5IATA

Mechanistic and structural analysis of substrate recognition and cofactor binding by an unusual bacterial prolyl hydroxylase - apo-bap4h
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
206
structure length
206
Chain Sequence
KEQTIFDHKGNVIKTEDREIQIISKFEEPLIVVLGNVLSDEECDELIELSKSKLARSKVGSSRDVNDIRTSSGAFLDDNELTAKIEKRISSIMNVPASHGEGLHILNYEVDQQYKAHYDYFAEHSRSAANNRISTLVMYLNDVEEGGETFFPKLNLSVHPRKGMAVYFEYFYQDQSLNELTLHGGAPVTKGEKWIATQWVRRGTYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Procollagen-Proline Dioxygenase
publication title Bacillus anthracis Prolyl 4-Hydroxylase Modifies Collagen-like Substrates in Asymmetric Patterns.
pubmed doi rcsb
source organism Bacillus anthracis
total genus 58
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5iatA01
5DAQA 2A1XA 4KBZA 4BQYA 2Y34A 4Q5OA 3OBZA 3NNJA 2OPWA 3ITQA 3HQRA 4XC9A 5IATA 4BQXA 5HV0A 5ERLA 5LBEA 5A3UA 4Y5SA 4UWDA 3KT1A 2FCVA 5L9VA 3OUHA 4XABA 3BVCA 2JIGA 5EPAA 5C5UA 5HV4A 3GZEA 5DAVA 5LASA 2FCUA 2RG4A 4BQWA 4IW3A 3W20A 3KT7A 2RDQA 5LBBA 2RDRA 3NNLA 5LB6A 2RDNA 3MGUA 4XAAA 3NNFA 4MHRA 3W21A 5DAWA 5M0TA 2FCTA 4MHUA 5IAXA 3DKQA 4JZRA 4NMIA 2RDSA 2G1MA 5C5TA 5DAPA 5EP9A 4XCAA 3NNMA 2Y33A 2G19A 3KT4A 4NAOA 3OUIA 3PL0A 4J25A 4XCBA 5LBCA 4NHKA 5LA9A 2JIJA 4NHXA 5IAVA 2V4AA 4Y5TA 3HQUA 3GJAA 4ZPIA 5EQUA 4XACA 5L9BA 5LBFA 4NHYA 5DAXA 2HBUA 5LATA 3OUJA 4NHLA 4ZONA 3GJBA 3EMRA 2HBTA 5L9RA 4NHMA
chains in the Genus database with same CATH superfamily
1ZZ7A 3IMMA 2AUYA 5J37A 1YUDA 5EWSA 1RJ7A 5ANNA 5FPLA 5FZCA 3T2OA 5BNNB 4O7XA 1SG3A 3A23A 3AMQA 3OY8A 4PQQA 2WS92 3J7NA 1EPWA 4Q5OA 2QJVA 3NNJA 1EYBA 4V2WA 2JEMA 1BEV1 2ZHLA 1XC6A 4C0BA 2MHFA 3VZOA 3S57A 4AQSA 1WKYA 4XMIA 5JZGC 5T5OA 2VG9A 2VGDA 3ST7A 2ZEYA 1VAVA 1JOPA 4NOTA 5FZBA 1JOJA 4QB1A 3S0MA 2Y6FA 5DG1A 2QQMA 2E9QA 4FOVA 5BV6A 1MZ5A 1TG7A 3D4KA 1TME2 3FX3A 3VBRA 5DUUA 2OQ7A 4BLIA 1LCLA 4XJ8A 1YJLA 3TEXA 1JHJA 2DCZA 4HSJA 4Q0VA 4NIIA 4BXSV 1W9WA 5GLWA 2BQPA 4DUXA 4DY3A 2FHRA 3PVOA 4FQZA 3N9LA 2HWE2 1W8WA 1AYM3 3OGJA 4XQ4A 3ZXDA 2WFF2 5IFTA 3ACLA 4NE9A 1D7PM 4XILA 5FZ1A 1GUIA 1W8ZA 2CHHA 4IESA 3SKJE 1YQ5A 1RUC3 1FX5A 2E33A 4YM3A 1K5MC 5E89A 1CAUB 4LJHA 4M0HA 3FN9A 3THPA 5EZWA 3T30A 1J3RA 1V6MA 3VBRC 2XJQA 5FZOB 1U0AA 4F3JA 3AZVA 5DUWA 4BXFA 4I0WB 4M3CF 3J26N 2AZ5A 3AJYA 3GXUA 3IPVB 1OA4A 2J42A 3JQWA 1OSGA 3LFMA 5FY0A 4Z2AA 4ZZ5A 4ZXEA 3H8UA 4QMAA 4SLIA 1O4YA 2ZOEB 4Q4X1 3PUIA 3EXUA 4X6QB 1Z78A 4GB33 4XUQA 4D7SA 3PTYA 1IQAA 4RR3A 1RMU3 2TBVA 1D0HA 1POV3 5BNPB 2G4IA 1NZIA 4LO5B 4MGSA 4CP0A 1W05A 2PLV1 3L9JT 4Y22A 2NQYA 4Q4V3 3AKSA 4Y20B 4F83A 2HJIA 1X9PA 4XCBA 3IZOA 4Q4Y1 1ZRRA 4AXOA 3B94A 1UZ0A 4FOQA 2AH2A 2JIJA 1WGPA 1H1MA 2IWGB 4AQTA 2FDFA 5FZDA 5LK5A 1W8NA 4LORA 1VRH3 1XU1A 2WZR2 1W8FA 4Y5TA 1C8M3 1PGW1 2GP5A 2LRPA 3NMBA 4PBPA 2JG9A 1EAH3 1ST8A 1W2TA 1BVP1 2PHXA 4RR3C 4DUVA 4QXHA 3VBUA 2EIGA 1DLCA 1VBD1 2D6OX 3OOXA 2W39A 4DFSA 4DXZA 1A78A 1RUJ1 3VDBA 3WT3A 4B7KA 4OI0A 1PO23 5E6HA 1ZZBA 3IB3A 3PVEA 1RUG3 5DZFA 5A3PA 4XPVA 2YPJA 4TTGA 1XPWA 4L99A 3EHKA 2Q5TA 1ND3A 5JDBA 2CSGA 3GZTB 2WS91 1VBA3 4META 1OURA 2PAKA 4AHWA 1CD3G 1REDA 4ISQA 1LHOA 4GQ7A 1GKBA 2JG9C 4CCEA 1HRI2 4HVRA 1DCSA 4H7MA 2GMPA 2GMMA 4YW7A 1VLNA 3VBUC 4JGYC 5JMCA 1BKZA 1SCSA 3BTYA 1PZ8A 1ZREA 1YFYA 3LA3A 1AR92 4RD7A 1VBB2 3B00A 1NKGA 4YZ4A 3ZFEB 1I6XA 2ZMNA 1GP4A 2EXHA 2GC1A 4L8QA 1W3VA 4Q0QA 3RJ2X 1W6PB 3VHOA 1TME1 2BU9A 3K75B 1W8UA 1ND3C 3ZYBA 3ELNA 3LA2A 2Q4SA 2RS12 4DIQA 5B2GB 4JVAA 1CVNA 4Q29A 1DYPA 1HN0A 3HN1A 2P3JA 4H7LA 2PXJA 3ACIA 3C8XA 4TN7A 1W9SA 3NVCA 4ARYA 1B35C 2E6VA 3KVAA 3LB9A 5FOBB 1H9PA 1EY2A 3PUHA 2D93A 1HN1A 3TYJA 1BK0A 4OYUA 1N3QA 2YFZA 4NRMA 3LEGA 1GOGA 4XHBA 2QQPA 1NCQA 2WIIB 2JICA 2XWJB 1GNYA 4KWLA 4H14A 3LFIA 4RSUA 1NE6A 1W39A 1XRUA 2DVFA 4BQ2A 3GALA 1SLAA 4CUBA 3NV2A 4KG8A 3ZSEA 4OMDA 4ES8A 1Z0HA 2IFWA 1CX1A 3UV9A 2C5DA 4IW3A 4NRQA 2XUEA 1ENRA 4CDWB 3SXWA 4FPKA 2ZAAA 4GWMA 1YC61 2RDQA 2VBPA 1XNAA 2ZGKA 3HEIA 5A3LA 5FP7A 1RUI3 4LHNA 3AVRA 3HJRA 3ZX7A 5FQ0B 3OPTA 2ENRA 1UOJA 5H9RA 2WO1A 4S2DA 4MGKE 1NCQC 2EXJA 1WA4A 1NAEA 1ZZ6A 2EVXA 2VUDA 1WLTA 3KVBA 3BB6A 4W8JA 4GWNA 5BYNA 2D43A 4EZHA 3H0OA 3N7LA 1OA2A 1O4ZA 2DFBA 2NPIA 4XFFA 2VCBA 2XHNA 1VRBA 3I3QA 3PURA 4XXPA 2J1AA 1FMD3 2QFEA 3HN3A 3I7DA 4Z07A 2O8OA 4GALA 3JU9A 3RMYA 3TOJA 2ZHNA 1QMJA 4E4ZA 4QPWA 1JBCA 1UX7A 4H55A 4A7YA 1ENXA 3GYDA 4QPIB 1H1IA 2EIDA 2OUHA 1JS9A 2ZEXA 2OA2A 2JDUA 3PDQA 3QLQA 1UKRA 1PX4A 3B01A 2B4KA 3KS7A 4OHVA 4RQPA 2WT1A 1WCSA 1RITA 4NHXA 1WW7A 1AR71 3B7MA 1HIXA 5GLUA 2WLQA 1S55A 2V4AA 5F5AA 4W6YA 4RGKA 3UGGA 4LULA 1F31A 1AXYA 4IEWA 3T2PA 3O1UA 3FLTA 3IWZA 4E27A 1Q8PA 1W0OA 3MFAA 3BKZA 1UOGA 1X8MA 3J7MA 3E5UA 1W6NB 3GJBA 2NYYA 1TMF2 1JXNA 1DHKB 4XW3A 2G9ZA 4Y26A 1UU6A 2HBTA 1C5HA 2QQOA 1SBDA 2RR13 4OULA 2QE3A 3O14A 2V72A 5FK7A 1WLDA 3N9PA 4EWEA 1CIWA 4CEYA 3WSOA 3MUZ1 1OH4A 3I54A 2ZMLA 1VBB1 3RZGA 4IEVA 1WUVA 3FUOA 4XFCA 4E8CA 2GMEA 1LB2A 1NXMA 5L7OC 2ZGMA 3E5QA 3AYEA 3VB9A 2ERFA 2B42B 3QH6A 1HXS2 4PCRA 3AMHA 4GKXA 2XKPA 5CB7A 5JPNB 4FXKB 3E6BA 5FMBA 3OD0A 5LBEA 2W1QA 1ZBE2 3UJOA 3MLLA 1TNFA 2DCJA 5FCCA 3LD8A 4JV4A 1XSRA 2OKXA 3ILFA 2WBKA 3ZO0B 5T50A 4Z1VA 2P6CA 1UAIA 4PDWA 2R063 3CF6E 5FIXA 1JH5A 1BK1A 3TRSB 3S5AA 1RVF3 4TSVA 2FDKA 3B9CA 2ZTNA 4M0NA 5HXMA 4IV3A 2WNVA 1ODNA 5A70A 5FREA 1NLSA 1G86A 4MGQA 4EN7B 2JDAA 4AWDA 4GKYA 4XHXA 1XJAA 4QU2A 4AI1A 1AHSA 2O1QA 5D1IA 4AF9A 4COVA 1RXGA 5A33A 4BQWA 1DQ4A 4D3WA 5JOWA 1BBT3 5T5LA 1SLLA 3Q8BA 3F95A 3I2HA 3CBNA 2LROA 4K40A 1OI6A 2AEZA 5A7OA 5LA0A 3FBYA 2FD8A 2VMCA 3JB8A 3RYPA 1ZBA1 4FVVA 4PDWC 5JR7B 2AC1A 2BW8A 3POEA 5H9PA 5JI7A 1U12A 2XB6C 1R1A3 1ULEA 2ZGNA 1FNZA 3THCA 1H6XA 1MZ6A 2XVKA 2WDBA 4IV3C 2WNVC 3TBDA 3I2DA 1MQTA 3KHBA 3T0AA 3ZYGA 4B1LA 2N7GA 4J6GA 2OZJA 1J83A 1UL9A 4NPRA 1JYIA 2HWF3 3ZFFB 3U4XA 1GLHA 5EP9A 2B46X 1MEC3 4GMP1 3WX5A 2VO5A 4R8HA 3VLBB 1QJU2 2ZZQA 4LQRA 2WQZC 3NV1A 4R4ZA 5IVYA 5GZDA 3I59B 3AP7A 1WMFA 2ILMA 4XJZA 1RUF2 1ZVFA 4IL7A 4DINB 4XFIA 4MX3A 3LOBA 1XXNA 2OUJA 2QCSB 3IIIA 5KXCA 2A5ZA 4GH4B 4BLJA 4YSFA 2AR6A 1YWKA 3FFZA 3ZVXA 2WWUA 3D8CA 1DG6A 3DECA 4JDMA 4OFGA 3T08A 4CPBA 4CA9A 3MZHA 4BCUA 4JDNA 4IXLA 4JGYB 1M4WA 2Z42A 5JCTA 1MQTC 4AFMA 5FZAA 1LNSA 3MEPA 1CN1A 2HYXA 3M4FA 3N4MA 4AOCA 5EQUA 3V0AA 1W06A 2DFCA 3NQHA 3VD3A 3ZDVA 1PNGA 5F1RA 2OIIA 2VZSA 2WYFA 4GMP0 1COV3 5LBFA 5C4WB 5LY1A 4A42A 1YFWA 1AYM1 2VU9A 5L19A 4DUWA 4S2HA 1EUUA 1AR63 2H6BA 1N3PA 3VBSA 3EMRA 1UNBA 4IEOA 4DXSA 1RUC1 2LS6A 1QJX3 3FHIB 4XXAA 2FDGA 2TUNA 1B35B 1D0GA 1YJKA 1OKQA 1PIV2 1RUE2 3ZFGB 4ZU4A 4FI9A 5GKAC 5FTTC 1YQCA 3K3OA 4LR4A 1ZYBA 3UESA 1XE0A 3P3NA 1J3PA 1OPMA 2YZ4A 1JI6A 4HBNA 3CZJA 2X09A 5J48A 2CAVA 2JG8B 4GAZA 1J59A 4YZ2A 3E5XA 4UXAA 5BNOA 1LENA 4Q4W3 3KMHA 3THDA 5C70A 1XE7A 4GB31 3VBSC 3GBFA 4KG0A 4C91A 4LBNA 2ARCA 1REFA 3I3BA 1RMU1 3LEMA 4AL9A 4EWAA 2GAUA 3KF3A 1LOEA 3T0BA 2R042 2IXIA 2ZGTA 1AL23 2ZEZA 2XG3A 1MACA 3VD4A 4XF4A 3CKHA 2VCMA 3OUHA 5A1FA 2KA3A 1V6LA 3MW3A 1HW5A 2PA7A 1JYXA 3D82A 4QXBA 4N43A 1GOHA 1VMJA 3RSJA 5IVJA 5CFDA 4G4FA 5F37A 5BNOC 3ON7A 2DURA 1Z7S2 1W2AX 3KLSA 5E1RA 3JBG3 5DN2A 4Y1UA 1UZVA 2QDRA 1VJ2A 5AVAA 4YYOA 1UXXX 1WCDJ 1PVC3 5JR2A 4YVWC 4IE7A 5FY8A 4A44A 2VNRA 3O5SA 1W28A 3WQ7A 2Y64A 4AVAA 3C7GA 5JSRA 3GF6A 3O1TA 2ZABA 5FMOS 4B3NA 4K1YA 5DMYA 1W3XA 1DLLA 1O59A 2ZAHA 5JIAA 4P9WA 4C90A 4N43C 3NJZA 3ZR5A 5A1AA 4FTSA 4AW7A 3MGUA 4W65A 1LHWA 3NNFA 1S0GA 5CFDC 1PMIA 1OUXA 4HKOA 3WNPA 1VBA1 3H8OA 2VCAA 4OQ9A 3ZDSA 3POIA 1NT0A 4AFCA 1DQ2A 1W6QB 1QJU1 3RFRA 4JZRA 4QGMA 2DF7A 5CVRA 4OI4A 5K0UA 4COZA 1C1FA 3HIFA 4N8MA 2VY0A 4XDQA 4E2SA 2G19A 2XJSA 3BODA 4TLFA 4XUNA 4DZGA 4XQWA 4Q8LA 1OOPA 3CDZB 5A7SA 1LJ7A 1POQA 1C8NA 1O4TA 1ZRFA 3BIWE 5FZIA 1DBNA 1O8PA 1MS5A 4Z82A 5FZEA 4BM8A 1G9DA 3M3QA 3KCYA 1S1AA 2D5HA 2H0BA 3FZ3A 1W9TA 3ZXKA 4MYEA 5L7OB 2VNVA 4ZZ8A 5BXXA 1MS4A 1CAVA 3HQUA 1F2NA 1ZA4A 4HZFA 2VW2A 3RNSA 1ND2B 3WR0A 5K0UC 3EJKA 1QNWA 4MGYE 4SBVA 4YFZA 2DTYA 1CAXB 4QKDA 4YG0A 4G9SB 4ZU7A 3WZ1A 3HQXA 4ET7A 1OOPC 2D97A 1QOTA 3OUJA 3DPRA 4ZU5A 1MS9A 3FUQA 4DRRA 2ZZJA 4M3CA 4NAMA 2VOWA 5CADA 3IIAA 5JOZA 4COYA 2JD9A 4AR2A 3RG0A 1PO13 3OEBA 4HT1T 5CFCA 3M7AA 3H3LA 5FK8A 3K51A 5A3MA 1DU3D 2WNUB 3LSDA 3LPFA 2XVGA 2D5FA 3BU7A 1KJLA 4H3WA 2QQNA 3PJYA 3RYKA 1LOCA 2OX0A 1XNKA 2YPDA 2PTMA 4QM9A 4XF0A 4AVBA 5GZGA 3NL1A 2WUHA 4WVMB 2WSVA 1EUTA 2RJKA 3DPRC 3OEAA 3T2QA 3RGBA 2A3XA 1ASJ2 5JXJA 1N1VA 5KHJA 2R041 4N7UA 4WVWA 5I8SA 3WDYA 1JU4A 4ARXA 4DEVA 5CFCC 1FMD1 1GZ9A 1PK6B 2GH8A 1QOOA 1UXZA 1YCIA 1D4M3 3H42B 1JTZX 3KV4A 3ZMNA 5ANQA 4EN8B 5IVCA 1OLMA 4NPMA 1H8VA 4LKEA 1MEC2 3VUOA 3S6PA 5KC5A 1Y9QA 5CKQA 1LU2A 4JAAA 5KBFA 3AMPA 3RYRA 4FAHA 1G7YA 3KF5A 2R072 1EP0A 3ES4A 1AJOA 3NRUA 2UURA 4JTNA 