5A3WA

Crystal structure of human plu-1 (jarid1b) in complex with pyridine-2, 6-dicarboxylic acid (pdca)
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
462
structure length
455
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKARDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
publication title Structural Analysis of Human Kdm5B Guides Histone Demethylase Inhibitor Development.
pubmed doi rcsb
source organism Homo sapiens
total genus 151
structure length 455
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a3wA01
3N9OA 3PUAA 5A7SA 4AI9A 4DIQA 5E6HA 4CCMA 5A3PA 3PU3A 4EZ4A 4UF0A 5FYZA 5FY0A 3OPWA 2YBPA 2WWJA 4QWNA 4LITA 4QX8A 4LIUA 5F5CA 2GP3A 5FYHA 4C8DA 5IVCA 3KV6A 4IGOA 5FJHA 3KV5A 3K3NA 3N9PA 4D6QA 4BISA 4QXCA 5F3EA 5FP7A 4AAPA 2PXJA 5IW0A 5A7OA 4CCLA 4QX7A 5A7WB 5A80A 2OQ6A 2YBKA 2YBSA 3LD8A 2XXZA 3UYJA 5FZBA 5FV3A 2WWUA 4TN7A 5ANQA 5K4LA 5A3WA 3PDQA 3PU8A 4CCNA 3KVAA 2OS2A 4D6SA 5FZAA 5A7PA 2VD7A 5FWEA 4XDPA 3DXUA 4CUGA 4Y33A 3N9NA 3OPTA 4UF0B 4ASKA 5FWJA 2P5BA 5FYYA 5F5IA 5FZ1A 4NUBA 2Q8EA 5FZ9A 5KR7A 2XMLA 5FP9A 4HOOA 5IVJA 3AVSA 2Q8DA 5FZ6A 4CCOA 4URAA 2OT7A 4CCKA 2YPDA 5FZ8A 4GJZA 5FPLA 4BXFA 4BU2A 5FXWA 5F3IA 5F39A 3DXTA 5LW9A 3K2OA 5FXXA 5CEHA 5FXZA 5IVEA 5F2WA 5IVVA 5FY8A 5FY9A 5FPUA 3PURA 3KV4A 5FPBA 5FYMA 5FZOA 3ZPOA 1VRBA 5FPVA 5A1LA 2XDVA 5F32A 3RVHA 4CCJA 3AVRA 4XDOA 5FYTA 5F5AA 5FY1A 4D6RA 3PUQA 5LY1A 5FYIA 5A1FA 4V2VA 5IVBA 4EYUA 4Y4RA 5A3NA 5FP3A 3LDBA 5FZFA 5FXVA 4CSWA 4QU1A 5FJKA 5FP8A 5FY4A 3U4SA 4LIVA 4EZHA 5F37A 5F2SA 5FZMA 4QXBA 2OQ7A 3NJYA 3N9MA 5F3CA 3AL6A 5FYSA 2OX0A 5FY5A 4V2WA 5IVYA 5IVFA 5FPAA 5ISLA 5FZ3A 5A7NA 5FP4A 5FYBA 3PTRB 5A3TA 5FBJA 5FZ0A 5FZGA 5FZ4A 5FZDA 5FZEA 2XUEA 5IWFA 5FUNA 2YU1A 4E4HA 4HONA 5A7WA 4Y3OA 2GP5A 5FY7A 3KVBA 3KV9A 2W2IA 3N9QA 4IGQA 5FYCA 5LY2A 4DO0A 5F3GA 5FYVA 3U78A 3N9LA 5FZOB 4GAZA 4QXHA 3ZLIA 5FZ7A 2Q8CA 5FZIA 5FZCA 5A7QA 5FUPA 4LXLA 5FZKA 3PUSA 2YU2A 3K3OA 4IGPA 3AL5A 5FZHA 5FYUA 5FZLA 4GJYA 4GD4A 5LWBA
chains in the Genus database with same CATH superfamily
2C0ZA 5K0UA 4XACA 4DXSA 4PBPA 3CHXA 4Y1VA 1ZZ9A 3DPRB 5IAVA 4EV0A 3KF5A 2VY0A 1QH7A 4QX8A 1DZQA 3TNQA 4YLZA 5IVCA 1YIPA 1OKOA 4PQ9A 5FMDA 1VBE3 1CAVA 3I2HA 1RUG3 2EIEA 4XIKA 2XJTA 4EN9B 1UPIA 3QCWA 2BEOA 5JIAA 5JPNB 2VBDA 4XBLA 4WM8B 2RM22 4LK7A 2ZPXA 3SH4A 4QT6A 3I59B 1JW6A 4IEQA 5ACA3 4UW3A 3SXWA 4CEYC 2CHHA 1RUI1 1RVF2 2X05A 2JDHA 1ENSA 2BZDA 2EXKA 2VQTA 2DVBA 1C5IA 4JRAA 4RR3C 1RJ8A 1IS3A 1WMEA 1LENA 1TE1B 2W87A 4MUVA 5LA9A 1SPPA 4DPNA 2A3YA 3LGRA 5J3UA 2D7FA 5DDJ1 1TEIA 2VMFA 4AVTA 4I0WB 5FYYA 5I0RA 4PF1A 1OSGA 2WZPP 1ZRIA 2ID4A 3CKHA 1NE6A 5KXEA 1EAH3 4H3WA 4MLOA 4LE3A 1OPMA 2XBO3 3ENRA 5CKNA 2HWB3 4B3NA 1D0HA 1HQLA 1VJ2A 2Y8KA 3OUJA 2VZQA 2NPIA 4AVVA 1CQ9A 3MYXA 3VBUB 4AFCA 2Q1MA 3HBZA 4INDA 5FXZA 1FNYA 4NIGA 1TMF3 4PIZA 3PURA 1HN1A 4R4ZA 3ORJA 3V0BB 4CDUB 2ZBJA 1PK6A 2WNOA 3INAA 4N43A 4S2FA 5G05L 2VQAA 1QXPA 4MXVA 1RUC3 3OTFA 3H3LA 4QGMA 4Y4RA 2BVBA 4QQHA 2VW2A 2Y34A 1ODNA 4XAEA 2B9VA 1RUD1 2ZACA 1HB4A 5BNPC 5JUVA 4WM7B 1NCRC 1S4CA 2QQLA 3DPRA 2BU9A 3NJYA 3VBRC 4Z2WA 4AK3A 2EXJA 1W2OA 3PVBB 2AENA 3ACGA 4K6BA 1W3XA 3WDXA 4BQYA 2J7MA 1VBB2 4YG3A 4IE0A 5FYBA 4YW1A 5CAZA 2DV9A 4SLIA 3M70A 2ZMLA 1ZBE1 4QKNA 4WVVA 3WDYA 5HCHA 2HWC2 4AI0A 1DQ6A 4WM8A 2X8KA 3IIIA 3I59A 4L8QA 5F3GA 5FK7A 4F83A 4ZZ8A 5LA0A 4QHZA 2QQWA 3LWCA 1Z7S2 3LZZA 3SKVA 3C7GA 3NSTA 2Y0IA 3SNMA 1O5LA 3D5OA 1G6NA 2UU8A 1AR71 3GXUA 4QX2A 2NP0A 2XWJB 3NKGA 5HV0A 1BEV1 3JZVA 2WL1A 1WW4A 5JLVA 2V5DA 2HH9A 3IM0A 1COV3 1BK0A 1OD3A 4BYYA 3SITA 5F5CA 4WZCA 4BLJA 2LUWA 3O1VA 4AVSA 4TSVA 1AUYA 2RE9A 3M1HA 2B7YA 2GNBA 3NW4A 4N53C 2A6YA 4NIIA 5D1IA 4BK4A 1HB1A 3VD9A 3VBUA 1NT0A 3RYPA 3AZVA 4ZU5A 4ORFA 1AYM1 2JIGA 5C8CB 3RI9A 2XPJA 3POWA 4QKBA 4XAAA 3V0BA 2JECA 1C28A 1W9WA 2E32A 2ERFA 1GOFA 1NY71 2LRPA 3MIBA 5FV3A 5GLUA 2IC1A 4CDUA 1PGSA 4Y1ZA 4B7KA 1HRV1 1I9RA 4OUMA 1DBNA 4TLGA 4Z07A 5F9TA 5GZFA 1LHUA 3ZO0B 4BQ4A 3VHNA 4Q4Y3 3N7JA 1R082 5EP9A 4FVVA 5DG1A 4COVA 2WZR1 1LJ7A 1NUKA 2P3IA 1KQRA 4FI9A 1F5JA 2VNRA 4EROA 2HWD1 1CPMA 2O0OA 2UURA 2ZX0A 4WM7A 3OPTA 2RS33 5A3OA 4ASKA 4M0NA 3ZOIA 4FAGA 4P02B 1LOGA 2XMLA 4ZXEA 4HOOA 3I3QA 4QU2A 1RINA 3Q8CA 5KHHA 1UYXA 2C1FA 2K9ZA 1DGLA 2R6QA 5FDBA 3N35A 3R05A 5FPLA 1YQ2A 2RS51 4IV1B 3IT8A 5JR2A 3I4IA 2DF7A 3J7LA 5F3IA 3C3VA 2HWE3 1QDOA 4O61A 3VZNA 1VB4A 3UNPA 3UGHA 4AEDB 3RZJA 1WBFA 2X10A 3BKZA 5LRRA 3VLBB 3PMEA 4FPEA 3B93A 2XVKA 1Y3TA 1H9PA 1UKRA 3B9CA 4MG2A 1IPSA 3TEYA 3DUIA 5FY4A 2A75A 2VAUA 2RS12 3UV9A 4P08A 3AXEA 1TME2 3I3MA 1MS3A 4JC1A 5AC92 5FXVA 1OF4A 2HYXA 2DCYA 4E8DA 2D3PA 1VBC1 3I2IA 1JI6A 3I8TA 4XXPA 5J48A 4TTGA 2VW0A 3O1MA 1U0AA 3NNMA 3VKLA 1ZZ7A 5JMCA 3R4SA 1QIQA 5E88A 3A23A 5I93A 2B4KA 1ENXA 2YC4A 3P6BA 4UFIA 4BH9A 1B35B 5KC6A 3WG4A 3BIEA 4AEJA 1EPZA 3C7OA 1RUNA 4OMCA 1W8TA 1G8WA 3WV6A 4BIOA 2W1UA 3DYOA 4NWWA 4QQLA 4YG6A 1FPN1 4YWAA 5C8CA 3MBWA 5A33B 4QD2A 2WA4A 2D98A 4PLNA 4BJ0A 1AL23 4CXWA 1HXS1 4C0HA 1OD5A 3LSEA 4GAZA 4MSVA 5FZIA 3MV01 2AR6A 2F17A 4ITCA 5T52A 2EIGA 4Q4X3 3QOPA 5L19A 3UK9A 1X7NA 3N7MA 4YW7A 3RGBA 4OI2A 2DWRA 2JKBA 2YGLA 4OVEA 2LS6A 3PUAA 3ZFEB 4COYA 4AEKA 1RUG2 1X9TA 1IG0A 1H8VA 4QAWA 2BFUS 2P3KA 1QJU2 2YC2A 3A21A 3I2DA 1AR61 3IWZA 2ZHMA 1O3RA 2FDHA 1DHKB 1LHNA 2BJSA 4XPVA 1W90A 2KM2A 3UL2A 4AI2A 2WS92 3VGIA 4FTEA 2DYCA 4LOTA 5ACA2 1RHI3 5L7OB 4W6WA 4LULA 1MR5A 1UX7A 5GZCA 4QXCA 4K1YA 3RJ2X 3BOPA 3O0XA 1POV0 4IV1A 3QH6A 1NXD1 3MO4A 3AMMA 4HVOA 4AEDA 1OA4A 1HDKA 3KT7A 4GMP1 1LKNA 2XLGA 4KBBA 4XF0A 2E63A 3UYJA 4BXSV 2D5FA 1G9BA 1IG3A 1PZ8A 4KNCA 4AL9A 2R16A 2C9KA 2WFF1 4XILA 2FHRA 4DUXA 3DCQA 2XBO2 1OLRA 3I97A 2BBVA 1K5MB 2UWCA 3L2YA 4IV3B 4UI9L 1CR7A 2QQMA 2BGCA 1IS4A 4JTNA 4AHWA 2C26A 2VOTA 3BCWA 4FP3A 2BP6A 1OH4A 2GC2A 3BIWE 1WD4A 1RUD2 2JKXA 2Z42A 1GYKA 1RXFA 1QKQA 2WUHA 1QJX3 4JAAA 3VB9A 1W06A 3ZXDA 4ET7A 4YGDA 3CNAA 3CDZB 4GWNA 1B35A 3WG2A 2B9UA 2J42A 1O91A 1QJEA 2QQUA 5DAPA 1KD7A 4AHZA 2VO5A 1KFXL 2X5IC 1OQDA 2DVDA 1MS4A 1DF0A 4PIXA 1EP0A 2LM3A 4YM2A 4I02A 1VMFA 3KV4A 4XUTA 1VRBA 3ES1A 1PVXA 4CCDA 4Q29A 2YFUA 2IXJA 4D6RA 1SCSA 2JDPA 1PMJX 5FYIA 3WNMA 4KQ7A 4YW4A 3K4DA 4YW2A 2VBBA 3IB3A 3NNGA 3RDIA 4YZ1A 1RGSA 1UY4A 2QDRA 3ZFEA 1H6XA 1HW5A 1W6NB 2PAKA 5A33A 5JCTA 1Q8OA 4B1LA 4NHYA 5C4WB 2VXJA 5FY5A 3KQ4B 3AJYA 2VOXA 2JG8B 2FDFA 2XHKA 2VQUA 5A7NA 3V56A 4AXOA 1AX1A 3CJXA 4R8HA 3J7MA 5L7OA 5FZ4A 1OUXA 4Q2FA 2V09A 4WVWA 1AYN2 5C5UA 4XMIA 2YU1A 1VBA3 2XR4A 4E4HA 1LOAA 4GKYA 3AFKA 5KXDA 1RMU3 4FBFA 2EXIA 4MHRA 3CJIC 3GDBA 1NCQB 1W8NA 1GV9A 3ZDSA 1V6LA 3TAYA 3KZ4C 2A6VA 4DS0A 1WUVA 1I3HA 1Q43A 3M3QA 5FZ7A 1D7PM 4J1WA 3LB9A 2Q8CA 4UXAA 5FZCA 5FUPA 3WP3A 2Y60A 1F35A 1OKQA 3KCYA 3WOGA 3E97A 4Z82A 1K5MA 4IV3A 3N4MA 4XUQA 1HLCA 1QJFA 1VRH2 5E6HA 1UY0A 4LMFA 5J96B 1HJFA 3AZYA 4PF5A 4XUPA 1F2NA 4KU8A 2JJ6A 4AI8A 4LIUA 1W2UA 4NWVA 4OZOA 5FYHA 1BYHA 4OHZA 5JOWA 3POYA 3T2TA 4IGOA 5C6CA 4RFT0 3FC0A 3NMBA 2E7TA 1H4GA 1RITA 5JVVA 4PLMA 4ZZ5A 4Q4V3 1ZZCA 3T2OA 5LASA 4DEQA 1SFYA 3PMSA 1RUH1 4Q0UA 2ZGNA 5D2AA 2R32A 4CEYB 2XQRA 1PZ9A 1RTVA 2VOKA 4IE4A 4E8CA 2YYOA 2VQ0A 4NVPA 2BVVA 4AVBA 4RR3B 1SBEA 4YFZA 5K4LA 1J58A 2R042 1PIV1 2YROA 4ZS3A 4D6SA 1JZ4A 1YQ5A 1W6NA 2R7EB 4AG4A 4RHV1 3RZLA 1F8VA 4JQTA 3N9NA 3T2PA 1URXA 4UF0B 3EJKA 2P3YA 5C4WA 5IYYA 1CIWA 4FFGA 1RUJ2 1N3PA 1ZZBA 4FPJA 4HVRA 4Q4W2 5FPZA 4E9KA 1NKGA 2JG8A 1CIYA 1DGWX 4JKKA 2FDGA 2ZXQA 4JRLA 3TBDA 3DKWA 3LDRA 3CBNA 2NYYA 3ETPA 4I01A 3T30A 2P17A 4S2GA 1SG3A 3O0VA 2NQYA 5ERLA 4XW3A 4UT5A 4JDOA 3SISA 3FHAA 4HXCA 3B69A 1W6QB 3FJSA 2XJSA 3SH3A 3MZHA 3W20A 4CCEA 1GZ9A 2E51A 5HBAA 4NHKA 1NCQA 4K8FA 3WNLA 1ZZ8A 2QBXA 1Q3EA 1I1EA 2QJVA 1HRI1 3RZGA 5EFUA 2RM23 4DMIA 1MZFA 3PNAA 1RUF1 4COWA 4Q1PA 3D6EA 3V65A 1KDMA 4EWAA 1RVF3 1ZBA1 3MFCA 4FPOB 3GHNA 2IWGB 3LDBA 5BNPB 1NLSA 3J7NA 1NCRB 3J8F1 3VBRB 3TN91 4COUA 1GMMA 4LIVA 3PJQA 4NHMA 3IDCB 3OYWB 1IS5A 4PDWC 2A3XA 3SLIA 5IK5A 1U12A 4PCRA 3OGSA 5FOJB 1MZEA 3G6JB 4YG0A 4BQXA 1CGPA 2YB7A 1CX1A 3JB8A 3PTRB 1JTZX 3ETQA 4OCTA 1NXMA 2JD4A 4ONUA 2QVSB 2W52A 5EXOA 1JZ3A 4LBJA 1QJY2 4J25A 4CA9A 5I8SA 5J37A 2ZAAA 1H30A 3C2UA 4MGKE 3KVBA 1QQP1 3DN7A 2W2IA 4YVSC 2HJIA 4IGQA 5BY5A 2IVJA 4TWTA 4CEYA 4E2GA 2ARCA 3U78A 5I8YA 1EUUA 1K5JA 3HN3A 5DUVA 3U11A 4UOJA 4MX3A 3RSJA 4RR3A 1X82A 3ZSJA 3SEEA 3VZOA 2ZEYA 3RZMA 2FMDA 1QOOA 2YU2A 3POSA 2WSVA 1ENQA 2QNKA 3WF3A 2VC9A 1UIKA 2R071 3B5LB 2EAAA 2VG9A 3E6DA 5I0UA 3RRDA 5IK4A 2UY8A 3PU3A 4UF0A 2KA3A 3MIGA 1QXRA 2VMCA 2IFWA 2G9FA 3IAPA 4CDXC 2GP3A 5GLVA 4C8DA 4EN7B 3TRSB 5LCWL 4N53B 2BNOA 3I2OA 3J26N 1D4M3 1OA2A 3A0NA 4NIDA 1U5ZA 1VBB3 3ZXKA 4X8PA 2DCKA 1DU3D 3E5QA 4YPJA 2PFWA 1W6QA 5FP7A 3UETA 4A41A 3GALA 4AGRA 2GSYA 3D4KA 1GOHA 1W2AX 4FPCA 5ANNA 5AVPA 5CG8A 4Y4YA 2HWC3 1SLIA 3O1PA 3H9AA 3DYMA 1S2KA 2FBEA 2RMU2 4XJZA 5FZBA 5FPXA 2UWAA 2GDFA 1SFPA 2H0VA 2JE7A 4AR2A 1Z7S3 4A3ZA 1OFSA 3PDQA 1Y43B 3FX3A 2OYZA 3IIAA 1LOBA 1C1FA 4CVUA 5BNPA 3A0KA 4XQ4A 3VBFB 1NCRA 2VD7A 5FWEA 3VBRA 1A8MA 3DXUA 1U5YA 3OYWA 4CUGA 3Q8EA 5C33A 4MGYE 3OBRA 2K2SA 2RR12 1UU6A 1DDLA 1UOFA 2VECA 4CXXA 1JUIA 3WD5A 3ZYPA 4H55A 2C24A 4EN0A 1S0GA 3MEPA 3GNEA 1J3PA 5FP9A 5HI0A 3B3QE 2ZX3A 1HV0A 4BK5A 1MS5A 1AR81 3AP6A 1HX6A 