3ZPYA

Crystal structure of the marine pl7 alginate lyase alya1 from zobellia galactanivorans
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
248
structure length
248
Chain Sequence
GNSPASVLGITANTWKINSFIGSPGSSATYYDDITDASGISYNTYSDDNYFYTDGEWVYFKCYRGLGGSANSQNPRVELREMDNGNLASWTGDSGTHTMEWTVQVNQLPQDTDGDGGVLCFGQIHGPSKNSDGVEVDDVVRVQFIGEENQSSGSVKLKISGYVTEEQGGSQTFSGYSLDTTYNCKLVYSGGYVELFMNGSSVFRKKMEVDDLSENYFKVGNYLQSVKGASYTGSYGLVRIKNLSVTHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparative Characterization of Two Marine Alginate Lyases from Zobellia Galactanivorans Reveals Distinct Modes of Action and Exquisite Adaptation to Their Natural Substrate.
pubmed doi rcsb
source organism Zobellia galactanivorans
molecule tags Lyase
molecule keywords ALGINATE LYASE, FAMILY PL7
total genus 62
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 4.2.2.11: Guluronate-specific alginate lyase.
pdb deposition date 2013-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08787 Alginate_lyase2 Alginate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zpyA00
1PZ7A 3GALA 3ZVXA 2AYHA 1DQ4A 4XJWA 1H9PA 4F83A 5IT6A 2ZZJA 3V0AA 3B9CA 1AF9A 3TB0A 3PVNA 3HN1A 1AVBA 3MW3A 4FPOB 2DU0A 1IS4A 1AXYA 1ULFA 2WSUA 3MW2A 4PBOA 4YM2A 2R16A 1O4YA 1IKQA 1W6OA 1N1VA 1DGLA 1ZM1A 4YGEA 1GZCA 2ZACA 1YO8A 1S0IA 1LOGA 1IS5A 5EWSA 1J1TA 4YW1A 1CR7A 1G9CA 2CWSA 3GNEA 1FX5A 3N7KA 4AVVA 4XBLA 2WKKA 4YW2A 4FOWA 3OY8B 4PCRA 4FQ4A 1BYHA 1QMJA 2AR6A 2GMPA 3RQ0A 2D6KA 4FVVA 1DQ6A 4XBNA 3WG2A 1IS3A 3N7JA 1OKQA 4XIKA 1FNYA 5JDBA 1DZQA 5HCFA 3SH4A 1A3KA 1EPWA 3PJQA 4RL7A 4OZXA 2JD4A 2D6OX 3WG3A 1U0AA 3ZXEA 2DUOA 4YLZA 3JU9A 5IUQA 4DRVA 1S0GA 2PELA 2ZHLA 5GM0A 1UZYA 3B01A 1ULEA 1F5FA 3O12A 4Q27A 1H30A 1HQWA 2D3SA 1MZ5A 1Q56A 2CTVA 2EALA 2JDZA 2R1DA 2ZGNA 2PHWA 2DWRA 1VIWB 4GKXA 4GALA 1UX6A 2YMZA 2E53A 1QOOA 1WCSA 3LSDA 1AZDA 3R05A 3USUB 3WZ1A 2D6NA 2A7AA 2VY0A 1S0DA 4PQ9A 3O0VA 4UW5A 1N47A 2A71A 4XMIA 2WLQA 5DZGA 2WT0A 3ILNA 3FBYA 2ZGQA 1GV9A 1C1LA 1VAVA 1LJ7A 1LOCA 2ZAAA 1MVEA 2OUHA 3ZSKA 1Q8SA 2W52A 1G8WA 2UURA 4Q1RA 3BOPA 2WNEA 3POYA 4Y1VA 5GLWA 3RRDA 3AJZA 3WDUA 1W6MA 1QOTA 3M3OA 4PF5A 2DVAA 3AZVA 1N3PA 5T50A 4W65A 1W6NA 4GWNA 2AREA 1ULDA 1YYNA 5CAZA 5GJ6A 5KXEA 2ZGUA 3A0KA 1QDOA 1UZZA 2D44A 4YG0A 3SITA 3TAYA 1DFQA 4JC1A 4RA0A 2DUQA 1MZ6A 1JOJA 1WW7A 1HQLA 3ZPYA 4FPJA 1QKQA 3DGTA 1PZ9A 1SLTA 1ULGA 2WQZC 4GXLA 5DUUA 1BZWA 4XXAA 1QNYA 2DVGA 1TEIA 4H55A 3ZXKA 5AVAA 3T1MA 2FHRA 2LTNA 5F9TA 2CYFA 1W6OB 1AJKA 2R0FA 5E8AA 3SH5A 4KBBA 1LGBA 1GYKA 4DFSA 1PZ8A 2CNAA 4ZXKA 3FLRA 3BIWE 3W59A 4U36A 1D0HA 2P37A 2W39A 1QNWA 4LBLA 2Q5TA 3WLUA 2DURA 2ZGMA 3OBTA 3WDYA 4YGBA 2VW1A 4CZSA 1WLCA 1WW4A 2AGSA 5E89A 3ZXJA 1MS1A 1ZA4A 2SLIA 2AH2A 5T5OA 2OVUA 4BMBA 5DZEA 3R4UA 4AVSA 2ZGTA 4YZ5A 3A4UA 1AX1A 1W0PA 5CNAA 3UJQA 2P34A 1LECA 2GNBA 3RS6A 2YY1A 3WHUA 3AXDA 5GZEA 4AGGA 4K21A 1LHOA 4FQZA 4M3CB 4IQPA 1AX0A 5FREA 4I30A 2JE7A 1GZWA 3AZXA 1W6PA 3OYWB 4ZKTB 3M3QA 1A8DA 4P14A 1LGNA 3IPVA 3FLTA 3ZXFA 3AX4A 3AZZA 1MS0A 2ERFA 3V65A 2P3IA 1FYUA 3WCRA 5JOYA 2W08A 1DQ0A 1G9FA 2ARXA 4K20A 4Q2FA 4WVWA 4GA9A 2OW4A 2WT2A 3OY8A 1GKBA 1W6QB 4P9WA 3D4KA 3WOGA 3OGGA 3SISA 3DUIA 5IK5A 2GN3A 2UWCA 2ZGRA 4DQAA 5GZCA 1HLCA 2A6XA 4YM3A 1YI7A 1JYCA 2A75A 1DYKA 3HR9A 1S0EA 3NWKA 3POWA 1WBFA 1GNHA 2DU1A 2EF6A 2TEPA 2ZGPA 4JCKA 5GZGA 3VUOA 4UW4A 5JVVA 2GDFA 1DQ5A 1BKZA 1JW6A 1MS4A 1RINA 2ZHKA 3D5OA 3ZXLA 3V0BA 4Q8LA 2ZGOA 1ULCA 3AJYA 4WZFA 3UJOA 1GLHA 4FPCA 3USUA 3WUDA 4M3CF 4Y1XA 1BQPA 4M3CE 2EXJA 2YV8A 4P9XA 1YXWA 1F9KA 3IN9A 5GZDA 5GALA 1CESA 1LEDA 1SLCA 4AWDA 1JHNA 1UAIA 2CL2A 3IKWA 5KXDA 3JUUA 2DVBA 2P2KA 1IS6A 4K1YA 4WV8A 3KQRA 1O4ZA 1Y7BA 4P9YA 4C1XA 1APNA 4YZ3A 3N35A 1G86A 3SLIA 4XJUA 1WD3A 1G7YA 1LHNA 