5A3WA

Crystal structure of human plu-1 (jarid1b) in complex with pyridine-2, 6-dicarboxylic acid (pdca)
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
462
structure length
455
Chain Sequence
b'SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKARDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
publication title Structural Analysis of Human Kdm5B Guides Histone Demethylase Inhibitor Development.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 151
structure length 455
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a3wA01
4GJZA 5FY8A 5LY1A 5FYZA 2YBSA 4EYUA 4IGOA 4NUBA 5FXXA 5FYYA 4QX8A 5FZ9A 5FJKA 3AL5A 2OS2A 3KVAA 4V2WA 5FP8A 5FV3A 5IVFA 3N9MA 3AVRA 3N9LA 4XDOA 3DXUA 5F3IA 5FZOA 5FXZA 2Q8DA 5FYBA 5K4LA 3N9QA 3PUSA 4AI9A 5A3PA 5A7OA 4EZ4A 4XDPA 5A7PA 4CCKA 5FP7A 4GD4A 5FZFA 2XXZA 3OPWA 4HOOA 4LITA 4CUGA 3KV6A 2Q8CA 2Q8EA 5IWFA 5IVEA 2OT7A 5FZ4A 4BISA 3PURA 5FZOB 3LDBA 2W2IA 5FZ0A 5IVYA 3NJYA 5FPAA 5FWJA 4D6SA 4BU2A 3UYJA 5KR7A 5F3GA 4UF0A 5FZCA 3KV9A 5FZ7A 4EZHA 3U78A 4D6QA 5A7SA 2GP3A 3N9NA 5IW0A 5FBJA 5FZHA 3KV4A 4BXFA 5FZ3A 5FYTA 5IVCA 4CCJA 5FPUA 5A7NA 4LIVA 5FZ6A 5A7WA 5F5AA 3U4SA 5F37A 3K3OA 4UF0B 4HONA 2YBKA 5IVJA 5FY0A 2P5BA 5A7QA 5FZEA 4QXBA 5CEHA 5FY4A 2YU2A 4GJYA 4DIQA 5FJHA 3K2OA 5FZ1A 2WWUA 3N9OA 4CCLA 2OX0A 5ANQA 5FYUA 3ZLIA 5A1LA 4V2VA 5FZKA 5A7WB 4LXLA 5FPVA 5FYIA 5FPLA 5FPBA 3KV5A 5FZLA 3KVBA 5FYCA 2OQ7A 5F2SA 5A3NA 5LY2A 5FY1A 2XDVA 5IVBA 5ISLA 3AVSA 4Y3OA 4QXHA 5FZMA 2XUEA 2YPDA 5FZ8A 3K3NA 3DXTA 4AAPA 5FYVA 1VRBA 4LIUA 5FWEA 4QWNA 4QX7A 3PUQA 5FZAA 5IVVA 3PUAA 5FZBA 4Y4RA 2PXJA 5F5IA 5FY9A 2VD7A 5FUPA 5FZGA 4DO0A 2WWJA 5FUNA 5LWBA 4IGPA 5A3WA 4Y33A 5FYSA 5F2WA 2GP5A 3N9PA 4IGQA 5A80A 3ZPOA 4E4HA 5FYMA 4URAA 5FZDA 3LD8A 5F3EA 2XMLA 3PDQA 5FP9A 4ASKA 4CCMA 2OQ6A 4CCNA 4D6RA 2YU1A 5F32A 3PU3A 3AL6A 4CSWA 5E6HA 5FY5A 4CCOA 5F3CA 5F5CA 5FP4A 5FYHA 3PU8A 5FP3A 2YBPA 4GAZA 5FXWA 4C8DA 3PTRB 5A3TA 4TN7A 5LW9A 5F39A 5FY7A 4QXCA 3OPTA 4QU1A 5FXVA 5FZIA 5A1FA 3RVHA
chains in the Genus database with same CATH superfamily
2CU5A 4GH4A 1O3RA 2PAMA 2ZGKA 1GBGA 3SQOA 4DZGA 4MZUA 4U36A 1NXMA 2ILMA 5FZ9A 3OEBA 3PIJA 2VNRA 4HVRA 1CZTA 3AYCA 5KBFA 3LOBA 3VHRA 3TEWA 3KF5A 4PI0A 4BK4A 3N9LA 5APAA 2NMOA 1RUJ2 5J96B 5CFDC 1OA3A 1PM7A 3PUSA 1AZDA 1NKGA 1JYTA 4XDPA 1C1FA 5FP7A 3WDWA 1J58A 3RZLA 1HRI3 1N1YA 1IG3A 1QDOA 4HOOA 5EV7A 5TSWA 3Q8FA 3W5NA 1LHNA 2E33A 3RMXA 4R9DA 4YFWA 5BNPA 1PK6A 2W2IA 3LDBA 4CEYA 4HPKB 5FWJA 3WW3A 2LROA 3OUJA 1RUI1 2OUHA 2Z2SB 4AQ6A 2Z42A 4XAAA 3NV4A 4IE4A 1S2BA 2FDGA 4LLOA 1XSQA 1AXZA 4XYXA 5KXDA 1R091 4WM7A 3N4MA 4OHXA 3N9NA 2FBEA 3GBWA 3OUIA 2GC0A 2XL7A 2ZHLA 1KD7A 2VJXA 4QQOA 1AYM2 1NLQA 4BXFA 4ES8A 4FI9A 3O1PA 1EPZA 3OBZA 3BKZA 4SLIA 3CLPA 1ACCA 3J7MA 2FCUA 3CF6E 4RQPB 4A7KA 3JUUA 1PVXA 3J4UH 4R4ZA 1VALA 4QM8A 2FDKA 1LEDA 1EP0A 3MW2A 2J22A 1XXNA 1HLCA 1OOPC 3MLKA 5I91A 4PDWA 1JS9A 1VRH3 2BNMA 1X7NA 1QMJA 3VBHA 5A33A 4CEWC 2ZGQA 2GH8A 1O4ZA 5F6LB 1D4VB 5FZLA 1ASJ3 1H2NA 2JG8A 2R49A 3RDIA 1ST8A 1URXA 1CAXA 2HYXA 2W95A 4LOSA 4QHZA 1JYNA 3H8RA 4LT5A 3AVSA 5I8SA 1CPNA 4CP1A 5T5JA 2RV9A 2W47A 1VBE3 2QQIA 3GALA 5FYVA 2ZHKA 3LIHA 3O1OA 2RVAA 4UFIA 4QWNA 1GYKA 1CD3G 4MGZE 2NZ9A 4CUBA 1SFYA 4YG3A 1NLSA 2RE9A 1U5ZA 4WVZA 1SDDB 2YUEA 5JR2A 3AXEA 2VE1A 1HV0A 3IPVB 3KLSA 1RHI3 4PT6A 4P9XA 4XUTA 5FMDA 2J1VA 1W6OB 2KD7A 4K7JA 2RS13 5FYMA 2VY0A 2YFZA 4E4HA 1ZBE2 2PHXA 3J7LA 4ISQA 1NQDA 3FBYA 3WZ1A 3IDAA 5JUVA 4S2HA 5JI9A 1WMDA 2C5DA 3U75A 4X6QB 5BPXA 1RVF1 4P5YA 1W6NB 2HWD3 4YVWB 3WHUA 3MO4A 1IKQA 5IK5A 1ZZ7A 2R063 2G1MA 4W50A 1G9CA 1T6GC 3H3LA 1H1IA 1QU0A 3I2IA 5EPAA 5K0UC 1WLTA 2UU8A 2ERFA 2Q4SA 3L9JT 1W03A 3O1SA 1KEXA 2Y6HA 1WW7A 1YUDA 4CDUA 1CIWA 4FOYA 4Q4W1 1H8TB 1YYNA 2W1QA 4ASLA 1JHNA 2DBNA 2VNVA 4NJ4A 1K5JA 4CDQC 4IGOA 1VB4A 4P9JA 4NUBA 5AC93 3H3ZA 2NM1A 2E7TA 4GWNA 2CDOA 3IB3A 3HBZA 3OY8A 2DVBA 4QPIC 5JMOA 1PVC2 2LALA 1Q56A 4COYA 5C8CC 5IFPA 4K9SA 4OHZA 3QACA 4AQSA 2V5DA 4GH4B 2WKKA 4AGGA 2BQPA 1QJZA 1RUG2 2RDQA 1DGWX 2VOWA 3CJIC 4DMIA 5C33A 4Y1UA 1DQ0A 1YJKA 3JXSA 5J48A 2ZEYA 4XHXA 4EE2A 4NPMA 3LZZA 4XF1A 5AVAA 3ZYJB 1VBD1 4IE5A 3J26N 5SV8A 3VZOA 2V4AA 2Y64A 1VBA1 3LPFA 3U0ZA 3AXDA 1V6KA 4Q8LA 1QH6A 4A3ZA 4FQ4A 4XJAA 1SDWA 1GQPA 1RUI3 2CTVA 1BK0A 1Y9MA 1BXHA 4QGLA 4YFZA 3V0AA 2PLV1 4DRVA 4LTAA 3ZVXA 3IT8A 3LFIA 5KR7A 1PGSA 1Q3EA 5DZFA 3T2PA 1NAEA 1GFF2 2JDZA 4OMDA 5FMBA 4RHV3 4EWDA 4PI2A 2BZDA 1UMHA 1WW5A 3ZXEA 3AM2A 1WMXA 3CL1A 2X5IA 1PK6B 4HN0A 1WA6X 1XYOA 1X9PA 4CEYB 4XUQA 1R082 4TYSA 4N43A 4NWWA 3A21A 5A32A 1EV13 2GMEA 4LBQA 5A7WA 4IXLA 4R52A 4GA9A 3WQBA 3IAQA 5C3OA 5IVJA 1DIWA 4H14A 2P2KA 5I8YA 4AL9A 4WM7B 3VBFC 1HJFA 1JXNA 2BERA 1HXS1 1F4AA 3HT2A 4Y5TA 5DAVA 2JDMA 3BN6A 4PF1A 3URFA 3S30A 1KJRA 1G8WA 3ZLIA 2R0FA 3NV3A 2O0OA 1W6MA 2GN3A 3KQRA 4XQDA 5LBEA 1MZ5A 4B1MA 1NG0A 5DZEA 3ILRA 5ANNA 5LK7B 2Y0IA 1RB8G 1FXZA 3POYA 4QX0A 3NO8A 4MGQA 2RM21 3VKFC 4DFSA 3LIGA 1W2OA 4KG8A 1DBNA 2XDVA 4KGGA 5HCFA 5ISLA 5DUVA 3VGIA 4PDWB 3MLJA 2XUEA 3VBHB 3Q8AA 1YNAA 3DXTA 5A33B 3ACIA 2L9LA 1W2AX 1DQ1A 1O3SA 4CP0A 2Y8KA 3AMMA 3D82A 5F5IA 1OC1A 2H6BA 2JG8B 4HZFA 1CAXB 2VZRA 2WZPP 1JODA 5A3WA 5FPXA 2DCKA 3MIEA 3SMHA 2ZKLA 1XB9A 3PIGA 3RG0A 4LJHA 1V0AA 3ZPOA 5KC6A 1EPWA 2VW2A 4XEZA 1PO12 3BPSA 4K21A 3ZYHA 4BQ2A 2XGXA 4ZZ5A 4NPRA 2IUWA 5JOWA 4HLTA 1H6XA 1OF4A 4TXWA 3R4UA 3ES1A 5F1RA 4OI2A 3HQXA 4CA9A 3LA2A 4L2NA 1YC61 2Q1FA 2W68A 1GLHA 5F5CA 1MS8A 1JTZX 4UW6A 1T2XA 2ZX3A 1ULGA 5LA2A 4XQ4A 3VZMA 1PX4A 3B69A 4H55A 4CDXA 1WW6A 1AR72 3DEMA 5B4NA 1PGW2 2PHDA 1F5FA 1OF3A 4Q4W3 4FCAA 1RYYA 5FLJA 3GJBA 5A1FA 3NNFA 4W65A 4BJ0A 5FY8A 4AGRA 5DDJ2 3ST7A 1AR81 2YG0A 3NQHA 1ZRDA 4XBNA 1LEMA 5FO7B 1P8JA 2R072 3SH5A 3KVAA 3ZSJA 4UFLA 2EIGA 2XVGA 3K4ZA 2RS33 4Q1PA 3BUCA 3Q8CA 2CAUA 2AR6A 4GQ7A 4XUNA 4YVWC 3LCPA 4CDUB 2QJVA 3S5AA 5K4LA 2G19A 4IEQA 2HWB3 4LHLA 5HCAA 1R1A3 5A7PA 1VBD3 2X53S 4N8MA 2MPFA 4Q4V1 1VBA3 5EHDA 4E27A 2WS92 1JU4A 2R16A 4A42A 4ORFA 4XOGA 1COV3 1GP4A 1TG7A 1UIJA 2R042 2WFF2 4RS5C 3T0DA 1OUXA 1Y3TA 3RI8A 4YW3A 4BISA 4PCRA 2GNDA 4XHBA 3V64A 4KMQA 1AX2A 1LENA 1OPMA 4XFHA 4ARYA 2ARBA 4UF0A 3U1XA 3ENRA 2WNOA 2J1SA 3DYMA 1CJDA 1WLCA 2VW1A 3IBMA 5LBBA 4ASMB 1SACA 1Q8OA 2F4LA 5KWRA 5FZHA 2C0ZA 1CVNA 1IS3A 1LU2A 4BHPA 3TRSB 4GH4C 5FYTA 4AFBA 4E2GA 3MI8A 3NNGA 4IE0A 4OQ9A 2W94A 3QOPA 4GMP0 1H30A 3ZFEC 3ILFA 4FTSA 2XQXA 1H2MA 1WZXA 1HIXA 5ABJA 4PJYA 1YQ2A 2X5IB 2E32A 1ZNPA 5J7MA 3HMYA 2IXCA 2JD4A 1WCUA 2LW8A 4N43B 4NOTA 1QF3A 1PZ8A 2E63A 5A32B 3QLQA 5A7WB 1EUUA 1JHJA 1L7LA 4LBQB 5IK7A 5LATA 1QJY1 4LA2A 2XJSA 1OXCA 1QHDA 1C8M2 1ULDA 5F2SA 5BNPC 4JKMA 5DG2A 1SZBA 5A6YA 1ALYA 4AI0A 3CQOA 4R9AA 3K3NA 3SC7X 5CBLA 3FL7A 4AEDA 1W6MB 5FWEA 3MZHA 1QJU2 3WDXA 3P5BA 5C4WB 2E51A 5FY9A 4ZS3A 5FTTC 3LSDA 5IK4A 2IC1A 4Q8KA 1QJX1 2KXLA 4E2SA 3ALQA 5FYSA 4RA0A 5M0TA 1GU3A 2GP5A 2F4PA 1BJQA 2FQPA 2YXSA 4FPEA 4A4AA 4YVSA 4DRRA 1TMF3 1LHWA 2GMMA 5F3EA 2HWE1 1DG6A 2ZX2A 4Y1XA 3H1WA 1XNAA 3C7GA 2BGOA 1WMFA 3IM0A 1POQA 2GNMA 4F3JA 3VBHC 3KGZA 4ISRA 1BLZA 1V00A 3B00A 4LBQD 3ZFGB 4D7SA 4B4RA 1SLAA 2WJSA 2JG8C 2WZR1 4GAZA 2PQSA 1HRV2 3J8F3 4KWLA 2Y33A 1WBLA 3FUQA 5HPOA 4WVVA 1PIV2 3EO6A 3H9AA 2CGNA 1NZIA 3U11A 2BNNA 5GALA 3POIA 4FFHA 2Q8OA 1G6NA 2DVGA 4AR2A 2HJIA 2CL2A 2PHWA 4CU9A 3USUA 1KRIA 1W8OA 1YO8A 3I2HA 3RFRA 2YPJA 4Q4X3 4CDXB 2BOJA 3D4KA 5L9RA 1ODMA 1I5PA 2XONA 4YZ3A 5SV5A 5DAQA 1Q43A 5BV6A 3MYXA 2FD8A 1BK1A 2C26A 3O1TA 1MS1A 1PGL2 2H0VA 4CDWA 4YZ1A 5IT6A 3VL8A 1XBFA 2H0BA 2JWPA 3WQ1A 1XYNA 1ZA4A 4YW7A 5L73A 2D44A 4D0QA 3B94A 4JQRA 1FATA 1DF0A 3GZAA 2P37A 3T2TA 4Q4Y3 1R64A 1QXPA 1J1LA 1N1TA 4WM8A 3EB7A 4YPJA 3ZSLA 2QQMA 2VW0A 1OFNA 1VLNA 3NKTA 3NJYA 4QB2A 4XE9A 2DUPA 4N9IA 1N3QA 2IXJA 4C0BA 2Y26A 3SXWA 4HL0A 4XAEA 2B9UA 3D3AA 4BCUA 5BY5A 2JECA 3O5SA 3BTYA 4AYUA 3ZM8A 4WVMA 1W9TA 4FPGA 3UKTA 4CDUC 1AVBA 5EJZB 3LWCA 3JQXA 5LK5A 2ZGUA 4XJ9A 3QBQA 2ZHMA 3FJSA 4UF0B 4HONA 5LCWL 2JXAA 1W05A 5FY0A 3MW3A 3I2DA 1YI7A 4JDOA 4JHTA 3P6BA 2LM3A 2N7GA 5LEJA 1V9U1 3MBWA 5ACA1 2ENRA 5FZ1A 1F15A 1JZ5A 3WQ0A 5CZKA 2WDBA 4QDSA 4XUOA 1AR61 2VQTA 1YRZA 4O61A 4NR1A 3LOIA 4ET7A 2I45A 3ZXAC 5FPLA 3E6BA 3UL2A 5ABJB 1H1MA 3VBRA 1B09A 2RS51 1RUC1 1STMA 4KWKA 3RGBA 1BBT2 1H6YA 4CZSA 2EF6A 4AAPA 4LUMA 2B42B 1UW8A 4S2FA 3KZ4C 5CA6A 4QX7A 1OBNA 2IXHA 1QJX3 1NA1A 2DCTA 2JKBA 2PXJA 3FHIB 3IAPA 3N7LA 4TLGA 5LA1A 1VBC2 1MZ6A 2ZGLA 5FUPA 3VD7A 1OSGA 1CX4A 2BOIA 5EJ3A 4DO0A 2X5IC 1W2TA 5FUNA 3WINE 3F95A 1FMD2 3GM8A 5AFBA 3C7HA 3ZSKA 4KWUA 1ZYBA 3NV2A 1IQAA 3POGA 4AEDB 2VUDA 1IZ3A 3H7YA 2DUQA 1GMMA 3IMMA 2WLQA 3ZPYA 2BV4A 4A45A 4O65A 5D8AA 4BMEA 1XNCA 4JQTA 3WEZA 1NOVA 1WCSA 1XC6A 4CCCA 4FOQA 4OULA 1S0IA 3B3QE 3RZKA 4FO9A 1V6JA 2J1TA 2WZR3 1BCXA 3B9IA 1OVSA 3HN1A 2PHTA 1XSRA 4WV8A 4YVSB 1CWPA 2JEMA 1SLCA 3WW4A 2RR13 2XOMA 2Y38A 3DPRA 3FLTA 3M3OA 4Q0VA 1LHOA 3MGUA 4UXAA 1TME1 4DXZA 1HB2A 4JC1A 3TN91 3WW2A 2GH2A 4DUWA 3RVHA 2W08A 4EN9B 1OLMA 2OZ6A 1DLLA 4I0AA 3O0WA 5FMOS 1C5HA 4M4PA 3U14A 5FREA 1GWKA 2HYKA 3M2MA 4KH9A 4PLNA 5KHHA 2PQQA 2FDFA 2E26A 2ET7A 2WQZC 2FMDA 2VU9A 1OH4A 1W0NA 3N9MA 2OPWA 4JTOA 4L0PA 5FAXA 4CP2A 3BTZA 1IPJA 3UGFA 1SBEA 4BDVB 2XR4A 2WNVA 3A23A 1GUIA 4KGQA 1VIWB 3USUB 5IUQA 