3MF9A 5FCCA 1JN2P 4DRVA 4QPIC 1LRHA 3ZXLA 2KR2A 5F39A 1V9U2 2G1MA 3OBAA 4MVTA 1U5XA 2UYAA 2NM1A 3T09A 4P9IA 2BV4A 3T2QA 4NHLA 2P3JA 4QHBA 2A71A 1XPWA 3UKTA 3QBQA 5F32A 1PO23 3VBHC 4O9GA 5A6QA 5CNAA 3T4VA 3GZUC 2AUYA 1CD3G 1WCSA 1W8HA 2E33A 1WGPA 2VMHA 1WMXA 1SDWA 2W1SA 3M2MA 2YPJA 4FO9A 2YUEA 4A3XA 1PO11 5H9QA 5JSOA 3RS6A 3ZYJB 2JDAA 3IKWA 4QU1A 4F7ZA 3H7JA 5F1RA 1R083 3EO6A 4XBQA 4EZHA 1PVC1 4XIOA 1AR92 3I54A 5F37A 3CO2A 3FUQA 3GM8A 1UY2A 4XJWA 1J83A 1VAKA 5ABJC 1PX3A 1EV11 1RMU2 3BPZA 3E5UA 4PLOA 1D2QA 5IVYA 4EN6B 4N53A 2BGOA 3PJYA 5FP4A 1WW5A 3L9JT 1OVSA 4G3YC 5FZ0A 5C5TA 3AP5A 3KM5A 1C3HA 2BQPA 2GH2A 3V0AB 1E5SA 5C3PA 1UW8A 3URFA 1YO8A 2YGMA 3N9QA 4FPFA 1T2XA 2ZEWA 1ASJ1 1ZNPA 3MPBA 4JX0A 1OHFA 3CL1A 5JOYA 1N3OA 2MHFA 2VM9A 2W1WA 4IQPA 3FL7A 1CZVA 3UT0A 4CZSA 2R49A 4Y22B 4YM3A 3JB4C 4Q0SA 4LUKA 4GALA 3U07A 2VUJA 1UNBA 3ZMOA 4B8EA 1LULA 3VBFA 1UAIA 4GKXA 4JV4A 1TME3 1KFUL 4PIYA 3UJQA 4JCKA 4EZ4A 5AC93 3OJBA 2GC1A 3WF2A 3ZR5A 3BGAA 1F4AA 3ELNA 2EAKA 4N8MA 2AH2A 2WC2A 1RB8G 4FFFA 4BIFA 3EXUA 3OD0A 1V6JA 1F9KA 3W9AA 1LOEA 2YZ4A 3CEWA 3OG2A 4IEUA 3M7AA 4KG8A 4RFRB 5FO7B 4EWEA 3JCIA 3ZYHA 4QX7A 2VE1A 1FOD1 1BVVA 3ZN4A 4RN5A 1BMV1 2D6MA 3GBGA 4QQ2A 3BU0A 1C8M2 2O8OA 2WWSA 3A4UA 4QDSA 5HV4A 2QQPA 4GWMA 1A34A 1W9YA 2VNVA 3T08A 1PGL1 1KDKA 4Z92B 1BQPA 4V1PA 1RUE1 5ANQA 4CCNA 5K7PA 2R1BA 4HMZA 4W50A 3AZWA 3P3NA 1YFUA 3RZHA 3ZFFB 2AREA 1BKZA 4WBBA 1H1AA 1PNGA 3NV4A 4HETA 2WN2A 3FHIB 5F5IA 1ZRRA 5FZ1A 1SFNA 1S1AA 1PMIA 1LU2A 2MEV1 5C8WA 5HCAA 1B09A 1KGYA 1Q8SA 1QJU3 3AVSA 5JOZA 2DURA 5DDJ3 5JXGA 1NZIA 5FFOC 4FXKB 2RVAA 2WS93 3V0AA 1OT5A 1ZZ6A 1JHNA 1FAYA 2X5IB 4OHVA 4ZHNA 3WG1A 1WCQA 4UYBA 1JBCA 2BERA 1US2A 3AYAA 3PHMA 2ZOEB 4LO8A 2E7QA 3OUIA 2GMEA 4B7EA 2PAEA 2GN7A 4ATFA 3I3EA 4N90A 3ZM8A 4BCUA 3ZPOA 3CMGA 2XDVA 4Q0VA 1NA1C 1DQ0A 4NPMA 4CU8A 2CDOA 4AE2A 4Y5TA 4Y22A 2PHDA 3PTYA 1JOJA 1MEC1 2OZ6A 2VZ3A 5JZGC 4OQ8A 5CU1A 2H6CA 1XSRA 4XF1A 1POV1 2ARXA 2NMNA 3SCHA 5CBLA 1V6MA 4NIAA 2YFZA 3TWIA 1DP0A 2VVEA 3PVEA 2JB4A 3LPGA 4GWIA 2PHUA 3UGFA 1GQHA 5FOBB 5F3CA 4M00A 1H2MA 1IZ3A 4CXYA 4XBNA 3S7EA 5BPXA 4LBNA 4FT8A 1VBD1 1RUD3 1TVGA 3ALQA 1VBE1 5FLIA 3RZZA 2ZMKA 3J4UH 5FZDA 1W8OA 4Z1VA 5JI9A 3U37A 5HCFA 1R1A2 5SV8A 1DGWA 3CJIB 1S0EA 3AP9A 5FREA 1CESA 5LA2A 4XCAA 1ND3C 3HJRA 5FYVA 4AFBA 4QM9A 1OLQA 4IEOA 3R0RA 3RQ0A 5BNNC 5FZOB 2ZZQA 1ZBE3 4I30A 3U14A 2GC3A 1Q8PA 1WW7A 2I07B 3HR9A 1FMD2 3L2HA 4P9LA 3B7MA 3PUSA 4QPYA 4DZGA 2VXRA 3QD6A 4E4ZA 1PM4A 2E53A 4JGYC 4AHYA 1VLNA 2PLV2 3ZFFA 1D4M2 2CWSA 3N9OA 4CPBD 4KMQA 1LOFC 5LK7B 2AEZA 2BBAA 4BQ1A 3AXDA 3HAGA 1QJZA 4QWNA 1EAH1 2Z4FA 3O14A 4K40A 1FXZA 4XZUG 2XGXA 1VMJA 1BCXA 1GANA 3I2JA 3QH7A 4EJRA 3CF6E 2HWB1 4MGQA 2TEPA 4ZS2A 3FFQA 1AJOA 2ZGOA 3THCA 4B1MA 5DN2A 4QGNA 3HIFA 1S0IA 2X5IA 4XQWA 3TNPB 4QB1A 2PXJA 4CCLA 4SBVA 1TMF1 1AYN3 3FLTA 3NWKA 5CIRA 1FI2A 2HWF2 1V70A 3I2GA 2YBSA 4NRQA 1CZSA 4KGQA 3ST7A 3NL1A 5KHGA 3JBG1 1O8SA 2CNAA 1QH6A 3NKTA 3H7YA 1RUC1 3TYJA 5C70A 1H2NA 1UYYA 3VZMA 1SACA 4RD7A 3S6PA 3TB0A 4AI1A 3WF1A 4AAXA 2VMIA 5AFBA 5J36A 2ZAHA 1QU0A 3HT1A 2WO1A 2AC1A 1GZTA 3IBMA 4HG6B 2EIDA 4Q8LA 1HRV3 4XEZA 4A45A 5JAXA 4MGZE 2CV6A 2D6LX 2IXKA 3W5NA 2W91A 4JGZC 4GB32 4P9XA 1VRH3 5E8AA 5LBBA 1HIXA 1W8UA 2O14A 1TZOA 1VMHA 1SHWB 5IK8A 2HWD3 4D7TA 4RA0A 3ACHA 1DQ1A 1E5IA 2DTYA 1PO22 4CE8A 1M06G 1XE0A 4XFFA 3ZFGC 2YHJA 3THDA 3CJIA 4ES9A 4GXLA 4BZ4A 4KWUA 3GCXA 5EJZB 1JYXA 3JD72 4FFIA 5FXXA 1YCIA 3WZ1A 4FOWA 4CDQC 5CEHA 3LSDA 5FYMA 5FZOA 4IESA 2Q5TA 4PHZA 1MQTC 1S55A 3APBA 1DQ5A 2OPKA 2RS53 1GLHA 1NQJA 5FY1A 5L36A 2D3RA 5BXXA 4CEWC 4MHUA 4GWJA 2ZGPA 5JOXA 4MGIE 3WNPA 2CU5A 4CSWA 1F31A 4OYUA 4PDWB 2R043 1UY3A 3FE5A 3OBZA 3IDAA 4Y24A 5FJKA 5G04L 1MZ5A 1XNAA 1COV1 5KHKA 1OA3A 2VW1A 4KL1A 3H8XA 4ZY9A 2PHWA 5IVFA 5FMCA 5FRAA 1IKPA 3ES4A 2PELA 1ULEA 1LU1A 3GYDA 1RUJ3 4Q4W3 5FR3A 3BTXA 2JB8A 3RNSA 2FZ2A 1RXGA 5FUNA 2ES3A 4MXWB 4K1ZA 2Y6GA 2QE3A 4YVSB 5DUXA 1MVEA 1AL0G 3TEXA 5FY7A 1LB2A 2W46A 1C4RA 3OGGA 1IQAA 2B42B 5CA6A 2XONA 1LGBA 2ZCWA 3O0WA 2IZWA 4CU7A 4IE6A 2WNVC 2WSUA 4Q4Y1 3NV2A 3Q8FA 3KHBA 2G9GA 2RDNA 1BBT2 3J7HA 1DG6A 4XCBA 3ACFA 3PIJA 4D6QA 2VJXA 1HXS3 4GJYA 5F7UA 1GBGA 2RS31 1WKYA 2AEYA 5CVRA 5EYXA 4QM8A 4BLIA 2R0HA 5FYZA 3NRUA 4XABA 3MLKA 1JOBA 4K8RB 1OXCA 4CDXB 3QACA 5JI7A 5T5JA 1O3QA 5GALA 1W2TA 1YJLA 4FP2A 4E2QA 3AP4A 1W0OA 4YZ2A 1V00A 2ENRA 2WKKA 2ADDA 3GJBA 2OVUA 3KV5A 1UQXA 4KG0A 5T54A 2VTXJ 1AF9A 2RHPA 3WW2A 1AR63 2BGPA 2A1XA 5IW0A 2HWE1 4R9AA 4RQPC 1QJY3 1ZA4A 2PQQA 2BW8A 2FZ1A 4LBKA 3LD8A 1RUI2 2B8MA 2J1SA 2AYHA 4OHYA 4U2AA 3C7FA 2HBTA 4LO4B 5L9RA 5IFPA 3B02A 2VCBA 5F5QA 1I5ZA 4NJ4A 2QTWB 2H6BA 2XKPA 3M3EA 4GMP3 1ALYA 5FZAA 4X6QB 4PDWA 3WXPA 1RYYA 3S5AA 5DDJ2 4X8NA 2FCUA 1O3TA 1O8PA 1KITA 2D44A 4XQDA 5FBZA 4CU9A 2UYBA 5FWJA 2UWBA 3CLPA 3ME2A 3UGGA 2ZKNA 2VTFA 2DU1A 3RMYA 2ZGMA 3ACLA 3ZKYA 1CWPA 3ZMNA 3A7QA 1QXJA 3BU7A 3UJOA 3VHOA 1HN0A 2RJ2A 4QPIB 5EPAA 5IAXA 4MXWA 4NOTA 5JR7B 4YVSA 2G19A 3PLQA 5D21A 1KRIA 3MLLA 3VL8A 1W03A 3WQ1A 3HNBM 2VGDA 4BMEA 4P9JA 5FY8A 1AL21 3VBHB 3I3BA 3BTZA 5BNQA 5A1LA 4CRQA 5GKAC 1ULOA 1YYNA 1XBFA 5J7MA 4Q4X1 5F5AA 1XNBA 2RMU3 2XKOA 1PM7A 2P4EA 3GGLA 3PVOA 4XFCA 5JXIA 3MICA 4AFAA 1BJQA 4MH0E 1LEDA 3A22A 2TBVA 3VBSC 2ZEZA 1ULDA 2WNUC 5T3NA 5CG9A 3T3YA 1QOSA 2ORXA 2ZX2A 1XNTA 3KD4A 1UOGA 2ZHNA 4CDXA 4XUOA 5ABJB 2R30A 1JZ2A 4JKMA 3CZJA 4DUWA 4OMDA 2CY6A 1N47A 5ISLA 3OGVA 4OLLA 2WLPA 4DB5A 2RR13 2J1EA 5K8SA 2HKXA 1RHI1 2WRAA 3OOXA 4AGGA 1YHFA 2R061 1ZBE2 5JPMB 5TSWA 4WVMB 5FK8A 4K20A 1Y7BA 3ROUA 4BDVB 3KV9A 3MI8A 1BZWA 5FYCA 4S2HA 1JMUB 4GH4C 1LHVA 4Q5OA 2WYSA 2VNOA 3U4XA 1V9U3 5J1XA 2IXCA 3WNXA 3VDDC 4FOYA 4HN0A 1CN1A 1AR72 4W8JA 4UFKA 1IGOA 2WLQA 5FZKA 5H9PA 4D3WA 2WAOA 1W6PB 2XJRA 4WV8A 4FSJA 1KS5A 4FXGB 1BEV2 2VZPA 5FYUA 3KB5A 4HVQA 4M0HA 5LWBA 3LIGA 1J1TA 3GBFA 3T1LA 5CFDC 4NHXA 1GFF2 3N7LA 3OPWA 1VAMA 1QJX1 3GZEA 3K4AA 1AR93 3SEPA 4BQ3A 5AFEA 4YZ5A 4ZPIA 4DUVA 1H1MA 4H14A 1DYPA 2XB6C 3HNMA 4QPIA 1C5HA 1L7RA 2W47A 1GNZA 3ZFEC 4A6SA 2DBIA 4MZUA 5GLTA 2BWCA 4BISA 2VUDA 5F6LB 1N1VA 1AYM2 3K48A 2F6BA 1G9AA 1LHOA 5BYNA 1XNKA 3NAPC 3NJXA 3VBHA 1NY72 1REFA 4OI4A 1W2NA 5LATA 2FD8A 2GC0A 3POIA 4QHOA 1HRV2 3WQ0A 3IAQA 1KJRA 4Q1RA 2AZ5A 1MS9A 2Y6KA 4OUEA 4CP2A 4TN7A 1LAJA 4CP0A 3QLQA 5BNOC 3ZSEA 2WT2A 1GU3A 3HQXA 2MPFA 2WZR2 3BOWA 3LPFA 4Y26A 1QGLA 3R6SA 4LNVA 4XE9A 2HWD2 1GQPA 2TNFA 2ZGSA 5EYYA 5DXDA 4LORA 2EA7A 4A6OA 5ABJA 1UD1A 3TEWA 1SLBA 1JXNA 4XTPA 3T0DA 1WBLA 1NOVA 1OURA 1ZVFA 1JHJA 1MS8A 4LKEA 4ZONA 3WCSA 5A6YA 2BNNA 1I6XA 3M8LA 3LA2A 2OT7A 5KXCA 4X6RB 1VBA1 2DVAA 4RL7A 4WVMA 4LA2A 2RS52 4GJZA 1W9FA 2FMYA 1H0BA 2OPWA 4BB3A 5HXMA 5FPUA 4U36A 1NA1B 3WT3A 2B46X 2VZSA 2WIIB 3WG3A 1W05A 2VPVA 4BE3A 5FYTA 5EIYB 3WLUA 1YI9A 3MIDA 5JZGB 2CWMA 1C8M3 2JX9A 2B5HA 1H6YA 1HKDA 1S0JA 1W6PA 2VZRA 2C5DA 2Y33A 2PYTA 4HPKB 4HSLA 4XF4A 4XXAA 2X29A 5KC5A 2AGSA 2ARBA 4BPZA 1VBC2 2A6WA 4XURA 3K46A 4XHBA 1A3KA 1NG0A 1WLDA 1XE8A 2BOIA 1EY2A 4P00B 4XFAA 3U4SA 3U1XA 5CYYA 3ZXAC 2QQKA 2ILMA 3DKQA 4LPLA 3P5BA 4XF3A 1A78A 4A7YA 4MV2A 1S0CA 3BODA 1VPHA 1FATA 4Q27A 5FZ3A 1XSQA 5HCBA 4G4FA 1PNFA 2C6SA 1PGW1 4NAOA 5FBJA 1R091 1F15A 3EMRA 4O65A 3BVCA 2XUEA 4HL0A 1IKQA 2ATFA 4Q4V1 1UOBA 1FPN2 3WDTA 3NVCA 5JSRA 4CUCA 2WFPA 3H0OA 4HLTA 1ND3B 1YWKA 5BNNB 2GMMA 1HXS2 3NJVA 2BYVE 2LW8A 4N9IA 1MZ6A 3THTA 1OLMA 1ULGA 2VZVA 3ZLIA 3VKNA 1GOGA 3AX4A 3ZYRA 3CU7A 2PHRA 3VDAA 4JGYB 3O1RA 1DFQA 3K3OA 5GZDA 2N7GA 1LODA 1O59A 4IE5A 2JG9C 2C4XA 3MDPA 4AVAA 1YUDA 1CPNA 4YW3A 3MF6A 2Y6LA 3EHKA 2YC0A 3AMQA 4QQOA 4S2DA 3IPVB 1AR62 2YG0A 1JZ7A 3O1OA 5A3MA 2D6OX 1JZ5A 4XUNA 3LEKA 4NRMA 2D43A 3NNLA 1YFXA 2ZGQA 1EYBA 4ISQA 1QEXA 3H3UA 4UW4A 3S7IA 1SQ4A 1NZCA 4YVWC 5F8PA 4BOWA 4DY3A 4QX0A 2WN3A 2YDEA 2Y38A 2GALA 2J1VA 4Q0QA 1Y9MA 4M01A 3BPSA 1DQ2A 1R1A3 3M3OA 3POJA 1AVBA 1GP5A 1NA1A 1K42A 2RM21 1YQCA 5KWRA 1FYUA 1QNYA 2VR4A 2DFBA 3KT4A 3W5MA 1QDCA 2DFCA 3AFGA 3KF3A 2WT0A 3Q8BA 2WFF2 4M3CB 1RVF1 1ACCA 5JZGA 1UMIA 1W39A 2WA3A 3AKRA 5A3WA 3VBOC 3PU8A 1P8JA 3HT2A 4HPKA 4AZZA 4CUBA 3O7OA 2OS2A 2VZTA 5EZWA 1FMD3 3DGTA 1SBFA 4HKWA 5LBCA 2BPA2 4YARA 1GKBA 1DZTA 3MIEA 4JGZB 4B4QA 5LBEA 3RWNA 1YQ6A 2PLV3 5A70A 4L11A 4BWOA 2RDSA 4D8MA 5FLHA 2Y6FA 3I2KA 5L73A 3KT1A 4URAA 3T4HB 3ZFGB 4JKLA 4GMP0 2YPDA 1W28A 4KU7A 2QQVA 1M4WA 3G7DA 4ARYA 4AQTA 4CDQB 1ND3A 3WINE 2GN3A 2CAUA 5IVVA 3LF7A 5BNNA 5EWSA 2Z5WA 1AR83 5FPBA 1MQTB 1UF2C 4CPBA 1ZREA 5C3OA 2HWF3 2WQ8A 3AKTA 3IZOA 1AJKA 4OZXA 4CEWB 5FLJA 1W8FA 4IDZA 4XDOA 1DIWA 4Y20B 1XYPA 4JGYA 4XF9A 3E6BA 1OLME 3LDKA 1UXXX 5CISA 5C9AC 1LOFA 2BDRA 4AQ2A 1X8EA 1XJAA 4I2OA 1SLAA 1YLLA 4XJ9A 1UY1A 4MADA 3IPVA 2JICA 1ODMA 1XOYA 1CJDA 4Y1YA 3O12A 3AL6A 1KXGA 4IEYA 1QHDA 5CKMA 2TUNA 2DDUA 3BALA 4Q0PA 5I0DA 1JYTA 1OF3A 4GB33 4FAHA 1LOCA 4XFHA 5A3TA 1VBB1 1UPSA 3B00A 3ZIWA 1Y4WA 2JDKA 1UXZA 3RYKA 1FT9A 4HK9A 1REEA 2ZHKA 3I2FA 3POEA 4N7IA 5EJ1B 1VALA 2F4LA 3FLPA 4ASLA 2HWC1 1GICA 5EV7A 1UN1A 4W6XA 1SCRA 1HQNA 4OFGA 3O5SA 1OMIA 3JD73 2FQPA 2L9LA 2WNVB 4M3CA 4TLFA 3ZYIB 2PAMA 2JDMA 1FX5A 1Z7S1 3OCPA 1FV3A 3W58A 5LA1A 4LXLA 1YC61 1IPJA 1DYOA 1H4HA 1XNCA 5KHIA 4LBQD 1VAVA 3WP6A 1CAWB 4PI2A 4RGKA 3POFA 4IUGA 4FTSA 4AI9A 3WX5A 4JGZA 3AC0A 3LCPA 