2OUJA 2JE9A 1V6MA 5SV8A 1V6JA 5JMCA 2PHRA 1W6MB 3OBRA 4LBKA 2AENA 1H9WA 4R9DA 1MS3A 4HL0A 1Z0HA 3AP5A 4GWMA 2W68A 2A6ZA 1B09A 1NXD1 2EIGA 1OFSA 2D3RA 4YW5A 5LK5A 1GSLA 3AZWA 5DG2A 3M3EA 1DLLA 2NMNA 4BLIA 2DTYA 5HCAA 2E51A 4Y22A 3UK9A 4XDQA 4Y1YA 4FP2A 4R9CA 1I1EA 2ZGLA 3FUQA 5GZFA 3KM5A 4ASMB 3M1HA 4PBPA 2E6VA 1Q8PA 4FPGA 4YZ1A 2DUPA 2EXKA 1MR5A 1QGLA 2SBAA 3M3CA 4HANA 4XBQA 1CIWA 2ZBJA 3OPZA 4YM0A 4AGRA 2NYYA 5DUXA 1WW5A 1LHWA 4ATEA 3ILRA 1V6LA 1FAYA 3IPVB 4CRQA 5H9SA 2ZKNA 4FOQA 1LOFC 3WDVA 3RSJA 1MACA 3FFZA 4FPHA 1S0BA 2DVDA 5DUWA 3WHTA 5T5JA 2I2SA 3LSEA 1V6NA 4TZDA 4XMAA 2CY6A 2JKBA 2A3WA 3O0WA 3ZSLA 2ZMLA 4LBQD 4AVTA 4YZ2A 2VH9A 1LULA 2CWMA 1GZ9A 1MS8A 2ZGSA 1RIRA 3INAA 1ONAA 1UL9A 2ZABA 4GKYA 3ASIA 2PHFA 3FUOA 5T5LA 1KRIA 1IOAA 3NV4A 1SLLA 3MEPA 1KDMA 2YZ4A 4YG3A 2GALA 5CB7A 3T2TA 1LOAA 1QOSA 3BODA 3B69A 1G9DA 1NLSA 2FMDA 2A3YA 1GICA 3AP9A 1SBEA 3T1LA 1ENRA 4UW6A 5EYXA 2NM1A 2NP0A 1N1SA 5GLVA 1Q8QA 1W6PB 3POSA 4XHBA 4Y24A 2GNTA 3WDXA 2A6WA 3IM0A 2VW2A 4XJZA 3U4XA 4Y20A 1JYIA 3QCWA 1BXHA 2GMMA 2ARBA 4ATFA 1LU1A 1LHUA 3AYCA 1Q8OA 1JN2P 4BM8A 2XG3A 1I3HA 2DTWA 5FRAA 1QDCA 1SCRA 2NZ9A 4TYSA 1AJOA 1QF3A 3MW4A 1WUVA 1AXZA 4LBQA 1DIWA 1HDKA 3AXEA 1OQ1A 2GNMA 1CVNA 1SACA 2D6MA 1LEMA 4XIOA 3AP7A 4XHXA 1CQ9A 5E88A 2GMEA 3UL2A 1GZWB 3N7LA 2E7QA 5KXCA 3OYWA 1CONA 2PHTA 4ITCA 4YGDA 3O5SA 2DV9A 1AXKA 1Q8VA 2R1BA 3AK0A 4BMEA 1LU2A 1KJLA 2E7TA 3MPPG 2C9AA 4R9AA 2WT1A 2D3PA 4AGVA 1SLIA 1LTEA 1WD4A 3V0BB 2JJ6A 3V0AB 4XYXA 4CTEA 1FNZA 3NV3A 5GLZA 2NN8A 1LOEA 1URXA 5L73A 5HCBA 1YIFA 4FOVA 4Y1UA 1JXNA 3AYEA 3SH3A 4NOTA 3VKNA 1X50A 4AYUA 4D69A 4DS0A 1SBDA 3VV1A 2BQPA 4JRAA 4NO4A 1WBLA 3AZYA 4FPLA 1CN1A 4MYEA 4Y26A 5KXBA 1DYPA 1CPMA 1LGCA 1G9AA 2ZHNA 1JBCA 2A5ZA 4YFZA 1W6NB 2V73A 5F5QA 1LESA 1HKDA 3LCPA 1LCLA 5H9RA 3VKOA 4M3CA 2P3JA 3AP6A 5EXOA 1IKPA 2PHXA 1C1FA 1UPSA 4YM1A 3AFKA 1SLAA 3O0XA 1V00A 5JOZA 3WCSA 4BLJA 1GANA 3AP4A 1DQ2A 5DZFA 1F31A 4YW4A 3ZSMA 3VKMA 2ZHMA 3ATGA 5DG1A 2VXRA 2UU8A 1N1YA 2KM2A 1WLDA 2PHUA 4XZPA 4FPKA 3AYAA 2D43A 1LOFA 5IK8A 2GNDA 3AYDA 1CJPA 3W58A 1V6KA 4FPEA 1JUIA 4YZ4A 3SNMA 1DHKB 3C2UA 3I4IA 1DBNA 2VUAA 3HMYA 5IK7A 3FLPA 1CPNA 1BJQA 2UWAA 3BTAA 3WVJA 1LODA 1LHVA 3ENRA 4Y20B 3V64A 3WV6A 2A3XA 2VW0A 5DUVA 2RHPA 3WUCA 3I8TA 2G4IA 3A0NA 3IMNA 4FOYA 1KDKA 1WLWA 2A70A 3CNAA 3OJBA 5H9PA 1C57A 2YXSA 5T52A 4LBNA 1UKGA 4BQ1A 4ISRA 1C4RA 4YW3A 3N36A 3NV1A 1MVQA 4LBQB 1ENQA 2NMOA 2C5DA 3WG4A 2ZMNA 2UWBA 3ZSJA 4Z8BA 3R4SA 2EXHA 5GLTA 2ZMKA 2XB6C 4Q8KA 1UN1A 3ZYPA 3RMYA 3B3QE 3APBA 5BYNA 3M2MA 2V5YA 1W0OA 1S1AA 1MS9A 2HYKA 3WDTA 2R49A 1XQNA 4L8QA 4XOGA 3RMXA 3VKFC 3ILFA 2JECA 1MS5A 1UMZA 2GN7A 1ENSA 1SLBA 2LALA 4YFWA 3WNXA 3L2YA 4XILA 4DRRA 1N1TA 4ISQA 2R0HA 4YGCA 3NV2A 3VKLA 1V6OA 1GNZA 1VLNA 1S0CA 2B7YA 1R1ZA 2D6PA 1LENA 4XJ9A 4BOWA 1G9BA 5JOWA 1SFYA 2EXIA 2ZGKA 4DPNA 4FPFA 1KJRA 2WJSA 4XTMA 1FV2A 2ZA9A 4Y22B 2D7FA 1QU0A 4WVVA 5IK4A 3N3HA 2VU9A 1FV3A 1SBFA 1VALA 3PMEA 4FP3A 1RITA 4K1ZA 3QLQA 1D2SA 1WW6A 5DXDA 5T55A 3WDWA 4LBMA 2WSVA 2D6LX 1V6IA 5CA6A 1Z78A 2A6YA 4UW3A 5T54A 2H0BA 1A78A 3N7MA 3RG0A 2EAKA 4YG6A 1S0FA 4XE9A 2DVFA 3WG1A 3ZYRA 2DYCA 4M00A 1N3QA 1GBGA 4Q1PA 2ENRA 1AX2A 1KQRA 4BPZA 2AUYA 5JOXA 3PVEA 1S0JA 4C1WA 2YROA 3Q9OA 3PVOA 2P3KA 1SCSA 2ES3A 4LBJA 3D6EA 4U2AA 5CBLA 4XJ8A 4M01A 1VAMA 4Q26A 1LOBA 2Z42A 4R9BA 5JLVA 3H0OA 4LBOA 1YRZA 2A6VA 1N3OA 1FATA 1KITA 3B00A 4FPYA 5EYYA 5H9QA 1W6QA 1DQ1A 4Y1ZA 4XTPA 5GLUA 4SLIA 4XXPA 5T5PA 4XJAA
chains in the Genus database with same CATH superfamily
