4R8HA

The role of protein-ligand contacts in allosteric regulation of the escherichia coli catabolite activator protein
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-activated global transcriptional regulator CRP
publication title The Role of Protein-Ligand Contacts in Allosteric Regulation of the Escherichia coli Catabolite Activator Protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 60
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4r8hA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4r8hA01
5K5RA 3M8EA 2MPFA 1QPMA 1LR5A 4MGIE 1Z6RA 3HYIA 4BAYA 2EA7A 2YPRA 4HX4A 2B5HA 5CVJA 4LTAA 2IW5A 2VE9A 4LEJA 1OD5A 1GXPA 2PA7A 5JVTA 4MGKE 3WG9A 5J48A 4HQMA 2HYGD 2VC0A 3H1YA 1ZLJA 2OYZA 3FZ3A 4OIOF 1W5SA 3DKWA 4N9IA 3DN7A 1G4DA 1O57A 3E5UA 5HDKA 5JI6A 1L3JA 3HTSB 2BGCA 1RUNA 2PG4A 2LF8A 1NXMA 1YFUA 5KHKA 2H6CA 4GGGA 3C18A 5HLHA 4QLCU 3QP6A 4ESFA 1YS6A 4LGWA 2IXCA 4QXKA 1XMAA 2FBIA 3CJNA 1BC7C 3HHGA 2HFHA 1IXRC 1YW9A 3MZHA 3F6OA 2QBYB 4OFGA 2O1QA 1TTYA 4AWXB 4LJZF 1BIAA 4UXNA 2P6SA 4LG0B 2XLFA 2NS0A 3V8LA 1HKTA 2QM3A 1R22A 4UUVA 3ROUA 2H27A 4HBLA 5E1ZB 1EV7A 4IEWA 3NL1A 4G9YA 3JTGA 1FY7A 2XVCA 2DBBA 2XGXA 3KGZA 2K4JA 4QGNA 4IEZA 4JVAA 3D5LA 5EZWA 4PZJA 2GIVA 3RZZA 1J75A 1CF7B 3NRVA 1JE8A 2L3DA 1K78B 2HGCA 1PMIA 4UVBA 4S05A 2FA5A 3T8TA 2A07F 1S29A 1FC3A 1FYMA 4YIFA 4RS8A 3IHUA 1KQ0A 3FMRA 3L00A 5FDBA 2ACJA 1QWRA 4KWKA 1S7OA 5ED4A 4LMYA 3CL1A 3VFZA 3CO6C 4IEUA 2P8TA 3BJAA 4NHJA 4RB0A 1Q1HA 5D5UB 1YFXA 1SD6A 3TDZC 3KSCA 2P6TA 3JW4A 1SQ4A 3CTAA 2IVMA 3NJZA 3SZTA 2D1VA 2Z9OA 4LK1F 4Q0VA 1ZARA 2DAOA 2QQAA 4Q0UA 2QCSB 1B4AA 3GFMA 1LQ1A 5EEHA 2IT0A 1PP8F 2IA0A 4M9ZA 3JAMK 2N7GA 3R60A 4DQ2A 1Q5OA 2D1HA 3ETQA 2ESNA 4FT8A 1HW5A 4M6YA 4WK8F 2HKOA 2YX7A 1U2WA 1QZYA 3B73A 4O5VA 4AIHA 5BPIA 4AVCA 3VEPA 1P2FA 1X3UA 1KA8A 2ZNYA 4I3PA 2KXLA 5C6CA 4YFNF 1FZPB 5I8SA 3D0JA 4HN0A 1R5GA 2O0YA 4XFIA 2VBZA 1D8JA 1HBXG 2PEXA 5KK1A 4OMYA 5ICGA 1PUEE 3G3ZA 2O8XA 3CLOA 1CAXA 1EYBA 2MA3A 3DEUA 4KIBA 4XF9A 3LA2A 1EH8A 1DUXC 4BNCA 2F5DA 1X8EA 1BC8C 2K7LA 5I0RA 3ECHA 3O2PE 3EO6A 4KL1A 4KYWA 2GXGA 3SHFA 2DW4A 1O4TA 1SFNA 4HVRA 3JSOA 4IJAA 1ZVFA 2CYYA 2M30A 1GHCA 3WTTC 3WTXC 3I64A 4YRDA 4MQ9F 5IT9K 3ES4A 1L0OC 4O9GA 2FOKA 2RQPA 2FXAA 3O3KA 2EV0A 4WWCA 4A0YA 4ZH4F 2E1NA 4TV7A 1DPRA 1P4XA 3ZMTA 5FD5A 4IEYA 3GF2A 4A5MA 3OGJA 2EFQA 1LNWA 2L54A 3ZMVA 4HLYA 4KMUX 2LNBA 4J1WA 5CYVA 1C0WA 2D5HA 4A0ZA 5FQ0A 2HTSA 2XAGA 3HT2A 3GYDA 3FX3A 3T8RA 4WF2A 4EMSA 3BROA 4EJVA 2DPDA 1DGWA 1DZTA 2VOOA 3LWFA 3S7IA 2EFNA 2JPBA 2UWMA 1ONVA 5LBQA 2JTVA 3TGNA 2BBYA 1G6NA 1W7PB 3L09A 3IL2A 2W24A 4HA8A 1MJ9A 4UXAA 5KHHA 2XRNA 2ZKLA 2XIGA 4NQWA 2QYOA 3BALA 3MQ0A 2ETHA 4D7TA 1FP2A 1U5TA 4KIFA 1XCVA 3EETA 4U0YA 1YFHA 2Z2SB 2HR3A 2GH2A 5E17F 1TQIA 3DPLC 3UKNA 1J0RA 2XAHA 3P7NA 2PMUA 1XGMA 1J5YA 1VP6A 1BJAA 4KICA 2IP2A 1TBXA 4P9FA 3LA3A 5K1YA 4XF0A 3M7GA 3NQOA 5LGTA 1PP7U 5D8KB 3CDHA 4Q0PA 4PIZA 3U10A 1ZRDA 3KE2A 2CWEA 3COAC 4RAZA 2JRTA 4FHTA 2HQNA 3CLPA 1Z05A 4ZYGA 3IKVA 3BPXA 3T1BA 3L2HA 5HOOA 1J1LA 1ZG5A 1E17A 2E7WA 4LB5A 1ZX5A 4IEOA 2OBPA 2QVOA 4H7LA 1HSTA 2A3SA 3P9KA 1P92A 5HLGA 1DDNA 2NNYA 4BHPA 2PMHA 2PI0A 1VJ2A 2MBFA 3LZZA 1BI2A 3RYPA 3GFLA 4KUMA 4IEQA 5D6FA 4FX4A 1NE6A 3F72A 3WU1B 1IXCA 4G94A 2H09A 4G8XA 4Y15A 2WFPA 5DD8A 4IRGA 3IC7A 3WTVC 2Z33A 3ZN0A 1KU3A 4E70A 4YFXF 4I09A 1LJ9A 1HKSA 4HOBA 3NKTA 2XAQA 3RNSA 3V7SA 2DLLA 2RVCA 4RGRA 4ENNA 1H9TA 4BQAA 1Q3EA 4R79A 4WBBA 5EFUA 3GLXA 2KRFA 3F3XA 4LD5A 4YYOA 3GVAA 3S0MA 3VODA 1YUDA 3O14A 4MGZE 2ZMEA 3GYHX 2VPVA 4O3MA 3MFKA 3M8FA 1YFYA 3S7EA 1HXDA 2BYVE 5E18F 3KGLA 2OZUA 3KP5A 1HW1A 4KNYA 1ZRRA 5HLIA 4RGXA 1ZH5A 4L0ZB 2RV8A 2GC2A 5DYMA 2QLZA 1XSVA 4XF3A 2IXHA 2V79A 3QPHA 3WODF 2NNNA 1V4RA 4PIXA 2GA1A 4XLNF 3GO5A 4JBAA 3TO7A 1J59A 4CDGA 3NVCA 2V9VA 2CG4A 4Q0SA 3J80Z 4AVBA 1QY4A 1ON1A 3R0JA 5I93A 3WTYC 4S04A 3BZ6A 4O9EA 1OI6A 2ATFA 4IEPA 5FLXK 1UW8A 2WC2A 2MHFA 2AXLA 2GC0A 2XHKA 2J5PA 1KGSA 3QOPA 5F64A 4EVIA 1Q43A 2PFWA 1OFNA 1O3QA 5LGUA 2HDCA 3CUOA 3I59A 3RKYA 4QGLA 3EQLF 1X82A 1FBUA 1RNLA 2P7CB 2W84A 2XLAA 2UXXA 5BPDA 4HVOA 5K5OA 1BIBA 5I91A 2ZJ2A 1SMYF 2CSOA 2HZTA 4WCGA 2XLGA 2DT5A 3HRTA 1J7KA 2ZBKA 4EJOA 4Q48A 1XB4A 1SFXA 2QENA 4ZU4A 4I01A 4P5OA 2KIMA 2ELHA 3O6BB 1J2XA 1T98A 3DV8A 1R7JA 3WTSC 3IDCB 4QM9A 2QNKA 5IT9Z 2EAAA 1UB9A 2ZXJA 2O61A 4Z07A 4A5NA 1FYKA 1KQ9A 1JUHA 3VB2A 2BE5F 4UVAA 1DGRA 2AS5F 2Y0MA 2EB7A 5FQ0B 3TNPB 4E2QA 4IESA 2IJLA 3GFJA 3ML6A 3E3VA 4MX3A 3DF8A 1QO0D 2G7HA 1R23A 5I8YA 2ETEA 3MZYA 2UY8A 4Q47A 3FXRA 3RKWA 2GWRA 2PAMA 4M71A 1J3RA 3J81K 1ZREA 2IC1A 3IIAA 2UYBA 3OV8A 4MH0E 3CUQA 2DU9A 2ZNZA 2XL7A 4Q0QA 4G7ZF 2DQLA 4KDPA 1ZN2A 1TQMA 1U5TB 3ELKA 3C7JA 2MLKA 3M1EA 3F8MA 4I0AA 2VODA 1LRHA 1FT9A 4FX0A 4FAHA 3HHHA 2Q0OA 4GO1A 1ZZ6A 5DCMA 2PQQA 1UCRA 3DFGA 2D40A 2ISYA 4MUVA 5FO5A 4I98B 4TLFA 3K1MA 4G6QA 1WLTA 2Q1ZB 1PDNC 3K1NA 1QZZA 4DINB 5K8SA 2IA1A 3WGGA 1TNTA 1IRFA 2O03A 2BNMA 3T0YA 4XSXF 1MDMB 5CADA 3F22A 3LWCA 1XE7A 2L4AA 4LUKA 1XDUA 3OTFA 1ZAOA 2CGPA 5ICFA 4RGSA 3GZ6A 2ADUA 4PJYA 3HT1A 3KLOA 1IN5A 