1R093 5F32A 4IE4A 4I3GA 4HPKB 1UMZA 4IGPA 4IDZA 3ACGA 1ONAA 5AC93 2WYSA 1R083 2IVJA 4YZ3A 4YVSA 1BEV2 1UYYA 1N1TA 2ID4A 4RGGA 1Q8SA 3OBAA 1VAMA 1E57A 4E4SA 1ULDA 4TZDA 2RJLA 5A7WA 1IQDC 2R6QA 3ILRA 3MUY1 5FJKA 1G9CA 3WF2A 1IG3A 1XNCA 4XAAA 4KWKA 1ALYA 2RR11 2H0VA 1LEDA 3RQ0A 3LE0A 2Q1ZB 2W1SA 4KL1A 1DZRA 3C7FA 3WF4A 4QGLA 1HQLA 2HWB3 2QKDA 4Q0SA 5C7GA 4W6WA 1NG0A 3UK9A 3M3OA 3MF6A 5EJ1B 4KWUA 4CDUB 4CUGA 3WQ0A 2XPJA 2P3IA 2ZEWA 1KXGA 1LHVA 5FKCA 4L0PA 4YVSC 1UO9A 3J8F2 4AG4A 2F4LA 5DG2A 4QQOA 1DDLA 2X10A 2J22A 4XDOA 2E7AA 1RUH3 1R1ZA 1B09A 1QNYA 2CYFA 3H7YA 1DF0A 4ASMB 4QU1A 1UF2C 4EZ4A 4XDPA 1AR82 5IJRA 2RMU3 3WVJA 1FYUA 2RV9A 2CGOA 2VW1A 3H7JA 4AEDB 4BPZA 2P6HA 4YGBA 2R061 2EF6A 5FP4A 5L9BA 1RVF1 3AMNA 1QXJA 2CWMA 4K3UA 4XUTA 5F3IA 4AHXA 4GWIA 1O6UA 2HBUA 4A41A 1I1EA 3WG2A 5DZGA 3V64A 1XNDA 2D7FA 4LIUA 2Q1FA 3O1RA 1GP5A 2RS53 2WZPP 3POYA 4YNIA 1JYWA 2HEYF 1FNYA 4NHMA 5HPOA 3FJSA 1GICA 1REEA 4EN6B 4E2GA 1LECA 4Q4Y2 2YFUA 4LITA 2YU1A 1BLZA 2X5IC 1K3IA 4QWNA 3U37A 3ACFA 3OBZA 4K20A 5FQ0A 4CEWB 1R1A1 1ASJ1 2QQKA 1URXA 4IEUA 4PLMA 4QPYA 3ZYIB 4YVWB 1DQ6A 4UBHA 1PGW2 3LQCA 3MPBA 1ULCA 2WA3A 4KWJA 1KFUL 1FT9A 4XFHA 1NY72 2HWF1 2W5FA 4Y5SA 2VMFA 2IVIB 1MEC1 1QF3A 1JHNA 2VE1A 5FJHA 2CNAA 1RUD3 2CTVA 1RUJ2 2V5YA 4HETA 4NUBA 3VDAA 3ZSJA 2R0HA 3ME2A 3B5LB 1UKGA 1JYCA 2P34A 2ZCWA 4QX0A 1MZEA 1EV13 3R0RA 2P5BA 3UKNA 2XBO3 5L36A 4M01A 3USUA 3VKOA 3AFKA 2E53A 1Y9GA 2VQ0A 2FDIA 4Y5Z0 4AFAA 4P00B 1V9U2 3OGSA 5A3NA 1CGPA 1GSLA 4DQAA 4AHYA 2J1UA 1UWWA 4OUMA 2BOIA 1LOGA 4GXLA 4PHZA 4NIAA 3SNMA 5ABJA 2W91A 5KC6A 1YFUA 4QPGB 4RS5A 5FYSA 4WM8B 2FCUA 2YYOA 3VZNA 3WNXA 1WBLA 1YEWA 2MNGA 2EALA 3DCQA 1L7LA 2ET7A 3RWKX 2VD7A 3OBTA 3KT7A 1GOFA 5CIRA 3WHTA 3OF1A 3M2MA 4GJZA 2D98A 4JRAA 1ENQA 4PI2A 1AR61 4WZFA 4XE9A 2RDRA 4IE0A 4INDA 1VPHA 2VZRA 2R7EB 1FOD2 3G6JB 4FFHA 1QJX1 3OYWA 4CZSA 3MW2A 4KQ7A 3WNMA 2OZ6A 4XFAA 2DVBA 2IUWA 2WNEA 5CKMA 3JD73 1HKDA 2WZ8A 3DYOA 4LE3A 1HX6A 5FZGA 1SACA 4N90A 4YLZA 5ABJC 1H4HA 1UN1A 4RS5C 4L92A 5F8PA 1XE8A 3VGIA 3ILNA 2V5DA 3J8F1 2K2SA 4U36A 2ADDA 5DAPA 4XCAA 1TZOA 2CV6A 2FMYA 2SLIA 1BQPA 4KU8A 5C9AA 3KT4A 3J7HA 3MICA 4UT5A 2DUOA 2XJPA 3KB5A 4Q4W1 3VBFC 2W87A 3WQBA 5J7MA 1AR81 1D2QA 1CQ9A 3J4UH 3TB0A 4XYXA 5FAXA 1C4RA 3LEKA 5BUVA 1XOYA 3SHRA 4MG2A 1F35A 4LOTA 5F2SA 2HWC3 4XJ9A 5IAVA 2CGNA 4LUMA 3BPZA 4Y4YA 1TQ5A 4FPFA 1RGSA 3I49A 4CP9B 1UD1A 1Y3TA 2HKXA 3WUDA 1UZZA 2GALA 2PHFA 1D4M2 3O1MA 4RFT0 2QVSB 3PUQA 2YMZA 3J7LA 3JZVA 4TWTA 4BIFA 2YBPA 5C9AC 2W95A 4B4QA 2E26A 3B9IA 2Y8KA 1QDCA 1E5HA 3JBG1 4ITCA 1GNZA 2UYAA 2CY6A 4DY5A 3I4IA 4W4ZA 2W3JA 2PAMA 4ORFA 1HQWA 3WQ1A 1PVC1 1GANA 1RUOA 2G9GA 2D6NA 5EHDA 1LAJA 3PHMA 2VZ3A 2GC2A 4QB2A 5ISLA 1LULA 4AVTA 2Y34A 3ZLIA 4CU7A 1JZ3A 2VZUA 3INAA 3ZN6B 2ZX1A 1W2UA 5BPXA 3W58A 1NCRB 4QGNA 4MH0E 1H9WA 3ZYPA 1CWPA 1O7FA 2E32A 2VQAA 4QDSA 1PMJX 2IC1A 4UW6A 5IVBA 4I30A 1AR72 2WQ8A 4NRPA 5FPVA 1NY71 2RJ2A 5FYHA 5I0TA 3VHPA 3HQRA 3DL3A 2W46A 4LK6A 3TN93 1FPN3 2A6WA 4YFWA 5CISA 1LOBA 3A22A 2EA7A 3KV5A 4UF0A 1H6YA 1NUKA 1YI9A 1WMXA 3AL5A 5FRAA 4QQPA 1WCQA 2OQ6A 1UYXA 1V9U1 3IT8A 3M8LA 3POFA 3LKJA 3U1XA 3ZPOA 4XF9A 5LRRA 1BYHA 4GH4A 3RRDA 1DGWA 1OVPA 2JIGA 3PVNA 4YW2A 3KCXA 3M1HA 4CP2A 1T6GC 3HOBA 3ZR6A 4OZXA 4D69A 2VJXA 2DU1A 3ATGA 1LHNA 3WXPA 3WD5A 1OD5A 3BTZA 1PMHX 4XBQA 2YU2A 5FYVA 5FYTA 1IKQA 1OQDA 2E63A 2ZKLA 5F2WA 3ETPA 3IDAA 4OUSA 2Z79A 3K4DA 5C8CB 1N1SA 3OJBA 1HJGA 1FOD1 3LEIA 1O3TA 1YXWA 1E5RA 2ZS6B 1MS1A 1MR5A 3D6EA 2W92A 1VB4A 1U5IA 5C8WA 1L7QA 3GHNA 2ARAA 2C9KA 4QDRA 4Y1VA 4AZZA 2ZMKA 1RHI3 1US2A 1NOVA 2WR9A 4AGVA 2WAAA 4LBQA 1W6OB 2K46A 4DO0A 3I3MA 2E7TA 1OPOA 3C7OA 4ZXKA 2BEOA 2I2SA 2RS32 1JYNA 5JPMB 4LHSA 1KJRA 4UI9L 1DFQA 2QUOA 4CP1A 2XL9A 1IS6A 5FLJA 2BUKA 4N53B 5D8AB 5FXXA 2P37A 4LBMA 3VBHA 3I2GA 2MPFA 5KHKA 3H1YA 4CU6A 4IV1B 5A32B 5I0RA 3T3YA 4QD2A 1CZTA 2BV4A 2YHJA 2ZGUA 4UBGA 4JGZA 3FBMA 2X5IB 3SCHA 5JVVA 3VBOB 5A3WA 1IS4A 1D4M1 3WP3A 3URFA 2ES3A 4IE6A 5FUNA 5JXIA 1ZBA2 2PHRA 3A21A 5F3EA 1HB1A 5JOXA 3ZYJB 1YLLA 2OS2A 3T4VA 3OBRA 4XACA 3AZXA 2BYVE 2A6YA 4E8DA 4LPLA 2FQPA 3AXDA 1Q8QA 2YUEA 4JHTA 3VBHC 5IVEA 5LATA 4NHLA 4S2FA 4LTAA 4WM7A 1CPNA 1CAWB 2NP0A 3AKQA 4XTMA 2Y6LA 3SLIA 5AC91 3V0BB 4BA6A 4AI3A 4JGZC 4O9GA 1R081 2O14A 4DEQA 4CXWA 3PVBB 3AC0A 1X7NA 4DXTA 3EQEA 4B4PA 2VMDA 2R49A 3CJXA 1A8DA 1O5UA 1O3SA 1JZ4A 3Q8EA 5FP9A 3GDBA 1W6MB 2DBIA 1S0JA 2VM9A 5LCWL 3WDXA 1QH6A 4EJRA 4BQ5A 3R4DB 2OPWA 4FTBA 5JZGB 2Y60A 4M4RA 4XFBA 3BI3A 4XTPA 4RHV3 2HWB1 3D0SA 4HANA 5ERLA 1W6QA 1J3QA 3U14A 1YQ6A 5FP8A 2XUMA 2E31A 1HB4A 3AB0A 4FFIA 4V1PA 2RE9A 3CL1A 1RTVA 3OY8B 1AYM2 3CU7A 3ORJA 3VZLA 4RQPC 1FV2A 1MPXA 4P5HA 3VKMA 2A70A 1OMIA 5A7NA 3T0DA 2BP6A 3I2JA 4LA2A 1VBE3 4YWAA 1RUC2 5GLVA 5T5JA 4EV0A 3OGGA 5JXGA 1KDMA 5HCHA 3Q9OA 1V6OA 3DV8A 3JQXA 4DS0A 4CVUA 5IWFA 1AX2A 4FPGA 2RMU1 1JUHA 2BERA 2EAAA 2Q8OA 1NQDA 3T2TA 4CDXA 3OPWA 1TE1B 2WL1A 1K5MB 3OCPA 3AYAA 2AACA 4C1WA 1S0CA 1BZWA 1IS5A 1I5ZA 2Y6KA 2ZGSA 3KD4A 5I93A 4JCKA 3O0VA 5FY5A 3FLRA 3NJYA 2W52A 4P08A 3VBRB 3VV1A 5ACA2 5FZMA 3B93A 1H0BA 5GLZA 3OPZA 5CBLA 1HDKA 1DP0A 4GB32 1D2SA 2Y6HA 1O3QA 1W8TA 3DXTA 1RMU2 2DUPA 3GBGA 3NNLA 4C1XA 4CEYC 2RS51 5A6YA 5F5QA 2WC2A 1QJY3 1H8TA 4UW5A 2RS31 5IUQA 5FZ0A 1GFF2 1I3HA 2B39A 4LLFA 4Q4V2 3C7HA 1Q5OA 2DU0A 4CDXC 1G9AA 2XQRA 2FCTA 4R9BA 1STMA 3KM5A 4FQ4A 1DGRN 4QQLA 3U78A 2VZTA 3QH7A 3N35A 1HLCA 2XQXA 3N9QA 1GV9A 1VRH2 4YGEA 5KHIA 1C8M2 3N9NA 2WT2A 2V09A 4WVVA 3Q8AA 4CCJA 1EAH2 4BISA 3PU3A 1ULPA 5LBCA 3O1OA 3KCCA 3IBMA 5FY4A 1AVBA 1H8TC 3TWIA 3O0XA 4OMCA 3HT1A 3VD5A 3K77A 4AI9A 1NXD1 2A3YA 4YZ1A 1W90A 4AYUA 2DUQA 1CX4A 1PO22 2VXJA 4GA9A 4RR3B 2X29A 1RUG2 4FPEA 1QJEA 3HD8B 1C3HA 1EV11 3OB8A 3WDWA 1GR3A 3BUCA 4ZPIA 4LOSA 4Y22B 5LA1A 2JKXA 3N3HA 2QZ3A 1G9FA 1VBA2 5A6XA 1NLRA 2XJVA 3CJIA 3UNPA 2BTVC 5DAXA 4E2QA 4GD4A 4KU7A 1XYNA 4Z8BA 5JAXA 4P9GA 4LBJA 2Q0AA 4HPKA 3H1WA 1AJKA 4RYDA 3GCWA 3WEZA 5KXDA 1YI7A 2L9LA 3DKWA 1SDWA 1VE0A 3MFCA 3IMNA 5C3SA 4AI2A 2JG9B 2W2IA 3UGFA 1OHFA 5FZ6A 1DGRA 1FAYA 3WW4A 4AAXA 3VBUB 4K9SA 4Y33A 2G9FA 2XONA 1X50A 2BWCA 3BCWA 3MBWA 5T52A 4BJ0A 3CJIC 3JD71 3E6CC 1C5IA 4AVSA 5GJ6A 3I8TA 4NIDA 1ND3B 4QX7A 1OH3A 1SBFA 3VL8A 2AEYA 5A3UA 2GNBA 1SFPA 1K5JA 4P9LA 2XKOA 2BFUL 1LR5A 4LBOA 4CDQA 1GZTA 2PFWA 1GZWA 1HRV3 1PVXA 1S0DA 2JDNA 1K12A 4AEKA 2D6MA 5FLHA 5HBAA 3QACA 3WP6A 4EN0A 1NE4A 4MXVA 2NN8A 4ZHNA 1RB8G 5T5PA 2XVLA 4YGCA 1Y7BA 5LA2A 3ZXLA 3ZIWA 4BDVB 4K6BA 2PHLA 5JSPA 2WA4A 5GALA 1QQP3 3AFGA 3D5OA 3O0WA 4W6XA 5KHGA 1H1AA 3SH4A 3UJQA 4YW3A 5ACA1 2IXHA 1ULFA 1RUI2 2A6ZA 4XMAA 5FY9A 5C71A 3AKPA 4HVOA 1GU3A 1SLCA 2YC4A 3N9OA 4AGRA 1D4VB 3DEMA 4CDQC 3LCPA 4A2UA 1S2KA 4MGTA 1S4CA 3A4UA 1POV1 4P02B 3PUSA 4AAPA 1UPIA 3HNMA 3QOPA 4Q4V1 4DXRA 4AVVA 4P9IA 1NCQB 1UY2A 2RDNA 1FMD2 4LBKA 1IG0A 5FDBA 5GZEA 1UZWA 2VTXJ 2DCKA 2X53S 3NV3A 4FO9A 3NAPA 4N9HA 5FZ8A 3SEEA 2QQLA 3BOWA 4D6RA 1HJFA 3TEZA 3PUAA 1NA1A 1OUSA 1OKOA 2IXLA 1XQNA 3DKQA 4HFSA 2IFRA 1VRH1 3IN9A 2XR4A 3VDDA 1C8M1 1OLQA 3B69A 4CCNA 4D6SA 1JYVA 3ALQA 4CEWA 1PZ9A 1EAH1 5G04L 4I3PA 3TN91 1POV0 2D3PA 2NMOA 1FPN1 2WFPA 4Q1RA 1XNBA 4BH9A 1SLIA 3K4ZA 1SBEA 1XB9A 4FPHA 4X8PA 2JB4A 3PMEA 1PO21 3HVDA 4HN1A 1RUG1 4D7TA 3NJXA 2VECA 3T1MA 5A1LA 3NAPC 4Q4X3 2BNNA 4AI0A 1RC6A 2MEV3 3HAGA 1SZBA 2XDVA 4K7JA 4F8AA 4I01A 4CRQA 4NIGA 1NA1C 1AX0A 3N9MA 4YW1A 2UYBA 2YGMA 5ACA3 2NMNA 5BNNA 2UU8A 1AYN3 4XEZA 1DYOA 2PLV3 5F7UA 2RR12 4F7ZA 5DPNA 1UIJA 3E6DA 5T3NA 1OFNA 3ZYHA 1Q8OA 1VBE2 4HONA 1WCKA 4URTA 3LZZA 1UY1A 2EIBA 2WO7A 2ZPXA 1CONA 4Q0UA 4RQPB 1VBC3 3KV6A 3A0KA 2LW8A 1TVGA 3OGVA 2I74A 4G3YC 5JI9A 1GWLA 1QJFA 2Y0IA 3LIGA 5L9RA 4OHZA 4JQTA 5DDJ3 4BQ3A 2ZA9A 1Q3EA 4DB5A 4JKMA 4AVCA 4UFKA 3AP5A 2VMEA 1U5YA 5A3OA 2DVAA 1VBD3 2ZGOA 5FPBA 1XSQA 2D40A 2VBDA 3GCXA 4NROA 2P2KA 1A6CA 2AGSA 4MXWB 1RHI1 4DMIA 5IK7A 4Q2FA 4LO4B 5I0SA 5J96B 2ZACA 1WCUA 2PHWA 2VR4A 3RZJA 2WO2A 2R062 2WS93 4UYBA 2I45A 1YO8A 2EAKA 1A8MA 4AFDA 1RVF2 1W04A 5LEJA 1XYOA 1S2EA 3JCIA 3MPPG 4R4XA 3NJVA 3T4HB 1CAUA 2FCVA 2KXLA 2WWJA 4M3CE 5CG9A 2PAEA 1OC1A 4BK5A 3WNOA 4P9JA 4QX8A 1ENSA 3MYXA 4XJWA 4XOGA 2D6PA 1BBT2 4FPCA 1V00A 5EYXA 5FZOA 2J1VA 3ZXFA 3I2IA 1RUI1 3VHRA 4C8DA 2JDPA 3WG1A 3C2UA 3DUIA 2YB7A 1KRIA 1GNHA 5CG8A 1TME3 3H8RA 2EICA 3IPVA 2LM3A 1RUNA 1UPSA 2F17A 1R1A2 2R0FA 2VBBA 4LKFA 1GBGA 2GNTA 4DNYA 2BPA2 1OFSA 3MV11 3R4UA 4PDWB 2HWE3 3RI9A 4EE2A 5BNPA 1JYTA 5LEKA 2WFF3 3I2FA 1KEXA 2BNMA 4EQVA 5FPUA 2HWF2 4K1ZA 1G9BA 2C24A 1M06G 4Y20A 4IV3B 2WNVB 3UYJA 3ZKUA 5I0UA 2PHTA 5F39A 4Y1ZA 2YDEA 1OLME 1CJDA 3WW3A 1JN2P 1SQ4A 3FHQA 5A33B 5IAXA 1YNAA 3UKVA 5EYYA 2D44A 2KM2A 4TYSA 2DVGA 1S0BA 4XIKA 4GZ9A 2JWPA 1QGLA 3NNMA 2Y33A 2RVAA 4LIVA 4OZOA 3ZSMA 4CYDA 3RZZA 5FV3A 