4R8HA

The role of protein-ligand contacts in allosteric regulation of the escherichia coli catabolite activator protein
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Role of Protein-Ligand Contacts in Allosteric Regulation of the Escherichia coli Catabolite Activator Protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords cAMP-activated global transcriptional regulator CRP
total genus 60
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4r8hA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4r8hA01
5JR3A 1BJAA 4LLGF 2MNGA 3HOSA 4OIOF 1V4RA 5HS9A 4EWAA 1T2KA 3OCPA 4L0ZB 5AIPA 4S05A 2F4PA 2PHLA 5D8KB 5H6QA 3ZMZA 5D5UB 1G6NA 4Z2YA 3V8KA 1ZN2A 3QPTA 4RB0A 1DZRA 3C18A 4EM1A 3B73A 1ZG3A 2RVCA 3J80Z 3J80K 2MPFA 2FEZA 3ML6A 4BHCA 2W57A 4FHTA 5LEKA 3ZMTA 3I59A 2PTMA 5J7MA 4Z07A 2HQNA 2XHKA 4L9NA 3L09A 2A68F 3NQOA 1XGOA 1F9NA 1TQMA 1VR3A 1R1VA 1S8NA 5HVQC 1UFMA 3FXRA 5DV5A 3KSCA 2G9WA 4EVIA 3ERED 3E6DA 4UXAA 1H1IA 2QBYB 3PVBB 2BYVE 4TLFA 2QBYA 2J5PA 1CF7B 1R00A 2PLYA 2MH9A 2O0YA 1HW5A 3K2ZA 1UPIA 4ZZLA 1S29A 2ZFWA 1ZRCA 2BNMA 5I91A 2Z33A 3EYIA 4MNUA 3KEQA 4M9SA 4X6QB 3RYKA 4LB5A 5L3FA 2QQBA 5K5RA 3FX3A 5JAXA 3TDZC 2CWEA 4QX5A 2GQQA 3DPTA 2OPKA 2GC2A 3QU6A 4HLYA 2PMHA 1O57A 5T3NA 1QQIA 1YQAA 5EZWA 3KP7A 1SD4A 3B02A 3CO7C 1VP6A 1W5SA 1BIBA 4HBNA 2EWNA 1SAXA 2IXKA 1W7PB 2MLKA 3E6MA 1L3JA 3CLOA 1IN6A 1YFUA 4XFAA 2XROA 3KP4A 2BNOA 5ICGA 1LB2A 3DN7A 5KHIA 4B29A 1FXZA 3K0LA 1ZX5A 3RJPA 1V3FA 3ISPA 2IA0A 3UKTA 3BY6A 1P92A 2EA7A 4QM9A 4UBGA 2NYXA 2P5KA 3ABTA 4Q29A 1J3RA 1RL3A 3KE2A 5D5WB 1RI7A 4GXOA 1USTA 1SFUA 4ZZDA 2L4AA 2OAZA 4WZCA 3SHRA 3VEPA 2DQLA 1X8MA 3W6JB 4XFFA 2Y0OA 1YW9A 2HYGD 5J8CA 2YU3A 3FF5A 2JTVA 4WXHA 4MUVA 3L2CA 3FZ3A 4D7SA 1LVAA 3JZVA 5E20A 1CAVB 3EETA 4BNCA 4M74A 4PCQA 3J81K 2M87A 1XMKA 2Z69A 1IXSB 1CGPA 1EYBA 3RYRA 4L11A 2ATFA 4XF0A 2D93A 3KCCA 1YUDA 2VT3A 3HIFA 2V1DA 4KWJA 3U11A 1YHFA 4P9FA 1HKQA 1IN7A 5J48A 2CO5A 1W7PD 3CDHA 3R6SA 3I59B 2V9VA 3LOIA 2VOOA 2KRFA 5JVTA 4CO8A 3LWCA 2XVCA 1MZBA 4FX4A 1RZ4A 3LA2A 1FI2A 2M45A 3TKYA 4S04A 2Z2SB 1B4AA 1KQ0A 1YFHA 2QNKA 3GX4X 1Z7UA 2R7FA 2PA7A 1XD7A 3I7DA 4BHPA 1TQ5A 4Y13A 3ELNA 4HQEA 3RYPA 4MGIE 4YRDA 4QM8A 2E1NA 4LK0F 3GO5A 1G4DA 3UKVA 3TDUC 4HN0A 3O2PE 2V6CA 2VN2A 3KFWX 3ES1A 3JTHA 3D5LA 5LHHA 3V7SA 1A04A 1BBYA 1W5TA 1J0RA 2Q30A 3HRTA 5J6XA 5E8IA 1ZZ9A 2K0GA 4HF1A 1MJ9A 3PFIA 4LGWA 5IT3A 3UKNA 4XRFA 1O7LA 2MC3A 1U78A 3NW4A 3TO6A 1JXSA 3E3VA 1X82A 1P4AA 4A5MA 2HS5A 4IPAA 4MGYE 5E17F 4Z82A 2ACJA 2P7CB 2DCTA 2QUFA 4CHUA 2A6HF 4Q4ZF 4UVCA 1ZG1A 2CV6A 5BPIA 4HDVA 3VHRA 1SEFA 5J8FA 1FSHA 4ENMA 5I0RA 4D0PA 3HTSB 1R1UA 1IN4A 3HOTA 3DL3A 4JV4A 1B9NA 4MEYF 3EDPA 3C7JA 4GO1A 2HFHA 4EWDA 3VB2A 1KQ9A 4E70A 1QY4A 3I58A 1ODDA 3R0AA 4M6XA 4L9VA 4E2SA 2VT2A 2CQKA 2X0LA 1H9GA 4JBAA 5ICCA 3P9CA 3PNAA 2FMLA 5LHGA 2HGCA 1WI9A 4XFHA 4IF4A 4IHTA 1UCRA 3FXQA 4DINB 3WTUC 2GXGA 5HDNA 1XRUA 2OBPA 4OLLA 1KYWA 2CW0F 2IXLA 3DF8A 1Z9CA 4KL1A 3G73A 4QXKA 1CAUA 5JFRA 3V7CA 1WGPA 2IA1A 3DXJF 1OD5A 1TBXA 1FBQA 3EUHA 1S7AA 1K7AA 2XLFA 4KA4A 1LR5A 2R3SA 2PJPA 5ILUA 3GXOA 1PMIA 3LZZA 1I1SA 2C6YA 2OZ6A 2EV0A 1H1MA 2FRHA 4IESA 3F8FA 2FU4A 1ZREA 4ZU5A 1BN5A 1EP0A 3SQNA 3HSEA 1EH7A 4MHGA 4EV0A 4PJYA 3PLQA 4E2QA 1GVJA 2XKPA 1CAWA 2XAQA 5JR7B 1YW8A 4U88A 2DFIA 1KA8A 3I64A 1HSJA 2VQAA 2XL7A 4QGMA 2HTSA 5JHUA 2VE9A 3SXWA 4H0EA 4XETA 1S6LA 2XGXA 4BAYA 1Z6RA 3EQLF 2VXZA 5I8TA 2OA4A 3C1DA 2CGPA 1QGPA 4MGKE 3T0YA 4ON0A 2Z9OA 1SD7A 4IETA 2OQGA 1I6XA 1ULYA 1P6RA 1WA4A 1EH6A 5EEHA 5LGTA 3I54A 4LD5A 3EO6A 3TNPB 1XE7A 1DGRA 4G94A 3H1WA 2KKOA 2GWRA 1XDSA 4IEQA 1CAUB 2W85A 2IPQX 3E5QA 2V1UA 1U5TB 1U5TA 2YR2A 3M8EA 3JSPA 1FZPB 1K78A 3OTFA 1FBUA 3H92A 1GQHA 5I8SA 2IJLA 4Q47A 4MTEA 2ZMEB 3H9AA 2P6TA 4JTOA 3RI4A 3MZYA 4LJZF 4XFCA 5EEGA 4CYDA 2FSWA 1BI3A 2FMYA 4N0BA 2DTRA 1UHMA 2EV6A 2IRFG 3IWFA 3L7WA 3ZMUA 4LLOA 1KQ8A 1IRFA 3CO6C 3WTYC 4IEVA 1MJBA 4FAGA 5FQ0A 5FLXZ 4AVBA 5FLXK 4PIXA 2WC2A 5LRRA 2VC1A 2VBZA 2H6CA 2EFNA 3ECOA 3FHZA 4OIPF 3FHIB 1LDKB 3WW3A 3GFIA 4PGHA 1D8KA 4PIYA 4AXOA 2HR3A 3WGHA 2PG4A 2D5HA 4FT8A 4OFGA 1Y0UA 2CG4A 4WVZA 3PQJA 3OGJA 3MDPA 3DEUA 1FSEA 1R36A 2Q0OA 3FM5A 2XL9A 4EWEA 3T5XA 6PAXA 1NYWA 2MD5A 1TTYA 1TQPA 2QZ8A 1IXCA 2EV5A 2KJBA 2OQRA 2FQ3A 1XGMA 4ESJA 1CAWB 5FLIA 4WWCA 3OF1A 3WODF 5D5XB 3H1YA 4HV5A 1BOAA 5BY5A 1I1GA 1NZCA 2D40A 2JPCA 2ZKZA 3OV8A 5DUIA 5KHJA 2JT1A 1HKTA 2DK8A 4MZUA 3BPZA 2QYOA 1U5TC 4RGRA 3QP5A 5ICFA 3FJSA 4WX9A 3S0MA 2K9ZA 5LLQA 2UYBA 1U8RA 1EPZA 2FNAA 1C0WA 3K1PA 1YG2A 2GAUA 2EK5A 5L3DA 2EFOA 1BC8C 4ZYDA 5D4SA 2O8XA 4ESBA 3BB6A 1BM9A 1OYIA 2LF7A 4ETSA 5ED4A 1REPC 3ZQ7A 4G6DA 1YFYA 3MPBA 4GGGA 3F22A 5BMZA 2IP2A 5DCMB 4GULA 2Y75A 3QACA 1J3QA 4EMSA 1S3JA 5FGMA 1R58A 1Q3EA 2K4JA 2IXIA 4P9UA 1H9TA 2VPVA 1IRGA 3VFZA 4MGZE 1O3TA 2H09A 2GIVA 1GXPA 1ZH5A 4KWLA 3ACLA 3L2HA 4AWXB 3SCFA 1R7JA 4I3PA 1BI2A 3H3ZA 4M9ZA 2RNJA 3OD0A 2IXHA 2ISYA 5EFUA 4BIFA 3CO2A 2I45A 4CXFA 1I27A 2PEXA 4HX4A 2Q4SA 1QO0D 3KETA 2XV4S 5KHKA 2OD5A 4NB5A 3BZ6A 1BC7C 2OU2A 1DP7P 3TOBA 1ZGJA 2A69F 3H1MA 2H0VA 