4R8HA

The role of protein-ligand contacts in allosteric regulation of the escherichia coli catabolite activator protein
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Role of Protein-Ligand Contacts in Allosteric Regulation of the Escherichia coli Catabolite Activator Protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords cAMP-activated global transcriptional regulator CRP
total genus 60
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4r8hA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4r8hA01
2EFOA 3H3UA 4GGGA 4OU0A 1EP0A 3TO7A 1D3YA 4IF4A 4O9GA 1LJ9A 1ODDA 2F2EA 5HS7A 2Q0AA 2HKOA 1G3SA 2GIVA 4HOBA 4LUKA 4OIPF 4M9ZA 1EH6A 1S6LA 2XROA 1ZH5A 2QQ9A 2ZXJA 5IT3A 3WW3A 2EJRA 2JPCA 2HGCA 4Q0SA 2O1QA 1H9TA 5FQ0B 3QACA 4EJVA 2E9QA 4QM8A 1P92A 1EY2A 2UYAA 1R1TA 1QZYA 1ZG3A 3WTVC 4TV7A 4P9GA 1F9NA 4OFGA 1BOAA 5FPZA 4FBFA 3V7CA 2HDCA 2DK5A 3R61A 2NYXA 1B4AA 3GX4X 1UHMA 5DD4A 2UZKA 2F5FA 3S7EA 2WTEA 1SQ4A 1AWCA 2B5HA 1CAUB 3JTGA 1YO5C 1FNNA 3WTUC 3DKWA 2EB7A 2VE8A 3REOA 4NVPA 1QPMA 5KHKA 5ILUA 5D8LB 2L4MA 1IXCA 1JHFA 3HSRA 1U3EM 1JXSA 2ESNA 3S0MA 3CL1A 5LBQA 4HLXA 4BQAA 3ZN1A 5FFZA 4I01A 1O5LA 4AVCA 2MPFA 1F5TA 2A69F 2VBYA 3M1EA 2IA0A 2BGCA 4A12A 5ERIA 4EGYA 1KU7A 4Z2YA 1ZZCA 2A3SA 2WC2A 1VR3A 4B8XA 4HX7A 2CGPA 2A6HF 3MZYA 4X6RB 4G7OF 4I7HA 4E2SA 1SMYF 3E5UA 2YR2A 1OD5A 5D8KB 2CYYA 3MYXA 3BWGA 1HW5A 2OD5A 3K1PA 1OYYA 4XF0A 4XFCA 1O3SA 5I0UA 3LA3A 3WTTC 3I71A 2DO7A 3DV8A 2GH2A 1WWXA 2OQRA 3KP7A 1F4KA 2Q30A 3U9GA 1DZTA 4RB0A 5IT9Z 4HSJA 2RN7A 2XUBA 2V1UA 3OTFA 1IAWA 3F23A 2XIGA 2YPRA 3ECHA 3L7WA 3ZMVA 3B73A 4CO8A 4N0BA 1R36A 2HTSA 4LB6B 3U10A 4YSFA 1IN7A 3H50A 3NQOA 4IEQA 5KK1A 3LWFA 4KN4X 2EV0A 1BI2A 4AIJA 3LAPA 2QUFA 2YU3A 1XDSA 4G9YA 2X0LA 4KT5C 3ELNA 2QVOA 1LNWA 1WI9A 2W24A 4WK8F 5LRSA 4J1WA 1RC6A 4F8AA 4M72A 1SFEA 4IEUA 2RC4A 5CJ9A 4E2QA 2XV4S 3P7NA 3ZMZA 1IXRC 4K2EA 4KU7A 4XFAA 4I2OA 4IJAA 5D1IA 1BN5A 1IN5A 2FNAA 3NSTA 1CAVB 4MTEA 1JUHA 2F4PA 2V1DA 3WGGA 2DLLA 1BIBA 1J3RA 1YLFA 4DINB 3FMRA 3TOAA 2JT1A 5JSOA 4JV4A 1YFXA 3O3KA 3ULQB 4A6DA 1RNLA 4XETA 5HS8A 2FQ3A 4PGGA 1X7NA 4I0AA 1ZLJA 2PJPA 2P5VA 3SXWA 2ELHA 4NB5A 2B9UA 1BIAA 2MLKA 1UD1A 3FZVA 2Z69A 4BHBA 5BY5A 1WA4A 3FHZA 5HDKA 3BPZA 4ASNA 1YFUA 5EZWA 3Q9VA 1L3LA 2Z9OA 4KYWA 3E97A 2PFBA 1U2WA 1YWKA 3KGZA 2EA4A 3EO6A 4G6DA 4B29A 3KP6A 3QP5A 3BY6A 3ML6A 3P9CA 1JGSA 2QBYB 1KA8A 2DI3A 6PAXA 3OF1A 5DDGA 4EVIA 2VC1A 5AVPA 1J59A 1DPRA 1W5TA 2FNPA 4L0ZB 5BUVA 3FF5A 4HDUA 1FP2A 3FE5A 4WXDA 1WGPA 2ACJA 4KDPA 5JI6A 2MLGA 4XSXF 1ZGAA 4O5VA 2QLZA 2D93A 3RKWA 1FWZA 3T0YA 2STTA 5CU1A 3E3VA 3SHFA 5E20A 2EVXA 3FFQA 3GZ6A 1S8NA 3C18A 4BNCA 4EJTA 1S7AA 1ON1A 1KGSA 3NJZA 1R1UA 3LSTA 2RV8A 3NVCA 1IPJA 3GLXA 2LDUA 1UFMA 5AIQA 3SCGA 2BV6A 3RIRA 4UXAA 1ZVFA 2Q1ZB 1O7LA 3F6OA 3KP5A 3M3IA 3GBFA 4A0ZA 3K2ZA 4HF0A 3MFKA 2QM3A 4PIYA 4IEXA 2PAMA 3DXJF 2ZMEB 3IWFA 1X8EA 2PLYA 2L02A 4AQ6A 4GYGA 4ZU4A 5HDNA 3EQLF 4KMUX 2RGVA 4HLTA 4LLNA 2PA7A 1J7KA 2HEOA 1RL3A 2HOEA 1I5ZA 4P9UA 2V9VA 4IRIA 1HW1A 5BQTA 2HFHA 4O9EA 1B9MA 1DDNA 3H3ZA 4WWCA 4O3MA 1U78A 3VHRA 1H9GA 4D7TA 4Y15A 5DEQA 4XFFA 1J5YA 3TQNA 3COAC 3FWEA 1ZZ8A 3LAGA 5L3FA 1QXRA 2ZKZA 2WV0A 3L2HA 2Z5UA 4CDGA 1GQGA 3SQNA 5DCMB 3CLOA 4LB5A 2CV6A 4L11A 1YYVA 1CAVA 3H9AA 4ETSA 1XCVA 1MJBA 2K4JA 2KIFA 3K69A 2A5YB 4MGYE 1L0OC 2RDPA 1HSJA 5DCMA 2STWA 4BYYA 4CHUA 1KYWA 1WRJA 3M9AA 4IEPA 1ZLKA 2EAAA 4UUVA 1IZ1A 4O6JA 4U0VA 1NHAA 1UCRA 1ZZ7A 4MX3A 3ACLA 3WTYC 3F8BA 1YS7A 3L09A 1T0FA 1Z91A 2VOOA 2FEZA 1FYMA 4AVBA 2FA5A 2OA4A 5FD6A 1XSDA 4HAMA 5BPIA 2QENA 4JK1X 3GFJA 2EFQA 2P5LC 3FZ3A 4MGKE 2KIMA 2YSRA 1WSUA 5AIPA 3KETA 3IDBB 4HLYA 3T8RA 4IEYA 3IIAA 3R0JA 1PMIA 1FT9A 3DPTA 5BV6A 2LSOA 2EWNA 4EWAA 2RKHA 3G7DA 1BI0A 1K78A 2CAUA 1ZARA 1J3PA 1ULYA 2B0LA 2E1CA 1LEAA 1ONVA 2XAFA 4HBNA 4G94A 3VFZA 4KNYA 5CVJA 4L9TA 3F21A 1LR5A 1B6AA 3KZYA 2KIUA 4ESFA 2PHLA 3BCWA 1ZX5A 2VECA 2VBZA 4KWKA 2DQLA 3F22A 2K27A 1IUYA 5BPXA 2BNMA 3VOEA 1MKMA 2F5DA 4OOIA 4MGZE 5BMZA 4UVBA 2ZFWA 1FYKA 1FC3A 3CDHA 1EPZA 1SD6A 3LQQA 4A0YA 1YFWA 2QZ8A 1KQ0A 1ZRCA 5L3DA 1J1LA 4IPAA 1GQHA 4Q29A 3FM3A 4MNUA 3DP7A 5LRRA 1BC8C 3ES1A 4E2GA 2B8MA 5TJJA 3IWZA 2XKOA 4U88A 2XAHA 3KEOA 1UB9A 3HT1A 3J80K 5E1ZB 1FY7A 2CWEA 5LEKA 3KCCA 1F1ZA 4UHTA 2L4AA 3SZTA 1ZG1A 1Q3EA 3D82A 4YIFA 2CSOA 4MQ9F 1LDDA 5CVRA 2FF4A 5LHIA 4L0YB 5F64A 2VT3A 4WXHA 3G73A 1H0MA 4LK1F 2O8XA 3O14A 5FO5A 2XGXA 1Z05A 2Z2SB 3Q5FA 1IN6A 3EJKA 3DN7A 4TLFA 2K7LA 4XF1A 2FBKA 2K9ZA 4WF2A 4LLLA 5J7MA 1EYBA 1MDMA 4LD5A 2W85A 1E17A 4LULA 4OIQF 2XLAA 1CAXA 4EWEA 3M70A 4OMYA 4PDKA 5E1XA 5L3GA 4G7ZF 1ZZ9A 3GFMA 3OGJA 3GXOA 3KLNA 2H6BA 5ICGA 2X4HA 4UNOA 1KQ8A 4R1HA 2VPVA 4J1XA 4WXCA 1G3YA 5C8WA 3BPXA 1ZGJA 5E18F 5EEHA 3I4PA 3QOPA 2DAOA 3KZZA 1KQ9A 1V4RA 2KRFA 3CUQB 5E1RA 3HSEA 3G3ZA 2QQBA 5L3CA 3U11A 4XFBA 4ESJA 1OMIA 4P96A 3UKVA 4UVCA 3PQKA 1OR7A 1XSVA 2DBBA 4MH0E 1H1IA 4RGXA 2W25A 2A68F 3OCPA 3WGHA 3N97A 3ZMSA 2EFPA 3RYKA 1XSXA 2WWYA 4OLLA 3ES4A 3HSFA 4OINF 4N9HA 4BHCA 2XLFA 2L54A 1DGRA 3TKYA 2R7FA 4ZU7A 2YX7A 4RAYA 4GULA 5KHIA 4UXNA 