5IATA

Mechanistic and structural analysis of substrate recognition and cofactor binding by an unusual bacterial prolyl hydroxylase - apo-bap4h
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
206
structure length
206
Chain Sequence
KEQTIFDHKGNVIKTEDREIQIISKFEEPLIVVLGNVLSDEECDELIELSKSKLARSKVGSSRDVNDIRTSSGAFLDDNELTAKIEKRISSIMNVPASHGEGLHILNYEVDQQYKAHYDYFAEHSRSAANNRISTLVMYLNDVEEGGETFFPKLNLSVHPRKGMAVYFEYFYQDQSLNELTLHGGAPVTKGEKWIATQWVRRGTYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Procollagen-Proline Dioxygenase
publication title Bacillus anthracis Prolyl 4-Hydroxylase Modifies Collagen-like Substrates in Asymmetric Patterns.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
total genus 58
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5iatA01
3OUHA 4MHUA 2JIJA 4NAOA 5HV4A 2RDNA 4IW3A 4BQWA 4BQXA 5ERLA 5IAXA 2HBTA 2Y34A 4ZONA 2FCUA 2RDQA 4XCAA 3HQUA 2G1MA 4NHYA 3HQRA 3NNLA 2FCTA 4XC9A 4NHMA 5LBEA 4NHLA 2V4AA 5EQUA 4Q5OA 5LB6A 4MHRA 4NMIA 5DAXA 5LBCA 3DKQA 5EPAA 5IAVA 5M0TA 2G19A 5L9BA 4JZRA 5LASA 3W21A 3GJBA 2FCVA 3NNMA 2JIGA 3GJAA 2RDSA 5LA9A 3NNFA 5DAQA 2OPWA 4NHKA 5DAWA 3KT7A 4BQYA 3KT4A 5DAPA 2RDRA 3BVCA 4ZPIA 5C5TA 3OUIA 3ITQA 2A1XA 3OBZA 4UWDA 4Y5TA 5C5UA 4XABA 4NHXA 5IATA 5HV0A 2Y33A 4XAAA 5LBFA 3GZEA 3PL0A 2RG4A 5LATA 4Y5SA 3W20A 3EMRA 2HBUA 5L9RA 4J25A 4KBZA 4XCBA 5EP9A 3NNJA 5LBBA 5A3UA 3MGUA 3KT1A 5L9VA 5DAVA 4XACA 3OUJA
chains in the Genus database with same CATH superfamily
1URXA 2BV4A 2BU9A 3LF7A 1WLWA 2W5FA 2VR4A 1BBT3 1O4YA 2RDNA 4YG0A 2RS53 2QQWA 5HCAA 1E5SA 5IVCA 2VUDA 1JU4A 4OQ8A 3AK0A 5F3CA 3EJKA 2TNFA 3JXSA 1YO8A 1G9AA 2EALA 4RR3B 2W1SA 1F5JA 2YU1A 3OBAA 1JH5A 1COV1 2GZWA 4BQ2A 2DVDA 2E63A 2Y6HA 4CCMA 4UXAA 1J3RA 1S2KA 4M4PA 3ZFEA 3VBUC 3MLJA 2RM21 3ZSJA 4F83A 4GA9A 1W6OB 4DUXA 3AFKA 1I5ZA 4IE4A 2Q8EA 1NLRA 2CDOA 1OURA 3SH5A 3O1SA 5C3QA 1TG7A 3WNPA 5GZGA 5JPMB 1ZBE2 3POYA 3I3DA 1W9YA 1JI6A 5DAXA 5E16A 5FQ0A 4OI4A 4XF3A 3URFA 5A33A 4AEDA 4K21A 4FPKA 3V0AA 3WW1A 2WBKA 4QHBA 1RUF1 5LASA 2BFUS 2JG9B 2OXBA 4QB2A 4S2FA 4KH9A 3P6BA 4LEJA 2RHPA 2HWE1 3B01A 1LCLA 2Q0AA 1V0AA 3M7AA 1CAWA 2B8MA 4ES8A 4NHKA 5FYVA 4DS0A 5CA6A 1VAKA 4WVZA 3ZPYA 1QOOA 4XDQA 1ULEA 3RWNA 4DQAA 3MW4A 2NP0A 1HRV3 3RS6A 1VBC1 3MDPA 3TN91 4WV8A 1ND3B 1W0PA 5KWRA 1K45A 5BUVA 1H4GA 2HLEA 4MXVA 1J3QA 4AFAA 1NLQA 3LIGA 4K6BA 4ZPIA 5EYXA 4BQ3A 4YGBA 5I8YA 4PQQA 5FY0A 2Y6LA 3AYDA 3BN6A 3ZFFC 1RUOA 2QCSB 3TEZA 4IUGA 4IEXA 4DMIA 1UZVA 2ZGNA 1Z0HA 2WLPA 4LO5B 4A6OA 5K0UB 2ID4A 3VBFA 4YZ1A 3RPQA 1UYZA 2MEV1 3MIBA 3ZM8A 3IT8A 3OEAA 2AYHA 2H0VA 5FMOL 2XJQA 2Q5TA 3WG4A 4BIFA 2ZX0A 1OKQA 2OZJA 2VH9A 2Q8OA 3UESA 1RUJ3 3K77A 1I3HA 3CMGA 2VE1A 4GKXA 4O9EA 4XJWA 1MQTA 4QAWA 2VOTA 2VW0A 3AYCA 5EJ1B 5FWJA 4CDWC 3IZOA 4URTA 1NXD1 4COZA 1DP0A 4K7JA 3GXUA 4YW7A 5GM0A 4DIQA 1CJPA 5E8AA 3B69A 1RYYA 4JVAA 1W6NB 2E7TA 5ABJB 1FV2A 2RS33 3TOJA 2G9ZA 1QMJA 1O5LA 3U78A 3ZYHA 1GUIA 5JXGA 1QJU1 2E31A 3RWKX 4UI9L 5IFPA 1V00A 3INAA 4QM9A 5FFOC 4CE8A 2WYSA 5D8AA 4BPZA 4RS5B 5BV6A 1HV1A 2JDUA 2MEV2 1H1IA 3HOBA 3I3BA 3WZ1A 1GWKA 2DCTA 2ZGKA 4MGIE 3ALQA 4E8DA 2JB4A 2UU8A 5FXXA 2D6NA 1GANA 4ZU7A 2HWD3 5FZIA 5DDJ2 2X5IB 2ZGPA 2O14A 2GC2A 3O1MA 1BEV1 3O12A 3VHNA 3OJBA 3ZX7A 2BNOA 4XJUA 3H1MA 3POFA 4AOCA 2VQAA 3WCSA 2W08A 4D0QA 3AMMA 2IXLA 2FCUA 4CXWA 5C6CA 2XJTA 2WNVB 1OH4A 2VM9A 3HNYM 3ETQA 1U5YA 4HBNA 1AR71 3MYXA 5K7PA 1YJKA 4ATEA 4NHYA 4BE3A 4FFHA 1A8MA 4PQ9A 3OY8B 1RUC1 4EYUA 1S2EA 2YFUA 2OPKA 3P5BA 3WG1A 1UZ0A 4TSVA 4EN6B 4BJ0A 3WV6A 2PHDA 2FDJA 2WDBA 3J8F3 1EAH3 1BLZA 1YC61 5EQUA 2XUEA 2BNMA 4E2SA 1BEV2 4BQ1A 4EWEA 2XVLA 2AEZA 2YG0A 3SISA 2XBO3 1BMV2 1KJLA 5FY4A 1CZSA 2JENA 2SLIA 5FYYA 4B3NA 1WW4A 4KBBA 3RZZA 3QBQA 5F5AA 4XPVA 1Q8PA 4LORA 3I3MA 3NNMA 4ZZ8A 2N7GA 5GZEA 4OHYA 1VBB1 1W3VA 2A7AA 1OOPC 3RZLA 4XQ4A 1V6IA 5EYYA 4XF1A 1RUC2 3TEWA 1VBE2 1JYNA 4AI2A 4D6RA 3R0RA 1US3A 1XE8A 2VXRA 1UIKA 1QJZA 4AVVA 3WNMA 4CEYB 1LOFC 1D2QA 5C9AB 4AVSA 1GP6A 2WNEA 3V64A 3DGTA 2R6QA 2WABA 4A41A 4OHXA 1ENSA 3N7MA 3USUB 4COYA 1IOAA 1RUG2 2QQLA 4L0PA 2C9AA 5F3EA 3V56A 3WUCA 1RUH1 2C4XA 4BWOA 5BYNA 1VR3A 1QH7A 2MNGA 1IGOA 1OQDA 2WRAA 4P9WA 1YHFA 1ENQA 4LTAA 1J83A 3ACGA 2BWCA 4MGZE 4W6WA 5GLZA 1BCXA 4AHXA 4UWDA 3KF3A 1VBB2 2RJ2A 4Q2FA 4H55A 2P3KA 5G05L 3ZYIB 5IATA 1W0OA 1SHWB 2BW8A 3PVEA 1O4ZA 1QY4A 2ZGOA 1LB2A 4AR2A 5KC5A 4I0AA 2XWBB 3E5XA 4E8CA 1C1LA 2ZBJA 5F2WA 3ZYPA 2D7FA 2W9XA 2QFEA 1RVF1 5FPXA 3JBG1 5JUVA 4JX0A 2VZQA 1COV3 2P6HA 2VOKA 1RUH2 1H2KA 3RNSA 2VG9A 4MLOA 2E7QA 3AXEA 1R1ZA 2VCCA 1RUD1 1FPN3 1GOGA 2RM23 5EP9A 2FBEA 5FPZA 1W8HA 1UW8A 1NA1B 2ZPXA 3D0SA 2JG8B 1T2XA 2VZOA 4QPIA 4RSUA 4AI9A 1VAVA 1C8M2 5ISLA 4AGVA 3IWZA 1QEXA 1OA2A 1AR92 3PVOA 4IXLA 3CL1A 1DLCA 4M0HA 1O4TA 1XNBA 4QXKA 3I59B 4RQPA 5J7MA 1RMU2 3DL3A 4ZS2A 1K5MB 4AAPA 3PUAA 1LU2A 4CDWA 3BTXA 4QHOA 3IM0A 5IK7A 3RQ0A 4AG4A 5BNPB 4NR1A 3POJA 2VCAA 1REFA 1QHDA 5FO8B 4ZXKA 1RUF3 3JBG2 3KGZA 3CJIA 2CNAA 5FY9A 4Q4W2 4NRPA 1TNFA 2ZGQA 2HWE3 4CDUC 5FP9A 2WWSA 5CZKA 4ES9A 4NVPA 1L7LA 2VOWA 2WWUA 4QGMA 4Y33A 3RZJA 2FZ2A 1XC6A 3O1UA 4A7KA 4EN0A 5JMCA 1CPNA 4FFGA 4IEVA 1NXMA 4GIQA 4HN0A 2JKBA 3VD3A 1PK6C 1IKPA 1VBC3 1QDOA 2XL9A 3M4FA 3ON7A 4LIVA 4XJZA 1ST8A 3ES4A 4NIIA 3TN93 3UV9A 1Z7S2 2AACA 4IGOA 4OCTA 3VD4A 5FIXA 3AJYA 5SV5A 1GOHA 3WDVA 3VBUB 5A70A 2FHRA 3H8RA 5JXIA 2Y64A 2XPJA 1O3TA 5LBCA 2BRTA 3ZN5A 4LNVA 2EIGA 1UZZA 2PFWA 3HBZA 4AFMA 4OZOA 5L36A 1XB9A 4BZ4A 4KG8A 2XJVA 2ZA9A 4R4XA 5LA9A 4N43C 2IXJA 2WZR2 4XJ9A 4UYBA 1WGPA 2QZ2A 3OGRA 4I0WB 1UX7A 4AHZA 4N53C 5CFCA 1H30A 5FKCA 1OA4A 2X10A 1MVEA 1UXZA 3BALA 3ECQA 1DQ5A 3IIAA 4Q4X1 3QACA 3ATGA 4FPLA 1EV11 1QJU3 4N9HA 4ZY9A 4P9LA 4Y22A 3C7HA 1SCSA 5CB7A 2AEYA 2D40A 2WL1A 3H3ZA 2HYXA 4P02B 4AQ6A 1IS4A 4OQ9A 5A1AA 1UKGA 3NKGA 3NW4A 4M3CE 5T50A 4E27A 2D43A 3OBZA 5DUVA 2BPA2 4EV0A 1PNGA 4PIYA 3ZFFB 4C90A 4HKWA 3CNAA 1HB3A 2D5FA 5D21A 4XZUG 4Y24A 2VTXA 3CZUA 3T2OA 1LHVA 5GJ6A 2I74A 1G86A 2Y6JA 3GZEA 1LRHA 3KLSA 4W65A 1LOFA 2PQQA 2VPVA 3KB5A 2O1QA 4EE2A 2DU0A 5J36A 4BM8A 5HI0A 1H8TA 3AFGA 1L7RA 1RC6A 3B02A 1AR73 2B45X 4JKKA 2E32A 5F7UA 1SLIA 5CNAA 3BTAA 1MS8A 5A80A 1BHGA 2QQJA 2R041 3O0VA 3FUQA 1JBCA 3PTYA 2VZSA 1A8DA 4BU2A 4DEVA 4BXFA 3MGUA 1DQ0A 1TEIA 2HJIA 2W2IA 3BIWE 4IESA 4UT5A 3D8CA 4XACA 4OULA 1AR62 5IYYA 1F15A 3P3PA 3ST7A 2JE8A 1RHI3 3Q8CA 2ARAA 1W8NA 4BQWA 4F8AA 4QU2A 1MS3A 4XMAA 4Y1XA 1R082 2QQVA 1UL9A 5DQ0A 3BOPA 4A42A 1I1EA 3NQHA 3WP3A 2GNTA 1VBB3 2Y38A 3CLPA 3UK9A 1V70A 2R042 4FP3A 4LO4B 5F9TA 5JDBA 4D7TA 2XJSA 1LGCA 2HWB3 3LPGA 4YWAA 2XJRA 4Z8BA 4WBBA 2J22A 3UKTA 4CPBA 3PU3A 4NHLA 1J1TA 3ZOIA 1OA3A 2E9QA 3RRDA 2CHHA 2XHNA 4BXSV 4LKFA 4JHZA 1NKGA 3RVHA 1F4AA 4BQ4A 3ZYRA 4CP9A 2ORXA 3KCYA 4NMIA 1LKNA 4IV3A 4QU1A 4QX3A 2L9LA 4P9JA 4AW7A 2P1BA 4NRMA 2RJLA 3HQXA 3IDAA 4RN5A 3UJQA 1UD1A 3ME2A 4JAAA 2TEPA 4R4ZA 4AHYA 5JMOA 1AL0G 2VGDA 3HBKA 1RB8G 1NZCA 4ASKA 4Q8LA 3C8XA 1TZOA 1UPIA 1BXHA 3NNFA 4MZUA 3IPVB 3OYWB 1Y43B 2RS12 1WCUA 2QDRA 2KD7A 4Z07A 4AVAA 2R1BA 3VZNA 3S5AA 2ORZA 4JGZA 4GMP3 1RVF3 4J6GA 3I3QA 4CUAA 2YROA 1JYTA 1RINA 3SEEA 1Y4WA 1AVBA 2LS6A 4U2AA 4EN7B 2JG9C 4FPEA 5GLUA 3ZKYA 4OHWA 4I30A 5A3TA 3RJ2X 5FZHA 1RUD3 1IPJA 2ZABA 4EROA 2VTXJ 3ITQA 1KS4A 3H3UA 1ULCA 2XWJB 4ZU4A 3OD0A 1N47A 2X53S 3C7EA 4D7YA 1YNAA 2HWF1 3S6PA 3D82A 3MFCA 4W6YA 2WSUA 3LIHA 1DLLA 1SCRA 2FDFA 4XDPA 5LCWL 2GH2A 3TYJA 2YPJA 3RI8A 1AJOA 2WA3A 3K75B 3VN4A 5JZGA 5HV0A 1MZFA 1JZ6A 4FPOB 5FUIA 5KXEA 1OMIA 3I2IA 4OVEA 4DXTA 1HQWA 3ABZA 4LBNA 4N53A 4YVWC 2QNKA 1OUXA 3HWJA 5K0UC 3RZGA 3WF4A 1TVGA 2WN3A 1R091 2Z42A 1AZDA 3RSJA 5L9RA 3LAGA 3KV5A 5CG8A 1T6GC 3FLTA 1AYM1 2AZ5A 2DVGA 3EYPA 3BB6A 3KS7A 4CUGA 1OVPA 2VW1A 1VBA2 2IUWA 1MZEA 2R073 3LKJA 2HWF2 3ILRA 2W92A 1HV0A 4EQVA 4X6QB 2QVSB 5LK5A 3O0WA 4NIDA 2WQZC 2VQUA 1ULPA 4RHV1 4XILA 1Y9GA 1O3QA 3WLUA 5ABJC 4NIGA 3PNAA 1W6QA 4UFIA 3JQXA 3QH6A 4FOVA 4HFSA 1CAVA 2NYYA 1JN2P 1GP4A 4ISQA 4UFJA 4LHNA 5AFEA 1OPOA 4D94A 1LNSA 4IEUA 4FQ4A 1F35A 2DTYA 3OBRA 1HRI3 1UMIA 4XF9A 1JZ8A 2PHTA 5IK5A 3W59A 4DXZA 1Q43A 1R092 2C0ZA 1LR5A 2WZ8A 4RS5C 1U5XA 3GGLA 5IVYA 4TTGA 3IIIA 3U1XA 4CVUA 3H7YA 2F4LA 3RGBA 5J3UA 1DQ4A 4BA6A 3LZZA 2NM1A 3FX3A 4C91A 4PF5A 4FPYA 3NNLA 2RR13 4CCJA 5BNNA 1PM7A 3E1F1 1U5IA 1SBFA 4CDUB 1HN0A 1YQ6A 2R061 3MV11 3OPWA 1ZX5A 4Q4X3 2WINB 2BWAA 5ANQA 4XXPA 1QJY1 1EV13 1X9TA 4P9IA 3WT3A 1LAJA 3HNBM 1SFNA 3LEGA 3E6CC 2HWC3 3MHZA 4JTOA 2WNVC 5FXZA 5LA0A 1PK6B 3WX5A 4KG0A 3BTZA 1DG6A 1WUVA 2ZGSA 2DVBA 3GNEA 3B9IA 3JB4C 4YARA 1V6LA 5JAXA 5LEKA 2JDAA 3LE0A 4FQZA 5EPAA 1VAMA 1WW6A 1PZ7A 1AXYA 1PO13 4HK9A 4QX1A 1AXKA 5FP3A 3GJBA 5LRSA 3ZFGC 1J3PA 3VBSB 5CISA 3CO2A 3MV01 2JIGA 1DGWX 5FZDA 2OYZA 1A6CA 4RFT0 4K3UA 1F5FA 2K46A 1DGWA 