3WTVC 2MLGA 4M73A 5ILVA 5CVVA 2PFBA 2NNYA 3BJAA 4LTAA 1DGWA 3H3UA 3HHGA 3I5UA 1IAWA 4U0VA 1Q43A 2MA3A 2M8EA 4UBHA 4PIZA 4YFKF 4KUMA 5CYVA 5CVRA 5FPXA 4N9IA 3FZVA 5HDGA 1ZAOA 4I09A 1FYLA 2QLZA 2P7VB 1Y9QA 3GLXA 4JVAA 4MV2A 2F5FA 2ET7A 1MDMA 2A3SA 4O3MA 3ELKA 2FOKA 4A12A 3G7DA 5BQTA 3KP3A 5HLHA 2BNNA 2UXXA 3SCHA 4DNCA 2ZNZA 3F3XA 3NRVA 3K1MA 2UWMA 3F8CA 5JSRA 2DI3A 5JI6A 2LKPA 4F8AA 1OYWA 2EA4A 3WTTC 1EY2A 2PI0A 5FD5A 4R1HA 5L3GA 5ERIA 3DP7A 2IA2A 1U6GA 4P96A 3E6BA 1F5TA 4ONUA 4FBFA 3WGGA 1TW2A 3QAHA 1ZG5A 3M8FA 4JTNA 1FLIA 5H6RA 1FY7A 3GF2A 4KICA 1IPKA 2KXLA 1B59A 3G3ZA 4IEPA 4ENNA 4EGZA 2AS5F 2L02A 1UHWA 4KMUX 3JW4A 4XFBA 1P4WA 1CAVA 2XAFA 5KK1A 1SD6A 4RD7A 2DAOA 2O1QA 4HYEA 1CF7A 1K6OA 3WGIA 1AWCA 4DQ2A 2GU9A 4HVQA 4OINF 4Q0VA 3IHUA 2M5WA 1FYMA 4HSLA 4AD9A 1X7NA 1I5ZA 5FD6A 2ZMEA 2GH2A 4YIFA 3O14A 1ON1A 4G8XA 1E2XA 3RKYA 1LEBA 4EROA 1OMIA 3KGZA 3P9IA 4J1XA 1USSA 3N4MA 2BEOA 4NHJA 1MDMB 3SMHA 2R7DA 4EJWA 4HX8A 2IXCA 2EB7A 2GZWA 3IL2A 3GFMA 2XAJA 3ULQB 1DZTA 4UUVA 4B8XA 2RQPA 1JHHA 1QXRA 1D5VA 1K78B 5E16A 4BQAA 2FBHA 3KGLA 2COMA 4ESFA 2Z5UA 3RKWA 1T98A 3J81Z 2C0ZA 3P7NA 3ROUA 5A2QZ 5A2QK 4A2UA 3E5XA 1FNNA 2JSCA 2DBBA 5LBQA 4MEXF 4IEWA 1G3YA 4Q5SF 5FFZA 2YX7A 4M72A 5E1WA 3R4KA 4LUMA 4UXNA 4NVPA 5BV6A 3ZN1A 1Z05A 2ZNYA 3QP6A 5TJJA 4L9TA 2L4MA 1STZA 1QXJA 3U2RA 1XGNA 5FQ0B 2BV6A 4KDPA 1D8JA 1KGSA 1UCXA 2O03A 1KU3A 5HLIA 4RB1A 3H7JA 5K8SA 5KHGA 2ELHA 3OOPA 1NHAA 1PP7U 3MZHA 5HDKA 4IRHA 4RS8A 2HOEA 2DO7A 2Q0AA 4I98B 4I02A 3LQQA 2FBKA 3EHKA 1QZYA 2ZJ2A 5D5VB 1MKMA 4YIIA 1IW7F 2HQRA 1TNTA 3KP5A 2A61A 5D8LB 1O3RA 3F23A 5BPXA 1DPUA 1CAXA 2QDRA 4ASNA 4WCGA 1RUOA 2ZCWA 2F5CA 1LRHA 2XLAA 1YW7A 2DLLA 2HZTA 1R5GA 3E97A 3HHHA 1D3YA 4XFIA 4AIKA 3FM3A 1DPRA 1QZZA 2PQ8A 3HSRA 5FFXA 3DFGA 4EM2A 1XMAA 1YO5C 4KT5C 3HYIA 1SFXA 5BPDA 3MQ0A 4KU7A 2QVSB 5AVPA 1XCBA 1J58A 4HLTA 4F7ZA 3LAPA 4L2NA 1PDNC 1R1TA 4Q0SA 2BBYA 2GA1A 3HRSA 2H27A 4L9JA 4GYGA 3BPVA 3TNQA 4ZYHA 1WRJA 2WTEA 3WU1B 2HJIA 5FB2A 1WSUA 4U0YA 4YYOA 3WTWC 2O61A 5C6CA 1J59A 1LQ1A 1QBJA 4G7OF 4UHTA 1J3PA 1RUNA 4EJVA 1HW1A 1YIOA 4ZYGA 4ENKA 2WV0A 3Q5FA 2M1BA 2K27A 3QRFF 3SFZA 4O9EA 2X4HA 4AQ6A 3ZMDA 4QGNA 3EBRA 3D82A 2TDXA 4E2GA 1SFEA 2NNNA 4LFUA 2RC4A 4I0AA 4LK1F 5JSPA 2RGVA 5DDGA 5LRSA 1FPQA 1R5HA 3HT2A 3SHFA 5H20A 2Z3YA 2O3FA 1KYZA 3HRMA 2Q1ZB 1LDJA 3ES4A 1Z1DA 3M70A 2ZXJA 4MQVA 1JE8A 2NS0A 5FCCA 4LG0B 1IPJA 1ZVFA 4KNYA 2PN6A 4WXCA 2M30A 2EAAA 4Q0QA 2VBXA 5CVJA 1KU2A 2JPBA 5DCMA 1SMTA 1AOYA 4META 3BPXA 3MAJA 1O3QA 4HA8A 4L18B 4XSZF 2Y0MA 2QQAA 3KEOA 3U10A 3BP8A 4XLNF 3H50A 3CL1A 2PAKA 4Q48A 5IT9K 4MQ9F 4L5IA 4RAZA 4UNOA 4NQWA 5FLJA 3R61A 3IC7A 4P9GA 2V1XA 1DDNA 5BOXA 5D6EA 1WQ2A 4LUKA 3V4GA 3CLPA 1O5UA 2PAMA 4K8FA 5CVUA 1T39A 2MBFA 3F6VA 1OFNA 2HEOA 4ZU4A 1QPMA 1IUYA 2PQQA 2N7GA 1X3UA 4XF1A 1F1ZA 3BJ6A 4TV7A 2D1HA 1HQCA 3KLNA 3NKTA 2H6BA 2PBIA 4MGRA 3RPQA 4EJOA 3F21A 4CDGA 4HMZA 4KN7X 2L3DA 4WBBA 1PP8F 3V7RA 2EJRA 1BI1A 2P6SA 5HS8A 5D1IA 4A5NA 1ZRDA 1YS7A 1FX7A 3I0TA 4KIFA 3DPLC 4QWQA 1YLFA 5K5QA 1ZHFA 3GYDA 1Y3TA 1WKMA 3FMRA 4YG2F 5CU1A 3WTXC 1ZZ7A 2UY8A 4A6DA 1XSDA 4OIRF 1TNSA 4L0YB 1RTVA 1ZLJA 1W4MA 4EJTA 5JSOA 3HT1A 4O6JA 2RDPA 1V70A 2ZBKA 5HLGA 3SZPA 5I0UA 1XE8A 2D1VA 5LHIA 2KIMA 4OMYA 2XAHA 4RB3C 4PDKA 5I8YA 1IN8A 2Q2EA 4RGXA 4UVBA 4QMAA 4OMZA 1IF1A 5E18F 5CJ9A 5I0SA 3MCZA 1ZGAA 3IIAA 4A0YA 1DUXC 2VC0A 1FT9A 3ZMVA 1UW8A 1H0MA 4P5OA 4HVRA 4IRIA 4LULA 3HRUA 2V79A 4A0XA 1T0FA 3QOPA 3ST7A 4KN4X 5LGNA 3K9TA 4A0ZA 2F5DA 4QLCU 5FLHA 2IXJA 2G7UA 4UVAA 3NSTA 3TO9A 2XAGA 2ESNA 4J1WA 4H7LA 3TGNA 4IEYA 2P17A 5E1RA 3C3WA 4ENJA 4MX3A 3M9AA 2PYTA 4LLNA 4U0WA 4G7HF 3P9KA 2E7WA 1S7OA 1R23A 1B6AA 4LLLA 5HS7A 3AAFA 2ETHA 4G9YA 5L3BA 4YSFA 2BGCA 2XASA 2DPDA 5F6FA 3JAMK 1IZ1A 3CF6E 2W25A 4HV6A 3JAMZ 4IHSA 2YX4A 3F6OA 1XCVA 2DQRA 2VE8A 3K69A 1FP2A 2BE5F 2HDCA 3ZPLA 4UV8A 2HYFA 1IXRC 3FWEA 1NXMA 4IVNA 2WFPA 2L01A 3GFLA 4Y15A 3JSOA 1WLTA 4LA3A 1ZARA 5KHHA 1XGSA 3D0JA 4FX0A 2VODA 4FAHA 2A07F 2DW4A 2UXNA 5DEQA 3HUGA 3BALA 3DV8A 1O7FA 2LNBA 1HW2A 2W84A 3CTAA 1U12A 4ZH4F 3H7YA 1OKRA 5LEJA 3S7EA 5AIQA 1MJAA 3CUQB 1FP1D 2B9UA 3VOEA 1VJ2A 1LKNA 1QNTA 3M7GA 1TW3A 2VONA 4N9HA 3WTSC 2ETEA 3COAC 5CLSA 1MGTA 1RIOH 3KP6A 3S2WA 2KJCA 4LG0A 3ZP5A 3BCWA 1PM7A 3IRRA 5K5OA 2D5FA 3ZN0A 4ZU7A 2FNPA 4EGYA 1L0OC 1EH8A 2EA2A 5J3UA 2EFPA 2GXBA 2DPUA 1UD1A 5D4RA 1YLLA 5TRDA 1GHCA 5DCFA 2L54A 2IT0A 1FBSA 1T38A 1KU7A 4XEZA 4IEZA 1J1LA 3V8LA 3T1BA 3K1NA 4BH9A 2B0LA 3WG9A 3R0JA 2STWA 2F2EA 4D7TA 1GQGA 4U7DA 1EV7A 2QVOA 2IW5A 5BS6A 4L5JA 2PFWA 1E17A 2V09A 3IRQA 2STTA 2W24A 4M6YA 3F8MA 1Q5OA 2PAEA 1YTYA 4Q0PA 2MHFA 4BYYA 1ZZCA 2FF4A 1O4TA 2HKXA 4R8HA 3RDIA 2O8QA 1U3EM 2KIUA 1HBXG 4EM0B 5LGUA 3F8NA 3LA7A 3W6KB 4MH0E 2PMUA 1B1BA 5FDBA 2K02A 4I01A 2FQPA 3LQRA 2VECA 3USSA 1XSXA 1J5YA 1L3LA 4LA2A 3CUQA 1SQ4A 2XKOA 3NL1A 4IJAA 5BXXA 1MD0A 2ZO4A 1VTNC 3M1EA 3O3KA 2J5OA 4OU0A 1O5LA 3GYHX 2B5HA 3NJZA 1SMYF 2FE3A 2LDUA 4RB2C 3U1DA 1KU9A 4AIJA 1P2FA 3ETQA 2E9QA 5C8WA 3GEZA 4B09A 1ONVA 1ZRRA 2CSOA 3BDDA 2QENA 4ORFA 1IN5A 3LSTA 3I71A 1ON2A 1LNWA 