3FXRA 3MEXA 3MWMA 4MTDA 1HBXG 2HWVA 4EJOA 2UY9A 2V1XA 5JSPA 1EH8A 4I09A 4YRDA 4QWQA 2DQRA 2QQAA 2G7HA 3BALA 3J7AO 1O7FA 4U0WA 3EYIA 4HZFA 3HTSB 3NKTA 1MJ9A 2DU9A 3TNPB 3RKXA 4PIZA 3BJ6A 1Z9CA 3UKTA 2OZJA 2D1HA 3OV8A 3GZ5A 1UIKA 1CX4A 3PQJA 2ZO4A 1O5UA 4RGSA 5LHHA 5H6RA 2IC1A 1E2XA 5HOOA 3K0LA 5JCTA 4HQMA 1RZ4A 4LFUA 3JW4A 3EETA 5FLJA 4AVPA 1YW9A 1TW3A 3T1BA 3EQEA 3K9TA 2GA2A 3RZZA 4AWXB 4PZJA 3GYDA 1LKNA 5JSRA 2L01A 5JVTA 1U8RA 3JAMZ 3WW2A 1P4WA 4ENKA 2K02A 3ZMUA 3WE3A 3B02A 4F7ZA 4OIRF 2GU9A 5FLXZ 3I54A 4G7HF 2MH2A 5KBFA 2J5PA 3PFIA 3IL2A 4G8XA 5ILVA 4Z07A 2IXJA 4XFIA 4YARA 1FPQA 4KMFA 2MC3A 1YW7A 1XGMA 2PN6A 4XF9A 1FBSA 2FBHA 1UW8A 3WW4A 1UHWA 3ST7A 4HF2A 3I5UA 4I3PA 2UXNA 4ENJA 5JR7B 4PIXA 4M71A 5E8IA 1G6NA 2NRAC 3CUQA 1RTVA 3D0SA 3L00A 1D8KA 3ZP5A 2G9WA 2FBIA 4KFCA 4FHTA 4WBBA 4UV8A 3KE2A 2VBWA 2C6YA 5FD5A 2Q0OA 4JTNA 1RUNA 3ROUA 4LLOA 3F8MA 2C0ZA 2IA2A 1TLHB 2IP2A 1TQPA 5LHGA 3E6DA 1K7AA 3MAJA 1YIOA 1CAWB 5HI0A 4HA8A 1V70A 3FXUA 2CAVA 4M9SA 3E5QA 4CICA 2ET1A 2OA2A 2M8EA 1Z1DA 2P8TA 3SZPA 4ENMA 4KL1A 1YLLA 4CXFA 1ZG5A 2VONA 1FBQA 1MZBA 1P2FA 2OQGA 4IEWA 3NW4A 1ZRFA 1XGSA 2IJLA 1RI7A 2MA3A 3QU3A 2D5FA 1IRFA 2I45A 3J80Z 2EK5A 4NQWA 3WTWC 3U1DA 3O6BB 4HX8A 4MUVA 5F1RA 3HTUA 2F5CA 1UPIA 2JRTA 3F8FA 2PTMA 2M87A 3H92A 4A2UA 1WKMA 1IN4A 4ZU5A 3IHUA 4QLCU 1XD7A 2J5OA 2FMYA 4M6XA 2ETHA 3IKTA 2DCTA 3C3VA 3HUGA 2JZYA 3QPTA 3KP3A 4YG2F 1QWRA 2PYTA 3HYIA 2NNYA 2H27A 4JBAA 5EFUA 1W7PB 3W6JB 3H7JA 3RJPA 1D5VA 3MPBA 1U5TB 5D4RA 5BXXA 2IXLA 4XEZA 1OYIA 1LB2A 1ZZ6A 4H0EA 2PFWA 2WFPA 3E6BA 2AXLA 2DW4A 1P4XA 4BXUA 1DZRA 1LEBA 2L3DA 5D5UB 4IERA 2K0GA 2BNOA 3V7SA 4RD7A 5I91A 2O8QA 4HV6A 4IEVA 3CTAA 4M74A 1T6SA 2QCSB 1MJAA 1OFNA 1U5TC 1FYLA 5I8YA 4QGNA 1R7JA 4QX5A 1ON2A 3OD0A 4U0YA 2Y75A 4Q0QA 4R52A 5H20A 5DUIA 4Q4ZF 3VEPA 2IW5A 5E16A 3L2CA 5DV5A 5H6QA 4CZZA 5LGNA 4HX4A 1W4MA 1NE6A 4XFGA 4HYEA 3WU0A 1CAUA 4FAHA 3S2WA 1P4AA 1XGOA 1MDMB 1J3QA 5JAXA 1G3WA 4YFKF 2CW0F 1W7PD 1K79A 1R5HA 2M30A 4H7LA 2GC3A 1FOKA 2COMA 2QDRA 2CG4A 2HR3A 2DTRA 3PVBB 3QU6A 1REPC 3LFKA 2VBXA 2ESHA 3M8EA 3SFZA 4L9VA 3AAFA 1G4DA 5A2QZ 3MQ0A 2XL9A 3CJXA 3FJSA 5J6XA 1TNSA 2ZKLA 4EQQA 1U6GA 4N9IA 5CVIA 1SAXA 1KU3A 4KU8A 4Q0VA 3I53A 2A07F 4RB1A 3WODF 1J9IA 3BJAA 2P17A 2QVSB 4Q0UA 3D5LA 1IXSB 4LLGF 2OZUA 1FXZA 1PDNC 1X3UA 1FSHA 1XE7A 1FI2A 5HDGA 1YHFA 2BYVE 1TQIA 3V8JA 3CUQC 5TRDA 2ZNZA 1PM7A 3P9KA 3J81Z 4DQ2A 2OZ6A 1TW2A 3IRQA 3GFLA 4OIOF 5LLQA 3PNAA 3E6MA 3MCZA 4ZH4F 2DT5A 2XAQA 1V3FA 3GWZA 1J58A 2H0VA 4QMAA 4UBGA 2HYGD 3TDZC 1BC7C 1TNTA 1WLTA 4LEJA 3SMHA 2TDXA 3H1YA 5LGTA 3JTHA 1T98A 1HW2A 5KHHA 2LKPA 5FB2A 2HS5A 1ZRRA 1JE8A 1YS6A 4D7SA 3HRSA 2XVCA 3TGNA 2P6SA 1I1SA 3SCFA 3NRVA 4Q5SF 4JQFA 1Y0UA 1TBXA 4M6YA 2V6CA 3E6CC 1I27A 1UIJA 3GO5A 1UCXA 5CYVA 5FPXA 4ON0A 4LA2A 3D0JA 5FQ0A 4L9NA 1RGSA 4I98B 2EFNA 4RGRA 4XRFA 5HLIA 3BROA 2GAUA 3H7YA 4LGWA 2Z3YA 4S05A 2IXKA 3ZPLA 4PJYA 4OMZA 3ZDSA 4LUMA 3KFWX 1YFHA 3RPQA 5D5WB 2PMHA 2H6CA 4RB2C 4EWDA 2VN2A 2GA1A 1HXDA 3EDPA 1SD7A 2GC0A 1SEFA 2EFWA 4HV5A 1O4TA 2VC0A 3U0ZA 2GXBA 1TTYA 2F5EA 4MEYF 5E1WA 4EMSA 4HVRA 2DK8A 3ZN0A 4EJWA 4KWJA 4Q48A 4PGHA 2ZCWA 1B59A 2R3SA 3HHGA 1FZPB 3LWCA 2LF8A 2O6GE 2Y0MA 4YFXF 2FE3A 3I64A 2IXIA 2ETEA 5I0RA 5ED4A 1GXQA 1HSTA 2A6EF 1BBYA 1K6OA 3R6SA 3OOPA 1O3QA 1MGTA 1DUXC 1YG2A 1DPUA 1Y9QA 2OBPA 1OI6A 2D2WA 2H09A 2O61A 4GYIA 1KYZA 2K4BA 2FRHA 5DD8A 4HW0A 2JSCA 3QRFF 3KLOA 1Z7UA 3V4GA 5I8SA 5L3EA 1HKQA 1L3JA 3RTRA 3LOIA 2MH9A 1OYWA 3DQVC 3BJOA 1S3JA 2PHDA 2W57A 3FMSA 1VJ2A 3V8LA 3O2PE 2P7VB 2MD5A 3JZVA 1FLIA 4L9JA 4CGZA 1GHCA 4AXOA 1R1VA 5FLHA 2O03A 1XE8A 2HTJA 3KEQA 4AD9A 5BS6A 4FX4A 1SFXA 3LA2A 3GYHX 3TNQA 5K5RA 2A61A 3DFGA 4NHJA 4QM9A 5K5QA 3IKVA 4WZCA 2E7WA 4LG0A 3UKNA 1J2XA 4L2NA 3ETQA 4LMYA 2PBIA 5JHUA 1HKTA 1XRUA 4ZYGA 4AIHA 4HVQA 2GC1A 3EYYA 4EGZA 3EHKA 3GF2A 5ICEA 3NL1A 5CVUA 1USSA 3F8CA 1RUOA 3GW2A 2HZTA 1H1MA 1KU9A 4YYOA 4Y13A 4MV2A 1LDKB 4G6QA 3RDIA 4A0XA 2OPKA 2OYZA 1SFUA 3LAJA 2UYBA 1O3TA 1FX7A 2BE5F 3ISPA 4LJZF 3LA7A 5FLIA 5FGMA 2P6TA 3BPVA 4MEXF 5DCFA 1FSEA 4M73A 1BJAA 2ISZA 3DF8A 2AS5F 1YUDA 4L5IA 4P5OA 1XDUA 1JHHA 3ECOA 3I0TA 4Q47A 4A6EA 4HBLA 1GXPA 3HIFA 4IETA 4ZYDA 1YQAA 1FBUA 1XCBA 3L9FA 2ZNYA 2RQPA 4A5MA 1PUEE 2N7GA 4LA3A 3JAMK 5BPDA 5ICCA 4EROA 4META 2DPUA 2E1NA 1FP1D 1LQ1A 4HDVA 4ORFA 1ZZBA 1BI1A 2HYFA 1A04A 1EV7A 4KIFA 5KHGA 4GO1A 5A2QK 2OAZA 1U12A 5D6EA 4MGIE 4ENNA 4EM1A 3VB2A 1MD0A 2O3FA 2QJVA 2PAEA 2PG4A 3F8NA 3F3XA 3CO6C 2E7XA 5D5VB 3RPUA 3RKYA 4R79A 3V8KA 4IEOA 5AONA 3WGIA 2PAKA 3S7IA 1LVAA 3ZQ7A 3H1MA 2IA1A 2NNNA 4L5JA 5DUKA 5ILSA 1WQ2A 4UBHA 3N4MA 4XFHA 3WTXC 3EUHA 4FT8A 4IHSA 2GXGA 1USTA 3QP6A 3V7RA 3ZMDA 1S7OA 5I0TA 2NS0A 2O0YA 4RB3C 1D8JA 1SMTA 4KICA 4QXKA 3ERED 2IPQX 1CF7B 2GQQA 3ABUA 1TQ5A 2D5HA 2PQQA 5C6CA 3BZ6A 2ZMEA 1GVJA 1NYWA 2RNJA 2Q4SA 3KSCA 2PEXA 4ESBA 2QWWA 5HLHA 5HVQC 4XF4A 4P9FA 2MBFA 4XSZF 1IN8A 2KJBA 5I0SA 5D5XB 4EJUA 5CLSA 4MQVA 1IRGA 3CJNA 1VTNC 4ZYEA 1QQIA 4UVAA 4IEZA 4EM2A 1Y3TA 2Z33A 3PLQA 2CO5A 4ZYHA 1CGPA 4EV0A 2FSWA 1ZREA 5FLXK 2VODA 1QO0D 1SD5A 3FM5A 