5C8CC

Crystal structure of recombinant coxsackievirus a16 capsid
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
242
structure length
242
Chain Sequence
GIPTELKPGTNQFLTTDDGVSAPILPGFHPTPPIHIPGEVHNLLEICRVETILEVNNLKTNETTPMQRLCFPVSVQSKTGELCAAFRADPGRDGPWQSTILGQLCRYYTQWSGSLEVTFMFAGSFMATGKMLIAYTPPGGNVPADRITAMLGTHVIWDFGLQSSVTLVVPWISNTHYRAHARAGYFDYYTTGIITIWYQTNYVVPIGAPTTAYIVALAAAQDNFTMKLCKDTEDIEQTANIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Structures of Coxsackievirus A16 Capsids with Native Antigenicity: Implications for Particle Expansion, Receptor Binding, and Immunogenicity.
pubmed doi rcsb
source organism Coxsackievirus a16 (strain tainan/5079/98)
molecule tags Virus
total genus 47
structure length 242
sequence length 242
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5c8cC00
1QJY2 1ND3A 1NCRA 4Z92B 4CEWB 2FZ2A 1ZBE2 1VRH1 1AL22 2WS91 1W39A 1RVF3 3VBRC 5DDJ1 1OHFA 5FOJB 1ZBA3 1FPN3 4N53C 1RUI3 1R083 2WZR2 4JGZC 1AR63 1POV0 4RS5C 4GB32 4Q4X2 4WM8B 4CEWA 1EAH2 4N53A 4SBVA 1PGW2 3JD71 4Q4V3 1MQTB 1VB2A 4RS5A 1NY71 1RB8G 1VBA3 1COV1 4GMP0 5C9AB 2ZTNA 4QPGC 1QQP1 1MQTC 5C9AC 1VBE1 1FOD3 2PLV3 1VBB1 1RUC2 4QPGA 1HXS1 1RUJ3 1MQTA 1RHI1 1EV13 1MEC3 1PVC2 4GH4B 1F2NA 2XBO2 4IV3C 5AC93 5C8CC 1C8M1 3ZFEC 5C9AA 4CEYC 5BNPC 1RUG2 3VBFB 5BNOB 2R071 5ACA1 1AR83 1M06G 2RS52 5BNPA 2BFUS 2Y26A 1QJU3 1VBD3 1D4M3 3VBUB 1AYN1 1RUH1 4AEDC 1DDLA 1V9U1 2VQ0A 1RMU2 5CFCC 5JZGC 1VRH3 3VBFA 2WS93 2R041 3VBUC 4AEDA 1BEV1 1NCQB 5DDJ3 1OOPB 1RVF2 1AR61 5L7OB 5C4WB 2R062 4WM7C 1PO11 1BBT1 5CFDB 3VBUA 1FPN2 1AR71 1RUI2 1VBC1 1R082 2GSYA 2HWC2 2RS31 2RM21 1X36A 1QJX2 1VAKA 4WM7A 3JD73 1VBA1 1NCQA 4QPIC 1OOPA 1POV1 2WFF1 4Q4V2 1COV3 5C4WA 4Y5Z0 2HWE1 2HWB1 1QQP3 3M8LA 4QPIA 1ASJ1 3ZFFB 1H8TB 1RUJ1 2RS11 1VBE3 4GMP1 1VBB3 5LK7B 5D8AB 1HXS3 1RHI3 1FOD2 2PLV2 4CDUB 1AYM2 2X5IB 1NCRB 1QJZA 1EV12 1C8M3 2DF7A 5D8AC 5AC92 1Z7S1 4CDWB 2X5IC 3VBHB 2R073 3ZFFA 1H8TA 5ACA3 1TME1 5D8AA 3VBRB 4CDUA 2WLPA 4CDWC 1PGL2 1AR82 2X5IA 3VBHC 1CJDA 1AYN3 1RUH3 1V9U3 4N53B 1QJU2 4JGZB 1PIV1 4Q4Y1 4CDWA 3VBHA 4RS5B 2R043 1BEV3 2WS92 3VDDC 3VBRA 5DDJ2 1A6CA 2WWSA 1PO13 4JGYC 1BBT3 1AL21 1F8VA 1AR73 1VBC3 3VBSB 2RS33 2RM23 4JGZA 4RR3B 5ABJB 1NOVA 4QPGB 4YVSC 4JGYA 1R1A2 3JBG1 1HRI3 1PO22 1POV3 2WFF3 3VBSC 1AL0G 4RR3C 5ABJC 1EAH1 1PGW1 2HWE3 2HWB3 4IV3B 5C8CB 3ZFEB 3VBSA 1ASJ3 3J8F1 3VBOB 2QQPA 4RR3A 5ABJA 4NWWA 1HRV1 1R092 4RHV1 3TN92 4CEYB 5BNPB 2RS13 2HWD1 2HWF1 1ND2B 4GMP3 2RR13 1VBE2 3VBOC 1RHI2 1RUF2 1FMD1 1ND2C 2MEV2 1Z7S3 4IV3A 4AEDB 3ZFEA 5C8CA 3VBOA 5CFCB 4CEYA 1TME3 5JZGB 4EJRA 1ND2A 2R072 4CDQC 1K5MB 1X33A 1RUG1 4WM7B 1K5MC 1PIV3 3JB4C 1V9U2 4Q4Y3 1BMV1 1IHMA 5CFCA 1RUD1 5JZGA 3HAGA 1ZBA2 1AR91 1K5MA 1RMU1 2GH8A 2R042 4FTSA 4YVWC 4QPIB 4N43B 4PDWC 1AR62 1AL23 5FMOL 2FZ1A 1PO12 1HRI1 1AR72 4YVWA 1GFF2 2RM22 2R061 4PDWA 2TBVA 4N43C 2RMU1 3FBMA 2WZR3 3JBG3 5K0UC 2HWC1 1VBA2 4GB33 1HQNA 1NA1C 2XPJA 1EAH3 2WFF2 1QJX1 2BBVA 4N43A 4LLFA 2HWE2 3J8F3 2RR11 1HRV3 4RHV3 2HWD3 2HWF3 1RUE1 1RUJ2 1MEC2 5A33B 1TMF1 1FMD3 1CD3G 3ZFGC 3S6PA 2ZZQA 1AYM1 1Z7S2 3NAPC 1RUG3 3IDEA 4BCUA 1VBD2 1D4M2 5A33A 3DPRB 3VDDB 4Q4W1 4JGYB 2BPA2 1VRH2 1ND3C 1QJY1 1AUYA 1PIV2 3DPRC 4Q4Y2 1RUD3 4YVSB 1ZBE1 1AR93 1RMU3 3DPRA 3VDDA 4FSJA 2WZR1 2R063 3JD72 2RMU3 4CEWC 4GB31 4Q4X1 3JB8A 4YVSA 2HWC3 1NY72 3JBG2 1COV2 1QJX3 5FMOS 1NG0A 1QQP2 1R1A1 1PO21 1VB4A 3J8F2 1VBB2 1RUE3 1HRV2 1HXS2 4NWVA 4RHV2 4WM8C 2HWD2 2HWF2 5BNNB 2BUKA 4CDQB 1TMF3 1RUC1 1C8M2 1R091 3TN91 5J96B 1E57A 1PVC1 4WM8A 1FMD2 2XBO1 5BNNC 5ACA2 1AYM3 1RUF1 4Y4YA 2MEV1 4RQPB 5BNNA 4CDQA 1AYN2 1RUH2 2RS51 4YVWB 4Q4W3 4GH4C 1SMVA 4PDWB 1OPOA 3CJIB 3ZXAC 4FTBA 4RQPC 1C8NA 1QJY3 1BEV2 1BMV2 4GH4A 1ZBE3 4IV1B 3VBFC 5BNOC 2ZAHA 3CJIC 1RUD2 4RQPA 5K0UB 1AR92 1BBT2 1NA1B 1RVF1 1VBC2 5BNOA 2RS32 4IV1C 1ZBA1 3CJIA 1FPN1 1RUI1 1R081 1B35B 1HRI2 4Q4X3 3LOBA 4IV1A 2RMU2 5K0UA 4CDXB 1NCQC 1OOPC 2HWB2 1B35C 4Q4V1 1NA1A 1R1A3 5L7OC 5C4WC 1ASJ2 1PO23 3ZFGB 5CFDC 2RS12 4CDXC 2RR12 4RFT0 1B35A 5L7OA 1RUE2 5CFDA 3NAPB 1RUC3 3TN93 1R093 5GKAC 4CDXA 1FOD1 2PLV1 1PVC3 1TMF2 2XBO3 2IZWA 5A32B 1EV11 3ZFGA 1MEC1 5J98B 2BFUL 5AC91 1TME2 1RUF3 1ND3B 3ZFFC 2MEV3 1H8TC 3NAPA 1HX6A 4FTEA 2RS53 4CDUC 1WCDJ 1NCRC 1PGL1 1AR81 4Q4W2 5A32A 1QJU1 1VBD1 1D4M1
chains in the Genus database with same CATH superfamily
