4R8HA

The role of protein-ligand contacts in allosteric regulation of the escherichia coli catabolite activator protein
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords cAMP-activated global transcriptional regulator CRP
publication title The Role of Protein-Ligand Contacts in Allosteric Regulation of the Escherichia coli Catabolite Activator Protein.
pubmed doi rcsb
source organism Escherichia coli
total genus 60
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4r8hA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4r8hA01
3GFMA 1FSHA 5DCMA 1HQCA 1ZLJA 2Z9OA 4IEOA 4M74A 1ZZ8A 1X3UA 4JQFA 5TJJA 2JTVA 1ZYRF 3H1WA 2O6GE 3M3IA 4ESBA 4XBFA 2ATFA 1DUXC 3B02A 3L2HA 2H09A 1R1VA 4EGYA 4MTEA 5AIPA 4AD9A 1SD4A 1VTNC 2ETEA 1Z6RA 3E97A 4LUKA 1ZN2A 2Y0MA 4U7BA 4L9TA 3CUOA 5H6QA 1J3QA 4ZZLA 4OLLA 4F7ZA 3J81Z 1QZZA 3M8FA 2G7UA 1W4MA 3LQRA 1SAXA 1B59A 3J80K 4KU7A 1U2WA 4AVAA 3P9CA 2GWRA 4RB1A 1LKNA 1BBYA 1LDDA 3WTYC 1Y3TA 1J2XA 3ECOA 3G3ZA 1T39A 2IC1A 3J7AO 2O3FA 2CFXA 4UHTA 4ENKA 2PAKA 3F6VA 3V8LA 2DQLA 2DAOA 1S7AA 1U5TC 5CYVA 5HS8A 4J1WA 5H20A 4PIXA 1P4WA 1F4KA 2D45A 2G7HA 3WGIA 5IT3A 2BE5F 2G9WA 3WE2A 1YYVA 3GZ5A 3WW3A 4YYOA 3IRRA 5I8SA 2ZKLA 2L4AA 2OQRA 2XAJA 2XAHA 3U10A 3COAC 5D6FA 3GFJA 4HSJA 4IEYA 4FBFA 4YNIA 3IKVA 2XAGA 3H92A 4IPAA 3HHGA 2DK5A 4EROA 4XF1A 1ON2A 2ZCWA 1FNNA 2E1NA 1YIOA 2RV8A 1IN5A 4MGYE 2UY8A 4YIIA 3FXUA 3L2CA 3F8MA 1UFMA 4BHPA 1DP7P 2QVSB 2W84A 2M45A 2TDXA 1FPQA 1QXRA 4MX3A 5E1XA 2Z5UA 1BN5A 4R1HA 4UUVA 3WTWC 3RKXA 4L18B 3BJOA 2E1CA 4HAMA 1OMIA 2V9VA 1QGPA 4MTDA 1VJ2A 3E6CC 3GW2A 2F5FA 2QNKA 1IXCA 4P96A 1LDKB 4A0XA 4HZFA 2HTJA 5J8FA 4JTNA 1HKTA 2EV6A 3LOIA 1SFUA 2EAAA 3F3XA 2PMUA 1MJBA 1K7AA 3SXWA 2F5CA 3E5QA 3ML6A 3KEOA 1K79A 2FMLA 4BXUA 3BCWA 4XFFA 2FRHA 2M8EA 1GXPA 1FX7A 4O3MA 4Z82A 2Y75A 3BU7A 1TTYA 1YG2A 2DLLA 5BV6A 4QLCU 1BC8C 2IXHA 1QWRA 1H1MA 3FHIB 1QXJA 3FZ3A 1RNLA 4A0YA 1XN7A 3MZHA 1HW5A 4G6QA 3KFWX 4XSXF 1G3YA 2ZJ2A 3ES4A 2P7VB 3EQLF 5JSPA 1H9TA 4HVRA 5C6CA 4IEXA 3LA3A 3BB6A 1C0WA 3K0LA 4UBHA 2PEXA 4L5JA 3FMSA 1ON1A 3RYRA 4QMAA 1GQGA 4L9VA 1T98A 2CV6A 4LLLA 1O4TA 5D4RA 3PNAA 3F23A 2RQPA 4EJOA 4OIOF 3J80Z 4AIKA 5K1YA 1G3TA 2P4WA 5EEGA 4DQ2A 2W24A 3VB2A 1IN8A 4CDGA 3U2RA 2K27A 5E16A 3AAFA 3IWZA 1FYMA 3HTSB 2A6HF 2H27A 4UV9A 5L3EA 4M6XA 2WWYA 5C8WA 4IEWA 3SQNA 3H8UA 3ROUA 3KP6A 5HVQC 1O3QA 2MH9A 2XL9A 2IRFG 5ILSA 2EWNA 1JUHA 1IZ1A 5KHJA 1XGSA 2J5PA 2FXAA 3M70A 3T0YA 4DNCA 4HF2A 2P5LC 3JZVA 2B0LA 5J3UA 5BUVA 4HBLA 1VP6A 2XV4S 4XFGA 4MZUA 2EFWA 2DO7A 4EWAA 1AWCA 1UCRA 5FLHA 2RNJA 4UVBA 4NVPA 4U0WA 2ETHA 2VT3A 2GC3A 4L9JA 2FQPA 1ZAOA 1XSVA 1ZG5A 2MA3A 2HFHA 3NL1A 2XRNA 3DV8A 3BPXA 1XB4A 3BJAA 3RIRA 5ICEA 4S04A 4EJVA 3ES1A 2K7LA 1XSDA 4MGIE 4RB3C 1CAUA 2GH2A 1J9IA 4P55A 4UVCA 3GLXA 5LGTA 3K9TA 4HOBA 1F9NA 4TLFA 4E2GA 2NNNA 3M9AA 4RAYA 3HOTA 2IT0A 3FMQA 4XFIA 1MD0A 5FQ0A 3PVBB 3ZMVA 4IJAA 3H9AA 2PI0A 1VR3A 2EA7A 2MPFA 4MV2A 5DCFA 4B29A 1Q43A 1FBQA 2H6BA 1U5TB 4LD5A 4P9GA 4HDUA 3HSFA 3WW4A 2M30A 3ZP5A 3H50A 3QU6A 2QVOA 5KHHA 4M72A 1ZGAA 2EJRA 3GYHX 3IC7A 5A2QK 3EO6A 2W57A 3RNSA 1J75A 2NS0A 1FYKA 3KP7A 1HXDA 4KWJA 3KEQA 1S3JA 1I27A 2IW5A 3F6OA 3QPTA 4RGSA 1Y0UA 4HF1A 1ZREA 3C3WA 4L2NA 1Z9CA 4M9ZA 1UD1A 2P6TA 4XFAA 3CJXA 1ZZ9A 2CSOA 4RB0A 3OV8A 3W6KB 1ZRCA 3I54A 3EYIA 3S7EA 3VOEA 4KWLA 4WWCA 4LLGF 2OD5A 1YO5C 2Z69A 4ZYGA 2O03A 2IP2A 3REOA 2A5YB 1I1SA 4IESA 1FZPB 3KLOA 1OPCA 5LRSA 1PUEE 1R22A 3KP2A 4G6DA 1OFNA 3C3VA 2DTRA 4L5IA 5IT9K 2UXXA 2IJLA 1U5TA 3L9FA 2XLAA 1QO0D 2HDCA 2UYAA 2YX4A 4PIYA 4Q0VA 1S6LA 2STWA 2VC1A 2WC2A 4KNYA 3W6JB 3G73A 2DFIA 3LZZA 3EETA 1TLHB 1YLFA 4Q0UA 5JAXA 4EJUA 4ZYDA 1FC3A 3HHHA 5BPIA 1O3RA 3DKWA 1YFHA 5F64A 2P7CB 2M1BA 2YPRA 1YFWA 2VC0A 2MLKA 3Q9VA 4WCGA 2PFBA 1OR7A 4HDVA 3V8JA 4G94A 2E7XA 4WXCA 3MQ0A 4M9SA 4MNUA 1HW1A 4Q0QA 2QCSB 1F5TA 2EFNA 3RJPA 3LAJA 4LG0B 4YIFA 4XF9A 4ONUA 1KA8A 1J1LA 2Z33A 1EH7A 4BH9A 2AS5F 3IL2A 5LHGA 4ON0A 4XETA 3NRVA 2HWVA 3KE2A 1NE4A 2ZNYA 3OD0A 2L54A 5D5VB 1RUNA 1QZYA 2W25A 2BBYA 1NHAA 3DEUA 1UPIA 3V4GA 1FSEA 1XSXA 3RZZA 2OQGA 2NYXA 3JTGA 3QOPA 5E18F 4HLYA 4LMYA 4YSFA 4WXDA 2QZ8A 2XVCA 4Z07A 3HQXA 4CZZA 5D8LB 3S7IA 4QXKA 1SMYF 2PAMA 1R23A 1DZRA 4BAYA 4ORFA 2D5FA 4YFNF 5A2QZ 3ABUA 1O5UA 2MH2A 4AQ6A 1CAWA 3T5XA 2KIUA 4AVPA 1SD7A 1UB9A 1ZARA 1NE6A 2MHFA 1J59A 4X6RB 2COMA 4ESFA 2KJCA 4LG0A 4I02A 5JR7B 4O5VA 1Z1DA 4XFBA 2BV6A 4JVAA 3I58A 3P9IA 2HYGD 5D4SA 3KZYA 1JHHA 1D3YA 4I3PA 4LK1F 4ENMA 1RUOA 3H3UA 2Z2SB 3HRSA 3WTSC 3G7DA 1U8RA 3CTAA 2VPVA 3HUGA 1TBXA 2KJBA 2ZBKA 3HRTA 5IT9Z 2LF8A 1CX4A 4JK1X 3CO2A 4LGWA 4OFGA 2YR2A 1B4AA 3HT1A 4HW0A 2BNOA 4G7ZF 2ISZA 2OZJA 3QU3A 3ZQ7A 5BPDA 1YW7A 5JFRA 4IRGA 4JBAA 1ZGJA 2PG4A 4Y17A 5KHGA 2ZNZA 1F1ZA 1ZRRA 3WW2A 5LGUA 3GWZA 3C1DA 2EK5A 3LFKA 1TQMA 1Z7UA 4XF3A 1B6AA 4XLPF 1FI2A 3CF6E 1G4DA 2VBXA 4IF4A 5AVPA 1OD5A 1DZTA 4G9YA 3WTZA 2A61A 4IETA 4LULA 1KU2A 2IVMA 2P5VA 2DW4A 1W5TA 2V6CA 1BC7C 1JHFA 2QBYB 2XKOA 1JGSA 4ZYEA 1SFNA 3KGLA 1Q1HA 3F8CA 5FPXA 2CG4A 4IRHA 1MKMA 3H7JA 4F8AA 1BJAA 1U78A 3TO6A 2JRTA 4OIRF 1IRGA 