1QOOA 5EFUA 2WNUC 1WWYA 3OPWA 4MADA 5EZWA 3VKOA 3WF3A 3FLRA 1JH5A 2IFWA 1OI6A 4S2DA 3ETPA 2YGMA 2BFUS 3PURA 4NVPA 2MNGA 4CDWB 1NY72 3AMQA 4L97A 3AC0A 3AZZA 3IIAA 3OTFA 1FPN3 1ZBA3 4QB6A 3DL3A 4QQPA 4KU8A 3O14A 2GAUA 2VCAA 1Z7S3 4WM8B 3KV4A 2X09A 1HRI2 4FPCA 3N3HA 1E5RA 4GZ9A 1UY4A 4CCJA 1LHUA 4EROA 1CQ9A 4ZY9A 4XETA 1ULCA 3NV1A 1V9U3 5FBZA 4P9IA 3W9AA 2R6QA 1PMHX 4V1PA 3CNAA 3O1MA 4WVMB 5FY4A 1B35A 1PZ9A 1WGPA 4Y5SA 2K0GA 1AR63 4LA3A 2WWUA 3TBDA 4Y4YA 3I2OA 2RMU3 4QX1A 1ULFA 4JGZA 4BQWA 3FUOA 1AHSA 3VUOA 3KV5A 2P1BA 3KVBA 4COUA 5FYCA 3OGGA 4NRPA 5LY2A 5FY1A 2NYYA 4IQPA 1AYN2 1RJ7A 3OJBA 2TEPA 1RUF2 2VBPA 2VMEA 1EUTA 4IERA 3AFGA 2FDHA 1QNWA 2DF7A 3PUAA 1S2EA 2ARCA 3C2UA 2QDRA 3B9CA 1GOFA 1K3IA 2EA7A 4R8HA 3ME2A 5T54A 4SBVA 4IGPA 4MVTA 2BU9A 4XFGA 1O7FA 1SQ4A 2X8KA 5I0SA 1K5MA 3USSA 2EXIA 1RUE2 3WDUA 3R4DB 2CV6A 3P3NA 2IXKA 4URAA 3D5OA 2XVLA 4CU6A 2HWC3 4I0WB 5FFOC 1AR91 1NA1B 1VRH1 1QJFA 1N47A 3HQRA 3JBG1 2XMLA 3MUY1 4MV2A 4W6YA 1C1LA 4U2AA 2VOKA 5HXVA 1W0OA 1VBE2 3WXPA 2ZX1A 5JWPA 2ZGRA 1UOBA 1ASJ1 3WNPA 1QEXA 1AL22 1E5HA 3AL6A 5A3MA 1WLDA 3MICA 3IPVA 2VZPA 3FLPA 4IEXA 1W6OA 3BGAA 3VN4A 5B4XA 1X36A 4X8NA 1CAVA 1F9KA 2YC2A 3ROUA 1GNZA 4BQ1A 1TME3 1RHI2 4YARA 2WLPA 4IEOA 3TN93 5KHGA 1ULPA 3NNLA 3DUIA 5D8AB 2RS12 3AKTA 1FX5A 4K20A 3WX5A 4AW7A 2X10A 4FPHA 3WF1A 2W39A 3PHMA 2YDEA 3AMHA 3R4SA 4ARXA 2A71A 1AF9A 4UBHA 4A6OA 2TUNA 4YM0A 3O1UA 1L7RA 3ZX7A 2ETEA 2HWD2 5FJKA 4Q26A 3ZR5A 2UURA 3W21A 2MEV2 1XE0A 2AUYA 2QFEA 4MGKE 4O9EA 5DG1A 4TZDA 2QNKA 2YV8A 4Q0PA 3VD3A 1QOTA 3A0NA 2AH2A 4YVSC 1JZ4A 2PELA 3INAA 4TWTA 1XNTA 3AP7A 4NIAA 3LDKA 4P9YA 3KHBA 1BKZA 2R061 2Z69A 3MIGA 5T5PA 3LDRA 2Q8EA 4B29A 2G4IA 4CCDA 5FZ4A 5DQ0A 4UW4A 3ZXJA 4CE8A 1LR5A 4L8QA 1S0EA 2BBAA 5DAPA 1O4YA 2Y0OA 1NCQA 2WNVB 5A3UA 1DQ4A 1YJLA 2K46A 4JHZA 3ZIWA 4CVUA 4AE2A 4EZHA 3N7KA 5JAXA 3BU0A 1J59A 5AC91 5A7SA 4XJUA 5IK8A 4HVOA 4EQVA 5IAXA 4QD2A 1Q8PA 4CXYA 1Q8VA 2Q1ZB 1HB3A 1J1TA 1IPSA 1XOYA 1BHGA 2F6BA 2WIIB 3U4SA 1DFQA 3RQ0A 3UT0A 5F37A 1RUI2 5J37A 2A5ZA 2LS6A 3DN7A 2C6SA 4YM1A 4RFRB 1EY2A 1R092 4CDWC 5HV4A 1GSLA 2XWJB 4B7EA 4YGEA 1TE1B 2P34A 5ANQA 5A1LA 5FK7A 5FPVA 5KHJA 2V5YA 5FPBA 2VMCA 4Z82A 1JN2P 4IV3A 4Q2FA 4JKLA 4WM8C 4LO8A 1LKNA 1A8MA 1B35B 4RHV1 5EQUA 5DZGA 1DQ6A 4Y3OA 3QD6A 2DWRA 3HIFA 3HPNA 2DVFA 5KC5A 1O6UA 3HD8B 3AJYA 4JGZB 1Y4WA 2D3PA 2FCVA 4P5HA 2B39A 4COZA 5D1IA 1EV11 1OQDA 1LGNA 5FQ0A 3UKVA 2FCTA 3MIDA 2W87A 5H9RA 2BEOA 2HWF1 1D0HA 4TTGA 4IEVA 5F2WA 2JDYA 3AP5A 3LEIA 1AR93 3ETQA 2ZEZA 3JBG3 4MLOA 3I2KA 5DUXA 3LFMA 3S7IA 2UYAA 5JR7B 2BWCA 1REEA 2D40A 2DUOA 3HBKA 2CSGA 2OQ6A 4M00A 3WP6A 5BNOC 2EIEA 5C9AA 5F32A 2V4VA 4W4ZA 1K5MB 2VTXA 3UESA 5KXEA 1VAVA 3BU7A 4GIQA 3U37A 2WUHA 4DUVA 1RXFA 5LEKA 4ZU5A 3VBRC 3BB6A 3VBOC 1LRHA 5L36A 1IG0A 4LOTA 3WCSA 1G9DA 5FZIA 5I0UA 4IEUA 5CNAA 4K1ZA 1MEC3 3VZLA 2XPJA 3P1IA 3OF1A 4LO7A 1RVF2 5LY1A 1CAVB 5JIAA 3WG2A 5BYNA 3ZKYA 2GC3A 3NNMA 5GZEA 1GZWA 4QXKA 4EN6B 1DQ2A 1V6OA 2Q8DA 1DZTA 1O5UA 1PO21 4UYBA 4N9HA 4NHLA 2IZWA 3RYPA 2VZUA 4AI3A 5A3PA 4DUXA 4Y26A 4Q4W2 1F5JA 3ITQA 4AFDA 4LKSA 5CG9A 1JI6A 4DEVA 1WCDJ 2D6MA 3WY6A 4BZ4A 3BI3A 5GLWA 2Y6KA 3H7JA 1XU2A 3O12A 1H2LA 1RITA 3CJXA 5DAXA 3ACLA 4UAPA 3GZTB 1QQP1 2VMIA 3PMEA 3SLIA 4GB33 2PAEA 3K4AA 4UWDA 4JDMA 3DPRC 5C3SA 1H8VA 2VAUA 3LEMA 1QNYA 2VR4A 1MS4A 1R1A2 1VBD2 3VHNA 5CKNA 1VBA2 1W8ZA 2XBO3 2WO1A 3THPA 2RS31 4XXAA 3FBMA 2D6KA 4IW3A 1NCQB 4A44A 1JYIA 1H9WA 2DFBA 2PLV2 2A1XA 2HWB1 4OFGA 1R1A1 1S0GA 5F5QA 4G9SB 1W6PA 4P9LA 1WCQA 1Y9GA 1FV3A 4XCAA 1COV1 5JMCA 1PMJX 2WN2A 3RJRA 5FYUA 3C8XA 1GWMA 1N1SA 5DN2A 3V65A 4GKYA 3MPBA 3I3DA 4W8JA 4HK8A 3KSCA 2XJQA 3OGJA 4LBOA 5A3NA 2P3YA 4AHWA 5J09A 2W46A 3RZHA 4YWAA 3LKJA 1XJAA 3W58A 1J83A 4AFMA 4CP9B 2XJUA 1HXS2 1D2QA 2D6NA 2JIJA 5FMOL 3ES4A 1POV0 5FO8B 3I7DA 2PYTA 4XFCA 4AFCA 1K12A 2HWF3 4LHKA 4IV3B 5GZCA 5FLIA 3TNPB 4I2OA 3PUHA 2W1SA 4AI1A 3T0AA 1AL0G 3UETA 2C24A 1LAJA 2RM22 3L2YA 3B02A 1UXZA 1UYYA 4A3XA 4AG4A 4TLFA 4DPNA 4DEQA 1KFXL 1US2A 5FPZA 2K2SA 4LEJA 1SPPA 1JYWA 3U07A 4K6BA 2WO2A 2WA3A 4XF0A 5C4WA 5BNQA 1G86A 4HMZA 5FQ0B 4LBKA 3I3MA 1B35C 2VCMA 4NAOA 1BEV1 2YB7A 1OURA 2BFUL 1PNGA 4Y24A 1UOJA 4JGZC 4QHBA 3NW4A 2GC1A 4LE3A 4NWVA 3NJVA 4RQPC 5FXWA 2ZMNA 5IFTA 3ILNA 4FPJA 1YCIA 4TN7A 4UFMA 5J98B 4F8AA 4YZ2A 3D0SA 3VDDB 5C9AB 4A41A 5C3PA 3OSDA 2Y34A 4QQHA 2NMNA 4MX3A 4NMIA 5FYZA 2XJTA 2FHRA 1HQWA 1VPHA 4G4FA 5FXXA 3APBA 3ZFGA 4N7UA 1C5IA 3M70A 4MXWA 1TMF1 4B4QA 2VL4A 3NL1A 1PO23 1T6BX 2GU9A 5F3IA 5FXZA 1D7PM 3MFCA 1GQGA 1SLTA 2W5FA 2BWAA 1UN1A 2CDPA 3K75B 3MIFA 2VTXJ 5A7OA 4MGIE 2FZ1A 3HQUA 2BGCA 3RPQA 4C0HA 4HBNA 4XIOA 5FZFA 2XXZA 4FTEA 3WOGA 2FZ2A 4LITA 2VM9A 3MF6A 1AR82 1S0CA 1IPKA 2WL1A 2ZKNA 4META 1OD3A 4KI5M 1WKYA 3SCGA 4ZU7A 1GZWB 3VB9A 3R0RA 3ZSMA 1QQP3 1HN0A 3J8F1 3JQWA 2PMWB 1S0BA 5E8AA 2ZAAA 1CESA 3ZMNA 2JE7A 3POWA 2OXBA 4HN1A 3SNMA 2ZTNA 1DGLA 5DXDA 3NMBA 3CKHA 5FIXA 4Q4V2 5IATA 2W1WA 5C71A 5LZ6A 3KCXA 4Q4X1 3M7AA 1LB2A 2VCBA 4I01A 3ZXKA 3GZEA 2VNGA 2AC1A 1MS0A 4XBQA 2UY9A 3Q8BA 4PIYA 4PIXA 1RINA 3NKGA 5A6QA 5CEHA 1W8NA 2ADDA 4ONUA 3VKLA 2YU2A 4GXLA 4LO5B 5JXJA 3THCA 2XHKA 4I0BA 4IEPA 4Q4Y1 1H8TC 2KM2A 4UI9L 3T4VA 3KF3A 3ZO0B 2RJLA 3WDYA 2JDKA 4H7MA 4XFAA 1FNYA 2NQYA 3B7MA 1W6PB 3AKQA 3PUIA 2A6YA 1OLME 2B7YA 1PVC3 1KGYA 2P17A 4MGSA 2XKPA 2RDNA 4UW5A 5FZ8A 4AEKA 2YFUA 1UYZA 4Q0UA 5J36A 2OVUA 3RMYA 4EV0A 2BTVC 3BTAA 1N3PA 2FDJA 1RUG3 1UWWA 2VTFA 4XACA 3ZYPA 5I8TA 1GQHA 2ZGTA 1QJY2 4QGNA 4ZHNA 3ACHA 3OGRA 4Y33A 1FV2A 1O3TA 2BBVA 3PVOA 3RI9A 1OA2A 1O8SA 4B4PA 1FI2A 1G9FA 3SKJE 3WD5A 3S0MA 2RDSA 4LO4B 5AVPA 5L7OA 4N53A 1SCRA 3K51A 5ERLA 3GBGA 4FFGA 3PDQA 3I3BA 5FKBA 1BEV3 2YMZA 3ON7A 4FBFA 1Y9QA 4CXWA 2W91A 4BIFA 1PK6C 1OKOA 1QJX2 4CSWA 4CEYC 1EAH1 4E8CA 3UV9A 1SCSA 2E7QA 4Z2WA 3KT1A 2AENA 4QKFA 4MGTA 1SPPB 2ZZQA 4C8DA 4PBPA 3S5QA 1RMU1 2I2SA 4NRQA 4WM7C 4AVCA 2HWE2 3WDVA 2TNFA 1UY3A 4J1WA 4FT8A 1GOHA 1DYPA 2VPVA 2JICA 4GJZA 4XF3A 5HXMA 3O0XA 2IWGB 2QQUA 3DECA 2VUJA 4P08A 3AYEA 1KDMA 1GZCA 4O9GA 4RR3A 1O59A 2WZR2 4GMP3 3ZXLA 4J1XA 2VQUA 4MH0E 2ZA9A 4PDWC 1APNA 2E53A 3GYDA 1KITA 5EYYA 3VBSB 2D97A 1UPIA 3E1F1 3N7MA 4JX0A 4Z1VA 3FHAA 1U12A 2P3IA 4MXWB 1GICA 4RFT0 3ZYRA 2VNOA 4INDA 5C9AC 1DZRA 2RR11 4RL7A 4IV1A 3O1VA 2RJ2A 3K48A 4UFHA 2VMGA 4JZRA 4Y22A 4IDZA 3MF9A 3NWKA 4P9GA 4XQWA 3DYPA 1V6IA 1UPSA 3NRUA 3K77A 2VOTA 3IWZA 1YFYA 1PO13 2WQ4A 2GP3A 2ZEWA 3WNKA 2RDRA 4EJRA 3I49A 3JD71 5CIRA 4PBOA 1UYXA 1I1EA 4UFKA 2WT0A 1K42A 5T50A 4NHKA 2D43A 2YBKA 2ZGPA 1US3A 3CU7A 4H7LA 4QGMA 4Y5Z0 2Q0AA 4OHWA 5K9YA 1DP0A 1NCRB 3T4HB 1IS4A 2QQOA 4IETA 5FZEA 5KHKA 1AR73 2QZ3A 3ORJA 4LKEA 3RWKX 3AZWA 5A3LA 1ZM1A 1VP6A 2E6VA 4YG0A 5DABA 3PNAA 5A70A 5C7GA 4NIHA 1RUOA 3AP4A 4Q1RA 5FYIA 1W04A 1S0FA 2CNAA 4LPLA 1D0GA 1V6NA 1RUD1 4AHZA 3PL0A 3I4IA 1UIKA 2R073 3AX4A 4AHXA 1FPN1 4CXXA 1ZBA1 1CONA 2WAOA 2DBIA 1V9U2 3RYKA 3AZVA 5ACA2 1XNKA 1Z7S1 4XC9A 2D98A 3AYAA 1NUKA 3BIEA 2WSUA 5CU1A 5J3UA 1AR62 1GWLA 1MS3A 2HEWF 2WS93 2WT1A 1CZSA 2AACA 3HWJA 4NROA 2F17A 3M1HA 1YIPA 3M4FA 3KB5A 2RS52 3BOPA 4C1XA 5JSPA 4IGQA 1RUC2 2R30A 2WFF3 5GZDA 5LRRA 1GZ9A 1AJKA 4F7ZA 1W2NA 2WR9A 1UD1A 4IE7A 1O5LA 4HKOA 2RMU1 5T5LA 1NQJA 1EAH3 2DFCA 2YU1A 2ORZA 5CISA 1W06A 1YFUA 5FY5A 3ZFFB 4NAMA 1I3HA 1R1ZA 1D4M1 1RMU3 5L7OB 4N53B 4OHVA 2D6PA 4C91A 3FE5A 4C90A 4ZXEA 1NE4A 4I3PA 1JMUB 4Y1YA 1ND3B 2PHFA 1QOSA 4BMBA 3KD4A 4NIDA 2XJVA 1KQRA 4N43C 4I09A 2QQNA 3UGHA 4OQ8A 1M4WA 2QE3A 3ZN6A 1YQ8A 5FP8A 4FTBA 1O3QA 5IVFA 3AKRA 1UZ0A 2A6VA 2HWC1 2ZMLA 4XJZA 3AVRA 3GXUA 3OD4A 4LQRA 3DXUA 3WG3A 3ZXDA 4CCEA 1OD5A 1WLWA 5JCTA 1TME2 3VHOA 2YY1A 3RSJA 2C4XA 3TN92 3OYWA 3BTXA 1W8FA 5LB6A 3CHXA 4DXSA 2VZ3A 3W59A 1BVP1 5C4WC 1JYXA 4FPKA 2VMHA 5H9QA 2LUWA 4RR3B 4XJWA 5CKQA 2J7MA 2QQJA 2C9AA 5HCBA 5J1XA 5JPNB 1UZVA 2YZ4A 4P02B 4ZONA 3TYJA 2B8MA 3KM5A 2DYCA 4XF4A 2LTNA 4XUPA 3GDBA 3TB0A 1AJOA 5GLUA 1VAKA 2QQPA 4QX3A 2ZMKA 1XE8A 2OA2A 5K0UA 2ATFA 4JGYB 1VMJA 3IKWA 3T1MA 1S1AA 5FCCA 1F2NA 4I02A 2VVDA 1CIYA 3JD73 4IV1B 3F2ZA 3MV01 1BZWA 4LULA 1W3VA 4Y22B 4AVTA 5IVCA 1QH7A 1ULOA 3ZFGC 4A2UA 1UY2A 2NPIA 3J7NA 5JXGA 3T3YA 1ZX5A 3J9SA 4YZ5A 2VVFA 2VZTA 5IAVA 4JRAA 1RL3A 1NT0A 1X8EA 2PHUA 2Q5TA 4GJYA 5FJHA 3K2OA 1W9WA 4FPFA 3ZYFA 2WYSA 1PIV3 4KU7A 2C9KA 2R1DA 3BYWA 4V2VA 3WF0A 1F8VA 4CRQA 2W1UA 1RUD3 4XMIA 3WUDA 2B5HA 1VB2A 3NVCA 4CDXC 4ZKTB 2XQRA 3ZYBA 3TOJA 1X8MA 3IZOA 1CN1A 3EYPA 3POJA 2JDPA 4JKKA 3E5XA 5DUWA 4O7XA 1TZOA 5E88A 4NN0A 1FOD1 1MVEA 3MIBA 3PUQA 5CYYA 4EN7B 2ARAA 3FC0A 1RXGA 4FXKB 5FZGA 2DCJA 4FQZA 1DYKA 4XFFA 3HT1A 2PFWA 4K40A 4ATFA 4EWEA 4FVVA 1UO9A 2GSYA 1UX6A 4GULA 4MUVA 4AI8A 2XLAA 4HG6B 5G05L 2EIDA 3H1YA 4PLOA 4R4XA 1G9AA 1Q8SA 1A34A 4KBZA 5EIYB 2BP6A 3WG4A 1A6CA 1X82A 4CTEA 2ZHNA 3ACFA 3M3CA 3MW4A 3VBFA 1CJPA 3H1MA 4XILA 3UKNA 2AYHA 1WD4A 4IUGA 3ECQA 3CBNA 1PNFA 4QM9A 4AFAA 1D4M3 2J1EA 1J3PA 2YC4A 1DLCA 4YYOA 3SITA 1GKBA 1W6QA 2XLFA 1ZRCA 5FP4A 1I9RA 1VMHA 2CGPA 5GZGA 5F39A 1KJLA 1UKGA 3OD0A 2KR2A 1AR92 1VRH2 2X05A 3MV11 3JBG2 1RUH1 2P6HA 2J42A 3LQCA 1ODNA 2ET1A 5K7PA 3CMGA 1XQNA 2ZGNA 5L9BA 1ASJ2 1J3QA 2H6CA 2VECA 2YBSA 4JRLA 1ZRFA 3ABZA 5ABJC 2D93A 2OS2A 4LKFA 4Z2AA 4IEZA 1SG3A 5T52A 4AWDA 3PMSA 2UYBA 3R05A 5EYXA 5LA0A 