5C8CC

Crystal structure of recombinant coxsackievirus a16 capsid
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
242
structure length
242
Chain Sequence
GIPTELKPGTNQFLTTDDGVSAPILPGFHPTPPIHIPGEVHNLLEICRVETILEVNNLKTNETTPMQRLCFPVSVQSKTGELCAAFRADPGRDGPWQSTILGQLCRYYTQWSGSLEVTFMFAGSFMATGKMLIAYTPPGGNVPADRITAMLGTHVIWDFGLQSSVTLVVPWISNTHYRAHARAGYFDYYTTGIITIWYQTNYVVPIGAPTTAYIVALAAAQDNFTMKLCKDTEDIEQTANIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords VP1
publication title Structures of Coxsackievirus A16 Capsids with Native Antigenicity: Implications for Particle Expansion, Receptor Binding, and Immunogenicity.
pubmed doi rcsb
source organism Coxsackievirus a16 (strain tainan/5079/98)
total genus 47
structure length 242
sequence length 242
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5c8cC00
1AUYA 1H8TB 1ZBE1 1VBD2 5ACA1 1RUE3 2HWE2 1QJX3 5GKAC 1H8TC 2HWF2 1BEV1 1MQTA 3NAPA 2QQPA 1FOD1 3S6PA 4RHV1 4Q4Y1 4CDWA 2FZ1A 5J98B 2HWD3 1AR61 1FMD2 2WS92 5AC93 1HXS3 5BNNA 2IZWA 4GMP1 4FTBA 1RUC3 5BNOB 3TN91 3ZFEA 2RMU3 1Z7S2 1PGW1 1POV1 4YVSA 2HWC3 2XBO1 5BNOC 1QQP2 5D8AB 5K0UA 3ZFGA 1VBC2 1RUE1 1VBB1 5BNPA 1HQNA 1VBD3 5D8AC 1AR92 3VBUB 1F8VA 5FMOS 1RHI2 5DDJ2 4CDUB 2HWD1 5L7OB 1HX6A 3VBUC 5AC91 1PO22 5A33B 4WM8B 1R082 1RUC1 1PGL2 1FMD3 4PDWB 4GB33 4CDUC 5L7OC 1VAKA 1VRH2 4JGYB 1RUI2 2R071 1QJZA 4RS5B 2HWC1 1BMV2 1HRV2 4PDWC 1VBE2 3VDDA 2RS32 1HRI3 1NCQB 4JGYC 4IV1B 3LOBA 4CDQA 1EAH3 4RS5C 2TBVA 1VBD1 5C8CA 1NCQC 4N43A 4YVWB 1BBT2 1AR93 1AR72 4Y4YA 5LK7B 3VBFB 5ACA3 1RUH2 4Q4V2 2RR12 1F2NA 4YVWC 3VBOB 5ABJB 1IHMA 1FMD1 1GFF2 3VBFC 4QPGA 3VBHA 4Q4Y3 1MEC3 1C8NA 1AYM2 3VBOC 5ABJC 1RUI3 2RM22 1RB8G 5C9AA 1HRI1 4RR3A 4RQPA 1A6CA 1QQP1 3CJIC 4CEYA 2ZAHA 4LLFA 2X5IA 5CFDA 1VBC1 1K5MB 4GH4A 1POV3 5CFCB 4Q4W2 2PLV3 1AYN3 4EJRA 1RUJ2 1D4M2 1TMF2 3J8F3 1AR91 3DPRA 3VBSA 1K5MC 5CFCC 4FSJA 1RUD2 2MEV2 1VBB3 1QJY3 4Q4V3 4NWVA 5FMOL 1MEC1 4Y5Z0 3VBRB 1ND2A 4AEDB 1RUI1 5JZGB 1B35B 1AYM3 5C4WA 4JGZA 2RS12 1EV12 1HRV1 3VBRC 2RS31 1PIV2 4AEDC 4FTEA 1W39A 5JZGC 1B35C 2R073 2PLV1 1AYN1 1ND3B 1RUG2 2HWB2 3J8F1 4Q4W3 4QPIA 1RUJ3 1D4M3 1PVC3 1ND3C 1AR71 1QJY1 1AL22 1R1A2 1RUH1 4Q4V1 1RUD3 1MQTB 2MEV3 3NAPB 2HWE3 4BCUA 4N53A 3ZFFA 4CDWB 2ZZQA 1M06G 1QJU2 2HWF3 4WM7A 3JB8A 3FBMA 3JBG2 1ASJ2 1MQTC 3NAPC 5BNNB 1AYM1 3M8LA 2Y26A 4CDWC 2RM21 2RS52 4NWWA 1NY72 2WS93 3ZFEB 1VBA2 1OOPA 1EV13 2RS13 4YVSB 1NCRA 1PIV3 1OPOA 4CDXA 5BNNC 1ZBE2 4WM8C 1Z7S3 4CEWA 3ZFEC 1PO12 2GH8A 5K0UB 4Q4W1 1CJDA 1RUJ1 3ZFGB 1AL0G 2HWB3 1D4M1 1PVC1 4YVSC 1RMU2 1QQP3 2VQ0A 1BEV2 1COV2 5BNPB 1NA1A 1C8M2 1OHFA 1VBC3 5K0UC 1RUD1 2MEV1 2HWE1 1NG0A 3ZFGC 4IV1C 1R1A3 2HWF1 3CJIA 5BNPC 4IV3A 5A32A 2WZR2 1QJU3 1RHI3 5DDJ3 1VB4A 2WS91 1PO23 1R083 1EV11 2RS11 1PIV1 1DDLA 1Z7S1 1VRH3 1RUE2 3VDDB 1H8TA 1QJX2 1RUG1 2HWB1 1HRV3 4CDQB 1VBE3 2RS33 4GMP0 5C8CB 4Q4X2 3VDDC 1RMU3 1COV3 2R042 4N43B 1ZBA2 1AL21 1R1A1 1AR82 4CDQC 4SBVA 5AC92 1HXS2 3ZXAC 5C8CC 1BBT3 1RUC2 1QJU1 2RMU2 1RHI1 3IDEA 1AR73 5DDJ1 4N43C 2WFF2 1R092 3JBG1 1ASJ1 1RUH3 5BNOA 2BBVA 3JD72 2R062 2RR13 1PO21 4QPGB 3VBHB 1R081 2RS51 1E57A 1PGL1 1NY71 1VRH1 5C9AB 5D8AA 4RR3B 4QPGC 3VBHC 4RQPB 2RM23 1BMV1 1PO11 1SMVA 1VBE1 4CEYB 1RVF2 2X5IB 1TME2 5CFDB 4GH4B 1RMU1 2BFUS 5C9AC 3VBUA 4RR3C 1COV1 4RQPC 1C8M1 4Q4X3 3DPRB 4CEYC 3VBSB 2R043 2X5IC 5CFDC 4CDUA 5L7OA 1BBT1 4GH4C 1TMF3 1ZBA3 1AR83 1X33A 4GB32 5A33A 2WZR1 4WM8A 4Z92B 3DPRC 4PDWA 3VBSC 2RR11 2GSYA 2WFF3 1R093 4JGYA 1RUF2 1V9U2 1HRI2 3JD73 2R063 4RS5A 1ND2B 1EAH2 1NCQA 2BPA2 5C4WB 4IV1A 4JGZB 1FPN2 1QJX1 1ND2C 4RFT0 2DF7A 1RVF3 1TME3 4YVWA 4JGZC 5ACA2 2WWSA 5C4WC 4Q4X1 4QPIB 2R041 1RUG3 3VBFA 1TMF1 1ZBA1 1AR81 1HXS1 1NOVA 1FOD2 1WCDJ 4RHV2 3VBOA 2ZTNA 5ABJA 4Q4Y2 4QPIC 1MEC2 2RMU1 4N53B 1X36A 2WFF1 1R091 3ZFFB 1AL23 1AR62 4WM7B 3JD71 2R061 1RUF3 1V9U3 3TN92 4N53C 3ZFFC 3JBG3 4WM7C 1ASJ3 1PGW2 2PLV2 1AYN2 1VB2A 2XBO2 3J8F2 1OOPB 1K5MA 2RS53 5CFCA 1NCRB 1FPN3 4CDXB 1RVF1 1TME1 1VBA3 4CEWB 2BUKA 1VBB2 1QJY2 1ZBE3 1OOPC 5FOJB 1PO13 1NCRC 4CDXC 2BFUL 1NA1B 4CEWC 1BEV3 2FZ2A 4GB31 1FOD3 2HWD2 4RHV3 5J96B 1C8M3 1POV0 3CJIB 1NA1C 4IV3B 5A32B 3VBRA 4AEDA 1RUF1 1V9U1 1AR63 2WLPA 5JZGA 1B35A 1CD3G 4GMP3 2WZR3 2XPJA 2R072 3TN93 3HAGA 4IV3C 1EAH1 2HWC2 3JB4C 4FTSA 1FPN1 1ND3A 2XBO3 1VBA1 1PVC2
chains in the Genus database with same CATH superfamily