1TQ5A 4S2GA 5CVRA 3WDTA 3FMGA 5FV3A 4YVSB 2QQMA 2YBKA 4R9DA 2R062 4XQWA 4KMQA 3DYPA 5CKNA 2GP5A 2R49A 3D6EA 1HXS1 1QJY2 2VNGA 4QX8A 4LBQD 5FO9B 1YXWA 4N43B 3KCCA 1N3PA 2A3XA 3SH3A 3NAPC 1ODNA 4AWDA 2VOVA 4RR3A 1X36A 3ZIWA 5C5TA 2CGOA 4RGKA 2WNOA 3N7LA 4K20A 4DOUA 5A1FA 1US2A 2YHJA 3CZJA 3BIEA 4NPLA 2DTWA 2W39A 4GZ9A 1J58A 4XUOA 5FOBB 5J09A 1W6OA 4LBQB 3APBA 2X29A 2LRPA 1ZBA1 2BZDA 1ZZ7A 5F39A 2QQKA 2UWCA 3PMSA 2WFPA 2CYFA 2PQSA 1O3RA 4HN1A 3EO6A 3HR9A 4L97A 4DEQA 3MFAA 1GZWB 3H3LA 4QWNA 2DCYA 5FZFA 4PLNA 5A7SA 1HXS2 1WMXA 1WCDJ 4AFDA 1OT5A 1CN1A 1OBNA 1VMJA 3VHPA 1EP0A 3N9NA 1C5HA 3NWKA 2HBUA 1JHJA 3O1PA 4AHWA 2Y26A 5FXWA 4IV1C 1WWYA 1JYIA 3KHBA 2XONA 4CCEA 5C4WB 3C2UA 4XHXA 2GALA 5EIYB 3N4MA 1APNA 4I2OA 3FUOA 4QDRA 5GZDA 1W9SA 2DYCA 2PA7A 3OGGA 4YM1A 3O1VA 1PIV3 1ZBA2 2C9KA 1BKZA 2WN2A 4FI9A 1ND3A 2D44A 4YM3A 4MHUA 1SLLA 1F8VA 2VVEA 3MIDA 4YW3A 3WQ7A 4GH4B 5FUNA 5HPOA 4YW4A 1U0AA 5FUPA 4C1XA 1ULDA 4MADA 2JJ6A 3KCXA 5FK8A 5FP7A 1Y9QA 2WT1A 1AF9A 2JG8C 1S4CA 4O7XA 1C57A 3PIJA 5FBJA 1G9DA 4LO8A 1H4HA 1CWPA 3HQUA 2NZ9A 1WW7A 1UU5A 4GKYA 1AJKA 3RYPA 4H7LA 2DURA 4GWJA 1D2SA 2OIIA 2R0HA 1PNFA 2DBNA 3N7KA 5BNPC 5LY2A 1T6BX 1W2TA 1W6NA 2V4AA 5ABJA 1D0HA 3KZ4C 4JRLA 2B42B 2FZ1A 1XU2A 2YMZA 4JQTA 5C8WA 1B35C 3I2OA 4OLLA 1H0BA 1V6JA 2ZMKA 1ZBE1 2WS92 3AL6A 3RDIA 3VDDC 4CDXB 5CFDB 4FPFA 3RMYA 5C3OA 1CX1A 2HKXA 4ASMB 5M0TA 2XR4A 3AM2A 3NJVA 3MIEA 4BMBA 3SKVA 1R1A2 3WDWA 1LOEA 4Y20B 2P6CA 2RDSA 4FOYA 4PF1A 4M00A 1JHNA 2WNUC 5FP8A 5BPXA 1MR5A 5E88A 2VZ3A 2GAUA 1O5UA 2X5IA 3WR0A 4D69A 5LWBA 3O1OA 4QB1A 3KT7A 4HSJA 5FRAA 5FREA 5GLWA 4LA2A 1BYHA 4BQYA 3ACFA 3VBRC 4IEYA 3VDAA 3ZN6B 1TMF2 5E6HA 3R4DB 1GMMA 1ZNPA 1U12A 1AX1A 3B94A 2LROA 1AYM3 1H6XA 4M4RA 5F8PA 1PM4A 2WNVA 1VRBA 4C0BA 2XG3A 1NAEA 3FHIB 1PVC3 4Q1PA 1L7QA 2VZPA 2OT7A 2A1XA 4OHZA 2UYBA 1BQPA 4AI8A 4BISA 1RJ7A 4YSFA 3S5QA 4NE9A 3WG2A 1S55A 4RHV3 2QE3A 4XTMA 2QQUA 3V65A 2YXSA 2JEMA 1K5JA 5JPNB 4MG2A 4TLFA 2BFUL 3AKPA 5CADA 3UKNA 4XUTA 3JQWA 1D7PM 3LFIA 5FZLA 1DBNA 2OZ6A 4DXRA 4BLJA 1POV0 4JGYA 2LM3A 2BGPA 4GWMA 1AL21 5C3PA 5FDBA 4LLOA 1NX9A 3AB0A 1MS1A 1FV3A 2YC0A 1NCRC 1Q8OA 2UWBA 4IQPA 4K1YA 4B29A 4D6SA 4FTBA 4B8EA 4XFIA 4YVWB 4JDMA 2RMU2 5A3NA 3T1MA 2QBXA 1SFYA 4QXBA 1E5HA 1LHWA 5IW0A 5A7OA 2BVVA 4AEJA 1ZRCA 3WDXA 2EA7A 4UW4A 1RL3A 4CEYA 2J1RA 3AVRA 1XNAA 2ZTNA 5C9AA 1WCQA 4ARXA 4E4SA 4CCKA 2VXJA 3WP5A 1VE0A 5C33A 3ROUA 1W99A 4TN7A 2UWAA 3I3EA 4MOAA 4Q4Y1 3USUA 5DDJ1 1HQNA 5F3IA 1ONAA 4YGCA 3A0NA 4GJZA 1WW5A 4KWJA 3TB0A 1AL22 5B4XA 1WCSA 4PDWC 3G7DA 2ERFA 1OKOA 3AZZA 2GC1A 3HMYA 4M01A 2WO1A 5ERLA 4IEPA 5GLTA 2E7AA 2QZ3A 1JXNA 5JOXA 3LD8A 4XCAA 5F5QA 3SNMA 1DGRA 2JDHA 2ZZJA 3O1TA 4LPLA 3T0BA 1YQ2A 3HQRA 4A6SA 3BPSA 4CDQC 1KRIA 1REDA 4IEQA 5JI9A 2FD8A 2QKDA 3WOGA 1OC1A 3ZN4A 5ACA3 1MS0A 1UXXX 4XF4A 3WDUA 2Y6FA 2J1AA 4NAMA 4EWDA 2AUYA 2XHKA 4JKLA 1WD3A 2B4KA 3PTRB 2I07B 2WQ8A 1SPPB 1ZVFA 4Q4Y2 2WKKA 5F32A 4FPGA 1MS9A 4CU8A 1H1AA 2VQTA 2WJSA 2BOJA 1ZA7A 5FYUA 2XGXA 2JECA 1FXZA 1HJFA 4V1PA 2EIEA 4HETA 1YJLA 3T1LA 1BMV1 3AMHA 2P4EA 4P5YA 4WVMB 1NA1A 2F17A 2Q4SA 3ACIA 1QJEA 3B93A 1W6MB 4E9KA 5H9PA 2XMLA 4L92A 2FCVA 3CKHA 1A78A 3L9JT 4ITCA 4OI2A 4O9GA 5L19A 2CU5A 1JUIA 2I2SA 4F7ZA 1OLMA 3I59A 3WNLA 1LODA 5JLVA 1PX4A 1VBE1 3AYAA 4QX7A 4D3WA 1K5MA 1XBFA 2OA2A 3SEPA 4TXWA 2BNNA 3ZFGB 2UY8A 3QLQA 1QOSA 3LQCA 4R52A 1UY1A 5FY8A 2X09A 2RDRA 4LUKA 2GDFA 1S0FA 3VLBB 2JB8A 3GZUC 5FZOB 1CGPA 2P17A 5JXHA 3OD4A 1RUG1 2J1SA 3OOXA 3VB9A 3UGFA 2O8QA 1ASJ2 1CZTA 3VKLA 3N9PA 5FQ0B 1FT9A 3MPPG 3DYOA 1W8FA 2RE9A 2WUHA 3IMNA 3ZSEA 2D97A 1OLQA 1Q8VA 2PN5A 3NAPB 1WBFA 4OI1A 3JD71 5FAXA 1YEWA 3DECA 3I2HA 3NNGA 4JV4A 4HOOA 4KQ7A 3KM5A 4IERA 4NHXA 4GWIA 3VBUA 4ZU5A 3VBOC 5J98B 4FOWA 4LQRA 1RUI1 4KWKA 4V2WA 3U0ZA 4COVA 4URAA 4PCRA 1JYXA 2VUJA 2R16A 4PHZA 4CCOA 3GHMA 1TME1 5FMDA 4QGLA 4YW1A 1X8MA 1S0GA 3H50A 3TBDA 4AI3A 1WLDA 2VC9A 4FTEA 1UX6A 5FYZA 4IDZA 3T2PA 3E5QA 4PIXA 1MPXA 2ZS6B 4LITA 5A7PA 1C8M1 4W4ZA 3JD72 3VZMA 5DAVA 4IV1B 1NCQB 1AR91 5DZGA 1FMD2 4FFIA 2Z2SB 4IGQA 2XVGA 4ZZ5A 2EVXA 2BJSA 3DPRC 3VBHC 2WFF1 2I45A 1RMU1 1ZBE3 3S7EA 4CU6A 3OGJA 1RUI2 2EXKA 3O0XA 4CCCA 3UJOA 5IWFA 4BQXA 3N9OA 3O5SA 5AC92 4P9GA 4B7KA 5FPAA 1F9KA 1YWKA 1ZA4A 2VQ0A 4HXCA 3ZSKA 1XE0A 1TME2 4FAGA 2ILMA 3OF1A 4IE6A 4Q4W1 1E5IA 3I2JA 1KDKA 5FZEA 4QM8A 1PZ8A 1XOYA 3ZFFA 3WHTA 1JTZX 2G1MA 1D4M1 5T55A 2VZRA 3S7IA 4OMCA 1A34A 3NSTA 5FYCA 1ZZCA 4PI2A 1GP5A 5FJKA 5D1IA 1Z7S1 1W90A 3CIHA 2KR2A 1DYKA 3FLRA 3T3YA 3ZR5A 2WR9A 1JZ2A 2JDMA 2WFF2 2CAUA 4Q4V2 4GWNA 1PO21 5EHDA 5K4LA 1RUE1 5LB6A 4A45A 1VBD1 4I0BA 3ZPOA 3BYWA 2OQ7A 3DKQA 3B9CA 3MUY1 5J48A 1DZTA 4RA0A 5IAVA 4MVTA 2ZAHA 4M0NA 4OI0A 4A3ZA 2VVFA 5I91A 3I97A 3K3OA 1B35B 5FLIA 5IUQA 2W52A 1UY3A 3N9QA 2VNRA 2XUMA 1BK1A 4NO4A 4FXKB 2J42A 1D4M2 3VDDB 4AAXA 1DF0A 2WZR1 3DYMA 5DPNA 2EXJA 2OPWA 3FBMA 5FY1A 1JYVA 5FBZA 3ZR6A 4FTSA 3FC0A 5JR7B 3VD7A 1N1VA 3V0BB 1GR3A 4QX5A 1JW6A 4XFHA 3H8XA 2GU9A 5AVPA 1QF3A 3ENRA 2XDVA 1WCKA 4NPRA 2A5ZA 1X33A 2WNUB 4I3GA 1PO22 3SMHA 1RUE2 3AKTA 1VBD2 2OUJA 3GHNA 3VBSC 4K8FA 5DUXA 4CA9A 4LKSA 5FYIA 1AX0A 3RFRA 3VBRB 2DDUA 1IQDC 2W47A 2PHXA 5A3LA 4WM8C 1CQ9A 2MEV3 4YVSC 5KHIA 1V9U2 4DY5A 3T4VA 1H2LA 4GD4A 2IXKA 4Q4Y3 4MX3A 5DDJ3 5A1LA 1GFF2 4HANA 2Y33A 2W1QA 2Y0OA 4MGSA 2K2SA 1W05A 2VJXA 4L2NA 4E2GA 3WINE 1XSQA 3AVSA 3C7GA 3N7JA 5BNOC 2GMMA 2WO3A 1XRUA 3S0MA 5A3WA 4NIAA 3F95A 1AYN1 2SBAA 2FMYA 4DNYA 4A2UA 4XVHA 4CUBA 1VRH2 3EHKA 3A22A 4R9BA 1RIRA 3VV1A 3IPVA 3OYWA 4CCLA 5T5LA 2GNBA 1IG0A 2XVKA 5A3UA 4WM7B 5C3SA 1V6MA 4E4ZA 3KT1A 5L9VA 1NCRB 2BOIA 2ADDA 4CXYA 1DCSA 1OOPA 3FLPA 1CONA 4FP2A 2D93A 1UU4A 1AR61 2HYKA 1BEV3 4HPKA 2W0XA 4FPJA 3OEBA 1H2NA 4FXGB 5F2SA 1H6YA 4NAOA 3WD5A 3ETPA 3ZSLA 3MLKA 1QJX1 3H1YA 5C4WC 2QQNA 1VIWB 1GBGA 4IW3A 2Q1MA 1SMVA 2RV9A 5T5JA 1XNKA 4QPGC 1OF4A 3ZXFA 3PURA 4DZGA 1R081 1ULGA 2V5DA 1AYN2 4QPYA 4RFRB 3GCXA 5JSOA 4CEWC 1SFPA 4P14A 4FOQA 1AXZA 4YRDA 1RUC3 1VBE3 1QU0A 4PDWB 3IAQA 5FZBA 4B1LA 3VUOA 4GH4C 4PLOA 2P3JA 2YBSA 4QDQA 2VBPA 4AK3A 5KHJA 3KVAA 2DFCA 4QPIB 4K9SA 3T0AA 3HJRA 4AXOA 5JVVA 2Y6KA 2Z69A 1PZ9A 1GLHA 1HB4A 2PTMA 5GALA 4CDQB 2JX9A 1RUG3 4YGDA 4Y1VA 4JRAA 1YFUA 1SBDA 1QJX2 2B9UA 2ES3A 4XYXA 5F1RA 5LA1A 4YPJA 3KWVA 2BEOA 3U07A 1ACCA 4NOTA 4Y4YA 2ZKLA 1FYUA 3AZXA 4QQ2A 1NE6A 2DF7A 3TEYA 3S57A 4D6QA 4NWWA 3K4ZA 4GQ7A 1NT0A 4FVVA 3W21A 3GJAA 1REEA 1GNYA 2ARXA 5FZKA 2DVFA 4CP0A 3PDQA 4BK4A 3ELNA 1N1YA 3NJZA 3U11A 5ANNA 5HXVA 1AR82 4QKDA 2W1UA 4S2DA 3U75A 2RS11 4UF0B 3CDZB 1GZCA 1JOJA 2XXZA 3WW2A 3MEPA 4CDXC 5CFDC 4AI1A 1FOD1 5I93A 3CF6E 1UO9A 5T5PA 3VD9A 1ULOA 5LZ6A 4COWA 2IFRA 2XQXA 4MH0E 3DXTA 1RUH3 3AP9A 3J7NA 2V73A 1O6UA 3FL7A 3WY6A 4RGAA 1C8M3 4CDUA 5IVVA 2H0BA 2CGNA 2WIIB 1AR93 2IXIA 5C3RA 1OF3A 2ARCA 4Y5TA 5C70A 1QXPA 3LA7A 2WSVA 2WAAA 4NJ4A 2WFF3 2DV9A 1RMU3 4L8QA 5JIAA 2GMEA 3ZO0B 1O3SA 3M1HA 3Q8FA 1HIXA 1BK0A 2ET7A 3M3EA 1PK6A 2YGLA 1Y7BA 3W5MA 4CU9A 3KV9A 1OD5A 2GC0A 2EXHA 5FTTC 1FOD2 3K4AA 3PL0A 1W8OA 3AP6A 4XFAA 3JBG3 1XYOA 2ATFA 4Q4W3 1OQEA 3VL9A 4LBKA 1MZ6A 3GDBA 4Y5SA 4COUA 2WQ4A 1POV1 2VMDA 4DFSA 2A73B 3D3AA 4LA3A 3NVCA 3VBOB 2BBVA 2VZTA 3MICA 4UW3A 3VBSA 5FYMA 4UBHA 1SLCA 2AC1A 3PHMA 1LHUA 2NMNA 4EZ4A 2ZGMA 1VBA1 4B4QA 2WWJA 4NROA 4FO9A 1S0CA 1MEC2 4YVSA 2JE7A 1DU3D 2AENA 3JZVA 4BB3A 1RGSA 1Z7S3 2R32A 2PYTA 4CTEA 5A3PA 4QQHA 5G04L 1QH6A 1O8PA 4N43A 1PO23 3OUJA 4C0HA 2ZHNA 1POQA 4F3JA 4HT1T 4YG3A 3WNNA 3K3NA 3NV2A 1WLCA 2E33A 2G9GA 3CQOA 2WT0A 1YI9A 2K0GA 2GN7A 4QKFA 2PHFA 1NYWA 1NZIA 4UAPA 2BTVC 5I0SA 5J1XA 3MZHA 2RS51 1ZZBA 2ZEZA 2JE9A 3HNMA 4XEZA 4ZONA 3DPRB 3VBHB 4AVBA 2VNOA 4LBQA 4XIKA 2O0OA 1H8VA 1F4HA 2WAOA 3AXDA 1BVVA 5IT6A 2WZR3 3RYKA 2DCJA 1W9WA 3C3VA 3E6BA 5L7OC 1WZXA 4LHKA 3KSCA 3UETA 1Q8SA 3FWEA 4Z2AA 2VULA 1GZWA 4XC9A 2F6BA 4XBNA 2IZWA 2IXHA 3TRSB 5C8CC 5CBLA 4ZKTB 3RMXA 4YLZA 3GM8A 4AEKA 1DQ1A 3A7QA 4HL0A 3POIA 1GQGA 4WVVA 4A44A 1JZ3A 1FI2A 4X8PA 5GZFA 4LE3A 2WYFA 3PLQA 3F2ZA 2QDNA 5T3NA 4N9IA 4P00B 1UNBA 2NMOA 4EZHA 2RS52 4JTNA 4NN0A 4MGKE 5L9BA 4CPBD 3QOPA 3AYEA 4OZXA 3GBGA 1Q5OA 1NOVA 3K48A 4BK5A 3NL1A 1Q3EA 1CZVA 2JWPA 1WMEA 3D5OA 3M3CA 4JDOA 4BLIA 5EV7A 1UY2A 2YZ4A 4LBOA 1B09A 3D4KA 3LDRA 3MW3A 5GZCA 3LFMA 2CTVA 3IDBB 4IL7A 5DAWA 5F6LB 4A3XA 1OLME 2EAKA 2OUHA 4EJRA 4QB6A 4LUMA 3I2FA 2TBVA 1CJDA 1PVXA 2B9VA 3TNQA 5IVFA 1Q56A 4A4AA 3PJQA 3VGIA 1ZZ8A 3M3OA 3S30A 1MS5A 4W6XA 5CAZA 1XU1A 1CAXB 2LALA 3I54A 2DUQA 2PXJA 1ND2B 1UOJA 3AC0A 5HCFA 2VTFA 2Y60A 2WLQA 3AZVA 3L2HA 5T52A 3J7MA 1SLBA 1G8WA 2GNDA 1AR63 3NO8A 4BDVB 1SLTA 2H6BA 1SACA 3OGVA 1GOFA 3NV4A 4WM8B 1KQRA 4AQTA 1QJX3 1N1TA 3GBFA 3AKQA 2ZX3A 2VO5A 4AF9A 5KR7A 3AZYA 4TLGA 4YZ2A 5K9YA 5FZCA 5CFDA 3DUIA 1UF2C 1VP6A 4LO7A 1R083 1W2UA 