2Z4FA 5FZOA 4JAAA 5GLZA 4AVVA 1BBT3 2WABA 3WV6A 1MS9A 4XMAA 3ZDVA 4ATEA 1OLQA 3ZN6B 1RTVA 1DGRN 5E1RA 4CUGA 1MPXA 1UCXA 3FMGA 4Y20B 2EAKA 4LBLA 2VMDA 2OKXA 1GANA 1VBC3 2K9ZA 3GHNA 3BALA 4HXCA 4NPLA 4HSLA 5C8WA 1AX1A 2BUKA 3OYWB 4JV4A 1F4HA 4LMFA 4BU2A 1VBB1 4AEDC 1FMD3 1GNHA 2V09A 2O8OA 1MEC1 2SLIA 1WW4A 2XKOA 3KV9A 5FZ7A 3DCQA 3ZDSA 4ZPIA 5FUIA 2VQ0A 1CGPA 3I59A 3ZKUA 1N1VA 1LNSA 1LECA 2R062 1QXRA 4XFBA 3R6SA 2DDUA 4PHZA 1DZQA 1REDA 4L92A 4RGAA 4A7ZA 3WP5A 4YSFA 3E5QA 4HANA 5I0TA 5K0UB 4RR3C 2WQ8A 4M4RA 2YHJA 3SH3A 1W3XA 4NHYA 4M3CF 5AC92 3OBTA 2IFRA 2AEYA 3N9OA 5JIUA 1ZZCA 1GP6A 2Y6LA 3D8CA 4LXLA 1JUHA 3KCCA 4BA6A 2O8QA 2HLEA 3VD4A 1JU3A 5HI0A 2DTYA 4DY3A 4GB31 4IEWA 1LGCA 4GKXA 3OBRA 4B8EA 3WP4A 1YWKA 2JG9A 1RGSA 3NNJA 2XH6A 4AVSA 2YGLA 4JCKA 4AEJA 4QXHA 1FOD3 3WSOA 4IL7A 4FPYA 2DVDA 1LOEA 2XBO1 1D2SA 1ZZ6A 5FZBA 3NAPA 4DB5A 4AHYA 2OZJA 1ZZ8A 5JVVA 1OQ1A 4XCBA 2QQWA 1QIQA 3IIIA 4OI4A 4XIKA 5CB7A 4DS0A 2ADEA 3VZNA 3N9PA 1REFA 1OFSA 2BNOA 2R0HA 4LK6A 4RHV2 4CP9A 3V0BA 1BMV1 5FOBB 3ZFEA 1YFWA 4D94A 1PZ7A 2JDAA 4GWJA 2UY8A 3SISA 1U5YA 1G9BA 4LBMA 5KHIA 2ZAHA 4BM8A 1EV12 4BQ5A 3E6CC 3Q9OA 2IVJA 2HWF2 4D7YA 4EN0A 4LUKA 2KA3A 4XF9A 3WG1A 1JZ8A 2YBPA 3LEKA 1LOGA 1OH3A 4IEYA 1X50A 1RUH3 3FFQA 3VBFB 1JZ2A 1RUJ1 4DINB 1ONAA 2YROA 3OPZA 4ITCA 4HKWA 3RZMA 2QUOA 3A22A 2A7AA 1W6QB 4AAXA 4DXTA 1L7QA 1OLRA 1ZZ9A 2XHNA 3I3EA 4QX8A 4AZZA 3H42B 1XNDA 2OUJA 5CFCA 2XLGA 5FV3A 3W20A 3CEWA 3IN9A 4YM2A 1LOCA 4OI0A 2X29A 3VDDA 3DKWA 3VZJA 5JDBA 3I2JA 5DAWA 4LBNA 2J1AA 1ZZBA 1AYN3 2VUCA 3DGTA 2EXJA 2RJKA 1UX7A 2G9ZA 4XURA 1RUF3 4FFFA 1UKRA 3B01A 3LA7A 5FKCA 1AYM1 2NLRA 1XRUA 3LF7A 5IVEA 2OT7A 5DUUA 4QMAA 4FSJA 1I5ZA 3SCFA 2CY6A 5JLVA 2A3WA 2VZOA 4Y1ZA 5FZOB 1VBB3 5FZ0A 4BB3A 2BW8A 2DU0A 3FHQA 1PO22 1TVGA 1HV1A 2R1BA 1NA1C 1RUE3 4M3CA 2WC2A 4Q5OA 3NSTA 4N7IA 2WSVA 1W90A 4LK7A 3H8OA 2JIGA 1HKDA 1LHVA 5CKMA 5IHRA 3UGGA 1UOFA 2PTMA 1MQTA 3E5UA 3AKSA 1POV1 3I3QA 1HB1A 4DNYA 2QQLA 5A7NA 1AL23 4D69A 4OUSA 4GWMA 2J1UA 2A6WA 2W52A 1IGOA 1QQP2 2EICA 3C7OA 3JCIA 2GDFA 4I3GA 5F9TA 1OT5A 3I59B 3LE0A 4HVQA 5D8AC 2WFPA 3WUCA 2O14A 4KBBA 3BIWE 1PMIA 5BUVA 3VL9A 4YW1A 1QGLA 1LULA 1S2KA 1YQCA 3Q8EA 1JZ6A 3S7EA 5JXHA 2XUMA 2RS32 1DGRA 2ZGSA 1C8NA 2RHPA 4HSJA 3NJZA 3THTA 1JZ3A 4E4DX 2OQ7A 2QTWB 2HWB2 2ZOEB 4YZ4A 2PHLA 4EWAA 1S0DA 1HQNA 2GALA 3C7EA 3U4XA 2R32A 2QQVA 1ZBE1 2LRPA 2ZABA 2MEV3 2B45X 3E6DA 3JZVA 3VD9A 1RUNA 4LIUA 1GZTA 1COV2 1CPMA 2BRTA 2QZ2A 3HOBA 4Y4RA 1XU1A 2RG4A 1S4CA 2VD7A 4Q0SA 2DCZA 1DU3D 3AFKA 2VZQA 4RS5B 2HEYF 2HH9A 1C28A 2EVXA 2JG9B 1DQ5A 4P00B 4XBLA 1I6XA 1C4RA 2A6ZA 4LE4A 2JDNA 5A80A 2WNVC 1OPOA 3KWVA 4Z07A 4ZU4A 4LHNA 1OVPA 4IESA 3B93A 1UY0A 3J7HA 3NAPB 4ZS2A 3WP3A 4CCMA 4YW6A 1W0PA 3GNEA 4D8MA 2Q30A 3PLQA 4HFSA 4P9WA 3AKPA 3PU3A 4FOVA 3EJKA 4HKLA 4J25A 3G7DA 3MEPA 1TQ5A 1MACA 1X9TA 5LASA 4CUCA 5JSOA 3V0BB 4DXRA 3ZIXA 3ZFEB 3RNSA 1PVC1 3B5LB 3OEAA 2OIIA 2WINB 3I8TA 1AX0A 1RUJ3 1SMVA 2Y6JA 3PTRB 1HJGA 4P14A 5DPNA 5A3TA 5F6KA 1QDCA 2VXJA 3C7FA 1LU1A 4MG2A 1ZRIA 1RUG1 2Y6FA 3HR9A 1RC6A 1H2KA 1WD3A 1BEV2 1R093 3KT7A 4NO4A 5CADA 3S6PA 2VBDA 5FDBA 5JOZA 3ELNA 4BXSV 4MOAA 2WWSA 5BNPB 2GNTA 5F7UA 1C57A 5C5TA 2DV9A 2HBTA 1N3OA 2BVVA 5A6XA 1UZYA 5FYBA 4M0HA 1VJ2A 2Y60A 2HKXA 2EXHA 5T5OA 3H8UA 5GKAC 3VV1A 1AYM3 4EN8B 5G04L 2A73B 4QDQA 1JOBA 5CFCB 1ND2A 1WBFA 4RN5A 3EMRA 3TEXA 1LCLA 3BVCA 1R081 4Z8BA 1CR7A 1TMF2 3D6EA 5FMCA 2ES3A 3OGVA 2XJPA 4D6SA 1TEIA 3CIHA 4PF5A 3RS6A 3VBSA 4XPVA 2ZPXA 1LJ7A 3LB9A 3GF6A 4L99A 5L9VA 4CU7A 2EALA 2E31A 2Z5WA 3T08A 3WT3A 3ZYIB 1H9PA 3OGSA 4GALA 2ARXA 5FBJA 3A0KA 5GM0A 1POV3 3I2GA 4H3WA 3DF0A 1W9FA 3OBAA 4E9KA 1K5MC 1BQPA 2FMYA 4YW5A 5K8SA 1XPWA 4KNCA 4GMP1 3VLBB 1DHKB 3J8F2 4BWOA 5FZ6A 3MDPA 4M3CB 3WNMA 3GGLA 2VBBA 2IXIA 2VZVA 3JB8A 1C3HA 5A7QA 3RJ2X 3T0BA 3N35A 2E9QA 3HN3A 2D5FA 4QXBA 2CYFA 4BIOA 1MQTB 1IS6A 1SLBA 3VKNA 1Z0HA 4Q4X2 4CCLA 2OX0A 2C1FA 2NN8A 2UWBA 2VUAA 3K4DA 2Z79A 2WNUA 4AF9A 4QKBA 1RVF3 4C1WA 3VDBA 4BQ4A 4AEMA 2JDHA 3HNMA 1ZBE3 1NCRA 1UU4A 4QPWA 1OMIA 3PTYA 5FZMA 1KXGA 1PO11 1W8HA 2XB6C 2I07B 3GZUC 1VRBA 1VMFA 1NLRA 1HDKA 1ENXA 4Q4Y2 2E7AA 5CVRA 5FZAA 5GLTA 4AXOA 2BJSA 4WVWA 5JI7A 1PX3A 2WYFA 2Y6GA 3LSEA 3WNNA 4BYYA 5KXCA 1K45A 2D7FA 2XG3A 3I97A 1NE6A 3OUHA 3AZXA 3POFA 3BODA 4XFIA 2WWJA 4DQAA 1GNYA 5LRSA 3ASIA 5GZFA 1CAWA 1KDKA 2GC2A 4Z92B 2DU1A 2OPKA 4RD7A 1GV9A 3DYOA 4WZCA 3VBUA 4FFIA 4JTNA 1JZ7A 1AR71 1YXWA 5FLHA 4DOUA 1PGW1 2AZ5A 1SFNA 4D7TA 3RRDA 1SFPA 1UY1A 5A3OA 3O1RA 4FOWA 5EWSA 5FP9A 3MIHA 4CCNA 5IJRA 4B3NA 4BQXA 2PAKA 3P3PA 3M3IA 5DDJ1 4AI2A 2D6LX 3CO2A 1U5XA 3WR0A 2R071 1NCQC 3CZJA 4LR4A 4COVA 4AK3A 2BPA2 3OY8B 4E8DA 2R7EB 2A6XA 3PU8A 5FP3A 1CX1A 3HVDA 4MSVA 4YGCA 3V56A 3LPGA 2JG9C 4QXCA 3ZYGA 2QKDA 2PLV3 3ZSEA 1JBCA 2VVEA 3AYDA 3QH6A 4RGKA 4BPZA 1OQEA 1LGBA 5I93A 2WS91 2ORXA 1UF2C 3WQ7A 3ZFFA 1EAH2 1YQ6A 4PIZA 5HV0A 3NAPC 2R041 3QH7A 2WFF1 4FP3A 1LOFA 2P4EA 4XJ8A 3GCXA 4QU2A 1JW6A 4FPLA 2ZACA 3AMPA 3WF2A 1UQXA 3D0JA 4L11A 1RMU2 2QBXA 3AMNA 3V0AB 5BNNA 1ND3A 3QCWA 1WCKA 4YG6A 3FX3A 4PQQA 3KGLA 4CCKA 5E89A 5JZGA 4A7YA 4R9BA 4LHSA 3KCYA 1HXS3 1R083 1W99A 3KQ4B 3OG2A 4LKDA 1UMIA 5LBFA 4PQ9A 5I0RA 4IV3C 4MHRA 4E2QA 1W8TA 4CUAA 2GMPA 1Q5OA 1L3JA 1W39A 2DVAA 3POEA 4CPBA 5FPAA 1MR5A 1WMEA 4ZXKA 5LA9A 1MVQA 3UYJA 1VAMA 5EP9A 4BQ3A 2RM23 3DKQA 1LOAA 5F3GA 3UJQA 4PLMA 4AGVA 3U78A 1UL9A 4FAHA 1A78A 1ND2B 4KG0A 1VR3A 4XTMA 3TWIA 3H0OA 4OVEA 2VH9A 2P3JA 2FDIA 3UJOA 1J3RA 3MUZ1 4ES9A 2HEVF 2RR12 1FAYA 1LODA 3WVJA 5FPUA 2O1QA 3SCHA 5AFEA 2SBAA 4LIVA 5JOYA 3LGRA 4K3UA 1C8M1 5CFCC 2HBUA 1OUSA 2VC9A 3H3UA 2GN7A 3HAGA 4JGYA 3VDDC 3S57A 3RYRA 2ZZJA 2ZGOA 2WAAA 1BVVA 1QJU1 1DYOA 3M3QA 5F8PA 3SEEA 3ZXGA 4JDNA 5JSRA 3OOXA 5FZKA 3I2FA 3PVNA 3JD72 2GNBA 5C3QA 2ZJCA 4QPGA 1DGWA 2DCYA 4LLFA 1QY4A 4TSVA 2B46X 2YPDA 4LO6B 2W0XA 3KT4A 4Q29A 1OKQA 1QKQA 1S55A 1Y43B 2YYOA 4AVBA 4K8FA 1SLLA 2EXKA 2WNUB 5T55A 4R9CA 4XDQA 4BLIA 1W28A 3PVBB 2I74A 1SLIA 3H50A 1IQDC 4HETA 4OUMA 4OI1A 4COWA 2P6CA 3MFAA 4LNVA 4KL1A 4YGDA 1AR83 1RUD2 1MQTC 2MHFA 2WN3A 2WZ8A 3T2OA 1CAUA 3VD5A 2V73A 3L2HA 1JOJA 4XTPA 1FPN2 5CFDA 4MXVA 1ZBA2 3T1LA 1HRV1 3EQEA 1SEFA 4NHMA 1Z7S2 1PIV1 1Y7BA 3THDA 3ZN5A 5B2GB 4YM3A 1QXJA 5DDJ3 5T3NA 3JB4C 3SEPA 1H1AA 3K46A 1CAWB 1HX6A 4Q4V3 3VHPA 1U0AA 3AB0A 2UWAA 1IKPA 3POSA 2QDNA 5E6HA 4OMCA 3ZR6A 3N36A 3VBUB 5A1AA 5C6CA 2W3JA 4XZUG 3EHKA 2QCSB 1DCSA 4QX2A 1UOGA 1HB4A 2XVKA 3ACGA 2VZ1A 5LW9A 2D5HA 2VG9A 3GHMA 1PGL1 4QAWA 3HEIA 2RMU2 4BH9A 1MS5A 1OA4A 3BPZA 4YRDA 5EJ1B 5C5UA 2R043 3GCWA 3O7OA 4OLLA 5BXXA 2G9GA 5FYYA 4QHOA 1UU6A 2CHHA 3A4UA 4X6RB 2JD9A 3AL5A 4MGYE 1U5IA 1D4M2 2VULA 2BDRA 2ZEXA 1AXKA 3M3EA 2WRAA 3C3VA 4OCTA 5D21A 1FT9A 2VGDA 1OOPA 3T2QA 1F31A 1AUYA 2PA7A 3N9QA 3T30A 1MZFA 2VOVA 4CEWA 1G7YA 3ZOIA 5FK8A 3KV6A 4CU8A 2P3KA 3WNLA 3G6JB 1SBFA 2PN5A 4UW3A 2Q8CA 4BLJA 4QX5A 5BNOA 1DDLA 3I54A 4D3WA 5BNNB 2HWC2 5E16A 1QJY3 3KS7A 2JE9A 5I0DA 2D3RA 4E4ZA 5JZGB 4K8RB 1V70A 2YC0A 4FXGB 5FZCA 3VBOA 4RYDA 3WF4A 4D6QA 2OW4A 1UMZA 2DURA 3WLUA 1ZREA 5IW0A 4FP2A 2VCCA 1PM4A 3ATGA 4HK9A 4Y20A 4AOCA 2JDUA 3BCWA 4B1LA 2B9VA 1E57A 3FZ3A 4H2AA 1C8M3 4I30A 5CAZA 3SHRA 3K3OA 3KMHA 1A3KA 1W8UA 1NXD1 1BBT1 4NIGA 3UK9A 2JE8A 1QJEA 1QJU3 1M06G 3OCPA 1YHFA 4DIQA 4HT1T 3PJYA 4MHUA 2A3YA 1HW5A 1UU5A 3CDZB 5DMYA 2AREA 2HWE3 4URTA 5FOJB 3WNXA 1VBC1 1E5SA 1JOPA 2ZX0A 1YIFA 3AZYA 4QKDA 4RGGA 1LTEA 4NRMA 1OHFA 1ND2C 1Q8QA 4FPOB 1IOAA 5D2AA 1FMD1 4QQLA 1YQ5A 4UFJA 3HNYM 1GR3A 1F35A 4LORA 2OYZA 1CZVA 3AJZA 4N90A 3SH4A 5CG8A 1RIRA 3T09A 1HN1A 3VBSC 4CDQA 5IVVA 1RJ8A 2D3SA 3E97A 5HBAA 2BYVE 2UWCA 1JUIA 4LBJA 4QPGB 1UZWA 4QPIA 5GLVA 5FR3A 1KS5A 1ENSA 3IDBB 3VZKA 4KWJA 5C8CA 3LAGA 3AP9A 2B4KA 4KQ7A 3H8XA 4AVAA 3W5MA 4M01A 4CPBD 1V6LA 1HRV3 2DTWA 1XE7A 2VZSA 4OYUA 4RSUA 4NE9A 3CJIA 4AQTA 2Q1MA 2ID4A 4A6SA 1KFUL 2CAVA 1FOD2 2BGPA 3WHTA 4ASKA 2JENA 1LOBA 3VDAA 2NP0A 1XYPA 1QWRA 1W9SA 4W6XA 4XABA 1CAUB 4YNIA 2XWBB 3VKMA 4CCOA 5KXBA 5CFDB 4OUEA 2A75A 4L9BA 4M3CE 2ZX4A 3TNQA 3TEYA 3IDEA 2ZBJA 5FYHA 2ZCWA 2W92A 3RWNA 3A7QA 4G3YC 4Q27A 2A3XA 1WA4A 4WZFA 1NCRC 3EBRA 5FXVA 5H9SA 1UAIA 2EIBA 2IVIB 4BK5A 3MHZA 3HNBM 2QVSB 4Y1VA 3EXUA 4EYUA 1V6MA 2XJRA 1UYPA 2ZS6B 1Z78A 2CWMA 4UBGA 3N7JA 3IDCB 4V2WA 4B7KA 3SKVA 3X29B 5JPMB 1ZVFA 2QQKA 1NY71 5IYYA 1NYWA 2EAAA 4XDOA 4IE6A 1SBDA 4HPKA 3VBUC 4AI9A 4QPYA 3LEGA 1RUH2 4EZ4A 1FNZA 4W6WA 4GD4A 1KS4A 3DV8A 2PHRA 1IS5A 1PHMA 2JJ6A 2BVBA 3WW1A 5ACA3 2VO5A 1HRI1 1X33A 1H0BA 1YI9A 1O4TA 4OZXA 5GJ6A 5IWFA 3ZXFA 4CYDA 4OHYA 1NZCA 2GZWA 3VDCA 1OOPB 5IVYA 1GP5A 1E5IA 1XNBA 4QB1A 4YLZA 3FWEA 2JB4A 1ENQA 1GOGA 3JU9A 4XZPA 4CEWB 2XL9A 2RS53 2ZXQA 1RUC3 4RQPA 5A6ZA 2AEZA 3IMNA 5BNOB 2ZGMA 4XW3A 1ZA7A 1SHWB 2WA4A 3LA3A 1EYBA 2AGSA 4J6GA 5FZ3A 4DY5A 4JVAA 2TBVA 4E4SA 2VQAA 4FAGA 3ZFFC 2J1RA 4K1YA 5F5AA 3MLLA 4QT6A 1LOFC 2JX9A 4N53C 3VBRB 5L7OC 3VBOB 5L19A 4WBBA 1VBB2 2WZEA 2G9FA 2P5BA 4GWIA 3GBFA 1AYN1 3POBA 4XVHA 1MEC2 5H9PA 5C3RA 3AK0A 1RUF1 3AP6A 4UT5A 1HQLA 5BNNC 1H4GA 1ND3C 1TNFA 4QKNA 1YEWA 2VMFA 2D6OX 3RZJA 3PJQA 2JKXA 1LESA 3OB8A 5JZGC 1ULEA 1BYHA 1TNRA 4AQ2A 1J84A 4YW2A 3ZN4A 1VE0A 1YFXA 4F83A 2CGOA 3TAYA 5JXIA 4QQ2A 1S0JA 5FO9B 1RUE1 4OZOA 5IVBA 1UNBA 1IHMA 4ZZ8A 3RZGA 4MYEA 2VOXA 1JYCA 4M0NA 3ZMOA 2W9XA 3U10A 2WT2A 1UXXX 4S2GA 3FN9A 1FYUA 3HJRA 1WUVA 4NHXA 5FRAA 1VBE1 3BOWA 2WO3A 4BQYA 2IXLA 1O8PA 3WCRA 1AL21 5LBCA 2WO7A 3GJAA 1MZEA 4BOWA 5LWBA 3TEZA 3CZUA 4GB32 5C70A 1H4HA 1W6NA 2VXRA 4YVWA 3WDTA 1O91A 1ZRRA 1W2UA 3UNPA 3KHCA 1RHI1 4CDQB 2JB8A 5JOXA 4Q0QA 5FZDA 3DPRB 3LD8A 1AXYA 2RS11 3PVEA 3MPPG 4QDRA 4QPIB 3NJXA 3O0VA 2XBO2 4JGYC 1W8WA 4UOJA 4XXPA 5C8CB 1NX9A 2WNEA 4RS5A 5EXOA 4D6RA 4YW4A 4IV1C 1UZZA 1A8DA 1H8TA 3RZZA 2WBKA 1ENRA 5F3CA 4MO3M 3CJIB 3FFZA 2HWD1 4BE3A 1W9YA 4NIIA 4X8PA 4QPGC 2MEV1 2A70A 1BMV2 3M8LA 5HCHA 1JYVA 4YGBA 5FY7A 3OPTA 3WNOA 4QU1A 1YLLA 2CWSA 2V72A
