4R8HA

The role of protein-ligand contacts in allosteric regulation of the escherichia coli catabolite activator protein
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-activated global transcriptional regulator CRP
publication title The Role of Protein-Ligand Contacts in Allosteric Regulation of the Escherichia coli Catabolite Activator Protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 60
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4r8hA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4r8hA01
3NQOA 2XLAA 1Y9QA 4P5OA 4A5NA 3CJXA 2IRFG 1G3TA 3G7DA 5LRRA 5LLQA 3ML6A 2Z99A 4HV5A 4PDKA 4LLNA 1STZA 3ZMVA 3ROUA 5TRDA 2V1UA 2MA3A 3SMHA 1R1TA 1YTYA 4DQ2A 1EH7A 1CF7A 3QU6A 5IT9Z 4A2UA 1I27A 1ON2A 4Q0UA 2XAHA 1YS7A 3SCFA 1KU7A 4WWCA 4LG0B 3ELKA 4QM9A 2OZJA 3HUGA 2VOPA 1RUOA 4A6EA 4Q29A 1LNWA 1OYIA 3IL2A 4I2OA 2W24A 5JAXA 5FDBA 5HLIA 1UCXA 4HX4A 2VOOA 4HF0A 3J80K 3H1WA 5F64A 2XAJA 2XKPA 4FAGA 2VXZA 4XLNF 4MTDA 2E7XA 4WXHA 2BNNA 1RIOH 1FBUA 4L18B 3ZMTA 1TQMA 3KCCA 2HYFA 4R52A 1DGRA 4EWDA 3LA7A 1B4AA 2DLLA 5J7MA 2Q0AA 1BI2A 4A0YA 3MQ0A 4ESBA 4Q4ZF 1X8MA 5JSPA 2CFXA 2VT2A 4I09A 2F5FA 4BHBA 4JTNA 5CYVA 2HDCA 3BB6A 3MYXA 1EV7A 3R6SA 2M5WA 3MZHA 2ETHA 2QZ8A 3BP8A 1BI0A 3IDBB 1FBQA 2KIUA 5DCFA 3VB2A 2EAAA 1YHFA 3DN7A 1FC3A 3HRUA 3NJZA 3F8CA 3IIAA 2XKOA 1UW8A 1WGPA 1Y3TA 1EH8A 2ZO4A 4G7ZF 4LTAA 2K4BA 1TNSA 3C18A 2HGCA 4LLGF 2GC2A 2D2WA 2JPCA 2Q4SA 2K9ZA 4O9EA 2MBFA 4R79A 2Y75A 2V1DA 5CVVA 2NYXA 2VONA 3LQRA 2UYBA 4BYYA 5DV5A 3F23A 1ZZBA 3U11A 2NAZA 1C0WA 3IDCB 1F9NA 4GGGA 4YYOA 4Y17A 1Q3EA 2EFPA 1TQPA 3J81K 3H92A 5JSRA 4Q48A 4HA8A 2YR2A 2DT5A 1HBXG 5FO5A 4MHGA 2RV8A 2GXBA 4QXKA 5FLJA 2D40A 2YX7A 1QGPA 4LB5A 1YUDA 1UB9A 2ZNZA 1ZRCA 3FXUA 5I0SA 4JTOA 1OYYA 2ISZA 2N7GA 3PQJA 2ESHA 2HEOA 2H6BA 4FT8A 1O7FA 2XL9A 4L9TA 3I54A 4A0XA 2GWRA 3ZDSA 2PJPA 2IXCA 2OAZA 1Z1DA 4XEZA 1D8JA 1I1SA 3M7GA 1IRFA 3LQQA 2EA4A 1FNNA 2Q2EA 3FE5A 1KU9A 5D8KB 2HKXA 3I59B 4IJAA 1L0OC 4NB5A 2HQRA 4I01A 3FM3A 4RS8A 1U5TB 1XCBA 4E2QA 3O3KA 5HS8A 1DPUA 4KFCA 2XAQA 1ZARA 4L11A 2FBHA 3IKVA 3PFIA 4OFGA 3RTRA 1HSJA 2ZXJA 3GF2A 3V7SA 3DQVC 2A07F 4O9GA 4HLTA 5LGTA 2IXLA 4XF1A 1T98A 2BNOA 2OZUA 4WXDA 1EH6A 5L3FA 2NNYA 2QUFA 2X4HA 4YFNF 1KQ8A 3DKWA 4IEVA 3E97A 2IT0A 2UWMA 2Z3YA 2AXLA 3CUOA 1H1IA 2V6CA 4HX8A 3F8MA 5KK1A 1S6LA 1V3FA 4WXCA 5L3BA 2PTMA 4HMZA 5A2QK 2K86A 2W84A 2D1VA 3WTVC 2Z5UA 1QQIA 5DD8A 1ZVFA 4MGYE 1SFEA 3KLOA 1ZG3A 4EGYA 3CTAA 2PFBA 3BU7A 2A68F 1FPQA 3L00A 1Z6RA 4XF3A 3V8JA 4QLCU 1IN6A 1IAWA 3GZ6A 3CL1A 3L2CA 1ZZ9A 3CLOA 4MGRA 4E2GA 4KWJA 1XSDA 3F3XA 4NHJA 4WBBA 3LA2A 1Z7UA 1ZRFA 4I7HA 1IN5A 4L0YB 4RB3C 4ZYHA 4IRHA 1QXRA 4ETSA 1Y0UA 1ZYRF 3SCHA 1DZTA 1DUXC 2GC1A 1YFYA 3H7JA 3RPUA 5JI6A 2WFPA 2EFNA 5CVIA 1EY2A 4J1WA 1ZN2A 4AQ2A 2A3SA 1EPZA 3I64A 1YYVA 2VC0A 4A12A 3RYRA 2HYGD 4LJZF 3REOA 1P6RA 2EWNA 4M9XA 2ADUA 1YQAA 5FQ0B 5IT9K 3HRSA 4Z82A 1QZZA 2D1HA 3FJSA 3BWGA 3WTXC 3JAMZ 4IVNA 2KXLA 4M73A 4ZYGA 3CUQA 4UVAA 1XGMA 1CAUA 3ZQ7A 4WVZA 4LA2A 5F1RA 1R1UA 2VE8A 2Y0MA 1IUYA 1ZGJA 5DUIA 2EFQA 1R7JA 1RL3A 3RNSA 1O7LA 3SXYA 4HN0A 3ZN1A 1YS6A 2GH2A 3FMRA 2PAKA 3D0JA 4OIPF 2DBBA 1RUNA 4I0AA 3UKTA 4U0YA 3TO7A 4ZZLA 2CYYA 4EMSA 3RKWA 3HHHA 4KMUX 1YLFA 4IHSA 2WC2A 2VPVA 3Q9SA 1SD7A 4LLLA 4L2NA 3FMSA 4NVPA 2DTRA 4HOBA 3CO6C 1F4KA 4B8XA 3F8NA 2FU4A 1I5ZA 5CVJA 3T1BA 1TW2A 4IRGA 4X6QB 4ON0A 1ZLKA 5I91A 1IZ1A 1FX7A 4BNCA 1EP0A 2GU9A 1LVAA 4U0WA 1T0FA 3IWZA 2M30A 1USSA 1WKMA 2GIVA 1YLLA 2OQRA 3IC7A 2FQPA 3G3ZA 4EJVA 2ACJA 2PHDA 1SD4A 1DP7P 1U5TC 4RAYA 1FLIA 5K5OA 4MQ9F 1O5LA 1HKQA 1X82A 4QGLA 3KP4A 1XN7A 2MC3A 1J7KA 1LR5A 5L3CA 4MX3A 2VBXA 2EV6A 4N9HA 1J9IA 4UVCA 2PHLA 2LF7A 1S7OA 3R60A 2FE3A 3MFKA 1LKNA 3ST7A 2UY8A 3QRFF 3P7NA 2XAGA 4HAMA 4R8HA 3HRTA 3GVAA 1TW3A 2VECA 5JHUA 1MJAA 2NS0A 1LDDA 3K9TA 4TLFA 3USSA 1XRUA 2P8TA 3IRQA 3W6JB 4GO1A 2QVOA 3SFZA 2IW5A 2D45A 1R58A 4HN1A 3CO7C 1CAVB 2FEZA 4AVAA 5BUVA 3JTGA 3M9AA 2EFWA 3HOTA 4KIFA 3BOQA 2O8QA 1MJBA 3F6OA 2P5KA 1JHFA 4AD9A 4CZZA 3RDIA 1DZRA 1WQ2A 4LK0F 5I93A 2PI0A 4Q0QA 2RDPA 1BM9A 2ET7A 1QPMA 4EM0B 4AVCA 5IT3A 4HBNA 4WX9A 4KL1A 3ZMZA 5EEHA 2AS5F 4EJOA 2O1QA 4D7TA 3VEPA 4ZYEA 1ZGAA 4WCGA 1XDUA 3HSEA 2F4PA 2CSOA 1NXMA 3U10A 4EM2A 1LJ9A 1O3SA 3GFIA 4BHPA 1B6AA 2BV6A 3PVBB 5FFZA 4KU7A 4IPAA 3DPTA 3BPVA 1NE6A 2E1NA 1ZRRA 4HF1A 4UBHA 2YPRA 4CYDA 3IWFA 5HDGA 3KP5A 1DDNA 4B29A 1ZLJA 4IRIA 3DL3A 1S3JA 2C0ZA 4ZU5A 3HSRA 4OLLA 1XE7A 4P9GA 3IRRA 5C8WA 3WTSC 2ETEA 2JSCA 2FBKA 2P17A 2Y0OA 4IEYA 4AVBA 1Z05A 3WGGA 3U1DA 5FPXA 3HYIA 1LEAA 3NVCA 4XF4A 5FGMA 3NSTA 3ULQB 5EZWA 3WW2A 3EQEA 4G94A 1IPJA 1S29A 3HTUA 4HDUA 1R5HA 5F6FA 5I8SA 4PGHA 4M72A 4WZCA 3BJAA 3V7RA 3T8TA 1CF7B 1RNLA 5CU1A 1XGNA 4BIFA 3IBMA 1FBSA 3BJ6A 1HQCA 4KT5C 2KIFA 2DI3A 2PQ8A 4RD7A 3I53A 2DPDA 1WWXA 3S2WA 5I0RA 4P96A 3WTYC 1FSEA 3RYPA 3JSPA 2D5HA 3NKTA 4RGRA 5J48A 1OMIA 2D5FA 2H27A 2LKPA 2K02A 5D5UB 2IA1A 2OYZA 1BI1A 2O3FA 1ZZ8A 1G6NA 1XD7A 3S7EA 4IEQA 4EGZA 2H94A 3SHRA 2CQKA 3KMHA 3H50A 2RN7A 5FLXK 3BDDA 3JSOA 2QQ9A 1B1BA 1NE4A 2L01A 1PP8F 5DUKA 4BXUA 