3HT1A 1IHMA 1UPSA 1HRV2 2VAUA 3IDCB 2NQYA 5T54A 4Z1VA 5A6YA 3E97A 1MS4A 4H2AA 4NRQA 3WQ1A 3PUSA 4X6RB 5A32B 2RS31 2R043 2YU2A 4Y20A 4QT6A 2VMGA 1WMDA 5BNOB 3BTYA 1JZ7A 1CIYA 4KBZA 4XCBA 1SBEA 4FT8A 3MI8A 3WNOA 5H9SA 5IK4A 4IE5A 1HN1A 3UKVA 5FWEA 5T5OA 3ZN6A 1UYPA 1IS5A 5C71A 4XQDA 3LGRA 1PGL1 1UWWA 1YI7A 2B7YA 3LWCA 1Q8QA 4G4FA 1CESA 3H0OA 1RUJ2 4JHTA 2QJVA 5I0TA 2VCBA 1J1LA 4YNIA 4HK8A 2QUOA 5F6KA 2YDEA 5FYHA 1NUKA 5GKAC 1YYNA 2JG9A 2VMFA 3NJXA 5FZ8A 4OYUA 4N7UA 4DRRA 1IZ3A 3SKJE 1JZ4A 2RS32 3VBFC 1S0BA 4ET7A 3LEKA 1LOAA 2XL7A 1NCQC 5DABA 4BIOA 1F2NA 4IEZA 1ZRFA 2A3YA 5FP4A 2RS13 3R4UA 4QPGB 1UOFA 5E89A 3ZYJB 1X8EA 3OCPA 2JKXA 2KXLA 2DBIA 1MQTC 1XNCA 2GN3A 4MGQA 4XDOA 4WVWA 1KD7A 2BDRA 2NLRA 3DN7A 4QD2A 4YW5A 4CEWB 4XETA 3O7OA 4XUNA 3EBRA 1CIWA 3EXUA 2BERA 3G6JB 1H9PA 3R6SA 3ZXLA 4DUVA 1PGL2 1HDKA 2C1FA 3LDBA 2P37A 5FZAA 1JOBA 4BQ5A 1W6QB 1EAH1 3KGLA 1LECA 1NG0A 1CAVB 2CSGA 2HWD2 3GZAA 3ZXGA 4YVWA 4CP1A 2R7EB 3NJYA 5A7WB 2WS91 4XURA 2AR6A 5K0UA 3VKFC 1VJ2A 1LEMA 2VW2A 2FDGA 5D8AC 4JZRA 5FMBA 4LHLA 4XMIA 3N36A 3X29B 2CGPA 1S0EA 3AL5A 1R1A1 2J1TA 1ODMA 2J1VA 2RJKA 4UFLA 4OMDA 4LULA 1CX4A 3HN3A 1W2NA 3Q9OA 3N9LA 2UY9A 4YZ3A 5I0RA 2VU9A 1GU3A 4KWLA 5I0UA 4LMFA 1E5RA 4LXLA 5BY5A 1TMF1 1G7YA 1POV3 3CHXA 4GULA 1W6PB 4CZSA 3O1RA 3J8F2 1EAH2 1RXFA 3B5LB 4XE9A 1G9CA 3VZOA 4XZPA 4JC1A 1HLCA 1KXGA 5FO7B 3VZJA 1G9FA 1VBA3 3TWIA 2HWF3 2ZZQA 2J7MA 3B00A 5LRRA 3ZMNA 4BMEA 4RS5A 2XBO2 5A6QA 4XIOA 3WF1A 1Y3TA 5DG2A 3AMPA 3DF0A 3QD6A 1VLNA 3CEWA 4DPNA 5C5UA 5I8TA 4YFZA 1OH3A 3R05A 4MXWB 1SPPA 4GXLA 3WQBA 2XOMA 5FZ9A 5BNQA 1X82A 5LA2A 5HBAA 1RTVA 1UMZA 1GQPA 2OW4A 4FCAA 1R093 1SEFA 2VMCA 4WVMA 3AJZA 3ZIXA 2UYAA 3W20A 5FY7A 1W6MA 3EMRA 1ENXA 1OXCA 1XYNA 3AZWA 4XFGA 3LEMA 5DXDA 4LO6B 4J25A 3NMBA 2GH8A 5IVJA 1GZ9A 3HVDA 2VD7A 2RMU1 3IN9A 5FPBA 3OY8A 3HN1A 3QH7A 1O91A 1PMHX 3CBNA 2V09A 2W3JA 2ET1A 2Y0IA 3M3QA 1FNYA 1HB2A 2D6LX 1FPN1 2ARBA 4HLTA 2IVJA 4JQRA 3ZFGA 2BYVE 3AMNA 4P5HA 1O59A 1WKYA 2AREA 3ZXDA 2YC2A 4HVOA 4CYDA 3BKZA 2JDPA 2PAEA 5FZOA 5I8SA 1YQ8A 2XQRA 1UOGA 3ZXJA 4OFGA 5A7QA 5FYBA 1LENA 1S0IA 3TEXA 2ZACA 3LOBA 4JKMA 4QQLA 2YBPA 2VCMA 4WM7C 4S2HA 1LOBA 3NAPA 4BCUA 4Y1YA 1EPZA 1IKQA 2YPDA 3HPNA 1SDWA 3VL8A 1COV2 2ZCWA 4XFCA 3THDA 5DMYA 1QNYA 3POSA 5CU1A 3ZXKA 5IFTA 1QJFA 1NE4A 3T09A 4M3CB 4FAHA 2HH9A 1OQ1A 2R063 2P3YA 1FPN2 2X8KA 2RM22 1QJY3 2Q8CA 3A23A 3WG3A 1CAUB 1VB2A 2YGMA 3THTA 4KNCA 4QXHA 5L7OB 1OHFA 2VMEA 2JDNA 3WVJA 5JIUA 2QTWB 1FNZA 4LJHA 5FPUA 4QMAA 5C8CB 4Q0QA 4AE2A 5FZ6A 1EY2A 2E53A 4HMZA 4YM2A 5FMOS 4UFHA 1XJAA 1GNHA 3POGA 5FPLA 1OPMA 1RUF2 4CP2A 1MACA 4QPIC 2HEYF 5CEHA 2A6WA 4IV1A 1NCQA 2XJUA 2HWE2 2CDPA 1GNZA 4LBLA 5J37A 1K3IA 2EF6A 1J59A 4RQPC 3UT0A 2WA4A 3USSA 5H9RA 1HXS3 1LGNA 4XBQA 1PMJX 3OSDA 4Y4RA 1SDDB 4GAZA 1LULA 5CKMA 3DXUA 4I02A 3K2OA 1VBC2 1W9FA 1LHOA 1JYCA 3KT4A 5TSWA 3TN92 3WF2A 4DRVA 2A6VA 4QQPA 4RL7A 3CJIC 2W1WA 2Z4FA 5DZEA 5A3MA 4Q0PA 2E51A 4XW3A 1WLTA 3BU7A 5CYYA 1ASJ1 3OUIA 2HEVF 5DUUA 3MO4A 3OGSA 2Q8DA 2JG8A 4AI0A 3AX4A 1ZBA3 5KHKA 1HKDA 1FX5A 1KDMA 2D5HA 3FJSA 3LSDA 4QKBA 4U36A 1ZREA 2ZEYA 3VKOA 1S0JA 4MV2A 4XABA 3FZ3A 2Q1FA 3U4SA 5HXMA 1KEXA 1RJ8A 3LOIA 3ZFEB 3ZKUA 5BNPA 1W0NA 2PMWB 2E6VA 1UAIA 3KMHA 1DQ2A 2R1DA 4OHVA 4DXSA 5IVBA 2CWSA 2Z79A 3EB7A 1B35A 2QQIA 3H1WA 3IKWA 4FFFA 4XUQA 1QJU2 5EJZB 1ZZ6A 3ORJA 5FZMA 3VZKA 5KBFA 2W68A 3VDDA 1K12A 2ZMNA 4I01A 3WW4A 3ZYGA 1RXGA 1X9PA 3M2MA 4C1WA 4JDNA 4AEDB 5A33B 4D7SA 2B46X 1ALYA 2DCKA 3V0AB 2BVBA 2JDKA 4LE4A 3V0BA 1G9BA 3POBA 3FFZA 2XKPA 5CFCC 2ZGUA 4HVRA 4UOJA 1RITA 1FMD1 1SLAA 2WNUA 3NV1A 3GALA 5FZGA 3HD8B 2JICA 1CAWB 1PGSA 1W2OA 1CVNA 3OB8A 2WS93 3BGAA 4UFMA 1N3OA 2VOXA 5IK8A 2JDYA 3ZVXA 3VBRA 2PHLA 2D3SA 4HSLA 4XTPA 3WQ0A 2Z5WA 1XNDA 4LKEA 5AC91 5LEJA 1RHI1 3CU7A 4JGYB 4QX0A 4IE7A 2HBTA 3SCHA 5L73A 4ATFA 3KD4A 1HW5A 2Y34A 1R1A3 1F31A 1KGYA 1YQ5A 2RDQA 3M8LA 4PBPA 4W8JA 1AX2A 1UN1A 4KU8A 5FZ4A 1LTEA 2CV6A 2YUEA 2FDIA 2K9ZA 4XF0A 1YFXA 2Y6GA 1AR72 1HB1A 5B4NA 5JOZA 1OSGA 4QGNA 5IHRA 1XPWA 4QKNA 5JSPA 4XAEA 3GCWA 4LLFA 1W06A 2IWGB 2VMIA 3VBFB 1TMF3 1JOPA 5EZWA 1PX3A 1DZQA 3SH4A 2LTNA 3SHRA 4Y26A 2HWB1 4B7EA 1FAYA 3PMEA 5FZ3A 3MF6A 2OQ6A 4KGGA 4Q4V1 1VB4A 1MQTB 1H8TC 2GP3A 1KS5A 2OKXA 2ZX1A 4LIUA 1RHI2 4YYOA 3JUUA 1SZBA 4Q0UA 1QNWA 3MF9A 5HCHA 3OTFA 5B2GB 5KXDA 1V6NA 2A3WA 3PIGA 4WM7A 5LY1A 1JMUB 1NCRA 5DN2A 1YIFA 1JU3A 2G9FA 4L99A 1D0GA 3TNPB 1ZRDA 4Q1RA 4UBGA 3RG0A 2VZUA 5D8AB 3THPA 3WNXA 2HEWF 1OI6A 1U5ZA 1YIPA 1W8ZA 2BGOA 2HWB2 3SXWA 4AL9A 4J1XA 2W91A 3LEIA 2IVIB 3WF0A 2PAKA 3VD5A 3T08A 4GMP1 3BVCA 1UKRA 3LDKA 1UY4A 2PLV1 1V6KA 2QQOA 4A7ZA 3PVNA 2RMU3 4UW5A 3AKSA 3ZLIA 3GZTB 3JCIA 4PDWA 5BXXA 3ZMOA 2P5BA 5IJRA 1V9U1 1N1SA 1X50A 4W50A 5FPVA 3J7HA 2LUWA 1DIWA 4Q29A 4MYEA 3WHUA 3FHAA 3ZXAC 3J26N 2XLAA 4CXXA 3MPBA 1YCIA 4CDQA 4LBMA 3HEIA 3PJYA 4LR4A 4CU7A 3ZYFA 2VUAA 4N90A 1AL23 2AH2A 4IGPA 1QWRA 3P1IA 2P34A 2XJPA 1ND2C 4FPHA 1ULFA 4IV3C 4ZHNA 5LATA 3WXPA 1HQLA 1RVF2 1W9TA 1PGW1 2PLV2 4MSVA 4CSWA 1W28A 5FKBA 2YYOA 3AP4A 3DKWA 4MO3M 4HKLA 1QDCA 1GYKA 1VRH1 1QOTA 3I8TA 4Q0SA 1L3JA 3N9MA 3WNKA 1RUD2 1J84A 1H9WA 1M4WA 3GBWA 3ACHA 4UF0A 5EWSA 4ARYA 1OVSA 2A6YA 2J1UA 2B5HA 2R071 5FOJB 3ZYBA 5JSRA 4BHPA 4JGZC 1QQP1 4GALA 5JI7A 3POEA 4AZZA 4XBLA 1SQ4A 4GB31 1W39A 1AUYA 4EN8B 3UYJA 4TZDA 5HCBA 3UNPA 2FMDA 3UL2A 5IVEA 5HV4A 4XFFA 1GICA 3ASIA 3U4XA 1CR7A 2FDKA 2IC1A 2PELA 2DCZA 2A75A 1PGW2 1LJ7A 1S2BA 1HRI1 3MIGA 3MIHA 4RGGA 4YG6A 1JUHA 4LK7A 3UGHA 2VY0A 4EN9B 2ADEA 2DWRA 2FQPA 2WO7A 2ZMLA 3BUCA 2CL2A 3U37A 3NV3A 3VHOA 4EWAA 4YW2A 4UFKA 2IFWA 5JZGC 2ZGLA 2VZ1A 2R072 2VBBA 4SBVA 5F5CA 5F3GA 2ENRA 2WC2A 2RR11 4K1ZA 1M06G 1QQP2 5LBEA 1R64A 1ZZ9A 4CUCA 4OUMA 4YGEA 4GB32 1CD3G 2PHWA 3LCPA 5A3OA 3VBOA 4YZ5A 1IS6A 3DEMA 4H3WA 4MHRA 1ASJ3 3BU0A 2YY1A 5EFUA 3QCWA 1XQNA 2HWC1 4P08A 3C7OA 1BVP1 2H6CA 3ILFA 4QDSA 3W9AA 3WCRA 4DO0A 3LSEA 4AGRA 1HRI2 4B1MA 3OG2A 4AFBA 3GYDA 4YW6A 4META 2Y8KA 1PO11 4K8RB 4LBJA 1N3QA 2V4VA 4QQOA 1GSLA 3IAPA 3SITA 3PUQA 1QIQA 1AR81 3BODA 4DINB 1YRZA 1LHNA 2C24A 2RR12 2MPFA 2P3IA 3E6DA 3HT2A 1DFQA 1W8WA 1GQHA 3PVBB 1DDLA 4AFCA 2C5DA 1YLLA 4P9YA 1UIJA 4WZCA 5DAPA 5LW9A 3AP7A 4Q4X2 4ZXEA 1BZWA 1FATA 3DPRA 1EV12 1KJRA 3RI9A 4RQPB 5CKQA 3E5UA 3VBHA 3RZKA 2BP6A 2RVAA 1D4VB 4YZ4A 1UMHA 2DU1A 2HWC2 2W46A 1S1AA 4CDWB 4AYUA 2PHRA 2CWMA 1K42A 3WP4A 1UY0A 5BNNC 3CJIB 2NPIA 3JD73 3D0JA 3ZXEA 4G9SB 4PT6A 4Y1UA 5KC6A 1PO12 5JR2A 5F5IA 3RZHA 1FMD3 4YFWA 3VDCA 4Z92B 3T0DA 1TE1B 2DUOA 2CY6A 3J4UH 4J1WA 1C5IA 2VMHA 2WZEA 3TAYA 5KXBA 1RUI3 1STMA 2BGCA 2UURA 2BUKA 4MGYE 2YC4A 5AC93 1WD4A 1VMHA 1GKBA 1XYPA 2GSYA 2VL4A 4ZS3A 1TME3 2PHUA 4PLMA 1UYXA 1DQ6A 4Q26A 1GWLA 2G4IA 1O8SA 1W03A 4LHSA 4JCKA 4SLIA 1LESA 3LPFA 4Q8KA 3UGGA 3I4IA 3IBMA 3ZDSA 4NUBA 4IETA 5FCCA 1JYWA 3W5NA 1ZM1A 3M70A 4PIZA 1DYOA 1UZWA 1C4RA 3WF3A 3K46A 3VKNA 3BPZA 2C6SA 1MEC1 5DUWA 4L9BA 3FN9A 4PJYA 5LBBA 5F37A 4RD7A 3I7DA 2LW8A 3M3IA 4AQ2A 1GV9A 3PU8A 2D6MA 2GC3A 4DY3A 4D8MA 4E2QA 4Q4V3 1PIV1 1NQDA 4HKOA 2B39A 1EUTA 2WO2A 4L11A 4LOSA 2JIJA 4V2VA 3VZLA 2CAVA 1CAXA 4RR3C 5KHGA 4DUWA 4R9CA 1TNRA 4I09A 1DGRN 5FLJA 5CFCB 1LEDA 1ND2A 3MIFA 3Q8AA 3RYRA 3J9SA 1C28A 4ORFA 3WUDA 5IAXA 3MUZ1 4E4DX 1IQAA 1W2AX 3KQ4B 5A6ZA 5C7GA 4KL1A 4XHBA 1IPSA 1D4M3 2XLFA 1WBLA 1OUSA 4Y22B 4WM8A 1Z78A 1Y9MA 3JU9A 2D6PA 4C8DA 2FCTA 1EPWA 3I2GA 4R9AA 1V6OA 3LA2A 4LOTA 1KFXL 2DFBA 4NIHA 1RUNA 4QXCA 1PIV2 1RUE3 5APAA 3ZDVA 1VBD3 3ZSMA 1OOPB 2PLV3 5LK7B 4Q5OA 3ACLA 2YV8A 4UW6A 1VPHA 2D6OX 1KITA 2YB7A 4HPKB 5A32A 3PUIA 2ZEWA 3WW3A 3K51A 1SG3A 3POWA 5BNOA 3SLIA 1BBT1 4ASLA 1E57A 1ENRA 3OBTA 1V9U3 2WT2A 2D98A 4CRQA 5A7NA 1LGBA 3OPZA 4TYSA 1H8TB 1LU1A 4OUEA 1UQXA 1W3XA 1OFSA 3Q8BA 4QX2A 5FK7A 2V5YA 4IE0A 4HVQA 1ND3C 4XJ8A 3KVBA 4I3PA 4NWVA 4TWTA 3KHCA 5EJ3A 1W04A 4Y5Z0 3WSOA 1QKQA 3JB8A 2VNVA 5AFBA 2FDHA 5SV8A 5FZ7A 4IEOA 4N7IA 1MVQA 2P2KA 2VBDA 4FBFA 5K8SA 5JOYA 1DZRA 3ILNA 1VRH3 3J7LA 4HZFA 4AQSA 2XH6A 1WA6X 5C4WA 1BBT2 5DZFA 3RZMA 1VMFA 2W95A 3A21A 3IDEA 4BH9A 2DVAA 4QPGA 2OS2A 4PBOA 3VKMA 2GNMA 1W8UA 1PVC1 4G3YC 1DHKB 2ZJCA 4CEWA 1QQP3 4XXAA 1CPMA 1A3KA 4GB33 2NN8A 1EUUA 3I49A 2DUPA 5FJHA 4GH4A 4XAAA 3NRUA 4Q0VA 4Z2WA 1YQCA 3AKRA 4GMP0 5LBFA 2A6XA 3AMQA 5A7WA 3T2TA 4ISRA 5J96B 2RG4A 2ZGTA 1I9RA 3SCGA 3NKTA 3T4HB 4O65A 1AYN3 1HRV1 3ES1A 2EXIA 2OVUA 2Q30A 4P9XA 2A6ZA 4Y1ZA 2ZKNA 5E1RA 5JCTA 3H42B 4CP9B 1OFNA 4FSJA 1AYM2 3R4SA 1NLSA 2ZHMA 1ZRRA 4IV3B 1PVC2 3MBWA 3ZFEC 2X5IC 3NNJA 5JWPA 5DG1A 1YFWA 3N3HA 4RHV2 1W6PA 3B3QE 3FFQA 5KHHA 1ZYBA 4NPMA 4WZFA 3OUHA 3EQEA 3SQOA 4N8MA 2QQPA 1RUJ1 1HX6A 3P3NA 2W87A 4K40A 1JZ5A 2D6KA 4CDXA 4B4RA 2TUNA 5CG9A 4JGZB 5A6XA 1JS9A 4AVCA 1UU6A 4A7YA 4AEDC 4X8NA 5JXJA 1G6NA 1H1MA 1QXRA 3I2KA 