3ZVXA 5JSRA 1YHFA 2J1UA 4MGTA 2HWD1 1H9PA 1AF9A 3TB0A 3MW3A 2TBVA 1IS4A 1AXYA 1ULFA 3MW2A 5L36A 2VZ1A 1O4YA 5FZ7A 3MIEA 1JZ8A 5CG8A 1N1VA 1DGLA 1JOPA 1U5ZA 1YO8A 1S0IA 1LOGA 3RI8A 3MFAA 1J1TA 1CR7A 4KNCA 2IXJA 4DZGA 1ND3A 3GNEA 2QQWA 5C5UA 2VVEA 4XBLA 1QJY1 3LDBA 2B9UA 4UF0A 2RS51 4FOWA 1FXZA 4ORFA 1DZRA 2GMPA 3OTFA 2D6KA 1F15A 4XBNA 1RUOA 5FZIA 3WG2A 3PIGA 3K77A 2JDAA 5FFOC 1WMFA 4XIKA 3EJKA 3RYKA 5DAXA 1HJGA 3PJQA 5LA2A 2V5DA 4RL7A 3USSA 2JD4A 2D6OX 3WG3A 5C8WA 4QQLA 4E2SA 2PAKA 2VOVA 5DDJ1 3CDZB 1K5JA 1PK6B 2OPKA 2YC0A 1O3TA 1BBT3 1IG0A 1ULEA 1F5FA 3O12A 4C8DA 2PHDA 4EYUA 1HQWA 3MIDA 5A3PA 5LA1A 2HEYF 1O91A 2EALA 3K4ZA 4JVAA 3ZKYA 3EO6A 4BCUA 1RTVA 2DWRA 4PJYA 3UYJA 4GKXA 5FYVA 1UX6A 2JDPA 2E53A 3R05A 4AEJA 4GB33 3CF6E 5IVFA 2CDOA 4G3YC 3EBRA 1N47A 3ILNA 1ACCA 4IEQA 1PVC2 4IGPA 1A34A 2RG4A 4CUGA 1LOCA 3VDDC 2XH6A 2Q8DA 1PX3A 1TME1 3MV11 5JR7B 3ZSKA 5AVPA 1Q8SA 4FTEA 1G8WA 3S30A 1OA4A 3BOPA 3POYA 2VZSA 1UKRA 1NX9A 3CQOA 2ILMA 4AI2A 1X82A 3AJZA 3WDUA 1QOTA 4PF5A 4COWA 4WM7C 2Q1FA 5T50A 4CXXA 4W65A 4JGYA 1ST8A 4XURA 2Y64A 4L99A 1D4VB 4W50A 1QJU1 1YYNA 1UPIA 5GJ6A 1JYTA 2JG9A 3A0KA 4YG0A 4IE4A 3VBRA 3WNPA 1PMHX 4RA0A 4I01A 3EQEA 1JOJA 1ZBA3 1ZZCA 1VBB3 3DGTA 4CDWA 2XJSA 4GXLA 4RGAA 1W03A 3AKPA 1QNYA 3GZTB 2YB7A 4CDWC 1PO23 4QB1A 2DVGA 2IZWA 2W1SA 4RHV1 1DCSA 3ZFGA 1POV0 2IC1A 2VOWA 2QTWB 1PGL2 3T1MA 2LTNA 3WW3A 1XOYA 5E8AA 5FQ0A 2JG9C 4XVHA 3KGZA 1PZ8A 1VR3A 3MO4A 3UGGA 5FUIA 3VBHA 3DKQA 5ACA1 4U36A 4LO8A 3RZGA 3GF6A 4XC9A 3KCCA 2W39A 1AUYA 2WR9A 2YFUA 2XVLA 4K7JA 2HWD3 1RHI2 1YUDA 2B9VA 4NJ4A 2DURA 4PIXA 5C3RA 4N7UA 3GGLA 1QJY2 4O65A 4YGBA 1WW4A 2C1FA 1BVVA 1ZA4A 1HN0A 2SLIA 5T5OA 4QGNA 4YARA 3VGIA 2G1MA 4AVSA 5CKNA 5L7OA 5A1LA 2TUNA 3A4UA 1ZVFA 5LATA 3UJQA 4AQ2A 2XPJA 1UD1A 1RHI3 2QZ3A 4KL1A 3RS6A 5JSPA 3WSOA 1UX7A 2E31A 1OT5A 4K8FA 1PNFA 3AXDA 4ZU5A 4XQWA 5GZEA 3WHUA 4D8MA 5AC92 1JH5A 2E32A 4HPKA 1HX6A 4KG0A 1Z7S1 1J3RA 4C90A 4CVUA 4M3CB 4IQPA 1FOD3 5CIRA 1X33A 5FP8A 4XF0A 3TEYA 3M3QA 3ZXFA 3IPVA 2BERA 3FLTA 3I2KA 1D7PM 4FO9A 4XUNA 1XNAA 4LIUA 3KV9A 2ERFA 3C7GA 3AKRA 4JRLA 1U5IA 2XR4A 3VZKA 2ARXA 3H50A 4Q2FA 4AI3A 1R093 2NLRA 4FFGA 1GKBA 4QX8A 4TN7A 3D4KA 4CE8A 1GFF2 4QHOA 1PGW2 3POEA 2CGOA 3C3VA 4UBHA 1XC6A 3THTA 5IK5A 5D8AC 1RUE2 2FDJA 3JQWA 4GIQA 2A6XA 3O1TA 2XVGA 1JYCA 4RS5B 4I3PA 3DPRC 1S0EA 4QX2A 1XNBA 2VCBA 2VZQA 2XQRA 1IZ3A 5CYYA 1PNGA 1FOD1 2ZGPA 5HV0A 2VQTA 2E9QA 2W9XA 4TSVA 3VUOA 2P5BA 2GDFA 3OG2A 1JW6A 2ETEA 1MS4A 2VPVA 1Q3EA 5JZGA 5K8SA 1OQEA 5C8CC 1GLHA 1BQPA 2IWGB 4COUA 1RMU3 3PHMA 4KU7A 1HRV1 5DPNA 1RUG2 3WQ7A 5GALA 2Q8EA 1KEXA 1OD5A 1RGSA 5FO8B 4CCNA 1E5HA 3TWIA 4QX3A 3T08A 2Y33A 4I02A 1ZZ8A 4OHVA 4RFRB 1PIV3 3KQRA 1BK1A 2GZWA 4LEJA 3O1SA 3TN92 4LUMA 4E4DX 1EV12 2HEWF 2OUJA 5AFBA 1V0AA 5A3UA 2VBPA 2RV9A 1OFNA 3EYPA 4LE3A 2ARCA 2FZ1A 1H9WA 5SV5A 2BGOA 1W2NA 2BV4A 3ETQA 3HNBM 2WZR2 3HIFA 3H8UA 1W39A 2W68A 4OUMA 1VRBA 1B09A 4NROA 3MDPA 5LK5A 3CLPA 2ZJCA 2DFBA 2JENA 1UYYA 3GBWA 4MGSA 3U07A 4CDUB 4GWJA 4K9SA 3WNKA 3MF6A 3M3EA 4QQ2A 4LA2A 3SQOA 2R061 4OI0A 2I07B 1NKGA 1UNBA 1WCKA 3LEMA 3KF5A 3GHMA 1EYBA 4XDQA 3UK9A 4Y1YA 1ZRCA 4R9CA 3R6SA 2XHNA 4NRPA 1ZZ9A 2E6VA 3H8RA 2ADDA 1ALYA 2BGPA 2IVJA 1BBT2 1OOPC 1OF4A 1R64A 3M3CA 4HG6B 4IE5A 4S2GA 4YM0A 1IG3A 4Z92B 2QQKA 1LHWA 3LFMA 4BU2A 3ZXGA 1V6LA 1FAYA 3IDAA 4PI0A 3IDCB 1W9YA 4FOQA 1ZBE1 2ET1A 4FI9A 4PF1A 1J1LA 5IVJA 1Y4WA 3S0MA 1M06G 3WHTA 1O5LA 3IWZA 3BTYA 2WDBA 4QM8A 4XMAA 4IETA 5E1RA 5HXMA 2WO1A 3O0WA 1JYXA 3EB7A 3A22A 2GP3A 2Y26A 4R4XA 3J7LA 5FZ8A 2CWMA 4HXCA 3ACFA 1RIRA 2EIDA 2WZR3 3UGHA 4NIAA 3ASIA 4QKDA 1QH6A 3KVBA 4AE2A 4Y33A 5IVYA 3SEPA 5LWBA 1JZ5A 4KMQA 2BZDA 1YWKA 2QZ2A 2YZ4A 2WQ4A 1QOSA 3TNPB 1G9DA 2FMDA 3CL1A 5LY2A 2WZ8A 4N9IA 1SBEA 1ENRA 2W87A 5FO9B 1AR81 4NR1A 3VBFB 2WO7A 1TVGA 5FLJA 4Y24A 3G6JB 1JHJA 1RUC1 1UMIA 1WWYA 3AFGA 4Q0SA 4Y20A 3U4XA 5FZKA 3FBMA 5FUPA 3MPBA 2JG9B 1LHUA 1TG7A 2ZAHA 5HCHA 4XFHA 2PA7A 3AYCA 1S2EA 1H1AA 4MH0E 5D2AA 4A3XA 1QDCA 4LHSA 1YFUA 4NAMA 