4JTOA 3H1WA 3LZZA 4ONUA 2DPDA 2D40A 2XAGA 3KMHA 1HKSA 5KVRA 4X6QB 2HQRA 4KUMA 2FXAA 3T5XA 2GC2A 2PI0A 2XL7A 2V09A 1YW8A 3R4KA 1NE4A 4AVAA 4RAZA 4HN0A 2NAZA 4IHTA 2BBYA 1I6XA 3M8FA 5BOXA 4GXOA 1U5TA 1P6RA 3SCHA 3RYPA 3IDCB 3IC7A 3JSPA 3FHIB 2CQKA 3FX3A 3VODA 1Z6TA 2W84A 4RS8A 3WTZA 3RI4A 2QBYA 3K1NA 4KN7X 5HS9A 2FU4A 2P7CB 1NZCA 5I93A 3RNSA 1B9NA 1IF1A 1LDJA 2HJIA 4HSLA 4KWLA 4IRGA 1ZAOA 2GZWA 2GWRA 3HHHA 2XHKA 4I0BA 3CUOA 1K78B 2EV6A 2ADUA 4XLNF 1C0WA 4YIIA 4IRHA 3MZHA 2RVCA 3KGLA 2LF7A 4MZUA 2IRFG 5I8TA 1SFNA 4M9XA 1X82A 1ZRDA 4IXAA 1QXJA 3TO9A 4AIKA 1J75A 4HVOA 4K8FA 2XAJA 5L3BA 3M7GA 3RYRA 3FXQA 5E8GA 5CVVA 1Z6RA 3BDDA 1VP6A 1DGWA 4IESA 3CEWA 3CLPA 5K5OA 1Q1HA 2EA7A 2HQNA 3R60A 1XB4A 4WCGA 3GVAA 3QPHA 3HRUA 1CAWA 1T2KA 3SHRA 3DEUA 2D1VA 4YNIA 3F6VA 3I59B 2ISYA 1ZYRF 2HKXA 3GUDA 4JVAA 3WTSC 4KA4A 1W7PA 1IW7F 4FX0A 3SXYA 2IT0A 2JTVA 2PQ8A 4LG0B 3DPLC 4RGUA 4HMZA 3EBRA 4B09A 1R58A 3C3WA 2KJCA 1XN7A 3TOBA 4BHPA 3HRMA 5CADA 4FAGA 5ICFA 1S29A 4XF3A 2G7UA 1O57A 3C7JA 4R8HA 3WU1B 4U7BA 1ZNPA 2IXHA 2MHFA 1CAXB 3W6KB 4BIFA 4BH9A 4DNCA 4GCVA 3IRRA 1T39A 5HLGA 4QGLA 3J81K 1QGPA 2ZJ2A 3BU7A 1W5SA 2ATFA 2Y0OA 3E5XA 3MDPA 2LNBA 3CO7C 1BI3A 1DP7P 1PP7U 2IXCA 2CFXA 2KXLA 2P4WA 4YFNF 4ZZDA 2FOKA 1KU2A 2EA2A 4UV9A 5LEJA 1R22A 5JR3A 4QGMA 2VT2A 1XMKA 2XKPA 3BP8A 2R7DA 4KIGA 5J3UA 3TO6A 3ZMTA 5K8SA 3ELKA 1Q5OA 3R0AA 5J48A 4LK0F 1ZHFA 2Q2EA 1G3TA 1NXMA 3WE2A 3BOQA 5T3NA 4Q0PA 2P5KA 4Z82A 2PMUA 2DFIA 5FCCA 3KP4A 1QBJA 3HOSA 2V79A 3Q9SA 1QZZA 4HN1A 2Q8KA 1QNTA 1HQCA 3I7DA 2IVMA 1R5GA 3HRTA 3HOTA 4LTAA 3FMQA 2H94A 3KP2A 1QY4A 5J8CA 2M1BA 4KIBA 5D4SA 3IBMA 3JSOA 5K1YA 1O3RA 1XMAA 2XRNA 2EV5A 4MHGA 2KKOA 3CO2A 4ZZLA 4AQ2A 1I1GA 1STZA 3NEUA 3HT2A 3GFIA 4Y17A 1RIOH 1OKRA 1X8MA 3F72A 1R00A 2XLGA 2XASA 3LQRA 1PP8F 4A5NA 5DYMA 3ABTA 3T8TA 3QAHA 2ET7A 2QYOA 1IPKA 1XGNA 4I02A 2UWMA 2JPBA 2MNGA 4HQEA 1YTYA 2UXXA 1OPCA 4E70A 3C1DA 2VQAA 4WX9A 3U2RA 2VXZA 2Z99A 1LRHA 1J0RA 2K86A 3CF6E 4PCQA 5FFXA 4XLPF 4S04A 3USSA 4U7DA 1CF7A 5J8FA 4XBFA 3I58A 1YFYA 1BM9A 3I59A 1EH7A 5D6FA 4D0PA 3HQXA 1T38A 3H8UA 2VOPA 3WW1A 4L18B 2UY8A 2FMLA 3P9IA 5F6FA 2QNKA 5JFRA 3WG9A 2M5WA 1TQMA 4EM0B 3DL3A 3GEZA 1SD4A 1Q43A 2YX4A 4HF1A 5IT9K 4WVZA 2D45A 5EEGA 4BAYA 2FQPA 4MGRA 5E17F 2M45A 3TDUC 1ZN2A 2BEOA 2ZBKA 4P55A 1R23A 4CYDA 3BB6A 5FDBA 2VE9A 2Y48A 5KHJA 3K1MA 1AOYA 4IVNA 5LGUA 2OU2A 2BNNA 1B1BA
chains in the Genus database with same CATH superfamily
1X3ZB 4LLFA 3H3UA 4JCKA 3USUB 5K0UC 4GJYA 3BG3A 5T5LA 1V6OA 4PF5A 2X48A 4XW3A 3BU0A 4O9GA 1LJ9A 1ODDA 4ZPIA 2AZ5A 4LE4A 2J7MA 2Q0AA 3VYRB 2GIVA 4HOBA 1HRI2 1XSQA 1EH6A 3HOWJ 3A4UA 3MD2A 5F32A 2ZXJA 4NIGA 2R1DA 2Y6LA 3ZN4A 5IT3A 1VQNI 3OYFA 1MZEA 2JPCA 2HGCA 4Q0SA 3N9LA 3IUOA 3MW4A 1UJ8A 1SPPA 1V6JA 3EXUA 1EY2A 3ZKUA 4P1WA 1F9NA 3TP3A 1ZTRA 4H2AA 4OFGA 4Y22A 2HDCA 1B4AA 4YW6A 1UHMA 5DD4A 3UR3C 4Q4Y2 3UT0A 4NQWB 4D69A 5JDBA 4Q2FA 2W92A 1AR61 1IS6A 2EB7A 3HPNA 1AYN1 2X1DA 5KHKA 5ILUA 2JUGA 3HSRA 1HKDA 1JXSA 2ESNA 4IV1C 4HLXA 3T0DA 3N9PA 1BBT1 1SFOJ 4NC8A 3MIFA 4UUTA 1F5TA 3TRSB 4CEYA 4B3NA 5LWBA 2ZJPF 3KLSA 2IA0A 1VE0A 3BTYA 4EN0A 5ERIA 4Z2YA 1ZZCA 2A3SA 1TNRA 1YQ6A 2JDYA 4XDOA 1MNMC 1VR3A 1SAUA 4MGQA 2DUQA 2WNOA 4X6RB 2C9AA 5JZGC 4I7HA 1W8WA 1SMYF 2ZS6B 3E5UA 3DUIA 4PFPA 1HQWA 3MKWB 4QU2A 3PJRA 2KRHA 5CFCC 3G6EI 4QPYA 3IP4B 2AR6A 5I0UA 3LA3A 1W8UA 3AYCA 2ZHKA 1WWXA 5FZ6A 5FUNA 4YW1A 3KP7A 3FXMA 1F4KA 2JX9A 4RB0A 2E5NA 3DBRB 5IT9Z 3ZOBA 4XOPA 2VJ5A 2V1UA 4UOJA 2DDBA 1JYXA 5FKMA 2XIGA 3F23A 3PU8A 2YPRA 2QQJA 4PQ9A 4GB33 2QQNA 1VBB3 3ZMVA 4ZDOA 3B73A 3ZR8X 4CO8A 1JTZX 5JWPA 3T09A 1PO12 2HDWA 4OYUA 4YSFA 3H8XA 2DMUA 4OI4A 4DUVA 4KN4X 4BQYA 1XXNA 5EQUA 3WG4A 2YU3A 1XDSA 2K9MA 4G9YA 2XPVA 2QQ8A 2X0LA 2WAFA 1W2TA 5HCHA 2DDUA 3ZSJA 1WI9A 3AP5A 5TSWA 4WK8F 3OYDA 3VBSC 2F4MB 3ZFGA 1CVNA 4BLIA 4J1WA 4F8AA 2QBXA 3SDGA 3ZMNA 4IEUA 1KS4A 1RESA 2RC4A 5A7WB 3A01B 2VUCA 2WAQN 3GGLA 1EAH3 1QJX1 3LMMA 4IJAA 3S2DJ 2ZEYA 3RG0A 4NRPA 3GTQJ 1BN5A 2ZGNA 2WR9A 1GZ9A 2V1DA 2DLLA 2L9LA 4DINB 3FMRA 2LRDA 2JT1A 2VOWA 4FPEA 3O3KA 4A6DA 3K4CA 4XETA 1DP3A 2FQ3A 1ERDA 1X7NA 1FOD1 1DGRM 5M3MJ 4I0AA 5HODA 5F08A 2ELHA 3WLUA 1QJX3 1Z3YA 3D1NI 2Z69A 3OYMA 4E4DX 1WA4A 4RMNA 1REFA 3K4AA 4XABA 5HDKA 3BPZA 4CEYC 1YFUA 2R7UA 1WCMJ 4BQ3A 4A3ZA 3E97A 2PFBA 1U2WA 3H5AA 5TGTA 3WINE 2F6BA 2E1OA 4G6DA 2YC4A 3EO6A 1OFCX 3LSEA 3VLBB 3ML6A 3ERMA 3P9CA 1JGSA 1UMZA 4XMIA 2K9QA 1KA8A 4D1QA 2WO1A 1WW7A 3OF1A 4QPGA 3ZDVA 2BFUL 4GA9A 3THPA 3OY8B 3MICA 2WA0A 1DPRA 1OISA 4IV1B 5BUVA 1YI7A 4QXCA 1RRJA 3H5RA 2X51A 2ACJA 2BVBA 5FXVA 3OUHA 4FQZA 5DUXA 1N78A 3ILRA 2EICA 3E3VA 3NKGA 2ZX3A 2EVXA 3FFQA 2ZAAA 4XONA 4CP1A 4C3JJ 1JYVA 1SC7A 4CDXC 1HB3A 1S7AA 3GTMJ 1ON1A 4IE7A 1W5CC 1IPJA 1CPNA 1UFMA 1XU1A 3SCGA 2DOEA 2Y2ZA 5FOBB 3RIRA 1NXD1 1WJDA 2EXKA 4DO0A 1G8WA 2XGEA 2ADEA 4A0ZA 3ZXSA 3DPRA 2UUZA 2W91A 4HF0A 5ANQA 1Q8SA 4BJ6C 3IWFA 5IK4A 4GYGA 1MS0A 3OB8A 4KMUX 2RGVA 3VBHA 3DEWA 2TEPA 1J7KA 3OS2A 4QPWA 1RL3A 2HOEA 1I5ZA 4P9UA 5BQTA 4ET7A 5F2SA 3TEYA 2NPIA 2K2SA 1WZXA 4IV3C 4O3MA 2ZGUA 1U78A 5FZ1A 3VHRA 