2ZEXA 1H2MA 4BOWA 5JOWA 2XB6C 1KFUL 3T30A 2Q1ZB 2MHFA 3B7MA 4HONA 5KXCA 4MXWA 1DYPA 1AR83 2OX0A 3AP5A 2EIDA 1VALA 4CCDA 1C1FA 1LOGA 5FZ0A 4NHMA 4H14A 3Q8EA 1NY71 1MZ5A 4JGYC 2WZPP 1IPKA 3W58A 5FY5A 4KGQA 4O61A 2VUCA 1HJGA 5ACA1 5FLHA 5JZGB 2VZVA 3H9AA 2HWD1 2ZOEB 3LA3A 3IMMA 3VDBA 2JXAA 3GF6A 1S0DA 2XLGA 4N53B 2ZXQA 4XJAA 5GLVA 4ONUA 4CCNA 2VECA 4HG6B 2A71A 2ZHLA 3MLLA 1IS3A 4M3CF 5FYTA 2G19A 1O7FA 1PHMA 1XXNA 4QPWA 3H8OA 4YM0A 2EICA 2R0FA 1C8NA 2XKOA 1I6XA 3OPTA 4CEYC 2O8OA 4PI0A 3WDYA 2JD4A 5C9AC 3H7JA 2BBAA 3MW2A 3WP6A 3U10A 2IXCA 2JDZA 3H8UA 2ZX4A 5CIRA 1W8TA 5DAQA 3C7FA 3L2YA 1WA4A 5FXVA 5AVAA 1FOD3 3PUHA 2VVDA 4BYYA 3RJRA 1JODA 1NY72 5ACA2 4MGTA 3IB3A 1UOBA 3SC7X 1UCXA 2R30A 3J8F1 1EYBA 4MUVA 4Z82A 3FBYA 3WEZA 1PMIA 2ZX2A 3SCFA 3KV6A 3HAGA 4INDA 3BCWA 3HIFA 4H7MA 4XOGA 2KA3A 1XNTA 3BOWA 5FZ1A 1MEC3 2AGSA 1OLRA 1YFYA 4M3CA 2F4PA 3KQRA 2EIBA 3FHQA 2XBO1 2KM2A 1YUDA 4KWUA 4B4PA 4DB5A 3DCQA 3N35A 5D2AA 5FMCA 2GMPA 2C26A 2ZAAA 3KV4A 4KI5M 1IG3A 1CAUA 3K4DA 1GZTA 3KF5A 1X7NA 2ZHKA 5H9QA 1GWMA 3CJXA 3T2QA 5FR3A 1UYYA 1NQJA 5L7OA 1I5PA 2W94A 4XFBA 1QXJA 1C3HA 1UZYA 3VHRA 5BNNB 3FE5A 2JD9A 2PAMA 4QHZA 5I0DA 5EXOA 1XSRA 2J1EA 2D3PA 5C8CA 3BI3A 4RYDA 4AGGA 2V72A 4AEMA 1BJQA 3A4UA 1OD3A 2YFZA 4R8HA 1LOCA 4IEWA 2D3RA 1NA1C 1P8JA 4Y3OA 2ETEA 3U14A 1AHSA 4LT5A 2EAAA 3I2DA 4XUPA 5FYSA 2X05A 2E26A 2ZGRA 3DV8A 4GJYA 1WMFA 1XE7A 2A70A 3LB9A 1ZRIA 4KU7A 4Q27A 3THCA 3A0KA 4AVTA 1K5MC 4OUSA 4E4HA 3O14A 1DGLA 4LK6A 4FPCA 4LKDA 1QGLA 2BQPA
chains in the Genus database with same CATH topology
3OUHA 4MHUA 2JIJA 4NAOA 5HV4A 2RDNA 4IW3A 4BQWA 4BQXA 5ERLA 5IAXA 2HBTA 2Y34A 4ZONA 2FCUA 2RDQA 4XCAA 3HQUA 2G1MA 4NHYA 3HQRA 3NNLA 2FCTA 4XC9A 4NHMA 5LBEA 4NHLA 2V4AA 5EQUA 4Q5OA 5LB6A 4MHRA 4NMIA 5DAXA 5LBCA 3DKQA 5EPAA 5IAVA 5M0TA 2G19A 5L9BA 4JZRA 5LASA 3W21A 3GJBA 2FCVA 3NNMA 2JIGA 3GJAA 2RDSA 5LA9A 3NNFA 5DAQA 2OPWA 4NHKA 5DAWA 3KT7A 4BQYA 3KT4A 5DAPA 2RDRA 3BVCA 4ZPIA 5C5TA 3OUIA 3ITQA 2A1XA 3OBZA 4UWDA 4Y5TA 5C5UA 4XABA 4NHXA 5IATA 5HV0A 2Y33A 4XAAA 5LBFA 3GZEA 3PL0A 2RG4A 5LATA 4Y5SA 3W20A 3EMRA 2HBUA 5L9RA 4J25A 4KBZA 4XCBA 5EP9A 3NNJA 5LBBA 5A3UA 3MGUA 3KT1A 5L9VA 5DAVA 4XACA 3OUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OUH A;  4MHU A;  2JIJ A;  4NAO A;  5HV4 A;  2RDN A;  4IW3 A;  4BQW A;  4BQX A;  5ERL A;  5IAX A;  2HBT A;  2Y34 A;  4ZON A;  2FCU A;  2RDQ A;  4XCA A;  3HQU A;  2G1M A;  4NHY A;  3HQR A;  3NNL A;  2FCT A;  4XC9 A;  4NHM A;  5LBE A;  4NHL A;  2V4A A;  5EQU A;  4Q5O A;  5LB6 A;  4MHR A;  4NMI A;  5DAX A;  5LBC A;  3DKQ A;  5EPA A;  5IAV A;  5M0T A;  2G19 A;  5L9B A;  4JZR A;  5LAS A;  3W21 A;  3GJB A;  2FCV A;  3NNM A;  2JIG A;  3GJA A;  2RDS A;  5LA9 A;  3NNF A;  5DAQ A;  2OPW A;  4NHK A;  5DAW A;  3KT7 A;  4BQY A;  3KT4 A;  5DAP A;  2RDR A;  3BVC A;  4ZPI A;  5C5T A;  3OUI A;  3ITQ A;  2A1X A;  3OBZ A;  4UWD A;  4Y5T A;  5C5U A;  4XAB A;  4NHX A;  5IAT A;  5HV0 A;  2Y33 A;  4XAA A;  5LBF A;  3GZE A;  3PL0 A;  2RG4 A;  5LAT A;  4Y5S A;  3W20 A;  3EMR A;  2HBU A;  5L9R A;  4J25 A;  4KBZ A;  4XCB A;  5EP9 A;  3NNJ A;  5LBB A;  5A3U A;  3MGU A;  3KT1 A;  5L9V A;  5DAV A;  4XAC A;  3OUJ A; 
#chains in the Genus database with same CATH topology
 1URX A;  2BV4 A;  2BU9 A;  3LF7 A;  1WLW A;  2W5F A;  2VR4 A;  1BBT 3;  1O4Y A;  2RDN A;  4YG0 A;  2RS5 3;  2QQW A;  5HCA A;  1E5S A;  5IVC A;  2VUD A;  1JU4 A;  4OQ8 A;  3AK0 A;  5F3C A;  3EJK A;  2TNF A;  3JXS A;  1YO8 A;  1G9A A;  2EAL A;  4RR3 B;  2W1S A;  1F5J A;  2YU1 A;  3OBA A;  1JH5 A;  1COV 1;  2GZW A;  4BQ2 A;  2DVD A;  2E63 A;  2Y6H A;  4CCM A;  4UXA A;  1J3R A;  1S2K A;  4M4P A;  3ZFE A;  3VBU C;  3MLJ A;  2RM2 1;  3ZSJ A;  4F83 A;  4GA9 A;  1W6O B;  4DUX A;  3AFK A;  1I5Z A;  4IE4 A;  2Q8E A;  1NLR A;  2CDO A;  1OUR A;  3SH5 A;  3O1S A;  5C3Q A;  1TG7 A;  3WNP A;  5GZG A;  5JPM B;  1ZBE 2;  3POY A;  3I3D A;  1W9Y A;  1JI6 A;  5DAX A;  5E16 A;  5FQ0 A;  4OI4 A;  4XF3 A;  3URF A;  5A33 A;  4AED A;  4K21 A;  4FPK A;  3V0A A;  3WW1 A;  2WBK A;  4QHB A;  1RUF 1;  5LAS A;  2BFU S;  2JG9 B;  2OXB A;  4QB2 A;  4S2F A;  4KH9 A;  3P6B A;  4LEJ A;  2RHP A;  2HWE 1;  3B01 A;  1LCL A;  2Q0A A;  1V0A A;  3M7A A;  1CAW A;  2B8M A;  4ES8 A;  4NHK A;  5FYV A;  4DS0 A;  5CA6 A;  1VAK A;  4WVZ A;  3ZPY A;  1QOO A;  4XDQ A;  1ULE A;  3RWN A;  4DQA A;  3MW4 A;  2NP0 A;  1HRV 3;  3RS6 A;  1VBC 1;  3MDP A;  3TN9 1;  4WV8 A;  1ND3 B;  1W0P A;  5KWR A;  1K45 A;  5BUV A;  1H4G A;  2HLE A;  4MXV A;  1J3Q A;  4AFA A;  1NLQ A;  3LIG A;  4K6B A;  4ZPI A;  5EYX A;  4BQ3 A;  4YGB A;  5I8Y A;  4PQQ A;  5FY0 A;  2Y6L A;  3AYD A;  3BN6 A;  3ZFF C;  1RUO A;  2QCS B;  3TEZ A;  4IUG A;  4IEX A;  4DMI A;  1UZV A;  2ZGN A;  1Z0H A;  2WLP A;  4LO5 B;  4A6O A;  5K0U B;  2ID4 A;  3VBF A;  4YZ1 A;  3RPQ A;  1UYZ A;  2MEV 1;  3MIB A;  3ZM8 A;  3IT8 A;  3OEA A;  2AYH A;  2H0V A;  5FMO L;  2XJQ A;  2Q5T A;  3WG4 A;  4BIF A;  2ZX0 A;  1OKQ A;  2OZJ A;  2VH9 A;  2Q8O A;  3UES A;  1RUJ 3;  3K77 A;  1I3H A;  3CMG A;  2VE1 A;  4GKX A;  4O9E A;  4XJW A;  1MQT A;  4QAW A;  2VOT A;  2VW0 A;  3AYC A;  5EJ1 B;  5FWJ A;  4CDW C;  3IZO A;  4URT A;  1NXD 1;  4COZ A;  1DP0 A;  4K7J A;  3GXU A;  4YW7 A;  5GM0 A;  4DIQ A;  1CJP A;  5E8A A;  3B69 A;  1RYY A;  4JVA A;  1W6N B;  2E7T A;  5ABJ B;  1FV2 A;  2RS3 3;  3TOJ A;  2G9Z A;  1QMJ A;  1O5L A;  3U78 A;  3ZYH A;  1GUI A;  5JXG A;  1QJU 1;  2E31 A;  3RWK X;  4UI9 L;  5IFP A;  1V00 A;  3INA A;  4QM9 A;  5FFO C;  4CE8 A;  2WYS A;  5D8A A;  4BPZ A;  4RS5 B;  5BV6 A;  1HV1 A;  2JDU A;  2MEV 2;  1H1I A;  3HOB A;  3I3B A;  3WZ1 A;  1GWK A;  2DCT A;  2ZGK A;  4MGI E;  3ALQ A;  4E8D A;  2JB4 A;  2UU8 A;  5FXX A;  2D6N A;  1GAN A;  4ZU7 A;  2HWD 3;  5FZI A;  5DDJ 2;  2X5I B;  2ZGP A;  2O14 A;  2GC2 A;  3O1M A;  1BEV 1;  3O12 A;  3VHN A;  3OJB A;  3ZX7 A;  2BNO A;  4XJU A;  3H1M A;  3POF A;  4AOC A;  2VQA A;  3WCS A;  2W08 A;  4D0Q A;  3AMM A;  2IXL A;  2FCU A;  4CXW A;  5C6C A;  2XJT A;  2WNV B;  1OH4 A;  2VM9 A;  3HNY M;  3ETQ A;  1U5Y A;  4HBN A;  1AR7 1;  3MYX A;  5K7P A;  1YJK A;  4ATE A;  4NHY A;  4BE3 A;  4FFH A;  1A8M A;  4PQ9 A;  3OY8 B;  1RUC 1;  4EYU A;  1S2E A;  2YFU A;  2OPK A;  3P5B A;  3WG1 A;  1UZ0 A;  4TSV A;  4EN6 B;  4BJ0 A;  3WV6 A;  2PHD A;  2FDJ A;  2WDB A;  3J8F 3;  1EAH 3;  1BLZ A;  1YC6 1;  5EQU A;  2XUE A;  2BNM A;  4E2S A;  1BEV 2;  4BQ1 A;  4EWE A;  2XVL A;  2AEZ A;  2YG0 A;  3SIS A;  2XBO 3;  1BMV 2;  1KJL A;  5FY4 A;  1CZS A;  2JEN A;  2SLI A;  5FYY A;  4B3N A;  1WW4 A;  4KBB A;  3RZZ A;  3QBQ A;  5F5A A;  4XPV A;  1Q8P A;  4LOR A;  3I3M A;  3NNM A;  4ZZ8 A;  2N7G A;  5GZE A;  4OHY A;  1VBB 1;  1W3V A;  2A7A A;  1OOP C;  3RZL A;  4XQ4 A;  1V6I A;  5EYY A;  4XF1 A;  1RUC 2;  3TEW A;  1VBE 2;  1JYN A;  4AI2 A;  4D6R A;  3R0R A;  1US3 A;  1XE8 A;  2VXR A;  1UIK A;  1QJZ A;  4AVV A;  3WNM A;  4CEY B;  1LOF C;  1D2Q A;  5C9A B;  4AVS A;  1GP6 A;  2WNE A;  3V64 A;  3DGT A;  2R6Q A;  2WAB A;  4A41 A;  4OHX A;  1ENS A;  3N7M A;  3USU B;  4COY A;  1IOA A;  1RUG 2;  2QQL A;  4L0P A;  2C9A A;  5F3E A;  3V56 A;  3WUC A;  1RUH 1;  2C4X A;  4BWO A;  5BYN A;  1VR3 A;  1QH7 A;  2MNG A;  1IGO A;  1OQD A;  2WRA A;  4P9W A;  1YHF A;  1ENQ A;  4LTA A;  1J83 A;  3ACG A;  2BWC A;  4MGZ E;  4W6W A;  5GLZ A;  1BCX A;  4AHX A;  4UWD A;  3KF3 A;  1VBB 2;  2RJ2 A;  4Q2F A;  4H55 A;  2P3K A;  5G05 L;  3ZYI B;  5IAT A;  1W0O A;  1SHW B;  2BW8 A;  3PVE A;  1O4Z A;  1QY4 A;  2ZGO A;  1LB2 A;  4AR2 A;  5KC5 A;  4I0A A;  2XWB B;  3E5X A;  4E8C A;  1C1L A;  2ZBJ A;  5F2W A;  3ZYP A;  2D7F A;  2W9X A;  2QFE A;  1RVF 1;  5FPX A;  3JBG 1;  5JUV A;  4JX0 A;  2VZQ A;  1COV 3;  2P6H A;  2VOK A;  1RUH 2;  1H2K A;  3RNS A;  2VG9 A;  4MLO A;  2E7Q A;  3AXE A;  1R1Z A;  2VCC A;  1RUD 1;  1FPN 3;  1GOG A;  2RM2 3;  5EP9 A;  2FBE A;  5FPZ A;  1W8H A;  1UW8 A;  1NA1 B;  2ZPX A;  3D0S A;  2JG8 B;  1T2X A;  2VZO A;  4QPI A;  4RSU A;  4AI9 A;  1VAV A;  1C8M 2;  5ISL A;  4AGV A;  3IWZ A;  1QEX A;  1OA2 A;  1AR9 2;  3PVO A;  4IXL A;  3CL1 A;  1DLC A;  4M0H A;  1O4T A;  1XNB A;  4QXK A;  3I59 B;  4RQP A;  5J7M A;  1RMU 2;  3DL3 A;  4ZS2 A;  1K5M B;  4AAP A;  3PUA A;  1LU2 A;  4CDW A;  3BTX A;  4QHO A;  3IM0 A;  5IK7 A;  3RQ0 A;  4AG4 A;  5BNP B;  4NR1 A;  3POJ A;  2VCA A;  1REF A;  1QHD A;  5FO8 B;  4ZXK A;  1RUF 3;  3JBG 2;  3KGZ A;  3CJI A;  2CNA A;  5FY9 A;  4Q4W 2;  4NRP A;  1TNF A;  2ZGQ A;  2HWE 3;  4CDU C;  5FP9 A;  2WWS A;  5CZK A;  4ES9 A;  4NVP A;  1L7L A;  2VOW A;  2WWU A;  4QGM A;  4Y33 A;  3RZJ A;  2FZ2 A;  1XC6 A;  3O1U A;  4A7K A;  4EN0 A;  5JMC A;  1CPN A;  4FFG A;  4IEV A;  1NXM