1SDDB 3LDRA 1ND3A 4CP0A 4CEWB 3ACIA 2FZ2A 2Z42A 1LOFC 2QKDA 4ZY9A 1W8UA 1AL22 2CL2A 2WS91 3KGZA 5G04L 1RVF3 3VBRC 4I2OA 1KFXL 4BHPA 5A80A 4QX0A 3UGHA 1OHFA 4A6OA 1LHOA 5HCFA 1UYYA 4LBNA 1WGPA 4BQWA 4JHZA 1RUI3 2CYFA 4DOUA 3WDUA 3ST7A 1AR63 3IBMA 3EHKA 2W92A 2R0HA 1W6QA 4PBPA 5F6LB 1ONAA 2W94A 3T09A 4WM8B 4CEWA 4Y33A 3UT0A 4LITA 2VTXA 5HXMA 1J83A 3RYKA 2ORZA 1MQTB 2E26A 4LBQD 2WT2A 4K6BA 4LXLA 5LA0A 1NY71 5FZMA 1VBA3 1L7LA 2E9QA 1IKQA 1LNSA 3FWEA 4IEOA 1RYYA 4XVHA 4QPGC 5FZ0A 5H9SA 2J1TA 3VGIA 2WZEA 1YJKA 1KDMA 4QDRA 3NSTA 1RUOA 2BGOA 3AJZA 4OMDA 5FYSA 2WAAA 1K42A 1O59A 1VBB1 2I07B 3NV2A 5TSWA 4AVAA 1MQTA 1WMDA 1EV13 3IPVB 5FKCA 2D3PA 1YXWA 3FLTA 4BIFA 3I49A 2XQRA 3GBGA 3SCFA 4O61A 4N9IA 2P1BA 3B7MA 4YW7A 1EUUA 1I1EA 4IGOA 1DBNA 1HJFA 3HPNA 2XLGA 2PHXA 1JYIA 3VL9A 5ACA1 2GP3A 1UY1A 2J1EA 1ZRRA 3PJYA 1DLLA 1RTVA 4CP9B 3WG4A 2JE7A 4K9SA 1NLRA 3ZSMA 2B9VA 4QT6A 4BYYA 3IPVA 4OHWA 4U2AA 4YNIA 5J36A 5J1XA 5FY8A 2QQNA 1Y7BA 1VBD3 1XE8A 1RUH1 4XF3A 2AGSA 4C0BA 1CZVA 1V9U1 4QPWA 5CFCC 1GQGA 5FMCA 1VRH3 4NR1A 2FMYA 1ZA7A 5FYTA 4V2VA 5GZEA 5C7GA 1CAWB 3ZDVA 3WNLA 1BEV1 3DYOA 1H2KA 5DDJ3 4CP9A 1GZ9A 3NW4A 1LECA 2W39A 3U11A 1ZZ7A 1BBT1 1W8OA 2XUEA 3MZHA 4UXAA 5IVEA 2E63A 1FPN2 3VUOA 2XONA 4ET7A 3ZSEA 2RS31 1H2LA 4UFJA 5DQ0A 3S30A 4LK7A 5T50A 3NNFA 4WM7A 4YW6A 1CAWA 4R4ZA 3OYWB 2WKKA 4CCLA 5J09A 2UU8A 2VOKA 1QOTA 2WFF1 4E8DA 1IGOA 4Q4V2 4AFCA 1QXJA 2ARXA 1TQ5A 5C71A 3MW2A 4JKKA 4AVSA 4Y5Z0 2HWE1 1LCLA 2HWB1 1NE4A 3M8LA 1C3HA 2W87A 3M1HA 4QPIA 1W90A 4P9GA 3H1MA 3NO8A 1W03A 1LHUA 2B4KA 2WFPA 2XJQA 4RGAA 2QDNA 3UKTA 4ARYA 4BXFA 1RUJ1 2DU0A 1RUNA 2YV8A 2RS11 1VBE3 3AMHA 4ZU5A 3ZXJA 5LK7B 4LKEA 1J3QA 2J1RA 3OYWA 1UXZA 4CCMA 4HVOA 3ZSKA 1US2A 3SISA 3JXSA 4EZ4A 1LJ7A 3W5MA 4EN9B 2Q8OA 4XMIA 3VKOA 4DY3A 1W2UA 2HBTA 2QQOA 3P3PA 2DF7A 3ITQA 5FUNA 5JDBA 1LENA 4D6SA 1S0FA 1ZRIA 5D8AC 3SMHA 1PZ9A 1DGRN 4AHYA 5C5TA 4C1WA 1BK0A 5FY1A 4CDWB 3RI8A 1ZZ9A 2ZHLA 4FPCA 4XF0A 5FK7A 2VH9A 4CXYA 3OPZA 3AMPA 1YHFA 2VMIA 2D6MA 3FFQA 1AZDA 1OUXA 5FZGA 2RDNA 2J1SA 1SLAA 5IWFA 5LASA 1AYN3 3T4VA 1DGRA 3PJQA 1QJU2 1IG0A 3S5AA 2D5FA 1GU3A 3FL7A 3KV9A 3M70A 3O1SA 1AXKA 4HSJA 3X29B 5F5CA 1W6NB 2EXKA 3ATGA 3IMNA 4BU2A 4CDWA 2JEMA 4RS5B 4DRRA 5IHRA 4K1YA 3DXTA 4CTEA 3B69A 1AVBA 4L99A 2D3RA 4C0HA 2JENA 2PAMA 1WLDA 5CADA 1A6CA 3GBWA 1PO13 2CWMA 3RRDA 2ET1A 1IS6A 1AL21 3OJBA 1F8VA 2VZTA 1T2XA 5IT6A 1GMMA 2RM23 4BWOA 2WUHA 1CX4A 2HYKA 4MYEA 2Z69A 3FZ3A 4JGYA 4OQ9A 3T08A 2XJTA 3VD3A 5A6XA 1R1A2 5D21A 4Q8LA 1POV3 1XNCA 4HL0A 2WDBA 1UN1A 4XBNA 4CCJA 2O8QA 3RMXA 4FQ4A 2BVBA 2BEOA 4P9YA 2OQ7A 1JYNA 3PVBB 1W6MA 3TNPB 5C3RA 4PT6A 2D43A 3AYCA 3DUIA 3ZFEB 4MGTA 3VBOB 4P02B 4MHRA 4YW3A 1UX6A 3BTYA 4NWWA 1DZRA 1QJEA 1VMJA 4NHYA 4RHV1 3LWCA 5LA9A 4C1XA 4CEYB 5BNPB 2Q5TA 1JYVA 1JHJA 1X9PA 5CISA 4O7XA 3ZR5A 2VBPA 5C6CA 4YM2A 1LEDA 1N1TA 1X50A 2EXHA 2C0ZA 5CAZA 3DL3A 3ALQA 1RHI2 1RUF2 3HBZA 4D6QA 1FMD1 1YO8A 1ND2C 1S4CA 5GJ6A 4OUEA 4AAXA 4JDNA 3ZFEA 4AEDB 3VBOA 3FHQA 4LBMA 2DBIA 4FPFA 4ZKTB 4CEYA 1TME3 1FT9A 2JE8A 2VNOA 3I54A 3K75B 4P9JA 1RINA 5BPXA 3S7EA 1G9AA 1GWKA 3UV9A 1UAIA 1WW4A 3I59B 4KNCA 3WNMA 4AK3A 5FR3A 5FAXA 2D98A 2PQQA 1DYPA 1W99A 4JX0A 4XMAA 4RGGA 1S2BA 2P2KA 3V0BB 1XE7A 3WT3A 2TEPA 2GZWA 2ZBJA 1PIV3 3ACFA 4WVZA 4JQRA 5FO8B 2L9LA 1IHMA 1OA3A 1MZEA 4BE3A 1OA4A 1PZ8A 3IMMA 3IM0A 5IATA 3HT1A 4JV4A 5KXBA 4XJ8A 5FBZA 4TLFA 2R042 4NMIA 2J1VA 3I59A 2YFUA 4FTSA 1QY4A 2A7AA 3N36A 3MUZ1 1MZ5A 2H0BA 4PDWC 5GM0A 1K45A 2BOJA 3TNQA 3WV6A 4A7KA 1AR62 2FZ1A 3VL8A 4L0PA 4YW5A 3V0BA 3PNAA 4UOJA 3CIHA 1AR72 3SC7X 3W5NA 2D97A 2B8MA 5A3PA 4XHBA 3FBMA 2WZR3 2ZEWA 4XZUG 4AL9A 4BB3A 4A44A 2YPJA 2BDRA 3ECQA 2CHHA 5L19A 1VBA2 1NA1C 2XPJA 3BU7A 2CAVA 3OOXA 2W1UA 4X8PA 2BBVA 3BCWA 2X29A 1G9BA 3N9LA 4CPBD 4LLFA 5HV0A 3J8F3 4NHKA 4L97A 2RR11 3E5XA 2DCKA 3EBRA 3HNYM 4QDQA 2HWF3 1W2OA 1A78A 4Z2AA 1RXFA 1VE0A 3LOIA 2ZABA 4YGCA 2BNMA 4NHMA 1SDWA 2VECA 4AHXA 4AHWA 3AKTA 3B9CA 1IPJA 2WZ8A 4BQXA 3QCWA 1XNBA 2CGNA 4AFMA 2IFRA 5FZFA 3APBA 5FPZA 2ZZQA 1V6JA 1WW5A 3LSDA 2OUJA 1QJFA 1M4WA 1GZCA 4IGPA 2YBSA 3E5UA 4QKFA 1PVXA 4A6SA 1YQCA 4AFDA 3BU0A 1PM4A 2XVKA 5J37A 3I3EA 5FYCA 5A3WA 4Y5SA 1VBD2 4ASMB 3ABZA 4MG2A 1E5SA 1AXZA 2WO3A 4Q4W1 1PX3A 2P3JA 4XABA 1OFSA 5GZGA 3VD9A 1ULOA 3Q8AA 2K2SA 1DIWA 1VRH2 4I0AA 4EV0A 1ND3C 3LFMA 1H2NA 3H50A 1AUYA 3UJQA 4XFFA 2I74A 2WC2A 4M00A 4A4AA 3ROUA 2DURA 2NN8A 3RZJA 1ZBE1 5KC5A 1J3PA 1RMU3 3KT7A 3N9MA 1SPPB 2H6CA 2XKPA 5FP3A 3B00A 3ZLIA 4WVVA 2QQPA 3AL6A 5FZ3A 3LA3A 3UETA 4CCCA 1VIWB 4ZZ8A 3AZZA 3PUSA 3MV11 4P5HA 1MR5A 2JB4A 2ZGOA 4QX3A 3IDAA 2RMU3 4CEWC 4K8RB 4GB31 4QXBA 3VD7A 1BCXA 5CBLA 2HWC3 1OPMA 3CZUA 5FZ7A 3JBG2 5F3CA 3H1YA 3BGAA 4YYOA 4C90A 3SCGA 2ZA9A 3CLPA 1LHNA 1JZ7A 2ZGRA 4LIUA 4YARA 1SFNA 1R1A1 4HOOA 1LGCA 2WJSA 5FZEA 4EN0A 4XTMA 1ZRCA 2EIEA 3H3LA 3BUCA 2ZPXA 3WNPA 2VOVA 4MADA 2DVBA 3K4ZA 1Y9QA 2DV9A 1SFYA 4WM8C 2WT1A 4W8JA 1SBDA 2IXLA 4L92A 2HWD2 1GOHA 1SACA 2TUNA 1H1AA 3ES1A 3OBTA 2E53A 5A1AA 2V4AA 2VPVA 4A41A 1RUC1 4EE2A 3AMQA 3H7YA 2UWCA 1E57A 4MXWA 4K20A 3N7KA 4LUMA 3GJBA 3U75A 1YJLA 1DQ2A 5EYYA 2VZPA 1GWLA 4JZRA 4MOAA 1IS4A 3D8CA 1WA6X 3LEGA 5HXVA 4HSLA 1RUF1 1UW8A 3N9OA 3B93A 1DQ6A 3SXWA 3BIWE 4P9WA 1J59A 1YNAA 3WF1A 4IGQA 5LA2A 1ZVFA 4KG8A 3WCSA 2IXHA 4HT1T 4J1XA 1AYN2 4Y1ZA 4O9GA 3WNKA 4LR4A 3BVCA 5FLJA 2YROA 1T6BX 4LT5A 1DGLA 1SMVA 2QQUA 1OPOA 2B46X 4JKLA 4M3CE 4RQPC 4Y3OA 4COVA 5EFUA 3WQBA 2GC2A 1UY3A 5KHGA 2A73B 2FMDA 4GH4A 4AE2A 4IERA 1OKOA 3CJIC 1H4HA 4QGNA 5JOWA 4CUAA 4DO0A 4MGIE 4YM1A 4KWLA 4PI2A 1W06A 1RVF1 5HI0A 2EAKA 4DS0A 3NJZA 1B09A 3I2GA 4XOGA 3AKSA 1WCQA 4A3XA 1DQ1A 1CZSA 4W6WA 4FOYA 4XW3A 1VLNA 4BQ2A 1RUI1 2VMFA 2XLFA 1B35B 4MUVA 3LOBA 3MIFA 2DVDA 5F6KA 4E4DX 2GALA 3UGFA 1REDA 1W2AX 1U5XA 4PI0A 1PNGA 1WCUA 3U07A 2ZMKA 4Y1VA 1OQDA 2ZGPA 3VLBB 2YYOA 4O9EA 1XNTA 4CDXB 5J3UA 2PFWA 3PL0A 