3W6VA 4EEFG 5CFDB 1PUFB 5C71A 4QPIB 1J5YA 3COAC 1ZZ8A 3INAA 2ZKZA 4P5YA 1X4OA 3AL0C 1DDLA 3PUQA 5FO7B 3H9AA 4C0HA 1I1EA 2I8DA 4DXRA 1DCSA 1MJBA 3AMNA 5FKNA 2K4JA 2KIFA 4MGYE 4BE2A 4DFSA 4BYYA 1KYWA 2BXYA 5FRMA 5KAIC 2QQOA 1BJQA 3M9AA 4IEPA 2ZXHA 1B72B 1H8TB 1NHAA 1UCRA 1VBA3 3ZYIB 3CJRB 3WTYC 3F8BA 4BCUA 5GLUA 5H9SA 1T0FA 1Z91A 5GKAC 2VOOA 3ZR5A 4B1RA 4CU7A 2P2KA 2OA4A 2QFEA 3UGFA 2ILMA 1AYM1 4L0PA 4Y1UA 3JRGA 5BPIA 2DXIA 4JK1X 1FPN1 4NUBA 2L7KA 3FZ3A 3BN6A 3GNEA 3ZQQA 2K9SA 2P4EA 1FT9A 3DPTA 5E3LA 4Q8KA 1MPXA 1W1WE 3NNJA 1J1TA 3UETA 5FZAA 3SDBA 3S30A 3A0KA 4RQPA 2JQ7A 1RR7A 2B0LA 1ETOA 3BCAA 1AHDP 1WW5A 1XMXA 2CV2A 1WWYA 1I5PA 2VTXJ 4L9TA 4GH4A 1LR5A 3KZYA 2XBO3 2M7BA 3OIOA 2PHLA 3BCWA 4BE0A 2R49A 4D7MA 4LBQB 2DQLA 1IUYA 1MNDA 5FOJB 1JODA 1MKMA 3HGYA 1RHI3 1V00A 4PJ0C 1Z21A 5BMZA 4E4ZA 1QOSA 5IVEA 1VBD3 1EPZA 3BTXA 2FBEA 3VZOA 5A33A 3CMYA 2QZ8A 1KQ0A 1ZRCA 2DURA 3KYCB 2E2IJ 1LGBA 1WBFA 4IPAA 2JIGA 4AI1A 3FM3A 4RGAA 3DP7A 4CP9B 2PX9A 3QYFA 1G86A 1RVF1 1GP6A 5ABJA 2YROA 5EWSA 4RLQA 2XAHA 1UB9A 5L7OA 1QH7A 4XVHA 2E34A 1HCRA 2CWEA 3BC8A 3ASNH 1QNWA 5F64A 2VT3A 3ILFA 3G73A 2O8XA 4KNCA 2XGXA 3Q5FA 4PLMA 3SITA 1HB1A 2K3PA 1JUIA 3FN9A 4V19K 3M7AA 2LG4A 2W85A 4KGQA 3TB0A 5FY5A 4JQTA 2Y6HA 3NWTA 5JOXA 3WHTA 4MOAA 1CAXA 5C3QA 3M3YJ 4PDKA 4G7ZF 3PIJA 3S1MJ 2CWSA 2AEZA 1PNFA 3S17J 3KLNA 2LTPA 4KI5M 1ZQ3P 4AHZA 4II2A 4R1HA 5LW9A 2F48A 5C8WA 4MXVA 1W2UA 5JVGF 1ZGJA 1GWKA 3BODA 3I4PA 1T56A 2DAOA 3KZZA 4HETA 2PHUA 1KS5A 4ESJA 1UYZA 3M3QA 3PQKA 5A3LA 1XSVA 4AFAA 2DBBA 4MH0E 2YPDA 2VQ0A 3WGHA 2W7NA 3X29B 5AC93 3S57A 1A6CA 1XSXA 3HSFA 1QJY3 2QKDA 2WNVC 2WAOA 2CHHA 3JRIA 1W39A 4BHCA 1OLRA 4HK8A 2GMPA 2L54A 2OUHA 1DGRA 1FNYA 1MBEA 3BTCA 2R7FA 3SEZA 1NQJA 5A6YA 5KHIA 3I4MJ 2ZTNA 2RDSA 1ST8A 4RA2A 4B1MA 1COV3 3ABLH 2R063 1ZBA2 2V1XA 5CQEA 5JLXA 2DQRA 2QQAA 3QH6A 2XMLA 3AVSA 3J7AO 4B3AA 4U0WA 1LENA 3ILNA 2D5VA 3HTSB 1MJ9A 2DU9A 3TNPB 1RUE2 1Z9CA 3UKTA 2OZJA 4IDZA 5ACA1 2ZO4A 1PK6C 5F1JA 4D6QA 2NVYJ 5E3MA 3K0LA 3JW4A 4M01A 4B1LA 5FLJA 1YW9A 3DU6A 1VQ4I 3B94A 3K9TA 3CCMI 2LREA 2GA2A 2HU9A 3RZZA 4AWXB 4PZJA 4XUNA 1HRI1 3VDCA 3NJVA 3CCQI 2SLIA 1BR1A 1GLHA 4NC6A 1OVSA 1P4WA 4R9AA 4CU9A 5C9AB 3WE3A 5EYXA 3B02A 1UX7A 3I54A 1TME3 2XJSA 4XM3A 2MH2A 1NCRA 4E4HA 3A7QA 3MFCA 4G8XA 1ACCA 4Z07A 4XFIA 4Y5TA 3BTZA 4M6VA 5JXJA 2MC3A 2VO5A 2DA5A 2DMNA 1QQP2 5KC6A 1UHWA 3K77A 3HMYA 2OVUA 4HF2A 1OQEA 4HG2A 3IIIA 5A3WA 2ZACA 1XS9A 4QPIA 2ADDA 3HEFA 4JGZA 2OPTA 4RBOA 1RTVA 3ZIWA 3H9GA 1UWWA 1D8KA 3ZP5A 2G9WA 4GKYA 2LM3A 4IQPA 4Y7NJ 4UV8A 1Y8QB 2VBWA 1F4HA 1QVTA 4JTNA 2A7AA 4GAZA 1G9DA 3ROUA 2HOTA 2IUWA 2C0ZA 5J09A 1M1EB 1VLNA 2PXJA 5T5OA 2XJPA 1S2KA 4XBNA 5AC92 1TQPA 1EKEA 1YIOA 4AIDA 3TEDA 3KD4A 1JT0A 2RS12 4M9SA 2ARBA 1WCKA 3ZXAC 2R043 1TT0A 4KMQA 2P8TA 3SH5A 3B69A 4C91A 1P2FA 3VDXA 3ZYFA 3AL5A 5CA6A 3NW4A 2X8KA 1RI7A 3QU3A 3J80Z 3WTWC 1LESA 3DWLE 4K21A 4MUVA 3ZGKA 5FZBA 4RQPB 2PTMA 3F2ZA 1GZTA 4XUTA 2RQQA 3Q8FA 4ZU5A 3IHUA 2R7WA 2K9NA 1JHJA 2YYOA 3HQRA 2FMYA 4M6XA 4NHKA 3TN93 3CCEI 2DA7A 2KIQA 1OSGA 3HUGA 1AR83 3QPTA 1QWRA 4AK3A 4OHVA 4ZY9A 4QPGB 4PJMA 2VNGA 3RJPA 3MPBA 1E3HA 4X6AJ 3TL4X 5LBEA 3OYHA 2VMFA 3OYWA 1CIWA 3ZFGB 1HX6A 3AC0A 2FZ2A 4WZFA 2DVBA 2WFPA 3LSHA 2JG8B 4M3FA 1LEBA 2L3DA 2OS2A 2XPUA 2K0GA 3KX2A 3RKQA 3KCXA 3HG9A 5I91A 3VDBA 4IEVA 5DAVA 4XBLA 4HSTA 4JKLA 4L99A 1T2XA 1MJAA 3UJQA 1OFNA 2RR11 1GV9A 1OA3A 5LB6A 4BIOA 5J1YA 2ZPXA 4R52A 1D5YA 2XDVA 5GADJ 2IW5A 3OSDA 1AU7A 4ABZA 2QA4I 5E16A 5H6QA 1S5LC 4BEHB 1FTTA 4DUXA 1MS8A 3AYEA 3S2WA 1P4AA 1ENRA 1D4VB 3NAUA 3HGGA 1MDMB 1J3QA 4KJZA 2K85A 2CW0F 2RAEA 3WHCA 4L8QA 4LBMA 3DXTA 1KXGA 1YXWA 4P9JA 3IT8A 2M30A 3PUAA 4YW7A 4XHBA 2E19A 2J42A 1OOPC 1U9NA 3RSNA 2DFHA 2DTRA 2RMU3 1REPC 2J1VA 4UF0B 1YRNA 5DDJ3 3M8EA 3SFZA 3AAFA 1YJKA 2XL9A 2LD5A 5FJHA 1LPQA 4P5HA 3CJXA 1PX3A 4ITVA 5J6XA 4EQQA 1U6GA 4N9IA 1SAXA 5EGOB 1FEXA 3VWBA 4O65A 2VC9A 1K4SA 1QU3A 3WF0A 1J9IA 5GAGJ 1PDNC 2AGSA 1RHI1 2VLAA 5IW0A 2CSGA 3NAPC 3P3PA 3W5MA 2HWC3 1R081 5C4JJ 1UY3A 2J1AA 3PUFA 3BUCA 3CUQC 5IYDJ 3KT1A 5TRDA 2ZNZA 4DQ2A 2OZ6A 1W90A 1H0BA 2LP0A 4LHLA 1KEXA 1SACA 2NOJB 2D6MA 4IL6C 1V3FA 2ZBJA 3M4FA 1J58A 2HYGD 1L7QA 1AJKA 1R4NB 2R7TA 4JGYA 1T98A 2IGOA 1X1BA 3K6GA 2A75A 5KHHA 3FKIJ 3GBWA 5LASA 1M06G 2E71A 3L1PA 1OFSA 2JRMA 3CJIC 1Y4WA 5JOZA 3RPUD 1I1SA 3OEBA 5FAXA 4DY3A 1UMIA 2V6CA 4PSWA 2VZPA 2BZTA 4XURA 3MW3A 3V56A 1UIJA 4R9BA 2D3PA 5IY5H 3VZKA 4AVTA 4QHBA 5IUQA 4C3IJ 5FQ0A 1I3HA 1AR73 4FSJA 1BCXA 3WNOA 2VMCA 3URFA 3S8PA 4A3EJ 1W99A 3BROA 4S05A 3ZPLA 3ACHA 4OMZA 2RM22 3LDBA 3DPUA 3MIBA 2H6CA 4RB2C 4ITCA 2HZDA 3IAPA 1LECA 2JDNA 5C4WC 3WDYA 1SBEA 1SEFA 1E5RA 2EFWA 4Y1XA 1D0HA 2X09A 3U0ZA 1COV2 2GXBA 1TTYA 3RQ0A 1XG1A 4MEYF 2R071 1JKQC 3WG7H 2DK8A 3DCQA 2ZCWA 3OPWA 3HHGA 1POV3 3TW7A 4XJ9A 1UG0A 2PLV1 4W6WA 1BK1A 3CP2A 4D0QA 2ETEA 1CONA 1ASJ3 4QDRA 1SBDA 4CYCA 1D7PM 4QPIC 2A6EF 1K6OA 3R6SA 4G9SB 1O3QA 3AFHA 4LO7A 2P0WA 4X8NA 2O9LA 4WVMB 2ECBA 2XONA 2VZ1A 2QQKA 4AEDB 1N3QA 1OI6A 1YI9A 1MQTC 3WUCA 4DZJA 1BBT2 5F3CA 4OHXA 4C30A 3WG2A 2O61A 3KV9A 