4R8HA

The role of protein-ligand contacts in allosteric regulation of the escherichia coli catabolite activator protein
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
200
structure length
200
Chain Sequence
b'DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-activated global transcriptional regulator CRP
publication title The Role of Protein-Ligand Contacts in Allosteric Regulation of the Escherichia coli Catabolite Activator Protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 60
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4r8hA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4r8hA01
1ON2A 4UXNA 4EROA 4GULA 2H6BA 1ZREA 4HV6A 5F64A 1TW3A 2GXGA 4M73A 2A07F 3KMHA 2FNPA 2QZ8A 1J59A 4QX5A 5E18F 4KWKA 2Q8KA 4UV8A 2YR2A 4IXAA 3F8MA 3FJSA 2OAZA 4Q0VA 3RNSA 1FP2A 2LF8A 1YQAA 1DGWA 1Y3TA 2IXJA 3GUDA 3SCHA 5D6EA 4ON0A 4HF0A 4MGRA 1U5TB 2EA4A 2ETHA 2LKPA 1ZZ7A 1TQMA 5ICCA 1WRJA 4OLLA 2VC0A 1F4KA 2FMLA 3ES4A 1PM7A 2PHLA 2NNYA 3RIRA 3QOPA 3O2PE 2E9QA 1IN7A 4AD9A 2P6SA 1RZ4A 1QZZA 2VBWA 2GH2A 5BQTA 1Z6TA 5D8LB 2VECA 1FI2A 4HMZA 3D5LA 3SMHA 2QLZA 4A0XA 4BNCA 5EZWA 4XSZF 1BI0A 3U0ZA 4MH0E 3MFKA 3CO7C 4HVQA 2MC3A 1MJBA 2EVXA 5J7MA 2R3SA 5BS6A 3OCPA 4G9YA 2PAEA 1LB2A 3GZ6A 2DPUA 4META 1B4AA 4MQVA 3BP8A 4MHGA 4IEOA 1Q43A 2STWA 1SD5A 5KHHA 5D5VB 1Q5OA 3PQKA 4JTOA 3HRTA 5JR3A 3WODF 2F5DA 2XAFA 4QXKA 3F8BA 2A68F 3KCCA 3J81K 5DYMA 2GC0A 3CEWA 3QRFF 5LGNA 1Z91A 2V09A 4XFBA 5E8IA 3KZZA 5JCTA 4LLNA 3BALA 4WXHA 1E2XA 4O6JA 4HA8A 3E5XA 3JAMK 2QYOA 3RJPA 1BOAA 3DXJF 3EJKA 3F8CA 1T2KA 3CUQA 3CUQC 3C3WA 5I0UA 4NB5A 2DT5A 2PA7A 1IXRC 2PJPA 1TBXA 4JVAA 2X4HA 2F5CA 1J58A 2OPKA 1RI7A 1YIOA 2HJIA 3NKTA 2VBYA 1SFUA 4ETSA 1CAUA 2HTSA 2EV0A 4HVOA 5FB2A 3KP4A 4IEXA 4KICA 2A6HF 1FBUA 2FEZA 2IXKA 1TQPA 3HOSA 2XL9A 4B29A 4KL1A 2MNGA 2M45A 1L0OC 3JW4A 1EH7A 2FOKA 3ULQB 4ENKA 1K79A 1LDDA 2RNJA 1I5ZA 2K7LA 3T1BA 4D0PA 3JSOA 3LWCA 5HS8A 3M1EA 1OD5A 2P5LC 2EV5A 4EJVA 5I91A 3ECOA 3TNQA 2ADUA 3WE3A 4I2OA 1IPJA 1KQ8A 1HW5A 1B9NA 1LEAA 2ZNYA 3HUGA 4XEZA 3H3ZA 4KN4X 2XUBA 1B1BA 3KP6A 1YG2A 2ACJA 2KIUA 2ZMEB 2CWEA 2L4AA 3CF6E 3RI4A 2ZNZA 2EFPA 3H7YA 2EV6A 3V8LA 4AQ6A 1TNTA 4GYGA 2WFPA 1J1LA 5L3CA 1QXRA 3TNPB 2PQQA 3LQQA 1MD0A 2YU3A 1ZZ9A 4KIFA 3QP5A 4R79A 4A6DA 1DZTA 4IEPA 2XLAA 2Z69A 2EA7A 2ZBKA 4A12A 4AQ2A 2ZFWA 2KJBA 2BYVE 2VODA 1IN8A 2P6TA 4L2NA 5E17F 2MLKA 4HX7A 5ICGA 2FE3A 3EQLF 2J5OA 1TLHB 3PFIA 1Z9CA 4HLXA 1XMAA 2IXLA 5D1IA 3L00A 3KE2A 5HLHA 2IXHA 4EGYA 4KYWA 1KGSA 2K4BA 1BIBA 2O3FA 4AIKA 4OIOF 4CDGA 1CF7B 1CAWB 4OMZA 3EQEA 3KETA 3FZVA 4KIBA 1G6NA 4N9HA 3HTUA 2UY9A 2Q2EA 2OA2A 2H27A 3QU3A 3WTTC 4QM9A 1YUDA 3HT2A 1ZARA 1FY7A 2A61A 4LUKA 5AVPA 4HN0A 4IEZA 5DV5A 5J3UA 1Q1HA 5EEGA 2DU9A 4XSXF 4WVZA 2IA0A 1YYVA 1FOKA 3N97A 5FQ0A 3KEQA 3S7IA 3HRMA 5ILUA 1F9NA 4N0BA 5E1ZB 2IC1A 4TV7A 4U0WA 3GFJA 2XASA 1FYLA 2K9ZA 1OYWA 2F5FA 5DUIA 1RUNA 4A5NA 2P5VA 3M8EA 3IWZA 2L4MA 2NYXA 3LA3A 3I71A 3WGGA 2K0GA 2G7HA 2ZKLA 3NL1A 1KU9A 1XSXA 3DPTA 5J8FA 2IT0A 2L01A 4P96A 5KHKA 1XCVA 3GO5A 3QP6A 1LR5A 1TQIA 4QM8A 2QJVA 2GA1A 3WW3A 2DBBA 1W5TA 2DCTA 4CO8A 1SEFA 4Z2YA 4IEWA 4CHUA 1RC6A 2QDRA 2RDPA 4RD7A 2FBKA 4P9FA 4P9UA 1NXMA 1HBXG 4YFXF 1R36A 5IT3A 3NVCA 4LA3A 5FPZA 4I02A 1EV7A 2MBFA 4Y13A 4YG2F 2MD5A 4MX3A 4OINF 3ACLA 5I8SA 1QZYA 4JV4A 1O5LA 3I53A 3RDIA 3S7EA 3G3ZA 4EVIA 2R7FA 3WTSC 1IZ1A 3JTGA 3T0YA 4Y17A 1W4MA 4FT8A 4AVPA 3FE5A 1PP7U 4S05A 5I8YA 1CX4A 4MTEA 3Q5FA 1J7KA 1BC7C 1NZCA 2H09A 4M74A 3TKYA 4GYIA 2YX4A 2M5WA 2Q30A 2FXAA 2Z99A 1KU2A 2QENA 4KN7X 2O6GE 3CJNA 3WGHA 4OMYA 2QQAA 4E2GA 3GFLA 2K27A 4HZFA 5FO5A 3KP5A 2FSWA 3IDBB 1OKRA 1ONVA 4I3PA 4HW0A 4RB2C 3K69A 2BV6A 4AVCA 5EEHA 1FBQA 2VBZA 3M70A 4Q29A 3V8JA 2KRFA 5L3BA 5LRSA 1W7PA 3CLOA 4MTDA 1ZRFA 1H1IA 4YIIA 2P4WA 1DUXC 2ZJ2A 1X3UA 3EHKA 3J81Z 1LVAA 4P9GA 5BXXA 2ZCWA 2W85A 2RV8A 4L5IA 2IXIA 1FZPB 1J3RA 4KU8A 5CVVA 4IRIA 4TLFA 1ZN2A 2FRHA 1XE8A 4K2EA 4Q0PA 2MHFA 3JAMZ 1SFEA 1OI6A 4UV9A 2DAOA 4Y15A 4WZCA 2Z5UA 3FHZA 4ASNA 3F3XA 1ZYRF 1B9MA 4KIGA 2YPRA 2GC3A 3ZMSA 3SCGA 1CAVB 5DUKA 1B59A 3E5UA 1KA8A 4PIZA 3BOQA 4HOBA 2F2EA 1Q3EA 3RKXA 4MZUA 4HF1A 1C0WA 3U2RA 4KA4A 1I1GA 4GGGA 4OOIA 3OD0A 2ZXJA 3CUOA 2O0YA 3G73A 3LOIA 3GF2A 3TO7A 2YX7A 3MEXA 5CJ9A 4DNCA 1MDMB 5FCCA 1RTVA 1JXSA 2XIGA 2EAAA 1K78A 3FXQA 3UKVA 4UBHA 4M9ZA 4G94A 4A0YA 1YW7A 2M30A 3AAFA 2VE8A 1PP8F 4CYDA 3GYHX 4KU7A 1BI2A 2V1UA 4HSLA 3QAHA 4EWEA 2PMUA 1BI3A 4HX4A 1JUHA 2K86A 4XFCA 3OOPA 3N4MA 3P9KA 4EM1A 5BPIA 1AOYA 1UPIA 4QWQA 3H9AA 3L2HA 2F5EA 1U5TC 3GFIA 1Z6RA 2V9VA 2EJRA 1T6SA 3FFQA 1YW9A 5FLHA 2FMYA 2D5HA 5CVRA 1UHMA 3KSCA 1RIOH 4O5VA 2OD5A 2VC1A 2UWMA 4I0AA 4KFCA 3ES1A 5J6XA 4UNOA 1CAXB 1ZG5A 1EP0A 3H1YA 2HYGD 2XKOA 5DEQA 1J75A 3M8FA 1D5VA 3BJAA 1O3QA 3EYIA 4PCQA 3ZN1A 5D5XB 3GEZA 3COAC 2DI3A 1LDKB 2OQRA 2STTA 5LRRA 3RKYA 4GXOA 4IHTA 3H1MA 3FZ3A 1ZG1A 5KVRA 2RKHA 2PFWA 3IC7A 1ZAOA 3GVAA 2WV0A 1FWZA 3KP3A 2QBYB 1BM9A 1SFNA 2HYFA 2A5YB 4LD5A 1HKQA 4HAMA 2ZKZA 1BC8C 1QPMA 3MAJA 2UXNA 4IEYA 4E2SA 4KWLA 4D7SA 2EK5A 2KIFA 2QQ9A 2XAJA 5C6CA 1SMYF 1ZZ6A 1D3YA 