1YQ8A 5FYCA 2QQUA 4Y1XA 5BNPC 3GGLA 3K46A 1HV1A 2RM23 3S5QA 3KV9A 3CIHA 5KXBA 3I3EA 3RZLA 3WW1A 1COV2 1QXPA 1MQTB 4C0HA 3AXEA 5FZ9A 5CAZA 2VMIA 2HEWF 2E51A 1AR62 2BBAA 1QKQA 1VBE1 1QJX2 3ASIA 1HB3A 1UY0A 1MVQA 2IXJA 1BVVA 4AFBA 3WNKA 1I5PA 1QU0A 3QBQA 4LKDA 3WCSA 1OLRA 2A7AA 3RI8A 3X29B 1Q8VA 2JD4A 3AM2A 5CA6A 3U10A 4HVQA 4XFGA 3TEYA 2GC3A 2W1WA 2WZR3 5BNQA 5FBZA 4AGGA 4MGZE 1IHMA 3ZFEA 3EBRA 3AP6A 4FCAA 5C6CA 5LK7B 2VOKA 4QKFA 1W6PA 3SKVA 4EWDA 5C8CA 2P4EA 4BQYA 1JMUB 4Q4W2 4QQHA 4BMEA 4L97A 5CEHA 1BXHA 2CDOA 4D0QA 5FO8B 4AQ6A 3V0AB 2VCCA 1QXRA 2CDPA 2O0OA 3WUCA 4BQ4A 1JZ2A 3ROUA 1OD3A 2Z2SB 3B02A 1AX1A 1QJY1 3B3QE 3SC7X 1AL22 1SMVA 2ET1A 5H9SA 3ITQA 1W6OA 3VBSB 5TSWA 3PNAA 2VVFA 2W9XA 3W5NA 2Z69A 3KGZA 2P3KA 3L2YA 1EPZA 3ZFEC 1J84A 3PIGA 2C9AA 1HRI3 4XJUA 1NX9A 2ZX3A 3USSA 3JUUA 5FP3A 2PYTA 4BHPA 4UWDA 3H3UA 2A71A 5DXDA 1AF9A 4ZS2A 5LY2A 2V73A 1V0AA 1S0EA 3GZAA 4CCOA 3JBG2 2JDYA 2K0GA 3MO4A 1AR93 2CWSA 1BBT1 1VBB3 1VMFA 2JECA 2PN5A 3THTA 5EFUA 4L2NA 2ORZA 4CDWA 1JW6A 1RJ8A 1F9KA 3EB7A 1PVC2 1JOBA 4PJYA 4D7YA 5BNOB 5FZ4A 2HLEA 1GP6A 1UW8A 2RS13 5IK5A 4RL7A 4JDOA 4LT5A 4M4PA 3ZM8A 5DQ0A 4LLOA 1JU3A 3WNNA 2X8KA 3M3CA 1C1LA 5LASA 2WZEA 2PELA 2JKBA 2Q8CA 5FYIA 2YC0A 3ZYFA 3C3VA 4AEMA 4N43B 3LDBA 2XHKA 5C3RA 2QDNA 4CDWC 1HQNA 4MOAA 2ORXA 2OVUA 4CCLA 4EYUA 5CFDB 2W1UA 5KR7A 3SCGA 1V6NA 3KQ4B 4UFMA 2B8MA 4AE2A 3PLQA 1W2NA 2BGCA 4QPIA 4A45A 2BJSA 4BIOA 3H8XA 4I09A 4JKLA 4CPBD 3R05A 1K45A 2XMLA 3CLPA 1KDKA 4HSLA 4UFIA 3VBFA 3SITA 2UWCA 3A0NA 1RYYA 1AXZA 3FFQA 3MIDA 4QHBA 3VN4A 1UYPA 1SPPB 2W47A 4BU2A 3VD7A 1SHWB 3BOPA 1COV1 2DWRA 1UCXA 4MZUA 4Q26A 4JC1A 3AYCA 3U11A 3U0ZA 1DZQA 3POJA 2BRTA 2J1TA 3AYDA 1W6NA 4QPIC 1O3RA 1OVSA 4XQDA 4NPLA 3OSDA 4KNCA 5CKNA 4Y24A 1HRV1 5CU1A 3SEPA 5T54A 3ZN5A 5K0UB 1S0FA 1DIWA 3WNLA 4GMP3 5K7PA 4V2VA 4XVHA 2JB8A 4W50A 1PO12 1X33A 2DV9A 4LMFA 1OOPB 2R32A 1KFXL 4IGQA 3U07A 3HPNA 1LGNA 3I2OA 1KGYA 2JE7A 2K9ZA 1QQP1 2A3WA 3SH5A 5A80A 3DF0A 4PBOA 1K5MA 2FDHA 3PIJA 2UWAA 4A4AA 2VTXA 2WT0A 2XLGA 4XAEA 2A6VA 2BGPA 3CNAA 1QH7A 2BGOA 4NN0A 2HYKA 4YM1A 1CAVB 3POGA 2HWD3 3NKTA 4PIYA 1UY3A 3I3DA 2C26A 2GH2A 1AL21 3BALA 2EIEA 3VDCA 3O7OA 1TMF3 2Y0OA 3NO8A 4R9AA 2VOVA 4WV8A 3OD4A 5HCBA 1GWKA 3DPRB 2YBSA 2GNDA 3I97A 4MUVA 1PZ7A 4M3CB 1BHGA 2UY9A 2QQWA 4UFJA 4XC9A 2VL4A 4OUEA 5DZEA 1US3A 3ZMOA 5CFCB 5J36A 4OQ8A 3CMGA 5JWPA 3D0JA 1X9TA 4WBBA 3AKTA 5A6QA 2ETEA 2JDKA 4QB6A 1UU4A 3DGTA 4P14A 3O1PA 2QZ2A 1R092 4YRDA 3WINE 3WDUA 5D21A 4QKBA 5JSOA 1HXS3 4HXCA 1DQ0A 4HN0A 5AC92 2ZGLA 2VQUA 1DGLA 4RA0A 1R082 3AL6A 1ZBE3 1R64A 4XBNA 4CXXA 1UZYA 2GSYA 4HL0A 2SBAA 4YPJA 4A6OA 1PM4A 2GN3A 2RM22 1A34A 3RZKA 5HCAA 2MEV1 1BMV2 2J7MA 3HNYM 3LDRA 5LRSA 4JRLA 5FMDA 2J1EA 5AFEA 1AYN1 3AX4A 3VHNA 1NQJA 3VZJA 2GU9A 3P3PA 1UX6A 1PGSA 3H50A 1JUIA 1ZX5A 3ZFFA 3KWVA 2HWB2 1H2MA 1U5XA 4WVZA 1OT5A 2KR2A 3G7DA 3QD6A 3PMSA 3KHCA 4I02A 1VBC1 4D6QA 3I59A 2VXRA 3SISA 5FPAA 4OI1A 4FPJA 3BYWA 5DDJ1 5FMCA 5SV8A 3W21A 3Q8FA 4MV2A 3TNQA 2WSUA 3JB4C 5T55A 1MZFA 4GIQA 2DCYA 4MHUA 1RUH2 2XXZA 3ZIXA 4YVSB 1O91A 4E9KA 4JGYA 2V4VA 5I8TA 5EJZB 1QEXA 3N7JA 5C5TA 2J1RA 4RN5A 2CAUA 2RMU2 5IHRA 2DCTA 3POWA 5A7WB 3ZFFC 5K9YA 2VAUA 2PQSA 5C4WA 1WW5A 1W9FA 2BBVA 5LWBA 3V56A 4D94A 1ZRDA 4NHKA 5A7PA 5JLVA 1W0NA 4QAWA 4GH4C 3POBA 5LZ6A 3KGLA 1QJU3 4XURA 1B35A 1PO11 1V6IA 3IDCB 4YM2A 4ATEA 3ZFGA 4EN9B 1RUF3 2XJUA 4KBBA 2VZ1A 4QXCA 2RS52 4Z92B 4LXLA 4EROA 2R30A 2WNOA 2VPVA 4NHYA 3PTRB 1CZVA 2JG8A 3LF7A 5C4WC 1WLCA 3GM8A 1YHFA 4AK3A 1NZCA 3AKRA 2ZHMA 2F6BA 5FZ7A 2FZ1A 4FBFA 2AREA 5FZLA 2VUAA 1J58A 2VUJA 3WP5A 4KBZA 2HWE1 3ZFGC 2VVDA 2TEPA 2WFF1 4QX2A 3VL9A 1WLWA 4E4DX 3FLPA 3P1IA 3HMYA 4YW4A 1G6NA 2W08A 3ZXGA 1H2LA 4I0AA 5FLIA 2D6KA 1RUD2 1FXZA 2YROA 1PIV3 1RUE3 2F4PA 4OI2A 4K8FA 2JG8C 4FPLA 2YY1A 5IVVA 4KH9A 1EV12 2XBO2 3CZUA 2I07B 3UGHA 4BQXA 3ES1A 1R091 2XL7A 4CU9A 5EIYB 4Y4RA 4URAA 3IAPA 4FPYA 5FKBA 3HBKA 5L9VA 1QHDA 3V65A 2P17A 5JXHA 2RM21 4NVPA 5FUIA 2VZQA 3K3NA 5J09A 5J1XA 1X36A 1BMV1 1P8JA 4ZKTB 4GULA 5CYYA 5K4LA 1GQPA 5EJ3A 5EPAA 3TAYA 4XF1A 1DQ1A 3EO6A 2XH6A 3E1F1 3FC0A 5FO7B 2R043 2VQTA 4COWA 3LDKA 3DN7A 4YM0A 1YRZA 1MS0A 2QNKA 4O61A 3ZSKA 3POSA 5DAVA 2TNFA 4OLLA 2W94A 4WM7C 4OHYA 2LALA 4Q0PA 4R9CA 5FYZA 1UY4A 1OQ1A 1KQRA 3JD72 5FXWA 5JIUA 4PIZA 4IE5A 2OPKA 1Q56A 3USUB 1Z7S3 2WZR1 3OG2A 2PHDA 4FOWA 5FMOL 5HCFA 1V6KA 3IM0A 3K4AA 5LB6A 2Z5WA 4A7KA 3SH3A 2IXCA 3VZMA 1RUH1 4Q27A 1WMEA 4U2AA 5J98B 5ABJB 5GZCA 2XLFA 1APNA 4CCKA 4RS5B 1YYNA 4XZPA 1TNRA 1AXKA 3NSTA 5FY7A 3WHUA 3WF3A 5B4XA 2OXBA 1BJQA 1YIPA 1KITA 2BVVA 2P3YA 5D2AA 5AVPA 3AVSA 2HWD2 5L7OA 1GWMA 4PLOA 4QT6A 3LAGA 3OGRA 2WLPA 2HWC2 4MXWA 3VBFB 2ZGRA 1ND2A 2VMHA 3WF0A 1GQHA 5C33A 3BGAA 3PU8A 1UMIA 1CAXA 3OYWB 5F3GA 4B1MA 5C3OA 2LUWA 2D3SA 2HEVF 1HRI1 1XU2A 5DUVA 2VVEA 2PHUA 4L11A 4I0BA 2NLRA 3LA7A 5LA9A 2W0XA 1MS3A 1XYPA 2RHPA 5B4NA 5IT6A 1AR91 4J1XA 3CQOA 3QCWA 5C9AB 3TEWA 4WZCA 1JZ5A 5FWJA 1VB2A 4OVEA 2WNUA 3WG4A 1BCXA 1W0PA 3RMXA 3HBZA 2QQJA 2UWBA 1ND2C 1ULOA 1LODA 2ZJCA 4UFLA 1UQXA 2RS11 4ASKA 5FZFA 1V70A 3KZ4C 4ZONA 1X82A 4WVMA 2YG0A 4QQ2A 1J1LA 1GQGA 3IAQA 5FY1A 4ES9A 3R6SA 2WINB 1N47A 1SFNA 1IOAA 5DAQA 1I9RA 4PI0A 4IEYA 2PMWB 3AMMA 3TN92 1FPN2 4PT6A 5C3PA 2XJTA 1O8SA 2ZX0A 2ZXQA 4FAGA 2IXKA 1PK6A 1RUD1 1SCRA 3MDPA 4O65A 5D8AC 1SEFA 2VUCA 2CGPA 2WNUC 1U5ZA 1L3JA 2DTWA 4QDQA 4B8EA 3R4SA 2Y26A 1LESA 2XBO1 4P9YA 5I91A 5IYYA 4LKSA 1IS3A 4YGDA 3GNEA 2Q8DA 3NWKA 1PHMA 3ZXJA 4A6SA 4UOJA 3TNPB 5F9TA 2GNMA 4XJAA 1OA3A 5EV7A 5IATA 3P6BA 2W68A 5HV0A 1QIQA 1H30A 4PIXA 4RFRB 5IW0A 2VULA 4X8NA 1UOFA 5SV5A 5AFBA 4YG6A 1W9YA 1XNTA 5E16A 4QHOA 3ZOIA 2R1BA 3FE5A 5FYBA 1PK6C 1T2XA 4BOWA 4IUGA 5H9QA 2BWAA 4KMQA 4XABA 1ASJ3 2ZGQA 5EXOA 2X05A 2VOXA 3NW4A 1PX3A 3AZZA 4B7EA 3DYMA 1RINA 3P5BA 5C5UA 1QY4A 5C3QA 5IFPA 1JZ6A 4QKNA 4HK8A 4UF0B 4JKKA 5GM0A 4A7ZA 4CXYA 3GZEA 2FZ2A 4NO4A 1W8OA 2WN2A 3MHZA 4X6RB 2D6LX 2ATFA 5FYMA 3KSCA 3HR9A 2RG4A 5IK8A 1O5LA 1AZDA 1RHI2 4CDUA 1UMHA 1XBFA 2R073 4ONUA 1LEMA 2QQIA 1UOBA 1OF4A 3W5MA 1UU5A 1WD4A 1X8EA 5LBBA 4LEJA 1PGL2 3W59A 4Y1YA 1JODA 3F2ZA 1E5SA 2DVDA 3ZXAC 2VZPA 4J1WA 1BEV3 3FWEA 3N7MA 4NR1A 5DAWA 1LHUA 5FXVA 2HWD1 3FMGA 5M0TA 4M00A 3PJQA 4Q1PA 3CEWA 2HWC1 2JE8A 4IERA 4PLNA 2RDSA 3GHMA 1TMF1 2C6SA 1H2KA 4PF5A 1S0IA 4CDUC 4AEDA 3L2HA 3MLKA 3ZXEA 1ZZ8A 1AUYA 4BQ1A 5FR3A 1LTEA 1G8WA 4UFHA 2CU5A 2GP3A 3K2OA 3OUIA 2ZBJA 4LHLA 5I0DA 3M3EA 3OTFA 5FPZA 2GC0A 5LW9A 4ZY9A 1F4AA 4LBQB 2VH9A 2Y6GA 1TEIA 4YW6A 2P1BA 1HV0A 1QOSA 1V6JA 2JDHA 3U75A 5JOYA 5KXEA 2FDJA 1SFYA 2VNGA 4QX3A 2JDZA 3J8F3 5CNAA 5F6LB 2Q8EA 1OF3A 4BB3A 2ZHKA 3UKTA 4HKWA 1HXS1 4LBLA 2EXIA 4LK7A 1VALA 5FPXA 3GBWA 2UY8A 4B29A 4AEDC 1ZBE1 2ZGPA 3MIHA 3VBHB 1CR7A 4GJYA 4L9BA 3RZHA 5FZ3A 2CL2A 2A6XA 1LKNA 1SLBA 2WABA 3MI8A 5K8SA 1AR83 1ZA7A 3MF9A 3O1SA 3HWJA 1J1TA 2R1DA 3WY6A 3IDEA 5JUVA 1VR3A 3VKLA 2WO3A 4JGZB 4YVWA 1WMDA 2JE9A 1JZ7A 1WD3A 4PQ9A 4KGQA 2R16A 1IPSA 1GMMA 2OT7A 4BMBA 1E5IA 4CUCA 4FTEA 2B45X 3S30A 4BK4A 4LO7A 2LTNA 2A1XA 4RHV2 1WZXA 1GZCA 1ZNPA 2VZVA 3DXUA 4MSVA 4H2AA 3H3ZA 4CCMA 3KQRA 3MIGA 5F6KA 2ARXA 2VW0A 3ZN4A 5DUXA 4LA3A 4AEJA 1CZSA 5HI0A 3H1MA 1C28A 4WM7B 1W99A 4FXGB 3VDDC 3FL7A 4A3XA 2A73B 4D8MA 4CEWC 2BZDA 3BU0A 1FI2A 1L7RA 2GDFA 2QTWB 2XLAA 4FOYA 1MVEA 4Y3OA 3RDIA 4XUPA 3MLJA 4Q4Y3 5KHHA 5IK4A 2VC9A 1WBFA 4FPOB 3A7QA 3LWCA 4IGOA 5FO9B 4QPGA 3RVHA 1UIKA 1WW6A 4LHKA 4R52A 3KT1A 3APBA 4WM8A 1SPPA 3ABZA 1C57A 1ZRIA 4YARA 1LGBA 4Z2WA 2B7YA 5FUPA 4IETA 1CESA 1ZM1A 2FMDA 5FOJB 3HNBM 3VKNA 2Y38A 3BVCA 3EYPA 1OXCA 5HXVA 1MS8A 5GZFA 4CE8A 5BNNC 4MO3M 3DYPA 2E7QA 5A3TA 4I2OA 2YBKA 2ZX2A 4GWJA 5FWEA 4CSWA 1RUJ3 3RS6A 5JMOA 4LBQD 1ZZ9A 2B9UA 2BVBA 5A6ZA 3WCRA 4ASLA 3K48A 1RUF1 2KD7A 2WRAA 2YV8A 4QM8A 3WDTA 3O1VA 3BIEA 5FZKA 2EXKA 1YFXA 2XJRA 1QJY2 2NM1A 4JQRA 4QPGC 4XF3A 5FYYA 1PGL1 3LPGA 3UETA 2YC2A 4WM8C 2DYCA 1V9U3 3W20A 1W8HA 2WKKA 1Y4WA 3U4SA 4Q8KA 3N7KA 4CEYB 1YQ2A 5FZHA 1WWYA 1DYKA 4MHRA 4CDXB 4HLTA 2C0ZA 3WW2A 2OW4A 4MGIE 5FXZA 1VIWB 1HB2A 1QWRA 2VOTA 2YGLA 5APAA 4OHXA 1F5JA 4FT8A 4NMIA 1DQ5A 5CZKA 2G1MA 3AJZA 1GYKA 4RGAA 1IPJA 1FOD3 3ZYRA 4CP9A 1K42A 1CPMA 4K21A 4HK9A 1LU1A 3RJRA 4NAOA 1PIV1 1RUE1 2ADEA 4KGGA 1H2NA 2WN3A 3ETQA 4MLOA 4MADA 4J25A 4FFGA 3BPSA 1H8TB 5L73A 1F4HA 5F3CA 1LOFA 3BN6A 1VAKA 1CIYA 2HH9A 3E97A 5A7QA 2GN7A 4BWOA 1ZZCA 3T09A 5J3UA 2JX9A 5FBJA 3VKFC 4TLGA 1FATA 4HMZA 2OYZA 3I2KA 4IEPA 4K8RB 3MIBA 3SQOA 1ODMA 2ZX4A 3GJAA 1QDOA 3FHAA 1Q43A 4ISRA 4XZUG 1N3OA 3WG3A 1PM7A 4QX5A 2DBNA 2WJSA 4S2GA 3ZN6A 4MVTA 2A75A 4DPNA 4YZ5A 1NCRA 1YIFA 2C1FA 2WQ4A 4FFFA 5GLTA 2ARBA 1RXFA 3LIHA 4JTOA 4IEQA 4NIHA 1LOFC 2FBEA 3RZMA 1LOAA 4RHV1 1FV3A 4QHZA 3WV6A 4UW4A 3WF1A 1VP6A 2H6CA 3UT0A 4IEZA 2QBXA 