2ZKNA 2PX9A 5DUVA 5DZFA 5K4LA 2M4KA 4LE4A 1U6GA 2VZPA 4KN4X 1G3TA 4KWJA 5FJHA 4CXWA 2Y31A 1R093 3HKZN 3W2AA 3S2WA 3S1QJ 5D6EA 1W39A 2XVGA 4LO5B 2R061 5JMOA 4LR4A 5GKAC 4BB3A 1ZRCA 2ELJA 2HWC1 2P3JA 1I1SA 2M0MA 5FREA 5E20A 3KVAA 4MOAA 2VC9A 2ZXIA 2OKXA 1C5HA 1YWKA 2EFNA 4IHSA 1RXGA 3O0XA 2EIEA 1PZ8A 2PMUA 1SFXA 2P5LC 2OUHA 3U2RA 1UB9A 3GLXA 2ETHA 4IHXA 2JA2A 2E35A 4YZ5A 2WLQA 2E2IJ 2VODA 1JU4A 4M3CF 4CXXA 2NZ9A 1U0AA 4O3MA 3ZQGA 1X58A 3CMAI 1W36C 2DCJA 2ARBA 4JZRA 4KNYA 3VHRA 3FDYA 2K02A 5DUIA 4GRIA 1C3HA 3WQ1A 1KS5A 1XPXA 1D5VA 1JYIA 4XF1A 3B7MA 3EYIA 2M1BA 4JCKA 4N43B 4L9VA 5LBFA 2DCYA 2E53A 1LULA 4HV5A 3C2HA 4M6XA 3POSA 3O1PA 1SDWA 1OKRA 3IAQA 4HL0A 5C3EJ 4LNVA 3VZMA 1OMIA 3JRBA 2VJ5A 4HVOA 5J47A 1ULOA 3Q8FA 3C7GA 4G8XA 1YQAA 5LBCA 3HPHA 2CQKA 4CU7A 2Y26A 5JPNB 3PNVA 3AP5A 3NV2A 2JWPA 2VBYA 2DYCA 1COV3 4JKLA 5B2GB 5FLXK 4ZU7A 2YDEA 4RS5A 1Q8QA 3LQQA 3L09A 1BW5A 2OS2A 1RHI3 5IK4A 3K4LA 1LPQA 3ZR8X 5HCBA 2AR6A 4YIRX 3M8FA 2DOEA 2UYBA 3RGBA 2EIGA 2DA4A 1FSHA 3BOQA 3A0KA 1QXJA 4HRIA 3I3DA 4QPGC 5J96B 3HSFA 1DQ5A 2NM1A 3WX5A 3FXJA 2JG9A 1RVF2 2GAUA 2G19A 3ZKUA 1NAEA 3NAUA 4LJZF 4OHZA 2NNNA 1ND2C 4C0BA 5B1BH 1V6KA 1H8TC 3UYJA 5EEHA 2L9VA 4EJWA 1TWCJ 1LOFC 1J0RA 4PGGA 1AKHB 4XJUA 2QQUA 1D4M2 4A12A 1YRNA 3OBRA 4PI0A 2GALA 2XHNA 5ABJA 2XUEA 1J09A 3M70A 1LR5A 3CDIA 4E27A 1JHHA 4AEMA 2PMHA 5L9VA 2WZEA 3CCLI 4J01A 3LEKA 5FV3A 2ARCA 3HJRA 3U1XA 4CDQB 3DU6A 2EV5A 1X3WB 3SCGA 4CU8A 4L11A 3RQ4A 1DUXC 2YC2A 5ACA3 3RS6A 5JOZA 1G9AA 3DTEA 2GZWA 1OSGA 4J6GA 5CG9A 1JUSA 3K48A 1PK6A 4MIMA 1APLC 2ZX3A 4TSVA 1WSUA 1NCRB 3FMRA 3IPVB 4KBBA 2DVFA 2JX9A 4ANJA 4CDXA 5J36A 1MS1A 1YC61 4A0XA 5D4RA 4JGYC 4M00A 3JCIA 1JHFA 2Z4FA 1S0FA 3POBA 5HODA 5A33A 2XXZA 1DZTA 4TTGA 2WS92 5H9PA 4Y1UA 3LSJA 4E4DX 2W00A 2Q2EB 2P4EA 2WYFA 