3ZMUA 4KWKA 2WFPA 4G7HF 5ILUA 1MGTA 1PMIA 4L0ZB 1O57A 1USTA 1XCBA 4IEUA 5FLIA 4MUVA 2L02A 2CO5A 4HQMA 2K86A 3MDPA 1LRHA 3U0ZA 3K69A 5FFXA 3K1NA 4CYDA 2BGCA 3OGJA 1AOYA 4QWQA 2HR3A 3T8TA 1GHCA 2GU9A 2B9UA 2GC2A 3SHRA 1U3EM 5FGMA 1Z91A 3P9KA 2F5DA 4OMYA 2KIFA 3CO7C 2P6SA 3ERED 2D5HA 2D40A 4P5OA 4GULA 1HBXG 1XGNA 4I0BA 1KYZA 4I01A 2PQQA 1YS6A 3JTHA 5F1RA 4MEYF 1FP2A 3QRFF 4HX7A 3D0JA 3TNQA 4LJZF 4GYGA 2QBYA 1ZG3A 1B9MA 4M9XA 2LSOA 5E20A 1QQIA 2QUFA 4L9NA 3DQVC 1LR5A 4E70A 4U0YA 1CGPA 1HSTA 3BPZA 4I7HA 1ZNPA 1T0FA 1FWZA 3KMHA 1QPMA 1EV7A 2QQ9A 4A6DA 5BMZA 4EV0A 4G7OF 4YG2F 4L11A 1YWKA 3FXQA 1R7JA 2A69F 1BI3A 2MNGA 3O14A 5JI6A 1Z6TA 4XFHA 2P8TA 3CLOA 5E17F 2RN7A 2XUBA 3FFQA 3QP6A 2V79A 4GGGA 5I0TA 4IEQA 3DPLC 1SMTA 3L00A 2VODA 2KXLA 1W5SA 1X7NA 2HQNA 3TQNA 3FM5A 2VT2A 5JSRA 1D5VA 1FY7A 1P2FA 5KK1A 4CHUA 5K5OA 5CADA 3WTUC 4ENJA 4NB5A 3CEWA 3V8KA 3ELNA 1RI7A 5CJ9A 2LNBA 4CXFA 2WV0A 2D1VA 4O9EA 3NSTA 3KZZA 3LSTA 1NZCA 5I0UA 2EA4A 2PBIA 1YTYA 4XF4A 3GF2A 2DI3A 1CAUB 4IRIA 3IHUA 2FF4A 3ST7A 3BP8A 4PIZA 3USSA 3RPQA 3MZYA 3ZPLA 3FXRA 5ICFA 4HX8A 4XSZF 2E7WA 2EV5A 3R6SA 2RVCA 2X0LA 1P4XA 5FQ0B 5I0SA 2N7GA 1YQAA 1R5HA 2DK8A 1ONVA 5J8CA 2PA7A 2OZUA 3BROA 3TOBA 2BEOA 2AXLA 4P9UA 1TNSA 3BPVA 3ETQA 3EBRA 5D8KB 3M8EA 4EM2A 2OZ6A 3DFGA 3GFLA 1S7OA 2MC3A 5CU1A 5D1IA 5BPXA 3QAHA 4LB6B 1LEBA 4ZU5A 2Y48A 3WG9A 5BXXA 2VOPA 1NXMA 4A6EA 1REPC 5LRRA 5FFZA 4NHJA 2CAUA 4I2OA 3NKTA 3F72A 4G8XA 1J3PA 4OU0A 3WGHA 3HIFA 1S29A 4E2SA 2BYVE 4JV4A 3S0MA 3M1EA 3VODA 4KYWA 3ZMDA 4OOIA 4QM9A 1I5ZA 3V7SA 1H9GA 1J3RA 3M7GA 3FE5A 2ESNA 3BOQA 2ADUA 4LFUA 2KKOA 2GXGA 1IF1A 1I6XA 3DP7A 1IPKA 1EY2A 4Q0PA 1G3SA 3H1YA 3F8BA 4MQ9F 3KP4A 1RL3A 4LUMA 1WA4A 4QGLA 4R52A 3NEUA 4J1XA 1B1BA 1RIOH 3HYIA 2PHDA 1IXRC 2FE3A 4LLOA 3U11A 1O5LA 5J7MA 2FQ3A 1PP7U 2FBKA 3CUQC 1ZRFA 3HSRA 1T38A 5D5UB 2OAZA 4KN7X 3EJKA 1ZLKA 2HKXA 2FNPA 4LA2A 3SZTA 1OYYA 3HRMA 3D0SA 1PDNC 4JTOA 4EQQA 3H1MA 3SMHA 5JR3A 3C7JA 1SQ4A 2HEOA 3GYDA 4XRFA 1Q3EA 5J6XA 3I64A 4KL1A 2RGVA 1P92A 2OA2A 3UKVA 2HKOA 3E6BA 3OTFA 4IXAA 4KICA 2XKPA 2HTSA 5ICGA 4AIJA 3BY6A 3NW4A 2HJIA 3FJSA 1WGPA 3R60A 4IVNA 1GQHA 4I09A 4IEVA 3TDZC 2Q0OA 4D7SA 4FAGA 2PMHA 5L3DA 4N0BA 3K2ZA 4ZZDA 5LBQA 3ISPA 4AXOA 3RKWA 4PDKA 4WBBA 2OA4A 3DXJF 5LGNA 4YFKF 3FX3A 3OCPA 5FLXK 4ZH4F 5HS7A 4RGXA 1MJ9A 3PQKA 5F6FA 3KSCA 1U12A 4UNOA 1PM7A 4HVOA 1YS7A 3IDCB 3SCHA 3CLPA 1WI9A 3TDUC 1SEFA 3FM3A 5FLJA 1OKRA 3S2WA 3F22A 4BNCA 3EYYA 5FO5A 2QJVA 5L3BA 1IXSB 2ZO4A 1CAWB 3BALA 4MGKE 1DGWA 4TV7A 4HN0A 2PHLA 1ZG1A 5I93A 3JSOA 4MQVA 1GXQA 2Z99A 4Q47A 1LB2A 4AVCA 2IXKA 4HSLA 2HS5A 3ZMSA 4PCQA 5CVUA 4LEJA 3LWCA 1V3FA 4U7DA 2MD5A 4GYIA 1ZZ6A 2CGPA 4Y15A 1D8KA 2STTA 3UKNA 2H94A 1XRUA 3LQQA 2IXLA 4KN4X 4EMSA 3QPHA 2K02A 4U0VA 2JPCA 3RPUA 4RB2C 5HS9A 5D5WB 4HBNA 2GC1A 3FF5A 3DL3A 3D5LA 5HDNA 1LVAA 5LLQA 1WQ2A 2DQRA 1FLIA 5FD6A 3NVCA 1IN4A 4EJTA 4WX9A 4BYYA 2PN6A 4LLNA 3H3ZA 3LWFA 4OINF 5HDKA 1E17A 1MDMB 4ESJA 3MYXA 2GZWA 3LA2A 1UW8A 1W7PB 2VONA 3GFIA 4ZU7A 4KT5C 1YHFA 2ZFWA 4HVQA 4I0AA 3HOSA 3WTXC 4YRDA 5DD4A 1WSUA 4Q5SF 1EH6A 2WTEA 3ULQB 2VBZA 5ERIA 3B73A 2FA5A 5LEKA 3KLNA 5BS6A 3TKYA 3E3VA 1WRJA 1SFEA 4WVZA 1QY4A 2JT1A 2XAQA 5HDGA 2Q1ZB 3LAGA 2D1HA 4PJYA 2LDUA 3SFZA 1JXSA 2PLYA 4KMUX 2FBHA 3R4KA 2M87A 3TNPB 1CF7A 1XE8A 2QDRA 4U88A 3GEZA 2I45A 4EWDA 5JSOA 4IERA 1TNTA 3QACA 4QX5A 3E5XA 4QM8A 4FHTA 1USSA 3ABTA 3CO6C 3I0TA 4WF2A 4GXOA 1CAVB 2L3DA 2PQ8A 2QWWA 2HZTA 4D7TA 5HOOA 1YFYA 1ZX5A 4AVBA 2VE9A 5FDBA 1TQPA 1A04A 4GO1A 4HLTA 2ET7A 5JVTA 3OOPA 5FLXZ 1MDMA 3JAMK 1LJ9A 5DYMA 1P6RA 1L0OC 4CO8A 1W7PA 2GIVA 5CVRA 4FAHA 3CUQB 2VQAA 2F4PA 3GZ6A 2LF7A 3L7WA 1KQ9A 1KU7A 2H0VA 3F8FA 4HMZA 2CWEA 4HLXA 1LNWA 4AQ2A 1OI6A 4XFCA 3ECHA 2DCTA 1FBUA 2Q4SA 3OF1A 3ZMZA 1J58A 2YSRA 2IA0A 4EM0B 4ETSA 4KIBA 4PZJA 3V7CA 4KMFA 4PGGA 3UKTA 4HN1A 5EFUA 2K4BA 1SD6A 3T8RA 3R0JA 3SZPA 4KUMA 2A6EF 1ZH5A 1O3SA 4R8HA 4XLNF 4QGNA 1YUDA 3KP3A 2IA1A 3SCGA 3WGGA 1HKSA 3ZMTA 3CJNA 2ACJA 1O3TA 2XIGA 4FX0A 3KCCA 5K5QA 1CAVA 4XF0A 5LHIA 1H0MA 2MLGA 3SXYA 3KETA 1EYBA 4EVIA 1K6OA 5DUIA 2K0GA 1Z05A 2DU9A 3MCZA 1TQ5A 1XGMA 2HQRA 1ZZBA 2FSWA 5HLIA 3KGZA 1X8MA 4XEZA 4E2QA 3CUQA 2X4HA 1YFUA 2XLGA 2P17A 4Q0SA 4R79A 1TW3A 5KVRA 2J5OA 4WZCA 2UXNA 1YFXA 3VFZA 1RZ4A 5E1ZB 4OMZA 1EH8A 1R00A 2GA2A 4WXHA 2FEZA 2O8XA 3MAJA 5H6RA 4B8XA 2EFOA 2FBIA 2HOEA 3RYKA 5I8YA 1X8EA 5KBFA 2EVXA 5E8IA 4B09A 3BDDA 2RC4A 4RS8A 2K9ZA 2VBYA 5FD5A 3ACLA 3C18A 5E1WA 2B8MA 3IDBB 2E9QA 1ZZ7A 5CVJA 4MGRA 2O1QA 4Q29A 2V1DA 2VXZA 4RAZA 3BJ6A 4QGMA 2MBFA 1XMKA 4IEZA 1YW9A 3NJZA 4LTAA 3WTTC 4BQAA 1DPRA 1H1IA 1BI1A 2ESHA 4OIPF 1IPJA 4KA4A 1BOAA 2DBBA 1R36A 5HI0A 2HGCA 2QQBA 5KHIA 3MWMA 2OBPA 5I0RA 1OYWA 1XDUA 2F5EA 4EJWA 3PFIA 4N9IA 5I8TA 5E1RA 2PYTA 4Q4ZF 5AONA 2C6YA 4UBGA 1BI0A 1BM9A 2R7FA 1L3JA 1IW7F 1HSJA 3LAPA 2OPKA 3JAMZ 2UYBA 3I7DA 5TRDA 1UHMA 1W7PD 3SCFA 4RD7A 1R58A 4ZYHA 1T2KA 3E6DA 1KU9A 5D6EA 3HSEA 4RGUA 1RC6A 4ZU4A 3IKTA 1R5GA 2LKPA 2XGXA 1E2XA 4O9GA 2L01A 2NNYA 1YW8A 4PGHA 4Y13A 3GVAA 3QP5A 1J7KA 3HT2A 2JZYA 4P9FA 3TO7A 3K1MA 1SD5A 1D8JA 