3ZPYA

Crystal structure of the marine pl7 alginate lyase alya1 from zobellia galactanivorans
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
248
structure length
248
Chain Sequence
GNSPASVLGITANTWKINSFIGSPGSSATYYDDITDASGISYNTYSDDNYFYTDGEWVYFKCYRGLGGSANSQNPRVELREMDNGNLASWTGDSGTHTMEWTVQVNQLPQDTDGDGGVLCFGQIHGPSKNSDGVEVDDVVRVQFIGEENQSSGSVKLKISGYVTEEQGGSQTFSGYSLDTTYNCKLVYSGGYVELFMNGSSVFRKKMEVDDLSENYFKVGNYLQSVKGASYTGSYGLVRIKNLSVTHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords ALGINATE LYASE, FAMILY PL7
publication title Comparative Characterization of Two Marine Alginate Lyases from Zobellia Galactanivorans Reveals Distinct Modes of Action and Exquisite Adaptation to Their Natural Substrate.
pubmed doi rcsb
source organism Zobellia galactanivorans
total genus 62
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 4.2.2.11: Guluronate-specific alginate lyase.
pdb deposition date 2013-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08787 Alginate_lyase2 Alginate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zpyA00
3VKOA 3DGTA 3FBYA 4XBQA 2OUHA 1HQWA 5T50A 1SFYA 2R0FA 1GNZA 3RMXA 2D3RA 3T1LA 3T2TA 5DUVA 1SCSA 1QMJA 2R16A 3FFZA 2GMEA 1CR7A 4AVVA 5JOYA 5JVVA 5F9TA 3IM0A 1SLLA 3W59A 3WDVA 1WLCA 4ITCA 1LOFA 2ZGKA 3ENRA 4JRAA 1S1AA 2DVDA 3O0VA 1WW6A 5L73A 4LBQB 1W6PB 3C2UA 1D2SA 5AVAA 3ZSJA 1CESA 1I3HA 3AXDA 1W6MB 2GNDA 1CVNA 1W6OB 1YYNA 2A3XA 2CWMA 1IKPA 2ZHMA 3AJZA 4FPOB 4JC1A 4YW3A 3POWA 1LU2A 1MZ6A 1V6IA 4XTMA 4YGDA 1MS8A 3WG1A 2PHRA 1Q8SA 1JYIA 1MR5A 4YM1A 4DPNA 1DYKA 1H30A 2DU1A 2W08A 5HCFA 1WW5A 3WG4A 3O0WA 2ZGNA 2B7YA 1V6KA 4FPHA 1LOGA 2P3KA 4M3CA 1H9WA 2SLIA 4Q1PA 3UL2A 1FV2A 3WNXA 1A3KA 4IQPA 2OW4A 2ZAAA 4PBOA 3V0BB 3GNEA 2YV8A 4XBNA 3HMYA 4UW4A 2GMPA 2ZMNA 1APNA 2DVFA 4WVWA 1URXA 5SV8A 4BLJA 4BLIA 5CBLA 4YZ1A 4FP2A 1X50A 1JW6A 2A6XA 1F9KA 2C5DA 2WT2A 2ZGOA 1AVBA 3PVOA 4YZ3A 1ULDA 4P9YA 3AZXA 3RSJA 3R4SA 4NO4A 3OJBA 1SACA 3IN9A 1ENRA 3SISA 2ZHKA 1QKQA 4OZXA 1MVEA 4ATFA 5CA6A 1G86A 4K21A 5T55A 5JDBA 2ZGPA 3V0AB 1MS4A 2A6WA 1GANA 2NM1A 2VW2A 1S0BA 2XG3A 1VLNA 4KBBA 3SH5A 2D6PA 2E6VA 3UK9A 4ATEA 4RL7A 4ZKTB 2UURA 1LEDA 1DBNA 1QU0A 3LCPA 5T5LA 1DQ2A 3I4IA 2DVGA 1S0GA 2OUJA 3RMYA 1LGBA 4LBQA 5H9PA 1HDKA 4XHXA 1W6PA 4PQ9A 5GZFA 1DFQA 2A7AA 3MEPA 2YZ4A 1W6MA 1W6OA 3WV6A 3RRDA 2FMDA 1CJPA 4Y22B 3INAA 2JD4A 5H9QA 3AYCA 1D0HA 3SH4A 3ASIA 4DRVA 4DFSA 1MZ5A 2R0HA 1LGCA 4Y26A 5H9RA 4RA0A 1XQNA 4ISQA 2WNEA 1LHUA 1DZQA 2D3PA 4R9AA 3WZ1A 3PJQA 2AGSA 1G9FA 1SLBA 2H0BA 2D44A 4YZ5A 3N7LA 3ZYRA 1C1FA 4Y24A 1BQPA 2E7TA 5E8AA 3AP9A 3DUIA 2OVUA 3N36A 2ARXA 2NN8A 2V5YA 1LOEA 1MS9A 1JUIA 4SLIA 3T1MA 2E51A 3WVJA 1LECA 3V0BA 4BPZA 1QOTA 1OKQA 4Q27A 1F31A 1LULA 1ENSA 3A4UA 1FNZA 3L2YA 3CNAA 3NV3A 3POSA 4Y1ZA 2PHTA 1CN1A 3WHUA 1G9BA 1MS1A 3MW4A 2ZGTA 3TB0A 3VKLA 5HCAA 2EAKA 2PELA 4Q26A 3ZSLA 4NOTA 1CQ9A 2DVAA 2ZABA 4XE9A 4YLZA 4CTEA 2C9AA 2DWRA 4DS0A 1N3OA 1O4YA 1JN2P 3N7JA 3LSDA 1PZ8A 1S0EA 5FRAA 5GLTA 1AX2A 1Y7BA 3V0AA 1UZYA 4H55A 4YZ2A 1G9DA 1FX5A 4Q2FA 1UX6A 1R1ZA 3GALA 4XXPA 5GLZA 4BOWA 2YY1A 5IK4A 4YGCA 5JOXA 1C4RA 1KJRA 1U0AA 1GZWB 5GZEA 2A3YA 2DTYA 2JDZA 2WQZC 1BZWA 3WDXA 1DQ0A 2VUAA 5DUXA 2D43A 3ZXJA 3FUQA 2CL2A 3D4KA 4FPJA 4FOWA 4Y22A 3A0KA 1AX0A 2JE9A 2UWAA 1UN1A 1IS4A 5FREA 1N3PA 1UKGA 2GNTA 2D7FA 1WLWA 2XB6C 1ZM1A 3LSEA 3VKNA 4W65A 1V6MA 2ARBA 2A70A 4PCRA 1LODA 2ZHLA 3WUDA 1LCLA 3UJOA 4YW5A 3M3EA 3ILNA 1BXHA 4LBMA 5JMCA 4FPYA 1G9AA 4AGVA 1GNHA 2JE7A 3OGGA 1QOOA 4JCKA 3OBTA 4Y1YA 4ASMB 4L8QA 4PBPA 4BQ1A 1G8WA 3SLIA 1A8DA 1LOFC 1LEMA 2ZGQA 2GNBA 5IK5A 3B9CA 4R9DA 2VW0A 1WBFA 2DTWA 2GDFA 3HN1A 5BYNA 3JU9A 3AYDA 4P9XA 1GV9A 1HQLA 3MPPG 1CPNA 5T5JA 4YW2A 1VAMA 2VY0A 3BTAA 4FOQA 1JOJA 1YXWA 1WD4A 2D3SA 3APBA 4F83A 4FPKA 3U4XA 4UW5A 4WV8A 1N1TA 1S0DA 2DURA 1BKZA 1DQ5A 1AXZA 2E53A 2R1DA 4XJ8A 4C1XA 1YRZA 5EYYA 1Q8OA 2WKKA 4P14A 4UW3A 1ONAA 4YFWA 2VH9A 1PZ7A 2ZGSA 5T52A 5T5OA 5GZGA 1GZWA 3AJYA 4FPEA 3N7KA 1S0CA 4GKYA 3WHTA 1G9CA 4M00A 1W0PA 5H9SA 1IS3A 1N47A 2DYCA 4BM8A 3AP6A 2ZGLA 2AREA 1DQ4A 2EXKA 2EXJA 1UMZA 2KM2A 5GJ6A 2UWCA 4D69A 4Z8BA 5KXEA 1WW4A 2WT0A 5DUUA 4K20A 5F5QA 1VALA 4XJUA 1SCRA 3FLPA 2AYHA 5DG1A 1AF9A 3B69A 5JOZA 4GXLA 5EXOA 2W52A 3ZSMA 5DZFA 4GWNA 5DUWA 5IK7A 1C57A 3OY8B 1QF3A 2A6YA 1FYUA 3AZVA 3M3OA 4FQ4A 3M1HA 4HANA 1SLCA 5CB7A 1KJLA 4XDQA 3B3QE 2YROA 1S0JA 2VU9A 5GM0A 1UZZA 1DHKB 1ULCA 5DZEA 4FPGA 5CAZA 2V73A 3OYWA 1RINA 2GNMA 2YXSA 3AXEA 3AP5A 5CNAA 2JKBA 2CTVA 2YMZA 3BODA 2R1BA 4WVVA 5EYXA 2ZGMA 1QDOA 4FPCA 3RG0A 3W58A 1C1LA 1DQ6A 1WW7A 1GBGA 2CY6A 1FV3A 2JECA 4XTPA 4AGGA 1ULGA 2E7QA 3R05A 2UU8A 1BYHA 4WZFA 1EPWA 1Q8VA 4K1ZA 4K1YA 4MYEA 3IPVB 2SBAA 1N3QA 1LOBA 2RHPA 3QCWA 1JHNA 3POYA 4UW6A 1SLIA 3PVEA 1BJQA 1S0FA 3N35A 2ZHNA 2D6OX 1WD3A 2GMMA 3Q9OA 1MVQA 1LESA 1LU1A 1QOSA 3TAYA 4M01A 2ERFA 4DRRA 2Q5TA 1V00A 3AZYA 3AZWA 4LBNA 4PF5A 5DXDA 4Q8KA 1QNYA 1LENA 2DVBA 1S0IA 2AR6A 4Q8LA 3WCRA 1IOAA 4YGBA 3ZXFA 3ZXLA 3MW2A 1IS5A 4XIKA 4XOGA 4FVVA 3AK0A 2BQPA 2AUYA 3OY8A 5DG2A 2FHRA 3N7MA 2D6MA 1MS5A 1OFSA 3BOPA 1KRIA 1F5FA 3MW3A 1TEIA 2A71A 4YG0A 2WSUA 3H0OA 2ZMLA 1WCSA 3USUB 4LBOA 