4AI1A 5H20A 5CYVA 4NJ4A 3S15J 1UY2A 3VB2A 1TMF3 4JV4A 4OIRF 1FMD1 1VBB1 4LPLA 2VZRA 1MW7A 1WCUA 2Q8EA 1TQMA 3W21A 3A0BC 1HW2A 2TRTA 1DZRA 4K3UA 3FUQA 3HL2A 1TBXA 3RZMA 1MMNA 1XYOA 5EV7A 1SPPA 1MEC3 3K2OA 1NE4A 1LJ7A 3PIPF 1XDSA 2VIXA 4CZCA 3USSA 4FTHA 2XPWA 3TEZA 4CVUA 3OPWA 5B3SH 3MD2A 4IE7A 4LB5A 4A3BJ 3DEWA 2RM22 3AFHA 4F3QA 5E18F 1MSFC 4BMBA 2C6YA 5L7OB 4BUPA 2DDUA 1JI8A 3D8CA 3ABKH 1MVEA 4KN7X 4SLIA 2VOXA 1SAXA 1Y1VJ 1KU7A 1VQ6I 4ARXA 1SG3A 2FDHA 2EIKH 2D6KA 4M3GA 2FDFA 4HEA2 4EGYA 1C0WA 5A7NA 5BNNC 4AEKA 3S1RJ 1AZDA 1ZBE2 3AFKA 2MHFA 1NA1B 3TQNA 5LBEA 3AZVA 1DU6A 1ZNPA 3E97A 1O59A 2LR8A 5FPBA 3A2KA 4LK0F 2R7OA 3VD9A 4PCQA 1X7NA 2EZLA 1N25A 3KM5A 1UFMA 3CC2I 3T0YA 1HDKA 4PDWB 2Y6HA 1H0BA 1RMU1 5K9YA 4LIUA 1SCSA 3D0JA 5C44J 1D2QA 4MHRA 3GZ5A 1IKQA 2DPDA 3P5JA 3P5BA 1J75A 5CADA 3BPSA 3N9LA 5C3RA 5LY2A 1VI0A 4XETA 2RN7A 1XE8A 4YVWC 4XKCA 2ZJ2A 4AG4A 1FC3A 1B72B 2RC4A 2WWYA 1C8M1 4RGAA 3H8OA 2ZMEB 3A02A 2BGCA 4BY1J 1WGPA 2OV7A 3Q0VA 2ACJA 2OQRA 2JSCA 1J1LA 3MW2A 2Q8CA 4AVBA 2YC4A 1TTYA 4GFBA 4HF1A 4YRVA 4BL0B 4ZTFA 3GYHX 2DPUA 3MIBA 5KAIC 1XNDA 3PFYA 5TSWA 1MS0A 2F4MB 3K4JA 1UMQA 3HDDA 3HJEA 4N53C 3G2BA 2E6VA 4XORA 3L2YA 1US3A 4KBZA 4XLEA 4BQOA 5D5XB 3HT1A 3T5XA 3OUHA 3KGLA 1FTZA 4BEHB 4Y33A 1N3QA 3VD7A 3N9OA 3SEPA 4P5HA 5BNPC 3DYOA 1QJX3 4CA0A 2CV1A 2AUYA 4I2OA 4CCCA 2R0QC 1D0GA 5FZOB 4CEYB 3KCYA 3KYCB 2XSJC 1WQ2A 1XGOA 4EEFG 1D5YA 4GULA 4ES9A 3H0DA 4LMYA 4C30A 4Y26A 1Z3XA 4B3AA 1XQNA 4AEDA 4QT6A 2YX4A 3RZDJ 4CYCA 3JSPA 1GNHA 1VBD1 5E89A 4PBOA 1AXYA 3TEXA 1IRFA 3W3CA 3WSOA 3ZXJA 5FRAA 3HOWJ 4CPBA 1IG7A 2V7FA 3H0GJ 1MZEA 2LALA 1R64A 1RUH1 3F21A 3VZJA 3AMMA 2E19A 2R5YA 3WU1B 5H2FC 3CTAA 4QHBA 1HKQA 3MF9A 5IWFA 2VCCA 3CF5F 4NHMA 2WADA 2HZTA 3N7MA 3BCBA 1YUDA 4JK1X 5J4VA 4BHBA 2B9UA 1S0EA 4GB32 2WAOA 