3L09A 3IBMA 5T3NA 5L3FA 4EM1A 1O7FA 5JHUA 3RYPA 2Q30A 5DV5A 2JSCA 3GBFA 3PQJA 1TQIA 2D2WA 2IXCA 3TO9A 1FXZA 1NYWA 2KIMA 5DDGA 1XE7A 5E8GA 2RKHA 3I71A 3DPTA 2YX7A 2FU4A 3BWGA 1KQ8A 3I5UA 4HV5A 3VHRA 4MH0E 4IHTA 3H7YA 3O6BB 2R3SA 1FP1D 5LEJA 4KU8A 3DN7A 2RDPA 5CVVA 1BI2A 5L3GA 2EFQA 3Q5FA 3I4PA 1GVJA 2A07F 2GC0A 2ZXJA 2FMYA 1X82A 1JE8A 4BHBA 4A0ZA 1IAWA 1HKQA 1T6SA 3E6MA 1ZRDA 1XCVA 1KU3A 4Z2YA 3WE3A 5K5RA 1IRFA 2C0ZA 2DT5A 1QNTA 3WU1B 1UCXA 3D82A 3CDHA 4N9HA 2XHKA 3I53A 1STZA 4L0YB 4MEXF 1BIAA 4D0PA 2JPBA 2W85A 4NQWA 3V7RA 5KHKA 1WKMA 1LQ1A 3I59B 1Y9QA 2BNMA 1B9NA 4LA3A 2XL7A 1R1TA 2V1XA 2CQKA 2QM3A 1IN6A 2D93A 2IXJA 1UIKA 5ILVA 1KGSA 3RKYA 3EQEA 1V4RA 1XDSA 3GXOA 2V09A 4M71A 3KP5A 2B5HA 4BIFA 2EFPA 1P4AA 3GX4X 3TGNA 2QENA 3R0AA 1EP0A 3MFKA 3MEXA 1J5YA 2EV0A 5EEHA 3ZDSA 4IHSA 4A12A 4GCVA 3MPBA 1UHWA 2PTMA 4UXAA 1G6NA 1KQ0A 3IRQA 3TOAA 4KFCA 3N4MA 2ISYA 5BOXA 6PAXA 4S05A 5BQTA 4KDPA 3FWEA 4AIHA 1R1UA 1DDNA 1CAXB 2GXBA 2Q0AA 5L3CA 3WW1A 2XASA 4EGZA 1PP8F 4FT8A 3FMRA 5K8SA 1TW2A 1ZHFA 1EPZA 2FNAA 3NQOA 1WWXA 3EUHA 3U1DA 1I1GA 2IPQX 4UXNA 4M6YA 1L3LA 3PLQA 2ELHA 1YLLA 2PAEA 2CYYA 5CLSA 1ZZCA 4LK0F 2CAVA 1IN7A 1U6GA 2EA2A 3HRUA 1K78B 4YARA 5I91A 5D5XB 5LHHA 4OIQF 1XD7A 2IA2A 3I59A 4H7LA 2O61A 4HQEA 4CICA 2A68F 4DINB 1SFXA 5HLGA 1QBJA 4HYEA 2O8QA 2UY9A 2Q2EA 1WLTA 3CL1A 3K1PA 4BHCA 4META 3WTVC 2EB7A 3ZN0A 1FYLA 2ZMEB 5DUKA 2NRAC 4LB5A 2XAFA 1ZVFA 1XGOA 2VECA 1MZBA 3O3KA 4O6JA 1DPUA 3IWFA 5AIQA 2OYZA 2YU3A 3N97A 2FOKA 2BNNA 5DD8A 1XMAA 1J0RA 2A3SA 3RI4A 1CAXA 4MHGA 5ICCA 1G3WA 1O7LA 2H6CA 2XLFA 3J81K 1BIBA 2GA1A 3FZVA 2UWMA 4HX4A 2KRFA 2QQAA 1S8NA 2NAZA 5BY5A 3GO5A 2Q8KA 2UZKA 1CF7B 5FPZA 3FHZA 1ODDA 4IEPA 4KIFA 3JSPA 1K78A 3R61A 1RGSA 4A5NA 4ENNA 2VN2A 3E5UA 2F2EA 3GUDA 4WK8F 2VOOA 4FX4A 4X6QB 3O2PE 1FBSA 4UV8A 5JCTA 2ET1A 3T1BA 4MGZE 3HTUA 3ZN1A 3Q9SA 3SHFA 1LEAA 4KIGA 4AWXB 2IXIA 4HV6A 4I98B 5DCMB 2R7DA 2P5KA 2ZMEA 3DF8A 2K4JA 1LDJA 1UIJA 2VBWA 2QYOA 2Z3YA 3LA7A 3P7NA 4CGZA 3WODF 1OYIA 2HYFA 2V1UA 4K2EA 2PJPA 4A2UA 2OU2A 4K8FA 4HA8A 2DPDA 4A5MA 5FCCA 3F8NA 4Q48A 3EHKA 1IUYA 2QLZA 1FOKA 2PFWA 5CVIA 4EWEA 4HF0A 3F21A 1MJAA 5DEQA 3WU0A 1FT9A 2M5WA 1HW2A 5ED4A 3VEPA 1V70A 3IIAA 5EZWA 2CW0F 2GAUA 2O0YA 5HLHA 1DGRA 2ZKZA 2VE8A 2GQQA 4ASNA 3RTRA 4UVAA 1ULYA 2L4MA 3EDPA 3ELKA 1RTVA 4RGRA 1KYWA 2XROA 4M73A 3RDIA 4YFXF 3BZ6A 5J48A 2DPUA 2Y0OA 4H0EA 3U9GA 3JW4A 5FB2A 1Q5OA
chains in the Genus database with same CATH superfamily
3AZYA 4BGDA 2Z9OA 4PFPA 1ASJ1 2K9MA 2Y31A 2WN3A 4M74A 3S93A 4JQFA 2ZEWA 3QD6A 1RUE2 3ZSEA 1OF3A 2P3IA 5TJJA 5F3GA 4ESBA 4XBFA 3VBSA 3JB8A 1ODMA 4N90A 4MTEA 4AD9A 1WBLA 2Y0MA 2AO9A 2PJRA 2ZXHA 5JWPA 4C2TA 3IM0A 2W1WA 4BJ6C 4ZZLA 1BJZA 4BY7J 2G7UA 4GFBA 4UW4A 2UWAA 3RFRA 2GP3A 3WXPA 2QEXI 4KU7A 3P9CA 3LIGA 3IMNA 1QXPA 3WTYC 1FPN1 3G3ZA 5KHDA 1PVC1 1T39A 1AL0G 1WLWA 4OHWA 2R7UA 2PLV3 5GTIC 2WNUC 5C4WB 1VQPI 2DQLA 2Z5WA 3BIWE 1S7AA 2WWUA 3BCBA 5HS8A 1Z7S1 2EIJH 2BFUL 3OEBA 1RJ8A 2D45A 3WE2A 1S0DA 4D7YA 1XJAA 4P08A 1ZELA 2JUCA 2XAJA 2XAHA 5JXIA 2ZHLA 1H8TA 2GOMA 5C44J 1F2NA 1DGRM 3GFJA 4IEYA 3ZCOA 4YNIA 3K4BA 3IAQA 2BPA2 4IPAA 4FTEA 3BTLA 4EROA 4C9YA 4IGPA 1FNNA 4NC7A 2E1NA 3JU9A 5HNFA 1IN5A 2UY8A 4YIIA 2D43A 3L2CA 4HEA2 1ZM1A 4XRSA 1X33A 4JCKA 5FP3A 2RQQA 3TEZA 2XWJB 5GTHC 1FPQA 1QXRA 2Z5UA 3PSIA 4MADA 1N3PA 4XUOA 1H8VA 2PLV2 1R5ID 1OMIA 2V9VA 3GHNA 3D5RC 4MTDA 4BJ5C 3E6CC 1VJ2A 3OL4A 4A44A 2Y69H 1AHSA 4QIWN 3K70C 3HNMA 4Y1UA 4P96A 2R041 1XNAA 2HOTA 4JTNA 1HKTA 4IE5A 1J84A 4ZTJA 1KDMA 5DAQA 4W6XA 4ISQA 1WW5A 2VQLA 1LGCA 4RAGA 3DUIA 4M0HA 5JIUA 2HWB3 1HXS1 3SDGA 2FMLA 2R0HA 2V4VA 4LBKA 4OHZA 1K6YA 1JZ5A 1NK2P 1FMD3 3OYBA 4OHYA 5EP9A 2LY1A 5E3NA 1MQTC 2JDMA 4AQSA 1Q56A 2AEYA 3CC7I 2ZJ2A 3EQLF 5JSPA 1H9TA 4BOWA 5C6CA 4IEXA 3J8F3 4IE4A 3K0LA 1HB4A 3FMSA 4BK5A 4CCDA 1OISA 3FIWA 2AHQA 3USUA 4D69A 1T98A 1O4TA 3RGBA 1C3HA 4S2HA 4OIOF 3J80Z 5JZGC 5TISC 4UB8C 1X2NA 5K1YA 5ANQA 2W5FA 2BRTA 2VMFA 2HVSA 4NROA 2JJ6A 5E16A 5FY4A 5GLTA 2R7XA 1FYMA 1LEMA 2H27A 3NNGA 4M6XA 2WWYA 1CZSA 2BHZA 5FMBA 4EN6B 3ROUA 3KP6A 4NMIA 2GXAA 1I3AA 2Y26A 2MH9A 1Q8QA 3H8OA 4CEWA 2CH0A 1V5FA 5EZGA 4NAOA 5FZ3A 3ZPOA 4HF2A 2VIXA 2B0LA 1VP6A 2HDDA 4MZUA 3IDEA 3J8F2 2EFWA 2DO7A 2FD8A 2DA3A 1LOBA 1MMGA 4UVBA 2E1MC 1WJ5A 1ZG5A 2HFHA 3ABLH 1AXYA 3NL1A 3CJQB 3HPGA 3BJAA 2K7LA 3WF3A 3O1MA 3HOWJ 1AL22 4OUSA 1CAUA 3GLXA 3ZYGA 2F5VA 3K4JA 3VBHA 3ZSLA 1F9NA 4E2GA 2NNNA 3AB0A 5HV0A 3M9AA 4MHRA 1VRH3 4S0HB 3CESA 1LVKA 3PVBB 2A71A 4PSWA 3C2GA 1QJY2 2V6EA 5FY8A 2IGNA 4CEYA 2HZDA 4MV2A 1U5TB 1LU1A 3TEDA 2Y0IA 3W5NA 1LU2A 3ZP5A 3GTOJ 3H50A 5L9VA 3NNLA 3QU6A 1QZEA 5CQEA 2Y9YA 5KHHA 3GYHX 1D1CA 4YW4A 3IC7A 5A3PA 3LEGA 4ISRA 5A2QK 1L7RA 5FUPA 3TOJA 1S72I 3BU0A 3JRIA 4CUCA 3GNEA 3KEQA 1S3JA 2ZGTA 1J1TA 3C3WA 1RKTA 1RUH1 4Q27A 5T52A 1YRNA 3LEMA 1UD1A 5K7FA 1T0FC 4RB0A 2OW4A 1YIFA 3WINE 5FKKA 1Y4WA 2RDRA 2MABA 1GV2A 1K61A 4B4PA 3D6EA 4BQYA 2VOXA 2YXSA 4LLGF 1NKGA 2ERFA 3S16J 1YO5C 4ZYGA 2BHYA 2IP2A 1Y56A 2A5YB 2VJJA 1CPMA 1U0AA 3ZQHA 3WDWA 2J22A 4K40A 3MI8A 3BR6A 1Z0XA 2HWE3 2YUEA 