chains in the Genus database with same CATH topology
4GJZA 5FY8A 5LY1A 5FYZA 2YBSA 4EYUA 4IGOA 4NUBA 5FXXA 5FYYA 4QX8A 5FZ9A 5FJKA 3AL5A 2OS2A 3KVAA 4V2WA 5FP8A 5FV3A 5IVFA 3N9MA 3AVRA 3N9LA 4XDOA 3DXUA 5F3IA 5FZOA 5FXZA 2Q8DA 5FYBA 5K4LA 3N9QA 3PUSA 4AI9A 5A3PA 5A7OA 4EZ4A 4XDPA 5A7PA 4CCKA 5FP7A 4GD4A 5FZFA 2XXZA 3OPWA 4HOOA 4LITA 4CUGA 3KV6A 2Q8CA 2Q8EA 5IWFA 5IVEA 2OT7A 5FZ4A 4BISA 3PURA 5FZOB 3LDBA 2W2IA 5FZ0A 5IVYA 3NJYA 5FPAA 5FWJA 4D6SA 4BU2A 3UYJA 5KR7A 5F3GA 4UF0A 5FZCA 3KV9A 5FZ7A 4EZHA 3U78A 4D6QA 5A7SA 2GP3A 3N9NA 5IW0A 5FBJA 5FZHA 3KV4A 4BXFA 5FZ3A 5FYTA 5IVCA 4CCJA 5FPUA 5A7NA 4LIVA 5FZ6A 5A7WA 5F5AA 3U4SA 5F37A 3K3OA 4UF0B 4HONA 2YBKA 5IVJA 5FY0A 2P5BA 5A7QA 5FZEA 4QXBA 5CEHA 5FY4A 2YU2A 4GJYA 4DIQA 5FJHA 3K2OA 5FZ1A 2WWUA 3N9OA 4CCLA 2OX0A 5ANQA 5FYUA 3ZLIA 5A1LA 4V2VA 5FZKA 5A7WB 4LXLA 5FPVA 5FYIA 5FPLA 5FPBA 3KV5A 5FZLA 3KVBA 5FYCA 2OQ7A 5F2SA 5A3NA 5LY2A 5FY1A 2XDVA 5IVBA 5ISLA 3AVSA 4Y3OA 4QXHA 5FZMA 2XUEA 2YPDA 5FZ8A 3K3NA 3DXTA 4AAPA 5FYVA 1VRBA 4LIUA 5FWEA 4QWNA 4QX7A 3PUQA 5FZAA 5IVVA 3PUAA 5FZBA 4Y4RA 2PXJA 5F5IA 5FY9A 2VD7A 5FUPA 5FZGA 4DO0A 2WWJA 5FUNA 5LWBA 4IGPA 5A3WA 4Y33A 5FYSA 5F2WA 2GP5A 3N9PA 4IGQA 5A80A 3ZPOA 4E4HA 5FYMA 4URAA 5FZDA 3LD8A 5F3EA 2XMLA 3PDQA 5FP9A 4ASKA 4CCMA 2OQ6A 4CCNA 4D6RA 2YU1A 5F32A 3PU3A 3AL6A 4CSWA 5E6HA 5FY5A 4CCOA 5F3CA 5F5CA 5FP4A 5FYHA 3PU8A 5FP3A 2YBPA 4GAZA 5FXWA 4C8DA 3PTRB 5A3TA 4TN7A 5LW9A 5F39A 5FY7A 4QXCA 3OPTA 4QU1A 5FXVA 5FZIA 5A1FA 3RVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GJZ A;  5FY8 A;  5LY1 A;  5FYZ A;  2YBS A;  4EYU A;  4IGO A;  4NUB A;  5FXX A;  5FYY A;  4QX8 A;  5FZ9 A;  5FJK A;  3AL5 A;  2OS2 A;  3KVA A;  4V2W A;  5FP8 A;  5FV3 A;  5IVF A;  3N9M A;  3AVR A;  3N9L A;  4XDO A;  3DXU A;  5F3I A;  5FZO A;  5FXZ A;  2Q8D A;  5FYB A;  5K4L A;  3N9Q A;  3PUS A;  4AI9 A;  5A3P A;  5A7O A;  4EZ4 A;  4XDP A;  5A7P A;  4CCK A;  5FP7 A;  4GD4 A;  5FZF A;  2XXZ A;  3OPW A;  4HOO A;  4LIT A;  4CUG A;  3KV6 A;  2Q8C A;  2Q8E A;  5IWF A;  5IVE A;  2OT7 A;  5FZ4 A;  4BIS A;  3PUR A;  5FZO B;  3LDB A;  2W2I A;  5FZ0 A;  5IVY A;  3NJY A;  5FPA A;  5FWJ A;  4D6S A;  4BU2 A;  3UYJ A;  5KR7 A;  5F3G A;  4UF0 A;  5FZC A;  3KV9 A;  5FZ7 A;  4EZH A;  3U78 A;  4D6Q A;  5A7S A;  2GP3 A;  3N9N A;  5IW0 A;  5FBJ A;  5FZH A;  3KV4 A;  4BXF A;  5FZ3 A;  5FYT A;  5IVC A;  4CCJ A;  5FPU A;  5A7N A;  4LIV A;  5FZ6 A;  5A7W A;  5F5A A;  3U4S A;  5F37 A;  3K3O A;  4UF0 B;  4HON A;  2YBK A;  5IVJ A;  5FY0 A;  2P5B A;  5A7Q A;  5FZE A;  4QXB A;  5CEH A;  5FY4 A;  2YU2 A;  4GJY A;  4DIQ A;  5FJH A;  3K2O A;  5FZ1 A;  2WWU A;  3N9O A;  4CCL A;  2OX0 A;  5ANQ A;  5FYU A;  3ZLI A;  5A1L A;  4V2V A;  5FZK A;  5A7W B;  4LXL A;  5FPV A;  5FYI A;  5FPL A;  5FPB A;  3KV5 A;  5FZL A;  3KVB A;  5FYC A;  2OQ7 A;  5F2S A;  5A3N A;  5LY2 A;  5FY1 A;  2XDV A;  5IVB A;  5ISL A;  3AVS A;  4Y3O A;  4QXH A;  5FZM A;  2XUE A;  2YPD A;  5FZ8 A;  3K3N A;  3DXT A;  4AAP A;  5FYV A;  1VRB A;  4LIU A;  5FWE A;  4QWN A;  4QX7 A;  3PUQ A;  5FZA A;  5IVV A;  3PUA A;  5FZB A;  4Y4R A;  2PXJ A;  5F5I A;  5FY9 A;  2VD7 A;  5FUP A;  5FZG A;  4DO0 A;  2WWJ A;  5FUN A;  5LWB A;  4IGP A;  5A3W A;  4Y33 A;  5FYS A;  5F2W A;  2GP5 A;  3N9P A;  4IGQ A;  5A80 A;  3ZPO A;  4E4H A;  5FYM A;  4URA A;  5FZD A;  3LD8 A;  5F3E A;  2XML A;  3PDQ A;  5FP9 A;  4ASK A;  4CCM A;  2OQ6 A;  4CCN A;  4D6R A;  2YU1 A;  5F32 A;  3PU3 A;  3AL6 A;  4CSW A;  5E6H A;  5FY5 A;  4CCO A;  5F3C A;  5F5C A;  5FP4 A;  5FYH A;  3PU8 A;  5FP3 A;  2YBP A;  4GAZ A;  5FXW A;  4C8D A;  3PTR B;  5A3T A;  4TN7 A;  5LW9 A;  5F39 A;  5FY7 A;  4QXC A;  3OPT A;  4QU1 A;  5FXV A;  5FZI A;  5A1F A;  3RVH A; 
#chains in the Genus database with same CATH topology
 2CU5 A;  4GH4 A;  1O3R A;  2PAM A;  2ZGK A;  1GBG A;  3SQO A;  4DZG A;  4MZU A;  4U36 A;  1NXM A;  2ILM A;  5FZ9 A;  3OEB A;  3PIJ A;  2VNR A;  4HVR A;  1CZT A;  3AYC A;  5KBF A;  3LOB A;  3VHR A;  3TEW A;  3KF5 A;  4PI0 A;  4BK4 A;  3N9L A;  5APA A;  2NMO A;  1RUJ 2;  5J96 B;  5CFD C;  1OA3 A;  1PM7 A;  3PUS A;  1AZD A;  1NKG A;  1JYT A;  4XDP A;  1C1F A;  5FP7 A;  3WDW A;  1J58 A;  3RZL A;  1HRI 3;  1N1Y A;  1IG3 A;  1QDO A;  4HOO A;  5EV7 A;  5TSW A;  3Q8F A;  3W5N A;  1LHN A;  2E33 A;  3RMX A;  4R9D A;  4YFW A;  5BNP A;  1PK6 A;  2W2I A;  3LDB A;  4CEY A;  4HPK B;  5FWJ A;  3WW3 A;  2LRO A;  3OUJ A;  1RUI 1;  2OUH A;  2Z2S B;  4AQ6 A;  2Z42 A;  4XAA A;  3NV4 A;  4IE4 A;  1S2B A;  2FDG A;  4LLO A;  1XSQ A;  1AXZ A;  4XYX A;  5KXD A;  1R09 1;  4WM7 A;  3N4M A;  4OHX A;  3N9N A;  2FBE A;  3GBW A;  3OUI A;  2GC0 A;  2XL7 A;  2ZHL A;  1KD7 A;  2VJX A;  4QQO A;  1AYM 2;  1NLQ A;  4BXF A;  4ES8 A;  4FI9 A;  3O1P A;  1EPZ A;  3OBZ A;  3BKZ A;  4SLI A;  3CLP A;  1ACC A;  3J7M A;  2FCU A;  3CF6 E;  4RQP B;  4A7K A;  3JUU A;  1PVX A;  3J4U H;  4R4Z A;  1VAL A;  4QM8 A;  2FDK A;  1LED A;  1EP0 A;  3MW2 A;  2J22 A;  1XXN A;  1HLC A;  1OOP C;  3MLK A;  5I91 A;  4PDW A;  1JS9 A;  1VRH 3;  2BNM A;  1X7N A;  1QMJ A;  3VBH A;  5A33 A;  4CEW C;  2ZGQ A;  2GH8 A;  1O4Z A;  5F6L B;  1D4V B;  5FZL A;  1ASJ 3;  1H2N A;  2JG8 A;  2R49 A;  3RDI A;  1ST8 A;  1URX A;  1CAX A;  2HYX A;  2W95 A;  4LOS A;  4QHZ A;  1JYN A;  3H8R A;  4LT5 A;  3AVS A;  5I8S A;  1CPN A;  4CP1 A;  5T5J A;  2RV9 A;  2W47 A;  1VBE 3;  2QQI A;  3GAL A;  5FYV A;  2ZHK A;  3LIH A;  3O1O A;  2RVA A;  4UFI A;  4QWN A;  1GYK A;  1CD3 G;  4MGZ E;  2NZ9 A;  4CUB A;  1SFY A;  4YG3 A;  1NLS A;  2RE9 A;  1U5Z A;  4WVZ A;  1SDD B;  2YUE A;  5JR2 A;  3AXE A;  2VE1 A;  1HV0 A;  3IPV B;  3KLS A;  1RHI 3;  4PT6 A;  4P9X A;  4XUT A;  5FMD A;  2J1V A;  1W6O B;  2KD7 A;  4K7J A;  2RS1 3;  5FYM A;  2VY0 A;  2YFZ A;  4E4H A;  1ZBE 2;  2PHX A;  3J7L A;  4ISQ A;  1NQD A;  3FBY A;  3WZ1 A;  3IDA A;  5JUV A;  4S2H A;  5JI9 A;  1WMD A;  2C5D A;  3U75 A;  4X6Q B;  5BPX A;  1RVF 1;  4P5Y A;  1W6N B;  2HWD 3;  4YVW B;  3WHU A;  3MO4 A;  1IKQ A;  5IK5 A;  1ZZ7 A;  2R06 3;  2G1M A;  4W50 A;  1G9C A;  1T6G C;  3H3L A;  1H1I A;  1QU0 A;  3I2I A;  5EPA A;  5K0U C;  1WLT A;  2UU8 A;  2ERF A;  2Q4S A;  3L9J T;  1W03 A;  3O1S A;  1KEX A;  2Y6H A;  1WW7 A;  1YUD A;  4CDU A;  1CIW A;  4FOY A;  4Q4W 1;  1H8T B;  1YYN A;  2W1Q A;  4ASL A;  1JHN A;  2DBN A;  2VNV A;  4NJ4 A;  1K5J A;  4CDQ C;  4IGO A;  1VB4 A;  4P9J A;  4NUB A;  5AC9 3;  3H3Z A;  2NM1 A;  2E7T A;  4GWN A;  2CDO A;  3IB3 A;  3HBZ A;  3OY8 A;  2DVB A;  4QPI C;  5JMO A;  1PVC 2;  2LAL A;  1Q56 A;  4COY A;  5C8C C;  5IFP A;  4K9S A;  4OHZ A;  3QAC A;  4AQS A;  2V5D A;  4GH4 B;  2WKK A;  4AGG A;  2BQP A;  1QJZ A;  1RUG 2;  2RDQ A;  1DGW X;  2VOW A;  3CJI C;  4DMI A;  5C33 A;  4Y1U A;  1DQ0 A;  1YJK A;  3JXS A;  5J48 A;  2ZEY A;  4XHX A;  4EE2 A;  4NPM A;  3LZZ A;  4XF1 A;  5AVA A;  3ZYJ B;  1VBD 1;  4IE5 A;  3J26 N;  5SV8 A;  3VZO A;  2V4A A;  2Y64 A;  1VBA 1;  3LPF A;  3U0Z A;  3AXD A;  1V6K A;  4Q8L A;  1QH6 A;  4A3Z A;  4FQ4 A;  4XJA A;  1SDW A;  1GQP A;  1RUI 3;  2CTV A;  1BK0 A;  1Y9M A;  1BXH A;  4QGL A;  4YFZ A;  3V0A A;  2PLV 1;  4DRV A;  4LTA A;  3ZVX A;  3IT8 A;  3LFI A;  5KR7 A;  1PGS A;  1Q3E A;  5DZF A;  3T2P A;  1NAE A;  1GFF 2;  2JDZ A;  4OMD A;  5FMB A;  4RHV 3;  4EWD A;  4PI2 A;  2BZD A;  1UMH A;  1WW5 A;  3ZXE A;  3AM2 A;  1WMX A;  3CL1 A;  2X5I A;  1PK6 B;  4HN0 A;  1WA6 X;  1XYO A;  1X9P A;  4CEY B;  4XUQ A;  1R08 2;  4TYS A;  4N43 A;  4NWW A;  3A21 A;  5A32 A;  1EV1 3;  2GME A;  4LBQ A;  5A7W A;  4IXL A;  4R52 A;  4GA9 A;  3WQB A;  3IAQ A;  5C3O A;  5IVJ A;  1DIW A;  4H14 A;  2P2K A;  5I8Y A;  4AL9 A;  4WM7 B;  3VBF C;  1HJF A;  1JXN A;  2BER A;  1HXS 1;  1F4A A;  3HT2 A;  4Y5T A;  5DAV A;  2JDM A;  3BN6 A;  4PF1 A;  3URF A;  3S30 A;  1KJR A;  1G8W A;  3ZLI A;  2R0F A;  3NV3 A;  2O0O A;  1W6M A;  2GN3 A;  3KQR A;  4XQD A;  5LBE A;  1MZ5 A;  4B1M A;  1NG0 A;  5DZE A;  3ILR A;  5ANN A;  5LK7 B;  2Y0I A;  1RB8 G;  1FXZ A;  3POY A;  4QX0 A;  3NO8 A;  4MGQ A;  2RM2 1;  3VKF C;  4DFS A;  3LIG A;  1W2O A;  4KG8 A;  1DBN A;  2XDV A;  4KGG A;  5HCF A;  5ISL A;  5DUV A;  3VGI A;  4PDW B;  3MLJ A;  2XUE A;  3VBH B;  3Q8A A;  1YNA A;  3DXT A;  5A33 B;  3ACI A;  2L9L A;  1W2A X;  1DQ1 A;  1O3S A;  4CP0 A;  2Y8K A;  3AMM A;  3D82 A;  5F5I A;  1OC1 A;  2H6B A;  2JG8 B;  4HZF A;  1CAX B;  2VZR A;  2WZP P;  1JOD A;  5A3W A;  5FPX A;  2DCK A;  3MIE A;  3SMH A;  2ZKL A;  1XB9 A;  3PIG A;  3RG0 A;  4LJH A;  1V0A A;  3ZPO A;  5KC6 A;  