4EJUA 4ZU7A 3HSEA 4KMUX 1WSUA 1SAXA 4FAGA 3R6SA 2EFNA 2HR3A 3ZMTA 2FNAA 4XRFA 3RPUA 4U7DA 1I1SA 2XLFA 2CG4A 5FLJA 5FPXA 3CO2A 3OGJA 4U0YA 3QU6A 2C6YA 2KIMA 4EWDA 3T8RA 2H94A 1DP7P 3QPTA 5DDGA 4ESBA 1SD4A 2P5KA 2L3DA 2KXLA 5CVJA 3MZYA 4ZYEA 4KUMA 4BXUA 4LB6B 3H92A 2LSOA 5FD6A 1RL3A 3H8UA 1DPRA 3V4GA 5BOXA 1B6AA 4PIXA 4YNIA 4WX9A 2JZYA 1ZVFA 4P55A 2WTEA 3WGIA 2BBYA 1J3PA 3DEUA 3RYPA 4Q48A 1DPUA 2F4PA 4RB3C 2ETEA 1FYMA 3DV8A 2VOOA 1UD1A 4FBFA 3IL2A 2HGCA 2MPFA 3QPHA 1O7FA 4P5OA 4MGZE 2E7XA 5L3FA 2FBIA 5HLIA 1R1UA 1Z05A 1P92A 4FAHA 3Q9VA 1ZZ8A 3MDPA 4H0EA 4KMFA 2UYAA 5DD8A 2EFOA 3R0AA 2VN2A 4LULA 3HHHA 2ZMEA 2JTVA 3FM3A 4ZZDA 3FMSA 3GFMA 4ENMA 3E6MA 3EO6A 2HQNA 2L54A 1R23A 3BCWA 2COMA 1YS6A 3R4KA 4B09A 1LKNA 4RB0A 2GXBA 2GQQA 5F6FA 5L3DA 4L5JA 4M6XA 4KT5C 3FX3A 4JQFA 3ZMDA 3R61A 2D5FA 1P4WA 3VODA 2BEOA 4L11A 4BAYA 2K02A 5A2QK 3EUHA 4OIPF 1YHFA 3MCZA 3LA2A 3LWFA 3PQJA 3ABTA 4YRDA 2D1HA 1I27A 3HRUA 4G6DA 4E2QA 1R22A 2B9UA 5I8TA 4ENNA 4LFUA 2XRNA 2QNKA 1BN5A 5BPDA 5BPXA 2RC4A 4PDKA 4Q47A 4UVCA 3VHRA 2DLLA 4XF1A 2HEOA 4L0YB 4ZU5A 3I59B 2IVMA 4HV5A 5HS7A 1KYZA 1VJ2A 1CF7A 1HKTA 1LJ9A 3MZHA 2Y48A 1UFMA 2H6CA 4ZYGA 1IRFA 3DP7A 4I09A 4EJOA 4YYOA 4XFFA 5L3GA 1FX7A 2NS0A 3SCFA 1Z7UA 2PYTA 4QMAA 3HHGA 3LAPA 1H1MA 4RB1A 1FSHA 3WU1B 1QBJA 3ELNA 4F8AA 2PEXA 4ZZLA 5KHGA 1YWKA 1TTYA 3D0JA 3USSA 1DDNA 3HQXA 4YIFA 3E6BA 2VQAA 3CO6C 1NE6A 1Z1DA 1SQ4A 4XFHA 5TJJA 1FP1D 1LDJA 2HZTA 2EB7A 4HQMA 1QO0D 2KKOA 3WTVC 3GXOA 3JZVA 3HTSB 1SMTA 4BYYA 1WQ2A 1EH6A 3BWGA 5KHIA 5E16A 4HDVA 1ZG3A 2Q0OA 5JSRA 4A6EA 4EJWA 1KU7A 1SFXA 1HW2A 2CYYA 2V6CA 1GHCA 2C0ZA 5D4RA 5IT9K 1ZRRA 2VXZA 2B5HA 1FNNA 2V79A 3BPXA 2L02A 3JSPA 4XLNF 1WI9A 4WCGA 5AONA 4IVNA 3IHUA 4IF4A 2CO5A 3EDPA 4OIQF 1ZZBA 1O3TA 4LLGF 1HXDA 1WA4A 1RGSA 3EYYA 1LNWA 3ZP5A 2QVSB 1R1VA 4ZU4A 3F8NA 4BQAA 5D5UB 1UCRA 5LBQA 2OU2A 2W25A 2ZO4A 1D8KA 3HSRA 4RGRA 4UUVA 5DCMB 1OFNA 3F72A 2DK8A 4Q4ZF 2GU9A 5D5WB 4XF9A 4RGXA 4MGYE 2BGCA 2PI0A 2O61A 1U8RA 3TOBA 2PFBA 1YFWA 4RS8A 4HX8A 3SHRA 3LSTA 5LGUA 3DKWA 5H6QA 3K1NA 2XROA 4XFAA 5BUVA 1V4RA 3HOTA 5ICEA 2PAMA 2A6EF 2PN6A 1U12A 3IRQA 2FU4A 4LTAA 1XDUA 2XAHA 1R00A 3PNAA 1U3EM 3ISPA 1X8EA 1V3FA 4ENJA 1YW8A 4ZYDA 4LJZF 1TNSA 3M7GA 5E20A 4EMSA 5I0SA 5K1YA 5FQ0B 3NQOA 3E97A 4DQ2A 4O3MA 1OYIA 4ORFA 2JRTA 1J2XA 2B8MA 4HDUA 4YSFA 4NHJA 2V1DA 2A69F 3ERED 4UVAA 3I7DA 1KU3A 1MGTA 4LA2A 3HRSA 3FF5A 1GXQA 3TOAA 2FF4A 2IPQX 2QQBA 2QVOA 2XAGA 5ILSA 1FLIA 4LLLA 5HVQC 2NNNA 4LGWA 2HQRA 4IEUA 1UHWA 2G7UA 4A0ZA 2D2WA 3SZPA 3PVBB 5F1RA 2UZKA 5DD4A 1V70A 3BU7A 4OIRF 4M6YA 4Z82A 4PJYA 4AVAA 5KBFA 5HDKA 3RZZA 1MJ9A 5E1XA 3F23A 3FWEA 3J80K 4HSJA 3J7AO 3WTZA 1DGRA 1S8NA 1CAVA 4U88A 3TQNA 4UVBA 5HI0A 1IXSB 4GCVA 1G3WA 3MWMA 3O6BB 4HYEA 3FXUA 4LK1F 2P7CB 2BNNA 2PTMA 2XL7A 1W7PD 4L18B 3V7CA 3HSFA 3MQ0A 4QGMA 1FSEA 4CICA 1ZZCA 4X6QB 1JHFA 2ISYA 2B0LA 3ZDSA 4ESJA 3BJOA 1QY4A 1IW7F 1XGOA 5ICFA 1MDMA 1GXPA 3W6JB 2Y0MA 1XGNA 5K5RA 3U1DA 3I58A 4UHTA 5JSOA 1H9GA 3ZMVA 2IA1A 2WC2A 1BBYA 1H9TA 4IETA 5FLIA 1J5YA 1BI1A 1P6RA 1FC3A 1YFYA 1YLLA 4I0BA 3SZTA 4K8FA 3I4PA 2E7WA 1R1TA 4EQQA 1F1ZA 3B02A 3GZ5A 2Q0AA 5LHIA 1QWRA 4KWJA 3JTHA 2CAVA 1Y9QA 2GC1A 2HKXA 3SXWA 1FBSA 3GBFA 1P2FA 4QGNA 2Z33A 5K8SA 3MYXA 1F5TA 1W7PB 3KLOA 1CAXA 2UYBA 1OPCA 4F7ZA 3KGLA 2OYZA 3FMRA 1MKMA 4XFIA 5FDBA 1ZRCA 3EETA 4BH9A 2XLGA 3E3VA 3GYDA 1IPKA 2ESNA 5E8GA 1NE4A 1J3QA 1D8JA 1TQ5A 5JAXA 3VEPA 2QBYA 5CLSA 3TO6A 1U5TA 2DTRA 3S0MA 4LB5A 4HLTA 1JE8A 5FD5A 2HFHA 3Q9SA 3R60A 2MH9A 2W84A 2X0LA 5KK1A 2O1QA 3H50A 4OFGA 1JGSA 1XSVA 4JBAA 2DQLA 2O03A 2BE5F 4OU0A 5ED4A 2HKOA 3SQNA 4G7OF 1H0MA 1ON1A 3WTYC 2J5PA 5D6FA 4HF2A 1X8MA 3L9FA 2Y0OA 1XD7A 3ROUA 4ESFA 5CADA 2E1NA 2UY8A 2ELHA 2W57A 3W6KB 2I45A 3LAJA 2VOPA 4QLCU 3GWZA 3K2ZA 4EV0A 3E5QA 2CW0F 1K78B 4I98B 3NSTA 3WU0A 3CJXA 1ZGAA 2PAKA 2RGVA 3IRRA 3E6DA 2RN7A 3OV8A 1IUYA 2NAZA 4X6RB 3RTRA 3D82A 5IT9Z 1NYWA 3CDHA 2KJCA 3QACA 3RPQA 3DF8A 4KNYA 1JHHA 5I0RA 4A2UA 3ZN0A 4EJTA 4R1HA 5LLQA 2GC2A 5JI6A 4LG0B 3H7JA 2GAUA 2W24A 1P4XA 4Z07A 4N9IA 5JSPA 2IRFG 1MZBA 1S7AA 3UKNA 1FYKA 1RUOA 3U10A 3U9GA 4BHCA 3RKWA 5CVUA 1FT9A 3GLXA 1PUEE 4KDPA 2EWNA 1FPQA 1VR3A 4FX4A 1X7NA 1T38A 2IP2A 3F22A 3ELKA 3L2CA 3KP2A 2G9WA 4IEVA 3BPZA 3BPVA 4JTNA 2OA4A 3BROA 5AIQA 2VT2A 5I93A 4YARA 1XDSA 4R8HA 3LAGA 3IIAA 1HKSA 4RGSA 4QGLA 1RNLA 2OZUA 2OZJA 6PAXA 3UKTA 3HT1A 1ZHFA 4I01A 3RYKA 1STZA 5LGTA 3WTWC 1U6GA 1QXJA 3C18A 1QNTA 3ZQ7A 5K5QA 3WW4A 2DW4A 3V7RA 4O9EA 3H3UA 4G8XA 3OTFA 4O9GA 3WW1A 4MGKE 1CGPA 2GWRA 4XETA 1KYWA 3SFZA 5C8WA 2OQGA 3ZMUA 3C3VA 1TW2A 3I59A 2QWWA 4AIHA 1GQHA 1O3SA 5L3EA 4J1XA 3T5XA 4M9XA 2IXCA 1ODDA 1NHAA 2DK5A 1YS7A 2M8EA 5I0TA 5FLXK 3VB2A 3K1MA 3VFZA 2XGXA 3U11A 2XVCA 2XKPA 2IJLA 3M9AA 2QCSB 4MUVA 2Q1ZB 4HVRA 3K0LA 1R5GA 4AVBA 3J80Z 1ZLKA 2N7GA 2ISZA 3K9TA 3NJZA 1O3RA 1IN6A 3MPBA 4HN1A 3EBRA 1ZGJA 2AXLA 1K7AA 3T8TA 1ZH5A 4B8XA 3BZ6A 1EPZA 3S2WA 1XN7A 4U0VA 3DL3A 4Q5SF 2VONA 1PMIA 3CTAA 2UXXA 1GQGA 4EWAA 3WW2A 2P8TA 2DO7A 1S6LA 2VT3A 4HBLA 1R7JA 3L09A 2P7VB 2CQKA 2OBPA 1CAWA 2CGPA 2PMHA 3BDDA 1FXZA 2FQ3A 5LEJA 