4IEXA 1GR3A 2WWJA 3V64A 4YRDA 3SKJE 1W8WA 1OUSA 4LITA 4IERA 1C57A 3OGJA 3SQOA 1W99A 5JWPA 3I49A 4ES8A 3MFAA 3OY8B 2WQZC 3ZFGA 4EE2A 2EALA 1L3JA 1YIFA 3H1WA 1GP6A 4RQPB 1H8TC 4LE4A 5CB7A 5B4XA 1UZYA 4CDQA 2QZ3A 1RUH2 2ARAA 2W94A 5DZFA 2Q30A 4I0AA 5FO9B 2FDKA 1VIWB 1MQTA 3C7HA 1AX0A 1SBDA 3LA7A 5AVAA 3VDBA 4Y1XA 1A6CA 3DV8A 4CYDA 4CEWA 2D6NA 4Y20A 1X50A 1K12A 4K21A 1PIV2 4BQ5A 4BQ2A 1X8MA 5LBFA 4E4SA 4FQ4A 1E5RA 2WZ8A 1DCSA 1D2SA 1GZWB 4LO7A 1JYCA 1R081 4RHV2 1BBT3 2OUJA 1Y9QA 2V5YA 5L9BA 2ZKLA 5A6XA 4PJYA 1DGRN 4AFMA 2RJKA 1ONAA 2VCMA 4EQVA 1RUE3 4Z8BA 3OUHA 3RZKA 1GWLA 4ZU4A 3POGA 2JDZA 2EVXA 3X29B 1OVPA 2JWPA 2VUCA 3KQRA 3DECA 4G9SB 4I3PA 1JS9A 2XJQA 5A3UA 4I09A 1C1LA 4HFSA 1RC6A 4CCOA 3VD4A 3JU9A 5J98B 2OIIA 4CCKA 1CVNA 1LESA 3ZSMA 1Y9GA 3MUY1 2VVDA 4QDQA 5EJ3A 1UWWA 2SLIA 3JUUA 3F95A 3ZXGA 1APNA 1ST8A 3N7KA 4E2SA 1HRI2 5FY9A 4OQ9A 1RIRA 4OULA 5IJRA 4MO3M 3SH5A 3VDCA 2WNVA 1RUF2 4IXLA 2VZUA 2DUOA 1JZ8A 1YJKA 4IETA 1J1LA 1GNHA 1RUI3 5LY1A 2W1QA 1MS0A 5JIUA 5A1FA 1ZBA2 2DU0A 4M3CE 3VBSB 2A5ZA 3J9SA 5IVBA 2RS11 4ZU7A 2WNUB 2YV8A 1AX2A 1CAWA 1TME1 2CGOA 3CIHA 3J8F2 5EQUA 3PUHA 4JDMA 1S0BA 2E31A 4RS5C 2F4PA 3TN92 5FIXA 4LOSA 5FP8A 5AC91 2DCJA 3E5XA 2W9XA 3IDBB 3B9IA 2PN5A 5FZMA 3MV11 2OQ7A 2E6VA 1JU4A 5FYSA 3WUCA 1LGCA 5H9SA 2G4IA 3SC7X 2XJPA 4LLOA 2BTVC 2VMGA 1POV3 2ZJCA 4AI3A 1CAXB 3MUZ1 3VZLA 3CZUA 3OY8A 3BB6A 2ETEA 3AYEA 4LO5B 3KCXA 2JE9A 3RYRA 1ZRDA 1V6IA 4P5HA 4RQPA 2B45X 2XJUA 3VKFC 1ZRFA 1XYNA 4H7MA 1QQP2 4JQRA 1HQWA 4L99A 1VBD3 1E5HA 1XU2A 2ZX4A 1JUHA 1N1YA 3GCWA 2XWBB 4GH4B 4ATEA 3DYPA 2G9ZA 1ZRCA 3VDDB 2KXLA 3M3CA 4JVAA 3PL0A 1QF3A 3WY6A 2W68A 5FMOS 1ULCA 3WEZA 3KSCA 4QX5A 4CTEA 2VOVA 3AP7A 4KWJA 2A70A 4UBHA 2ZMNA 2R072 4AFDA 1GZWA 5CFDB 4LLFA 3ZYGA 4LKDA 2GU9A 3NV1A 5A7SA 4ISRA 2GNTA 2RDRA 2Y6JA 4DY5A 4R52A 1RUG1 4LHNA 1YRZA 2XLFA 1Z0HA 2XJVA 3NV3A 1HJGA 3WW3A 3WHUA 1QJU1 1O4TA 1O4YA 2OW4A 1VP6A 1OFNA 2IVIB 2I2SA 3VL9A 1LNSA 3N3HA 1S0FA 3AB0A 3KV6A 2WS91 3WNOA 4JTOA 5ACA1 5LZ6A 3R4DB 2X09A 4IE7A 4LBLA 2VCAA 3H1MA 4P9YA 4R9CA 2ORZA 2VOWA 3NAPB 5A7OA 4AAPA 1GWMA 2LALA 4XJUA 5A7WB 5A6ZA 4LHKA 1U5IA 2HEYF 4URTA 4ARXA 2JEMA 1CONA 1HV1A 1ND2C 3MGUA 5LRSA 2D6KA 1MVQA 4O7XA 2VZOA 4AGVA 4UBGA 1OBNA 5BNOB 2CGNA 1UU4A 3ZSLA 1T6GC 2XL7A 3GHMA 3VBSA 1PMHX 3W21A 2IFRA 5GLWA 2NZ9A 2EXHA 2WNUA 5CFCC 1WMFA 1AR73 1OPOA 3JBG3 2HBUA 2J1UA 3OBTA 3OB8A 2XBO1 4YGBA 4P5YA 5A7PA 3VN4A 4NPLA 3H8OA 4MOAA 5DAXA 2QQIA 2Q1FA 2RDQA 2DUPA 1REDA 1AXKA 1BEV3 1W0NA 1XNDA 5EHDA 3SMHA 2PA7A 4XETA 3H8RA 2DCTA 4FPYA 4NUBA 4PBOA 3VV1A 3K75B 1JYIA 5A1AA 5HPOA 1CAXA 4Y5SA 5IVJA 1AR82 1PHMA 4A4AA 3D82A 5FZ6A 2DVGA 1RJ7A 2E9QA 4QPGC 1L7QA 3RPQA 2K46A 4J6GA 4KBZA 2GMPA 4R4XA 4GH4A 5LW9A 3MW3A 3DXTA 2WO7A 2O8QA 4LHLA 3Q8AA 2CGPA 1AYM3 3VDDA 4XDQA 4KWKA 3EB7A 1WZXA 1LECA 3PUIA 5GZEA 1NE4A 4HT1T 1STMA 5GJ6A 5B4NA 4NR1A 1W04A 4LHSA 1HB3A 3LA3A 1PO12 1W6OB 4QB2A 4EYUA 4F8AA 3VD3A 3USUA 5CFDA 3IMMA 1PVC2 1PZ7A 3B01A 1CX4A 2WZR3 4Q26A 3W59A 4QXKA 5KXBA 2Z69A 1UZZA 4TXWA 4CDWC 5I0TA 3N9MA 1EV12 3MIFA 4W65A 3LEGA 3AMPA 1FV2A 2JE8A 2WO2A 3NJZA 5KHJA 3K4ZA 1S2BA 3HVDA 3DEMA 2XL9A 1R64A 4YFWA 5IWFA 3WVJA 4LKSA 2NMOA 3ZXEA 2H0BA 3AKPA 1AYN1 3NAPA 3POBA 4TZDA 2MNGA 3HBKA 3IMNA 1ASJ2 5A7WA 3SCGA 1YQ8A 4L0PA 3WSOA 3LIHA 3FMGA 5IT6A 2CL2A 1E57A 2P6HA 1K45A 2XVLA 3P1IA 4JHTA 4MYEA 5BNOA 3LKJA 5D8AC 5DABA 2WO3A 2WZEA 1ZX5A 3JQXA 4QX1A 2JG9B 2NN8A 1NLQA 1S2EA 4GZ9A 1IPKA 4UFHA 3ZSKA 2PMWB 5C3RA 1VB2A 3O1TA 3USSA 1W8ZA 4CCMA 1VRH1 3KGZA 4LT5A 1VBC3 2DBNA 1AHSA 2YBPA 5FQ0B 3VKMA 1TNRA 4IW3A 4FCAA 1OH3A 1CZTA 2JXAA 2VBPA 2ZTNA 3DF0A 3H8UA 5DPNA 3WR0A 4D7YA 2WQ4A 3VBFC 5JXHA 2WNEA 3LOBA 4YVWB 2Q8OA 5FAXA 2BFUL 5FJHA 1CAUB 3K3NA 3N9PA 1V6OA 2JDUA 4LUMA 1G9CA 4HSJA 2GAUA 4P14A 4PQQA 5HXVA 3WP5A 1LR5A 3JXSA 1FOD2 3WNKA 5SV5A 1Q5OA 1FPN3 1H2LA 3AMHA 1K3IA 1UIJA 2Z79A 2XXZA 4NAMA 2E26A 3H3ZA 1PGL2 2LTNA 1ULPA 2Y64A 5CZKA 2R1DA 1DLLA 3VBOB 1RUE2 4RGGA 3ZXFA 1UMZA 2ZZJA 1IHMA 1UL9A 2DUQA 1W6OA 4CU6A 2R041 3KCCA 1OOPC 1WWYA 1V6NA 4H2AA 4MGTA 3LFIA 2OZJA 4LK6A 1G7YA 3BN6A 1UYPA 4LQRA 1UU5A 4NE9A 1MS1A 3HMYA 5K0UC 3OF1A 3HD8B 1IQDC 2MEV2 3K77A 2VL4A 3HQRA 4XVHA 5KR7A 1RUJ1 4OHWA 4Q4W1 4FFHA 1JZ6A 2BWAA 3AYDA 2P1BA 3LAGA 3TEZA 3JQWA 4A7KA 1W6MB 2YY1A 3CQOA 2X53S 3ILRA 3ZVXA 1UX6A 3RMXA 2VMEA 4GULA 4JHZA 4RYDA 2SBAA 4PT6A 4HN1A 4AF9A 2IUWA 1SLTA 5FPVA 5T5OA 4QQPA 3OPZA 4YNIA 3OEBA 4DFSA 3C7EA 3MIHA 4NIHA 1OC1A 1MEC2 1Q8VA 2NLRA 5C9AB 2W92A 2JG9A 4HKOA 4LKFA 4CUAA 3S5QA 2WFF3 5A3NA 4L9BA 1NX9A 5CKQA 1QY4A 5I0SA 3GBWA 3VHRA 4D7SA 4I3GA 3VD7A 2ZS6B 1X36A 5FQ0A 5L9VA 2D3SA 2PHFA 3SCFA 3SHRA 2C9AA 4KWLA 1VBD2 1V0AA 1LEMA 2XQXA 1VBE2 2ZGTA 4E27A 1DZRA 4YVWA 2VU9A 4XOGA 1JH5A 2PHTA 3FZ3A 4HKLA 3WQBA 2QUOA 5I8TA 1CAUA 1JU3A 2P2KA 3DL3A 5FZEA 5JDBA 1ULFA 2Y0OA 3WDUA 1PX4A 5LB6A 1WA6X 1J3RA 4LR4A 1EUTA 3T1MA 1QJY1 1W9SA 4DXZA 4NPRA 4C0BA 2WABA 2ZGRA 2WJSA 4A42A 4FPHA 3VZKA 4QB6A 1ZM1A 2XUMA 4LBQB 5LY2A 4YZ3A 2R063 4IEPA 4LO6B 1GWKA 2A6XA 3F2ZA 3HN1A 4IEVA 1IOAA 2VMDA 4RSUA 1JODA 3VBOA 3VZJA 3FFZA 1KS4A 3KMHA 3M3IA 5IUQA 5IATA 5A7QA 1O6UA 1RL3A 1VE0A 1PK6C 4KI5M 5CADA 2QQOA 4IGPA 4L97A 1SDDB 4N43C 4B4PA 4DXRA 1DYKA 1NQDA 2XG3A 1F4HA 3B94A 1H2KA 3FN9A 1N1SA 5E16A 3U75A 3WF0A 1LCLA 3BI3A 3S30A 5BUVA 4IL7A 4L2NA 1EAH2 4QPWA 4UAPA 4FPLA 2WBKA 3OD4A 4DRRA 4YM1A 2WT1A 1F5FA 3O1UA 2HWB2 3DPRC 4GA9A 3WCRA 2ET1A 1JYNA 4UWDA 2PHLA 5DZEA 2P34A 3ZFFC 2FDJA 3S57A 1H8TB 1TQ5A 2ZA9A 4UW5A 1W6MA 3BYWA 4EN8B 3BUCA 1TMF2 4UFMA 5LK5A 5LEKA 3GZTB 2OQ6A 3JBG2 3RWKX 1NYWA 2Y26A 1L7LA 2GH8A 4WM8C 3HOBA 5DQ0A 1YFYA 2A73B 2Z2SB 4K7JA 1RUC2 5IFTA 2RMU1 5C9AA 1N1TA 3HPNA 4KH9A 3NNFA 1BHGA 1XU1A 3FBYA 3ZDVA 2D5HA 2Q1ZB 2KD7A 3D0JA 4DINB 4NRPA 1GSLA 3ILFA 3I3DA 5DAQA 2RR11 4M4PA 4FOQA 2Q8EA 4AW7A 1POQA 1LGNA 4AEMA 1SEFA 3EYPA 1SZBA 5JXJA 1EPWA 2HEWF 1KEXA 2V72A 4K3UA 4XMAA 2Q8DA 2A3WA 1GP4A 3M4FA 1GZCA 2VNGA 5B2GB 5DAWA 1LTEA 3VBUC 1T6BX 1UOJA 2D40A 4LBQA 4QDRA 3ON7A 4D69A 5IVEA 4A44A 1UCXA 1V9U1 2D6PA 3D3AA 3OGRA 1RUH3 2QQJA 4L92A 2QZ2A 3OSDA 2BOJA 5FKBA 1D0GA 4XTMA 3AVRA 4NMIA 3AK0A 4QGLA 4CDUC 3PUQA 4M3CF 4Y5Z0 4OI1A 3FBMA 2LROA 4RS5B 4LBMA 1PIV3 2XLAA 4D94A 4FTBA 1WW6A 1COV2 1OQ1A 2WDBA 2WINB 4RHV3 5F6KA 1CJPA 1AR91 2ZGUA 1GUIA 4LTAA 4WM7C 4DNYA 4DXTA 5M0TA 4NO4A 1US3A 5FPAA 1H9WA 2JDYA 4CP9B 1RMU1 3EBRA 1H8TA 1X33A 2VZ1A 3R4UA 1MACA 1YXWA 4H7LA 1IS6A 2B39A 2J1AA 1NLRA 3VUOA 2HLEA 2Q4SA 1J3QA 1R1ZA 1LHWA 4META 2CYFA 1R093 5KBFA 1W3VA 3MHZA 1WD3A 3E1F1 3I7DA 2RJLA 4YGCA 1YEWA 3N9LA 5GLZA 5T5LA 1DLCA 1QMJA 1WLWA 2GZWA 1HRI3 2V73A 4Q4Y2 4W6YA 2PTMA 4F3JA 5DMYA 2RV9A 2IXHA 4AQSA 1RUF3 4XYXA 3ECQA 3D8CA 4W4ZA 2YXSA 1BVP1 1QNWA 2Q0AA 3KGLA 2RS32 2JD9A 4CP1A 1ZBA3 1NAEA 1WA4A 2VCCA 4DIQA 3AMNA 3J8F3 5A3LA 3TN93 4GIQA 2GNMA 3ATGA 1XE7A 3ZYFA 1DGRA 4KGGA 3TOJA 2ZGLA 4IEZA 1YFWA 4YGEA 1ZA7A 1DQ4A 3U10A 3LOIA 3WW1A 4BMBA 1N3QA 1MPXA 3T0AA 3OEAA 5T5PA 2HWE2 3HWJA 5F3EA 4AQ6A 3UKVA 3AJZA 2PQSA 2P6CA 1D4VB 5A80A 1ND2B 4LA3A 2YBKA 1WLCA 1QQP3 1WCKA 3MW4A 1UO9A 1QOTA 3NO8A 5C8CC 2CAVA 1OQEA 4ZKTB 5A32B 2BRTA 3IN9A 4P9WA 1C8M1 2IXIA 1W0PA 3AKSA 5CFCB 2YMZA 4MGSA 5JSPA 2A6ZA 4RS5A 3H42B 1SMVA 2FCVA 4Z2AA 2EF6A 2QFEA 4XDPA 4B4RA 2R073 2EICA 4Y33A 1A8DA 2P5BA 3USUB 1AXYA 4BM8A 3BTYA 1V6KA 4CP9A 4LBOA 3VKOA 3GZAA 4QPGB 4ASMB 1G86A 2OUHA 3FHQA 1XC6A 5E89A 2W95A 3MW2A 3LEMA 5FZ8A 4XC9A 4BXFA 4QX3A 1AL22 1BXHA 2GNDA 2ET7A 1OI6A 3NNJA 5F2WA 4IV1C 2W39A 3ZN6B 3PIGA 4C1XA 4UW6A 3ZKUA 3ITQA 4FQZA 4AEDC 4NROA 4Q4X2 5DZGA 3RVHA 4N9HA 5FO8B 4DEVA 5K9YA 5FUIA 2QQNA 5GM0A 1O4ZA 5C71A 4Y1UA 4AYUA 3AKQA 1KJLA 4RGAA 5FZFA 2WYFA 4QMAA 4YW6A 4CDWB 2A7AA 2P37A 4AWDA 3U0ZA 4HANA 4DOUA 2D93A 4QXBA 2D97A 2HYKA 1WCUA 2OX0A 3HQUA 4V2WA 5DUUA 1RHI2 3AZZA 4WZFA 1ENRA 2R062 1QWRA 3RG0A 4O9EA 4XHXA 3VHPA 5BV6A 4TYSA 3ACIA 4FPGA 3UESA 1B35C 3KHCA 1BLZA 1Z78A 2WR9A 3P3PA 4YYOA 1R1A1 4ZXKA 4Y3OA 3FWEA 3WHTA 1WCDJ 1O3SA 1ND2A 4XZPA 1TG7A 4PI0A 4DO0A 2ZHLA 3KLSA 4WVZA 2XH6A 1O5UA 4C90A 2OXBA 5D8AB 2QCSB 3FUOA 1AZDA 4FPKA 4COZA 4YSFA 2W08A 2W3JA 5A32A 3K51A 5CFCA 3IDEA 2V4VA 4AOCA 1FMD1 3O1SA 3H1YA 4YZ4A 1ZYBA 5FZHA 3S0MA 5FZLA 4GD4A 5T55A 1PO13 4JZRA 3ZX7A 1SLLA 2EIBA 2FCTA 2PLV1 4XJAA 1HB2A 1D4M1 1QJX2 5A3PA 5JMOA 3N36A 1UZVA 1PVC3 2W0XA 2XOMA 3KWVA 3GJAA 4XFBA 5FY0A 5T50A 4FOVA 4R9BA 4BQWA 5DG2A 3HEIA 1UZWA 2HEVF 3PVNA 4M4RA 3ABZA 2VUAA 1GQGA 1EV13 4QPGA 5DUWA 4DQAA 3MLJA 2VVFA 3RFRA 4C91A 2DVFA 1SLCA 2WAAA 4IEWA 2XHNA 2ZGKA 5L7OC 1G9FA 1G9DA 5LEJA 4UFLA 2XVGA 4OUSA 4LJHA 3ZN6A 1XXNA 2HWF1 1ASJ3 3WDVA 3FLRA 1S0DA 1UYZA 3WF4A 1X9PA 4K9SA 1UMHA 2WWUA 2J1TA 1BK1A 1WLTA 3LE0A 2FDIA 1Q8QA 3AZXA 4OHXA 4XFGA 4J1XA 2R0FA 2Y6HA 1I5PA 1OOPB 2VH9A 5FMBA 4AVCA 3KVAA 4NN0A 3WQ7A 3WUDA 4BA6A 5H9RA 2OKXA 4CDWA 1FNZA 2IXLA 1K5MC 3AYCA 4IV3C 3RJRA 5K0UB 2CTVA 4B29A 3WDWA 3LEIA 3UKNA 3ZYBA 4EWDA 2UY9A 3WNNA 1YI7A 3WW4A 1JOPA 5FZ9A 4C1WA 2ZABA 2I74A 4GB31 4YW5A 4N7UA 4HK8A 1VBA2 2ZEXA 3ZN5A 3GF6A 1CAVB 2QKDA 1XYOA 2DCZA 5C7GA 1PO21 4D0QA 1XB9A 3EQEA 1O7FA 4QKFA 2VULA 5FXWA 4BU2A 3C8XA 3ZXJA 3K2OA 3MPPG 2PHXA 3JD71 1FOD3 3ZR6A 5D8AA 5J09A 4UFJA 4CCJA 5APAA 1J59A 4I0BA 2ZX1A 4YM0A 5DAVA 2J1RA 1VR3A 4V2VA 3T0BA 2ADEA 2W5FA 4P9GA 5FP3A 4AHXA 5IHRA 3BTAA 2V4AA 1GNYA 5IK7A 4HZFA 5C4WC 4A2UA 1SPPB 4HBNA 3ASIA 1BMV2 5FTTC 2K0GA 2QDNA 3Q9OA 4GQ7A 5F2SA 3D0SA 5C3QA 3KS7A 2RS13 1UZ0A 3LFMA 2CDPA 5FMOL 1XRUA 1H1IA 2O1QA 2JDNA 3H50A 5E1RA 1PGW2 3RI8A 3THPA 1R092 3ZIXA 1XQNA 1JYWA 1J84A 1W9TA 2JG8C 2MEV3 1TNFA 1RUOA 2VTXA 5FZGA 4Q4V2 1JYVA 2OA2A 1AXZA 2DTWA 2I45A 3VD5A 3HNYM 4R9DA 4HONA 5FKCA 5I91A 4XJ8A 2BNMA 2RG4A 2GP5A 4Q8KA 2AACA 2CSGA 3AM2A 1WMDA 2BUKA 4LEJA 3LQCA 4JDNA 3NQHA 1C8NA 1NCQC 1YNAA 4QXHA 3ZPYA 4E4DX 1PK6B 4QKDA 1UKGA 3WP4A 4BHPA 4N43B 3ILNA 1OOPA 1Q56A 2J22A 4CCCA 4OI0A 5C3SA 2JIJA 3AL5A 5GZGA 1BBT1 1MEC3 2JENA 4XFIA 3E6CC 4A7ZA 2E7AA