1SLTA 2DU0A 2ZACA 1PZ9A 1LOCA 4TZDA 2ES3A 4R9BA 5GLUA 2AH2A 2Z42A 3WDTA 2P34A 1N1VA 4TYSA 5IK8A 3NWKA 1Q8QA 1GYKA 1WUVA 4DQAA 3B00A 1DYPA 3IPVA 4AVSA 5E88A 4YM0A 3O0XA 4YG6A 1MS3A 3AYAA 4LBLA 1AXYA 1KQRA 4XXAA 4XHBA 2A75A 3UJQA 1KDKA 4YGEA 1QGLA 1ZA4A 1KDMA 3NV1A 4YZ4A 5KXDA 3OYWB 1GICA 1W0OA 1LHOA 1AJKA 5EWSA 2LALA 3WG3A 2ZBJA 3B01A 4XILA 3RS6A 2EALA 4ISRA 1QNWA 4Y20B 4I30A 1GSLA 2W68A 5JLVA 4AYUA 1V6OA 2WT1A 4BMEA 2ZGUA 1GKBA 3M3CA 4XYXA 4FOVA 3ZVXA 4AWDA 2G4IA 2PHUA 1Q8PA 4LBJA 5T54A 2D6KA 4LBKA 2VW1A 2GN3A 1CPMA 5JOWA 1LTEA 3VV1A 1LJ7A 4BMBA 3ATGA 2W39A 3USUA 3AP4A 1SBEA 5HCBA 2DUQA 3FLRA 3NV2A 4FP3A 1AXKA 4LBQD 5GALA 1B09A 5E89A 4U2AA 4HL0A 1ULEA 2PHWA 4M3CE 2DV9A 1H9PA 3ZSKA 1IKQA 1WBLA 2ZA9A 3D6EA 4ZXKA 1FAYA 1V6LA 5LK5A 2ZGRA 2P2KA 2NMNA 3AFKA 2PHFA 2D6LX 1SBDA 1Q56A 3PMEA 4FOYA 3WDUA 1W6QB 2UWBA 4GALA 1V6NA 3I8TA 1GZ9A 1AZDA 1YI7A 2EF6A 5IUQA 3O5SA 4FQZA 3M3QA 4FPLA 2A5ZA 5GLWA 3WDWA 4XBLA 4YW1A 1LHVA 4YW4A 3NV4A 1SBFA 2HYKA 2I2SA 1SLAA 2NYYA 1O4ZA 3M2MA 1J1TA 4YM3A 3R4UA 2ZMKA 4Y20A 4XZPA 2LTNA 3WCSA 1VIWB 3N3HA 3KQRA 3QLQA 3SH3A 1JBCA 2P3IA 2JJ6A 4XJAA 1JYCA 5GZDA 1IS6A 1NXD1 1HLCA 1FATA 2DUOA 1QDCA 3V64A 4XIOA 3OBRA 4YM2A 3OPZA 1JXNA 2ENRA 3D5OA 1DGLA 2ZZJA 1AX1A 4U36A 1LHWA 3IMNA 1RITA 5GZCA 5KXCA 1W6NB 3FLTA 3ZYPA 2EIGA 3FUOA 3VUOA 2A6VA 3AP7A 4M3CF 3ZPYA 4GWMA 1MACA 1ENQA 2GALA 2A6ZA 2P3JA 4CRQA 1CIWA 3PVNA 3ZXKA 4XJZA 3ILFA 1UAIA 1G7YA 1A78A 1GLHA 1LHNA 5KXBA 1FNYA 1DLLA 2TEPA 2PHXA 3VKFC 3WLUA 1GZCA 2A3WA 2AENA 1WLDA 1W6QA 1LOAA 1UPSA 3AX4A 3BIWE 5DZGA 2WSVA 4FPFA 1Z78A 4Q1RA 1KITA 1I1EA 4CZSA 1ULFA 4XMAA 1VAVA 3JUUA 1HKDA 2CYFA 3WDYA 1YIFA 2R49A 1N1YA 3IKWA 4Y1VA 1CONA 3V65A 4XJWA 1DIWA 3ZXEA 3A0NA 4GKXA 2GN7A 3HR9A 1LGNA 3ILRA 4YG3A 4R9CA 2EXHA 5T5PA 1NLSA 2NZ9A 3SITA 2NMOA 4YFZA 5GLVA 3RQ0A 1MS0A 1OQ1A 1Z0HA 3O12A 2EXIA 2CWSA 3AYEA 4GA9A 4AGRA 3VKMA 2NP0A 3AZZA 1DQ1A 2WLQA 2ZKNA 3KM5A 3SNMA 4M3CB 4C1WA 1AJOA 3WOGA 1YO8A 1V6JA 5IT6A 3WG2A 2CNAA 2D6NA 2DUPA 2P37A 2WJSA 1RIRA 1W6NA 4P9WA 4XMIA 4XJ9A 3WUCA 4AVTA 1UL9A 2VXRA 4Y1XA 1N1SA 4Y1UA
chains in the Genus database with same CATH superfamily
1GP5A 3DGTA 1POV1 5BV6A 1NG0A 2RM23 4XBQA 2OUHA 4LA2A 1RUJ1 4XFFA 5F32A 3I3DA 3CZJA 3ZFEC 1RGSA 1XSRA 2D3RA 3RMXA 1QMJA 5A7PA 3ZLIA 4I0BA 2JDPA 1AR71 5JVVA 4BJ0A 1CAVB 2BFUL 3H3UA 2OXBA 3IM0A 5APAA 5F9TA 4N53A 2PMWB 5IYYA 3I2OA 2CDOA 3ACGA 3WDVA 2EVXA 1WLCA 5CG9A 1C8M1 2WNOA 1LOFA 4QXKA 1YJKA 3A7QA 4LPLA 2W9XA 4I3GA 1W6PB 3P1IA 5LBBA 1XE8A 3ZSJA 1I3HA 3AXDA 1W6MB 2GNDA 4JGYB 3AJZA 2CWMA 4BQXA 1A34A 1IKPA 5FZEA 4OHWA 1MZ6A 3L2HA 4YGDA 1MS8A 3WG1A 1YCIA 2PLV1 4LHKA 1Q8SA 4NRQA 3D0SA 1MR5A 2H6CA 2VUCA 3KVAA 4LHLA 3TN91 4NIHA 3ZFGC 3EMRA 4HLTA 3WG4A 5LEJA 4JKKA 3ETQA 4UFKA 1OBNA 2P3KA 2JE8A 3AKTA 1UOGA 4Q5OA 3UL2A 1H2KA 3D82A 3WNXA 4QQLA 2BTVC 3FHQA 3WP5A 3AB0A 5SV8A 1Y9GA 2B5HA 2DVFA 4GMP1 4BLJA 4CU7A 4BIOA 1CD3G 5FBJA 1JW6A 4O61A 2A6XA 3ME2A 3S5AA 5C3PA 2WT2A 4ZU7A 2OZJA 3MF9A 1ULDA 4P9YA 4IE6A 3R4SA 2VMEA 4NO4A 5KR7A 1GQGA 2QZ3A 2ZHKA 4OZXA 4IE4A 1QJFA 4CUAA 5T55A 1MEC1 2A6WA 2XG3A 4KBBA 1POQA 4ATEA 1VLNA 4CYDA 2VQ0A 1RVF2 1XYPA 5FK7A 1UCXA 2HEYF 3LCPA 3BGAA 4CU6A 4A7ZA 1GP4A 2AC1A 1X82A 2IXHA 2BEOA 1DP0A 3MEPA 3SQOA 1H2LA 3VDDA 5IVVA 4DMIA 2FMDA 5LB6A 4L0PA 1O3QA 1HB1A 2YU1A 2WINB 5H9QA 1D0HA 2GC1A 3SH4A 3ASIA 3U11A 2R0HA 2ZEWA 1VPHA 3QBQA 5H9RA 1FOD1 4RA0A 4CDXC 4IV1C 2Y64A 4HK8A 5KWRA 1HRV3 2Y34A 2XHKA 4R9AA 3WZ1A 4YZ5A 2QQIA 2D44A 3N7LA 3ZYRA 1UO9A 1WLTA 5FYIA 3ES4A 4B4PA 4AZZA 2E7TA 4AVBA 3DUIA 3T1MA 2ARXA 2HWC2 3VHRA 1UZ0A 4A3XA 1JZ3A 5HV4A 1LULA 2IXCA 3E97A 3H3ZA 3L2YA 3CNAA 2PAKA 1OPOA 2PHTA 1CN1A 1VB4A 3CHXA 3WF3A 5I0SA 1G9BA 1MS1A 2QQPA 3MW4A 4AFDA 3TB0A 4Q4X1 4Q4W1 5EHDA 5FXXA 4AR2A 1PX4A 1AR93 2XXZA 3ZSLA 1CQ9A 2I74A 1IQDC 4YLZA 2R063 2PLV2 4AEDA 2QQNA 1N3OA 4QX8A 5F5AA 4XZUG 1WKYA 4N9HA 2W94A 5EV7A 5F8PA 3VZOA 1J59A 3LSDA 1PZ8A 1S0EA 5GLTA 1AX2A 2W87A 3NRUA 1K42A 2Y6LA 1FX5A 4PIXA 1QH6A 2RS51 5LA2A 5GLZA 4QB2A 4XXPA 2YY1A 1MZEA 2RDQA 1JZ5A 1QQP1 1KJRA 4M4PA 2RV9A 5A7WB 4D3WA 2JIJA 2DTYA 2PN5A 5JCTA 3MHZA 4AI9A 5BNNB 3ZXJA 4CP1A 5C9AA 2D5FA 4K8RB 3NKTA 1S2EA 2JE9A 2UWAA 1KFXL 4PF1A 3USSA 3RZJA 5BUVA 5FUNA 1ZVFA 1ACCA 1ZM1A 4XPVA 4W65A 2WZEA 1V6MA 3JQXA 4W8JA 4YVSC 4B8EA 2A70A 3J8F2 3VD5A 1LODA 3FWEA 3WUDA 3ZIXA 1Q5OA 2BPA2 2BP6A 3VBSB 3JD71 2WC2A 5JMCA 2BGCA 3ON7A 3KHBA 4AGVA 2JE7A 4G4FA 4N53C 4QPGA 1O8PA 4PBPA 1OOPA 3Q8BA 3R6SA 1A8DA 1LOFC 3PU3A 3UKTA 5F3GA 1ZZ9A 4PDWB 4RFT0 3CKHA 5IK5A 2DBNA 4XCBA 4DIQA 3K48A 1W8UA 4AQ6A 1WBFA 2GDFA 3HN1A 5BYNA 1JZ8A 1RUF1 4HMZA 2IVIB 2V4VA 4YW2A 2PTMA 3GZAA 2VY0A 3NAPA 4FOQA 4DXRA 4UWDA 4EV0A 4HFSA 4FO9A 2OZ6A 4LO5B 2ZX1A 1FOD2 5FLHA 1N1TA 1VBE1 2GP3A 3RFRA 4NUBA 3J7NA 2ZJCA 4XF4A 1DQ5A 4XDPA 4RYDA 1E5SA 1K45A 2J1AA 2XBO3 2VCMA 1Q8OA 5EYYA 3A21A 2KD7A 5A3OA 3S6PA 1EPZA 3ZDVA 3ZOIA 1XJAA 5T52A 5C5UA 5D8AB 2VNOA 5DQ0A 1R083 3VN4A 4CP9B 3N7KA 3U07A 5C5TA 4CDUB 1ZX5A 2BGPA 4WVZA 3TNPB 3WHTA 4LK7A 5B4XA 3KHCA 5FYSA 3DV8A 4RQPA 3OEBA 2XH6A 2ZPXA 5CKMA 1C5HA 2DYCA 4BM8A 3BTZA 4QKBA 3VB9A 4GAZA 4NHMA 4Z8BA 2K46A 4KGGA 1MQTC 4D69A 5KXEA 2O1QA 1W2TA 