4OMZA 4ZYEA 4L18B 3J7AO 1IUYA 5LRSA 1KQ8A 4AVPA 4XFAA 3RIRA 5H6QA 4L9NA 1R1TA 3HSRA 2PLYA 5DDGA 5JSPA 4R8HA 4RAYA 3WU0A 4A2UA 1QXJA 3RYRA 1YWKA 4UHTA 1NHAA 4U0WA 2OZ6A 4JTNA 4YIIA 2GA2A 5DCFA 4K8FA 1TNSA 3F8FA 1KYZA 4OIQF 3REOA 5JR3A 4J1XA 2F5EA 1CAUB 1W4MA 2A6EF 3HRUA 5J8FA 2BEOA 3H50A 2FQ3A 4LULA 2VQAA 5L3EA 3ZN1A 4U88A 1RGSA 4XRFA 2WV0A 4MTEA 2GZWA 2B9UA 4A6DA 1WKMA 1B59A 1EY2A 1MKMA 5FLJA 4KIGA 4EM2A 3UKTA 3R4KA 1XD7A 2ZFWA 3E6MA 4L9VA 2VE8A 2Q4SA 3WGIA 1JGSA 3SXWA 2D93A 3ACLA 4P9UA 4ESJA 3HSFA 4BXUA 1ZZBA 1RTVA 5FFXA 4ON0A 4HF0A 5LHIA 3ABUA 3GX4X 4HZFA 3I53A 1IPKA 3JZVA 3GWZA 3DPTA 4UBHA 2HQRA 2KIFA 4B29A 2GQQA 2F5CA 2STTA 3TOBA 1S3JA 2DO7A 3LSTA 4GXOA 1U8RA 1LDJA 1QNTA 3EUHA 3FWEA 3RJPA 5E1WA 4QWQA 2EJRA 1XDSA 4XFGA 1XRUA 2RN7A 3RPUA 5L3GA 4LLNA 1OR7A 5E8IA 4HBNA 5FLHA 5T3NA 1CGPA 3N97A 1LEBA 4HYEA 4BHBA 1A04A 4ENJA 3SCFA 1IAWA 4Z2YA 3ZP5A 2FU4A 5AVPA 3WGHA 2Y0OA 3LQRA 1YG2A 2O8QA 4U0VA 1S7AA 3T5XA 1XMKA 1U3EM 4M73A 3C3WA 5L3BA 5ILUA 1W7PD 2ZO4A 2Z5UA 1CAWA 4XFBA 1ON2A 5KBFA 1BOAA 1TLHB 4MZUA 2XV4S 1SMTA 3WW2A 2A68F 4CHUA 3V8JA 1X8MA 1LKNA 4WXCA 4HW0A 3HTUA 1ZGJA 4WX9A 4IVNA 5DD4A 5H6RA 1R5HA 1LDDA 4LLGF 5HS7A 1G3WA 2PQ8A 2L01A 1FNNA 4AD9A 5ILSA 3N4MA 4EM0B 2BV6A 3LOIA 1WWXA 5I0SA 2FSWA 2DCTA 2CQKA 1UD1A 5E1RA 1DP7P 2ZKZA 3TDUC 3IDBB 1XN7A 5D4RA 4HF2A 4NB5A 2YX4A 1MZBA 3FF5A 4R1HA 5LRRA 3S2WA 4L5IA 3CUQB 1XSDA 5FPZA 3KEQA 3IWFA 2DK5A 1O7LA 2V1XA 2COMA 3GEZA 1D5VA 2FNAA 4M9SA 3E6CC 3ELNA 4HMZA 4XF1A 2VC1A 4E2SA 3AAFA 1YLFA 2LF7A 4EJTA 5EEGA 1IPJA 4EGZA 3D82A 2QUFA 4QX5A 3Q9VA 1SD7A 2M87A 1CAVA 5JCTA 4L5JA 3BPVA 4O6JA 4P96A 3QPTA 1JHFA 4MGYE 4WXDA 3WW3A 3GXOA 5D4SA 2CV6A 3CF6E 3DL3A 2MD5A 3BCWA 3BPZA 4AQ2A 1I6XA 3WE2A 1KU2A 3E97A 5JFRA 5CJ9A 3I58A 1IN7A 4UVCA 4XBFA 5BPXA 2EK5A 1MJBA 5HS8A 3TO9A 4MEYF 1W5TA 5FB2A 2Q8KA 4ENKA 2IXJA 2UXNA 4OINF 1VTNC 1K6OA 3PNAA 2RNJA 2EA4A 3KMHA 4ZU5A 3KCCA 3GUDA 4MGRA 4L0YB 3BOQA 4MHGA 1HQCA 3Q5FA 3FHZA 2L02A 3V7RA 2FNPA 4YSFA 1R58A 3BY6A 2OA4A 5CLSA 3H3UA 4JQFA 3HUGA 3IBMA 5DUKA 1X7NA 5BS6A 3K9TA 2Y48A 1LEAA 3I71A 3BWGA 2XASA 3WTZA 1E2XA 3SHRA 4H0EA 3K69A 1EPZA 1G3SA 3IKTA 2QBYA 4PDKA 5D5XB 4HSLA 1RUOA 1EH7A 1KU9A 2RGVA 2QJVA 2FF4A 1AOYA 4LG0A 2XL9A 3DXJF 3R0AA 3LAGA 3SCHA 4L11A 3Q9SA 1FI2A 2I45A 5I8TA 2BNOA 1AWCA 4M72A 5CU1A 3ZPLA 2MH2A 2XUBA 4Q5SF 1V70A 2Z69A 1IRGA 2EFOA 5TJJA 3ZQ7A 1SEFA 1UPIA 3BP8A 4EROA 1CF7A 2YSRA 4ETSA 4OIRF 1GQHA 4PIYA 4U7DA 5AIPA 3BU7A 3SFZA 1YTYA 1TQPA 2JSCA 5FGMA 3PQKA 4EWEA 4BHCA 1ZGAA 2PAKA 4YNIA 3PFIA 3K1PA 3OF1A 4ONUA 4HQEA 3ZMDA 1XGOA 4CGZA 4L2NA 3KLNA 2P5KA 5DV5A 2A6HF 4RGUA 2P4WA 1BI3A 1B6AA 5LLQA 4IEVA 3CJXA 3FZVA 3SMHA 4Y17A 2G7UA 3RTRA 5FLIA 1FSEA 1SD5A 2E7XA 1WGPA 1K79A 5KHGA 4HV5A 3R6SA 1XE8A 3ZDSA 5FFZA 2NRAC 3JAMZ 5CVUA 5KHJA 1DPUA 3GW2A 2VONA 2E9QA 3RPQA 4ZYHA 1WSUA 2Y75A 1CAXB 2M1BA 2QQ9A 5JAXA 3EYIA 1RL3A 2QDRA 4D7SA 2MH9A 1R1UA 1U78A 1O3RA 5ICCA 5I0TA 1BM9A 4UNOA 1BN5A 2C6YA 2MNGA 3RYKA 4LB6B 3ABTA 4EJWA 4HLTA 2OQRA 4FBFA 5FD6A 3BDDA 4DNCA 2V09A 1T6SA 1IZ1A 4KN4X 3HSEA 2O3FA 2EA2A 1SFUA 3USSA 1CAWB 5CVIA 1FOKA 3SQNA 3U2RA 5LHHA 2PTMA 4E2GA 4HSJA 2RDPA 3C1DA 3KP4A 1FP1D 4GULA 2MLGA 1T0FA 5FCCA 2GXBA 1I5ZA 1T2KA 1DZRA 4L9TA 2HOEA 2V1UA 1ZYRF 4RD7A 1MGTA 1ZHFA 5HVQC 4G7HF 3CO7C 5E20A 2FQPA 2L4MA 1LVAA 2CFXA 3SXYA 3QU3A 2GU9A 4LA3A 3HOSA 4BYYA 5BMZA 4EWAA 1J9IA 4AQ6A 2STWA 3W6JB 3I7DA 2JPCA 4IRIA 2P5LC 1XGNA 2KIUA 3F8BA 4FAGA 2IA2A 2B0LA 3M70A 1IN4A 3DQVC 2XAFA 3FFQA 5H20A 1O5LA 3MPBA 3MWMA 2WWYA 4IETA 1YLLA 2HKXA 4KU8A 3CO2A 1SFEA 5KHIA 2GAUA 1O5UA 5DEQA 4A0XA 3FHIB 4OLLA 2R7DA 1CAVB 4HV6A 5E1XA 4QM8A 1B1BA 4P55A 2H6BA 4BH9A 1Z1DA 1JHHA 1T38A 1OKRA 1USSA 4HLXA 2V6CA 2VN2A 2FBHA 2OPKA 1W7PA 1RZ4A 1UFMA 2FMLA 4G7OF 1UIKA 4P9GA 2VBXA 2A5YB 2RC4A 2XKOA 2FBKA 5I0UA 3C3VA 1BI0A 4XLPF 2PJPA 5D1IA 2QQBA 1CX4A 5BQTA 5JHUA 3FE5A 1V3FA 2CW0F 3ISPA 4KMFA 1K7AA 3SCGA 2DPUA 3HRMA 2BNNA 3KP6A 3ZMZA 4B09A 3R61A 2CAVA 4Y13A 5JR7B 1H1IA 4CXFA 3F21A 4UV9A 1S8NA 4RB2C 2PHDA 5HI0A 5ICEA 1B9MA 1SAXA 5F1RA 1FYLA 3HOTA 1Z9CA 5BUVA 1TW3A 1SD4A 2VBYA 1H0MA 4IHTA 3F8NA 4PGGA 5J3UA 1IW7F 3E6BA 2VT3A 3DP7A 4HDVA 2FRHA 2DK8A 1USTA 3I4PA 1GVJA 4K2EA 2PYTA 3H8UA 2R3SA 5J6XA 3FM3A 3G73A 4OOIA 1LB2A 1U6GA 5C8WA 4L9JA 3H7JA 1R36A 5LGNA 2IXKA 2XKPA 2VECA 2DTRA 2HYFA 3E5XA 2M5WA 4I2OA 2PN6A 4ZZLA 2EV6A 3E5QA 3W6KB 2PBIA 4LK0F 3LA7A 1G3YA 1WRJA 2P5VA 4EJUA 2HWVA 2ZMEB 2UZKA 3EYYA 2JZYA 4AIKA 3LAJA 2DFIA 2VT2A 2V1DA 1OYWA 2KJCA 1EP0A 1H1MA 1I1GA 5A2QK 4OU0A 6PAXA 1ZLKA 4EM1A 4ENMA 4UV8A 1G3TA 2UYAA 4GYIA 2XAJA 2LKPA 3U0ZA 5CVRA 3L9FA 1YIOA 3MDPA 1GQGA 1EH6A 4WZCA 2IXIA 1F9NA 2VXZA 1WA4A 4YFKF 4XEZA 3F23A 1ZZ9A 4XF4A 3OOPA 4XFHA 3H7YA 3L7WA 1NYWA 2B8MA 3HQXA 3KETA 4M74A 3TOAA 3K2ZA 3TKYA 3RKXA 2ESHA 5AIQA 1YHFA 4R52A 2CAUA 3H1WA 3M9AA 2HEOA 1IXSB 3J80K 3VOEA 2KJBA 2K02A 2OQGA 5TRDA 4LLLA 3GBFA 1S6LA 4OIPF 4NVPA 3MCZA 3V4GA 1IF1A 5HS9A 3I59B 2PHLA 1D3YA 3P9CA 1D8KA 2OAZA 4MNUA 2X0LA 3RI4A 1U5TC 2LDUA 3I54A 3ES1A 1O3TA 5FLXZ 1TQ5A 4KWJA 4CZZA 2R7FA 3PVBB 4U7BA 2EV5A 2H94A 2FEZA 2M8EA 