3ZSKA 3VZNA 4EJVA 4BXFA 1Z78A 2LBFA 1CPMA 4D0PA 1OFCX 4L92A 4NHXA 2MLGA 3VEPA 2BUKA 3Q9OA 1WW6A 3POGA 4NRMA 4F92B 4NHLA 5HV0A 2HH9A 3U4SA 1VZ0A 5D8LB 2FZ1A 2UY9A 3B93A 1UZVA 2RMU1 2XRLA 2ECCA 2F5FA 3B3QE 3R6SA 3HM5A 4QXCA 5HV4A 1SD7A 3IB3A 4L9TA 2FJ1A 4UW6A 2ZBJA 3F0CA 1MS5A 1DYKA 4PJMA 4W97A 5J6XA 4KYWA 1VQOI 1RC9A 1ZRDA 2YU1A 5J4YA 4N43C 3LPGA 3RDIA 5H9RA 1MD0A 1RGSA 2HXIA 1JH5A 1I39A 1LNSA 3VZOA 2J1TA 4AAPA 2TDXA 3Q8EA 3FKJA 4XIDA 1ZZ7A 1EKEA 3FZVA 1HA8A 5H9SA 2GC2A 4BNCA 3IUOA 1P6RA 1LQ1A 3KP5A 3BIWE 5FLIA 3I0TA 5J40A 1T2KA 3R60A 5LZ6A 1GANA 3PVBB 2LK2A 2RDQA 3UNGC 1TWGJ 1BK0A 2EQRA 2O8XA 4MSVA 1R4MB 1R081 2IRFG 5F8PA 2FD5A 1CONA 2B5HA 3LA7A 1A6IA 2BFUL 1XTAA 5JR3A 3PU3A 4P9WA 2UU8A 3S32A 4U87A 1HRV3 4PIXA 4PLMA 2GN7A 3RNSA 5FYIA 4YZ1A 1EH6A 4PHZA 4JHZA 5FYBA 2YFUA 1H1AA 2XKOA 2HDWA 3ILFA 1AR62 3LOIA 3CJRB 3PTYA 2D3RA 1YFXA 2DFBA 6PAXA 4PJ0C 3QODA 1MS9A 1Z67A 2VPVA 3QACA 1IV8A 1AR72 2M2EA 4I0WB 5BYNA 3O1VA 5E3LA 3MVPA 3OWTA 4GMP3 4KIBA 5LATA 3KP4A 4JAAA 2DUPA 1SFPA 4XFIA 1HRI2 3F8MA 1AYN3 5IW0A 3HEFA 3IHUA 1YTYA 1AF9A 3I2IA 5JLVA 3J7AO 2IAIA 3VZLA 4Q4V3 3VKLA 1EJ9A 1K5JA 5TGTA 4BWOA 3AZZA 3WNKA 2KDOA 2A5WA 2M9HA 4A3GJ 1RUOA 1SVOA 4UFKA 3AG1H 2R7SA 4BE2A 1OLMA 3GMEA 4NAOA 1X82A 4Q4X3 1YIJI 1J2XA 4AYUA 3ACGA 3ZXAC 4BKXA 4QPWA 1DLLA 1DG6A 4FPKA 4CDQC 1CQ9A 2D43A 4BISA 3EJKA 3FHQA 1CAXB 4XC9A 4UI9L 3SDBA 3HOZJ 3ZPOA 5FYCA 2CTVA 4C8DA 5M3FJ 1H2MA 2DCTA 1K6OA 5HNHA 1DGRN 2LROA 4JBAA 2KA3A 3GTOJ 4G12A 5JXIA 1NCRC 4AFBA 4COZA 1VQMI 2GC3A 4AVAA 1PVEA 1TC3C 4I3PA 2L02A 1IQAA 3JUUA 3JRCA 3PUIA 4PCRA 4UAPA 5I93A 3EETA 2C4XA 3K2ZA 3HN3A 1ZRFA 2GSYA 2COMA 1PM4A 1W9TA 2AS5F 4NIIA 3MFCA 3OBZA 2QUFA 1WHUA 2L7MP 3CCSI 2QE3A 4M6VA 2RS52 1OLME 5FZAA 1U12A 2PQ8A 3WG2A 2VAUA 4BGDA 2NN8A 4JTNA 3NNFA 1J5YA 4A6SA 