chains in the Genus database with same CATH topology
3N9OA 3PUAA 5A7SA 4AI9A 4DIQA 5E6HA 4CCMA 5A3PA 3PU3A 4EZ4A 4UF0A 5FYZA 5FY0A 3OPWA 2YBPA 2WWJA 4QWNA 4LITA 4QX8A 4LIUA 5F5CA 2GP3A 5FYHA 4C8DA 5IVCA 3KV6A 4IGOA 5FJHA 3KV5A 3K3NA 3N9PA 4D6QA 4BISA 4QXCA 5F3EA 5FP7A 4AAPA 2PXJA 5IW0A 5A7OA 4CCLA 4QX7A 5A7WB 5A80A 2OQ6A 2YBKA 2YBSA 3LD8A 2XXZA 3UYJA 5FZBA 5FV3A 2WWUA 4TN7A 5ANQA 5K4LA 5A3WA 3PDQA 3PU8A 4CCNA 3KVAA 2OS2A 4D6SA 5FZAA 5A7PA 2VD7A 5FWEA 4XDPA 3DXUA 4CUGA 4Y33A 3N9NA 3OPTA 4UF0B 4ASKA 5FWJA 2P5BA 5FYYA 5F5IA 5FZ1A 4NUBA 2Q8EA 5FZ9A 5KR7A 2XMLA 5FP9A 4HOOA 5IVJA 3AVSA 2Q8DA 5FZ6A 4CCOA 4URAA 2OT7A 4CCKA 2YPDA 5FZ8A 4GJZA 5FPLA 4BXFA 4BU2A 5FXWA 5F3IA 5F39A 3DXTA 5LW9A 3K2OA 5FXXA 5CEHA 5FXZA 5IVEA 5F2WA 5IVVA 5FY8A 5FY9A 5FPUA 3PURA 3KV4A 5FPBA 5FYMA 5FZOA 3ZPOA 1VRBA 5FPVA 5A1LA 2XDVA 5F32A 3RVHA 4CCJA 3AVRA 4XDOA 5FYTA 5F5AA 5FY1A 4D6RA 3PUQA 5LY1A 5FYIA 5A1FA 4V2VA 5IVBA 4EYUA 4Y4RA 5A3NA 5FP3A 3LDBA 5FZFA 5FXVA 4CSWA 4QU1A 5FJKA 5FP8A 5FY4A 3U4SA 4LIVA 4EZHA 5F37A 5F2SA 5FZMA 4QXBA 2OQ7A 3NJYA 3N9MA 5F3CA 3AL6A 5FYSA 2OX0A 5FY5A 4V2WA 5IVYA 5IVFA 5FPAA 5ISLA 5FZ3A 5A7NA 5FP4A 5FYBA 3PTRB 5A3TA 5FBJA 5FZ0A 5FZGA 5FZ4A 5FZDA 5FZEA 2XUEA 5IWFA 5FUNA 2YU1A 4E4HA 4HONA 5A7WA 4Y3OA 2GP5A 5FY7A 3KVBA 3KV9A 2W2IA 3N9QA 4IGQA 5FYCA 5LY2A 4DO0A 5F3GA 5FYVA 3U78A 3N9LA 5FZOB 4GAZA 4QXHA 3ZLIA 5FZ7A 2Q8CA 5FZIA 5FZCA 5A7QA 5FUPA 4LXLA 5FZKA 3PUSA 2YU2A 3K3OA 4IGPA 3AL5A 5FZHA 5FYUA 5FZLA 4GJYA 4GD4A 5LWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N9O A;  3PUA A;  5A7S A;  4AI9 A;  4DIQ A;  5E6H A;  4CCM A;  5A3P A;  3PU3 A;  4EZ4 A;  4UF0 A;  5FYZ A;  5FY0 A;  3OPW A;  2YBP A;  2WWJ A;  4QWN A;  4LIT A;  4QX8 A;  4LIU A;  5F5C A;  2GP3 A;  5FYH A;  4C8D A;  5IVC A;  3KV6 A;  4IGO A;  5FJH A;  3KV5 A;  3K3N A;  3N9P A;  4D6Q A;  4BIS A;  4QXC A;  5F3E A;  5FP7 A;  4AAP A;  2PXJ A;  5IW0 A;  5A7O A;  4CCL A;  4QX7 A;  5A7W B;  5A80 A;  2OQ6 A;  2YBK A;  2YBS A;  3LD8 A;  2XXZ A;  3UYJ A;  5FZB A;  5FV3 A;  2WWU A;  4TN7 A;  5ANQ A;  5K4L A;  5A3W A;  3PDQ A;  3PU8 A;  4CCN A;  3KVA A;  2OS2 A;  4D6S A;  5FZA A;  5A7P A;  2VD7 A;  5FWE A;  4XDP A;  3DXU A;  4CUG A;  4Y33 A;  3N9N A;  3OPT A;  4UF0 B;  4ASK A;  5FWJ A;  2P5B A;  5FYY A;  5F5I A;  5FZ1 A;  4NUB A;  2Q8E A;  5FZ9 A;  5KR7 A;  2XML A;  5FP9 A;  4HOO A;  5IVJ A;  3AVS A;  2Q8D A;  5FZ6 A;  4CCO A;  4URA A;  2OT7 A;  4CCK A;  2YPD A;  5FZ8 A;  4GJZ A;  5FPL A;  4BXF A;  4BU2 A;  5FXW A;  5F3I A;  5F39 A;  3DXT A;  5LW9 A;  3K2O A;  5FXX A;  5CEH A;  5FXZ A;  5IVE A;  5F2W A;  5IVV A;  5FY8 A;  5FY9 A;  5FPU A;  3PUR A;  3KV4 A;  5FPB A;  5FYM A;  5FZO A;  3ZPO A;  1VRB A;  5FPV A;  5A1L A;  2XDV A;  5F32 A;  3RVH A;  4CCJ A;  3AVR A;  4XDO A;  5FYT A;  5F5A A;  5FY1 A;  4D6R A;  3PUQ A;  5LY1 A;  5FYI A;  5A1F A;  4V2V A;  5IVB A;  4EYU A;  4Y4R A;  5A3N A;  5FP3 A;  3LDB A;  5FZF A;  5FXV A;  4CSW A;  4QU1 A;  5FJK A;  5FP8 A;  5FY4 A;  3U4S A;  4LIV A;  4EZH A;  5F37 A;  5F2S A;  5FZM A;  4QXB A;  2OQ7 A;  3NJY A;  3N9M A;  5F3C A;  3AL6 A;  5FYS A;  2OX0 A;  5FY5 A;  4V2W A;  5IVY A;  5IVF A;  5FPA A;  5ISL A;  5FZ3 A;  5A7N A;  5FP4 A;  5FYB A;  3PTR B;  5A3T A;  5FBJ A;  5FZ0 A;  5FZG A;  5FZ4 A;  5FZD A;  5FZE A;  2XUE A;  5IWF A;  5FUN A;  2YU1 A;  4E4H A;  4HON A;  5A7W A;  4Y3O A;  2GP5 A;  5FY7 A;  3KVB A;  3KV9 A;  2W2I A;  3N9Q A;  4IGQ A;  5FYC A;  5LY2 A;  4DO0 A;  5F3G A;  5FYV A;  3U78 A;  3N9L A;  5FZO B;  4GAZ A;  4QXH A;  3ZLI A;  5FZ7 A;  2Q8C A;  5FZI A;  5FZC A;  5A7Q A;  5FUP A;  4LXL A;  5FZK A;  3PUS A;  2YU2 A;  3K3O A;  4IGP A;  3AL5 A;  5FZH A;  5FYU A;  5FZL A;  4GJY A;  4GD4 A;  5LWB A; 
#chains in the Genus database with same CATH topology
 2C0Z A;  5K0U A;  4XAC A;  4DXS A;  4PBP A;  3CHX A;  4Y1V A;  1ZZ9 A;  3DPR B;  5IAV A;  4EV0 A;  3KF5 A;  2VY0 A;  1QH7 A;  4QX8 A;  1DZQ A;  3TNQ A;  4YLZ A;  5IVC A;  1YIP A;  1OKO A;  4PQ9 A;  5FMD A;  1VBE 3;  1CAV A;  3I2H A;  1RUG 3;  2EIE A;  4XIK A;  2XJT A;  4EN9 B;  1UPI A;  3QCW A;  2BEO A;  5JIA A;  5JPN B;  2VBD A;  4XBL A;  4WM8 B;  2RM2 2;  4LK7 A;  2ZPX A;  3SH4 A;  4QT6 A;  3I59 B;  1JW6 A;  4IEQ A;  5ACA 3;  4UW3 A;  3SXW A;  4CEY C;  2CHH A;  1RUI 1;  1RVF 2;  2X05 A;  2JDH A;  1ENS A;  2BZD A;  2EXK A;  2VQT A;  2DVB A;  1C5I A;  4JRA A;  4RR3 C;  1RJ8 A;  1IS3 A;  1WME A;  1LEN A;  1TE1 B;  2W87 A;  4MUV A;  5LA9 A;  1SPP A;  4DPN A;  2A3Y A;  3LGR A;  5J3U A;  2D7F A;  5DDJ 1;  1TEI A;  2VMF A;  4AVT A;  4I0W B;  5FYY A;  5I0R A;  4PF1 A;  1OSG A;  2WZP P;  1ZRI A;  2ID4 A;  3CKH A;  1NE6 A;  5KXE A;  1EAH 3;  4H3W A;  4MLO A;  4LE3 A;  1OPM A;  2XBO 3;  3ENR A;  5CKN A;  2HWB 3;  4B3N A;  1D0H A;  1HQL A;  1VJ2 A;  2Y8K A;  3OUJ A;  2VZQ A;  2NPI A;  4AVV A;  1CQ9 A;  3MYX A;  3VBU B;  4AFC A;  2Q1M A;  3HBZ A;  4IND A;  5FXZ A;  1FNY A;  4NIG A;  1TMF 3;  4PIZ A;  3PUR A;  1HN1 A;  4R4Z A;  3ORJ A;  3V0B B;  4CDU B;  2ZBJ A;  1PK6 A;  2WNO A;  3INA A;  4N43 A;  4S2F A;  5G05 L;  2VQA A;  1QXP A;  4MXV A;  1RUC 3;  3OTF A;  3H3L A;  4QGM A;  4Y4R A;  2BVB A;  4QQH A;  2VW2 A;  2Y34 A;  1ODN A;  4XAE A;  2B9V A;  1RUD 1;  2ZAC A;  1HB4 A;  5BNP C;  5JUV A;  4WM7 B;  1NCR C;  1S4C A;  2QQL A;  3DPR A;  2BU9 A;  3NJY A;  3VBR C;  4Z2W A;  4AK3 A;  2EXJ A;  1W2O A;  3PVB B;  2AEN A;  3ACG A;  4K6B A;  1W3X A;  3WDX A;  4BQY A;  2J7M A;  1VBB 2;  4YG3 A;  4IE0 A;  5FYB A;  4YW1 A;  5CAZ A;  2DV9 A;  4SLI A;  3M70 A;  2ZML A;  1ZBE 1;  4QKN A;  4WVV A;  3WDY A;  5HCH A;  2HWC 2;  4AI0 A;  1DQ6 A;  4WM8 A;  2X8K A;  3III A;  3I59 A;  4L8Q A;  5F3G A;  5FK7 A;  4F83 A;  4ZZ8 A;  5LA0 A;  4QHZ A;  2QQW A;  3LWC A;  1Z7S 2;  3LZZ A;  3SKV A;  3C7G A;  3NST A;  2Y0I A;  3SNM A;  1O5L A;  3D5O A;  1G6N A;  2UU8 A;  1AR7 1;  3GXU A;  4QX2 A;  2NP0 A;  2XWJ B;  3NKG A;  5HV0 A;  1BEV 1;  3JZV A;  2WL1 A;  1WW4 A;  5JLV A;  2V5D A;  2HH9 A;  3IM0 A;  1COV 3;  1BK0 A;  1OD3 A;  4BYY A;  3SIT A;  5F5C A;  4WZC A;  4BLJ A;  2LUW A;  3O1V A;  4AVS A;  4TSV A;  1AUY A;  2RE9 A;  3M1H A;  2B7Y A;  2GNB A;  3NW4 A;  4N53 C;  2A6Y A;  4NII A;  5D1I A;  4BK4 A;  1HB1 A;  3VD9 A;  3VBU A;  1NT0 A;  3RYP A;  3AZV A;  4ZU5 A;  4ORF A;  1AYM 1;  2JIG A;  5C8C B;  3RI9 A;  2XPJ A;  3POW A;  4QKB A;  4XAA A;  3V0B A;  2JEC A;  1C28 A;  1W9W A;  2E32 A;  2ERF A;  1GOF A;  1NY7 1;  2LRP A;  3MIB A;  5FV3 A;  5GLU A;  2IC1 A;  4CDU A;  1PGS A;  4Y1Z A;  4B7K A;  1HRV 1;  1I9R A;  4OUM A;  1DBN A;  4TLG A;  4Z07 A;  5F9T A;  5GZF A;  1LHU A;  3ZO0 B;  4BQ4 A;  3VHN A;  4Q4Y 3;  3N7J A;  1R08 2;  5EP9 A;  4FVV A;  5DG1 A;  4COV A;  2WZR 1;  1LJ7 A;  1NUK A;  2P3I A;  1KQR A;  4FI9 A;  1F5J A;  2VNR A;  4ERO A;  2HWD 1;  1CPM A;  2O0O A;  2UUR A;  2ZX0 A;  4WM7 A;  3OPT A;  2RS3 3;  5A3O A;  4ASK A;  4M0N A;  3ZOI A;  4FAG A;  4P02 B;  1LOG A;  2XML A;  4ZXE A;  4HOO A;  3I3Q A;  4QU2 A;  1RIN A;  3Q8C A;  5KHH A;  1UYX A;  2C1F A;  2K9Z A;  1DGL A;  2R6Q A;  5FDB A;  3N35 A;  3R05 A;  5FPL A;  1YQ2 A;  2RS5 1;  4IV1 B;  3IT8 A;  5JR2 A;  3I4I A;  2DF7 A;  3J7L A;  5F3I A;  3C3V A;  2HWE 3;  1QDO A;  4O61 A;  3VZN A;  1VB4 A;  3UNP A;  3UGH A;  4AED B;  3RZJ A;  1WBF A;  2X10 A;  3BKZ A;  5LRR A;  3VLB B;  3PME A;  4FPE A;  3B93 A;  2XVK A;  1Y3T A;  1H9P A;  1UKR A;  3B9C A;  4MG2 A;  1IPS A;  3TEY A;  3DUI A;  5FY4 A;  2A75 A;  2VAU A;  2RS1 2;  3UV9 A;  4P08 A;  3AXE A;  1TME 2;  3I3M A;  1MS3 A;  4JC1 A;  5AC9 2;  5FXV A;  1OF4 A;  2HYX A;  2DCY A;  4E8D A;  2D3P A;  1VBC 1;  3I2I A;  1JI6 A;  3I8T A;  4XXP A;  5J48 A;  4TTG A;  2VW0 A;  3O1M A;  1U0A A;  3NNM A;  3VKL A;  1ZZ7 A;  5JMC A;  3R4S A;  1QIQ A;  5E88 A;  3A23 A;  5I93 A;  2B4K A;  1ENX A;  2YC4 A;  3P6B A;  4UFI A;  4BH9 A;  1B35 B;  5KC6 A;  3WG4 A;  3BIE A;  4AEJ A;  1EPZ A;  3C7O A;  1RUN A;  4OMC A;  1W8T A;  1G8W A;  3WV6 A;  4BIO A;  2W1U A;  3DYO A;  4NWW A;  4QQL A;  4YG6 A;  1FPN 1;  4YWA A;  5C8C A;  3MBW A;  5A33 B;  4QD2 A;  2WA4 A;  2D98 A;  4PLN A;  4BJ0 A;  1AL2 3;  4CXW A;  1HXS 1;  4C0H A;  1OD5 A;  3LSE A;  4GAZ A;  4MSV A;  5FZI A;  3MV0 1;  2AR6 A;  2F17 A;  4ITC A;  5T52 A;  2EIG A;  4Q4X 3;  3QOP A;  5L19 A;  3UK9 A;  1X7N A;  3N7M A;  4YW7 A;  3RGB A;  4OI2 A;  2DWR A;  2JKB A;  2YGL A;  4OVE A;  2LS6 A;  3PUA A;  3ZFE B;  4COY A;  4AEK A;  1RUG 2;  1X9T A;  1IG0 A;  1H8V A;  4QAW A;  2BFU S;  2P3K A;  1QJU 2;  2YC2 A;  3A21 A;  3I2D A;  