1EPW A;  2VW2 A;  4XEZ A;  1PO1 2;  3BPS A;  4K21 A;  3ZYH A;  4BQ2 A;  2XGX A;  4ZZ5 A;  4NPR A;  2IUW A;  5JOW A;  4HLT A;  1H6X A;  1OF4 A;  4TXW A;  3R4U A;  3ES1 A;  5F1R A;  4OI2 A;  3HQX A;  4CA9 A;  3LA2 A;  4L2N A;  1YC6 1;  2Q1F A;  2W68 A;  1GLH A;  5F5C A;  1MS8 A;  1JTZ X;  4UW6 A;  1T2X A;  2ZX3 A;  1ULG A;  5LA2 A;  4XQ4 A;  3VZM A;  1PX4 A;  3B69 A;  4H55 A;  4CDX A;  1WW6 A;  1AR7 2;  3DEM A;  5B4N A;  1PGW 2;  2PHD A;  1F5F A;  1OF3 A;  4Q4W 3;  4FCA A;  1RYY A;  5FLJ A;  3GJB A;  5A1F A;  3NNF A;  4W65 A;  4BJ0 A;  5FY8 A;  4AGR A;  5DDJ 2;  3ST7 A;  1AR8 1;  2YG0 A;  3NQH A;  1ZRD A;  4XBN A;  1LEM A;  5FO7 B;  1P8J A;  2R07 2;  3SH5 A;  3KVA A;  3ZSJ A;  4UFL A;  2EIG A;  2XVG A;  3K4Z A;  2RS3 3;  4Q1P A;  3BUC A;  3Q8C A;  2CAU A;  2AR6 A;  4GQ7 A;  4XUN A;  4YVW C;  3LCP A;  4CDU B;  2QJV A;  3S5A A;  5K4L A;  2G19 A;  4IEQ A;  2HWB 3;  4LHL A;  5HCA A;  1R1A 3;  5A7P A;  1VBD 3;  2X53 S;  4N8M A;  2MPF A;  4Q4V 1;  1VBA 3;  5EHD A;  4E27 A;  2WS9 2;  1JU4 A;  2R16 A;  4A42 A;  4ORF A;  4XOG A;  1COV 3;  1GP4 A;  1TG7 A;  1UIJ A;  2R04 2;  2WFF 2;  4RS5 C;  3T0D A;  1OUX A;  1Y3T A;  3RI8 A;  4YW3 A;  4BIS A;  4PCR A;  2GND A;  4XHB A;  3V64 A;  4KMQ A;  1AX2 A;  1LEN A;  1OPM A;  4XFH A;  4ARY A;  2ARB A;  4UF0 A;  3U1X A;  3ENR A;  2WNO A;  2J1S A;  3DYM A;  1CJD A;  1WLC A;  2VW1 A;  3IBM A;  5LBB A;  4ASM B;  1SAC A;  1Q8O A;  2F4L A;  5KWR A;  5FZH A;  2C0Z A;  1CVN A;  1IS3 A;  1LU2 A;  4BHP A;  3TRS B;  4GH4 C;  5FYT A;  4AFB A;  4E2G A;  3MI8 A;  3NNG A;  4IE0 A;  4OQ9 A;  2W94 A;  3QOP A;  4GMP 0;  1H30 A;  3ZFE C;  3ILF A;  4FTS A;  2XQX A;  1H2M A;  1WZX A;  1HIX A;  5ABJ A;  4PJY A;  1YQ2 A;  2X5I B;  2E32 A;  1ZNP A;  5J7M A;  3HMY A;  2IXC A;  2JD4 A;  1WCU A;  2LW8 A;  4N43 B;  4NOT A;  1QF3 A;  1PZ8 A;  2E63 A;  5A32 B;  3QLQ A;  5A7W B;  1EUU A;  1JHJ A;  1L7L A;  4LBQ B;  5IK7 A;  5LAT A;  1QJY 1;  4LA2 A;  2XJS A;  1OXC A;  1QHD A;  1C8M 2;  1ULD A;  5F2S A;  5BNP C;  4JKM A;  5DG2 A;  1SZB A;  5A6Y A;  1ALY A;  4AI0 A;  3CQO A;  4R9A A;  3K3N A;  3SC7 X;  5CBL A;  3FL7 A;  4AED A;  1W6M B;  5FWE A;  3MZH A;  1QJU 2;  3WDX A;  3P5B A;  5C4W B;  2E51 A;  5FY9 A;  4ZS3 A;  5FTT C;  3LSD A;  5IK4 A;  2IC1 A;  4Q8K A;  1QJX 1;  2KXL A;  4E2S A;  3ALQ A;  5FYS A;  4RA0 A;  5M0T A;  1GU3 A;  2GP5 A;  2F4P A;  1BJQ A;  2FQP A;  2YXS A;  4FPE A;  4A4A A;  4YVS A;  4DRR A;  1TMF 3;  1LHW A;  2GMM A;  5F3E A;  2HWE 1;  1DG6 A;  2ZX2 A;  4Y1X A;  3H1W A;  1XNA A;  3C7G A;  2BGO A;  1WMF A;  3IM0 A;  1POQ A;  2GNM A;  4F3J A;  3VBH C;  3KGZ A;  4ISR A;  1BLZ A;  1V00 A;  3B00 A;  4LBQ D;  3ZFG B;  4D7S A;  4B4R A;  1SLA A;  2WJS A;  2JG8 C;  2WZR 1;  4GAZ A;  2PQS A;  1HRV 2;  3J8F 3;  4KWL A;  2Y33 A;  1WBL A;  3FUQ A;  5HPO A;  4WVV A;  1PIV 2;  3EO6 A;  3H9A A;  2CGN A;  1NZI A;  3U11 A;  2BNN A;  5GAL A;  3POI A;  4FFH A;  2Q8O A;  1G6N A;  2DVG A;  4AR2 A;  2HJI A;  2CL2 A;  2PHW A;  4CU9 A;  3USU A;  1KRI A;  1W8O A;  1YO8 A;  3I2H A;  3RFR A;  2YPJ A;  4Q4X 3;  4CDX B;  2BOJ A;  3D4K A;  5L9R A;  1ODM A;  1I5P A;  2XON A;  4YZ3 A;  5SV5 A;  5DAQ A;  1Q43 A;  5BV6 A;  3MYX A;  2FD8 A;  1BK1 A;  2C26 A;  3O1T A;  1MS1 A;  1PGL 2;  2H0V A;  4CDW A;  4YZ1 A;  5IT6 A;  3VL8 A;  1XBF A;  2H0B A;  2JWP A;  3WQ1 A;  1XYN A;  1ZA4 A;  4YW7 A;  5L73 A;  2D44 A;  4D0Q A;  3B94 A;  4JQR A;  1FAT A;  1DF0 A;  3GZA A;  2P37 A;  3T2T A;  4Q4Y 3;  1R64 A;  1QXP A;  1J1L A;  1N1T A;  4WM8 A;  3EB7 A;  4YPJ A;  3ZSL A;  2QQM A;  2VW0 A;  1OFN A;  1VLN A;  3NKT A;  3NJY A;  4QB2 A;  4XE9 A;  2DUP A;  4N9I A;  1N3Q A;  2IXJ A;  4C0B A;  2Y26 A;  3SXW A;  4HL0 A;  4XAE A;  2B9U A;  3D3A A;  4BCU A;  5BY5 A;  2JEC A;  3O5S A;  3BTY A;  4AYU A;  3ZM8 A;  4WVM A;  1W9T A;  4FPG A;  3UKT A;  4CDU C;  1AVB A;  5EJZ B;  3LWC A;  3JQX A;  5LK5 A;  2ZGU A;  4XJ9 A;  3QBQ A;  2ZHM A;  3FJS A;  4UF0 B;  4HON A;  5LCW L;  2JXA A;  1W05 A;  5FY0 A;  3MW3 A;  3I2D A;  1YI7 A;  4JDO A;  4JHT A;  3P6B A;  2LM3 A;  2N7G A;  5LEJ A;  1V9U 1;  3MBW A;  5ACA 1;  2ENR A;  5FZ1 A;  1F15 A;  1JZ5 A;  3WQ0 A;  5CZK A;  2WDB A;  4QDS A;  4XUO A;  1AR6 1;  2VQT A;  1YRZ A;  4O61 A;  4NR1 A;  3LOI A;  4ET7 A;  2I45 A;  3ZXA C;  5FPL A;  3E6B A;  3UL2 A;  5ABJ B;  1H1M A;  3VBR A;  1B09 A;  2RS5 1;  1RUC 1;  1STM A;  4KWK A;  3RGB A;  1BBT 2;  1H6Y A;  4CZS A;  2EF6 A;  4AAP A;  4LUM A;  2B42 B;  1UW8 A;  4S2F A;  3KZ4 C;  5CA6 A;  4QX7 A;  1OBN A;  2IXH A;  1QJX 3;  1NA1 A;  2DCT A;  2JKB A;  2PXJ A;  3FHI B;  3IAP A;  3N7L A;  4TLG A;  5LA1 A;  1VBC 2;  1MZ6 A;  2ZGL A;  5FUP A;  3VD7 A;  1OSG A;  1CX4 A;  2BOI A;  5EJ3 A;  4DO0 A;  2X5I C;  1W2T A;  5FUN A;  3WIN E;  3F95 A;  1FMD 2;  3GM8 A;  5AFB A;  3C7H A;  3ZSK A;  4KWU A;  1ZYB A;  3NV2 A;  1IQA A;  3POG A;  4AED B;  2VUD A;  1IZ3 A;  3H7Y A;  2DUQ A;  1GMM A;  3IMM A;  2WLQ A;  3ZPY A;  2BV4 A;  4A45 A;  4O65 A;  5D8A A;  4BME A;  1XNC A;  4JQT A;  3WEZ A;  1NOV A;  1WCS A;  1XC6 A;  4CCC A;  4FOQ A;  4OUL A;  1S0I A;  3B3Q E;  3RZK A;  4FO9 A;  1V6J A;  2J1T A;  2WZR 3;  1BCX A;  3B9I A;  1OVS A;  3HN1 A;  2PHT A;  1XSR A;  4WV8 A;  4YVS B;  1CWP A;  2JEM A;  1SLC A;  3WW4 A;  2RR1 3;  2XOM A;  2Y38 A;  3DPR A;  3FLT A;  3M3O A;  4Q0V A;  1LHO A;  3MGU A;  4UXA A;  1TME 1;  4DXZ A;  1HB2 A;  4JC1 A;  3TN9 1;  3WW2 A;  2GH2 A;  4DUW A;  3RVH A;  2W08 A;  4EN9 B;  1OLM A;  2OZ6 A;  1DLL A;  4I0A A;  3O0W A;  5FMO S;  1C5H A;  4M4P A;  3U14 A;  5FRE A;  1GWK A;  2HYK A;  3M2M A;  4KH9 A;  4PLN A;  5KHH A;  2PQQ A;  2FDF A;  2E26 A;  2ET7 A;  2WQZ C;  2FMD A;  2VU9 A;  1OH4 A;  1W0N A;  3N9M A;  2OPW A;  4JTO A;  4L0P A;  5FAX A;  4CP2 A;  3BTZ A;  1IPJ A;  3UGF A;  1SBE A;  4BDV B;  2XR4 A;  2WNV A;  3A23 A;  1GUI A;  4KGQ A;  1VIW B;  3USU B;  5IUQ A;  1QOO A;  5EFU A;  2WNU C;  1WWY A;  3OPW A;  4MAD A;  5EZW A;  3VKO A;  3WF3 A;  3FLR A;  1JH5 A;  2IFW A;  1OI6 A;  4S2D A;  3ETP A;  2YGM A;  2BFU S;  3PUR A;  4NVP A;  2MNG A;  4CDW B;  1NY7 2;  3AMQ A;  4L97 A;  3AC0 A;  3AZZ A;  3IIA A;  3OTF A;  1FPN 3;  1ZBA 3;  4QB6 A;  3DL3 A;  4QQP A;  4KU8 A;  3O14 A;  2GAU A;  2VCA A;  1Z7S 3;  4WM8 B;  3KV4 A;  2X09 A;  1HRI 2;  4FPC A;  3N3H A;  1E5R A;  4GZ9 A;  1UY4 A;  4CCJ A;  1LHU A;  4ERO A;  1CQ9 A;  4ZY9 A;  4XET A;  1ULC A;  3NV1 A;  1V9U 3;  5FBZ A;  4P9I A;  3W9A A;  2R6Q A;  1PMH X;  4V1P A;  3CNA A;  3O1M A;  4WVM B;  5FY4 A;  1B35 A;  1PZ9 A;  1WGP A;  4Y5S A;  2K0G A;  1AR6 3;  4LA3 A;  2WWU A;  3TBD A;  4Y4Y A;  3I2O A;  2RMU 3;  4QX1 A;  1ULF A;  4JGZ A;  4BQW A;  3FUO A;  1AHS A;  3VUO A;  3KV5 A;  2P1B A;  3KVB A;  4COU A;  5FYC A;  3OGG A;  4NRP A;  5LY2 A;  5FY1 A;  2NYY A;  4IQP A;  1AYN 2;  1RJ7 A;  3OJB A;  2TEP A;  1RUF 2;  2VBP A;  2VME A;  1EUT A;  4IER A;  3AFG A;  2FDH A;  1QNW A;  2DF7 A;  3PUA A;  1S2E A;  2ARC A;  3C2U A;  2QDR A;  3B9C A;  1GOF A;  1K3I A;  2EA7 A;  4R8H A;  3ME2 A;  5T54 A;  4SBV A;  4IGP A;  4MVT A;  2BU9 A;  4XFG A;  1O7F A;  1SQ4 A;  2X8K A;  5I0S A;  1K5M A;  3USS A;  2EXI A;  1RUE 2;  3WDU A;  3R4D B;  2CV6 A;  3P3N A;  2IXK A;  4URA A;  3D5O A;  2XVL A;  4CU6 A;  2HWC 3;  4I0W B;  5FFO C;  1AR9 1;  1NA1 B;  1VRH 1;  1QJF A;  1N47 A;  3HQR A;  3JBG 1;  2XML A;  3MUY 1;  4MV2 A;  4W6Y A;  1C1L A;  4U2A A;  2VOK A;  5HXV A;  1W0O A;  1VBE 2;  3WXP A;  2ZX1 A;  5JWP A;  2ZGR A;  1UOB A;  1ASJ 1;  3WNP A;  1QEX A;  1AL2 2;  1E5H A;  3AL6 A;  5A3M A;  1WLD A;  3MIC A;  3IPV A;  2VZP A;  3FLP A;  4IEX A;  1W6O A;  3BGA A;  3VN4 A;  5B4X A;  1X36 A;  4X8N A;  1CAV A;  1F9K A;  2YC2 A;  3ROU A;  1GNZ A;  4BQ1 A;  1TME 3;  1RHI 2;  4YAR A;  2WLP A;  4IEO A;  3TN9 3;  5KHG A;  1ULP A;  3NNL A;  3DUI A;  5D8A B;  2RS1 2;  3AKT A;  1FX5 A;  4K20 A;  3WX5 A;  4AW7 A;  2X10 A;  4FPH A;  3WF1 A;  2W39 A;  3PHM A;  2YDE A;  3AMH A;  3R4S A;  4ARX A;  2A71 A;  1AF9 A;  4UBH A;  4A6O A;  2TUN A;  4YM0 A;  3O1U A;  1L7R A;  3ZX7 A;  2ETE A;  2HWD 2;  5FJK A;  4Q26 A;  3ZR5 A;  2UUR A;  3W21 A;  2MEV 2;  1XE0 A;  2AUY A;  2QFE A;  4MGK E;  4O9E A;  5DG1 A;  4TZD A;  2QNK A;  2YV8 A;  4Q0P A;  3VD3 A;  1QOT A;  3A0N A;  2AH2 A;  4YVS C;  1JZ4 A;  2PEL A;  3INA A;  4TWT A;  1XNT A;  3AP7 A;  4NIA A;  3LDK A;  4P9Y A;  3KHB A;  1BKZ A;  2R06 1;  2Z69 A;  3MIG A;  5T5P A;  3LDR A;  2Q8E A;  4B29 A;  2G4I A;  4CCD A;  5FZ4 A;  5DQ0 A;  4UW4 A;  3ZXJ A;  4CE8 A;  1LR5 A;  4L8Q A;  1S0E A;  2BBA A;  5DAP A;  1O4Y A;  2Y0O A;  1NCQ A;  2WNV B;  5A3U A;  1DQ4 A;  1YJL A;  2K46 A;  4JHZ A;  3ZIW A;  4CVU A;  4AE2 A;  4EZH A;  3N7K A;  5JAX A;  3BU0 A;  1J59 A;  5AC9 1;  5A7S A;  4XJU A;  5IK8 A;  4HVO A;  4EQV A;  5IAX A;  4QD2 A;  1Q8P A;  4CXY A;  1Q8V A;  2Q1Z B;  1HB3 A;  1J1T A;  1IPS A;  1XOY A;  1BHG A;  2F6B A;  2WII B;  3U4S A;  1DFQ A;  3RQ0 A;  3UT0 A;  5F37 A;  1RUI 2;  5J37 A;  2A5Z A;  2LS6 A;  3DN7 A;  2C6S A;  4YM1 A;  4RFR B;  1EY2 A;  1R09 2;  4CDW C;  5HV4 A;  1GSL A;  2XWJ B;  4B7E A;  4YGE A;  1TE1 B;  2P34 A;  5ANQ A;  5A1L A;  5FK7 A;  5FPV A;  5KHJ A;  2V5Y A;  5FPB