4AFBA 3POFA 1QJY3 4MGKE 1NCQC 1RUF2 2BFUS 5FZ6A 1W9WA 3B5LB 3MW4A 4HPKB 4CDQB 1Q43A 1LEMA 4XIOA 5HBAA 1S55A 2YGMA 1IHMA 3SCHA 4IL7A 1HXS1 3OYWA 2OYZA 4CP0A 5KXCA 3E5QA 1RUF3 3FL7A 3ZIWA 1I5ZA 4ITCA 1GUIA 5FZBA 3HBKA 5EJZB 2R1BA 2E7TA 1FMD2 2JEMA 3B9IA 4R9AA 1UOBA 5CFCC 4UFKA 1QJX3 2BTVC 2JJ6A 4LO7A 1QXRA 2OQ6A 2BU9A 2R6QA 5L73A 3VN4A 1REEA 2WL1A 1YIFA 2YYOA 4J1WA 4LO4B 4Y1UA 2B42B 1Y43B 4CCMA 3AYEA 5J09A 5FPXA 3VKNA 2VVFA 2WZPP 3VV1A 4JRAA 4NO4A 1W9TA 4WM8C 4ASKA 4CPBD 4FCAA 3WX5A 5EFUA 1G9AA 2ZHNA 4JX0A 1JBCA 1W8TA 5KHGA 5F5QA 3UESA 4AI8A 4MZUA 1LCLA 2W2IA 4M3CA 4GH4B 2P6CA 5A7OA 1IPKA 1C1FA 1RUH1 2PHXA 3P3PA 1YI9A 3LA2A 4YM1A 4E4HA 4CU6A 1WCUA 4EZHA 1PO12 5FZ1A 3WCSA 4BLJA 3DYOA 5C33A 4P00B 4AEDA 4FBFA 1JZ3A 5F8PA 3ZFGC 1ND3B 2UU8A 2KM2A 1WLDA 4GD4A 3RVHA 4S2HA 4X6QB 4EV0A 4LKDA 1PO13 1RUC2 4I0BA 5KC6A 4FPEA 1F4AA 1JUIA 2CAVA 2O8QA 4E8CA 3I4IA 1DBNA 2VUAA 1QXJA 3FLPA 2UWAA 3BTAA 5A6YA 2K9ZA 5FQ0B 3ENRA 4NHXA 4Y20B 1AL23 4BIFA 4Q0QA 3LDKA 5FXWA 2RHPA 4IEXA 1C3HA 3ZM8A 1R092 4FOYA 3KVAA 3L2HA 3OJBA 5ERLA 1DF0A 5A6XA 2YXSA 3MUZ1 1O3SA 1OSGA 2JICA 2J7MA 1HXS2 4ISRA 1C4RA 1OURA 1MVQA 1LNSA 3WY6A 1XNCA 2NMOA 3W20A 5J7MA 4HZFA 3ETPA 4XW3A 4LJHA 5I0TA 4B8EA 3O14A 5FK7A 1GU3A 1AR83 2XB6C 4Q8KA 2AEYA 3E6BA 4KGGA 4DXRA 2V72A 5BYNA 1X36A 3M2MA 3VL8A 2VJXA 3N9OA 2IXHA 5FBZA 1S1AA 4M0HA 1MS9A 5CFCB 2EIEA 1XQNA 1JZ4A 3ZXDA 1AR62 2VG9A 4DUXA 1L7QA 1AHSA 2R7EB 3ZR6A 1MS5A 2GN7A 2WFF1 4QDRA 2J1EA 4ZPIA 3WNXA 3JBG2 2Y6HA 1N1TA 4ISQA 4YGCA 3DECA 4JHZA 3VKLA 1DU3D 1V6OA 1VLNA 5ABJA 1RB8G 1OBNA 1NY71 2QQMA 4BOWA 3EXUA 4C0BA 2WAOA 4WM8B 4GJYA 4AFCA 4DPNA 4COVA 5BNOB 4FPFA 2WJSA 4ZHNA 4PI2A 3FWEA 2ZA9A 2HBUA 3CKHA 1QU0A 4WVVA 5EIYB 1WMEA 3PMEA 3RFRA 2VZUA 5FKBA 3O1VA 1RITA 4K1ZA 5T55A 1UMHA 2ZKLA 4N90A 3PURA 2V4VA 4UYBA 4RQPA 2BWCA 2YHJA 1A78A 2Y38A 4IE7A 4YG6A 3F95A 4IV1B 1S0FA 4IXLA 5I0UA 4XUPA 3AMHA 3VZMA 4YVWA 1VMHA 2ZX2A 5LBEA 3NO8A 1GBGA 4Q1PA 1BHGA 4PHZA 3RDIA 5JCTA 1OC1A 3I59B 5LCWL 4BIOA 1SHWB 3N9LA 5C8CB 2VD7A 2ATFA 4UFLA 3GZEA 3D6EA 3M70A 2HWB2 4XJ8A 1ZRRA 2RS53 4HK8A 4Q26A 2HYXA 5C71A 1JZ7A 5JLVA 2ADEA 1DYOA 4XUOA 4IEYA 4KBZA 1YRZA 1O6UA 2A6VA 2XKOA 1KITA 1NCRB 3I3BA 4Q4X3 4Y5SA 1CAXB 5EYYA 5BNNB 4AEMA 2YU2A 2YBSA 2MHFA 3S7IA 2VNRA 2FBEA 3CJIA 4AAPA 3MF9A 5JMOA 4UAPA 2WWSA 3PTYA 2P4EA 4KWKA 5T5PA 3VD7A 2RJ2A 1GMMA 4HN0A 1REFA 1DQ4A 3Q8FA 3BALA 1S2BA 3ZFGB 1RL3A 1RUJ2 4PBOA 3H1YA 4LE4A 1W3XA 4OULA 5A80A 5KHKA 1KS4A 1W6OA 1JUHA 3GHNA 1W8HA 3KZ4C 1Y3TA 2D98A 3NNMA 3POGA 4XF4A 2BNNA 4J1XA 5EWSA 3CJXA 3VD5A 4B4RA 1M4WA 4JKLA 4AVVA 1R1A2 1WLTA 2WKKA 3I7DA 4Q0UA 3D0SA 4XFIA 4AL9A 1YFYA 3ZYGA 4FVVA 1H4HA 4E4ZA 3I3QA 3N7JA 4RN5A 2VUCA 4LITA 1JS9A 2XL9A 2Q8OA 1DZQA 5HCFA 2OA2A 2RS52 5JDBA 2EA7A 5L7OC 5KR7A 4CDQA 2J1AA 3ECQA 3URFA 3K46A 1S0GA 1UW8A 2WO3A 3K48A 3RNSA 5IHRA 2GC0A 3B01A 1AYM3 3OGSA 4Q27A 1GQHA 2E33A 4AEDB 2YC4A 1W8ZA 5BNOA 1MZ5A 2CTVA 2OX0A 1NOVA 2R1DA 5BNOC 1O8SA 3ITQA 1FI2A 2HBTA 4GALA 1GOFA 1QOOA 1AZDA 2W3JA 1YQ2A 3WZ1A 4N43C 2D6NA 4BXFA 2A7AA 3DN7A 1SPPB 1OPOA 3O0VA 1HW5A 4NRMA 3WR0A 2MPFA 5FPLA 4DUVA 2PMWB 4UT5A 2H6BA 3P1IA 4XCBA 1GV9A 1C1LA 1VAVA 4RHV3 4KWUA 4YW7A 1X9PA 2ZAAA 5FJHA 4EN8B 2BFUL 4IV1C 3HJRA 5J98B 3M4FA 2HWB1 1T2XA 4Q1RA 4ET7A 1GOHA 2WNEA 2WNOA 4Y1VA 3RZZA 2RR11 1D4M2 3KD4A 1PIV1 1W6MA 4MLOA 2DVAA 1YFWA 1N3PA 1RJ8A 3AZVA 3I2JA 3PUQA 4BQ4A 5FJKA 5FYBA 4D0QA 3MZHA 2AREA 5FP7A 2BBAA 4AZZA 2GH8A 2VOKA 3HPNA 4NIGA 5CAZA 5HXVA 4Q4V2 1WGPA 1CJDA 2VQ0A 3J4UH 3THDA 2ZGUA 3OGRA 1QDOA 4WZCA 3TN93 5JUVA 4OVEA 3SITA 3ZXEA 4JC1A 1QJU2 2DUQA 1MZ6A 3ZPYA 3OBZA 4FPJA 2J1RA 3AL5A 4EWDA 1PZ9A 1SLTA 1RUG1 4OQ8A 1BZWA 2MEV3 4RSUA 4GAZA 2XJRA 4CSWA 3UKVA 5BNPB 4Y4RA 3VDDB 5FZEA 1TEIA 3WD5A 2O0OA 1XYNA 1K42A 2BRTA 4O7XA 5A7WB 