1P6RA 4JK1X 2X4HA 2QVSB 2G9WA 2YR2A 3H92A 4IF4A 4META 3KP7A 4WVZA 1ZZ8A 4AVAA 2GC3A 4HAMA 5FPXA 2OA2A 3LQQA 5AONA 2VOPA 5D5WB 2K0GA 4F8AA 3UKVA 1R00A 1ZG3A 3H9AA 4HN1A 4KT5C 1Z91A 3F8CA 3WTWC 2EFWA 1B9NA 4HX8A 2ET1A 3V7CA 4I7HA 1YFWA 4LLOA 3E6DA 2MC3A 3KEOA 2D2WA 4PCQA 3FXQA 2FE3A 2D5FA 2W57A 2HTJA 4KA4A 3MEXA 3M3IA 5JSRA 3IRQA 2P17A 1QQIA 1IN8A 4N0BA 3TO6A 4RB3C 3EHKA 1XSXA 2E1CA 5J7MA 3L2CA 1GXQA 5D6EA 4XSZF 1STZA 1QGPA 1WQ2A 4IRHA 1ULYA 4IXAA 3GFIA 3QRFF 1J3QA 3U9GA 2IXLA 1YW7A 4QGMA 2FMYA 3SZPA 4KU7A 1FBSA 3FXUA 4AIJA 1HW2A 3ZMUA 5DCMB 4LFUA 3J81Z 2ISZA 1QBJA 2DQRA 2K27A 4YARA 4X6QB 5D8LB 2C0ZA 4Q29A 1ZRCA 4LUMA 4XFCA 1HKQA 2DI3A 1YO5C 2A69F 1OPCA 1UIJA 4M6XA 1R1VA 1NZCA 1RC6A 3FJSA 1T39A 1I27A 1FX7A 1U12A 2K4BA 4CYDA 1J58A 1H9GA 2TDXA 3OCPA 1ZZCA 2K9ZA 4RB1A 3QAHA 4JV4A 5BV6A 3B02A 2YU3A 1O3SA 2Z3YA 3NW4A 1TW2A 3BJOA 1ZRFA 2RKHA 1Y9QA 1I1SA 3HRSA 4A12A 4HX7A 4EWDA 2NYXA 4GYGA 2JT1A 2PAEA 5DUIA 5L3FA 1F4KA 5HDGA 4EV0A 2OU2A 3KZZA 5L3CA 3WW4A 1MDMA 2K86A 4IHSA 5ERIA 3NSTA 3PLQA 3I5UA 2Q2EA 3MYXA 4X6RB 4MEXF 1FBQA 3PQJA 1UHWA 5BY5A 1Z7UA 1VR3A 2NAZA 4XFFA 4Q4ZF 2ET7A 3ST7A 4MV2A 4XETA 4CICA 1F5TA 2IPQX 3EDPA 1QXRA 2H0VA 2EVXA 2P7VB 3TQNA 5L3DA 3JSPA 3H1MA 4I02A 5LHGA 1FWZA 5ILVA 1FPQA 4QMAA 2F2EA 3H3ZA 4ORFA 4PGHA 2J5OA 3VHRA 3BJ6A 4JTOA 2QZ8A 4HVQA 4HF1A 1K78A 1CAUA 3RDIA 1WI9A 2ZCWA 2IRFG 1P4WA 3KZYA 1BBYA 4ASNA 4ESBA 1Z6TA 3GZ5A 1LDKB 5BOXA 1ODDA 5E8GA 1HSJA 2VBWA 4N9HA 1PM7A 3FM5A 3KP2A 2OD5A 2HJIA 4ZU7A 3ERED 3IWZA 1YQAA 3OD0A 1XGSA 5BXXA 5A2QZ 2A61A 1Y0UA 3TNQA 3U11A 1RIOH 2WTEA 5K5QA 3K0LA 1YW8A 4M9XA 4Z82A 3P9IA 4G6DA 2F5FA 3D0SA 3FMSA 3QP5A 1UHMA 3QU6A 5LEJA 5IT3A 4KN7X 1KYWA 4A6EA 5CVVA 1MD0A 2EFPA 3CUQC 2GC1A 1UCXA 3MAJA 1REPC 4HDUA 4UBGA 2PFBA 2KKOA 2CO5A 2W85A 4MQVA 3HIFA 3ZMSA 3WTUC 1RI7A 4ZZDA 1O7FA 5J8CA 4MTDA 4IEXA 4D0PA 3LAPA 1OYYA 2LSOA 4EGYA 4LA2A 1OMIA 1XCBA 3EJKA 3FMQA 5KVRA 3V8KA 3WW1A 3KP3A 1KU7A 4IERA 2Q0AA 3CEWA 4EQQA 1JXSA 4ZYDA 2F4PA 5LEKA 3ECOA 3ULQB 5E16A 1L3LA 2D45A 3BB6A 3LFKA 4GCVA 1ZG1A 2Q30A 2EWNA 5D5VB 1BI1A 1YYVA 4KFCA 2Z99A 3G7DA 1FXZA 5HDNA 2OZJA 1FLIA 1ZNPA 2M45A 1NE4A 4I0BA 4CO8A 3F6VA 1Y3TA 2HS5A 2UY9A 4WXHA 2XROA 4B8XA 4BIFA 1J3PA 1YS7A 1MJAA 1OYIA 4F7ZA 1ZZ7A 2QWWA 3EQEA 3I0TA 4KWLA 1IN6A 1F1ZA 3KFWX 3EBRA 3U1DA 3WE3A 1FSHA 4AXOA 5F6FA 5JSOA 2W25A 3QACA 4IPAA 3JTHA 4YG2F 1P4AA 3NEUA 3IRRA 2O6GE
chains in the Genus database with same CATH superfamily
5HODA 5FZ8A 2V4JC 1LR5A 4MO7A 5FZ6A 1Z6RA 3HYIA 2R1DA 4O65A 4BQYA 2YPRA 4GD4A 2IW5A 2VE9A 1GXPA 1FTTA 2PA7A 4C0HA 3BOPA 1BMV1 1CESA 3HJRA 1ZELA 2VC0A 4RMNA 1PVC3 3ZFGA 1AYM1 5FPBA 4NPLA 3GTLJ 2D6MA 2R5ZB 4N9IA 2EF6A 3K70C 1C8M1 2BOIA 4P14A 3ZYBA 5A1FA 2K9LA 5DQ0A 1RUNA 1NXMA 4D0QA 4GGGA 3WCSA 2JA8J 5KC5A 2VZ3A 4Y22B 4LGWA 1NA1B 2Q2EB 4UUSA 1MBFA 3CESA 2QBYB 2XBO2 3ZLIA 1SVOA 1DFQA 1KITA 3LPGA 4FPYA 4Q4W3 4LG0B 1FMD2 4FPKA 1LOEA 3V64A 3I49A 3RQ4A 3GCWA 4LBNA 1R22A 2V4VA 1VALA 4UUVA 1OLRA 3ROUA 1PVC1 1PVEA 4HBLA 3CC2I 5E1ZB 2OW4A 1IHMA 2HWD1 2LROA 4DXTA 4CEWC 2K4JA 4JVAA 1ENHA 4GFBA 3UK9A 3JB8A 3N7KA 1CX1A 1APNA 4RGGA 2PMWB 3NAPA 2A07F 4QX3A 1W6NA 4HETA 5A3WA 1SANA 1FYMA 4YIFA 4QPGA 3IHUA 3DTEA 3JREA 3PO3J 3L00A 3BI3A 4UOJA 2ACJA 4KISA 5D8AB 1H8AC 4LO8A 2ZJPF 3ZN6B 1S7OA 3W3CA 1AR72 3IM0A 4Q4W1 2D6NA 2FDJA 2XVGA 2VJJA 2QQVA 3I2IA 5FRAA 3OR1C 1Q1HA 2QCOA 5D5UB 2RR13 3OMYA 4XNFA 1JKOC 4RN5A 2P3JA 4MO3M 1RESA 4LK1F 4XMIA 4Q0VA 5A32B 1ZARA 2QQAA 3S16J 3PIPF 1LQ1A 5EEHA 1PP8F 1PVXA 3V0BA 4CP0A 2DYCA 1JJ8C 2W4SA 3TWIA 2LG4A 1K5MC 4M9ZA 2N7GA 3R60A 1NX9A 3OWTA 1X36A 3MUY1 2GSYA 2JIGA 1SG3A 2ESNA 4KITB 2QA4I 4M6YA 1JI8A 1I3AA 1P9QC 1U2WA 1QZYA 2XDVA 3WF0A 2JE8A 3VEPA 4BY1J 1KA8A 1IRZA 4I3PA 4YFNF 1FZPB 1H0BA 5I8SA 3WNXA 3PSFA 5ICGA 2M4GA 3CCLI 3TL4X 2TRTA 4BLJA 1QJU3 2E2IJ 3CLOA 1CAXA 1I3QJ 2L9LA 2RR11 3LA2A 5GZCA 3KQRA 2KRCA 4R9CA 3GTQJ 3C8XA 4I0WB 1OPMA 3OOXA 3EO6A 2R072 4AFDA 1WHUA 1WKYA 1X58A 3KX2A 3U4XA 2CUEA 1GHCA 4RA0A 1VZ0A 4MQ9F 4R9BA 2AXTC 5IT9K 1LHNA 3CD6I 5C3RA 3WINE 1YRNB 2RQPA 1XJAA 4CEYB 2VUCA 1I3HA 3QPLA 1XSQA 3OEAA 3SEPA 4ZH4F 1NA1C 3GTOJ 4TV7A 2ZHLA 5FD5A 1K45A 1QJU1 2NVQJ 3AKPA 4HLYA 2FCUA 4KMUX 4J1WA 1APLC 2E71A 1AYN3 3HNBM 3AL6A 1C0WA 1OUXA 3I97A 5GM0A 2BXZA 1XS9A 2BVMA 2DPDA 2YGMA 1AL21 2EIMH 1TME3 2VZOA 4RAGA 2D5VA 1R1A3 5CQEA 3IL2A 2PHUA 5FP7A 4JAAA 5DDJ1 2HI3A 4UXAA 3ZSLA 4RFT0 1PIV3 2XIGA 4NQWA 4XN3A 4M3FA 2ETHA 4II2A 1ETYA 2JRMA 4D7TA 1FP2A 1U5TA 4NN0A 1HDKA 2BBVA 3KVAA 4GWJA 5IK8A 4U0YA 2C4XA 2F17A 2Z2SB 4AFAA 1MBHA 1JH5A 1AYN1 2V9PA 5FTTC 4Z1VA 2XAHA 3BTLA 2PMUA 1XGMA 1J5YA 1VP6A 5GJ6A 1BJAA 2E2HJ 2MEV1 1TBXA 4P9FA 1HLCA 3GGLA 5K1YA 2VTFA 3M7GA 3K70D 2M4KA 4XC9A 1TME1 4JGZB 1UWWA 3COAC 3SKVA 4BQWA 4II3A 2K40A 1NH3A 4ZYGA 5EYYA 4GWMA 1PIV1 4LKDA 5HOOA 1G8XA 1ZG5A 5K7FA 2QSHX 1LGBA 3J7HA 3NNLA 1VBE3 3CC7I 4LB5A 2YPJA 1K4SA 4A3GJ 2ERFA 4OHXA 1EPWA 2OBPA 4MXWB 5FP9A 5L7OC 2Y60A 1F43A 3LCPA 2WWUA 1P92A 3D5OA 4HANA 3M3QA 2XC7A 1X1AA 3FKJA 2F48A 4LBMA 4X8PA 5F3GA 1BI2A 5JVGF 3GFLA 2GNMA 1C57A 5FXWA 4UFIA 1AXKA 1KRIA 3F72A 