2G7HA 1P4XA 2E7XA 4CZZA 2ISZA 5KBFA 3BJOA 3J7AO 3L00A 2F5EA 2QWWA 3ECHA 3S7IA 1T6SA 1G3WA 3M3IA 3LAGA 3F8BA 4EJUA 1XB4A 3E5UA 2ZKLA 5DUKA 1LDDA 2GC1A 2KIFA 1F4KA 2NAZA 4YNIA 2Z99A 2OYZA 1G3TA 2P8TA 4CICA 3MWMA 2WWYA 4AIHA 4AVAA 1G3SA 1TQIA 3I4PA 4Q0UA 5DD4A 4I0BA 3WTZA 3RIRA 3FMQA 5JCTA 3KP2A 2UZKA 4HAMA 2OZJA 4R79A 4KWKA 4GCVA 2DK5A 3D0SA 1ZLKA 2EVXA 2HTJA 4KYWA 2XIGA 3GWZA 1YFXA 2XLGA 3HTUA 1UIKA 1K79A 4R52A 3GUDA 5IT9Z 4A6EA 4IRGA 4O9GA 5FPZA 1BI0A 4JK1X 3GFJA 1CX4A 1OYYA 3TO7A 2OA2A 3ABUA 1LJ9A 3GZ5A 4U7BA 3L9FA 4RAYA 1R22A 1YYVA 5DYMA 3GVAA 3EJKA 3LA3A 4HQMA 4UV9A 1NE4A 2RV8A 2YSRA 3I53A 3HQXA 4QGLA 1LEAA 4G7ZF 1Z91A 3CUQC 5E8GA 5HOOA 1NE6A 4BXUA 2P4WA 2JRTA 4BHBA 1U2WA 3REOA 3WE3A 1CAXB 2VOPA 3FFQA 3WW4A 4LMYA 4KU8A 1ZYRF 3GZ6A 1XSVA 5L3CA 3GW2A 4HDUA 5BUVA 3MYXA 4M9XA 2LF8A 3LFKA 1W7PA 4OOIA 3WW2A 4WK8F 4XFGA 3SZTA 3VODA 3NVCA 1QWRA 2HKOA 2B8MA 4HOBA 4XF3A 3DQVC 5CADA 3FMSA 2OZUA 1ZZBA 2LSOA 3U0ZA 4OIQF 2VBYA 1ZZ8A 4HZFA 5AONA 4EQQA 4RGUA 5F64A 2HWVA 2JZYA 2QCSB 1FOKA 3T8TA 3WU0A 4X6RB 3IKVA 1J2XA 1BIAA 2VBWA 4P55A 1B9MA 1WWXA 4KMFA 1UIJA 1OPCA 1XN7A 4HW0A 3FXUA 1X8EA 2CFXA 2QJVA 5KVRA 1HKSA 2FBIA 2ADUA 4HLXA 1JGSA 3Q9SA 4XLPF 3IBMA 1RGSA 2XRNA 2QQ9A 4LEJA 2CYYA 2GA2A 4YFNF 2ET1A 3WW1A 1HSTA 2MH2A 4RGSA 1HXDA 1YFWA 5I0TA 3KLOA 1Z6TA 5DD8A 2GC3A 2K4BA 4HSJA 2AXLA 4I7HA 3LAJA 4IEUA 1JUHA 4KFCA 2H94A 3IDCB 2QM3A 3CEWA 2Y48A 3R60A 3TOAA 1J7KA 5E1ZB 4O5VA 1GXQA 2P5LC 5ICEA 2IVMA 3Q9VA 3SCGA 5E1XA 2A5YB 3SXYA 1SD5A 3LWFA 4WXDA 2UYAA 1RC6A 2DU9A 3QU3A 2EFQA 4IEXA 4KIGA 3CJNA 3CUOA 3HSFA 3IKTA 3V8JA 4HVOA 4YFXF 3ZDSA 1FWZA 3E6CC 3DKWA 4GYIA 2CAUA 1PUEE 2GC0A 2EFWA 5F1RA 1XDUA 3T8RA 4IEOA 1YS6A 3C3VA 4ZYEA 3ZMSA 4I2OA 2RKHA 3MEXA 1ZRFA 3EYYA 4HBLA 3U9GA 3KMHA 5CVIA 4WF2A 4KIBA 5ILSA 3GBFA 3H8UA 4HF2A 4AQ2A 3JTGA 2ESHA 3BOQA 2D2WA 1Q1HA 3IDBB 2CAVA 2FXAA 4XBFA 2D45A 3RTRA 5K1YA 4HN1A 2K86A 3O6BB 1OR7A 1J9IA 3NEUA 4XF9A 4HX7A 3BU7A 1TLHB 4PGGA 1JHFA 4G6QA 2E1CA 5FO5A 1YWKA 4K2EA 1OI6A 4YARA 4HF0A 1J75A 3IWZA 4CGZA 2O6GE 3WE2A 3RPUA 3FE5A 1FYKA 3CJXA 2XUBA 2IC1A 2PHDA 4LB6B 2RN7A 1O3SA 2UY9A 1ZNPA 5L3EA 1UB9A 3RZZA 3EQEA 3KZYA 3KZZA 3F72A 3BROA 2YPRA 5I93A 3RKXA 3MFKA 4JQFA 4AVCA 2DT5A 2Q8KA 3RNSA 4Y17A 3PQKA 2FA5A 1RNLA 4XSXF 1ZZ6A 4AVPA 4IERA 1SFNA 5HI0A 4PZJA 4MTDA 4M71A 3QPHA 3N97A 4IXAA 2P5VA 4XF4A 5D6FA 2K7LA 1FC3A 3TQNA 3BWGA 2A6EF 2NRAC
chains in the Genus database with same CATH superfamily
5JR3A 2LTPA 4NAMA 3ZFEA 4Z1VA 1GVDA 1APNA 1QJX2 1RB8G 1W9SA 2A70A 1UX7A 4XRMA 1T2KA 3WNOA 5AIPA 3OBRA 2W00A 5H6QA 5D5UB 1XU1A 1G6NA 4Z2YA 3AC0A 1ZN2A 2UWCA 4A7KA 4P00B 3C18A 3GZTB 3IZOA 3B73A 2W1QA 2RVCA 2V4AA 3QWLA 3NNGA 2AQFA 1DQUA 2NN8A 1OKOA 3BCAA 2PTMA 4QQHA 4LJHA 5FZ3A 2XHKA 3S32A 1QJU3 4YGBA 1NG7A 1Z67A 1VR3A 1R1VA 1KZHA 2RDSA 1UFMA 3U14A 3KSCA 1AX2A 4EVIA 4RHV1 4W65A 3E6DA 1H1IA 4GB32 2QBYB 3FBIB 2HXOA 3KX2A 2JECA 3SFIA 3NWKA 1R00A 2EINH 3K2ZA 1S29A 4XBLA 2BY1A 1F2NA 1AL0G 2Y6GA 3KEQA 5L3FA 2QQBA 2DFFA 2K2SA 1O57A 5T3NA 4PLOA 3K4KA 1JKRC 2QQVA 1C8M1 2RR12 2IXKA 3LSMA 4IUGA 1XQNA 2BWCA 2MLKA 3MKYB 1YQCA 3ZXDA 3CLOA 4E7JA 5FXWA 1YFUA 3RMXA 1GZWA 1VF9A 5ICGA 2A3WA 2BXZA 3ISPA 3A23A 4BLIA 2JK3A 1J84A 1P92A 1OXCA 2CU5A 4CZSA 4UBGA 2NYXA 4GKXA 2AACA 5JXIA 1J3RA 1UMZA 1USTA 5FZMA 4QX8A 3ECQA 4HNUA 2JA8J 3ACIA 1X8MA 2JG9C 3MEPA 1W8FA 3UETA 5J8CA 2BW8A 2YU3A 3FF5A 4E8CA 4WXHA 1UNBA 4D7SA 1PVC1 2EPFA 3TAYA 5A3OA 1B8IA 4BNCA 4M74A 1XMKA 2OUHA 2JB4A 3RYRA 2YU2A 3BN6A 4NDLA 2VT3A 1HCRA 1ULFA 5GJ6A 2BGOA 5JIUA 4XAEA 4DOZA 1OQDA 4P9FA 1IN7A 2LG4A 1W7PD 2XF6A 2JSPA 1KFUL 2TUNA 3I59B 3MICA 2P5BA 3S2HJ 4BQWA 2VQHA 2Q8DA 2Y2ZA 3CMMA 3KYLA 3LWCA 1ETWA 4B7KA 2QQLA 4HT1T 3K2AA 3OBZA 1FI2A 1IG3A 1B4AA 1QDCA 1Z7UA 2PA7A 1XD7A 3PVEA 2R063 3I7DA 4XLEA 4Y13A 4HQEA 2KA3A 3I2DA 1VZ0A 4QM8A 2E1NA 3TDUC 5GALA 3U21A 3J7YJ 4BY1J 3PUQA 1FMVA 1JKQC 3OYIA 5LHHA 1OLRA 1URXA 5IK7A 4GB33 4YFZA 1K4SA 5E8IA 2E5ZA 2EALA 3ZYRA 4WV8A 2D98A 3UKNA 2RS33 3NAPB 1U78A 3NW4A 3TO6A 1X82A 2HS5A 1X9PA 5FXZA 3UL2A 2PLV2 5APAA 2DCTA 2A6HF 3W59A 3GHNA 4C2TA 4RLFA 2CV6A 2RMU1 3OGGA 2K9MA 2L9LA 1AJKA 2J1SA 1GZWB 3BG5A 1YJWI 2M0MA 4XORA 2VKHA 5F5IA 3ZSEA 2YC4A 5FYHA 4JV4A 1B9NA 2MYSA 2EILH 3RMYA 3EDPA 3C7JA 2JXAA 3VB2A 3T2OA 2WINB 1KQ9A 4BJ6C 1VBE3 4HOOA 4EN8B 3I58A 2RS13 2PLV3 3SH5A 4M6XA 3FXKA 3DLLF 1OA2A 4MXWB 4QDQA 2CQKA 1UO9A 1XNAA 1BEV2 3D8CA 1B35A 4Y7NJ 4BXXJ 5LHGA 1WI9A 4IF4A 3OYKA 1QJY3 2OCCH 2GXGA 4XJZA 2CW0F 1ND3C 3EUHC 3DF8A 3ZDVA 3BOWA 1AA7A 1KDMA 4QXKA 1ENQA 5JFRA 3W2VA 1G8WA 2IA1A 5JMOA 1OD5A 1TBXA 1UY0A 3HN1A 4AYUA 5ERLA 2XLFA 3POYA 4A42A 3WP6A 4XLFA 3RGBA 1TNRA 2F6CA 2QZ3A 2C6YA 2OZ6A 1UXZA 3WVJA 1BJZA 2EV0A 1MS1A 1H1MA 5HV4A 1POV0 3Q0WA 1OPMA 3I2OA 4JRAA 1ZREA 1ZBE3 1WJDA 3DBHB 3SQNA 3VLBB 2DA3A 2AENA 3OPTA 4XJ9A 3SLIA 5E89A 2RVAA 1CAWA 2A6YA 2HWC3 5JR7B 3PIOF 1CZSA 5A3NA 3AKZA 1FTZA 4QPGC 1LODA 4CEYB 2XL7A 2DOAA 3WZ1A 2VMEA 4OHYA 1GP6A 4EZ4A 3LSHA 1O91A 4B4PA 4OCTA 3EQLF 1WCDJ 2GMEA 4HG6B 4AAPA 5IYBJ 4K21A 5JDBA 2XPUA 3C1DA 4XOTA 4ON0A 1IC8A 4QXHA 2Z9OA 5CEHA 1SD7A 