1AR6 1;  3IWZ A;  2ZHM A;  1O3R A;  2FDH A;  1DHK B;  1LHN A;  2BJS A;  4XPV A;  1W90 A;  2KM2 A;  3UL2 A;  4AI2 A;  2WS9 2;  3VGI A;  4FTE A;  2DYC A;  4LOT A;  5ACA 2;  1RHI 3;  5L7O B;  4W6W A;  4LUL A;  1MR5 A;  1UX7 A;  5GZC A;  4QXC A;  4K1Y A;  3RJ2 X;  3BOP A;  3O0X A;  1POV 0;  4IV1 A;  3QH6 A;  1NXD 1;  3MO4 A;  3AMM A;  4HVO A;  4AED A;  1OA4 A;  1HDK A;  3KT7 A;  4GMP 1;  1LKN A;  2XLG A;  4KBB A;  4XF0 A;  2E63 A;  3UYJ A;  4BXS V;  2D5F A;  1G9B A;  1IG3 A;  1PZ8 A;  4KNC A;  4AL9 A;  2R16 A;  2C9K A;  2WFF 1;  4XIL A;  2FHR A;  4DUX A;  3DCQ A;  2XBO 2;  1OLR A;  3I97 A;  2BBV A;  1K5M B;  2UWC A;  3L2Y A;  4IV3 B;  4UI9 L;  1CR7 A;  2QQM A;  2BGC A;  1IS4 A;  4JTN A;  4AHW A;  2C26 A;  2VOT A;  3BCW A;  4FP3 A;  2BP6 A;  1OH4 A;  2GC2 A;  3BIW E;  1WD4 A;  1RUD 2;  2JKX A;  2Z42 A;  1GYK A;  1RXF A;  1QKQ A;  2WUH A;  1QJX 3;  4JAA A;  3VB9 A;  1W06 A;  3ZXD A;  4ET7 A;  4YGD A;  3CNA A;  3CDZ B;  4GWN A;  1B35 A;  3WG2 A;  2B9U A;  2J42 A;  1O91 A;  1QJE A;  2QQU A;  5DAP A;  1KD7 A;  4AHZ A;  2VO5 A;  1KFX L;  2X5I C;  1OQD A;  2DVD A;  1MS4 A;  1DF0 A;  4PIX A;  1EP0 A;  2LM3 A;  4YM2 A;  4I02 A;  1VMF A;  3KV4 A;  4XUT A;  1VRB A;  3ES1 A;  1PVX A;  4CCD A;  4Q29 A;  2YFU A;  2IXJ A;  4D6R A;  1SCS A;  2JDP A;  1PMJ X;  5FYI A;  3WNM A;  4KQ7 A;  4YW4 A;  3K4D A;  4YW2 A;  2VBB A;  3IB3 A;  3NNG A;  3RDI A;  4YZ1 A;  1RGS A;  1UY4 A;  2QDR A;  3ZFE A;  1H6X A;  1HW5 A;  1W6N B;  2PAK A;  5A33 A;  5JCT A;  1Q8O A;  4B1L A;  4NHY A;  5C4W B;  2VXJ A;  5FY5 A;  3KQ4 B;  3AJY A;  2VOX A;  2JG8 B;  2FDF A;  2XHK A;  2VQU A;  5A7N A;  3V56 A;  4AXO A;  1AX1 A;  3CJX A;  4R8H A;  3J7M A;  5L7O A;  5FZ4 A;  1OUX A;  4Q2F A;  2V09 A;  4WVW A;  1AYN 2;  5C5U A;  4XMI A;  2YU1 A;  1VBA 3;  2XR4 A;  4E4H A;  1LOA A;  4GKY A;  3AFK A;  5KXD A;  1RMU 3;  4FBF A;  2EXI A;  4MHR A;  3CJI C;  3GDB A;  1NCQ B;  1W8N A;  1GV9 A;  3ZDS A;  1V6L A;  3TAY A;  3KZ4 C;  2A6V A;  4DS0 A;  1WUV A;  1I3H A;  1Q43 A;  3M3Q A;  5FZ7 A;  1D7P M;  4J1W A;  3LB9 A;  2Q8C A;  4UXA A;  5FZC A;  5FUP A;  3WP3 A;  2Y60 A;  1F35 A;  1OKQ A;  3KCY A;  3WOG A;  3E97 A;  4Z82 A;  1K5M A;  4IV3 A;  3N4M A;  4XUQ A;  1HLC A;  1QJF A;  1VRH 2;  5E6H A;  1UY0 A;  4LMF A;  5J96 B;  1HJF A;  3AZY A;  4PF5 A;  4XUP A;  1F2N A;  4KU8 A;  2JJ6 A;  4AI8 A;  4LIU A;  1W2U A;  4NWV A;  4OZO A;  5FYH A;  1BYH A;  4OHZ A;  5JOW A;  3POY A;  3T2T A;  4IGO A;  5C6C A;  4RFT 0;  3FC0 A;  3NMB A;  2E7T A;  1H4G A;  1RIT A;  5JVV A;  4PLM A;  4ZZ5 A;  4Q4V 3;  1ZZC A;  3T2O A;  5LAS A;  4DEQ A;  1SFY A;  3PMS A;  1RUH 1;  4Q0U A;  2ZGN A;  5D2A A;  2R32 A;  4CEY B;  2XQR A;  1PZ9 A;  1RTV A;  2VOK A;  4IE4 A;  4E8C A;  2YYO A;  2VQ0 A;  4NVP A;  2BVV A;  4AVB A;  4RR3 B;  1SBE A;  4YFZ A;  5K4L A;  1J58 A;  2R04 2;  1PIV 1;  2YRO A;  4ZS3 A;  4D6S A;  1JZ4 A;  1YQ5 A;  1W6N A;  2R7E B;  4AG4 A;  4RHV 1;  3RZL A;  1F8V A;  4JQT A;  3N9N A;  3T2P A;  1URX A;  4UF0 B;  3EJK A;  2P3Y A;  5C4W A;  5IYY A;  1CIW A;  4FFG A;  1RUJ 2;  1N3P A;  1ZZB A;  4FPJ A;  4HVR A;  4Q4W 2;  5FPZ A;  4E9K A;  1NKG A;  2JG8 A;  1CIY A;  1DGW X;  4JKK A;  2FDG A;  2ZXQ A;  4JRL A;  3TBD A;  3DKW A;  3LDR A;  3CBN A;  2NYY A;  3ETP A;  4I01 A;  3T30 A;  2P17 A;  4S2G A;  1SG3 A;  3O0V A;  2NQY A;  5ERL A;  4XW3 A;  4UT5 A;  4JDO A;  3SIS A;  3FHA A;  4HXC A;  3B69 A;  1W6Q B;  3FJS A;  2XJS A;  3SH3 A;  3MZH A;  3W20 A;  4CCE A;  1GZ9 A;  2E51 A;  5HBA A;  4NHK A;  1NCQ A;  4K8F A;  3WNL A;  1ZZ8 A;  2QBX A;  1Q3E A;  1I1E A;  2QJV A;  1HRI 1;  3RZG A;  5EFU A;  2RM2 3;  4DMI A;  1MZF A;  3PNA A;  1RUF 1;  4COW A;  4Q1P A;  3D6E A;  3V65 A;  1KDM A;  4EWA A;  1RVF 3;  1ZBA 1;  3MFC A;  4FPO B;  3GHN A;  2IWG B;  3LDB A;  5BNP B;  1NLS A;  3J7N A;  1NCR B;  3J8F 1;  3VBR B;  3TN9 1;  4COU A;  1GMM A;  4LIV A;  3PJQ A;  4NHM A;  3IDC B;  3OYW B;  1IS5 A;  4PDW C;  2A3X A;  3SLI A;  5IK5 A;  1U12 A;  4PCR A;  3OGS A;  5FOJ B;  1MZE A;  3G6J B;  4YG0 A;  4BQX A;  1CGP A;  2YB7 A;  1CX1 A;  3JB8 A;  3PTR B;  1JTZ X;  3ETQ A;  4OCT A;  1NXM A;  2JD4 A;  4ONU A;  2QVS B;  2W52 A;  5EXO A;  1JZ3 A;  4LBJ A;  1QJY 2;  4J25 A;  4CA9 A;  5I8S A;  5J37 A;  2ZAA A;  1H30 A;  3C2U A;  4MGK E;  3KVB A;  1QQP 1;  3DN7 A;  2W2I A;  4YVS C;  2HJI A;  4IGQ A;  5BY5 A;  2IVJ A;  4TWT A;  4CEY A;  4E2G A;  2ARC A;  3U78 A;  5I8Y A;  1EUU A;  1K5J A;  3HN3 A;  5DUV A;  3U11 A;  4UOJ A;  4MX3 A;  3RSJ A;  4RR3 A;  1X82 A;  3ZSJ A;  3SEE A;  3VZO A;  2ZEY A;  3RZM A;  2FMD A;  1QOO A;  2YU2 A;  3POS A;  2WSV A;  1ENQ A;  2QNK A;  3WF3 A;  2VC9 A;  1UIK A;  2R07 1;  3B5L B;  2EAA A;  2VG9 A;  3E6D A;  5I0U A;  3RRD A;  5IK4 A;  2UY8 A;  3PU3 A;  4UF0 A;  2KA3 A;  3MIG A;  1QXR A;  2VMC A;  2IFW A;  2G9F A;  3IAP A;  4CDX C;  2GP3 A;  5GLV A;  4C8D A;  4EN7 B;  3TRS B;  5LCW L;  4N53 B;  2BNO A;  3I2O A;  3J26 N;  1D4M 3;  1OA2 A;  3A0N A;  4NID A;  1U5Z A;  1VBB 3;  3ZXK A;  4X8P A;  2DCK A;  1DU3 D;  3E5Q A;  4YPJ A;  2PFW A;  1W6Q A;  5FP7 A;  3UET A;  4A41 A;  3GAL A;  4AGR A;  2GSY A;  3D4K A;  1GOH A;  1W2A X;  4FPC A;  5ANN A;  5AVP A;  5CG8 A;  4Y4Y A;  2HWC 3;  1SLI A;  3O1P A;  3H9A A;  3DYM A;  1S2K A;  2FBE A;  2RMU 2;  4XJZ A;  5FZB A;  5FPX A;  2UWA A;  2GDF A;  1SFP A;  2H0V A;  2JE7 A;  4AR2 A;  1Z7S 3;  4A3Z A;  1OFS A;  3PDQ A;  1Y43 B;  3FX3 A;  2OYZ A;  3IIA A;  1LOB A;  1C1F A;  4CVU A;  5BNP A;  3A0K A;  4XQ4 A;  3VBF B;  1NCR A;  2VD7 A;  5FWE A;  3VBR A;  1A8M A;  3DXU A;  1U5Y A;  3OYW A;  4CUG A;  3Q8E A;  5C33 A;  4MGY E;  3OBR A;  2K2S A;  2RR1 2;  1UU6 A;  1DDL A;  1UOF A;  2VEC A;  4CXX A;  1JUI A;  3WD5 A;  3ZYP A;  4H55 A;  2C24 A;  4EN0 A;  1S0G A;  3MEP A;  3GNE A;  1J3P A;  5FP9 A;  5HI0 A;  3B3Q E;  2ZX3 A;  1HV0 A;  4BK5 A;  1MS5 A;  1AR8 1;  3AP6 A;  1HX6 A;  3MF9 A;  5FCC A;  1JN2 P;  4DRV A;  4QPI C;  1LRH A;  3ZXL A;  2KR2 A;  5F39 A;  1V9U 2;  2G1M A;  3OBA A;  4MVT A;  1U5X A;  2UYA A;  2NM1 A;  3T09 A;  4P9I A;  2BV4 A;  3T2Q A;  4NHL A;  2P3J A;  4QHB A;  2A71 A;  1XPW A;  3UKT A;  3QBQ A;  5F32 A;  1PO2 3;  3VBH C;  4O9G A;  5A6Q A;  5CNA A;  3T4V A;  3GZU C;  2AUY A;  1CD3 G;  1WCS A;  1W8H A;  2E33 A;  1WGP A;  2VMH A;  1WMX A;  1SDW A;  2W1S A;  3M2M A;  2YPJ A;  4FO9 A;  2YUE A;  4A3X A;  1PO1 1;  5H9Q A;  5JSO A;  3RS6 A;  3ZYJ B;  2JDA A;  3IKW A;  4QU1 A;  4F7Z A;  3H7J A;  5F1R A;  1R08 3;  3EO6 A;  4XBQ A;  4EZH A;  1PVC 1;  4XIO A;  1AR9 2;  3I54 A;  5F37 A;  3CO2 A;  3FUQ A;  3GM8 A;  1UY2 A;  4XJW A;  1J83 A;  1VAK A;  5ABJ C;  1PX3 A;  1EV1 1;  1RMU 2;  3BPZ A;  3E5U A;  4PLO A;  1D2Q A;  5IVY A;  4EN6 B;  4N53 A;  2BGO A;  3PJY A;  5FP4 A;  1WW5 A;  3L9J T;  1OVS A;  4G3Y C;  5FZ0 A;  5C5T A;  3AP5 A;  3KM5 A;  1C3H A;  2BQP A;  2GH2 A;  3V0A B;  1E5S A;  5C3P A;  1UW8 A;  3URF A;  1YO8 A;  2YGM A;  3N9Q A;  4FPF A;  1T2X A;  2ZEW A;  1ASJ 1;  1ZNP A;  3MPB A;  4JX0 A;  1OHF A;  3CL1 A;  5JOY A;  1N3O A;  2MHF A;  2VM9 A;  2W1W A;  4IQP A;  3FL7 A;  1CZV A;  3UT0 A;  4CZS A;  2R49 A;  4Y22 B;  4YM3 A;  3JB4 C;  4Q0S A;  4LUK A;  4GAL A;  3U07 A;  2VUJ A;  1UNB A;  3ZMO A;  4B8E A;  1LUL A;  3VBF A;  1UAI A;  4GKX A;  4JV4 A;  1TME 3;  1KFU L;  4PIY A;  3UJQ A;  4JCK A;  4EZ4 A;  5AC9 3;  3OJB A;  2GC1 A;  3WF2 A;  3ZR5 A;  3BGA A;  1F4A A;  3ELN A;  2EAK A;  4N8M A;  2AH2 A;  2WC2 A;  1RB8 G;  4FFF A;  4BIF A;  3EXU A;  3OD0 A;  1V6J A;  1F9K A;  3W9A A;  1LOE A;  2YZ4 A;  3CEW A;  3OG2 A;  4IEU A;  3M7A A;  4KG8 A;  4RFR B;  5FO7 B;  4EWE A;  3JCI A;  3ZYH A;  4QX7 A;  2VE1 A;  1FOD 1;  1BVV A;  3ZN4 A;  4RN5 A;  1BMV 1;  2D6M A;  3GBG A;  4QQ2 A;  3BU0 A;  1C8M 2;  2O8O A;  2WWS A;  3A4U A;  4QDS A;  5HV4 A;  2QQP A;  4GWM A;  1A34 A;  1W9Y A;  2VNV A;  3T08 A;  1PGL 1;  1KDK A;  4Z92 B;  1BQP A;  4V1P A;  1RUE 1;  5ANQ A;  4CCN A;  5K7P A;  2R1B A;  4HMZ A;  4W50 A;  3AZW A;  3P3N A;  1YFU A;  3RZH A;  3ZFF B;  2ARE A;  1BKZ A;  4WBB A;  1H1A A;  1PNG A;  3NV4 A;  4HET A;  2WN2 A;  3FHI B;  5F5I A;  1ZRR A;  5FZ1 A;  1SFN A;  1S1A A;  1PMI A;  1LU2 A;  2MEV 1;  5C8W A;  5HCA A;  1B09 A;  1KGY A;  1Q8S A;  1QJU 3;  3AVS A;  5JOZ A;  2DUR A;  5DDJ 3;  5JXG A;  1NZI A;  5FFO C;  4FXK B;  2RVA A;  2WS9 3;  3V0A A;  1OT5 A;  1ZZ6 A;  1JHN A;  1FAY A;  2X5I B;  4OHV A;  4ZHN A;  3WG1 A;  1WCQ A;  4UYB A;  1JBC A;  2BER A;  1US2 A;  3AYA A;  3PHM A;  2ZOE B;  4LO8 A;  2E7Q A;  3OUI A;  2GME A;  4B7E A;  2PAE A;  2GN7 A;  4ATF A;  3I3E A;  4N90 A;  3ZM8 A;  4BCU A;  3ZPO A;  3CMG A;  2XDV A;  4Q0V A;  1NA1 C;  1DQ0 A;  4NPM A;  4CU8 A;  2CDO A;  4AE2 A;  4Y5T A;  4Y22 A;  2PHD A;  3PTY A;  1JOJ A;  1MEC 1;  2OZ6 A;  2VZ3 A;  5JZG C;  4OQ8 A;  5CU1 A;  2H6C A;  1XSR A;  4XF1 A;  1POV 1;  2ARX A;  2NMN A;  3SCH A;  5CBL A;  1V6M A;  4NIA A;  2YFZ A;  3TWI A;  1DP0 A;  2VVE A;  3PVE A;  2JB4 A;  3LPG A;  4GWI A;  2PHU A;  3UGF A;  1GQH A;  5FOB B;  5F3C A;  4M00 A;  1H2M A;  1IZ3 A;  4CXY A;  4XBN A;  3S7E A;  5BPX A;  4LBN A;  4FT8 A;  1VBD 1;  1RUD 3;  1TVG A;  3ALQ A;  1VBE 1;  5FLI A;  