3U0ZA 1U78A 3QYEA 4C90A 2DXIA 3H1YA 5A7SA 2WAQN 3RZKA 3WE2A 1BEV1 4UT5A 1BOAA 2X6XA 1OYYA 3URFA 1R00A 3KGZA 2YFZA 3QCWA 2GNBA 4BQXA 3LSTA 1ASJ3 3MAJA 1B1BA 1PO22 1DGWA 2ELHA 1S4CA 2X4HA 2P1BA 2EILH 1RUF1 3TAYA 1TME2 2J1VA 2F17A 3OSGA 5L7OC 1CR7A 1ODDA 3U37A 1PVC1 1W3VA 2GN3A 1OXCA 3WTUC 4C91A 4HLTA 4G7ZF 4YZ2A 3BB6A 4UWDA 1F5FA 4GD4A 1MZBA 1XB4A 2E7AA 2Q8KA 4Q0SA 4W4ZA 2ESHA 3RKWA 2KHMA 5D5UB 3VBRB 2QQBA 2BXZA 2MC3A 3MFAA 1D0YA 3V8JA 4BJ0A 4M3BA 1J3PA 2PQSA 3FN9A 1NA1C 3ASIA 1X8MA 2PAMA 2Q1FA 4Q4Y3 3MHZA 3OIPA 4Y1XA 4N9HA 5EGOB 1RUD1 1ETWA 2DFEA 3E5QA 3SMHA 4E6KG 3CHXA 4D5CA 1FIAA 4XBNA 2W82A 4FFFA 1ZM1A 3LNQA 5F5AA 2QZ2A 2RJKA 1CPNA 4DOUA 2XLAA 1KGSA 2CQXA 1KYZA 1ULDA 1MBJA 4Q29A 3BGAA 2ZKZA 1FJLA 3SISA 1ZX5A 3WDYA 2YPDA 4LXLA 2DUQA 2VZ3A 3V42A 2JDYA 3DXUA 2VJIA 3LOBA 2GLOA 5C71A 1AYM3 5EZHA 1GNYA 3IAPA 2KZVA 1WMDA 5K7PA 4X8NA 1SFEA 5EJZB 2VKVA 4CCOA 4PJJA 2D1HA 2QDNA 2K40A 4FE4A 1O57A 2I45A 2QVSB 5FFOC 1COV2 1MBFA 1UPSA 2R49A 4W1UA 1ODMA 5DUKA 2HWC3 3MIHA 3QP6A 4A5MA 4XL9A 1UOJA 2FBIA 4NPRA 4XF4A 5DDJ3 2FDKA 2J5PA 4YGBA 4WVVA 2LM3A 1RHI2 3PSFA 3Q9SA 1CIWA 3FMSA 3VSLA 1R1TA 3W6JB 3L2HA 3QRFF 5HS7A 1CAVB 3CD6I 1VMJA 3W6VA 1ZGAA 1SANA 4R79A 3AXEA 4U2AA 3K3NA 4CEYC 2PHFA 2F5VA 2A6YA 3T2TA 4H14A 1C1FA 3OYDA 1I6XA 4IRHA 4H55A 4COWA 2Y60A 3PUHA 3OR2C 1ULGA 1UOBA 3WCSA 4NC8A 1RUI2 3WZ1A 4AVTA 4GCVA 4NUBA 1LHVA 3PQJA 3AMQA 2A6XA 1I3AA 4F8AA 3M07A 4M3CA 5A7PA 2XOMA 5F0HA 5EJ3A 4OHVA 4LHKA 1T95A 4IGQA 3D5RC 1DP3A 4OI0A 1XBFA 5F6KA 1HCRA 1JZ6A 3UJQA 3KSCA 3VZKA 1VIWB 2L7ZA 2WO3A 2DBNA 2JD4A 3I3LA 4NR1A 3UGGA 1JXNA 3VKOA 1IDZA 2Q0AA 3G7DA 1LU1A 3G4SI 2FQ4A 4XK4A 2RAEA 1I50J 2CWMA 3RJPA 3TDZC 3F23A 3G1MA 3H3ZA 1VPHA 1C5IA 1W9YA 2ARAA 4C2UA 1S0BA 5FZGA 4HONA 3OTFA 4QD2A 2EK5A 1UU5A 5FXVA 1LHOA 3W5MA 5DZEA 2XWBB 