3ZLIA 5KHGA 2RDRA 4LEJA 3OY8B 4MGIE 5GZEA 3GZAA 5FBZA 4YZ3A 5ACA1 3PUIA 4YFWA 5IHRA 1W8NA 3AMPA 3WNXA 1H9PA 1OA3A 2JICA 5FWEA 5GKAC 2BTVC 1XE8A 4J6GA 1H8TC 2HWF2 2RE9A 2NQYA 4ITCA 4NO4A 4AAXA 4LO4B 1DZQA 2QQPA 4MO3M 1US2A 3E6CC 2IFRA 3LDKA 3KB5A 4Q4Y1 2ZABA 4OMDA 3W59A 3BTAA 4XMAA 3GZEA 4AOCA 2IXJA 4O7XA 3B7MA 3NV2A 1FMD2 1MS0A 4LBKA 5FXWA 1W3XA 4K6BA 2ZOEB 3C7FA 4H3WA 4ZU4A 5JSRA 4BZ4A 4CRQA 3VHNA 2Q4SA 4WV8A 3VUOA 1YEWA 4D7YA 5A3OA 4QX8A 3I3MA 2HYXA 2VW2A 3O12A 4YVSA 3POSA 2VO5A 3O5SA 1D0HA 3B5LB 1C57A 4TXWA 2YHJA 5F39A 1QQP2 1XU1A 3DXUA 3GCXA 1JYWA 4XF0A 1NX9A 2TNFA 2WL1A 2XJSA 4Q0SA 4XAEA 5E16A 3ZFGA 1ENQA 2EIEA 4FP3A 2HBUA 1HQNA 1VBD3 4AQ6A 2A1XA 4CU8A 5D8AC 5CADA 4UW6A 1W6NB 3SEEA 2JG8C 5LA0A 5FKCA 4AGGA 3K46A 2PHXA 4W4ZA 4HFSA 5F6LB 3QD6A 4L92A 2WKKA 2ZGNA 1SDDB 2VVEA 3FHQA 1F8VA 2VL4A 1B09A 5DDJ2 2XVKA 3WP4A 4CDUB 4HMZA 3MV11 1JZ5A 1DYKA 4GKYA 1PO22 1JH5A 2DDUA 5A33B 2RDQA 3HN1A 4WM8B 4DIQA 1R082 1V6JA 1ENRA 2OUJA 2ZX2A 4Q26A 4XUNA 3P5BA 1J3QA 1CZTA 5L7OC 5LY1A 2MNGA 3WINE 4YW1A 1UU6A 4ONUA 4X6QB 1QJZA 1VLNA 3PURA 2VUCA 3ZXLA 2DV9A 4FFFA 2GH2A 3WUDA 2D6NA 2PQQA 4FPYA 1VBE2 4PDWC 4EZ4A 2J1RA 3T1LA 1NCQB 1QH6A 3O1RA 3DUIA 2BV4A 4RS5C 1X8MA 2GDFA 4QXHA 4HLTA 4QPWA 1VBD1 2E7AA 2GU9A 2BGCA 3AMMA 5L36A 1TZOA 3D8CA 4OLLA 4URTA 4N43A 1YQ8A 4WVMA 4PIXA 4XFBA 2JD4A 2WSUA 2YV8A 3VGIA 2K0GA 2BBAA 3WNPA 4Y4YA 3JCIA 4DUXA 3VBFB 1RUH2 4MH0E 4Q4V2 5CNAA 4NHMA 4QHOA 3OYWA 4I3GA 4YVWC 5JIUA 3ITQA 3VBOB 1LGNA 2EAKA 5EHDA 1FAYA 2GMPA 3HMYA 4LO6B 5FKBA 3GDBA 1WLTA 3ZYIB 3JU9A 4G3YC 1AYM2 1REEA 4JCKA 4ZU5A 1RB8G 3H8XA 3NMBA 3BYWA 1X9TA 2BEOA 4JQTA 4LA2A 3HEIA 1QXRA 2VPVA 4P9XA 3NV1A 3KV4A 2DCKA 3O0VA 4LBQA 2XJTA 3HWJA 1H6XA 1XU2A 3LSEA 5CFDA 4CUCA 2G1MA 1K5MB 5CVRA 5GZGA 3O1VA 1POV3 4Q4W2 2PLV3 2VTXA 4UFLA 5FYVA 1HB4A 3V56A 2FQPA 2QQJA 5FYHA 4EV0A 3KVBA 2R49A 3J8F3 1OLMA 1QH7A 4H55A 2Z2SB 4KG8A 3H3UA 4OI4A 2I2SA 1Q8VA 4RFRB 2AEYA 3VBSA 1CAUB 1F5FA 4M0HA 5FMBA 1CONA 5CFCC 2OXBA 3OUIA 5FRAA 2EIBA 1G9CA 2WNVC 4TZDA 1TEIA 5SV5A 2VZPA 5EP9A 3V65A 1OA2A 3KM5A 4BPZA 5FXZA 1OLRA 3OGJA 1LOCA 5JLVA 1EP0A 5FYTA 4XILA 4E4SA 2XKPA 2YGMA 3MBWA 4HZFA 1Q43A 4QX1A 3RMXA 4YZ1A 1OSGA 1WLDA 3VBRB 2X10A 3MIEA 2OW4A 5GLWA 1UPIA 2VD7A 3GALA 4PI0A 1OD5A 4AI2A 1LOAA 3WDXA 4QDSA 2VM9A 2G4IA 1FNZA 3THPA 5C4WA 2B4KA 1EV12 1GSLA 1HRV1 1GKBA 3A22A 1LECA 4IEYA 4EWAA 1PIV2 4NPMA 2R6QA 5FZ8A 4QKNA 3ES1A 4UOJA 1YFWA 4EN0A 1B35C 4Z1VA 1UKGA 4IEQA 2PLV1 4BJ0A 1FNYA 1RUG2 2E9QA 4FCAA 1QOOA 2WQ4A 4GAZA 4MGSA 4PF5A 1XNTA 3J8F1 4XHBA 5F3GA 2ID4A 1YQ6A 3OGGA 1BK0A 4COYA 4MOAA 1AX2A 3MGUA 1GOFA 2WABA 2Y34A 4S2GA 4KGGA 4Y4RA 2WR9A 1PVC3 5FK7A 2XUMA 3SCGA 2JX9A 4HN0A 2CU5A 1W9WA 5C6CA 2BWAA 3SQOA 2W91A 1E5HA 3AJYA 3V0AA 1YIPA 1MQTB 2A73B 2MEV3 4BCUA 3GHMA 1OQEA 4KQ7A 5LBCA 4CUAA 1M06G 2HWF3 4TTGA 1UYPA 3ACGA 1MS1A 2JEMA 2XQRA 2FDJA 2Y8KA 1BZWA 1EUUA 3BIWE 3TB0A 1CX4A 3T30A 2JJ6A 3O1SA 3NAPC 2JKBA 5BNNB 1Y7BA 1N1YA 2Y26A 2YC0A 3N3HA 3T4VA 3ZFEB 1F4HA 1HQWA 1UZ0A 3B01A 2P3KA 4DXRA 4XUPA 5HXVA 1DGWA 1OOPA 2E26A 2PAEA 4C90A 3UJQA 5FZIA 5GJ6A 2ZBJA 2XJUA 4MXWB 5FZDA 5A6ZA 2IFWA 1PO12 4HVQA 1EUTA 2B45X 1NLRA 4OUSA 1CJDA 2LALA 2YPDA 4AQTA 3EB7A 1WA4A 2HWB3 2OVUA 3LDBA 1PVC1 1RMU2 1QIQA 1QQP3 1RJ8A 3KSCA 5A7PA 5T50A 1Y9MA 3LZZA 1COV2 5FMDA 3GCWA 5A3WA 1NA1A 3VD4A 5CEHA 1GP4A 4K1ZA 1AHSA 2JG9C 1IS6A 1SACA 2MEV1 5C3SA 3RZZA 4Q5OA 4P14A 4DQAA 2HWF1 2HKXA 5BNPC 4UFKA 5FFOC 4Y1XA 2CWSA 2WNEA 2WIIB 5DUUA 2CAVA 3CL1A 4R8HA 1O3TA 2ZGQA 3GBWA 3U07A 3H42B 5DDJ3 2VJXA 4DEQA 3GHNA 1H9WA 3KLSA 5F9TA 4XUOA 5IK7A 4LJHA 2PQSA 3G6JB 5FXXA 2VZTA 2ADEA 2Q8OA 4ZXKA 4C91A 5J3UA 1PO23 2V73A 3NQHA 3O0XA 3WOGA 1R083 3A7QA 4BQ2A 4LE4A 2D6OX 1IOAA 3OCPA 2Z79A 4NIHA 1DDLA 2RG4A 4IQPA 4BIOA 1IPSA 4XEZA 5DG1A 2XH6A 2YPJA 3VDDB 1H8TA 3CZJA 2QQNA 4Q29A 1JYNA 5HCFA 1OLME 3AL6A 2HWB1 4HVRA 5LRSA 2ZKLA 1VBE3 3I2KA 2Q8EA 2OT7A 4XAAA 4XABA 4YW2A 5J1XA 1SFPA 3SHRA 4GMP0 5C8CB 2CV6A 4LTAA 2Y64A 1GOHA 1UN1A 3QACA 5FR3A 3TEZA 4YW7A 2P3IA 1ZBA2 2VUJA 1YNAA 3WW3A 4CDQC 2Q8DA 3ZXAC 5A3PA 1OH3A 3CMGA 1JYCA 3N9NA 4AVAA 1S0BA 3AXDA 3QOPA 2W3JA 2RMU2 2HEYF 5L19A 1PMHX 3HQRA 5DDJ1 1H0BA 3JBG1 1EYBA 1RUH3 4HOOA 4CCCA 1O3RA 5FPXA 2DFCA 2BBVA 2P3YA 2DCYA 1PO21 2QCSB 2KXLA 4MGKE 4Y1ZA 4E4DX 1R081 1RGSA 3MLKA 4CCDA 1NY71 4M0NA 2G9GA 2W1QA 3VD5A 3I4IA 1VE0A 4AYUA 1DP0A 2JB4A 3VKLA 4EE2A 1DQ0A 2IVIB 5D8AA 3RZLA 1T6BX 2JG8A 2JENA 3VBHC 2WQZC 4LMFA 3ZDVA 1TQ5A 2PMWB 4AW7A 1JUHA 4Y5TA 1SFNA 1VBE1 1HB1A 1SLBA 1GOGA 2NYYA 2XMLA 5C3PA 1RL3A 3V64A 4DRRA 5BYNA 1TME2 4QAWA 1DQ2A 4GH4B 1KQRA 1RUNA 5C9AC 3CF6E 3FC0A 2X09A 1V6IA 4RR3C 1C5IA 3HVDA 5GZDA 3ZYGA 2VMEA 4MGZE 3M3CA 2R043 2XONA 1O91A 3LAGA 4OI2A 5L7OA 1J1TA 4R52A 5LBBA 1G9BA 3I3BA 4GB32 1IKPA 2WZR1 1F4AA 5IK8A 3ILRA 3S57A 4PDWA 1MZEA 3K77A 5FUPA 1LEMA 2RVAA 1ZZ7A 5CG8A 5KXBA 2NP0A 1RUF2 1V9U2 2GNMA 2PHFA 1UYYA 4UW4A 3LCPA 4W6YA 1HRI2 4RS5A 1SPPA 2VBDA 1ND2B 4C0HA 3RZHA 1WGPA 1HV0A 4ORFA 4MG2A 4RGAA 2BPA2 3ZYRA 4HPKA 1W6MB 1OQDA 3HD8B 4NIGA 1FPN2 1KDMA 1QJX1 3AX4A 3P3NA 4HSLA 3WV6A 2VTFA 3B9IA 1ZZ8A 1BLZA 3WDVA 1V6MA 4XTMA 3K3OA 2QQIA 3KZ4C 1GZTA 2DF7A 1PNFA 1HLCA 2I74A 2QQUA 4IDZA 5CKNA 5JXJA 1WZXA 2CTVA 2WSVA 1GWMA 4YVWA 4JGZC 5ACA2 1XRUA 5FZCA 1VR3A 1ZA4A 4QPIB 5JOYA 2B9VA 2I07B 2PHTA 2QNKA 3WLUA 2R041 1RUG3 1QXJA 3RS6A 2QDRA 1LHNA 3M1HA 3PUAA 1WMFA 4NN0A 5FXVA 4QU1A 1CAVA 5LA9A 3UK9A 3KQ4B 4MUVA 1CN1A 4KU7A 4Q4Y2 4Q8KA 1MEC2 2VQTA 4GWIA 1FATA 5GLVA 5JOXA 1PZ8A 3U75A 4AR2A 1CESA 3D82A 3LIGA 1W0OA 2VNOA 5CISA 4M3CB 1D0GA 3K3NA 3LSDA 3AMQA 5FBJA 3GZTB 1QOTA 3HJRA 4Y22A 3UV9A 3N7LA 4LBQD 1XPWA 3HT1A 3ZFFC 3E5XA 4KI5M 4COWA 5HPOA 1CGPA 4XCBA 2QJVA 1O8PA 5GLZA 4B4QA 5FPUA 2FDIA 2AREA 2Q1MA 3LEGA 5IYYA 5CFCA 2ET7A 3M3QA 4YM1A 4CDXB 2WNVA 3J7MA 1SEFA 4FI9A 3GJAA 5DAVA 3T3YA 1QY4A 4QM8A 2BUKA 3T0DA 3N35A 2B39A 1PZ9A 1QJY2 4IEPA 