4IQPA 1Z7S1 2NZ9A 4JHZA 4YW5A 4FP3A 3NNGA 3CJIB 3AZYA 3BTAA 3S7IA 4ATFA 2DDUA 1NCRC 3SMHA 1HRV2 4YG3A 5IVFA 3AZWA 1DGWX 2AYHA 5G05L 4KI5M 2Z4FA 3ECQA 3MW4A 1CJPA 4O9EA 4B4RA 3LOIA 3SCFA 2BFUS 3T1LA 2VNOA 2BOJA 3MV01 3J9SA 4LE4A 3ZSLA 4DRVA 2XWBB 3MIFA 5FFOC 3ZKYA 1QQP2 1AR73 3WDVA 1ULGA 3VD9A 2WAOA 4N9IA 2GZWA 4PF1A 2BNOA 2QQVA 4CU8A 4UW3A 4BZ4A 2J1SA 4FSJA 1KS5A 2B5HA 3ENRA 4XIOA 4XUOA 3RPQA 1QJZA 1W03A 1W2OA 2XGXA 4LUKA 3ZPYA 2JJ6A 4COUA 5HV4A 4AI8A 3WOGA 3ACHA 4FP2A 4P9XA 2AENA 4CCCA 3H9AA 4CUAA 3BTXA 3JXSA 3AP4A 4CDQB 4DOUA 3AK0A 2D3RA 2VZOA 1GZWB 4CCDA 4LO6B 1KD7A 3IKWA 1ZRCA 2JENA 1N1YA 3D3AA 3M3IA 2Q1MA 3RWNA 4BYYA 1NYWA 1OQEA 2B9VA 4NWVA 4XETA 3VZKA 5F5CA 5C8CC 1UYZA 2Q30A 1PNFA 4N53A 4QXKA 5D8AA 4HOOA 1DZTA 5I8YA 4IV1A 2Y6JA 2ZKNA 5A32A 4JX0A 1ACCA 1OBNA 2YXSA 4TXWA 4QX1A 1H4GA 3CO2A 4OCTA 3LGRA 3CHXA 4NWWA 1VMHA 4N7IA 4E4HA 1RIRA 2VMGA 2X5IA 3VBOA 4LNVA 3WLUA 5E8AA 1LGCA 2VTFA 2XOMA 4P5YA 1IPKA 2JDMA 4Q4X2 2IZWA 2MEV2 1NLQA 2O8QA 4HKLA 2BDRA 1LRHA 3PL0A 1IKPA 3Q8CA 4N53C 4UAPA 1RL3A 3LSEA 3MIEA 2PQQA 2C4XA 1T6BX 3NKGA 2RS33 3O12A 1AYN2 4NJ4A 3S7EA 2PLV2 3NAPB 4HG6B 1SLTA 4IV1C 4XBLA 1CAWA 1WW4A 2JXAA 1NA1B 3IDBB 5DABA 1IZ3A 3C7EA 5F5IA 3V0BA 4R9DA 1F8VA 3N36A 4ZS3A 3VDDB 4IEXA 1WA6X 3VBOC 3UL2A 4BE3A 1VBC2 5KWRA 3HT2A 4AQ2A 3M70A 1Y9MA 5E88A 1F5FA 5DDJ2 4A3ZA 3AP9A 1W6MA 1JZ8A 1AL0G 1S2BA 1SDDB 3WP4A 1Y43B 4AHZA 4CTEA 3GZUC 4OHWA 5JZGA 1VBD2 1ZBA3 1A3KA 1IGOA 1KS4A 2WWSA 3W9AA 3NV4A 1F15A 5FYUA 5BY5A 4LO8A 2R071
chains in the Genus database with same CATH topology
5DAQA 2A1XA 4KBZA 4BQYA 2Y34A 4Q5OA 3OBZA 3NNJA 2OPWA 3ITQA 3HQRA 4XC9A 5IATA 4BQXA 5HV0A 5ERLA 5LBEA 5A3UA 4Y5SA 4UWDA 3KT1A 2FCVA 5L9VA 3OUHA 4XABA 3BVCA 2JIGA 5EPAA 5C5UA 5HV4A 3GZEA 5DAVA 5LASA 2FCUA 2RG4A 4BQWA 4IW3A 3W20A 3KT7A 2RDQA 5LBBA 2RDRA 3NNLA 5LB6A 2RDNA 3MGUA 4XAAA 3NNFA 4MHRA 3W21A 5DAWA 5M0TA 2FCTA 4MHUA 5IAXA 3DKQA 4JZRA 4NMIA 2RDSA 2G1MA 5C5TA 5DAPA 5EP9A 4XCAA 3NNMA 2Y33A 2G19A 3KT4A 4NAOA 3OUIA 3PL0A 4J25A 4XCBA 5LBCA 4NHKA 5LA9A 2JIJA 4NHXA 5IAVA 2V4AA 4Y5TA 3HQUA 3GJAA 4ZPIA 5EQUA 4XACA 5L9BA 5LBFA 4NHYA 5DAXA 2HBUA 5LATA 3OUJA 4NHLA 4ZONA 3GJBA 3EMRA 2HBTA 5L9RA 4NHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DAQ A;  2A1X A;  4KBZ A;  4BQY A;  2Y34 A;  4Q5O A;  3OBZ A;  3NNJ A;  2OPW A;  3ITQ A;  3HQR A;  4XC9 A;  5IAT A;  4BQX A;  5HV0 A;  5ERL A;  5LBE A;  5A3U A;  4Y5S A;  4UWD A;  3KT1 A;  2FCV A;  5L9V A;  3OUH A;  4XAB A;  3BVC A;  2JIG A;  5EPA A;  5C5U A;  5HV4 A;  3GZE A;  5DAV A;  5LAS A;  2FCU A;  2RG4 A;  4BQW A;  4IW3 A;  3W20 A;  3KT7 A;  2RDQ A;  5LBB A;  2RDR A;  3NNL A;  5LB6 A;  2RDN A;  3MGU A;  4XAA A;  3NNF A;  4MHR A;  3W21 A;  5DAW A;  5M0T A;  2FCT A;  4MHU A;  5IAX A;  3DKQ A;  4JZR A;  4NMI A;  2RDS A;  2G1M A;  5C5T A;  5DAP A;  5EP9 A;  4XCA A;  3NNM A;  2Y33 A;  2G19 A;  3KT4 A;  4NAO A;  3OUI A;  3PL0 A;  4J25 A;  4XCB A;  5LBC A;  4NHK A;  5LA9 A;  2JIJ A;  4NHX A;  5IAV A;  2V4A A;  4Y5T A;  3HQU A;  3GJA A;  4ZPI A;  5EQU A;  4XAC A;  5L9B A;  5LBF A;  4NHY A;  5DAX A;  2HBU A;  5LAT A;  3OUJ A;  4NHL A;  4ZON A;  3GJB A;  3EMR A;  2HBT A;  5L9R A;  4NHM A; 
#chains in the Genus database with same CATH topology
 1ZZ7 A;  3IMM A;  2AUY A;  5J37 A;  1YUD A;  5EWS A;  1RJ7 A;  5ANN A;  5FPL A;  5FZC A;  3T2O A;  5BNN B;  4O7X A;  1SG3 A;  3A23 A;  3AMQ A;  3OY8 A;  4PQQ A;  2WS9 2;  3J7N A;  1EPW A;  4Q5O A;  2QJV A;  3NNJ A;  1EYB A;  4V2W A;  2JEM A;  1BEV 1;  2ZHL A;  1XC6 A;  4C0B A;  2MHF A;  3VZO A;  3S57 A;  4AQS A;  1WKY A;  4XMI A;  5JZG C;  5T5O A;  2VG9 A;  2VGD A;  3ST7 A;  2ZEY A;  1VAV A;  1JOP A;  4NOT A;  5FZB A;  1JOJ A;  4QB1 A;  3S0M A;  2Y6F A;  5DG1 A;  2QQM A;  2E9Q A;  4FOV A;  5BV6 A;  1MZ5 A;  1TG7 A;  3D4K A;  1TME 2;  3FX3 A;  3VBR A;  5DUU A;  2OQ7 A;  4BLI A;  1LCL A;  4XJ8 A;  1YJL A;  3TEX A;  1JHJ A;  2DCZ A;  4HSJ A;  4Q0V A;  4NII A;  4BXS V;  1W9W A;  5GLW A;  2BQP A;  4DUX A;  4DY3 A;  2FHR A;  3PVO A;  4FQZ A;  3N9L A;  2HWE 2;  1W8W A;  1AYM 3;  3OGJ A;  4XQ4 A;  3ZXD A;  2WFF 2;  5IFT A;  3ACL A;  4NE9 A;  1D7P M;  4XIL A;  5FZ1 A;  1GUI A;  1W8Z A;  2CHH A;  4IES A;  3SKJ E;  1YQ5 A;  1RUC 3;  1FX5 A;  2E33 A;  4YM3 A;  1K5M C;  5E89 A;  1CAU B;  4LJH A;  4M0H A;  3FN9 A;  3THP A;  5EZW A;  3T30 A;  1J3R A;  1V6M A;  3VBR C;  2XJQ A;  5FZO B;  1U0A A;  4F3J A;  3AZV A;  5DUW A;  4BXF A;  4I0W B;  4M3C F;  3J26 N;  2AZ5 A;  3AJY A;  3GXU A;  3IPV B;  1OA4 A;  2J42 A;  3JQW A;  1OSG A;  3LFM A;  5FY0 A;  4Z2A A;  4ZZ5 A;  4ZXE A;  3H8U A;  4QMA A;  4SLI A;  1O4Y A;  2ZOE B;  4Q4X 1;  3PUI A;  3EXU A;  4X6Q B;  1Z78 A;  4GB3 3;  4XUQ A;  4D7S A;  3PTY A;  1IQA A;  4RR3 A;  1RMU 3;  2TBV A;  1D0H A;  1POV 3;  5BNP B;  2G4I A;  1NZI A;  4LO5 B;  4MGS A;  4CP0 A;  1W05 A;  2PLV 1;  3L9J T;  4Y22 A;  2NQY A;  4Q4V 3;  3AKS A;  4Y20 B;  4F83 A;  2HJI A;  1X9P A;  4XCB A;  3IZO A;  4Q4Y 1;  1ZRR A;  4AXO A;  3B94 A;  1UZ0 A;  4FOQ A;  2AH2 A;  2JIJ A;  1WGP A;  1H1M A;  2IWG B;  4AQT A;  2FDF A;  5FZD A;  5LK5 A;  1W8N A;  4LOR A;  1VRH 3;  1XU1 A;  2WZR 2;  1W8F A;  4Y5T A;  1C8M 3;  1PGW 1;  2GP5 A;  2LRP A;  3NMB A;  4PBP A;  2JG9 A;  1EAH 3;  1ST8 A;  1W2T A;  1BVP 1;  2PHX A;  4RR3 C;  4DUV A;  4QXH A;  3VBU A;  2EIG A;  1DLC A;  1VBD 1;  2D6O X;  3OOX A;  2W39 A;  4DFS A;  4DXZ A;  1A78 A;  1RUJ 1;  3VDB A;  3WT3 A;  4B7K A;  4OI0 A;  1PO2 3;  5E6H A;  1ZZB A;  3IB3 A;  3PVE A;  1RUG 3;  5DZF A;  5A3P A;  4XPV A;  2YPJ A;  4TTG A;  1XPW A;  4L99 A;  3EHK A;  2Q5T A;  1ND3 A;  5JDB A;  2CSG A;  3GZT B;  2WS9 1;  1VBA 3;  4MET A;  1OUR A;  2PAK A;  4AHW A;  1CD3 G;  1RED A;  4ISQ A;  1LHO A;  4GQ7 A;  1GKB A;  2JG9 C;  4CCE A;  1HRI 2;  4HVR A;  1DCS A;  4H7M A;  2GMP A;  2GMM A;  4YW7 A;  1VLN A;  3VBU C;  4JGY C;  5JMC A;  1BKZ A;  1SCS A;  3BTY A;  1PZ8 A;  1ZRE A;  1YFY A;  3LA3 A;  1AR9 2;  4RD7 A;  1VBB 2;  3B00 A;  1NKG A;  4YZ4 A;  3ZFE B;  1I6X A;  2ZMN A;  1GP4 A;  2EXH A;  2GC1 A;  4L8Q A;  1W3V A;  4Q0Q A;  3RJ2 X;  1W6P B;  3VHO A;  1TME 1;  2BU9 A;  3K75 B;  1W8U A;  1ND3 C;  3ZYB A;  3ELN A;  3LA2 A;  2Q4S A;  2RS1 2;  4DIQ A;  5B2G B;  4JVA A;  1CVN A;  4Q29 A;  1DYP A;  1HN0 A;  3HN1 A;  2P3J A;  4H7L A;  2PXJ A;  3ACI A;  3C8X A;  4TN7 A;  1W9S A;  3NVC A;  4ARY A;  1B35 C;  2E6V A;  3KVA A;  3LB9 A;  5FOB B;  1H9P A;  1EY2 A;  3PUH A;  2D93 A;  1HN1 A;  3TYJ A;  1BK0 A;  4OYU A;  1N3Q A;  2YFZ A;  4NRM A;  3LEG A;  1GOG A;  4XHB A;  2QQP A;  1NCQ A;  2WII B;  2JIC A;  2XWJ B;  1GNY A;  4KWL A;  4H14 A;  3LFI A;  4RSU A;  1NE6 A;  1W39 A;  1XRU A;  2DVF A;  4BQ2 A;  3GAL A;  1SLA A;  4CUB A;  3NV2 A;  4KG8 A;  3ZSE A;  4OMD A;  4ES8 A;  1Z0H A;  2IFW A;  1CX1 A;  3UV9 A;  2C5D A;  4IW3 A;  4NRQ A;  2XUE A;  1ENR A;  4CDW B;  3SXW A;  4FPK A;  2ZAA A;  4GWM A;  1YC6 1;  2RDQ A;  2VBP A;  1XNA A;  2ZGK A;  3HEI A;  5A3L A;  5FP7 A;  1RUI 3;  4LHN A;  3AVR A;  3HJR A;  3ZX7 A;  5FQ0 B;  3OPT A;  2ENR A;  1UOJ A;  5H9R A;  2WO1 A;  4S2D A;  4MGK E;  1NCQ C;  2EXJ A;  1WA4 A;  1NAE A;  1ZZ6 A;  2EVX A;  2VUD A;  1WLT A;  3KVB A;  3BB6 A;  4W8J A;  4GWN A;  5BYN A;  2D43 A;  4EZH A;  3H0O A;  3N7L A;  1OA2 A;  1O4Z A;  2DFB A;  2NPI A;  4XFF A;  2VCB A;  2XHN A;  1VRB A;  3I3Q A;  3PUR A;  4XXP A;  2J1A A;  1FMD 3;  2QFE A;  3HN3 A;  3I7D A;  4Z07 A;  2O8O A;  4GAL A;  3JU9 A;  3RMY A;  3TOJ A;  2ZHN A;  1QMJ A;  4E4Z A;  4QPW A;  1JBC A;  1UX7 A;  4H55 A;  4A7Y A;  1ENX A;  3GYD A;  4QPI B;  1H1I A;  2EID A;  2OUH A;  1JS9 A;  2ZEX A;  2OA2 A;  2JDU A;  3PDQ A;  3QLQ A;  1UKR A;  1PX4 A;  3B01 A;  2B4K A;  3KS7 A;  4OHV A;  4RQP A;  2WT1 A;  1WCS A;  1RIT A;  4NHX A;  1WW7 A;  1AR7 1;  3B7M A;  1HIX A;  5GLU A;  2WLQ A;  1S55 A;  2V4A A;  5F5A A;  4W6Y A;  4RGK A;  3UGG A;  4LUL A;  1F31 A;  1AXY A;  4IEW A;  3T2P A;  3O1U A;  3FLT A;  3IWZ A;  4E27 A;  1Q8P A;  1W0O A;  3MFA A;  3BKZ A;  1UOG A;  1X8M A;  3J7M A;  3E5U A;  1W6N B;  3GJB A;  2NYY A;  1TMF 2;  1JXN A;  1DHK B;  4XW3 A;  2G9Z A;  4Y26 A;  1UU6 A;  2HBT A;  1C5H A;  2QQO A;  1SBD A;  2RR1 3;  4OUL A;  2QE3 A;  3O14 A;  2V72 A;  5FK7 A;  1WLD A;  3N9P A;  4EWE A;  1CIW A;  4CEY A;  3WSO A;  3MUZ 1;  1OH4 A;  3I54 A;  2ZML A;  1VBB 1;  3RZG A;  4IEV A;  1WUV A;  3FUO A;  4XFC A;  4E8C A;  2GME A;  1LB2 A;  1NXM A;  5L7O C;  2ZGM A;  3E5Q A;  3AYE A;  3VB9 A;  2ERF A;  2B42 B;  3QH6 A;  1HXS 2;  4PCR A;  3AMH A;  4GKX A;  2XKP A;  5CB7 A;  5JPN B;  4FXK B;  3E6B A;  5FMB A;  3OD0 A;  5LBE A;  2W1Q A;  1ZBE 2;  3UJO A;  3MLL A;  1TNF A;  2DCJ A;  5FCC A;  3LD8 A;  4JV4 