1YFXA 1W9YA 4Q4X2 3RYPA 2BOIA 2VTXJ 3ACFA 4K20A 4QXBA 1SCRA 3VBRA 1XBFA 4NPLA 1TME1 4GXLA 5EXOA 1WCUA 2R073 3MV11 2D40A 4JKLA 1CAUA 5FLJA 1WWYA 5F6KA 5A6ZA 3OGSA 2YDEA 2VZOA 4GWNA 1KFUL 1ND3B 4K6BA 4NAOA 5DUWA 1C57A 1PNFA 3DKQA 3WQ0A 1ULPA 3I2GA 2FDIA 4AOCA 3UGHA 1HQNA 2A6YA 5IFPA 2AACA 1PMIA 3E6CC 3DYPA 2XJTA 1SLCA 5CB7A 4XDQA 2O0OA 5FP3A 2JKXA 3VDDC 1NUKA 3VBUC 2VU9A 4AK3A 1ULCA 1UXZA 2HWB3 1RYYA 5LA1A 3OYWA 1RINA 4GWJA 2RR13 5LY1A 2YXSA 2WBKA 1NE4A 1ZZ6A 1D4M3 4N43A 5C4WA 4OHXA 5A3TA 5CNAA 1BVP1 1OA3A 3I2JA 3O1MA 2HBTA 3BODA 4R4ZA 4XURA 3LEKA 4L99A 3C7GA 4M0NA 1A6CA 1CIYA 1US2A 1VRH2 1DQ6A 3W58A 1GBGA 1W28A 1FV3A 4CUCA 1XOYA 4XTPA 4JVAA 2E7QA 5I0TA 3N9QA 1CAWB 4B3NA 1RUC1 4TLGA 3H8UA 1EPWA 2AEYA 1DU3D 3IPVB 4QM9A 2HWF2 3QCWA 1W8ZA 2IUWA 2X5IA 1O8SA 2XL9A 4AHZA 1SLIA 5DAQA 1AL23 4C90A 2ZHNA 1BBT3 1WD3A 2VMGA 1UX7A 1RUF2 2RDRA 1NCQB 1LU1A 2ZEYA 1JH5A 3OCPA 1ZREA 1QOSA 1X9TA 2CSGA 4MXWB 4M01A 1QHDA 1RUE2 1VBD3 3KZ4C 4OI4A 2Q5TA 5A32B 4DRRA 5DXDA 5BNPC 4KWUA 1SZBA 3GJBA 1H8TA 1E57A 2JG9C 4LKEA 5LW9A 4YYOA 1NQJA 4E9KA 3TEWA 1IOAA 1VBE2 3ZXLA 5CISA 1IS5A 2PFWA 1GWMA 1PK6A 1IPJA 3OY8A 3MIGA 5DG2A 4IV3A 2D6MA 4JQTA 4EWDA 1MS5A 1OT5A 3O1VA 4EE2A 4YG0A 2WSUA 3I2FA 3USUB 3E6DA 5FY9A 3SHRA 5FXWA 3PUHA 4LBOA 3G6JB 3VZLA 5A3PA 4TZDA 2J7MA 3P6BA 5AC93 4UI9L 3VHPA 4LA3A 2Y6FA 4AI2A 4E2QA 1EV13 2VBPA 3M3IA 4URAA 2GC0A 1PIV1 1A8MA 1GUIA 2K0GA 4TYSA 4OHYA 4AFAA 4IL7A 4IE7A 1TME2 3ZFGB 4AE2A 4QX5A 3HNMA 4K8FA 4HSLA 5BNOA 2H6BA 1QJU3 1XYNA 1WUVA 2CDPA 2RS32 3VD4A 3KQ4B 3J26N 3CIHA 1PO12 4XDOA 4AVSA 2CGOA 5E88A 3TNQA 3O0XA 1MS3A 1S2BA 5FPXA 5LA0A 1FPN2 4XHBA 1KDKA 3S7IA 1UOBA 1E5HA 1QGLA 3NAPC 2X29A 3O1TA 2OQ6A 3M8LA 4AQTA 1D0GA 1W0OA 1RUH1 2P6HA 2RDSA 3OBAA 1LHOA 4W6YA 3EYPA 3WG3A 2ZBJA 2EALA 1KXGA 2W68A 1NYWA 4LULA 1V6OA 4Y5TA 2ZGUA 3M3CA 3ECQA 3CJIA 4XYXA 4FOVA 4L9BA 2PHUA 2QDNA 1ZBE3 4LBJA 4NRMA 3T2QA 3JBG1 3ZXAC 1K5MB 5FQ0B 2Y6HA 3LWCA 1U5YA 2TUNA 1YQ6A 3NMBA 1PMHX 5JSOA 3AP4A 3C3VA 1QH7A 2DUQA 3FLRA 2BVBA 1W06A 4LBQD 5A7QA 5CEHA 2DBIA 3THPA 1VMHA 1S55A 1UY4A 3QD6A 4M3CE 2DV9A 1H9PA 4CPBD 3VBRC 1O3SA 4NN0A 2X53S 4BE3A 3PTYA 2IFWA 3ALQA 3D6EA 4IV1B 1FAYA 1V6LA 2XJVA 4M0HA 4O65A 4ZXKA 5LK5A 2NMNA 2VCCA 3H7JA 4IXLA 5I8YA 2IXIA 4BU2A 3VZMA 4HVOA 1Q56A 4FOYA 3WDUA 1T2XA 1V9U1 2BWAA 4OVEA 1GZ9A 3R4DB 4INDA 3FN9A 1VBB2 4FQZA 2H0VA 2QQKA 1RUI1 2FCUA 5GLWA 3WDWA 4MUVA 3WP3A 4YNIA 3P5BA 1J3PA 1HRI2 1QY4A 5K9YA 4YW1A 5FDBA 3KV9A 1CX4A 1RHI1 2V5DA 3NV4A 3WD5A 4N43C 5L7OA 1SLAA 5C4WC 2BU9A 2MNGA 3SEEA 3M2MA 1J1TA 3I2IA 5ANNA 4P5HA 3RNSA 5IATA 4YM3A 4QDQA 2B45X 2ZMKA 4MGKE 3LIHA 2ID4A 3QLQA 3RYKA 1HN1A 1QJX2 3KQRA 3WCSA 4ZS3A 4AHWA 4LHSA 4ES9A 5D1IA 2VZVA 3NNLA 1JZ4A 2RS11 1HLCA 1FATA 5C71A 4I0AA 2PHLA 1COV2 1YFWA 2JG8B 3OPZA 1ZZ8A 1JXNA 5K0UA 3E1F1 1BEV3 2JDHA 3IMNA 1XNBA 3RWKX 3VUOA 2L9LA 4L92A 2YPJA 3ZPYA 1MACA 3CU7A 3ROUA 2LROA 3K46A 3PVNA 5LA9A 3SKJE 2YU2A 4XJZA 5A3UA 5CKQA 1GLHA 4QX0A 5DABA 3UESA 2TEPA 4XETA 3WLUA 1GZCA 2WA3A 3C7OA 4GZ9A 3WW1A 1O91A 2WR9A 3AX4A 1PK6C 1R1A2 4N53B 4DEQA 3NSTA 4IDZA 2XUEA 4LO8A 1R093 1QXPA 1PVC3 1I1EA 4CZSA 4XMAA 2JX9A 2WO2A 2C1FA 5AVPA 3LA2A 3BN6A 4Y1VA 1JZ6A 4XAEA 1W2OA 1XNCA 4EN7B 2HBUA 3ITQA 1DIWA 1SDDB 2JEMA 2GN7A 4EZ4A 1RUG2 1LGNA 2WS91 3ILRA 4ZZ8A 2YGLA 4JGZA 1OQDA 4KWLA 1XSQA 4YG3A 5T5PA 3ABZA 1NLSA 2I07B 5DN2A 3WF4A 4TTGA 1LAJA 1DCSA 5CIRA 4I01A 1PGL1 3FMGA 3RQ0A 2QE3A 1MS0A 2HEWF 5BNOC 1Z0HA 1GQPA 1YC61 2EXIA 3AYEA 4GA9A 5FP4A 2JDNA 2YBPA 2K2SA 3AZZA 2V72A 4UFJA 3H8XA 3SNMA 4FAGA 1RXFA 4FFFA 2J1RA 1OFNA 1V9U2 1YO8A 3Q8EA 2GH2A 2D6NA 2WIIB 2WJSA 1SG3A 4XJ9A 2XHNA 5LRRA 1RUI2 2VXRA 4Y1XA 4F83A 5DUVA 2BNOA 2WFF3 3VKOA 4MOAA 5T3NA 1T6BX 4COZA 5FXZA 4IEWA 1AYM3 1HQWA 1RHI2 4QX1A 3LEIA 4GIQA 1GNZA 4DB5A 3T2TA 3EHKA 4K40A 4Y4YA 5EPAA 1BK0A 3FFZA 3K51A 2C26A 1CR7A 3K75B 2R043 3GCWA 1PO23 4HT1T 5C3SA 3AL6A 1W05A 1HXS2 2KR2A 4XFHA 2R6QA 3BPSA 1RUOA 4OYUA 2OT7A 2ZGKA 3ENRA 1BCXA 4E8DA 3CQOA 3CJXA 4GH4A 4GD4A 2IFRA 1WW6A 4QQPA 5L73A 1DGRA 4COWA 3EXUA 1ZRIA 5AVAA 1RMU3 3VDDB 2RJLA 4JC1A 1UMIA 4FPOB 3GHMA 3POWA 1LU2A 1V6IA 1UZWA 1YI9A 3ZN6A 1OURA 5FO9B 4YM1A 4RHV1 4PI2A 3I3EA 5HCFA 4AQSA 5A3MA 3WNKA 1IGOA 2ZGNA 1PX3A 3N9OA 4DUXA 3T08A 5JWPA 5FCCA 3D8CA 4QQ2A 1FV2A 2C4XA 4IQPA 2YV8A 4HOOA 1APNA 4D6SA 1URXA 1ZRDA 5CBLA 1X50A 3RZGA 3OUIA 1X33A 3MO4A 4EROA 2ZGOA 2LS6A 2E32A 2R32A 3MIHA 4E27A 1UYPA 3RSJA 5EP9A 2HWD3 1SACA 5EQUA 2TBVA 2WZR2 4JZRA 1ENRA 2GH8A 4AEDB 3LIGA 1H6YA 4K21A 5JDBA 4J1WA 3GJAA 1MS4A 1YIPA 4CU8A 1S0BA 1K12A 1OH3A 3K4DA 4FFGA 1J58A 1ZRCA 1NZCA 5T5LA 1OH4A 2QQMA 3MLLA 5IWFA 1H4GA 2IVJA 4BZ4A 4NROA 3RMYA 3DEMA 3TRSB 1RTVA 2VMIA 1HDKA 3GCXA 3GZTB 3IDBB 4LBQA 5FK8A 5GZFA 5K0UC 1JMUB 5J7MA 1GMMA 4EZHA 3TWIA 3RRDA 5C9AB 3ZMOA 4CPBA 4Y4RA 4YWAA 1XC6A 4DFSA 3LZZA 3KS7A 2WNEA 3OGRA 1DZQA 4LO6B 2D3PA 1GOGA 2AGSA 2B8MA 2Z69A 5C8CA 1C8NA 4QMAA 3BTXA 1QXRA 1ND3C 1Y3TA 4QPGB 2OVUA 3PUAA 2NN8A 3POGA 2VOTA 2MEV3 3V56A 1XNTA 4E8CA 3V0BA 3LDRA 4Z1VA 5A3LA 3O1PA 1ENSA 2YFUA 4CP2A 3NV3A 3POSA 2EICA 2HWE3 4LLOA 5I0DA 3ZFEA 2X10A 3ETPA 1B35A 1CZVA 2ZGTA 3VKLA 4GJZA 4I2OA 3JB4C 3RI8A 2FD8A 3NAPB 