1R5HA 4BHPA 5J48A 5ILVA 3CUQB 2PHDA 1WGPA 5CVIA 4PIYA 4PGGA 4L9JA 4D7TA 4IEQA 3TDUC 3IKVA 2JSCA 4RGUA 4BHBA 2FA5A 3LQRA 3DFGA 4IPAA 1IN5A 3OF1A 4AIJA 1LEBA 2FQPA 1U2WA 1CAUB 2RVCA 3D0SA 4LMYA 3IBMA 1EH8A 2PBIA 4RAYA 1W5SA 1J0RA 5FFZA 4MEXF 4XFGA 5JVTA 1PDNC 1I6XA 5DCFA 2Y75A 3WTUC 1USSA 2DQRA 2XAQA 1IXCA 1QGPA 5DCMA 2D1VA 1WLTA 5E1WA 1SD7A 1HSTA 2P17A 3KGZA 1WKMA 3BY6A 2JPCA 2XHKA 3LZZA 4CXFA 2TDXA 2QUFA 3B73A 4L9VA 1T39A 1J9IA 3KFWX 4WXDA 4PZJA 1E17A 1S3JA 3VOEA 2HS5A 3SXYA 3C1DA 3NW4A 4AXOA 2VE9A 1XRUA 1YLFA 2LNBA 5BY5A 1U78A 1ZX5A 4L9TA 1L3JA 5ERIA 1O4TA 1OMIA 5FFXA 3WG9A 1IAWA 1HQCA 4H7LA 3NEUA 4LLOA 1LRHA 2ET7A 3V7SA 1ZRDA 3CLPA 2DFIA 2RQPA 4IRHA 2D45A 2YSRA 3H1WA 3ZMZA 4M9SA 2GZWA 2BNOA 3K1PA 4WF2A 4J1WA 3TGNA 3IWFA 3BB6A 1UCXA 4UBGA 5HOOA 1S29A 3V8KA 4ZH4F 4XF4A 5EFUA 4HQEA 1QQIA 1AWCA 2A3SA 2D40A 3IKTA 1UIKA 3LA7A 5H20A 1VTNC 2O8QA 1GVJA 2WWYA 2Z3YA 1REPC 4MV2A 4S04A 3F6VA 5KHJA 5BMZA 4IHSA 5JHUA 2PG4A 4FHTA 4L9NA 2HWVA 3F8FA 4HBNA 1ULYA 3P9IA 5HDGA 1G4DA 2EA2A 3TDZC 5J8CA 1Y0UA 5H6RA 1L3LA 3FHIB 4IERA 4XF3A 2PQ8A 4AWXB 1S7OA 3F6OA 3REOA 4A5MA 4EM2A 4WBBA 3O14A 4G7HF 1HSJA 4FX0A 2HOEA 3GW2A 4XLPF 1EY2A 3KP7A 4U7BA 4NQWA 5LHHA 3O3KA 2CAUA 3WTXC 1O5UA 5JR7B 4NVPA 1A04A 5HDNA 2O8XA 3G7DA 4MEYF 4ONUA 2CV6A 3PLQA 4BIFA 3ETQA 4WK8F 4Q0SA 2LF7A 4MNUA 2H0VA 4DINB 1XB4A 4R52A 2MA3A 1K6OA 3DN7A 1XCBA 3TO9A 2HDCA 4Q0UA 2ESHA 3KZYA 1UIJA 1OYYA 1O57A 3SHFA 2M1BA 4I7HA 1YFHA 2DPDA 3BJ6A 2GA2A 5BV6A 3KLNA 3HIFA 1DZRA 4EGZA 4GO1A 4RAZA 5AIPA 4ZYHA 4L0ZB 4LEJA 3ABUA 4XBFA 2LDUA 1XGMA 1IRGA 3R0JA 1G3TA 5D4SA 5T3NA 2BNMA 1YFUA 4E70A 3ST7A 1OR7A 4EM0B 2Z9OA 4YFKF 5CYVA 2AS5F 2QM3A 4G7ZF 4M72A 1XE7A 4YFNF 2ATFA 1MJAA 1P4AA 1ZNPA 1G3YA 1G3SA 1EYBA 5HLGA 2GIVA 5FGMA 3M3IA 3C7JA 4MQ9F 2D93A 2JPBA 5FLXZ 1VP6A 4UXAA 3IDCB 1O7LA 1USTA 3I5UA 3HYIA 1R58A 3P9CA 1BJAA 2EFQA 4IESA 3ZPLA 1T0FA 5A2QZ 1UW8A 1YO5C 2PLYA 3E6CC 2NRAC 2IA2A 2V1XA 5JFRA 2E1CA 3F21A 4M71A 3WE2A 3I54A 3L7WA 1IF1A 5LHGA 2MLGA 3DPLC 2JT1A 5K5OA 2CSOA 3FM5A 1WWXA 4WXCA 4Q0QA 2HTJA 2Q4SA 2XV4S 2M87A 1HW1A 3RYRA 5HS9A 2Z2SB 1XSDA 2IW5A 3LFKA 3KEOA 1IN4A 1T98A 1ZLJA 1KQ9A 2K4JA 3P7NA 4IRGA 3DQVC 4LUMA 5D8KB 2VPVA 1BIAA 3ML6A 4WWCA 4MGIE 1LQ1A 3NRVA 3CL1A 4LG0A 4G6QA 4CZZA 2CFXA 3FMQA 1XMKA 5CU1A 1XGSA 2R7DA 2VBXA 3I0TA 5LEKA 2FBHA 3I64A 2ET1A 1YFXA 5E1RA 3GX4X 4XF0A 5TRDA 1SD6A 1YTYA 4LK0F 4CGZA 2OZ6A 1KQ0A 2EFWA 4JK1X 4PGHA 1UB9A 4IJAA 4HLYA 1X82A 2MH2A 3ECHA 3FXRA
chains in the Genus database with same CATH superfamily
3C2BA 3TB0A 4GULA 1DGRN 1CR7A 4YEJA 4HV6A 1L7QA 5F64A 1IKPA 5A32A 1TW3A 2GXGA 1RUD1 2DBNA 2FNPA 2QZ8A 1YJKA 5A3UA 3T2QA 2Q8KA 4M3GA 2DJNA 2DA3A 1LOCA 3RNSA 4X6AJ 2BVLA 2XSJC 3GUDA 5D6EA 4HF0A 4XMAA 3QOEA 2ETHA 4UB6C 2LKPA 4NMIA 1ZZ7A 1TQMA 3N9NA 1WRJA 3BN6A 4QIWN 4FFHA 2VC0A 1F4KA 2FMLA 1PM7A 1S55A 3PVEA 1K4TA 4YW6A 2J1RA 1T08B 1IN7A 3BR0A 2P6SA 1DQ4A 4V2FA 1ETQA 1QZZA 2GH2A 3FFZA 4E8DA 2VECA 1T2XA 2YB7A 1KD7A 3D5LA 2CGOA 1LODA 5CBLA 3KIOA 5FXZA 4XSZF 1BI0A 3U0ZA 3CJRB 5M3FJ 3MFKA 4MH0E 4WVVA 4JKMA 3I3MA 3ZFGB 1QDOA 2R7UA 1FV3A 1RKWA 4MQVA 3CHXA 4LO7A 1IDZA 3AZZA 1Q43A 1VQNI 3LSMA 2STWA 5F5AA 1BVP1 5D5VB 1Q5OA 3PQKA 3FKIJ 3HRTA 1OC1A 1YQCA 5JR3A 3WDYA 2HNHA 3T2TA 1LGBA 1IG7A 1Z91A 2V09A 5EYXA 3U1XA 5JCTA 1G9BA 4LLNA 3CC7I 3VBFB 4O6JA 4HA8A 4BBRJ 1B8IA 3OYHA 1BOAA 4GWNA 3S57A 1ETXA 3LSPA 1HRI2 2N8GA 2FX0A 3C3WA 1FEXA 5I0UA 2DT5A 2ARXA 1Z7S2 1HC8A 1OOPC 1TBXA 1UY3A 2X5IA 2F5CA 1J58A 4YLZA 4BXSV 2GNTA 1HB2A 4DOZA 3OEBA 2HTSA 1FOD1 1MEC1 3NNLA 4IE5A 2QKDA 1AF9A 2JVGA 4KICA 4Y20B 4Y33A 5DM7F 4GZ9A 1EAH1 2H0BA 4C8DA 4BKXA 1K79A 1WJCA 1I5ZA 2CQQA 1XX5A 3JSOA 3KS7A 3M1EA 1WCMJ 2P3JA 3CF5F 1NG0A 1UZYA 4LHSA 1HW5A 1SZBA 1DU6A 4ITVA 4XEZA 3H3ZA 2KIUA 2ZMEB 1A78A 3KT1A 1HRI3 2RV9A 2WFF2 1ZBA1 5FLVA 1X1CA 5LK7B 1Z7S3 1ZA4A 2QA4I 5HCFA 1J1LA 1L7LA 1DIWA 2PQQA 3ZIXA 1MD0A 1YIPA 4KIFA 1RUH2 2BGPA 1DZTA 3GJAA 2V72A 2XBO2 2XPWA 1JU4A 1JYXA 4A12A 3CZUA 2ZFWA 2KJBA 4WV8A 2W46A 3JBG2 4L2NA 4BE0A 1SBDA 3UK9A 2ELJA 2I8DA 1XS9A 3ZN5A 3OYGA 1HLVA 1XMAA 3VBOB 1QKQA 1Y7BA 4K1ZA 2X29A 1KGSA 2A73B 3C7HA 4IDZA 1V5FA 4OIOF 1CAWB 2BY3A 4URAA 3HN3A 5FXXA 1G6NA 4N9HA 3HTUA 2UY9A 1BBT2 2WFF3 2RDNA 3ZKYA 3WG7H 3HT2A 4FCAA 1FY7A 2RS31 4IEZA 5DV5A 5J3UA 2DYRH 3THPA 2Y6LA 1EV13 2HOTA 1RUH3 3KCXA 4WVZA 3N9PA 1FOKA 5JZGA 3F9KA 3KEQA 1KFUL 4XUPA 1GOHA 3IPVB 2ZFUA 2XBO3 4LMFA 3IMNA 3N9LA 5EF6A 5EIYB 2C26A 3GTKJ 2IC1A 3ACHA 4U0WA 4A5NA 3JBG3 2DU1A 4AHXA 1CQTA 1S9HA 1KONA 2QTWB 1RXGA 4M3CB 3A7QA 3OYEA 5CPRB 4OUSA 4PSWA 4QX1A 2A6WA 4PT6A 2VQCA 1G7YA 1ULGA 4CU9A 1Y43B 1SVLA 4OAZA 1LR5A 4PQQA 2DMUA 2Y34A 4OZXA 2HQAA 2WY7Q 1CX1A 2WZ8A 1BBT3 2VASA 3ILFA 3NAPA 5FJKA 2LY1A 2LTNA 4RD7A 1YC61 2CU5A 3POFA 4XXAA 4S2FA 3CDIA 2B39A 1RUE1 5A3MA 1NXMA 3GCMA 4IE4A 5A7PA 3HPNA 4MXVA 3UNGC 4QPIA 5GP9A 5D8AA 4LA3A 1EV7A 2MBFA 4DY3A 1OF3A 4ISRA 4PSXA 4MX3A 2EF6A 1DP0A 1UN1A 1C1FA 4M01A 5I8SA 1QZYA 3POYA 2Y30A 4JV4A 3RDIA 5F6LB 3S7EA 5C5TA 2GH8A 4LITA 4MO3M 5C4WB 1KXGA 2JDNA 2QQMA 4UUTA 3WP5A 5I8YA 1CX4A 1JHNA 4IGOA 1LOFA 1RC9A 4TXWA 