A;  1XSR A;  2OKX A;  3ILF A;  2WBK A;  3ZO0 B;  5T50 A;  4Z1V A;  2P6C A;  1UAI A;  4PDW A;  2R06 3;  3CF6 E;  5FIX A;  1JH5 A;  1BK1 A;  3TRS B;  3S5A A;  1RVF 3;  4TSV A;  2FDK A;  3B9C A;  2ZTN A;  4M0N A;  5HXM A;  4IV3 A;  2WNV A;  1ODN A;  5A70 A;  5FRE A;  1NLS A;  1G86 A;  4MGQ A;  4EN7 B;  2JDA A;  4AWD A;  4GKY A;  4XHX A;  1XJA A;  4QU2 A;  4AI1 A;  1AHS A;  2O1Q A;  5D1I A;  4AF9 A;  4COV A;  1RXG A;  5A33 A;  4BQW A;  1DQ4 A;  4D3W A;  5JOW A;  1BBT 3;  5T5L A;  1SLL A;  3Q8B A;  3F95 A;  3I2H A;  3CBN A;  2LRO A;  4K40 A;  1OI6 A;  2AEZ A;  5A7O A;  5LA0 A;  3FBY A;  2FD8 A;  2VMC A;  3JB8 A;  3RYP A;  1ZBA 1;  4FVV A;  4PDW C;  5JR7 B;  2AC1 A;  2BW8 A;  3POE A;  5H9P A;  5JI7 A;  1U12 A;  2XB6 C;  1R1A 3;  1ULE A;  2ZGN A;  1FNZ A;  3THC A;  1H6X A;  1MZ6 A;  2XVK A;  2WDB A;  4IV3 C;  2WNV C;  3TBD A;  3I2D A;  1MQT A;  3KHB A;  3T0A A;  3ZYG A;  4B1L A;  2N7G A;  4J6G A;  2OZJ A;  1J83 A;  1UL9 A;  4NPR A;  1JYI A;  2HWF 3;  3ZFF B;  3U4X A;  1GLH A;  5EP9 A;  2B46 X;  1MEC 3;  4GMP 1;  3WX5 A;  2VO5 A;  4R8H A;  3VLB B;  1QJU 2;  2ZZQ A;  4LQR A;  2WQZ C;  3NV1 A;  4R4Z A;  5IVY A;  5GZD A;  3I59 B;  3AP7 A;  1WMF A;  2ILM A;  4XJZ A;  1RUF 2;  1ZVF A;  4IL7 A;  4DIN B;  4XFI A;  4MX3 A;  3LOB A;  1XXN A;  2OUJ A;  2QCS B;  3III A;  5KXC A;  2A5Z A;  4GH4 B;  4BLJ A;  4YSF A;  2AR6 A;  1YWK A;  3FFZ A;  3ZVX A;  2WWU A;  3D8C A;  1DG6 A;  3DEC A;  4JDM A;  4OFG A;  3T08 A;  4CPB A;  4CA9 A;  3MZH A;  4BCU A;  4JDN A;  4IXL A;  4JGY B;  1M4W A;  2Z42 A;  5JCT A;  1MQT C;  4AFM A;  5FZA A;  1LNS A;  3MEP A;  1CN1 A;  2HYX A;  3M4F A;  3N4M A;  4AOC A;  5EQU A;  3V0A A;  1W06 A;  2DFC A;  3NQH A;  3VD3 A;  3ZDV A;  1PNG A;  5F1R A;  2OII A;  2VZS A;  2WYF A;  4GMP 0;  1COV 3;  5LBF A;  5C4W B;  5LY1 A;  4A42 A;  1YFW A;  1AYM 1;  2VU9 A;  5L19 A;  4DUW A;  4S2H A;  1EUU A;  1AR6 3;  2H6B A;  1N3P A;  3VBS A;  3EMR A;  1UNB A;  4IEO A;  4DXS A;  1RUC 1;  2LS6 A;  1QJX 3;  3FHI B;  4XXA A;  2FDG A;  2TUN A;  1B35 B;  1D0G A;  1YJK A;  1OKQ A;  1PIV 2;  1RUE 2;  3ZFG B;  4ZU4 A;  4FI9 A;  5GKA C;  5FTT C;  1YQC A;  3K3O A;  4LR4 A;  1ZYB A;  3UES A;  1XE0 A;  3P3N A;  1J3P A;  1OPM A;  2YZ4 A;  1JI6 A;  4HBN A;  3CZJ A;  2X09 A;  5J48 A;  2CAV A;  2JG8 B;  4GAZ A;  1J59 A;  4YZ2 A;  3E5X A;  4UXA A;  5BNO A;  1LEN A;  4Q4W 3;  3KMH A;  3THD A;  5C70 A;  1XE7 A;  4GB3 1;  3VBS C;  3GBF A;  4KG0 A;  4C91 A;  4LBN A;  2ARC A;  1REF A;  3I3B A;  1RMU 1;  3LEM A;  4AL9 A;  4EWA A;  2GAU A;  3KF3 A;  1LOE A;  3T0B A;  2R04 2;  2IXI A;  2ZGT A;  1AL2 3;  2ZEZ A;  2XG3 A;  1MAC A;  3VD4 A;  4XF4 A;  3CKH A;  2VCM A;  3OUH A;  5A1F A;  2KA3 A;  1V6L A;  3MW3 A;  1HW5 A;  2PA7 A;  1JYX A;  3D82 A;  4QXB A;  4N43 A;  1GOH A;  1VMJ A;  3RSJ A;  5IVJ A;  5CFD A;  4G4F A;  5F37 A;  5BNO C;  3ON7 A;  2DUR A;  1Z7S 2;  1W2A X;  3KLS A;  5E1R A;  3JBG 3;  5DN2 A;  4Y1U A;  1UZV A;  2QDR A;  1VJ2 A;  5AVA A;  4YYO A;  1UXX X;  1WCD J;  1PVC 3;  5JR2 A;  4YVW C;  4IE7 A;  5FY8 A;  4A44 A;  2VNR A;  3O5S A;  1W28 A;  3WQ7 A;  2Y64 A;  4AVA A;  3C7G A;  5JSR A;  3GF6 A;  3O1T A;  2ZAB A;  5FMO S;  4B3N A;  4K1Y A;  5DMY A;  1W3X A;  1DLL A;  1O59 A;  2ZAH A;  5JIA A;  4P9W A;  4C90 A;  4N43 C;  3NJZ A;  3ZR5 A;  5A1A A;  4FTS A;  4AW7 A;  3MGU A;  4W65 A;  1LHW A;  3NNF A;  1S0G A;  5CFD C;  1PMI A;  1OUX A;  4HKO A;  3WNP A;  1VBA 1;  3H8O A;  2VCA A;  4OQ9 A;  3ZDS A;  3POI A;  1NT0 A;  4AFC A;  1DQ2 A;  1W6Q B;  1QJU 1;  3RFR A;  4JZR A;  4QGM A;  2DF7 A;  5CVR A;  4OI4 A;  5K0U A;  4COZ A;  1C1F A;  3HIF A;  4N8M A;  2VY0 A;  4XDQ A;  4E2S A;  2G19 A;  2XJS A;  3BOD A;  4TLF A;  4XUN A;  4DZG A;  4XQW A;  4Q8L A;  1OOP A;  3CDZ B;  5A7S A;  1LJ7 A;  1POQ A;  1C8N A;  1O4T A;  1ZRF A;  3BIW E;  5FZI A;  1DBN A;  1O8P A;  1MS5 A;  4Z82 A;  5FZE A;  4BM8 A;  1G9D A;  3M3Q A;  3KCY A;  1S1A A;  2D5H A;  2H0B A;  3FZ3 A;  1W9T A;  3ZXK A;  4MYE A;  5L7O B;  2VNV A;  4ZZ8 A;  5BXX A;  1MS4 A;  1CAV A;  3HQU A;  1F2N A;  1ZA4 A;  4HZF A;  2VW2 A;  3RNS A;  1ND2 B;  3WR0 A;  5K0U C;  3EJK A;  1QNW A;  4MGY E;  4SBV A;  4YFZ A;  2DTY A;  1CAX B;  4QKD A;  4YG0 A;  4G9S B;  4ZU7 A;  3WZ1 A;  3HQX A;  4ET7 A;  1OOP C;  2D97 A;  1QOT A;  3OUJ A;  3DPR A;  4ZU5 A;  1MS9 A;  3FUQ A;  4DRR A;  2ZZJ A;  4M3C A;  4NAM A;  2VOW A;  5CAD A;  3IIA A;  5JOZ A;  4COY A;  2JD9 A;  4AR2 A;  3RG0 A;  1PO1 3;  3OEB A;  4HT1 T;  5CFC A;  3M7A A;  3H3L A;  5FK8 A;  3K51 A;  5A3M A;  1DU3 D;  2WNU B;  3LSD A;  3LPF A;  2XVG A;  2D5F A;  3BU7 A;  1KJL A;  4H3W A;  2QQN A;  3PJY A;  3RYK A;  1LOC A;  2OX0 A;  1XNK A;  2YPD A;  2PTM A;  4QM9 A;  4XF0 A;  4AVB A;  5GZG A;  3NL1 A;  2WUH A;  4WVM B;  2WSV A;  1EUT A;  2RJK A;  3DPR C;  3OEA A;  3T2Q A;  3RGB A;  2A3X A;  1ASJ 2;  5JXJ A;  1N1V A;  5KHJ A;  2R04 1;  4N7U A;  4WVW A;  5I8S A;  3WDY A;  1JU4 A;  4ARX A;  4DEV A;  5CFC C;  1FMD 1;  1GZ9 A;  1PK6 B;  2GH8 A;  1QOO A;  1UXZ A;  1YCI A;  1D4M 3;  3H42 B;  1JTZ X;  3KV4 A;  3ZMN A;  5ANQ A;  4EN8 B;  5IVC A;  1OLM A;  4NPM A;  1H8V A;  4LKE A;  1MEC 2;  3VUO A;  3S6P A;  5KC5 A;  1Y9Q A;  5CKQ A;  1LU2 A;  4JAA A;  5KBF A;  3AMP A;  3RYR A;  4FAH A;  1G7Y A;  3KF5 A;  2R07 2;  1EP0 A;  3ES4 A;  1AJO A;  3NRU A;  2UUR A;  4JTN A;  1R09 3;  5F32 A;  4IE4 A;  4I3G A;  4HPK B;  1UMZ A;  4IGP A;  4IDZ A;  3ACG A;  1ONA A;  5AC9 3;  2WYS A;  1R08 3;  2IVJ A;  4YZ3 A;  4YVS A;  1BEV 2;  1UYY A;  1N1T A;  2ID4 A;  4RGG A;  1Q8S A;  3OBA A;  1VAM A;  1E57 A;  4E4S A;  1ULD A;  4TZD A;  2RJL A;  5A7W A;  1IQD C;  2R6Q A;  3ILR A;  3MUY 1;  5FJK A;  1G9C A;  3WF2 A;  1IG3 A;  1XNC A;  4XAA A;  4KWK A;  1ALY A;  2RR1 1;  2H0V A;  1LED A;  3RQ0 A;  3LE0 A;  2Q1Z B;  2W1S A;  4KL1 A;  1DZR A;  3C7F A;  3WF4 A;  4QGL A;  1HQL A;  2HWB 3;  2QKD A;  4Q0S A;  5C7G A;  4W6W A;  1NG0 A;  3UK9 A;  3M3O A;  3MF6 A;  5EJ1 B;  4KWU A;  4CDU B;  4CUG A;  3WQ0 A;  2XPJ A;  2P3I A;  2ZEW A;  1KXG A;  1LHV A;  5FKC A;  4L0P A;  4YVS C;  1UO9 A;  3J8F 2;  4AG4 A;  2F4L A;  5DG2 A;  4QQO A;  1DDL A;  2X10 A;  2J22 A;  4XDO A;  2E7A A;  1RUH 3;  1R1Z A;  1B09 A;  1QNY A;  2CYF A;  3H7Y A;  1DF0 A;  4ASM B;  4QU1 A;  1UF2 C;  4EZ4 A;  4XDP A;  1AR8 2;  5IJR A;  2RMU 3;  3WVJ A;  1FYU A;  2RV9 A;  2CGO A;  2VW1 A;  3H7J A;  4AED B;  4BPZ A;  2P6H A;  4YGB A;  2R06 1;  2EF6 A;  5FP4 A;  5L9B A;  1RVF 1;  3AMN A;  1QXJ A;  2CWM A;  4K3U A;  4XUT A;  5F3I A;  4AHX A;  4GWI A;  1O6U A;  2HBU A;  4A41 A;  1I1E A;  3WG2 A;  5DZG A;  3V64 A;  1XND A;  2D7F A;  4LIU A;  2Q1F A;  3O1R A;  1GP5 A;  2RS5 3;  2WZP P;  3POY A;  4YNI A;  1JYW A;  2HEY F;  1FNY A;  4NHM A;  5HPO A;  3FJS A;  1GIC A;  1REE A;  4EN6 B;  4E2G A;  1LEC A;  4Q4Y 2;  2YFU A;  4LIT A;  2YU1 A;  1BLZ A;  2X5I C;  1K3I A;  4QWN A;  3U37 A;  3ACF A;  3OBZ A;  4K20 A;  5FQ0 A;  4CEW B;  1R1A 1;  1ASJ 1;  2QQK A;  1URX A;  4IEU A;  4PLM A;  4QPY A;  3ZYI B;  4YVW B;  1DQ6 A;  4UBH A;  1PGW 2;  3LQC A;  3MPB A;  1ULC A;  2WA3 A;  4KWJ A;  1KFU L;  1FT9 A;  4XFH A;  1NY7 2;  2HWF 1;  2W5F A;  4Y5S A;  2VMF A;  2IVI B;  1MEC 1;  1QF3 A;  1JHN A;  2VE1 A;  5FJH A;  2CNA A;  1RUD 3;  2CTV A;  1RUJ 2;  2V5Y A;  4HET A;  4NUB A;  3VDA A;  3ZSJ A;  2R0H A;  3ME2 A;  3B5L B;  1UKG A;  1JYC A;  2P34 A;  2ZCW A;  4QX0 A;  1MZE A;  1EV1 3;  3R0R A;  2P5B A;  3UKN A;  2XBO 3;  5L36 A;  4M01 A;  3USU A;  3VKO A;  3AFK A;  2E53 A;  1Y9G A;  2VQ0 A;  2FDI A;  4Y5Z 0;  4AFA A;  4P00 B;  1V9U 2;  3OGS A;  5A3N A;  1CGP A;  1GSL A;  4DQA A;  4AHY A;  2J1U A;  1UWW A;  4OUM A;  2BOI A;  1LOG A;  4GXL A;  4PHZ A;  4NIA A;  3SNM A;  5ABJ A;  2W91 A;  5KC6 A;  1YFU A;  4QPG B;  4RS5 A;  5FYS A;  4WM8 B;  2FCU A;  2YYO A;  3VZN A;  3WNX A;  1WBL A;  1YEW A;  2MNG A;  2EAL A;  3DCQ A;  1L7L A;  2ET7 A;  3RWK X;  2VD7 A;  3OBT A;  3KT7 A;  1GOF A;  5CIR A;  3WHT A;  3OF1 A;  3M2M A;  4GJZ A;  2D98 A;  4JRA A;  1ENQ A;  4PI2 A;  1AR6 1;  4WZF A;  4XE9 A;  2RDR A;  4IE0 A;  4IND A;  1VPH A;  2VZR A;  2R7E B;  1FOD 2;  3G6J B;  4FFH A;  1QJX 1;  3OYW A;  4CZS A;  3MW2 A;  4KQ7 A;  3WNM A;  2OZ6 A;  4XFA A;  2DVB A;  2IUW A;  2WNE A;  5CKM A;  3JD7 3;  1HKD A;  2WZ8 A;  3DYO A;  4LE3 A;  1HX6 A;  5FZG A;  1SAC A;  4N90 A;  4YLZ A;  5ABJ C;  1H4H A;  1UN1 A;  4RS5 C;  4L92 A;  5F8P A;  1XE8 A;  3VGI A;  3ILN A;  2V5D A;  3J8F 1;  2K2S A;  4U36 A;  2ADD A;  5DAP A;  4XCA A;  1TZO A;  2CV6 A;  2FMY A;  2SLI A;  1BQP A;  4KU8 A;  5C9A A;  3KT4 A;  3J7H A;  3MIC A;  4UT5 A;  2DUO A;  2XJP A;  3KB5 A;  4Q4W 1;  3VBF C;  2W87 A;  3WQB A;  5J7M A;  