3VBFA 4Q26A 4CTEA 5A3WA 1WMXA 5DDJ2 2Y33A 2C9AA 2DWRA 2W47A 3M70A 2GC3A 1OD5A 1O4YA 4Y3OA 1JN2P 4QPWA 1ZBA2 1BMV2 5CZKA 5ACA3 5FRAA 4HPKA 1Y7BA 5JZGA 3ZYBA 3T30A 4YZ2A 1G9DA 3BOWA 1RVF1 4IEOA 2YC2A 5CVRA 3RZZA 3ZN5A 2OPKA 5HXMA 1AYN2 3E5UA 1UX6A 4QM8A 1VBA2 2I45A 1OA4A 4A41A 1XU2A 2WNUA 4QGNA 2A3YA 4DUVA 3LPFA 2R7EB 4CXWA 5FZLA 4LORA 5DUXA 3SCGA 5BNQA 2CL2A 2BZDA 4RQPB 2E31A 2J1TA 2Q8OA 3HNYM 1NCQC 2B9VA 5FREA 1N3PA 1Z7S2 2YHJA 4R8HA 1WLWA 5FV3A 3THTA 3ZFFA 4MH0E 1UXXX 2D93A 3VBRB 4AF9A 1IZ3A 4X6QB 1RUD3 2WNVA 3S0MA 3UJOA 1UMHA 4BXFA 3C8XA 3B93A 1BXHA 1CAUB 2IXJA 4WZCA 4OHVA 2FCTA 1G9AA 2FDJA 1H0BA 4JCKA 4ASMB 1JU3A 3SLIA 2HWC1 2ET1A 2G1MA 2J1UA 1AHSA 3WF0A 2XWBB 2GNBA 3PIJA 4GH4C 4IGQA 4DO0A 1JI6A 3AC0A 3B9CA 5A3NA 5JPMB 2VW0A 1Y9QA 1RB8G 2UY8A 1W9WA 5IVEA 1GV9A 1HQLA 2IXLA 4I09A 2W5FA 2XJPA 4CCKA 3DPRC 1SHWB 3AMPA 3IT8A 1YXWA 1L3JA 4N43B 5C4WB 1FMD1 3OD0A 5IJRA 3TOJA 5EZWA 2YBKA 1O3TA 3JXSA 1S0DA 4LNVA 4IGPA 1AXZA 5JI9A 1H8VA 5EJ1B 5FR3A 3RZLA 1ZA7A 1ONAA 4UW3A 4YFWA 1PZ7A 4QX2A 5GZGA 1EYBA 1S0CA 3UGFA 4PHZA 1G9CA 4M00A 3LD8A 1W0PA 1N47A 3DKWA 3LFMA 3MIDA 2PAEA 2EXKA 2EXJA 5G04L 5GJ6A 1F4AA 2WT0A 4DXZA 5FZKA 5F5QA 4C0HA 3G7DA 4XJUA 3J8F1 2AYHA 3CDZB 5IAXA 1W3VA 1AF9A 4CUBA 4DEVA 5JOZA 1H8TB 5KC5A 3UKVA 4AI8A 3FE5A 4CDWA 2XWJB 3UT0A 3OG2A 1PK6B 1WCQA 1XE7A 1ASJ3 3KV5A 3OY8B 1K5MC 4OZOA 4NR1A 2JB4A 4IV3B 4FQ4A 3M3OA 1XNDA 3M1HA 4LQRA 1F5JA 1CGPA 1KJLA 3KVBA 3U10A 1EAH1 1JYTA 4MGYE 4NWVA 4BK5A 2BOJA 1HV1A 1C3HA 5DZEA 4W6WA 3WQ1A 1J3QA 5FY4A 5FZ8A 3VLBB 4AEJA 5JUVA 3AP5A 2JKBA 1LR5A 2ET7A 2KXLA 4WVVA 5EYXA 2VOVA 1UIJA 2ZGMA 1W8WA 3PNAA 1OMIA 1WW7A 3LA3A 2VECA 4RS5A 5FY7A 3ZYJB 5ANQA 5BNOB 1BYHA 2W95A 5KHJA 4WZFA 1JU4A 1POV3 1Q8VA 1ULOA 4K1YA 4MYEA 4WM7A 2QZ2A 2QQVA 1RUJ3 3HVDA 1XB9A 2A73B 1LOBA 2RHPA 4TSVA 1JHNA 2WWUA 4UW6A 3IBMA 3VZJA 1BJQA 1S0FA 3N35A 1NT0A 2EA7A 2XBO1 3FC0A 1B35C 4GWIA 2VVEA 4ZY9A 1AR73 2QQLA 1LESA 1QIQA 3A23A 1LNSA 1UU4A 2YBSA 4S2DA 2TNFA 3PURA 2ERFA 3AZWA 4LBNA 2IWGB 1C8M3 4Q8KA 1QNYA 4COUA 1FMD2 5IVCA 5A33A 5JZGC 4LUMA 3HAGA 4B4QA 5FZDA 4XACA 5JR2A 2QFEA 3CJIB 1OLME 1AR92 4XIKA 4XOGA 2HYXA 4NIDA 3IDAA 2R062 1MZFA 4CP0A 2FHRA 4JRLA 2WNUC 2Q1MA 2JG8C 3MW3A 5J36A 1TEIA 2LRPA 2OQ7A 3BTYA 4RGAA 3ZXGA 1WCSA 3ZR6A 1NA1C 2VAUA 3O1UA 4CE8A 4XQWA 3TN93 1SLTA 4DOUA 2ZACA 1PZ9A 2VZ1A 3LEMA 1JOBA 3PUIA 5FY5A 2YUEA 3ZFFC 2EIDA 5GLUA 5IVYA 4XF3A 2BWCA 2XLAA 2WNVC 1PHMA 3WDTA 2WQ4A 1VRH1 3J4UH 4XFGA 3S5QA 3E6BA 1KD7A 4GMP3 3Q8AA 3WF2A 4C91A 1GYKA 2Z5WA 4I02A 1DZTA 3O14A 4IE5A 3GBGA 3U37A 3B00A 1Y4WA 2VPVA 2HWF1 1W8HA 1NXMA 4NAMA 4ONUA 4YG6A 5JAXA 4LBLA 3NNGA 3WT3A 1OD3A 3MV01 5LATA 1NLRA 1DGRN 4WVMA 3N9NA 1MEC3 1EAH2 3RDIA 1VMFA 5EJZB 4OMCA 3M7AA 1CZTA 3J9SA 4RGKA 5FLIA 2VZQA 1RUE1 4BISA 5L7OB 1R64A 1UZVA 3PU8A 1AJKA 5EWSA 2LALA 3KF3A 4X8NA 3B01A 2C24A 3WR0A 4ISRA 1QNWA 5C6CA 1JYWA 2NPIA 4GB33 1GKBA 1UWWA 2WQ8A 4XFAA 5D21A 2XKPA 1VBD1 3ZVXA 3T2OA 4AAXA 1JUHA 1GOFA 2D6KA 4LBKA 2J1EA 3ACHA 3LDKA 1HX6A 4KMQA 1LTEA 4I3PA 2XR4A 3ORJA 4OI2A 3PTRB 1FOD3 3B02A 4YSFA 2XJSA 5K0UB 2VZSA 1SBEA 3H1WA 1QJY1 3LPGA 1UQXA 3NV2A 4FP3A 1AXKA 2RG4A 1W8FA 2XBO2 4MZUA 4QB6A 5FP8A 5L9RA 3T3YA 1CX1A 3VD7A 4BWOA 3IDCB 5KHIA 1WZXA 3KSCA 4XAAA 3UV9A 1R082 4LUKA 1NY72 1IKQA 2F4PA 5FMCA 1AL0G 2Y6JA 2ORXA 4EJRA 5ISLA 4NIIA 2ZGRA 2P2KA 2G19A 3MYXA 2D6LX 2BBVA 3THCA 1WMEA 3AVSA 5FZ1A 2KA3A 1ZZCA 2RS31 3PMEA 4CDWC 3WSOA 4H3WA 4Q4W3 4Q4X3 5FZ6A 3IDEA 1PO11 4QHOA 3MIBA 1EV11 4GALA 1KS5A 4Q0SA 3I8TA 4Q4V1 4BCUA 4BQ5A 4E4DX 5FOBB 1PGW2 3F95A 3MPBA 4KU7A 5FY1A 2RE9A 2R072 2WAAA 5LBFA 4FPLA 4LEJA 5FYCA 4PQQA 3OB8A 1QJU1 5HV0A 3W5MA 1FPN1 5LEKA 2XLGA 2Z2SB 3DXTA 1UYZA 2BYVE 1OVSA 2RS53 1YQ5A 2NYYA 4RR3A 4CEYA 3DF0A 2W1WA 1QQP3 4JGZB 2WO1A 2LM3A 5DAXA 1JYIA 2FZ2A 4KNCA 3RJ2X 3VL9A 3H1MA 4MO3M 3I3MA 5FWEA 1DF0A 2JJ6A 2XOMA 1JTZX 3NNJA 4XJAA 2HWB2 1JYCA 4RS5C 5GZDA 4DXSA 4ZZ5A 2RR12 4K7JA 1DG6A 1D4M2 3WW3A 1QDCA 4WM7C 4ASKA 5FY8A 3BALA 1YQ8A 2A1XA 4YM2A 3S30A 5J3UA 3FHAA 2F17A 2ENRA 3D5OA 2ZZJA 1DLCA 5KXCA 2CHHA 1UKRA 1RITA 4O9GA 3WNMA 3FLTA 4QX3A 3ZYIB 3VHOA 2FDHA 1WCDJ 5CU1A 3BKZA 2XQXA 3H3LA 3JD73 1ENQA 3ZR5A 2P3JA 4CRQA 3VHNA 1QXJA 1CIWA 2QQOA 5IVFA 2WLPA 1LHNA 5FMDA 4IW3A 4ZPIA 5BXXA 4AEDC 4AEMA 5KXBA 1W39A 1G6NA 5FPAA 3I97A 1AL22 1BBT2 1W2UA 2VUDA 1X8MA 1WLDA 5DZGA 1UPSA 1VBD2 4FPFA 4LIVA 1D4VB 1Z78A 3UETA 3HQXA 4IEZA 2ZOEB 4BQ3A 3NQHA 1REFA 1UW8A 1VBB1 3NO8A 4LO7A 4GH4B 3ZO0B 4O9EA 4D6QA 2W0XA 3IKWA 4X6RB 3KD4A 1HRI1 2JXAA 5C9AC 1QJY2 2DFBA 2Y0OA 5JIAA 3URFA 4NJ4A 4XC9A 3V65A 3H8RA 3ZXEA 2CV6A 3A0NA 3DPRB 2YYOA 4MV2A 3ZN6B 3FJSA 2VCBA 3LEGA 3RJRA 4R9CA 1J84A 2EXHA 5K4LA 4XQ4A 5J48A 1QJX1 3RZHA 3BB6A 4XQDA 2AEZA 1KGYA 2ZZQA 2ZX4A 1OQ1A 2BRTA 2CWSA 5F5IA 2QVSB 3GDBA 5I8SA 4QPGC 3VKMA 2W1UA 1KEXA 2ZTNA 3HBZA 1OOPC 1COV1 2Q8DA 3SKVA 1EV12 1V6JA 4Q4V2 2P37A 1W6NA 1AR61 1UY2A 4P9WA 4XCAA 4XMIA 3WUCA 1TME3 4AVTA 1CAXA 1QJU2 1L7QA 4PIZA 3P3NA 2Q4SA 1J3RA 3FBYA 3AKQA 1VR3A 2GZWA 2P6CA 3FFQA 3KT4A 3LE0A 5T50A 3VGIA 2R0FA 4XUOA 5C3RA 1SCSA 1H2NA 1YFUA 3KGZA 1XPWA 1BLZA 1S4CA 3KT1A 3GXUA 4IEYA 4IEQA 3SXWA 4E4ZA 4AVVA 1HW5A 1F35A 2JICA 