3VKMA 2H09A 5APAA 4UW4A 3TKYA 2ZSIB 2K85A 1TWCJ 2YX4A 1LPQA 2Q30A 4FQZA 2VOTA 4FETA 1KU2A 1C8M1 2QENA 2GP5A 4AFBA 3CJNA 3OGGA 1DP3A 1OURA 2EIMH 3GFLA 4CPBA 4HZFA 4P9LA 5FO5A 1TMF2 4I3PA 3MV01 4BDVB 5EEHA 5GADJ 2RR11 2VBZA 4LO4B 3Q8BA 2WWUA 2CUZA 4RR3C 2HI3A 5L3BA 1PVC1 4YIIA 1QA6A 1ND3A 3ZFFB 4AEKA 4RGAA 3EHKA 1E3HA 1LVAA 2RMU1 5FLMJ 2OPWA 4NAMA 4GWJA 4C90A 1UNBA 4HKWA 2R071 1ZN2A 2FRHA 3IAS2 2WIIB 3WDWA 4Y15A 2FCUA 3FHZA 1QNYA 3O1RA 3OOXA 2WAEA 3MKLA 2OXBA 2P3KA 3ZMSA 3SCGA 5DUKA 3DYPA 3MFCA 2JJ7A 3ECQA 1BK1A 5M5YJ 3FBNB 2F2EA 1TMF3 3QYFA 1MS4A 4AGRA 4II3A 4OHWA 4OUMA 1TZLA 3U2RA 1I1GA 1TC3C 4GGGA 2ZXJA 1REFA 1T6GC 4ZKTB 5I0DA 3LOIA 1IHMA 3IIIA 1W99A 4A7KA 2VVFA 2KA3A 2VMCA 1SCSA 2QQVA 3KVBA 1MDMB 1WVRA 1K78A 3KYDB 3OUJA 3UKVA 2B45X 1WW7A 3BYWA 1F43A 5JWPA 1OQ1A 3BI3A 3ZO0B 1PP8F 1WJ5A 4XQFA 3QAHA 3B93A 3A02A 1WH5A 4HXCA 2K86A 3DBHB 3DYMA 3N4MA 4EM1A 5LBFA 2LD5A 5JDBA 4FPEA 1VBE1 3QH6A 4YW5A 2E34A 5EYYA 2EJRA 1T6SA 4JGYC 5IYCJ 3FFQA 1YW9A 1BA5A 5CVRA 4QB2A 3ASIA 1BW6A 2QBXA 3KSCA 4CEWC 3ON7A 2EZKA 2OD5A 2VC1A 4Y22A 4A45A 5FO7B 2HYGD 3BTIA 4GMP1 1J75A 3AP6A 5BNGA 2O7OA 3S1MJ 1TNRA 3PU8A 3EYIA 2ZX0A 1X3ZB 4C91A 1FNYA 4J25A 5C3RA 2PHUA 2AXTC 2MSYA 4XOGA 1YEWA 3LSGA 3VDBA 2ZX4A 4GXOA 5F27A 5GZDA 3WCSA 2Q5TA 3IC7A 1ZAOA 3DEEA 2WV0A 5FP9A 4XC9A 2HWC2 1WLCA 2LBFB 4AEMA 2A5YB 5A6QA 3OY9A 2NVTJ 2A5ZA 4F55A 3J4UH 5ERLA 2EIDA 2UXNA 4X8PA 3OBTA 4M4PA 4ZHNA 2KIFA 2QQ9A 2OIIA 4B8EA 2XAJA 4II2A 4CP0A 1D3YA 2JB8A 2YROA 1WSUA 3R6SA 2EFNA 2K9MA 4XRFA 2R1DA 1DGWY 2XSDC 3K10A 4HNTA 5FLJA 5FPXA 1Z0XA 1VI0A 2KIMA 1C5IA 2H94A 2ZAAA 5IVYA 3THTA 1DP7P 4K20A 1H1AA 5EYRA 2E7TA 2P5KA 2KXLA 2E60A 2Y26A 1GKBA 4BBSJ 1K45A 3H8UA 4S2DA 1RYYA 3HR9A 3VZMA 2V5DA 2HWC3 2QQJA 4WM8B 4XJZA 4MGSA 4YM0A 4YNIA 3O12A 3U37A 3B5LB 4P55A 4IHVA 2WTEA 1VMFA 3RYPA 4Q48A 4DYRA 2F4PA 1HJFA 3HPGA 1VAVA 4BQ5A 2HGCA 1O7FA 3ACFA 4MGZE 5A80A 2FBIA 5JLXA 2HVSA 2D6PA 3S6PA 1P92A 5ABJC 1RIRA 2PHWA 3BQZA 2AYHA 3Q9VA 4HSRA 3MIEA 2HWF1 1MNDA 3GTJJ 2UYAA 2EFOA 2VN2A 1VQ8I 2P6HA 1STMA 1RUD2 1OOPA 2HEVF 3AB0A 3FMSA 3VHOA 3A0KA 3GFMA 4J19A 3EO6A 2L54A 2XAUA 3VBSC 2IGMA 4BQXA 4B09A 1PIV2 1E5SA 1XU1A 2WYSA 1HQWA 3SYTA 2R30A 4L5JA 4M6XA 1W5CC 4E7IA 4KT5C 4JQFA 3AFKA 1RETA 5A2QK 1YHFA 3EUHC 4FE7A 3LQCA 1W36C 3WDTA 1ULFA 1XC5A 3ABTA 2M34A 4D6SA 3AG3H 3FXMA 1I27A 5FZLA 4YZ3A 2B9UA 1MS9A 4LFUA 2WJSA 3IAQA 5A3PA 1N25A 1NX9A 5FYIA 2RC4A 2R1BA 4XF1A 2HEOA 3VV1A 2R16A 1TWFJ 3K70D 3RZJA 4P14A 2O14A 3I4NJ 1R4NB 3MZHA 3K4CA 1UFMA 1RUD3 1H2MA 4F3JA 2E2JJ 3DP7A 1BHGA 3SLIA 1QJY2 4EJOA 4XFFA 4DZJA 1W8FA 1FX7A 3HM5A 2A3XA 3SCFA 1PIV3 5BNOA 3DLLF 4HL0A 4QKNA 2PYTA 1H1MA 2YZ4A 3WU1B 3ELNA 3ZYIB 2G9ZA 3CKHA 5K7HA 1W3VA 1DGWX 3ZM8A 4TSVA 3USSA 4XILA 5FPUA 2W52A 5E79C 3E6BA 2BY1A 3A4CA 4GD4A 1W2UA 2YBSA 4UFKA 4CP9B 3JRAA 3ZKUA 1JZ2A 3LIGA 4JKLA 3DGTA 1SFPA 4GFBA 1DQ5A 1WQ2A 1MQTC 1EH6A 1MBJA 3PJQA 4HDVA 2M4KA 2FBEA 5A7OA 3CJQB 5DS9A 2CTVA 2WNVC 3C2GA 3HNMA 4A6EA 4EJWA 3SH5A 4Y4YA 1QJY3 2C0ZA 5D4RA 1GNZA 1ZRRA 3PUBA 2WAQN 5HCHA 5IFPA 2UV1A 2L02A 2O8OA 3JSPA 1WI9A 4DXZA 1FOD2 3MIDA 1MEC2 2OTLI 2QSFX 2VTFA 4B44A 1IS5A 2ZACA 3BCBA 1WA4A 3EYYA 1LNWA 1EAH2 3K51A 3ZP5A 4H4KC 1DLLA 1R1VA 4ZU4A 5D5UB 2VCAA 4AQTA 5LBQA 2GOXB 3SEQA 3NV1A 2W25A 1D8KA 3HSRA 1I9RA 3KV9A 4UAPA 5K0UA 1OFNA 3PTRB 1WFXA 2O61A 4I6ZA 2PFBA 1OVPA 4C3HJ 2EH3A 4HX8A 3UR3C 5FRNA 1GR3A 3ZIWA 1ZBA2 1H4HA 4RLQA 1MPXA 2W4SA 2A6EF 4NHXA 4TN7A 3HOVJ 3IM0A 4AR2A 2FU4A 1XDUA 2Q2EB 2LH9A 1AL22 2BDRA 3ISPA 1X8EA 1FOD3 4NN0A 2WO7A 3SEZA 5DM6F 4MVTA 5J4VA 4ZYDA 3CZJA 1TNSA 3SH3A 2NLRA 5K1YA 2Q8CA 1EAH3 1IS6A 2BVVA 1VLNA 1XPXA 2B8MA 4JCKA 4YSFA 2GIZA 4DJAA 2V1DA 3H42B 3I7DA 3UV9A 4LA2A 4B3NA 4V1PA 2J1EA 3FF5A 3WP6A 2QQBA 4IOCF 1FLIA 5HVQC 1UHWA 1B72A 4MO7A 2UZKA 2YC4A 5EG0B 3KB5A 3URFA 5T55A 1Z21A 3ZN6A 1DFQA 4QTRA 4M6YA 4XHBA 2TRTA 3I2DA 4ABZA 3FWEA 1FMD3 1IUFA 1AL23 2VTXA 1CAVA 3KQ4B 3ZXAC 2Q8EA 4Z2AA 1WBLA 4FPFA 5DAWA 1IXSB 3MWMA 1PUFA 3H36A 2VO5A 3FXUA 3VHNA 2VBPA 1GP5A 2PTMA 4NPMA 1W7PD 4RAGA 2M4GA 5DDJ3 5FZ0A 2YHJA 3W2WA 1ZZCA 4Q4Y1 2IS6A 2B0LA 1V6IA 4I0WB 3ZDSA 4AF9A 1XGOA 5ICFA 5E3LA 3T1MA 3VBRC 5FREA 3LSJA 3O8HA 2W1SA 5K5RA 3I58A 1LHWA 3HBKA 2VU9A 1H0BA 3LSKA 3KV6A 3OIOA 2BXZA 1P6RA 1NCRC 1WW4A 1YLLA 4KMQA 3I4PA 1R1TA 4BY1J 1I39A 2NP0A 2Q0AA 1S2BA 4RQPB 3K4JA 3FLRA 5L9RA 3J7LA 3JTHA 2WNUB 3V0BA 1KS4A 3IAM2 2GC1A 1YJNI 1ULEA 4RLFA 5FKMA 3TOJA 3O5SA 1IQDC 2E5ZA 3AVRA 1US3A 1WJEA 1UZCA 3OSFA 2KL4A 1W7PB 1Z78A 2UYBA 2DA1A 1BJQA 3THDA 2O0OA 3HQRA 1I3QJ 4XFIA 5FDBA 3MO4A 1ZRCA 2HZDA 3EETA 4QPQA 2PX9A 1C8M2 1IPKA 3GTLJ 3MV11 1LFUP 2ESNA 5J37A 3KF5A 2YS9A 2QBYA 1ZA7A 3TO6A 1RUG2 4Y5SA 3D1NI 2E26A 5FOBB 3S0MA 4JGYA 4YVWC 1JE8A 2HFHA 4DS0A 5KK1A 3H50A 5L7OC 2Z79A 4JBAA 4Y1YA 5ED4A 3BR2A 2DVFA 4YVSA 2RMU2 1MBKA 2J5PA 2WZPP 1JT6A 3UKGA 4UUSA 2L9LA 1W6OA 1WI3A 1W2AX 4MSVA 2CNAA 2XQRA 2E1NA 3MIHA 1VF9A 3W6KB 4CDQB 5IVVA 4QLCU 4AL9A 2GXAA 2A6VA 3AG4H 1C8M3 3LEIA 3WU0A 3VZOA 2JK3A 3CJXA 1ZGAA 2PAKA 3IRRA 3E6DA 4UFLA 3OV8A 3NMBA 4X6RB 2ZGQA 3G4SI 3RTRA 3D82A 3OYLA 4RM3A 3PIGA 1NYWA 