1TNFA 3GALA 5DPNA 4Q0VA 2G9ZA 4KWUA 3KCCA 4MHUA 4LTAA 4RFT0 1B35A 4XIOA 4XJZA 1UKGA 1W6PB 1Z78A 5BUVA 4J6GA 1H6XA 1VP6A 2QE3A 5F3GA 4RL7A 1REFA 2DU1A 4FPEA 1W8HA 2GAUA 3NNLA 5GKAC 3T2TA 3TN93 4CDXA 5CKMA 1LB2A 2A6VA 2V73A 3R05A 4XF9A 1TMF2 5FJKA 1SEFA 3U4XA 3N7MA 1EV11 1YCIA 2WWJA 1A3KA 3OSDA 1TME2 3NKTA 5JVVA 2P6CA 5H9PA 4K1ZA 1H1MA 5LWBA 1W6PA 1XC6A 3N9PA 4ZS3A 3WF0A 3EMRA 2GMEA 4S2GA 5CA6A 1W8NA 1O3TA 3PHMA 5CG8A 2P3IA 3LA7A 2NQYA 4XF1A 4D8MA 4BJ0A 3AP9A 2UWBA 4AI1A 3QOPA 4P00B 1N1SA 3DGTA 2BVVA 1ALYA 1BVVA 1H0BA 3B5LB 5EIYB 3O1TA 1W8ZA 2YMZA 2ZKNA 3NNGA 1VBD1 1WA4A 2BJSA 2PMWB 2GU9A 4I0BA 2C1FA 4DZGA 3M3OA 4FPKA 4Z92B 1A34A 3N9QA 4M01A 4CUGA 2F17A 1VRH1 3N3HA 3VD5A 4YZ1A 4B1LA 3HR9A 4QXHA 2F4PA 2JECA 4OHXA 4QXKA 1W39A 1J58A 3WINE 1MPXA 3TEYA 5DDJ1 2QNKA 2ID4A 5FOJB 1C28A 3QACA 1MZFA 1ZBA3 3B02A 2AENA 1FPN3 1YC61 4IW3A 3AZVA 1OF4A 5FZDA 1X9TA 2Y0OA 1SCSA 2WZR2 3ZXEA 4KWJA 5IK4A 1POV0 4HBNA 2PHWA 3A4UA 4URAA 1UYXA 2WO7A 5BY5A 4RS5C 4Q4X2 4KI5M 1CX1A 2HEVF 4ARXA 4N53A 1OKQA 3W20A 1PGW2 2D6PA 3POWA 5B2GB 2GC3A 4Q4V3 4YFZA 5A3TA 3VN4A 4ZHNA 3B01A 4TSVA 4XPVA 3RZZA 2ZXQA 5KC6A 1W04A 1PM7A 4LK6A 2ZMNA 5FMDA 2ARAA 1FNZA 4XUPA 3ZN4A 4LE3A 1Q8QA 2W2IA 2ZEXA 3O1UA 3I2HA 3MIEA 2BNOA 5FY9A 5EJ3A 4LNVA 3TBDA 4OVEA 1UMZA 3V0AB 5C9AC 1VBE1 2A5ZA 4AQTA 3HIFA 2VGDA 3I4IA 3WLUA 3KSCA 3FHAA 1PVC2 1A8MA 5FO7B 2GMPA 4MV2A 3WHUA 2DCZA 3WW4A 3ZFEC 3ZXFA 3MHZA 2GN7A 5FY7A 3AKPA 3MIGA 1V6NA 4CEYC 4B7EA 5BNPC 4I3PA 2AR6A 1UF2C 1ULFA 4MGYE 3AFKA 3V0AA 2WLQA 3RZLA 4WZCA 3ACHA 2UYBA 2RS52 5A7PA 2UURA 2WNUB 3I3BA 4AF9A 1QJU3 2EAAA 3I2DA 2ZHMA 5FP9A 1AYN1 4OI0A 4AEDC 3GXUA 4N8MA 3VD4A 2O14A 3LQCA 1RMU2 4DXSA 4QQOA 1NLSA 4LOSA 5E1RA 1GV9A 2WO1A 1YFYA 4FOWA 4B7KA 5KHIA 3OUIA 2VUCA 2Q8EA 4BH9A 4CYDA 3A0NA 3KS7A 3KT4A 2Q8DA 3VBUC 5JPMB 3VDBA 4QDSA 1SBEA 4XAAA 1JMUB 1F9KA 3E1F1 4PLNA 2DVFA 4LO8A 1H30A 1O7FA 1HQLA 1CAUB 3M3EA 3POIA 2PTMA 4YFWA 2Y33A 1PMJX 5C4WB 4PF5A 1PO11 2K46A 4XUOA 3MUY1 4XDQA 1X8MA 2GSYA 2HWC2 1R082 4FAGA 2RM21 2GN3A 3RDIA 4ZXKA 1LAJA 3WQ7A 4YWAA 1G9FA 2BGCA 3SH3A 2VZUA 5EHDA 1OXCA 4CUBA 4LA2A 1W2TA 3QH7A 4FPYA 2DUQA 1JBCA 3E97A 1POV1 1JZ8A 2B5HA 1XNAA 1CAUA 2JXAA 1COV3 4YSFA 2YXSA 5C4WA 3U0ZA 5JXHA 1CR7A 3LDKA 5CG9A 4EN6B 5E6HA 1QQP3 2O0OA 3BN6A 3IAQA 4JTOA 2G4IA 3ZFFB 1H8TB 3AYEA 4KH9A 4YG6A 1ZZCA 4QHZA 4BDVB 2ZX3A 4K3UA 2ZX0A 4JDMA 3WG3A 4AFAA 4QD2A 2VZRA 1XYOA 3KCYA 5T3NA 3WW2A 1HXS3 1RHI3 3OBZA 1OQEA 3W21A 5FQ0B 3AKRA 4XCAA 3TAYA 2X5IB 4FPHA 3RZKA 4LJHA 1LRHA 5EXOA 5FPVA 3GZUC 5FRAA 5FYZA 3RWNA 3OBAA 2CDPA 4AZZA 2D7FA 1W9SA 2WNVA 3ZFFA 1H8TA 1AX0A 3AMMA 5T54A 1TME1 1OH4A 5CIRA 5FZBA 3THDA 4IEZA 3F2ZA 3WDVA 3LPFA 4I01A 2ZGUA 5GZDA 4A7YA 3FLRA 5FQ0A 5KHHA 1W6QB 2WLPA 2B39A 4Y20A 1AR82 1Y9GA 2DUOA 2X5IA 1O5UA 5FYHA 3VBHC 4MO3M 3A22A 1LHVA 4ZXEA 1Q8SA 1S2EA 2XB6C 4JGZB 1Q8VA 1Y3TA 4QKBA 4BA6A 1PIV1 1O4TA 1PK6A 4ONUA 5M0TA 2YC2A 2R043 2WA4A 2GNTA 4LIVA 1SHWB 3LIHA 5DZGA 2VQAA 1F15A 3MLKA 3PVOA 1DZTA 4NVPA 3KHCA 3OD4A 1KS4A 4EN7B 1A8DA 1JUIA 2W95A 4GZ9A 3HWJA 2WWSA 1OLME 5CB7A 1WLTA 4XACA 1UO9A 5L9RA 3ORJA 3WP5A 2XJVA 2QTWB 5J48A 2X53S 3T0BA 1AR73 4I0WB 4LO4B 3LEKA 5AVAA 4JGZA 5A7SA 5HCHA 1DYOA 2FDGA 4HK9A 2PAEA 5C33A 1W9YA 1MVEA 2WT0A 3J4UH 2VJXA 5BNQA 4XAEA 1HRI3 2ETEA 5LRRA 4PLMA 1JN2P 2OW4A 2ORXA 4XXPA 1NYWA 5JCTA 3VBSC 4AI2A 1AL0G 1UXXX 4R52A 4RR3C 4XJWA 1RITA 5ABJC 1HIXA 2P37A 5FPXA 1YI9A 1QF3A 2VG9A 1W8FA 2BWCA 2RDSA 5HBAA 3ZOIA 1PGW1 4H2AA 4QMAA 5FLHA 4E8CA 4META 4QU1A 3RSJA 4AI9A 5C8CB 2FCUA 5LBEA 1HN1A 2D6NA 3J8F1 1CESA 1NLQA 3AP6A 4F8AA 1WLCA 2VY0A 1LOCA 3TN92 2NZ9A 1IQDC 2V5YA 2HWF1 2XWBB 4GMP3 5F8PA 3O0WA 4HG6B 1UZVA 5I8SA 3O0XA 4DY5A 2ZGTA 2BNNA 2OZJA 3M3CA 1XYNA 1YQ2A 1CPNA 2VE1A 5IVBA 3R0RA 2E51A 5C8CA 3D4KA 5DAPA 4FI9A 5BV6A 3BB6A 5FPAA 3WNOA 1XNDA 3NV1A 3GYDA 5CU1A 4EJRA 4E27A 4AFBA 2R072 4COYA 4FAHA 3PMEA 2DWRA 2QDRA 1W6OB 4B4RA 2Q4SA 3E6DA 2W9XA 4KBBA 5FP7A 4WM7B 2IXJA 4FO9A 1K5MC 1W9TA 4ASLA 3A0KA 1H4GA 1BMV1 4BQ5A 2WYFA 3O7OA 4D0QA 4IEVA 1X8EA 4ZZ5A 5JZGA 4LBLA 1ZBA2 2ET7A 1RMU1 2UWAA 4NIDA 3ZYHA 3D3AA 1CAVB 2A3YA 3GGLA 3OUHA 2ZS6B 1W6OA 4YZ2A 5JAXA 4QPIB 3O1RA 1SLCA 2YY1A 1YFUA 1LULA 3AM2A 3AXDA 4N43B 4UT5A 1RXGA 1LEMA 2BZDA 4FFIA 1UY4A 4IE6A 4W65A 3ETQA 3OCPA 2WQZC 3OY8B 5LBBA 2CGOA 1FXZA 3ZIXA 4YVWA 1GFF2 4DEVA 2XHKA 2RMU1 3JBG3 2PQSA 5FXZA 4DPNA 5IK8A 2W0XA 2HWC1 3U14A 1CAVA 1LOAA 2WSVA 3THPA 4N43A 4FFHA 1EY2A 1CJPA 3K48A 1LODA 1GP4A 4GKXA 5T5PA 4N9HA 3VHRA 4PQ9A 1WW7A 3ZSLA 3OY8A 1XU2A 3WOGA 1F4AA 3UJOA 1SBFA 2HWD3 2YBPA 2YB7A 4GALA 5A1FA 2YG0A 4GD4A 4WV8A 1ODMA 1WD4A 2W46A 2P17A 1UYZA 5IVCA 3S5QA 3W59A 4ATEA 3PIJA 1CN1A 4QM8A 5A33B 3T0DA 2WBKA 1GNYA 1K12A 2GNDA 3C7FA 4AHZA 2A6WA 2DCYA 1JYXA 2DTWA 4FXKB 3WD5A 1AX2A 1ODNA 4X8NA 5FV3A 1OSGA 1XU1A 4ZS2A 4HFSA 3WF2A 4TYSA 5KR7A 1Z7S2 2I45A 1FI2A 4HKWA 5G05L 4QXCA 4W6YA 2D6OX 2E7TA 5APAA 3VHPA 2B45X 3IDEA 2XJRA 2WINB 3AC0A 5A33A 5FYMA 3N7LA 3VDDB 1QMJA 1C5IA 3VZMA 4JGYB 4LE4A 3P6BA 5FZCA 2B7YA 5E16A 2A1XA 2BPA2 5DMYA 1BJQA 4R9CA 1GQPA 3WR0A 1HW5A 3DPRC 4Q4Y2 4YVSB 4OZXA 2O1QA 3KB5A 1RJ8A 1TG7A 1W6MB 1Y43B 2OYZA 