2WBMA 1I6XA 2OQ7A 2BU9A 3W3CA 1ASJ2 4W6YA 3G2BA 5F5AA 3W2AA 1MBJA 1UMHA 3BQZA 4ZPIA 1K61A 2Q8OA 2ZGPA 2KKOA 3BR2A 1XDSA 4IEQA 3WU2C 5FKKA 1CAUB 2FUG2 5E3NA 4AEJA 3WHUA 1JU4A 5F0FA 4ISRA 1OCPA 4XDOA 3TW7A 3O1VA 1JTZX 3MIGA 2GOXB 4FFIA 1W8TA 3RG0A 2O7OA 5I8SA 4MTEA 2ZMEB 2P6TA 4JTOA 4C30A 3O0XA 3MZYA 4M4PA 4LJZF 3TP3A 2D43A 5EEGA 4A4AA 1W0TA 3GM8A 2FMYA 5L7OC 4N0BA 1ND2A 1VBE2 1ETOA 2DTZA 1MACA 4OMDA 2ZJRF 1O4XA 2XDVA 1MZ6A 4QWNA 2VB6A 4LLOA 1KQ8A 3T1LA 2JN6A 2BXYA 1WCQA 2ZB9A 5FQ0A 4AHWA 4A6SA 4AVBA 2WC2A 3TB0A 4UF0A 2OPWA 1MMNA 4IZZA 4GH4C 4OIPF 3HOXJ 3WW3A 1D8KA 4AFDA 4TWTA 4GJZA 2NMNA 2FZ1A 2EQRA 1EPWA 2PG4A 3THPA 1W9FA 1FOD2 2HU9A 3BC8A 1Y0UA 4QHOA 1UOFA 1IDYA 1L7RA 1FSEA 2Q0OA 3FM5A 2XL9A 2WUHA 4IV3B 3O1OA 1TTYA 1TQPA 2VD7A 4NIAA 2OQRA 1XGMA 1RYYA 3VWBA 3H1YA 1OD3A 2BERA 1NZCA 4C1XA 1TL8A 5DUIA 3K51A 2JT1A 4MZUA 2L7FP 1RUF1 1MBGA 1WPKA 3FJSA 4BMBA 2RS52 2XVKA 5LLQA 2NPIA 1ZA4A 3TEDA 5J98B 3K1PA 1MS3A 3AJZA 2GAUA 2EK5A 4A3CJ 2IAIA 3JR9A 3H5AA 5L3DA 4ZYDA 2RG4A 5SV5A 3H42B 1GZ9A 3KV6A 2G9GA 1IS5A 5ED4A 1REPC 1KJLA 4QSHA 4G6DA 1YFYA 3CJIB 1AKHB 4IGPA 4XMIA 1H2LA 2Q1FA 3QACA 5ACA1 2I07B 4EMSA 1GV5A 3S6PA 5FGMA 4UFIA 4URTA 4P9UA 1PVEA 2Z4FA 4Q4V3 5EYYA 4KWLA 1TC3C 1X2NA 3KV4A 4W1UA 3L2HA 4JGZA 1WCUA 4I3PA 4XMAA 2W0XA 2HWB3 2RNJA 4YVSC 2IXHA 2ISYA 1PIV2 2EZIA 1TWCJ 1AXKA 2MC4A 4BIFA 3CJIC 2JEMA 2JVGA 4CDWA 5KHKA 1YJNI 4NB5A 5A7OA 2OU2A 2EAKA 4DZGA 1ZGJA 5IK8A 3HUGB 3OGRA 1A6IA 2JMWA 4EYUA 4QKFA 1CPMA 1RIRA 3BJAA 5B1AH 4LTAA 1QMJA 1IAWA 1I3QJ 4PIZA 3GTOJ 1GOFA 4KUMA 3ZQFA 1M4WA 2V5YA 1ULDA 4BEHA 4OI1A 1PNGA 3RVHA 4XAAA 2R5ZA 4IE6A 5CFCB 1RXGA 4MV2A 4PJMA 1MDMA 2A3SA 2L7KA 3AL5A 5BNPA 2JG9B 1OCTC 5A3PA 1MQTA 2GDFA 1EA3A 4BK4A 1RUG3 1COV1 2JDMA 3K1MA 5F6KA 3VDCA 4L0PA 1AR73 5FAXA 3ZIXA 1RUJ3 1PGL2 3SDGA 1OYWA 4RQPB 2X6OA 1VRH2 2ZX4A 3KVAA 3MV01 2VKVA 1EY2A 1LULA 2B7YA 5FD5A 5K7HA 5L3GA 5ERIA 3DP7A 1ACIA 1W39A 4BXSV 3TYJA 2ZMLA 4WVMA 1U6GA 5EZGA 3NWTA 3E6BA 4FBFA 3BR3A 5JI9A 4TZDA 1C1LA 4BE3A 2JE7A 3X29B 1TW2A 4JTNA 4XJ8A 3M8FA 3GTLJ 3KPHA 1FY7A 5FZBA 3POSA 4QPIC 5F3EA 1B59A 1RUI3 1R9TJ 4I6ZA 4EGZA 2L02A 1UHWA 3HZJA 4MLOA 3ACGA 3DU6A 1DGRM 1SD6A 2E7AA 1KJRA 4XABA 1RPWA 2X51A 2NS7A 3ZYPA 2ZGUA 1Y0NA 4XURA 2X09A 1SBEA 1AYN3 4YG6A 5FZ4A 4HVQA 3ZQQA 2M5WA 1YEWA 1TE1B 1I5ZA 4JDOA 1RC9A 1ON1A 2C24A 2YFUA 4L9BA 1GT0C 2BRTA 1K6YA 3I55I 1E2XA 3EPZA 4EROA 5FKLA 1VBC2 3JD73 4ES9A 4XONA 1D1BA 1SZBA 4NHJA 1H2NA 1IUFA 5CKTA 5J4VA 2PQSA 2R7DA 2DA5A 4EJWA 3CMEI 2EIKH 2JIGA 4CDQB 3CF5F 3PHMA 1APLC 3WSOA 2F4MB 2W7NA 3I3DA 4UUVA 3HDDA 4B8XA 1TME1 1QXRA 3MKWB 1K78B 2FBHA 4YIRX 2VCCA 1W6NB 3WNPA 2LH9A 4XKBA 5A2QZ 4QXCA 3LL7A 4A2UA 5A2QK 4CP2A 3SDBA 3VD3A 3OUJA 4MEXF 4IEWA 5E1WA 5IY5H 5CKMA 1OOPA 4LUMA 4UXNA 3JRFA 5BV6A 2ZNYA 3QP6A 2LD5A 2G19A 3WXPA 4L9TA 5FLVA 2L4MA 2DVFA 1STZA 4BKXA 4RMNA 1LOAA 1XGNA 2VOKA 4GMP0 4PI2A 4YVWC 1JZ8A 1W6PA 4Y1XA 2CJJA 3IPVB 4MADA 2B46X 2YBPA 1PP7U 5GAEJ 2VUAA 4AEDC 1ND3B 3SJMA 4YZ2A 1DHKB 2DO7A 4C91A 5C70A 5FYIA 2Q0AA 2QEXI 3IP4B 5JXJA 1RUG2 3APBA 4XUPA 2WIIB 2UUZA 2ZJ2A 3SQOA 3KM5A 3L1PA 3KEYA 3CQOA 1V55H 4K3UA 5IYDJ 4NOTA 2C9KA 4ASNA 3PUFA 2ENRA 4HK8A 4ITVA 2XLAA 4FOQA 2HZTA 1R5GA 5F1JA 4JCKA 5T5PA 4XFIA 3VBUC 3GCWA 1OC1A 1UU4A 1DPRA 3HSRA 5FFXA 2BUKA 5J4YA 2DUQA 2WZR3 3MBWA 1XMAA 4KT5C 3HYIA 2VQTA 1CZVA 2N8GA 3VBHA 4ZXEA 3HM5A 3K4CA 4NQWB 3I4IA 2CW7A 4P5YA 4HLTA 3T4VA 3HGYA 3HQUA 3KV9A 5BNNC 4NAOA 4RR3C 1YYNA 1R1TA 2H27A 3HBLA 3J8F1 4LQRA 2V9PA 3WU1B 5FB2A 4U0YA 5DUWA 2VY0A 3H3VK 4XDPA 4EJVA 5GTIC 3EXUA 1YIOA 4ENKA 4V1PA 4IV1C 1ZYBA 2X4HA 4AQ6A 3A03A 1QNYA 2NQYA 3HEIA 1WI3A 1VBD1 2RC4A 1U9NA 2YS9A 2WAQA 2KHMA 4M3EA 1J1TA 2ZMKA 1ULOA 2RGVA 3MLLA 1PO12 4LBLA 4IX7A 1UOJA 3LFUA 1FPQA 3K4BA 3BTLA 2WFF3 1LESA 4R9BA 4XMYA 4RR3B 3ZVXA 4I30A 3M70A 4GALA 4KITB 3OYAA 1UU5A 1LENA 2KDZA 2ZXHA 1ZVFA 3RSJA 2KRCA 4KWUA 3ZGKA 4WXCA 2ZJPF 3BIEA 2Y0SA 1KU2A 2JPBA 5B4XA 3BPXA 1U9OA 1OFCX 2H0BA 4ZTFA 3KEOA 1S7EA 3BP8A 4TTGA 2XJUA 1BBT1 4HANA 1T33A 3CNAA 5IT9K 4RAZA 4GH4B 4PFPA 5GZGA 3ZR5A 1CPNA 3S14J 1LCLA 2Y9ZA 3VBHC 1ETXA 1WQ2A 4LUKA 3ZYGA 1WKYA 1O5UA 3JB8A 1SAUA 4Q4Y1 3LB9A 1T39A 3VSKA 2HWE1 2VULA 2VGDA 1OFNA 2JVHA 3L2RA 3JBG3 2N7GA 1ZBE1 3S17J 1EKEA 1WD3A 1BMV1 1WBLA 4M00A 4FI9A 4Q4V1 1IQAA 3FXOA 3KLNA 3RPQA 1S0BA 2X05A 4Y26A 5F5CA 2QGUA 2LFBA 1XXNA 4DXRA 4QQLA 2DURA 3N7KA 3WDXA 4XIDA 1V6OA 4QDRA 3WD5A 1RITA 1U8BA 2CQ7A 3QODA 1AYN1 2R32A 5AC91 2FDJA 3KLSA 5CAZA 4FFFA 4FTSA 5D1IA 3VBHB 3HKZN 1UQXA 4COWA 1I1EA 4YG2F 1OLMA 3UK9A 3FLRA 1XE0A 1QPIA 1EV13 2ID4A 1ZLJA 1PGW1 2CQNA 3VD7A 4O6JA 3ZYBA 5M5YJ 4QIWN 3WNMA 3LIHA 4DY3A 3C2UA 1WMFA 2XAHA 4RB3C 4GH4A 4PDKA 2OS2A 3DU5A 5I8YA 2Q2EA 4UVBA 2B39A 1OCZH 1BVVA 3FUQA 1ZQ3P 5CJ9A 2XMLA 3MCZA 1XYNA 1JTXA 2G9ZA 4LBKA 1DUXC 1SANA 4ZZ8A 3JB4C 1F4AA 3ZMVA 4C3HJ 2TEPA 4P5OA 4IRIA 3HRUA 3JREA 1T0FA 1W06A 3P1IA 4LO4B 4KN4X 3GMEA 1D4M3 4AFCA 1C28A 4LKSA 3Q8EA 5EXOA 2E7TA 3K4JA 1T56A 2YXSA 5FLHA 3SEPA 4YVSB 4UVAA 1DGLA 4UW4A 2LKXA 3TO9A 1JOPA 2GNBA 4JAAA 5A1LA 4J1WA 5EPAA 3USUA 2Y0IA 1MMDA 4N4OB 2VZSA 