A;  2VMC A;  4Z82 A;  1JN2 P;  4IV3 A;  4Q2F A;  4JKL A;  4WM8 C;  4LO8 A;  1LKN A;  1A8M A;  1B35 B;  4RHV 1;  5EQU A;  5DZG A;  1DQ6 A;  4Y3O A;  3QD6 A;  2DWR A;  3HIF A;  3HPN A;  2DVF A;  5KC5 A;  1O6U A;  3HD8 B;  3AJY A;  4JGZ B;  1Y4W A;  2D3P A;  2FCV A;  4P5H A;  2B39 A;  4COZ A;  5D1I A;  1EV1 1;  1OQD A;  1LGN A;  5FQ0 A;  3UKV A;  2FCT A;  3MID A;  2W87 A;  5H9R A;  2BEO A;  2HWF 1;  1D0H A;  4TTG A;  4IEV A;  5F2W A;  2JDY A;  3AP5 A;  3LEI A;  1AR9 3;  3ETQ A;  2ZEZ A;  3JBG 3;  4MLO A;  3I2K A;  5DUX A;  3LFM A;  3S7I A;  2UYA A;  5JR7 B;  2BWC A;  1REE A;  2D40 A;  2DUO A;  3HBK A;  2CSG A;  2OQ6 A;  4M00 A;  3WP6 A;  5BNO C;  2EIE A;  5C9A A;  5F32 A;  2V4V A;  4W4Z A;  1K5M B;  2VTX A;  3UES A;  5KXE A;  1VAV A;  3BU7 A;  4GIQ A;  3U37 A;  2WUH A;  4DUV A;  1RXF A;  5LEK A;  4ZU5 A;  3VBR C;  3BB6 A;  3VBO C;  1LRH A;  5L36 A;  1IG0 A;  4LOT A;  3WCS A;  1G9D A;  5FZI A;  5I0U A;  4IEU A;  5CNA A;  4K1Z A;  1MEC 3;  3VZL A;  2XPJ A;  3P1I A;  3OF1 A;  4LO7 A;  1RVF 2;  5LY1 A;  1CAV B;  5JIA A;  3WG2 A;  5BYN A;  3ZKY A;  2GC3 A;  3NNM A;  5GZE A;  1GZW A;  4QXK A;  4EN6 B;  1DQ2 A;  1V6O A;  2Q8D A;  1DZT A;  1O5U A;  1PO2 1;  4UYB A;  4N9H A;  4NHL A;  2IZW A;  3RYP A;  2VZU A;  4AI3 A;  5A3P A;  4DUX A;  4Y26 A;  4Q4W 2;  1F5J A;  3ITQ A;  4AFD A;  4LKS A;  5CG9 A;  1JI6 A;  4DEV A;  1WCD J;  2D6M A;  3WY6 A;  4BZ4 A;  3BI3 A;  5GLW A;  2Y6K A;  3H7J A;  1XU2 A;  3O12 A;  1H2L A;  1RIT A;  3CJX A;  5DAX A;  3ACL A;  4UAP A;  3GZT B;  1QQP 1;  2VMI A;  3PME A;  3SLI A;  4GB3 3;  2PAE A;  3K4A A;  4UWD A;  4JDM A;  3DPR C;  5C3S A;  1H8V A;  2VAU A;  3LEM A;  1QNY A;  2VR4 A;  1MS4 A;  1R1A 2;  1VBD 2;  3VHN A;  5CKN A;  1VBA 2;  1W8Z A;  2XBO 3;  2WO1 A;  3THP A;  2RS3 1;  4XXA A;  3FBM A;  2D6K A;  4IW3 A;  1NCQ B;  4A44 A;  1JYI A;  1H9W A;  2DFB A;  2PLV 2;  2A1X A;  2HWB 1;  4OFG A;  1R1A 1;  1S0G A;  5F5Q A;  4G9S B;  1W6P A;  4P9L A;  1WCQ A;  1Y9G A;  1FV3 A;  4XCA A;  1COV 1;  5JMC A;  1PMJ X;  2WN2 A;  3RJR A;  5FYU A;  3C8X A;  1GWM A;  1N1S A;  5DN2 A;  3V65 A;  4GKY A;  3MPB A;  3I3D A;  4W8J A;  4HK8 A;  3KSC A;  2XJQ A;  3OGJ A;  4LBO A;  5A3N A;  2P3Y A;  4AHW A;  5J09 A;  2W46 A;  3RZH A;  4YWA A;  3LKJ A;  1XJA A;  3W58 A;  1J83 A;  4AFM A;  4CP9 B;  2XJU A;  1HXS 2;  1D2Q A;  2D6N A;  2JIJ A;  5FMO L;  3ES4 A;  1POV 0;  5FO8 B;  3I7D A;  2PYT A;  4XFC A;  4AFC A;  1K12 A;  2HWF 3;  4LHK A;  4IV3 B;  5GZC A;  5FLI A;  3TNP B;  4I2O A;  3PUH A;  2W1S A;  4AI1 A;  3T0A A;  1AL0 G;  3UET A;  2C24 A;  1LAJ A;  2RM2 2;  3L2Y A;  3B02 A;  1UXZ A;  1UYY A;  4A3X A;  4AG4 A;  4TLF A;  4DPN A;  4DEQ A;  1KFX L;  1US2 A;  5FPZ A;  2K2S A;  4LEJ A;  1SPP A;  1JYW A;  3U07 A;  4K6B A;  2WO2 A;  2WA3 A;  4XF0 A;  5C4W A;  5BNQ A;  1G86 A;  4HMZ A;  5FQ0 B;  4LBK A;  3I3M A;  1B35 C;  2VCM A;  4NAO A;  1BEV 1;  2YB7 A;  1OUR A;  2BFU L;  1PNG A;  4Y24 A;  1UOJ A;  4JGZ C;  4QHB A;  3NW4 A;  2GC1 A;  4LE3 A;  4NWV A;  3NJV A;  4RQP C;  5FXW A;  2ZMN A;  5IFT A;  3ILN A;  4FPJ A;  1YCI A;  4TN7 A;  4UFM A;  5J98 B;  4F8A A;  4YZ2 A;  3D0S A;  3VDD B;  5C9A B;  4A41 A;  5C3P A;  3OSD A;  2Y34 A;  4QQH A;  2NMN A;  4MX3 A;  4NMI A;  5FYZ A;  2XJT A;  2FHR A;  1HQW A;  1VPH A;  4G4F A;  5FXX A;  3APB A;  3ZFG A;  4N7U A;  1C5I A;  3M70 A;  4MXW A;  1TMF 1;  4B4Q A;  2VL4 A;  3NL1 A;  1PO2 3;  1T6B X;  2GU9 A;  5F3I A;  5FXZ A;  1D7P M;  3MFC A;  1GQG A;  1SLT A;  2W5F A;  2BWA A;  1UN1 A;  2CDP A;  3K75 B;  3MIF A;  2VTX J;  5A7O A;  4MGI E;  2FZ1 A;  3HQU A;  2BGC A;  3RPQ A;  4C0H A;  4HBN A;  4XIO A;  5FZF A;  2XXZ A;  4FTE A;  3WOG A;  2FZ2 A;  4LIT A;  2VM9 A;  3MF6 A;  1AR8 2;  1S0C A;  1IPK A;  2WL1 A;  2ZKN A;  4MET A;  1OD3 A;  4KI5 M;  1WKY A;  3SCG A;  4ZU7 A;  1GZW B;  3VB9 A;  3R0R A;  3ZSM A;  1QQP 3;  1HN0 A;  3J8F 1;  3JQW A;  2PMW B;  1S0B A;  5E8A A;  2ZAA A;  1CES A;  3ZMN A;  2JE7 A;  3POW A;  2OXB A;  4HN1 A;  3SNM A;  2ZTN A;  1DGL A;  5DXD A;  3NMB A;  3CKH A;  5FIX A;  4Q4V 2;  5IAT A;  2W1W A;  5C71 A;  5LZ6 A;  3KCX A;  4Q4X 1;  3M7A A;  1LB2 A;  2VCB A;  4I01 A;  3ZXK A;  3GZE A;  2VNG A;  2AC1 A;  1MS0 A;  4XBQ A;  2UY9 A;  3Q8B A;  4PIY A;  4PIX A;  1RIN A;  3NKG A;  5A6Q A;  5CEH A;  1W8N A;  2ADD A;  4ONU A;  3VKL A;  2YU2 A;  4GXL A;  4LO5 B;  5JXJ A;  3THC A;  2XHK A;  4I0B A;  4IEP A;  4Q4Y 1;  1H8T C;  2KM2 A;  4UI9 L;  3T4V A;  3KF3 A;  3ZO0 B;  2RJL A;  3WDY A;  2JDK A;  4H7M A;  4XFA A;  1FNY A;  2NQY A;  3B7M A;  1W6P B;  3AKQ A;  3PUI A;  2A6Y A;  1OLM E;  2B7Y A;  1PVC 3;  1KGY A;  2P17 A;  4MGS A;  2XKP A;  2RDN A;  4UW5 A;  5FZ8 A;  4AEK A;  2YFU A;  1UYZ A;  4Q0U A;  5J36 A;  2OVU A;  3RMY A;  4EV0 A;  2BTV C;  3BTA A;  1N3P A;  2FDJ A;  1RUG 3;  1UWW A;  2VTF A;  4XAC A;  3ZYP A;  5I8T A;  1GQH A;  2ZGT A;  1QJY 2;  4QGN A;  4ZHN A;  3ACH A;  3OGR A;  4Y33 A;  1FV2 A;  1O3T A;  2BBV A;  3PVO A;  3RI9 A;  1OA2 A;  1O8S A;  4B4P A;  1FI2 A;  1G9F A;  3SKJ E;  3WD5 A;  3S0M A;  2RDS A;  4LO4 B;  5AVP A;  5L7O A;  4N53 A;  1SCR A;  3K51 A;  5ERL A;  3GBG A;  4FFG A;  3PDQ A;  3I3B A;  5FKB A;  1BEV 3;  2YMZ A;  3ON7 A;  4FBF A;  1Y9Q A;  4CXW A;  2W91 A;  4BIF A;  1PK6 C;  1OKO A;  1QJX 2;  4CSW A;  4CEY C;  1EAH 1;  4E8C A;  3UV9 A;  1SCS A;  2E7Q A;  4Z2W A;  3KT1 A;  2AEN A;  4QKF A;  4MGT A;  1SPP B;  2ZZQ A;  4C8D A;  4PBP A;  3S5Q A;  1RMU 1;  2I2S A;  4NRQ A;  4WM7 C;  4AVC A;  2HWE 2;  3WDV A;  2TNF A;  1UY3 A;  4J1W A;  4FT8 A;  1GOH A;  1DYP A;  2VPV A;  2JIC A;  4GJZ A;  4XF3 A;  5HXM A;  3O0X A;  2IWG B;  2QQU A;  3DEC A;  2VUJ A;  4P08 A;  3AYE A;  1KDM A;  1GZC A;  4O9G A;  4RR3 A;  1O59 A;  2WZR 2;  4GMP 3;  3ZXL A;  4J1X A;  2VQU A;  4MH0 E;  2ZA9 A;  4PDW C;  1APN A;  2E53 A;  3GYD A;  1KIT A;  5EYY A;  3VBS B;  2D97 A;  1UPI A;  3E1F 1;  3N7M A;  4JX0 A;  4Z1V A;  3FHA A;  1U12 A;  2P3I A;  4MXW B;  1GIC A;  4RFT 0;  3ZYR A;  2VNO A;  4IND A;  5C9A C;  1DZR A;  2RR1 1;  4RL7 A;  4IV1 A;  3O1V A;  2RJ2 A;  3K48 A;  4UFH A;  2VMG A;  4JZR A;  4Y22 A;  4IDZ A;  3MF9 A;  3NWK A;  4P9G A;  4XQW A;  3DYP A;  1V6I A;  1UPS A;  3NRU A;  3K77 A;  2VOT A;  3IWZ A;  1YFY A;  1PO1 3;  2WQ4 A;  2GP3 A;  2ZEW A;  3WNK A;  2RDR A;  4EJR A;  3I49 A;  3JD7 1;  5CIR A;  4PBO A;  1UYX A;  1I1E A;  4UFK A;  2WT0 A;  1K42 A;  5T50 A;  4NHK A;  2D43 A;  2YBK A;  2ZGP A;  1US3 A;  3CU7 A;  4H7L A;  4QGM A;  4Y5Z 0;  2Q0A A;  4OHW A;  5K9Y A;  1DP0 A;  1NCR B;  3T4H B;  1IS4 A;  2QQO A;  4IET A;  5FZE A;  5KHK A;  1AR7 3;  2QZ3 A;  3ORJ A;  4LKE A;  3RWK X;  3AZW A;  5A3L A;  1ZM1 A;  1VP6 A;  2E6V A;  4YG0 A;  5DAB A;  3PNA A;  5A70 A;  5C7G A;  4NIH A;  1RUO A;  3AP4 A;  4Q1R A;  5FYI A;  1W04 A;  1S0F A;  2CNA A;  4LPL A;  1D0G A;  1V6N A;  1RUD 1;  4AHZ A;  3PL0 A;  3I4I A;  1UIK A;  2R07 3;  3AX4 A;  4AHX A;  1FPN 1;  4CXX A;  1ZBA 1;  1CON A;  2WAO A;  2DBI A;  1V9U 2;  3RYK A;  3AZV A;  5ACA 2;  1XNK A;  1Z7S 1;  4XC9 A;  2D98 A;  3AYA A;  1NUK A;  3BIE A;  2WSU A;  5CU1 A;  5J3U A;  1AR6 2;  1GWL A;  1MS3 A;  2HEW F;  2WS9 3;  2WT1 A;  1CZS A;  2AAC A;  3HWJ A;  4NRO A;  2F17 A;  3M1H A;  1YIP A;  3M4F A;  3KB5 A;  2RS5 2;  3BOP A;  4C1X A;  5JSP A;  4IGQ A;  1RUC 2;  2R30 A;  2WFF 3;  5GZD A;  5LRR A;  1GZ9 A;  1AJK A;  4F7Z A;  1W2N A;  2WR9 A;  1UD1 A;  4IE7 A;  1O5L A;  4HKO A;  2RMU 1;  5T5L A;  1NQJ A;  1EAH 3;  2DFC A;  2YU1 A;  2ORZ A;  5CIS A;  1W06 A;  1YFU A;  5FY5 A;  3ZFF B;  4NAM A;  1I3H A;  1R1Z A;  1D4M 1;  1RMU 3;  5L7O B;  4N53 B;  4OHV A;  2D6P A;  4C91 A;  3FE5 A;  4C90 A;  4ZXE A;  1NE4 A;  4I3P A;  1JMU B;  4Y1Y A;  1ND3 B;  2PHF A;  1QOS A;  4BMB A;  3KD4 A;  4NID A;  2XJV A;  1KQR A;  4N43 C;  4I09 A;  2QQN A;  3UGH A;  4OQ8 A;  1M4W A;  2QE3 A;  3ZN6 A;  1YQ8 A;  5FP8 A;  4FTB A;  1O3Q A;  5IVF A;  3AKR A;  1UZ0 A;  2A6V A;  2HWC 1;  2ZML A;  4XJZ A;  3AVR A;  3GXU A;  3OD4 A;  4LQR A;  3DXU A;  3WG3 A;  3ZXD A;  4CCE A;  1OD5 A;  1WLW A;  5JCT A;  1TME 2;  3VHO A;  2YY1 A;  3RSJ A;  2C4X A;  3TN9 2;  3OYW A;  3BTX A;  1W8F A;  5LB6 A;  3CHX A;  4DXS A;  2VZ3 A;  3W59 A;  1BVP 1;  5C4W C;  1JYX A;  4FPK A;  2VMH A;  5H9Q A;  2LUW A;  4RR3 B;  4XJW A;  5CKQ A;  2J7M A;  2QQJ A;  2C9A A;  5HCB A;  5J1X A;  5JPN B;  1UZV A;  2YZ4 A;  4P02 B;  4ZON A;  3TYJ A;  2B8M A;  3KM5 A;  2DYC A;  4XF4 A;  2LTN A;  4XUP A;  3GDB A;  3TB0 A;  1AJO A;  5GLU A;  1VAK A;  2QQP A;  4QX3 A;  2ZMK A;  1XE8 A;  2OA2 A;  5K0U A;  2ATF A;  4JGY B;  1VMJ A;  3IKW A;  3T1M A;  1S1A A;  5FCC A;  1F2N A;  4I02 A;  2VVD A;  1CIY A;  3JD7 3;  4IV1 B;  3F2Z A;  3MV0 1;  1BZW A;  4LUL A;  1W3V A;  4Y22 B;  4AVT A;  5IVC A;  1QH7 A;  1ULO A;  3ZFG C;  4A2U A;  1UY2 A;  2NPI A;  3J7N A;  5JXG A;  3T3Y A;  1ZX5 A;  3J9S A;  4YZ5 A;  2VVF A;  2VZT A;  5IAV A;  4JRA A;  1RL3 A;  1NT0 A;  1X8E A;  2PHU A;  2Q5T A;  4GJY A;  5FJH A;  3K2O A;  1W9W A;  4FPF A;  3ZYF A;  2WYS A;  1PIV 3;  4KU7 A;  2C9K A;  2R1D A;  3BYW A;  4V2V A;  3WF0 A;  1F8V A;  4CRQ A;  2W1U A;  1RUD 3;  4XMI A;  3WUD A;  2B5H A;  1VB2 A;  