4LIUA 1NXD1 4XFAA 1W3VA 4ARXA 1W8OA 3WP5A 4OI1A 2SLIA 3WX5A 1PO13 5FOJB 1DGRN 3R6SA 5J37A 1Y3TA 3BPSA 5IFPA 4FXKB 4CEWC 3L9JT 2P4EA 2D43A 4I30A 3H8RA 3NSTA 1FOD3 1W0PA 1Z0HA 5FO8B 1DYPA 4ZS3A 1T2XA 5F8PA 4JAAA 3SH5A 2FD8A 1C1LA 4EN9B 1MS4A 1B35A 1I5PA 2ZGKA 2OQ7A 1AVBA 1GNZA 1KRIA 1CD3G 4D7SA 4AVSA 4EQVA 4R9AA 5LRRA 1Q8PA 3GJBA 2W68A 3N36A 4KWKA 4M00A 4JRAA 3ZSJA 2VMIA 3SH4A 4AF9A 4NR1A 1H6YA 2I45A 1LODA 2GP3A 4KBZA 4IXLA 1UNBA 1K45A 4I01A 4LOTA 2VU9A 4P00B 1APNA 1S55A 5LA2A 3NV3A 2WA3A 2J1AA 5EWSA 1VBD2 2VUAA 3ZSLA 3UL2A 1OVPA 2TEPA 2A5ZA 4E4HA 4XF3A 5JSPA 4HBNA 3NNFA 2A70A 2ZHNA 4Y26A 5GLUA 2PA7A 5FDBA 2A75A 4Q1PA 4JTOA 4NIIA 3PL0A 2ZJCA 3NAPA 4COUA 1G9DA 1FOD1 3S6PA 4I2OA 5AFBA 3LA3A 3AJZA 1W2AX 2ARXA 4GWNA 1BQPA 3AC0A 1KXGA 1ENSA 3KMHA 3OEBA 4OHVA 2VCAA 5C5TA 2WS92 1OT5A 1Y43B 1VALA 2D6KA 3WXPA 5KWRA 4LOSA 2ZX3A 1DHKB 5FYYA 1CAXA 1ZRIA 2RMU3 3VDBA 3A0NA 3B94A 4BH9A 3CNAA 4YW6A 4L0PA 2PTMA 2XB6C 2XHNA 3RSJA 2HWC3 3B69A 2Y6HA 3M3IA 3ZXEA 2JG9A 4A44A 5BNOC 3USUA 2R16A 3ILFA 3SLIA 3WF2A 1LHVA 2XR4A 3FLTA 5EFUA 3VZOA 5C3QA 1UMIA 5FY7A 3IIIA 4PLOA 3L2HA 2CY6A 1VBB1 2R7EB 5BNPA 2Y0OA 3GGLA 2HYKA 3RYKA 3WCRA 2PFWA 2QTWB 4ES9A 1ZRDA 4D6SA 4OVEA 3E5QA 2W1WA 3OD0A 5FYCA 4XQDA 2L9LA 4NRQA 3OUJA 2VOXA 1X8EA 2GN3A 1RHI2 1YJLA 4Q2FA 1HN1A 5CZKA 3D0SA 1LB2A 2QKDA 4NIDA 2JDAA 3ACIA 2WAAA 3VBUC 1GUIA 5C3OA 4D94A 1G8WA 4Y33A 2VZ1A 4XZPA 2VCCA 3U14A 4MADA 4X8NA 4D69A 1PGL2 4JKMA 2E51A 4GB33 2BOIA 3FWEA 3HBKA 2PHRA 4Q0QA 4XUQA 4BQWA 1UPSA 3OD4A 4XBLA 2HWC1 1C3HA 4B1LA 5FUNA 1HRV2 4PQQA 4NJ4A 2VQAA 4K40A 1HRI3 4D6QA 5A32A 2WFPA 4CYDA 3AP7A 1DQ1A 1W8WA 2BU9A 4JGYC 3RQ0A 3V0BB 1OXCA 1OFNA 3AVSA 3DV8A 4CDQA 1HW5A 3KCYA 2MPFA 2TBVA 2E6VA 3AP6A 3VD3A 5A1AA 5I91A 4BLJA 3VB9A 2YZ4A 1NAEA 5I0DA 2UWCA 4CCNA 3FX3A 4DS0A 2ZHMA 2D5FA 4BMBA 1ZVFA 2OKXA 5B2GB 3F95A 5FY1A 5LK7B 4IEOA 5ACA3 2BVBA 1JZ2A 1LRHA 3PU3A 1YFXA 3Q8FA 1W2TA 5EXOA 1JZ8A 3ASIA 3N9OA 4QQ2A 5F2WA 1PM7A 1IHMA 1W8UA 2YFUA 3EO6A 2WZEA 3W20A 4XIOA 4IGQA 3WVJA 4URAA 1NLSA 3VBHA 3B9CA 4Q4Y3 3I2OA 1OD3A 1MEC3 4A3ZA 5J09A 1C8NA 5FP8A 1IS5A 4XZUG 5ABJC 3CKHA 2FDHA 3GXUA 2UYAA 1YRZA 3A4UA 4HONA 5C9AA 1HRI1 5DG2A 2V09A 2ZZJA 4RR3A 3RYPA 3ZSMA 5FYBA 4E8DA 1IZ3A 2WQ8A 2D3PA 2G19A 3LDRA 4LBNA 3NJYA 5FZ9A 3NL1A 5FZFA 1VBC1 3J7LA 4UT5A 2D40A 2J1VA 2VR4A 2WRAA 3MIBA 2VOVA 4INDA 4LKEA 5F2SA 1SLLA 3N7JA 3LFIA 5FQ0B 1PK6C 4JRLA 4KL1A 5L9BA 4XJWA 4FPFA 3DL3A 4CP9B 1TE1B 1YIFA 1ULPA 5CBLA 3KWVA 3K4ZA 4YG3A 3IMNA 2MEV2 1K12A 4TLGA 5FZ7A 2Y60A 2ILMA 1QJY3 5T52A 2NMOA 4CE8A 5F6KA 1FV2A 3E6BA 2C5DA 4NWVA 1RUOA 3R0RA 3CEWA 5A80A 1VRBA 5DN2A 1TG7A 2IXLA 3CQOA 5JXIA 1MEC1 5EJZB 1NUKA 1NQDA 1GNYA 3NRUA 4H7LA 4Z2WA 3AP4A 2V4AA 2A7AA 4EYUA 3I59B 3NV4A 1GP5A 2C9AA 2PHLA 3HN3A 4AQSA 4JC1A 4CU7A 4JGZA 1OFSA 2JE7A 3O14A 4R4ZA 2QQKA 4AEDC 4MX3A 4FTEA 1W39A 1BVVA 4W65A 5JZGC 4GALA 1QDOA 1XSRA 3LEIA 1ND3B 1CX1A 5CB7A 2HWB2 3EQEA 3VHOA 3RPQA 3MV01 4BOWA 2Y6LA 1RUJ3 4H2AA 1D4M3 1DLLA 1W8FA 3DYPA 3IM0A 3VKMA 1JI6A 1SZBA 4K1YA 5L9VA 2YC4A 3H9AA 1QJY1 5DAWA 2SBAA 4SLIA 2P6HA 3E97A 4CCOA 1HKDA 2VQUA 4OCTA 3C7GA 1S4CA 5AVPA 1PX4A 4GD4A 3WF4A 4FQZA 1O5LA 4B7KA 1FT9A 2JKXA 4UYBA 3ZFFA 2ZZQA 3TEWA 2LW8A 5DABA 4L2NA 1WW5A 3MW4A 3JBG2 5DMYA 3I97A 5DAQA 1G7YA 1H4GA 1W2UA 1CAWA 3IPVA 3PIJA 4LK6A 2KR2A 5JI7A 3MUZ1 4K21A 1UWWA 3O1MA 4XF9A 4CDWC 2RM21 3MIFA 2GN7A 1NY72 2WS93 3ZMOA 3VDCA 1U0AA 1Q5OA 3I2GA 2BGPA 4N8MA 2TUNA 1VBA2 4R9BA 3DF0A 4YVSB 1GV9A 4GULA 1H2LA 1H1IA 1ZBE2 1GZ9A 4HANA 4KNCA 4CEWA 4MLOA 1D4VB 5FWJA 2VMHA 4Y1UA 2YC2A 5JWPA 1RUJ1 3ZFGB 1AL0G 3UKTA 1D4M1 1W06A 4YSFA 2VQ0A 4XDQA 1QF3A 2ZGOA 4MHRA 4FPOB 4MXVA 2GC3A 2YBPA 1OHFA 4IE5A 4BB3A 4P9IA 1DYOA 5K0UC 1AXZA 4HVOA 1ZA7A 1KJLA 2WN2A 3T2TA 4XFFA 2VW0A 1R1A3 1WW7A 1YC61 2W47A 1UIJA 5AVAA 3ZM8A 4HXCA 3CJIA 4PIZA 1ONAA 4N9HA 4P5HA 2WZR2 2ERFA 2PELA 4B1MA 2JDYA 4XIKA 2PN5A 1GQHA 4CCLA 1FYUA 3S5AA 1RHI3 2H0VA 1D7PM 2G9FA 1POQA 1JU4A 1VB4A 4F83A 4JTNA 1O3QA 2WS91 5A7WA 5JPMB 2KD7A 2D3RA 2RV9A 4M3CF 1DZTA 3N7MA 1W6QA 4AHYA 3IB3A 3FUOA 2D97A 4YW4A 1RUE2 3HBZA 3DECA 1AF9A 3T09A 1QJX2 2AUYA 4FQ4A 1PM4A 4P9JA 1PZ7A 2A6VA 5E6HA 3NKTA 3MUY1 2ZGMA 5SV8A 3UGHA 5A3LA 4ZU7A 4N7UA 1HRV3 3Q9OA 3WG3A 2NPIA 1LGBA 1KFXL 4E4ZA 2JDPA 3IKWA 3LIHA 4TWTA 3D5OA 1CPMA 2WWJA 1V6NA 4B7EA 5FZGA 2P37A 2R042 3R4DB 4N43B 4WVMB 3WSOA 3N9LA 1AL21 1R1A1 1SLAA 2WO7A 3FUQA 4SBVA 1IPKA 4QQHA 5FYUA 3HQXA 2P1BA 1OKQA 2QUOA 5HCHA 3H7JA 1QXPA 1MACA 1JUIA 1RHI1 3AZZA 3IDEA 3LWCA 3OYWB 4IERA 4NRMA 5DPNA 2OZJA 2JDHA 3LKJA 1H2KA 4AHWA 1LHOA 4DUWA 5BNOA 2D6PA 5JXHA 1AJKA 4LITA 3AM2A 1LULA 3VKFC 1RTVA 2RDSA 4BQ4A 5ANNA 4LHKA 5FY4A 1PGL1 3PVBB 4OULA 2OS2A 1E5IA 2C1FA 2ZMLA 4KWJA 4AI8A 5M0TA 3ZR6A 2ZGRA 4MHUA 4AFBA 3PNAA 4J1XA 4LA3A 5FMCA 3ZYBA 4KU8A 5JI9A 3S5QA 4QPGC 4TYSA 3AK0A 5DAXA 4QXCA 1U12A 3OPZA 4Q0UA 4QX2A 3ACHA 1LOGA 1TNFA 3FL7A 4LBQB 4XW3A 3RJ2X 3POFA 2DCJA 3PMEA 4ET7A 5FPLA 4ISQA 3ZXKA 5CFDB 4LO7A 4XXAA 3DCQA 3EYPA 1GBGA 3ZMNA 3B02A 4JX0A 3VBUA 3ZX7A 4AXOA 4PBPA 1HN0A 4RQPC 3K4AA 2HEVF 4FFGA 3SC7X 4CTEA 5I93A 5FYMA 1K42A 2DU0A 3JZVA 4CEYC 4FAHA 1YUDA 2IXKA 2X5IC 