3WU1B 5LK5A 5DABA 1UU5A 2OIIA 2WFPA 4Y20B 5LWBA 2Z33A 4MLOA 1WJAA 2DOEA 1KU3A 4X8NA 2JMWA 4I09A 3T08A 1HKSA 2WY7Q 4M00A 1C8NA 1MH4A 5LCWL 1OLQA 1W99A 2DLLA 4RGRA 1MZ5A 2JIJA 4CCCA 1KDKA 3MKWB 3DEMA 3D5RC 3GZAA 3KLSA 3F3XA 4LD5A 2FCVA 5JHFA 3W5MA 5FLMJ 3APBA 1YUDA 4MGZE 2ZMEA 2G4IA 4FPGA 4LE3A 4CEYC 2BYVE 2OVUA 1ND2C 2LOOA 1KXGA 1HW1A 4LQRA 5C3QA 2KPMA 1ZH5A 2BY2A 1W9TA 2WSUA 4AVZA 5F3IA 1XSVA 3MFCA 3NV4A 1PO13 4E7LA 4XF3A 3UR3C 2NNNA 5JXIA 2R7ZJ 3N7JA 3WUDA 4KGGA 2X29A 1ETVA 2Y6FA 3O0VA 3A23A 3GO5A 2VOTA 2R0QC 4CDGA 4CDWC 3QOEA 3AM2A 4Q0SA 2K46A 1JBCA 3IP4B 3BZ6A 4O9EA 2ATFA 2K9QA 2GC0A 1J1TA 4XXAA 4HK9A 4EVIA 1Q43A 4HKLA 4RLQA 5HV4A 1OFNA 3RKYA 3EQLF 1AR83 1M4WA 3T3YA 4D69A 4F3JA 2KMUA 1BIBA 2HWB3 1SMYF 4PF1A 5FMOS 3AFKA 1LAJA 5IATA 1VRH2 3HRTA 3T0BA 1NLSA 1PO11 3GJAA 1WCSA 4Q48A 1XB4A 3DEWA 2Y30A 3S14J 5FWJA 4NROA 1FMVA 3K4AA 4AI8A 3ZQIA 4IHVA 2VZ1A 4E7IA 3S3OA 1RUF3 1ORKA 5GP9A 3U75A 1MS5A 3LNQA 5FZCA 3OPZA 3NNJA 2A73B 2L0KA 2DDUA 3WQ1A 3AXEA 3LF7A 4JGZC 2EINH 4Z07A 3LMMA 4RLFA 3VB2A 4UVAA 2AS5F 2Y0MA 5FQ0B 4E2QA 5EYXA 4ARXA 4QPQA 1XNCA 3E3VA 1AR81 2HWB1 4B43A 5I8YA 4P9JA 3MZYA 5CEHA 1AXYA 4B1LA 4WVVA 5A7OA 4BXFA 1URXA 2GWRA 2PAMA 3AZVA 4M71A 3C7OA 2UYBA 3OV8A 1LVKA 1AR63 5FREA 1JOJA 1WVRA 1DZQA 2X53S 4JX4A 2XPWA 4YVWA 3K4NA 4KDPA 2VNOA 2XSDC 1SAUA 3ELKA 1RUF1 2RAEA 4CPBA 4I0AA 2VODA 2ZXHA 2IEKA 1LOFA 3DBLB 1FT9A 4FAHA 2FZ1A 2Q0OA 1PZ8A 2E2JJ 2VH9A 3DFGA 3VBSA 5IFPA 3CQZJ 3K1MA 3FHAA 5LD2C 2Q1ZB 2Q8DA 1G59A 3POWA 4DINB 5FPVA 5K8SA 2IA1A 2BNMA 4JX0A 3T0YA 4XSXF 4A45A 4JQTA 4BXXJ 2L4AA 3JUUA 4LUKA 3OTFA 1PO23 1KDMA 1Z77A 1W90A 1JODA 2M7BA 3GZ6A 3OEBA 3AJYA 1KONA 1AR61 4ISQA 1IN5A 4OMZA 4V2GA 1EV12 4JX6A 1XTAA 3J7AO 1IUYA 3VBUA 1WZ2A 2OCEA 3K2AA 3CCVI 3VDCA 4XFAA 5C5TA 3FXLA 4L9NA 4NAMA 3WQ0A 4AL9A 2J1TA 5SV8A 5FZHA 3P3NA 4MGQA 1QXJA 3RZLA 3RYRA 3LSDA 4Z8BA 1YWKA 4UHTA 1NHAA 4U0WA 5FZ4A 2OZ6A 1R71A 4A6SA 1O8SA 4YIIA 1J84A 4K8FA 2Y9YA 2I5UA 2WFF2 3F8FA 4Y52J 2G19A 1CZVA 4C90A 1MMDA 4XLAA 3HPGA 5FKOA 2DYRH 2FQ3A 1PO21 2DFFA 2VQAA 2MSYA 3ZN1A 3GM8A 5GALA 4XRFA 2VTXJ 2B9UA 3JRAA 3CCYA 1BHGA 5AFBA 4EM2A 1GZTA 5F0HA 3UKTA 1WJDA 2JA6J 5JMOA 1OQDA 3WGIA 4W8JA 2P37A 1BBT2 1U5XA 2PHTA 3VDDB 4E27A 4BBSJ 1JN2P 3AFGA 2H1KA 1NQJA 2ORXA 4B1MA 4P9UA 2ID4A 5BNOB 5LA0A 4ZJZA 3EPZA 1YCIA 3RVHA 2ZFUA 2IFRA 4ON0A 3I4NJ 5CQGA 4Y5Z0 4HF0A 3S1NJ 1QJX3 1WMDA 1JUIA 4UBHA 1HRV3 2QQ8A 1W6OA 1C3HA 1VMJA 3L2YA 2BXYA 2KRHA 4A42A 1IC8A 3FBIB 1MS0A 3GJBA 1HB3A 1U8RA 1QNTA 1I1EA 5CISA 2X10A 2YXSA 4BQXA 3RJPA 1V0AA 5E1WA 2RN7A 5L3GA 1OR7A 1IS6A 5IW0A 1RITA 5T3NA 3AP5A 1CGPA 1A04A 4ENJA 4Z2YA 1WMFA 3LQRA 2WYSA 2O8QA 3T5XA 1RUJ2 2LKSA 3C3WA 5L3BA 1H4HA 5C9AC 1N3PA 2Z5UA 2FDHA 4XFBA 5KBFA 1BOAA 1B8IB 1SMTA 2IVJA 5FBZA 1CJDA 2PLV3 3X29B 2P4EA 4CHUA 4NIGA 4A4AA 1D7PM 5C4XJ 1Y43B 2WA3A 1XSRA 4IEJA 1SPPB 1D0ZA 1E57A 5ILSA 3N4MA 2WJSA 4P1WA 5BNNC 2BV6A 5I0SA 4GKXA 1NCRB 4MXVA 3UKGA 1ULOA 3ILNA 3IN9A 4A3MJ 1Z7LA 4HF2A 2DA1A 2VMIA 4LHKA 2YX4A 1MZBA 4R1HA 4CVUA 2ZACA 1XSDA 5EZGA 4ITCA 3MLJA 3M3EA 1O7LA 2V1XA 3BOWA 3GEZA 2E6VA 2XB5A 3ELNA 4PI0A 3E0JB 4E2SA 3AAFA 2LF7A 4XLFA 5EEGA 4GRIA 4YVSA 3OL4A 5IP6A 4EGZA 4QX5A 2B46X 4BU2A 4CCOA 1SD7A 2M87A 1CAVA 3VDAA 4L5JA 4GJZA 2XVLA 3TP3A 1XU2A 5J1RA 3WW3A 3GXOA 5FMBA 2W82A 2VJ5A 5CFDB 2ORZA 4N8MA 3WE2A 2W7NA 3ZQCA 2A6YA 5JFRA 5M5XJ 5A7WB 1ACCA 2A5ZA 5HS8A 3TO9A 1FYUA 3SH5A 1YITI 4S2GA 4PLOA 3VDDC 1K6OA 2EA4A 3HXLA 3CC4I 2Y8KA 3KCCA 3GUDA 4P5HA 2W91A 3HPHA 3Q5FA 1IO2A 2VCAA 5GZEA 3FHZA 5IY5H 2FNPA 4ZDOA 5CLSA 3DCFA 2FJ1A 3HUGA 5DUKA 3WNNA 3VBRA 1GU3A 3O5SA 1WH7A 4K21A 3SHRA 1G3SA 3IKTA 3NJXA 3TW6A 1QOSA 4MG2A 5D5XB 5JOXA 2B7EA 4U87A 1B35C 3OYNA 1PUFB 3AYDA 1LJ7A 2ZX1A 1QKQA 3DXJF 2BFUS 4XUPA 1HN0A 2JG8C 2IXSA 4R4XA 5FO7B 2QFEA 2BNOA 4GQ7A 3O1RA 2GXAA 3GBGA 2XUBA 1V70A 1PGW2 1IRGA 2I10A 2H1LA 5TJJA 4AHZA 3POFA 1SEFA 1TE1B 3O0WA 2YSRA 4ETSA 3OGVA 4OIRF 1WMEA 3PURA 1ETOA 1GQHA 3WVJA 4JGYA 1BR2A 5AIPA 2QQIA 2JSCA 4PJNA 1HOMA 4BHCA 4NIAA 1FATA 3PFIA 3W5NA 3SEZA 4HQEA 4XONA 3VLBB 1MMSA 5FP3A 4CGZA 1TT0A 5CNAA 2P5KA 5DV5A 5HPOA 3CNAA 1LHWA 3PJYA 3OS1A 1X2NA 4RR3B 2KP6A 1YIJI 3WSOA 5ISLA 2V4AA 2QZ3A 3F0CA 2G7UA 3RTRA 1FSEA 4FE4A 3THCA 3S17J 1WGPA 5DZEA 3OYJA 1ENRA 1PM4A 1MQTB 2IBDA 3JAMZ 5J37A 1QRYA 2RM23 3RPQA 3POGA 1MZEA 2IAIA 2QQ9A 1D1BA 4UW4A 1UY0A 3VBHB 1RL3A 4LLFA 5I0TA 2XHNA 1KEXA 1TWCJ 3ZYPA 1YX5A 3ABTA 4EJWA 2OQRA 2X05A 1D4M2 3BDDA 4DNCA 4IQPA 1T6SA 4XAAA 2EA2A 1MZ6A 1CAWB 3KF5A 5CVIA 3U2RA 1JZ4A 4AI9A 5A1LA 3BZKA 2MGQA 1W8UA 3FIWA 3H5AA 4FPFA 4Y1VA 4JCKA 2RS52 2UWAA 2EALA 1OPOA 2V1UA 2RM21 4RD7A 4CE8A 3V0AA 5JLXA 1H9PA 3S15J 1LVAA 4OI2A 3SXYA 2GU9A 3K7AJ 2QQWA 4M4PA 2VQGA 4XJUA 2WO3A 4C2MJ 5FJKA 3JCIA 4BQNA 2BVVA 2WA4A 4IRIA 2KIUA 3F8BA 2XOMA 3DQVC 4QHOA 2C6SA 2WO7A 3MPBA 4W65A 2OUMA 4KU8A 2BTVC 3LEKA 1SFEA 5LW9A 4XE9A 4AI3A 5ACA3 1F15A 2GAUA 4P02B 1SACA 1DQ5A 4OLLA 2LY1A 1JUSA 4QM8A 4NC8A 1HB4A 2DOFA 1UZ0A 1JHHA 1WCDJ 1LUJB 2DN0A 3WR0A 4HLXA 2VN2A 4RAFA 3AMHA 2FQ4A 4P9GA 2JECA 2DURA 2QQJA 3ZSMA 1VE0A 1FPN2 5J3LA 4XYXA 