3ZXKA 2FDFA 2KA3A 2FHRA 3RYPA 1W6OB 1UOGA 2R0FA 3SH5A 4KBBA 3U78A 1LGBA 4A45A 1BCXA 2FQPA 2KR2A 3OSDA 4ZXKA 3FLRA 4QX5A 5IYYA 1OUSA 1ZNPA 2IXCA 3QACA 1PGL1 2JDKA 1LR5A 3IAPA 4KU8A 3BUCA 1D4M3 1QNWA 1QQP1 2OKXA 4LBLA 3WLUA 4AFMA 3WDYA 4QDSA 4LLOA 5JPNB 1H8TA 3T2OA 1WLCA 2VZ3A 3KWVA 1B35A 2AGSA 3NJVA 5E89A 4QPGB 2CAUA 5FY7A 1WCDJ 2WWUA 1AR63 3HN3A 1VBE1 2ZEYA 5FPZA 2QDRA 2JG8B 4HFSA 1YFXA 2P34A 5CNAA 2GNBA 4AFDA 4JGZA 3H8XA 3BI3A 4QQOA 3D8CA 2P17A 2R043 4Z2AA 5KHHA 1NE4A 1LHOA 1W8NA 5F32A 1MZFA 1BEV2 1AX0A 3MFCA 4ZONA 3AVRA 5FREA 5B2GB 3THPA 1GZWA 1W6PA 3WQ1A 3N4MA 4CU9A 4K8RB 1A8DA 2R073 2NPIA 1REDA 2BW8A 4MSVA 4DEQA 3V65A 1FYUA 2LW8A 1LRHA 1ZBA2 4MOAA 5M0TA 1AYM1 3H9AA 1HRV3 5HV4A 5A33B 4B1MA 2VUDA 4K20A 5FPVA 4GA9A 4O9GA 2OW4A 4QPWA 1YQ8A 2WT2A 3OY8A 1UCXA 3AC0A 3HQUA 3WOGA 4P9GA 3OGGA 5IVBA 4X8PA 2MNGA 1UY1A 1ZRFA 2XLAA 2ZGRA 4CEWB 2Y0OA 4RFT0 1QH7A 2C9KA 4QB2A 1UYXA 4QPIC 3VD4A 2RR12 3BTXA 1X8MA 4QKNA 2G9GA 5FR3A 1YI7A 5FPUA 3HR9A 4PQQA 2ET7A 1XYOA 5F3IA 4AI1A 1GNHA 5D21A 2DU1A 1V9U2 3U0ZA 5A70A 2TEPA 1H2MA 3HBZA 4TXWA 5JVVA 1S4CA 1GP4A 1BKZA 2ZHKA 3D5OA 1RINA 4CCEA 3AKTA 2ZGOA 1ULCA 3WUDA 2BVVA 1BLZA 5BNPA 4HKOA 2FD8A 3I49A 3OUHA 4I09A 3PVBB 2YV8A 4LMFA 3TYJA 5BNPC 1OH4A 1YXWA 3IN9A 5A7WA 1CD3G 1NXMA 5FXVA 1JHNA 2CL2A 1UAIA 3LEKA 5KXDA 3JUUA 3ES4A 1QQP2 4CDXB 3KHBA 1POQA 3NKGA 3S6PA 2FCUA 2QQLA 1O7FA 3AM2A 4JGYC 4P9YA 1APNA 3H42B 2A73B 5C9AB 3N35A 3NL1A 4OZOA 5CFCA 1LHNA 3GJAA 5JMCA 2W5FA 2RVAA 3J26N 2HWF2 2OQ7A 2FMYA 2VZPA 4R9DA 4QB6A 1YJLA 1MS3A 4HL0A 1VBB2 3TN91 5FZOA 1JOBA 5FWJA 2A6ZA 3OD0A 1FMD1 2VCCA 2VXJA 3LZZA 3A21A 3AZWA 5LW9A 2D40A 1AR71 3KS7A 2XJTA 1I9RA 1VBA3 1ULPA 2WZR1 2YFZA 2JD9A 5F6KA 2OPWA 4LK7A 4CCDA 2E51A 3FHIB 1OQDA 3LPGA 4Y22A 4AEKA 1VBE2 1VBC1 2ZS6B 2ZGLA 3BTZA 3VDAA 4F8AA 2VMCA 4ASMB 1IQAA 3MUY1 1C8M2 1Q8PA 2X5IB 4YZ1A 2EXKA 5C6CA 3O1MA 2SBAA 4HANA 4GH4C 2VULA 2ZZQA 4AGRA 2R30A 5EPAA 2NYYA 4GMP0 2QNKA 4LQRA 1UYZA 4B3NA 5IATA 1E5SA 1RUH3 2VQUA 4CCOA 4MXVA 1LOFC 5FP4A 5FYHA 4QM9A 4FPHA 1S0BA 4K6BA 2DVDA 5T5JA 5FY8A 3DXTA 3I59A 4UFJA 5LEKA 4LTAA 3TBDA 3H1WA 1TME2 1RUH2 1LB2A 1NLQA 2ZMLA 3MIHA 3MIFA 4LO5B 2W1WA 3VBRC 2Q1MA 4ZU7A 5FMOS 4FXKB 2VH9A 3RZLA 1LULA 1QJX2 4GH4A 3TRSB 1JYVA 4AHYA 3MV01 1KRIA 2W0XA 4EN9B 2RM22 3LE0A 3POBA 1VBC3 3NV4A 1SLLA 4LKSA 5BNNC 1DGRN 3P3NA 2QFEA 5I0RA 4QXCA 4AHZA 4NUBA 3T2TA 2EVXA 5LASA 3B69A 3RJ2X 4BQ2A 3WW1A 3BKZA 5A7NA 1OMIA 1XE7A 5FZ0A 1V9U1 2LS6A 5J1XA 3SMHA 1C8NA 3B93A 4G4FA 5FXXA 5FYSA 1Q8QA 3VDDA 1HIXA 4IERA 5F1RA 1COV2 2AACA 1PGSA 2GNTA 2A6WA 3IM0A 2VW2A 1JYIA 4QU1A 2GMMA 4ATFA 4W8JA 1LU1A 4H7MA 3O1UA 1LKNA 2XJQA 3UKTA 5BUVA 2WFPA 3TEZA 5C9AA 1NQDA 1VBB1 4JDMA 2XG3A 1I3HA 2YGLA 3IMMA 3IB3A 5F39A 3PIJA 4JQRA 2RDSA 4MVTA 4TYSA 1DDLA 1YQCA 1AR72 3KCXA 3UJOA 1K3IA 3MIBA 5C5TA 1DIWA 1HDKA 5FZOB 1OQ1A 2D93A 2GNMA 4FTSA 3BGAA 3AP7A 1O4TA 1GZWB 1A6CA 1K12A 2A1XA 2KD7A 3K51A 3N7LA 1XSRA 4OHXA 2JE8A 3LIGA 2PHTA 4B4QA 1H2KA 2VOXA 3DF0A 1LU2A 3UV9A 2WT1A 3ZFFB 2WBKA 1BEV3 5JAXA 3QD6A 4FFFA 3V0BB 3VZLA 3V0AB 4PLNA 1NZCA 1OLMA 5LRSA 1FNZA 1QY4A 3IDEA 3NV3A 2NN8A 2VMGA 1H6XA 1URXA 4YVSC 1VMJA 5F5AA 3VHNA 3VHOA 5CISA 3LOBA 3Q8CA 4FOVA 3ZLIA 2JIJA 4MG2A 3SH3A 4D69A 4DS0A 1SBDA 4HMZA 2BQPA 3AKQA 3K2OA 1OD3A 4N7IA 4NVPA 1CN1A 2C4XA 2R041 3OGVA 4JKMA 4TWTA 1CAVB 5LBBA 3PUHA 1C5HA 1DYPA 3IT8A 1CPMA 1NYWA 1DLCA 2J1TA 3LCPA 1PVC1 2F17A 1PO22 3VKOA 3AP6A 1UPSA 5K0UA 3PLQA 2PAEA 1ZBE3 1XRUA 3AFKA 1SLAA 3D82A 3O0XA 4MXWB 4CCKA 4LIVA 4LULA 1EUUA 3KHCA 1GANA 3AP4A 1DQ2A 1F31A 1QJX1 3LWCA 3T30A 3VZNA 4EWEA 1ZRDA 1QJFA 3ATGA 2V4AA 3VBSC 4DXTA 4CU7A 4XZPA 1N1YA 3DKWA 2PHUA 4AVAA 3ACGA 2D5HA 3AYAA 1LOFA 3AYDA 1A8MA 1CJPA 4AW7A 2XONA 1V6KA 3SNMA 5IK7A 4GULA 1QEXA 3HMYA 5FZFA 2P3YA 1DGWX 3W21A 