3AKRA 4I0WB 3VBSB 3ZDSA 5FP9A 5FY0A 4QXBA 1AR83 1X33A 2IUWA 2YU1A 2YROA 4LBJA 3UNPA 3OGRA 3PTYA 3OEAA 2VZVA 3DPRC 3E6DA 2XWBB 3LEKA 3POGA 4S2FA 2D44A 2VNVA 4EWDA 3BTZA 1W2NA 2AEZA 3ZYHA 4KMQA 4O61A 4JGYA 5ANQA 1WCKA 2R063 4DOUA 5A6XA 1BK1A 3ZIWA 1GMMA 5CU1A 2WO1A 4XMIA 5FZ6A 4M4PA 4XC9A 1OURA 3MPBA 4IV1A 3NJVA 5L73A 5C4WB 2N7GA 3ACFA 1LOBA 3NJXA 3ORJA 3ZXFA 4UWDA 4Y20A 5FYIA 3D4KA 4B8EA 4RFT0 5J7MA 3ZSKA 3U11A 1DZRA 4PLMA 4DXSA 3GNEA 1LJ7A 1NXMA 2QQWA 3LGRA 4CPBA 4DPNA 1DIWA 2PHWA 1XYOA 1XC6A 5D2AA 3UGGA 1RINA 4F3JA 4MYEA 2DYCA 4QQLA 2ORXA 5KR7A 4XFHA 4BISA 1REFA 1AR81 3FHAA 4UFHA 1BCXA 1HXS1 4WZCA 1ODMA 1FOD2 4XVHA 3ZYPA 1WCDJ 5ABJA 2ZTNA 5CYYA 1UF2C 3IT8A 3WG4A 1DQ6A 3V0AB 3ILNA 2A6WA 1PX3A 2D5HA 1X36A 4GKXA 4JQRA 1JN2P 2GNDA 2KA3A 2E63A 3SXWA 3EMRA 3O1UA 2IXCA 2R061 2WC2A 3AZVA 2P34A 3OB8A 4BMEA 1U5YA 3OPWA 1PHMA 3I3DA 1LOEA 3KCCA 4UF0A 4N53C 3BOPA 5I0TA 1CWPA 2QVSB 5B4XA 1JTZX 4IEZA 2HLEA 2J1SA 1PK6A 2ZGLA 3JBG3 4WM7C 3ETQA 1MS9A 5DZEA 4A7ZA 1O59A 1QU0A 2BGOA 4XJ9A 2AC1A 3IMMA 4X8PA 3ROUA 1RXFA 2W1SA 3AYDA 3H7YA 5APAA 5HI0A 1OOPB 5EQUA 1G9AA 1SDWA 1P8JA 3MI8A 4Y1VA 4OQ8A 4W6XA 2QDNA 5GZFA 4Z82A 1VBA3 3LE0A 1XNBA 3WNLA 5IAVA 4AK3A 4AL9A 3MW3A 2ZGPA 4A7KA 1VBB2 4FOQA 4PIYA 1ZBE3 2O14A 3D3AA 3OGSA 3HNMA 1J3PA 3J26N 2W92A 3WDWA 3HOBA 3ZN4A 1NCRC 3KCXA 3FLRA 3VZMA 1U5IA 1NA1B 3TBDA 5FZ0A 4DY3A 1OBNA 3ZN5A 4FPGA 3IWZA 3POYA 4P9WA 5IFTA 1WBLA 4Z07A 4QPYA 1E5SA 1POV0 3BTXA 1Q56A 1R1ZA 4AVBA 1RITA 3NKGA 4D3WA 1ZRCA 1H2NA 4AEDA 4FPJA 1EPWA 2WLPA 1AR63 3ECQA 4O65A 3T0AA 5JZGA 1AX1A 2WZR3 2Y6GA 2B7YA 4XJUA 2YBSA 2ZMKA 1IG0A 4QU2A 4XUTA 3A23A 2Y0IA 3I3QA 3KF3A 4XDOA 3HAGA 5LATA 4IV3C 1EAH1 3LA2A 1JS9A 3RRDA 1W9SA 2HWC2 4FPEA 3RVHA 5BNQA 5EJ1B 1L3JA 1W8ZA 4JDMA 4QWNA 3THDA 1RYYA 2FMDA 3EBRA 4QGMA 4MV2A 2VVDA 5JR2A 1VBA1 1QJEA 2OA2A 1H8TB 2W0XA 2EXHA 5JUVA 2ETEA 3PMSA 4IE4A 2V72A 2VECA 1ZBE1 4UXAA 5TSWA 2W95A 3W5NA 1RUE3 1ULFA 4UW3A 2XVGA 1M4WA 4P5YA 2HWE2 1QJX3 2WNUC 5FP4A 4E9KA 3MIDA 2GP5A 1UZYA 2XGXA 1UD1A 4NMIA 1FV3A 1VMFA 4IE6A 4LO8A 1JOPA 4CDWA 2BDRA 1XE0A 1CJPA 3UJOA 2LTNA 1KS4A 5J98B 1A8DA 2HWD3 3TAYA 2FCUA 3MZHA 4YZ4A 2ZEXA 2YDEA 2WZ8A 1AR61 1DFQA 2BVVA 4GZ9A 4YZ5A 4OQ9A 2IZWA 4FTBA 2DFBA 1NQJA 1GR3A 2XLGA 4IGOA 5FLJA 3Q8CA 4NVPA 1ZZBA 3POWA 5IAXA 2ZEYA 5EPAA 1OVSA 4LLOA 5L9RA 4KWLA 1W8TA 5LBFA 5F3IA 2WBKA 1N1SA 5JOZA 3PHMA 3PU8A 3C7EA 4OMCA 4KWUA 4EN8B 4NPRA 2AZ5A 5D8AB 3KV6A 5K0UA 1JOBA 4D0QA 2JG8B 2H0BA 2ZGTA 3OSDA 1WWYA 4LHNA 4BLIA 1VBC2 1YQ2A 3U4XA 5FPBA 1RUE1 2VZOA 3L2YA 4PCRA 1URXA 5BV6A 1MR5A 3AB0A 4CU6A 3BUCA 1W8HA 1N1VA 1XNCA 5A7QA 5FZ1A 3EJKA 5FO9B 3NNJA 2FHRA 4JHTA 1QDCA 4BA6A 2J7MA 2VOTA 1CVNA 5EZWA 3AL5A 5T3NA 2P3JA 4YLZA 5KXDA 4BHPA 1GLHA 1VPHA 2HWD1 5L7OB 4D7TA 1ALYA 1S2KA 1HX6A 3VD9A 3BIEA 2V4VA 1NKGA 1U5XA 1WCSA 3WNOA 5CG9A 4AI9A 2VZRA 3PVOA 1V00A 2DBIA 1LEDA 1MS8A 4PI2A 3NNMA 2FCTA 4XQ4A 2VUDA 4I3PA 4PDWB 2WZPP 1JYVA 4F8AA 4CDUC 1VRH2 2GC1A 1UOJA 1YI7A 2QBXA 2R071 2JXAA 3JQXA 4RS5B 1SPPB 2XKOA 3U4SA 2YBKA 4KG0A 1BMV2 2BNMA 2X8KA 3ENRA 3GBFA 3H1YA 5FK8A 1W9YA 5FZLA 1Y4WA 1OF3A 3AP9A 1W90A 4CCKA 2XUEA 2DCTA 4CUBA 4HPKB 5H9QA 5IVVA 3LOBA 4FOYA 3C7OA 3M3OA 3T0BA 2E7TA 3POIA 1REDA 3BU7A 3ZXJA 4YW5A 2ZHLA 5I0SA 4ZPIA 5A6QA 3E5UA 1NCQC 2E33A 4YVWB 1BBT2 1ZRFA 2NLRA 1AR93 1G86A 4QT6A 3ZN6A 3VZJA 3I49A 2R1DA 2Q1ZB 2JDNA 4QKFA 2A3YA 3D6EA 1Q3EA 1SLCA 2UURA 2CL2A 5DZGA 4XHXA 1JBCA 1YJKA 4ZS2A 1CAVB 2EAAA 2RR12 3H3LA 4QGNA 1ZREA 3U37A 5JSOA 3SEPA 1ZZCA 2R0HA 3ON7A 5A6YA 1GFF2 1HQLA 4E2GA 4DY5A 4XPVA 1TNRA 3VBFC 1OUSA 2D93A 4QPGA 4YGBA 1LR5A 1OQ1A 1LNSA 3APBA 2BP6A 4ZKTB 2DVAA 2YGLA 4AVCA 1DGWX 2J42A 2W5FA 3VBOC 2HH9A 1RUI3 2RM22 4KH9A 4XJZA 1HB2A 2OYZA 4LNVA 4Y22B 1WD3A 4RGKA 2Y6KA 4YWAA 4EN6B 4RQPA 5C70A 2EICA 4RYDA 3TYJA 3BKZA 2OPKA 3RDIA 3CJIC 4CEYA 2CGNA 4LLFA 2X5IA 4NUBA 5CFCB 3WT3A 2GC0A 2UY9A 1DF0A 2WNVB 1RUJ2 2LUWA 1D4M2 1TMF2 2R30A 2Q8CA 3WDTA 1UL9A 1AR91 3DPRA 1YYNA 4P9YA 5EYYA 5JR7B 3HPNA 3ZYJB 2Z69A 3Q8AA 1K5MC 4UI9L 1WMEA 4FSJA 4TSVA 2E7QA 1W6PA 3ME2A 1VBB3 2OUHA 3FMGA 1GWKA 2RJLA 3VDAA 4ZZ8A 5C33A 1YO8A 2X53S 2GNTA 5FMOL 5FPVA 1BKZA 2W52A 2D3SA 2W46A 3CIHA 3MDPA 3RI9A 4Y5Z0 3UT0A 4M01A 5B4NA 4NHXA 1RUI1 3VZKA 1B35B 2XWJB 4QM9A 4A41A 2V5DA 4LPLA 3KD4A 3BB6A 1WW6A 3MLLA 4DNYA 5C3RA 1UW8A 1O8SA 5F32A 5F37A 5C8WA 4OZOA 3VBRC 2RS31 4OHZA 4FBFA 5J48A 2GNBA 2VH9A 4FFIA 4QMAA 2X05A 2PAMA 4AI1A 1S1AA 4CPBD 1TVGA 2BWCA 3HQUA 3O0WA 1JHNA 4W8JA 5DUXA 4HG6B 2VCMA 2EF6A 5H9SA 2FDKA 4HK9A 3VHRA 3AYAA 5K7PA 2DUOA 1S0IA 2VZSA 1PGSA 4FOVA 4BDVB 3WQ7A 1SLIA 4QGLA 1AR71 4CP0A 4M3CE 4ARYA 1AX0A 1D2QA 3BU0A 1AL22 1N1TA 1J58A 1R1A2 3HNBM 3RGBA 4A4AA 4FP2A 1RUD3 5JPNB 3NAPB 2HWE3 3OJBA 4S2DA 4N53A 1XB9A 2CYFA 4ES8A 1I3HA 1BJQA 1J3RA 4BM8A 4WM7A 1WW4A 5FP3A 3ETPA 4L11A 3BN6A 4RL7A 1JODA 3JB8A 3FBMA 3WUCA 1MQTC 5F5IA 1A8MA 1N3OA 2WLQA 5H9PA 2WYFA 4GIQA 4BWOA 2VULA 1SG3A 4OHXA 4B29A 4B4PA 2XOMA 1CAXB 4NWWA 3TRSB 4PHZA 3MFCA 5I8SA 3ST7A 4XJ8A 2RS13 3BTYA 4CZSA 5LWBA 4NRPA 1NCRA 2PAKA 4RN5A 4XE9A 3ZPYA 5BNNC 4AEJA 4K8RB 3U1XA 2CDPA 1C1FA 1QOSA 2B8MA 2CWMA 2JG9B 3C3VA 3USUB 