1WCMJ 3I3MA 3QYEA 3C3WA 4ENJA 5EJ1B 4LLNA 2DFHA 1R23A 2Y9YA 4XTMA 2LY9A 3MVPA 3AAFA 2ETHA 5FROA 5K7FA 2VQCA 4YSFA 4NBQA 2QQWA 5LBFA 2E35A 4WVWA 1RUC3 1DF0A 3J7ZI 1MMAA 3JAMK 1IZ1A 2W25A 2QE3A 1EV11 5IK5A 2XR4A 3K69A 4B4RA 5IW0A 3ZPLA 4L5EA 4UV8A 4EATA 4RLQA 1VQ8I 1WLTA 3Q8AA 3A0BC 5HV0A 1XGSA 4DW6A 3D0JA 4LBQA 5IUQA 3S93A 2WYFA 3NAUA 5A6ZA 2J1VA 2OUMA 1DP3A 2ZGLA 4GFBA 2X5IB 3OS1A 1RUE1 5IATA 2Y33A 5DEQA 3CC4I 1O7FA 1REFA 2LNBA 4BOWA 2W84A 3CTAA 4E7IA 3S7EA 5LASA 3OEAA 3U07A 1U5IA 2I8DA 2B9UA 1LKNA 3RCOA 4QKBA 2VONA 4P5HA 1EV12 1HXS3 1R1ZA 1MGTA 1RIOH 3RZLA 2KJCA 4LG0A 2JRMA 4HPKA 2VOWA 4EGYA 1EH8A 3NAPA 5JOXA 4AK3A 5BNOC 2WY7Q 1DGRN 3D5OA 1SLLA 5D4RA 1YLLA 1DU6A 2L54A 2ZAAA 1T38A 4ATEA 2GH8A 4Q4Y3 3M8JA 1B8IB 4DYQA 4D6RA 1G9DA 5F27A 5DZGA 1RUF3 3WG9A 1D0HA 1HXS2 2A75A 1G9AA 3OG2A 1GQGA 2MD0A 2IW5A 3LEIA 3WINE 4FPCA 1RR7A 1QEXA 2ZEZA 2W24A 2NMOA 4M6YA 3F8MA 1CONA 1Q5OA 2R0FA 4Q0PA 2HOSA 1BR1A 4XUNA 4U87A 4M3BA 4LBQB 5LK5A 1O4TA 2HKXA 5IP6A 3VZOA 3BG6A 3OYBA 3TOJA 1U3EM 4D9JA 5K9YA 3MFCA 4IE4A 3B9CA 3MZ8A 5FIXA 3MD2A 2JICA 3LA7A 5LD2C 2PMUA 3GTPJ 1E5IA 3LQRA 1XSXA 1J5YA 1L3LA 2XJPA 4LA2A 3CUQA 2V72A 1POV3 1VQ7I 2XKOA 3NL1A 4IJAA 5BXXA 4ZXKA 2EICA 1O4ZA 3AYDA 1YX3A 1YI2I 2MEV3 3HOWJ 4Y20B 4BA6A 5C3RA 3K4MA 3AYCA 4YM3A 4RB2C 1P2FA 4XACA 2E9QA 1QVUA 1YC61 5C8WA 4B09A 1WJBA 3BDDA 3O5SA 3HOVJ 4ORFA 3ZXAC 5M3MJ 1H8TB 3DEEA 3LSTA 4JX0A 2V26A 1LNWA 2G7HA 1F8VA 3FC0A 3L00A 2HVQA 4BWOA 4F3JA 3ZN5A 1G3WA 2LUWA 3F8BA 2PMZA 3CLQA 4EJUA 1XB4A 1JZ4A 4G6TB 4YNIA 2Z99A 1C1FA 2CUFA 2P8TA 4F92B 4AIHA 4AVAA 3I9V2 4YW7A 4DXSA 3I4PA 5T50A 1AL21 3MIEA 4Q0UA 4QPIA 3THCA 3WTZA 3RI8A 4HAMA 5GLZA 2ZHNA 3M1HA 1ZLKA 3DPRA 2PHXA 2CV2A 2UWBA 1G9BA 4LHSA 2VW1A 1GNZA 2HH9A 1DYOA 1JZ5A 1UIKA 3A0NA 1WVRA 1V6LA 3CJIA 4TYSA 4C9YA 1DQ1A 1Q8OA 4IRGA 3B6AA 1MNDA 4O9GA 4LK7A 1COV2 5FPZA 1MEC2 1S5LC 1OYYA 2WNVA 4Q4X2 2XPVA 3KQ4B 4MO3M 4NPMA 1W2AX 1R22A 1EUUA 1OVPA 1YYVA 3EJKA 4XQ4A 1LEAA 5EJCA 2DXIA 3N9NA 4FPHA 4Z2WA 5JVVA 1NE6A 2JRTA 4BHBA 1GMMA 3GF6A 5D21A 5FUPA 2VOPA 5IP7J 1P7JA 2DODA 2LLKA 3ZXSA 4K20A 1MR5A 3AXDA 5JXHA 1OHFA 2JDKA 3GW2A 3G4SI 1FNZA 4JGYB 3ZQLA 2LF8A 2G0EA 5H9RA 1W7PA 3OYWB 2ELKA 1BK1A 3SZTA 3NVCA 4E7KA 3JRBA 4B48A 2B8MA 1BZWA 2X9DA 5LZ6A 3CKHA 4LKFA 2OUJA 4OIQF 2VBYA 3V0BA 4HZFA 4EQQA 2HWVA 2JZYA 4UUSB 1FOKA 3WU0A 3HR9A 1YQ2A 2NZ9A 1A36A 5FK7A 2VBWA 3QBQA 1VMFA 3PNVA 3A7QA 3AVSA 3FXUA 2QJVA 3UKGA 1WCKA 1W36D 1PK6A 1GOHA 2X1EA 1HB2A 2CFOA 1JGSA 2WS93 4O61A 2GOMA 4XLPF 2XRNA 4PHZA 3BVCA 4OZXA 2CYYA 2GA2A 1ITYA 1HSTA 1RUI2 2Y69H 3HVDA 3KLOA 2GC3A 3A4CA 3WDWA 2RM22 4DEVA 3IDCB 2H94A 4BBRJ 2CDPA 5F9TA 4OI4A 3L2VA 2ORXA 2XSJC 4O5VA 1GXQA 2IVMA 1VQMI 3VZJA 4YZ5A 3SXYA 1SD5A 3CDIA 2HWE2 3GHMA 2DU9A 3WNLA 4E8DA 2EFQA 1R49A 4FPLA 4IEXA 4A3KJ 4KIGA 5C9AB 3CUOA 2V5DA 1CN1A 4UWDA 4CU7A 4B8EA 3ZDSA 3F2ZA 1R093 2WLQA 3ZFEB 3E6CC 4E27A 5FFOC 4AC0A 2HNHA 1XDUA 1BW6A 3LDRA 4IV3C 4XDQA 2BY2A 1ZTRA 1JN2P 5A7WA 4EE2A 4J6GA 3SYTA 3C3VA 4ZYEA 2IXSA 5C44J 3MEXA 2X6WA 4GIQA 3EYYA 5KC5A 4E7HA 1DGWY 1R091 3VDXA 2ZGQA 4B3NA 4KIBA 5ILSA 3A1YA 3FK6A 1W8NA 4AQ2A 1VAKA 2VBDA 2ZPXA 2VBBA 1Q1HA 2CAVA 2FXAA 2DA2A 3T4HB 2ZGMA 4BMEA 3LD8A 5DAQA 4XF9A 1IHMA 2ARXA 3BU7A 2QSFX 1JHFA 1LE8B 1PVXA 1W6QB 4A41A 1OLME 3GJBA 2XJSA 3WE2A 3OBAA 3BOPA 3NQHA 4CCMA 2KR2A 5T55A 1FYKA 3I8TA 2IEKA 4IW3A 4QB1A 3P5BA 1VB2A 5LA1A 3JD72 5K7ZA 1RUE2 1SC7A 5C4WA 1ZNPA 1UB9A 1RR8C 5A6YA 3EQEA 3KZZA 3BROA 1PJRA 3RKXA 3ZQIA 1YJ9I 2DT5A 4XBQA 1OISA 4IXLA 3VD4A 2FA5A 1RNLA 4XSXF 2NVUB 1ZZ6A 1SFNA 4M71A 3A01B 3LQCA 5KWRA 4IXAA 1RVF2 1FC3A 3PJYA 2X6XA 2ZS6B 2VTXJ 5FBZA 2EXIA 2KISA 4LLGF 3UJOA 2MNGA 4I76A 1TWGJ 2OVUA 2AGSA 5FP7A 5C8CB 5FKOA 2W82A 1QU3A 3ABKH 4ZJZA 2CWSA 2Y38A 1W8OA 2PHLA 2P4EA 5FZHA 2WV1A 3V8KA 2W3JA 2UURA 2WAAA 1DZRA 5GZCA 3J80Z 1UF2C 3J80K 5FTTC 2MPFA 3ML6A 3NKGA 3AZZA 1BK0A 4PT6A 2E2IJ 3P6BA 5HXMA 2P6HA 4CU6A 5FZ7A 3H8OA 4A3MJ 1JHNA 1Y6IA 3O1UA 3L09A 3K7AJ 1DYPA 4RM2A 4P9XA 5ISLA 3WOGA 2WR9A 1F9NA 5HVQC 1RHI1 5C8CC 4JKMA 2ES3A 3AX4A 4L97A 3AP7A 3BYWA 2BYVE 3MKZA 1VNDA 1VQPI 2WNEA 5JMCA 3ENRA 1KS4A 2O0YA 1ZRCA 3INAA 2ECBA 3EYIA 4CDUA 3PIGA 2D3PA 5C7GA 2AH2A 1SCSA 1UZWA 3H0GJ 3RYKA 2JG8B 3FX3A 5JAXA 2CWEA 3PIPF 2OKXA 2OPKA 2GC2A 4Q8LA 3QU6A 4HLYA 2PMHA 4GA9A 1F43A 5SV8A 3KP7A 3IKWA 1SD4A 3B02A 3CO7C 1VP6A 4LXLA 1W5SA 5DABA 1BIBA 4CCKA 4HBNA 4Y1UA 1C8M2 1RHI2 5KCMA 2XROA 3AFKA 3LSEA 2BNOA 4UFKA 4GDFA 5KHIA 3K0LA 2IA0A 3UKTA 5E79C 2VC9A 3OOXA 4AVZA 2EZHA 1HV0A 1R5ID 4MFDA 4NIDA 2I2SA 1RL3A 3NMBA 3OYFA 4UFLA 4GXOA 4GAZA 1SFUA 5HODA 2E53A 4Y3OA 2Y0OA 3I49A 1YW9A 2KM2A 1MMSA 4PLMA 2JTVA 3L2CA 1MH4A 3HB9A 1PGSA 1OBNA 1DFQA 3OGSA 1HF0A 3VN4A 1J09A 3EETA 2G4IA 2YC2A 3J81K 2M87A 3OIPA 2X6YA 1IXSB 1CGPA 3N35A 1QGLA 1D0XA 1VPHA 4UB6C 2V1DA 1X3WB 3LMMA 4A3XA 1R6RA 3U11A 4DNYA 5LA9A 2VXRA 5J48A 4QD2A 5CBLA 2AZ5A 5JVTA 4CO8A 1MZBA 2E2JJ 1BCXA 4FX4A 1RZ4A 3LA2A 3OGVA 4FPKA 3R0RA 2Z2SB 5DUVA 1HOMA 2QNKA 1E3PA 2R7FA 4CDQA 3O1PA 3CCQI 1S0CA 1F36A 1TQ5A 4CDWB 3ELNA 3ONQA 3BT9A 2Q8EA 1X9TA 3TEXA 1WH7A 5DDJ1 