A;  4GIQ A;  4HN0 A;  2JKB A;  3VD3 A;  1PK6 C;  1IKP A;  1VBC 3;  1QDO A;  2XL9 A;  3M4F A;  3ON7 A;  4LIV A;  4XJZ A;  1ST8 A;  3ES4 A;  4NII A;  3TN9 3;  3UV9 A;  1Z7S 2;  2AAC A;  4IGO A;  4OCT A;  3VD4 A;  5FIX A;  3AJY A;  5SV5 A;  1GOH A;  3WDV A;  3VBU B;  5A70 A;  2FHR A;  3H8R A;  5JXI A;  2Y64 A;  2XPJ A;  1O3T A;  5LBC A;  2BRT A;  3ZN5 A;  4LNV A;  2EIG A;  1UZZ A;  2PFW A;  3HBZ A;  4AFM A;  4OZO A;  5L36 A;  1XB9 A;  4BZ4 A;  4KG8 A;  2XJV A;  2ZA9 A;  4R4X A;  5LA9 A;  4N43 C;  2IXJ A;  2WZR 2;  4XJ9 A;  4UYB A;  1WGP A;  2QZ2 A;  3OGR A;  4I0W B;  1UX7 A;  4AHZ A;  4N53 C;  5CFC A;  1H30 A;  5FKC A;  1OA4 A;  2X10 A;  1MVE A;  1UXZ A;  3BAL A;  3ECQ A;  1DQ5 A;  3IIA A;  4Q4X 1;  3QAC A;  3ATG A;  4FPL A;  1EV1 1;  1QJU 3;  4N9H A;  4ZY9 A;  4P9L A;  4Y22 A;  3C7H A;  1SCS A;  5CB7 A;  2AEY A;  2D40 A;  2WL1 A;  3H3Z A;  2HYX A;  4P02 B;  4AQ6 A;  1IS4 A;  4OQ9 A;  5A1A A;  1UKG A;  3NKG A;  3NW4 A;  4M3C E;  5T50 A;  4E27 A;  2D43 A;  3OBZ A;  5DUV A;  2BPA 2;  4EV0 A;  1PNG A;  4PIY A;  3ZFF B;  4C90 A;  4HKW A;  3CNA A;  1HB3 A;  2D5F A;  5D21 A;  4XZU G;  4Y24 A;  2VTX A;  3CZU A;  3T2O A;  1LHV A;  5GJ6 A;  2I74 A;  1G86 A;  2Y6J A;  3GZE A;  1LRH A;  3KLS A;  4W65 A;  1LOF A;  2PQQ A;  2VPV A;  3KB5 A;  2O1Q A;  4EE2 A;  2DU0 A;  5J36 A;  4BM8 A;  5HI0 A;  1H8T A;  3AFG A;  1L7R A;  1RC6 A;  3B02 A;  1AR7 3;  2B45 X;  4JKK A;  2E32 A;  5F7U A;  1SLI A;  5CNA A;  3BTA A;  1MS8 A;  5A80 A;  1BHG A;  2QQJ A;  2R04 1;  3O0V A;  3FUQ A;  1JBC A;  3PTY A;  2VZS A;  1A8D A;  4BU2 A;  4DEV A;  4BXF A;  3MGU A;  1DQ0 A;  1TEI A;  2HJI A;  2W2I A;  3BIW E;  4IES A;  4UT5 A;  3D8C A;  4XAC A;  4OUL A;  1AR6 2;  5IYY A;  1F15 A;  3P3P A;  3ST7 A;  2JE8 A;  1RHI 3;  3Q8C A;  2ARA A;  1W8N A;  4BQW A;  4F8A A;  4QU2 A;  1MS3 A;  4XMA A;  4Y1X A;  1R08 2;  2QQV A;  1UL9 A;  5DQ0 A;  3BOP A;  4A42 A;  1I1E A;  3NQH A;  3WP3 A;  2GNT A;  1VBB 3;  2Y38 A;  3CLP A;  3UK9 A;  1V70 A;  2R04 2;  4FP3 A;  4LO4 B;  5F9T A;  5JDB A;  4D7T A;  2XJS A;  1LGC A;  2HWB 3;  3LPG A;  4YWA A;  2XJR A;  4Z8B A;  4WBB A;  2J22 A;  3UKT A;  4CPB A;  3PU3 A;  4NHL A;  1J1T A;  3ZOI A;  1OA3 A;  2E9Q A;  3RRD A;  2CHH A;  2XHN A;  4BXS V;  4LKF A;  4JHZ A;  1NKG A;  3RVH A;  1F4A A;  4BQ4 A;  3ZYR A;  4CP9 A;  2ORX A;  3KCY A;  4NMI A;  1LKN A;  4IV3 A;  4QU1 A;  4QX3 A;  2L9L A;  4P9J A;  4AW7 A;  2P1B A;  4NRM A;  2RJL A;  3HQX A;  3IDA A;  4RN5 A;  3UJQ A;  1UD1 A;  3ME2 A;  4JAA A;  2TEP A;  4R4Z A;  4AHY A;  5JMO A;  1AL0 G;  2VGD A;  3HBK A;  1RB8 G;  1NZC A;  4ASK A;  4Q8L A;  3C8X A;  1TZO A;  1UPI A;  1BXH A;  3NNF A;  4MZU A;  3IPV B;  3OYW B;  1Y43 B;  2RS1 2;  1WCU A;  2QDR A;  2KD7 A;  4Z07 A;  4AVA A;  2R1B A;  3VZN A;  3S5A A;  2ORZ A;  4JGZ A;  4GMP 3;  1RVF 3;  4J6G A;  3I3Q A;  4CUA A;  2YRO A;  1JYT A;  1RIN A;  3SEE A;  1Y4W A;  1AVB A;  2LS6 A;  4U2A A;  4EN7 B;  2JG9 C;  4FPE A;  5GLU A;  3ZKY A;  4OHW A;  4I30 A;  5A3T A;  3RJ2 X;  5FZH A;  1RUD 3;  1IPJ A;  2ZAB A;  4ERO A;  2VTX J;  3ITQ A;  1KS4 A;  3H3U A;  1ULC A;  2XWJ B;  4ZU4 A;  3OD0 A;  1N47 A;  2X53 S;  3C7E A;  4D7Y A;  1YNA A;  2HWF 1;  3S6P A;  3D82 A;  3MFC A;  4W6Y A;  2WSU A;  3LIH A;  1DLL A;  1SCR A;  2FDF A;  4XDP A;  5LCW L;  2GH2 A;  3TYJ A;  2YPJ A;  3RI8 A;  1AJO A;  2WA3 A;  3K75 B;  3VN4 A;  5JZG A;  5HV0 A;  1MZF A;  1JZ6 A;  4FPO B;  5FUI A;  5KXE A;  1OMI A;  3I2I A;  4OVE A;  4DXT A;  1HQW A;  3ABZ A;  4LBN A;  4N53 A;  4YVW C;  2QNK A;  1OUX A;  3HWJ A;  5K0U C;  3RZG A;  3WF4 A;  1TVG A;  2WN3 A;  1R09 1;  2Z42 A;  1AZD A;  3RSJ A;  5L9R A;  3LAG A;  3KV5 A;  5CG8 A;  1T6G C;  3FLT A;  1AYM 1;  2AZ5 A;  2DVG A;  3EYP A;  3BB6 A;  3KS7 A;  4CUG A;  1OVP A;  2VW1 A;  1VBA 2;  2IUW A;  1MZE A;  2R07 3;  3LKJ A;  2HWF 2;  3ILR A;  2W92 A;  1HV0 A;  4EQV A;  4X6Q B;  2QVS B;  5LK5 A;  3O0W A;  4NID A;  2WQZ C;  2VQU A;  1ULP A;  4RHV 1;  4XIL A;  1Y9G A;  1O3Q A;  3WLU A;  5ABJ C;  4NIG A;  3PNA A;  1W6Q A;  4UFI A;  3JQX A;  3QH6 A;  4FOV A;  4HFS A;  1CAV A;  2NYY A;  1JN2 P;  1GP4 A;  4ISQ A;  4UFJ A;  4LHN A;  5AFE A;  1OPO A;  4D94 A;  1LNS A;  4IEU A;  4FQ4 A;  1F35 A;  2DTY A;  3OBR A;  1HRI 3;  1UMI A;  4XF9 A;  1JZ8 A;  2PHT A;  5IK5 A;  3W59 A;  4DXZ A;  1Q43 A;  1R09 2;  2C0Z A;  1LR5 A;  2WZ8 A;  4RS5 C;  1U5X A;  3GGL A;  5IVY A;  4TTG A;  3III A;  3U1X A;  4CVU A;  3H7Y A;  2F4L A;  3RGB A;  5J3U A;  1DQ4 A;  4BA6 A;  3LZZ A;  2NM1 A;  3FX3 A;  4C91 A;  4PF5 A;  4FPY A;  3NNL A;  2RR1 3;  4CCJ A;  5BNN A;  1PM7 A;  3E1F 1;  1U5I A;  1SBF A;  4CDU B;  1HN0 A;  1YQ6 A;  2R06 1;  3MV1 1;  3OPW A;  1ZX5 A;  4Q4X 3;  2WIN B;  2BWA A;  5ANQ A;  4XXP A;  1QJY 1;  1EV1 3;  1X9T A;  4P9I A;  3WT3 A;  1LAJ A;  3HNB M;  1SFN A;  3LEG A;  3E6C C;  2HWC 3;  3MHZ A;  4JTO A;  2WNV C;  5FXZ A;  5LA0 A;  1PK6 B;  3WX5 A;  4KG0 A;  3BTZ A;  1DG6 A;  1WUV A;  2ZGS A;  2DVB A;  3GNE A;  3B9I A;  3JB4 C;  4YAR A;  1V6L A;  5JAX A;  5LEK A;  2JDA A;  3LE0 A;  4FQZ A;  5EPA A;  1VAM A;  1WW6 A;  1PZ7 A;  1AXY A;  1PO1 3;  4HK9 A;  4QX1 A;  1AXK A;  5FP3 A;  3GJB A;  5LRS A;  3ZFG C;  1J3P A;  3VBS B;  5CIS A;  3CO2 A;  3MV0 1;  2JIG A;  1DGW X;  5FZD A;  2OYZ A;  1A6C A;  4RFT 0;  4K3U A;  1F5F A;  2K46 A;  1DGW A;  1TQ5 A;  4S2G A;  5CVR A;  3WDT A;  3FMG A;  5FV3 A;  4YVS B;  2QQM A;  2YBK A;  4R9D A;  2R06 2;  4XQW A;  4KMQ A;  3DYP A;  5CKN A;  2GP5 A;  2R49 A;  3D6E A;  1HXS 1;  1QJY 2;  2VNG A;  4QX8 A;  4LBQ D;  5FO9 B;  1YXW A;  4N43 B;  3KCC A;  1N3P A;  2A3X A;  3SH3 A;  3NAP C;  1ODN A;  4AWD A;  2VOV A;  4RR3 A;  1X36 A;  3ZIW A;  5C5T A;  2CGO A;  4RGK A;  2WNO A;  3N7L A;  4K20 A;  4DOU A;  5A1F A;  1US2 A;  2YHJ A;  3CZJ A;  3BIE A;  4NPL A;  2DTW A;  2W39 A;  4GZ9 A;  1J58 A;  4XUO A;  5FOB B;  5J09 A;  1W6O A;  4LBQ B;  3APB A;  2X29 A;  2LRP A;  1ZBA 1;  2BZD A;  1ZZ7 A;  5F39 A;  2QQK A;  2UWC A;  3PMS A;  2WFP A;  2CYF A;  2PQS A;  1O3R A;  4HN1 A;  3EO6 A;  3HR9 A;  4L97 A;  4DEQ A;  3MFA A;  1GZW B;  3H3L A;  4QWN A;  2DCY A;  5FZF A;  4PLN A;  5A7S A;  1HXS 2;  1WMX A;  1WCD J;  4AFD A;  1OT5 A;  1CN1 A;  1OBN A;  1VMJ A;  3VHP A;  1EP0 A;  3N9N A;  1C5H A;  3NWK A;  2HBU A;  1JHJ A;  3O1P A;  4AHW A;  2Y26 A;  5FXW A;  4IV1 C;  1WWY A;  1JYI A;  3KHB A;  2XON A;  4CCE A;  5C4W B;  3C2U A;  4XHX A;  2GAL A;  5EIY B;  3N4M A;  1APN A;  4I2O A;  3FUO A;  4QDR A;  5GZD A;  1W9S A;  2DYC A;  2PA7 A;  3OGG A;  4YM1 A;  3O1V A;  1PIV 3;  1ZBA 2;  2C9K A;  1BKZ A;  2WN2 A;  4FI9 A;  1ND3 A;  2D44 A;  4YM3 A;  4MHU A;  1SLL A;  1F8V A;  2VVE A;  3MID A;  4YW3 A;  3WQ7 A;  4GH4 B;  5FUN A;  5HPO A;  4YW4 A;  1U0A A;  5FUP A;  4C1X A;  1ULD A;  4MAD A;  2JJ6 A;  3KCX A;  5FK8 A;  5FP7 A;  1Y9Q A;  2WT1 A;  1AF9 A;  2JG8 C;  1S4C A;  4O7X A;  1C57 A;  3PIJ A;  5FBJ A;  1G9D A;  4LO8 A;  1H4H A;  1CWP A;  3HQU A;  2NZ9 A;  1WW7 A;  1UU5 A;  4GKY A;  1AJK A;  3RYP A;  4H7L A;  2DUR A;  4GWJ A;  1D2S A;  2OII A;  2R0H A;  1PNF A;  2DBN A;  3N7K A;  5BNP C;  5LY2 A;  1T6B X;  1W2T A;  1W6N A;  2V4A A;  5ABJ A;  1D0H A;  3KZ4 C;  4JRL A;  2B42 B;  2FZ1 A;  1XU2 A;  2YMZ A;  4JQT A;  5C8W A;  1B35 C;  3I2O A;  4OLL A;  1H0B A;  1V6J A;  2ZMK A;  1ZBE 1;  2WS9 2;  3AL6 A;  3RDI A;  3VDD C;  4CDX B;  5CFD B;  4FPF A;  3RMY A;  5C3O A;  1CX1 A;  2HKX A;  4ASM B;  5M0T A;  2XR4 A;  3AM2 A;  3NJV A;  3MIE A;  4BMB A;  3SKV A;  1R1A 2;  3WDW A;  1LOE A;  4Y20 B;  2P6C A;  2RDS A;  4FOY A;  4PF1 A;  4M00 A;  1JHN A;  2WNU C;  5FP8 A;  5BPX A;  1MR5 A;  5E88 A;  2VZ3 A;  2GAU A;  1O5U A;  2X5I A;  3WR0 A;  4D69 A;  5LWB A;  3O1O A;  4QB1 A;  3KT7 A;  4HSJ A;  5FRA A;  5FRE A;  5GLW A;  4LA2 A;  1BYH A;  4BQY A;  3ACF A;  3VBR C;  4IEY A;  3VDA A;  3ZN6 B;  1TMF 2;  5E6H A;  3R4D B;  1GMM A;  1ZNP A;  1U12 A;  1AX1 A;  3B94 A;  2LRO A;  1AYM 3;  1H6X A;  4M4R A;  5F8P A;  1PM4 A;  2WNV A;  1VRB A;  4C0B A;  2XG3 A;  1NAE A;  3FHI B;  1PVC 3;  4Q1P A;  1L7Q A;  2VZP A;  2OT7 A;  2A1X A;  4OHZ A;  2UYB A;  1BQP A;  4AI8 A;  4BIS A;  1RJ7 A;  4YSF A;  3S5Q A;  4NE9 A;  3WG2 A;  1S55 A;  4RHV 3;  2QE3 A;  4XTM A;  2QQU A;  3V65 A;  2YXS A;  2JEM A;  1K5J A;  5JPN B;  4MG2 A;  4TLF A;  2BFU L;  3AKP A;  5CAD A;  3UKN A;  4XUT A;  3JQW A;  1D7P M;  3LFI A;  5FZL A;  1DBN A;  2OZ6 A;  4DXR A;  4BLJ A;  1POV 0;  4JGY A;  2LM3 A;  2BGP A;  4GWM A;  1AL2 1;  5C3P A;  5FDB A;  4LLO A;  1NX9 A;  3AB0 A;  1MS1 A;  1FV3 A;  2YC0 A;  1NCR C;  1Q8O A;  2UWB A;  4IQP A;  4K1Y A;  4B29 A;  4D6S A;  4FTB A;  4B8E A;  4XFI A;  4YVW B;  4JDM A;  2RMU 2;  