3ZSJA 2I74A 5JOYA 4QXCA 1X36A 2XLAA 3PJQA 2HDCA 2UYAA 2YX4A 1Q8PA 4Q0VA 3V0BB 3RZGA 1IG7A 1NY71 3OSGA 2IS1A 2WLQA 2VQGA 3AKZA 2DFIA 5FZ0A 3LZZA 5FYVA 4Q0UA 3LL7A 3E1F1 3HHHA 5GZEA 1YFHA 2P7CB 1MZ5A 2XF7A 3S57A 1ZR2A 4K1ZA 1DLLA 1OR7A 4HDVA 2EH3A 3POEA 2VQ0A 4R9DA 3TP3A 3LOBA 4WXCA 4MNUA 4AQTA 3HBKA 3KV9A 4Q0QA 5LBCA 1PUFA 2EFNA 4HPKA 3LAJA 2BY3A 1UOFA 4YIFA 4YW6A 2IAIA 3N36A 1KA8A 1J1LA 1KRIA 4XMYA 1IO2A 3AKTA 3IL2A 5H9PA 1OLRA 5JLXA 4CA0A 2HWVA 1BBT3 1OFCX 3HM5A 2Y38A 4ES9A 1RJ7A 2L54A 1X4PA 1RUNA 1RMU3 1QZYA 4QKDA 3VYRB 3K4MA 1UPIA 3V4GA 2C26A 3OR1C 3SH3A 3VBSB 4LMYA 2BW3A 2W48A 4CZZA 4BS9A 3LDRA 3HDDA 4QXKA 2PJRB 4AG4A 1SMYF 2EZKA 4P9IA 4ATFA 4YEJA 4ORFA 3GTQJ 1O5UA 4A3IJ 3UL2A 2MH2A 1CAWA 1MZFA 1QNYA 5FYTA 3HPNA 3ECQA 2P0WA 1ZBA2 4L5EA 4LKEA 2FBEA 4X6RB 2YDEA 2COMA 4ESFA 2OC6A 4AI9A 4QU2A 3K7AJ 2D7FA 2OV7A 2DA4A 4JVAA 3MV01 5FZ8A 1RMU2 3TB0A 3VZJA 4C3IJ 4E7LA 3TMOA 4CXXA 4AFAA 2VCBA 1N3OA 5IW0A 3DF0A 2K9LA 1QF3A 1GZWA 1KZHA 4OQ8A 3WHBA 1G8WA 2VKHA 1H8TB 1NLRA 3I2KA 3HRTA 2RAEA 2LF8A 1CX4A 3ZPYA 2V9KA 4LGWA 2ZHNA 4OFGA 2DJIA 3M4OJ 3QU3A 2HQAA 1PZ9A 1BK1A 1JMUB 4IRGA 2PG4A 3R4SA 1C8M3 2ZKNA 5DG1A 5B1BH 3RS6A 2PQSA 1MEC3 1TQMA 4HKWA 4GIQA 4YG6A 4JC1A 4XLPF 4ZHNA 2DTYA 1G4DA 4QAWA 3U78A 1GT0C 3AX4A 3WDXA 5F2WA 5B3SH 5E3LA 3JRFA 2WAAA 4YWAA 1AZDA 3GF6A 3CZ6A 4ZYEA 1NUKA 1IUFA 3EYPA 3OPWA 1Q1HA 5FPXA 3WG1A 1NOVA 2BOJA 2E63A 4DEQA 5F0CA 1QJU1 1POGA 4R9CA 2VB6A 4XOPA 3F95A 4XAAA 1IRGA 5DPNA 2WFPA 3QLQA 4XRMA 1YE9A 4G7HF 3RPUD 1PIV1 1UYYA 1USTA 1YO8A 2DCZA 4IEUA 1B35C 1MEC2 5T5JA 4CYDA 3OGJA 1GQPA 4CDUB 1AOYA 5FRNA 1XBFA 1QIQA 3AXEA 4ATEA 2GU9A 1LUJB 1WD4A 4BIOA 1BXHA 2B9UA 3K77A 5T55A 5CPRB 1BL0A 1Z91A 4AWDA 4GWIA 3P1IA 1O4XA 1S0FA 3THTA 2P6SA 2D5HA 5EJZB 3ACFA 3S3MA 4UYBA 2D40A 4WM8A 2HBUA 3A4UA 2WV1A 5JPMB 4MEYF 2VL4A 2KL4A 3TNQA 4LJZF 3I55I 1B9MA 4LHNA 3IV5A 2VVFA 4QKNA 4L9NA 1H4GA 3ME2A 2ICWG 3N7LA 4ANJA 1CGPA 3BPZA 5FP8A 2O8KA 2E36A 1M1EB 4RFT0 1VMHA 3H42B 1K4SA 1E5IA 4A6DA 4FCYA 4RFRB 4L9BA 5A3LA 3PUSA 4ZZ5A 1F9KA 2VOVA 4CEWB 4XDOA 4F3JA 4NIDA 3O14A 4LBJA 4AEDC 2W2IA 1UMZA 3CLOA 3CD6I 4Q4W2 4TWTA 2VD7A 1H1AA 4GXLA 4Q4V2 2V79A 4EQVA 1K83J 5DTDA 4Q8LA 3BGAA 1UO9A 3OPTA 4UW3A 4IEQA 3DPLC 3T4HB 3OSDA 2HQNA 4P9LA 1IV8A 4A3JJ 3P3PA 3CEWA 3ELNA 1RI7A 2GNDA 1WW6A 2R30A 2D1VA 3L2UA 3LSTA 5IP9J 2O8OA 1IDYA 4D7MA 1NZCA 2ARXA 1WCMJ 3F0CA 1YTYA 2XXZA 1DCSA 1CAUB 4LORA 1FYUA 2WNVA 5J4YA 3W20A 2FF4A 3IH2A 1SDDB 4P9JA 2YPDA 4PIZA 3RPQA 1SBEA 3VBHB 1W06A 1DHKB 2ZSHB 3WP6A 1TWFJ 2EV5A 1P4XA 2DVFA 1X1BA 4XYXA 4YVWB 2BWCA 2N7GA 1YQAA 2DF7A 3RRDA 5FKLA 1QDCA 2BEOA 2RE9A 2AXLA 2X6YA 4P9UA 4O7XA 2W39A 3ETQA 1VIWB 3M8EA 2OZ6A 4OZXA 1S7OA 5D1IA 1D1AA 2W47A 1POV0 4JDOA 2WWSA 2Y48A 1JKPC 5HCAA 5LRRA 2CAUA 2W1OA 3F72A 4MXVA 3AK0A 1YRNB 3WGHA 2HEVF 2HQ5A 1AR92 3HNYM 5EPAA 2BYVE 3M3YJ 5K4LA 3S0MA 3M1EA 1YJ9I 4E27A 3AVRA 4NC8A 3W2VA 4M3DA 1I5ZA 3LIHA 4RAFA 3FE5A 2ZGRA 3I56I 1SLAA 1X3ZB 5J1XA 2GXGA 1IF1A 2JG9C 4XZPA 2W94A 4GB33 3H1YA 2L9SA 3F8BA 4D9JA 1RL3A 4QGLA 2YG0A 4R52A 3K4NA 4J1XA 3K4CA 1B1BA 1R1A1 4NHMA 5J40A 4HRIA 2YY1A 1W9FA 4N4NB 3VBRA 4ZDLA 2NMOA 4QQPA 2WO2A 1N75A 1HRV3 4CXYA 3QODA 2FNPA 3FHNA 1RC9A 5IP7J 2YFZA 3WDUA 3CP8A 1C8NA 1VBE1 4ES8A 1X9PA 5F3EA 3D0SA 4JTOA 3MN2A 4RM2A 4RA0A 1DFQA 4JQTA 5FZFA 5LD2C 1SQ4A 1QQP2 2HEOA 4LK6A 3WNPA 5J6XA 3I64A 4KL1A 1H6XA 1P92A 1PUFB 1T2XA 2IFRA 2HKOA 3OYJA 5BNOC 2LROA 4DZPA 2BERA 4A7KA 4NUBA 5ICGA 1RUE1 2HJIA 3LSMA 1VZ0A 2VOWA 2L9NA 1PX4A 4IVNA 4B44A 1GQHA 4JKMA 1S0EA 4IEVA 1OVSA 2VUDA 4OUMA 2Q0OA 3DEMA 4D7SA 1SACA 3GALA 5DAPA 2PMHA 3RKWA 1W0TA 2WZR3 3ZQGA 3MO4A 2W0XA 3UNGC 1WCUA 4Q8KA 3DXJF 3FBIB 2LM3A 5FJHA 1KJLA 2XF5A 3KSCA 2BW3B 1U12A 5A7WB 4HVOA 2XUMA 2KDZA 5FZGA 3QH6A 3ZFFA 3TDUC 5LA0A 3RMXA 5M5WJ 2YS9A 2QJVA 2VXDA 1CAWB 4MGKE 5J09A 4UT5A 4MQVA 4QX0A 1GXQA 4AVCA 1HB2A 2RJLA 1MSFC 1W04A 4PDWB 3ZMSA 1NQDA 2ZGQA 5KCMA 4XJAA 5A7PA 3LSKA 4LEJA 1X1CA 1GWKA 1O4YA 5J1YA 3LDBA 3NAPC 3LQQA 4KN4X 2WZR2 5EDNA 1W8UA 2K02A 4U0VA 3RPUA 3HOVJ 3DL3A 3FF5A 3FK7A 4CU7A 1RUC2 5LLQA 2LH9A 1GZWB 1FIPA 2DQRA 5CZKA 3OYGA 4BJTA 1ND3C 4KQ7A 5FD6A 3VHPA 3PNYA 1V9U3 4EJTA 3BTAA 4PT6A 2CV1A 2VE1A 3ZQLA 4YIRX 4IKFA 5D8AC 5A32A 2VJ4A 2PLV1 4Z8BA 5ANNA 5JMCA 1WBFA 4Y20A 4UWDA 3MYXA 1PK6C 2GZWA 2X1DA 4QD2A 4ASLA 1GVDA 3RZJA 2FDJA 3B94A 1AR71 2P34A 2HOSA 4I0AA 3MGUA 4QQHA 2C4XA 3POSA 4C30A 1WSUA 5GZCA 1EH6A 1BMV2 4A6OA 4LXLA 1MW7A 1PZ8A 3NNMA 1ENQA 5LEKA 3KLNA 5BS6A 1S7EA 1WRJA 4B47A 4MFEA 2WAQA 5EYYA 4WM7C 1JBCA 2R0FA 4IDZA 1BR2A 2J1AA 3JBG3 2B4KA 5HDGA 5KXBA 1G9BA 4GMP3 1JN2P 2CYFA 2MSYA 1WZ2A 1JXSA 1AR63 4E7KA 2XGCA 3VPRA 3JREA 4AHXA 3DYPA 2C6SA 3R4KA 3WDTA 1V9U2 2ZGKA 4CDXB 4AHWA 1XE8A 1MH3A 3GEZA 4B3AA 1AJKA 2I45A 4EATA 4Q4Y2 5JSOA 1LKXA 1JHJA 4FETA 2EIGA 3VDBA 1JZ2A 4GXOA 2L3DA 2XR4A 4H3WA 1OLMA 1CVNA 3X29B 5HOOA 1YFYA 1ZX5A 2G4IA 1WA6X 2V9PA 4RR3C 3BTIA 2DU0A 1EV12 1US2A 1LJ9A 1IS4A 1ITYA 2VQAA 1RVF2 3GZ6A 5AC93 4HMZA 1HV0A 2CWEA 2WB1N 3K4KA 3JBG2 1GOFA 4AU7A 1M06G 1EF4A 1AR62 4CCCA 1NLSA 4FVVA 4K3UA 4OYUA 4EM0B 4ETSA 1CIWA 