3MCZA 1XB4A 4DINB 3C1DA 1KU2A 1J75A 4LUKA 5DCMB 3JW4A 3EETA 1R22A 4QGNA 4Q5SF 2Q1ZB 2D93A 3D0SA 3GFLA 4A6DA 3F22A 5TJJA 4PIZA 3K1PA 4GYIA 3SXWA 2FMYA 4PIYA 1T39A 2IA2A 3JAMK 4TV7A 5LBQA 2HTSA 4JK1X 3WW4A 2GC0A 2Q30A 2PQQA 3ETQA 1BI3A 4RB0A 1P4AA 5J8CA 3KEOA 1DGWA 1LB2A 3GFMA 5E1ZB 2KIMA 1E2XA 2H0VA 4Q0VA 2EA2A 1FP1D 1Z6TA 1XE8A 4XSXF 3HT1A 5ED4A 2VC1A 1VR3A 4BHCA 2ZFWA 3BY6A 2J5OA 2GC3A 2X0LA 1NYWA 4R1HA 3VFZA 3KP3A 4HZFA 3P9KA 3QACA 5BPXA 1O57A 3HQXA 4EQQA 5FCCA 2Y48A 2MNGA 1SFXA 5LHHA 2XL7A 2V1XA 4LB6B 2XGXA 3E6CC 1YW9A 4N0BA 4HW0A 5DD4A 3FHIB 3LAJA 3CO2A 3FMQA 3GYHX 1XDSA 1RI7A 1R23A 2HTJA 2YSRA 1ZAOA 2QBYA 5KHGA 3MWMA 1BOAA 4H7LA 3TDZC 4ENJA 3GFJA 3GW2A 4IESA 4U88A 4MTEA 1VP6A 1BN5A 2QYOA 2MH9A 2QVSB 4Y15A 4EWAA 3WODF 1ZZ6A 1GQHA 4IEXA 4MV2A 2BBYA 1Q5OA 5E20A 3GEZA 2O61A 1MKMA 4I98B 3O6BB 1B9NA 2DQRA 2XLFA 3ES4A 3FHZA 1HW1A 2E7WA 2CG4A 4HYEA 2XUBA 4L0ZB 1G3YA 2A6EF 3KGLA 3BZ6A 1D8KA 1R1VA 3KZYA 1CAWB 5BMZA 3HIFA 4EV0A 3ZP5A 1RC6A 4BQAA 1OR7A 2XIGA 1SMYF 4YIIA 5L3EA 4ZH4F 3KP6A 2O0YA 1XMKA 1P4XA 1J3QA 1J59A 3L09A 1HXDA 2JPBA 3V8KA 2GXGA 3ECHA 1IF1A 4KN7X 4EJUA 2PN6A 1K78A 1AOYA 1T38A 4KIBA 2STTA 4JQFA 1A04A 1O3RA 2PMUA 2K0GA 2K7LA 5ILVA 2VE9A 3TO6A 3UKNA 4WK8F 3UKVA 4MGIE 4YFXF 2CAVA 1FWZA 2PG4A 3WGIA 3MDPA 3ZN0A 5KVRA 5CVRA 3FX3A 1ZX5A 1OKRA 2O6GE 1SD5A 2K27A 1HW2A 2OA2A 3I59A 4H0EA 3LOIA 4LEJA 4ENMA 1G4DA 3ERED 1J1LA 5E8IA 2UXNA 4U7BA 1U5TA 3CF6E 4UVBA 3BCWA 2KKOA 2UXXA 3DF8A 1J3PA 3AAFA 4PGGA 1YFXA 2DPUA 2ZKZA 3F6VA 3G73A 5D8LB 4ONUA 3K1NA 4ENNA 2M1BA 4XF0A 4UUVA 1XMAA 5D6EA 3NL1A 1OD5A 2OA4A 4I02A 2P7CB 5HDNA 3LAPA 2VN2A 5CADA 1QBJA 1D3YA 2DQLA 4FHTA 4KA4A 3TNPB 2IPQX 5FB2A 3WTZA 2Z69A 1TQ5A 1TBXA 1P92A 4AIJA 1YFWA 1SQ4A 4AXOA 2EV5A 2HWVA 1IXRC 3R0JA 1ON1A 2KJBA 2P6SA 2VBYA 3WTUC 5LEKA 5K5RA 3RZZA 5LGUA 4MGKE 5KHKA 1ZHFA 1XSVA 1W4MA 3RPQA 3ZMDA 4MH0E 3RIRA 2V09A 1CAUB 1CAXA 3R0AA 1B9MA 1TNTA 3WTWC 3GXOA 3M70A 1KU3A 1EYBA 2O03A 4P9UA 2CWEA 4GULA 4IERA 1MDMB 1O5UA 1T6SA 3U2RA 4KMFA 3KETA 1YW7A 3FM5A 1RZ4A 2PYTA 2QQAA 2PFWA 2W25A 4L9JA 5BXXA 4LMYA 5FLIA 2HFHA 1I6XA 1FYKA 1BIBA 3B73A 1MJ9A 2C6YA 4UXAA 4BAYA 4EVIA 3K1MA 2QENA 3GWZA 4N9IA 2HQNA 4D0PA 1W7PB 1H9TA 4GCVA 3JTHA 4XLPF 5J6XA 2FXAA 2IP2A 4UBGA 2LNBA 2FMLA 2M87A 2QQBA 2XVCA 1J5YA 4QGMA 3F8BA 2B8MA 1K7AA 1H9GA 2PAMA 2VBZA 2IVMA 3RJPA 1LDKB 4E70A 3HSFA 3U0ZA 2OQGA 3F72A 5J3UA 3TOBA 1R00A 1BIAA 3PQKA 2DCTA 3K2ZA 2OZ6A 5E17F 2P5VA 2G7UA 3EJKA 5JFRA 1AWCA 3FZ3A 2QNKA 4YG2F 3M1EA 1SEFA 1IN7A 1ONVA 2ATFA 2Z33A 4UHTA 3GX4X 1P4WA 1PUEE 1O3TA 2BEOA 1XCVA 2RNJA 1OYWA 4OMZA 1ULYA 2ZMEB 3OGJA 2M45A 4MQVA 3HT2A 2PBIA 2RQPA 3SQNA 3L2HA 2A6HF 3TNQA 2V79A 4XSZF 2UY9A 1G3WA 4M74A 2PA7A 1J2XA 2OPKA 3I0TA 3DFGA 1TTYA 1BJAA 4KWLA 3C3WA 4AIHA 2G7HA 5T3NA 5KHIA 3QP5A 1IW7F 1H0MA 4Q0PA 2ZNYA 2ISYA 4U0VA 2LDUA 5E8GA 5J8FA 5BV6A 1UD1A 4Q47A 3MPBA 2IXKA 1OI6A 1LQ1A 1RTVA 5HDKA 2PEXA 2K4JA 3K69A 5CLSA 1T2KA 4XFHA 2CV6A 3GYDA 5HS7A 1W5SA 4HQEA 2F2EA 1CAVA 2G9WA 4IEUA 1B59A 1QXJA 1UIKA 2FA5A 3WTTC 2QLZA 3O14A 4LD5A 1R36A 2QDRA 3F8FA 5DYMA 4S04A 4HVOA 4O5VA 2FOKA 4E2SA 3L7WA 1SD6A 4KN4X 3DPLC 2UZKA 3TQNA 4M9SA 5AIQA 4RB1A 2HS5A 5L3GA 4Y13A 2ESNA 4AQ6A 3E6BA 1V70A 3EHKA 5D4SA 5D5VB 2H6CA 1X3UA 5HS9A 4UV8A 1KQ0A 3KZZA 2EB7A 1SMTA 2HKOA 1DPRA 3F21A 3WU0A 1U3EM 4A0ZA 1U12A 4HLYA 1ZG1A 3VODA 1HSTA 4RGUA 3R4KA 6PAXA 5ICFA 4P9FA 3FWEA 1MD0A 2P7VB 2VQAA 3EDPA 5ICGA 3QPTA 4LGWA 4HSJA 2FBIA 2DW4A 5FD6A 2PLYA 1ZZ7A 2Z9OA 4ZZDA 3JZVA 4YFKF 4PJYA 4XFAA 5CVUA 2Z2SB 4L5IA 4XFGA 2O8XA 1XSXA 2GAUA 3LAGA 2EJRA 3GO5A 3HRMA 2XRNA 2BNMA 1UHWA 2YU3A 5K8SA 1NZCA 5KBFA 2CO5A 1LEBA 2HZTA 1J0RA 2W85A 2BYVE 1BC8C 5C6CA 5HOOA 3SHFA 1LRHA 3IKTA 1K79A 2L54A 4F8AA 4YARA 1REPC 1P2FA 4HF2A 1GXQA 4YIFA 1ZNPA 3DP7A 4DNCA 5H20A 4LLOA 4CGZA 5D1IA 2PAEA 3V8LA 1UFMA 3EBRA 3S0MA 1OFNA 4K8FA 4FAHA 3QAHA 4HQMA 4OMYA 3K0LA 4LG0A 3OD0A 2XHKA 3MZYA 5JCTA 1LDJA 5JR3A 3RKXA 1YFUA 4MEXF 2A61A 3FXQA 1WI9A 3KP2A 1JUHA 1UPIA 1FT9A 1L3LA 1K6OA 1QWRA 2DK5A 2EK5A 3E5UA 1FYMA 5BOXA 4XFCA 3RYKA 2FF4A 5FD5A 2GQQA 4HX7A 3DXJF 1QNTA 3O2PE 1FOKA 2XASA 5DCMA 5AVPA 1V4RA 2MHFA 5ERIA 3QOPA 4PCQA 5FPZA 2GA1A 3E6MA 3D5LA 3Q5FA 3WW3A 3FFQA 4CHUA 5D5XB 3BPZA 4ORFA 2P5LC 5BPDA 4ENKA 2QWWA 3NEUA 2EV0A 2R3SA 3MEXA 4KU8A 3GLXA 2ZJ2A 2HJIA 1W5TA 2STWA 1VJ2A 2HR3A 4MZUA 4UNOA 2OD5A 3C3VA 2J5PA 3NRVA 4IEWA 2L4AA 3DV8A 3SZTA 1HKTA 4IEZA 4WF2A 4HVRA 3MAJA 5CJ9A 4EM1A 2LSOA 2IXHA 3BALA 4KYWA 3FZVA 2QBYB 1KYZA 1NHAA 5K1YA 2COMA 2XLGA 4L9VA 5LHGA 3I4PA 5EEGA 2CGPA 4XBFA 4CXFA 1JGSA 1IN4A 3KP7A 4OIRF 1ZG5A 2ZKLA 1WSUA 4RGSA 3OTFA 3ABUA 4XFBA 3M8EA 4FX0A 4QWQA 4OIOF 5DDGA 2ZBKA 3T8RA 4EJWA 1QY4A 1TLHB 1YFHA 2A5YB 2M8EA 1U8RA 2VODA 3U9GA 1YIOA 1ZREA 2JT1A 3VHRA 5HVQC 2WV0A 4M6XA 4IETA 2IA0A 4J1XA 3COAC 1F1ZA 5D4RA 3CJNA 1E17A 2Q8KA 2MPFA 1WA4A 4IEOA 3TKYA 1U2WA 2BGCA 5HLHA 2A69F 3W6KB 4NQWA 5JR7B 2GA2A 1K78B 3I71A 1YW8A 1ZRDA 4ZU7A 2JRTA 5E18F 2IC1A 5I8YA 1IPKA 5FLHA 4G8XA 5BPIA 1FP2A 4EWEA 2VT3A 3T0YA 1PDNC 4IF4A 1CAWA 1H1MA 3EQLF 5LRSA 2EVXA 3EYYA 4Z2YA 2MH2A 3S7IA 2B0LA 