4BJ5C 1VMHA 1S0JA 4IERA 3VD3A 3WXPA 1RUE2 4NOTA 1Z91A 3LAPA 3HG9A 1WJCA 1RUJ3 1U2WA 4YIFA 1OD5A 3GM8A 3VL8A 4AQSA 4EGZA 5K8SA 4M3CE 3AYCA 4HQEA 4OZXA 2PLV2 3JQXA 4XFBA 2BERA 4NHJA 3NEUA 4IV1A 2WZR1 3LSPA 1A04A 4PIZA 5I0TA 3T09A 1IN6A 3K4BA 2CQQA 1GUUA 2G7HA 2XWJB 2GM4A 2QQMA 1QZZA 2HWE2 1LKNA 5AC91 2A71A 1FPN2 1Z3YA 4UFLA 2WB1A 5E88A 2BY2A 3LQRA 2CGNA 1W2TA 1JYVA 3FMQA 2OX0A 2GMEA 3N7KA 4RB1A 4CCNA 3AFGA 5IT9K 2VJJA 2W1UA 4YW5A 1MEC2 3NJZA 5ICCA 3O12A 4A3XA 1JTXA 3DEMA 4YW2A 3IRQA 1D4M1 4COUA 2YROA 4YM0A 5C4WA 2Y0SN 5I0SA 5LA2A 3HRTA 3J26N 4AW7A 2EFOA 2XBO3 4IZZA 3H9JA 1X2NA 5FP9A 5JZGA 2VE9A 1PJRA 2VO5A 3WNLA 1NQJA 3I56I 4I0AA 3GCMA 4DNYA 1SD5A 2OF7A 1V4RA 2R7VA 1FPQA 3TL4X 3NNJA 3FUOA 2E5ZA 4EROA 4XLCA 1P7JA 2JDAA 4A7ZA 1MGTA 1YW9A 1MSEC 3IIIA 3UK9A 2ZXJA 4G6QA 4UFHA 3LA2A 4RS5B 4P02B 4NHKA 3JB8A 4YW6A 2ZXWH 3HNBM 1OQEA 2VW2A 1NTCA 1O3RA 1DCSA 4QPIA 4AHXA 1SFUA 4Q47A 3A4UA 4TLGA 3GJBA 4KMFA 3TEYA 2VULA 1UHMA 5A7WB 2MA3A 2K4JA 3PUBA 1K45A 4QB2A 3JBG2 4AR2A 3EYYA 1X19A 2WS91 1PO12 5C3QA 2W91A 1UY1A 2Z9OA 1HF0A 2GNTA 4L9BA 4PF5A 1RUC2 1S6LA 5GZGA 4OUMA 2PN6A 1GHCA 4QB1A 4Q5OA 2R7XA 3HNYM 4PF1A 2VJ4A 2E1NA 4K8FA 4C0HA 3WINE 4CA9A 3RQIA 1UL9A 1RESA 2Z99A 2EBIA 4BHCA 1E57A 4IO9F 4HVRA 1FP1D 5CA6A 3FL7A 2JA5J 3RJRA 1G2HA 3W5NA 2VE8A 1KFUL 2KP6A 2BDRA 2RS33 2W87A 3JRFA 4Q4ZF 3VBOB 2IGMA 1PNGA 3OGSA 2VZVA 4O9GA 4LKDA 2LSOA 1YRNB 1QJEA 3LFMA 5ABJB 4FQZA 4AQ6A 2RM21 5HDKA 5K5QA 3ECOA 5KR7A 3OPZA 2R7FA 2WY8Q 2R5ZA 3MQ0A 1AHSA 4KITB 1J1TA 3GHNA 2YSRA 1DLCA 3HQUA 2FHRA 1X1AA 4HYEA 2MG4A 4Y5TA 2KL4A 3GZNB 4YM1A 2Q30A 2KFDA 3BTJA 1IW7F 5FMBA 4WBBA 2WO7A 2DTYA 5C5UA 4X0GA 4LE3A 2IP2A 3VDDB 2CSGA 2WRAA 1EY2A 5CU1A 4LLLA 4K7JA 1VQ7I 2P6TA 1LESA 1USTA 2PHDA 5LA0A 4G7HF 4CP0A 5A33B 4QB6A 1QJX2 2X8KA 4PLOA 3UESA 