2E7TA 3O8GA 4V2FA 4OI4A 3AMQA 2LD5A 1AYM3 1LJ7A 4E7HA 3OS0A 1COV3 4NJ4A 2K4BA 2ZS6B 5FXWA 3J8F1 3SZPA 4R9AA 1UELB 3WQ0A 2RS51 5L7OA 1OOPA 3ZYPA 1FOD3 5F8PA 1YUDA 2VQHA 1XE0A 4ZKTB 3HQRA 5FWEA 2R7QA 1DP3A 3D3AA 4FX0A 3KCCA 5K5QA 1CAVA 5LA1A 2MLGA 5C8CA 4CDWA 5AC92 5C70A 1TQ5A 1TZOA 4QX1A 1AL21 1XGMA 5CEHA 2R7OA 4LBQA 4E2QA 2DV9A 5T5PA 1UKRA 4IE7A 4HFSA 3CUQA 1YFUA 4HONA 4Q0SA 1TW3A 1T8IA 5K0UA 1A78A 3I97A 2J5OA 4LO6B 1RR8C 3NWTA 4Y22B 3VFZA 4OMZA 1S5LC 2G0EA 3AP7A 4XPVA 1AYM2 1RUI1 3FBYA 4RMNA 3GJAA 2E5NA 1QJY1 1COV2 3M2MA 5I8YA 2ECBA 3RYKA 2E53A 1X8EA 3R4UA 3IT8A 5FZMA 2WNVB 2EVXA 2DU1A 4RGGA 1RYYA 2QQOA 3BDDA 4NHLA 1D0YA 1FOD2 3OOUA 3FUOA 3C18A 1RUG3 2B8MA 4R4ZA 2E9QA 3VBOC 5AFEA 1WHUA 1ZZ7A 5CVJA 4COZA 4V1PA 1BCXA 4LPLA 5DS9A 2YV8A 4AEKA 1FOYA 3WTTC 4XIDA 4BQAA 1ULEA 1DPRA 3CCVI 1W36C 3GZEA 3C7GA 3QBQA 2YFUA 1OYWA 1XDUA 3PFIA 1LFPA 5GLWA 4ZJZA 4RSUA 5AONA 2OQ7A 2DTWA 4UBGA 2VNOA 2R7FA 5F5AA 2R1BA 3M1HA 2RV9A 4IL7A 3LAPA 2R93J 4XXAA 1ZBE3 5M0TA 3I7DA 1NA1C 3JRAA 2HEWF 5IVJA 3I2OA 5FO9B 1R58A 4ZYHA 1T2KA 2JA8J 1KU9A 5D6EA 5M5XJ 2IGMA 2XMLA 2VZVA 2YPJA 1RUG2 2LKPA 4JHTA 1E2XA 2WWJA 2WYSA 2NNYA 5FO7B 2FQ4A 4K8RB 3NV4A 3CCJI 3DTKA 1JI8A 1J7KA 3LFMA 3FHAA 3PNTA 3TN93 2BY2A 3UJQA 4YGBA 2F4MB 5F0HA 5FY0A 3IBMA 1JYTA 5T3NA 4YW7A 3I3BA 5FO8B 1ETYA 1A35A 4ZC3A 2WNOA 5CFDC 4KWUA 1CX1A 5IJRA 2AQFA 1N1SA 3FLRA 1EKEA 3PQJA 1TQIA 2LC2A 4HSTA 3VBRB 2IXCA 4MIMA 1ERDA 2H0BA 1FXZA 4YG0A 1ZBE2 3HGYA 5DDGA 1XE7A 4XBQA 5BNPA 4X1EA 3CC4I 3HOZJ 3HC7A 3BWGA 3LB9A 4PQQA 1K5MA 3O6BB 1V6IA 3GTPJ 1GWLA 5J1RA 2G19A 4XZUG 4CU8A 2Y8KA 4KU8A 1IS6A 3RCOA 2X09A 1OQDA 3I4PA 2B42B 3NJXA 2BVLA 1A6CA 4XUNA 2RR12 3THDA 4YVSC 2LKSA 2E2JJ 4IGOA 4CRQA 1C5HA 1IAWA 4K9SA 4RS5B 4KJZA 2GNTA 5TSWA 5FZ6A 1XCVA 1KU3A 4PJJA 1W9SA 2HVRA 2C0ZA 1R1ZA 3LSGA 4DS0A 3HR9A 3FXKA 1UCXA 5L9BA 1LCLA 3AZXA 3I53A 3ZKYA 3LCPA 2JDHA 3RZMA 3V7RA 4AGGA 2ZJCA 1IV6A 3ZN6A 1IGNA 3OUJA 1B9NA 2NN8A 4Z1VA 2TEPA 2K5CA 3JRDA 1FMVA 3FN9A 2IXJA 2ORXA 2OUJA 3K51A 2ZJRF 1KGSA 2H8RA 2AGSA 2V09A 4M71A 1ZBA1 4BIFA 2E2HJ 1DBNA 2MG4A 4XE9A 1P4AA 4BZ4A 1WJEA 1JJ6C 1N47A 4ZXKA 2Z4FA 3ZFFB 1RESA 2QENA 3TGNA 1DYPA 1EP0A 5FAXA 3MFKA 2EV0A 3ZDSA 3IIIA 2GH8A 1UHWA 5LW9A 1RMU1 3GLLA 3QYFA 5LA9A 1KONA 1GOGA 4KDPA 4R4XA 1RRJA 3MIGA 3OG2A 2OTJI 1KD7A 3OIQA 3VGIA 4XUQA 3HPHA 1RHI3 4OUEA 4M3CE 5K8SA 1TW2A 2NOGA 4K20A 4WVMA 2YGLA 3KV5A 3NQOA 5T5OA 1FTZA 1I1GA 2IPQX 3U1DA 5C4WC 4RLFA 2ELHA 4Y52J 1YLLA 2PAEA 3B9IA 4QDQA 2EA2A 1TNFA 2EZIA 3O1OA 1LODA 1YJKA 2DFBA 1K78B 3MMYB 4TSVA 5I91A 5LHHA 2Q8DA 3I59A 5ACA3 1X19A 4H7LA 3KYDB 5EIYB 3LNQA 5A32B 2UY9A 3AMNA 1QHHD 1VAKA 5EGOA 1WLTA 1RXFA 4Y20B 3WTVC 2R7VA 2ZMEB 1HDPA 5DUKA 5FMDA 1ZVFA 4QPGA 1XGOA 3O3KA 3S32A 1AJOA 3FXMA 4JX4A 5EJ3A 3PUIA 2A6ZA 3GJBA 4FCAA 2FOKA 3NO8A 3DTIA 4BA6A 2DN0A 4B7EA 4DMIA 4L97A 2WIIB 2A3SA 1FX5A 3DKYA 2H6CA 1HCRA 2XJUA 1F5FA 3JB4C 3UKGA 1BIBA 3L2WA 2GA1A 5JPNB 3PMSA 1MEC1 2X6WA 2Q8KA 3FHZA 2W82A 3PU3A 2RVAA 2ZHMA 2LBFA 3L9JT 3R61A 1RGSA 3ATGA 2R063 4ENNA 2VN2A 2JVHA 1CZVA 4BLIA 4CDQC 3DU6A 1NCRA 2ET1A 3ACGA 5ABJC 3HTUA 3Q9SA 3SHFA 3LEIA 4AWXB 2Y64A 2LYCA 5DCMB 3HMYA 2HWF3 4M00A 4NR1A 4O61A 1UX7A 1W39A 4LO4B 4HXCA 2VBWA 2VMEA 3ZO0B 2EIDA 4NN0A 1OYIA 4N53A 2NVQJ 3WQ7A 4A2UA 2WJSA 4LBNA 3GTMJ 2UURA 4RL7A 1UPSA 3AP9A 4XORA 3VL9A 1G9DA 4IHVA 1ULPA 1W2NA 1S0BA 2WKKA 4Q4W1 5FZAA 1OCOH 5DEQA 4Q4V1 2M5WA 1GDTA 5ED4A 1DGWX 4FTSA 4AI1A 5HLHA 1OOPB 1OH4A 1YI2I 3MV11 3SJMA 5CQGA 5C5UA 3O0WA 4IV1A 2CTVA 1S0JA 2VBDA 2FDHA 1UG0A 4M73A 3RDIA 4YFXF 5C8CB 4CDWB 1SCSA 4K21A 4OI0A 5J48A 2E60A 2ZGLA 1WJCA 4H0EA 2V5YA 1OC1A 4LBQB 1FSHA 5F39A 5CFCA 4IEOA 2QKDA 1A31A 4XAEA 3NAUA 3JRGA 4FFGA 2BW8A 5K0UB 2A3XA 5DMYA 3H1WA 2JTVA 1ZYRF 1JJ8C 3PO3J 1SDWA 4RYDA 3L2HA 3ILNA 4JQRA 1SD4A 2V1NA 2ETEA 4HNTA 2R5ZB 4LUKA 1ZN2A 1C1LA 2JEMA 2X05A 3J4UH 3I8TA 5H6QA 2NVUB 1J3QA 4QX7A 4GWNA 2OX0A 3J81Z 4XMIA 4XKBA 2WFF3 1R081 1W8ZA 1U2WA 3ONQA 4GALA 3ZYIB 2W46A 1BBYA 5DZEA 3J7AO 4FASD 2PAKA 4NRPA 3V8LA 3ZMNA 1U5TC 4CCNA 1OPMA 2J7MA 5CYVA 4CP9A 5FRMA 4JOMA 2BP6A 4D94A 5FREA 1AR91 2G7HA 3VDDC 2G9WA 4XQFA 4EEFG 1O6UA 3KZ4C 2L4AA 1RB8G 4XJZA 3OMYA 4KISA 3COAC 5D6FA 1CN1A 4MGQA 2XAGA 2JDUA 1OSGA 2JXAA 1JZ8A 3ZIWA 5FXZA 1OH3A 2YU2A 2WFF2 1UY4A 2BTVC 4AYUA 1DP7P 2WZEA 4C3JJ 4MO7A 5EV7A 2FD5A 1R9TJ 3B6AA 2E1CA 4HAMA 2CQXA 3AFHA 4RQPA 4DFSA 3BOPA 2CJJA 3GW2A 2QNKA 2A75A 4A0XA 3CCMI 3V56A 4LQRA 4ARXA 4XLAA 2XHNA 2EV6A 3KT7A 1QQP1 2LUWA 4PK4A 1TVGA 4P02B 2EAAA 2VZSA 3S1QJ 3ZN5A 2D6MA 1K7AA 1ASJ3 5BNPB 5FZIA 4JGYA 1FJLA 2F5CA 2JWTA 3E5QA 2QSHX 3ML6A 4XFFA 1K5MB 1GXPA 1FX7A 2HXIA 1OCTC 1QOOA 3RKQA 4A6SA 2DLLA 3M7AA 1RUD2 1K45A 1BC8C 2VVDA 4OULA 2IXHA 1XXNA 2IFWA 4IO9F 3FHIB 1OD3A 3LQCA 2GN3A 1NG0A 5KAFC 3HOXJ 4ZTFA 3WNKA 3BR5A 2P7VB 3BTJA 3PJRA 1PNFA 3LA3A 3KV4A 2DDUA 2RS11 4UBHA 5FZ1A 2K9SA 2HWC1 2NLRA 1X3WB 1ON1A 2ECCA 2VM9A 4Z6YA 1GQGA 1FPN3 2ZTNA 1PVC3 2A6XA 2JWPA 1VI0A 1KDKA 2CV6A 4BISA 4LLLA 1XPWA 4XJUA 5H9RA 4HT1T 5JXGA 2RQPA 3OYHA 4NPRA 1G3TA 4MXWA 2P4WA 2W24A 3VB2A 1IN8A 1WLCA 1UF2C 1LOGA 5CNAA 5F7UA 