2EFOA 5E16A 1GQGA 2XAFA 3H3UA 2W57A 3VOEA 5LGNA 3FF5A 1GHCA 1PM7A 3N97A 4ZU4A 3TO9A 1IRGA 4CO8A 2XROA 5I8TA 1ZZCA 3NW4A 4X6RB 4U7DA 5D5WB 3DEUA 4LA3A 3QP6A 2FNAA 3N4MA 1Z91A 1WRJA 4CICA 1U6GA 2P6TA 4MNUA 4RGXA 1ODDA 5ICCA 1BBYA 2JTVA 2ELHA 2JZYA 1KA8A 3OF1A 5L3DA 1X7NA 5FFXA 3KE2A 4BH9A 2L02A 2MD5A 5H6QA 4AWXB 2NNNA 3FXRA 3LWCA 2RVCA 3E6DA 5K5QA 4XETA 3LFKA 1XGSA 3V7CA 3EUHA 4M71A 5BY5A 4M9ZA 2QJVA 1X8EA 2RC4A 4CDGA 4O6JA 1KGSA 3CLPA 4LUMA 2L3DA 4QM8A 3PLQA 2BE5F 5BQTA 3J80Z 4JVAA 3E3VA 2FNPA 2EA7A 5E1WA 5FLXZ 5I0UA 2OBPA 1JXSA 4IHTA 1CAXB 3WG9A 3P9IA 4G6DA 4Z07A 3CUQB 4HDVA 5LHIA 1MZBA 4XFIA 2RGVA 3ABTA 3OOPA 1S8NA 2WTEA 1FSHA 3KFWX 4QX5A 1G3SA 3D82A 1IXCA 3ISPA 5ILUA 4S05A 4P55A 1JHHA 4PZJA 3H7YA 1PP7U 4L5JA 2MLKA 1TQIA 5H6RA 4PIXA 1SFUA 2P4WA 3GUDA 4GXOA 5KHJA 1FY7A 4YSFA 4G7OF 5FQ0A 2NRAC 3H3ZA 2MLGA 1CGPA 3LWFA 4G6QA 5ILSA 1WLTA 4YNIA 3LA3A 4MUVA 4HVQA 3IHUA 5ICEA 2WWYA 4IEPA 1YG2A 4UXNA 3ZMSA 5AONA 1SAXA 4KUMA 3L9FA 5E1RA 4Q0SA 3WE3A 1IXSB 1UHMA 5KHHA 3RI4A 4LULA 3V4GA 3WE2A 1MDMA 2H09A 1D5VA 2QCSB 3EYIA 1XGOA 4RAZA 1O4TA 3GZ5A 4UV9A 1OPCA 2FQ3A 2CW0F 4ESFA 2F5CA 4HBLA 3Q9VA 1UCRA 1W7PD 5BS6A 3RKYA 3GBFA 3SCGA 4ESJA 1Q43A 3QPHA 4G7HF 4XF9A 3H9AA 5JSOA 2HOEA 1J58A 4XFFA 3BJOA 4I3PA 4HV6A 4XRFA 4B09A 1W7PA 4O3MA 4QMAA 3ELNA 3I7DA 4RB2C 4AVPA 2B5HA 1UIJA 4I0BA 1YWKA 1MGTA 3I5UA 2B9UA 2I45A 4FBFA 3WU1B 1FYLA 2XV4S 3J81Z 4OU0A 1SFNA 3P9CA 4LK1F 2VBWA 2IJLA 1L3JA 5LEJA 3M8FA 3ZPLA 3ECOA 4ZYDA 1J3RA 2CAUA 5HI0A 2Q0OA 4KWKA 2KJCA 1FXZA 1CX4A 1GVJA 1QZYA 1S7AA 3E5QA 4HLXA 1KYWA 3J7AO 3R61A 2DO7A 4OOIA 2R7DA 3E5XA 2GZWA 3LSTA 4IXAA 2LF8A 3CDHA 3EO6A 4YRDA 1BC7C 4META 3KEQA 2UYAA 3KGZA 3H8UA 2YX4A 1YO5C 4M6YA 4HSLA 4EROA 3B02A 4JBAA 2V9VA 4G9YA 2ZMEA 3WGHA 2DFIA 1Z9CA 1JE8A 1F5TA 3M3IA 4MGZE 3C7JA 1R5GA 4AIKA 4OIQF 1U78A 4KDPA 1VTNC 2L4MA 3ACLA 4EJTA 3H1MA 1USTA 2DU9A 2FSWA 2FRHA 5EFUA 1O3QA 2DK8A 4GYGA 2F5DA 1IN8A 3ES1A 5HLGA 5JVTA 3PNAA 5AIPA 3TOAA 1QO0D 2E9QA 3WW1A 4JV4A 2OU2A 3TDUC 1GXPA 2IXIA 1I1GA 1Q1HA 2PMHA 3CUQC 3BPXA 1FI2A 2F5EA 4FX4A 3QU3A 4ASNA 4A5MA 5A2QZ 5I0TA 2KRFA 1RGSA 2DAOA 2ET1A 1FZPB 5D6FA 4OINF 4D7SA 3KLNA 1KQ9A 3BROA 4MEYF 2IXJA 1ZH5A 2QM3A 1HW5A 3HOSA 2R7FA 3HTSB 4KICA 4L9NA 4K2EA 4F7ZA 3CEWA 3TGNA 3KSCA 3T5XA 2RKHA 2TDXA 5E1XA 5DEQA 3I58A 4LFUA 3SZPA 4KNYA 3HHGA 4KIGA 1HKSA 1PMIA 3H1YA 2ZCWA 3OV8A 3ZMUA 3LZZA 2E1CA 3OCPA
chains in the Genus database with same CATH superfamily
1VQ7I 1B72A 3AMMA 5FZ3A 4P5OA 3VDXA 2IRFG 4BBSJ 1D2SA 3F95A 3M3CA 1R093 3POFA 2RM22 2Z99A 2BOLA 4QX8A 4HV5A 4LLNA 3ZMVA 3OEAA 3PMSA 5TRDA 2V1UA 2MA3A 2NQYA 1FPN1 4S2FA 1R1TA 1BBT3 1BMV2 1EH7A 3ZRGA 4Y26A 1KFXL 4XAEA 2RDRA 2XAHA 3RQ4A 3FK6A 4QKNA 3SCFA 2YZ4A 3U1KA 4NDLA 2OZJA 3D4KA 1RUOA 2BFUS 3WEZA 4BQ1A 1VQ4I 2QDNA 2V5DA 2RJKA 1DLLA 3OWTA 4AGRA 4LBMA 2F6BA 1UCXA 2VXRA 3AZWA 2SLIA 1FOXA 4UFLA 5F64A 1UZCA 3NV1A 3WNXA 1QQP1 1BA5A 1PX3A 1VQNI 2BNNA 3ZMTA 5J1UA 1CPMA 2V5YA 1MH3A 2M3AA 4ZXEA 3LMMA 4EWDA 3KB5A 3J8F3 5J7MA 1OCPA 2DMUA 4NIIA 2DUPA 4A0YA 5M5XJ 3POIA 3MQ0A 1QJU2 4ESBA 4KMQA 5A32A 4YG0A 3JCIA 3FHQA 4Q4ZF 1GQPA 1ZRIA 4QKFA 2KRHA 4Q4X2 3FBMA 4QQ2A 3P1IA 3U75A 3AFHA 1SFYA 1C8M3 2JEMA 2OW4A 2KIUA 5A6QA 3RGBA 3NJZA 3F8CA 2XKOA 3CCYA 1UW8A 4GMP0 2LLKA 4ITVA 1SBDA 5DUUA 4D1QA 2P3JA 5FZ7A 1VI0A 1JZ4A 2X5IA 4MFDA 1TNSA 3TB0A 3VBHA 3WUDA 4II2A 2MABA 1MZFA 2UU8A 4IOCF 4R79A 4F3QA 1VE0A 4R9AA 3R0RA 3H8OA 1A6QA 1DHKB 2UYBA 2OKXA 4EN0A 2JJ7A 1O4ZA 1HJGA 3VBRA 2VZQA 2YG0A 3LEKA 2E1MB 5FP9A 3ZXGA 2AEZA 2ARXA 4Y17A 2CW7A 4GALA 5A7QA 1TQPA 2EFPA 3J81K 3T2TA 2B9VA 1OCTC 4IHVA 5H9QA 2YR2A 2DT5A 1XNBA 3K4BA 3ZXJA 1XNKA 3U37A 2D40A 3AP5A 1R4MB 4SLIA 2Y34A 1FMD2 3HBZA 1DGRN 1ZRCA 3FXUA 1TME3 3I3BA 3H9QA 3FKIJ 2VOXA 2K9QA 1UOGA 2HPIA 1Y8QB 2E26A 3RZLA 1OYYA 2ISZA 3PQJA 4FT8A 4GWMA 5CFDB 3QD6A 1Y0NA 2WADA 2RREA 2EZHA 1RUD3 5BNOA 1EUUA 4A41A 1Z1DA 1RINA 4M0NA 1IRFA 3LQQA 1FNNA 2LRPA 3I59B 3VBSC 2E2HJ 5JXJA 2CDOA 2HQRA 2VAUA 3I4NJ 4B1LA 4KFCA 3AMHA 5KR7A 2WY7Q 2A3XA 4WZFA 3U07A 3RTRA 2ILMA 2P0WA 3V7SA 4XMIA 2P1BA 2J1AA 1SMVA 5LGTA 2IXLA 2E35A 3VDDB 1FMD1 5DPNA 2OZUA 5FV3A 4WXDA 4YZ3A 2LYCA 1NLSA 1QNWA 2X4HA 1T33A 4YFNF 1UZZA 1NQJA 2UWMA 4OUEA 2M0CA 2AXLA 1A8DA 4MXWB 3MD2A 5BYNA 3CC4I 1H2LA 3F8MA 1S6LA 1W6OB 5JXGA 2Z5UA 1QQIA 4Q1RA 3KLOA 2XQRA 2MYSA 3CTAA 2PFBA 4EGYA 3IAS2 4A3EJ 1JYCA 1IN6A 4IV1C 3WF2A 3CL1A 1ZZ9A 3CLOA 1FV2A 1PO21 2JDAA 1MMGA 4MGQA 2Q8OA 1Z7UA 1ACIA 1W9FA 4F52A 1QHGA 4ETSA 1R9TJ 4XTMA 1ZYRF 1DZTA 5A7OA 1K3IA 1HIXA 1R082 4YLZA 4QPGA 4M3CE 2EFNA 4PQQA 5CVIA 1SG3A 2RM23 2FCTA 1EPZA 1YYVA 4A12A 2GNMA 1GV2A 4LJZF 2DCJA 1P6RA 2EWNA 3C7FA 4M9XA 2W08A 1QVTA 4Z82A 3SDGA 1MBJA 2AGSA 4CZSA 1WHUA 5BNGA 4IVNA 4ZYGA 3CUQA 2PLV3 1XGMA 2ZXQA 4LA2A 2BHZA 2Y0MA 4B7KA 4YPJA 4HKWA 3RNSA 1O7LA 3ZQGA 4QWNA 1GWMA 1YS6A 2GH2A 3FMRA 2DBBA 2E7TA 1HLCA 1YITI 5LASA 3FIWA 3TO7A 4ZZLA 1U5ZA 4EMSA 4KMUX 3TP3A 5L9VA 5IW0A 5A7WA 4NVPA 2VQ0A 2QQVA 3IUOA 1QJU3 3ACHA 2D6LX 2I8DA 3SYTA 2FU4A 3BTYA 4ZS3A 4AW7A 3T4VA 4P9IA 4Q4X3 2LFBA 1LU1A 3SQOA 5I91A 4JX6A 2Q8DA 2VTXA 1SPPA 