5A3N A;  3T1M A;  2QBX A;  1SFY A;  4QXB A;  1E5H A;  1LHW A;  5IW0 A;  5A7O A;  2BVV A;  4AEJ A;  1ZRC A;  3WDX A;  2EA7 A;  4UW4 A;  1RL3 A;  4CEY A;  2J1R A;  3AVR A;  1XNA A;  2ZTN A;  5C9A A;  1WCQ A;  4ARX A;  4E4S A;  4CCK A;  2VXJ A;  3WP5 A;  1VE0 A;  5C33 A;  3ROU A;  1W99 A;  4TN7 A;  2UWA A;  3I3E A;  4MOA A;  4Q4Y 1;  3USU A;  5DDJ 1;  1HQN A;  5F3I A;  1ONA A;  4YGC A;  3A0N A;  4GJZ A;  1WW5 A;  4KWJ A;  3TB0 A;  1AL2 2;  5B4X A;  1WCS A;  4PDW C;  3G7D A;  2ERF A;  1OKO A;  3AZZ A;  2GC1 A;  3HMY A;  4M01 A;  2WO1 A;  5ERL A;  4IEP A;  5GLT A;  2E7A A;  2QZ3 A;  1JXN A;  5JOX A;  3LD8 A;  4XCA A;  5F5Q A;  3SNM A;  1DGR A;  2JDH A;  2ZZJ A;  3O1T A;  4LPL A;  3T0B A;  1YQ2 A;  3HQR A;  4A6S A;  3BPS A;  4CDQ C;  1KRI A;  1RED A;  4IEQ A;  5JI9 A;  2FD8 A;  2QKD A;  3WOG A;  1OC1 A;  3ZN4 A;  5ACA 3;  1MS0 A;  1UXX X;  4XF4 A;  3WDU A;  2Y6F A;  2J1A A;  4NAM A;  4EWD A;  2AUY A;  2XHK A;  4JKL A;  1WD3 A;  2B4K A;  3PTR B;  2I07 B;  2WQ8 A;  1SPP B;  1ZVF A;  4Q4Y 2;  2WKK A;  5F32 A;  4FPG A;  1MS9 A;  4CU8 A;  1H1A A;  2VQT A;  2WJS A;  2BOJ A;  1ZA7 A;  5FYU A;  2XGX A;  2JEC A;  1FXZ A;  1HJF A;  4V1P A;  2EIE A;  4HET A;  1YJL A;  3T1L A;  1BMV 1;  3AMH A;  2P4E A;  4P5Y A;  4WVM B;  1NA1 A;  2F17 A;  2Q4S A;  3ACI A;  1QJE A;  3B93 A;  1W6M B;  4E9K A;  5H9P A;  2XML A;  4L92 A;  2FCV A;  3CKH A;  1A78 A;  3L9J T;  4ITC A;  4OI2 A;  4O9G A;  5L19 A;  2CU5 A;  1JUI A;  2I2S A;  4F7Z A;  1OLM A;  3I59 A;  3WNL A;  1LOD A;  5JLV A;  1PX4 A;  1VBE 1;  3AYA A;  4QX7 A;  4D3W A;  1K5M A;  1XBF A;  2OA2 A;  3SEP A;  4TXW A;  2BNN A;  3ZFG B;  2UY8 A;  3QLQ A;  1QOS A;  3LQC A;  4R52 A;  1UY1 A;  5FY8 A;  2X09 A;  2RDR A;  4LUK A;  2GDF A;  1S0F A;  3VLB B;  2JB8 A;  3GZU C;  5FZO B;  1CGP A;  2P17 A;  5JXH A;  3OD4 A;  1RUG 1;  2J1S A;  3OOX A;  3VB9 A;  3UGF A;  2O8Q A;  1ASJ 2;  1CZT A;  3VKL A;  3N9P A;  5FQ0 B;  1FT9 A;  3MPP G;  3DYO A;  1W8F A;  2RE9 A;  2WUH A;  3IMN A;  3ZSE A;  2D97 A;  1OLQ A;  1Q8V A;  2PN5 A;  3NAP B;  1WBF A;  4OI1 A;  3JD7 1;  5FAX A;  1YEW A;  3DEC A;  3I2H A;  3NNG A;  4JV4 A;  4HOO A;  4KQ7 A;  3KM5 A;  4IER A;  4NHX A;  4GWI A;  3VBU A;  4ZU5 A;  3VBO C;  5J98 B;  4FOW A;  4LQR A;  1RUI 1;  4KWK A;  4V2W A;  3U0Z A;  4COV A;  4URA A;  4PCR A;  1JYX A;  2VUJ A;  2R16 A;  4PHZ A;  4CCO A;  3GHM A;  1TME 1;  5FMD A;  4QGL A;  4YW1 A;  1X8M A;  1S0G A;  3H50 A;  3TBD A;  4AI3 A;  1WLD A;  2VC9 A;  4FTE A;  1UX6 A;  5FYZ A;  4IDZ A;  3T2P A;  3E5Q A;  4PIX A;  1MPX A;  2ZS6 B;  4LIT A;  5A7P A;  1C8M 1;  4W4Z A;  3JD7 2;  3VZM A;  5DAV A;  4IV1 B;  1NCQ B;  1AR9 1;  5DZG A;  1FMD 2;  4FFI A;  2Z2S B;  4IGQ A;  2XVG A;  4ZZ5 A;  2EVX A;  2BJS A;  3DPR C;  3VBH C;  2WFF 1;  2I45 A;  1RMU 1;  1ZBE 3;  3S7E A;  4CU6 A;  3OGJ A;  1RUI 2;  2EXK A;  3O0X A;  4CCC A;  3UJO A;  5IWF A;  4BQX A;  3N9O A;  3O5S A;  5AC9 2;  4P9G A;  4B7K A;  5FPA A;  1F9K A;  1YWK A;  1ZA4 A;  2VQ0 A;  4HXC A;  3ZSK A;  1XE0 A;  1TME 2;  4FAG A;  2ILM A;  3OF1 A;  4IE6 A;  4Q4W 1;  1E5I A;  3I2J A;  1KDK A;  5FZE A;  4QM8 A;  1PZ8 A;  1XOY A;  3ZFF A;  3WHT A;  1JTZ X;  2G1M A;  1D4M 1;  5T55 A;  2VZR A;  3S7I A;  4OMC A;  1A34 A;  3NST A;  5FYC A;  1ZZC A;  4PI2 A;  1GP5 A;  5FJK A;  5D1I A;  1Z7S 1;  1W90 A;  3CIH A;  2KR2 A;  1DYK A;  3FLR A;  3T3Y A;  3ZR5 A;  2WR9 A;  1JZ2 A;  2JDM A;  2WFF 2;  2CAU A;  4Q4V 2;  4GWN A;  1PO2 1;  5EHD A;  5K4L A;  1RUE 1;  5LB6 A;  4A45 A;  1VBD 1;  4I0B A;  3ZPO A;  3BYW A;  2OQ7 A;  3DKQ A;  3B9C A;  3MUY 1;  5J48 A;  1DZT A;  4RA0 A;  5IAV A;  4MVT A;  2ZAH A;  4M0N A;  4OI0 A;  4A3Z A;  2VVF A;  5I91 A;  3I97 A;  3K3O A;  1B35 B;  5FLI A;  5IUQ A;  2W52 A;  1UY3 A;  3N9Q A;  2VNR A;  2XUM A;  1BK1 A;  4NO4 A;  4FXK B;  2J42 A;  1D4M 2;  3VDD B;  4AAX A;  1DF0 A;  2WZR 1;  3DYM A;  5DPN A;  2EXJ A;  2OPW A;  3FBM A;  5FY1 A;  1JYV A;  5FBZ A;  3ZR6 A;  4FTS A;  3FC0 A;  5JR7 B;  3VD7 A;  1N1V A;  3V0B B;  1GR3 A;  4QX5 A;  1JW6 A;  4XFH A;  3H8X A;  2GU9 A;  5AVP A;  1QF3 A;  3ENR A;  2XDV A;  1WCK A;  4NPR A;  2A5Z A;  1X33 A;  2WNU B;  4I3G A;  1PO2 2;  3SMH A;  1RUE 2;  3AKT A;  1VBD 2;  2OUJ A;  3GHN A;  3VBS C;  4K8F A;  5DUX A;  4CA9 A;  4LKS A;  5FYI A;  1AX0 A;  3RFR A;  3VBR B;  2DDU A;  1IQD C;  2W47 A;  2PHX A;  5A3L A;  4WM8 C;  1CQ9 A;  2MEV 3;  4YVS C;  5KHI A;  1V9U 2;  4DY5 A;  3T4V A;  1H2L A;  4GD4 A;  2IXK A;  4Q4Y 3;  4MX3 A;  5DDJ 3;  5A1L A;  1GFF 2;  4HAN A;  2Y33 A;  2W1Q A;  2Y0O A;  4MGS A;  2K2S A;  1W05 A;  2VJX A;  4L2N A;  4E2G A;  3WIN E;  1XSQ A;  3AVS A;  3C7G A;  3N7J A;  5BNO C;  2GMM A;  2WO3 A;  1XRU A;  3S0M A;  5A3W A;  4NIA A;  3F95 A;  1AYN 1;  2SBA A;  2FMY A;  4DNY A;  4A2U A;  4XVH A;  4CUB A;  1VRH 2;  3EHK A;  3A22 A;  4R9B A;  1RIR A;  3VV1 A;  3IPV A;  3OYW A;  4CCL A;  5T5L A;  2GNB A;  1IG0 A;  2XVK A;  5A3U A;  4WM7 B;  5C3S A;  1V6M A;  4E4Z A;  3KT1 A;  5L9V A;  1NCR B;  2BOI A;  2ADD A;  4CXY A;  1DCS A;  1OOP A;  3FLP A;  1CON A;  4FP2 A;  2D93 A;  1UU4 A;  1AR6 1;  2HYK A;  1BEV 3;  4HPK A;  2W0X A;  4FPJ A;  3OEB A;  1H2N A;  4FXG B;  5F2S A;  1H6Y A;  4NAO A;  3WD5 A;  3ETP A;  3ZSL A;  3MLK A;  1QJX 1;  3H1Y A;  5C4W C;  2QQN A;  1VIW B;  1GBG A;  4IW3 A;  2Q1M A;  1SMV A;  2RV9 A;  5T5J A;  1XNK A;  4QPG C;  1OF4 A;  3ZXF A;  3PUR A;  4DZG A;  1R08 1;  1ULG A;  2V5D A;  1AYN 2;  4QPY A;  4RFR B;  3GCX A;  5JSO A;  4CEW C;  1SFP A;  4P14 A;  4FOQ A;  1AXZ A;  4YRD A;  1RUC 3;  1VBE 3;  1QU0 A;  4PDW B;  3IAQ A;  5FZB A;  4B1L A;  3VUO A;  4GH4 C;  4PLO A;  2P3J A;  2YBS A;  4QDQ A;  2VBP A;  4AK3 A;  5KHJ A;  3KVA A;  2DFC A;  4QPI B;  4K9S A;  3T0A A;  3HJR A;  4AXO A;  5JVV A;  2Y6K A;  2Z69 A;  1PZ9 A;  1GLH A;  1HB4 A;  2PTM A;  5GAL A;  4CDQ B;  2JX9 A;  1RUG 3;  4YGD A;  4Y1V A;  4JRA A;  1YFU A;  1SBD A;  1QJX 2;  2B9U A;  2ES3 A;  4XYX A;  5F1R A;  5LA1 A;  4YPJ A;  3KWV A;  2BEO A;  3U07 A;  1ACC A;  4NOT A;  4Y4Y A;  2ZKL A;  1FYU A;  3AZX A;  4QQ2 A;  1NE6 A;  2DF7 A;  3TEY A;  3S57 A;  4D6Q A;  4NWW A;  3K4Z A;  4GQ7 A;  1NT0 A;  4FVV A;  3W21 A;  3GJA A;  1REE A;  1GNY A;  2ARX A;  5FZK A;  2DVF A;  4CP0 A;  3PDQ A;  4BK4 A;  3ELN A;  1N1Y A;  3NJZ A;  3U11 A;  5ANN A;  5HXV A;  1AR8 2;  4QKD A;  2W1U A;  4S2D A;  3U75 A;  2RS1 1;  4UF0 B;  3CDZ B;  1GZC A;  1JOJ A;  2XXZ A;  3WW2 A;  3MEP A;  4CDX C;  5CFD C;  4AI1 A;  1FOD 1;  5I93 A;  3CF6 E;  1UO9 A;  5T5P A;  3VD9 A;  1ULO A;  5LZ6 A;  4COW A;  2IFR A;  2XQX A;  4MH0 E;  3DXT A;  1RUH 3;  3AP9 A;  3J7N A;  2V73 A;  1O6U A;  3FL7 A;  3WY6 A;  4RGA A;  1C8M 3;  4CDU A;  5IVV A;  2H0B A;  2CGN A;  2WII B;  1AR9 3;  2IXI A;  5C3R A;  1OF3 A;  2ARC A;  4Y5T A;  5C70 A;  1QXP A;  3LA7 A;  2WSV A;  2WAA A;  4NJ4 A;  2WFF 3;  2DV9 A;  1RMU 3;  4L8Q A;  5JIA A;  2GME A;  3ZO0 B;  1O3S A;  3M1H A;  3Q8F A;  1HIX A;  1BK0 A;  2ET7 A;  3M3E A;  1PK6 A;  2YGL A;  1Y7B A;  3W5M A;  4CU9 A;  3KV9 A;  1OD5 A;  2GC0 A;  2EXH A;  5FTT C;  1FOD 2;  3K4A A;  3PL0 A;  1W8O A;  3AP6 A;  4XFA A;  3JBG 3;  1XYO A;  2ATF A;  4Q4W 3;  1OQE A;  3VL9 A;  4LBK A;  1MZ6 A;  3GDB A;  4Y5S A;  4COU A;  2WQ4 A;  1POV 1;  2VMD A;  4DFS A;  2A73 B;  3D3A A;  4LA3 A;  3NVC A;  3VBO B;  2BBV A;  2VZT A;  3MIC A;  4UW3 A;  3VBS A;  5FYM A;  4UBH A;  1SLC A;  2AC1 A;  3PHM A;  1LHU A;  2NMN A;  4EZ4 A;  2ZGM A;  1VBA 1;  4B4Q A;  2WWJ A;  4NRO A;  4FO9 A;  1S0C A;  1MEC 2;  4YVS A;  2JE7 A;  1DU3 D;  2AEN A;  3JZV A;  4BB3 A;  1RGS A;  1Z7S 3;  2R32 A;  2PYT A;  4CTE A;  5A3P A;  4QQH A;  5G04 L;  1QH6 A;  1O8P A;  4N43 A;  1PO2 3;  3OUJ A;  4C0H A;  2ZHN A;  1POQ A;  4F3J A;  4HT1 T;  4YG3 A;  3WNN A;  3K3N A;  3NV2 A;  1WLC A;  2E33 A;  2G9G A;  3CQO A;  2WT0 A;  1YI9 A;  2K0G A;  2GN7 A;  4QKF A;  2PHF A;  1NYW A;  1NZI A;  4UAP A;  2BTV C;  5I0S A;  5J1X A;  3MZH A;  2RS5 1;  1ZZB A;  2ZEZ A;  2JE9 A;  3HNM A;  4XEZ A;  4ZON A;  3DPR B;  3VBH B;  4AVB A;  2VNO A;  4LBQ A;  4XIK A;  2O0O A;  1H8V A;  1F4H A;  2WAO A;  3AXD A;  1BVV A;  5IT6 A;  2WZR 3;  3RYK A;  2DCJ A;  1W9W A;  3C3V A;  3E6B A;  5L7O C;  1WZX A;  4LHK A;  3KSC A;  3UET A;  1Q8S A;  3FWE A;  4Z2A A;  2VUL A;  1GZW A;  4XC9 A;  2F6B A;  4XBN A;  2IZW A;  2IXH A;  3TRS B;  5C8C C;  5CBL A;  4ZKT B;  3RMX A;  4YLZ A;  3GM8 A;  4AEK A;  1DQ1 A;  3A7Q A;  4HL0 A;  3POI A;  1GQG A;  4WVV A;  4A44 A;  1JZ3 A;  1FI2 A;  4X8P A;  5GZF A;  4LE3 A;  2WYF A;  3PLQ A;  3F2Z A;  2QDN A;  5T3N A;  4N9I A;  4P00 B;  1UNB A;  2NMO A;  4EZH A;  2RS5 2;  4JTN A;  4NN0 A;  4MGK E;  5L9B A;  4CPB D;  3QOP A;  