4RA0A 1ZZ6A 4Y1XA 1V70A 2OQ6A 3FUOA 5FP4A 1IPKA 2OS2A 2W08A 5F3IA 4GA9A 4LHSA 3JQWA 1Q8PA 2BQPA 4N7UA 1MS8A 3VDDA 3GF6A 4XDPA 2FD8A 2HH9A 2JDHA 4OHZA 2LM3A 3BKZA 2VAUA 5IVJA 1S0EA 3ZDSA 2VXJA 2EA7A 2XUMA 1WZXA 2YU1A 4YVSA 2VZQA 3MGUA 3O0VA 3RMYA 2W68A 1IQAA 4YW2A 1COV2 1UIKA 3VZNA 4QQ2A 1QJX3 1P8JA 4LBKA 4L8QA 3VKNA 5FMOS 5JXJA 4EN8B 3KM5A 1V6OA 4JQTA 2I2SA 1Y4WA 1QQP2 2FDKA 2VNGA 3WXPA 1HB3A 4DB5A 4Y24A 2VULA 1G8WA 5IVFA 2HKXA 2J1UA 5FZKA 3KCXA 1DQ0A 4XILA 1HRV2 1HXS2 2XJPA 4NWVA 1JH5A 4A42A 4JAAA 5JZGB 1L3JA 2D40A 2BUKA 1UU5A 2C5DA 2VD7A 4CDQB 5IYYA 2QFEA 1TMF3 1UD1A 2RJLA 2YC0A 3HQUA 1GSLA 4YGBA 5LY2A 3TN91 4AR2A 5JMOA 1NQJA 2YZ4A 4MSVA 5D1IA 3IN9A 5EQUA 5FBJA 5BNNC 2GP5A 4K8FA 3CKHA 3AZWA 1AYM3 3B9IA 2D3SA 2X05A 4FOVA 1KQRA 3T30A 1DGWX 3LEMA 3NNMA 4PIZA 4RN5A 3SH5A 2P6HA 4CCNA 4CU8A 3LPGA 5A3UA 4QB1A 2B9UA 4XFAA 4B1MA 4Q0SA 5F1RA 2KXLA 4PF1A 4CDQA 3KVBA 3SCHA 2QQIA 1OFNA 3TRSB 3AL5A 1LOEA 1J1TA 1I6XA 3U78A 1QHDA 3ZPOA 4B4QA 4LBOA 2ERFA 5FTTC 1VMFA 4M4PA 2OPKA 4HN0A 5K4LA 1ZRDA 4EQVA 2JKBA 2OT7A 2Q0AA 3PVEA 4IV1B 3POYA 4KL1A 4D3WA 3ZMOA 2D93A 1CAXA 1RUD2 5ERLA 5K0UB 1AR92 3ELNA 3IT8A 4XURA 3G7DA 4IXLA 3SHRA 3T0AA 4GWNA 5BNOA 3PDQA 3OGJA 2WNUC 3ME2A 1ZBA1 2XJSA 1LKNA 3AYDA 1FPN1 3OGVA 4XQ4A 4E2GA 1JZ3A 1HRI2 1SLIA 1QOOA 3JCIA 4Q4X3 1GKBA 4LMFA 4IV1A 2H0VA 1FAYA 4UW4A 5K0UA 1UKRA 1XXNA 1ZA4A 2YU2A 4FPJA 5ISLA 2JICA 1DCSA 3GZTB 2WR9A 4Q4V1 1G9DA 4RGKA 1CONA 5C4WC 1PO23 4B29A 4HETA 1JU4A 3A23A 4B8EA 2Y64A 1L7QA 4NIIA 3I2OA 4NHXA 5D2AA 2Y6GA 4NIHA 3DKWA 5L7OA 1HDKA 4Y26A 4XTPA 1S0CA 1O6UA 4UFLA 1RUE2 5K7PA 2Q1MA 5CFDA 3NAPB 1BK1A 1R093 3J7HA 3MBWA 5FCCA 4DXRA 2DCJA 3GHNA 3HD8B 1PVC3 5KXDA 3H8OA 1JOBA 1ZREA 3VV1A 2AC1A 5JLVA 1MS1A 1NZIA 2H6BA 1HQWA 3ACLA 4NROA 1YIPA 4BIOA 4L9BA 3KGLA 3ZFFC 1H8TC 3GHMA 3C8XA 4KGGA 2QVSB 4BOWA 2JG9C 4MGQA 3NAPA 1W0PA 5FZIA 3J7LA 5JSPA 3ZYJB 2WNOA 3AZXA 5C8WA 2RS53 2BBAA 3L2YA 3AZYA 3POFA 3J9SA 3ES4A 1BKZA 1OBNA 2YBKA 2PHUA 4QHBA 4BPZA 1ZNPA 4UAPA 1I3HA 1QJU1 2ZX4A 1K3IA 3DYPA 3PVNA 4M0NA 1QJY2 2XGXA 1NCRA 5LEJA 3R4DB 4FT8A 1UYPA 5IVVA 3D0JA 2EIDA 2PHTA 4XCBA 3UL2A 1V6LA 1SLLA 1PMHX 2JDZA 2FCTA 4H14A 3DN7A 3UGGA 2CY6A 4GWJA 5IK5A 4W4ZA 2CDOA 3PU8A 4Y22B 1DQ5A 5A70A 2D6KA 1LOFA 2Z4FA 3BALA 5JXGA 4FP2A 1O8PA 4S2HA 4NRQA 1R083 2LTNA 1FV3A 3JUUA 1TZOA 4JGZC 5GLWA 2P3YA 2HJIA 2ENRA 3OGRA 5F9TA 3DKQA 3IB3A 2R7EB 4MXWB 4WVMB 1KRIA 2AEZA 2WN3A 1GNZA 2XJUA 4LA3A 4OFGA 2OPWA 4FQZA 1UL9A 4NN0A 4SBVA 3AB0A 2ZX1A 4XEZA 5FIXA 3RWKX 4CU6A 4R9BA 4YG3A 2BWAA 1LGBA 4FFGA 5A7QA 1OVPA 2Y6LA 2JD4A 4Y22A 5FOBB 2VW0A 1NT0A 1JYTA 1COV1 4GMP0 1IZ3A 1LGNA 2VMHA 2YGMA 2ZTNA 4CCKA 5F2WA 5F2SA 2R32A 1QQP1 3MLLA 1MQTC 3NVCA 4KG0A 4CCEA 2BV4A 4CXWA 5LZ6A 3WZ1A 1W9WA 2VZ1A 3HMYA 4AW7A 4WVMA 1KEXA 1AXYA 4IEUA 4NRPA 2VM9A 3KHBA 1DLCA 5A7NA 4LKDA 5FZ4A 4FVVA 3WDYA 3FFZA 1DHKB 4QPGA 1HXS1 1RUJ3 4SLIA 4UF0A 1RHI1 3T1LA 4CVUA 1QDCA 4XJ9A 3JU9A 4GH4B 1VJ2A 2KR2A 2VMGA 1MS4A 2HYXA 2PHFA 2XBO2 3V56A 5C8CC 1YQ6A 3NL1A 2DVAA 1WBLA 3TYJA 4F3JA 2VCMA 3K4AA 3CQOA 3O12A 4Q0QA 4LOTA 1JYWA 3AP4A 1EPZA 4O65A 3LF7A 4CA9A 5A1LA 1OF3A 1S2KA 4AVVA 1AR83 4QGMA 1XSRA 1SZBA 2Z79A 1ZZBA 3MW4A 2W1QA 1D4M3 1GR3A 3WCRA 3WDWA 3Q8EA 1DDLA 5FO9B 2QBXA 3WSOA 4AXOA 2IC1A 1BMV2 5JZGC 2Y6KA 4ZU7A 1N1YA 4N90A 3TEZA 1GZWB 2IVJA 4YW4A 4NRMA 1CIWA 2R041 2X8KA 2QQKA 4IEPA 3ZYGA 1WWYA 4E4ZA 1NCQB 2ZGSA 5JSOA 3TEWA 2QQMA 4QQPA 4DEQA 3OBRA 2F4LA 3MIDA 4MZUA 1AR61 5IFTA 3TWIA 2DCTA 2DUPA 2FCVA 4WM7C 3UKNA 2RE9A 2YFZA 1JOPA 1ZYBA 5IAVA 1HV1A 3C7GA 2NM1A 1AR71 1URXA 2UYAA 2WAOA 4BQ3A 1YQ8A 1QJX2 3WDTA 1WW6A 1WMFA 1GBGA 1GZWA 4XFBA 1OLMA 2GC1A 3JD73 3OG2A 1WCKA 4V2WA 2XMLA 1VBA1 4QU2A 4AEMA 1NCQA 1AX1A 4QPIC 5C3PA 5FZ9A 4NAMA 4XFGA 4B3NA 4CE8A 1PHMA 4HXCA 4H7MA 4JHTA 2JKXA 1LU2A 5JIUA 1S0JA 1S0IA 2R0FA 2WQ4A 1LR5A 3HJRA 2XG3A 1VMHA 3PUHA 5FYUA 4TTGA 1QXPA 4GMP1 3WF4A 1HB4A 1ULEA 2VZSA 5D8AB 5C5UA 1FOD2 5I91A 2PLV2 3IDCB 1AYM2 4INDA 1JI6A 3MLJA 3NRUA 1C8M3 4NJ4A 1C57A 2Y38A 1UOBA 5AC92 1ZRFA 2A75A 5FY0A 3DXUA 5GZFA 4C91A 1ZM1A 5A7WB 5LEKA 4P5YA 4C8DA 2FDFA 2R073 1IKPA 1GOFA 2SLIA 2ZMLA 4GQ7A 4V1PA 4XYXA 5FZAA 5BXXA 3WF3A 5KHJA 3ZXGA 5FZ8A 4LUKA 5D8AA 1VAMA 3AJYA 5EZWA 3SITA 1YI7A 5CEHA 4JC1A 3I2KA 4UBGA 3MF9A 4FPOB 4ATFA 2FDJA 4QGLA 4CDWC 4EWAA 4L2NA 1CJDA 3KV4A 2NPIA 3HNMA 3TEXA 2AEYA 1MS3A 2VOTA 4N53B 1SQ4A 1UNBA 1YRZA 2CNAA 3GNEA 3O14A 1VAVA 4NHLA 3BTXA 2R30A 5A7WA 4BK4A 3BI3A 2VQTA 1DQ4A 2ZGQA 5EYXA 2VXRA 2XXZA 4XJUA 1G86A 2WS92 1EP0A 2RJKA 3N7JA 3VDDC 2CSGA 1CPMA 5JXIA 4JGYC 1PNFA 3C7HA 3KF3A 2R1DA 4AYUA 1OC1A 5I0SA 4YPJA 1VBC3 4WZFA 3C7OA 2XQXA 3EYPA 3RJ2X 2C9KA 4YVSC 1PMIA 4BMBA 2EF6A 1ULCA 2K9ZA 3JBG1 2JJ6A 4MH0E 4BQ4A 2BOIA 3KQ4B 1PO22 3SKJE 3LEIA 4XJAA 3K77A 4LEJA 1POQA 2C9AA 2WYSA 3M7AA 3SH4A 1KS5A 2Y6HA 2ARCA 5GALA 3EJKA 4OLLA 3RYRA 3MEPA 5T5JA 1RIRA 3H42B 1MS9A 4IV3B 4PLOA 3FJSA 3VKLA 3FLPA 1ASJ3 1SG3A 5CYYA 3ZPYA 2JG8B 5LRSA 1R092 1UX7A 4RSUA 2HWD1 4IEXA 1ND2B 2RR13 1U0AA 4QB2A 1KDKA 2CV6A 1N3PA 2JDUA 2JDNA 3BOPA 3VBOC 5I0RA 2A71A 4UFIA 3RFRA 1W28A 1NZCA 4Z82A 1S0BA 3T1MA 2ZKLA 4FPGA 5I8TA 3POGA 4I09A 