2Q1FA 4W4ZA 5FZMA 5JOYA 4MGZE 3O1RA 1Y9MA 1R1A1 1SLLA 3DECA 3KB5A 1AUYA 4CXYA 3WXPA 4LKDA 5FO7B 3U4SA 1S1AA 1H6XA 4CEWA 1ZNPA 2DVDA 3O0VA 5CFDA 2HLEA 1H1AA 4LBQB 3D3AA 4RQPC 1CESA 2J42A 1TMF1 4JX0A 1CVNA 1K3IA 1YYNA 2A3XA 2B9UA 1VRBA 2ZHMA 4YW3A 4XW3A 1ODMA 1ZBE2 3H9AA 1RUG1 5FZFA 1U5ZA 1RUC3 3KCYA 4QKFA 3CO2A 5JI7A 4DPNA 2XUMA 2FQPA 1ST8A 3LOIA 4L2NA 3UNPA 2DU1A 2W08A 1HB3A 3SCFA 5C8CB 3NKGA 3B94A 3EQEA 5LRSA 3ZSEA 1LOGA 4M3CA 4L11A 1W9TA 1A3KA 2OW4A 3V0BB 3GNEA 5BNNA 2XKOA 4XBNA 5F7UA 3HMYA 4UW4A 3ZM8A 4CUGA 1Y43B 2ZMNA 4CXXA 3TEYA 2XONA 3L9JT 4BLIA 5A7NA 4CCLA 3OUHA 1B35B 2GC2A 2Y6GA 4Q0VA 1YNAA 3T4HB 4L97A 2C5DA 4QKNA 4RR3C 1AVBA 3PVOA 3MLKA 4YZ3A 1AR83 2FMYA 3THDA 2XVLA 3AZXA 3VBFB 3ZX7A 3BVCA 1VBC3 1KS4A 2JIGA 3IN9A 4JQRA 5J37A 2ZKLA 3SISA 4E2GA 3VBSA 4ATFA 5CA6A 3BCWA 1TVGA 5LBEA 4CSWA 1ZZ7A 2ZGPA 4JDMA 5JZGB 3OTFA 3UK9A 3I49A 2D6PA 1H1IA 5FYYA 4RL7A 1HXS1 2VO5A 5JXIA 4ARYA 1QU0A 2P5BA 3J7LA 4PDWA 1DQ2A 3I4IA 1NOVA 4HN1A 4HK9A 2OUJA 3S57A 2PQSA 1YEWA 3LB9A 1LGBA 2WNUB 4YRDA 3BPZA 2X5IC 4XHXA 5H9PA 2A7AA 4NIAA 1CZSA 1PIV3 2PA7A 2WA4A 1W6OA 1NA1B 3WV6A 1AR62 2QQJA 3OOXA 2VMDA 3NNFA 2Y8KA 3HIFA 4QQHA 1O4TA 2JD4A 5E1RA 3ZFFB 2WUHA 4AFCA 4ISQA 1RMU1 1BEV2 5HCHA 1QJEA 2WNVB 1H8TC 4P9JA 3UGGA 1ZZBA 5I8TA 1SLBA 5FPLA 1OKOA 4Y5Z0 4XF9A 1O59A 3SMHA 1C1FA 4JTOA 1OF4A 2X8KA 1BQPA 3PUSA 1W8NA 5E8AA 3AP9A 4XUTA 5D8AA 3N36A 4SLIA 3RPQA 5JXJA 1MS9A 2BDRA 1LECA 4CU9A 1E5IA 4LOSA 1RUH3 1YQCA 1QOTA 4IV3C 4UFLA 4D7TA 1F31A 2FZ1A 1TNRA 2PQQA 3LA7A 2N7GA 4OMDA 1TMF2 5F37A 5HCAA 4TXWA 5FJKA 2EAKA 3BUCA 4A6SA 4CCCA 3IAPA 2PELA 3I54A 3AM2A 5A80A 2GU9A 4Z2AA 2ZABA 1PVC2 4YPJA 2WZR1 3CBNA 3B5LB 3JBG3 3WNPA 1FXZA 3N7JA 4UF0A 2JENA 3V0AA 2W3JA 5FO8B 3T0AA 3ZDSA 4H55A 1OXCA 3GALA 5K8SA 1E5RA 3CL1A 2VOXA 3HT2A 1LKNA 5F5CA 3DCQA 2E63A 1BZWA 5J09A 1DQ0A 2VUAA 2D43A 3I3BA 3OPWA 2WRAA 3FUQA 4Y22A 4FOWA 4QPYA 4X8PA 5FYTA 4YVWA 1XE0A 2GSYA 1UN1A 1IS4A 4XF1A 2GNTA 2V09A 2IXKA 4W50A 3RGBA 5LWBA 2YB7A 4D8MA 1V9U3 1VB2A 5FJHA 4FI9A 4PCRA 3H50A 1UY3A 4CCJA 4NPMA 4KGQA 4I0WB 3M3EA 4AQ2A 1RUI3 2O8OA 2NLRA 5DAPA 1CJDA 4FCAA 3HEIA 3K2OA 1GNHA 3CJIC 4Q4Y1 4CDWB 1VMJA 2VZPA 4L8QA 3WP6A 1AYM2 1G8WA 4BQ1A 2BJSA 1WCKA 3FBMA 3NJXA 4MLOA 1RHI3 1LEMA 3JQWA 3WF1A 3RYRA 2ZGQA 4O7XA 4GULA 4LXLA 2VTXA 3K3NA 4RSUA 2ARAA 4R9DA 1JODA 5CFDC 5JXGA 2BUKA 3GZUC 2R042 2DTWA 2QBXA 3AKRA 3AYDA 3NJYA 4H2AA 4P9XA 4F7ZA 2G9FA 4S2FA 4P02B 5FZ7A 1CPNA 1SFPA 2QQWA 1GNYA 1VAMA 3K77A 3BTAA 4YARA 4UFMA 1JOJA 1HB2A 2RS13 2WABA 1WD4A 2D3SA 2HJIA 3APBA 4S2HA 5DDJ1 3OEAA 3WEZA 3DN7A 3KV4A 4FPKA 5LASA 1Q3EA 1ZBA1 4ES8A 4A7KA 4UW5A 4WV8A 1BMV1 1RMU2 2RMU1 1TNFA 2R1DA 1V70A 4V2WA 1AYN1 3IAQA 4C1XA 4RS5B 5FYHA 1VBA1 2LUWA 4EN0A 2VH9A 2ZGSA 3FL7A 1GZWA 3AJYA 4WM7B 1OA2A 3J7MA 4K9SA 4GKYA 5F3EA 4YW6A 1W2NA 1V0AA 5FKBA 3WW4A 5H9SA 1IS3A 2FBEA 2BVVA 2W1QA 3AP6A 2AREA 4ARXA 2KM2A 1Z7S1 2UWCA 2WN3A 1WW4A 4R52A 5L7OC 3EBRA 1VALA 2EIBA 2WO7A 4SBVA 1NZIA 1UY1A 4LMFA 3FHIB 5DG1A 3TEZA 3ZFGA 2VL4A 3ZSMA 5DZFA 4Z2WA 5A33B 5FZAA 5B4NA 2RM21 5I93A 5IK7A 4JDOA 5J98B 3O1OA 4HXCA 3K4ZA 4EQVA 4OQ8A 2HWD2 4QHBA 1FYUA 2WS93 4XEZA 4HG6B 4HANA 5FPZA 2QJVA 4B7EA 3POIA 3B3QE 4A2UA 2YROA 1S0JA 3AVRA 2P3YA 4BIFA 4MGQA 2Q30A 1JS9A 1UZZA 5CAZA 4FPGA 1GR3A 2XVKA 4LLFA 2E26A 3D0JA 4AI0A 2ZX2A 3AXEA 3DYMA 3H7YA 2CTVA 5IFTA 2YMZA 2R1BA 5F2WA 4DZGA 3U75A 5TSWA 3AMQA 1QDOA 4FPCA 5FZOA 4IUGA 2CY6A 2JECA 4JKMA 4CCMA 4AGGA 3ZN4A 2C6SA 1ULGA 4G3YC 3R05A 3IZOA 1OI6A 2GP5A 4Q4Y2 1WMFA 2ZX3A 4K1ZA 1OOPB 4NHYA 5D2AA 4AFMA 2ADEA 2ZS6B 1W9SA 2WDBA 4ZU5A 3POYA 5FZ0A 2FDGA 3PVEA 3OSDA 4EYUA 4HKWA 4FBFA 2D6OX 2YGMA 3POJA 3GBFA 3AL5A 2GMMA 4WVMB 1MVQA 5C8WA 4MX3A 2MEV2 3ZKUA 1SEFA 5AFBA 2P4EA 3AZYA 4XABA 4OUSA 4PF5A 4CDXA 4JGZC 5FMOS 3AMHA 2DVBA 1C5IA 3ZIWA 3LQCA 2BW8A 3WCRA 3NL1A 4YGBA 1EP0A 3ZXFA 2RMU2 5A6XA 3MW2A 3AFGA 2B42B 1ZRFA 4PLMA 2PXJA 4FVVA 2BQPA 4D7YA 3N9PA 3E5QA 1BVVA 3N7MA 1OUSA 4ZHNA 1OFSA 1F5FA 1QJZA 2A71A 4ZU4A 1O5LA 5ACA2 1W90A 3Q8FA 4RHV3 4AW7A 1REDA 1ZRRA 1WGPA 2W92A 3N9MA 4N7IA 4CA9A 2VVDA 2JWPA 4HN0A 4YVWC 2RVAA 1VE0A 3I2DA 3EO6A 2Y26A 5E16A 4MXVA 2XGXA 4IESA 1HN0A 1O3RA 4FFIA 2AH2A 1F2NA 1ENXA 3ZYHA 1OSGA 1F4HA 2P34A 5FUPA 1O5UA 4HETA 4J1XA 4J6GA 1SPPA 5FZ3A 4A44A 3AMMA 1IG3A 4NMIA 5FTTC 5IK8A 1F8VA 4DQAA 3BU0A 2RM22 4CDQA 1I9RA 1UF2C 3W21A 1DYPA 1F15A 2VZ3A 5BY5A 5L9VA 1RUD2 1HRV1 1P8JA 3KT7A 2R30A 3AYAA 1AXYA 3EJKA 4HBNA 4MGSA 5I0UA 1KQRA 2Q8CA 3OF1A 4XXAA 2VOWA 2RJ2A 3K3OA 1ALYA 1ZA4A 4BYYA 4YZ4A 1WMDA 4KWJA 4YVSA 3OYWB 1GICA 1UYXA 4RR3B 4CEYB 2FDFA 1X7NA 1GFF2 2JDMA 2WZ8A 4FXKB 4W6XA 1OHFA 4XILA 3RS6A 5C3OA 3Q8CA 3N4MA 2X09A 5FPUA 1VAKA 2WT1A 5FKCA 5FMBA 4BMEA 4QB1A 3HQRA 4KWKA 3NW4A 3SCHA 1NQDA 1PVXA 3DYOA 3LGRA 4PJYA 1AR91 4IGOA 5G05L 2G4IA 4G9SB 3ST7A 2RDNA 5T54A 2R061 4OCTA 4KQ7A 1U12A 2VW1A 5JOWA 1DGWX 2Q0AA 3MFAA 3TYJA 1LJ7A 1RC6A 2QUOA 4BMBA 1XRUA 3ATGA 2W39A 2X5IB 3C7EA 3IIAA 3PLQA 5HCBA 4LIUA 4V2VA 4A6OA 2AZ5A 1I5ZA 5GALA 1PM4A 3KV6A 5LCWL 4HL0A 5FZGA 3WP4A 1ULEA 2DCTA 2W2IA 2PHWA 4UAPA 3LDBA 4KH9A 3J7HA 3T2PA 4BK4A 3HBKA 2XJUA 2FDKA 3AFKA 1NKGA 3RVHA 1HV0A 5CKNA 5IVJA 5ABJA 1O6UA 