3O2PE 2V6CA 3KFWX 4OZOA 1SG3A 1JS9A 3V7SA 2RDNA 1BBYA 2NS8A 1J0RA 4YVWB 2OF7A 3ZOBA 1IV8A 1ZZ9A 1MJ9A 3PFIA 4XRFA 1O7LA 4RBOA 2MC3A 5J36A 4GWIA 1QJZA 1CJPA 1U5XA 1IKPA 1JXSA 2KD7A 1P4AA 4IPAA 3ZR8X 2ACJA 2JWPA 3ZXFA 1JYIA 4UVCA 5FWJA 5BPIA 4B3AA 3HN3A 3VHRA 1SEFA 1TZOA 5J8FA 1W6MB 1FSHA 5HNHA 4ENMA 3WG1A 5I0RA 4C3IJ 2WNUB 2DA6A 1IN4A 9ANTA 2BBVA 2DMTA 4MEYF 2QFEA 2R041 1C8M3 2XWBB 3S8PA 2M4GA 3K4LA 3FLPA 4DBRA 2KZGA 5IFTA 1SDDB 1Y56A 2VT2A 2X0LA 5IOZA 3O12A 3FFZA 3P9CA 2HGCA 1VBB3 1UCRA 3FXQA 4DINB 1ULGA 3CMAI 3V42A 1XRUA 5HDNA 4DJAA 2OBPA 2NYYA 4NIGA 2IXLA 3JXSA 4KL1A 1WUVA 4JKKA 3PUHA 1FBQA 1QJEA 3MW2A 4MVTA 4YZ1A 1IKQA 2CUEA 1RMU1 1OKQA 2R3SA 4LBJA 4ZZ5A 2OV7A 2WBKA 5ILUA 1I1SA 3RWKX 3I4NJ 4RSUA 2FRHA 4QKDA 2VBPA 1ALYA 2VVFA 2CGOA 3RPUD 1N77A 1DGWX 4ZU5A 2VH9A 3ZFGC 2IS6A 1UWWA 4XKVA 3PLQA 4PJYA 2CQXA 2XUEA 1GVJA 2QBXA 4V2WA 2LY2A 2XB5A 2R062 4Q8KA 2VO5A 1HSJA 4D3WA 5JLWA 4QGMA 1FOWA 4R9CA 2HTSA 4XETA 4KQ7A 4CXWA 4LORA 1XG1A 1ETVA 1SMVA 5I8TA 3J8F2 2IS1A 3TRSB 3T0YA 1BYHA 2V7FA 3T2PA 2VNVA 2OQGA 3BTCA 1EH6A 4BQOA 1A6QA 2IFWA 1UG2A 4JQTA 4XUTA 4CXXA 2GWRA 5F8PA 2W85A 2C26A 5FZDA 2FDIA 4LO7A 5C9AC 3M8EA 5BNNA 2HXIA 1FZPB 3WHCA 1GQHA 5EP9A 3L2YA 2CUJA 3CDLA 1CJDA 1PGW2 2PLV1 2JDAA 4CVUA 4Q4V2 1OUXA 4CYDA 1D4M2 3TBDA 4W4ZA 3UGHA 1UHMA 3O1SA 4N7UA 3ZMUA 1Z0XA 3IN9A 1KONA 5IFPA 1IRFA 3WTYC 1F35A 2Z5WA 1MJBA 4P9LA 5FLXK 4HKLA 5ABJC 2KLOA 4UI9L 2H6CA 4XCAA 3FHZA 3ILRA 1GQPA 4H14A 3J7MA 4UFMA 5J1RA 4RFRB 4N43C 4BQ5A 2HR3A 3WCSA 4M3CB 2D5HA 4OFGA 5FXXA 1RUH1 3HC7A 3ZXEA 4WVZA 3PQJA 3MDPA 3AZVA 3DEUA 3MGUA 2HDDA 5FZOB 2HWD1 2VQUA 4EWEA 1XPXA 2E1OA 5F2SA 1UYPA 1NYWA 2WO7A 4BIOA 2MABA 5JLXA 1NTCA 3TW6A 2CV1A 1IXCA 1X1BA 4IQJA 4GZ9A 3ZN4A 4AHXA 1QZEA 1IZ3A 3OF1A 1GOGA 1OUSA 2RS11 1RUJ2 4CCNA 1BOAA 4UFJA 3OV8A 5TSWA 1WD4A 1HKTA 3WF1A 2QTWB 2QYOA 1U5TC 3RZHA 3QP5A 5ICFA 4FP3A 4WX9A 2E1MB 3AFGA 4KG8A 3S30A 1LEDA 1R083 4ZS2A 4PQ9A 2FNAA 1S1AA 5C5TA 1JJ6C 2R7TA 2BOJA 4FTHA 3N9PA 1OVSA 1VBC1 1U5ZA 4XRSG 5B2GB 5DAVA 4AAXA 5D4SA 2O8XA 2RREA 3M1CA 3BB6A 2IGMA 1BA5A 2A5ZA 3KHBA 2IS4A 4QX1A 1V6NA 5FZCA 3MW3A 1IDZA 2VZPA 3MPBA 1FMWA 3ZSLA 3F22A 1MPXA 1JT0A 3CBNA 3ON7A 1S0GA 1XOYA 4BGDA 2IP2A 5DCMB 3KZ4C 4GULA 5C4JJ 3HOZJ 1J3QA 3ZKYA 2QDNA 1TNFA 2Q5TA 1POQA 1H9TA 3W5NA 4NRQA 1O3TA 2H09A 1GXPA 3S1NJ 2F4LA 3S1MJ 1ODNA 2LM3A 4IHVA 3U78A 3UR3C 3SCFA 1R7JA 1BI2A 1QOOA 2HQAA 2W4SA 3OYCA 3RZKA 1FPN3 4DO0A 2J1TA 1UZZA 1Q1VA 2SBAA 4FPYA 4CXFA 4HX4A 2Q4SA 2A6WA 2CRGA 3KETA 2XV4S 1RUI1 1UZYA 3CZUA 4RHV2 2M8GX 1G59A 1XU2A 1BC7C 3GCMA 1SACA 4GB31 2H0VA 4HSRA 1QHGA 1JOJA 3WTVC 3BTYA 5EG0A 1KXGA 1H88C 5CVVA 3PFYA 4M4RA 2PFBA 2NNYA 2ZSIB 3HHGA 3I5UA 1Q43A 5BNOB 2M8EA 1FPN2 4YFKF 1OOPB 3AKPA 5CYVA 4A3GJ 3FZVA 3IV5A 5HXVA 5HDGA 5LA0A 5A3MA 1NG6A 3WF2A 2X8KA 4I09A 1IRXA 4JDNA 4XJUA 5FLMJ 5J3LA 5CG9A 3ZCOA 3ZMOA 2P7VB 4H3WA 4Q1PA 1Y9QA 4M6VA 4JVAA 2ET7A 5IT6A 1AR63 4PF1A 4Q4W1 3LCPA 4J00A 3A21A 4A12A 2RS51 2BQPA 3I3EA 5BQTA 2P3KA 2VCAA 3G1LA 2ZEWA 3QYBA 2G9FA 5JI6A 2ZJCA 2Q2EB 2L5QA 1PUFA 1R1A1 2KL4A 4R1HA 4MGQA 4CYCA 1YJLA 2PXJA 2NVTJ 4B3XA 1W0OA 2WZR1 2FCUA 4GD4A 3AP5A 3WGGA 3ILNA 1S0EA 4JHZA 5H6RA 1AR71 1IPKA 1NUKA 3PDQA 1KQRA 2M9HA 3WG2A 1S0DA 2KXLA 1X19A 3G3ZA 2VOXA 1S2KA 4L99A 2AS5F 3I56I 1AYM3 1W8HA 1P4WA 2PHTA 2QCOA 4P9WA 5FP8A 2DAOA 2ZXWH 2BVMA 5IAVA 4HYEA 3WGIA 2HEWF 2PJRB 4JRLA 3IHUA 1NXD1 1X7NA 5FD6A 3G1MA 5FUNA 1YRZA 4G8XA 3RKYA 1LEBA 4YW2A 1SVMA 4J1XA 1QHHD 3WP3A 2BEOA 1H30A 1K5MA 4GMP3 1QVTA 1MDMB 2WSVA 4Y22B 2AR6A 1NCQC 4RDUA 2EB7A 3ZN6A 2QQPA 3HAGA 2XAJA 3ULQB 1Z3YA 3GXUA 5JIAA 5A7SA 3PUIA 2FD5A 4NHXA 5JPNB 1W6QA 1VRH1 1RVF3 2YBKA 5DZEA 3UJQA 5FYTA 4ESFA 2Z5UA 2P34A 3W20A 1T98A 3J81Z 4CDXA 3ROUA 3W2WA 4YG3A 2WAFA 1FNNA 3GBWA 2VNRA 4FISA 4NRPA 1G3YA 1DZQA 5E3MA 5FFZA 4M72A 1V54H 3PU8A 3R4KA 4DRRA 4FSJA 1O8SA 1A35A 5J37A 4XM3A 1YIPA 4B7EA 2MW8A 4II2A 5FQ0B 4E4SA 2BV6A 1QA6A 2O03A 3GGLA 4EN0A 1TG7A 2ELHA 2W5FA 1ACCA 1QQP1 1NHAA 3GTGJ 4IRHA 1Z7LA 3BTXA 1L7LA 4RS8A 1W2NA 1V5EA 2HOEA 5D8AB 1MS0A 5A7PA 1T2XA 2XAUA 3PTRB 4A3ZA 2XQRA 2R072 2FDKA 1TME3 2DT7B 4I02A 3LQQA 1V5GA 2E34A 3K4DA 2XUMA 3MPPG 5CZKA 4A3BJ 2BZTA 1V0AA 3BTJA 2GXAA 2LC2A 1WBFA 3I2IA 4ZDLA 2IBDA 3LSDA 1DPUA 2PMZN 3RKQA 1GP4A 4YM0A 4WCGA 1RUOA 3WHBA 2ZCWA 2F5CA 2F5VA 2LALA 1V6KA 1LPQA 3ZYIB 1D3YA 4D1QA 3VBFC 4SLIA 5FMOS 3AP6A 4C90A 4CP0A 3FM3A 2IFRA 3Q8BA 1QZZA 4EJRA 3PL8A 3TWIA 1SFXA 2R7VA 3MQ0A 1JZ3A 4XQFA 1R4NB 3ZLIA 4F7ZA 2HEYF 3PU3A 1U0JA 1HRI2 3IIIA 1PNFA 4L2NA 1PDNC 4V2GA 1DQ6A 4AFAA 4GYGA 3KWVA 4FPEA 3TNQA 4ZYHA 1WRJA 2WTEA 1Y1WJ 3FLTA 4R4XA 4YYOA 3WTWC 1BXHA 1J59A 1MEC3 1LQ1A 1QBJA 4G7OF 4UHTA 3IPVA 1RUNA 1K5MC 1HW1A 2M1BA 3SFZA 2R16A 3OY8B 3K48A 4AEDA 4XUOA 3ZMDA 5A1AA 3EBRA 3D82A 3SKJE 3HD8B 1SFEA 4I0AA 4WM7A 2DFEA 5JSPA 1GLNA 4W6XA 2OPTA 1I39A 5F32A 1MVQA 2JKXA 3HT2A 4F3QA 3GZAA 1KYZA 3HRMA 1LDJA 3ES4A 3IMNA 3H5NA 3VBUA 3WG4A 4FASD 1IG7A 4IHWA 4KNYA 2PN6A 1DU0A 1H2MA 3H0OA 2YU1A 4D7NA 5FV3A 2M30A 3C7OA 2VBXA 3ZXKA 5HCHA 1QJY2 1LFBA 4X1EA 3OYJA 3GCXA 4Q4W3 1NKGA 5FXVA 3TP0A 4L18B 