3HBKA 1Z7S3 4IV3A 3T2QA 3ZYBA 1HKDA 1RC6A 5FY5A 3KMHA 2JG8A 2JE9A 4GWIA 2EXJA 3QD6A 4JRAA 1ND2A 2WN2A 2XVGA 4IETA 4CDQC 1X33A 3K2OA 3KV6A 1O91A 4Q2FA 3GBFA 2AACA 2VL4A 5JUVA 3BOWA 5AFBA 3H8XA 2CWSA 2BTVC 1W3XA 1QH6A 3J26N 3LDBA 3LSEA 5IVYA 4WVWA 2PA7A 4DUXA 3E5QA 4P9IA 2EIGA 2EXIA 3WDXA 1UMIA 1V9U2 2G9GA 4Q4Y3 3ZYRA 1Q43A 5AVPA 2OA2A 1U5ZA 2ZAAA 3FX3A 1IPSA 1I9RA 1I5ZA 1OD5A 2IVIB 4JRLA 5L9VA 1Q5OA 4PCRA 5FLIA 3ZR6A 1OA2A 3HAGA 1U12A 1W8TA 2JB8A 3OUJA 1V6IA 2ZGMA 3L9JT 2NYYA 2Y8KA 3OTFA 4HANA 5CKQA 4F83A 4N7IA 5FMOL 5IUQA 4R9AA 3TB0A 2QQJA 4M4RA 3NMBA 4TZDA 5L73A 4DMIA 2A3XA 4XETA 4COWA 4D94A 1ZX5A 3M3IA 4PDWA 2ZEZA 5EWSA 3T4HB 3KQRA 5FKBA 5K0UC 2QQWA 5F5AA 1PX4A 4GB33 1HQNA 4MGKE 4HLTA 1EAH3 2WFF2 1QJX1 3NNJA 1UZZA 3POBA 2WO2A 2WNVB 3USUB 4QKDA 5FZHA 3M4FA 4GAZA 2HWE2 3ETPA 5A6ZA 3QH6A 3VHNA 1HRV3 3AK0A 2JWPA 3WUCA 5LBFA 3H9AA 4Y5TA 4Y20B 4HMZA 1W05A 1J84A 5E89A 1RUJ2 4TN7A 3D5OA 4QAWA 3EO6A 1DZQA 5FZ1A 2LALA 1OMIA 4ORFA 1NXD1 1TMF1 4Z2WA 3N4MA 1CD3G 2AUYA 1US3A 2VUAA 4H7LA 2GMMA 1PK6B 3USUA 3S6PA 4UW3A 3GZAA 1GLHA 2VVFA 3O1MA 2VO5A 1KJRA 5DAVA 4OYUA 3CL1A 1AYM1 3ZSJA 3BODA 3VZJA 1NQDA 1MS0A 1HJGA 1VR3A 3H0OA 3NAPC 4AI3A 5IAXA 4D7SA 2VVEA 5F5QA 1RUG3 4XUTA 1UQXA 3I3QA 5DZFA 1D4M2 4M0HA 4S2FA 3T2PA 4BLIA 3UESA 4AEJA 5FPBA 2XHNA 4IDZA 2GC0A 1DU3D 3GCWA 1F31A 3RG0A 1NUKA 2P4EA 4A2UA 1RUD3 1SLTA 3U10A 3UYJA 1K5JA 1GWMA 1KJLA 1AR93 2YC4A 3I2JA 1U5IA 4NIAA 4NIGA 1BVP1 4IEQA 5SV5A 2ZGLA 3CF6E 2F6BA 2WIIB 1DGWA 2Z2SB 3VZLA 1BHGA 4LO6B 3ZM8A 4ES8A 5FZOB 5F37A 4QB6A 3WY6A 2WZR1 3NWKA 2PHDA 5C3SA 1BLZA 1C4RA 2XR4A 3IKWA 1GQHA 1S1AA 2R063 3JD72 4I3GA 4IE0A 3WW1A 4Q4X1 2XL9A 4GWMA 2A6ZA 3J7NA 5JR7B 2QZ2A 3QLQA 2VW2A 2IUWA 4P9XA 5DG2A 3RQ0A 1UIJA 5AFEA 2VCBA 4KQ7A 2TNFA 4X6RB 5FPUA 1WLWA 3GCXA 3D6EA 4AQ6A 2MHFA 1PO21 5FZOA 3LCPA 3RZHA 3RJRA 1SLBA 3H1WA 2Y60A 1EYBA 1F5JA 1RUE3 3D0SA 2FQPA 1UCXA 1OI6A 1V0AA 3KWVA 4RHV2 4D7TA 5FWJA 1W3VA 4P9LA 2D44A 5B4NA 2P34A 2LS6A 2HLEA 1C8M2 1R091 2JIJA 4X6QB 5FZ6A 1PVC1 3J7MA 4WM8A 1FMD2 2VW1A 4XUQA 3Q8FA 2J42A 4PHZA 4XBLA 1IS3A 5FYYA 3R6SA 4CZSA 5FPLA 3OB8A 2ZJCA 4QX5A 1D2SA 3R4UA 2XVLA 3VKMA 4JTNA 4QX7A 1Q8OA 3A21A 5B4XA 3E6CC 2R1BA 1MACA 4RQPB 2PHRA 3AP7A 3KT1A 3NQHA 4R9DA 3MDPA 3USSA 5KBFA 3WUDA 3DYMA 5LCWL 2OUHA 2JDKA 5EP9A 3PUAA 2RS51 4YVWB 3KD4A 4GH4C 4CP2A 3CJIB 4WBBA 1JXNA 2V4VA 5L36A 2PELA 3IWZA 1IS5A 1EPWA 4TLGA 3WW3A 1QJY3 2VZ3A 3P3NA 4XFHA 5GLVA 2Q8CA 5FXXA 2BYVE 4AQ2A 1FATA 2OVUA 5DUVA 2OX0A 2ZAHA 3DV8A 2VCAA 4I02A 4RQPA 3WQ0A 4Q0UA 3VB9A 3CJXA 4J1WA 2QJVA 1VBC2 1QIQA 1LTEA 1NX9A 2AREA 2XDVA 5F39A 4A45A 3DECA 3GZEA 3CJIA 4J25A 2QCSB 4LBQB 4JVAA 1ZZ8A 2R16A 2BW8A 3AKQA 4TWTA 1R081 2GDFA 2VZVA 4P08A 4ZPIA 2HBUA 3VZOA 3WP3A 4CP1A 2OIIA 2PYTA 4Z07A 4E4HA 4GKYA 2DFBA 4JCKA 1N1VA 2WNEA 3LIGA 3ON7A 5H9QA 1NCQC 2D6LX 1H6YA 3DEMA 3RNSA 2Q1FA 5JSRA 3H8RA 3GM8A 2WWUA 1B35C 4LPLA 3VHOA 2SBAA 3BTZA 3ZIWA 3ACGA 1ASJ2 1D0HA 3ZFGB 2VZOA 5LBCA 3VDCA 4LBQA 5FUIA 1BZWA 3EXUA 4HZFA 3HT2A 4OI4A 3THCA 4CDXC 2NLRA 4DUVA 2RR12 4YGDA 3IZOA 2DYCA 1H9WA 4UBHA 4B4PA 4IEWA 1F4HA 3O1OA 3HQXA 3ZKUA 1OLQA 3I2FA 4QX2A 2OXBA 2ZX2A 4IESA 2WRAA 1UOJA 5F7UA 2IFWA 3KLSA 4Q27A 4TXWA 3S7IA 2D5HA 3ZMNA 3RYPA 3AYAA 4DNYA 3CZJA 5J7MA 1CVNA 1NXMA 2XBO3 2JX9A 1UY2A 4ISRA 3ZFGA 2EIBA 5DUWA 5FMBA 4QQLA 2WZPP 4M3CB 3CO2A 1NAEA 1QU0A 2MEV3 4UW6A 1CQ9A 3JQXA 5E88A 4DIQA 1V6KA 3MPBA 4YLZA 3AVRA 1HX6A 4FTEA 4CCOA 1YFXA 5DAQA 2PHLA 1WCDJ 4PQQA 4XBQA 1AR81 1UWWA 4EROA 4E9KA 3FE5A 4Q4W2 5KXCA 3K46A 4LHNA 1KGYA 4K40A 4DUWA 1MS5A 1D4M1 1MVQA 3ZYIB 4COUA 4M3CA 3AFGA 5A6QA 4Q26A 4LO5B 2RDQA 1ULGA 3W58A 4QKNA 2PXJA 1ZBE2 2W1WA 3NJYA 3LFIA 5A3NA 3IAPA 1HV0A 1ULDA 2HEWF 3PU3A 3PUQA 3IIAA 1H2MA 1E5RA 4XUNA 4FCAA 1OT5A 1N3QA 3GDBA 2R49A 4OZOA 4R8HA 4AVCA 3S57A 4N53C 4EWEA 3WVJA 4XE9A 1XYPA 2VBBA 2E6VA 4GB32 4XQDA 4A7ZA 5KXEA 4Q29A 1EAH2 3H8UA 1HB2A 4RD7A 4G9SB 4PIYA 2Y34A 1O3RA 3JD71 1JHNA 1T6GC 2N7GA 2ZHNA 5IW0A 1R64A 3HNBM 3RVHA 1W6NA 3POJA 2HEYF 1VB2A 4RS5A 2YUEA 3IIIA 1RB8G 4CXXA 3WX5A 5C9AB 1JYCA 1L7RA 2XWJB 1OH3A 2BP6A 4D7YA 4DQAA 3MICA 4W50A 4MX3A 2XH6A 3PIGA 3L2HA 1FOD3 1FX5A 2PLV3 3RZMA 2PN5A 1OQ1A 1AHSA 3LE0A 1RUC2 2WABA 3PTYA 4IL7A 4AEKA 4OQ8A 4UFKA 2Q30A 1EUTA 3K3OA 4LQRA 4NPMA 5HV4A 1I5PA 1FV2A 1MEC3 3MFAA 3I3MA 1F2NA 1JS9A 4OCTA 1CAXB 2EVXA 4IV3C 5AC93 1C8M1 1PZ7A 5C3QA 5C9AA 3PLQA 2JG8C 2YDEA 4LKFA 3FBYA 2VBDA 1LOGA 1W9FA 1UY0A 1RUG2 2OKXA 2ADEA 4AWDA 1WKYA 3VBFB 5BNOB 4BM8A 2R071 3C3VA 4ISQA 3KZ4C 4IUGA 4YZ5A 4Q1PA 1UOFA 4CCDA 1LESA 1D7PM 1M06G 1GP6A 4Q8KA 5BNPA 2BFUS 2Y26A 4HK8A 5JIAA 4Q1RA 3C7EA 3VBUB 2VMEA 1JU3A 3KVAA 1PGL2 1UU6A 2UY8A 4CUCA 2ES3A 2VQ0A 2W47A 2DTYA 3JZVA 4GIQA 2ATFA 3KV5A 5DG1A 5FK8A 3VBFA 3NJVA 1W2NA 2NP0A 1PGSA 4FFFA 4FPLA 2WS93 5EJ1B 3WP4A 4AEDA 5FYBA 3UNPA 5LW9A 1HLCA 1OOPB 3WG1A 5IK7A 4IE5A 4KU8A 1RVF2 2V09A 5L7OB 5LA1A 2DVGA 3LA2A 4YRDA 2R062 1QNYA 1CGPA 5CFDB 3ILNA 3V64A 3VBUA 4AGGA 1RUI2 1VBC1 1KD7A 3KF5A 4JKMA 5FYVA 5GLTA 1YIFA 5K9YA 5LATA 1X36A 4ASKA 1VAKA 3MF6A 1ACCA 4Q0PA 1G6NA 1OOPA 1UPSA 2WL1A 1O3SA 1TVGA 1GICA 1DFQA 1HB1A 1C5HA 5FZLA 2YGLA 4DXZA 