1O4ZA 1RUF2 4U2AA 2B7EA 2AR6A 1RUG3 4KNYA 2JA2A 1Z0HA 1NCQC 1ZK8A 2GC2A 3WD5A 3H7JA 2ZMNA 2VQLA 2GALA 4HNUA 2GAUA 3ZPYA 4EZHA 3T09A 4FP3A 2L5QA 2BHZA 4NIAA 4C1XA 2VBBA 2DFBA 4QDQA 3AKTA 2RMU3 3CD6I 3OSGA 2LTPA 1DHKB 3LB9A 3RKWA 2WQ8A 4XIKA 1VQ7I 5GAEJ 4BEHA 1X7NA 5HXMA 2NXNB 3WCRA 1QJFA 3VHPA 3ELKA 3S3NA 2G9WA 3OS2A 4R9CA 5A32B 5LW9A 4UOJA 3H3VK 2WN3A 3H8RA 2XH6A 3BPVA 2DA7A 3BROA 4XNFA 5EJ1B 3KZ4C 3LAGA 3BGAA 3IIAA 1RUF3 4QGLA 1VBE2 1M1EB 3HT1A 3CDLA 1ZHFA 3TP3A 5LGTA 3WTWC 2R7ZJ 1XPWA 3LPGA 4X1EA 2L7KA 2C9AA 1OCOH 3FXOA 4Z92B 3RS6A 5K7ZA 3C18A 2ORXA 3VD4A 3LDRA 3ZQ7A 1XMXA 3R4UA 2DW4A 2HXOA 4O9EA 5IK5A 4CCJA 3JREA 5ABJA 2DDAA 1HXS1 3WW1A 1CGPA 2V1NA 4HG2A 3AL5A 1B09A 1KYWA 2ID6A 5C8WA 3GNEA 3M3EA 2OQGA 5DQ0A 3ZMUA 4AK3A 4AIHA 2DMPA 1GQHA 4N43C 1O3SA 5FUPA 3PL0A 2R6QA 4BK4A 3BG7A 4N90A 2DK5A 1SDWA 2JDPA 2VQHA 2M8EA 2EXIA 3VBSA 2V9KA 3ZXLA 1FJLA 2FDJA 3CQZJ 5IUQA 2QCSB 4MUVA 4HVRA 1R5GA 4AVBA 3J80Z 3K9TA 1X2MA 1IN6A 4ITCA 2ZGSA 1CPNA 1VBE3 1QJEA 4CCCA 5AVAA 3C7EA 4XM3A 4QAWA 3N3HA 5AFBA 5HV0A 3ILNA 2WLQA 3BZ6A 3IDAA 2E7QA 4U0VA 1NA1C 3RWNA 4Q5SF 4UFMA 2JKXA 5C4XJ 4BS9A 3KVAA 3EUKL 1RHI3 2OBPA 5J09A 4XUNA 4JDNA 1B8IB 2JICA 2FQ3A 1R5HA 4FPHA 1WHUA 4RS5A 4WVMB 2KPMA 4NOTA 4JGZC 2YUEA 3CJIC 5FWEA 2X5IB 2R49A 3HKZN 4IEQA 3IKVA 2E71A 1LFBA 1ND2A 1QJX1 2JWPA 3LQRA 1C5HA 4IPAA 4AIJA 2WT0A 1CN1A 1YIFA 4LMYA 3DKYA 2XJRA 3GMEA 1E5RA 4XE9A 1BZWA 2VI6A 3FXKA 1JODA 4MEXF 3H1CA 3ALQA 1YQ8A 5FP3A 1SACA 2YGMA 1JUPA 2XAQA 1QGPA 5DCMA 4DQAA 2ENRA 3WNXA 1SD7A 5JI7A 5IHRA 3RI8A 2HWF2 2OQ6A 1OXCA 1WKMA 1SFOJ 3BY6A 3PNTA 2BWCA 2BOLA 4EN8B 2WNVA 4NRQA 4EYUA 4WXDA 4PZJA 1UOGA 1E17A 1S3JA 2HS5A 4D0QA 3VYUB 3OOUA 2VE9A 5JXHA 2UWBA 1L3JA 5ACA1 1PO11 2ZHLA 3AYDA 4GH4A 1ZRDA 3CLPA 3CDZB 4H7MA 2LMDA 1UPSA 2VUAA 3LOBA 2WYFA 4OZOA 3LD8A 3ESWB 4AOCA 5EWSA 2HBUA 2LALA 9ANTA 1MZFA 1E3OC 2IWGB 3BB6A 3WP4A 2JDKA 1KQRA 2XGEA 5HOOA 1RR7A 1S29A 3MZ8A 5EFUA 2A3SA 2HWF3 2D40A 3TYJA 1D4M1 4Z6YA 4Y24A 2VZUA 2GN3A 1REPC 1W0NA 3OGSA 5F9TA 5LATA 1G9FA 2EINH 5JHUA 1KJRA 3GHMA 1OLQA 3ZR5A 3NAUA 2KMUA 5LY1A 2EIEA 4CUCA 5J8CA 1L3LA 5JXJA 1PK6C 3RWKX 2PQ8A 2FQ4A 5JZGB 3REOA 2EIGA 1N3QA 1PNGA 3Q0UA 2VUMJ 5FYCA 5F39A 5A33A 3RMYA 3GW2A 3LFIA 2QQKA 3ZSEA 3VKOA 3I56I 2KIQA 2M9HA 1R71A 1CONA 3OBAA 5LHHA 3CMMA 4IQ4A 3WTXC 4NVPA 2K40A 4LKEA 1BEV1 3KYLA 4C3JJ 2QQWA 4Q0SA 2ARBA 4GXLA 1MW7A 4MNUA 4E7LA 4R52A 2MA3A 2K9QA 1XCBA 4CPBD 3NAPB 3PUFA 2BZTA 3DPRB 4DMIA 4Q0UA 4P9XA 2ESHA 3ZCOA 1UX6A 1O57A 3U75A 3AK0A 4NC7A 4G4FA 5FP7A 1ETVA 4CDUA 3H9JA 2M1BA 3SH4A 4FFGA 2D44A 1Y39A 4QPIB 5BV6A 5D8AB 1Y6IA 3K4AA 4CYCA 3KLNA 4AIDA 3WT3A 4FPOB 1MBFA 4Q5OA 4LEJA 3PIJA 3ABUA 1LGCA 3R0JA 2ZGOA 1W0UA 1GZWA 5T3NA 5CYVA 2AS5F 4YW1A 3GM8A 2K9SA 1XU2A 1XNCA 3RMXA 5FYHA 1UU4A 1EYBA 4ISQA 2KRCA 2LVSA 3BTJA 4JQTA 2GIVA 5A6YA 4LBKA 4QPGA 2E32A 1LTEA 2A6XA 2BUKA 2EPFA 4LOSA 3CC2I 1YI2I 1V00A 1PZ7A 4HONA 2HWE1 4IESA 3CLQA 1W6PA 1T0FA 4IOAF 4XN3A 1UW8A 2PLYA 4E4ZA 2F4LA 4AVTA 4E4HA 5B4NA 2V1XA 4M6VA 3F21A 3ZMNA 3VD5A 2EILH 3L7WA 5FYZA 3JUUA 4Y5TA 1IF1A 2R7VA 1LUJB 3W5NA 4PLNA 2RDSA 1UMIA 1R081 3ZXJA 2XPVA 4KWUA 3FM5A 1WWXA 2YY1A 5IAVA 2XJTA 2K5CA 1N1TA 2QSGX 3FUQA 1PGSA 4AVSA 4CH7A 5HS9A 1WMFA 2ZBJA 4CU6A 1RINA 1XSDA 3HWJA 3LFKA 4LO5B 4PBOA 3V56A 2QF7A 1ZLJA 1ASJ1 5FYTA 1KQ9A 3KLSA 5DZGA 3J7MA 3DQVC 5D8KB 2E51A 1G9AA 3ZR8X 2WO1A 3GGLA 2YFZA 3KCYA 2DVAA 4AGVA 1UG2A 4YG6A 4LG0A 1JI6A 1IKQA 2QQPA 4CZZA 3HOWJ 1XSRA 2VJ4A 1OFSA 5LEKA 5CKNA 1W04A 1RMU1 2X1CA 2AHQA 3I64A 4Q4Y2 1YFXA 3I3LA 4MHRA 3BG6A 4A6SA 4UFJA 4OQ8A 4ZXKA 4XN0A 4XUTA 4LK0F 4PDWB 2OZ6A 2QQNA 1ETYA 4PGHA 4AM3A 4JQRA 1X82A 3H8XA 3FXRA 3Q8AA 4EROA 1A6QA 2NYYA 1QF3A 5TGTA 2CQNA 3P5JA 1X3WB 3IDEA 3KMHA 5F6KA 3GCWA 1Y1VJ 4QX5A 1SCRA 4UV8A 2YR2A 3T2PA 3AKRA 3FJSA 4Q0VA 1NCQA 2J1VA 5F5CA 1Y3TA 4H2AA 4AVVA 1LCLA 5CFDC 2MABA 4YWAA 4WVWA 4XAAA 2QZ2A 3OPZA 4FOWA 1S0JA 3ES4A 3SNMA 2MG4A 4MFDA 5CNAA 4MGQA 3NWKA 2PHLA 4GJZA 3RIRA 4Q4Y3 2I2SA 4Y22B 3C7FA 2VBDA 4RM2A 2BY2A 2RDQA 1XXNA 4FP2A 1MSEC 2VBWA 1VQPI 2ZHNA 1Z6TA 1XQNA 2ZXQA 5D8LB 2DA2A 2JG9C 4HMZA 3DYOA 3CCUI 2QLZA 4A0XA 2WSVA 3WV6A 3NO8A 3AMHA 3CO7C 2MC3A 2EVXA 2FOWA 5J7MA 5HNFA 2WT2A 3OGVA 1LB2A 5IP9J 5HCBA 1A34A 3GZ6A 2RREA 1B4AA 3BP8A 3POEA 4IEOA 1IO2A 3AMNA 2ZXIA 4JTOA 5IYYA 3I2IA 5JI9A 2Y60A 2FHRA 2XAFA 4QXKA 3KCCA 1C1LA 2EBIA 5D21A 5DZEA 1G9DA 3KZZA 3GJBA 3X29B 1JW6A 3LSIA 4LBQD 3E5XA 2QYOA 1OJLA 3AX4A 5M5XJ 1WMEA 2QKLB 1V55H 3MF9A 2R5ZA 3CUQA 5BNQA 2VOKA 3G6EI 1EJ9A 4IL6C 1W90A 3R0RA 1I5PA 1NLQA 2X4HA 1HN0A 2BFUL 1TME1 1RI7A 3R4DB 4CUBA 4Q26A 3F0CA 1YO8A 3NJXA 1F8VA 2GBYA 2HJIA 2RNGA 2VBYA 1CAUA 1DF0A 4LKDA 3DCFA 2XB5A 4HVOA 5FB2A 5C3OA 2JDAA 2D6NA 4BMBA 2XL9A 2M45A 1L0OC 4XJAA 2ID3A 2AQEA 2FZ2A 2FOKA 3OBZA 4XKWA 1LDDA 2RNJA 3ZQHA 3T1BA 5FPVA 3Q8EA 2YC0A 4NDLA 4FQ4A 4AEDC 2P5LC 4EJVA 5FKCA 4M0HA 5FZBA 3V64A 4NROA 4IGQA 3TNQA 2ADUA 1IPJA 3L2RA 1KQ8A 4XAEA 3LEGA 4W1UA 1GWKA 1LEAA 2PHRA 3K7AJ 2GNBA 2HWD1 3HUGA 2M7BA 2GNMA 2XUBA 5FY4A 4CDXC 3CJIA 3KP6A 1YG2A 2ACJA 5BNNC 2L4AA 4KISA 2EFPA 2HXIA 3DF0A 4CCMA 3FK7A 4BQOA 