1MSEC 1MS3A 2WNOA 5BQTA 2V5DA 1PZ9A 4AEJA 2YG0A 1V3FA 2CW0F 1W9YA 4KMFA 1Z3YA 3PVOA 4QDQA 3MKLA 3R61A 2CAVA 5IVYA 5DM6F 4RR3C 4XOGA 2DCEA 1H1IA 2VW2A 2XUMA 3BTCA 4UV9A 1S8NA 4RB2C 2PHDA 1GNHA 3QPSA 2VXDA 3HQUA 5F1RA 2JKBA 1TW3A 3C7GA 3DXUA 3CMYA 3I3LA 3ACFA 3F8NA 2D44A 4BQ3A 4PGGA 3K4ZA 5DMYA 1V6KA 2JDAA 2IWGB 2DK8A 3I4PA 3GALA 2R3SA 3VBHC 4W6YA 3BG3A 3FM3A 3AKTA 1LB2A 3KV4A 3NWKA 1B72B 3MLKA 3C7FA 1D0XA 3BR3A 5LGNA 4ANJA 2WO1A 4OMCA 4CDUA 2DTRA 2HYFA 4LO5B 1VB4A 4IE5A 3E5QA 3W6KB 3LL7A 3CIHA 4AEMA 1ZA4A 2NQYA 1VBC2 4HKWA 2UZKA 2GN7A 3K4JA 2R1BA 4DBQA 2V1DA 2KJCA 1EP0A 4QXBA 5A2QK 1ZLKA 2EXIA 1S0EA 3JQWA 2XWJB 2O8OA 2LKPA 1V5EA 4OYUA 1EH6A 3ETPA 4EN8B 3LD8A 4LMFA 1KJLA 3F23A 4XF4A 4YZ4A 3H7YA 2D3SA 5F32A 4F91B 3L7WA 2B8MA 1NYWA 2BW3A 3KETA 2LALA 4M74A 5GAHJ 3SLIA 1JW6A 2E63A 4R52A 2J1EA 3GHNA 1PK6A 4XDOA 3J80K 2OQGA 2K02A 2B42B 3NV3A 1W6PB 1AR71 3H8OA 3PUSA 2RMU2 4FCAA 2QF7A 4NHYA 3FLPA 5FZ7A 1RVF2 1F35A 2LDUA 4RM2A 1QNYA 1GQPA 3ES1A 5FLXZ 1TQ5A 4KWJA 4CZZA 1RUH2 2PJRA 4XUNA 2WT0A 1GV9A 2A3YA 2VM9A 2R5YA 4WM7A 2XF7A 2BOJA 4META 2XB6C 2R7TA 4WVZA 3BKZA 2WINB 3WDYA 1DQ6A 5FPXA 4ATFA 2P34A 2R073 3M8LA 2VQUA 4LOSA 5AONA 1WFXA 5D5WB 4F8AA 2JG9B 4FOYA 1ZG3A 3LDBA 2YFZA 4BQQA 3ZR5A 3H9AA 3IZOA 3BG9A 4KT5C 3WTWC 4RFRB 4HX8A 5K0UB 1YFWA 2MC3A 3FXQA 2C9AA 4BEHA 3CMEI 5C33A 3ZKYA 2W57A 5EJ1B 4C1WA 5F2WA 4DRRA 4FFGA 2FUG2 2VZTA 1GFF2 1XSXA 3L2CA 1NK2P 1JZ3A 5D6EA 5IVFA 5A3PA 1WQ2A 3B5LB 5AVAA 2IGOA 3FUOA 2Y34A 4IZZA 4EATA 2ZSHB 1VLNA 3HN3A 1YW7A 2R071 2VUDA 4QGMA 4AIJA 1ZYBA 5DCMB 5FZMA 5LA9A 3ME2A 1OVPA 3J81Z 4BWOA 5D8LB 3GLLA 3H5RA 1OCPA 3N9PA 4NHXA 3ILFA 1G9CA 1OPCA 1UIJA 1MS8A 1WW6A 1NZCA 3FJSA 1VQKI 3CJRB 2LRPA 3DF0A 5EGOA 4YPJA 2TDXA 3OCPA 1W2NA 2W47A 1O4YA 5FMCA 4I30A 2Z3YA 4F83A 3IH3A 2GH8A 2R5ZA 3LSKA 3OG2A 3KCYA 2OJED 2FMDA 1FIAA 3ZSJA 1W6MA 3VKMA 4HX7A 1X33A 1XNAA 1Y8QB 4GYGA 3AMPA 4CYCB 1BW5A 4CP9B 1F4KA 2MW8A 1HX6A 5AC92 5IVVA 2OU2A 5L3CA 1D2SA 2K86A 2YU2A 3NSTA 2A3WA 1LECA 4DO0A 4DPNA 2Q2EA 4X6RB 1FBQA 3GMEA 3FFZA 4AQTA 3DGTA 1OISA 3PQJA 1BJQA 2OPTA 3V42A 1VR3A 4M4RA 3NWTA 4MV2A 4XTMA 3F9KA 5GADJ 1UZCA 5M3FJ 1QXRA 5L3DA 1QU3A 1HV0A 1RUG2 1H88C 4QMAA 3NNFA 1IRXA 3W6VA 1UHSA 5FZ9A 3ZXSA 4G6TB 4JTOA 3WG4A 3PUHA 4EN6B 2CWSA 3OYAA 3UYJA 5FZ3A 2IRFG 3KZYA 1X2MA 3E1SA 4ZXKA 4ESBA 4ZDPA 5ANQA 5BOXA 3OYWB 1HSJA 1JHJA 5D8AA 2OQ7A 3J26N 1UYXA 3FM5A 1UXXX 2Z79A 2JA5J 2OD5A 2QGUA 4AI1A 3G4SI 2VJIA 4ZU7A 2HEVF 2R16A 3ERED 2VL8A 1ODNA 2HQ5A 2ZHKA 5FY7A 2RVAA 5JXJA 4AYBN 2RJKA 1YW8A 2YC4A 4URTA 4Z82A 2LW8A 2YU1A 2F5FA 2W1OA 3KHCA 3QU6A 1R64A 1WA6X 2HVRA 3VZLA 5CVVA 5F0FA 3HG9A 1RHI2 4OUSA 4XQDA 2LKXA 1OCRH 4MQVA 3QYFA 3ORJA 4L9BA 3MHZA 1RI7A 2D6LX 1BVVA 2WNEA 5J8CA 4D0PA 3LAPA 2CUJA 3HEIA 4P9IA 4PI2A 3E7LA 1XCBA 3PDQA 2VCCA 4C3HJ 2DFBA 3V8KA 2D7FA 1EAH3 4B4PA 2RS13 1KU7A 5HXVA 2Q0AA 3WUCA 2XXZA 4ZYDA 5FKKA 3ECOA 1IPSA 1L3LA 1VRH3 1QH6A 3OYHA 3BB6A 3WNKA 5LFAA 2VOWA 1GZCA 1FXZA 2DODA 4NIDA 3O12A 1ZNPA 2K3FA 4IV3C 2AEYA 4I0BA 3ZKUA 1MNMC 1YRNA 2NMNA 4JOMA 1DQ0A 3ZXKA 3BCBA 3WG7H 2YC2A 2ICWG 2JENA 2QWWA 3WY6A 2V6EA 2HWE3 1F1ZA 3PTRB 3URFA 1JUMA 1EAH1 3EBRA 4NC6A 3WE3A 1FSHA 2JDZA 5EWSA 2CTVA 5JSOA 2W25A 3CP2A 2IS6A 4BJ5C 2P3KA 2WIIB 1VRH1 2CGNA 1GNZA 2E60A 4V19K 1QPMA 5F5IA 1UY2A 5FZOB 3DLLF 3WDTA 1NUKA 3ZFEA 2B5HA 2Y0SA 2BVBA 4XRSA 1VQOI 4TLGA 2XF6A 4PF5A 3ASIA 4MSVA 4HOOA 2HYGD 3H1YA 1W39A 3OYLA 3AP7A 3DN7A 1W9SA 2KD7A 1JTZX 5JI6A 3FLTA 3HTSB 2KL4A 4L0PA 2BGCA 3KWVA 4QQHA 3RZKA 1IQAA 5HLHA 4TTGA 1WJEA 4MGTA 3QP6A 1G9BA 4ZS3A 3CZUA 2HFHA 3RWKX 1TNRA 1IXRC 1N77A 5JIUA 1PNFA 1UYYA 1FJLA 2V73A 1VQNI 3H35A 1G8WA 4JGZA 2M3AA 5EJCA 5J4YA 1F8VA 4NIHA 5FXVA 3CQOA 3DEEA 3EUHC 2Y26A 2L7MP 1ZM1A 2H27A 2VJXA 1EV7A 3ECQA 2VC9A 3JTGA 5A3MA 2DBBA 2IVIB 3KGZA 4F52A 4JQRA 4YZ1A 3TEZA 2WFF3 3D5LA 4PZJA 1S0IA 2GIVA 3RZZA 1Y4WA 4N43B 1J75A 4MXWA 1STMA 1PMIA 2HGCA 4H55A 5CG9A 3VZJA 2AUYA 2K9NA 1S29A 4FE7A 2ZEZA 4XJ9A 5C5UA 1C1LA 1JZ6A 4LNVA 1KQ0A 1EJ9A 2FX0A 1OH4A 1QWRA 4Y20A 2DVDA 1PGL2 3OYDA 4L99A 4CDQB 2FDFA 3HOYJ 1N3QA 2M0CA 3CL1A 1F36A 3CO6C 4GAZA 4ZZ5A 4RB0A 3DKQA 3ZFFC 1F5FA 1N47A 1YFXA 4E9KA 2R043 2A05A 4XJZA 3CTAA 5C3PA 2IVMA 3NJZA 2VQLA 2DMNA 1UELB 2WFF1 2QCSB 1T8IA 5IT6A 4M3CE 2GOMA 4JKKA 3JCUC 3N9LA 2RJ2A 3FXOA 4IQ4A 3DPUA 4DQ2A 5EJ3A 2XH6A 4GB32 4G9SB 4YW5A 2CFOA 2O7OA 4WK8F 2HKOA 2YX7A 2B45X 5BPIA 4HRIA 4AVCA 1ZBA2 1X3UA 3K51A 1QGLA 1SDDB 2ZX4A 4B3NA 2O0YA 1D8JA 5KK1A 2X6OA 1EYBA 3ZYFA 3TEWA 2Y6JA 2MA3A 4KIBA 1ULCA 4QQ2A 1DUXC 2K5CA 2M8GX 4QPWA 3VBFB 2A3XA 2F5DA 1RR8C 1X8EA 2DCKA 5I0RA 3ECHA 1QU0A 4KL1A 2ZXQA 2BWCA 3SHFA 1O4TA 1R092 4D6QA 4E7HA 4IJAA 2PQSA 3I55I 1ZVFA 1UYZA 4PQ9A 4RGAA 3WTTC 3WTXC 2VQCA 4FPJA 3B69A 1LCLA 2Q8CA 4DUVA 4O9GA 1K6YA 3ZM8A 2FOKA 2XGEA 1R4NB 2RE9A 2JEMA 4FP2A 5EV7A 1B09A 3T1MA 4AI0A 2VKVA 1TG7A 4ITVA 5DZFA 1DPRA 2EIJH 3ZMTA 2VBDA 3B9CA 3K46A 5B1BH 3GF2A 1H2LA 4M0NA 2LNBA 4LO6B 4D7YA 4UF0B 1LFPA 2D5HA 3ZQFA 5FQ0A 2HTSA 2XAGA 3EUAA 1WGXA 3FX3A 4EMSA 5FY4A 3A01A 1DZTA 3HPNA 5GZGA 1UX6A 2X51A 5FYTA 1ONVA 1E5IA 3I2GA 5LBQA 