3AYE A;  4OZX A;  3GBG A;  1Q5O A;  1NOV A;  3K48 A;  4BK5 A;  3NL1 A;  1Q3E A;  1CZV A;  2JWP A;  1WME A;  3D5O A;  3M3C A;  4JDO A;  4BLI A;  5EV7 A;  1UY2 A;  2YZ4 A;  4LBO A;  1B09 A;  3D4K A;  3LDR A;  3MW3 A;  5GZC A;  3LFM A;  2CTV A;  3IDB B;  4IL7 A;  5DAW A;  5F6L B;  4A3X A;  1OLM E;  2EAK A;  2OUH A;  4EJR A;  4QB6 A;  4LUM A;  3I2F A;  2TBV A;  1CJD A;  1PVX A;  2B9V A;  3TNQ A;  5IVF A;  1Q56 A;  4A4A A;  3PJQ A;  3VGI A;  1ZZ8 A;  3M3O A;  3S30 A;  1MS5 A;  4W6X A;  5CAZ A;  1XU1 A;  1CAX B;  2LAL A;  3I54 A;  2DUQ A;  2PXJ A;  1ND2 B;  1UOJ A;  3AC0 A;  5HCF A;  2VTF A;  2Y60 A;  2WLQ A;  3AZV A;  3L2H A;  5T52 A;  3J7M A;  1SLB A;  1G8W A;  2GND A;  1AR6 3;  3NO8 A;  4BDV B;  1SLT A;  2H6B A;  1SAC A;  3OGV A;  1GOF A;  3NV4 A;  4WM8 B;  1KQR A;  4AQT A;  1QJX 3;  1N1T A;  3GBF A;  3AKQ A;  2ZX3 A;  2VO5 A;  4AF9 A;  5KR7 A;  3AZY A;  4TLG A;  4YZ2 A;  5K9Y A;  5FZC A;  5CFD A;  3DUI A;  1UF2 C;  1VP6 A;  4LO7 A;  1R08 3;  1W2U A;  3HT1 A;  1IHM A;  1UPS A;  1HRV 2;  2VAU A;  3IDC B;  2NQY A;  5T54 A;  4Z1V A;  5A6Y A;  3E97 A;  1MS4 A;  4H2A A;  4NRQ A;  3WQ1 A;  3PUS A;  4X6R B;  5A32 B;  2RS3 1;  2R04 3;  2YU2 A;  4Y20 A;  4QT6 A;  2VMG A;  1WMD A;  5BNO B;  3BTY A;  1JZ7 A;  1CIY A;  4KBZ A;  4XCB A;  1SBE A;  4FT8 A;  3MI8 A;  3WNO A;  5H9S A;  5IK4 A;  4IE5 A;  1HN1 A;  3UKV A;  5FWE A;  5T5O A;  3ZN6 A;  1UYP A;  1IS5 A;  5C71 A;  4XQD A;  3LGR A;  1PGL 1;  1UWW A;  1YI7 A;  2B7Y A;  3LWC A;  1Q8Q A;  4G4F A;  1CES A;  3H0O A;  1RUJ 2;  4JHT A;  2QJV A;  5I0T A;  2VCB A;  1J1L A;  4YNI A;  4HK8 A;  2QUO A;  5F6K A;  2YDE A;  5FYH A;  1NUK A;  5GKA C;  1YYN A;  2JG9 A;  2VMF A;  3NJX A;  5FZ8 A;  4OYU A;  4N7U A;  4DRR A;  1IZ3 A;  3SKJ E;  1JZ4 A;  2RS3 2;  3VBF C;  1S0B A;  4ET7 A;  3LEK A;  1LOA A;  2XL7 A;  1NCQ C;  5DAB A;  4BIO A;  1F2N A;  4IEZ A;  1ZRF A;  2A3Y A;  5FP4 A;  2RS1 3;  3R4U A;  4QPG B;  1UOF A;  5E89 A;  3ZYJ B;  1X8E A;  3OCP A;  2JKX A;  2KXL A;  2DBI A;  1MQT C;  1XNC A;  2GN3 A;  4MGQ A;  4XDO A;  4WVW A;  1KD7 A;  2BDR A;  2NLR A;  3DN7 A;  4QD2 A;  4YW5 A;  4CEW B;  4XET A;  3O7O A;  4XUN A;  3EBR A;  1CIW A;  3EXU A;  2BER A;  3G6J B;  1H9P A;  3R6S A;  3ZXL A;  4DUV A;  1PGL 2;  1HDK A;  2C1F A;  3LDB A;  2P37 A;  5FZA A;  1JOB A;  4BQ5 A;  1W6Q B;  1EAH 1;  3KGL A;  1LEC A;  1NG0 A;  1CAV B;  2CSG A;  2HWD 2;  3GZA A;  3ZXG A;  4YVW A;  4CP1 A;  2R7E B;  3NJY A;  5A7W B;  2WS9 1;  4XUR A;  2AR6 A;  5K0U A;  3VKF C;  1VJ2 A;  1LEM A;  2VW2 A;  2FDG A;  5D8A C;  4JZR A;  5FMB A;  4LHL A;  4XMI A;  3N36 A;  3X29 B;  2CGP A;  1S0E A;  3AL5 A;  1R1A 1;  2J1T A;  1ODM A;  2J1V A;  2RJK A;  4UFL A;  4OMD A;  4LUL A;  1CX4 A;  3HN3 A;  1W2N A;  3Q9O A;  3N9L A;  2UY9 A;  4YZ3 A;  5I0R A;  2VU9 A;  1GU3 A;  4KWL A;  5I0U A;  4LMF A;  1E5R A;  4LXL A;  5BY5 A;  1TMF 1;  1G7Y A;  1POV 3;  3CHX A;  4GUL A;  1W6P B;  4CZS A;  3O1R A;  3J8F 2;  1EAH 2;  1RXF A;  3B5L B;  4XE9 A;  1G9C A;  3VZO A;  4XZP A;  4JC1 A;  1HLC A;  1KXG A;  5FO7 B;  3VZJ A;  1G9F A;  1VBA 3;  3TWI A;  2HWF 3;  2ZZQ A;  2J7M A;  3B00 A;  5LRR A;  3ZMN A;  4BME A;  4RS5 A;  2XBO 2;  5A6Q A;  4XIO A;  3WF1 A;  1Y3T A;  5DG2 A;  3AMP A;  3DF0 A;  3QD6 A;  1VLN A;  3CEW A;  4DPN A;  5C5U A;  5I8T A;  4YFZ A;  1OH3 A;  3R05 A;  4MXW B;  1SPP A;  4GXL A;  3WQB A;  2XOM A;  5FZ9 A;  5BNQ A;  1X82 A;  5LA2 A;  5HBA A;  1RTV A;  1UMZ A;  1GQP A;  2OW4 A;  4FCA A;  1R09 3;  1SEF A;  2VMC A;  4WVM A;  3AJZ A;  3ZIX A;  2UYA A;  3W20 A;  5FY7 A;  1W6M A;  3EMR A;  1ENX A;  1OXC A;  1XYN A;  3AZW A;  4XFG A;  3LEM A;  5DXD A;  4LO6 B;  4J25 A;  3NMB A;  2GH8 A;  5IVJ A;  1GZ9 A;  3HVD A;  2VD7 A;  2RMU 1;  3IN9 A;  5FPB A;  3OY8 A;  3HN1 A;  3QH7 A;  1O91 A;  1PMH X;  3CBN A;  2V09 A;  2W3J A;  2ET1 A;  2Y0I A;  3M3Q A;  1FNY A;  1HB2 A;  2D6L X;  1FPN 1;  2ARB A;  4HLT A;  2IVJ A;  4JQR A;  3ZFG A;  2BYV E;  3AMN A;  4P5H A;  1O59 A;  1WKY A;  2ARE A;  3ZXD A;  2YC2 A;  4HVO A;  4CYD A;  3BKZ A;  2JDP A;  2PAE A;  5FZO A;  5I8S A;  1YQ8 A;  2XQR A;  1UOG A;  3ZXJ A;  4OFG A;  5A7Q A;  5FYB A;  1LEN A;  1S0I A;  3TEX A;  2ZAC A;  3LOB A;  4JKM A;  4QQL A;  2YBP A;  2VCM A;  4WM7 C;  4S2H A;  1LOB A;  3NAP A;  4BCU A;  4Y1Y A;  1EPZ A;  1IKQ A;  2YPD A;  3HPN A;  1SDW A;  3VL8 A;  1COV 2;  2ZCW A;  4XFC A;  3THD A;  5DMY A;  1QNY A;  3POS A;  5CU1 A;  3ZXK A;  5IFT A;  1QJF A;  1NE4 A;  3T09 A;  4M3C B;  4FAH A;  2HH9 A;  1OQ1 A;  2R06 3;  2P3Y A;  1FPN 2;  2X8K A;  2RM2 2;  1QJY 3;  2Q8C A;  3A23 A;  3WG3 A;  1CAU B;  1VB2 A;  2YGM A;  3THT A;  4KNC A;  4QXH A;  5L7O B;  1OHF A;  2VME A;  2JDN A;  3WVJ A;  5JIU A;  2QTW B;  1FNZ A;  4LJH A;  5FPU A;  4QMA A;  5C8C B;  4Q0Q A;  4AE2 A;  5FZ6 A;  1EY2 A;  2E53 A;  4HMZ A;  4YM2 A;  5FMO S;  4UFH A;  1XJA A;  1GNH A;  3POG A;  5FPL A;  1OPM A;  1RUF 2;  4CP2 A;  1MAC A;  4QPI C;  2HEY F;  5CEH A;  2A6W A;  4IV1 A;  1NCQ A;  2XJU A;  2HWE 2;  2CDP A;  1GNZ A;  4LBL A;  5J37 A;  1K3I A;  2EF6 A;  1J59 A;  4RQP C;  3UT0 A;  2WA4 A;  3USS A;  5H9R A;  1HXS 3;  1LGN A;  4XBQ A;  1PMJ X;  3OSD A;  4Y4R A;  1SDD B;  4GAZ A;  1LUL A;  5CKM A;  3DXU A;  4I02 A;  3K2O A;  1VBC 2;  1W9F A;  1LHO A;  1JYC A;  3KT4 A;  5TSW A;  3TN9 2;  3WF2 A;  4DRV A;  2A6V A;  4QQP A;  4RL7 A;  3CJI C;  2W1W A;  2Z4F A;  5DZE A;  5A3M A;  4Q0P A;  2E51 A;  4XW3 A;  1WLT A;  3BU7 A;  5CYY A;  1ASJ 1;  3OUI A;  2HEV F;  5DUU A;  3MO4 A;  3OGS A;  2Q8D A;  2JG8 A;  4AI0 A;  3AX4 A;  1ZBA 3;  5KHK A;  1HKD A;  1FX5 A;  1KDM A;  2D5H A;  3FJS A;  3LSD A;  4QKB A;  4U36 A;  1ZRE A;  2ZEY A;  3VKO A;  1S0J A;  4MV2 A;  4XAB A;  3FZ3 A;  2Q1F A;  3U4S A;  5HXM A;  1KEX A;  1RJ8 A;  3LOI A;  3ZFE B;  3ZKU A;  5BNP A;  1W0N A;  2PMW B;  2E6V A;  1UAI A;  3KMH A;  1DQ2 A;  2R1D A;  4OHV A;  4DXS A;  5IVB A;  2CWS A;  2Z79 A;  3EB7 A;  1B35 A;  2QQI A;  3H1W A;  3IKW A;  4FFF A;  4XUQ A;  1QJU 2;  5EJZ B;  1ZZ6 A;  3ORJ A;  5FZM A;  3VZK A;  5KBF A;  2W68 A;  3VDD A;  1K12 A;  2ZMN A;  4I01 A;  3WW4 A;  3ZYG A;  1RXG A;  1X9P A;  3M2M A;  4C1W A;  4JDN A;  4AED B;  5A33 B;  4D7S A;  2B46 X;  1ALY A;  2DCK A;  3V0A B;  2BVB A;  2JDK A;  4LE4 A;  3V0B A;  1G9B A;  3POB A;  3FFZ A;  2XKP A;  5CFC C;  2ZGU A;  4HVR A;  4UOJ A;  1RIT A;  1FMD 1;  1SLA A;  2WNU A;  3NV1 A;  3GAL A;  5FZG A;  3HD8 B;  2JIC A;  1CAW B;  1PGS A;  1W2O A;  1CVN A;  3OB8 A;  2WS9 3;  3BGA A;  4UFM A;  1N3O A;  2VOX A;  5IK8 A;  2JDY A;  3ZVX A;  3VBR A;  2PHL A;  2D3S A;  4HSL A;  4XTP A;  3WQ0 A;  2Z5W A;  1XND A;  4LKE A;  5AC9 1;  5LEJ A;  1RHI 1;  3CU7 A;  4JGY B;  4QX0 A;  4IE7 A;  2HBT A;  3SCH A;  5L73 A;  4ATF A;  3KD4 A;  1HW5 A;  2Y34 A;  1R1A 3;  1F31 A;  1KGY A;  1YQ5 A;  2RDQ A;  3M8L A;  4PBP A;  4W8J A;  1AX2 A;  1UN1 A;  4KU8 A;  5FZ4 A;  1LTE A;  2CV6 A;  2YUE A;  2FDI A;  2K9Z A;  4XF0 A;  1YFX A;  2Y6G A;  1AR7 2;  1HB1 A;  5B4N A;  5JOZ A;  1OSG A;  4QGN A;  5IHR A;  1XPW A;  4QKN A;  5JSP A;  4XAE A;  3GCW A;  4LLF A;  1W06 A;  2IWG B;  2VMI A;  3VBF B;  1TMF 3;  1JOP A;  5EZW A;  1PX3 A;  1DZQ A;  3SH4 A;  2LTN A;  3SHR A;  4Y26 A;  2HWB 1;  4B7E A;  1FAY A;  3PME A;  5FZ3 A;  3MF6 A;  2OQ6 A;  4KGG A;  4Q4V 1;  1VB4 A;  1MQT B;  1H8T C;  2GP3 A;  1KS5 A;  2OKX A;  2ZX1 A;  4LIU A;  1RHI 2;  4YYO A;  3JUU A;  1SZB A;  4Q0U A;  1QNW A;  3MF9 A;  5HCH A;  3OTF A;  5B2G B;  5KXD A;  1V6N A;  2A3W A;  3PIG A;  4WM7 A;  5LY1 A;  1JMU B;  1NCR A;  5DN2 A;  1YIF A;  1JU3 A;  2G9F A;  4L99 A;  1D0G A;  3TNP B;  1ZRD A;  4Q1R A;  4UBG A;  3RG0 A;  2VZU A;  5D8A B;  3THP A;  3WNX A;  2HEW F;  1OI6 A;  1U5Z A;  1YIP A;  1W8Z A;  2BGO A;  2HWB 2;  3SXW A;  4AL9 A;  4J1X A;  2W91 A;  3LEI A;  2IVI B;  3WF0 A;  2PAK A;  3VD5 A;  3T08 A;  4GMP 1;  3BVC A;  1UKR A;  3LDK A;  1UY4 A;  2PLV 1;  1V6K A;  2QQO A;  4A7Z A;  3PVN A;  2RMU 3;  4UW5 A;  3AKS A;  3ZLI A;  3GZT B;  3JCI A;  4PDW A;  5BXX A;  3ZMO A;  2P5B A;  5IJR A;  1V9U 1;  1N1S A;  1X50 A;  4W50 A;  5FPV A;  3J7H A;  2LUW A;  1DIW A;  4Q29 A;  4MYE A;  3WHU A;  3FHA A;  3ZXA C;  3J26 N;  2XLA A;  4CXX A;  3MPB A;  1YCI A;  4CDQ A;  4LBM A;  3HEI A;  3PJY A;  4LR4 A;  4CU7 A;  3ZYF A;  2VUA A;  4N90 A;  1AL2 3;  2AH2 A;  4IGP A;  1QWR A;  3P1I A;  2P34 A;  2XJP A;  1ND2 C;  4FPH A;  1ULF A;  4IV3 C;  4ZHN A;  5LAT A;  3WXP A;  1HQL A;  1RVF 2;  1W9T A;  1PGW 1;  2PLV 2;  4MSV A;  4CSW A;  1W28 A;  5FKB A;  2YYO A;  3AP4 A;  3DKW A;  4MO3 M;  4HKL A;  1QDC A;  1GYK A;  1VRH 1;  1QOT A;  3I8T A;  4Q0S A;  1L3J A;  3N9M A;  3WNK A;  1RUD 2;  1J84 A;  1H9W A;  1M4W