1UZWA 3OGGA 3A7QA 3SKVA 4ZONA 2VUJA 4XDOA 1ASJ1 4OULA 3BTAA 2V5DA 1JODA 4FBFA 4IQPA 3MO4A 2YHJA 1AF9A 1VBB3 3AP5A 3AVSA 4LKSA 5CVRA 1Q56A 3LGRA 4CDUB 1DYKA 3K3NA 2VTFA 2G9FA 1NCRB 2WNVC 1QJZA 1JOJA 1EV12 1XOYA 2ARBA 2C6SA 4NAOA 4YZ4A 3ZO0B 2K0GA 3POSA 1YEWA 1REEA 5JR2A 4FP3A 1Z7S1 2KA3A 1IG3A 1YUDA 4AQSA 1U5YA 2AH2A 2X5IC 5DAXA 5FYIA 3VBHB 5ACA3 4HKOA 2ZCWA 3HQRA 5BYNA 3BIEA 3P5BA 2RJ2A 3PTRB 1DP0A 1H9PA 3AX4A 2VR4A 3C2UA 2VQUA 2CGPA 3VBRB 2NMOA 4FOQA 3I7DA 5FJHA 4CDUA 1PK6C 1C1LA 3HN3A 1UZYA 1XB9A 1RUH3 3WP6A 4BXSV 1V9U3 2VNRA 1YLLA 2ZZJA 4QM9A 4Q4Y1 4CSWA 2LROA 3VBHA 3FN9A 1W0NA 1JZ5A 4JDOA 4K21A 5FDBA 1JZ6A 5JPNB 1BEV3 1O8SA 2CU5A 4XFIA 4U36A 3HOBA 4I30A 1N47A 1JZ4A 2ADDA 4XZPA 4ES9A 3ZXKA 1SCRA 3MI8A 5DDJ2 3VBRA 2UY9A 1BBT3 4YW1A 1S0GA 3VBSB 2RS33 2VC9A 2VTXJ 3K4DA 4RR3B 5ABJB 4UF0B 1NOVA 4QPGB 5FY4A 2CTVA 4A3ZA 1KITA 4F7ZA 1UZ0A 1WCSA 4BZ4A 4YG0A 2VUDA 2P5BA 2WFF3 1LU1A 5FXVA 3K51A 5A7OA 1EAH1 2A6XA 4DXTA 5I0TA 2HWE3 1MZ6A 2WSUA 2ZHKA 2HWB3 1XSQA 3HVDA 3LAGA 1SPPA 3LD8A 3O5SA 5EPAA 5FXWA 1ENSA 3VBSA 4QQHA 1W8WA 2FBEA 5A3OA 4CPBA 4RR3A 5ABJA 2XLAA 2V72A 3W9AA 1HRV1 4DINB 3MIBA 3FC0A 2RS13 3T3YA 2LUWA 3SLIA 2EICA 1YWKA 4E2QA 2E32A 2EALA 1GOGA 1VBE2 1J1LA 4OI2A 5IJRA 1RL3A 3URFA 2R6QA 1NKGA 3NV3A 3MPPG 4K7JA 5F5IA 1XQNA 3Q9OA 3MIHA 2MEV2 4YZ3A 1V6MA 2QQVA 2GNBA 2X10A 3LB9A 3I3DA 4PBOA 1KFUL 4LORA 5CFCB 2XKOA 1Y9MA 2ZGNA 2Y0IA 4KGQA 2E7AA 3NKGA 2A3WA 3ZN5A 1K5MB 5L9BA 2VOXA 3I8TA 4OUMA 2GH2A 4XHXA 1F5FA 2ZGKA 4CRQA 1RUG1 4HVQA 3DCQA 2RV9A 4XQWA 1XJAA 4KWKA 5DUUA 3U4SA 1AJKA 1ULPA 1HN0A 4AG4A 3ZXLA 3JB4C 3H7JA 4BMEA 1GP5A 3ILFA 4AGVA 3LKJA 4P14A 4HPKB 5CFCA 1VPHA 1JW6A 4URTA 1RUD1 1E5IA 1BQPA 2J1AA 1AR91 1K5MA 3CU7A 2GH8A 2Y6JA 4OUSA 5LB6A 4EYUA 2JDPA 4LO7A 4YVWC 2A70A 1ENQA 1QXRA 1AL23 1UMHA 3ASIA 3RS6A 3U37A 1PO12 3PMSA 3ZXDA 4EWDA 4Z8BA 3AMNA 1HRI1 1CIYA 2ZACA 4MGSA 4UW5A 2E7QA 4NOTA 4D69A 2RM22 2VCCA 2R061 3OPWA 2TBVA 4HPKA 3N9NA 4N43C 4Y1UA 4AVBA 2FDHA 2WA3A 2ZOEB 5F3EA 3ZX7A 4QX8A 3ZYFA 5I8YA 1YQ5A 4BK5A 2BERA 5I0UA 1OVSA 4HN1A 2OZ6A 1JTZX 4BLJA 3MYXA 3UKVA 1S55A 4RHV3 1GUIA 4H55A 3SQOA 4GXLA 4MVTA 4QX1A 1CZTA 2W3JA 5CZKA 1WD3A 5JOXA 2RDRA 1RUE1 5LK5A 3SNMA 3HEIA 2KD7A 3E6BA 3M3QA 4CU7A 1MEC2 4GJYA 4NPLA 4CU9A 1Z0HA 2VVDA 3U1XA 1FMD3 3ZFGC 3FHIB 4COZA 3VDAA 3WHTA 2C24A 4NO4A 3CNAA 2VMCA 3CEWA 4AGRA 1VALA 1QNWA 3O1PA 3ENRA 1APNA 2DBNA 4AOCA 1GYKA 5F32A 2C4XA 4W6XA 1LHWA 3M2MA 4G4FA 3ZVXA 4OMCA 1FYUA 4BCUA 3DPRB 5E8AA 1S0DA 1D2QA 2E33A 5DXDA 3WQ1A 4LHKA 5A3LA 1E5HA 3R4SA 2RHPA 4L11A 4RYDA 3POEA 4BQ1A 1QEXA 5K8SA 3H3UA 5H9RA 1DF0A 1QJY1 2VNVA 4S2DA 1PIV2 1F35A 5HCAA 5DAWA 4OHYA 1DG6A 1UOGA 3VKFC 1D0GA 1AJOA 5IFPA 4NPRA 3HN1A 4KMQA 5DABA 5CKNA 4Z1VA 2VU9A 3CHXA 2B42B 4YM3A 5FP8A 4MGZE 3DPRA 4MLOA 1QKQA 5FREA 4PIXA 4BISA 1NE6A 4FSJA 4UFHA 1FNYA 1X7NA 1RJ7A 3PURA 5SV8A 2BRTA 5ANNA 4E2SA 5C70A 1O4ZA 5KHKA 4HKLA 3JB8A 1ENRA 4KU7A 1WUVA 3EQEA 3SEEA 1LOBA 5I93A 1NY72 2ILMA 3RZGA 4G3YC 4GULA 2XL7A 2RG4A 4PJYA 4XXAA 1N3OA 1TNRA 3Q8BA 1ST8A 2FHRA 1NG0A 4IEYA 3LZZA 4YGEA 5JI9A 4HVRA 1UU4A 1WMEA 3INAA 3WNNA 1VB4A 2DFCA 1Q3EA 4XC9A 5DZEA 3D82A 2QUOA 5GLZA 4Y4RA 3MW3A 4LBJA 3CBNA 1H8VA 3J8F2 1G7YA 1VBB2 1O4YA 3BPSA 4UWDA 1JZ2A 1OURA 5FFOC 2P3KA 5CNAA 5GLUA 2HWF2 2MPFA 5BNNB 4KBZA 5T5OA 3OPTA 3THTA 4QHOA 5J96B 1GZTA 5FUPA 5JWPA 4GJZA 1QWRA 2W5FA 1BYHA 2XBO1 2LRPA 3BYWA 5ACA2 3CDZB 4IE4A 2VMDA 4QWNA 1TEIA 3ZN6B 5I0DA 3O1VA 3NJXA 1TE1B 3G6JB 4ITCA 4Y4YA 5GZCA 2G19A 2MEV1 2AZ5A 3CMGA 3SEPA 3RGBA 1X82A 5BNNA 4NE9A 5JMCA 2MNGA 2WQ8A 1RUH2 2IWGB 3FUQA 3B94A 5FWEA 1CWPA 1OUSA 4Q4W3 4AI8A 1QGLA 5JI7A 4PDWB 4H3WA 1IOAA 3H3ZA 3ZXAC 4FTBA 3NV4A 1C8NA 1ENXA 3ZYPA 3RI9A 2J22A 4NUBA 3ZN6A 3UK9A 3F95A 1BEV2 3P1IA 2CAUA 3OEBA 4XFCA 1V00A 1KXGA 1SFPA 1O5LA 1ZBE3 3VBFC 5BNOC 1G9CA 2ZEYA 2QZ3A 1O3QA 2DDUA 1BXHA 1JUHA 1BBT2 5KWRA 1YYNA 2J7MA 4RFRB 5EV7A 1NA1B 1UPIA 1C1FA 1XPWA 2GNMA 2RS32 3MV01 2W52A 4IV1C 1WMXA 2KM2A 4MXVA 2NMNA 4UI9L 5EJZB 2Q1ZB 3Q8CA 2FDIA 2XOMA 4QPYA 4M3CF 1QOSA 3EB7A 2JDAA 4OHVA 4FXGB 4LLOA 2LW8A 2BU9A 5ANQA 1XBFA 1GNHA 3BPZA 1J3RA 1GANA 2X09A 5T5LA 2WNUA 2Z5WA 2RMU2 4UYBA 1QH7A 2YPDA 3QBQA 3V65A 5DN2A 2W91A 3OGSA 4DRVA 5HPOA 2Y6FA 4XIKA 3S0MA 3WEZA 1OOPC 2C26A 4D6RA 2HWB2 3PUIA 5T52A 1NA1A 1R1A3 5L7OC 4UFMA 2IXKA 2IXCA 4LHLA 4XF4A 1XE0A 4Y1YA 2JIGA 5CFDC 3WNXA 2RS12 2RVAA 1XNKA 1QDOA 5HCBA 4OI1A 5JOZA 2JD9A 1W0OA 4ZU4A 4Q5OA 1STMA 4YM0A 3VZKA 4AI0A 3DF0A 3B3QE 3GJAA 2AYHA 1RGSA 1RUC3 4E4SA 1FOD1 2PLV1 5C3OA 2A6YA 1OLRA 1OD3A 5LY1A 2O8OA 2IZWA 5A32B 1MEC1 2JG9B 2VOWA 5J98B 2BFUL 5AC91 3OEAA 1D4VB 1RUF3 2W1SA 3MFCA 4HONA 4LULA 3I97A 4DFSA 2JDMA 1ND3B 2PAKA 3T2OA 2JDYA 3ILRA 1YFWA 1XRUA 2BGPA 5T55A 3OF1A 4IE7A 2E31A 3TOJA 4EZHA 1WBFA 4BQYA 3ZKYA 1VRBA 3AXEA 4CDUC 2G1MA 3I2IA 2IXIA 1NCRC 1R1ZA 4AAPA 1PGL1 4R4XA 5JOYA 3WG2A 5A32A 5A6YA 5A3MA 3RPQA 2JG9A 3N35A 3OD0A 5DUXA 1H1IA 3IDBB 4AVTA 3FMGA 2QQLA
chains in the Genus database with same CATH topology