4H14A 5C7GA 2CU5A 1RJ7A 1FI2A 1V6NA 3MF6A 2EF6A 5IUQA 3O5SA 4AL9A 2Q1ZB 5L36A 2DCYA 2DDUA 3M3QA 4OFGA 4QKDA 4WM8A 4XBLA 2B39A 2XQRA 3B7MA 3OGVA 1MQTA 4CCEA 2C9KA 1LHVA 1RVF3 1O7FA 4D94A 2IZWA 1ASJ2 1SBFA 3VDBA 2I2SA 1JYVA 4UXAA 5GKAC 1JZ7A 1ND2A 1O4ZA 1VP6A 3U78A 5L19A 1W8TA 2QKDA 2BV4A 5IT6A 4Y20A 4CCNA 2LTNA 1VIWB 2IC1A 3N3HA 2MPFA 3SH3A 2P3IA 5LBCA 2JB8A 1UNBA 1GQHA 3PJYA 4N9IA 5C8CC 1L7LA 1IS6A 3O1SA 1L7RA 5CADA 3BIEA 4XFBA 3ZYFA 4Q29A 1GZTA 4XIOA 1I5PA 3PL0A 4ZXEA 4GB31 1DGLA 2G9ZA 1HRV2 1AX1A 4U36A 4Q0QA 4Y5SA 3MICA 1W6NB 4UYBA 3VBUA 3ZYPA 3FUOA 2A6VA 2XJQA 1CAXB 4M3CF 3A22A 4KL1A 2GALA 4TWTA 2A6ZA 4QHZA 1EUTA 5DPNA 3ES1A 1R081 1RUJ2 4RD7A 3VBFC 1NY71 2HWC3 3ILFA 1UAIA 1G7YA 4NHKA 2OA2A 2Y0IA 5HI0A 3K4AA 2FCVA 1FNYA 1DLLA 5F6LB 3VD9A 3ACIA 1AR72 2A3WA 5FBZA 4DXTA 1W6QA 2OX0A 5DAWA 5JPNB 1C8M2 2QDRA 1PGW1 4PLOA 5JR7B 5KHHA 4B29A 4CEWB 1KITA 5CFCA 2R071 2PLV3 1FMD3 5FPVA 2PAMA 3JUUA 5CFDB 4N90A 2CYFA 3WDYA 3TBDA 4AHYA 1N1YA 5JXHA 4P9LA 1UY0A 1RL3A 4TN7A 1OLMA 4XJWA 1NCRA 4Y33A 1CWPA 2VR4A 3TEXA 5A6QA 3HR9A 5BNPA 3LKJA 5FZHA 4OUEA 5EFUA 4JHTA 2NQYA 2JG9A 1S2KA 4JDNA 2DFCA 2NZ9A 5JMOA 4Q0PA 3TN92 1RJ8A 2NMOA 4YFZA 5GLVA 5I91A 2HWB1 3WNOA 2RR11 1VJ2A 2MHFA 3T0BA 4H7LA 1D4M1 4CDQC 3C7FA 2WLQA 5KHGA 2ZKNA 3KM5A 5FYVA 3KF5A 4M3CB 1D2QA 5KHKA 1AJOA 4OULA 3WOGA 4OI1A 3WG2A 2CNAA 3J8F3 5IHRA 1RIRA 1SMVA 4S2GA 3PVBB 4P9GA 1UL9A 2P1BA 3GM8A 5CYYA 4NHLA 3B9IA 4UOJA 2BFUS 5IVBA 4B1MA 3AKPA 1SFYA 1TQ5A 2ADDA 2WO3A 3T1LA 2ORZA 2Z4FA 2R16A 4CCOA 1HJGA 5FYMA 2GMEA 2CGNA 1AL21 5FZBA 4LKFA 1BBT1 3GZEA 4K3UA 1MEC2 1JZ2A 1EAH3 5HBAA 5LK7B 1IHMA 3KGLA 3WY6A 2ILMA 3W59A 2J1SA 3IMMA 5DAVA 2YC0A 4UFHA 4ITCA 5HXVA 5IAVA 4JRAA 4QXCA 2VMCA 1PMJX 4NWWA 4QGLA 1H2MA 1W8OA 4NVPA 4GB32 3C2UA 3VBOA 1D2SA 3EB7A 1W2AX 1W6OB 4HSJA 3VKFC 3KCCA 5LY2A 1JYXA 4LR4A 4BQWA 4XTMA 2PHRA 4NRPA 4QPIA 1NE6A 1IG0A 3VBHA 1YQ2A 3C7HA 1UD1A 1M4WA 4MHUA 3UKNA 4QX7A 4HVRA 4XUPA 1DZRA 1DYKA 1H30A 4URTA 4NPRA 4IE0A 5ABJC 1WW5A 3O0WA 2B7YA 2VQAA 3I59A 3KLSA 2VGDA 4QAWA 2E7AA 5AC91 1V6KA 4FPHA 5FP9A 2VUJA 4QWNA 3MFCA 1H9WA 4CEYC 2SLIA 4Q1PA 4AI1A 2ZAAA 4PBOA 5FP7A 4WM8C 2GMPA 2ZAHA 4DNYA 4WVWA 3HPNA 2E33A 4A45A 4YZ1A 4FP2A 3JZVA 1PGSA 4Q4W2 4XUNA 1GWKA 1F9KA 1UU6A 5AFEA 4OLLA 1ND2C 4COVA 3POBA 2PYTA 3OJBA 4E2SA 1US3A 1QKQA 1MVEA 4NIGA 1G86A 2VXJA 3HD8B 4UF0B 3WNNA 3BYWA 3V0AB 2NM1A 1GANA 1CAVA 2VW2A 4UT5A 5FIXA 3SH5A 4ZKTB 2E6VA 5C70A 2RS52 2UURA 1LEDA 1DBNA 2P17A 1EY2A 2DVGA 1QQP2 1S0GA 2VE1A 4FTBA 2D97A 1W6PA 1X9PA 2B4KA 4PQ9A 1DFQA 2G9GA 4BQ4A 1K5JA 3LAGA 1VRH3 1H4HA 1W6MA 2YZ4A 3F2ZA 4JGYA 3UYJA 1LB2A 4P5YA 4Y22B 1CJPA 1WA4A 3HT1A 3INAA 1ZBE1 1TE1B 4QXHA 4YVWB 3AYCA 4DRVA 3NNMA 1MZ5A 1LGCA 4Y26A 4ZONA 4WBBA 1XQNA 1LHUA 2HWF3 3M4FA 2ETEA 3PJQA 1G9FA 2H0BA 3OBZA 4ASLA 2UY9A 3JD72 4KU8A 4LJHA 4Y24A 3SC7X 1YLLA 4FSJA 1RUF3 3GGLA 4DINB 2V5YA 1LOEA 1JUIA 2E51A 3WVJA 5CFCC 1RUE3 4D0QA 4OUMA 4BPZA 1OKQA 4Q27A 3HOBA 5A7OA 3A4UA 1FNZA 1GOHA 5C3QA 4Y1ZA 3NJZA 3T0DA 3WHUA 5A1LA 2J1VA 1VBE3 3MI8A 2Y38A 3P3PA 3QOPA 1NCRC 4QDSA 2OYZA 3MZHA 4NOTA 2DVAA 2VBDA 4XE9A 5A1AA 3T09A 3ZFEB 2BERA 4DS0A 2YC4A 3WNLA 4UBGA 5F2SA 1UZYA 1QJY3 3HN3A 1AR81 4Q2FA 3JCIA 4KG0A 4BOWA 1R1ZA 3FX3A 5AC92 1VBC1 5IK4A 4YGCA 5JOXA 3WINE 1C4RA 1U0AA 1GZWB 1PNGA 2VMFA 5GZEA 4IEXA 1W99A 2JDZA 5FZ9A 4AVCA 1W9FA 2WQZC 3BU7A 3WDXA 3CF6E 4AFBA 5DMYA 4QT6A 3D4KA 4FPJA 4XFIA 3A0KA 1AX0A 1J83A 4XVHA 4LHNA 3AKSA 1UKGA 1XNAA 2RS33 2D7FA 2XB6C 3LSEA 3VKNA 1PO13 4RN5A 2ARBA 4COYA 4Q4V3 1BEV1 2UYAA 2XMLA 2ZHLA 4HZFA 4JV4A 1LCLA 4FT8A 4YW5A 3ZYGA 3ILNA 4P9IA 4BHPA 4LBMA 2CAVA 4FPYA 1UU5A 1FPN3 3OGGA 1QOOA 4Y1YA 1PM7A 2B46X 2RJKA 3MUY1 3OBTA 4IEPA 4M4RA 5KC6A 1DGWA 3W5NA 3U1XA 2WWJA 4AEKA 1GU3A 4XUQA 2CGPA 2DCKA 3VBOC 4QDRA 3I2KA 1QWRA 3JU9A 5SV5A 4DY3A 4EN8B 2OS2A 3MPPG 5A6YA 1DYOA 5T5JA 4E4HA 4DY5A 1M06G 1C28A 3OD4A 1D7PM 4E4SA 1R091 4LK6A 1SQ4A 4BA6A 1PVC1 4JAAA 4QPIC 3H8OA 4XFCA 3VBHC 3U4XA 5I0RA 5FZOB 2DURA 2VM9A 5F3IA 1BKZA 1NAEA 2E53A 1OQEA 2VG9A 4A7YA 4XJ8A 3MBWA 1YRZA 2JDUA 2ARCA 2WKKA 4PI0A 4P14A 1TG7A 5FAXA 1ODNA 4EWEA 1RUC2 5HPOA 5T5OA 2LW8A 1OF3A 2EAAA 3QH7A 2ATFA 4FPEA 5IW0A 5A7WA 5EIYB 2HKXA 4FXGB 3O7OA 3WX5A 1JYNA 2JDYA 5L9BA 1MPXA 4PT6A 1T6GC 2ZGLA 3MUZ1 1DQ4A 1HB4A 1UMZA 2HH9A 4Q0UA 3CEWA 4EWAA 2YPDA 5DUUA 1HJFA 2D98A 2QCSB 2YFZA 2WN2A 3FLPA 3HWJA 4CDXB 2VC9A 1NLQA 2DCJA 4JHZA 4AAPA 5JSPA 3B69A 1VBB3 5FWJA 4P00B 2W52A 3LF7A 2WFF1 1U5IA 1UPIA 4HPKB 3CMGA 1HRI3 4JTNA 1AYM1 3PUQA 5M0TA 1AR82 2WYFA 1VBC2 1JHJA 1QF3A 3AZVA 4HKLA 3ZPOA 4AG4A 2R041 1OVPA 2Y60A 3PHMA 1PO21 1QJX3 4JGYC 4NE9A 4C8DA 3ZKYA 3JB8A 5FPBA 5GM0A 1DHKB 3VDAA 2V73A 4QU2A 2GNMA 3QH6A 5FZ4A 3W20A 1OLQA 2DF7A 1COV3 3N9LA 5FYBA 1BHGA 3VZNA 3RZKA 5F1RA 3FZ3A 3RG0A 1PIV2 1C1LA 5K7PA 4AHXA 1AR63 1SPPB 4RGGA 5FYUA 1GP6A 1YHFA 2F6BA 2JDKA 3U0ZA 2WFPA 2UU8A 2J22A 4CDQB 4BH9A 3T4VA 4MGIE 2SBAA 3I7DA 2ZXQA 1N3QA 4CDUA 3LOBA 2UYBA 5EJ3A 5E6HA 2OIIA 1TZOA 5FOJB 5LZ6A 4UBHA 2WWSA 4B1LA 3KCXA 2O14A 1UOFA 3Q9OA 2VQTA 3TAYA 1R1A3 1RUH2 4YVSB 1R092 1V00A 3MGUA 4MSVA 4IETA 3VZKA 1LENA 2WYSA 1S0IA 4ORFA 1SDWA 5A70A 5BPXA 2AR6A 3PDQA 4Q8LA 