4UI9L 2L0KA 2A6HF 1SBFA 3CCSI 4B43A 3M07A 4IEWA 3H8UA 1OQ1A 4A3ZA 4DY5A 2IRFG 5ILSA 4FPKA 2EWNA 4IUGA 2RDNA 5A6XA 1URXA 4CZCA 2WZR1 4LIVA 3JZVA 4Q5OA 5J3UA 4HBLA 1WCDJ 1RUC1 2MEV3 4YGEA 1UCRA 2VOTA 2RNJA 5KC5A 4NVPA 4U0WA 2WR9A 2FQPA 3RSJA 4RA2A 2MA3A 4WVMB 1N3QA 2XB5A 2XRNA 3PTYA 3BPXA 3N9QA 2CSGA 4GWMA 3NARA 1PNGA 5HLTA 4DRRA 4TZDA 4RB3C 5IK8A 5FZBA 2IBDA 3KYLA 3OBAA 1PVXA 4AFDA 4HOBA 1BMV1 4TLFA 5FUIA 4C0BA 2VKDA 1U9NA 4AGVA 3AL6A 1HXS3 4Y1ZA 5EGOB 1Z3XA 1MD0A 4IJAA 3H9AA 4QXBA 2JG8A 2BBAA 1X9TA 1VR3A 1JYCA 4QPGB 3O1SA 2LMDA 5CKQA 4QPIB 5A6ZA 2MEV2 4Z92B 5FFOC 3ETPA 3HB9A 3K10A 3SEZA 2QBXA 4P9GA 1DLCA 3CC2I 3WW4A 4HKOA 2M30A 4BMEA 3DCFA 3UR3C 2VKVA 2QVOA 2KPMA 2VZQA 4M72A 2QSGX 2VQUA 4FQGA 2VASA 4A3LJ 4Q4Y1 3HKZN 2W57A 1LTEA 1N1TA 2K3PA 5K7ZA 3A1YA 1FYKA 4YM0A 3KP7A 1ZYBA 3MIFA 2FCVA 4UFHA 4YG3A 4CZSA 4DNYA 1IPSA 5E8AA 4HF1A 2YC2A 1Y43B 2GMMA 1CR7A 3TEXA 4M9ZA 5FP4A 4QTRA 1EV11 3CMAI 2CSOA 1AR82 3ZM8A 2GDFA 3OV8A 2A5ZA 1RVF1 3W6KB 3I3QA 4CU6A 1LOEA 1ZRCA 5FWJA 3I54A 5A3UA 1SPPA 3VOEA 1OUXA 3R05A 1XC6A 3S8PA 3JBG1 3P3NA 2OD5A 4I6ZA 4CSWA 1NCRB 1N1VA 2O03A 1I1SA 2HLEA 1AR61 4Y3OA 1FZPB 2B7EA 3KLOA 5LRSA 1ACCA 1PUEE 2XJQA 4EE2A 2DDBA 4CDUC 2R0QC 4G9SB 4L5IA 5IT9K 2IS6A 2UXXA 1Q8OA 2WNUA 2IJLA 1XSRA 5F6KA 2QDNA 2IUWA 4P5YA 4CCOA 1WVRA 1AXZA 1FNZA 2E1OA 2DFHA 1DQUA 2VC1A 4XTMA 2XJSA 2PN5A 1TLHB 3EETA 4EJUA 5F3IA 4QB6A 3S2DJ 4N43C 2YPRA 1X50A 2V4AA 3WLUA 3PSFA 2MYSA 4QPYA 4G94A 4OCTA 2V72A 2C5DA 4M9SA 5GLVA 4J25A 1ZR4A 3T2PA 5FZCA 4GKXA 5C3PA 4LG0B 3AC0A 1XYPA 4ONUA 3SNMA 5L19A 2Z33A 1S9HA 3CU7A 4CEWC 1EH7A 4BH9A 4IHXA 3PTRB 3ZXGA 1AYM1 4XETA 1PZ7A 3NRVA 1NE4A 3SEPA 3CCQI 2JE9A 3POBA 2K2SA 5LBBA 5FOJB 4ZY9A 3OD0A 1SLLA 2D5VA 3Q8CA 3HUGB 4IHWA 2RM22 3AP5A 3O5SA 1AX0A 1NHAA 3DEUA 4E9KA 1SVLA 5JOZA 2RREA 1FSEA 4LKFA 1XG1A 2VULA 1R64A 2FOWA 2QGUA 3QOPA 5E18F 2QZ8A 4ZPIA 5D8LB 2E33A 3HBLA 2VTXJ 3S7IA 4XHXA 4KITB 1TP4A 1H2NA 2D5FA 5FYCA 4YFNF 5A2QZ 1MZEA 3ABUA 1RUH3 1B09A 1A8MA 2VVEA 2YU1A 3HJRA 1YIPA 4PLOA 1MQTA 2XGDA 4FXGB 1ZARA 3PUFA 2WB1A 5A7SA 2JRMA 1NE6A 4C90A 3HVDA 1J59A 1DDLA 4YVWC 2KJCA 1V6NA 3ZQFA 4HG6B 1SFOJ 4H7MA 5FR3A 3DPUA 5M3MJ 3MIHA 2BV6A 4AHZA 3P9IA 4A41A 4CP9B 4QHZA 3DU5A 1D3YA 4LK1F 1MS5A 4ENMA 5B2GB 1RUG1 3IAS2 1RUOA 5JZGA 3HRSA 4YW2A 2BGOA 2YZ4A 3RQ0A 2KJBA 4FOYA 4M01A 2ZBKA 3VZKA 4CH7A 1UN1A 3K2OA 3IMMA 3CO2A 2EQRA 2YR2A 3HT1A 2VMCA 2BNOA 4KGGA 1W6MA 3ZQ7A 2IEKA 3CCEI 1YW7A 3TBIA 2HYXA 1ZGJA 1F1ZA 1ZRIA 5C3SA 5LGUA 3DBHB 3LFKA 1UQXA 2KRCA 4XF3A 1B6AA 1AVBA 5F5IA 1GV5A 4DJAA 4IF4A 1ZBE1 5F3CA 3K46A 2A61A 3JRHA 4LULA 2EXJA 4RQPB 2UUZA 1BC7C 5JLVA 4LBLA 2XKOA 2X1EA 2ZJPF 1MBJA 3VBFB 4YW3A 3KGLA 3F8CA 3LEKA 2YROA 4XJ8A 5FJKA 2LTNA 4IRHA 3LPGA 3CQZJ 2P3KA 3NJYA 3H7JA 5FY7A 3OYEA 4JGYB 4UW5A 3BUCA 2JA2A 4BEHA 2RR11 1UJ8A 1I5PA 2CY6A 4AF9A 4NRQA 4URAA 3H8XA 2TBVA 2EINH 2X85A 4IL6C 1MGTA 4BQXA 1PO22 2R49A 2VW1A 3G6JB 3WCSA 5DUUA 1Y7BA 4D7NA 3T1MA 2L02A 2CO5A 2JSPA 4SBVA 3ILRA 3K1NA 2BGCA 2VZ1A 2EIBA 3FBNB 3B6CA 1GHCA 5EG0A 2KHMA 1U3EM 5A33B 4OMYA 5DUVA 2PMZN 4L99A 2VI6A 4RGKA 3WNNA 1GMMA 3S1RJ 5JMOA 3HG9A 2AH2A 1HBXG 5J1UA 4I01A 3JTHA 3QRFF 1POV1 4HX7A 3U1XA 3A03A 2AACA 2QBYA 4M9XA 1QQIA 4B4QA 4COWA 2QUFA 3DQVC 2YC0A 4E70A 4U0YA 4MG2A 1JOBA 4I7HA 1T0FA 1W03A 1FWZA 3FDYA 3T2OA 2QQ9A 4EV0A 1MBHA 1LHNA 1JZ6A 2R5YA 1VMJA 3RWNA 1G7YA 1BI3A 1CJPA 1Z78A 3RG0A 5JI6A 1B8IA 2ZZQA 2P8TA 4YW1A 2XUBA 3UGHA 5JXJA 2ZEYA 2ZBJA 1A34A 2ZMLA 3WVJA 4PDWC 1SMTA 3L00A 2ME6A 3TQNA 3FM5A 2VT2A 5JSRA 1XOYA 4DQAA 5K5OA 1UY0A 5CADA 5L36A 4DIQA 1CPNA 1R6RA 1IRZA 2NPIA 2QZ2A 1UMQA 4XN0A 3S3NA 4BL0B 3GZNB 1H30A 4Y4RA 3GF2A 2DI3A 4AI0A 3RWKX 3WCRA 3ST7A 1D4M2 2RHPA 1A8DA 1LHOA 1MACA 4BE3A 3GCWA 1QJU3 5ICFA 2WSVA 2I5UA 2ILMA 3N9LA 3A2KA 2E7WA 1UAIA 5GZFA 1PIV3 1HLVA 1ZGWA 1ONVA 4AL9A 2CHHA 1UAAA 1WMEA 3BPVA 3ZR8X 3PVNA 4LLFA 3SDBA 1Z67A 1MS4A 2DURA 4P14A 3QYEA 1G9CA 2GIZA 3K6GA 1NAEA 4LB6B 1LHVA 2CMPA 3KHCA 3K4ZA 1NXMA 2AEZA 3D8CA 5FFZA 1BK0A 1VQ5I 3HL2A 5T5LA 2QA4I 4G4FA 4LNVA 1UOGA 3HIFA 1Y39A 5DQ0A 4JV4A 4CDXC 4BU2A 1UY1A 4XICA 2Y0SA 4KYWA 5FPVA 1NT0A 5J98B 2XVLA 3WUDA 4OOIA 5FY9A 1D4VB 3GDBA 1PO12 1SPPB 3C7HA 1H9GA 4XXPA 3M7GA 1HX6A 2VMHA 3BOQA 4XLHA 2X1CA 1IPKA 2KFDA 2AR6A 4XCBA 1G3SA 2VU9A 4MQ9F 3KP4A 5IYBJ 3GCMA 3WOGA 4IV3C 1IXRC 3OEAA 3ZVXA 2FQ3A 1PP7U 2FBKA 1W2UA 3HSRA 4XKCA 3AFKA 1T38A 1TE1B 2X9DA 5D5UB 2W95A 4KN7X 3EJKA 1ZLKA 4ET7A 2HKXA 1TMF1 4MO3M 3HRMA 2EILH 2P6HA 4EQQA 5DAVA 5FZ7A 4FTHA 3C7JA 5C3OA 2QKLB 2CUJA 3GYDA 4XRFA 4D6SA 2QSFX 4X8PA 3DYOA 3UKVA 3E6BA 4IXAA 2M3AA 2TUNA 4KNCA 4KICA 2HTSA 3NWSA 1YJLA 4RHV2 2A05A 1MVEA 3ASIA 4Q1RA 4YFWA 3WDVA 4XQDA 5B4XA 3AZWA 3FJSA 1ETXA 3R60A 2GMEA 1SFKA 5IT6A 2DFCA 1BLZA 4FAGA 1X58A 2WAEA 2KT0A 4W1UA 5LBQA 1ZA7A 3O0XA 4C1WA 3O1RA 4LJHA 3W58A 5HXVA 2Y33A 3FX3A 1MNEA 5FLXK 1V6OA 5HS7A 1MJ9A 1PM7A 5DUXA 4GD4A 1IG0A 3SCHA 1WI9A 1OKRA 1OCRH 2W00A 1AUYA 3S2WA 3EYYA 4A69C 1LE8B 1DP0A 5L3BA 1B35A 3ZX7A 4EZHA 4KMQA 5E3MA 4HNVA 3APBA 1MQTB 2IVIB 4Q47A 2IXKA 4HSLA 2KLOA 3G1LA 1EAH2 4Y5Z0 3VWBA 1MVQA 1VBC2 