4CP0A 1ND3A 4CEWB 2FZ2A 2Z42A 1LOFC 2QKDA 1AL22 2CL2A 2WS91 3KGZA 4I2OA 1RVF3 3VBRC 1KFXL 4BHPA 1OHFA 1LHOA 5HCFA 4LBNA 1WGPA 1RUI3 2CYFA 4DOUA 3WDUA 3ST7A 1AR63 3IBMA 3EHKA 2R0HA 1W6QA 4PBPA 5F6LB 1ONAA 4CEWA 4WM8B 3RYKA 1MQTB 4LBQD 2WT2A 4K6BA 1NY71 1VBA3 2E9QA 1IKQA 3FWEA 4IEOA 4QPGC 5H9SA 3VGIA 1YJKA 1KDMA 3NSTA 1RUOA 3AJZA 1VBB1 2I07B 3NV2A 5TSWA 4AVAA 1MQTA 1WMDA 1EV13 3IPVB 2D3PA 1YXWA 3FLTA 4BIFA 3GBGA 3SCFA 4N9IA 3B7MA 1I1EA 1DBNA 2XLGA 2PHXA 1JYIA 3VL9A 5ACA1 1ZRRA 3PJYA 1DLLA 1RTVA 3WG4A 2JE7A 4K9SA 1NLRA 3ZSMA 4QT6A 4BYYA 3IPVA 4OHWA 4U2AA 4YNIA 5J36A 1Y7BA 1VBD3 1XE8A 1RUH1 4XF3A 2AGSA 1V9U1 5CFCC 1GQGA 1VRH3 4NR1A 2FMYA 5GZEA 1CAWB 1BEV1 1H2KA 5DDJ3 1GZ9A 3NW4A 1LECA 2W39A 3U11A 1ZZ7A 1BBT1 3MZHA 4UXAA 2E63A 1FPN2 3VUOA 3ZSEA 2RS31 1H2LA 3S30A 5T50A 4WM7A 1CAWA 4R4ZA 3OYWB 2WKKA 5J09A 2UU8A 2VOKA 1QOTA 2WFF1 1IGOA 4Q4V2 4AFCA 1QXJA 2ARXA 1TQ5A 3MW2A 4AVSA 4Y5Z0 2HWE1 1LCLA 2HWB1 1NE4A 3M8LA 1C3HA 3M1HA 4QPIA 4P9GA 3H1MA 3NO8A 1LHUA 2WFPA 2XJQA 4RGAA 2QDNA 3UKTA 1RUNA 1RUJ1 2DU0A 2YV8A 2RS11 1VBE3 3AMHA 4ZU5A 3ZXJA 5LK7B 1J3QA 3OYWA 4HVOA 3ZSKA 3SISA 1LJ7A 4EN9B 2Q8OA 4XMIA 3VKOA 4DY3A 1W2UA 3P3PA 2DF7A 5JDBA 1LENA 1S0FA 5D8AC 3SMHA 1PZ9A 1DGRN 4AHYA 4C1WA 4CDWB 3RI8A 1ZZ9A 2ZHLA 4FPCA 4XF0A 2VH9A 3OPZA 3AMPA 1YHFA 2VMIA 2D6MA 3FFQA 1AZDA 1SLAA 1AYN3 1DGRA 3PJQA 1QJU2 2D5FA 3M70A 1AXKA 4HSJA 3X29B 4CDWA 1W6NB 2EXKA 3ATGA 3IMNA 4DRRA 2JEMA 4RS5B 4K1YA 4CTEA 3B69A 1AVBA 4L99A 2D3RA 4C0HA 2JENA 2PAMA 1WLDA 5CADA 1A6CA 3GBWA 1PO13 2CWMA 3RRDA 2ET1A 1IS6A 1AL21 3OJBA 1F8VA 5IT6A 2RM23 4BWOA 1CX4A 2HYKA 4MYEA 2Z69A 3FZ3A 4JGYA 2XJTA 1R1A2 4Q8LA 1POV3 1XNCA 4HL0A 1UN1A 4XBNA 2O8QA 3RMXA 4FQ4A 2BVBA 2BEOA 4P9YA 3PVBB 1W6MA 3TNPB 2D43A 3AYCA 3DUIA 3ZFEB 3VBOB 4YW3A 1UX6A 4NWWA 1DZRA 4RHV1 4C1XA 4CEYB 3LWCA 5BNPB 2Q5TA 5C6CA 4YM2A 1LEDA 1N1TA 1X50A 2EXHA 2C0ZA 5CAZA 3DL3A 3ALQA 1RHI2 1RUF2 3HBZA 1FMD1 1YO8A 1ND2C 5GJ6A 4AEDB 4JDNA 3ZFEA 3VBOA 4LBMA 4ZKTB 4FPFA 4CEYA 1TME3 1FT9A 2VNOA 3I54A 5JPNB 5BPXA 4P9JA 1RINA 3S7EA 1G9AA 3UV9A 1UAIA 1WW4A 3I59B 4KNCA 4AK3A 5FAXA 2D98A 2PQQA 1DYPA 4XMAA 4RGGA 1S2BA 2P2KA 3V0BB 1XE7A 3WT3A 2TEPA 2GZWA 2ZBJA 1PIV3 4WVZA 5FO8B 4JQRA 1IHMA 1OA3A 1MZEA 4BE3A 1OA4A 1PZ8A 3IM0A 3HT1A 4JV4A 5KXBA 4XJ8A 5FBZA 4TLFA 2R042 3I59A 4FTSA 1QY4A 2A7AA 3N36A 4PDWC 1MZ5A 2H0BA 1AR62 5GM0A 3WV6A 3TNQA 4A7KA 2FZ1A 3VL8A 4YW5A 3V0BA 3PNAA 1AR72 2D97A 2B8MA 4XHBA 3FBMA 2WZR3 2YPJA 3ECQA 5L19A 1VBA2 1NA1C 2XPJA 3BU7A 2CAVA 4X8PA 2BBVA 3BCWA 2X29A 1G9BA 4LLFA 3J8F3 4NHKA 4L97A 2RR11 3E5XA 2DCKA 3EBRA 2HWF3 1A78A 3LOIA 2ZABA 4YGCA 2BNMA 4NHMA 1SDWA 2VECA 4AHXA 4AHWA 3AKTA 3B9CA 1IPJA 3QCWA 1XNBA 2CGNA 4AFMA 2IFRA 3APBA 5FPZA 2ZZQA 1V6JA 1WW5A 3LSDA 2OUJA 1M4WA 1GZCA 3E5UA 1PVXA 4AFDA 2XVKA 5J37A 1VBD2 4ASMB 1AXZA 4Q4W1 2P3JA 5GZGA 1OFSA 2K2SA 1DIWA 1VRH2 4I0AA 4EV0A 1ND3C 3UJQA 1H2NA 3H50A 1AUYA 4XFFA 2I74A 2WC2A 4M00A 2DURA 2NN8A 1ZBE1 5KC5A 1J3PA 1RMU3 3KT7A 2XKPA 2H6CA 3B00A 4WVVA 3LA3A 1VIWB 3AZZA 4P5HA 1MR5A 2ZGOA 2RMU3 4CEWC 4GB31 1BCXA 5CBLA 2HWC3 1OPMA 3JBG2 3H1YA 4YYOA 4C90A 3SCGA 2ZA9A 3CLPA 1LHNA 2ZGRA 4YARA 1SFNA 1R1A1 1LGCA 2WJSA 4EN0A 1ZRCA 4XTMA 2ZPXA 2VOVA 2DVBA 1Y9QA 2DV9A 1SFYA 4WM8C 2WT1A 1SBDA 2IXLA 4L92A 2HWD2 1SACA 2TUNA 1H1AA 3ES1A 3OBTA 2E53A 2VPVA 1RUC1 3AMQA 3H7YA 2UWCA 1E57A 4MXWA 4K20A 3N7KA 4LUMA 1YJLA 1DQ2A 5EYYA 1IS4A 3D8CA 5HXVA 4HSLA 1RUF1 1UW8A 3B93A 1DQ6A 3SXWA 3BIWE 4P9WA 1J59A 1YNAA 1ZVFA 4KG8A 3WCSA 2IXHA 4HT1T 4J1XA 1AYN2 4Y1ZA 4O9GA 4LR4A 5FLJA 4LT5A 2YROA 1DGLA 1SMVA 1OPOA 2B46X 4M3CE 4RQPC 5EFUA 2GC2A 5KHGA 2A73B 2FMDA 4GH4A 4AE2A 4IERA 3CJIC 1H4HA 4QGNA 5JOWA 4MGIE 4YM1A 4KWLA 1RVF1 5HI0A 2EAKA 4DS0A 3NJZA 1B09A 4XOGA 3AKSA 4A3XA 1DQ1A 4W6WA 4FOYA 4XW3A 1VLNA 1RUI1 2XLFA 1B35B 4MUVA 3LOBA 3MIFA 2DVDA 5F6KA 4E4DX 2GALA 1REDA 1U5XA 1PNGA 3U07A 2ZMKA 4Y1VA 1OQDA 2ZGPA 3VLBB 2YYOA 4O9EA 4CDXB 5J3UA 2PFWA 1TNFA 3GALA 4Q0VA 3KCCA 4RFT0 4LTAA 4XIOA 1B35A 4XJZA 1UKGA 1W6PB 1Z78A 5BUVA 4J6GA 1VP6A 2QE3A 4RL7A 1REFA 2DU1A 4FPEA 2GAUA 3T2TA 5GKAC 3TN93 4CDXA 1LB2A 2A6VA 2V73A 3R05A 4XF9A 1TMF2 1SEFA 3U4XA 3N7MA 1EV11 1YCIA 1A3KA 1TME2 3NKTA 5JVVA 5H9PA 4K1ZA 1H1MA 1W6PA 4S2GA 2GMEA 5CA6A 1O3TA 3PHMA 5CG8A 2P3IA 3LA7A 2NQYA 4XF1A 3AP9A 2UWBA 4AI1A 3QOPA 1N1SA 3DGTA 2BVVA 1ALYA 1BVVA 1H0BA 3B5LB 2ZKNA 2YMZA 1VBD1 1WA4A 4I0BA 2GU9A 2C1FA 4DZGA 3M3OA 4FPKA 4Z92B 4M01A 1VRH1 3N3HA 4YZ1A 3HR9A 2F4PA 2JECA 4OHXA 4QXKA 1W39A 1J58A 3WINE 5DDJ1 2QNKA 5FOJB 1C28A 3QACA 1MZFA 1ZBA3 3B02A 2AENA 1FPN3 3AZVA 2Y0OA 1SCSA 2WZR2 3ZXEA 4KWJA 5IK4A 1POV0 4HBNA 2PHWA 3A4UA 5BY5A 4RS5C 4Q4X2 2HEVF 4N53A 1OKQA 1PGW2 2D6PA 3POWA 5B2GB 2GC3A 4Q4V3 4YFZA 3VN4A 3B01A 4TSVA 4XPVA 3RZZA 5KC6A 1PM7A 2ZMNA 1FNZA 3ZN4A 4LE3A 1Q8QA 3MIEA 2BNOA 5EJ3A 4LNVA 3TBDA 4OVEA 1UMZA 3V0AB 5C9AC 1VBE1 2A5ZA 4AQTA 3HIFA 2VGDA 3I4IA 3WLUA 3KSCA 1PVC2 1A8MA 5FO7B 2GMPA 4MV2A 3WHUA 2DCZA 3WW4A 3ZFEC 3ZXFA 2GN7A 3AKPA 3MIGA 1V6NA 4CEYC 4B7EA 5BNPC 4I3PA 2AR6A 1UF2C 1ULFA 4MGYE 3AFKA 3V0AA 2WLQA 4WZCA 2UYBA 2RS52 2UURA 2WNUB 4AF9A 1QJU3 2EAAA 3I2DA 2ZHMA 1AYN1 4OI0A 4AEDC 1RMU2 4QQOA 1NLSA 5E1RA 1GV9A 4FOWA 1YFYA 4B7KA 5KHIA 4BH9A 4CYDA 3A0NA 3KS7A 3KT4A 3VBUC 1SBEA 1F9KA 4PLNA 2DVFA 4LO8A 1H30A 