3RZZ A;  2ZMK A;  3J4U H;  5FZD A;  1W8O A;  4Z1V A;  5JI9 A;  3U37 A;  5HCF A;  1R1A 2;  5SV8 A;  1DGW A;  3CJI B;  1S0E A;  3AP9 A;  5FRE A;  1CES A;  5LA2 A;  4XCA A;  1ND3 C;  3HJR A;  5FYV A;  4AFB A;  4QM9 A;  1OLQ A;  4IEO A;  3R0R A;  3RQ0 A;  5BNN C;  5FZO B;  2ZZQ A;  1ZBE 3;  4I30 A;  3U14 A;  2GC3 A;  1Q8P A;  1WW7 A;  2I07 B;  3HR9 A;  1FMD 2;  3L2H A;  4P9L A;  3B7M A;  3PUS A;  4QPY A;  4DZG A;  2VXR A;  3QD6 A;  4E4Z A;  1PM4 A;  2E53 A;  4JGY C;  4AHY A;  1VLN A;  2PLV 2;  3ZFF A;  1D4M 2;  2CWS A;  3N9O A;  4CPB D;  4KMQ A;  1LOF C;  5LK7 B;  2AEZ A;  2BBA A;  4BQ1 A;  3AXD A;  3HAG A;  1QJZ A;  4QWN A;  1EAH 1;  2Z4F A;  3O14 A;  4K40 A;  1FXZ A;  4XZU G;  2XGX A;  1VMJ A;  1BCX A;  1GAN A;  3I2J A;  3QH7 A;  4EJR A;  3CF6 E;  2HWB 1;  4MGQ A;  2TEP A;  4ZS2 A;  3FFQ A;  1AJO A;  2ZGO A;  3THC A;  4B1M A;  5DN2 A;  4QGN A;  3HIF A;  1S0I A;  2X5I A;  4XQW A;  3TNP B;  4QB1 A;  2PXJ A;  4CCL A;  4SBV A;  1TMF 1;  1AYN 3;  3FLT A;  3NWK A;  5CIR A;  1FI2 A;  2HWF 2;  1V70 A;  3I2G A;  2YBS A;  4NRQ A;  1CZS A;  4KGQ A;  3ST7 A;  3NL1 A;  5KHG A;  3JBG 1;  1O8S A;  2CNA A;  1QH6 A;  3NKT A;  3H7Y A;  1RUC 1;  3TYJ A;  5C70 A;  1H2N A;  1UYY A;  3VZM A;  1SAC A;  4RD7 A;  3S6P A;  3TB0 A;  4AI1 A;  3WF1 A;  4AAX A;  2VMI A;  5AFB A;  5J36 A;  2ZAH A;  1QU0 A;  3HT1 A;  2WO1 A;  2AC1 A;  1GZT A;  3IBM A;  4HG6 B;  2EID A;  4Q8L A;  1HRV 3;  4XEZ A;  4A45 A;  5JAX A;  4MGZ E;  2CV6 A;  2D6L X;  2IXK A;  3W5N A;  2W91 A;  4JGZ C;  4GB3 2;  4P9X A;  1VRH 3;  5E8A A;  5LBB A;  1HIX A;  1W8U A;  2O14 A;  1TZO A;  1VMH A;  1SHW B;  5IK8 A;  2HWD 3;  4D7T A;  4RA0 A;  3ACH A;  1DQ1 A;  1E5I A;  2DTY A;  1PO2 2;  4CE8 A;  1M06 G;  1XE0 A;  4XFF A;  3ZFG C;  2YHJ A;  3THD A;  3CJI A;  4ES9 A;  4GXL A;  4BZ4 A;  4KWU A;  3GCX A;  5EJZ B;  1JYX A;  3JD7 2;  4FFI A;  5FXX A;  1YCI A;  3WZ1 A;  4FOW A;  4CDQ C;  5CEH A;  3LSD A;  5FYM A;  5FZO A;  4IES A;  2Q5T A;  4PHZ A;  1MQT C;  1S55 A;  3APB A;  1DQ5 A;  2OPK A;  2RS5 3;  1GLH A;  1NQJ A;  5FY1 A;  5L36 A;  2D3R A;  5BXX A;  4CEW C;  4MHU A;  4GWJ A;  2ZGP A;  5JOX A;  4MGI E;  3WNP A;  2CU5 A;  4CSW A;  1F31 A;  4OYU A;  4PDW B;  2R04 3;  1UY3 A;  3FE5 A;  3OBZ A;  3IDA A;  4Y24 A;  5FJK A;  5G04 L;  1MZ5 A;  1XNA A;  1COV 1;  5KHK A;  1OA3 A;  2VW1 A;  4KL1 A;  3H8X A;  4ZY9 A;  2PHW A;  5IVF A;  5FMC A;  5FRA A;  1IKP A;  3ES4 A;  2PEL A;  1ULE A;  1LU1 A;  3GYD A;  1RUJ 3;  4Q4W 3;  5FR3 A;  3BTX A;  2JB8 A;  3RNS A;  2FZ2 A;  1RXG A;  5FUN A;  2ES3 A;  4MXW B;  4K1Z A;  2Y6G A;  2QE3 A;  4YVS B;  5DUX A;  1MVE A;  1AL0 G;  3TEX A;  5FY7 A;  1LB2 A;  2W46 A;  1C4R A;  3OGG A;  1IQA A;  2B42 B;  5CA6 A;  2XON A;  1LGB A;  2ZCW A;  3O0W A;  2IZW A;  4CU7 A;  4IE6 A;  2WNV C;  2WSU A;  4Q4Y 1;  3NV2 A;  3Q8F A;  3KHB A;  2G9G A;  2RDN A;  1BBT 2;  3J7H A;  1DG6 A;  4XCB A;  3ACF A;  3PIJ A;  4D6Q A;  2VJX A;  1HXS 3;  4GJY A;  5F7U A;  1GBG A;  2RS3 1;  1WKY A;  2AEY A;  5CVR A;  5EYX A;  4QM8 A;  4BLI A;  2R0H A;  5FYZ A;  3NRU A;  4XAB A;  3MLK A;  1JOB A;  4K8R B;  1OXC A;  4CDX B;  3QAC A;  5JI7 A;  5T5J A;  1O3Q A;  5GAL A;  1W2T A;  1YJL A;  4FP2 A;  4E2Q A;  3AP4 A;  1W0O A;  4YZ2 A;  1V00 A;  2ENR A;  2WKK A;  2ADD A;  3GJB A;  2OVU A;  3KV5 A;  1UQX A;  4KG0 A;  5T54 A;  2VTX J;  1AF9 A;  2RHP A;  3WW2 A;  1AR6 3;  2BGP A;  2A1X A;  5IW0 A;  2HWE 1;  4R9A A;  4RQP C;  1QJY 3;  1ZA4 A;  2PQQ A;  2BW8 A;  2FZ1 A;  4LBK A;  3LD8 A;  1RUI 2;  2B8M A;  2J1S A;  2AYH A;  4OHY A;  4U2A A;  3C7F A;  2HBT A;  4LO4 B;  5L9R A;  5IFP A;  3B02 A;  2VCB A;  5F5Q A;  1I5Z A;  4NJ4 A;  2QTW B;  2H6B A;  2XKP A;  3M3E A;  4GMP 3;  1ALY A;  5FZA A;  4X6Q B;  4PDW A;  3WXP A;  1RYY A;  3S5A A;  5DDJ 2;  4X8N A;  2FCU A;  1O3T A;  1O8P A;  1KIT A;  2D44 A;  4XQD A;  5FBZ A;  4CU9 A;  2UYB A;  5FWJ A;  2UWB A;  3CLP A;  3ME2 A;  3UGG A;  2ZKN A;  2VTF A;  2DU1 A;  3RMY A;  2ZGM A;  3ACL A;  3ZKY A;  1CWP A;  3ZMN A;  3A7Q A;  1QXJ A;  3BU7 A;  3UJO A;  3VHO A;  1HN0 A;  2RJ2 A;  4QPI B;  5EPA A;  5IAX A;  4MXW A;  4NOT A;  5JR7 B;  4YVS A;  2G19 A;  3PLQ A;  5D21 A;  1KRI A;  3MLL A;  3VL8 A;  1W03 A;  3WQ1 A;  3HNB M;  2VGD A;  4BME A;  4P9J A;  5FY8 A;  1AL2 1;  3VBH B;  3I3B A;  3BTZ A;  5BNQ A;  5A1L A;  4CRQ A;  5GKA C;  1ULO A;  1YYN A;  1XBF A;  5J7M A;  4Q4X 1;  5F5A A;  1XNB A;  2RMU 3;  2XKO A;  1PM7 A;  2P4E A;  3GGL A;  3PVO A;  4XFC A;  5JXI A;  3MIC A;  4AFA A;  1BJQ A;  4MH0 E;  1LED A;  3A22 A;  2TBV A;  3VBS C;  2ZEZ A;  1ULD A;  2WNU C;  5T3N A;  5CG9 A;  3T3Y A;  1QOS A;  2ORX A;  2ZX2 A;  1XNT A;  3KD4 A;  1UOG A;  2ZHN A;  4CDX A;  4XUO A;  5ABJ B;  2R30 A;  1JZ2 A;  4JKM A;  3CZJ A;  4DUW A;  4OMD A;  2CY6 A;  1N47 A;  5ISL A;  3OGV A;  4OLL A;  2WLP A;  4DB5 A;  2RR1 3;  2J1E A;  5K8S A;  2HKX A;  1RHI 1;  2WRA A;  3OOX A;  4AGG A;  1YHF A;  2R06 1;  1ZBE 2;  5JPM B;  5TSW A;  4WVM B;  5FK8 A;  4K20 A;  1Y7B A;  3ROU A;  4BDV B;  3KV9 A;  3MI8 A;  1BZW A;  5FYC A;  4S2H A;  1JMU B;  4GH4 C;  1LHV A;  4Q5O A;  2WYS A;  2VNO A;  3U4X A;  1V9U 3;  5J1X A;  2IXC A;  3WNX A;  3VDD C;  4FOY A;  4HN0 A;  1CN1 A;  1AR7 2;  4W8J A;  4UFK A;  1IGO A;  2WLQ A;  5FZK A;  5H9P A;  4D3W A;  2WAO A;  1W6P B;  2XJR A;  4WV8 A;  4FSJ A;  1KS5 A;  4FXG B;  1BEV 2;  2VZP A;  5FYU A;  3KB5 A;  4HVQ A;  4M0H A;  5LWB A;  3LIG A;  1J1T A;  3GBF A;  3T1L A;  5CFD C;  4NHX A;  1GFF 2;  3N7L A;  3OPW A;  1VAM A;  1QJX 1;  3GZE A;  3K4A A;  1AR9 3;  3SEP A;  4BQ3 A;  5AFE A;  4YZ5 A;  4ZPI A;  4DUV A;  1H1M A;  4H14 A;  1DYP A;  2XB6 C;  3HNM A;  4QPI A;  1C5H A;  1L7R A;  2W47 A;  1GNZ A;  3ZFE C;  4A6S A;  2DBI A;  4MZU A;  5GLT A;  2BWC A;  4BIS A;  2VUD A;  5F6L B;  1N1V A;  1AYM 2;  3K48 A;  2F6B A;  1G9A A;  1LHO A;  5BYN A;  1XNK A;  3NAP C;  3NJX A;  3VBH A;  1NY7 2;  1REF A;  4OI4 A;  1W2N A;  5LAT A;  2FD8 A;  2GC0 A;  3POI A;  4QHO A;  1HRV 2;  3WQ0 A;  3IAQ A;  1KJR A;  4Q1R A;  2AZ5 A;  1MS9 A;  2Y6K A;  4OUE A;  4CP2 A;  4TN7 A;  1LAJ A;  4CP0 A;  3QLQ A;  5BNO C;  3ZSE A;  2WT2 A;  1GU3 A;  3HQX A;  2MPF A;  2WZR 2;  3BOW A;  3LPF A;  4Y26 A;  1QGL A;  3R6S A;  4LNV A;  4XE9 A;  2HWD 2;  1GQP A;  2TNF A;  2ZGS A;  5EYY A;  5DXD A;  4LOR A;  2EA7 A;  4A6O A;  5ABJ A;  1UD1 A;  3TEW A;  1SLB A;  1JXN A;  4XTP A;  3T0D A;  1WBL A;  1NOV A;  1OUR A;  1ZVF A;  1JHJ A;  1MS8 A;  4LKE A;  4ZON A;  3WCS A;  5A6Y A;  2BNN A;  1I6X A;  3M8L A;  3LA2 A;  2OT7 A;  5KXC A;  4X6R B;  1VBA 1;  2DVA A;  4RL7 A;  4WVM A;  4LA2 A;  2RS5 2;  4GJZ A;  1W9F A;  2FMY A;  1H0B A;  2OPW A;  4BB3 A;  5HXM A;  5FPU A;  4U36 A;  1NA1 B;  3WT3 A;  2B46 X;  2VZS A;  2WII B;  3WG3 A;  1W05 A;  2VPV A;  4BE3 A;  5FYT A;  5EIY B;  3WLU A;  1YI9 A;  3MID A;  5JZG B;  2CWM A;  1C8M 3;  2JX9 A;  2B5H A;  1H6Y A;  1HKD A;  1S0J A;  1W6P A;  2VZR A;  2C5D A;  2Y33 A;  2PYT A;  4HPK B;  4HSL A;  4XF4 A;  4XXA A;  2X29 A;  5KC5 A;  2AGS A;  2ARB A;  4BPZ A;  1VBC 2;  2A6W A;  4XUR A;  3K46 A;  4XHB A;  1A3K A;  1NG0 A;  1WLD A;  1XE8 A;  2BOI A;  1EY2 A;  4P00 B;  4XFA A;  3U4S A;  3U1X A;  5CYY A;  3ZXA C;  2QQK A;  2ILM A;  3DKQ A;  4LPL A;  3P5B A;  4XF3 A;  1A78 A;  4A7Y A;  4MV2 A;  1S0C A;  3BOD A;  1VPH A;  1FAT A;  4Q27 A;  5FZ3 A;  1XSQ A;  5HCB A;  4G4F A;  1PNF A;  2C6S A;  1PGW 1;  4NAO A;  5FBJ A;  1R09 1;  1F15 A;  3EMR A;  4O65 A;  3BVC A;  2XUE A;  4HL0 A;  1IKQ A;  2ATF A;  4Q4V 1;  1UOB A;  1FPN 2;  3WDT A;  3NVC A;  5JSR A;  4CUC A;  2WFP A;  3H0O A;  4HLT A;  1ND3 B;  1YWK A;  5BNN B;  2GMM A;  1HXS 2;  3NJV A;  2BYV E;  2LW8 A;  4N9I A;  1MZ6 A;  3THT A;  1OLM A;  1ULG A;  2VZV A;  3ZLI A;  3VKN A;  1GOG A;  3AX4 A;  3ZYR A;  3CU7 A;  2PHR A;  3VDA A;  4JGY B;  3O1R A;  1DFQ A;  3K3O A;  5GZD A;  2N7G A;  1LOD A;  1O59 A;  4IE5 A;  2JG9 C;  2C4X A;  3MDP A;  4AVA A;  1YUD A;  1CPN A;  4YW3 A;  3MF6 A;  2Y6L A;  3EHK A;  2YC0 A;  3AMQ A;  4QQO A;  4S2D A;  3IPV B;  1AR6 2;  2YG0 A;  1JZ7 A;  3O1O A;  5A3M A;  2D6O X;  1JZ5 A;  4XUN A;  3LEK A;  4NRM A;  2D43 A;  3NNL A;  1YFX A;  2ZGQ A;  1EYB A;  4ISQ A;  1QEX A;  3H3U A;  4UW4 A;  3S7I A;  1SQ4 A;  1NZC A;  4YVW C;  5F8P A;  4BOW A;  4DY3 A;  4QX0 A;  2WN3 A;  2YDE A;  2Y38 A;  2GAL A;  2J1V A;  4Q0Q A;  1Y9M A;  4M01 A;  3BPS A;  1DQ2 A;  1R1A 3;  3M3O A;  3POJ A;  1AVB A;  1GP5 A;  1NA1 A;  1K42 A;  2RM2 1;  1YQC A;  5KWR A;  1FYU A;  1QNY A;  2VR4 A;  2DFB A;  3KT4 A;  3W5M A;  1QDC A;  2DFC A;  3AFG A;  3KF3 A;  2WT0 A;  3Q8B A;  2WFF 2;  4M3C B;  1RVF 1;  1ACC A;  5JZG A;  1UMI A;  1W39 A;  2WA3 A;  3AKR A;  5A3W A;  3VBO C;  3PU8 A;  1P8J A;  3HT2 A;  4HPK A;  4AZZ A;  4CUB A;  3O7O A;  2OS2 A;  2VZT A;  5EZW A;  1FMD 3;  3DGT A;  1SBF A;  4HKW A;  5LBC A;  2BPA 2;  4YAR A;  1GKB A;  1DZT A;  3MIE A;  4JGZ B;  4B4Q A;  5LBE A;  3RWN A;  1YQ6 A;  2PLV 3;  5A70 A;  4L11 A;  4BWO A;  2RDS A;  4D8M A;  5FLH A;  2Y6F A;  3I2K A;  5L73 A;  3KT1 A;  4URA A;  3T4H B;  3ZFG B;  4JKL A;  4GMP 0;  2YPD A;  1W28 A;  4KU7 A;  2QQV A;  1M4W A;  3G7D A;  4ARY A;  4AQT A;  