3ZFEC 4CP2A 3MW2A 4LT5A 1VJ2A 1S0FA 5JMOA 4LHLA 1GZWA 2Z5WA 3PTRB 5FZOA 1GANA 3WW2A 1BEV2 2W87A 5F5QA 1W6OA 4XFIA 3I8TA 5BNPB 5I0UA 2F17A 4FVVA 4MGYE 3NVCA 1VBC3 1W2OA 2O8OA 4A6SA 1RUD1 3X29B 2HWE1 1NG0A 3WY6A 4IV1C 1HB3A 3OPTA 2A6ZA 4OZXA 4V2WA 1NYWA 1UU5A 5DUVA 1KS5A 2O1QA 4IV3A 1N3QA 2VZ3A 2WT2A 4XJAA 3HT2A 1QWRA 3RJRA 2CGOA 4L9BA 3WD5A 3WDYA 3AYCA 4DXZA 4MGTA 3PJYA 1QJU3 4BXFA 4W6WA 3K75B 2CGPA 3MPPG 3WQ0A 1UX7A 4GQ7A 1MZ6A 1A34A 1WCUA 4HT1T 5IW0A 1FXZA 1VAVA 4QB2A 2YYOA 1YQ5A 4AE2A 5EIYB 2J1EA 1UY2A 1ZM1A 2RHPA 4CXYA 2RS11 1UU4A 1XSQA 2W2IA 2CNAA 2ES3A 1EY2A 2JDMA 2VVFA 4NAMA 1YLLA 4QKDA 2WNUA 4A2UA 1VRH3 5A7OA 2A6YA 3KQRA 5FZBA 5FY8A 4ZXEA 3OY8A 4WVWA 3W58A 3P1IA 1MZ5A 3GYDA 4JVAA 1WD4A 3LFMA 1ULCA 4CDQB 3T2PA 5HV0A 3T4HB 5KC6A 3VDDC 4M4RA 4DUVA 4K3UA 3WG2A 3PUQA 5KBFA 2RJKA 2ZGUA 4YPJA 1QNYA 1AR82 1XE7A 5AC92 1HXS2 1X9PA 2A3XA 1DLCA 4DO0A 5C8CC 3AMHA 4QB1A 1BBT3 3H0OA 1RUC2 2XVLA 4FPKA 1JXNA 2P2KA 3FBYA 4QX5A 1QJU1 4BXSV 3UESA 4DFSA 1JYTA 1QKQA 2WWUA 3H50A 4EROA 5K4LA 2NM1A 3AVRA 4HL0A 4RGGA 1WMXA 3BPZA 3KV9A 4L99A 1DQ5A 1ASJ1 3KT4A 5C7GA 2EIDA 2JIJA 5FZMA 2R062 2ZCWA 2RR13 2C24A 3OBTA 2ENRA 3VBHB 1SQ4A 2RS51 3JQWA 4DRVA 1UXXX 4LHSA 1MS3A 3N9PA 2VBBA 1XXNA 1VRH1 3OG2A 4GJYA 4ASMB 5C9AB 1YFYA 1W05A 2W39A 3ATGA 3H3ZA 4RR3B 4ZZ5A 1JYXA 2QE3A 4BQ3A 4OUMA 5IATA 2RM23 3LEMA 1BMV1 4AEMA 3CDZB 1US3A 2JE9A 1C28A 3WHTA 1WLCA 4ISRA 5BY5A 1MVQA 1W6NA 3IAQA 1UQXA 3VKOA 5HV4A 4UAPA 1QGLA 4AWDA 1C8M1 3LOIA 4Q4X3 2E32A 4WVVA 3KT7A 2WA4A 5JOWA 4CDUA 1F31A 1BBT1 4GH4C 1TMF3 4XF1A 4CCMA 3VL8A 2A6XA 1JYIA 1XNDA 5A33A 4WM8A 2FCVA 1BHGA 4AAPA 1I1EA 2OZ6A 5IVFA 2AR6A 5ISLA 2P17A 4CXXA 2Y6JA 2RR11 4JV4A 1KFUL 2WFF3 1R093 1V0AA 3JUUA 4NROA 2MHFA 5C71A 3JD73 5H9RA 1CIWA 4WZFA 1A3KA 3NNGA 3KVAA 2Q1FA 5DAPA 3VHPA 4BYYA 1EAH2 1S0DA 1DCSA 2XJVA 3K4DA 1NCQA 2QZ3A 1O7FA 4H7MA 4JGZB 5CKQA 5A3MA 5LY2A 2PXJA 2BZDA 2DU1A 4V2VA 1ND2C 4COVA 2W94A 3WW1A 5JMCA 5A70A 2LRPA 4ZHNA 5FYZA 1RVF3 5KHJA 3B3QE 2VCBA 2WWSA 2XHKA 4Q4X1 4AZZA 3N9MA 4BQYA 2FBEA 4YG6A 5FLHA 5K8SA 3IBMA 4HETA 3VBFA 1TMF1 4BK4A 4TLFA 2Z42A 2WUHA 4ATFA 1XQNA 3VV1A 1HJFA 3VBOA 3MHZA 1W99A 4IEUA 3BCWA 4QPIC 3RZGA 2DCZA 1GQPA 3A0KA 2BJSA 3BODA 2WFF1 1R091 5FZHA 1GYKA 2DVGA 3FLPA 3GM8A 1AL23 1H1MA 2WINB 4XFCA 3ZFFB 4EZHA 1AR62 2R1BA 1X7NA 2CAUA 1V70A 3JD71 3KT1A 4GA9A 3I2HA 4AFCA 4AQ2A 3BI3A 1JW6A 3T1MA 5EV7A 2A71A 3K2OA 1V6LA 1AJOA 1CAWB 2DUPA 3IPVB 4HKOA 4CU9A 2DVBA 4ZY9A 3RYRA 4YGCA 4YRDA 5FPZA 4YYOA 2JB8A 5BUVA 2VNRA 2BERA 1AYN2 4E2SA 1VB2A 5LW9A 1JZ7A 1K5MA 4LUMA 3N9QA 1O5UA 1RVF1 3DKQA 1R64A 5J36A 1CZSA 3IDBB 4CEWB 1FI2A 4XXPA 2YG0A 1VMHA 1CAUA 3M3EA 3PVEA 5JIAA 3WCSA 3SISA 3PIGA 2VC9A 4IEWA 4CDXC 2BFUL 5FJKA 2XLFA 3TEXA 3VN4A 5LK5A 4YNIA 1I5ZA 1JU3A 4XBQA 1XNAA 2AGSA 1BEV3 2FZ2A 4PQ9A 4CCJA 4Y3OA 4LORA 2HWD2 2GMMA 2E31A 3J4UH 4RHV3 1OLQA 2XJPA 3DKWA 2FMYA 2J22A 1YI9A 3ALQA 3B00A 4XACA 4HK8A 4GWMA 2C26A 3AP5A 3CJIB 3VBRA 2D7FA 2D6LX 3QH6A 2QFEA 5IVJA 3POEA 2E53A 4JKKA 1VMJA 1IS3A 3MFAA 4AHXA 2G9ZA 4UBGA 1C5HA 4GMP3 1WUVA 3MIHA 2XPJA 5A7WB 2R072 2R32A 1SLTA 4LBOA 3TN93 3WF1A 3R4UA 4I0BA 4QHZA 3JB4C 4QX7A 3RWNA 4FTSA 5FYSA 5EJ3A 1W6QB 5D21A 4AGVA 5KXEA 1DBNA 2IC1A 2XBO3 5D1IA 5DXDA 3MYXA 3WW4A 1K5JA 1AUYA 2VMGA 3S30A 4DINB 2ATFA 1CPNA 2VW1A 2YFZA 3U78A 4DXTA 2VE1A 1ST8A 3MICA 1OUXA 1GWLA 4FAGA 2BNOA 1F35A 3J7NA 4OHYA 4LXLA 4PLNA 1UAIA 2Y6FA 5DZFA 1JMUB 1K3IA 4QD2A 1BEV1 4R9DA 3NW4A 1MQTA 5T5JA 1Q8OA 1Q8SA 4WVZA 4XTPA 4XQWA 4RHV1 5FV3A 3FE5A 5G05L 2FZ1A 2P5BA 4FPHA 3W9AA 3ZKYA 1NZIA 2ZA9A 5FZEA 1GICA 1HXS3 4Q0VA 5AC93 1LHWA 3IZOA 3TWIA 3AKPA 5BNNA 1CQ9A 3UKNA 4GMP1 3U0ZA 2K2SA 4IEVA 1RUC3 3VKNA 1O3SA 2QQOA 5BNOB 2C0ZA 1NLQA 3TN91 3ZFEA 1ULEA 2K46A 2VMCA 4U36A 4Z2AA 1Z7S2 3JXSA 1JZ6A 5K9YA 3D0JA 1PGW1 1POV1 2B9UA 3EHKA 3PJQA 3KS7A 4LQRA 1CR7A 3HR9A 2BRTA 2ZX4A 2VMFA 2XBO1 4V1PA 3C2UA 3IAPA 4MXWA 4ASKA 4BQXA 4O9EA 4CA9A 4QX0A 4DZGA 5IVCA 3LPFA 1RXGA 3WZ1A 3ZXGA 5KHIA 4J25A 1ZNPA 3RI8A 2UY8A 5I0RA 2OX0A 3OGVA 1WKYA 2ZMNA 4NOTA 1SHWB 1AR92 1FX5A 1LKNA 1V6KA 3AMNA 3VBUB 2LS6A 1I6XA 1VAMA 1UOFA 2QZ2A 2JD9A 2RJ2A 4LK7A 1IS4A 5FMOS 1O6UA 5FTTC 2WAOA 1J1LA 4A6OA 4W50A 1RJ7A 1WA6X 1DQ4A 3I2IA 1BXHA 1Y9QA 1HIXA 4XF4A 3WEZA 1SBDA 3H8UA 5AC91 1MS5A 1ULGA 5E1RA 5I8TA 1YWKA 1S0JA 3N7KA 1RUC1 3NWKA 5LASA 4FPCA 1FMD3 1PNGA 1DGLA 3KGZA 1KJRA 2VY0A 1VAKA 4JGYB 1RUI2 5CIRA 3O1OA 2NZ9A 4DEVA 1UOBA 4QB6A 3N4MA 3OBZA 1XOYA 3TNPB 3IIAA 3RFRA 1QEXA 1JZ3A 4MSVA 5FZ3A 3VDDA 1E5RA 3HIFA 2RS32 3VL9A 4B3NA 2LM3A 4G9SB 2XQXA 4IV1B 2F4PA 5HBAA 3OBRA 3SNMA 4UBHA 3DEMA 1EAH3 4Y20B 4J1WA 1IQDC 3P3PA 1NT0A 3POJA 4YW3A 5C8CA 4IW3A 4K9SA 3ZSEA 1W03A 2OPWA 5IK5A 1H4HA 4HKLA 4IESA 3C8XA 2BW8A 2AH2A 4U2AA 4C0BA 4AFMA 5A1LA 1AR72 3R4SA 2J1TA 4QDRA 1KD7A 5JAXA 2QQMA 2WYSA 1YFUA 5FAXA 2XJQA 2DTYA 4R4XA 3WP6A 4UFMA 3KV5A 1F2NA 1UO9A 3AYEA 2YMZA 5ABJB 4R9CA 3VD7A 4Q1RA 1FMD1 4QXKA 3C7HA 5LCWL 3GZUC 2EXKA 1OC1A 1UY4A 3CHXA 3DYMA 5T5LA 3AXEA 4CCEA 3KGLA 3WP3A 5KXCA 5FZ4A 3FN9A 3M2MA 5FLIA 3ZO0B 4C1XA 3TOJA 4UF0B 3I2DA 5A7SA 2WT1A 4YGDA 1S0EA 2GALA 1UY0A 4LR4A 1PK6B 1D2SA 1A6CA 1OMIA 