1USSA 4HG6B 3M8LA 3V0BB 1H2KA 1WKMA 3J7ZI 2GIVA 2A3YA 3IC7A 3LSJA 3BQYA 4FXGB 4RGKA 1RUI2 2AREA 2PHDA 4LKEA 1R1A2 4QQLA 1ZYBA 2FOWA 1ULDA 3TMOA 1XQNA 3KP4A 2MC3A 5L3CA 1AZDA 1DCSA 1GLNA 2EV6A 4UFIA 3F2ZA 3R60A 4M6VA 2JKBA 3H35A 3C2GA 5D8AB 3I4IA 4ES8A 4UFHA 3P7NA 4HAMA 4YFWA 4R8HA 3HRTA 1AR83 2RQQA 2VECA 2FHRA 5JHUA 3PJQA 3K9TA 1V6MA 3USSA 3VB9A 4Z1VA 2XPJA 3JU9A 4W4ZA 3WDWA 4QU2A 5KC6A 5FP3A 3OGGA 4K6BA 3VBFA 1CAVB 4M3GA 1JJ6C 1RUF2 1B35C 4IV3B 3H1CA 4NAMA 4PCRA 4Y22B 1JHFA 1X4OA 1R1A1 3G6EI 1DZRA 4LK0F 3OYBA 2P81A 5FZIA 4NIAA 4EM0B 4AVCA 4WX9A 2M4KA 5CKTA 4KL1A 2DFHA 1WLDA 3B3QE 4WCGA 4XIDA 2F4PA 2AO9A 3H3LA 4JX4A 4FCAA 4FQ4A 4EM2A 4GRIA 2XGCA 2QQWA 2RVAA 4JGYA 4QX2A 4BM8A 1UO9A 1UMQA 3OBAA 1LECA 5FFZA 2VL4A 3A0BC 4G9SB 2ZAHA 3ENRA 1RUF1 3H5NA 1AL21 2ZEWA 2Q5TA 1FMVA 1F8VA 3HSRA 4P9GA 4CCNA 2VVDA 5C8WA 3VBUB 3WP4A 3WTSC 4A3GJ 2FBKA 1H89C 1YC61 3UKGA 2LD5A 5C3RA 4BY7J 2DODA 3EQEA 4KG8A 5DDJ2 5F6FA 4Q1PA 2WWSA 2ECBA 1S4CA 3V7RA 5CU1A 1UMZA 2KIFA 3OOXA 2IVIB 2Q8CA 4MO7A 1Y9MA 4XKBA 4P9WA 2PQ8A 4RD7A 2Y2ZA 1ULEA 3I53A 2DPDA 4C90A 1YJNI 2QGUA 3WTYC 1F31A 3JSPA 2D5HA 4RGRA 5J48A 2D5FA 3WNMA 4W97A 2ZSIB 4N7UA 2OYZA 3T2PA 2O3FA 3AMNA 2WAQN 4XUTA 5T50A 1H30A 3SHRA 3TL4X 1I3QJ 5A3PA 3H50A 5IVFA 4PUSA 1VB2A 2BVMA 4XDPA 3VBSA 3NJYA 3K4AA 1R083 1POQA 2W2IA 2ENRA 3BTAA 4UUSA 4RMNA 1XB4A 5DDJ1 4LUKA 5DCMB 4RQPC 2YBKA 3ZN4A 1Z21A 3EETA 4QGNA 3PFYA 1AX2A 3IH4A 3GFLA 1H8VA 4A6DA 5CKNA 2XGEA 4PIZA 3K1PA 5IAVA 3POEA 3SXWA 3ZYFA 1W6MB 3HOXJ 1RUH2 2IA2A 3JAMK 2XR4A 4ISRA 2HTSA 4XABA 3OYLA 1BI3A 2DA2A 3PSIA 3KEOA 2R073 3WP6A 3W21A 2KIMA 4OCTA 3QBQA 1MEC2 3VHOA 2EALA 1ND3C 3S5QA 2JB8A 1XE8A 4DB5A 1EF4A 2Z1DA 5ED4A 1VR3A 4JGZA 1RPWA 4R1HA 3KP3A 1APLC 3QACA 3AFKA 5KXBA 1O57A 3VV1A 2EIBA 2MNGA 3DKXA 3I97A 5HNFA 2ZXWH 2PQSA 3E6CC 2A75A 4Y4RA 3LAJA 3K48A 3BOWA 1XDSA 1WI3A 1R23A 5FRNA 2YSRA 2PX9A 1BOAA 3NKGA 3RKQA 4LR4A 5LK5A 1RUI3 3MZ8A 1MEC1 2K9SA 2L7MP 1YI9A 1R1A3 4I0WB 2WAEA 5F3IA 2R1BA 1BN5A 2QYOA 5GAEJ 3ZQCA 2PMZA 3I4MJ 1PGW2 4IEXA 4IGQA 2K46A 2BBYA 3CBNA 2O61A 2XLFA 3FHZA 1GNYA 4A93J 1VALA 2VNRA 2NMNA 2QQMA 5EJ1B 1G3YA 1YX5A 1UYZA 3DXUA 1D8KA 3MLLA 5FJ8J 3DUIA 5FY0A 5L36A 3HIFA 4XRMA 1RC6A 5FYBA 4BQAA 5FKLA 1SMYF 2D6PA 4W1UA 5L3EA 1MACA 4XLAA 1LOFC 2A05A 4NWVA 5JWPA 1J3QA 3LSIA 4AHXA 4RR3A 3WNLA 3L09A 5HV0A 3V8KA 5K7HA 1VQMI 2EZIA 3OSFA 1AOYA 4KIBA 4BQQA 4JQFA 1CN1A 4BXSV 2PMUA 1PVC2 3UL2A 4MGIE 2AEYA 1PGW1 4BQNA 3AXDA 5HODA 4DBRA 3WGIA 1HJFA 4IGPA 3AL5A 4GB33 3ZN0A 1H2MA 1BVVA 1TNFA 1GYKA 2KDOA 5CQEA 2OA2A 1LAJA 4RAGA 1VQKI 1XNAA 4FTHA 3JB4C 5E8IA 2WNVA 4A42A 4RGGA 2XRLA 3DF8A 3AAFA 2BY2A 4PGGA 1ULGA 2DPUA 4X8PA 3G73A 5E6HA 1SHWB 1WLWA 5IVVA 3K1NA 1UAAA 2M1BA 5D6EA 3ZYGA 1OD5A 1ENXA 5HDNA 3KX2A 1GV5A 1NK3P 3LAPA 5CADA 5T52A 2IPQX 1XU1A 3MF9A 3FBIB 3USUA 4UFKA 1HCRA 1PVC1 3BZCA 4IDZA 4XBLA 4M00A 1NTCA 3QYEA 3OR1C 1PX4A 1DQ1A 2EINH 5A70A 2XJUA 4HPKB 2JA2A 3UV9A 3F0CA 3UR3C 3W5MA 2DVDA 4AGVA 2EV5A 1XC6A 5ERLA 2XJTA 2HWVA 1IXRC 3ZR6A 3R0JA 2WDBA 4CTEA 2EAKA 3WTUC 1S0DA 5KHKA 5LGUA 5DZFA 1W4MA 1HDKA 1CQ9A 5FROA 1VIWB 3MUY1 4MH0E 2DA3A 1ZR2A 3WF4A 4IE4A 2CQXA 2B7EA 3CCVI 5ABJB 1R4NB 2R16A 3WCSA 1EYBA 4HK8A 2P6CA 1H8AC 2VKEA 2WV1A 3K6GA 4DBQA 2DU1A 3U2RA 5KXDA 2CS3A 1B8IB 3RJRA 4AHZA 1RZ4A 1JUPA 2WNUA 3GHMA 2L9NA 2PFWA 3H9GA 4L9JA 1LFUP 5FLIA 1TWGJ 3O12A 3B73A 2A6TA 4CH7A 3AVSA 3VHNA 2C6YA 4EVIA 2QENA 2XBO2 4FOQA 5J1YA 4LK6A 4WVMB 3HNYM 4D0PA 1P7JA 4BK5A 1H9TA 1DDLA 2UUZA 3JTHA 5J6XA 5FYMA 2VE1A 2IP2A 4UBGA 4XMYA 2XVCA 2JWTA 4QGMA 1RUH3 3A01B 4CEWB 2VBZA 3RJPA 1AYN2 3CNAA 1LOAA 4A7KA 5LY1A 2HWF3 1DGWY 3F72A 1YI7A 4C2MJ 4N43C 4E7KA 4PQ9A 2E32A 3Q8FA 3WY6A 5E17F 4BCUA 1FJLA 4HK9A 3OYKA 2WT2A 2JSPA 4FTBA 2Z33A 3M4OJ 3ZFEA 1XCVA 5FYIA 1OH4A 4OMZA 2VKVA 1OSGA 3HT2A 4UW4A 1AYN1 3SQNA 3L2HA 3N9LA 3NAPB 2UY9A 1G3WA 4M74A 4KGGA 3EUHC 2QQUA 2OPKA 3I0TA 3C3WA 3ZFGB 3HC7A 3QP5A 1Q8QA 2PXJA 3NWSA 5K9YA 3E0JB 5E8GA 2M9HA 5J8FA 1SBEA 5BV6A 3BVCA 3W9AA 3ZQIA 2PEXA 4BQ3A 4CDXC 1E3HA 3AYCA 1DYKA 4YVWC 4LO6B 4D6QA 3GMEA 1B59A 2W1UA 2QLZA 1J83A 2QDRA 4EJRA 1T8IA 3WSOA 5HCFA 2Z5WA 3DPLC 1KS4A 2DYRH 4RDUA 4XUNA 4TLGA 3S6PA 5D4SA 4BACA 1CZSA 1KQ0A 1OVPA 5FKNA 4EQVA 1ND2C 2YPJA 1YJ9I 1WFXA 3WU0A 5GAHJ 2JENA 1B72B 2ZS6B 1K42A 3AL6A 5ICFA 3FWEA 3ASIA 2DMPA 2P7VB 3VN4A 4LGWA 1UOJA 1XYNA 1NOVA 4UYBA 5C71A 2F4IA 1XOYA 2DW4A 2WSUA 1ULOA 3IT8A 1TMF1 3JZVA 3MICA 4YFKF 4GQ7A 1GOGA 4XFAA 4M3FA 3GZUC 3NNFA 1XSXA 2GAUA 2IS2A 3LEIA 3ZM8A 3GO5A 2CFOA 1G9AA 1HDDC 5F0FA 5A6XA 4CE8A 2F4OB 2CO5A 1YIJI 1J0RA 2BYVE 1BC8C 2JMWA 3WP3A 1Z7S2 5BNQA 3SHFA 2X85A 3EUAA 1REPC 2R7TA 1P2FA 4HF2A 3DP7A 3X2QH 2F48A 2XHNA 5F6LB 1KITA 4FPGA 4M4RA 1OOPA 1MR5A 2RS33 4FAHA 4NIGA 1OJLA 4OMYA 1VBE2 1QZEA 3N9NA 2BXZA 2ZKNA 1F15A 4JCKA 2DVGA 3VPRA 3MIBA 2F4MB 3IP4B 3KZ4C 3U4SA 5C3QA 1HN1A 2DYCA 2A61A 3FK7A 1WI9A 2H8RA 4O7XA 3N36A 3IMMA 3KP2A 3WOGA 3LDKA 1FT9A 5F37A 1L3LA 3DPRB 1QWRA 4AF9A 3E5UA 3OIPA 2O8KA 2ZMEC 5BOXA 2FUG2 1Z7S1 4YZ4A 3OD4A 5C9AA 3OYWA 1QNTA 3O2PE 2A6VA 5AVPA 2DCEA 3B69A 2DVAA 2X5IB 1GP6A 