4CDQ B;  1ND3 A;  3WIN E;  2GN3 A;  2CAU A;  5IVV A;  3LF7 A;  5BNN A;  5EWS A;  2Z5W A;  1AR8 3;  5FPB A;  1MQT B;  1UF2 C;  4CPB A;  1ZRE A;  5C3O A;  2HWF 3;  2WQ8 A;  3AKT A;  3IZO A;  1AJK A;  4OZX A;  4CEW B;  5FLJ A;  1W8F A;  4IDZ A;  4XDO A;  1DIW A;  4Y20 B;  1XYP A;  4JGY A;  4XF9 A;  3E6B A;  1OLM E;  3LDK A;  1UXX X;  5CIS A;  5C9A C;  1LOF A;  2BDR A;  4AQ2 A;  1X8E A;  1XJA A;  4I2O A;  1SLA A;  1YLL A;  4XJ9 A;  1UY1 A;  4MAD A;  3IPV A;  2JIC A;  1ODM A;  1XOY A;  1CJD A;  4Y1Y A;  3O12 A;  3AL6 A;  1KXG A;  4IEY A;  1QHD A;  5CKM A;  2TUN A;  2DDU A;  3BAL A;  4Q0P A;  5I0D A;  1JYT A;  1OF3 A;  4GB3 3;  4FAH A;  1LOC A;  4XFH A;  5A3T A;  1VBB 1;  1UPS A;  3B00 A;  3ZIW A;  1Y4W A;  2JDK A;  1UXZ A;  3RYK A;  1FT9 A;  4HK9 A;  1REE A;  2ZHK A;  3I2F A;  3POE A;  4N7I A;  5EJ1 B;  1VAL A;  2F4L A;  3FLP A;  4ASL A;  2HWC 1;  1GIC A;  5EV7 A;  1UN1 A;  4W6X A;  1SCR A;  1HQN A;  4OFG A;  3O5S A;  1OMI A;  3JD7 3;  2FQP A;  2L9L A;  2WNV B;  4M3C A;  4TLF A;  3ZYI B;  2PAM A;  2JDM A;  1FX5 A;  1Z7S 1;  3OCP A;  1FV3 A;  3W58 A;  5LA1 A;  4LXL A;  1YC6 1;  1IPJ A;  1DYO A;  1H4H A;  1XNC A;  5KHI A;  4LBQ D;  1VAV A;  3WP6 A;  1CAW B;  4PI2 A;  4RGK A;  3POF A;  4IUG A;  4FTS A;  4AI9 A;  3WX5 A;  4JGZ A;  3AC0 A;  3LCP A;  4IEX A;  1GR3 A;  2WWJ A;  3V64 A;  4YRD A;  3SKJ E;  1W8W A;  1OUS A;  4LIT A;  4IER A;  1C57 A;  3OGJ A;  3SQO A;  1W99 A;  5JWP A;  3I49 A;  4ES8 A;  3MFA A;  3OY8 B;  2WQZ C;  3ZFG A;  4EE2 A;  2EAL A;  1L3J A;  1YIF A;  3H1W A;  1GP6 A;  4RQP B;  1H8T C;  4LE4 A;  5CB7 A;  5B4X A;  1UZY A;  4CDQ A;  2QZ3 A;  1RUH 2;  2ARA A;  2W94 A;  5DZF A;  2Q30 A;  4I0A A;  5FO9 B;  2FDK A;  1VIW B;  1MQT A;  3C7H A;  1AX0 A;  1SBD A;  3LA7 A;  5AVA A;  3VDB A;  4Y1X A;  1A6C A;  3DV8 A;  4CYD A;  4CEW A;  2D6N A;  4Y20 A;  1X50 A;  1K12 A;  4K21 A;  1PIV 2;  4BQ5 A;  4BQ2 A;  1X8M A;  5LBF A;  4E4S A;  4FQ4 A;  1E5R A;  2WZ8 A;  1DCS A;  1D2S A;  1GZW B;  4LO7 A;  1JYC A;  1R08 1;  4RHV 2;  1BBT 3;  2OUJ A;  1Y9Q A;  2V5Y A;  5L9B A;  2ZKL A;  5A6X A;  4PJY A;  1DGR N;  4AFM A;  2RJK A;  1ONA A;  2VCM A;  4EQV A;  1RUE 3;  4Z8B A;  3OUH A;  3RZK A;  1GWL A;  4ZU4 A;  3POG A;  2JDZ A;  2EVX A;  3X29 B;  1OVP A;  2JWP A;  2VUC A;  3KQR A;  3DEC A;  4G9S B;  4I3P A;  1JS9 A;  2XJQ A;  5A3U A;  4I09 A;  1C1L A;  4HFS A;  1RC6 A;  4CCO A;  3VD4 A;  3JU9 A;  5J98 B;  2OII A;  4CCK A;  1CVN A;  1LES A;  3ZSM A;  1Y9G A;  3MUY 1;  2VVD A;  4QDQ A;  5EJ3 A;  1UWW A;  2SLI A;  3JUU A;  3F95 A;  3ZXG A;  1APN A;  1ST8 A;  3N7K A;  4E2S A;  1HRI 2;  5FY9 A;  4OQ9 A;  1RIR A;  4OUL A;  5IJR A;  4MO3 M;  3SH5 A;  3VDC A;  2WNV A;  1RUF 2;  4IXL A;  2VZU A;  2DUO A;  1JZ8 A;  1YJK A;  4IET A;  1J1L A;  1GNH A;  1RUI 3;  5LY1 A;  2W1Q A;  1MS0 A;  5JIU A;  5A1F A;  1ZBA 2;  2DU0 A;  4M3C E;  3VBS B;  2A5Z A;  3J9S A;  5IVB A;  2RS1 1;  4ZU7 A;  2WNU B;  2YV8 A;  1AX2 A;  1CAW A;  1TME 1;  2CGO A;  3CIH A;  3J8F 2;  5EQU A;  3PUH A;  4JDM A;  1S0B A;  2E31 A;  4RS5 C;  2F4P A;  3TN9 2;  5FIX A;  4LOS A;  5FP8 A;  5AC9 1;  2DCJ A;  3E5X A;  2W9X A;  3IDB B;  3B9I A;  2PN5 A;  5FZM A;  3MV1 1;  2OQ7 A;  2E6V A;  1JU4 A;  5FYS A;  3WUC A;  1LGC A;  5H9S A;  2G4I A;  3SC7 X;  2XJP A;  4LLO A;  2BTV C;  2VMG A;  1POV 3;  2ZJC A;  4AI3 A;  1CAX B;  3MUZ 1;  3VZL A;  3CZU A;  3OY8 A;  3BB6 A;  2ETE A;  3AYE A;  4LO5 B;  3KCX A;  2JE9 A;  3RYR A;  1ZRD A;  1V6I A;  4P5H A;  4RQP A;  2B45 X;  2XJU A;  3VKF C;  1ZRF A;  1XYN A;  4H7M A;  1QQP 2;  4JQR A;  1HQW A;  4L99 A;  1VBD 3;  1E5H A;  1XU2 A;  2ZX4 A;  1JUH A;  1N1Y A;  3GCW A;  2XWB B;  4GH4 B;  4ATE A;  3DYP A;  2G9Z A;  1ZRC A;  3VDD B;  2KXL A;  3M3C A;  4JVA A;  3PL0 A;  1QF3 A;  3WY6 A;  2W68 A;  5FMO S;  1ULC A;  3WEZ A;  3KSC A;  4QX5 A;  4CTE A;  2VOV A;  3AP7 A;  4KWJ A;  2A70 A;  4UBH A;  2ZMN A;  2R07 2;  4AFD A;  1GZW A;  5CFD B;  4LLF A;  3ZYG A;  4LKD A;  2GU9 A;  3NV1 A;  5A7S A;  4ISR A;  2GNT A;  2RDR A;  2Y6J A;  4DY5 A;  4R52 A;  1RUG 1;  4LHN A;  1YRZ A;  2XLF A;  1Z0H A;  2XJV A;  3NV3 A;  1HJG A;  3WW3 A;  3WHU A;  1QJU 1;  1O4T A;  1O4Y A;  2OW4 A;  1VP6 A;  1OFN A;  2IVI B;  2I2S A;  3VL9 A;  1LNS A;  3N3H A;  1S0F A;  3AB0 A;  3KV6 A;  2WS9 1;  3WNO A;  4JTO A;  5ACA 1;  5LZ6 A;  3R4D B;  2X09 A;  4IE7 A;  4LBL A;  2VCA A;  3H1M A;  4P9Y A;  4R9C A;  2ORZ A;  2VOW A;  3NAP B;  5A7O A;  4AAP A;  1GWM A;  2LAL A;  4XJU A;  5A7W B;  5A6Z A;  4LHK A;  1U5I A;  2HEY F;  4URT A;  4ARX A;  2JEM A;  1CON A;  1HV1 A;  1ND2 C;  3MGU A;  5LRS A;  2D6K A;  1MVQ A;  4O7X A;  2VZO A;  4AGV A;  4UBG A;  1OBN A;  5BNO B;  2CGN A;  1UU4 A;  3ZSL A;  1T6G C;  2XL7 A;  3GHM A;  3VBS A;  1PMH X;  3W21 A;  2IFR A;  5GLW A;  2NZ9 A;  2EXH A;  2WNU A;  5CFC C;  1WMF A;  1AR7 3;  1OPO A;  3JBG 3;  2HBU A;  2J1U A;  3OBT A;  3OB8 A;  2XBO 1;  4YGB A;  4P5Y A;  5A7P A;  3VN4 A;  4NPL A;  3H8O A;  4MOA A;  5DAX A;  2QQI A;  2Q1F A;  2RDQ A;  2DUP A;  1RED A;  1AXK A;  1BEV 3;  1W0N A;  1XND A;  5EHD A;  3SMH A;  2PA7 A;  4XET A;  3H8R A;  2DCT A;  4FPY A;  4NUB A;  4PBO A;  3VV1 A;  3K75 B;  1JYI A;  5A1A A;  5HPO A;  1CAX A;  4Y5S A;  5IVJ A;  1AR8 2;  1PHM A;  4A4A A;  3D82 A;  5FZ6 A;  2DVG A;  1RJ7 A;  2E9Q A;  4QPG C;  1L7Q A;  3RPQ A;  2K46 A;  4J6G A;  4KBZ A;  2GMP A;  4R4X A;  4GH4 A;  5LW9 A;  3MW3 A;  3DXT A;  2WO7 A;  2O8Q A;  4LHL A;  3Q8A A;  2CGP A;  1AYM 3;  3VDD A;  4XDQ A;  4KWK A;  3EB7 A;  1WZX A;  1LEC A;  3PUI A;  5GZE A;  1NE4 A;  4HT1 T;  1STM A;  5GJ6 A;  5B4N A;  4NR1 A;  1W04 A;  4LHS A;  1HB3 A;  3LA3 A;  1PO1 2;  1W6O B;  4QB2 A;  4EYU A;  4F8A A;  3VD3 A;  3USU A;  5CFD A;  3IMM A;  1PVC 2;  1PZ7 A;  3B01 A;  1CX4 A;  2WZR 3;  4Q26 A;  3W59 A;  4QXK A;  5KXB A;  2Z69 A;  1UZZ A;  4TXW A;  4CDW C;  5I0T A;  3N9M A;  1EV1 2;  3MIF A;  4W65 A;  3LEG A;  3AMP A;  1FV2 A;  2JE8 A;  2WO2 A;  3NJZ A;  5KHJ A;  3K4Z A;  1S2B A;  3HVD A;  3DEM A;  2XL9 A;  1R64 A;  4YFW A;  5IWF A;  3WVJ A;  4LKS A;  2NMO A;  3ZXE A;  2H0B A;  3AKP A;  1AYN 1;  3NAP A;  3POB A;  4TZD A;  2MNG A;  3HBK A;  3IMN A;  1ASJ 2;  5A7W A;  3SCG A;  1YQ8 A;  4L0P A;  3WSO A;  3LIH A;  3FMG A;  5IT6 A;  2CL2 A;  1E57 A;  2P6H A;  1K45 A;  2XVL A;  3P1I A;  4JHT A;  4MYE A;  5BNO A;  3LKJ A;  5D8A C;  5DAB A;  2WO3 A;  2WZE A;  1ZX5 A;  3JQX A;  4QX1 A;  2JG9 B;  2NN8 A;  1NLQ A;  1S2E A;  4GZ9 A;  1IPK A;  4UFH A;  3ZSK A;  2PMW B;  5C3R A;  1VB2 A;  3O1T A;  3USS A;  1W8Z A;  4CCM A;  1VRH 1;  3KGZ A;  4LT5 A;  1VBC 3;  2DBN A;  1AHS A;  2YBP A;  5FQ0 B;  3VKM A;  1TNR A;  4IW3 A;  4FCA A;  1OH3 A;  1CZT A;  2JXA A;  2VBP A;  2ZTN A;  3DF0 A;  3H8U A;  5DPN A;  3WR0 A;  4D7Y A;  2WQ4 A;  3VBF C;  5JXH A;  2WNE A;  3LOB A;  4YVW B;  2Q8O A;  5FAX A;  2BFU L;  5FJH A;  1CAU B;  3K3N A;  3N9P A;  1V6O A;  2JDU A;  4LUM A;  1G9C A;  4HSJ A;  2GAU A;  4P14 A;  4PQQ A;  5HXV A;  3WP5 A;  1LR5 A;  3JXS A;  1FOD 2;  3WNK A;  5SV5 A;  1Q5O A;  1FPN 3;  1H2L A;  3AMH A;  1K3I A;  1UIJ A;  2Z79 A;  2XXZ A;  4NAM A;  2E26 A;  3H3Z A;  1PGL 2;  2LTN A;  1ULP A;  2Y64 A;  5CZK A;  2R1D A;  1DLL A;  3VBO B;  1RUE 2;  4RGG A;  3ZXF A;  1UMZ A;  2ZZJ A;  1IHM A;  1UL9 A;  2DUQ A;  1W6O A;  4CU6 A;  2R04 1;  3KCC A;  1OOP C;  1WWY A;  1V6N A;  4H2A A;  4MGT A;  3LFI A;  2OZJ A;  4LK6 A;  1G7Y A;  3BN6 A;  1UYP A;  4LQR A;  1UU5 A;  4NE9 A;  1MS1 A;  3HMY A;  5K0U C;  3OF1 A;  3HD8 B;  1IQD C;  2MEV 2;  3K77 A;  2VL4 A;  3HQR A;  4XVH A;  5KR7 A;  1RUJ 1;  4OHW A;  4Q4W 1;  4FFH A;  1JZ6 A;  2BWA A;  3AYD A;  2P1B A;  3LAG A;  3TEZ A;  3JQW A;  4A7K A;  1W6M B;  2YY1 A;  3CQO A;  2X53 S;  3ILR A;  3ZVX A;  1UX6 A;  3RMX A;  2VME A;  4GUL A;  4JHZ A;  4RYD A;  2SBA A;  4PT6 A;  4HN1 A;  4AF9 A;  2IUW A;  1SLT A;  5FPV A;  5T5O A;  4QQP A;  3OPZ A;  4YNI A;  3OEB A;  4DFS A;  3C7E A;  3MIH A;  4NIH A;  1OC1 A;  1MEC 2;  1Q8V A;  2NLR A;  5C9A B;  2W92 A;  2JG9 A;  4HKO A;  4LKF A;  4CUA A;  3S5Q A;  2WFF 3;  5A3N A;  4L9B A;  1NX9 A;  5CKQ A;  1QY4 A;  5I0S A;  3GBW A;  3VHR A;  4D7S A;  4I3G A;  3VD7 A;  2ZS6 B;  1X36 A;  5FQ0 A;  5L9V A;  2D3S A;  2PHF A;  3SCF A;  3SHR A;  2C9A A;  4KWL A;  1VBD 2;  1V0A A;  1LEM A;  2XQX A;  1VBE 2;  2ZGT A;  4E27 A;  1DZR A;  4YVW A;  2VU9 A;  4XOG A;  1JH5 A;  2PHT A;  3FZ3 A;  4HKL A;  3WQB A;  2QUO A;  5I8T A;  1CAU A;  1JU3 A;  2P2K A;  3DL3 A;  5FZE A;  5JDB A;  1ULF A;  2Y0O A;  3WDU A;  1PX4 A;  5LB6 A;  1WA6 X;  1J3R A;  4LR4 A;  1EUT A;  3T1M A;  1QJY 1;  1W9S A;  4DXZ A;  4NPR A;  4C0B A;  2WAB A;  2ZGR A;  2WJS A;  4A42 A;  4FPH A;  3VZK A;  4QB6 A;  1ZM1 A;  2XUM A;  4LBQ B;  5LY2 A;  4YZ3 A;  2R06 3;  4IEP A;  4LO6 B;  1GWK A;  2A6X A;  3F2Z A;  3HN1 A;  4IEV A;  1IOA A;  2VMD A;  4RSU A;  1JOD A;  3VBO A;  3VZJ A;  3FFZ A;  1KS4 A;  3KMH A;  3M3I A;  5IUQ A;  5IAT A;  5A7Q A;  1O6U A;  1RL3 A;  1VE0 A;  1PK6 C;  4KI5 M;  5CAD A;  2QQO A;  4IGP A;  4L97 A;  1SDD B;  4N43 C;  4B4P A;  4DXR A;  1DYK A;  1NQD A;  2XG3 A;  1F4H A;  3B94 A;  1H2K A;  3FN9 A;  1N1S A;  5E16 A;  3U75 