2BBVA 3ZFFC 4XZUG 3WINE 5JXGA 3JZVA 5C4WB 1XE8A 2VECA 2A3XA 2W1UA 3WV6A 1HRV2 4KG8A 3I8TA 1HRI1 2Z69A 3BPZA 4C0HA 2Q0AA 4KWLA 4MGZE 5FIXA 4ZZ5A 2JX9A 3K4DA 5T52A 2IFWA 3KSCA 1SFNA 4YW3A 1EAH2 3SC7X 4AF9A 3NV1A 4LBQB 4QPGA 2WNVB 2IFRA 4P9IA 4MADA 3MBWA 3VBSB 3RZHA 3WG4A 3ZSEA 1EUTA 3KT4A 1W8FA 2UWBA 5FY4A 3VD3A 5FO7B 3R4SA 5F2SA 5GLTA 4GB31 2N7GA 3WF4A 3H7JA 3GYDA 1VBE3 1UN1A 4WM7B 3ZYPA 3ON7A 3B3QE 5FYIA 1RUD1 2V5YA 4CP1A 1POV1 2HYKA 2R49A 3FJSA 2KXLA 2XBO3 4L8QA 3VKFC 5C3SA 3LA7A 5HI0A 1W06A 4MHUA 1AR92 3AL6A 1ENSA 1OA2A 1SLBA 1SZBA 2LALA 3AKSA 4LO6B 4XCAA 3DYPA 3MI8A 4YFWA 5IFPA 3S5AA 2JDMA 4XILA 4HONA 2BNMA 1DG6A 4NAOA 5A33A 4OI1A 1GNZA 2QCSB 2FCTA 2JDNA 2RMU2 4PDWA 2XBO2 4UOJA 5FYUA 3T4HB 3POJA 1G9BA 2PLV1 2VBBA 4NPRA 2ZGKA 4XF1A 2C26A 1XYPA 2RDNA 1XNKA 4XTMA 4A7ZA 2JB8A 3QBQA 4Y22B 4QHBA 4Q4V3 2DFCA 3NNJA 1R1A3 1SDDB 3QLQA 1D2SA 2RE9A 4SBVA 4XACA 3ELNA 1NG0A 5FYYA 1RUG3 4NWVA 1QWRA 1QJU3 4BDVB 4YWAA 1H2LA 1R083 4YVSB 3PUSA 2HWC3 3WG1A 3ZYRA 3HQRA 4M00A 2ENRA 4CXWA 1RUE1 2AUYA 1GR3A 1S0JA 1E57A 5CFDC 4B29A 3Q9OA 5I0DA 5BNQA 2ES3A 5IVEA 2WS93 1H8TB 1AR93 5C7GA 1AR82 2X05A 1VAMA 1LOBA 2Z42A 1GQGA 4CDXA 2ZX3A 4QWNA 4XAEA 2VMFA 4JZRA 1YCIA 1FATA 2RMU3 3PL0A 3RZMA 3KCYA 1W6QA 5JIUA 4XTPA 1ENXA 3T0BA 1KXGA 4XXPA 2VTXJ 4Y3OA 1ND3C 4QXHA 1HB4A 1TNFA 2XVKA 4H2AA 4E9KA 1I5PA 4Z1VA 1W8WA 1PZ7A 3VHPA 4FFIA 1T6GC 3NSTA 2WNVA 4XJWA 5IAXA 4F83A 2ZZJA 3V0AA 1VP6A 3HN1A 1RUC3 3VBUA 5C3PA 2DU0A 2WSUA 2HWC1 5IT6A 3QOPA 2R16A 4ARYA 1IKQA 1CAUB 2B4KA 4PLOA 5FOJB 5FMOL 1ZM1A 1EV11 2ARAA 1GZCA 2ZACA 4MGYE 1IS5A 4YW1A 1RUJ1 3AMMA 2WFF2 2CWSA 3N7KA 3RGBA 3UT0A 2PXJA 4AVCA 2RS12 3OY8B 4FQ4A 1MEC3 1BYHA 1QMJA 2X5IC 3DPRA 4IV3C 1DQ6A 4IEVA 2ZEXA 4CEWA 1FT9A 4QU2A 5LBFA 3ABZA 3U1XA 2NQYA 2RS31 3SH4A 1EPWA 3KV4A 4Q0VA 5G05L 2PHLA 2X10A 1U0AA 1PMJX 2QQOA 3H3UA 1UXXX 4LXLA 4PDWB 4RS5A 4YLZA 5IUQA 2ORXA 2PELA 2ZHLA 4MXWA 4DRVA 5J96B 4YVWC 4DIQA 4NHLA 2D3SA 2ZGNA 2JDZA 2VOTA 3ZKUA 2XBO1 4AHXA 1C5IA 2DCZA 1KGYA 1J3QA 1VIWB 2P6HA 2PLV2 3MGUA 1WCSA 5L9VA 2JDUA 1XB9A 1ZBE2 5CU1A 4UW5A 1S0DA 4PQ9A 4XMIA 2A71A 2WLQA 3FBYA 4N53B 5CKMA 4JQTA 1LJ7A 1PX4A 2GC2A 3LF7A 2JDHA 5FY1A 4B4PA 4CCLA 4FTBA 5C3OA 1GNYA 2PLV3 2OUHA 2IXIA 2LUWA 2B45X 1JZ6A 3E97A 5GLWA 2YU1A 4UBGA 1UY2A 1PVC3 3GCXA 4IDZA 4BK5A 4BISA 1SQ4A 3NJXA 4QKBA 3ZMNA 3BB6A 3HQXA 4ONUA 2WA3A 4P08A 1WA6X 1K45A 4XQDA 1D4M1 1QQP3 4XAAA 4A7KA 1LAJA 3P6BA 3GZAA 1W2OA 2Y60A 1AYN1 1FPN2 2VGDA 2Y6GA 3U10A 3N9MA 5FKCA 4CDUA 3TAYA 1OI6A 1W2TA 2Q4SA 1Y9QA 2RDRA 4HN1A 3H1MA 1WW7A 2XHKA 1UU6A 2VMHA 3J7HA 4DOUA 5EZWA 2WS91 2WYFA 2X5IA 3T2PA 2C24A 5D1IA 3BOWA 4OYUA 2RS11 5AVAA 2HWB3 2VAUA 3HVDA 4QX0A 4FXGB 4QPYA 4JV4A 3F2ZA 2HWE1 3WEZA 4JTNA 1F8VA 1GYKA 1ZZ7A 3VB9A 1K5MC 4BXSV 1ULOA 3BIWE 4GZ9A 4BE3A 5BV6A 5FYMA 4CXYA 3W59A 4UFIA 1D0HA 3WNNA 4QDQA 3LB9A 3T09A 1CIYA 2JB4A 3DPRB 1UYPA 2Q5TA 4MGIE 2CSGA 2JKXA 4A41A 2ZGMA 1UY4A 5A3TA 3JD72 4NIHA 1GWKA 1BMV2 2VW1A 4XUQA 4CZSA 5A3LA 3TEWA 1F35A 5DABA 4FSJA 2VUJA 3VBSA 5DZEA 4N8MA 2P1BA 1YQ5A 2ZGTA 4YZ5A 3DEMA 1LECA 1RUJ3 1SG3A 4INDA 4P5YA 1C8M1 1XNTA 1HJFA 2QBXA 4PLMA 3V56A 4ES8A 2WYSA 3LA3A 2OIIA 4YVWB 5K0UC 3OEBA 3WP6A 4Z07A 1CZTA 4FQZA 2GU9A 3C8XA 4CEYC 4XFGA 3ZFEA 1K5MB 3I3EA 5LB6A 1OLQA 2XLFA 1XBFA 1W28A 3LEGA 3W9AA 4CPBA 4ZKTB 1LGNA 4EN6B 1UOJA 2Y6FA 3AX4A 3AZZA 2HKXA 3MLJA 4IV3B 2QQPA 3LAGA 4CYDA 2BNOA 2P3IA 3K75B 2D97A 4UI9L 3WCRA 3FX3A 2W08A 2YDEA 5JOYA 1DQ0A 4JDNA 4BYYA 1X7NA 2WNUB 4WVWA 2G9FA 2GC3A 5L9RA 2XUEA 4CDQC 1W6QB 4Q4V1 2RS33 3SISA 4WVMB 4AXOA 3GXUA 3Q8AA 3JB8A 1AYM2 4BJ0A 2GN3A 2UWCA 2XXZA 1PO11 1HLCA 2O14A 3CIHA 2YPDA 5FK8A 3HNMA 2J22A 1C8M3 5CG9A 2A75A 2G19A 5FZHA 3POIA 4QQPA 3NWKA 1CX4A 1PK6A 1W9SA 2ORZA 4BK4A 1WBFA 2WS92 2CDPA 3GJBA 2EF6A 3BVCA 