1QQP1 3K51A 3SH3A 3M7AA 3SKJE 5CKMA 4K7JA 1S2EA 2ZKNA 4F7ZA 2ZAHA 3ZOIA 5LA1A 4UFJA 1G9FA 1QMJA 4FO9A 4GH4A 3ABZA 3POBA 1AYN3 2WT0A 4EJRA 3BALA 1T6GC 1HJGA 4K20A 5FCCA 1CIYA 2VXJA 1S2BA 3ES4A 5IK4A 1IKQA 1S0GA 2UWBA 2XL7A 4Q8LA 4LUKA 1GZCA 1RIRA 4L97A 2JDKA 1DG6A 3WF0A 1RUD2 3QLQA 4CSWA 3W21A 5F3CA 2VOWA 2RDNA 2ZX0A 4QQPA 2B5HA 4HKWA 2ADDA 3THTA 1ODNA 4Q4V3 1UOGA 4P08A 2XLAA 2J1UA 3HNYM 2ARAA 3B93A 1VP6A 3GF6A 4FFHA 5LBEA 4YARA 4YZ2A 2ZXQA 1ND2A 3I3EA 4LBLA 4AEDB 4AVTA 4NAOA 4GXLA 5JZGB 2ZAAA 5JXGA 1UMHA 5F7UA 4TN7A 5DQ0A 3O1PA 1AYM3 3H1MA 2W9XA 3O7OA 4NHLA 1IQAA 2VXRA 3KF5A 2RS12 1W6MA 2GC2A 4QHBA 3QBQA 1GQGA 2OQ6A 3I2JA 2D6MA 2YUEA 3DN7A 5GLTA 1A78A 2BNNA 3ZVXA 4AVVA 4UFIA 2JIGA 5FOBB 2R073 1AYN1 1H8VA 5G04L 1OF4A 5FZAA 1UIKA 4XBNA 1UY3A 1ULDA 5FO7B 3S7IA 4Q4W3 3CLPA 4QPIA 1LAJA 1ZZ9A 1LOFC 1UX6A 1DU3D 3FFQA 3TEYA 2Q30A 3DGTA 3S7EA 1LHUA 4E2QA 3MEPA 2VZUA 3QH7A 5A3UA 3MO4A 1ND3C 3PUSA 2VGDA 2JDUA 2P6CA 5HCAA 5E8AA 4GWJA 2H6CA 4EWEA 3RZJA 3AFGA 1ULOA 1RUH1 4Q4V1 1MPXA 4S2HA 3KHCA 1OI6A 3I54A 3IDCB 5T54A 4CDWB 1QJU2 3ZXDA 4XFGA 2ZS6B 3F2ZA 4M3CA 1IPJA 1O4YA 1ASJ2 1UZZA 2PYTA 3AFKA 3AZYA 3WQ1A 1XYPA 2CHHA 5AFEA 2VMDA 1AYM1 2EVXA 3AKQA 4LO5B 5F5CA 2ZEWA 4LE3A 3M8LA 2RS52 3S0MA 2O0OA 2Y38A 1QHDA 4KGQA 4UW5A 4XETA 2WDBA 5FPAA 4MGQA 5JVVA 3AZXA 4BQ5A 2ZHKA 1EV13 1HDKA 1XNKA 2JWPA 4AFAA 5CA6A 1OH4A 1KDKA 1PIV3 1OPOA 1SBFA 4HSJA 1HV1A 1SFYA 2V5YA 4I09A 4WM8C 1Z7S3 4YG0A 2UYBA 1STMA 2EXJA 1ZRRA 3MLJA 3OTFA 2D98A 2H6BA 2GH8A 5KHHA 4Q4W1 5K0UB 1X82A 4YM2A 3TNQA 3GBGA 3RWKX 3A21A 5HXMA 4RSUA 5DUWA 3WHUA 1JOJA 4NE9A 1OA4A 1NE6A 1DGRA 1WBFA 4YVSC 5FY9A 5LZ6A 2JECA 2UU8A 2WN3A 1LU2A 4DMIA 4GJZA 1UMZA 1C8M2 3NNLA 2YB7A 4JZRA 3RZMA 1GU3A 4Q27A 5LB6A 1MZFA 5BPXA 3ZFGC 3ACLA 4CUGA 2IVJA 4KBBA 4H14A 2Y33A 3UGFA 3M70A 3VZNA 1N3PA 3FFZA 4I02A 4XYXA 3SCHA 3W5MA 5HCBA 2BYVE 4Y24A 4YM0A 4Q0PA 1O4ZA 2AENA 4OHWA 5JCTA 3O1TA 2VZQA 3KHBA 1JHJA 2W1UA 2DUQA 1NZCA 5FREA 3EXUA 1AXKA 4JHZA 3CO2A 2FDGA 5T5OA 4IUGA 1L7RA 4ASLA 4D8MA 3WNKA 4ATEA 2O8QA 4FT8A 1H1AA 1YCIA 2ARCA 2VBPA 3BVCA 4COZA 1EV11 4IEXA 5FP7A 5A1FA 3RMYA 1PIV1 2NN8A 2QQVA 4Y1YA 1S0CA 1Z7S1 4LIVA 1UYZA 5GZCA 1YQCA 4FOWA 1V6OA 1WMDA 1RUG1 1XJAA 5IWFA 4YM3A 3K48A 1WLWA 1H30A 2K9ZA 3AKSA 2RS33 4AGRA 3AKTA 4NHKA 4OI0A 1BYHA 1NE4A 2WO3A 3PVNA 4DB5A 2Z4FA 4Q4X2 3T2OA 4P02B 1RMU3 1CZVA 1PVXA 2EXIA 4QQOA 1COV3 2ARBA 2EA7A 2GMEA 2NMNA 2ZX1A 4IL7A 3LF7A 2FDFA 1YXWA 3ZN6B 1AXYA 3BGAA 3M4FA 2BQPA 2DTWA 4Y5SA 1UCXA 3RNSA 4B4RA 5LEKA 1N47A 2Q0AA 5FIXA 1OKOA 2VTXJ 2Q5TA 1AR73 1XYNA 4N43C 2WFF2 1R092 4LBMA 4P9LA 5A7NA 1Q8QA 3CZUA 1LU1A 2BOJA 2DBNA 4RA0A 4YFZA 3JD72 2F6BA 3PUHA 3FHIB 4QPGB 4D6RA 5ERLA 1W28A 4CXWA 1E57A 4N90A 4A7YA 4QKBA 1W04A 2GZWA 2C4XA 1ZYBA 5EYXA 2VNGA 1QJFA 3SMHA 1G6NA 1W0NA 3MF9A 1PMJX 1W9FA 1J83A 5F5AA 4IE7A 4P9GA 1ZZ6A 2PHUA 4RQPB 1J59A 4NPLA 1U5ZA 1LESA 1GP6A 1PO11 4IETA 1SMVA 1SCRA 3I2FA 3URFA 4CEYB 1I9RA 1RVF2 4AHZA 2X5IB 3VZLA 3R05A 4Z8BA 3OF1A 2YU2A 4MVTA 1RMU1 2BFUS 4A42A 3J9SA 3UKVA 4AEKA 1COV1 3DXTA 4AG4A 4OUEA 2DVFA 4A45A 3DPRB 2JE8A 2HEWF 3MIGA 4FXGB 3WG1A 5CFDC 2ZPXA 1ZBA3 3IDAA 5IVBA 2HBTA 3VLBB 3CJXA 3SITA 1W6PB 3RG0A 5E88A 1Z78A 2XXZA 5KC5A 4BU2A 1PMIA 4Z92B 2HJIA 3LQCA 3NO8A 1OPMA 2WJSA 2WNOA 4LKSA 2GSYA 4MZUA 3VBSC 4PJYA 1X50A 1KEXA 2VAUA 2PHDA 2VOKA 5FJHA 3WQBA 2ORZA 4PT6A 4I0AA 5IVEA 3LA7A 1LGCA 2WO2A 1UYXA 2DVDA 4AI3A 2ZACA 4META 5KHKA 1ZX5A 3T2QA 3PDQA 2IXIA 1L7QA 4YGEA 2YXSA 4A3XA 1Y9GA 2XG3A 3UETA 5GALA 3V0BA 2C9KA 4BE3A 1RC6A 2YY1A 4CVUA 3WR0A 3Q8BA 1YHFA 5T55A 1JZ4A 4N9IA 4JDNA 1KGYA 4E27A 4FPLA 5E89A 1UZWA 2DURA 4PBOA 4ZONA 5FUIA 1TME3 2B42B 5C4WC 4JKLA 1W9TA 2KM2A 1H2MA 3CBNA 3BOWA 2CSGA 1F15A 2EIGA 3OOXA 5IUQA 3PLQA 1ZBA1 4N7IA 5T5PA 2C6SA 3LD8A 4JDOA 3OUHA 1NOVA 3ZIXA 3ZYFA 4RHV2 4AI0A 3SCFA 4OYUA 4RD7A 5LEJA 1F5JA 3J7HA 1LENA 2RMU1 4LKDA 3WNNA 3H8OA 4N53B 1IGOA 4QX3A 2IXHA 2XJRA 2EALA 1XBFA 3T08A 4C8DA 5FY5A 3WDUA 4WM7B 5I8YA 5IT6A 3THCA 4C1WA 3WF3A 3I7DA 3SKVA 1WCQA 3ZPOA 1L7LA 3RZKA 4BK5A 1RUF3 1V9U3 5A3TA 3TN92 1O4TA 4LKFA 4IE0A 5IJRA 3FJSA 2ET1A 4G4FA 2AACA 1ASJ3 1PGW2 2IWGB 4EN7B 4L8QA 2PLV2 2QQLA 4XCAA 2ZEZA 3P6BA 2B46X 4XDPA 2XBO2 3MF6A 4AFDA 2R0FA 3J8F2 2LROA 3FZ3A 2RS53 2UWAA 4NHYA 1LCLA 1NCRB 4XOGA 1FPN3 5FQ0A 2VG9A 2ZGSA 1UY1A 3ZR5A 1TME1 1SCSA 5CAZA 1MVEA 3USSA 4CP9A 5A3NA 1F9KA 1GZWB 1IG3A 3OBAA 1VIWB 1OOPC 4HN1A 5BXXA 1AZDA 5FZOB 1W6OB 1BVP1 3AZWA 2GAUA 4PF1A 4E8CA 4LULA 2CDOA 1ACCA 3CU7A 4BIFA 3NJZA 3Q8EA 4O9GA 3LB9A 4WBBA 1UKRA 2A3WA 4GB31 1UXZA 4BQ1A 1J84A 5F3EA 4IGPA 5J96B 1EPZA 1C8M3 4NIAA 2JDZA 2W08A 2XDVA 4CDXA 5IVYA 5JDBA 1NA1C 4IV3B 5A32B 4CP1A 1KITA 4X6RB 3H1WA 4OFGA 4QDQA 2DWRA 1LTEA 1RUF1 1V9U1 3WNMA 5FZKA 3U10A 3ZKUA 5C5UA 1UZVA 3I59A 1GNHA 1C4RA 3G7DA 2OIIA 1QNWA 3E1F1 3UYJA 4K8FA 3LPGA 5F1RA 2X29A 3QCWA 1SBEA 2AYHA 4XURA 1LOFA 3DYOA 3INAA 2F4LA 1FPN1 1ND3A 2WNUB 3IN9A 5GM0A 2XL9A 1ENXA 3ELNA 1PVC2
chains in the Genus database with same CATH topology