3Q9OA 2BBVA 3AK0A 1VBA3 3Q5FA 1K6YA 3FFQA 4CHUA 4WM8C 1VBE1 1WCUA 1TWAJ 3QWLA 3OL3A 1OLMA 2XBO3 3IKWA 2BFUL 3NEUA 2ZJPF 2R3SA 3GLXA 2ZJ2A 4BXFA 3CQZJ 1A36A 1KXGA 2JB4A 2CRGA 2OD5A 2QQIA 3DV8A 4WF2A 3MAJA 3VBRB 1XNCA 2LSOA 3Q3SA 2IXHA 1OLTA 3BALA 1HB4A 4E7IA 2QBYB 1NHAA 5K1YA 1L7QA 2XLGA 5FO9B 1CQTA 3I4PA 1JZ3A 2CGPA 4HNVA 4XK4A 4OIRF 3WU2C 3GTQJ 1QMJA 5A33B 3WNNA 3OUIA 3VL9A 4FX0A 4OIOF 2ZX4A 5FKOA 2W92A 1U9OA 2BGPA 3S3NA 2VZOA 1CWPA 1WW4A 2CJJA 3UJQA 2WNOA 2W5FA 3JBG2 2I5UA 1W8FA 5FRMA 3F9KA 1S2BA 2M8EA 4FE4A 2VODA 1TT0A 4QX3A 3T30A 1JKQC 1C1LA 2FD5A 4M6XA 3BCAA 3ZYHA 4J1XA 3MKWB 3FDYA 3OYFA 1F1ZA 3CJNA 2VOVA 4MYEA 2MPFA 3TKYA 2BGCA 5HLHA 1G9CA 4MHUA 1ZKGA 3HEFA 3H36A 4ZU7A 4Y1VA 2LS6A 5E18F 1RUE3 5J4YA 1SVLA 1IPKA 4RN5A 5FLHA 4KI5M 1NKGA 4BB3A 1O8PA 4IF4A 1QOOA 4BOWA 5LRSA 4BPZA 3JBG1 2M2EA 2W57A 3FF5A 2LY2A 4OI1A 4JC1A 2ZBJA 1E57A 1IRGA 3OOUA 5I8TA 3NW4A 4X6RB 4U7DA 2OX0A 5J96B 3KCXA 2V7FA 1BEV2 3RZKA 3QP6A 2ME6A 4CYCA 1BW5A 3DYPA 5CG9A 4YVSC 1WRJA 5DS9A 4PLOA 1OF4A 1BLZA 2P6TA 3SFIA 2JTVA 3ZXSA 4L99A 2ELHA 5B2GB 1KA8A 1ZBA2 4XDOA 2CGOA 2XDVA 3GCWA 4OQ9A 3LF7A 5H6QA 2CQQA 3E6DA 5K5QA 2VNVA 1IDZA 2V6EA 2L9LA 3EUHA 4C2TA 4URTA 2J1RA 3A2KA 1QPIA 4LHSA 2XJSA 2X6OA 3W3CA 4NIDA 2BE5F 3J80Z 3OS2A 3MVPA 3AFGA 1W6PB 2EA7A 1GUUA 4AFAA 1X1DA 5E1WA 1LOCA 4IOAF 1CAXB 3EMRA 3OYDA 3WG9A 5TSWA 3CUQB 5KXEA 1TZLA 4CDXA 3J7MA 5LHIA 1EAH2 1Z7S3 4YVWA 2O8OA 2HWC2 1W6NA 3KFWX 2MD0A 1G3SA 5BNNC 1ZBA1 4Y3OA 2P3KA 3H7YA 3LEGA 4IE5A 4PIXA 1SFUA 4YW2A 5J1XA 2IZWA 4GXOA 2HEWF 4W50A 5KHJA 4AYUA 1TNRA 1VBE3 1VBB1 1QJY2 2NRAC 3H3ZA 3LWFA 1HXS1 4BDZA 1WLTA 2VTXJ 2J42A 1OLRA 3IHUA 3MPPG 5ICEA 3DF0A 2K3PA 2LH9A 1Y7BA 3ZMSA 4CCDA 5IJRA 3RCOA 3DXTA 4BU2A 1JOBA 2Y0SN 3RI4A 3V4GA 5B5EC 1YQ2A 3EYIA 2VZTA 2ZGUA 4OZXA 4PLMA 1JZ8A 5E3LA 2VIXA 4OAZA 1EAH1 1A34A 2HWC1 5BS6A 1W7PD 3SCGA 4NOTA 4GJYA 2F4LA 4MOAA 1MMAA 3AKZA 2XH6A 3DKYA 1PGL2 2HOEA 1MMNA 3BJOA 1NG7A 4B09A 3ELNA 3I7DA 4RB2C 4AVPA 1QJY1 4AR2A 1A31A 3C2UA 1YJWI 2B9UA 5FUPA 3CDLA 4AYBA 1PZ8A 4OU0A 3P9CA 2ZHNA 4LK1F 1V6JA 3OGRA 1L3JA 1V9U3 2J1EA 1E5IA 4LE3A 2X09A 4JKLA 2Q0OA 4KWKA 2KJCA 4MFEA 1CX4A 2W46A 1OVSA 4KGQA 3E5QA 1QZYA 5JZGC 1H88C 2VNOA 4Z92B 2DO7A 1EJ9A 4OOIA 2R7DA 3LSTA 4AQSA 3O1UA 1PGL1 2UYAA 2R7ZJ 3KGZA 4GMP1 2VMGA 1WJEA 3G1LA 3B02A 2E71A 1DU0A 2ZMEA 3WGHA 2KQRA 3M3IA 4MGZE 4Y1ZA 1S1AA 4DZJA 2JIJA 3W59A 3PUAA 2VNGA 5FZ4A 3LEMA 4P14A 4EJTA 3H1MA 1PJRA 4GA9A 1CIYA 2DK8A 4BQXA 1CX1A 3UNPA 1IN8A 4GKYA 4LIUA 4P9YA 2L2OA 2EBIA 3BU0A 3A1YA 2OU2A 2ZGLA 2HXOA 2WYSA 2ZACA 1W6QA 3AG4H 5CG8A 1ENRA 3EPZA 4ASNA 5I0TA 2JDUA 2IGKA 5GLUA 4R4ZA 2LY1A 4Q8LA 4LO5B 3AJZA 1ZH5A 3HTSB 4L9NA 2Y9YA 4XPVA 1BJQA 4NRPA 4I30A 3H0OA 4PHZA 1W06A 1D4M2 1G2HA 3TRSB 4H14A 1RETA 4AZZA 1ALYA 5CIRA 3ZKYA 3BPSA 3URFA 1IRXA 2M7AA 4D3WA 1BEV3 4R4XA 3HHGA 4TXWA 2KRCA 1HKSA 1PMIA 1MNMC 2ZCWA 3OV8A 4A45A 3OCPA 3NQOA 2XLAA 1R1ZA 4XKCA 3G7DA 5LRRA 4NC8A 4XOTA 3ML6A 2HBUA 1H6YA 3S8PA 1STZA 3ROUA 3SMHA 2LM3A 1YTYA 2VOTA 1CF7A 3VBSB 1EV12 4Q0UA 4A3ZA 4WWCA 4K8RB 2DA7A 1BHGA 4UUSB 2XXZA 3SISA 1DFQA 1MQTC 4A6EA 2WQZC 1LNWA 4C91A 5JAXA 3VD3A 2HWB3 5HLIA 3IAPA 4LIVA 1TP4A 4HF0A 2VOOA 3DGTA 3DECA 2XAJA 2XKPA 1D0HA 4E8CA 4FAGA 2RJ2A 4CDUC 4W6XA 1K83J 4XLNF 2OPTA 3LNQA 3GZTB 2E7XA 4WXHA 2DTYA 4UB8C 1EAH3 1R5ID 3L2RA 2HWC3 4OUSA 3KCCA 3CC7I 2VCMA 1BOBA 4MADA 4QB2A 3LA7A 3EUKL 4LBKA 2Q0AA 1BI2A 2YS9A 4HXCA 4MO3M 2YC0A 1YQ5A 1DZQA 4IV1B 3GZAA 4KJZA 1EV11 2CFXA 3O1RA 2F5FA 4JTNA 4LKFA 5GP9A 1JOJA 1IKQA 2BPA2 3FBNB 1ENSA 4YWAA 2M5WA 3BP8A 3G6JB 3FXOA 3IDBB 1FBQA 3PU8A 1YHFA 2Y0IA 1FC3A 3HRUA 4MLOA 1MBHA 4CP9A 1XU2A 4BIOA 2K4BA 3C18A 2HGCA 3RRDA 2LG4A 5FUIA 2EIKH 3EYPA 5CQGA 2MBFA 1QJEA 3WDVA 2V1DA 4XJUA 5IVYA 5CVVA 2NYXA 3ZXEA 2JICA 5JI9A 2LBFA 4BYYA 4CU6A 1WPKA 2FZ2A 1QJX3 2R7XA 4PT6A 1F36A 5DV5A 2P6HA 1NY71 2W47A 4E4HA 5J98B 3OBZA 4BQOA 1ZZBA 3VD5A 5FY4A 2ARAA 2NAZA 1RKWA 1C0WA 2XF7A 2V4AA 4GGGA 2XJQA 4YYOA 4V19K 1Q3EA 5GAGJ 3OYJA 3MV01 3CF5F 4HA8A 4CUBA 4D5CA 4MHGA 5C8CC 4QXKA 3S16J 3D5SC 4NQWB 4M3CA 1QGPA 1YUDA 4XLCA 1UB9A 2ZNZA 3BG7A 5FYSA 5I0SA 4JTOA 5FZ0A 4C3HJ 2EF6A 2HEOA 2H6BA 4NHYA 1O7FA 2XL9A 5KAIC 4BBRJ 2VQGA 4F3JA 3I8TA 2GWRA 3ZDSA 2IXCA 5CYYA 4XEZA 4MGSA 2KZGA 2NVYJ 2EA4A 4XRSA 2Z42A 2K40A 1KU9A 5EJ3A 4FTEA 4I01A 2W1WA 4E2QA 3O3KA 5FLMJ 2R49A 1FTZA 3EXUA 4OFGA 3AX4A 1X2MA 3BR1A 3M4FA 2QEXI 4CUCA 1U5YA 1F5FA 1UY2A 3AP6A 1W9TA 3FMGA 5L3FA 3K4MA 1YHQI 2E63A 3ZFFC 2PELA 1KQ8A 3DKWA 2DCKA 4ZPIA 4IEVA 5FZHA 3E97A 1IS3A 3USUB 3WR0A 3CUOA 2DF7A 4DXZA 4ZHNA 2UV1A 4HX8A 3GJBA 1F35A 3A0HC 5A2QK 4N90A 2W84A 3ORJA 3WTVC 4XCAA 2WN3A 4J6GA 1ZVFA 5IK5A 3SJMA 1OUSA 4XF3A 3L00A 1WJ5A 1IAWA 1MBGA 1B35B 2E33A 1W39A 3F3XA 4FCYA 1PK6A 1D4M3 2BW8A 4NHJA 3FKJA 3ZVXA 4I7HA 3LFUA 2ZGNA 4QKBA 3CF2A 3K51A 1W99A 3SCHA 5FTTC 2GC1A 3WINE 3WNPA 5IFPA 1X3ZB 5JHFA 3PL0A 2P2KA 1EY2A 1OQ1A 3M3OA 3I9V2 3RWKX 4AQ2A 2A3SA 3CDIA 2HWE3 3IH3A 1AR63 3AKSA 2KP6A 1YQAA 1VQ5I 3VLBB 4CDWA 3HRSA 4XORA 3I3MA 1N75A 1I1EA 2LTNA 3BWGA 3WTXC 5K0UA 3I3EA 5KHDA 2NOGA 2C5DA 4S2GA 1VMFA 4WVZA 