3WHCA 1G6NA 3L09A 2W24A 1QJEA 2EIBA 5HBAA 2QQPA 2XRNA 2ZKLA 2QYOA 4W97A 3TEXA 5C8CA 2JN6A 3CJIC 4KIFA 5IAXA 1XCVA 1DGWY 2QDNA 3KYCB 1OOPA 4JKLA 5F5AA 3SH3A 3D4KA 2GH2A 2W00A 4LBLA 4IO9F 4ZC3A 2IFWA 5CFCC 1E5HA 2IP2A 2P6CA 3HOZJ 2BUKA 3LA3A 4XKBA 2TCTA 4BA6A 3AG4H 5D8KB 3GTJJ 4Q0PA 4RHV2 5KXBA 3U10A 3I2KA 2YUEA 2CWEA 1WPKA 3ZXAC 4RAZA 2JRTA 2G9GA 4FHTA 5GPAA 2HQNA 3CLPA 1Z05A 5E6HA 5EG0A 1NCQB 1NY72 3T1BA 1QJY2 3L2HA 1T08B 1J1LA 5IVJA 1A3KA 4JKMA 2E7WA 2W87A 4Y1XA 2ZB9A 1DDNA 5HLGA 4A7ZA 2PMHA 3IAS2 2MBFA 4D3WA 3RYPA 4QPYA 1OF4A 1NE6A 1IXCA 3RPUD 4G94A 2ZMLA 1IS4A 2QKLB 4IRGA 2VR4A 4YFXF 1T0FC 2VUAA 3ALQA 2L9RA 2WN3A 3VBFC 3NKTA 2DTZA 4Q4X2 1LOCA 1ZQ3P 3VB9A 2RVCA 4BQAA 1H89C 4R79A 4QHZA 2LY2A 3GLXA 3SZGA 1FOXA 3OPWA 3J8F3 2P3YA 1N3OA 3BU0A 2DDBA 3NAUA 2AH2A 4E7ZA 3GVAA 4BL0B 3S0MA 5EYRA 5D2AA 4KJZA 1U9OA 2R7QA 3ZXFA 3H9GA 4XM3A 2PHWA 3BR5A 2DDAA 4UW3A 3FK7A 2KLOA 4BQ2A 4ASMB 4KNYA 1VBA2 4HG2A 4RGXA 1SFOJ 2RV8A 1R082 5BNOA 3OYGA 2GC2A 3G6JB 4XTPA 4A69C 2XMLA 2BV4A 4JZRA 2V79A 3QPHA 1SCRA 3WODF 1JKQC 3N9MA 4PIXA 4K3UA 4AWDA 4XOTA 4JBAA 2BZTA 3KVBA 4KBZA 2CG4A 5FPAA 1QY4A 3SDBA 3LSIA 3WTYC 3L2VA 1MACA 1IGNA 1QEXA 2YPDA 1UW8A 5JOWA 4RQPB 4XDQA 1O3QA 2UUZA 1YEWA 4QD2A 2HDCA 3CUOA 3I59A 2DYSH 2OUJA 4QGLA 1FBUA 1D4M3 3H8XA 1RNLA 4DOUA 5BPDA 1V6JA 5K5OA 4AFMA 2QSGX 1GSLA 1Q8VA 4QB1A 2DT5A 1J7KA 2FD5A 4XJ8A 2CRGA 4EJOA 3CDIA 4D1QA 4Y1YA 4ZU4A 1QOTA 4LOCA 1WW5A 4I01A 2ZHNA 5DAWA 2A5WA 1Z7S3 1B8IA 3PIGA 5F08A 2ELHA 3OYBA 3O6BB 3WTSC 3VZNA 4BS9A 1SPPA 3O8HA 1YHQI 1EUUA 1PNGA 1KQ9A 4FTEA 4D6RA 3MF6A 2BE5F 1DGRA 2EB7A 4AEKA 1W05A 1LGCA 5F5QA 1D4M1 1GZWB 1CN1A 2I74A 5E88A 1GP6A 1NCRA 2ETEA 4NPRA 2UY8A 3PNVA 1NLQA 1VQPI 1ZREA 3IIAA 3OUHA 2DU9A 4TZDA 4DNYA 4Q0QA 4FQ4A 2DVFA 1Z7S1 3C7JA 4FOVA 4UB6C 3F8MA 1RUD2 1BQPA 4FX0A 5B5EC 3UV9A 2PQQA 5T52A 1UCRA 5G05L 5CKTA 2BWAA 2ISYA 4MUVA 5IVCA 3LSGA 3KZIC 2JJ7A 4TLFA 1JT0A 1ALYA 5CFDA 1QZZA 1FPN3 3WGGA 1TNTA 2WT2A 1Q8PA 2MFZA 5GAGJ 1QA6A 1JKPC 5A7WA 3LWCA 5ICFA 1UZYA 1YNAA 2ADUA 2K9MA 1FOD3 3HT1A 4PJYA 5ABJC 4ZYEA 4XLEA 5FLVA 5LRSA 2W46A 4CSWA 2EZIA 1WW4A 4Q4V3 3L9JT 1AHSA 1R1TA 4YEJA 2PLYA 5FMOL 5DDGA 4IXLA 5JZGC 4WM8C 4A2UA 2WZPP 3AL5A 1OC1A 2BY3A 4JTNA 5FYMA 2GA2A 5DCFA 2O9LA 4ZHNA 4JP0A 1KYZA 3REOA 4J19A 5JR3A 4J1XA 2CQXA 2P6HA 2F5EA 5LBFA 3IB3A 4UW6A 1FPN1 1CAUB 3HRUA 5J8FA 4KI5M 1V9U3 3QLQA 1E3HA 3ZCOA 1UAIA 4RQPC 5L3EA 4E7JA 3TBIA 1FOD1 3GTMJ 2GZWA 3IDAA 2DOAA 5FLJA 4Y33A 1G9DA 2ZGSA 5HCBA 4E4ZA 3ZVXA 4L9VA 2VE8A 2Q4SA 3PSIA 3H0OA 3NWSA 3DPRC 4S2DA 2JVHA 3CCJI 2VLAA 3LKJA 4C1XA 1ODMA 1ZZBA 5IFTA 3AKRA 5FFXA 3I3EA 2LBFB 3RKQA 5JI7A 5LHIA 4HZFA 1IPKA 2WT1A 2F4MB 2HQRA 1OCZH 2ID3A 2GOXB 2WZ8A 4HL0A 2EIKH 4OAZA 1YQCA 1HDPA 1MQTA 4RS5C 3ACGA 2ZEWA 3J9SA 3HM5A 3FWEA 2E32A 2HWF3 4AEDB 3RS6A 1FNZA 4QWQA 3E1F1 1XQNA 2EJRA 4RSUA 3QODA 2BQPA 1ETKA 4XFGA 2D6PA 3KF3A 4XURA 2DWRA 1JZ5A 5E8IA 1IV6A 1OFCX 4BQ1A 5FLHA 2YMZA 3N97A 4GIQA 4HYEA 3ZP5A 4Q5OA 1RUH3 5AVPA 3ZRGA 1U3EM 2ARAA 2ZO4A 1CAWA 3MIBA 4AC0A 1TLHB 2HPIA 3MGUA 3JD72 4MZUA 3H5NA 4HPQA 4L97A 2WNVB 1X1DA 2VXRA 2A68F 3V8JA 2HDDA 1LKNA 1TMF3 4FOQA 3RGBA 3HJEA 4IVNA 5H6RA 2PMZN 1LDDA 4Y4RA 4FTHA 2L01A 3IMMA 2BY1A 4EM0B 3VKLA 1E0EA 2JX9A 1RVF1 2XAUA 1UMZA 4ZZ8A 1LPQA 3IDBB 2DMPA 1COV3 3LEIA 2XPUA 1XN7A 4BQOA 1RUH1 2D3RA 1W8FA 3CUQB 2ZAHA 5B1AH 1H8TB 2YDEA 3MBWA 1D5VA 4S2FA 2TNFA 2IGNA 3E6CC 4HMZA 3HAGA 3ZFGB 2VC1A 2RDRA 1YLFA 4EJTA 2IS2A 1AX0A 3D82A 2QUFA 3H9QA 2UURA 1WUVA 3BPVA 4P96A 3QPTA 2JE9A 3UL2A 4XAEA 5D4SA 4YW7A 3ZXLA 2CW7A 1RINA 2MD5A 1HJGA 3GZNB 2NPIA 3BCWA 3V65A 4BQ5A 3AG3H 2ARCA 2KQRA 5FZDA 3ZIWA 2NVXJ 3VN4A 1W04A 3T09A 1MJBA 4SLIA 1COV1 2EPFA 5BNPB 5ANNA 3PUBA 3ZYRA 5FB2A 1VTNC 3PNAA 3KMHA 4MGRA 4GWIA 3BOQA 3OB8A 4FETA 5FV3A 5A7PA 5LA1A 3HBLA 4RGKA 1ULDA 2L02A 1VQMI 1R58A 1HRI2 5C3EJ 2OA4A 4BACA 2WB1A 4NUBA 1GMMA 3NJYA 1LEAA 1R4MB 2HVSA 3BWGA 4C2TA 4Y26A 4TYSA 2XASA 2E31A 3H9JA 4H0EA 3BR6A 3FK6A 5JLWA 1YYNA 3LSJA 3NAPB 2ZGTA 3R0AA 5C3OA 4MHUA 2VIXA 2JA7J 4YZ3A 2FDGA 3LAGA 3WT3A 1LEDA 3TEDA 1E3PA 3N9NA 4PDWC 1AL0G 3Q8FA 1RUG3 5I8TA 3OYFA 1AWCA 2ZX0A 2E33A 3ZPLA 5FOBB 2MH2A 1B72A 4BDVB 4Q5SF 2EFOA 3ZQ7A 3BTIA 3JRGA 1UPIA 5K9YA 1CF7A 1MMAA 4UFHA 5KXEA 2CDPA 4PIYA 5AC91 3BU7A 1Y1WJ 1YTYA 2RDNA 1TQPA 1VBD3 2HPMA 2Y69H 1Q8QA 4EWEA 1ZGAA 2PAKA 1S1AA 2WNVC 4YNIA 4M01A 3ZMDA 2WZR2 2OCCH 4LKEA 1AX2A 3M07A 5LLQA 1BK0A 3CJXA 4Y17A 2GNBA 3HOXJ 1SD5A 1UKRA 1RUG1 3HD8B 5GAEJ 1XE8A 2BP6A 3JRCA 4JX5A 4H3WA 1VQ9I 2DMUA 2NRAC 3RQ0A 1Y9MA 2HBTA 3GW2A 3CBNA 1ERDA 3OYCA 3EUKL 1R49A 1CAXB 2Y75A 5LY1A 2M1BA 3ZMNA 1BA5A 5FUIA 3ZYJB 3S93A 2A6TA 1HIXA 3EYIA 4XICA 1O8PA 2QDRA 2MH9A 2I8DA 5ICCA 4CEWB 1VBD1 4AAXA 1H8TC 1VQ4I 4UNOA 3MIDA 4NIIA 5F0CA 1BN5A 5IK4A 2C6YA 2MNGA 2ZGMA 4KG0A 3RYKA 4YWAA 4LB6B 3ZFGC 4P5YA 5IOYA 3WHBA 2DFEA 1SLBA 4FBFA 2YC0A 5FD6A 1H2KA 2V09A 1W1WE 2E1MB 4KN4X 4V2VA 2W2IA 1X1PA 3CLQA 2W5FA 1BOBA 3W9AA 2RDPA 3TB0A 4FCYA 1RMU3 3KP4A 3ZX7A 1FP1D 2WADA 2MLGA 3WOGA 4Q1RA 1T2KA 1DZRA 5BNPC 1ZYRF 4G7HF 1DU6A 3SH4A 1AYM2 4NMIA 5A1AA 1H2NA 1YJWI 2L4MA 