2VNGA 1SFNA 4PIYA 1GWLA 2VTFA 1ND3A 1TMF3 5J1XA 1XNKA 1XXNA 3AK0A 3DL3A 2HWD1 2AUYA 3NJVA 1IPSA 1W3XA 4Z07A 5JIUA 2XL7A 1RUG3 3JBG2 4FTSA 3PIGA 1HIXA 5FMOL 3BOPA 1KRIA 3H0OA 2ZMLA 4QGMA 3OGJA 2XJRA 4QU1A 2BNMA 2DU0A 4B7KA 1LOCA 3RWNA 4PLNA 2ES3A 2QQUA 4FFHA 4R9BA 3HNBM 5FYZA 5FXVA 4MHRA 4B4RA 4R4XA 2Z42A 2E9QA 1UIKA 4XF0A 1N1VA 2W91A 3NWKA 4FAHA 1REEA 1QEXA 2WFF2 1CAWA 4A42A 4F3JA 1Q8QA 3MDPA 3ACLA 5FUIA 3W9AA 4IEUA 4KI5M 4A3ZA 5ABJB 1RUNA 4MADA 3IPVA 4TLFA 2VZUA 2QTWB 4YM0A 4YW7A 4CEWC 4D7SA 2VZTA 3VDCA 4Z92B 4N8MA 4Z82A 2BBAA 4WM8B 3QACA 1PO22 3UJQA 2A75A 2QNKA 3E5XA 1NCQA 2WZPP 4BQ2A 4YGEA 3GF6A 3ZXDA 4LITA 1MQTB 2WAOA 1KDMA 1X8EA 2MEV1 3NV1A 4MXWA 1HXS3 1LRHA 5A32A 5KXDA 3DXUA 3POEA 4J25A 4BB3A 1UOJA 4LT5A 1ND2B 2VMHA 4CVUA 2HWE1 4Y20B 4I30A 1GSLA 5JLVA 3U14A 2PHDA 4AYUA 2VZRA 1ZYBA 4LO4B 1YFYA 4AWDA 1Q8PA 2BGOA 2RS12 3VD3A 2VJXA 2GAUA 2GN3A 1CPMA 2ZX0A 2ZCWA 3HQUA 4IEVA 3VV1A 5ACA1 5BNNC 5ERLA 1UYYA 4LTAA 3USUA 3GYDA 1WA6X 5KBFA 3VBUB 3R0RA 1B09A 4IERA 2XVGA 4U2AA 5E89A 3RI9A 4LE3A 3DPRA 4OQ9A 2VCAA 4BDVB 4MGTA 4BXSV 3KMHA 1X36A 1WBLA 1EUUA 3ZSKA 2CAUA 4EN9B 3ELNA 4N7UA 2ZA9A 2EIEA 3GBWA 4UFIA 3VBSC 3SEPA 2VOKA 4V1PA 2PHFA 2X05A 4HVQA 1SBDA 4A4AA 1W6QB 3I3QA 1XU1A 4KBZA 2UWBA 4PDWC 1FT9A 4ZS2A 4OHZA 1AZDA 1JOPA 1RUD1 3OPTA 1YUDA 1NX9A 1YI7A 5CFCB 5J96B 2WZR3 2XLFA 2A5ZA 2VQUA 2DCZA 3CLPA 3GHNA 3WQ7A 1POV0 1Q43A 1STMA 2HYKA 2VBBA 1NCRB 3PMSA 4QQOA 4YW4A 4C0BA 4NHXA 2VVFA 2WS92 3AMNA 5BNPB 1OUXA 3R4UA 4XZPA 4AVAA 2JG9B 4GQ7A 5FFOC 5FZCA 1JBCA 1PGL2 4KG8A 5A1FA 4HKOA 4MVTA 3CZUA 3ZMNA 1YWKA 1NXD1 4MG2A 2VD7A 3I2HA 2DUOA 5D8AC 1YJLA 1K5MA 5FQ0A 3V64A 2OPWA 4CDUC 3OBRA 5FZIA 3H42B 2YG0A 3WQBA 2W1SA 4P08A 1LHWA 4META 5GZCA 3H1YA 3S7EA 2EIGA 4FTEA 2JDAA 3AP7A 4DUWA 5FY0A 4GWMA 3IB3A 1W03A 4Q4Y3 2Y6KA 1BK1A 2C0ZA 3OUJA 3ZXKA 1W0NA 2XDVA 1A78A 4IV1A 2Q8EA 2XPJA 2HWE2 2PHXA 2F4LA 5B2GB 4AXOA 2AENA 2ZEZA 1LOAA 2ZEXA 3RZMA 3BIWE 2V4AA 4LKSA 2Z79A 2WSVA 5F39A 1H1MA 3IIIA 4F8AA 3HJRA 1DDLA 3POFA 2O8QA 2OKXA 1IQAA 4Q1RA 5DDJ3 4D6RA 4EN6B 3LFIA 1I6XA 1ULFA 1VAVA 3WW2A 4AI3A 4CCDA 5JSRA 1HKDA 1OC1A 1YIFA 1ZBA3 2D5HA 2R49A 3NVCA 4GMP0 3VBOB 4OI0A 1CONA 2RMU3 4RFRB 4LOTA 2VNRA 4GJYA 5A7SA 1ASJ1 1J1LA 1AYN3 1IPKA 2K9ZA 3IWZA 4GKXA 4BQYA 4H7MA 1VBA3 2VNVA 3BI3A 2BNNA 4CP9A 1U5XA 4QPIB 4RHV2 5C33A 3VBHB 2JD9A 3SITA 4HONA 4ET7A 3O12A 4AGRA 2NP0A 2HEVF 3I59B 3MIFA 1DQ1A 1Z7S3 4LE4A 2VULA 2WL1A 2JG8A 4C1WA 5F3CA 3KWVA 2W46A 3MIEA 2DUPA 1OLRA 5CG8A 1RXGA 1NA1A 1OPMA 4QD2A 1XYOA 3MLJA 3X29B 3VL8A 1N1SA 4Y1UA 1W04A
chains in the Genus database with same CATH topology
3DGTA 1POV1 5BV6A 1NG0A 2RM23 4XBQA 2OUHA 4LA2A 1RUJ1 4XFFA 3ZFEC 1RGSA 2D3RA 3RMXA 1QMJA 4I0BA 1AR71 5JVVA 1CAVB 2BFUL 3H3UA 5F9TA 3IM0A 4N53A 3WDVA 2EVXA 1WLCA 5CG9A 1C8M1 1LOFA 4QXKA 1YJKA 4I3GA 1W6PB 1XE8A 3ZSJA 1I3HA 3AXDA 1W6MB 2GNDA 4JGYB 3AJZA 2CWMA 1IKPA 4OHWA 1MZ6A 3L2HA 4YGDA 1MS8A 3WG1A 1YCIA 2PLV1 4LHKA 1Q8SA 3D0SA 1MR5A 2H6CA 4LHLA 3TN91 3ZFGC 4HLTA 3WG4A 5LEJA 3ETQA 2P3KA 3AKTA 3UL2A 1H2KA 3D82A 3WNXA 4QQLA 2BTVC 3WP5A 3AB0A 5SV8A 2DVFA 2B5HA 4GMP1 4BLJA 4BIOA 1CD3G 1JW6A 2A6XA 3ME2A 2WT2A 4ZU7A 2OZJA 3MF9A 1ULDA 4P9YA 3R4SA 4NO4A 1GQGA 2QZ3A 2ZHKA 4OZXA 5T55A 1MEC1 2A6WA 2XG3A 4KBBA 4ATEA 1VLNA 4CYDA 2VQ0A 1RVF2 1XYPA 1UCXA 2HEYF 3LCPA 4A7ZA 1X82A 2IXHA 2BEOA 3MEPA 1H2LA 3VDDA 4DMIA 2FMDA 1O3QA 5H9QA 2WINB 3SH4A 1D0HA 2GC1A 3U11A 3ASIA 2R0HA 3QBQA 5H9RA 1FOD1 4RA0A 4CDXC 4IV1C 4HK8A 5KWRA 1HRV3 2XHKA 4R9AA 3WZ1A 4YZ5A 2D44A 3N7LA 3ZYRA 1WLTA 3ES4A 4B4PA 2E7TA 4AVBA 3DUIA 3T1MA 2ARXA 2HWC2 3VHRA 4A3XA 1LULA 2IXCA 3E97A 3H3ZA 3L2YA 3CNAA 2PAKA 1OPOA 2PHTA 1CN1A 1VB4A 5I0SA 1G9BA 1MS1A 2QQPA 3MW4A 4AFDA 3TB0A 4Q4X1 4Q4W1 1AR93 3ZSLA 1CQ9A 2I74A 4YLZA 2R063 2PLV2 4AEDA 1N3OA 5EV7A 1J59A 4N9HA 3VZOA 3LSDA 1PZ8A 1S0EA 5GLTA 1AX2A 1FX5A 4PIXA 1QH6A 2RS51 5GLZA 4XXPA 2YY1A 1MZEA 1QQP1 1KJRA 4D3WA 2DTYA 2PN5A 5JCTA 5BNNB 3ZXJA 4CP1A 5C9AA 2D5FA 3NKTA 2JE9A 2UWAA 1KFXL 3USSA 5BUVA 1ZVFA 1ZM1A 4XPVA 4W65A 4YVSC 1V6MA 3JQXA 4B8EA 2A70A 3J8F2 1LODA 3FWEA 3WUDA 3ZIXA 1Q5OA 2BPA2 3VBSB 3JD71 2WC2A 5JMCA 2BGCA 4AGVA 2JE7A 4G4FA 4N53C 4QPGA 4PBPA 1OOPA 3R6SA 1A8DA 1LOFC 3UKTA 1ZZ9A 4PDWB 4RFT0 5IK5A 3K48A 4AQ6A 1WBFA 2GDFA 3HN1A 5BYNA 1RUF1 4HMZA 4YW2A 2PTMA 3GZAA 2VY0A 3NAPA 4FOQA 4EV0A 4HFSA 4FO9A 2OZ6A 4LO5B 2ZX1A 1FOD2 5FLHA 1N1TA 1VBE1 2ZJCA 4XF4A 1DQ5A 2XBO3 5EYYA 1Q8OA 3S6PA 1EPZA 5T52A 5D8AB 2VNOA 1R083 3VN4A 3N7KA 3U07A 4CDUB 1ZX5A 4WVZA 3TNPB 3WHTA 3DV8A 4RQPA 2XH6A 2ZPXA 1C5HA 2DYCA 4BM8A 4NHMA 4Z8BA 5KXEA 4KGGA 1MQTC 4D69A 2O1QA 4Q4X2 1YFXA 3RYPA 4K20A 3VBRA 1SCRA 1TME1 4GXLA 5EXOA 2R073 5FLJA 2D40A 1CAUA 5F6KA 2YDEA 4GWNA 1KFUL 1ND3B 4K6BA 5DUWA 3WQ0A 1C57A 1PNFA 1HQNA 2A6YA 1PMIA 3E6CC 2XJTA 1SLCA 5CB7A 4XDQA 2O0OA 3VDDC 3VBUC 2VU9A 4AK3A 1ULCA 2HWB3 3OYWA 1RINA 2RR13 2YXSA 1NE4A 1ZZ6A 1D4M3 4N43A 5C4WA 4OHXA 5CNAA 1BVP1 1OA3A 3BODA 4R4ZA 4L99A 4M0NA 1A6CA 1VRH2 3W58A 1DQ6A 1GBGA 1FV3A 4XTPA 4JVAA 2E7QA 5I0TA 1CAWB 4B3NA 1RUC1 3H8UA 1EPWA 1DU3D 3IPVB 4QM9A 2HWF2 3QCWA 2X5IA 2XL9A 4AHZA 1SLIA 1AL23 4C90A 2ZHNA 1BBT3 1WD3A 2VMGA 1RUF2 1NCQB 1LU1A 