A;  3GBW A;  3ACH A;  4UF0 A;  5EWS A;  4ARY A;  1OVS A;  2A6Y A;  2J1U A;  2B5H A;  2R07 1;  5FOJ B;  3ZYB A;  5JSR A;  4BHP A;  4JGZ C;  1QQP 1;  4GAL A;  5JI7 A;  3POE A;  4AZZ A;  4XBL A;  1SQ4 A;  4GB3 1;  1W39 A;  1AUY A;  4EN8 B;  3UYJ A;  4TZD A;  5HCB A;  3UNP A;  2FMD A;  3UL2 A;  5IVE A;  5HV4 A;  4XFF A;  1GIC A;  3ASI A;  3U4X A;  1CR7 A;  2FDK A;  2IC1 A;  2PEL A;  2DCZ A;  2A75 A;  1PGW 2;  1LJ7 A;  1S2B A;  1HRI 1;  3MIG A;  3MIH A;  4RGG A;  4YG6 A;  1JUH A;  4LK7 A;  3UGH A;  2VY0 A;  4EN9 B;  2ADE A;  2DWR A;  2FQP A;  2WO7 A;  2ZML A;  3BUC A;  2CL2 A;  3U37 A;  3NV3 A;  3VHO A;  4EWA A;  4YW2 A;  4UFK A;  2IFW A;  5JZG C;  2ZGL A;  2VZ1 A;  2R07 2;  2VBB A;  4SBV A;  5F5C A;  5F3G A;  2ENR A;  2WC2 A;  2RR1 1;  4K1Z A;  1M06 G;  1QQP 2;  5LBE A;  1R64 A;  1ZZ9 A;  4CUC A;  4OUM A;  4YGE A;  4GB3 2;  1CD3 G;  2PHW A;  3LCP A;  5A3O A;  3VBO A;  4YZ5 A;  1IS6 A;  3DEM A;  4H3W A;  4MHR A;  1ASJ 3;  3BU0 A;  2YY1 A;  5EFU A;  3QCW A;  1XQN A;  2HWC 1;  4P08 A;  3C7O A;  1BVP 1;  2H6C A;  3ILF A;  4QDS A;  3W9A A;  3WCR A;  4DO0 A;  3LSE A;  4AGR A;  1HRI 2;  4B1M A;  3OG2 A;  4AFB A;  3GYD A;  4YW6 A;  4MET A;  2Y8K A;  1PO1 1;  4K8R B;  4LBJ A;  1N3Q A;  2V4V A;  4QQO A;  1GSL A;  3IAP A;  3SIT A;  3PUQ A;  1QIQ A;  1AR8 1;  3BOD A;  4DIN B;  1YRZ A;  1LHN A;  2C24 A;  2RR1 2;  2MPF A;  2P3I A;  3E6D A;  3HT2 A;  1DFQ A;  1W8W A;  1GQH A;  3PVB B;  1DDL A;  4AFC A;  2C5D A;  1YLL A;  4P9Y A;  1UIJ A;  4WZC A;  5DAP A;  5LW9 A;  3AP7 A;  4Q4X 2;  4ZXE A;  1BZW A;  1FAT A;  3DPR A;  1EV1 2;  1KJR A;  3RI9 A;  4RQP B;  5CKQ A;  3E5U A;  3VBH A;  3RZK A;  2BP6 A;  2RVA A;  1D4V B;  4YZ4 A;  1UMH A;  2DU1 A;  2HWC 2;  2W46 A;  1S1A A;  4CDW B;  4AYU A;  2PHR A;  2CWM A;  1K42 A;  3WP4 A;  1UY0 A;  5BNN C;  3CJI B;  2NPI A;  3JD7 3;  3D0J A;  3ZXE A;  4G9S B;  4PT6 A;  4Y1U A;  5KC6 A;  1PO1 2;  5JR2 A;  5F5I A;  3RZH A;  1FMD 3;  4YFW A;  3VDC A;  4Z92 B;  3T0D A;  1TE1 B;  2DUO A;  2CY6 A;  3J4U H;  4J1W A;  1C5I A;  2VMH A;  2WZE A;  3TAY A;  5KXB A;  1RUI 3;  1STM A;  2BGC A;  2UUR A;  2BUK A;  4MGY E;  2YC4 A;  5AC9 3;  1WD4 A;  1VMH A;  1GKB A;  1XYP A;  2GSY A;  2VL4 A;  4ZS3 A;  1TME 3;  2PHU A;  4PLM A;  1UYX A;  1DQ6 A;  4Q26 A;  1GWL A;  2G4I A;  1O8S A;  1W03 A;  4LHS A;  4JCK A;  4SLI A;  1LES A;  3LPF A;  4Q8K A;  3UGG A;  3I4I A;  3IBM A;  3ZDS A;  4NUB A;  4IET A;  5FCC A;  1JYW A;  3W5N A;  1ZM1 A;  3M70 A;  4PIZ A;  1DYO A;  1UZW A;  1C4R A;  3WF3 A;  3K46 A;  3VKN A;  3BPZ A;  2C6S A;  1MEC 1;  5DUW A;  4L9B A;  3FN9 A;  4PJY A;  5LBB A;  5F37 A;  4RD7 A;  3I7D A;  2LW8 A;  3M3I A;  4AQ2 A;  1GV9 A;  3PU8 A;  2D6M A;  2GC3 A;  4DY3 A;  4D8M A;  4E2Q A;  4Q4V 3;  1PIV 1;  1NQD A;  4HKO A;  2B39 A;  1EUT A;  2WO2 A;  4L11 A;  4LOS A;  2JIJ A;  4V2V A;  3VZL A;  2CAV A;  1CAX A;  4RR3 C;  5KHG A;  4DUW A;  4R9C A;  1TNR A;  4I09 A;  1DGR N;  5FLJ A;  5CFC B;  1LED A;  1ND2 A;  3MIF A;  3Q8A A;  3RYR A;  3J9S A;  1C28 A;  4ORF A;  3WUD A;  5IAX A;  3MUZ 1;  4E4D X;  1IQA A;  1W2A X;  3KQ4 B;  5A6Z A;  5C7G A;  4KL1 A;  4XHB A;  1IPS A;  1D4M 3;  2XLF A;  1WBL A;  1OUS A;  4Y22 B;  4WM8 A;  1Z78 A;  1Y9M A;  3JU9 A;  2D6P A;  4C8D A;  2FCT A;  1EPW A;  3I2G A;  4R9A A;  1V6O A;  3LA2 A;  4LOT A;  1KFX L;  2DFB A;  4NIH A;  1RUN A;  4QXC A;  1PIV 2;  1RUE 3;  5APA A;  3ZDV A;  1VBD 3;  3ZSM A;  1OOP B;  2PLV 3;  5LK7 B;  4Q5O A;  3ACL A;  2YV8 A;  4UW6 A;  1VPH A;  2D6O X;  1KIT A;  2YB7 A;  4HPK B;  5A32 A;  3PUI A;  2ZEW A;  3WW3 A;  3K51 A;  1SG3 A;  3POW A;  5BNO A;  3SLI A;  1BBT 1;  4ASL A;  1E57 A;  1ENR A;  3OBT A;  1V9U 3;  2WT2 A;  2D98 A;  4CRQ A;  5A7N A;  1LGB A;  3OPZ A;  4TYS A;  1H8T B;  1LU1 A;  4OUE A;  1UQX A;  1W3X A;  1OFS A;  3Q8B A;  4QX2 A;  5FK7 A;  2V5Y A;  4IE0 A;  4HVQ A;  1ND3 C;  4XJ8 A;  3KVB A;  4I3P A;  4NWV A;  4TWT A;  3KHC A;  5EJ3 A;  1W04 A;  4Y5Z 0;  3WSO A;  1QKQ A;  3JB8 A;  2VNV A;  5AFB A;  2FDH A;  5SV8 A;  5FZ7 A;  4IEO A;  4N7I A;  1MVQ A;  2P2K A;  2VBD A;  4FBF A;  5K8S A;  5JOY A;  1DZR A;  3ILN A;  1VRH 3;  3J7L A;  4HZF A;  4AQS A;  2XH6 A;  1WA6 X;  5C4W A;  1BBT 2;  5DZF A;  3RZM A;  1VMF A;  2W95 A;  3A21 A;  3IDE A;  4BH9 A;  2DVA A;  4QPG A;  2OS2 A;  4PBO A;  3VKM A;  2GNM A;  1W8U A;  1PVC 1;  4G3Y C;  1DHK B;  2ZJC A;  4CEW A;  1QQP 3;  4XXA A;  1CPM A;  1A3K A;  4GB3 3;  2NN8 A;  1EUU A;  3I49 A;  2DUP A;  5FJH A;  4GH4 A;  4XAA A;  3NRU A;  4Q0V A;  4Z2W A;  1YQC A;  3AKR A;  4GMP 0;  5LBF A;  2A6X A;  3AMQ A;  5A7W A;  3T2T A;  4ISR A;  5J96 B;  2RG4 A;  2ZGT A;  1I9R A;  3SCG A;  3NKT A;  3T4H B;  4O65 A;  1AYN 3;  1HRV 1;  3ES1 A;  2EXI A;  2OVU A;  2Q30 A;  4P9X A;  2A6Z A;  4Y1Z A;  2ZKN A;  5E1R A;  5JCT A;  3H42 B;  4CP9 B;  1OFN A;  4FSJ A;  1AYM 2;  3R4S A;  1NLS A;  2ZHM A;  1ZRR A;  4IV3 B;  1PVC 2;  3MBW A;  3ZFE C;  2X5I C;  3NNJ A;  5JWP A;  5DG1 A;  1YFW A;  3N3H A;  4RHV 2;  1W6P A;  3B3Q E;  3FFQ A;  5KHH A;  1ZYB A;  4NPM A;  4WZF A;  3OUH A;  3EQE A;  3SQO A;  4N8M A;  2QQP A;  1RUJ 1;  1HX6 A;  3P3N A;  2W87 A;  4K40 A;  1JZ5 A;  2D6K A;  4CDX A;  4B4R A;  2TUN A;  5CG9 A;  4JGZ B;  5A6X A;  1JS9 A;  4AVC A;  1UU6 A;  4A7Y A;  4AED C;  4X8N A;  5JXJ A;  1G6N A;  1H1M A;  1QXR A;  3I2K A;  2ZEX A;  1H2M A;  4BOW A;  5JOW A;  2XB6 C;  1KFU L;  3T30 A;  2Q1Z B;  2MHF A;  3B7M A;  4HON A;  5KXC A;  4MXW A;  1DYP A;  1AR8 3;  2OX0 A;  3AP5 A;  2EID A;  1VAL A;  4CCD A;  1C1F A;  1LOG A;  5FZ0 A;  4NHM A;  4H14 A;  3Q8E A;  1NY7 1;  1MZ5 A;  4JGY C;  2WZP P;  1IPK A;  3W58 A;  5FY5 A;  4KGQ A;  4O61 A;  2VUC A;  1HJG A;  5ACA 1;  5FLH A;  5JZG B;  2VZV A;  3H9A A;  2HWD 1;  2ZOE B;  3LA3 A;  3IMM A;  3VDB A;  2JXA A;  3GF6 A;  1S0D A;  2XLG A;  4N53 B;  2ZXQ A;  4XJA A;  5GLV A;  4ONU A;  4CCN A;  2VEC A;  4HG6 B;  2A71 A;  2ZHL A;  3MLL A;  1IS3 A;  4M3C F;  5FYT A;  2G19 A;  1O7F A;  1PHM A;  1XXN A;  4QPW A;  3H8O A;  4YM0 A;  2EIC A;  2R0F A;  1C8N A;  2XKO A;  1I6X A;  3OPT A;  4CEY C;  2O8O A;  4PI0 A;  3WDY A;  2JD4 A;  5C9A C;  3H7J A;  2BBA A;  3MW2 A;  3WP6 A;  3U10 A;  2IXC A;  2JDZ A;  3H8U A;  2ZX4 A;  5CIR A;  1W8T A;  5DAQ A;  3C7F A;  3L2Y A;  1WA4 A;  5FXV A;  5AVA A;  1FOD 3;  3PUH A;  2VVD A;  4BYY A;  3RJR A;  1JOD A;  1NY7 2;  5ACA 2;  4MGT A;  3IB3 A;  1UOB A;  3SC7 X;  1UCX A;  2R30 A;  3J8F 1;  1EYB A;  4MUV A;  4Z82 A;  3FBY A;  3WEZ A;  1PMI A;  2ZX2 A;  3SCF A;  3KV6 A;  3HAG A;  4IND A;  3BCW A;  3HIF A;  4H7M A;  4XOG A;  2KA3 A;  1XNT A;  3BOW A;  5FZ1 A;  1MEC 3;  2AGS A;  1OLR A;  1YFY A;  4M3C A;  2F4P A;  3KQR A;  2EIB A;  3FHQ A;  2XBO 1;  2KM2 A;  1YUD A;  4KWU A;  4B4P A;  4DB5 A;  3DCQ A;  3N35 A;  5D2A A;  5FMC A;  2GMP A;  2C26 A;  2ZAA A;  3KV4 A;  4KI5 M;  1IG3 A;  1CAU A;  3K4D A;  1GZT A;  3KF5 A;  1X7N A;  2ZHK A;  5H9Q A;  1GWM A;  3CJX A;  3T2Q A;  5FR3 A;  1UYY A;  1NQJ A;  5L7O A;  1I5P A;  2W94 A;  4XFB A;  1QXJ A;  1C3H A;  1UZY A;  3VHR A;  5BNN B;  3FE5 A;  2JD9 A;  2PAM A;  4QHZ A;  5I0D A;  5EXO A;  1XSR A;  2J1E A;  2D3P A;  5C8C A;  3BI3 A;  4RYD A;  4AGG A;  2V72 A;  4AEM A;  1BJQ A;  3A4U A;  1OD3 A;  2YFZ A;  4R8H A;  1LOC A;  4IEW A;  2D3R A;  1NA1 C;  1P8J A;  4Y3O A;  2ETE A;  3U14 A;  1AHS A;  4LT5 A;  2EAA A;  3I2D A;  4XUP A;  5FYS A;  2X05 A;  2E26 A;  2ZGR A;  3DV8 A;  4GJY A;  1WMF A;  1XE7 A;  2A70 A;  3LB9 A;  1ZRI A;  4KU7 A;  4Q27 A;  3THC A;  3A0K A;  4AVT A;  1K5M C;  4OUS A;  4E4H A;  3O14 A;  1DGL A;  4LK6 A;  4FPC A;  4LKD A;  1QGL A;  2BQP A; 
#chains in the Genus database with same CATH homology
 3OUH A;  4MHU A;  2JIJ A;  4NAO A;  5HV4 A;  2RDN A;  4IW3 A;  4BQW A;  4BQX A;  5ERL A;  5IAX A;  2HBT A;  2Y34 A;  4ZON A;  2FCU A;  2RDQ A;  4XCA A;  3HQU A;  2G1M A;  4NHY A;  3HQR A;  3NNL A;  2FCT A;  4XC9 A;  4NHM A;  5LBE A;  4NHL A;  2V4A A;  5EQU A;  4Q5O A;  5LB6 A;  4MHR A;  4NMI A;  5DAX A;  5LBC A;  3DKQ A;  5EPA A;  5IAV A;  5M0T A;  2G19 A;  5L9B A;  4JZR A;  5LAS A;  3W21 A;  3GJB A;  2FCV A;  3NNM A;  2JIG A;  3GJA A;  2RDS A;  5LA9 A;  3NNF A;  5DAQ A;  2OPW A;  4NHK A;  5DAW A;  3KT7 A;  4BQY A;  3KT4 A;  5DAP A;  2RDR A;  3BVC A;  4ZPI A;  5C5T A;  3OUI A;  3ITQ A;  2A1X A;  3OBZ A;  4UWD A;  4Y5T A;  5C5U A;  4XAB A;  4NHX A;  5IAT A;  5HV0 A;  2Y33 A;  4XAA A;  5LBF A;  3GZE A;  3PL0 A;  2RG4 A;  5LAT A;  4Y5S A;  3W20 A;  3EMR A;  2HBU A;  5L9R A;  4J25 A;  4KBZ A;  4XCB A;  5EP9 A;  3NNJ A;  5LBB A;  5A3U A;  3MGU A;  3KT1 A;  5L9V A;  5DAV A;  4XAC A;  3OUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...