5KHGA 4LEJA 3OY8B 4MGIE 5GZEA 3GZAA 5FBZA 4YZ3A 5ACA1 4YFWA 3AMPA 3WNXA 1H9PA 1OA3A 2JICA 5GKAC 2BTVC 1XE8A 4J6GA 1H8TC 2HWF2 2RE9A 2NQYA 4ITCA 4NO4A 4LO4B 1DZQA 2QQPA 3E6CC 2IFRA 3KB5A 4Q4Y1 2ZABA 3W59A 3BTAA 4XMAA 2IXJA 3B7MA 3NV2A 1FMD2 1MS0A 4LBKA 4K6BA 2ZOEB 4H3WA 4ZU4A 5JSRA 4BZ4A 4CRQA 3VHNA 2Q4SA 4WV8A 3VUOA 4D7YA 3O12A 2VW2A 4YVSA 3POSA 3O5SA 1D0HA 3B5LB 1C57A 2YHJA 1QQP2 1XU1A 4XF0A 2TNFA 2WL1A 2XJSA 4Q0SA 5E16A 3ZFGA 1ENQA 4FP3A 1HQNA 1VBD3 4AQ6A 5D8AC 5CADA 4UW6A 1W6NB 2JG8C 4AGGA 2PHXA 4HFSA 5F6LB 3QD6A 4L92A 2WKKA 2ZGNA 2VVEA 1F8VA 1B09A 5DDJ2 2XVKA 3WP4A 4CDUB 4HMZA 1DYKA 4GKYA 1PO22 1JH5A 5A33B 3HN1A 4WM8B 1R082 1V6JA 1ENRA 2OUJA 2ZX2A 4Q26A 1J3QA 5L7OC 2MNGA 3WINE 4YW1A 1UU6A 4ONUA 4X6QB 1QJZA 1VLNA 3ZXLA 2DV9A 2GH2A 3WUDA 2D6NA 2PQQA 4FPYA 1VBE2 4PDWC 3T1LA 1NCQB 1QH6A 3DUIA 4RS5C 1X8MA 2GDFA 4HLTA 1VBD1 2E7AA 2GU9A 2BGCA 3AMMA 5L36A 3D8CA 4OLLA 4URTA 4N43A 4WVMA 4PIXA 4XFBA 2JD4A 2WSUA 2YV8A 3VGIA 2K0GA 4Y4YA 3JCIA 3VBFB 1RUH2 4MH0E 4Q4V2 5CNAA 4NHMA 3OYWA 4I3GA 4YVWC 5JIUA 3VBOB 1LGNA 2EAKA 1FAYA 2GMPA 3HMYA 4LO6B 3ZYIB 1WLTA 3JU9A 4G3YC 1AYM2 1REEA 4JCKA 4ZU5A 1RB8G 2BEOA 4LA2A 1QXRA 2VPVA 4P9XA 3NV1A 3O0VA 2DCKA 4LBQA 2XJTA 3HWJA 3LSEA 1XU2A 5CFDA 5CVRA 1K5MB 5GZGA 1POV3 4Q4W2 2PLV3 3V56A 2FQPA 4EV0A 2R49A 3J8F3 4H55A 1QH7A 2Z2SB 4KG8A 3H3UA 4OI4A 2I2SA 1Q8VA 3VBSA 1CAUB 1F5FA 4M0HA 5CFCC 1CONA 5FRAA 1G9CA 2WNVC 4TZDA 1TEIA 5SV5A 3V65A 1OA2A 3KM5A 4BPZA 1OLRA 3OGJA 1LOCA 5JLVA 1EP0A 4XILA 4E4SA 2XKPA 2YGMA 4HZFA 3RMXA 1Q43A 4YZ1A 1OSGA 1WLDA 3VBRB 3MIEA 2OW4A 5GLWA 1UPIA 3GALA 1OD5A 4AI2A 1LOAA 3WDXA 2G4IA 1FNZA 3THPA 5C4WA 1EV12 1GSLA 1HRV1 1GKBA 4IEYA 1LECA 4EWAA 1PIV2 2R6QA 3ES1A 1YFWA 4EN0A 1B35C 4Z1VA 1UKGA 4IEQA 2PLV1 1FNYA 1RUG2 2E9QA 4FCAA 1QOOA 2WQ4A 4PF5A 4XHBA 3J8F1 3OGGA 4COYA 1AX2A 3MGUA 4S2GA 4KGGA 1PVC3 2XUMA 3SCGA 2JX9A 4HN0A 5C6CA 2BWAA 3AJYA 3V0AA 1YIPA 1MQTB 2A73B 2MEV3 4BCUA 3GHMA 1OQEA 4KQ7A 1M06G 2HWF3 1MS1A 2JEMA 3TB0A 1BZWA 3BIWE 1CX4A 2JJ6A 3NAPC 2JKBA 5BNNB 1Y7BA 1N1YA 2Y26A 2YC0A 3N3HA 3ZFEB 1HQWA 3B01A 2P3KA 5HXVA 1DGWA 1OOPA 2PAEA 4C90A 3UJQA 5GJ6A 2ZBJA 2XJUA 4MXWB 2IFWA 1PO12 4HVQA 2B45X 1NLRA 4OUSA 1CJDA 2LALA 4AQTA 1WA4A 2HWB3 2OVUA 1PVC1 1RMU2 1RJ8A 1QQP3 5T50A 3KSCA 3LZZA 1COV2 1NA1A 4K1ZA 1AHSA 2JG9C 1IS6A 1SACA 2MEV1 3RZZA 4P14A 4DQAA 2HWF1 2HKXA 5BNPC 5FFOC 4Y1XA 2CWSA 2WNEA 2WIIB 5DUUA 2CAVA 3CL1A 4R8HA 1O3TA 2ZGQA 3GBWA 3U07A 5DDJ3 3GHNA 1H9WA 3KLSA 5F9TA 5IK7A 3G6JB 2Q8OA 4ZXKA 4C91A 5J3UA 1PO23 2V73A 3O0XA 3WOGA 1R083 4LE4A 2D6OX 1IOAA 3OCPA 2Z79A 1DDLA 4IQPA 4BIOA 4XEZA 5DG1A 2XH6A 2YPJA 3VDDB 1H8TA 4Q29A 5HCFA 2HWB1 4HVRA 5LRSA 2ZKLA 1VBE3 4YW2A 3SHRA 4GMP0 5C8CB 2CV6A 4LTAA 1UN1A 3QACA 2P3IA 1ZBA2 2VUJA 1YNAA 3WW3A 4CDQC 3ZXAC 1JYCA 4AVAA 1S0BA 3AXDA 3QOPA 2RMU2 2HEYF 5L19A 5DDJ1 1H0BA 3JBG1 1EYBA 1RUH3 1O3RA 5FPXA 2DFCA 2BBVA 2DCYA 1PO21 2QCSB 2KXLA 4MGKE 4Y1ZA 4E4DX 1R081 1RGSA 3MLKA 1NY71 4M0NA 2G9GA 3I4IA 4AYUA 3VKLA 1DQ0A 5D8AA 2JG8A 2JENA 3VBHC 2WQZC 1TQ5A 4AW7A 1JUHA 1SFNA 1VBE1 1SLBA 1G9DA 2NYYA 1RL3A 3V64A 4DRRA 5BYNA 1TME2 1DQ2A 4GH4B 1KQRA 1RUNA 5C9AC 3CF6E 3FC0A 1V6IA 4RR3C 1C5IA 5GZDA 3ZYGA 4MGZE 3M3CA 2R043 3LAGA 1O91A 4OI2A 5L7OA 1J1TA 4R52A 1G9BA 4GB32 1IKPA 2WZR1 5IK8A 3ILRA 4PDWA 1MZEA 1LEMA 1ZZ7A 5CG8A 5KXBA 2NP0A 1RUF2 1V9U2 2GNMA 2PHFA 4UW4A 3LCPA 4W6YA 1HRI2 4RS5A 4C0HA 1ND2B 1WGPA 1HV0A 4ORFA 4RGAA 2BPA2 3ZYRA 4HPKA 1W6MB 1OQDA 3HD8B 1FPN2 1KDMA 1QJX1 3AX4A 3P3NA 4HSLA 3WV6A 3B9IA 1ZZ8A 3WDVA 1V6MA 4XTMA 3KZ4C 2I74A 2DF7A 1PNFA 1HLCA 2CTVA 2WSVA 4YVWA 4JGZC 5ACA2 1XRUA 1VR3A 1ZA4A 4QPIB 5JOYA 2I07B 2QNKA 2PHTA 3WLUA 2R041 1RUG3 1QXJA 3RS6A 2QDRA 1LHNA 3M1HA 1WMFA 4NN0A 1CAVA 3UK9A 4MUVA 1CN1A 4KU7A 4Q4Y2 4Q8KA 1MEC2 1FATA 5GLVA 5JOXA 1PZ8A 1CESA 3D82A 1W0OA 2VNOA 4M3CB 1D0GA 3LSDA 3AMQA 3GZTB 1QOTA 4Y22A 3UV9A 3N7LA 4LBQD 3HT1A 3ZFFC 3E5XA 4COWA 2QJVA 5GLZA 4B4QA 2AREA 2Q1MA 5CFCA 2ET7A 3M3QA 4YM1A 4CDXB 2WNVA 1SEFA 1QY4A 4QM8A 2BUKA 3N35A 2B39A 1PZ9A 1QJY2 4IEPA 1NXD1 4XFAA 3WP5A 5FOJB 4OI1A 2SLIA 3WX5A 1PO13 1DGRN 3R6SA 5J37A 1Y3TA 4FXKB 4CEWC 3L9JT 2D43A 4I30A 3NSTA 1FOD3 1W0PA 1Z0HA 5FO8B 1DYPA 4JAAA 3SH5A 1C1LA 4EN9B 1MS4A 1B35A 2ZGKA 1AVBA 1GNZA 1KRIA 1CD3G 4D7SA 4AVSA 4R9AA 5LRRA 1Q8PA 3N36A 2W68A 4KWKA 4M00A 3ZSJA 4JRAA 2VMIA 3SH4A 4AF9A 4NR1A 2I45A 1LODA 4IXLA 4I01A 2VU9A 1APNA 1S55A 3NV3A 2WA3A 5EWSA 1VBD2 2VUAA 3ZSLA 3UL2A 2TEPA 2A5ZA 4XF3A 5JSPA 4HBNA 2A70A 2ZHNA 4Y26A 5GLUA 2PA7A 5FDBA 2A75A 4Q1PA 4JTOA 2ZJCA 3NAPA 4COUA 4I2OA 1FOD1 3S6PA 5AFBA 3LA3A 3AJZA 2ARXA 4GWNA 1BQPA 1KXGA 1ENSA 3KMHA 4OHVA 2WS92 1Y43B 1VALA 2D6KA 3WXPA 5KWRA 2ZX3A 1DHKB 1CAXA 2RMU3 3A0NA 3B94A 4BH9A 3CNAA 2PTMA 2XB6C 3RSJA 2HWC3 3B69A 3M3IA 3ZXEA 5BNOC 2JG9A 3USUA 2R16A 3ILFA 3SLIA 1LHVA 3FLTA 5EFUA 3VZOA 4PLOA 3L2HA 2CY6A 1VBB1 5BNPA 2Y0OA 3RYKA 2HYKA 4ES9A 3WCRA 2PFWA 1ZRDA 4OVEA 3E5QA 3OD0A 4XQDA 2VOXA 1X8EA 2GN3A 1RHI2 1YJLA 4Q2FA 3D0SA 1LB2A 2QKDA 3VBUC 4D94A 1G8WA 4XZPA 4D69A 4X8NA 1PGL2 2E51A 4GB33 3FWEA 2PHRA 4Q0QA 1UPSA 3OD4A 4XBLA 2HWC1 1C3HA 1HRV2 2VQAA 4K40A 1HRI3 5A32A 2WFPA 4CYDA 3AP7A 1DQ1A 4JGYC 3RQ0A 3V0BB 1OFNA 3DV8A 4CDQA 1HW5A 3KCYA 2MPFA 2TBVA 2E6VA 3AP6A 5I91A 4BLJA 2YZ4A 2UWCA 3FX3A 4DS0A 