3THTA 2ZGOA 4B48A 3TN91 4BMEA 4OMDA 2G4IA 3I3DA 2DFFA 5DUIA 2EFQA 4BKXA 2VQCA 1RL3A 3SXYA 3ZN1A 5LWBA 2PAKA 4I0AA 3UGFA 3HKZA 4XTPA 3UKTA 3HR9A 4U0YA 2W94A 4I76A 1U0JA 5C5UA 1H0BA 4DUWA 4CEYC 3HHHA 1OISA 2F17A 4IHSA 2WC2A 2VPVA 3Q9SA 1SD7A 4L2NA 3FMSA 4HOBA 5EJZB 5LATA 2K9MA 1G7YA 3PU3A 4B8XA 4CCEA 4O61A 2XQXA 3AZVA 1JYWA 3HXLA 4NHXA 4M3BA 4LO4B 4N53C 2BVBA 1HA8A 1I5ZA 2WR9A 3T1BA 5LA1A 5LY2A 1SAUA 3E1SA 4ON0A 1ZLKA 3OL4A 1GBGA 3HJRA 2GU9A 1EP0A 2LR8A 1POV3 3MMYB 1D5YA 3PNVA 3K46A 3IAQA 1YLLA 4XBNA 2AACA 2ACJA 4XLHA 1YIFA 4RAYA 4JYKA 3OS1A 4Z6YA 1AKHA 4FE7A 4CA9A 4MQ9F 1O5LA 1UPSA 4RQPB 2DURA 2G9ZA 2L9RA 1X82A 2VH9A 4QGLA 2X6WA 1LR5A 4MX3A 2VBXA 1XBFA 4A3DJ 5ACA1 1S7OA 1IGOA 3DYOA 4XUOA 4YM1A 1MVQA 3ST7A 2UY8A 4CDUA 1XYOA 4Y1YA 2ZX2A 1UY4A 2DV9A 1J84A 4XUQA 1S0BA 2E19A 5HXMA 3WUCA 3E1F1 2LMDA 3TAYA 4GO1A 2QVOA 1L7RA 1ETOA 3CCQI 2D45A 1R58A 4JKKA 1OH3A 5DXDA 2FEZA 1Y39A 5BUVA 3M9AA 4E7HA 3HOTA 2DT7B 2QQNA 2ES3A 4Q2FA 2EXKA 1WZ2A 3CP8A 1ENQA 2PI0A 4Q0QA 1ZM1A 1QPMA 1V6IA 1EA3A 1J1TA 4GH4C 2O1QA 5EEHA 2AS5F 3L2YA 4RYDA 4ATFA 3U10A 3POWA 4IE7A 4PDWC 5F2SA 3BQZA 3KLSA 1HOMA 5D2AA 5B4NA 4Q26A 4LITA 4BS9A 4IPAA 3BG9A 3DPTA 1V00A 2ZABA 5LFAA 1NE6A 2CQNA 1ZRRA 4OHXA 4CP0A 4HF1A 1ONAA 2VOKA 4UBHA 1RESA 2HQAA 5FZOA 5EZHA 3KP5A 1DDNA 3GZNB 4B29A 1W9SA 1ZLJA 1F4AA 1S3JA 2C0ZA 4PBOA 4Z2AA 4LMFA 3IRRA 4BISA 3MN2A 2ETEA 2JSCA 2Y0OA 4AVBA 1PGSA 2IWGB 4QDSA 3U1DA 3AMPA 1LEAA 4IGOA 3NSTA 2NLRA 3ULQB 2HDWA 2PHWA 4G94A 1IPJA 4HDUA 4PGHA 3JREA 3PUQA 3O0VA 5H9RA 3T8TA 1XGNA 3IBMA 4UT5A 1RKTA 2EXHA 3OY8B 4KWUA 1AJOA 3HUGB 2DI3A 3LPGA 5A3MA 4G6TB 3WF3A 2RDNA 3S2WA 5I0RA 2DTWA 3PIPF 1FSEA 2JKXA 2BWAA 3NKTA 4CEWC 1UWWA 1GR3A 1DIWA 4XRSG 4E7ZA 4NJ4A 2HYKA 1J09A 1UXXX 4KQ7A 4M01A 1G6NA 2Y33A 1XD7A 3S7EA 4IEQA 4EGZA 2H94A 1PUFB 4BJTA 1W8WA 5ANNA 3HQRA 3UYJA 4TTGA 3VSLA 2BZTA 1K45A 5FKBA 1Z7LA 4EZHA 1NT0A 2QQKA 3OYWB 5DUKA 2W48A 5LA2A 4Q4W3 3C1DA 3VZJA 3JRCA 3Q8CA 1OA2A 5IK8A 2M4GA 2EIGA 2D93A 2V26A 3GCXA 3F22A 4GYIA 4PIYA 5M5YJ 3C7OA 3ZFFA 3OGSA 2ME0A 4TV7A 4JK1X 4CDQC 2GC0A 2PQQA 2ZXHA 3UJOA 3Q0VA 5BNPC 1Q8VA 4JHTA 2CNAA 3D5OA 1A78A 4KH9A 3Q8BA 5A6ZA 3ESWB 2EA2A 3T08A 3SNMA 4XSXF 1UU6A 2VC1A 4BHCA 3BY6A 2J5OA 2FZ1A 1GMMA 2GC3A 2WT0A 1NYWA 2HQ5A 3A4CA 2ZA9A 3VFZA 3M8JA 4LBQA 3CJIC 1RMU3 1GWLA 4XXAA 1JTXA 5BPXA 4XJWA 3CCLI 2Y31A 1FMWA 5JXIA 2ZGQA 3OB8A 5LHHA 4G12A 2AHQA 4F83A 4LB6B 3RG0A 1YW9A 4N4NB 5DD4A 3CO2A 4PSXA 1K5MC 2FJ1A 3GYHX 5FZLA 1RI7A 2YC2A 4ENJA 2QKLB 3GW2A 2ZMKA 2YUEA 2Y38A 1YI2I 2MH9A 3W2VA 4Y15A 4EWAA 3UESA 2ZEXA 3A0NA 4OHZA 4W8JA 4RAFA 2VW1A 1Q5OA 1W3VA 2BV4A 3GEZA 1MKMA 2DQRA 4FO9A 1HW1A 2E7WA 2CG4A 4HYEA 2A6ZA 2D3SA 4UUTA 2Y69H 3BZ6A 1Z77A 1GP5A 2E1OA 3ZP5A 5IYBJ 4QPIA 4EN7B 2Q2EB 4UFJA 2YGMA 3LD8A 1AX0A 4CEYA 2O0YA 3GTJJ 2W1SA 1VRH1 4N43B 4C0HA 1UHSA 5C4WA 1ZBE3 3ECHA 2O9LA 1N47A 1T38A 4N53A 2DXIA 4YZ1A 2D5VA 1O3RA 4AWDA 2K0GA 2F6CA 3O1VA 1JOPA 4CYCB 2QA4I 5APAA 3CMGA 2YXSA 2CAVA 4CCOA 2TEPA 1O4XA 2PG4A 3MDPA 2DA4A 4JDMA 2VZSA 1D0GA 1UF2C 4XJAA 1GICA 2O6GE 1V5EA 2K27A 1HW2A 4FOVA 4LEJA 3ZIWA 4ENMA 3ERED 3TBDA 1HRI2 4QQOA 4AEMA 2XPVA 1V55H 2UURA 1XX5A 1TG7A 4H3WA 5L7OA 1D0ZA 1W0OA 2OUJA 4ENNA 4GXLA 4XF0A 1UJ8A 3NL1A 3KWVA 1GNZA 4I02A 3I55I 4IE6A 1PNGA 2GM4A 3OBRA 1REFA 4QX7A 4KA4A 1SVOA 4C1XA 4ZS2A 2NP0A 5FB2A 3OYMA 3LSKA 1TQ5A 4R9BA 5FREA 3KD4A 1TBXA 5GLWA 4CDXB 5EZGA 2XG3A 1P92A 4AIJA 4IHXA 3IIIA 4EZ4A 4YVWB 3VBHC 3KV6A 3WNKA 1MS5A 5A3UA 5JMOA 5HBAA 1HRI1 2VBYA 5FMOL 1GU3A 4A3MJ 2VUAA 2LKSA 3BR2A 1OHFA 1ZHFA 3DWLE 1FOYA 3ZMDA 2VLAA 4RS5C 2DFCA 1CAUB 1W0PA 2R0HA 2LVSA 1TNTA 3WLUA 3GXOA 1ND2B 3M70A 1UELB 2O03A 3A4UA 3BKZA 3PNTA 4LBJA 1QH7A 4KMFA 3K4ZA 2VJ4A 3KETA 1C5HA 1NCRA 2VB6A 5FZDA 2PYTA 2NVUB 2W25A 4D94A 3VSKA 1BIBA 1MJ9A 4IW3A 2QTWB 2Z4FA 3K1MA 2VZPA 3NJXA 4IQJA 4YEJA 2R7RA 3WQ7A 4N9IA 1L7LA 1UXZA 4XC9A 4XLPF 2FXAA 4BY1J 3KYDB 3NV2A 1PHMA 2JG8A 3GTLJ 1WW5A 2FMLA 1G8XA 2ICWG 1J5YA 3PSFA 5BNOC 3LFMA 1H9GA 2IVMA 1FV3A 1LDKB 1F4HA 4E70A 3V56A 1QEXA 3ZQLA 3CMAI 2OQGA 1QXPA 2ZXIA 2KFDA 3ACIA 1HC8A 1DYPA 1BIAA 3PQKA 3VBOA 4UW6A 2JECA 3FXJA 4Q4Y2 1UX6A 1Z3YA 3BODA 3MV11 1AL0G 3EJKA 4NIHA 4YGBA 5JFRA 1AWCA 2GMPA 4JOMA 1RUC2 3WHBA 1IOAA 3D3AA 2LP0A 2GALA 3NRUA 4ZY9A 2MW8A 3VL8A 1O3TA 1BKZA 2C9KA 2BEOA 3AZYA 4ASMB 2HWD2 1Q8PA 3AKRA 2DFEA 1ULYA 2ZMEB 1CJPA 1N3OA 4MQVA 5KNLA 5A6YA 2PBIA 3O8HA 1MH4A 3TNQA 2V79A 2PA7A 3K75B 4L97A 4L92A 1J2XA 3VUOA 3DFGA 1UMHA 4KWLA 5CAZA 2BOJA 4PFPA 1IW7F 1Z67A 2ZNYA 1Z0XA 3WP5A 4WM8B 4Q4Y1 2OUMA 4U0VA 2LDUA 3P3PA 4GWIA 3OYGA 1UD1A 4Q47A 2D43A 4CDQA 5FPUA 2GXAA 4AEDA 2PJRB 2CH0A 4XN0A 3ASNH 1RUC1 1RTVA 2VC9A 4QPGC 2K4JA 5C3SA 3ABLH 4D8MA 1WGXA 4DZPA 2EH3A 2BJSA 1X1CA 2D7FA 2G9WA 4MGTA 3PVOA 3S30A 1DBNA 2MFZA 4LD5A 1A5JA 5DYMA 2NZ9A 5F08A 1PNFA 4O5VA 2DUQA 3VKLA 2FOKA 1WJFA 3L7WA 4FFHA 3QH7A 3I2DA 2L9VA 1NAEA 2LOOA 4M9SA 3CJIA 2HS5A 2QKMB 3PIOF 4CSWA 3E6BA 3EHKA 5A3NA 5HS9A 4UV8A 4LHKA 3KZZA 3PUIA 2J7MA 4AVVA 2XB5A 3F21A 4DOUA 1LOGA 3PDQA 1U12A 2A70A 1ZG1A 1S9HA 3PNYA 2YU9J 3R4KA 2HEVF 4AHWA 2BUKA 1WBLA 2VQAA 