1AR8 1;  1D2Q A;  1CQ9 A;  3J4U H;  3TB0 A;  4XYX A;  5FAX A;  1C4R A;  3LEK A;  5BUV A;  1XOY A;  3SHR A;  4MG2 A;  1F35 A;  4LOT A;  5F2S A;  2HWC 3;  4XJ9 A;  5IAV A;  2CGN A;  4LUM A;  3BPZ A;  4Y4Y A;  1TQ5 A;  4FPF A;  1RGS A;  3I49 A;  4CP9 B;  1UD1 A;  1Y3T A;  2HKX A;  3WUD A;  1UZZ A;  2GAL A;  2PHF A;  1D4M 2;  3O1M A;  4RFT 0;  2QVS B;  3PUQ A;  2YMZ A;  3J7L A;  3JZV A;  4TWT A;  4BIF A;  2YBP A;  5C9A C;  2W95 A;  4B4Q A;  2E26 A;  3B9I A;  2Y8K A;  1QDC A;  1E5H A;  3JBG 1;  4ITC A;  1GNZ A;  2UYA A;  2CY6 A;  4DY5 A;  3I4I A;  4W4Z A;  2W3J A;  2PAM A;  4ORF A;  1HQW A;  3WQ1 A;  1PVC 1;  1GAN A;  1RUO A;  2G9G A;  2D6N A;  5EHD A;  1LAJ A;  3PHM A;  2VZ3 A;  2GC2 A;  4QB2 A;  5ISL A;  1LUL A;  4AVT A;  2Y34 A;  3ZLI A;  4CU7 A;  1JZ3 A;  2VZU A;  3INA A;  3ZN6 B;  2ZX1 A;  1W2U A;  5BPX A;  3W58 A;  1NCR B;  4QGN A;  4MH0 E;  1H9W A;  3ZYP A;  1CWP A;  1O7F A;  2E32 A;  2VQA A;  4QDS A;  1PMJ X;  2IC1 A;  4UW6 A;  5IVB A;  4I30 A;  1AR7 2;  2WQ8 A;  4NRP A;  5FPV A;  1NY7 1;  2RJ2 A;  5FYH A;  5I0T A;  3VHP A;  3HQR A;  3DL3 A;  2W46 A;  4LK6 A;  3TN9 3;  1FPN 3;  2A6W A;  4YFW A;  5CIS A;  1LOB A;  3A22 A;  2EA7 A;  3KV5 A;  4UF0 A;  1H6Y A;  1NUK A;  1YI9 A;  1WMX A;  3AL5 A;  5FRA A;  4QQP A;  1WCQ A;  2OQ6 A;  1UYX A;  1V9U 1;  3IT8 A;  3M8L A;  3POF A;  3LKJ A;  3U1X A;  3ZPO A;  4XF9 A;  5LRR A;  1BYH A;  4GH4 A;  3RRD A;  1DGW A;  1OVP A;  2JIG A;  3PVN A;  4YW2 A;  3KCX A;  3M1H A;  4CP2 A;  1T6G C;  3HOB A;  3ZR6 A;  4OZX A;  4D69 A;  2VJX A;  2DU1 A;  3ATG A;  1LHN A;  3WXP A;  3WD5 A;  1OD5 A;  3BTZ A;  1PMH X;  4XBQ A;  2YU2 A;  5FYV A;  5FYT A;  1IKQ A;  1OQD A;  2E63 A;  2ZKL A;  5F2W A;  3ETP A;  3IDA A;  4OUS A;  2Z79 A;  3K4D A;  5C8C B;  1N1S A;  3OJB A;  1HJG A;  1FOD 1;  3LEI A;  1O3T A;  1YXW A;  1E5R A;  2ZS6 B;  1MS1 A;  1MR5 A;  3D6E A;  2W92 A;  1VB4 A;  1U5I A;  5C8W A;  1L7Q A;  3GHN A;  2ARA A;  2C9K A;  4QDR A;  4Y1V A;  4AZZ A;  2ZMK A;  1RHI 3;  1US2 A;  1NOV A;  2WR9 A;  4AGV A;  2WAA A;  4LBQ A;  1W6O B;  2K46 A;  4DO0 A;  3I3M A;  2E7T A;  1OPO A;  3C7O A;  4ZXK A;  2BEO A;  2I2S A;  2RS3 2;  1JYN A;  5JPM B;  4LHS A;  1KJR A;  4UI9 L;  1DFQ A;  2QUO A;  4CP1 A;  2XL9 A;  1IS6 A;  5FLJ A;  2BUK A;  4N53 B;  5D8A B;  5FXX A;  2P37 A;  4LBM A;  3VBH A;  3I2G A;  2MPF A;  5KHK A;  3H1Y A;  4CU6 A;  4IV1 B;  5A32 B;  5I0R A;  3T3Y A;  4QD2 A;  1CZT A;  2BV4 A;  2YHJ A;  2ZGU A;  4UBG A;  4JGZ A;  3FBM A;  2X5I B;  3SCH A;  5JVV A;  3VBO B;  5A3W A;  1IS4 A;  1D4M 1;  3WP3 A;  3URF A;  2ES3 A;  4IE6 A;  5FUN A;  5JXI A;  1ZBA 2;  2PHR A;  3A21 A;  5F3E A;  1HB1 A;  5JOX A;  3ZYJ B;  1YLL A;  2OS2 A;  3T4V A;  3OBR A;  4XAC A;  3AZX A;  2BYV E;  2A6Y A;  4E8D A;  4LPL A;  2FQP A;  3AXD A;  1Q8Q A;  2YUE A;  4JHT A;  3VBH C;  5IVE A;  5LAT A;  4NHL A;  4S2F A;  4LTA A;  4WM7 A;  1CPN A;  1CAW B;  2NP0 A;  3AKQ A;  4XTM A;  2Y6L A;  3SLI A;  5AC9 1;  3V0B B;  4BA6 A;  4AI3 A;  4JGZ C;  4O9G A;  1R08 1;  2O14 A;  4DEQ A;  4CXW A;  3PVB B;  3AC0 A;  1X7N A;  4DXT A;  3EQE A;  4B4P A;  2VMD A;  2R49 A;  3CJX A;  1A8D A;  1O5U A;  1O3S A;  1JZ4 A;  3Q8E A;  5FP9 A;  3GDB A;  1W6M B;  2DBI A;  1S0J A;  2VM9 A;  5LCW L;  3WDX A;  1QH6 A;  4EJR A;  4BQ5 A;  3R4D B;  2OPW A;  4FTB A;  5JZG B;  2Y60 A;  4M4R A;  4XFB A;  3BI3 A;  4XTP A;  4RHV 3;  2HWB 1;  3D0S A;  4HAN A;  5ERL A;  1W6Q A;  1J3Q A;  3U14 A;  1YQ6 A;  5FP8 A;  2XUM A;  2E31 A;  1HB4 A;  3AB0 A;  4FFI A;  4V1P A;  2RE9 A;  3CL1 A;  1RTV A;  3OY8 B;  1AYM 2;  3CU7 A;  3ORJ A;  3VZL A;  4RQP C;  1FV2 A;  1MPX A;  4P5H A;  3VKM A;  2A70 A;  1OMI A;  5A7N A;  3T0D A;  2BP6 A;  3I2J A;  4LA2 A;  1VBE 3;  4YWA A;  1RUC 2;  5GLV A;  5T5J A;  4EV0 A;  3OGG A;  5JXG A;  1KDM A;  5HCH A;  3Q9O A;  1V6O A;  3DV8 A;  3JQX A;  4DS0 A;  4CVU A;  5IWF A;  1AX2 A;  4FPG A;  2RMU 1;  1JUH A;  2BER A;  2EAA A;  2Q8O A;  1NQD A;  3T2T A;  4CDX A;  3OPW A;  1TE1 B;  2WL1 A;  1K5M B;  3OCP A;  3AYA A;  2AAC A;  4C1W A;  1S0C A;  1BZW A;  1IS5 A;  1I5Z A;  2Y6K A;  2ZGS A;  3KD4 A;  5I93 A;  4JCK A;  3O0V A;  5FY5 A;  3FLR A;  3NJY A;  2W52 A;  4P08 A;  3VBR B;  3VV1 A;  5ACA 2;  5FZM A;  3B93 A;  1H0B A;  5GLZ A;  3OPZ A;  5CBL A;  1HDK A;  1DP0 A;  4GB3 2;  1D2S A;  2Y6H A;  1O3Q A;  1W8T A;  3DXT A;  1RMU 2;  2DUP A;  3GBG A;  3NNL A;  4C1X A;  4CEY C;  2RS5 1;  5A6Y A;  5F5Q A;  2WC2 A;  1QJY 3;  1H8T A;  4UW5 A;  2RS3 1;  5IUQ A;  5FZ0 A;  1GFF 2;  1I3H A;  2B39 A;  4LLF A;  4Q4V 2;  3C7H A;  1Q5O A;  2DU0 A;  4CDX C;  1G9A A;  2XQR A;  2FCT A;  4R9B A;  1STM A;  3KM5 A;  4FQ4 A;  1DGR N;  4QQL A;  3U78 A;  2VZT A;  3QH7 A;  3N35 A;  1HLC A;  2XQX A;  3N9Q A;  1GV9 A;  1VRH 2;  4YGE A;  5KHI A;  1C8M 2;  3N9N A;  2WT2 A;  2V09 A;  4WVV A;  3Q8A A;  4CCJ A;  1EAH 2;  4BIS A;  3PU3 A;  1ULP A;  5LBC A;  3O1O A;  3KCC A;  3IBM A;  5FY4 A;  1AVB A;  1H8T C;  3TWI A;  3O0X A;  4OMC A;  3HT1 A;  3VD5 A;  3K77 A;  4AI9 A;  1NXD 1;  2A3Y A;  4YZ1 A;  1W90 A;  4AYU A;  2DUQ A;  1CX4 A;  1PO2 2;  2VXJ A;  4GA9 A;  4RR3 B;  2X29 A;  1RUG 2;  4FPE A;  1QJE A;  3HD8 B;  1C3H A;  1EV1 1;  3OB8 A;  3WDW A;  1GR3 A;  3BUC A;  4ZPI A;  4LOS A;  4Y22 B;  5LA1 A;  2JKX A;  3N3H A;  2QZ3 A;  1G9F A;  1VBA 2;  5A6X A;  1NLR A;  2XJV A;  3CJI A;  3UNP A;  2BTV C;  5DAX A;  4E2Q A;  4GD4 A;  4KU7 A;  1XYN A;  4Z8B A;  5JAX A;  4P9G A;  4LBJ A;  2Q0A A;  4HPK A;  3H1W A;  1AJK A;  4RYD A;  3GCW A;  3WEZ A;  5KXD A;  1YI7 A;  2L9L A;  3DKW A;  1SDW A;  1VE0 A;  3MFC A;  3IMN A;  5C3S A;  4AI2 A;  2JG9 B;  2W2I A;  3UGF A;  1OHF A;  5FZ6 A;  1DGR A;  1FAY A;  3WW4 A;  4AAX A;  3VBU B;  4K9S A;  4Y33 A;  2G9F A;  2XON A;  1X50 A;  2BWC A;  3BCW A;  3MBW A;  5T52 A;  4BJ0 A;  3CJI C;  3JD7 1;  3E6C C;  1C5I A;  4AVS A;  5GJ6 A;  3I8T A;  4NID A;  1ND3 B;  4QX7 A;  1OH3 A;  1SBF A;  3VL8 A;  2AEY A;  5A3U A;  2GNB A;  1SFP A;  1K5J A;  4P9L A;  2XKO A;  2BFU L;  1LR5 A;  4LBO A;  4CDQ A;  1GZT A;  2PFW A;  1GZW A;  1HRV 3;  1PVX A;  1S0D A;  2JDN A;  1K12 A;  4AEK A;  2D6M A;  5FLH A;  5HBA A;  3QAC A;  3WP6 A;  4EN0 A;  1NE4 A;  4MXV A;  2NN8 A;  4ZHN A;  1RB8 G;  5T5P A;  2XVL A;  4YGC A;  1Y7B A;  5LA2 A;  3ZXL A;  3ZIW A;  4BDV B;  4K6B A;  2PHL A;  5JSP A;  2WA4 A;  5GAL A;  1QQP 3;  3AFG A;  3D5O A;  3O0W A;  4W6X A;  5KHG A;  1H1A A;  3SH4 A;  3UJQ A;  4YW3 A;  5ACA 1;  2IXH A;  1ULF A;  1RUI 2;  2A6Z A;  4XMA A;  5FY9 A;  5C71 A;  3AKP A;  4HVO A;  1GU3 A;  1SLC A;  2YC4 A;  3N9O A;  4AGR A;  1D4V B;  3DEM A;  4CDQ C;  3LCP A;  4A2U A;  1S2K A;  4MGT A;  1S4C A;  3A4U A;  1POV 1;  4P02 B;  3PUS A;  4AAP A;  1UPI A;  3HNM A;  3QOP A;  4Q4V 1;  4DXR A;  4AVV A;  4P9I A;  1NCQ B;  1UY2 A;  2RDN A;  1FMD 2;  4LBK A;  1IG0 A;  5FDB A;  5GZE A;  1UZW A;  2VTX J;  2DCK A;  2X53 S;  3NV3 A;  4FO9 A;  3NAP A;  4N9H A;  5FZ8 A;  3SEE A;  2QQL A;  3BOW A;  4D6R A;  1HJF A;  3TEZ A;  3PUA A;  1NA1 A;  1OUS A;  1OKO A;  2IXL A;  1XQN A;  3DKQ A;  4HFS A;  2IFR A;  1VRH 1;  3IN9 A;  2XR4 A;  3VDD A;  1C8M 1;  1OLQ A;  3B69 A;  4CCN A;  4D6S A;  1JYV A;  3ALQ A;  4CEW A;  1PZ9 A;  1EAH 1;  5G04 L;  4I3P A;  3TN9 1;  1POV 0;  2D3P A;  2NMO A;  1FPN 1;  2WFP A;  4Q1R A;  1XNB A;  4BH9 A;  1SLI A;  3K4Z A;  1SBE A;  1XB9 A;  4FPH A;  4X8P A;  2JB4 A;  3PME A;  1PO2 1;  3HVD A;  4HN1 A;  1RUG 1;  4D7T A;  3NJX A;  2VEC A;  3T1M A;  5A1L A;  3NAP C;  4Q4X 3;  2BNN A;  4AI0 A;  1RC6 A;  2MEV 3;  3HAG A;  1SZB A;  2XDV A;  4K7J A;  4F8A A;  4I01 A;  4CRQ A;  4NIG A;  1NA1 C;  1AX0 A;  3N9M A;  4YW1 A;  2UYB A;  2YGM A;  5ACA 3;  2NMN A;  5BNN A;  2UU8 A;  1AYN 3;  4XEZ A;  1DYO A;  2PLV 3;  5F7U A;  2RR1 2;  4F7Z A;  5DPN A;  1UIJ A;  3E6D A;  5T3N A;  1OFN A;  3ZYH A;  1Q8O A;  1VBE 2;  4HON A;  1WCK A;  4URT A;  3LZZ A;  1UY1 A;  2EIB A;  2WO7 A;  2ZPX A;  1CON A;  4Q0U A;  4RQP B;  1VBC 3;  3KV6 A;  3A0K A;  2LW8 A;  1TVG A;  3OGV A;  2I74 A;  4G3Y C;  5JI9 A;  1GWL A;  1QJF A;  2Y0I A;  3LIG A;  5L9R A;  4OHZ A;  4JQT A;  5DDJ 3;  4BQ3 A;  2ZA9 A;  1Q3E A;  4DB5 A;  4JKM A;  4AVC A;  4UFK A;  3AP5 A;  2VME A;  1U5Y A;  5A3O A;  2DVA A;  1VBD 3;  2ZGO A;  5FPB A;  1XSQ A;  2D40 A;  2VBD A;  3GCX A;  4NRO A;  2P2K A;  1A6C A;  2AGS A;  4MXW B;  1RHI 1;  4DMI A;  5IK7 A;  4Q2F A;  4LO4 B;  5I0S A;  5J96 B;  2ZAC A;  1WCU A;  2PHW A;  2VR4 A;  3RZJ A;  2WO2 A;  2R06 2;  2WS9 3;  4UYB A;  2I45 A;  1YO8 A;  2EAK A;  1A8M A;  4AFD A;  1RVF 2;  1W04 A;  5LEJ A;  1XYO A;  1S2E A;  3JCI A;  3MPP G;  4R4X A;  3NJV A;  3T4H B;  1CAU A;  2FCV A;  2KXL A;  2WWJ A;  4M3C E;  