2A68F 4FTEA 1ZTRA 1RMU3 5F64A 5A3UA 1WWXA 1LDJA 4XJ9A 3KP2A 3BOWA 3J8F3 4XFFA 1E5IA 4QGMA 3EMRA 1RUG3 5A3PA 2A3YA 4ZDLA 5E3MA 3PLQA 2VMDA 2OJED 1X1CA 5L3BA 2RV9A 2VQ0A 2ZFUA 1C8M3 1I27A 1KU3A 4GIQA 2MEV3 2QQ8A 1GZWA 4IV3A 1FMWA 3LA3A 1AUYA 4A5NA 3QLQA 1CF7B 4IHVA 4U0YA 1SPPB 2XAGA 5EEAA 3WGIA 4CP9A 3UETA 4D9JA 3W9AA 2HYKA 2Y6LA 3ZPYA 5HOOA 1ZAOA 2GH2A 3ABMH 2XB0X 5F3CA 2IS6A 2KRCA 3BALA 3VUOA 1LHNA 1X2MA 3KFWX 4LO8A 1JUHA 3VBRC 1A35A 3ZFEA 4K20A 1MQTB 4URAA 1W5TA 3DN7A 2LG4A 4AI9A 3ZSJA 2X9DA 5BPIA 1I5PA 5J8FA 2W47A 3ZYRA 2J5OA 4XKBA 3S2DJ 3ZFGB 4M3FA 1O7FA 3V0BB 4DFSA 1Y39A 2P7VB 3OV8A 1G3YA 1HDDC 2DU0A 5DDGA 4RAGA 2HYFA 2Z1DA 3CCRI 2G7UA 4HNTA 2O8QA 1XX5A 3VWBA 2HWB3 3PL0A 3T4HB 1HXS1 3HHHA 2HXOA 2HS5A 3AK0A 2PLYA 1IPJA 2V4JC 2XQRA 3RI9A 2CJJA 1ZBA3 2NYYA 2FA5A 1JU3A 4MFDA 2CW7A 3C1DA 1ULPA 3GVAA 4FETA 1XNKA 3CDHA 4ZU5A 3KZ4C 4DW6A 3BCAA 3TYJA 1R4NB 5JLXA 5JPMB 3S1NJ 1FMVA 2N7GA 3OEBA 1YFUA 1YIPA 2GIZA 4CZSA 4ISRA 2VQTA 3TEDA 5LA1A 3IDBB 2E9QA 5DMYA 1POV1 5E1WA 2VPRA 5GZCA 3M3QA 2VCBA 3MDPA 1XU2A 1JTYA 5HDNA 5FYZA 2JXAA 2C1FA 1AR83 2H0VA 4XBQA 4HV6A 3ZCOA 4NRQA 2Q1ZB 1MS4A 3H1CA 4PUSA 4Z8BA 1DQ1A 3ES1A 1LEMA 4IGOA 3WODF 3TKYA 4FTSA 3GUDA 2ZGLA 5F08A 1Z21A 1YX5A 4HBLA 2JE7A 2ZOEB 5A1LA 4ZYGA 1S2KA 2KT0A 2ZEYA 4ZDPA 1W6NA 1L7QA 4ITCA 3I4MJ 4YM2A 1QVTA 4YG0A 5C9AB 2WNOA 3KX2A 4EN9B 2F4LA 1S0GA 1YW7A 2NVXJ 4V2VA 4X6RB 4GYIA 1NG6A 4QM9A 5J8CA 1JHNA 2VXJA 3I2GA 4MGSA 4Q4V2 1OCZH 5FZKA 1PMIA 3D0SA 3ZYFA 1DGLA 4AEDB 2IXHA 4R8HA 4JRLA 4XZPA 5A3NA 4L5JA 3KMHA 4LIVA 4B4QA 1DP0A 1E3HA 4Q4X2 5FQ0B 3JXSA 1DPRA 3GZAA 5A3OA 4BLIA 5LFAA 2ZFWA 1VBE1 3TDUC 3LEGA 4DQ2A 2R5YB 2XF6A 2FOKA 5IP6A 3HOVJ 4B4CA 4LK6A 3HB9A 4QKFA 3OOPA 3JB4C 4ZH4F 1BQPA 5FP8A 4WXDA 2DMUA 3OL4A 3BJ6A 3S30A 1JYWA 1LGCA 4HW0A 4YW1A 1T33A 1FYUA 