4PCQA 2NYYA 2C24A 2ZGOA 2AYHA 3LWCA 4U7DA 2MD5A 1X2MA 2CWMA 5DM6F 5BNQA 1BR4A 2STTA 1GV9A 2H94A 4RM3A 1XRUA 2V4JC 4RB2C 3LSHA 1E0EA 4HBNA 2GC1A 2JKBA 4QPWA 1DGLA 1UZ0A 1P8JA 2MW8A 2VJ5A 3JRBA 3UYJA 1W6OB 1IN4A 4WX9A 1BZWA 2GM4A 2VUCA 3OYDA 4Q26A 5AFBA 3QWLA 1W6MB 3J7AY 3Q9OA 2KZGA 5HDKA 2HNHA 3IP4B 1E17A 4ESJA 1JTYA 5D21A 1W7PB 3GFIA 2J1UA 5A1FA 5IYYA 4AEDA 3WTXC 3AMPA 4YRDA 1JTXA 4OI2A 3H5NA 1Y9MA 3VZOA 1W05A 3OPZA 3OYNA 5ERIA 3VSKA 1RPWA 1ST8A 2ZGPA 5DABA 4IQ4A 2K3FA 1Z21A 3W5MA 4CPBD 1H0BA 1QY4A 2SBAA 4II2A 1W8HA 4E7ZA 3LAGA 1HQLA 1VQNI 4PJYA 4DPNA 1E5SA 1RUD1 2QZ3A 2PLYA 3VZLA 4KMUX 2VBPA 2FBHA 5E6HA 1XX5A 2VXJA 1YI7A 2QDRA 4GZ9A 1VAVA 4PJMA 1NCQC 3QACA 4QX8A 5F0FA 2QQNA 4QX5A 4QM8A 3LMMA 3UGGA 3I0TA 4AEJA 4AVZA 1R093 2QWWA 2HZTA 1OBNA 5FP9A 3DYMA 3H0OA 1XNDA 2VE9A 1HB3A 1A04A 5JVTA 1MDMA 2NS7A 5DYMA 3FC0A 4CO8A 5CVRA 4BPZA 1QU0A 1D7PM 2F4PA 2JIJA 3AG2H 3L7WA 1YXWA 3S5QA 3KB5A 2ADEA 4RS5C 4NE9A 2D3PA 1NQJA 1LNWA 3Q0VA 2DYRH 2VTFA 2JA7J 1OI6A 2DCTA 3EUHC 2CRGA 2BV4A 3ZMZA 1POQA 3IUOA 3PIGA 4KT6A 3N9NA 1J58A 2QQLA 4FPCA 4QQOA 2IA0A 3QQAA 1PJRA 3V7CA 2AZ5A 5IK7A 5BNNC 4QSHA 2X8KA 1R4NB 5EFUA 4HOOA 3T8RA 3KZIC 4C3HJ 5IK5A 1PM4A 4KUMA 1R092 3W2WA 2WBMA 1OKOA 1ZH5A 1O3SA 1GFF2 1S0GA 4ZS3A 1HF0A 4AOCA 2R5YB 1JKQC 3KP3A 2Y6GA 3SCGA 4J01A 3ZFFC 1HKSA 4PJNA 4KG8A 2HI3A 4PBPA 2JG9A 4XF0A 5LHIA 1VE0A 1TEIA 4QPOA 5DUIA 2K0GA 1Z05A 2DU9A 3E7LA 4C0HA 4DXTA 1AR73 3BN6A 4XEZA 1Z0HA 2P17A 4BCUA 1BOBA 2D98A 1D0GA 5KVRA 4K1YA 4WZCA 2UXNA 4AIDA 1W36D 1RZ4A 5E1ZB 1EH8A 3VKOA 1WW7A 1GSLA 3A21A 3MAJA 1Y0NA 4B8XA 5C3RA 3W6VA 3ZXEA 2MEV1 1I50J 5E8IA 4B09A 1RITA 4XOTA 1CD3G 1YC61 4RS8A 4QU1A 2K9ZA 3IDBB 1JOPA 1VQ7I 4MGRA 3PUQA 2V1DA 4RAZA 3AJZA 5GKAC 5KWRA 4QGMA 3ZOBA 4IEZA 2XSJC 4I3GA 1YW9A 3NJZA 4LTAA 2LY9A 5H9SA 1APNA 5B1AH 2ZMEC 1AR72 3WX5A 2VUJA 2DBBA 4M0NA 2ZX3A 4P9XA 1LFBA 3NRUA 2QQBA 1BR1A 5B4NA 5KHIA 3FKIJ 2OBPA 5I0RA 1AR81 1VPHA 2YB7A 4AI8A 4EJWA 5LBFA 1SG3A 2ID3A 2PYTA 4Q4ZF 3LDKA 1BI0A 1MS3A 1H2LA 1IW7F 1HSJA 2UYBA 1V6MA 5TRDA 1UHMA 1W7PD 3VLBB 4A7ZA 4RD7A 1UZCA 1VRBA 4UAPA 3HQUA 1RC6A 1R5GA 1SVOA 2L5QA 3D5SC 3NV1A 4AM3A 2HWD2 1YW8A 2OPTA 1ETOA 5CIRA 2AREA 3HT2A 3LSJA 2JZYA 2WA0A 2RS53 2FDIA 4NIHA 4P9FA 3TO7A 1D8JA 4BMBA 5D2AA 4LE3A 3U1KA 5L3FA 1O7FA 2W1UA 2ZGUA 5C33A 5DV5A 3RZKA 3NAPA 1AL23 3MZ8A 2IZWA 2D2WA 3TW6A 1Z3YA 3HJEA 2DCJA 5C4JJ 5E8GA 1W6NB 3I71A 1VMFA 2OVUA 2YX7A 2FU4A 3VB9A 1KQ8A 2LKXA 1S1AA 4EYUA 3M1CA 1WUVA 5D8AA 1RUI3 2FDFA 2GMPA 1KS4A 1QJY3 2JVGA 5L3GA 3DWLE 3Q5FA 2DUOA 2WY8Q 1QU3A 2RS52 2FMYA 1JE8A 3CJIA 2RM21 4INDA 5E3OA 4XK4A 3HKZA 4FPGA 1W1WE 3E6MA 1ZRDA 4U36A 2CUEA 3RI9A 4IHYA 3WE3A 1OKQA 2VZTA 3N7MA 1JXNA 2FHRA 4AVSA 3D82A 3CDHA 1UZVA 4WM7A 2CV2A 4L0YB 2FCTA 4MEXF 4NQWA 2D6NA 3HOUJ 2HPIA 5KHKA 5GAGJ 1WKMA 1Y9QA 1LENA 2CQKA 2D93A 1TNRA 3ZKUA 5G05L 3EQEA 5K0UC 4L92A 4COUA 1RUI2 1E57A 1VF9A 3GX4X 2JIGA 3WDYA 3R0AA 1ULFA 1IS5A 4UOJA 3FL7A 4F93B 2QQKA 3MPBA 1B35B 5DDJ3 2BVBA 3ORJA 1KQ0A 4RR3A 3EXUA 2JK3A 3ZYHA 2D3RA 4AIHA 1SFPA 1CAXB 2GXBA 5L3CA 4EGZA 2RG4A 4FT8A 1OXCA 3FMRA 1GUUA 1TL8A 1STMA 3DCQA 4J19A 1EPZA 2IGOA 1IQAA 2J1SA 3HGGA 2R6QA 5CLSA 1ZZCA 2QFEA 1U6GA 3HRUA 3BG9A 4GQ7A 2RS32 4U2AA 2LVSA 4OIQF 2IA2A 1GOHA 4B1LA 4DINB 4N4OB 1SFXA 4OMDA 3GBGA 5HLGA 3WP5A 5C5TA 3CL1A 4QDRA 1D0HA 2XH6A 3ERMA 2A3YA 5DDJ2 1W8NA 1MIJA 2EB7A 2CUZA 1L7QA 4CYCA 2Q8EA 2OXBA 3J7HA 4MFDA 5GAHJ 4D0QA 2VBBA 1HRI2 2DMUA 5AIQA 3H5AA 4F52A 4E6KG 3KIOA 2VJIA 1XMAA 4FFHA 5FYSA 3TAYA 3RI4A 1PO21 5LASA 3SLIA 2UWMA 5T54A 4HX4A 4AI2A 4AC0A 2VL8A 5BY5A 4P9YA 1SHWB 2C1FA 3CKHA 2XGEA 1WJBA 4XILA 5ISLA 3WNLA 2Y2ZA 1FV3A 2ZMKA 3JSPA 3H9GA 1W0UA 3UK9A 4A5NA 4PBOA 1ZBA3 5IVCA 4WK8F 1AXKA 2VOOA 1QOTA 3A02A 2VQTA 2KIQA 4FX4A 1HC8A 1IZ3A 4C8DA 4UV8A 2WUHA 4MGZE 3MLKA 3ZXFA 5CG8A 4QKBA 2R7DA 2P5KA 3WG2A 1AA7A 4Y33A 1JUPA 4HETA 1HV1A 3I2DA 3LA7A 1ENSA 3P7NA 2Q5TA 2O5RA 4RGAA 2V1UA 3V0AA 3DEWA 1OUSA 2OQ6A 1CQTA 4K8FA 4NC6A 1SC7A 5FCCA 3BG7A 3F8NA 1UU6A 2XPJA 1PX3A 1NA1A 1YJNI 4Q48A 1JS9A 1VQLI 3EHKA 1MS1A 4DXZA 2EXHA 2DFFA 4CP1A 2PFWA 4EWEA 3VYSB 3ABZA 3F21A 1OQYA 3B00A 4MVTA 1MJAA 3VKFC 1V70A 3IIAA 2O0YA 2GAUA 2VCAA 3FBMA 2COBA 2ZKZA 2VE8A 3VD4A 4BY1J 3KVAA 4YGCA 3EDPA 1VLNA 1KYWA 3B7MA 1ND2C 4FSJA 5A3TA 2XROA 4BXSV 1N25A 3AMMA 2DPUA 1GICA 1GANA 1YQ8A 2PXJA 1Q5OA 3MKYB 2RDQA 5CFDA 4ZS2A 3LGRA 3IAPA 1D4M1 4YFZA 3RZLA 3WU2C 4WVVA 1X3UA 3PVEA 3J7YJ 1F4HA 2R072 1PGL2 4DEVA 3THPA 3ZFGA 3M3IA 5K7HA 2WT0A 2ATFA 2H09A 2EXKA 1F15A 1R1VA 4EGYA 4MHUA 3HWJA 1VTNC 1Z6RA 3E97A 4AFCA 4U7BA 2YUSA 2ZXWH 1WW4A 4OLLA 3AL0B 3M8FA 1FNYA 3KQRA 5IVVA 4AVAA 2GWRA 4RB1A 4YVSA 5EHDA 1LDDA 4Y5SA 1Y3TA 1J2XA 4FISA 4DGWB 2MFZA 2IC1A 3BTCA 2O3FA 2CFXA 3SH5A 4NPMA 1WMXA 1REDA 5A3MA 4QPIC 4B3XA 2N8GA 2W1QA 5FROA 3BKZA 4J1WA 2EICA 1P4WA 1UL9A 2BE5F 2VZRA 1YYVA 3WW3A 4YYOA 2QQUA 4XCAA 1PO11 4J6GA 3RQIA 3U10A 2DA2A 5IOZA 1AF9A 3LKJA 1H89C 4FBFA 1DF0A 4AYBN 4XN3A 5EJCA 3H92A 1RKWA 3HHGA 4Y1YA 1C1FA 3JXSA 2A73B 3AYCA 1ON2A 2ZCWA 5IWFA 2RV8A 2GSYA 1MMNA 4B4CA 3FXUA 4Q4W3 3VHOA 1QA6A 4BHPA 2DMQA 