5CG9 A;  2PAE A;  1OC1 A;  4BK5 A;  3WNO A;  4P9J A;  4QX8 A;  1ENS A;  3MYX A;  4XJW A;  4XOG A;  2D6P A;  1BBT 2;  4FPC A;  1V00 A;  5EYX A;  5FZO A;  2J1V A;  3ZXF A;  3I2I A;  1RUI 1;  3VHR A;  4C8D A;  2JDP A;  3WG1 A;  3C2U A;  3DUI A;  2YB7 A;  1KRI A;  1GNH A;  5CG8 A;  1TME 3;  3H8R A;  2EIC A;  3IPV A;  2LM3 A;  1RUN A;  1UPS A;  2F17 A;  1R1A 2;  2R0F A;  2VBB A;  4LKF A;  1GBG A;  2GNT A;  4DNY A;  2BPA 2;  1OFS A;  3MV1 1;  3R4U A;  4PDW B;  2HWE 3;  3RI9 A;  4EE2 A;  5BNP A;  1JYT A;  5LEK A;  2WFF 3;  3I2F A;  1KEX A;  2BNM A;  4EQV A;  5FPU A;  2HWF 2;  4K1Z A;  1G9B A;  2C24 A;  1M06 G;  4Y20 A;  4IV3 B;  2WNV B;  3UYJ A;  3ZKU A;  5I0U A;  2PHT A;  5F39 A;  4Y1Z A;  2YDE A;  1OLM E;  1CJD A;  3WW3 A;  1JN2 P;  1SQ4 A;  3FHQ A;  5A33 B;  5IAX A;  1YNA A;  3UKV A;  5EYY A;  2D44 A;  2KM2 A;  4TYS A;  2DVG A;  1S0B A;  4XIK A;  4GZ9 A;  2JWP A;  1QGL A;  3NNM A;  2Y33 A;  2RVA A;  4LIV A;  4OZO A;  3ZSM A;  4CYD A;  3RZZ A;  5FV3 A;  1YQ8 A;  5FYC A;  2QQU A;  4Y1X A;  5BNP C;  3GGL A;  3K46 A;  1HV1 A;  2RM2 3;  3S5Q A;  3KV9 A;  3CIH A;  5KXB A;  3I3E A;  3RZL A;  3WW1 A;  1COV 2;  1QXP A;  1MQT B;  4C0H A;  3AXE A;  5FZ9 A;  5CAZ A;  2VMI A;  2HEW F;  2E51 A;  1AR6 2;  2BBA A;  1QKQ A;  1VBE 1;  1QJX 2;  3ASI A;  1HB3 A;  1UY0 A;  1MVQ A;  2IXJ A;  1BVV A;  4AFB A;  3WNK A;  1I5P A;  1QU0 A;  3QBQ A;  4LKD A;  3WCS A;  1OLR A;  2A7A A;  3RI8 A;  3X29 B;  1Q8V A;  2JD4 A;  3AM2 A;  5CA6 A;  3U10 A;  4HVQ A;  4XFG A;  3TEY A;  2GC3 A;  2W1W A;  2WZR 3;  5BNQ A;  5FBZ A;  4AGG A;  4MGZ E;  1IHM A;  3ZFE A;  3EBR A;  3AP6 A;  4FCA A;  5C6C A;  5LK7 B;  2VOK A;  4QKF A;  1W6P A;  3SKV A;  4EWD A;  5C8C A;  2P4E A;  4BQY A;  1JMU B;  4Q4W 2;  4QQH A;  4BME A;  4L97 A;  5CEH A;  1BXH A;  2CDO A;  4D0Q A;  5FO8 B;  4AQ6 A;  3V0A B;  2VCC A;  1QXR A;  2CDP A;  2O0O A;  3WUC A;  4BQ4 A;  1JZ2 A;  3ROU A;  1OD3 A;  2Z2S B;  3B02 A;  1AX1 A;  1QJY 1;  3B3Q E;  3SC7 X;  1AL2 2;  1SMV A;  2ET1 A;  5H9S A;  3ITQ A;  1W6O A;  3VBS B;  5TSW A;  3PNA A;  2VVF A;  2W9X A;  3W5N A;  2Z69 A;  3KGZ A;  2P3K A;  3L2Y A;  1EPZ A;  3ZFE C;  1J84 A;  3PIG A;  2C9A A;  1HRI 3;  4XJU A;  1NX9 A;  2ZX3 A;  3USS A;  3JUU A;  5FP3 A;  2PYT A;  4BHP A;  4UWD A;  3H3U A;  2A71 A;  5DXD A;  1AF9 A;  4ZS2 A;  5LY2 A;  2V73 A;  1V0A A;  1S0E A;  3GZA A;  4CCO A;  3JBG 2;  2JDY A;  2K0G A;  3MO4 A;  1AR9 3;  2CWS A;  1BBT 1;  1VBB 3;  1VMF A;  2JEC A;  2PN5 A;  3THT A;  5EFU A;  4L2N A;  2ORZ A;  4CDW A;  1JW6 A;  1RJ8 A;  1F9K A;  3EB7 A;  1PVC 2;  1JOB A;  4PJY A;  4D7Y A;  5BNO B;  5FZ4 A;  2HLE A;  1GP6 A;  1UW8 A;  2RS1 3;  5IK5 A;  4RL7 A;  4JDO A;  4LT5 A;  4M4P A;  3ZM8 A;  5DQ0 A;  4LLO A;  1JU3 A;  3WNN A;  2X8K A;  3M3C A;  1C1L A;  5LAS A;  2WZE A;  2PEL A;  2JKB A;  2Q8C A;  5FYI A;  2YC0 A;  3ZYF A;  3C3V A;  4AEM A;  4N43 B;  3LDB A;  2XHK A;  5C3R A;  2QDN A;  4CDW C;  1HQN A;  4MOA A;  2ORX A;  2OVU A;  4CCL A;  4EYU A;  5CFD B;  2W1U A;  5KR7 A;  3SCG A;  1V6N A;  3KQ4 B;  4UFM A;  2B8M A;  4AE2 A;  3PLQ A;  1W2N A;  2BGC A;  4QPI A;  4A45 A;  2BJS A;  4BIO A;  3H8X A;  4I09 A;  4JKL A;  4CPB D;  3R05 A;  1K45 A;  2XML A;  3CLP A;  1KDK A;  4HSL A;  4UFI A;  3VBF A;  3SIT A;  2UWC A;  3A0N A;  1RYY A;  1AXZ A;  3FFQ A;  3MID A;  4QHB A;  3VN4 A;  1UYP A;  1SPP B;  2W47 A;  4BU2 A;  3VD7 A;  1SHW B;  3BOP A;  1COV 1;  2DWR A;  1UCX A;  4MZU A;  4Q26 A;  4JC1 A;  3AYC A;  3U11 A;  3U0Z A;  1DZQ A;  3POJ A;  2BRT A;  2J1T A;  3AYD A;  1W6N A;  4QPI C;  1O3R A;  1OVS A;  4XQD A;  4NPL A;  3OSD A;  4KNC A;  5CKN A;  4Y24 A;  1HRV 1;  5CU1 A;  3SEP A;  5T54 A;  3ZN5 A;  5K0U B;  1S0F A;  1DIW A;  3WNL A;  4GMP 3;  5K7P A;  4V2V A;  4XVH A;  2JB8 A;  4W50 A;  1PO1 2;  1X33 A;  2DV9 A;  4LMF A;  1OOP B;  2R32 A;  1KFX L;  4IGQ A;  3U07 A;  3HPN A;  1LGN A;  3I2O A;  1KGY A;  2JE7 A;  2K9Z A;  1QQP 1;  2A3W A;  3SH5 A;  5A80 A;  3DF0 A;  4PBO A;  1K5M A;  2FDH A;  3PIJ A;  2UWA A;  4A4A A;  2VTX A;  2WT0 A;  2XLG A;  4XAE A;  2A6V A;  2BGP A;  3CNA A;  1QH7 A;  2BGO A;  4NN0 A;  2HYK A;  4YM1 A;  1CAV B;  3POG A;  2HWD 3;  3NKT A;  4PIY A;  1UY3 A;  3I3D A;  2C26 A;  2GH2 A;  1AL2 1;  3BAL A;  2EIE A;  3VDC A;  3O7O A;  1TMF 3;  2Y0O A;  3NO8 A;  4R9A A;  2VOV A;  4WV8 A;  3OD4 A;  5HCB A;  1GWK A;  3DPR B;  2YBS A;  2GND A;  3I97 A;  4MUV A;  1PZ7 A;  4M3C B;  1BHG A;  2UY9 A;  2QQW A;  4UFJ A;  4XC9 A;  2VL4 A;  4OUE A;  5DZE A;  1US3 A;  3ZMO A;  5CFC B;  5J36 A;  4OQ8 A;  3CMG A;  5JWP A;  3D0J A;  1X9T A;  4WBB A;  3AKT A;  5A6Q A;  2ETE A;  2JDK A;  4QB6 A;  1UU4 A;  3DGT A;  4P14 A;  3O1P A;  2QZ2 A;  1R09 2;  4YRD A;  3WIN E;  3WDU A;  5D21 A;  4QKB A;  5JSO A;  1HXS 3;  4HXC A;  1DQ0 A;  4HN0 A;  5AC9 2;  2ZGL A;  2VQU A;  1DGL A;  4RA0 A;  1R08 2;  3AL6 A;  1ZBE 3;  1R64 A;  4XBN A;  4CXX A;  1UZY A;  2GSY A;  4HL0 A;  2SBA A;  4YPJ A;  4A6O A;  1PM4 A;  2GN3 A;  2RM2 2;  1A34 A;  3RZK A;  5HCA A;  2MEV 1;  1BMV 2;  2J7M A;  3HNY M;  3LDR A;  5LRS A;  4JRL A;  5FMD A;  2J1E A;  5AFE A;  1AYN 1;  3AX4 A;  3VHN A;  1NQJ A;  3VZJ A;  2GU9 A;  3P3P A;  1UX6 A;  1PGS A;  3H50 A;  1JUI A;  1ZX5 A;  3ZFF A;  3KWV A;  2HWB 2;  1H2M A;  1U5X A;  4WVZ A;  1OT5 A;  2KR2 A;  3G7D A;  3QD6 A;  3PMS A;  3KHC A;  4I02 A;  1VBC 1;  4D6Q A;  3I59 A;  2VXR A;  3SIS A;  5FPA A;  4OI1 A;  4FPJ A;  3BYW A;  5DDJ 1;  5FMC A;  5SV8 A;  3W21 A;  3Q8F A;  4MV2 A;  3TNQ A;  2WSU A;  3JB4 C;  5T55 A;  1MZF A;  4GIQ A;  2DCY A;  4MHU A;  1RUH 2;  2XXZ A;  3ZIX A;  4YVS B;  1O91 A;  4E9K A;  4JGY A;  2V4V A;  5I8T A;  5EJZ B;  1QEX A;  3N7J A;  5C5T A;  2J1R A;  4RN5 A;  2CAU A;  2RMU 2;  5IHR A;  2DCT A;  3POW A;  5A7W B;  3ZFF C;  5K9Y A;  2VAU A;  2PQS A;  5C4W A;  1WW5 A;  1W9F A;  2BBV A;  5LWB A;  3V56 A;  4D94 A;  1ZRD A;  4NHK A;  5A7P A;  5JLV A;  1W0N A;  4QAW A;  4GH4 C;  3POB A;  5LZ6 A;  3KGL A;  1QJU 3;  4XUR A;  1B35 A;  1PO1 1;  1V6I A;  3IDC B;  4YM2 A;  4ATE A;  3ZFG A;  4EN9 B;  1RUF 3;  2XJU A;  4KBB A;  2VZ1 A;  4QXC A;  2RS5 2;  4Z92 B;  4LXL A;  4ERO A;  2R30 A;  2WNO A;  2VPV A;  4NHY A;  3PTR B;  1CZV A;  2JG8 A;  3LF7 A;  5C4W C;  1WLC A;  3GM8 A;  1YHF A;  4AK3 A;  1NZC A;  3AKR A;  2ZHM A;  2F6B A;  5FZ7 A;  2FZ1 A;  4FBF A;  2ARE A;  5FZL A;  2VUA A;  1J58 A;  2VUJ A;  3WP5 A;  4KBZ A;  2HWE 1;  3ZFG C;  2VVD A;  2TEP A;  2WFF 1;  4QX2 A;  3VL9 A;  1WLW A;  4E4D X;  3FLP A;  3P1I A;  3HMY A;  4YW4 A;  1G6N A;  2W08 A;  3ZXG A;  1H2L A;  4I0A A;  5FLI A;  2D6K A;  1RUD 2;  1FXZ A;  2YRO A;  1PIV 3;  1RUE 3;  2F4P A;  4OI2 A;  4K8F A;  2JG8 C;  4FPL A;  2YY1 A;  5IVV A;  4KH9 A;  1EV1 2;  2XBO 2;  3CZU A;  2I07 B;  3UGH A;  4BQX A;  3ES1 A;  1R09 1;  2XL7 A;  4CU9 A;  5EIY B;  4Y4R A;  4URA A;  3IAP A;  4FPY A;  5FKB A;  3HBK A;  5L9V A;  1QHD A;  3V65 A;  2P17 A;  5JXH A;  2RM2 1;  4NVP A;  5FUI A;  2VZQ A;  3K3N A;  5J09 A;  5J1X A;  1X36 A;  1BMV 1;  1P8J A;  4ZKT B;  4GUL A;  5CYY A;  5K4L A;  1GQP A;  5EJ3 A;  5EPA A;  3TAY A;  4XF1 A;  1DQ1 A;  3EO6 A;  2XH6 A;  3E1F 1;  3FC0 A;  5FO7 B;  2R04 3;  2VQT A;  4COW A;  3LDK A;  3DN7 A;  4YM0 A;  1YRZ A;  1MS0 A;  2QNK A;  4O61 A;  3ZSK A;  3POS A;  5DAV A;  2TNF A;  4OLL A;  2W94 A;  4WM7 C;  4OHY A;  2LAL A;  4Q0P A;  4R9C A;  5FYZ A;  1UY4 A;  1OQ1 A;  1KQR A;  3JD7 2;  5FXW A;  5JIU A;  4PIZ A;  4IE5 A;  2OPK A;  1Q56 A;  3USU B;  1Z7S 3;  2WZR 1;  3OG2 A;  2PHD A;  4FOW A;  5FMO L;  5HCF A;  1V6K A;  3IM0 A;  3K4A A;  5LB6 A;  2Z5W A;  4A7K A;  3SH3 A;  2IXC A;  3VZM A;  1RUH 1;  4Q27 A;  1WME A;  4U2A A;  5J98 B;  5ABJ B;  5GZC A;  2XLF A;  1APN A;  4CCK A;  4RS5 B;  1YYN A;  4XZP A;  1TNR A;  1AXK A;  3NST A;  5FY7 A;  3WHU A;  3WF3 A;  5B4X A;  2OXB A;  1BJQ A;  1YIP A;  1KIT A;  2BVV A;  2P3Y A;  5D2A A;  5AVP A;  3AVS A;  2HWD 2;  5L7O A;  1GWM A;  4PLO A;  4QT6 A;  3LAG A;  3OGR A;  2WLP A;  2HWC 2;  4MXW A;  3VBF B;  2ZGR A;  1ND2 A;  2VMH A;  3WF0 A;  1GQH A;  5C33 A;  3BGA A;  3PU8 A;  1UMI A;  1CAX A;  3OYW B;  5F3G A;  4B1M A;  5C3O A;  2LUW A;  2D3S A;  2HEV F;  1HRI 1;  1XU2 A;  5DUV A;  2VVE A;  2PHU A;  4L11 A;  4I0B A;  2NLR A;  3LA7 A;  5LA9 A;  2W0X A;  1MS3 A;  1XYP A;  2RHP A;  5B4N A;  5IT6 A;  1AR9 1;  4J1X A;  3CQO A;  3QCW A;  5C9A B;  3TEW A;  4WZC A;  1JZ5 A;  5FWJ A;  1VB2 A;  4OVE A;  2WNU A;  3WG4 A;  1BCX A;  1W0P A;  3RMX A;  3HBZ A;  2QQJ A;  2UWB A;  1ND2 C;  1ULO A;  1LOD A;  2ZJC A;  4UFL A;  1UQX A;  2RS1 1;  4ASK A;  5FZF A;  1V70 A;  3KZ4 C;  4ZON A;  1X82 A;  4WVM A;  2YG0 A;  4QQ2 A;  1J1L A;  1GQG A;  3IAQ A;  5FY1 