2ZHMA 2D5FA 4BMBA 1ZVFA 5B2GB 5LK7B 4IEOA 5ACA3 2BVBA 1LRHA 1YFXA 5EXOA 3ASIA 4QQ2A 1PM7A 1IHMA 3EO6A 4XIOA 3WVJA 1NLSA 3VBHA 3B9CA 4Q4Y3 1MEC3 5J09A 1C8NA 1IS5A 5ABJC 2UYAA 1YRZA 3A4UA 5C9AA 1HRI1 5DG2A 2V09A 2ZZJA 4RR3A 3RYPA 3ZSMA 1IZ3A 2D3PA 4LBNA 3NL1A 1VBC1 2D40A 3MIBA 2VOVA 4INDA 5FQ0B 1SLLA 3N7JA 1PK6C 4JRLA 4KL1A 4XJWA 4FPFA 3DL3A 1TE1B 1YIFA 5CBLA 4YG3A 3IMNA 2MEV2 2ILMA 1QJY3 5T52A 2NMOA 5F6KA 1FV2A 3E6BA 2C5DA 4NWVA 1RUOA 3R0RA 3CEWA 2IXLA 1MEC1 1NQDA 4H7LA 4Z2WA 3AP4A 2A7AA 3I59B 3NV4A 2C9AA 2PHLA 4AQSA 4JC1A 4JGZA 1OFSA 2JE7A 3O14A 4R4ZA 4AEDC 4MX3A 4FTEA 1W39A 1BVVA 4W65A 5JZGC 4GALA 1QDOA 1ND3B 5CB7A 2HWB2 3EQEA 3VHOA 3RPQA 4BOWA 1RUJ3 1D4M3 1DLLA 3IM0A 3VKMA 4K1YA 3H9AA 1QJY1 2SBAA 4SLIA 3E97A 1HKDA 5AVPA 4FQZA 1O5LA 4B7KA 1FT9A 3ZFFA 2ZZQA 4L2NA 1WW5A 3MW4A 3JBG2 1G7YA 1H4GA 1W2UA 1CAWA 3IPVA 5JI7A 4K21A 4XF9A 4CDWC 2RM21 3MIFA 2GN7A 1NY72 2WS93 3ZMOA 1U0AA 1Q5OA 2TUNA 1VBA2 4R9BA 3DF0A 4YVSB 1GV9A 4GULA 1H2LA 1H1IA 1ZBE2 1GZ9A 4HANA 4KNCA 4CEWA 4MLOA 1D4VB 2VMHA 4Y1UA 5JWPA 1RUJ1 3ZFGB 1AL0G 3UKTA 1D4M1 4YSFA 2VQ0A 4XDQA 1QF3A 2ZGOA 4FPOB 4MXVA 2GC3A 1OHFA 4P9IA 5K0UC 1AXZA 4HVOA 1KJLA 3T2TA 4XFFA 2VW0A 1R1A3 1WW7A 5AVAA 1UIJA 4PIZA 3CJIA 1ONAA 4N9HA 4P5HA 2WZR2 2ERFA 2PELA 4XIKA 2PN5A 1GQHA 1FYUA 1RHI3 2H0VA 2G9FA 1VB4A 4F83A 4JTNA 1O3QA 2WS91 5JPMB 2D3RA 4M3CF 1DZTA 3N7MA 1W6QA 4AHYA 3FUOA 2D97A 4YW4A 1RUE2 3HBZA 1AF9A 1QJX2 2AUYA 4FQ4A 4P9JA 1PZ7A 2A6VA 3NKTA 2ZGMA 5SV8A 5A3LA 4ZU7A 4N7UA 1HRV3 3Q9OA 3WG3A 2NPIA 1LGBA 1KFXL 4E4ZA 3IKWA 4TWTA 4B7EA 3D5OA 1CPMA 1V6NA 2P37A 2R042 3R4DB 4N43B 4WVMB 1AL21 1R1A1 1SLAA 3FUQA 4SBVA 1IPKA 4QQHA 3HQXA 1OKQA 2QUOA 3H7JA 1QXPA 1MACA 1JUIA 1RHI1 3AZZA 3IDEA 3LWCA 3OYWB 4IERA 2OZJA 3LKJA 1H2KA 4AHWA 1LHOA 5BNOA 2D6PA 1AJKA 3AM2A 1LULA 3VKFC 1RTVA 4LHKA 1PGL1 3PVBB 4OULA 4KWJA 2C1FA 2ZMLA 4AI8A 2ZGRA 4AFBA 3PNAA 4J1XA 4LA3A 4KU8A 5JI9A 4QPGC 4TYSA 3AK0A 1U12A 3OPZA 4Q0UA 4XW3A 3RJ2X 1LOGA 1TNFA 4LBQB 2DCJA 3PMEA 4ISQA 3ZXKA 5CFDB 4LO7A 4XXAA 1GBGA 3ZMNA 3B02A 3VBUA 3ZX7A 4AXOA 4PBPA 4RQPC 2HEVF 5I93A 4CTEA 2DU0A 3JZVA 4CEYC 4FAHA 1YUDA 2IXKA 2X5IC 3AKRA 4I0WB 3VBSB 3ZDSA 1AR83 1X33A 4LBJA 2YROA 3PTYA 3DPRC 3E6DA 2XWBB 4S2FA 2D44A 4EWDA 4JGYA 1WCKA 2R063 4DOUA 1BK1A 3ZIWA 5CU1A 4XMIA 3MPBA 4IV1A 5C4WB 5L73A 2N7GA 1LOBA 3ZXFA 4Y20A 3D4KA 4B8EA 4RFT0 5J7MA 3ZSKA 3U11A 1DZRA 4PLMA 3GNEA 1LJ7A 1NXMA 3LGRA 4DPNA 1DIWA 2PHWA 1XYOA 1RINA 4F3JA 4MYEA 2DYCA 4QQLA 4XFHA 1REFA 1AR81 1BCXA 1HXS1 4WZCA 1FOD2 3ZYPA 1WCDJ 5ABJA 2ZTNA 1UF2C 3IT8A 3WG4A 1DQ6A 3V0AB 3ILNA 2A6WA 2D5HA 1X36A 4GKXA 4JQRA 1JN2P 2GNDA 2KA3A 2E63A 3SXWA 2IXCA 2R061 2WC2A 3AZVA 2P34A 4BMEA 1U5YA 1PHMA 1LOEA 3KCCA 4N53C 3BOPA 5I0TA 2QVSB 1JTZX 4IEZA 3JBG3 1PK6A 2ZGLA 4WM7C 3ETQA 1MS9A 5DZEA 4A7ZA 1QU0A 4XJ9A 4X8PA 3ROUA 3AYDA 5HI0A 3H7YA 1OOPB 1G9AA 1SDWA 3MI8A 4Y1VA 4W6XA 2QDNA 5GZFA 4Z82A 1VBA3 1XNBA 4AK3A 3MW3A 2ZGPA 4A7KA 1VBB2 4FOQA 4PIYA 1ZBE3 1J3PA 3J26N 3WDWA 3ZN4A 1NCRC 3KCXA 3FLRA 3VZMA 1U5IA 1NA1B 3TBDA 4DY3A 3ZN5A 4FPGA 3IWZA 3POYA 4P9WA 1WBLA 4Z07A 4QPYA 1POV0 1Q56A 1R1ZA 4AVBA 1RITA 3NKGA 4D3WA 1ZRCA 1H2NA 4AEDA 4FPJA 1EPWA 2WLPA 1AR63 3ECQA 5JZGA 1AX1A 2WZR3 2B7YA 4XJUA 2ZMKA 4QU2A 2Y0IA 3HAGA 4IV3C 1EAH1 3LA2A 3RRDA 2HWC2 4FPEA 5BNQA 1L3JA 4JDMA 2FMDA 3EBRA 4QGMA 4MV2A 2VVDA 1VBA1 2OA2A 1H8TB 2W0XA 2EXHA 2ETEA 3PMSA 4UXAA 2VECA 1ZBE1 5TSWA 1RUE3 1ULFA 4UW3A 2XVGA 1M4WA 2HWE2 1QJX3 2WNUC 4E9KA 3MIDA 1UZYA 2XGXA 1UD1A 1FV3A 4LO8A 4CDWA 1CJPA 3UJOA 2LTNA 1KS4A 5J98B 1A8DA 2HWD3 3TAYA 4YZ4A 2YDEA 1AR61 1DFQA 2BVVA 4YZ5A 2IZWA 4FTBA 2DFBA 1NQJA 1GR3A 2XLGA 5FLJA 4NVPA 1ZZBA 3POWA 4LLOA 4KWLA 5JOZA 1N1SA 3PHMA 4EN8B 4NPRA 2AZ5A 5D8AB 5K0UA 2JG8B 2H0BA 2ZGTA 4LHNA 4BLIA 1VBC2 3U4XA 1RUE1 3L2YA 4PCRA 1URXA 5BV6A 1MR5A 3AB0A 1N1VA 1XNCA 3EJKA 5FO9B 2FHRA 1QDCA 4BA6A 1CVNA 5EZWA 5T3NA 2P3JA 4YLZA 5KXDA 4BHPA 1GLHA 2HWD1 5L7OB 4D7TA 1ALYA 1S2KA 1HX6A 1U5XA 1WCSA 5CG9A 3PVOA 1V00A 1LEDA 1MS8A 4XQ4A 2WZPP 4I3PA 4PDWB 4F8AA 4CDUC 1VRH2 2GC1A 1YI7A 2R071 2JXAA 3JQXA 4RS5B 2XKOA 4KG0A 1BMV2 2BNMA 2X8KA 3ENRA 3GBFA 3H1YA 3AP9A 2DCTA 4HPKB 5H9QA 3LOBA 4FOYA 3M3OA 2E7TA 1REDA 3BU7A 3ZXJA 4YW5A 2ZHLA 5I0SA 3E5UA 1NCQC 4YVWB 1BBT2 1ZRFA 2NLRA 1AR93 1G86A 4QT6A 3ZN6A 3VZJA 2R1DA 2Q1ZB 2A3YA 3D6EA 1Q3EA 1SLCA 2UURA 2CL2A 5DZGA 4XHXA 1JBCA 1YJKA 1CAVB 2EAAA 2RR12 4QGNA 1ZREA 5JSOA 1ZZCA 2R0HA 1GFF2 1HQLA 4E2GA 4DY5A 4XPVA 1TNRA 3VBFC 4YGBA 2D93A 4QPGA 1LR5A 1OQ1A 3APBA 4ZKTB 2DVAA 2YGLA 4AVCA 1DGWX 3VBOC 1RUI3 2RM22 4KH9A 4XJZA 2OYZA 4LNVA 4Y22B 1WD3A 4EN6B 4RQPA 3TYJA 2OPKA 3RDIA 3CJIC 4CEYA 2CGNA 4LLFA 2X5IA 5CFCB 3WT3A 2GC0A 2UY9A 1DF0A 2WNVB 1RUJ2 2LUWA 1D4M2 1TMF2 2R30A 3WDTA 1UL9A 1AR91 3DPRA 1YYNA 4P9YA 5EYYA 5JR7B 3ZYJB 2Z69A 1K5MC 1WMEA 4FSJA 4TSVA 2E7QA 1W6PA 3ME2A 1VBB3 2OUHA 3FMGA 2RJLA 5C33A 1YO8A 2X53S 2GNTA 5FMOL 1BKZA 2W52A 2D3SA 3MDPA 3RI9A 4Y5Z0 4M01A 1RUI1 3VZKA 1B35B 2XWJB 4QM9A 3KD4A 3BB6A 1WW6A 3MLLA 4DNYA 1UW8A 5C8WA 3VBRC 5J48A 2RS31 4OHZA 4FBFA 2GNBA 2VH9A 4QMAA 2PAMA 4AI1A 1S1AA 3O0WA 2BWCA 1JHNA 5DUXA 2EF6A 5H9SA 4HK9A 3VHRA 3AYAA 5K7PA