3OCPA 1JH5A 1ZREA 1QOSA 4MXWB 4M01A 1QHDA 1RUE2 1VBD3 3KZ4C 4OI4A 2Q5TA 5A32B 4DRRA 5DXDA 5BNPC 1H8TA 1E57A 2JG9C 4YYOA 1NQJA 4E9KA 1IOAA 1VBE2 3ZXLA 1IS5A 2PFWA 1PK6A 1IPJA 3OY8A 3MIGA 5DG2A 4IV3A 2D6MA 4EWDA 1MS5A 4YG0A 2WSUA 3USUB 3E6DA 3SHRA 4LBOA 3G6JB 3VZLA 4TZDA 5AC93 3VHPA 4LA3A 4AI2A 4E2QA 1EV13 3M3IA 2GC0A 1PIV1 1A8MA 2K0GA 4TYSA 4OHYA 4AFAA 4IL7A 1TME2 3ZFGB 4AE2A 4QX5A 4K8FA 4HSLA 5BNOA 2H6BA 1QJU3 1XYNA 1WUVA 2RS32 3J26N 1PO12 4AVSA 2CGOA 5E88A 3TNQA 3O0XA 1MS3A 1S2BA 5FPXA 1FPN2 4XHBA 1KDKA 3S7IA 1QGLA 3NAPC 2X29A 3M8LA 4AQTA 1D0GA 1RUH1 1W0OA 4W6YA 1LHOA 3WG3A 2ZBJA 2EALA 1KXGA 2W68A 1NYWA 4LULA 1V6OA 2ZGUA 3M3CA 3ECQA 3CJIA 4XYXA 4FOVA 4L9BA 2PHUA 2QDNA 1ZBE3 4LBJA 3JBG1 3ZXAC 1K5MB 5FQ0B 3LWCA 1U5YA 2TUNA 3AP4A 3C3VA 1QH7A 2DUQA 3FLRA 2BVBA 4LBQD 3THPA 1S55A 3QD6A 4M3CE 2DV9A 1H9PA 3VBRC 1O3SA 4NN0A 2X53S 4BE3A 3PTYA 2IFWA 3ALQA 3D6EA 4IV1B 1FAYA 1V6LA 2XJVA 4M0HA 4ZXKA 5LK5A 5I8YA 2NMNA 3H7JA 4IXLA 2IXIA 3VZMA 4HVOA 1Q56A 4FOYA 3WDUA 1V9U1 2BWAA 4OVEA 1GZ9A 3R4DB 4INDA 1VBB2 4FQZA 2H0VA 1RUI1 5GLWA 3WDWA 4MUVA 3WP3A 4YNIA 1J3PA 1HRI2 1QY4A 5K9YA 4YW1A 5FDBA 1CX4A 1RHI1 3NV4A 3WD5A 4N43C 5L7OA 1SLAA 5C4WC 2MNGA 3M2MA 1J1TA 4P5HA 3RNSA 4YM3A 2B45X 2ZMKA 4MGKE 3RYKA 3WCSA 3QLQA 3KQRA 1QJX2 4AHWA 4ES9A 5D1IA 2RS11 1HLCA 1FATA 4I0AA 2PHLA 1COV2 1YFWA 2JG8B 3OPZA 1ZZ8A 1JXNA 5K0UA 1BEV3 3IMNA 1XNBA 3VUOA 4L92A 2YPJA 3ZPYA 1MACA 3CU7A 3ROUA 3PVNA 4XJZA 1GLHA 2TEPA 4XETA 3WLUA 1GZCA 2WA3A 3WW1A 1O91A 3AX4A 1PK6C 1R1A2 4N53B 3NSTA 4LO8A 1R093 1QXPA 1PVC3 1I1EA 4CZSA 4XMAA 2JX9A 2C1FA 5AVPA 3LA2A 4Y1VA 1XNCA 4EN7B 1DIWA 2JEMA 2GN7A 1RUG2 1LGNA 2WS91 3ILRA 2YGLA 4JGZA 1OQDA 4KWLA 4YG3A 5T5PA 1NLSA 2I07B 5CIRA 4I01A 1PGL1 3FMGA 3RQ0A 2QE3A 1MS0A 2HEWF 5BNOC 1Z0HA 2EXIA 4GA9A 3AYEA 3AZZA 2K2SA 3SNMA 4FAGA 1OFNA 1V9U2 1YO8A 2GH2A 2D6NA 2WIIB 2WJSA 4XJ9A 5LRRA 1RUI2 2VXRA 4Y1XA 4F83A 5DUVA 2BNOA 2WFF3 3VKOA 5T3NA 4COZA 4IEWA 1AYM3 1HQWA 1RHI2 4DB5A 4GIQA 1GNZA 3T2TA 3EHKA 4K40A 4Y4YA 3FFZA 3K51A 1CR7A 2R043 1PO23 4HT1T 1HXS2 4XFHA 2R6QA 1RUOA 2ZGKA 3ENRA 1BCXA 3CJXA 4GH4A 4QQPA 2IFRA 1WW6A 5L73A 1DGRA 4COWA 3EXUA 5AVAA 1RMU3 3VDDB 2RJLA 4JC1A 4FPOB 3GHMA 3POWA 1LU2A 1V6IA 1YI9A 3ZN6A 5FO9B 4YM1A 4RHV1 5HCFA 4AQSA 5A3MA 1IGOA 2ZGNA 5JWPA 5FCCA 3D8CA 4QQ2A 1FV2A 4IQPA 2YV8A 1APNA 1URXA 1ZRDA 5CBLA 1X50A 1X33A 4EROA 2ZGOA 3MIHA 2R32A 4E27A 3RSJA 2HWD3 1SACA 2TBVA 2WZR2 1ENRA 2GH8A 4AEDB 4K21A 5JDBA 4J1WA 1MS4A 1YIPA 1S0BA 1J58A 1ZRCA 1NZCA 5T5LA 3MLLA 1H4GA 4BZ4A 3RMYA 3TRSB 1RTVA 2VMIA 1HDKA 3IDBB 3GZTB 4LBQA 5K0UC 5GZFA 5J7MA 3TWIA 3RRDA 5C9AB 3ZMOA 4DFSA 3LZZA 3KS7A 2WNEA 1DZQA 4LO6B 2D3PA 2AGSA 2B8MA 2Z69A 5C8CA 1C8NA 4QMAA 1QXRA 1ND3C 1Y3TA 4QPGB 2OVUA 2NN8A 2MEV3 3V56A 3V0BA 5A3LA 4Z1VA 1ENSA 4CP2A 3NV3A 3POSA 2HWE3 4LLOA 1B35A 2ZGTA 3VKLA 4I2OA 3JB4C 3RI8A 3NAPB 3VBFA 4Q26A 4CTEA 5DDJ2 2C9AA 2DWRA 3M70A 2GC3A 1OD5A 1O4YA 1JN2P 1ZBA2 1BMV2 5JZGA 5ACA3 5FRAA 4HPKA 1Y7BA 4YZ2A 1G9DA 3BOWA 1RVF1 4IEOA 5CVRA 3RZZA 3ZN5A 2OPKA 1AYN2 3E5UA 1UX6A 4QM8A 1VBA2 2I45A 1OA4A 1XU2A 2WNUA 4QGNA 2A3YA 5DUXA 3SCGA 5BNQA 2CL2A 4RQPB 2Q8OA 1NCQC 5FREA 1N3PA 1Z7S2 2YHJA 4R8HA 1WLWA 3THTA 3ZFFA 4MH0E 4AF9A 2D93A 3VBRB 1IZ3A 4X6QB 1RUD3 2WNVA 3S0MA 3UJOA 3B93A 1BXHA 1CAUB 2IXJA 4WZCA 4OHVA 1G9AA 1H0BA 4JCKA 4ASMB 3SLIA 2HWC1 2ET1A 1AHSA 2XWBB 2GNBA 4GH4C 3B9CA 1RB8G 5JPMB 2VW0A 1Y9QA 2UY8A 1GV9A 1HQLA 2IXLA 4I09A 2XJPA 3DPRC 3AMPA 3IT8A 1YXWA 1L3JA 4N43B 5C4WB 1FMD1 3OD0A 3TOJA 5EZWA 1O3TA 1S0DA 4LNVA 1AXZA 5JI9A 1H8VA 4UW3A 1ONAA 4YFWA 1PZ7A 5GZGA 1EYBA 1S0CA 1G9CA 4M00A 1W0PA 1N47A 3DKWA 3MIDA 2PAEA 2EXKA 2EXJA 5GJ6A 2WT0A 4DXZA 5F5QA 4C0HA 3G7DA 4XJUA 3J8F1 2AYHA 1AF9A 5JOZA 1H8TB 5KC5A 3UKVA 4AI8A 3FE5A 4CDWA 2XWJB 1PK6B 1XE7A 1ASJ3 3OY8B 1K5MC 4NR1A 4IV3B 4FQ4A 3M3OA 1XNDA 3M1HA 1F5JA 1CGPA 1KJLA 3U10A 1EAH1 4MGYE 4NWVA 1HV1A 1C3HA 5DZEA 4W6WA 3WQ1A 1J3QA 3VLBB 4AEJA 3AP5A 2JKBA 1LR5A 2ET7A 2KXLA 4WVVA 5EYXA 2VOVA 1UIJA 2ZGMA 3PNAA 1OMIA 1WW7A 3LA3A 2VECA 4RS5A 3ZYJB 5BNOB 1BYHA 5KHJA 4WZFA 1POV3 1Q8VA 4K1YA 4MYEA 4WM7A 2QZ2A 1RUJ3 4TSVA 2A73B 1LOBA 2RHPA 1JHNA 4UW6A 3IBMA 3VZJA 1BJQA 1S0FA 3N35A 2EA7A 2XBO1 3FC0A 1B35C 2VVEA 1AR73 1LESA 1UU4A 4S2DA 2TNFA 2ERFA 3AZWA 4LBNA 2IWGB 1C8M3 4Q8KA 1QNYA 4COUA 1FMD2 5A33A 5JZGC 4LUMA 3HAGA 4B4QA 2QFEA 3CJIB 1AR92 4XIKA 4XOGA 2R062 1MZFA 4CP0A 2FHRA 4JRLA 2WNUC 2Q1MA 2JG8C 3MW3A 5J36A 1TEIA 4RGAA 3ZXGA 1WCSA 1NA1C 4XQWA 3TN93 1SLTA 4DOUA 2ZACA 1PZ9A 2YUEA 3ZFFC 5GLUA 4XF3A 2BWCA 2XLAA 2WNVC 1PHMA 3WDTA 2WQ4A 1VRH1 3J4UH 4XFGA 3E6BA 1KD7A 4GMP3 4C91A 1GYKA 2Z5WA 4I02A 1DZTA 3O14A 3GBGA 3B00A 2VPVA 2HWF1 4ONUA 1NXMA 4YG6A 5JAXA 4LBLA 3WT3A 1NLRA 1DGRN 4WVMA 1MEC3 1EAH2 3RDIA 3M7AA 3J9SA 5FLIA 1RUE1 5L7OB 5EWSA 1AJKA 2LALA 4X8NA 3B01A 5C6CA 3WR0A 4ISRA 1QNWA 2NPIA 4GB33 1GKBA 4XFAA 2XKPA 1VBD1 3ZVXA 1JUHA 2D6KA 4LBKA 1HX6A 1LTEA 4I3PA 4OI2A 1FOD3 3B02A 4YSFA 2XJSA 5K0UB 3H1WA 1SBEA 1QJY1 3NV2A 4FP3A 1AXKA 2XBO2 4MZUA 4BWOA 3IDCB 5KHIA 3KSCA 3UV9A 1R082 4LUKA 1NY72 1IKQA 2F4PA 1AL0G 4EJRA 2ZGRA 2P2KA 3MYXA 2D6LX 2BBVA 1WMEA 4CDWC 2KA3A 1ZZCA 2RS31 3PMEA 4H3WA 4Q4W3