A;  4ES9 A;  3R6S A;  2WIN B;  1N47 A;  1SFN A;  1IOA A;  5DAQ A;  1I9R A;  4PI0 A;  4IEY A;  2PMW B;  3AMM A;  3TN9 2;  1FPN 2;  4PT6 A;  5C3P A;  2XJT A;  1O8S A;  2ZX0 A;  2ZXQ A;  4FAG A;  2IXK A;  1PK6 A;  1RUD 1;  1SCR A;  3MDP A;  4O65 A;  5D8A C;  1SEF A;  2VUC A;  2CGP A;  2WNU C;  1U5Z A;  1L3J A;  2DTW A;  4QDQ A;  4B8E A;  3R4S A;  2Y26 A;  1LES A;  2XBO 1;  4P9Y A;  5I91 A;  5IYY A;  4LKS A;  1IS3 A;  4YGD A;  3GNE A;  2Q8D A;  3NWK A;  1PHM A;  3ZXJ A;  4A6S A;  4UOJ A;  3TNP B;  5F9T A;  2GNM A;  4XJA A;  1OA3 A;  5EV7 A;  5IAT A;  3P6B A;  2W68 A;  5HV0 A;  1QIQ A;  1H30 A;  4PIX A;  4RFR B;  5IW0 A;  2VUL A;  4X8N A;  1UOF A;  5SV5 A;  5AFB A;  4YG6 A;  1W9Y A;  1XNT A;  5E16 A;  4QHO A;  3ZOI A;  2R1B A;  3FE5 A;  5FYB A;  1PK6 C;  1T2X A;  4BOW A;  4IUG A;  5H9Q A;  2BWA A;  4KMQ A;  4XAB A;  1ASJ 3;  2ZGQ A;  5EXO A;  2X05 A;  2VOX A;  3NW4 A;  1PX3 A;  3AZZ A;  4B7E A;  3DYM A;  1RIN A;  3P5B A;  5C5U A;  1QY4 A;  5C3Q A;  5IFP A;  1JZ6 A;  4QKN A;  4HK8 A;  4UF0 B;  4JKK A;  5GM0 A;  4A7Z A;  4CXY A;  3GZE A;  2FZ2 A;  4NO4 A;  1W8O A;  2WN2 A;  3MHZ A;  4X6R B;  2D6L X;  2ATF A;  5FYM A;  3KSC A;  3HR9 A;  2RG4 A;  5IK8 A;  1O5L A;  1AZD A;  1RHI 2;  4CDU A;  1UMH A;  1XBF A;  2R07 3;  4ONU A;  1LEM A;  2QQI A;  1UOB A;  1OF4 A;  3W5M A;  1UU5 A;  1WD4 A;  1X8E A;  5LBB A;  4LEJ A;  1PGL 2;  3W59 A;  4Y1Y A;  1JOD A;  3F2Z A;  1E5S A;  2DVD A;  3ZXA C;  2VZP A;  4J1W A;  1BEV 3;  3FWE A;  3N7M A;  4NR1 A;  5DAW A;  1LHU A;  5FXV A;  2HWD 1;  3FMG A;  5M0T A;  4M00 A;  3PJQ A;  4Q1P A;  3CEW A;  2HWC 1;  2JE8 A;  4IER A;  4PLN A;  2RDS A;  3GHM A;  1TMF 1;  2C6S A;  1H2K A;  4PF5 A;  1S0I A;  4CDU C;  4AED A;  3L2H A;  3MLK A;  3ZXE A;  1ZZ8 A;  1AUY A;  4BQ1 A;  5FR3 A;  1LTE A;  1G8W A;  4UFH A;  2CU5 A;  2GP3 A;  3K2O A;  3OUI A;  2ZBJ A;  4LHL A;  5I0D A;  3M3E A;  3OTF A;  5FPZ A;  2GC0 A;  5LW9 A;  4ZY9 A;  1F4A A;  4LBQ B;  2VH9 A;  2Y6G A;  1TEI A;  4YW6 A;  2P1B A;  1HV0 A;  1QOS A;  1V6J A;  2JDH A;  3U75 A;  5JOY A;  5KXE A;  2FDJ A;  1SFY A;  2VNG A;  4QX3 A;  2JDZ A;  3J8F 3;  5CNA A;  5F6L B;  2Q8E A;  1OF3 A;  4BB3 A;  2ZHK A;  3UKT A;  4HKW A;  1HXS 1;  4LBL A;  2EXI A;  4LK7 A;  1VAL A;  5FPX A;  3GBW A;  2UY8 A;  4B29 A;  4AED C;  1ZBE 1;  2ZGP A;  3MIH A;  3VBH B;  1CR7 A;  4GJY A;  4L9B A;  3RZH A;  5FZ3 A;  2CL2 A;  2A6X A;  1LKN A;  1SLB A;  2WAB A;  3MI8 A;  5K8S A;  1AR8 3;  1ZA7 A;  3MF9 A;  3O1S A;  3HWJ A;  1J1T A;  2R1D A;  3WY6 A;  3IDE A;  5JUV A;  1VR3 A;  3VKL A;  2WO3 A;  4JGZ B;  4YVW A;  1WMD A;  2JE9 A;  1JZ7 A;  1WD3 A;  4PQ9 A;  4KGQ A;  2R16 A;  1IPS A;  1GMM A;  2OT7 A;  4BMB A;  1E5I A;  4CUC A;  4FTE A;  2B45 X;  3S30 A;  4BK4 A;  4LO7 A;  2LTN A;  2A1X A;  4RHV 2;  1WZX A;  1GZC A;  1ZNP A;  2VZV A;  3DXU A;  4MSV A;  4H2A A;  3H3Z A;  4CCM A;  3KQR A;  3MIG A;  5F6K A;  2ARX A;  2VW0 A;  3ZN4 A;  5DUX A;  4LA3 A;  4AEJ A;  1CZS A;  5HI0 A;  3H1M A;  1C28 A;  4WM7 B;  1W99 A;  4FXG B;  3VDD C;  3FL7 A;  4A3X A;  2A73 B;  4D8M A;  4CEW C;  2BZD A;  3BU0 A;  1FI2 A;  1L7R A;  2GDF A;  2QTW B;  2XLA A;  4FOY A;  1MVE A;  4Y3O A;  3RDI A;  4XUP A;  3MLJ A;  4Q4Y 3;  5KHH A;  5IK4 A;  2VC9 A;  1WBF A;  4FPO B;  3A7Q A;  3LWC A;  4IGO A;  5FO9 B;  4QPG A;  3RVH A;  1UIK A;  1WW6 A;  4LHK A;  4R52 A;  3KT1 A;  3APB A;  4WM8 A;  1SPP A;  3ABZ A;  1C57 A;  1ZRI A;  4YAR A;  1LGB A;  4Z2W A;  2B7Y A;  5FUP A;  4IET A;  1CES A;  1ZM1 A;  2FMD A;  5FOJ B;  3HNB M;  3VKN A;  2Y38 A;  3BVC A;  3EYP A;  1OXC A;  5HXV A;  1MS8 A;  5GZF A;  4CE8 A;  5BNN C;  4MO3 M;  3DYP A;  2E7Q A;  5A3T A;  4I2O A;  2YBK A;  2ZX2 A;  4GWJ A;  5FWE A;  4CSW A;  1RUJ 3;  3RS6 A;  5JMO A;  4LBQ D;  1ZZ9 A;  2B9U A;  2BVB A;  5A6Z A;  3WCR A;  4ASL A;  3K48 A;  1RUF 1;  2KD7 A;  2WRA A;  2YV8 A;  4QM8 A;  3WDT A;  3O1V A;  3BIE A;  5FZK A;  2EXK A;  1YFX A;  2XJR A;  1QJY 2;  2NM1 A;  4JQR A;  4QPG C;  4XF3 A;  5FYY A;  1PGL 1;  3LPG A;  3UET A;  2YC2 A;  4WM8 C;  2DYC A;  1V9U 3;  3W20 A;  1W8H A;  2WKK A;  1Y4W A;  3U4S A;  4Q8K A;  3N7K A;  4CEY B;  1YQ2 A;  5FZH A;  1WWY A;  1DYK A;  4MHR A;  4CDX B;  4HLT A;  2C0Z A;  3WW2 A;  2OW4 A;  4MGI E;  5FXZ A;  1VIW B;  1HB2 A;  1QWR A;  2VOT A;  2YGL A;  5APA A;  4OHX A;  1F5J A;  4FT8 A;  4NMI A;  1DQ5 A;  5CZK A;  2G1M A;  3AJZ A;  1GYK A;  4RGA A;  1IPJ A;  1FOD 3;  3ZYR A;  4CP9 A;  1K42 A;  1CPM A;  4K21 A;  4HK9 A;  1LU1 A;  3RJR A;  4NAO A;  1PIV 1;  1RUE 1;  2ADE A;  4KGG A;  1H2N A;  2WN3 A;  3ETQ A;  4MLO A;  4MAD A;  4J25 A;  4FFG A;  3BPS A;  1H8T B;  5L73 A;  1F4H A;  5F3C A;  1LOF A;  3BN6 A;  1VAK A;  1CIY A;  2HH9 A;  3E97 A;  5A7Q A;  2GN7 A;  4BWO A;  1ZZC A;  3T09 A;  5J3U A;  2JX9 A;  5FBJ A;  3VKF C;  4TLG A;  1FAT A;  4HMZ A;  2OYZ A;  3I2K A;  4IEP A;  4K8R B;  3MIB A;  3SQO A;  1ODM A;  2ZX4 A;  3GJA A;  1QDO A;  3FHA A;  1Q43 A;  4ISR A;  4XZU G;  1N3O A;  3WG3 A;  1PM7 A;  4QX5 A;  2DBN A;  2WJS A;  4S2G A;  3ZN6 A;  4MVT A;  2A75 A;  4DPN A;  4YZ5 A;  1NCR A;  1YIF A;  2C1F A;  2WQ4 A;  4FFF A;  5GLT A;  2ARB A;  1RXF A;  3LIH A;  4JTO A;  4IEQ A;  4NIH A;  1LOF C;  2FBE A;  3RZM A;  1LOA A;  4RHV 1;  1FV3 A;  4QHZ A;  3WV6 A;  4UW4 A;  3WF1 A;  1VP6 A;  2H6C A;  3UT0 A;  4IEZ A;  2QBX A;  4IQP A;  1Z7S 1;  2NZ9 A;  4JHZ A;  4YW5 A;  4FP3 A;  3NNG A;  3CJI B;  3AZY A;  3BTA A;  3S7I A;  4ATF A;  2DDU A;  1NCR C;  3SMH A;  1HRV 2;  4YG3 A;  5IVF A;  3AZW A;  1DGW X;  2AYH A;  5G05 L;  4KI5 M;  2Z4F A;  3ECQ A;  3MW4 A;  1CJP A;  4O9E A;  4B4R A;  3LOI A;  3SCF A;  2BFU S;  3T1L A;  2VNO A;  2BOJ A;  3MV0 1;  3J9S A;  4LE4 A;  3ZSL A;  4DRV A;  2XWB B;  3MIF A;  5FFO C;  3ZKY A;  1QQP 2;  1AR7 3;  3WDV A;  1ULG A;  3VD9 A;  2WAO A;  4N9I A;  2GZW A;  4PF1 A;  2BNO A;  2QQV A;  4CU8 A;  4UW3 A;  4BZ4 A;  2J1S A;  4FSJ A;  1KS5 A;  2B5H A;  3ENR A;  4XIO A;  4XUO A;  3RPQ A;  1QJZ A;  1W03 A;  1W2O A;  2XGX A;  4LUK A;  3ZPY A;  2JJ6 A;  4COU A;  5HV4 A;  4AI8 A;  3WOG A;  3ACH A;  4FP2 A;  4P9X A;  2AEN A;  4CCC A;  3H9A A;  4CUA A;  3BTX A;  3JXS A;  3AP4 A;  4CDQ B;  4DOU A;  3AK0 A;  2D3R A;  2VZO A;  1GZW B;  4CCD A;  4LO6 B;  1KD7 A;  3IKW A;  1ZRC A;  2JEN A;  1N1Y A;  3D3A A;  3M3I A;  2Q1M A;  3RWN A;  4BYY A;  1NYW A;  1OQE A;  2B9V A;  4NWV A;  4XET A;  3VZK A;  5F5C A;  5C8C C;  1UYZ A;  2Q30 A;  1PNF A;  4N53 A;  4QXK A;  5D8A A;  4HOO A;  1DZT A;  5I8Y A;  4IV1 A;  2Y6J A;  2ZKN A;  5A32 A;  4JX0 A;  1ACC A;  1OBN A;  2YXS A;  4TXW A;  4QX1 A;  1H4G A;  3CO2 A;  4OCT A;  3LGR A;  3CHX A;  4NWW A;  1VMH A;  4N7I A;  4E4H A;  1RIR A;  2VMG A;  2X5I A;  3VBO A;  4LNV A;  3WLU A;  5E8A A;  1LGC A;  2VTF A;  2XOM A;  4P5Y A;  1IPK A;  2JDM A;  4Q4X 2;  2IZW A;  2MEV 2;  1NLQ A;  2O8Q A;  4HKL A;  2BDR A;  1LRH A;  3PL0 A;  1IKP A;  3Q8C A;  4N53 C;  4UAP A;  1RL3 A;  3LSE A;  3MIE A;  2PQQ A;  2C4X A;  1T6B X;  3NKG A;  2RS3 3;  3O12 A;  1AYN 2;  4NJ4 A;  3S7E A;  2PLV 2;  3NAP B;  4HG6 B;  1SLT A;  4IV1 C;  4XBL A;  1CAW A;  1WW4 A;  2JXA A;  1NA1 B;  3IDB B;  5DAB A;  1IZ3 A;  3C7E A;  5F5I A;  3V0B A;  4R9D A;  1F8V A;  3N36 A;  4ZS3 A;  3VDD B;  4IEX A;  1WA6 X;  3VBO C;  3UL2 A;  4BE3 A;  1VBC 2;  5KWR A;  3HT2 A;  4AQ2 A;  3M70 A;  1Y9M A;  5E88 A;  1F5F A;  5DDJ 2;  4A3Z A;  3AP9 A;  1W6M A;  1JZ8 A;  1AL0 G;  1S2B A;  1SDD B;  3WP4 A;  1Y43 B;  4AHZ A;  4CTE A;  3GZU C;  4OHW A;  5JZG A;  1VBD 2;  1ZBA 3;  1A3K A;  1IGO A;  1KS4 A;  2WWS A;  3W9A A;  3NV4 A;  1F15 A;  5FYU A;  5BY5 A;  4LO8 A;  2R07 1; 
#chains in the Genus database with same CATH homology
 5DAQ A;  2A1X A;  4KBZ A;  4BQY A;  2Y34 A;  4Q5O A;  3OBZ A;  3NNJ A;  2OPW A;  3ITQ A;  3HQR A;  4XC9 A;  5IAT A;  4BQX A;  5HV0 A;  5ERL A;  5LBE A;  5A3U A;  4Y5S A;  4UWD A;  3KT1 A;  2FCV A;  5L9V A;  3OUH A;  4XAB A;  3BVC A;  2JIG A;  5EPA A;  5C5U A;  5HV4 A;  3GZE A;  5DAV A;  5LAS A;  2FCU A;  2RG4 A;  4BQW A;  4IW3 A;  3W20 A;  3KT7 A;  2RDQ A;  5LBB A;  2RDR A;  3NNL A;  5LB6 A;  2RDN A;  3MGU A;  4XAA A;  3NNF A;  4MHR A;  3W21 A;  5DAW A;  5M0T A;  2FCT A;  4MHU A;  5IAX A;  3DKQ A;  4JZR A;  4NMI A;  2RDS A;  2G1M A;  5C5T A;  5DAP A;  5EP9 A;  4XCA A;  3NNM A;  2Y33 A;  2G19 A;  3KT4 A;  4NAO A;  3OUI A;  3PL0 A;  4J25 A;  4XCB A;  5LBC A;  4NHK A;  5LA9 A;  2JIJ A;  4NHX A;  5IAV A;  2V4A A;  4Y5T A;  3HQU A;  3GJA A;  4ZPI A;  5EQU A;  4XAC A;  5L9B A;  5LBF A;  4NHY A;  5DAX A;  2HBU A;  5LAT A;  3OUJ A;  4NHL A;  4ZON A;  3GJB A;  3EMR A;  2HBT A;  5L9R A;  4NHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...