4NIAA 1Y9GA 5DD8A 2JSCA 3LDKA 2W46A 3OG2A 2ELJA 5L3EA 1FV3A 1AYN2 3GCWA 1GYKA 3DQVC 2IS1A 1S3JA 1AR62 5E3OA 2KHMA 5FZ8A 1XX5A 3O7OA 1T0FC 2P7VB 1ETKA 1NCQC 2P37A 4CGZA 1GHCA 4AXOA 2R061 1R1VA 3C8XA 2O03A 1N1YA 1QJU2 4FX4A 3LA2A 5B5EC 3CCLI 1DU6A 2PELA 3CC7I 3TNQA 3T2PA 3PUHA 5K5QA 1I39A 5JLVA 4WZCA 1LODA 2ARAA 1OBNA 4MG2A 2OTJI 4V2FA 2F17A 2CQ7A 2Y30A 2PLV3 3AX4A 4P08A 3CF5F 4LMYA 1IUFA 4AIHA 2EF6A 1W3XA 4XN0A 2VJXA 2YHJA 5CVUA 5K7PA 1YI2I 1DU0A 1NUKA 1O4YA 2JA8J 2HZTA 3HKZN 1H1MA 2XB0X 4MXWA 5FKBA 4PK4A 3RDIA 4ZYAA 1W2OA 3ENRA 2E26A 2OYZA 1F8VA 4BACA 1SFUA 2ZGKA 2IEKA 3GLLA 2TNFA 5FBZA 4XXAA 2WT2A 1FX7A 4FETA 1X1DA 3LA7A 3U1KA 2P6TA 2B39A 3B5LB 3AK0A 5A3MA 2M8GX 1FX5A 1MS3A 1S72I 3CJTB 3GTGJ 3I3BA 4HBLA 2FOWA 5FP7A 2E31A 3HIFA 1IOAA 2XBO2 2ID6A 3WQ7A 3JCUC 1XCBA 1H30A 4YELA 2ZNYA 1Z77A 2N7GA 4XAAA 2ZGLA 3P1IA 5DS9A 2NVTJ 5CB7A 1FP1D 4GMP1 4AOCA 3ZN6A 5KC5A 3LF7A 3OYWB 1FAYA 1JZ8A 1EA3A 3CMMA 5KHGA 2LH9A 3TN91 4LBLA 1W0UA 2HEYF 1MD0A 4ZC3A 2ELKA 1X1PA 2XF6A 2PAEA 1FOXA 3VKMA 5JHFA 5A7NA 4AW7A 3CO6C 2DTWA 2BJSA 2E7XA 4L5EA 4R79A 2WN2A 4IEOA 2ME0A 3I4NJ 3FKJA 3UJOA 2PAKA 3G1OA 1V9U2 3DTKA 2NNNA 5DUKA 3J9SA 3N4MA 1G9AA 3M8JA 4IOCF 3ZMDA 3WR0A 1A3KA 2W47A 2R5YA 1NTCA 4JZRA 1D8JA 1I3AA 4KICA 3OBZA 4QXKA 4FPGA 4GIQA 3U1XA 2YG0A 3ABUA 2VOVA 3NAPA 5DAQA 1YJLA 2D5HA 4UFHA 2GN7A 5FXXA 3BZ6A 3CJQB 1JJ8C 2A5ZA 1NYWA 3AP7A 1R1A2 2F4LA 2YGMA 5DMYA 1D1AA 1YE9A 3Q9OA 5HVQC 4XXPA 1AL23 1KGYA 4XSZF 4XF4A 1QU0A 2W1UA 5CLSA 5T50A 4MQVA 1NH3A 2XPWA 1VTNC 3AKPA 4QKDA 3UNGC 5JIUA 4IEZA 5FYZA 3PLQA 2CO5A 2FSWA 1ZREA 2D6KA 1SD5A 1GV5A 1U0AA 3H1WA 5FUPA 2XGDA 5LATA 3I3LA 3S1QJ 2AENA 4ONUA 3O1PA 4BJ0A 2R7ZJ 4IX7A 2HQRA 1QHHD 3SYTA 3OR1C 2FXAA 5J36A 2PI0A 3KVAA 4YZ1A 3POYA 1Y1VJ 2V09A 3PUSA 1IZ3A 3R4KA 2XUMA 4RAZA 4HN0A 3K46A 5FKLA 1VBC3 4IHTA 3HR9A 4RQPC 4CDXA 4KWUA 1Z7S2 1P6RA 5JPNB 2WNEA 3RYPA 4BU2A 3FHIB 4Y24A 5FFOC 5J1RA 3ZIXA 1TC3C 4RS8A 3H0OA 1GMMA 3RI4A 2QBYA 4CXWA 2WT0A 2XH6A 3AYDA 3PNVA 5HS9A 2P7CB 5I93A 4LBNA 5JMOA 3AL6A 5HXMA 1FMD1 1B9NA 5E3NA 1UY4A 3B9CA 3OYIA 4HSLA 3WHUA 1ZAOA 3RQ4A 2GWRA 2GN3A 2JDUA 4RN5A 3OYBA 2ZGMA 4A3MJ 4M3CB 2WQZC 3RWNA 4MZUA 5FO9B 1TE1B 3GMEA 4Y33A 1RUJ2 2F6CA 2VW1A 2VJ4A 1BW5A 2XAJA 5L3BA 2ZABA 3PL0A 1CJDA 5CVVA 5EG0A 1OUXA 1BLZA 4CSWA 2D3SA 4IESA 1D0ZA 3CLPA 2PMZA 4JGYC 5K5OA 1Q1HA 2WNUC 2HQNA 3BOPA 2XGCA 1GZWB 4JGYB 2VCAA 4WCGA 3I59B 2ISYA 3DECA 1GZWA 5FK7A 1PZ8A 1N3OA 3WDXA 1F15A 3KCYA 2BGOA 3WTSC 5DDJ1 5C8CC 2IT0A 3I9V2 5FYYA 1EV11 1SBFA 2ORZA 4RGUA 1KDKA 3SC7X 2RS31 4UI9L 1R58A 5CISA 2FUG2 2NN8A 3TOBA 4BHPA 4BK4A 2I74A 1W0OA 3GTOJ 3IV5A 2A6YA 1IGOA 4CEWA 2L7MP 3P5JA 2G7UA 1N47A 3T1LA 2VJJA 4XTPA 4FE7A 1SDWA 1GFF2 4BIFA 2DT6A 4IL7A 4RA0A 2VQHA 2M0MA 3EYPA 2VZRA 4GRIA 4YZ5A 3EUAA 4DBRA 4QGLA 3J81K 1QGPA 2ZJ2A 2RR12 2Y0OA 3NJYA 4P02B 4U36A 2XVLA 5M3FJ 2ZGTA 1YIFA 2CFXA 1UNBA 2KXLA 2P4WA 3R0RA 4ZZDA 1HRV2 2FOKA 2ZJCA 2AACA 3BQYA 1R22A 3ZPYA 3NJXA 4ZDLA 3BP8A 4BQ4A 1X58A 3WF2A 3B01A 1DLCA 2DVGA 1Z7LA 3ELKA 5CFCB 4BMEA 1PUFA 4OHYA 3POEA 1IDYA 5K7HA 3JREA 2E5ZA 3L2UA 1ZHFA 1NXMA 2JICA 4ISQA 3BOQA 5T3NA 1BMV1 2WQ8A 4AYUA 3C2GA 2VI6A 4H14A 3BIEA 5FCCA 2BRTA 2XG3A 1A34A 1QBJA 3PO3J 2LROA 2V79A 1QZZA 4CCJA 3PDQA 3MUZ1 1FMVA 1HXS3 2VZ3A 2VD7A 2WWUA 1WLDA 2YC0A 2H94A 2RR13 4W65A 3FHNA 4KIBA 5D4SA 1O3RA 2R7VA 5FZOA 4MHGA 2KKOA 4LHSA 1I1GA 1UOFA 3Q0VA 3PU3A 4LBKA 3NEUA 3JQWA 1ZA7A 1LFUP 2XASA 2E2HJ 4QWNA 1V0AA 4ZXEA 5DYMA 3ABTA 2ET7A 1BZWA 4IE4A 4HANA 4BB3A 1YTYA 4E70A 3D3AA 3HOZJ 2BOJA 2BVLA 3KIOA 4PCQA 4CEYB 4XYXA 3C7FA 1IGNA 2WLQA 4K40A 1TWHJ 3WVJA 2L9NA 4A3XA 1YFYA 4LIUA 3H8UA 3VYTB 4P14A 4JDNA 3ACFA 2VJIA 1A8DA 2QNKA 2Q1FA 3N3HA 2W2IA 5ISLA 4FPJA 4AI9A 1Q43A 4HF1A 3PJQA 2WSVA 2GNBA 4FOYA 2DMTA 1QVUA 2JE8A 2X05A 4M4RA 4W6XA 2ZBKA 1S55A 1VRBA 3LEIA 3K1MA 4DOZA 3RWKX 4S2DA 3FIWA 1W2NA 4XCBA 5LK7B 2EFOA 3ZMOA 2YPJA 1VMJA 3VD5A 1I6HJ 2VNVA 4Q4V3 5LCWL 1D3YA 2F2EA 5HS7A 1W9WA 3WCSA 4Q1PA 2DFFA 2HKOA 1G3SA 2JKXA 1W6MB 4AU7A 4FPFA 4NHMA 4XJZA 2VUMJ 1F31A 4LUKA 4OIPF 3CDZB 3IMNA 3VSLA 2VZVA 2CUEA 1GICA 2X10A 2W1SA 5JUVA 1OLME 3ZSLA 4EJVA 2E9QA 4QB1A 1W28A 4QM8A 3NQHA 4GZ9A 1ZG3A 3AVRA 1RUE1 2V7FA 3J4UH 2GDFA 3V7CA 3PVOA 3R61A 1OA4A 4PBOA 1O8PA 2XQRA 3S7EA 1D0GA 1RC9A 1SQ4A 3BR5A 2B5HA 4Y20A 2V9PA 1YO5C 2AEYA 1AHSA 1F43A 1S4CA 3UYJA 1JHFA 3O0VA 1U3EM 1A6IA 1A5JA 5LBQA 2BDRA 3L2VA 4JX6A 3AYAA 1ENXA 4BQAA 3ASOH 1APNA 5DDJ2 2NQYA 1RUJ3 3GCMA 2W68A 1MEC1 2ZJQF 4K6BA 5LK5A 2VY0A 3FBMA 1OLTA 3C7GA 5K7ZA 2A69F 2X9DA 1LGCA 4A12A 1LHNA 3PTRB 1B09A 1RUF3 2P34A 2G9FA 3JRCA 4HPQA 2ZC2A 4G7OF 2DCKA 4FPYA 4N4NB 1SLTA 1LTEA 2YR2A 1W8OA 5EGOA 4IGQA 2M0CA 5D8KB 1D0YA 2CYYA 3BWGA 1W36D 3N7KA 2PLV2 1BEV3 3LSGA 3DKQA 4XF0A 4OI0A 5CAZA 1XNCA 5FZCA 4XFCA 4K1YA 1C3HA 3I71A 1COV1 1Z7S3 5DUUA 2AHQA 2WY7Q 2Q30A 5GJ6A 3U9GA 3T3YA 4DEQA 2RN7A 2XUBA 3OTFA 4N8MA 1LE8B 5FZMA 3ECHA 1MS1A 4URTA 5FZ4A 5FZ0A 1G8XA 4H3WA 4N0BA 1Q8QA 2KA3A 4XACA 1R36A 1W0NA 4LB6B 3K3NA 5FP3A 3U10A 3N9MA 4D5FA 3GF6A 3AFKA 1R1ZA 2IGNA 3AG3H 3JRAA 4LKDA 5GPCA 5IP6A 3IDAA 4AIJA 