2Y6HA 5LA9A 2DMQA 3V8LA 1TNTA 2EICA 5C3EJ 3RZMA 3JRHA 3TNPB 2YU3A 1S0FA 4A3BJ 5FXVA 1NOVA 1DGLA 2KQRA 1XSQA 3BUCA 1D5YA 1C4RA 1ACIA 2EA7A 2ZBKA 1UKGA 2VODA 2BYVE 3KD4A 2P6TA 5LZ6A 3POIA 3LFUA 2MLKA 3P5BA 3CCMI 4CEYA 4HX7A 5CA6A 4DRRA 5ICGA 3EQLF 1RXFA 3PFIA 3PVNA 2VG9A 1JUMA 1HDDC 1BL0A 2ADEA 2IXLA 3L00A 3KE2A 2IXHA 1WCUA 4EGYA 4KYWA 5FKKA 1PYVA 2K4BA 3B69A 1BIBA 3D4KA 4QDRA 1PO21 4LHKA 4S2HA 5K7PA 4CDGA 2DTZA 3EQEA 4OMZA 5DAVA 3FZVA 4AVZA 2RVAA 1OA3A 3WQ0A 4NWVA 5KXCA 2WZR1 3QU3A 3I3QA 2P34A 4LK7A 5LA0A 1ZARA 4LUKA 4XUOA 5BNOB 2VZ1A 4CUGA 2VKDA 2IGNA 4GIQA 5EEGA 4XSXF 5GAHJ 4GRIA 2DTWA 3LL7A 3N97A 5FQ0A 4O65A 4IV1A 3FC0A 3ONQA 3WG2A 2O9LA 3HXLA 5BNPA 5E1ZB 3UGHA 3GFJA 2XASA 1FYLA 1OYWA 2F5FA 3DECA 3M8EA 1US2A 1PJRA 4QXHA 1D4VB 1OQYA 2NYXA 3LA3A 3DBLB 4YZ1A 3I71A 3IH3A 3J7YJ 3WGGA 1H2LA 3JRCA 5DAXA 2K0GA 1V6NA 3NL1A 1W05A 1YJWI 5EZHA 1VBA1 4OHZA 2RS11 3DPTA 1K5MB 5J8FA 3VKLA 4P9IA 3KYCB 1YJ9I 3QP6A 3GTQJ 1S2KA 3PUHA 1M4WA 3VZLA 2JD4A 2GA1A 5EJ3A 2XMLA 2DCTA 2DCJA 4CO8A 1QJX2 5EGOA 2LW8A 2VXDA 4HOOA 4XLAA 1RC6A 1ENXA 1LENA 3LF7A 5HPOA 4P9FA 4P9UA 2M0CA 2DDBA 2J1UA 1YYNA 4I02A 2XXZA 2MD5A 1BOBA 4PQ9A 2PHXA 4XONA 4YFZA 5K0UB 1X1DA 3I53A 1O5LA 4H14A 3JRBA 3G3ZA 1R9TJ 2R7FA 1QJU2 3FDYA 4OHXA 5DABA 3JTGA 2E1OA 4AVPA 2HYKA 2EZLA 2M2EA 4MTEA 3Q5FA 1OUSA 1J7KA 1MH3A 1W8WA 5ACA2 1UYZA 4M74A 4JYKA 1PO12 1RUJ1 3CCEI 4C2TA 2M5WA 3RVHA 1NLRA 1QJX3 4KN7X 3H9GA 3WGHA 4P02B 4UW3A 4E2GA 4AEJA 2K27A 4DO0A 3KP5A 3MGUA 3VL9A 1UU5A 3K69A 2BV6A 3T30A 1N77A 1ZM1A 3QD6A 4RBOA 1GYKA 1H1IA 1QHGA 1D4M2 2ZJ2A 3J81Z 1DQ1A 4EN0A 1QJU3 5C8CC 1N1YA 3SZGA 3DEMA 2BRTA 5BXXA 4L5IA 1B72B 1UY0A 1J3RA 3UGFA 2IGOA 4Y26A 2NOJB 2LYCA 2W87A 1DU3D 3ZN6B 3AL6A 2IZWA 2MHFA 3JAMZ 3O1VA 3PNVA 4UV9A 2DAOA 1REDA 4WZCA 1PO13 3MF6A 3F3XA 5GAGJ 1B9MA 4KIGA 1LECA 3O1UA 5E8AA 1CAVB 1Q56A 1NXD1 1KA8A 3O0WA 1Q8SA 4XDQA 1T56A 3IP4B 2L9SA 5F8PA 3MVPA 1TWAJ 2F48A 4HF1A 5FZOB 3WF1A 5GZGA 4QQOA 5F2WA 5F32A 5HV4A 3OD0A 3CUOA 2O0YA 2K9LA 1KS5A 5G05L 3GF2A 1D4M3 2YX7A 1RUC3 3L2UA 2W9XA 4LIUA 4DNCA 3APBA 1LAJA 4YZ2A 1GZ9A 2XIGA 2EAAA 4D94A 2X10A 3ZQQA 2LM3A 1WW5A 1PMJX 5FZCA 4JC1A 4LBNA 1YW7A 4U36A 2JE7A 2VE8A 3BC8A 5FJ8J 1DQ6A 4PI0A 3JXSA 1BI2A 4HSLA 2PMUA 2RDRA 1AKHA 2R92J 3SKJE 1POV3 2L0KA 2R0FA 3P9KA 4BQ4A 1C3HA 5CISA 4DYQA 1UPIA 2Q8OA 1WGXA 2FCVA 2F5EA 5IAXA 2HVQA 2V9VA 3V0BB 2XB0X 3WDVA 3OYCA 4IUGA 4XKVA 1RESA 1HQLA 5IP7J 3FBMA 3QH7A 3HVDA 3H1YA 3GZTB 5T5PA 2XKOA 4CZCA 1D5VA 1NTCA 3IB3A 3QPSA 5D5XB 1AR61 3GEZA 1GUUA 4DUXA 3AG1H 1LDKB 2OQRA 2STTA 2VKHA 3RKYA 3H1MA 2ZX3A 1VIWB 5KVRA 2PFWA 1OH3A 2WB1N 3GVAA 1VQOI 2QBYB 2I07B 5CFDA 3ZFGC 1SFNA 1YJLA 1FYUA 4LD5A 4M3CE 2V9PA 2AEYA 5CKMA 3D8CA 2ZKZA 1BC8C 1QPMA 2XJSA 4KWLA 4D7SA 2EK5A 3DXTA 4TZDA 5JOWA 3A0HC 2X6XA 1E3PA 2Y9YA 4EJUA 4ZU7A 1WJFA 4YVSB 1SAXA 3ZQIA 4FAGA 3ZMTA 4YZ4A 1HIXA 2L7MP 2A70A 2VR4A 3RPUA 1I1SA 1ULDA 2JG9A 2XLFA 4COWA 4E4DX 2CG4A 1PNFA 3VBFC 3CO2A 3WEZA 3QU6A 2XF7A 1MZ5A 3T8RA 4CUAA 2W1WA 5DDGA 3OYKA 3FXJA 4CDWA 1ASJ2 5FBZA 1C8NA 2H8RA 3H92A 2WDBA 1RL3A 1DPRA 5LBEA 1LOBA 2DYSH 5BOXA 4NIGA 1W8OA 1UYYA 2VL4A 3MW3A 4D1QA 2VVEA 2JZYA 3WGIA 1NKGA 2D6KA 5KCMA 1V5EA 2ETEA 4BQ1A 1FYMA 3DV8A 1UD1A 3RSJA 1D0GA 1RMU2 2VZRA 5B2GB 3GF6A 3QYEA 4ARXA 4P5OA 1WCSA 1PM4A 2VZ3A 3SEPA 1EUUA 2CUEA 2BBVA 4Y1VA 3B9CA 4CZSA 1R1UA 4FPKA 4QDSA 2GP3A 3WDXA 1Z05A 2VPRA 3M8LA 5FYBA 2NOGA 4FAHA 2Y6KA 1J09A 1ZZ8A 3MDPA 4H0EA 2PHTA 1W0PA 1FOWA 2W1OA 4LHLA 4LULA 2BTVC 4FTEA 3HHHA 2LC2A 1BR2A 1IS4A 3FM3A 4ENMA 2VKVA 1ASJ3 1W8TA 4L0PA 1R23A 1LKNA 1JHJA 2PMZA 4RB0A 2GXBA 2GQQA 2BW3A 1LEMA 3VBUA 3ZXFA 1A35A 1Y8QB 1PGL2 1XYNA 3FX3A 3ZMDA 2D5FA 4A6OA 4HPQA 5FUIA 1GSLA 4PJ0C 2BEOA 4BAYA 2K02A 4I76A 1MSFC 3LWFA 1RMU3 4ES9A 2OX0A 5ABJB 2D6MA 2OV7A 4G6DA 4I30A 5I8TA 1CZSA 4ENNA 5C9AA 1W0OA 2QNKA 5GZEA 4Q47A 4UVCA 4OWRB 1PVXA 1DU0A 2CWSA 4ZU5A 3VBOC 2Y31A 5JPMB 4ES8A 1FATA 5BNNA 2PXJA 1HKTA 1LJ9A 1OCPA 2DFEA 4GB31 1GFF2 2H6CA 1MVEA 2VMDA 3U21A 3OG2A 4IE6A 1IRFA 3R4SA 5L3GA 4BPZA 3VL8A 2NS0A 1JN2P 2YFUA 5IVFA 1WPKA 4LG3A 4F93B 1YWKA 2AENA 2ARAA 1TTYA 5JIUA 3HQXA 4INDA 3NKGA 1AR71 2JIGA 2WT1A 4HFSA 1HLCA 4AGGA 1AX2A 4NAOA 2EB7A 4BXFA 1QO0D 2KKOA 1MBGA 3GXOA 3JZVA 3A01A 4BYYA 1Y1WJ 3BWGA 4BY7J 4RS5B 2MD0A 1SFXA 3H5AA 2V6CA 1LHOA 2UUZA 4O61A 2VXZA 2R062 5C3PA 1ND2B 4XLNF 3KHCA 4JRLA 3IHUA 3EDPA 1ZZBA 1Y9MA 3D5OA 2QQ8A 4GMP0 1RGSA 3WUCA 2QVSB 3RKQA 3F8NA 2QEXI 1RKTA 3Q9OA 2OU2A 4PJNA 4RGRA 1JZ7A 5DCMB 2L9NA 2VQTA 4Q4ZF 5D5WB 2BGCA 2PI0A 1K4SA 1ETKA 1WJAA 5C4WC 4WM7A 1SLAA 4ZJZA 4RS8A 3SHRA 1S5LC 3H9QA 4NPLA 5H6QA 3WSOA 3K1NA 2XROA 3B6CA 4P00B 1V4RA 2B7YA 2WO2A 1BR4A 4M00A 4UFHA 4BUPA 3OS1A 3G1OA 5E6HA 3ZYJB 4BOWA 2R063 4N53A 3ERMA 2XAHA 2VMHA 2XPJA 4GH4B 3QWLA 1U3EM 4DIQA 1QHDA 1BLZA 1QNWA 4E9KA 1V3FA 4ENJA 2A75A 3M1HA 2V4JC 5E20A 3ZYBA 5I0SA 5CFCB 1OYIA 3NNFA 4ORFA 2VNOA 4XDOA 4CCOA 4HDUA 5KAFC 4NHJA 1V6OA 2A69F 3ABLH 2WV1A 2JJ6A 3TOAA 3ZFFC 5B4XA 1QGLA 2IPQX 5IK8A 4LLLA 4EATA 2G0EA 2HQRA 2G7UA 4B4RA 2D2WA 5AC91 3NJYA 3PVBB 5F1RA 1AJKA 5F3GA 1PX3A 5J1RA 2WBMA 3LSEA 1F5JA 1UHSA 