2JG9A 2CFXA 3BR1A 3QU3A 2CS3A 1LHVA 4BYYA 5BMZA 1C8M2 3MIFA 4EWAA 2BHZA 1JGGA 4AQ6A 5K0UA 2YROA 3SISA 4HONA 3HZJA 2QSFX 2P5LC 1XGNA 3ASNH 2OTJI 1K5MB 4FAGA 2Y38A 1VMFA 1UOJA 1BLZA 1BZWA 1VQ5I 2G9FA 3FFQA 1OCCH 2VPRA 1O5LA 1V55H 3MWMA 3IT8A 2VZRA 3INAA 3Q0VA 1H4GA 2HKXA 2X1CA 3CO2A 1RMU1 3NAPC 5KHIA 2ZEYA 2ELJA 3RG0A 5DEQA 4A0XA 3FDYA 2R7DA 4GZ9A 2MYSA 4QPGC 4UFLA 3SNMA 4P55A 2GMMA 3UGHA 2H6BA 1PVC2 2KDZA 5GTHC 5T55A 3PVEA 3LSPA 1W7PA 3V56A 2VBXA 2RC4A 1IS5A 1OLMA 2WBMA 1YQ8A 2HWD3 5M5WJ 4OUEA 1MVQA 4JHTA 3KV5A 2W9XA 3ISPA 4M3GA 1K7AA 1LOGA 1DYOA 4B1RA 3ZMZA 2AZ5A 2ZGPA 4B09A 2J42A 2V5YA 2SLIA 1OVSA 4Y13A 1K3IA 2NVTJ 1N78A 2JD9A 4OHZA 2M34A 4CYCA 4HEA2 5ICEA 1Y6IA 1FYLA 4P9LA 2CMPA 1PMJX 1Z9CA 1XYPA 2ENRA 5BUVA 4COUA 4OZOA 1S0GA 2CV0A 2M9HA 2ZC2A 5J3UA 2VT3A 3DP7A 4OWRB 1YXWA 2EILH 3GF6A 1FOWA 1GVJA 3H8UA 4LBQA 2W95A 1UF2C 2P0WA 1UZZA 4AAPA 4OOIA 3G73A 4AQSA 1CPMA 4DXZA 1XC5A 3H7JA 1R36A 2IXKA 2XKPA 2VECA 3KD4A 1Z21A 2CJJA 3QQAA 4ZZLA 4A3LJ 3LA7A 4B7EA 2E1MC 4A7YA 4BIOA 3NKGA 3R4DB 2E34A 3BODA 2VNVA 4DEQA 4EJUA 2HWVA 2ZMEB 4AIKA 4F55A 3LAJA 2DFIA 2RR12 4NDLA 2VOVA 3ON7A 6PAXA 2IGMA 1U0JA 5FIXA 4EM1A 4ENMA 4UV8A 2XAJA 3U0ZA 1KJRA 1GLHA 1WMXA 1VAKA 2IXIA 1NZIA 2GALA 3WU2C 4IE6A 3LFMA 4XHBA 4Q1PA 1XPXA 1W9WA 3KT1A 1CONA 4B44A 2DV9A 3K2ZA 3P5BA 3NQHA 2ESHA 2Y33A 2CAUA 3I2JA 2HEOA 2HXOA 2E1OA 4MHRA 4NRPA 4OIPF 1FNYA 2LMDA 3V4GA 1IF1A 2G9ZA 1PGL1 3DXTA 1UMIA 2D43A 2PHLA 3GHMA 5L7OB 2R49A 1D8KA 2RV9A 3RMYA 2OAZA 4MNUA 4HNTA 1T95A 1YJNI 2HLEA 1U5TC 4FI9A 2KT0A 2LP0A 3MICA 3OBZA 1AKHB 3PVBB 2EV5A 2FEZA 2X4HA 1UO9A 2YR2A 4IF4A 2NP0A 3T0AA 1LKXA 4AVAA 2GC3A 2OA2A 3AB0A 3NNGA 2VOPA 2K0GA 3SITA 3HOBA 3QD6A 3CCMI 1AL23 3CF2A 3TYJA 4CCJA 1G9FA 2X6WA 2BGOA 3RSNA 1B9NA 5KWRA 4I7HA 1HA8A 5DDJ3 4D6SA 2CU5A 5JMCA 2HWC2 3BTXA 1ND2B 2ZHMA 3I8TA 1AYN2 2HTJA 3ZPYA 1JYVA 2DMTA 3T4VA 3IRQA 2P17A 1QQIA 2KZGA 4HNVA 1IN8A 3R05A 3TO6A 4RB3C 1YI2I 3EHKA 5AFEA 5BYNA 4XDPA 1GXQA 3C7EA 2CV1A 3RFRA 1JTYA 4IRHA 2VB6A 1TME2 2RNGA 3GFIA 3A21A 1R1A2 2L7FP 2MEV3 4IX7A 4QPOA 4CDWB 2FD8A 4D9JA 5H9RA 1R091 3CJQB 4CH7A 4KMQA 2JB4A 1CVNA 4MOAA 2ZKNA 1QBJA 1P7IA 1RJ8A 3SDGA 4YARA 3K4DA 1ZRCA 3BZCA 4QX8A 2DI3A 2A69F 3ZIXA 1RC6A 2XVKA 1FX7A 2C1FA 4XIOA 1J58A 4ASLA 5J98B 1ONAA 2K9ZA 2ZMEC 3QAHA 3B02A 3NW4A 4BCUA 1TW2A 3BJOA 2XGDA 4A3DJ 1Y9QA 1I1SA 2XJUA 2YZ4A 5FRNA 2PAEA 4YFZA 5DUIA 1OJLA 5L3FA 1X9TA 4Q26A 3JB4C 3KZZA 1MDMA 4R4ZA 2E7AA 1JOPA 4QX7A 3FKIJ 3JXSA 3LPFA 4CCKA 4NJ4A 1VBE2 3CKHA 4DEVA 4Y7NJ 3AJZA 1Z7UA 1QJY3 4XFFA 1I50J 4DGWB 4NC7A 3FC0A 2NYYA 1GNYA 3PL8A 4XABA 5JVVA 2P7VB 4I02A 3L2WA 1FWZA 5ILVA 3THPA 3WDWA 5TSWA 4AE2A 4ORFA 4PGHA 3A2KA 4Z6YA 3AMQA 4IUGA 2O14A 4DXSA 2X1EA 4XBLA 3OYIA 1EKEA 1L7RA 4N43A 3TEYA 3OIQA 3JBG2 1HXS2 4OUMA 2VE1A 3QBQA 3UESA 2ZGLA 2LC2A 2Q8OA 3QH7A 1BBYA 4Q4X3 5L19A 3GZ5A 2CH0A 3SKJE 5E8GA 4N9HA 1QJY1 4CDQA 3GTKJ 2NLRA 1POV3 3SC7X 4A6OA 3IWZA 5F7UA 1MSFC 1XGSA 2A61A 1NKGA 2R7SA 4YM2A 1JHNA 3U11A 3K2OA 2X1DA 3OUJA 2YFUA 3K0LA 2AO9A 2WS92 3P9IA 5JOZA 3O0XA 3QP5A 4E4SA 3X2QH 3MO4A 2W08A 5DG1A 5A3UA 1UCXA 3MAJA 4Q4X1 4UBGA 4YVWC 3O1UA 4XRSG 3GBWA 3OPTA 4HNUA 5T5LA 2WAOA 4B4RA 3I3MA 5LB6A 4FSJA 4ZZDA 2WZEA 3L2RA 3TN93 4AHXA 1EF4A 1AR82 1OYYA 1POV1 4YIRX 4LA2A 1OMIA 5ERLA 3VBSC 2HWB2 3R4SA 1ZK8A 3OGGA 3FMQA 1QF3A 1T33A 5KVRA 2MG4A 1AU7A 4CZSA 4OMDA 5CYYA 3KP3A 4N4OB 1UJ8A 1JXSA 3MV11 4BY7J 1R081 3DBRB 2XPJA 1UY3A 3VBFA 2VW1A 3ULQB 5E16A 2Y64A 2QQOA 2R30A 4NOTA 1RUF2 2PN5A 1V5FA 1CQTA 1DP3A 3P3PA 4AGRA 2DVAA 1JS9A 5D5VB 4XVHA 3CMAI 3J7AY 1YYVA 4KFCA 2Z99A 1ASJ2 3VBUC 4X1EA 3NO8A 5M5YJ 4IQJA 4CZCA 3OBAA 3F6VA 3DKYA 4CCLA 3PHMA 3TN91 3RJRA 3RI9A 3R0RA 5LK7B 1OYIA 3U4SA 1ZZ7A 4QTRA 4BK4A 4Z2AA 1IN6A 5CKQA 3RSJA 3K48A 3U14A 4YG6A 1X50A 3RZDJ 1CZTA 4YVSB 3ZYGA 1XNKA 4UF0A 4CU7A 1W8WA 2Z16A 1KFXL 4I6ZA 4LO7A 5K5RA 2WRAA 4MGIE 4SBVA 4BAYA 2EA7A 4HX4A 5CVJA 4XRMA 1OD5A 3G6EI 2WLQA 4CUGA 2HEYF 4JDMA 4MGKE 4YM0A 2B9VA 5J48A 4HQMA 3FISA 3PJQA 4BB3A 1SCSA 1UN1A 3D1NI 1ZLJA 2OYZA 4NWWA 3FZ3A 4XHXA 4OIOF 4COYA 1RIRA 2G1MA 1G4DA 5FKBA 5C9AB 2F6BA 1O57A 2XGCA 3E5UA 5HDKA 1PO22 1DP0A 3CU7A 4FISA 3ZPOA 2PG4A 4O7XA 1JOBA 2H6CA 4GDFA 3C18A 4QLCU 4ESFA 2X6XA 3VBRB 1YS6A 1JT6A 2IXCA 3LEGA 4QXKA 1SFYA 1ND3A 4C9YA 1BC7C 1AR93 2LREA 2VNGA 4CU8A 2ZA9A 1YW9A 2WNUA 4FO9A 3MZHA 5F8PA 2J1AA 2O1QA 1W0TA 5BNNB 4AWXB 4LJZF 5T5PA 2L9NA 1W9FA 1BIAA 2YYOA 2NS0A 1O6UA 3V8LA 4N7UA 2YY1A 1PYVA 2OV7A 3M4FA 2A6WA 1KZHA 1BKZA 5F9TA 4WVMB 1NCQA 4IEWA 3NL1A 3VHPA 2XVCA 3G1OA 3T0DA 1OR7C 2XGXA 1JU4A 3HR9A 4IEZA 2L7KA 1A6IA 3HOUJ 3WQBA 4B3AA 2LTNA 3WP3A 3KZ4C 4LJHA 1K78B 4M3BA 4S05A 4JGYB 1WLDA 5C4WB 1CPNA 1ZGWA 1F2NA 2QQLA 1WD3A 1FC3A 2IZWA 2W94A 1AR91 2KR2A 2J7MA 5FDBA 2XR4A 1TNFA 2GN3A 4PK4A 3T4HB 5EF6A 3QYBA 4E8CA 2KHMA 2DBIA 2VOKA 4LMYA 3VFZA 1TVGA 3JRFA 3B7MA 2KA3A 1WCMJ 3KYLA 1RXFA 4IEUA 3PUIA 3BJAA 5FYZA 1SD6A 3KSCA 1SQ4A 4XILA 4YZ5A 1QJX2 2D1VA 5CZKA 1FTZA 4OI0A 2DAOA 4Q0UA 4PCRA 3B94A 2X5IB 1HRV2 5IWFA 2IA0A 4HSRA 2YBKA 4LORA 3MIGA 2D1HA 5JLVA 4RL7A 1HW5A 2YGLA 4E7SA 4D5CA 3BVCA 