3LAPA 2QUFA 4RS5B 4D7YA 1LVKA 1DU3D 1TEIA 3OYEA 2EQRA 2QVOA 2R7QA 2ES3A 2BBAA 3F0CA 1JN2P 3KT4A 2QE3A 5K0UB 2LFBA 4HONA 2WNVB 4M72A 1T95A 3MKZA 3U07A 4K2EA 1VBB1 3S3OA 2CV0A 4XFAA 5D1IA 1V5EA 3MGUA 1BW6A 4GWMA 4AGVA 3FBYA 1R093 3OD4A 2F4PA 4AHWA 1Y6IA 1J3RA 4LNVA 5FV3A 1YLFA 3ECQA 3U4XA 1YFXA 3I2HA 1IG3A 3PO2J 1OKOA 2JDZA 4GD4A 3APBA 1HB2A 3SXWA 4I99C 4N53A 4NB5A 3VD9A 3HJRA 1RKWA 2MLKA 1UD1A 3D5OA 1Z0HA 3FZVA 1ULEA 4BHBA 4NBQA 5KCMA 1HXS1 1TL8A 4HNVA 4N53B 2LMDA 5EZWA 3Q9VA 3KV6A 4KYWA 5HLTA 1YWKA 5LFAA 2XC7A 3MV01 5EG0B 4Y5SA 1C4RA 3BY6A 3LFUA 1FPN2 2QBYB 4IV3A 1F36A 2PHWA 5DDGA 4EVIA 2VNOA 4GMP3 1AX1A 4L0ZB 2FNPA 2ZSIB 1FP2A 3PIGA 3FE5A 1WGPA 4K20A 2MLGA 4XSXF 2RVAA 2D6NA 5HCFA 4QTRA 2JJ6A 1ODNA 4AFDA 2YY1A 3T0YA 1LCLA 4NIHA 4GFBA 4EQVA 3GZ6A 3CZ6A 4QPOA 1GDTA 1CN1A 4CCEA 1MVQA 4RDUA 1RIRA 4BNCA 2FJ1A 1P7IA 1OJLA 2XQXA 1U0JA 1R1UA 2RV8A 3NVCA 3GLXA 2LDUA 1LOCA 2DDAA 1MZFA 5GZEA 1ZVFA 5AC91 1QJZA 3AMHA 4OWRB 3ZQFA 5IAXA 3O8HA 1EUUA 2EIKH 3ZOIA 2B45X 4IEXA 3DXJF 5A7QA 2ZMEB 1NCQB 3AMMA 3EMRA 4YVWC 3DKYA 2ZZQA 2ZGSA 2PA7A 1UAIA 4EZ4A 2HEOA 3TYJA 3SEQA 3L2RA 1WJEA 1HW1A 3CBNA 2H8WA 5F0FA 1LGNA 4O9EA 2JECA 3H3ZA 3KZ4C 4LG3A 4Y15A 4BEHA 4ANJA 1PK6B 5L3FA 3LL7A 1C8M3 2BWCA 2Z5UA 1CPMA 3RI8A 1UY1A 4P9IA 3GBGA 3CLOA 4AYBA 4LB5A 1W6NA 5T5JA 4L11A 1YYVA 1Z67A 4XNFA 3ON7A 1PX4A 2DVFA 4OULA 5BNOB 2A5YB 1WMXA 2RDPA 1HSJA 2A73B 3OPZA 2STWA 4KG0A 1WRJA 3BTAA 1AR63 5IWFA 4LOTA 2NXNB 1ZLKA 2EAAA 4UUVA 2LYCA 2ZMKA 2VTFA 4MX3A 1MH4A 1W3VA 4XZPA 3ACLA 4BBRJ 5HCAA 3L09A 5JXHA 3K75B 4DZGA 3BG9A 1WCQA 4BZ4A 3ZXFA 4HAMA 3W58A 3GFJA 3GTPJ 2P5LC 4MGKE 1ULGA 2YSRA 2W39A 1XBFA 2R062 5AIPA 3KETA 3ZQCA 4AEDA 4TLGA 3IDBB 2OCCH 3DBHB 3AKTA 1BOBA 5FUIA 2VPLA 3S5QA 4DJAA 1K78A 5FMDA 2VCBA 2E1CA 4KITB 1ONVA 2XAFA 3M4OJ 2X29A 1FOD2 4RS5C 5CVJA 4ESFA 4QPGC 1ZX5A 4DY5A 5FYBA 1W36C 3K70D 2K27A 3VOEA 3ABZA 2WABA 5M0TA 4UVBA 3QPSA 3A4CA 1FC3A 1SD6A 3WNNA 3ZYGA 3OL4A 4A0YA 1YFWA 5L3DA 3CIHA 1ZRIA 3QYEA 1IQAA 2P6HA 1H2LA 3HDDA 1S0GA 1UY2A 1BHGA 5FPBA 5J1UA 5J96B 4J19A 3J80K 2DN0A 2XJVA 1PZ7A 5CNAA 5LEKA 3KCCA 4BDZA 5DZGA 3OYAA 4MQ9F 5CVRA 2DUOA 5LHIA 4XLCA 4E7ZA 5FLVA 3UGGA 4WXHA 3SKJE 3LIGA 2YZ4A 3O14A 1UXXX 1QEXA 1J84A 1LOGA 1AR93 3SH3A 5F3GA 3K51A 4UT5A 1JOJA 2K7LA 2MABA 2K9ZA 3OYJA 2JA2A 4LD5A 1W04A 2YFUA 4GB31 4OQ9A 4DMIA 3A2KA 4KT6A 3TEZA 1POQA 5L3GA 2XJRA 3VKOA 3GTLJ 5LA0A 3X2QH 1WD4A 1LFBA 2H6BA 4A3FJ 2BOLA 3OYCA 4J1XA 4WXCA 3VB9A 1G3YA 2K5CA 5E18F 3UL2A 4LKFA 3CUQB 4ZZ8A 2QQBA 1AR92 5FP8A 1QOOA 3LSDA 2BZDA 2QTWB 4XFBA 1VZ0A 3NAPB 1OMIA 5F5IA 1UU6A 5FYSA 5EZGA 4RGXA 4DNYA 3N97A 3ZMSA 3BR1A 2EFPA 3RYKA 2ZEZA 4OLLA 1YOVB 4QQOA 4G12A 4A3DJ 4M3CE 2JG9C 3SLIA 5BNGA 2XSDC 4GH4C 3O0WA 4BM8A 4QX8A 3WP5A 4RAYA 1QDCA 1CD3G 2CS3A 4UXNA 4LK6A 2BHZA 2O14A 2R0HA 4MTDA 1HBXG 4EJOA 1P9QC 1K5MB 5JSPA 1EH8A 4YRDA 4QWQA 3ZXJA 2G7HA 3BALA 3CF2A 4XUPA 2RS33 1CJPA 3VZJA 1NAEA 2LALA 2IAIA 2TBVA 3NKTA 3S5AA 3RKXA 4PIZA 3OV8A 2KQRA 2RDRA 4HEA2 1AYM2 1CX4A 3PQJA 1AKHA 4MLOA 3ZPOA 4DYCA 4NRQA 5HOOA 4DXTA 3V42A 1LOAA 2DYCA 4AVPA 1GOHA 1TW3A 4IV3B 4FFFA 1VQMI 2BU9A 5BNNB 1F5JA 3EQEA 1AKHB 1CZTA 3ZQIA 2MEV1 4XQWA 4XILA 1SZBA 1HN0A 1LKNA 2L01A 5HNHA 2LTNA 4A7KA 2ZX0A 4XKWA 4XL9A 2BPA2 3ZMUA 5AVAA 2WNVA 4OIRF 3WDUA 3JUUA 1K12A 2VKVA 1EPWA 3PFIA 3HJEA 3ME2A 3RZMA 4XIDA 4V1PA 4FXKB 2OV7A 2PN6A 3NWSA 3RZHA 1SVMA 4CZSA 5FZFA 4SLIA 3BZKA 2X5IC 4I3PA 4PIXA 1APLC 4M71A 5E8IA 4CDXB 2NRAC 3CUQA 1IDZA 2QSHX 2WSUA 3MI8A 4KFCA 4FHTA 4WBBA 3OGGA 1POV1 1I50J 4F52A 1WJBA 1JZ5A 1XNDA 1RUNA 1GLNA 5IFTA 3KWVA 2A3XA 5FZ9A 1ULOA 1JTXA 5HBAA 4OMDA 3MAJA 2E60A 4AUXA 2PHFA 5HI0A 1V70A 3QODA 1C28A 1OLQA 5L9RA 3E5QA 2QQMA 4PFOA 3N36A 2RG4A 4RL7A 2OA2A 5GM0A 3F95A 1X50A 2ZHNA 3GALA 3SZPA 3I55I 1YLLA 2DA6A 1ZG5A 2VONA 3U4SA 2AXTC 1QRYA 1RUG3 4QX0A 1I3QJ 4NQWA 4EYUA 3U21A 3HTUA 1RUE3 2F5CA 3MV11 1WZ2A 4UFKA 2M87A 3H92A 4A2UA 1K83J 1IN4A 2RS11 1C8M1 4FPLA 3IKTA 1S1AA 3I3EA 3KP3A 3KYDB 1QJEA 2W48A 2PYTA 2GM4A 3RQIA 3HYIA 1PJRA 2YBKA 2C6SA 4JAAA 1SCRA 2OF7A 5F6LB 3TEWA 4B3XA 5C4XJ 4XEZA 1YX5A 2MFZA 5IYBJ 1OYIA 3G71I 1YIJI 2PFWA 3E6BA 1DZRA 4BXUA 1Q1VA 2HQAA 5GZCA 5D5UB 4IERA 4BY1J 3V7SA 4RD7A 4AFCA 2O8QA 2OUJA 3U78A 4HV6A 3CTAA 4M74A 1T6SA 4W6YA 2QCSB 4HFSA 1ND2A 1T08B 4XAEA 3GTKJ 2V72A 1ON2A 3OD0A 4Q0QA 2WADA 3ALQA 4HK9A 5FYUA 4PHZA 4QQLA 2WFF3 2CNAA 3ZN5A 3L2CA 5DV5A 5LGNA 4HX4A 1W4MA 1NE6A 2BY2A 4Q4W3 4HYEA 1CAUA 5C3OA 1XGOA 3RMXA 1H8TC 5FY0A 1ZBA3 2UWCA 1YEWA 4GWNA 2B9SA 3TBIA 4Q5OA 4XIOA 1K79A 4DRVA 3CMAI 2GC3A 4NWWA 4S2HA 2XRLA 2QDRA 3PVBB 4ARYA 1M4WA 2VMHA 4COYA 1ULFA 4OZOA 4CXXA 5EJ3A 3N9OA 5CFCA 1X9PA 5GLZA 5A2QZ 2MEV3 1UX6A 3MQ0A 1PO11 2V73A 3BG5A 4UUSA 1TNSA 4NN0A 5CFDC 5CVIA 3WDTA 1R091 4KU8A 4CVUA 4BXXJ 2VCMA 4WV8A 3W9AA 2D97A 1VBE3 4RB1A 1F2NA 4ZXKA 2P17A 3BJAA 4Q0UA 3D5LA 2LBFB 1ZBA1 3I49A 2WS93 1V6LA 4XRMA 1FI2A 5HDGA 3FUOA 3ZFEA 3HL2A 4LBQD 2BY3A 1LAJA 3IRQA 3MCZA 1HB4A 3FHAA 3N9NA 4K3UA 2L5QA 4LBQA 2ME6A 2FHRA 3GWZA 5DUWA 3CMGA 4XZUG 4QMAA 1MNEA 4UBGA 4KBBA 3TDZC 1TNTA 4NO4A 2DV9A 3PL8A 2TDXA 4CE8A 