3EDPA 5ICGA 3WG4A 2PLYA 2X1DA 2WIIB 5CVUA 4LLFA 4L5IA 1H9WA 1AA7A 4CU7A 2CUZA 1W04A 3JRIA 1GOFA 2BNMA 1UHWA 2YU3A 3M07A 2HZTA 2W85A 5C6CA 3HOYJ 3S1QJ 2C24A 1LRHA 4F8AA 3ZQQA 5H20A 4XONA 4CGZA 5D1IA 2Y9ZA 5F3EA 3WQ0A 4FFGA 2PAEA 1UFMA 2XJRA 3S0MA 2FCUA 4NUBA 4BA6A 1OFNA 1IS6A 3IM0A 4HQMA 3MW3A 1QKQA 1W2NA 4XQDA 2RS52 3GHNA 1RVF3 1RJ7A 5FZ8A 3JR9A 1BW6A 2CL2A 5JR3A 1GZCA 4HANA 4F93B 3IH2A 3D6EA 4YVSB 4MEXF 2E5ZA 1UPIA 4A3KJ 4B4RA 3ZPYA 1MS8A 2EK5A 1MMDA 4RM3A 1AXKA 4XFCA 5A7PA 2FF4A 5FD5A 1SLTA 2GQQA 1AR91 2PHXA 5E3OA 3DXJF 5FXZA 3VBFC 4CUGA 2MEV1 4CP9B 1V4RA 4BEHA 1WJCA 3QOPA 2WB1A 4PCQA 5FPZA 5A3TA 3BTCA 3E6MA 1OQDA 2B46X 4RA0A 3TWIA 5A7NA 4K40A 5GZDA 3BPZA 2RS51 4ORFA 2P5LC 1ETXA 1JH5A 4A6SA 2J1SA 5BPDA 1NQDA 3WV6A 1FNYA 5EQUA 1IQAA 2QWWA 4EN8B 1U5XA 4C3IJ 3J7NA 4A44A 2HJIA 2STWA 1E0EA 5M3MJ 2L4AA 2XMLA 1JYNA 3SZTA 4JGYC 3LSEA 1HKTA 4B1MA 3S5AA 4HVRA 1TWFJ 4Q4V3 2W1OA 3GBWA 2TNFA 5BNNB 3GALA 3M1CA 1O4YA 2YMZA 3IDEA 2WZR1 2R5YA 5FY9A 4L9VA 5LHGA 1LJ7A 4G3YC 3ZMNA 3M2MA 3KP7A 4LT5A 4RS5A 2ZKLA 1I3AA 1ZG5A 1QHDA 3PTYA 4M3CB 2NVXJ 2YPDA 2HEYF 3M8EA 4QWQA 4P00B 1GZWB 4ZJZA 1D0YA 2ZBKA 1RUC3 4FISA 1QY4A 3HGGA 1ETVA 1U8RA 5FUNA 5GLTA 1MMSA 1K12A 4CU8A 2HWD3 2IA0A 2E34A 1PVXA 3ZXLA 2VL8A 5JLWA 5DUXA 1IHMA 5D4RA 2WLPA 2QF7A 3T3YA 1Q1VA 1T08B 3JD73 1K78B 2W00A 2L5QA 3I71A 1MS9A 1RYYA 2JRTA 3BCBA 4BDVB 2W9XA 1Q56A 3S17J 3JRDA 1AXZA 1PO12 1U9NA 5LBEA 3S3MA 2DDAA 5CFDA 5GLVA 1CAWA 1H1MA 3EYYA 4Z2YA 3S7IA 2B0LA 1PO22 2XAFA 1JJ8C 5DAQA 2XSJC 5F04A 3H3UA 4CXYA 4RHV3 2HXIA 5J37A 1PM7A 2CWSA 4XBQA 3N97A 4ZU4A 2Y6FA 3PO2J 3FLRA 2OCEA 5LBBA 4XCBA 3FUQA 5JZGB 3DEUA 1F9KA 5GM0A 3APBA 3THCA 4C30A 2LKXA 4CICA 3VYRB 1TL8A 5IYDJ 4B3NA 5FXVA 3VDDA 3S32A 4MNUA 4RGXA 2CW8A 4XL9A 5ICCA 2ZEYA 4PJLA 4MXVA 1FPN3 1ULCA 2WZ8A 3OF1A 2GN3A 5FFXA 4Y20A 1XPWA 1PO11 3SKVA 2L02A 3POBA 4DNYA 4E4DX 2NNNA 3K3NA 3LWCA 1JHJA 1XGSA 4A3JJ 3K70D 4M71A 4JGZC 5DAWA 2HVRA 3OR2C 2GN7A 4LKDA 5KCMA 1W36C 4O6JA 1KGSA 4LUMA 4QM8A 4FFFA 5BQTA 3E3VA 2ZX0A 4CDWB 2BOIA 1V6LA 2D6KA 5E88A 2V4VA 4AVZA 2NXNB 3E7LA 1QQP3 1MNEA 1JXSA 4Z07A 2LRDA 2FDFA 2R0QC 4FFIA 1JKPC 1S5LC 4HDVA 2XJPA 3KYLA 1AYM2 4XFIA 1OXCA 3OOPA 1FSHA 4QX5A 2KHMA 3D82A 1COV2 4PZJA 1JHHA 2ZGRA 3J4UH 1PP7U 3O0XA 3ZYJB 2MLKA 2E6VA 4EN6B 5IHRA 3NNGA 2P4WA 3ECQA 3GUDA 1ZK8A 5FKCA 3J7LA 4WVWA 1UY3A 2E7QA 4YSFA 4G7OF 3AL0C 3ACFA 2MLGA 4EATA 4E7JA 1CGPA 4G6QA 5ILSA 3RZMA 4A3FJ 3LA3A 4MUVA 3ABKH 2ID4A 3OUJA 3WQBA 2WWYA 5DUVA 1YG2A 5FO7B 2RR12 2LUWA 2VMFA 2WA4A 3HGYA 3L9FA 5KHHA 1NCQA 2VMCA 4LULA 4AI0A 1MDMA 3LDBA 4RAZA 1O4TA 3RZOJ 1WZXA 3ZYIB 2FQ3A 3N7JA 1AYM1 2FD8A 2ZJRF 3VKMA 2QSFX 4RR3C 1UCRA 1COV1 2DMQA 4NBQA 4ESJA 1Q43A 3BTZA 3QPHA 5FMBA 4XF9A 3H9AA 1SLBA 3V0AB 5HLTA 5TISC 1AKHB 4XFFA 4I3PA 4O3MA 1W7PA 1MQTB 4QMAA 3CD6I 3TEZA 1UIJA 3ZXFA 2AUYA 3FXKA 3C2BA 1DQ6A 4HOOA 2R0FA 4CDUB 1YOVB 2VKDA 5CA6A 1PIV2 1LE8A 1US3A 4FBFA 3WU1B 2GSYA 2WQ8A 3KF5A 2RR11 3GTPJ 2WNVC 4NROA 2J1UA 5JXHA 2ZGSA 3V0BA 1SFNA 5F7UA 2ECCA 3L1PA 2BTVC 3BZKA 5SV8A 3KQRA 2ZOEB 3H5RA 3ZPLA 3HAGA 3RJ2X 4NRQA 3DCFA 1K4TA 5HI0A 2CAUA 4K21A 1FXZA 1WCMJ 1GVJA 1S7AA 4GWJA 3ZSKA 3J7AO 5FK8A 3B00A 3WHCA 3E5XA 3WDYA 4IXAA 2LF8A 3CDHA 4YRDA 3MIEA 3OYHA 3H0DA 4META 1JZ5A 3KEQA 1U8BA 3H8UA 2VUJA 4M6YA 4HSLA 4EROA 3ALQA 5FMDA 2WUHA 2B42B 5M5WJ 2NVQJ 4RGAA 2DFIA 2BHYA 1R5GA 5FRAA 1OA4A 4KDPA 1AL22 2W0XA 1PIV1 1D0XA 1UZWA 4OI0A 1MBFA 1USTA 4PJJA 2FRHA 5EFUA 1EPWA 4GYGA 1M4WA 2P37A 4IV3A 2F5DA 4L8QA 2VKHA 2E2JJ 1FMD3 1SFPA 3PNAA 4CVUA 2E9QA 1QO0D 1B09A 2JX9A 2PHTA 3WW1A 5DTDA 1XS9A 1W0UA 5FZOB 1WCKA 2IXIA 5JUVA 1HV1A 1TWHJ 1OBNA 3CU7A 5F0HA 3BPXA 1WH7A 3HB9A 1IS4A 1E5SA 1PO13 1SZBA 2F5EA 2KL4A 3WNOA 4YELA 1FATA 2VZUA 2KRFA 1RGSA 2DAOA 3PVNA 1FZPB 5D6FA 4D7SA 3TEWA 2FCVA 4MEYF 4TN7A 9ANTA 3CIHA 1LKXA 1PO23 3OY9A 2WNUC 2R062 2XONA 1DP0A 2DVBA 2R7FA 2DYSH 4AGGA 1H8TC 2M0MA 4B3XA 3KSCA 2VASA 3T5XA 2RKHA 1SC7A 5C8CB 1NLQA 5FBJA 2CSGA 2IGNA 3SZPA 4JRLA 4L9BA 3AG2H 2DTZA 3H1YA 3BTLA 4XZPA 3LZZA 1SLLA 2E1CA 1OURA 1TC3C 1Y9QA 2I74A 4COUA 3VBUA 1G3TA 5FP8A 5FFOC 2J1VA 1W8NA 5IVJA 1T0FC 2JVGA 5LLQA 3FBYA 5DAVA 1RHI1 3ZSEA 4AEKA 2FDIA 1OUXA 1PYVA 4B44A 4AI1A 2EICA 1W03A 5J3LA 2HDDA 1VQ9I 1MIJA 2RNGA 3OSDA 4DQ2A 4LG3A 3KZIC 3QU6A 5IT9Z 1I27A 1ON2A 2MG4A 1YS7A 2KPMA 4LG0B 2R061 4QM9A 5FKKA 4K1YA 2C1FA 4Q29A 1OYIA 3IL2A 4I2OA 2W24A 4V2VA 1TT5B 4QPQA 1IRZA 3J80K 3H1WA 1OCZH 4LPLA 4MVTA 3ZFEC 2VXZA 4FPKA 1W9WA 2YY1A 3ZFFB 4Z8BA 1FOD1 2ZSHB 5A7SA 1NUKA 1C8NA 2HYFA 4ES9A 1DGRA 3LSRA 1DQ5A 2OIIA 1B4AA 3FC0A 2ID6A 3MKLA 4AI3A 2ZJCA 1SEUA 1OKOA 2JJ6A 2WS92 1VMHA 2Y26A 2QZ3A 1X8MA 5JSPA 2ZZQA 3PO3J 1Z0HA 4I09A 4WM7C 2R7SA 4BHBA 2HDCA 2QQ8A 1QGLA 3MYXA 2VXJA 5GLZA 4DRVA 3H0GJ 3MZHA 4QU1A 4FPLA 5DCFA 2EAAA 2RR13 3DN7A 1NX9A 2VPLA 2JDNA 3KS7A 2WO3A 2X1EA 4BE0A 2KISA 4LBQD 1EH8A 4V2GA 4HFSA 1VBD2 3KM5A 3KCYA 3B6CA 3ACGA 4C1WA 1IKPA 4LLGF 2QQPA 5LA9A 5C44J 3D1NI 1RUJ2 3DEMA 1N3QA 4B7EA 3RZGA 2XB0X 2WS91 4A7ZA 5F2WA 5FZ6A 1MSFC 5DZEA 2OC6A 2WZPP 2WINB 3RZHA 1RC9A 2BVLA 3F23A 4PI2A 4H7MA 4DXRA 5FMCA 