2QVSB 2W84A 4Q4V3 2TDXA 3WD5A 4MX3A 5E1XA 3GTJJ 1DU0A 1BN5A 4R1HA 3WTWC 4L18B 4Z2AA 2RJ2A 2ME0A 1NCRC 3USUB 4CP0A 2VAUA 3VDCA 2F5FA 3VD9A 1GP6A 3KCYA 3OD4A 1AX1A 1LDKB 5JI7A 2F17A 4QX2A 4HZFA 3MBWA 2R4GA 2HTJA 3DBRB 3NAPB 5C4WA 3LOIA 2M7AA 1MMDA 5JOWA 4NAMA 2PMUA 1QVUA 5FJ8J 3LPFA 3SXWA 1T56A 5KR7A 3N7KA 3KEOA 1K79A 2F6BA 2ZGNA 4LHKA 3BCWA 1KFUL 4RHV1 2FRHA 4O3MA 3AKRA 4P9WA 2Y75A 3L2YA 3N7JA 5IY5H 2XWBB 1YG2A 5D8AB 2D6OX 3GTLJ 1GKBA 4QLCU 1VBA1 1QWRA 3OGRA 1H1MA 3OGVA 5LWBA 5KNLA 4DW6A 3KF5A 4YZ4A 1AHDP 1P7IA 3VKMA 4D6QA 1XN7A 1I3HA 3MZHA 2DYSH 2WNEA 3KFWX 4XSXF 3CJIB 1G3YA 4JRLA 3S30A 2A6YA 2HVQA 1R083 4ZDOA 2DUPA 3KM5A 4HVRA 3PUBA 4B3NA 1G86A 4BDYA 3I3DA 1C0WA 3RYRA 3TL4X 4L9VA 2DYCA 2HDWA 5D4RA 3PNAA 4LO8A 1KITA 3P5JA 4EJOA 4QQLA 4AIKA 4BJ0A 1H2KA 2WQ8A 2DVGA 4FI9A 5EEGA 4DQ2A 2E7QA 4D5CA 1AR93 4OHXA 3U2RA 2K27A 5A3OA 3HTSB 4UV9A 1ETVA 1EAH1 3P6BA 1VBC1 2ZACA 3C8XA 5HVQC 1O3QA 2K40A 1ZA4A 4CEYB 3ZDVA 4CA9A 1D1BA 2XL9A 4IXLA 1JUHA 1IZ1A 4CDQA 5KHJA 1ORKA 1WKYA 2Y30A 5FPLA 5ABJA 1XQNA 3AYDA 2P5LC 1HDDC 5BUVA 4ZDPA 2NZ9A 1F43A 1R082 1SCRA 4HANA 2XV4S 4Y5TA 3CMMA 4OVEA 3MF9A 4EWAA 1AWCA 3WEZA 5FLHA 2CWSA 3MD2A 3AG1H 4M3BA 2IWGB 1WCSA 2DWRA 2ETHA 2VT3A 3O1PA 1QHDA 2K85A 5F04A 1ZAOA 5CA6A 1MMSA 4A3CJ 3SYTA 1Y6IA 1WPKA 3PIOF 2VY0A 1T95A 5FYYA 2JUGA 3ES1A 1XSDA 4MGIE 4QB1A 3T2TA 1J9IA 4UVCA 1QQP3 1TWGJ 5IFTA 2GNMA 3K9TA 4ARYA 3N9MA 4L8QA 4E7IA 4XBNA 2VW2A 5GALA 1DQ4A 2AXTC 2WQZC 3WZ1A 3G71I 3IPVA 2Q8CA 2IT0A 1OURA 5FQ0A 1QVTA 4B7KA 5FYIA 2PI0A 5F2SA 3B93A 4CYCB 2EA7A 1R49A 4BDZA 2J1RA 3PUAA 5DCFA 4B29A 2QE3A 4FP2A 1FBQA 1BJQA 2H6BA 4LD5A 1VB2A 4HDUA 3HSFA 3H36A 1F4AA 3CBNA 3AKPA 4JZRA 4G3YC 1ZGAA 1TC3C 4NBQA 4YW5A 3PMEA 4JKKA 2C9AA 2RS13 3CNAA 2VPLA 1J75A 5BYNA 2HWC3 3C2UA 1HXDA 1SVMA 4KWJA 2UV1A 1FOWA 4FPJA 2IW5A 3F6OA 3G1OA 3QPTA 4LIUA 1YIJI 1ZREA 4M4RA 3VBFC 4L2NA 3LSPA 2P6TA 3S2HJ 5SV5A 4XFAA 4HPKB 3CJXA 1ZZ9A 2CFOA 2D97A 3WP4A 1JTZX 1KGYA 1VALA 4Q4X2 2R1DA 1Q1VA 4KWLA 2KZVA 2NVTJ 5JUVA 4LHSA 1QJEA 3FXJA 3MUZ1 1U5YA 1YHQI 1H2MA 3G6EI 2I10A 5DZGA 1R22A 2TCTA 4G6DA 3C3VA 4ASMB 2FX0A 3WG3A 4H55A 1BEV1 2W68A 1U5TA 3L9FA 3AZVA 1QO0D 2OTLI 2RS12 1RUC3 2VW0A 2AUYA 1SLCA 2HWC2 4PIYA 1U8BA 3S6PA 2STWA 3W2AA 2WC2A 2KA3A 3VDDA 5JXHA 1R091 4KNYA 3T3YA 3G73A 3V0AB 5A1LA 3KWVA 1YLFA 5JAXA 1O3RA 5BPIA 4XLFA 3OUIA 5F64A 4YRVA 4RDUA 1YFWA 2MLKA 3Q9VA 4QXHA 4DUXA 2PFBA 3VDAA 1F35A 4CXWA 3MLLA 3CCRI 3M4FA 5IOYA 3V8JA 3T08A 2E7XA 3DPRC 4E4SA 3H5RA 2A6VA 2O14A 1F5TA 1CESA 3B69A 3RJPA 5IK4A 4CCMA 3VN4A 4XF9A 4YZ1A 3CZJA 3I3MA 1LECA 4ZXEA 2UWBA 3VUOA 2AS5F 2DT7B 5GPAA 5EF6A 2D3SA 4ON0A 3KE2A 1NG6A 2HH9A 2ZNYA 2EZHA 3W21A 4FPHA 5EQUA 5D5VB 3OYLA 3HEFA 3OGGA 2EXIA 2W25A 2W9XA 4A3DJ 4D3WA 4YLZA 3Q0WA 3W3CA 1CONA 2AC1A 1XSXA 3WF0A 4Q4Y3 3RZZA 3ZFGB 2NYXA 3JTGA 3GM8A 2BBVA 3V0BA 4HLYA 2E34A 4YSFA 4WXDA 4TN7A 1OA4A 4QKFA 2CW8A 5EJ1B 4IQJA 2PAMA 1R23A 3O1TA 2ZX0A 1G59A 4AQ6A 4ITVA 3T5XA 1EV13 2KIUA 2YBSA 4JRAA 4AVPA 2GALA 2O0OA 3ZFEA 1UB9A 5H2FC 3NKGA 5FLVA 1RVF3 2A70A 4YVSB 2KP6A 2MHFA 2W3JA 2IS4A 1QEXA 4D6RA 4H4KC 1LULA 3K4DA 1ZQ3P 5D4SA 2HYGD 3J7LA 4GH4C 5CG9A 1I39A 2D6PA 3H3UA 2Z2SB 2HWD1 3WTSC 1QJX2 3FISA 3G7DA 1U8RA 2CQNA 4IEJA 5C71A 4F92B 4PI2A 4XIOA 1TBXA 1PVEA 2MGQA 4H2AA 1RUJ2 3FK6A 5IT9Z 1B4AA 4HW0A 1Y1VJ 4NNJA 4D1QA 3PIPF 2ISZA 2OZJA 2WAQN 1OLQA 3MIBA 2XSDC 4JBAA 4Y17A 2ZNZA 4IE6A 1UXZA 3WW2A 3BC8A 3GWZA 2F4LA 2WS93 3C1DA 1H9PA 2EK5A 1Z7UA 3AP4A 3V64A 5HODA 4E7SA 1FI2A 3BOWA 3CF6E 2VBXA 4YZ5A 5AVPA 1H6YA 1DGRN 1LHUA 4G9YA 3WTZA 4WM8B 3ZQIA 4IETA 3AYAA 3ACIA 1KU2A 2RNGA 4JGZC 4J00A 4COVA 2P5VA 1E3OC 2DW4A 1W5TA 2OUMA 5FV3A 1JHFA 2WLPA 3BZKA 3SITA 5FTTC 4N8MA 2CG4A 2V26A 1CZTA 5FPAA 4F8AA 1BJAA 1U78A 3TO6A 4KWKA 4UFLA 5ILUA 2EBIA 2I2SA 1TWHJ 4L0ZB 4ITCA 3Q8EA 1LOFA 5FLIA 3AZZA 4HQMA 2WS92 2K86A 1LRHA 2XDVA 3U0ZA 3K69A 1S55A 4LMFA 2VZ3A 3CCYA 3DEEA 4JAAA 4QWQA 1LESA 2NS8A 3ZXSA 2WAFA 4KG0A 1BHGA 3ZLIA 3SHRA 5FGMA 2BZDA 3P9KA 3BCAA 2F5DA 1PGW2 3M8LA 2RDSA 2ZAAA 4A4AA 2YGMA 4R9BA 3RZHA 2R16A 3WF4A 1W8OA 3T0AA 2KIFA 3CO7C 3J26N 2Y6JA 4P5OA 3EB7A 2BU9A 4X0GA 4FXKB 4GULA 1XGNA 5FPBA 3AVSA 1KYZA 2PQQA 3OBRA 3CLQA 5F1RA 1FP2A 5DZFA 1M4WA 1OCZH 2HYKA 2JJ7A 1ZG3A 3SEQA 3VZNA 2LSOA 5FYMA 3IDAA 4PLMA 3EUAA 2Y6LA 3PFYA 4XW3A 2Q8OA 5FYBA 3U21A 3KMHA 1QPMA 5FBZA 2R7TA 4L11A 2A69F 1GU3A 4CDQB 2CL2A 2ZOEB 4NDLA 1Z6TA 4NWVA 2JQ7A 5ABJB 1D2SA 2LK2A 5E17F 2XONA 3GTKJ 3FFQA 3R4DB 4FPFA 4CDUA 4YM3A 3HXLA 2RS31 1TT5B 2HOAA 3ZXAC 4AAPA 4UFJA 2VODA 2KXLA 2ID4A 3WTUC 4COYA 5CJ9A 2LNBA 4EN9B 5DN2A 4O9EA 3KEYA 5GJ6A 5DDJ1 3KZZA 5I0UA 3INAA 4BE2A 1F8VA 4N43A 2OT7A 1JOJA 3NJVA 1GZCA 3IHUA 4XABA 1HRI1 3ZSKA 3FHQA 5JDBA 3MZYA 4XUTA 2DFEA 2HWB2 3FXRA 2OUHA 2XQXA 5C9AA 2RR13 1GYKA 2X0LA 3IPVB 5FQ0B 2BVMA 1FMD2 2ZZJA 4LOCA 3ABMH 2P3JA 2Y6HA 2JECA 3BROA 1YNAA 2L7ZA 1XNCA 3OYCA 3GTGJ 1TNSA 3H9QA 3URFA 2JA5J 3OJBA 4L0PA 3EBRA 5D8KB 2YYOA 4EM2A 1O4ZA 2XVKA 1V00A 4XJWA 2MC3A 4W97A 2XAUA 5BPXA 1W6PA 2R92J 5IPAA 1LEBA 3RMYA 5LK7B 3WG9A 1BKZA 4NRMA 3IAM2 1REPC 1VBD3 1MNDA 4NHJA 2XG3A 1D0