3M1HA 5GLWA 3SEEA 3E0JB 1ACIA 4M00A 1F5FA 1HW2A 1MMSA 3DYOA 1UZCA 2LKPA 2HS5A 1ZRRA 5FZGA 1JE8A 2KD7A 2AREA 5T55A 2KR2A 1C5HA 1JI8A 1O59A 3SCFA 1VAVA 2TUNA 4IE5A 5EIYB 3K2AA 4NC7A 3N7LA 4NR1A 2FDJA 2XB5A 2CY6A 4FO9A 4M6YA 3S6PA 1RUI3 1I27A 1XJAA 2KPMA 5CYVA 4XC9A 3VV1A 5FPXA 1RUC2 1EJ9A 2W08A 3NNLA 4LA2A 2AH2A 1POV0 4L9NA 4P9WA 4Q4Y1 4RGRA 1BR2A 1OUSA 3W2WA 5HLIA 3K4MA 1BXHA 4PJYA 2Z3YA 3L2QA 3ZDSA 2FMDA 4BBSJ 2P81A 3VGIA 2PMHA 1LHOA 5FZ3A 1HXDA 1H9PA 3CLQA 3EDPA 3CCYA 5FKOA 1O4TA 2VC0A 4LKEA 5E1WA 2DWRA 4EJWA 3R4SA 4LORA 3PIOF 2VVDA 2LLKA 1D1BA 2R3SA 3CCRI 2LF8A 2XOMA 1NA1C 4F91B 4CDUC 1DBNA 5FPUA 2FE3A 2IXIA 3WNKA 5FYTA 3VL9A 3H3VK 3WNLA 1GXQA 3SNMA 2BVMA 1TWGJ 2UU8A 1Y0NA 1DPUA 1VBA1 1Y9QA 3CCSI 1VAKA 4RAFA 1RUD3 2BVVA 3DEMA 2NS8A 2D2WA 4I3GA 3IAQA 2P3IA 4GYIA 3VSKA 1JKOC 1JH5A 4HW0A 5EDNA 3NWKA 3PJYA 2XUEA 3V4GA 1X19A 3RTRA 2MH9A 2YC2A 2VG9A 1RXGA 3HN1A 1VJ2A 5GLTA 3V8LA 3FHQA 2MD5A 2Y69H 4ZHNA 1WH7A 1FLIA 1A36A 1AXYA 1N77A 2AC1A 3VHPA 2HTJA 4AD9A 5BS6A 1SFXA 4QX1A 1LFPA 3B3QE 4CDWB 4YZ4A 4B7EA 1DQ5A 3BIWE 4FCYA 2ZSHB 3G1MA 4JHTA 4HOOA 5IP9J 1VQLI 5A80A 1AF9A 2PBIA 2VKHA 1GOGA 2BV4A 4B8EA 3MO4A 4HVQA 2GC1A 3CQZJ 1QH6A 4QDSA 5ICEA 2ZMLA 2KT0A 2GNDA 1YJWI 1USSA 5GLVA 3AKRA 3GW2A 2QQIA 1XPXA 1LDKB 4NPLA 1X36A 2VKDA 4OQ8A 5T5PA 5CKMA 1SLAA 4LKSA 2UYBA 1VBE1 3LEKA 4EJRA 4Y52J 2PHXA 5FLIA 3SZGA 5FGMA 3DTIA 4PI2A 3BPVA 1MSEC 5DCFA 1BMV2 5IYYA 3DF8A 1YUDA 4CCNA 4NMIA 2BGPA 5C5TA 4PBPA 1GXPA 3MPPG 2CYFA 1FBUA 1VQ9I 4AHXA 1STMA 3L9FA 2BUKA 3ZN6B 2RQPA 2C24A 3JAMK 3CCUI 1MS4A 3AJZA 1NCQA 5C4WB 1LQ1A 4HDVA 2ZKNA 4NHXA 4D9JA 5GZGA 1EAH2 4N7UA 5F5AA 1OQ1A 4HPKA 1WCSA 2NMNA 3ETPA 5BNNC 3O1MA 5C3RA 2O3FA 5ERLA 2PG4A 2J1TA 1D2QA 1UYXA 2MYSA 3F3XA 2X1CA 5FZ7A 3V8KA 1XQNA 4MHUA 2DA3A 3GZTB 3LKJA 3W20A 4ZDPA 3N35A 2MG4A 3WDWA 5EZHA 3H1MA 4YVWB 4L5JA 1W6PA 2OXBA 5ILSA 2RS32 1WQ2A 3RRDA 2WA4A 4ASMB 3ZXDA 5IOZA 4BXFA 5AFEA 1PZ9A 1Z78A 1EV12 5KHDA 4DOUA 3K4BA 5B1BH 3O5SA 1NT0A 3WUDA 1USTA 1C5IA 5A1LA 1R9TJ 2O0YA 3AM2A 3B7MA 1CQ9A 2A6TA 2G9GA 1RYYA 5IPAA 3ERED 3ASIA 3RCOA 1CF7B 1WJFA 2PQQA 3T0AA 1ETVA 3HUGB 1V6NA 2KISA 3O1UA 4CYCB 1W0TA 4UUSB 3ZSMA 2VIXA 3HPGA 1W9SA 5B2GB 4Q4X2 5FROA 1HLCA 2WB1N 2P3YA 2R073 2KJBA 4J00A 1SDDB 3DYMA 4AG4A 4B4PA 3H5NA 4EJUA 1DHKB 2VOTA 2B4KA 1IRGA 2DFEA 2VKEA 4BUPA 1RUJ1 4W97A 1AR72 1Y3TA 2RJKA 4B7KA 1U5ZA 5DG2A 2LOOA 5A70A 4EV0A 5DM7F 3H42B 2VODA 1QO0D 5B3SH 1HV0A 1RUD2 2DPDA 4C8DA 1NQDA 5J3LA 1Z3XA 3MIEA 4AFBA 1GP4A 1VBB2 2WL1A 2W00A 4L9BA 4FTSA 1FJLA 4IQJA 2UWBA 4YVSC 4GALA 4YFWA 3S15J 1RUF1 2NAZA 1OCPA 3A02A 2Z1DA 1SLLA 1XNBA 3ZSEA 1I6XA 3IAM2 2XJQA 2JB8A 3EUHC 3AKZA 4GXOA 3SCHA 5F7UA 4WM8C 2GP3A 3IDCB 1CESA 4AE2A 2VVFA 1VQPI 3K1NA 1WW4A 3UK9A 4AVZA 1FPN3 2LR8A 3QBQA 4L97A 2HJIA 3AG1H 2JDKA 3RJRA 4LE3A 4MFEA 2DF7A 2GZWA 3HHHA 3CUOA 5J40A 4XLNF 2R7RA 1C0WA 4YIIA 3VZLA 3S1NJ 1TVGA 4M3GA 4QB2A 2LF7A 5I8TA 2JG8C 2D44A 4M9XA 4IXAA 5C7GA 3TO9A 2MC4A 3OBTA 2WNUA 4AIKA 1MACA 2V5DA 3I2JA 5J1XA 4K8FA 3I3DA 3CNAA 5DAXA 2CGOA 4UW6A 4FXGB 2JWTA 2VL8A 3KPHA 2RMU2 1BJZA 3BDDA 1VP6A 4YPJA 3VD7A 2EZIA 2EA7A 5F27A 2PJRB 1JBCA 3I97A 1JU3A 3R60A 4Y1YA 4XCAA 4AEKA 3GVAA 4BKXA 3QPHA 3HRUA 1CAWA 3SHRA 1VQ5I 3M8LA 4YNIA 2VQLA 2J22A 1ZYRF 4MHRA 2BERA 2VH9A 3BGAA 3GUDA 4JVAA 1W7PA 1HQNA 3U37A 5FKKA 3IB3A 4YG6A 2JTVA 2PQSA 3DPLC 1AYN3 1X1AA 4HMZA 1D1CA 1JYNA 1NX9A 3AXDA 4XRSG 5IVFA 2KJCA 1VQ6I 2HPIA 1V9U1 2ZOEB 3LSJA 4YFZA 1S29A 2ZMEC 4E6KG 1YO8A 2R042 4R8HA 2HWF1 3WU1B 1ZNPA 3D4KA 2C5DA 3KZIC 4BA6A 1OKQA 4DNCA 5FY1A 3IRRA 4PF1A 2DYRH 3O1OA 4NRMA 1JUMA 4M3CF 3HOUJ 4J01A 4BXSV 3E5XA 3MDPA 4EZHA 2BY0A 4COZA 1S0EA 2GSYA 4WVWA 4UV9A 2B7EA 5LEJA 2HWE1 5JR3A 1H4HA 2VT2A 2PHRA 1XMKA 2E33A 4I76A 1P7JA 2VQGA 3CZJA 5J3UA 5K8SA 2ZXWH 4DPNA 4QIWN 4F3JA 2G4IA 4D7NA 1PO23 1OF4A 1PNGA 2ZMNA 1QQP3 2R93J 1FNZA 2G9ZA 4AVSA 3LE0A 5AFBA 1DZQA 5FPAA 2HWC2 3GZAA 2CRGA 4YIRX 1V6MA 5JLWA 1UY0A 4HN1A 5C9AC 2IVMA 1R5GA 1VB2A 4QQPA 4AFMA 3ZFEB 1EF4A 4CCCA 3HRTA 3HOTA 3ORJA 3KP2A 1QY4A 5J8CA 2M1BA 1RJ7A 3AB0A 1UU4A 3IBMA 4M4PA 2COBA 2E2JJ 4JGZB 1XMAA 3VBOA 2HWB2 2EV5A 2BOIA 4R4ZA 4L92A 3HT2A 1WD3A 1ZBE1 1W9TA 1X8MA 3NNGA 2XLGA 1PP8F 3FBNB 3LQRA 3T8TA 1IPKA 2JDAA 2KZVA 2MNGA 4OCTA 4HQEA 4LOSA 5IK8A 5L73A 2BW8A 3Q3SA 3U2RA 1LRHA 3QOEA 2K86A 3CF6E 4CCLA 3JRBA 1D4M3 2A71A 1UZVA 4FP2A 5F04A 1WCUA 4XLPF 2VQTA 3U75A 4U7DA 1CF7A 1HDDC 2HVSA 1ENQA 4XBFA 3I58A 5C9AA 1BM9A 2GALA 1EH7A 5D6FA 1ALYA 2VOPA 4L18B 2E32A 3CJIA 2ZFUA 2JG9A 3DCFA 2KRCA 3P9IA 2LK2A 3JD72 1GZCA 1TQMA 3C2UA 3FLPA 4M3CA 2Q8OA 5EF6A 4WVZA 2D45A 4BAYA 2ENRA 4MGRA 2R7EB 2BEOA 2VU9A 3ZXLA 5FDBA 4KISA 3C7OA 2VE9A 2M3AA 1REEA 2VXJA 1XNAA 3GJBA 4IVNA 3J7LA 4PI0A 4OU0A 1BEV1 2W1WA 1YQ8A 5BNQA 4R9DA 1MSFC 1RPWA 3TO7A 4OAZA 3B6CA 4IF4A 1BBT3 4NPMA 1VBD1 1U9OA 2CUZA 4RR3A 1C57A 5FZKA 2YS9A 1WJCA 1IG0A 4M9ZA 1WMFA 3KM5A 2ZHLA 2XROA 3LFMA 3M3CA 2JD9A 3ZYRA 4YM2A 3FXKA 4RR3B 4KH9A 2YU1A 2EJRA 1GNHA 1IG7A 4XQFA 2O1QA 2VM9A 1H9TA 3QACA 1DQUA 1HC8A 2BWAA 2GNMA 1P92A 2RM21 3QLQA 2QCOA 2UYAA 2P1BA 3POGA 1R1TA 3WTVC 4TV7A 