4XSZF 4LOCA 2Y0MA 2RJKA 3ACHA 3CL1A 1MBFA 4IKFA 2PJRA 2PAKA 5EYRA 3VBOB 4QXBA 3MMYB 3OMYA 5LK7B 2GMMA 3AMQA 4NQWA 4P9GA 1DDNA 1H6YA 5D6EA 3ZSMA 2VR4A 2Z16A 3F95A 3V4GA 3CLPA 4FQ4A 2PAMA 4K8FA 4AGGA 2BY0A 4MG2A 5B1BH 2MBFA 4U36A 1LOEA 4ZU4A 1QPMA 1H89C 4ZTJA 1IUYA 2R7XA 2E19A 1X3UA 1PO21 3PURA 3BJ6A 4TV7A 2JX9A 2VQ0A 4XLCA 2H6BA 4RGKA 1FOD1 4A7YA 2AQEA 4K7JA 1R1A3 4C3JJ 1QHDA 2Y0SN 4AHYA 3GDBA 4HMZA 4QPQA 4FQGA 4WBBA 1HQWA 3BGAA 3SH4A 1PUFB 1JZ2A 1BI1A 1Y9MA 1GDTA 4AIDA 4H2AA 4YGEA 5HS8A 3S1RJ 3NNJA 1YS7A 1FX7A 4NWVA 3HXLA 1NK2P 1YLFA 1ZHFA 5K5QA 2L0KA 5EJZB 2E1MC 3FMRA 1XTAA 5CU1A 2WZR2 1UMQA 4WM8A 1FV3A 3KF3A 1TNSA 4L0YB 3EUKL 2GP3A 3M7AA 1W4MA 1ENXA 1VFCA 1H8TA 5FYZA 4P08A 2VUMJ 1JYCA 2FHRA 2RDPA 3RSNA 1V70A 1W6PB 1FAYA 5HLGA 1REDA 3SZPA 3B7MA 2D1VA 1MQTB 3VBRC 1RUF2 4MSVA 5LHIA 2XRLA 2WNOA 1D1AA 1A8MA 4OMYA 2Y8KA 4QPYA 1HQNA 5E18F 3OL4A 1WLCA 2WA4A 1ZGAA 5T54A 3LDBA 2EF6A 4XW3A 1BR2A 2CMPA 1S2EA 2WFF2 1H0MA 2L9NA 2VNGA 3IUOA 3GTKJ 2PN5A 1FPN1 3C2GA 2JUGA 5C3PA 5LGNA 2VZQA 3L2UA 1SPPB 3CDZB 1JI6A 1E5HA 2E71A 2IXJA 1D2QA 2X5IA 2VZTA 2WT0A 1X1CA 2L7ZA 3BR6A 2DOEA 2Y30A 3CC2I 3DEWA 4IEYA 2P17A 3POJA 1XPWA 1T6GC 3M3EA 4XRSA 4ZDPA 3ZFFA 1AVBA 5L3BA 3A0KA 3HKZA 3JRAA 2XASA 5F6FA 3E0JB 2ZHLA 1QNWA 4KNCA 1MZFA 2L9VA 2YX4A 2DQRA 1VBB2 2VE8A 2HYFA 4PJNA 2BBAA 2GMPA 2D5VA 4IVNA 3GFLA 1DQ2A 4F55A 2EIDA 1VQ5I 1G2HA 1MSFC 2VKEA 1PO11 3WQ0A 4UUTA 3JRDA 5C3OA 3BIWE 3VZMA 2UXNA 1R082 3O1TA 3HUGA 3BALA 2J7MA 3R4UA 2V4VA 1OURA 1HW2A 1N3QA 3SEQA 1OKRA 4UW3A 3LPFA 5EV7A 5A3LA 2KRHA 1FNYA 5F37A 2JJ6A 1VB4A 2VTXA 5FPBA 1FP1D 1VJ2A 5C4WB 1UYXA 2RS32 2ETEA 2X29A 4IDZA 1LTEA 3COAC 3LEKA 5CLSA 1GWLA 3S2WA 3BCWA 2EIMH 1PM7A 3CQZJ 3ZN0A 4A3JJ 1TEIA 1FX5A 5J3UA 2X53S 5GLUA 4Y33A 2HWC1 4ZDOA 2FJ1A 3NJVA 2X85A 5FRMA 1FBSA 3VKMA 1KU7A 4XEZA 4OAZA 4B47A 2CYFA 1RXFA 5IJRA 4JGZC 3K1NA 4XLAA 4PBPA 1EUTA 4D7TA 2Y6JA 4U7DA 2QVOA 4XILA 1O4YA 1UAAA 3VDDC 1QXPA 1Z7S2 1E17A 2V09A 3VD5A 3BZKA 5K0UA 2STTA 1BMV2 2ZHMA 1YTYA 2EH3A 2MHFA 3WNKA 4BYYA 1BR4A 4IL6C 3JD71 2FF4A 3E1F1 4EN9B 1TMF2 2Z1DA 3LE0A 2RDRA 2O8QA 1O8PA 4M3DA 4Q4Y2 3KIOA 1HBXG 4EM0B 2DA4A 1ULEA 1W9WA 4MH0E 1B1BA 4XPVA 1BBT3 3JQWA 5FDBA 2FQPA 4ET7A 2VECA 1W03A 4FFHA 3ZIWA 1YIFA 4BQYA 4R9AA 5CNAA 4YEJA 1VTNC 2W87A 3W5MA 4S2GA 3M1EA 1LFPA 1Q8SA 1SMYF 2FE3A 4M3CA 3RQ0A 1ND2C 1TT5B 3GEZA 3HPGA 4M3FA 1OA3A 4WVVA 2P81A 1PX4A 2WNUC 5JZGB 1DCSA 2ZMEC 1ON2A 1P4XA 2ISZA 4CZZA 2WN3A 2EBIA 3BJOA 3J7AO 2ZX3A 2ME6A 2QWWA 4Q5OA 2EXHA 4YLZA 4Y24A 1VALA 4GKYA 2ZC2A 3E5UA 4LE3A 2ZKLA 2KIFA 1F4KA 2LVSA 2XJRA 2F6BA 1T0FC 1COV3 2XH6A 5FJ8J 4CICA 3MWMA 1AR72 1PVC2 4XBNA 4OHVA 5K7PA 4BY7J 1Q8VA 5BYNA 3TEYA 5DD4A 3RIRA 3ZPOA 3FMQA 4DBQA 2OZJA 5B66C 2WY8Q 4R79A 4KWKA 2V9KA 2EVXA 4KYWA 1VQOI 1YFXA 2LROA 3HTUA 4YZ3A 2JDYA 3GUDA 3B6CA 5IT9Z 2VCBA 4A6EA 3N3HA 2XJQA 5IPAA 2FDFA 4L8QA 1BI0A 3V0AA 1QJFA 3P3NA 3GFJA 4BQ1A 1UZVA 2E63A 2OA2A 2QQMA 2L7MP 3T0AA 1A3KA 3GZ5A 3WF3A 5K0UC 4U7BA 4RAYA 5L36A 3GVAA 3DTEA 1NE4A 3MFAA 2YSRA 1RVF1 2HBUA 3CUQC 2CUZA 2D3RA 1SDWA 4BXUA 3V56A 1XC5A 1NQDA 1GYKA 3RZGA 4LMYA 2KPMA 4KU8A 2DF7A 2CV0A 2QKMB 1Z7S3 3GZ6A 2WA3A 1XSVA 5L3CA 1BL0A 2LTNA 5AC93 4M9XA 2D6KA 4XYXA 5KXBA 5C3QA 2DWRA 2QQJA 4UYBA 2V73A 4XKCA 3KVBA 1W6NA 4WK8F 1QWRA 1TZLA 4JX5A 4AOCA 2HKOA 4HOBA 1TWHJ 4XF3A 5FOBB 1VMHA 3B69A 2OZUA 1ZZBA 2JA2A 5FUIA 1C5HA 2B7EA 4JZRA 4I0WB 4RGUA 2QCSB 4XHXA 3RJRA 1GFF2 4XZUG 1AU7A 1J2XA 2TCTA 2A6ZA 2Y6FA 2DYRH 5F3GA 1WWXA 3AKRA 4H55A 3PO3J 1UIJA 1OPCA 1XN7A 1IS4A 1X8EA 2CFXA 1HKSA 3FKJA 2FBIA 1A6CA 3V0AB 4J19A 3OPWA 1F5JA 2QQ9A 4TLGA 2VJIA 4CRQA 3WW1A 1U5YA 4RGSA 3DKXA 1LKXA 5I0TA 1YOVB 4N90A 2A73B 5LCWL 2YPJA 5FP9A 5J47A 1JUHA 3NJXA 5DN2A 2QM3A 3CEWA 1HDKA 2Y48A 1HJFA 1J7KA 3WDUA 3K10A 5E1ZB 4AE2A 2RS53 2IVIB 4UUSA 3Q9VA 2A5YB 4X6AJ 4ABZA 2UYAA 5A70A 3H35A 2BP6A 1RC6A 4HRIA 3QU3A 3DF0A 5EGOB 5FKNA 1CVNA 3OYWA 5F0HA 1B35B 3IKTA 3V8JA 2R7SA 1LOBA 4R4ZA 5FZ8A 1W6OA 5KXEA 1YITI 3DKWA 2WDBA 3NRUA 2YHJA 4CH7A 1PUEE 2GC0A 4XIKA 4BQ4A 4AUXA 1YS6A 2YUSA 1UG0A 4FCAA 4I2OA 2XONA 5TGTA 3OYMA 1HRI3 4YVWA 3KMHA 1FIAA 1N3OA 1P7IA 1ENRA 2WWSA 2UV1A 5FY5A 4Y4YA 4M3GA 2W52A 4XBFA 2A6XA 5A32A 5K1YA 4HN1A 2YDEA 1UELB 3O6BB 1OR7A 4QPGA 2UWAA 3GLLA 1BHGA 3D1NI 1AHDP 2DYCA 2WABA 5ANQA 5FO5A 2IS2A 1YWKA 2QKDA 1LU1A 1W3VA 2WQZC 3JRIA 1ZBA2 3D6EA 2O6GE 4PI0A 3OUIA 3OYLA 3OB8A 4RN5A 3K3OA 4BL0B 4ZYAA 4X8NA 3CJXA 1OA4A 3N9MA 4KBBA 4GWJA 4URAA 1WJEA 1PO22 5L3EA 3FL7A 3BU0A 4Y1ZA 5IYCJ 3MFKA 4JQFA 1N25A 3WP5A 3M4FA 1RUD2 5HI0A 4PZJA 4ZS3A 3QPHA 1W2UA 3N97A 1AR62 2P5VA 4P9JA 4F83A 4FTEA 3TQNA 4G9SB 3DLAA 3N36A 1D4VB 3ZR6A 3LKJA 2WN2A 2WL1A 4OIOF 5HS9A 4MFEA 3I2JA 4EWAA 5L9VA 1R081 3OCPA 4L0ZB 4S05A 1RJ7A 5GTHC 5D8KB 2BHYA 1JYVA 2DCKA 3L9JT 1ZG3A 3AJYA 2DUOA 1N75A 1GZTA 1Z77A 5LEKA 4BB3A 1BEV1 2W08A 4Z07A 4CDUC 4D5FA 2HQNA 5I0DA 4R9DA 1N1SA 3L2WA 4L9NA 4GRIA 2P3IA 2A68F 4W97A 1OFSA 5M3FJ 1XGOA 2FCVA 1S8NA 3ZSKA 3AFHA 3KYDB 3FXRA 4HKWA 3TN93 2G9WA 2NVYJ 4M01A 1UZCA 3ERED 2E33A 3VHNA 4FOWA 3PVBB 1QQP2 4TLFA 4BJ0A 4I3GA 2QBYA 4KGGA 3OWTA 