4JCKA 5GZGA 2J42A 5DN2A 4HVQA 3VBOB 1NLRA 4UW4A 3CU7A 1J58A 1DQ5A 3HT1A 3OCPA 1TMF1 5FLIA 5FPAA 3ZXLA 3O1OA 3FN9A 2R071 3AJYA 4WZFA 2QQVA 1UOFA 1W04A 2Z2SB 4FPCA 3SKVA 4Y1XA 3GM8A 3USUA 3RWNA 3WW4A 4M3CE 4XFCA 2EXJA 3ZDSA 4AHWA 2GC1A 1ZREA 4P9XA 5GZDA 1CESA 4HETA 5A32A 1WCQA 5FV3A 2DVBA 4WM7A 2P2KA 4WV8A 1O4ZA 4D7YA 1NZIA 5FYZA 2YUEA 1RMU2 1MEC2 1CAVA 2X29A 4LT5A 2JE9A 2PQSA 2DCJA 1WZXA 3ALQA 3N9NA 4HT1T 4QAWA 5ANNA 2AENA 4W6YA 5GKAC 2H0VA 3ZYIB 4BQXA 4NIDA 1UXZA 4X8NA 3KT1A 4JDOA 2R062 1ND2B 3SCGA 4AG4A 1NXD1 1OFSA 1EV13 1S2KA 2UYBA 2VZTA 1GSLA 5JSOA 1X9TA 5DAVA 4N53A 1DLLA 1NUKA 2WIIB 3NVCA 5I8YA 5I93A 4XFAA 1JI6A 1NA1C 2OZ6A 3ZFFA 3FUQA 1VE0A 5GZFA 3KM5A 2VC9A 3PNAA 4YRDA 4PBPA 2Q8CA 2BOIA 2JDYA 4FPGA 1HB3A 2DUPA 1U12A 1MR5A 2IXLA 3C7OA 3OOXA 3OUIA 4Q4Y1 1CIWA 2ZBJA 4W4ZA 5IFTA 1XE0A 3ORJA 3PMSA 1WW5A 5DUXA 4ATEA 3RZKA 1H2NA 3ZN4A 5H9SA 1T6BX 3NMBA 5DAWA 4META 1QJEA 1UU5A 2QQIA 3RSJA 5C4WA 4F3JA 3J9SA 2ZX1A 3VBHB 5L19A 3VD9A 5I8SA 5E16A 1US2A 1XJAA 2XKPA 4M4RA 2CY6A 2W46A 1AL21 3CZJA 4L2NA 4BHPA 3ZSLA 2PYTA 4KH9A 4WVZA 1JZ2A 4D7SA 4LBQD 4AVTA 1CWPA 4YZ2A 1W3VA 5BPXA 2Q30A 3INAA 1MS8A 4A6SA 5K0UB 5A1AA 1FPN3 3M3IA 4HVRA 4C91A 4HOOA 4YYOA 4E2QA 1XXNA 4CEYB 1IOAA 1W05A 2R072 1KDMA 2XMLA 3PU8A 1KFUL 1UZWA 2GALA 5CB7A 1RUI2 1LOAA 4Z82A 3SEEA 3Q8BA 1NLSA 2I45A 4B1LA 1EPZA 1GICA 4XFFA 3AP9A 3MLLA 1XU2A 1HV0A 2NM1A 1N1SA 1OHFA 3K3NA 3U75A 2WNUC 3POSA 3KQ4B 3CBNA 3H7YA 3C7EA 1SMVA 5J36A 4KWJA 4FFHA 3QCWA 4EE2A 2ARBA 2RJKA 3I2HA 5FYTA 4QQHA 3KMHA 4JKKA 2JG8A 1JN2P 3H3LA 3H8OA 2ZOEB 4XDOA 4LK6A 2NZ9A 4LHKA 1AJOA 3PU3A 4D7TA 5K7PA 5A6QA 1RMU1 4LBQA 4BH9A 1MEC1 3AXEA 3WNMA 5I8TA 1ND2A 1CVNA 1UIKA 4P5HA 3I2OA 2I74A 3ZFEB 4Y4YA 1CQ9A 2GMEA 1ZRIA 2F6BA 3MYXA 3D3AA 1IGOA 3U37A 1RUD2 5LRRA 3R4DB 4URTA 4O61A 4YGDA 1AXKA 1Q8VA 4Q4Y2 1Q5OA 5F5IA 1L7RA 4BMEA 2YBKA 2OS2A 3N9QA 1RUNA 1JTZX 4RYDA 5JZGB 4OHYA 1NA1B 4NHYA 4AGVA 1LTEA 1WD4A 4CTEA 1DP0A 5GLZA 3ZYHA 5FBJA 1GWMA 1YC61 4RR3C 2VQAA 4I0WB 1OH3A 5AC93 5KBFA 5KHJA 2QQUA 1R082 4IE6A 1JXNA 4M0NA 1X50A 4AYUA 2E63A 1RVF2 5EV7A 2JXAA 4KQ7A 3LOIA 1XSQA 5BNNA 3W5NA 1O3RA 2BPA2 3VBFC 4MYEA 5KXBA 2UY8A 3K4AA 4ZY9A 4GQ7A 3T3YA 3ZFEC 1HV1A 1MZEA 2ZPXA 3B94A 3LGRA 3WNLA 5JWPA 1RUE3 2A5ZA 4RD7A 4YFZA 1W6NB 3VHRA 2V73A 2WUHA 1HKDA 2VTXA 5H9RA 3BPSA 2VNGA 1YEWA 2P3JA 3FHQA 5EXOA 2HEVF 1IKPA 5JIAA 5EJ3A 1K5MA 2X8KA 4XPVA 2Q1ZB 4IEUA 2O1QA 4E8DA 1G6NA 5JOZA 1HN1A 3OGJA 1CAUA 2VNOA 5DZFA 1TNRA 4YW4A 4QHZA 2XLGA 4Q4X1 5A7PA 2YBPA 1EP0A 5FZMA 4Q4Y3 2VXRA 2W94A 3VBOC 4FPKA 2CGPA 1W8OA 5IK8A 2GNDA 3GBFA 3ZN6B 1FOD2 1SFPA 4HKLA 4QXBA 1JYWA 4TLGA 4LHLA 4Q4W3 5EHDA 5JXJA 4NHMA 4NE9A 1CPNA 3WVJA 2XJVA 3S7EA 1LODA 5F7UA 2B8MA 5JZGC 4DUWA 1ODMA 4NMIA 1IPSA 4OFGA 2RS13 3OEAA 2VW0A 4IESA 3GZUC 2G4IA 1TE1B 3A0NA 1L7LA 3ZYFA 1KDKA 1WLWA 3CNAA 4M4PA 5H9PA 3H3ZA 2Y8KA 3L9JT 1VBD3 1UKGA 3VBOA 1GP6A 2HWC2 2R32A 1WA4A 1HRI2 4Q0PA 4XETA 1NCQB 3KB5A 2FDKA 3ME2A 2MEV2 2HH9A 4BQWA 4DMIA 3RZJA 2W95A 2Z5WA 4Q29A 1SPPA 2IUWA 2ZMNA 1D0GA 3ZSJA 4Z8BA 4PDWC 4HKWA 3OBAA 4ASLA 2EXHA 1ASJ1 1AR61 3WF1A 2Z79A 4R8HA 1RHI1 3APBA 1OLME 4Q4W1 1H0BA 1W0OA 2ZXQA 4XUTA 4GB32 4FAGA 4AFAA 3OD4A 4XOGA 5FAXA 2RDQA 5F37A 1YNAA 2JECA 5JXHA 3DCQA 4A42A 2RR13 1O3QA 3L2YA 1AR73 2B39A 4DRRA 1RYYA 4OMCA 5EP9A 2R0HA 5F5CA 1QJZA 4L11A 3VZJA 3NV2A 3E5XA 3AMQA 3PUIA 3HNYM 2Z4FA 2B7YA 2WNUA 3FZ3A 5DAQA 4E4SA 2D6PA 4AAXA 4AEDC 1CAWA 1HB2A 5JOWA 3I3MA 3I2DA 4NWWA 1KJRA 1FV2A 3LEIA 2VU9A 2CHHA 1NY72 3D0JA 1HXS3 4FP3A 4DEVA 2IXKA 5IVCA 3WDWA 5CKQA 4LBMA 4CCJA 1ZBA1 2WSVA 1V6IA 5JI7A 5CA6A 3KV6A 5T54A 3I3DA 4NIIA 2VZRA 4RS5C 2EAKA 3VDBA 1IPJA 4URAA 1AYN3 4NPLA 4XE9A 4CDUC 2DVFA 3FFQA 3T0AA 3BCWA 2DYCA 1N3QA 4E2GA 3UKNA 5FP3A 1KQRA 5C8CA 4XABA 1OUXA 4Q4X2 2VL4A 5FZGA 