A;  3WF0 A;  1LCL A;  3BI3 A;  3S30 A;  5BUV A;  4IL7 A;  4L2N A;  1EAH 2;  4QPW A;  4UAP A;  4FPL A;  2WBK A;  3OD4 A;  4DRR A;  4YM1 A;  2WT1 A;  1F5F A;  3O1U A;  2HWB 2;  3DPR C;  4GA9 A;  3WCR A;  2ET1 A;  1JYN A;  4UWD A;  2PHL A;  5DZE A;  2P34 A;  3ZFF C;  2FDJ A;  3S57 A;  1H8T B;  1TQ5 A;  2ZA9 A;  4UW5 A;  1W6M A;  3BYW A;  4EN8 B;  3BUC A;  1TMF 2;  4UFM A;  5LK5 A;  5LEK A;  3GZT B;  2OQ6 A;  3JBG 2;  3RWK X;  1NYW A;  2Y26 A;  1L7L A;  2GH8 A;  4WM8 C;  3HOB A;  5DQ0 A;  1YFY A;  2A73 B;  2Z2S B;  4K7J A;  1RUC 2;  5IFT A;  2RMU 1;  5C9A A;  1N1T A;  3HPN A;  4KH9 A;  3NNF A;  1BHG A;  1XU1 A;  3FBY A;  3ZDV A;  2D5H A;  2Q1Z B;  2KD7 A;  3D0J A;  4DIN B;  4NRP A;  1GSL A;  3ILF A;  3I3D A;  5DAQ A;  2RR1 1;  4M4P A;  4FOQ A;  2Q8E A;  4AW7 A;  1POQ A;  1LGN A;  4AEM A;  1SEF A;  3EYP A;  1SZB A;  5JXJ A;  1EPW A;  2HEW F;  1KEX A;  2V72 A;  4K3U A;  4XMA A;  2Q8D A;  2A3W A;  1GP4 A;  3M4F A;  1GZC A;  2VNG A;  5B2G B;  5DAW A;  1LTE A;  3VBU C;  1T6B X;  1UOJ A;  2D40 A;  4LBQ A;  4QDR A;  3ON7 A;  4D69 A;  5IVE A;  4A44 A;  1UCX A;  1V9U 1;  2D6P A;  3D3A A;  3OGR A;  1RUH 3;  2QQJ A;  4L92 A;  2QZ2 A;  3OSD A;  2BOJ A;  5FKB A;  1D0G A;  4XTM A;  3AVR A;  4NMI A;  3AK0 A;  4QGL A;  4CDU C;  3PUQ A;  4M3C F;  4Y5Z 0;  4OI1 A;  3FBM A;  2LRO A;  4RS5 B;  4LBM A;  1PIV 3;  2XLA A;  4D94 A;  4FTB A;  1WW6 A;  1COV 2;  1OQ1 A;  2WDB A;  2WIN B;  4RHV 3;  5F6K A;  1CJP A;  1AR9 1;  2ZGU A;  1GUI A;  4LTA A;  4WM7 C;  4DNY A;  4DXT A;  5M0T A;  4NO4 A;  1US3 A;  5FPA A;  1H9W A;  2JDY A;  4CP9 B;  1RMU 1;  3EBR A;  1H8T A;  1X33 A;  2VZ1 A;  3R4U A;  1MAC A;  1YXW A;  4H7L A;  1IS6 A;  2B39 A;  2J1A A;  1NLR A;  3VUO A;  2HLE A;  2Q4S A;  1J3Q A;  1R1Z A;  1LHW A;  4MET A;  2CYF A;  1R09 3;  5KBF A;  1W3V A;  3MHZ A;  1WD3 A;  3E1F 1;  3I7D A;  2RJL A;  4YGC A;  1YEW A;  3N9L A;  5GLZ A;  5T5L A;  1DLC A;  1QMJ A;  1WLW A;  2GZW A;  1HRI 3;  2V73 A;  4Q4Y 2;  4W6Y A;  2PTM A;  4F3J A;  5DMY A;  2RV9 A;  2IXH A;  4AQS A;  1RUF 3;  4XYX A;  3ECQ A;  3D8C A;  4W4Z A;  2YXS A;  1BVP 1;  1QNW A;  2Q0A A;  3KGL A;  2RS3 2;  2JD9 A;  4CP1 A;  1ZBA 3;  1NAE A;  1WA4 A;  2VCC A;  4DIQ A;  3AMN A;  3J8F 3;  5A3L A;  3TN9 3;  4GIQ A;  2GNM A;  3ATG A;  1XE7 A;  3ZYF A;  1DGR A;  4KGG A;  3TOJ A;  2ZGL A;  4IEZ A;  1YFW A;  4YGE A;  1ZA7 A;  1DQ4 A;  3U10 A;  3LOI A;  3WW1 A;  4BMB A;  1N3Q A;  1MPX A;  3T0A A;  3OEA A;  5T5P A;  2HWE 2;  3HWJ A;  5F3E A;  4AQ6 A;  3UKV A;  3AJZ A;  2PQS A;  2P6C A;  1D4V B;  5A80 A;  1ND2 B;  4LA3 A;  2YBK A;  1WLC A;  1QQP 3;  1WCK A;  3MW4 A;  1UO9 A;  1QOT A;  3NO8 A;  5C8C C;  2CAV A;  1OQE A;  4ZKT B;  5A32 B;  2BRT A;  3IN9 A;  4P9W A;  1C8M 1;  2IXI A;  1W0P A;  3AKS A;  5CFC B;  2YMZ A;  4MGS A;  5JSP A;  2A6Z A;  4RS5 A;  3H42 B;  1SMV A;  2FCV A;  4Z2A A;  2EF6 A;  2QFE A;  4XDP A;  4B4R A;  2R07 3;  2EIC A;  4Y33 A;  1A8D A;  2P5B A;  3USU B;  1AXY A;  4BM8 A;  3BTY A;  1V6K A;  4CP9 A;  4LBO A;  3VKO A;  3GZA A;  4QPG B;  4ASM B;  1G86 A;  2OUH A;  3FHQ A;  1XC6 A;  5E89 A;  2W95 A;  3MW2 A;  3LEM A;  5FZ8 A;  4XC9 A;  4BXF A;  4QX3 A;  1AL2 2;  1BXH A;  2GND A;  2ET7 A;  1OI6 A;  3NNJ A;  5F2W A;  4IV1 C;  2W39 A;  3ZN6 B;  3PIG A;  4C1X A;  4UW6 A;  3ZKU A;  3ITQ A;  4FQZ A;  4AED C;  4NRO A;  4Q4X 2;  5DZG A;  3RVH A;  4N9H A;  5FO8 B;  4DEV A;  5K9Y A;  5FUI A;  2QQN A;  5GM0 A;  1O4Z A;  5C71 A;  4Y1U A;  4AYU A;  3AKQ A;  1KJL A;  4RGA A;  5FZF A;  2WYF A;  4QMA A;  4YW6 A;  4CDW B;  2A7A A;  2P37 A;  4AWD A;  3U0Z A;  4HAN A;  4DOU A;  2D93 A;  4QXB A;  2D97 A;  2HYK A;  1WCU A;  2OX0 A;  3HQU A;  4V2W A;  5DUU A;  1RHI 2;  3AZZ A;  4WZF A;  1ENR A;  2R06 2;  1QWR A;  3RG0 A;  4O9E A;  4XHX A;  3VHP A;  5BV6 A;  4TYS A;  3ACI A;  4FPG A;  3UES A;  1B35 C;  3KHC A;  1BLZ A;  1Z78 A;  2WR9 A;  3P3P A;  4YYO A;  1R1A 1;  4ZXK A;  4Y3O A;  3FWE A;  3WHT A;  1WCD J;  1O3S A;  1ND2 A;  4XZP A;  1TG7 A;  4PI0 A;  4DO0 A;  2ZHL A;  3KLS A;  4WVZ A;  2XH6 A;  1O5U A;  4C90 A;  2OXB A;  5D8A B;  2QCS B;  3FUO A;  1AZD A;  4FPK A;  4COZ A;  4YSF A;  2W08 A;  2W3J A;  5A32 A;  3K51 A;  5CFC A;  3IDE A;  2V4V A;  4AOC A;  1FMD 1;  3O1S A;  3H1Y A;  4YZ4 A;  1ZYB A;  5FZH A;  3S0M A;  5FZL A;  4GD4 A;  5T55 A;  1PO1 3;  4JZR A;  3ZX7 A;  1SLL A;  2EIB A;  2FCT A;  2PLV 1;  4XJA A;  1HB2 A;  1D4M 1;  1QJX 2;  5A3P A;  5JMO A;  3N36 A;  1UZV A;  1PVC 3;  2W0X A;  2XOM A;  3KWV A;  3GJA A;  4XFB A;  5FY0 A;  5T50 A;  4FOV A;  4R9B A;  4BQW A;  5DG2 A;  3HEI A;  1UZW A;  2HEV F;  3PVN A;  4M4R A;  3ABZ A;  2VUA A;  1GQG A;  1EV1 3;  4QPG A;  5DUW A;  4DQA A;  3MLJ A;  2VVF A;  3RFR A;  4C91 A;  2DVF A;  1SLC A;  2WAA A;  4IEW A;  2XHN A;  2ZGK A;  5L7O C;  1G9F A;  1G9D A;  5LEJ A;  4UFL A;  2XVG A;  4OUS A;  4LJH A;  3ZN6 A;  1XXN A;  2HWF 1;  1ASJ 3;  3WDV A;  3FLR A;  1S0D A;  1UYZ A;  3WF4 A;  1X9P A;  4K9S A;  1UMH A;  2WWU A;  2J1T A;  1BK1 A;  1WLT A;  3LE0 A;  2FDI A;  1Q8Q A;  3AZX A;  4OHX A;  4XFG A;  4J1X A;  2R0F A;  2Y6H A;  1I5P A;  1OOP B;  2VH9 A;  5FMB A;  4AVC A;  3KVA A;  4NN0 A;  3WQ7 A;  3WUD A;  4BA6 A;  5H9R A;  2OKX A;  4CDW A;  1FNZ A;  2IXL A;  1K5M C;  3AYC A;  4IV3 C;  3RJR A;  5K0U B;  2CTV A;  4B29 A;  3WDW A;  3LEI A;  3UKN A;  3ZYB A;  4EWD A;  2UY9 A;  3WNN A;  1YI7 A;  3WW4 A;  1JOP A;  5FZ9 A;  4C1W A;  2ZAB A;  2I74 A;  4GB3 1;  4YW5 A;  4N7U A;  4HK8 A;  1VBA 2;  2ZEX A;  3ZN5 A;  3GF6 A;  1CAV B;  2QKD A;  1XYO A;  2DCZ A;  5C7G A;  1PO2 1;  4D0Q A;  1XB9 A;  3EQE A;  1O7F A;  4QKF A;  2VUL A;  5FXW A;  4BU2 A;  3C8X A;  3ZXJ A;  3K2O A;  3MPP G;  2PHX A;  3JD7 1;  1FOD 3;  3ZR6 A;  5D8A A;  5J09 A;  4UFJ A;  4CCJ A;  5APA A;  1J59 A;  4I0B A;  2ZX1 A;  4YM0 A;  5DAV A;  2J1R A;  1VR3 A;  4V2V A;  3T0B A;  2ADE A;  2W5F A;  4P9G A;  5FP3 A;  4AHX A;  5IHR A;  3BTA A;  2V4A A;  1GNY A;  5IK7 A;  4HZF A;  5C4W C;  4A2U A;  1SPP B;  4HBN A;  3ASI A;  1BMV 2;  5FTT C;  2K0G A;  2QDN A;  3Q9O A;  4GQ7 A;  5F2S A;  3D0S A;  5C3Q A;  3KS7 A;  2RS1 3;  1UZ0 A;  3LFM A;  2CDP A;  5FMO L;  1XRU A;  1H1I A;  2O1Q A;  2JDN A;  3H50 A;  5E1R A;  1PGW 2;  3RI8 A;  3THP A;  1R09 2;  3ZIX A;  1XQN A;  1JYW A;  1J84 A;  1W9T A;  2JG8 C;  2MEV 3;  1TNF A;  1RUO A;  2VTX A;  5FZG A;  4Q4V 2;  1JYV A;  2OA2 A;  1AXZ A;  2DTW A;  2I45 A;  3VD5 A;  3HNY M;  4R9D A;  4HON A;  5FKC A;  5I91 A;  4XJ8 A;  2BNM A;  2RG4 A;  2GP5 A;  4Q8K A;  2AAC A;  2CSG A;  3AM2 A;  1WMD A;  2BUK A;  4LEJ A;  3LQC A;  4JDN A;  3NQH A;  1C8N A;  1NCQ C;  1YNA A;  4QXH A;  3ZPY A;  4E4D X;  1PK6 B;  4QKD A;  1UKG A;  3WP4 A;  4BHP A;  4N43 B;  3ILN A;  1OOP A;  1Q56 A;  2J22 A;  4CCC A;  4OI0 A;  5C3S A;  2JIJ A;  3AL5 A;  5GZG A;  1BBT 1;  1MEC 3;  2JEN A;  4XFI A;  3E6C C;  4A7Z A;  2E7A A; 
#chains in the Genus database with same CATH homology
 3N9O A;  3PUA A;  5A7S A;  4AI9 A;  4DIQ A;  5E6H A;  4CCM A;  5A3P A;  3PU3 A;  4EZ4 A;  4UF0 A;  5FYZ A;  5FY0 A;  3OPW A;  2YBP A;  2WWJ A;  4QWN A;  4LIT A;  4QX8 A;  4LIU A;  5F5C A;  2GP3 A;  5FYH A;  4C8D A;  5IVC A;  3KV6 A;  4IGO A;  5FJH A;  3KV5 A;  3K3N A;  3N9P A;  4D6Q A;  4BIS A;  4QXC A;  5F3E A;  5FP7 A;  4AAP A;  2PXJ A;  5IW0 A;  5A7O A;  4CCL A;  4QX7 A;  5A7W B;  5A80 A;  2OQ6 A;  2YBK A;  2YBS A;  3LD8 A;  2XXZ A;  3UYJ A;  5FZB A;  5FV3 A;  2WWU A;  4TN7 A;  5ANQ A;  5K4L A;  5A3W A;  3PDQ A;  3PU8 A;  4CCN A;  3KVA A;  2OS2 A;  4D6S A;  5FZA A;  5A7P A;  2VD7 A;  5FWE A;  4XDP A;  3DXU A;  4CUG A;  4Y33 A;  3N9N A;  3OPT A;  4UF0 B;  4ASK A;  5FWJ A;  2P5B A;  5FYY A;  5F5I A;  5FZ1 A;  4NUB A;  2Q8E A;  5FZ9 A;  5KR7 A;  2XML A;  5FP9 A;  4HOO A;  5IVJ A;  3AVS A;  2Q8D A;  5FZ6 A;  4CCO A;  4URA A;  2OT7 A;  4CCK A;  2YPD A;  5FZ8 A;  4GJZ A;  5FPL A;  4BXF A;  4BU2 A;  5FXW A;  5F3I A;  5F39 A;  3DXT A;  5LW9 A;  3K2O A;  5FXX A;  5CEH A;  5FXZ A;  5IVE A;  5F2W A;  5IVV A;  5FY8 A;  5FY9 A;  5FPU A;  3PUR A;  3KV4 A;  5FPB A;  5FYM A;  5FZO A;  3ZPO A;  1VRB A;  5FPV A;  5A1L A;  2XDV A;  5F32 A;  3RVH A;  4CCJ A;  3AVR A;  4XDO A;  5FYT A;  5F5A A;  5FY1 A;  4D6R A;  3PUQ A;  5LY1 A;  5FYI A;  5A1F A;  4V2V A;  5IVB A;  4EYU A;  4Y4R A;  5A3N A;  5FP3 A;  3LDB A;  5FZF A;  5FXV A;  4CSW A;  4QU1 A;  5FJK A;  5FP8 A;  5FY4 A;  3U4S A;  4LIV A;  4EZH A;  5F37 A;  5F2S A;  5FZM A;  4QXB A;  2OQ7 A;  3NJY A;  3N9M A;  5F3C A;  3AL6 A;  5FYS A;  2OX0 A;  5FY5 A;  4V2W A;  5IVY A;  5IVF A;  5FPA A;  5ISL A;  5FZ3 A;  5A7N A;  5FP4 A;  5FYB A;  3PTR B;  5A3T A;  5FBJ A;  5FZ0 A;  5FZG A;  5FZ4 A;  5FZD A;  5FZE A;  2XUE A;  5IWF A;  5FUN A;  2YU1 A;  4E4H A;  4HON A;  5A7W A;  4Y3O A;  2GP5 A;  5FY7 A;  3KVB A;  3KV9 A;  2W2I A;  3N9Q A;  4IGQ A;  5FYC A;  5LY2 A;  4DO0 A;  5F3G A;  5FYV A;  3U78 A;  3N9L A;  5FZO B;  4GAZ A;  4QXH A;  3ZLI A;  5FZ7 A;  2Q8C A;  5FZI A;  5FZC A;  5A7Q A;  5FUP A;  4LXL A;  5FZK A;  3PUS A;  2YU2 A;  3K3O A;  4IGP A;  3AL5 A;  5FZH A;  5FYU A;  5FZL A;  4GJY A;  4GD4 A;  5LWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...