4QX0A 2XOMA 1F9NA 1X9TA 1T95A 5EDNA 3HJEA 2VBPA 3N3HA 5C7GA 4DPNA 5JSRA 2M34A 4Q48A 1HBXG 5FO5A 1VBD1 4CEYB 2RV8A 1OLQA 5FLJA 3NAUA 1GUIA 2X10A 5AC92 5C4WB 4HETA 1RUJ1 2XVLA 4N53B 4IQ4A 2N7GA 3ZGKA 2DBIA 4QDRA 2ESHA 3BIWE 3DEWA 4L9TA 4NPRA 3ZYPA 4A0XA 4D0QA 3KF3A 4XILA 2OAZA 1OOPC 1D8JA 3MIDA 1W1WE 1QRYA 1I1SA 3M7GA 2BDRA 3FE5A 5FZGA 5D8KB 3ZSLA 2HKXA 3AKQA 3ZN6A 4TWTA 1RUF3 4NB5A 1AL23 3FM3A 4RS8A 5HS8A 4GWNA 2OF7A 4AK3A 1WCQA 1XJAA 1DPUA 5FPLA 2XAQA 4L11A 4AHYA 2FBHA 3PFIA 2K85A 2ZXJA 1YX3A 2Y60A 3DQVC 2A07F 4XURA 4O9GA 5E3NA 4UAPA 5T5PA 5IUQA 2KIQA 1EH6A 4A3IJ 2NNYA 5AC91 2JDPA 3WF1A 3A03A 2WAFA 2IT0A 1NLRA 1R092 5C9AC 4Q27A 1H1IA 2V6CA 3OYAA 5KK1A 1V3FA 4WXCA 5L3BA 5A80A 4HMZA 1GWKA 2D1VA 1SDDB 4MGYE 1BBT2 3BU7A 2A68F 1FPQA 2R063 2R7QA 4QLCU 5DQ0A 1SCSA 3BIEA 2JA6J 1X19A 2KR2A 2LW8A 2DDBA 4MGRA 2QSHX 1WA6X 2ZGTA 4E2GA 1XSDA 1ZELA 3DTEA 4DMIA 2X6YA 4CZCA 1BYHA 1ODNA 2G1MA 3LA2A 1XXNA 4PJNA 1LNSA 4L0YB 3QLQA 1QXRA 3C7HA 2E5NA 4GH4B 2DA5A 4C3JJ 5HV4A 1DUXC 3VZKA 2AQEA 5LK7B 2I07B 3S2HJ 5DDJ3 2R6QA 2W39A 4PDWB 5JI6A 4PF5A 1GV9A 4AQTA 5FZKA 5FIXA 5GTHC 1E3PA 3LIHA 3BC8A 1R091 2VZVA 2VC0A 3RYRA 2HYGD 3O5SA 3REOA 1O6UA 3VZMA 1WBFA 2C6SA 2P5BA 5FQ0B 4F91B 1BBT1 4B4PA 1QZZA 2D1HA 2JA7J 1OF3A 4ATEA 2KXLA 4M73A 3CCUI 3PUBA 4IX7A 4UVAA 2SBAA 3WXPA 4Y24A 5FYTA 5F1RA 1R1UA 5ABJA 1ZGJA 1R7JA 2QFEA 3PTRB 2BY0A 2JG8B 3ZLIA 2PHFA 3RSJA 4OIPF 1RUNA 4HL0A 4B1RA 2VZ3A 1B8IA 1H8TA 5LZ6A 1VPHA 3CMMA 3OMYA 5T55A 3CO6C 2LY9A 1IC8A 2IVJA 3KVAA 3J8F1 5F0CA 3F8NA 3DTIA 1IUFA 1DLCA 5A1FA 3JXSA 4WVMA 1ETWA 5CVJA 3ME2A 1V6KA 2TCTA 4IRGA 4X6QB 4EE2A 5E8AA 1FX7A 4BNCA 1T0FA 3IWZA 2O7OA 3A01A 1YCIA 1FOWA 3ZXAC 5IYYA 1MEC3 3HPHA 1XMXA 1C8M1 2OQRA 5FYVA 2TRTA 3BR3A 1DP7P 1U5TC 1P8JA 5K5OA 2HBTA 5J1RA 3RVHA 4S2DA 1HKQA 2YHJA 5HXVA 1XN7A 2X6XA 1NA1C 3VYSB 1J7KA 2DJIA 1X50A 1RUJ3 4RLQA 1TME2 3MBWA 2LF7A 1S2EA 5IOZA 2FE3A 3MFKA 4CRQA 1LKNA 5J09A 2XAGA 3H3VK 2VD7A 1HQWA 1XNDA 1S0JA 4AIDA 2WNEA 4CDQB 1MJAA 2NS0A 1LDDA 5BNPB 3VYTB 5C3EJ 3TP0A 3R4UA 5GZGA 3SFZA 2IW5A 5F32A 1BCXA 4AI8A 1SFKA 2EFWA 3HNMA 4H55A 1JZ6A 3BOQA 1DQ4A 2TBVA 5B1AH 2O8QA 2P5KA 3T2OA 4AD9A 4CZZA 4WM7A 2WAQA 3ZFGA 1WQ2A 5F6KA 5I93A 3N7LA 4ARXA 2WA0A 1BM9A 1JTZX 2ET7A 3CJIB 4HBNA 5AC93 4FQZA 1S0EA 5CKQA 3VEPA 3HOBA 5DUWA 3CCEI 5E79C 1FEXA 1TME1 2UWAA 2CSOA 4IEJA 1AVBA 5C70A 3A23A 5FZFA 1TMF2 1LJ9A 4LO7A 1O3SA 3GFIA 1B6AA 5IAXA 5DM6F 1K5MB 2MGQA 3AJYA 4DRRA 5JLXA 2ZGMA 3K4KA 4LORA 2ZX3A 4A7YA 3OYCA 2P3YA 3FXLA 4NE9A 1MSEC 4CYDA 2YGLA 3IWFA 2CWMA 5HDGA 4P1WA 1E3OC 1OCCH 1C57A 3CP2A 3QQAA 1PVC3 2CUFA 4U36A 1AJKA 4ZU5A 4DEQA 4OLLA 1XE7A 3UGHA 3T2QA 5LBCA 3J26N 2P17A 4IEYA 5E3MA 1Z05A 5H9PA 3WGGA 2GMMA 5FPXA 3NVCA 4BE2A 2BY1A 5EZWA 3JRAA 2VW2A 3HTUA 5I8SA 4M72A 3AB0A 4WZCA 1S0FA 1QH6A 1XYPA 1RNLA 3VDAA 2YROA 3QODA 4BIFA 3BJ6A 1HQCA 4KT5C 4MG2A 4RSUA 4XMAA 5JOWA 1WWXA 4P96A 5DABA 4CCCA 4ZTJA 2LKPA 2K02A 5D5UB 1BI1A 2PLV2 2HH9A 2OT7A 1ZZ8A 3MIFA 1IG7A 2NYYA 4BJ6C 5JR2A 1XSRA 3KMHA 4C9YA 4NAOA 1YRNA 2RN7A 5FLXK 4ARYA 2QQ9A 4AVTA 3OBTA 1NE4A 2L01A 1JT6A 1P9QC 2R4GA 1PP8F 2IS1A 4LKSA 3MCZA 2WY8Q 4DINB 1R71A 3L9JT 1J75A 1UU5A 3JW4A 3MUZ1 2RM21 5A32B 2EZLA 4BEHB 4P5HA 1WMXA 5FXWA 3D0SA 3I3LA 1BMV1 2JD4A 1RR7A 5T5OA 5GZFA 1AR72 3T0AA 2Q30A 3DPRA 4RB0A 1DGWA 1Y1VJ 3ZDVA 2CV0A 1S0CA 3CJQB 1LB2A 1LCLA 3GFMA 2PLV1 2EIEA 1E2XA 1HB3A 4JRAA 1E5RA 1V5FA 1FP1D 2K3FA 3VBHB 1RXGA 2NOJB 5FJHA 1DGRM 2RS12 3ZO0B 3JCUC 5DM7F 5T5JA 5FZMA 4A3XA 2AYHA 2R5YB 4E27A 2OVUA 2F5VA 1WWYA 4RS5B 2RV9A 1UQXA 4OYUA 2XL7A 2V1XA 1QJU1 2XGXA 1AR71 1FX5A 1AR82 1UU4A 4FPOB 1AYN3 1W0TA 4N0BA 4RLFA 4BQWA 4Q4X1 3IAM2 1DF0A 1STMA 3ZMOA 2CV2A 5DN2A 2HNHA 3FMQA 2HTJA 1ZAOA 2QBYA 3W2WA 4H7LA 3TDZC 3KPHA 3G1OA 2W7NA 1I3HA 3GFJA 1HX6A 4U88A 5FPBA 5JPMB 4MTEA 4IKFA 4YZ2A 2VZRA 5FP4A 2IXSA 1DU6A 2QVSB 1DQ2A 2RS11 3O7OA 4L0PA 1D1AA 1OQYA 3WODF 1GQHA 1ZZ6A 3S93A 3GZEA 5A33A 3I56I 2JUCA 3PL8A 4I98B 1B9NA 5DG2A 1BR1A 3NJVA 2K9NA 2R042 4FPFA 3D8CA 2XUBA 1N3PA 2O5RA 4L0ZB 2A6EF 5BNOB 1SDWA 1R1VA 1CAWB 2HYJA 5BMZA 4LO8A 2Y6GA 1OR7A 1AR81 1JN2P 3ASOH 4YIIA 2VY0A 4ZH4F 5J40A 3KP6A 2GOMA 2ZAAA 1XMKA 3DLLF 1VZ0A 4XICA 2GDFA 3ABZA 4K3UA 3HN1A 1J59A 2JPBA 4ZDOA 3CQOA 1ERDA 2GXGA 1IF1A 4KN7X 2PN6A 1QVUA 2DT6A 2E36A 2STTA 2PMWB 1A04A 1W28A 1S0GA 2K7LA 1Z78A 2VE9A 2EPFA 2WA3A 5IFTA 4WK8F 5HPOA 5T54A 1FWZA 3KVBA 2VMEA 3K10A 4D7NA 1LESA 5CVRA 1ZX5A 2B7YA 1OKRA 5EG0A 2HOTA 4UF0A 3H8XA 2R041 1SD5A 3NNLA 4H0EA 3LOIA 2DOFA 4Y20B 1TMF3 1J1LA 1UG2A 2W68A 2UXNA 1U5TA 1URXA 3CF6E 1MZEA 3ZR8X 2XVGA 1J3PA 4CCJA 3RZJA 2ZKZA 3F6VA 4HRIA 2WAOA 3ZR5A 5D8LB 1W2TA 4ONUA 1H4HA 5B3SH 5FZ1A 1JUMA 1NA1A 4AFBA 4UUVA 1XMAA 4U2AA 2OA4A 2P7CB 4XUPA 3SEEA 1S55A 1QBJA 5GPCA 1BVP1 1D3YA 2DQLA 4FHTA 3T1LA 4PI0A 1HQNA 3FL7A 1MS3A 3ZYRA 2PMZN 1H2NA 4QPGB 1VBB2 5M3FJ 1C28A 2DBNA 3J7AY 3IMNA 4RBOA 1HXS2 3QCWA 2DVFA 1SQ4A 3H42B 4AXOA 3V42A 5CZKA 5FLVA 2LC2A 4FPCA 3I3QA 4BLIA 1VRBA 3J9SA 3ERMA 2KJBA 3IPVA 2P6SA 3B01A 1CPNA 5LEKA 5K5RA 5DZGA 3K4JA 4MGKE 2AC1A 3RZZA 1LGBA 1W6PA 4K20A 2QE3A 4Y5TA 2RDQA<