3NVC A;  4CDX C;  4ZKT B;  2XQR A;  3ZYB A;  3TOJ A;  1X8M A;  3IZO A;  1CN1 A;  3EYP A;  3POJ A;  2JDP A;  4JKK A;  3E5X A;  5DUW A;  4O7X A;  1TZO A;  5E88 A;  4NN0 A;  1FOD 1;  1MVE A;  3MIB A;  3PUQ A;  5CYY A;  4EN7 B;  2ARA A;  3FC0 A;  1RXG A;  4FXK B;  5FZG A;  2DCJ A;  4FQZ A;  1DYK A;  4XFF A;  3HT1 A;  2PFW A;  4K40 A;  4ATF A;  4EWE A;  4FVV A;  1UO9 A;  2GSY A;  1UX6 A;  4GUL A;  4MUV A;  4AI8 A;  2XLA A;  4HG6 B;  5G05 L;  2EID A;  3H1Y A;  4PLO A;  4R4X A;  1G9A A;  1Q8S A;  1A34 A;  4KBZ A;  5EIY B;  2BP6 A;  3WG4 A;  1A6C A;  1X82 A;  4CTE A;  2ZHN A;  3ACF A;  3M3C A;  3MW4 A;  3VBF A;  1CJP A;  3H1M A;  4XIL A;  3UKN A;  2AYH A;  1WD4 A;  4IUG A;  3ECQ A;  3CBN A;  1PNF A;  4QM9 A;  4AFA A;  1D4M 3;  2J1E A;  1J3P A;  2YC4 A;  1DLC A;  4YYO A;  3SIT A;  1GKB A;  1W6Q A;  2XLF A;  1ZRC A;  5FP4 A;  1I9R A;  1VMH A;  2CGP A;  5GZG A;  5F39 A;  1KJL A;  1UKG A;  3OD0 A;  2KR2 A;  1AR9 2;  1VRH 2;  2X05 A;  3MV1 1;  3JBG 2;  1RUH 1;  2P6H A;  2J42 A;  3LQC A;  1ODN A;  2ET1 A;  5K7P A;  3CMG A;  1XQN A;  2ZGN A;  5L9B A;  1ASJ 2;  1J3Q A;  2H6C A;  2VEC A;  2YBS A;  4JRL A;  1ZRF A;  3ABZ A;  5ABJ C;  2D93 A;  2OS2 A;  4LKF A;  4Z2A A;  4IEZ A;  1SG3 A;  5T52 A;  4AWD A;  3PMS A;  2UYB A;  3R05 A;  5EYX A;  5LA0 A;  2Z4F A;  5FZO A;  4JAA A;  5GLZ A;  4AVV A;  1BBT 3;  2WAB A;  3WV6 A;  1MS9 A;  4XMA A;  3ZDV A;  4ATE A;  1OLQ A;  3ZN6 B;  1RTV A;  1DGR N;  5E1R A;  4CUG A;  1MPX A;  1UCX A;  3FMG A;  4Y20 B;  2EAK A;  4LBL A;  2VMD A;  2OKX A;  1GAN A;  1VBC 3;  2K9Z A;  3GHN A;  3BAL A;  4HXC A;  4NPL A;  4HSL A;  5C8W A;  1AX1 A;  2BUK A;  3OYW B;  4JV4 A;  1F4H A;  4LMF A;  4BU2 A;  1VBB 1;  4AED C;  1FMD 3;  1GNH A;  2V09 A;  2O8O A;  1MEC 1;  2SLI A;  1WW4 A;  2XKO A;  3KV9 A;  5FZ7 A;  3DCQ A;  3ZDS A;  4ZPI A;  5FUI A;  2VQ0 A;  1CGP A;  3I59 A;  3ZKU A;  1N1V A;  1LNS A;  1LEC A;  2R06 2;  1QXR A;  4XFB A;  3R6S A;  2DDU A;  4PHZ A;  1DZQ A;  1RED A;  4L92 A;  4RGA A;  4A7Z A;  3WP5 A;  4YSF A;  3E5Q A;  4HAN A;  5I0T A;  5K0U B;  4RR3 C;  2WQ8 A;  4M4R A;  2YHJ A;  3SH3 A;  1W3X A;  4NHY A;  4M3C F;  5AC9 2;  3OBT A;  2IFR A;  2AEY A;  3N9O A;  5JIU A;  1ZZC A;  1GP6 A;  2Y6L A;  3D8C A;  4LXL A;  1JUH A;  3KCC A;  4BA6 A;  2O8Q A;  2HLE A;  3VD4 A;  1JU3 A;  5HI0 A;  2DTY A;  4DY3 A;  4GB3 1;  4IEW A;  1LGC A;  4GKX A;  3OBR A;  4B8E A;  3WP4 A;  1YWK A;  2JG9 A;  1RGS A;  3NNJ A;  2XH6 A;  4AVS A;  2YGL A;  4JCK A;  4AEJ A;  4QXH A;  1FOD 3;  3WSO A;  4IL7 A;  4FPY A;  2DVD A;  1LOE A;  2XBO 1;  1D2S A;  1ZZ6 A;  5FZB A;  3NAP A;  4DB5 A;  4AHY A;  2OZJ A;  1ZZ8 A;  5JVV A;  1OQ1 A;  4XCB A;  2QQW A;  1QIQ A;  3III A;  4OI4 A;  4XIK A;  5CB7 A;  4DS0 A;  2ADE A;  3VZN A;  3N9P A;  1REF A;  1OFS A;  2BNO A;  2R0H A;  4LK6 A;  4RHV 2;  4CP9 A;  3V0B A;  1BMV 1;  5FOB B;  3ZFE A;  1YFW A;  4D94 A;  1PZ7 A;  2JDA A;  4GWJ A;  2UY8 A;  3SIS A;  1U5Y A;  1G9B A;  4LBM A;  5KHI A;  2ZAH A;  4BM8 A;  1EV1 2;  4BQ5 A;  3E6C C;  3Q9O A;  2IVJ A;  2HWF 2;  4D7Y A;  4EN0 A;  4LUK A;  2KA3 A;  4XF9 A;  3WG1 A;  1JZ8 A;  2YBP A;  3LEK A;  1LOG A;  1OH3 A;  4IEY A;  1X50 A;  1RUH 3;  3FFQ A;  3VBF B;  1JZ2 A;  1RUJ 1;  4DIN B;  1ONA A;  2YRO A;  3OPZ A;  4ITC A;  4HKW A;  3RZM A;  2QUO A;  3A22 A;  2A7A A;  1W6Q B;  4AAX A;  4DXT A;  1L7Q A;  1OLR A;  1ZZ9 A;  2XHN A;  3I3E A;  4QX8 A;  4AZZ A;  3H42 B;  1XND A;  2OUJ A;  5CFC A;  2XLG A;  5FV3 A;  3W20 A;  3CEW A;  3IN9 A;  4YM2 A;  1LOC A;  4OI0 A;  2X29 A;  3VDD A;  3DKW A;  3VZJ A;  5JDB A;  3I2J A;  5DAW A;  4LBN A;  2J1A A;  1ZZB A;  1AYN 3;  2VUC A;  3DGT A;  2EXJ A;  2RJK A;  1UX7 A;  2G9Z A;  4XUR A;  1RUF 3;  4FFF A;  1UKR A;  3B01 A;  3LA7 A;  5FKC A;  1AYM 1;  2NLR A;  1XRU A;  3LF7 A;  5IVE A;  2OT7 A;  5DUU A;  4QMA A;  4FSJ A;  1I5Z A;  3SCF A;  2CY6 A;  5JLV A;  2A3W A;  2VZO A;  4Y1Z A;  5FZO B;  1VBB 3;  5FZ0 A;  4BB3 A;  2BW8 A;  2DU0 A;  3FHQ A;  1PO2 2;  1TVG A;  1HV1 A;  2R1B A;  1NA1 C;  1RUE 3;  4M3C A;  2WC2 A;  4Q5O A;  3NST A;  4N7I A;  2WSV A;  1W90 A;  4LK7 A;  3H8O A;  2JIG A;  1HKD A;  1LHV A;  5CKM A;  5IHR A;  3UGG A;  1UOF A;  2PTM A;  1MQT A;  3E5U A;  3AKS A;  1POV 1;  3I3Q A;  1HB1 A;  4DNY A;  2QQL A;  5A7N A;  1AL2 3;  4D69 A;  4OUS A;  4GWM A;  2J1U A;  2A6W A;  2W52 A;  1IGO A;  1QQP 2;  2EIC A;  3C7O A;  3JCI A;  2GDF A;  4I3G A;  5F9T A;  1OT5 A;  3I59 B;  3LE0 A;  4HVQ A;  5D8A C;  2WFP A;  3WUC A;  2O14 A;  4KBB A;  3BIW E;  1PMI A;  5BUV A;  3VL9 A;  4YW1 A;  1QGL A;  1LUL A;  1S2K A;  1YQC A;  3Q8E A;  1JZ6 A;  3S7E A;  5JXH A;  2XUM A;  2RS3 2;  1DGR A;  2ZGS A;  1C8N A;  2RHP A;  4HSJ A;  3NJZ A;  3THT A;  1JZ3 A;  4E4D X;  2OQ7 A;  2QTW B;  2HWB 2;  2ZOE B;  4YZ4 A;  2PHL A;  4EWA A;  1S0D A;  1HQN A;  2GAL A;  3C7E A;  3U4X A;  2R32 A;  2QQV A;  1ZBE 1;  2LRP A;  2ZAB A;  2MEV 3;  2B45 X;  3E6D A;  3JZV A;  3VD9 A;  1RUN A;  4LIU A;  1GZT A;  1COV 2;  1CPM A;  2BRT A;  2QZ2 A;  3HOB A;  4Y4R A;  1XU1 A;  2RG4 A;  1S4C A;  2VD7 A;  4Q0S A;  2DCZ A;  1DU3 D;  3AFK A;  2VZQ A;  4RS5 B;  2HEY F;  2HH9 A;  1C28 A;  2EVX A;  2JG9 B;  1DQ5 A;  4P00 B;  4XBL A;  1I6X A;  1C4R A;  2A6Z A;  4LE4 A;  2JDN A;  5A80 A;  2WNV C;  1OPO A;  3KWV A;  4Z07 A;  4ZU4 A;  4LHN A;  1OVP A;  4IES A;  3B93 A;  1UY0 A;  3J7H A;  3NAP B;  4ZS2 A;  3WP3 A;  4CCM A;  4YW6 A;  1W0P A;  3GNE A;  4D8M A;  2Q30 A;  3PLQ A;  4HFS A;  4P9W A;  3AKP A;  3PU3 A;  4FOV A;  3EJK A;  4HKL A;  4J25 A;  3G7D A;  3MEP A;  1TQ5 A;  1MAC A;  1X9T A;  5LAS A;  4CUC A;  5JSO A;  3V0B B;  4DXR A;  3ZIX A;  3ZFE B;  3RNS A;  1PVC 1;  3B5L B;  3OEA A;  2OII A;  2WIN B;  3I8T A;  1AX0 A;  1RUJ 3;  1SMV A;  2Y6J A;  3PTR B;  1HJG A;  4P14 A;  5DPN A;  5A3T A;  5F6K A;  1QDC A;  2VXJ A;  3C7F A;  1LU1 A;  4MG2 A;  1ZRI A;  1RUG 1;  2Y6F A;  3HR9 A;  1RC6 A;  1H2K A;  1WD3 A;  1BEV 2;  1R09 3;  3KT7 A;  4NO4 A;  5CAD A;  3S6P A;  2VBD A;  5FDB A;  5JOZ A;  3ELN A;  4BXS V;  4MOA A;  2WWS A;  5BNP B;  2GNT A;  5F7U A;  1C57 A;  5C5T A;  2DV9 A;  2HBT A;  1N3O A;  2BVV A;  5A6X A;  1UZY A;  5FYB A;  4M0H A;  1VJ2 A;  2Y60 A;  2HKX A;  2EXH A;  5T5O A;  3H8U A;  5GKA C;  3VV1 A;  1AYM 3;  4EN8 B;  5G04 L;  2A73 B;  4QDQ A;  1JOB A;  5CFC B;  1ND2 A;  1WBF A;  4RN5 A;  3EMR A;  3TEX A;  1LCL A;  3BVC A;  1R08 1;  4Z8B A;  1CR7 A;  1TMF 2;  3D6E A;  5FMC A;  2ES3 A;  3OGV A;  2XJP A;  4D6S A;  1TEI A;  3CIH A;  4PF5 A;  3RS6 A;  3VBS A;  4XPV A;  2ZPX A;  1LJ7 A;  3LB9 A;  3GF6 A;  4L99 A;  5L9V A;  4CU7 A;  2EAL A;  2E31 A;  2Z5W A;  3T08 A;  3WT3 A;  3ZYI B;  1H9P A;  3OGS A;  4GAL A;  2ARX A;  5FBJ A;  3A0K A;  5GM0 A;  1POV 3;  3I2G A;  4H3W A;  3DF0 A;  1W9F A;  3OBA A;  4E9K A;  1K5M C;  1BQP A;  2FMY A;  4YW5 A;  5K8S A;  1XPW A;  4KNC A;  4GMP 1;  3VLB B;  1DHK B;  3J8F 2;  4BWO A;  5FZ6 A;  3MDP A;  4M3C B;  3WNM A;  3GGL A;  2VBB A;  2IXI A;  2VZV A;  3JB8 A;  1C3H A;  5A7Q A;  3RJ2 X;  3T0B A;  3N35 A;  2E9Q A;  3HN3 A;  2D5F A;  4QXB A;  2CYF A;  4BIO A;  1MQT B;  1IS6 A;  1SLB A;  3VKN A;  1Z0H A;  4Q4X 2;  4CCL A;  2OX0 A;  2C1F A;  2NN8 A;  2UWB A;  2VUA A;  3K4D A;  2Z79 A;  2WNU A;  4AF9 A;  4QKB A;  1RVF 3;  4C1W A;  3VDB A;  4BQ4 A;  4AEM A;  2JDH A;  3HNM A;  1ZBE 3;  1NCR A;  1UU4 A;  4QPW A;  1OMI A;  3PTY A;  5FZM A;  1KXG A;  1PO1 1;  1W8H A;  2XB6 C;  2I07 B;  3GZU C;  1VRB A;  1VMF A;  1NLR A;  1HDK A;  1ENX A;  4Q4Y 2;  2E7A A;  5CVR A;  5FZA A;  5GLT A;  4AXO A;  2BJS A;  4WVW A;  5JI7 A;  1PX3 A;  2WYF A;  2Y6G A;  3LSE A;  3WNN A;  4BYY A;  5KXC A;  1K45 A;  2D7F A;  2XG3 A;  3I97 A;  1NE6 A;  3OUH A;  3AZX A;  3POF A;  3BOD A;  4XFI A;  2WWJ A;  4DQA A;  1GNY A;  5LRS A;  3ASI A;  5GZF A;  1CAW A;  1KDK A;  2GC2 A;  4Z92 B;  2DU1 A;  2OPK A;  4RD7 A;  1GV9 A;  3DYO A;  4WZC A;  3VBU A;  4FFI A;  4JTN A;  1JZ7 A;  1AR7 1;  1YXW A;  5FLH A;  4DOU A;  1PGW 1;  2AZ5 A;  1SFN A;  4D7T A;  3RRD A;  1SFP A;  1UY1 A;  5A3O A;  3O1R A;  4FOW A;  5EWS A;  5FP9 A;  3MIH A;  4CCN A;  5IJR A;  4B3N A;  4BQX A;  2PAK A;  3P3P A;  3M3I A;  5DDJ 1;  4AI2 A;  2D6L X;  3CO2 A;  1U5X A;  3WR0 A;  2R07 1;  1NCQ C;  3CZJ A;  4LR4 A;  4COV A;  4AK3 A;  2BPA 2;  3OY8 B;  4E8D A;  2R7E B;  2A6X A;  3PU8 A;  5FP3 A;  1CX1 A;  3HVD A;  4MSV A;  4YGC A;  3V56 A;  3LPG A;  2JG9 C;  4QXC A;  3ZYG A;  2QKD A;  2PLV 3;  3ZSE A;  1JBC A;  2VVE A;  3AYD A;  3QH6 A;  4RGK A;  4BPZ A;  1OQE A;  1LGB A;  5I93 A;  2WS9 1;  2ORX A;  1UF2 C;  3WQ7 A;  3ZFF A;  1EAH 2;  1YQ6 A;  4PIZ A;  5HV0 A;  3NAP C;  2R04 1;  3QH7 A;  2WFF 1;  4FP3 A;  1LOF A;  2P4E A;  4XJ8 A;  3GCX A;  4QU2 A;  1JW6 A;  4FPL A;  2ZAC A;  3AMP A;  3WF2 A;  1UQX A;  3D0J A;  4L11 A;  1RMU 2;  2QBX A;  3AMN A;  3V0A B;  5BNN A;  1ND3 A;  3QCW A;  1WCK A;  4YG6 A;  3FX3 A;  4PQQ A;  3KGL A;  4CCK A;  5E89 A;  5JZG A;  4A7Y A;  4R9B A;  4LHS A;  3KCY A;  1HXS 3;  1R08 3;  1W99 A;  3KQ4 B;  3OG2 A;  4LKD A;  1UMI A;  5LBF A;  4PQ9 A;  5I0R A;  4IV3 C;  4MHR A;  4E2Q A;  1W8T A;  4CUA A;  2GMP A;  1Q5O A;  1L3J A;  1W39 A;  2DVA A;  3POE A;  