2QEXI 3AVSA 3UJOA 3BPVA 1Q56A 1G9FA 2GU9A 4NQWA 2L0KA 2ZKLA 3VBHA 1UQXA 5GADJ 2ZGSA 1BKZA 2D45A 4GXLA 3AP7A 3C7HA 5FZEA 1V6OA 3RMXA 2QQNA 2BGOA 5EF6A 3ZXFA 1AR71 3IIAA 3KWVA 1NQDA 4LO7A 3Q3SA 1TWAJ 3ZXEA 5L36A 2ZGRA 4YEJA 1Y8RB 3MF6A 5A32A 1KJRA 5FLXZ 2IGNA 3TNQA 1KZHA 1D4VB 3D82A 2CHHA 4E7JA 1H9TA 2V4AA 5FK7A 2OPKA 1QJU1 2PJRA 4OUSA 1PGW2 5FUNA 5CVJA 5I0RA 1AL21 1DQUA 3WQ7A 3CJNA 3A21A 3OBTA 1QQIA 1KQRA 1BBT3 5FZFA 3OG2A 1RUNA 1NCQC 2BJSA 3FXKA 1PUFA 5T5LA 1B6AA 3RPUD 1ASJ2 2RQQA 1H30A 2VBDA 1TNRA 4HKWA 1KXGA 2YR2A 5FP7A 3CBNA 5FZ8A 1JUMA 1IS6A 2AYHA 4LOTA 1WJEA 2XF5A 5DG2A 2P8TA 4AWDA 3OY8A 1LTEA 2IVJA 4UB6C 3MZHA 3AM2A 1MH3A 1W8OA 3TMOA 5GLVA 4ZZLA 1GV2A 1G3WA 1T0FC 1LGNA 3MN2A 2XAHA 3AJZA 4U88A 1CESA 1QXRA 5HI0A 1SLIA 2P3IA 1VNDA 5FKLA 1Y9MA 3DPUA 4PJLA 2I5UA 4JKKA 3HR9A 2K9QA 1VMFA 3VBSA 1MKMA 2OUJA 1SDDB 2HWD2 2G9ZA 1E5HA 2FCTA 2IPQX 4Q0PA 4QXHA 4A42A 1PGL2 4F7ZA 1G86A 2W95A 4AL9A 1GSLA 2QVOA 2EPFA 1KS4A 3VD5A 3MICA 2QUOA 2HBUA 1QH6A 1X50A 1BEV3 4C3JJ 1OCTC 1C1LA 4LUMA 2Y75A 2WAAA 3ZOIA 1B35A 1UMHA 1CX1A 4V19K 3I4IA 1T56A 3SH4A 3FFQA 2DODA 3KV5A 1MZ6A 2A6WA 3VBOC 3WD5A 5LA9A 3RG0A 2XC7A 2VOWA 2R1DA 5FPXA 1N3OA 2QF7A 1AYM2 2JDNA 3O1OA 1PVC3 1OPMA 3AG4H 1TME1 4PSXA 3SEZA 1BW6A 3AYAA 4MGYE 1R1VA 2B7YA 1SACA 5FZHA 2JT1A 4UY8I 2M4GA 1MJBA 2CUEA 2VT3A 4LK1F 2VNOA 2Y33A 2HLEA 2XH6A 3SXWA 3CUQB 1R091 2W9XA 4EWDA 2XJSA 1YQ2A 1D8JA 3VDDC 4CTEA 4R9BA 1I6HJ 5A7OA 5JLWA 2LNBA 2RR12 3H7YA 4P08A 5A3TA 2K86A 3VN4A 1ONAA 4LITA 3VBUA 3HGYA 1BBYA 4A7KA 1NKGA 4GH4B 4Q2FA 4OHYA 3L00A 3CCQI 1IXCA 2SLIA 4B3XA 2VQAA 3RPQA 3IKVA 5KHJA 2DBBA 3QQAA 3V4GA 3S3MA 4P5YA 5BNOA 4XLPF 2ZMKA 3TN93 4GWIA 3GYDA 3WG4A 3DEUA 4A2UA 4Q48A 4XXPA 3F72A 1V70A 2ZAAA 1WCMJ 1BL0A 1W0TA 1B59A 2A6TA 2JUGA 4INDA 4P9JA 1RETA 4FFHA 3W2VA 5