2W82A 4AVAA 5HDKA 1QVTA 4DFSA 1SLCA 3RZZA 4XABA 1MJ9A 4D3WA 2P81A 3F23A 3J80K 4HSJA 1YX5A 5L73A 2CV2A 3WTZA 5FY7A 4ZS3A 2VZTA 1XJAA 3PNYA 1MNEA 4UVBA 3VPRA 3CCRI 3O6BB 4XQ4A 5A33B 1KDKA 2F5VA 1ENHA 2BNNA 4OULA 4BLJA 2MYSA 4L18B 2HYXA 4BJ5C 4LPLA 3QQAA 4K3UA 5C8CA 1VBA2 2RS12 4QSHA 2MGQA 1NAEA 3N9MA 1JHFA 3MN2A 1QY4A 3J9SA 3AP5A 5EXOA 3SEEA 2VL8A 3PVOA 2Y0MA 2KP6A 1H9GA 2OW4A 2P2KA 5DUVA 1BBYA 2P0WA 4PJJA 5FLIA 4MADA 1YFYA 3DKQA 1ZR4A 4CDUB 2E7WA 1MMNA 1F1ZA 3D5SC 1W9YA 2WR9A 1OA4A 4CA9A 3JQXA 4CYCB 1QWRA 4TWTA 2CAVA 1Y9QA 1VB2A 3A1YA 1GZWB 4QGNA 5CEHA 2WSUA 5SV8A 1LFPA 1F5TA 2RS13 5IVCA 3KLOA 2V73A 1CAXA 3WNKA 1JYNA 3MPPG 1NK2P 3CJTB 3FMRA 5HNHA 4Q8KA 3BR6A 5EJCA 3TBDA 1RUJ2 2DT7B 1N1SA 4TLGA 2WNOA 2JSPA 3GYDA 4QPGB 2WA3A 4RL7A 4ZYAA 4R4ZA 1J3QA 4QKDA 4Q4V1 5JAXA 1DGRM 4Q8LA 5C4JJ 3THCA 2HWB1 3ZYHA 2DTRA 1V9U1 3RI9A 3AMPA 2VQGA 2A6ZA 5J1YA 1W6PB 3ZGKA 3Q9SA 2MH9A 3S1RJ 2O1QA 4HG6B 5FYYA 1XSVA 1OLMA 2W94A 1Y9GA 1QPIA 2BE5F 3RQIA 3B3QE 3JU9A 3CCQI 3JD72 5FTTC 1JJ8C 3I3DA 4W6WA 3HGYA 1H0MA 3WTYC 4G12A 1YQ6A 4DUWA 3L9FA 1XD7A 4NHMA 2UY8A 2W48A 1XNBA 2W57A 2H1LA 1BKZA 3GWZA 1GP4A 3K2ZA 3TP0A 4BE1A 1RUJ3 3HEFA 3EXUA 1VRH3 2RS52 5EQUA 5FAXA 4ANJA 1WZ2A 3NSTA 4XBNA 2QQUA 1SG3A 2XVKA 2Y6GA 3OYWA 2X09A 5IT9Z 1OCZH 1WMXA 3CDHA 1R091 2L2OA 2MFZA 3MW2A 4N8MA 4WM8C 2KJCA 3DF8A 3ZN0A 4EJTA 4R1HA 4XACA 2YV8A 2V5YA 4ASLA 4LG0B 4V2GA 1YQ5A 5TSWA 1IV8A 4XQWA 4ZS2A 2ZHMA 2EAKA 2W24A 4Z07A 2CRGA 4N9IA 5JSPA 2VPLA 2CUFA 1MZBA 2JUCA 3JD73 3UKNA 1MH4A 1FYKA 1H8TA 4IQPA 3ZSLA 5FRMA 5CVUA 1FT9A 4B43A 1LVKA 1ETWA 3DU5A 4KJZA 1R1A2 1FPQA 1JTZX 5HBAA 2HYJA 3KP2A 3HC7A 1V6MA 2RS53 5H9PA 4JTNA 5FK7A 2OA4A 4TTGA 5CQGA 5IATA 1JZ5A 1OCCH 1X2NA 4R8HA 4FASD 2IAIA 4RGSA 1GV9A 1RNLA 3ZDVA 3N9OA 3E1F1 4XZUG 1QXJA 4SLIA 3MLLA 2VW0A 5B3SH 4XYXA 5JOZA 1VAMA 3CMAI 3V7RA 3OL4A 4G8XA 4P08A 4QPOA 3B9IA 5JVGF 3SFZA 2BU9A 4DNYA 3I59A 3CP8A 5EZGA 1AR62 5KWRA 1I50J 1VBB2 1R1A3 2VD7A 3OSDA 2G9FA 4NIDA 2SLIA 1IGNA 1XNAA 1UOJA 4Y1UA 5J4YA 5I0TA 3B01A 3VB2A 1AR82 2W3JA 3VFZA 1FTTA 4FE4A 3M9AA 4Y3OA 4ATEA 1OF4A 3K0LA 4W6XA 2ISZA 1O3RA 2DMTA 3RCOA 2W5FA 3EBRA 1UY4A 1XG1A 1H9WA 1ZH5A 4B8XA 3C7OA 3S2WA 1XN7A 2RQQA 1Q8VA 1TE1B 2VONA 4OHYA 5FROA 4ET7A 4BQQA 4EWAA 3WW2A 2P8TA 1GU3A 4NPRA 2VT3A 3AYAA 3HL2A 2X6YA 1ZR2A 3ZFEA 2P7VB 1CAWA 5FUNA 1O4XA 3TW7A 1R4MB 1AR63 1FPN1 1VBB3 5ILVA 2W92A 3W59A 3IAPA 2R5ZB 3CUQB 3K70C 4ZY9A 2E1MB 2F6BA 3BKZA 1AR83 4L9JA 3K4KA 3DLAA 4Q4X1 1M06G 3VBHA 4DB5A 5B5EC 1IN5A 5A7NA 5SV5A 2EXJA 2ZA9A 1CAUB 1IV6A 1A3KA 3LEMA 3WNNA 1ZELA 4GWIA 1EH8A 5FFZA 2QQIA 1PDNC 1I6XA 5T52A 2RG4A 2BZDA 4RFRB 1AX1A 3PIPF 1AVBA 5CG8A 5E1WA 3ZSKA 2P17A 1OH4A 2Y6JA 4QXBA 4NIIA 3N9QA 3LZZA 4B7KA 3ASOH 3WQ1A 2ZKNA 2TDXA 3B73A 4L9VA 3W3CA 2DCYA 3HUGB 4ZZ8A 4E7HA 2QSHX 3OPWA 3VOEA 2AGSA 5IYBJ 4E7KA 3RQ0A 3G6JB 4AFCA 1XRUA 4IE0A 5A7SA 2LNBA 1VPHA 4L9TA 1ZX5A 1O4TA 5FFXA 3WG9A 1JYVA 3GTOJ 1LRHA 2D3SA 2ET7A 3U4XA 2RQPA 4IRHA 3WNPA 2D45A 3H1WA 3VWBA 4LKFA 4M9SA 1O4YA 4MYEA 3TW6A 2BNOA 2C5DA 2DXIA 3GTGJ 2E5NA 3ZSMA 4AE2A 3BTAA 3VLBB 4J1WA 4CEYB 4NJ4A 4DEQA 3IWFA 1S0IA 1SLTA 1MVQA 2Y0SA 4XF4A 4HQEA 4AAXA 4BQ2A 1PHMA 1Z7LA 3IKTA 2BQPA 1UIKA 1GV5A 3LA7A 3POJA 2O8QA 4IL7A 2LRDA 4GB32 2VLAA 4S04A 1KEXA 4G3YC 3F6VA 5FPAA 3I97A 4IHSA 2PG4A 2HWVA 1DYPA 1HX6A 2C6SA 4IKFA 4XOPA 1ULYA 1G4DA 4XZPA 1Y0UA 4IERA 2WQZC 2VULA 2WZEA 1W6NA 2A5WA 1GZTA 1GLHA 1S7OA 4IV1B 1JBCA 4WBBA 4LORA 5GJ6A 1HSJA 5BNPB 5EPAA 3CP2A 1AR72 4X8NA 2DV9A 2G9GA 2FDFA 5IVEA 1HN1A 2B4KA 4IV3A 4ZDPA 3KP7A 1HV0A 1L7RA 4U7BA 1VQ9I 1UF2C 3O3KA 1WH7A 4QB1A 2F4OB 4FTBA 1A04A 4MEYF 4ONUA 4BIFA 4A44A 1JXNA 3UL2A 2GLOA 1GMMA 5EGOB 3LEKA 1K6OA 3DN7A 3MEPA 1UU6A 1NQDA 3HOBA 3KZYA 3N36A 3U4SA 4OQ9A 2DA5A 4I7HA 2GA2A 1IS3A 4YGCA 3VD3A 1OPOA 4RQPC 2KDOA 1DZRA 4EGZA 4GO1A 2WNUC 5AIPA 1OCTC 4L0ZB 1AR73 2LDUA 1XGMA 1IRGA 2R0QC 4JX0A 1G3TA 5D4SA 4BACA 2NZ9A 1H2KA 3PMSA 4EM0B 1OR7C 2P3IA 4G7ZF 4CXXA 2ATFA 1IRZA 3OYJA 1R49A 3RZDJ 1OKOA 5ANQA 2Y69H 5F3EA 5FGMA 2ZJRF 3CESA 5K4LA 5FLXZ 2CDPA 1U5ZA 4UXAA 4MLOA 2NVXJ 3HDDA 4YZ5A 1MNMC 3I5UA 1IG3A 3RG0A 3P9CA 2EFQA 4HSTA 3ZPLA 2DURA 5A2QZ 2ZGTA 1ENRA 2BBAA 1SPPA 1YO5C 5JPNB 2NRAC 2ZAHA 2IA2A 4R9DA 2E1CA 1AU7A 5IP6A 4Y5Z0 4JOMA 4BU2A 1GANA 5LHGA 2JT1A 1P9QC 2JN6A 2XONA 5F0HA 4CDQC 1W9FA 4Q0QA 1AR92 2Q4SA 4NBQA 2P1BA 4FTHA 2M87A 1Z3YA 1VE0A 3VZNA 3RYRA 4HETA 2Z2SB 1O8SA 1UYXA 2IW5A 3KEOA 2YBKA 1HB3A 3UETA 3OYMA 2OKXA 4HNVA 3P7NA 2JIJA 1UKRA 1NY72 5FV3A 2VPVA 3U14A 4BLIA 4MGIE 1WCKA 1DYKA 3G1MA 1LQ1A 1SANA 5JVVA 3FMQA 3OR2C 3AJZA 3KT7A 1P7JA 3TN92 2R7DA 1JZ8A 2VBXA 4ZTJA 2FBHA 2WAOA 3S15J 4KGGA 2QZ3A 2ZZQA 4XUQA 2ET1A 1RVF1 2ZEWA 4K9SA 1WA6X 2P3YA 3AG2H 1IJWC 3I2OA 4IJAA 2PQSA 4HLYA 3FXLA 4UW5A 5JOXA 1S1AA 1AR93 2ZX2A 2P37A 1JZ4A 2B42B 1HRI1 3VKFC 1Z7S1 4M73A 2CV0A 5BYNA 2KDZA 1F4AA 1AKHB 3F8MA 2OAZA 1HB4A 1YQAA 4RSUA 5J96B 3SCHA 1COV2 4ON0A 3OYFA 1GBGA 4YW2A 4RN5A 4DY5A 1U5TB 2EA4A 5T54A 2MEV2 3CCLI 3T1LA 3WNOA 4OLLA 3TN93 4YELA 3WINE 2P4EA 5JR2A 2CW8A 2NNYA 3O2PE 3JCUC 2R4GA 4P1WA 5F5IA 1RZ4A 2JEMA 1QOOA 5IJRA 1FI2A 