4CPB A;  5FPA A;  1MR5 A;  1WME A;  4ZXK A;  5LA9 A;  1MVQ A;  3UYJ A;  1VAM A;  5EP9 A;  4BQ3 A;  2RM2 3;  3DKQ A;  1LOA A;  5F3G A;  3UJQ A;  4PLM A;  4AGV A;  3U78 A;  1UL9 A;  4FAH A;  1A78 A;  1ND2 B;  4KG0 A;  1VR3 A;  4XTM A;  3TWI A;  3H0O A;  4OVE A;  2VH9 A;  2P3J A;  2FDI A;  3UJO A;  1J3R A;  3MUZ 1;  4ES9 A;  2HEV F;  2RR1 2;  1FAY A;  1LOD A;  3WVJ A;  5FPU A;  2O1Q A;  3SCH A;  5AFE A;  2SBA A;  4LIV A;  5JOY A;  3LGR A;  4K3U A;  1C8M 1;  5CFC C;  2HBU A;  1OUS A;  2VC9 A;  3H3U A;  2GN7 A;  3HAG A;  4JGY A;  3VDD C;  3S57 A;  3RYR A;  2ZZJ A;  2ZGO A;  2WAA A;  1BVV A;  1QJU 1;  1DYO A;  3M3Q A;  5F8P A;  3SEE A;  3ZXG A;  4JDN A;  5JSR A;  3OOX A;  5FZK A;  3I2F A;  3PVN A;  3JD7 2;  2GNB A;  5C3Q A;  2ZJC A;  4QPG A;  1DGW A;  2DCY A;  4LLF A;  1QY4 A;  4TSV A;  2B46 X;  2YPD A;  4LO6 B;  2W0X A;  3KT4 A;  4Q29 A;  1OKQ A;  1QKQ A;  1S55 A;  1Y43 B;  2YYO A;  4AVB A;  4K8F A;  1SLL A;  2EXK A;  2WNU B;  5T55 A;  4R9C A;  4XDQ A;  4BLI A;  1W28 A;  3PVB B;  2I74 A;  1SLI A;  3H50 A;  1IQD C;  4HET A;  4OUM A;  4OI1 A;  4COW A;  2P6C A;  3MFA A;  4LNV A;  4KL1 A;  4YGD A;  1AR8 3;  1RUD 2;  1MQT C;  2MHF A;  2WN3 A;  2WZ8 A;  3T2O A;  1CAU A;  3VD5 A;  2V73 A;  3L2H A;  1JOJ A;  4XTP A;  1FPN 2;  5CFD A;  4MXV A;  1ZBA 2;  3T1L A;  1HRV 1;  3EQE A;  1SEF A;  4NHM A;  1Z7S 2;  1PIV 1;  1Y7B A;  3THD A;  3ZN5 A;  5B2G B;  4YM3 A;  1QXJ A;  5DDJ 3;  5T3N A;  3JB4 C;  3SEP A;  1H1A A;  3K46 A;  1CAW B;  1HX6 A;  4Q4V 3;  3VHP A;  1U0A A;  3AB0 A;  2UWA A;  1IKP A;  3POS A;  2QDN A;  5E6H A;  4OMC A;  3ZR6 A;  3N36 A;  3VBU B;  5A1A A;  5C6C A;  2W3J A;  4XZU G;  3EHK A;  2QCS B;  1DCS A;  4QX2 A;  1UOG A;  1HB4 A;  2XVK A;  3ACG A;  2VZ1 A;  5LW9 A;  2D5H A;  2VG9 A;  3GHM A;  1PGL 1;  4QAW A;  3HEI A;  2RMU 2;  4BH9 A;  1MS5 A;  1OA4 A;  3BPZ A;  4YRD A;  5EJ1 B;  5C5U A;  2R04 3;  3GCW A;  3O7O A;  4OLL A;  5BXX A;  2G9G A;  5FYY A;  4QHO A;  1UU6 A;  2CHH A;  3A4U A;  4X6R B;  2JD9 A;  3AL5 A;  4MGY E;  1U5I A;  1D4M 2;  2VUL A;  2BDR A;  2ZEX A;  1AXK A;  3M3E A;  2WRA A;  3C3V A;  4OCT A;  5D21 A;  1FT9 A;  2VGD A;  1OOP A;  3T2Q A;  1F31 A;  1AUY A;  2PA7 A;  3N9Q A;  3T30 A;  1MZF A;  2VOV A;  4CEW A;  1G7Y A;  3ZOI A;  5FK8 A;  3KV6 A;  4CU8 A;  2P3K A;  3WNL A;  3G6J B;  1SBF A;  2PN5 A;  4UW3 A;  2Q8C A;  4BLJ A;  4QX5 A;  5BNO A;  1DDL A;  3I54 A;  4D3W A;  5BNN B;  2HWC 2;  5E16 A;  1QJY 3;  3KS7 A;  2JE9 A;  5I0D A;  2D3R A;  4E4Z A;  5JZG B;  4K8R B;  1V70 A;  2YC0 A;  4FXG B;  5FZC A;  3VBO A;  4RYD A;  3WF4 A;  4D6Q A;  2OW4 A;  1UMZ A;  2DUR A;  3WLU A;  1ZRE A;  5IW0 A;  4FP2 A;  2VCC A;  1PM4 A;  3ATG A;  4HK9 A;  4Y20 A;  4AOC A;  2JDU A;  3BCW A;  4B1L A;  2B9V A;  1E57 A;  3FZ3 A;  4H2A A;  1C8M 3;  4I30 A;  5CAZ A;  3SHR A;  3K3O A;  3KMH A;  1A3K A;  1W8U A;  1NXD 1;  1BBT 1;  4NIG A;  3UK9 A;  2JE8 A;  1QJE A;  1QJU 3;  1M06 G;  3OCP A;  1YHF A;  4DIQ A;  4HT1 T;  3PJY A;  4MHU A;  2A3Y A;  1HW5 A;  1UU5 A;  3CDZ B;  5DMY A;  2ARE A;  2HWE 3;  4URT A;  5FOJ B;  3WNX A;  1VBC 1;  1E5S A;  1JOP A;  2ZX0 A;  1YIF A;  3AZY A;  4QKD A;  4RGG A;  1LTE A;  4NRM A;  1OHF A;  1ND2 C;  1Q8Q A;  4FPO B;  1IOA A;  5D2A A;  1FMD 1;  4QQL A;  1YQ5 A;  4UFJ A;  3HNY M;  1GR3 A;  1F35 A;  4LOR A;  2OYZ A;  1CZV A;  3AJZ A;  4N90 A;  3SH4 A;  5CG8 A;  1RIR A;  3T09 A;  1HN1 A;  3VBS C;  4CDQ A;  5IVV A;  1RJ8 A;  2D3S A;  3E97 A;  5HBA A;  2BYV E;  2UWC A;  1JUI A;  4LBJ A;  4QPG B;  1UZW A;  4QPI A;  5GLV A;  5FR3 A;  1KS5 A;  1ENS A;  3IDB B;  3VZK A;  4KWJ A;  5C8C A;  3LAG A;  3AP9 A;  2B4K A;  4KQ7 A;  3H8X A;  4AVA A;  3W5M A;  4M01 A;  4CPB D;  1V6L A;  1HRV 3;  2DTW A;  1XE7 A;  2VZS A;  4OYU A;  4RSU A;  4NE9 A;  3CJI A;  4AQT A;  2Q1M A;  2ID4 A;  4A6S A;  1KFU L;  2CAV A;  1FOD 2;  2BGP A;  3WHT A;  4ASK A;  2JEN A;  1LOB A;  3VDA A;  2NP0 A;  1XYP A;  1QWR A;  1W9S A;  4W6X A;  4XAB A;  1CAU B;  4YNI A;  2XWB B;  3VKM A;  4CCO A;  5KXB A;  5CFD B;  4OUE A;  2A75 A;  4L9B A;  4M3C E;  2ZX4 A;  3TNQ A;  3TEY A;  3IDE A;  2ZBJ A;  5FYH A;  2ZCW A;  2W92 A;  3RWN A;  3A7Q A;  4G3Y C;  4Q27 A;  2A3X A;  1WA4 A;  4WZF A;  1NCR C;  3EBR A;  5FXV A;  5H9S A;  1UAI A;  2EIB A;  2IVI B;  4BK5 A;  3MHZ A;  3HNB M;  2QVS B;  4Y1V A;  3EXU A;  4EYU A;  1V6M A;  2XJR A;  1UYP A;  2ZS6 B;  1Z78 A;  2CWM A;  4UBG A;  3N7J A;  3IDC B;  4V2W A;  4B7K A;  3SKV A;  3X29 B;  5JPM B;  1ZVF A;  2QQK A;  1NY7 1;  5IYY A;  1NYW A;  2EAA A;  4XDO A;  4IE6 A;  1SBD A;  4HPK A;  3VBU C;  4AI9 A;  4QPY A;  3LEG A;  1RUH 2;  4EZ4 A;  1FNZ A;  4W6W A;  4GD4 A;  1KS4 A;  3DV8 A;  2PHR A;  1IS5 A;  1PHM A;  2JJ6 A;  2BVB A;  3WW1 A;  5ACA 3;  2VO5 A;  1HRI 1;  1X33 A;  1H0B A;  1YI9 A;  1O4T A;  4OZX A;  5GJ6 A;  5IWF A;  3ZXF A;  4CYD A;  4OHY A;  1NZC A;  2GZW A;  3VDC A;  1OOP B;  5IVY A;  1GP5 A;  1E5I A;  1XNB A;  4QB1 A;  4YLZ A;  3FWE A;  2JB4 A;  1ENQ A;  1GOG A;  3JU9 A;  4XZP A;  4CEW B;  2XL9 A;  2RS5 3;  2ZXQ A;  1RUC 3;  4RQP A;  5A6Z A;  2AEZ A;  3IMN A;  5BNO B;  2ZGM A;  4XW3 A;  1ZA7 A;  1SHW B;  2WA4 A;  3LA3 A;  1EYB A;  2AGS A;  4J6G A;  5FZ3 A;  4DY5 A;  4JVA A;  2TBV A;  4E4S A;  2VQA A;  4FAG A;  3ZFF C;  2J1R A;  4K1Y A;  5F5A A;  3MLL A;  4QT6 A;  1LOF C;  2JX9 A;  4N53 C;  3VBR B;  5L7O C;  3VBO B;  5L19 A;  4WBB A;  1VBB 2;  2WZE A;  2G9F A;  2P5B A;  4GWI A;  3GBF A;  1AYN 1;  3POB A;  4XVH A;  1MEC 2;  5H9P A;  5C3R A;  3AK0 A;  1RUF 1;  3AP6 A;  4UT5 A;  1HQL A;  5BNN C;  1H4G A;  1ND3 C;  1TNF A;  4QKN A;  1YEW A;  2VMF A;  2D6O X;  3RZJ A;  3PJQ A;  2JKX A;  1LES A;  3OB8 A;  5JZG C;  1ULE A;  1BYH A;  1TNR A;  4AQ2 A;  1J84 A;  4YW2 A;  3ZN4 A;  1VE0 A;  1YFX A;  4F83 A;  2CGO A;  3TAY A;  5JXI A;  4QQ2 A;  1S0J A;  5FO9 B;  1RUE 1;  4OZO A;  5IVB A;  1UNB A;  1IHM A;  4ZZ8 A;  3RZG A;  4MYE A;  2VOX A;  1JYC A;  4M0N A;  3ZMO A;  2W9X A;  3U10 A;  2WT2 A;  1UXX X;  4S2G A;  3FN9 A;  1FYU A;  3HJR A;  1WUV A;  4NHX A;  5FRA A;  1VBE 1;  3BOW A;  2WO3 A;  4BQY A;  2IXL A;  1O8P A;  3WCR A;  1AL2 1;  5LBC A;  2WO7 A;  3GJA A;  1MZE A;  4BOW A;  5LWB A;  3TEZ A;  3CZU A;  4GB3 2;  5C70 A;  1H4H A;  1W6N A;  2VXR A;  4YVW A;  3WDT A;  1O91 A;  1ZRR A;  1W2U A;  3UNP A;  3KHC A;  1RHI 1;  4CDQ B;  2JB8 A;  5JOX A;  4Q0Q A;  5FZD A;  3DPR B;  3LD8 A;  1AXY A;  2RS1 1;  3PVE A;  3MPP G;  4QDR A;  4QPI B;  3NJX A;  3O0V A;  2XBO 2;  4JGY C;  1W8W A;  4UOJ A;  4XXP A;  5C8C B;  1NX9 A;  2WNE A;  4RS5 A;  5EXO A;  4D6R A;  4YW4 A;  4IV1 C;  1UZZ A;  1A8D A;  1H8T A;  3RZZ A;  2WBK A;  1ENR A;  5F3C A;  4MO3 M;  3CJI B;  3FFZ A;  2HWD 1;  4BE3 A;  1W9Y A;  4NII A;  4X8P A;  4QPG C;  2MEV 1;  2A70 A;  1BMV 2;  3M8L A;  5HCH A;  1JYV A;  4YGB A;  5FY7 A;  3OPT A;  3WNO A;  4QU1 A;  1YLL A;  2CWS A;  2V72 A; 
#chains in the Genus database with same CATH homology
 4GJZ A;  5FY8 A;  5LY1 A;  5FYZ A;  2YBS A;  4EYU A;  4IGO A;  4NUB A;  5FXX A;  5FYY A;  4QX8 A;  5FZ9 A;  5FJK A;  3AL5 A;  2OS2 A;  3KVA A;  4V2W A;  5FP8 A;  5FV3 A;  5IVF A;  3N9M A;  3AVR A;  3N9L A;  4XDO A;  3DXU A;  5F3I A;  5FZO A;  5FXZ A;  2Q8D A;  5FYB A;  5K4L A;  3N9Q A;  3PUS A;  4AI9 A;  5A3P A;  5A7O A;  4EZ4 A;  4XDP A;  5A7P A;  4CCK A;  5FP7 A;  4GD4 A;  5FZF A;  2XXZ A;  3OPW A;  4HOO A;  4LIT A;  4CUG A;  3KV6 A;  2Q8C A;  2Q8E A;  5IWF A;  5IVE A;  2OT7 A;  5FZ4 A;  4BIS A;  3PUR A;  5FZO B;  3LDB A;  2W2I A;  5FZ0 A;  5IVY A;  3NJY A;  5FPA A;  5FWJ A;  4D6S A;  4BU2 A;  3UYJ A;  5KR7 A;  5F3G A;  4UF0 A;  5FZC A;  3KV9 A;  5FZ7 A;  4EZH A;  3U78 A;  4D6Q A;  5A7S A;  2GP3 A;  3N9N A;  5IW0 A;  5FBJ A;  5FZH A;  3KV4 A;  4BXF A;  5FZ3 A;  5FYT A;  5IVC A;  4CCJ A;  5FPU A;  5A7N A;  4LIV A;  5FZ6 A;  5A7W A;  5F5A A;  3U4S A;  5F37 A;  3K3O A;  4UF0 B;  4HON A;  2YBK A;  5IVJ A;  5FY0 A;  2P5B A;  5A7Q A;  5FZE A;  4QXB A;  5CEH A;  5FY4 A;  2YU2 A;  4GJY A;  4DIQ A;  5FJH A;  3K2O A;  5FZ1 A;  2WWU A;  3N9O A;  4CCL A;  2OX0 A;  5ANQ A;  5FYU A;  3ZLI A;  5A1L A;  4V2V A;  5FZK A;  5A7W B;  4LXL A;  5FPV A;  5FYI A;  5FPL A;  5FPB A;  3KV5 A;  5FZL A;  3KVB A;  5FYC A;  2OQ7 A;  5F2S A;  5A3N A;  5LY2 A;  5FY1 A;  2XDV A;  5IVB A;  5ISL A;  3AVS A;  4Y3O A;  4QXH A;  5FZM A;  2XUE A;  2YPD A;  5FZ8 A;  3K3N A;  3DXT A;  4AAP A;  5FYV A;  1VRB A;  4LIU A;  5FWE A;  4QWN A;  4QX7 A;  3PUQ A;  5FZA A;  5IVV A;  3PUA A;  5FZB A;  4Y4R A;  2PXJ A;  5F5I A;  5FY9 A;  2VD7 A;  5FUP A;  5FZG A;  4DO0 A;  2WWJ A;  5FUN A;  5LWB A;  4IGP A;  5A3W A;  4Y33 A;  5FYS A;  5F2W A;  2GP5 A;  3N9P A;  4IGQ A;  5A80 A;  3ZPO A;  4E4H A;  5FYM A;  4URA A;  5FZD A;  3LD8 A;  5F3E A;  2XML A;  3PDQ A;  5FP9 A;  4ASK A;  4CCM A;  2OQ6 A;  4CCN A;  4D6R A;  2YU1 A;  5F32 A;  3PU3 A;  3AL6 A;  4CSW A;  5E6H A;  5FY5 A;  4CCO A;  5F3C A;  5F5C A;  5FP4 A;  5FYH A;  3PU8 A;  5FP3 A;  2YBP A;  4GAZ A;  5FXW A;  4C8D A;  3PTR B;  5A3T A;  4TN7 A;  5LW9 A;  5F39 A;  5FY7 A;  4QXC A;  3OPT A;  4QU1 A;  5FXV A;  5FZI A;  5A1F A;  3RVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...