3B73A 1VIWB 1P2FA 5T5JA 1W0UA 4YVSC 4PUSA 1ULGA 2KXLA 3DLAA 1BVP1 1B35B 5FPLA 5EHDA 1HBXG 2PEXA 4ES9A 2F6CA 2DFCA 4DS0A 3FBYA 2O8XA 3WCRA 2JG8B 2WAAA 4AUXA 4IDZA 4BNCA 3T2QA 3LSRA 1QPIA 4S2HA 2JQ7A 1IV8A 4AFCA 5K7ZA 3V0AB 3A1YA 2K7LA 1ZRIA 3HQRA 3ATGA 3WEZA 3J7NA 2PLV2 4KYWA 3ZR6A 4OQ8A 2DW4A 4BOWA 2CYYA 2M30A 3JD73 5J1XA 3I64A 4YRDA 5FY5A 1L0OC 3Q9OA 3VV1A 2MABA 2X8KA 3O3KA 3D3AA 1ENXA 4WWCA 1G9AA 3S8PA 3VYRB 3VBRC 1VI0A 2A1XA 4F92B 4Q27A 1P4XA 4XW3A 4IEYA 3KT4A 1F4AA 2D97A 4A5MA 3OGJA 2EFQA 1LNWA 3ZMVA 3M2MA 5CYVA 4Q4Y2 3JRBA 1RUE3 1W8ZA 3ACIA 2HBUA 1MMNA 3HT2A 1W2OA 3LGRA 3GYDA 3T8RA 3BROA 4EJVA 1GZWA 3J7ZI 2BBAA 1K42A 1SDWA 2H0BA 4GALA 2Q1MA 1DGWA 2E5ZA 5E79C 3O8GA 1JI6A 2JTVA 3JD71 4LO4B 3TGNA 1OQ1A 3GNEA 4HA8A 3O1VA 2HOSA 3ENRA 3MFAA 1MJ9A 4JGYC 1AA7A 3KT7A 5C4WC 2R7OA 5HNFA 4FFHA 3BALA 3MQ0A 3B01A 2QZ2A 4LXLA 4DQAA 3VD4A 2HR3A 3CMMA 1TQIA 3UNGC 3DPLC 1JXNA 4BQ4A 5FYSA 1RUE1 3LEMA 3SYTA 5IOZA 1UOGA 4Y4YA 4HPKB 4XF0A 4PLMA 3OY8B 1PP7U 3CDHA 4PIZA 3SFIA 1ZRDA 2L9VA 3OGRA 1XOYA 1QIQA 1QJFA 3PVNA 2X5IC 1HRI3 2DBNA 3FXKA 4A3BJ 1K5JA 3U1XA 3IKVA 3BPXA 2KM2A 4OULA 3WDXA 5LASA 1E17A 1QVTA 5DAVA 1U5YA 3KIOA 1DLCA 2QVOA 4N7IA 2TEPA 2DT6A 1HSTA 2A3SA 5FR3A 4BHPA 2RDQA 5IJRA 3USUB 5G04L 4KUMA 4IEQA 3BUCA 2QEXI 4FX4A 3OUIA 4AR2A 3ABLH 3OSGA 4LBOA 3GZEA 3IC7A 3ZN0A 2QUOA 4E70A 1LJ9A 1K12A 2BDRA 2HZDA 4ATEA 3RNSA 3V7SA 2CGOA 1A6QA 1XNBA 1HRI1 4CDXB 3OOUA 4N53B 5IYBJ 1DIWA 4J01A 5DUVA 1Q3EA 5EFUA 5HCFA 2W48A 5FYBA 1PJRA 1I6HJ 3DUIA 4XPVA 4YYOA 4QSHA 3VODA 3ASOH 5KAFC 2UV1A 2FHRA 2RDSA 4HSTA 1D1AA 1BEV2 3BCAA 3GYHX 2BW3B 3RZJA 5LBBA 1MS4A 4O3MA 3MFKA 5FKMA 4A93J 3K75B 5JR2A 2OZUA 1CQ9A 3WDVA 5HLIA 4L0ZB 2EXHA 5DYMA 2QLZA 4L5EA 2ADDA 1GANA 1VQLI 2RM22 2OF7A 1TEIA 2XUEA 4R9DA 4CUCA 1RUC3 1IQDC 2LBFA 2QTWB 1V4RA 3HOWJ 2VTXA 2W1SA 1H30A 2NM1A 4DY5A 2DCZA 2GNTA 3TO7A 3NVCA 3J80Z 4CP2A 1ON1A 3WLUA 1X19A 3R0JA 5I93A 2WQ8A 3HL2A 4S04A 1OI6A 1SBDA 2XQXA 5DTDA 1D0YA 2KISA 2XG3A 4GA9A 2WC2A 1XX5A 4QU1A 4AEDA 5FK8A 2XHKA 1W28A 3I3DA 1KGSA 3QOPA 2PFWA 3PU3A 5LGUA 1DCSA 1JU3A 2W84A 2R7EB 5IK7A 4HVOA 4LR4A 4AYUA 5I91A 3JQXA 4CXYA 4LKFA 3B9IA 4DW6A 4IE4A 4QQLA 1D0HA 2R062 1SFXA 1RUC1 2QENA 3WP5A 1OKOA 4P5OA 2KIMA 1HB1A 4C3IJ 4YG0A 2DF7A 4LBJA 1J2XA 4XOPA 3AFHA 2DFHA 3IDCB 3GZTB 4QM9A 2QNKA 3PIOF 3B6AA 3RQIA 4A3JJ 3ZQHA 4H14A 2O61A 5TISC 2W92A 2CV2A 2VMFA 4A5NA 1FYKA 1IDZA 3EB7A 2YU9J 3G1LA 2EIDA 5LA2A 3TNPB 1JZ8A 4IE0A 4IESA 4UT5A 3GFJA 2FZ2A 3ML6A 2ZPXA 2EH3A 4MX3A 3VBOB 5ACA2 1R23A 1BW6A 4QT6A 1PZ7A 4ZDLA 1DYKA 4CDUC 3LFUA 4LOTA 4MH0E 3CUQA 4CUBA 4PFOA 2ZGUA 2ZNZA 1OCOH 1SBEA 1H8TA 4G7ZF 5EGOB 5DAPA 4EN7B 3M1EA 4ZS2A 1LRHA 4Y5SA 3HHHA 1E5RA 4IV1A 3A0NA 2JDYA 1WCUA 2EIGA 1YJ9I 2JDHA 2R7VA 2WAFA 2D40A 2JK3A 3AP6A 1RRJA 5L9RA 1RC9A 2JUGA 1W6MB 2P3IA 4I98B 4CDXC 4G6QA 4N53C 3GTPJ 1WLTA 2Q1FA 1PDNC 4YZ2A 3C2UA 3DTKA 3SQOA 2ADEA 4AZZA 5CADA 3F22A 1XE7A 4QDSA 4GKYA 2CSGA 4Q8LA 5FXZA 1XDUA 1ZAOA 5BNPA 2CGPA 1LGNA 2VBPA 1JYTA 4RGSA 1W8NA 1SEUA 1A78A 1UNBA 5FYIA 4L18B 3OIOA 5APAA 1IZ3A 5LATA 1PK6C 2ME0A 1KQ8A 4IKFA 1SLAA 2GDFA 1KS4A 2XBO3 2R7WA 1NK3P 4CXXA 3WU0A 3N3HA 2K85A 2PHXA 4XJAA 1FMD3 1VAVA 4XCAA 2WBKA 2BVLA 2Y31A 3KS7A 3LSEA 1OCTC 1VB2A 1QXPA 4FFFA 1MVEA 5A33B 4BE1A 3AZWA 1HLVA 2BEOA 3S5QA 3H50A 4WM7C 3ABMH 4LULA 5A7NA 3UGFA 4HT1T 4RA2A 4I99C 1RGSA 4MTEA 4A6DA 3ONQA 4BJ6C 3FXMA 4YW4A 3OSFA 2PXJA 1EY2A 2AC1A 2RS32 3Q8EA 5DG2A 1LEMA 1NAEA 4BZ4A 2HVQA 2XBO1 2WAQA 4GH4B 1JGSA 4UFMA 3AYCA 1AR73 3SXWA 1SVLA 4IOAF 1FMD1 3BT9A 5FZFA 4ESJA 2BJSA 1RKWA 3PU8A 4XQFA 4BMBA 3I56I 1RR7A 3DKXA 3DTIA 4ARYA 1GWKA 2X85A 3TOJA 4Y1UA 5JPMB 3GX4X 3I53A 3VDXA 1MW7A 2WABA 4XL9A 4DXRA 3JZVA 4Y1ZA 3GWZA 2XJTA 4ZPIA 4D7MA 2KIFA 4B29A 4XKWA 4FFIA 4QDRA 2DO7A 3SJMA 3VBOC 1IG0A 2VNRA 5EP9A 3RZGA 2LR8A 1LDJA 5LBEA 3ZOIA 3VZOA 4Q2FA 4BDYA 5HCAA 4LLNA 2Q5TA 3ZOBA 1XYOA 3AZYA 4AW7A 1Q8SA 3BPSA 4CEWA 1WLCA 5B66C 4BJTA 2GNDA 5FWEA 1LEBA 4S0HB 4BHBA 3SCFA 5E89A 1IAWA 1DGWX 3WGHA 2VD7A 1S7AA 1XMKA 5F27A 4M73A 5F6LB 5ILUA 1GUIA 2QQNA 2Z4FA 2E5NA 4XUTA 1ON2A 4IGOA 2XV4S 4RM3A 1UQXA 5DM7F 3VKOA 3WW2A 2ZABA 1LESA 4XUQA 4ASKA 4MGSA 4WXCA 4HW0A 3HTUA 1ZGJA 5DD4A 4BE2A 5HS7A 4K9SA 1UX7A 2KIQA 1FNNA 2YV8A 2W1QA 2HWC3 3LOIA 4U36A 3AG2H 4AOCA 3CCRI 1WWXA 2DCTA 5FP8A 2CQKA 3FXJA 1UD1A 5E1RA 4UWDA 3VPRA 1DP7P 2ZKZA 2WUHA 3OJBA 3TDUC 4KG8A 2ZGQA 5FKLA 1US3A 2VASA 1ETXA 4MADA 2ZGRA 4NB5A 4BM8A 3ZFEB 3FF5A 1K5MA 5DXDA 1OA3A 4R9AA 3IWFA 1WH5A 2VBBA 5FKNA 3JRHA 2MD0A 1X4PA 4XF1A 2VQ0A 3BTZA 3FBNB 2ZGKA 1AJKA 4MYEA 4O6JA 1Y56A 1JHFA 1YC61 4MGYE 1V54H 2CV6A 3CF6E 1F5JA 5FOJB 5D8AC 2I2SA 3BPZA 2HWC1 2YS9A 5J96B 3I58A 3RMXA 1GOFA 1IN7A 4UVCA 1LFUP 4XBFA 5J47A 2EK5A 2E53A 5IVBA 4MEYF 1W5TA 1MS1A 1IKQA 4GH4C 1HCRA 3L2UA 4OINF 3WV6A 1VAMA 4LHLA 1AF9A 1QJZA 1HQCA 1R1A1 3WDUA 4AHWA 1LHOA 3HGYA 2WQ4A 4IV3B 3V7RA 3PIJA 4YSFA 4WVWA 2WSVA 3N7MA 3H3UA 3AX4A 3IBMA 1RKTA 3K10A 1L7QA 1X7NA 3K9TA 1W6QB 4Y22A 1NA1A 3WTZA 1E2XA 2ARBA 1EPZA 3C2GA 2QBYA 1W2AX 3WHUA 2V72A 4PDKA 1RUOA 1V6IA 1EH7A 1NT0A 1RJ7A 1KU9A 2RGVA 2QJVA<