3I9V2 2W91A 2NVYJ 1E57A 4BNCA 4XRSG 4EN7B 2WFF1 1X4OA 5IYDJ 2BERA 1MJBA 1HA8A 2HWB2 3PUIA 1MR5A 3K2OA 1V6JA 4G9YA 2PAEA 4V2VA 1EV11 4IXLA 1RUH1 4YG3A 2DPUA 4META 3S8PA 3PO2J 1COV3 3O8GA 2XBO1 4MHGA 3LDKA 4AI8A 3BTZA 4V2WA 3ZYGA 2MEV3 2JXAA 3JBG1 5LA1A 2HPMA 4AHYA 3WUDA 2VZOA 4DRVA 3J81K 2GC0A 3CEWA 1R6RA 1ZTRA 5B1AH 5DG1A 4XFBA 4QWNA 5E8IA 5DXDA 4LO6B 4ZC3A 4WXHA 3BZCA 2VJ5A 4JDMA 3JAMK 3RJPA 3O0VA 3F8CA 4CDWB 1VBD1 3MIGA 1BBT1 1IXRC 1R092 1QHHD 2EIJH 2HWB3 4D5FA 3ABMH 2ZZJA 2BGOA 3H5RA 4XOTA 4AZZA 1LGNA 3WR0A 2E63A 1YIOA 3NKTA 1SFUA 4ETSA 4LHNA 1IRXA 2EV0A 2VZPA 3G1LA 3KP4A 4IEXA 2A6HF 1FBUA 2FEZA 4LQRA 3C2UA 3FK6A 4AI2A 3HOSA 4B29A 2ZS6B 4FFFA 3RZLA 2CWMA 4GA9A 2H8WA 5B66C 4ENKA 1IGOA 1X33A 1UMZA 2JX9A 2EQRA 4KH9A 3DEWA 1OD5A 2EV5A 5I91A 3ECOA 3WE3A 3C8XA 2IS1A 4LLFA 2JA6J 3JRFA 3L9JT 4KN4X 1B1BA 5F08A 2OUMA 2CWEA 3CF6E 3RI4A 4FPLA 5FYMA 2VAUA 2EV6A 1OD3A 4BGDA 4AQ6A 2WFPA 1R093 1S0CA 3GBGA 3CU7A 4IZZA 5LASA 4J6GA 3LQQA 2BW3B 1ZZ9A 1N3OA 3K75B 2L9VA 3VBUB 4BB3A 4R79A 4A6DA 3OS0A 3I2FA 3WNMA 1TEIA 2VIXA 4CTEA 2FJ1A 4AQ2A 2IXSA 5JUVA 5L9VA 1ZQ3P 3VDAA 5KR7A 1VQ4I 4COUA 1IN8A 1IG0A 3QPLA 1UJ8A 4OHVA 1KGYA 5C9AB 1Z77A 4EN6B 2J5OA 3HJEA 2JECA 2OQ7A 4HLXA 4NNJA 2DODA 3CMGA 1VNDA 3LSRA 5BNNB 1T33A 2QQOA 3A0BC 3T3YA 4PFOA 3G71I 4AIKA 3KETA 4C30A 4KIBA 3AL0B 3HOYJ 2AO9A 2Q2EA 2D6LX 1WLDA 2YC2A 5DMYA 2WBKA 3W5MA 4QM9A 1YUDA 3TEXA 3M3QA 5AVPA 2ZC2A 4J00A 5L9BA 2DU9A 1OA2A 3VUOA 2IA0A 3ORJA 2K9NA 1YYVA 5JZGC 2Z16A 1TMF1 2ZB9A 1F9NA 4MOAA 4N0BA 5KHDA 5FZHA 3HOUJ 1BYHA 2XJPA 4D5CA 3IWZA 1OQDA 2L4MA 2YXSA 4HEA2 4XIOA 4AUXA 2AZ5A 1GP6A 1K61A 4XK4A 3TMOA 1T6BX 2ZKLA 2D3PA 3PJRA 3OY8A 1KU9A 3A01B 1OVSA 5FYSA 4N7IA 5FZFA 4FPYA 5EG0A 2WKKA 2IT0A 5KHKA 1TQIA 3U07A 4AC0A 2EXKA 2QJVA 2AUYA 3WW3A 2WA0A 2X1EA 1HB1A 2PJRB 4Q4X2 1V5GA 3PSFA 4Z2YA 4IEWA 4DYCA 4B4PA 4CHUA 3NAPC 3DPRC 3WHBA 2RDPA 1W03A 2FBKA 3BQYA 1IQAA 1D1CA 5M0TA 4FPCA 1HBXG 1R36A 5IT3A 2VMEA 2WS91 1UELB 4QPIC 4LBOA 2VMFA 1MEC3 5D8AC 4Y13A 5CZKA 4YG2F 1ENSA 2JDYA 4OINF 3J7ZI 2QKMB 3AMMA 4EVIA 2ADDA 1FIPA 1IZ1A 1Y0NA 4WM7B 3T0YA 2W7NA 2KHMA 1CZTA 2UWCA 1GZCA 3FE5A 1PP7U 4S05A 2Z5WA 1YCIA 3K3NA 1LOFC 5FMCA 2OUJA 2WINB 1W8HA 1ZBA3 1CJDA 2FXAA 2Z99A 1ODNA 4Q4X3 4PJMA 3ZN4A 1LOGA 4N53B 1H4GA 3NQHA 4OMYA 4E7SA 1ZYBA 2RS32 2QQAA 3ZXGA 4M3DA 1WCDJ 2I10A 2CU7A 3CMYA 4NO4A 3CZ6A 1FMWA 2JA7J 2FSWA 3IDBB 1OKRA 2H1KA 2WNUA 4OMCA 2IS4A 3SKVA 1G8WA 4RB2C 4AVCA 3M70A 2NMOA 1H8VA 1X1PA 4Q29A 2G19A 3ZX7A 4RR3A 3ZLIA 5LRSA 2VCMA 2BW8A 5CG9A 1W7PA 4AFDA 3CLOA 5FWJA 4MTDA 1ZRFA 1N47A 1QU3A 3LNQA 2P4WA 3V0AA 4NIHA 2J1TA 5EP9A 3LGRA 3HAGA 2ZCWA 4KT6A 2IXIA 1FZPB 4KU8A 5CVVA 4IRIA 3DUIA 1JT0A 1MS1A 1XE8A 1VB4A 4Q0PA 1F31A 5CIRA 1OI6A 1WUVA 3AFHA 2CGNA 2JRMA 2VOWA 2PELA 4OI4A 2YPRA 3D6EA 3KPHA 2GC3A 1W28A 2RS33 2BV4A 1B59A 3K4LA 1RUE2 2WAAA 2LKSA 3BOQA 5F04A 4HOBA 1MIJA 1Q3EA 3RKXA 4E4SA 4JZRA 3M3OA 4MZUA 1JKPC 1C0WA 3OB8A 5C8CB 3G73A 3S1NJ 3V65A 1EF4A 3FLTA 3MEXA 3K4DA 4A3XA 4CDQA 3W2VA 5CJ9A 2ECCA 2XR4A 4PDWC 1Z67A 3RJRA 4AI0A 5FCCA 5KXBA 3PIOF 4UBHA 3CC4I 1JZ6A 2WA4A 4G94A 2M30A 3AAFA 2CW7A 4CYDA 1C57A 4KU7A 2V1UA 4EWEA 4ZZ5A 3SDGA 1BI3A 1JUHA 2W1UA 3AP9A 1POQA 3OOPA 5A6ZA 1RUE3 1S0BA 3L2HA 5DAQA 1QRYA 4UF0B 1HDKA 3GFIA 1TNFA 2RR12 1WLWA 3A2KA 5FLHA 2XGCA 1F5FA 1UHMA 4B4QA 3IKWA 4CEWA 1DQ2A 4YW4A 1F36A 1PVC2 4I0AA 3MIFA 4KFCA 1FX5A 4LKSA 4UNOA 1CAXB 2UURA 2NVQJ 4LXLA 3ACGA 3M4FA 1YXWA 5DEQA 3M8FA 2VM9A 2O8KA 2DUPA 1O3QA 1BW5A 4PCQA 2WN2A 2ZEZA 4XRSA 2R072 3ZN1A 5IOYA 1MZEA 1MZ6A 2DI3A 3DWLE 3NV2A 1Y56A 3FZ3A 2RKHA 4C9YA 1MMGA 5T5JA 3KP3A 1PIV1 2HYFA 5GTHC 2Y6FA 3MI8A 4ZXEA 1HKQA 1GQPA 1PGW1 4CCNA 4IW3A 4QX0A 4IEYA 4E2SA 2RR13 2X48A 5C6CA 3QYBA 3S2DJ 3LMMA 3MLJA 1ZZ6A 3M7AA 5DUXA 4GAZA 1PVC3 1MBEA 2JG8B 1CIWA 1OKQA 2VJIA 1CD3G 2DYCA 2C6YA 3FLPA 1YI7A 1YRNA 5GLZA 4EWDA 5FP4A 1LESA 2R073 3N7LA 4A42A 3OUHA 2EIKH 4ESBA 1SD4A 4XJUA 1QJY1 5CVJA 3MZYA 4ZYEA 3AM2A 4KUMA 3OYWB 2LSOA 4K21A 4CCLA 5FD6A 1MMDA 1X50A 1XBFA 3V4GA 1NK3P 4WX9A 3V42A 4YM1A 1LOEA 1LU1A 4H3WA 3DEUA 3WHCA 1DPUA 3J7AY 4DXSA 4NHLA 2VOOA 1CPMA 2YPDA 2MPFA 5HCAA 5D2AA 1BJZA 2NQYA 1REEA 2ICWG 1RVF2 1WCQA 1WZXA 2QE3A 1V0AA 2ZGNA 2LY9A 1K5JA 3GDBA 5HLIA 1H8TB 3WF4A 4SBVA 3GTMJ 1OQEA 1J83A 2DWRA 4K1YA 5FYVA 4KMFA 1QH7A 4WVMA 2BWAA 5DD8A 4DPNA 4D6RA 1D1AA 2X1DA 2XUMA 5IOZA 2JTVA 5HODA 4ZZDA 4FXGB 2HQNA 1XYOA 5H9QA 2G1MA 2COMA 3R4KA 3PU3A 4QQ2A 1KZHA 3GZNB 5FY9A 3POBA 5C44J 5EDNA 4DXRA 5KC5A 3R61A 1P4WA 2WO3A 3HNBM 3VODA 1RB8G 4OIPF 3EUHA 2QUOA 3MCZA 4YRDA 4LIVA 1FTZA 4X0GA 5KXDA 3JRIA 1RVF3 3GALA 1BR1A 4R4XA 5JHFA 3S93A 3TEYA 4PDKA 3C7GA 3QCWA 3VHRA 2DLLA 3PUSA 5FYUA 4OMDA 4L0YB 5GLWA 4HKOA 3I59B 2IVMA 4GMP3 4QXCA 4HV5A 5HS7A 3L2WA 2CH0A 4XTMA 4D7NA 1CF7A 2X85A 3DCQA 2M8GX 2Y48A 1D7PM 1J84A 2OCEA 4I09A 4FISA 4YYOA 3LSDA 1EV12 1FMD1 1UYPA 2AH2A 1AL21 3U78A 5BNOC 4QMAA 1FSHA 4QPWA 4F8AA 2PEXA 5KHGA 2NVUB 3D0JA 1AZDA 4W97A 1DDNA 2JD9A 3J7HA 2VQAA 5DDJ1 1Z1DA 3ZYRA 3UT0A 1LDJA 5FPBA 2HZTA 5FZEA 4HQMA 4BDZA 3I55I 3ZFEB 3GLLA 4UW6A 4TYSA 3HTSB 2XQXA 1JYIA 1SMTA 1K5M