1O7FA 1HQLA 1CAUB 3M3EA 2PTMA 4YFWA 5C4WB 4PF5A 1PO11 4XDQA 1X8MA 2GSYA 2HWC2 1R082 4FAGA 2RM21 2GN3A 3RDIA 4ZXKA 3WQ7A 1G9FA 2BGCA 3SH3A 4LA2A 3QH7A 4FPYA 2DUQA 1JBCA 3E97A 1POV1 2B5HA 1CAUA 2JXAA 1COV3 4YSFA 2YXSA 5C4WA 3U0ZA 1CR7A 5CG9A 4EN6B 1QQP3 2O0OA 4JTOA 2G4IA 3ZFFB 1H8TB 3AYEA 4KH9A 4YG6A 1ZZCA 2ZX3A 4K3UA 2ZX0A 4JDMA 3WG3A 4AFAA 4QD2A 3KCYA 1XYOA 5T3NA 3WW2A 1HXS3 1RHI3 1OQEA 5FQ0B 3AKRA 3TAYA 2X5IB 4FPHA 1LRHA 5EXOA 3GZUC 5FRAA 3RWNA 2D7FA 2WNVA 3ZFFA 1H8TA 1AX0A 3AMMA 5T54A 1TME1 5CIRA 4IEZA 3WDVA 4I01A 2ZGUA 5GZDA 4A7YA 3FLRA 5FQ0A 5KHHA 1W6QB 2WLPA 2B39A 4Y20A 1AR82 2X5IA 2DUOA 3VBHC 1O5UA 1LHVA 1Q8SA 2XB6C 4JGZB 1Q8VA 1Y3TA 4BA6A 1PIV1 1O4TA 1PK6A 4ONUA 2R043 2WA4A 2GNTA 5DZGA 2VQAA 3MLKA 3PVOA 4NVPA 1DZTA 3OD4A 1KS4A 4EN7B 1A8DA 1JUIA 3HWJA 2WWSA 5CB7A 1WLTA 3WP5A 2XJVA 5J48A 2X53S 1AR73 4I0WB 4LO4B 5AVAA 4JGZA 4HK9A 2PAEA 5C33A 2WT0A 1MVEA 3J4UH 5BNQA 1HRI3 2ETEA 5LRRA 4PLMA 1JN2P 2OW4A 4XXPA 5JCTA 1NYWA 3VBSC 4AI2A 1AL0G 4R52A 4RR3C 4XJWA 5ABJC 1RITA 1HIXA 2P37A 5FPXA 1YI9A 1QF3A 2VG9A 5HBAA 2BWCA 1PGW1 4QMAA 5FLHA 4META 3RSJA 5C8CB 4F8AA 2D6NA 3J8F1 1CESA 3AP6A 1WLCA 2VY0A 1LOCA 3TN92 2NZ9A 2V5YA 2HWF1 2XWBB 4GMP3 3O0WA 5I8SA 3O0XA 4DY5A 2ZGTA 2BNNA 2OZJA 3M3CA 1XYNA 1CPNA 3R0RA 2E51A 5C8CA 3D4KA 5BV6A 3BB6A 1XNDA 3NV1A 3GYDA 5CU1A 4EJRA 4E27A 4AFBA 2R072 4COYA 4FAHA 3PMEA 2DWRA 2QDRA 1W6OB 4B4RA 2Q4SA 3E6DA 4KBBA 4WM7B 2IXJA 4FO9A 1K5MC 4ASLA 3A0KA 1H4GA 1BMV1 3O7OA 4IEVA 1X8EA 5JZGA 4LBLA 1ZBA2 2ET7A 1RMU1 2UWAA 1CAVB 2A3YA 2ZS6B 1W6OA 4YZ2A 5JAXA 4QPIB 1SLCA 2YY1A 1YFUA 1LULA 3AM2A 3AXDA 4N43B 1LEMA 4W65A 3ETQA 3OCPA 2WQZC 3OY8B 2CGOA 1FXZA 3ZIXA 4YVWA 1GFF2 2XHKA 2RMU1 3JBG3 4DPNA 5IK8A 2W0XA 2HWC1 1CAVA 1LOAA 2WSVA 3THPA 4N43A 1EY2A 1CJPA 3K48A 1LODA 4GKXA 5T5PA 4N9HA 3VHRA 4PQ9A 1WW7A 3ZSLA 3OY8A 1XU2A 3WOGA 3UJOA 1SBFA 2HWD3 4GALA 4WV8A 1WD4A 2P17A 3W59A 4ATEA 5A33B 1CN1A 4QM8A 2GNDA 4AHZA 2A6WA 2DCYA 2DTWA 4FXKB 3WD5A 1AX2A 4X8NA 1OSGA 1XU1A 4HFSA 4TYSA 1Z7S2 2I45A 1FI2A 4HKWA 4W6YA 2D6OX 2E7TA 3VHPA 2B45X 3IDEA 2XJRA 2WINB 5A33A 3N7LA 3VDDB 1QMJA 1C5IA 3VZMA 4JGYB 4LE4A 2B7YA 5E16A 2BPA2 1BJQA 4R9CA 3WR0A 1HW5A 3DPRC 4Q4Y2 4YVSB 4OZXA 2O1QA 3KB5A 1RJ8A 1W6MB 1Y43B 2OYZA 4RA0A 1ZZ6A 4Y1XA 1V70A 3FUOA 1IPKA 2W08A 4GA9A 3VDDA 3JQWA 1Q8PA 2BQPA 4N7UA 1MS8A 3GF6A 4OHZA 2LM3A 1S0EA 3ZDSA 2EA7A 2XUMA 4YVSA 3MGUA 3O0VA 3RMYA 2W68A 1IQAA 4YW2A 1COV2 1UIKA 3VZNA 4QQ2A 1QJX3 4LBKA 4L8QA 3VKNA 5FMOS 4EN8B 3KM5A 1V6OA 2I2SA 1QQP2 2VNGA 3WXPA 4DB5A 4Y24A 2VULA 1G8WA 2HKXA 3KCXA 1DQ0A 4XILA 1HRV2 1HXS2 2XJPA 4NWVA 1JH5A 5JZGB 4JAAA 1L3JA 2D40A 2BUKA 1UU5A 2C5DA 4CDQB 2QFEA 1TMF3 1UD1A 2RJLA 2YC0A 4YGBA 1GSLA 3TN91 5JSRA 1NQJA 2YZ4A 4MSVA 5D1IA 3IN9A 5BNNC 4K8FA 3AZWA 1AYM3 3B9IA 2D3SA 4FOVA 1KQRA 1DGWX 4PIZA 3SH5A 2B9UA 4XFAA 4Q0SA 5F1RA 2KXLA 4CDQA 3SCHA 1OFNA 3TRSB 1LOEA 1J1TA 1I6XA 4B4QA 1QHDA 4LBOA 2ERFA 5FTTC 2OPKA 4HN0A 1ZRDA 2JKBA 2Q0AA 3PVEA 4IV1B 3POYA 4KL1A 4D3WA 3ZMOA 2D93A 1CAXA 1RUD2 5K0UB 1AR92 3ELNA 3IT8A 3G7DA 4IXLA 3SHRA 4GWNA 5BNOA 3OGJA 2WNUC 3ME2A 1ZBA1 2XJSA 1LKNA 3AYDA 1FPN1 4XQ4A 4E2GA 1HRI2 1SLIA 1QOOA 3JCIA 4Q4X3 1GKBA 4IV1A 2H0VA 1FAYA 4UW4A 5K0UA 1UKRA 1XXNA 1ZA4A 4FPJA 2JICA 3GZTB 4Q4V1 1G9DA 5C4WC 1CONA 1PO23 4B29A 4HETA 4B8EA 3DKWA 5L7OA 1HDKA 4Y26A 4XTPA 1S0CA 1RUE2 5K7PA 2Q1MA 5CFDA 3NAPB 1BK1A 1R093 5FCCA 5KXDA 2DCJA 3GHNA 3HD8B 1PVC3 1ZREA 3VV1A 5JLVA 1MS1A 2H6BA 1HQWA 3ACLA 1YIPA 4BIOA 4L9BA 3KGLA 3ZFFC 1H8TC 3GHMA 4KGGA 2QVSB 4BOWA 2JG9C 5JSPA 3NAPA 1W0PA 3ZYJB 3AZXA 5C8WA 2RS53 3L2YA 3AZYA 3J9SA 3ES4A 1BKZA 4QHBA 2PHUA 4BPZA 1ZNPA 1I3HA 1QJU1 2ZX4A 3PVNA 4M0NA 1QJY2 2XGXA 1NCRA 5LEJA 3R4DB 4FT8A 3D0JA 2PHTA 3UL2A 1V6LA 1SLLA 2JDZA 4H14A 3DN7A 2CY6A 5IK5A 4Y22B 1DQ5A 2D6KA 1LOFA 3BALA 4FP2A 4S2HA 1R083 2LTNA 1FV3A 3JUUA 4JGZC 5GLWA 2HJIA 2ENRA 5F9TA 4MXWB 4WVMB 1KRIA 2XJUA 4LA3A 1GNZA 4OFGA 4COVA 4SBVA 4FQZA 1UL9A 4NN0A 3AB0A 2ZX1A 4XEZA 4R9BA 4YG3A 2BWAA 1LGBA 2JD4A 4Y22A 5FOBB 2VW0A 1COV1 4GMP0 1IZ3A 1LGNA 2VMHA 2YGMA 2ZTNA 2R32A 1QQP1 3MLLA 1MQTC 3NVCA 4KG0A 3WZ1A 3HMYA 4AW7A 4WVMA 1AXYA 4IEUA 3WDYA 4FVVA 3FFZA 1DHKB 4QPGA 1HXS1 1RUJ3 4SLIA 3T1LA 1RHI1 1QDCA 4XJ9A 3JU9A 4GH4B 1VJ2A 2VMGA 1MS4A 2PHFA 2XBO2 3V56A 5C8CC 3NL1A 2DVAA 1WBLA 3TYJA 4F3JA 3O12A 4Q0QA 3AP4A 1EPZA 1S2KA 4AVVA 1AR83 4QGMA 2Z79A 1ZZBA 3MW4A 1D4M3 1GR3A 3WCRA 3WDWA 1DDLA 5FO9B 4AXOA 2IC1A 5JZGC 4ZU7A 1N1YA 4N90A 1GZWB 4YW4A 3ZYGA 1CIWA 2R041 2X8KA 4IEPA 4E4ZA 1NCQB 2ZGSA 5JSOA 4QQPA 3OBRA 3MIDA 4MZUA 1AR61 3TWIA 2DCTA 2DUPA 4WM7C 3UKNA 2RE9A 1ZYBA 1HV1A 2NM1A 1AR71 1URXA 2UYAA 1QJX2 3WDTA 1WW6A 1WMFA 1GBGA 1GZWA 4XFBA 2GC1A 3JD73 1WCKA 4AEMA 4QU2A 1VBA1 1NCQA 1AX1A 4QPIC 4XFGA 4B3NA 1PHMA 4H7MA 1LU2A 5JIUA 1S0JA 1S0IA 2R0FA 2WQ4A 1LR5A 2XG3A 1QXPA 4GMP1 1ULEA 5D8AB 1FOD2 5I91A 2PLV2 3IDCB 1AYM2 4INDA 3MLJA 1C8M3 1C57A 2Y38A 5AC92 1ZRFA 2A75A 5GZFA 4C91A 1ZM1A 5LEKA 2R073 1IKPA 2SLIA 2ZMLA 4GQ7A 4V1PA 4XYXA 5BXXA 5KHJA 3ZXGA 4LUKA 5D8AA 1VAMA 3AJYA 5EZWA 3SITA 1YI7A 4JC1A 4UBGA 3MF9A 4FPOB 4ATFA 4QGLA 4CDWC 4EWAA 1PGL2 4L2NA 1CJDA 2NPIA 1MS3A 4N53