5FPZA 4FBFA 2QUOA 2DK5A 2Y0SA 3GX4X 3KF5A 2UZKA 2F5FA 4F55A 2EZKA 2IS4A 2WTEA 1Y9MA 2WYFA 1AWCA 3TMOA 3JTGA 5FRAA 5JXGA 4GKXA 2VE8A 3REOA 4NVPA 1QPMA 3ABKH 3WG1A 1V5FA 3OSFA 3S0MA 3LGRA 1B35B 4XLAA 1TNFA 2VMGA 3ZN1A 5FFZA 1O5LA 2YU9J 4AVCA 4A45A 2A1XA 5A6XA 3UV9A 3DKXA 3HD8B 5E88A 5FZDA 1OA2A 3M1EA 2R30A 2WC2A 5JOYA 4B8XA 2CGPA 4IUGA 1A6QA 5GAHJ 2G19A 2DCEA 3ZM8A 1S2EA 1CQTA 4XOTA 2OW4A 3L2WA 1D0XA 1HW5A 5EHDA 4CPBA 3I8TA 4JKMA 4UFJA 1O3SA 1K5MA 1R083 1NKGA 3WTTC 5CFDA 2DO7A 1R082 3DV8A 2GH2A 4OZXA 3FXOA 1DZTA 2ZGPA 4CA0A 3TAYA 4CA9A 3PFYA 5L7OC 4RFRB 2JA7J 1IAWA 1W9YA 1AXKA 4ZS3A 3L7WA 4UW4A 4DB5A 2R1BA 1FMD2 4XBQA 2DBNA 4D94A 1VB4A 1R6RA 1P8JA 1IN7A 2K40A 3NQOA 2J1UA 1Y7BA 1TWAJ 4IEQA 5KK1A 4FI9A 4QAWA 5KAFC 1BVP1 5BNPB 1IRXA 1VQKI 4P9YA 2DU0A 4KT5C 2CGNA 3O1TA 2W24A 2ZX1A 2C4XA 1XB9A 5LRSA 2UURA 2VMIA 1N1TA 1NY71 5F39A 1SVLA 5F8PA 2V5YA 1SFEA 2NYYA 4E2QA 2XV4S 4BJ5C 3ZMZA 1IXRC 2RS51 4KU7A 2A3WA 4I2OA 2Z79A 4AI8A 2KMUA 4QB6A 3PVEA 1OQDA 4E7HA 3WGGA 1BIBA 3CD6I 2CMPA 3D5SC 2VE1A 1PGSA 2VW2A 5BNOA 3LD8A 3PURA 4JV4A 4Q4W1 3JB4C 1RNLA 1JJ6C 1QJY2 5HS8A 1T33A 4D3WA 4GMP0 3WXPA 1E5SA 5A3OA 2YMZA 2PJPA 2P5VA 4KGGA 2P5BA 1PVC1 2B9UA 4PJJA 2GMMA 3NV4A 3VUOA 5BY5A 4LJHA 3FHZA 1YRNB 5DN2A 4ASNA 3G1LA 3MIHA 2CU7A 5LY2A 1L3LA 4QX7A 2EA4A 3AP4A 5LBBA 4B29A 3IH2A 3KP6A 1PGL1 2XVGA 1AL21 1GKBA 1SLBA 3MKYB 5M5WJ 4RYDA 2HEVF 3HQUA 5IAVA 4YLZA 2DI3A 4C9YA 6PAXA 3HB9A 4URAA 2JUCA 1J59A 1W5TA 3V0AB 5ANNA 1X9TA 4QU1A 3FF5A 5FRNA 3HBLA 4WXDA 4KDPA 1UHSA 2V4JC 4O5VA 4H7MA 1IV8A 2GBYA 3RKWA 4UB8C 5L9VA 3PM1A 2QEXI 2STTA 1S0IA 4HKLA 4R4XA 1KONA 2JVGA 1U5YA 3WNXA 2BBVA 4MXWB 3A22A 4A3IJ 2DJNA 1TZLA 4EJTA 3BPSA 3NJZA 1SMVA 2W3JA 2BV6A 3VBUC 4RR3C 4UXAA 1O7LA 1RUG1 3CU7A 3KP5A 1FIAA 3GBFA 3M3IA 2WV1A 3HBKA 4JYKA 3H0DA 2F4IA 4IW3A 2QM3A 1ODMA 5CKNA 1TG7A 1AZDA 2L02A 2OC6A 3OWTA 3VDDC 2X6YA 4LLNA 4IOAF 1PYVA 3WP3A 1HLVA 2RS13 2HWE3 2C9KA 5SV5A 3Q8EA 3SFIA 3CJIB 2GOXB 2O8KA 1B9MA 1DDNA 3Q0UA 2Q8CA 1H9GA 4D7TA 4IEJA 4CUBA 3TQNA 3FWEA 3LAGA 1QXRA 3WOGA 1HJFA 2WV0A 3L2HA 4CDGA 2VGDA 4N7IA 5DCMB 2CV6A 2IBDA 2W1OA 4A3JJ 4YW3A 1CAVA 4V2GA 1XCVA 1XU2A 2CW7A 2UWAA 4OHZA 3K69A 5DCMA 4CHUA 2MD0A 5KXBA 3ZVXA 2GOMA 4YRVA 4YW2A 3OUJA 2EXIA 4UYBA 2NVUB 1DGLA 5LA2A 5EV7A 2D43A 1PO13 1R64A 2XHNA 5C8CB 2FEZA 1FYMA 1YQ5A 3S14J 2FA5A 3A1YA 5FD6A 2P3JA 3GCXA 3T08A 5ACA2 3ZKYA 3POJA 2QENA 1MBHA 2CUFA 2EFQA 2KIMA 1K5MC 2DA1A 5C8CA 2XR4A 4LPLA 4UB6C 3RFRA 3ZQLA 3FBIB 3T8RA 3IIAA 3R0JA 1PMIA 2W1QA 3VYUB 4NE9A 2UV1A 5BV6A 2LSOA 4MYEA 2RKHA 3G7DA 1BI0A 3VBSB 1ZARA 1ULYA 1LEAA 1X4PA 4Y1ZA 3P6BA 4HBNA 5FMOL 4G94A 3J7YJ 4KNYA 3FUQA 2VECA 4QX3A 4KWKA 3F22A 4OHWA 5BPXA 1YHQI 2DYSH 1S0FA 2BNMA 4TSVA 4P00B 1HA8A 3AZZA 2F5DA 3BYWA 4MGZE 4CZCA 4XUQA 2ORXA 2B63J 5F0CA 2D3RA 3LCPA 4IHYA 2RS52 4Q29A 3T30A 1BC8C 5GZDA 4YZ3A 3FK7A 1NY72 4E2GA 3TP0A 1RINA 5DZFA 3HT1A 1K45A 4C1WA 4BL0B 4UW3A 2R072 4W1UA 3C7EA 2RDNA 3SZTA 1ZG1A 1Q3EA 2WA3A 4EN8B 3D82A 1E3PA 1MMDA 2FF4A 2QF7A 4L0YB 4M3BA 5JZGB 4LK1F 2HLEA 3J7AY 2Z2SB 3POBA 3GHNA 3EJKA 4TLFA 4Y4YA 3KS7A 2X1EA 4WF2A 4LLLA 5J7MA 3ZXGA 1WJAA 4DYRA 4XKVA 1E17A 1N25A 1UYPA 3FC0A 5DPNA 5F3EA 4OIQF 3HEIA 4EWEA 3M70A 4OMYA 1AUYA 5E1XA 4XN3A 5F9TA 1CZVA 5GPAA 2WO3A 4PQQA 3GXOA 2X6XA 1GOFA 2ID4A 3WX5A 2L9VA 3IAS2 3POIA 2X4HA 4UNOA 1KQ8A 4XKBA 2DTZA 5IVJA 5D8AB 3W2AA 4E8DA 4J6GA 5EEHA 5A1FA 4UF0A 2LY2A 1KQ9A 1V4RA 2KRFA 3MF9A 5E1RA 3G3ZA 1RUI2 5L3CA 3ZO0B 3ACGA 5K4LA 1C8NA 4P96A 2WZ8A 2Q8EA 2A5WA 4UVCA 5FLMJ 1OR7A 2W52A 1H1IA 2A68F 3OCPA 1NG7A 2YFZA 3OBAA 3PSIA 1MR5A 2WWYA 1XYOA 3POWA 2KL4A 3D5RC 5T54A 4IKFA 3G2BA 5A32A 1GQPA 1LEDA 1VRH2 1WKYA 1Y39A 3TKYA 4XMAA 4CU8A 3LOCA 2YX7A 1Y43B 4GULA 4SBVA 1JKRC 4FQ4A 3FXRA 1NA1A 1W9FA 3HM5A 5LA1A 1WBLA 3MKLA 2HWVA 1RHI2 4CDQB 2IFWA 5GZFA 4PUSA 4BOWA 1A31A 2RM23 4YG0A 1N75A 2DA2A 3I2DA 2ZA9A 1O7FA 1JUSA 2EIGA 1XC6A 3OR2C 2J1RA 4AL9A 2L2OA 1D4M2 3N7MA 3GZ5A 4NDLA 4BQ5A 2EILH 5LHHA 1K61A 1R4MB 5H6RA 3DXUA 1WFXA 2WAEA 2IC1A 2Q8DA 5JCTA 1AA7A 4LFUA 5C3SA 3EETA 3JBG2 5A6ZA 2E35A 4C2UA 3O1RA 3PUIA 3OS1A 3V0AA 2Y26A 5JSRA 5ABJB 4KG8A 2HWB3 3I2IA 4ZTJA 4ENKA 2K02A 2ZGQA 4LIVA 4NIIA 2J1EA 4F7ZA 3AP9A 5FLXZ 5JVVA 3MLJA 4G7HF 1RXFA 2J5PA 2M9HA 3H9QA 4E7LA 5F0HA 4XICA 5ILVA 1FOWA 2IXJA 1MVEA 4KMFA 1ULPA 1YW7A 1XGMA 4Y26A 3IH3A 3GZNB 2GIZA 2TRTA 1FBSA 1UW8A 1XE0A 2DVAA 1MS5A 3VBHC 3ST7A 1OVPA 2HPMA 4ENJA 4A44A 5JR7B 4CUAA 1G6NA 1LHUA 3M3OA 2FD8A 3JD71 3D0SA 3L00A 4XKCA 1LHVA 1LULA 5JXIA 4CP9A 2CQNA 1UPSA 1RUC3 2ZX4A 4LLOA 3ZFEC 2IA2A 4B44A 4A69C 1KD7A 1ASJ1 3HXLA 2B42B 1TLHB 3BTLA 5LHGA 3E6DA 1K7AA 2RNGA 2EBIA 3RI9A 1CAWB 1UZWA 1JYWA 3HAGA 3CESA 1PIV3 2CAVA 5FO8B 4C3HJ 3O12A 3HOVJ 4FFIA 1YYNA 2R5ZA 2M8EA 5A3UA 4KL1A 1SPPB 1ULCA 4BISA 4CXFA 2DBIA 4LMFA 5LBCA 1FBQA 3MLKA 1J83A 2D7FA 5IVBA 1ZRFA 2IJLA 1XGSA 2GP5A 1S7EA 3ZRGA 3NMBA 2D5FA 1IRFA 2I45A 3T1MA 4PCRA 3U1DA 2RREA 2E51A 3O6BB 4HX8A 4LOCA 4F3QA 1G9FA 5F1RA 2Z16A 3S93A 5CPRB 3BR0A 3N05A 1UPIA 2JRTA 4GJZA 2HQ5A 3F8FA 3FISA 3C2BA 4YVSA 4QLCU 3J7HA 1XD7A 2ETHA 2B46X 2DCTA 3C3VA