1AYM2 1PZ9A 1CF7B 2PLYA 1NLQA 3VKOA 2ZFWA 1POGA 5JR2A 1GNYA 1LVKA 1MBEA 4M9SA 3U4XA 1OH4A 4X6QB 4MXVA 4LB5A 2GQQA 1VRBA 5F2WA 1CESA 3DPTA 3VD9A 2E6VA 1DQ4A 1YQAA 2WFF1 4DUVA 1H8TC 5FYYA 5JOYA 1V00A 4CU9A 5JWPA 1SAXA 3HNBM 1NCRC 1AL23 1QKQA 4CUGA 2ZEXA 3CZJA 3E6MA 3RJ2X 1L3JA 1IN6A 4XFAA 1YCIA 3KP4A 4UF0B 1LB2A 4YW4A 3DN7A 4B29A 1FXZA 3RJPA 1V3FA 2EA7A 5C3SA 5F7UA 2Y31A 3A2KA 1IS6A 4Q29A 3ABTA 3VBUB 1RI7A 2HLEA 4BPZA 1LHNA 4ZZDA 4RAGA 2BOIA 3LFIA 2L4AA 4PUSA 4WZCA 3VEPA 1KDKA 2DQLA 5L9RA 3W6JB 4XFFA 1Y9GA 3WX5A 3I2KA 4CTEA 4IOCF 2M4KA 1X33A 4P14A 2KZVA 5FYVA 1LVAA 3H36A 3PM1A 5A33B 3T09A 1CAVB 5DDJ2 4PCQA 1X2MA 1IGOA 2Z69A 4L11A 3ZSJA 2ATFA 1FJLA 3KCCA 5F39A 1RUJ1 4RQPA 2Y64A 1HKQA 1JUPA 2WAQN 5A6QA 4ISQA 3O0WA 3LOIA 2A6TA 2VOOA 2KRFA 3ASOH 2YG0A 2XVCA 2DTWA 2QZ2A 1CD3G 3MO4A 2MFZA 4OUSA 3TKYA 3LPGA 1X1DA 2W1WA 3GX4X 1DP0A 3S57A 3N9LA 3MIFA 3ZFGA 1B09A 4BHPA 4IGOA 2H8RA 1W9YA 4MGIE 1K4TA 4LK0F 3ESWB 3GO5A 2NVQJ 3UKVA 3POGA 4HN0A 1VQLI 2VN2A 2RDQA 2PX9A 3IB3A 3D5LA 1VQNI 4OVEA 2OJED 1A04A 1HX6A 1MNEA 2XWJB 4LLFA 4AZZA 2YV8A 5J6XA 2K0GA 1WW4A 4LGWA 4LO6B 3AZYA 3E3VA 4A5MA 4MGYE 4TXWA 1DLCA 4XE9A 1JZ6A 3QH6A 1TP4A 1ZGWA 1R64A 3HL2A 4RAFA 3KCYA 1HRV2 4K6BA 4D0PA 3K4ZA 3HTSB 1R1UA 2RHPA 3DL3A 1Y4WA 3JCIA 2Y26A 1QDOA 4GO1A 2HFHA 4EWDA 2OC6A 3R4SA 5K0UB 1QY4A 1N1TA 4K40A 1ODDA 1F31A 2HPIA 3R0AA 1XNKA 4L9VA 1YI9A 4E2SA 3VBFA 2Y60A 1Y43B 1H9GA 2H1KA 4JBAA 4CP1A 3PNAA 4CA9A 3PJRA 1EAH2 1OLQA 3A22A 4IHTA 2VMHA 4AGRA 4CEYA 2IVJA 1NX9A 1KYWA 1WLWA 2NVXJ 4A93J 1Z9CA 2GP5A 3OIOA 2D6OX 2IZWA 3CCMI 3AXEA 2O0OA 3WQBA 1CAUA 3V7CA 3TBIA 4IV1A 4XOPA 2PMWB 4Y5Z0 3DXJF 3OYDA 3EUHA 4QPWA 1K7AA 3LSJA 1O59A 4Q4W2 1H9WA 1DQ0A 1UKRA 1LR5A 2PJPA 2WAEA 1FOXA 3ZQCA 1PMIA 2ZAHA 1DQ5A 3AYAA 1W8UA 4PJJA 3WV6A 1E3HA 1EAH1 1E57A 3R05A 1AR93 1ERDA 2D97A 3VYRB 1Z7S1 4CPBA 1JGGA 1EH7A 4MHGA 4EV0A 4Y1YA 2XAQA 1YW8A 4CCLA 2FDGA 2DFIA 2J1RA 2WNVC 2Y6KA 4N43B 4QU2A 2JJ7A 4H0EA 3FHAA 2FZ2A 1AR92 1C5IA 4PDWB 3KHCA 1ZBA1 2RV9A 4INDA 3G6EI 1QGPA 5CFDB 4NC8A 4MGKE 3H9QA 3U4SA 3OIQA 1C8NA 4IETA 2HWD3 1WA4A 5EEHA 1CQ9A 5LGTA 2CWMA 3F9KA 4LD5A 2W1OA 4UFHA 1VBA3 5GAHJ 2F48A 2JDPA 5FPLA 4KH9A 3TNPB 2V4JC 3CZ6A 3E5QA 2V1UA 1U5TB 4PK4A 2MEV1 2WNVB 4LHKA 1UOGA 2ZGSA 3HJRA 4YW5A 5A1FA 3VZLA 2HEVF 1OF4A 1K78A 3OTFA 1FBUA 3H92A 1K3IA 2R6QA 4BXFA 4Q4X3 4DUWA 4PDWC 1ND3A 2ICWG 1Q8PA 2O8OA 2IJLA 2D6LX 4Q47A 4P02B 2NOGA 5F3IA 2NOJB 3RI4A 5IVBA 1VBA2 3F0CA 2VI6A 4LHLA 1WA6X 2ZA9A 4E7ZA 2FSWA 4WVMB 1BI3A 3ZYHA 2R5YA 1W28A 1PM4A 5AFBA 2ID6A 4NIIA 4AFMA 3POEA 2WWJA 3NARA 2ERFA 5T52A 5H2FC 3CO6C 4BQQA 1Y7BA 3RS6A 1GICA 1EJ9A 4FAGA 5FLXZ 2ZX1A 4FPOB 1NH3A 4YVSA 3AMNA 4PIXA 2B63J 4E4DX 1AX0A 2VBZA 2EFNA 3ECOA 2ZXIA 3GFIA 4PGHA 2HVRA 5CKQA 4E7SA 4PIYA 4QX2A 1GR3A 3UGFA 1S0FA 2B42B 2CG4A 3OGJA 2W1UA 2YY1A 4D0QA 3T5XA 3SH3A 2MD5A 1H8AC 2KJBA 4YFWA 3NNFA 4IE0A 2PHRA 3BG3A 4U2AA 1CAWB 5FLIA 4AW7A 4WWCA 5BNPB 5GPAA 2ZACA 5D5XB 3VPRA 2A7AA 2WS92 5EIYB 2ZKZA 3DKQA 3S16J 1SEUA 3IT8A 2DBIA 3BPZA 2M2EA 1QJY1 3WR0A 2K9ZA 4NJ4A 4ZKTB 2UYBA 3ATGA 1C0WA 1K12A 5F08A 4CYCB 3MUZ1 3LOCA 3LSGA 1YG2A 2EFOA 5LW9A 3PUSA 4QB2A 3H5RA 1BW5A 4BEHB 2JA5J 4ESBA 5FKCA 3DPUA 1HRI1 1BM9A 3QCWA 4ASKA 1OYIA 2LF7A 5F6LB 4ETSA 4S2FA 1S0IA 3ZQ7A 3MW4A 1MZEA 4WZFA 1W6OB 1IJWC 2J1EA 2VMFA 3AM2A 4GGGA 2B4KA 1OQEA 3I4MJ 5BMZA 4XQWA 3AK0A 1T6BX 3GTQJ 3FBNB 1UOBA 1YHQI 1Q3EA 2DVDA 2K4JA 3UNGC 2IXIA 4QX0A 4CCOA 4MGZE 1UN1A 1JH5A 2GIVA 2QQUA 4CU8A 3ACLA 4AWXB 3K75B 3O7OA 2R5YB 3OD0A 4IL7A 1GNHA 1Z78A 5EFUA 1XYOA 4COYA 2JWTA 2ZMNA 3WDTA 1Z3XA 3W9AA 5FY4A 2I45A 2VQLA 3SKVA 4G3YC 2PEXA 4LNVA 1QO0D 4LMFA 1DP7P 3DTIA 2A69F 2MLGA 3BKZA 2BV4A 1KD7A 1VI0A 5ILVA 4WM7B 4CDWC 5CPRB 5DG1A 5L73A 1DGWA 3H3UA 2JD4A 4U0VA 2MA3A 1VMJA 1GLHA 4NPLA 4IV3A 3M3YJ 2ZHKA 2JD9A 1ZAOA 1FYLA 2W94A 4MYEA 4UW5A 4MOAA 2F5FA 3U1XA 3ASIA 5ACA2 4IV1B 5HLHA 2BNNA 2UXXA 4A3EJ 3CIHA 2XSDC 2ZNZA 3F3XA 2BJSA 3NRVA 1E5SA 3F8CA 2W39A 5JSRA 2DI3A 2LKPA 4JGYC 3POIA 2D44A 1RUC2 3NNMA 2PI0A 1HRV1 3J4UH 2HOAA 3ALQA 3C7GA 1A8DA 4X0GA 2P6CA 2IA2A 3AVRA 2GBYA 4P96A 3S2DJ 1ZBE2 1F5TA 4ONUA 1VBD3 5JUVA 5BNQA 3WEZA 3QAHA 4BJTA 1ZG5A 1FLIA 5FYCA 1QF3A 3GF2A 4KICA 3DCQA 3HWJA 2Y6HA 4MHRA 1NLSA 2CL2A 4ENNA 1I9RA 4KMUX 3H0DA 5D8AC 1GV2A 3KB5A 3JW4A 4NHLA 4RD7A 4ARXA 2O1QA 4Q26A 5D8AA 3B00A 4NHMA 1AWCA 4HKOA 4QQOA 2R7WA 1FYMA 4HSLA 4AD9A 1HN1A 2VJ5A 3A0HC 2GH2A 4Q1RA 5FZ9A 2VU9A 3GTJJ 2WYSA 5T5OA 4DMIA 2JA6J 3P9IA 4AVTA 3FK7A 2BTVC 2OTLI 1RUE3 1USSA 3N4MA 1PO23 1ZR2A 3AL0C 3SMHA 1BEV3 2V1NA 3VYTB 3AB0A 4HX8A 2J1AA 2IXCA 2GZWA 3IL2A 3VDBA 3FBYA 1DZTA 5E6HA 2RQPA 5FMBA 3JRGA 3OY8A 5E16A 3WQ7A 4QU1A 1LGBA 1MSEC 2C0ZA 3Q8FA 2E32A 4CDXB 1LOGA 2JSCA 4CA0A 2DBBA 4BQ3A 5B4NA 5GLVA 3AG3H 4Q5SF 2YX7A 2LBFB 5FZ6A 4B4QA 4BJ5C 4NVPA 3ZN1A 3WDVA 1QJU1 3MV11 4LIUA 2VL8A 4LKEA 1K5MB 4KDPA 1D8JA 1KGSA 3DWLE 2RM21 3DXTA 2R7OA 3IAS2 5K8SA 1RMU2 2VASA 1IPSA 3MZHA 1XX5A 5HDKA 3PSIA 4Z8BA 2VVEA 2P37A 1UX6A 4XJAA 1CZTA 1AR81 4XZPA 5FMOL 3K46A 2R061 1ASJ1 2EIEA 3EHKA 1QZYA 3O0VA 5D5VB 3CCJI 2O8KA 1IW7F 3CP2A 1JZ7A