1SEFA 2P3KA 2JG8C 3ZPOA 4LBJA 2J1SA 5CBLA 4Z2WA 2Y6JA 4KGQA 4XQ4A 1H1IA 4W6XA 4R9BA 2TNFA 4TLFA 3ST7A 3WT3A 3H0OA 2VM9A 4LBOA 2XJPA 4IUGA 2WQ8A 2XWBB 3B00A 4L92A 4ARXA 5C3QA 3RWKX 4EROA 5LK7B 5H9QA 2XWJB 1DQ1A 1EY2A 1V9U3 3K3OA 2XDVA 1NQJA 4LPLA 5JR2A 4PIYA 2DF7A 1TZOA 3GALA 5CFDA 5HPOA 2AYHA 5FMCA 1UZVA 1BVP1 4WBBA 3G7DA 2HJIA 3B9CA 3BU7A 4A3ZA 3NJZA 3PVNA 1AVBA 4FPOB 4D94A 1Z7S3 4YM2A 2XJUA 4CDXC 1FMD3 2C0ZA 4YGEA 1RUI3 1OVPA 1VMFA 1G9CA 4BQ5A 2YC2A 1FX5A 1VBD1 4YW2A 4PCRA 4WVMA 3RQ0A 2AR6A 1NCRC 4V2VA 2HWF3 3HWJA 1IS3A 1OKQA 1FNYA 3ZIXA 3CZUA 3NKTA 1A3KA 4GJZA 4OZXA 4MO3M 4W6WA 1UZ0A 5IJRA 2FDIA 2DUOA 3JU9A 1VBC2 3VBHC 5GM0A 5FCCA 1UZYA 4JAAA 1UY0A 2BEOA 2RS32 2X09A 1OKOA 3AMNA 1H30A 4ZU4A 3U14A 4B7KA 3E5UA 4H14A 4AQTA 1PVXA 1Q56A 4ZS2A 2PHWA 4FAHA 1YJKA 4LORA 4MUVA 5D8AB 4COYA 2YMZA 5CADA 3LSDA 4QGMA 3USUB 1ASJ3 4MGQA 2VY0A 2FDHA 5DZGA 2WT0A 3NAPB 1PO21 1Z7S2 2ZGQA 1US3A 3LKJA 4EN7B 5A32B 3GDBA 1MVEA 5FPBA 1CGPA 4ZXEA 2VCMA 3J8F2 5DAPA 5A6ZA 2W52A 2UURA 4UWDA 3QH6A 3RRDA 3WP4A 4AVBA 4D6SA 2VBDA 5A1FA 5JI9A 3T2QA 3ACLA 2V09A 4LNVA 3M3OA 3ZOIA 3AB0A 1UO9A 1W6NA 2QKDA 3J8F3 4GWNA 4ZZ8A 1ULDA 2E26A 2FZ2A 5KXEA 3WF0A 2BP6A 3CHXA 4LA3A 1JYNA 2OXBA 2UYAA 1KS5A 1UZZA 2D44A 3ZO0B 2WINB 4OMDA 4N43B 2F4LA 4RGKA 3NNGA 1DFQA 3LQCA 2BVBA 4CP2A 1HQLA 4Y5TA 1COV3 1KFXL 1QKQA 3NAPC 2FDGA 1ULGA 4I2OA 2WQZC 4K3UA 5DUUA 4XXAA 4F7ZA 2XUMA 4OI4A 4EWAA 4OUSA 4RQPB 1GOGA 2VZVA 3JQXA 4H55A 4RGGA 1VBD2 5ACA2 4JHTA 5F9TA 2CYFA 1HRI3 4IE0A 1AJKA 1MPXA 4IV1A 4QX1A 3ZMOA 3EMRA 4DFSA 2W1QA 2CNAA 3O1PA 4LKFA 1RUF1 5A7SA 2B5HA 2FCVA 2P37A 4YNIA 3MHZA 3VBFA 1MQTC 3OBTA 5FOBB 2ID4A 4QXKA 4NHKA 3THCA 3C7FA 2WA4A 3ZXJA 1MS1A 2AH2A 2VVDA 2OVUA 2PN5A 4OI2A 4BMBA 1OLRA 3R4UA 5AC91 3VL9A 3ZYBA 3U11A 1AX1A 1W0PA 3JXSA 3NNLA 2BOJA 1CAXA 1AL0G 2YY1A 4QPIB 5IWFA 4N9HA 5BXXA 3ZX7A 4YVSA 2WZEA 3LIHA 5FZ9A 4EJRA 5DDJ2 4YW6A 4AGGA 5FY9A 4K21A 2YG0A 2WFF3 1OOPA 4R4ZA 3ZYJB 3WP3A 3BIEA 5FZCA 3IAQA 4I30A 4E27A 2JE7A 1NAEA 3AZXA 3OYWB 1RJ7A 1ZX5A 4P14A 4QX7A 4GWIA 2R042 1MS0A 3IBMA 4PT6A 1TQ5A 1Y9MA 1PGW1 1BBT1 1WMDA 1G9FA 4LHNA 5FY5A 3PTRB 5G04L 5FZLA 1NT0A 1L3JA 2ZEZA 5B4XA 1YLLA 1PHMA 4QMAA 4P9WA 2OZJA 1VB4A 2PTMA 1AYN2 4I3GA 3CO2A 1JMUB 3DUIA 3JB4C 2AC1A 4Y5Z0 4DQAA 3KT7A 4P9LA 5GZCA 5C70A 3JCIA 3CJIC 5C9AC 4CP9A 4YM3A 3AMPA 1SDWA 5FYCA 1H1MA 4QT6A 1DYKA 2BWAA 4JGZC 3VBUB 3VZOA 3POWA 4L97A 2GH2A 2XOMA 5A3OA 1E5IA 3LD8A 3NQHA 4OHWA 3TOJA 3JD73 4ES9A 5F2WA 3ROUA 4IW3A 4AOCA 2VE1A 3RPQA 2WO2A 4EZ4A 3V0BA 3HT2A 4Q8LA 3MLKA 2HWE2 4DNYA 4K40A 4M3CF 2Y0IA 2VR4A 2G9ZA 3N9PA 1F9KA 4IGQA 4DO0A 1LEDA 1SLCA 4AWDA 3IKWA 1R091 1BMV1 1VRH3 1YIPA 3HAGA 4CEWC 1JODA 3BYWA 4OCTA 1IS6A 4P02B 4K1YA 4PIZA 5IW0A 1Y7BA 4C1XA 3S57A 4H3WA 4YZ3A 1G86A 3KV5A 1EAH1 1WD3A 2DBIA 4XJUA 1G7YA 3SLIA 2ZCWA 3UETA 4BQYA 1V6MA 5SV8A 1V6JA 4IGOA 2WAAA 2PHRA 1W6MB 1RXGA 2QQJA 2C6SA 3OBRA 3M8LA 4LBKA 1C28A 3NW4A 4HSJA 1GWLA 1VAKA 2ZX0A 3VLBB 4AQ6A 5I91A 1Z0HA 5FZDA 2CV6A 3AP5A 1KD7A 1RVF3 4GWMA 4OQ9A 1O8PA 3PDQA 2EIGA 2WABA 2D3RA 4YW5A 5B4NA 5L7OB 5J37A 1UF2C 4QKFA 2PAMA 2AZ5A 5DG2A 3WQBA 2NMNA 4BLIA 2DTYA 4RQPC 3WF3A 5HCAA 1O59A 4CU8A 1OA3A 4FP2A 1I1EA 3SHRA 1NA1A 1W8UA 4ZS3A 4A2UA 4FT8A 3M1HA 2VMIA 5FTTC 3ZN6A 4Q5OA 2VTFA 1QGLA 4XBQA 2HWE3 3OPZA 2WWJA 1UWWA 3O1RA 4IEZA 1F5JA 1ZA7A 3ILRA 3IPVB 1VJ2A 4CRQA 2ZKNA 1MQTB 5FP9A 2Y6KA 3WDVA 1UIJA 1PM4A 3MICA 1MACA 3FFZA 3A7QA 2EAAA 2DCKA 2WRAA 3LPFA 5DUWA 3OB8A 2XGXA 2I2SA 3WNOA 4QPGC 3LSEA 5EJ1B 3OPWA 2BDRA 1V6NA 4TZDA 4N43A 2GP5A 2JKBA 4R52A 3ES1A 2A3WA 5TSWA 1J84A 5J3UA 2RM21 4CA9A 3FC0A 3B02A 5D8AA 2DCTA 1DZTA 1GZ9A 2ZGSA 2VMDA 4AR2A 4CP9B 1AL22 4HK9A 1PIV2 1ONAA 1UL9A 2BUKA 2ZABA 2WC2A 4GKYA 2O8OA 5F3GA 5ABJB 1W2AX 2PHFA 4LKEA 3FUOA 2W92A 3NJYA 4OLLA 5T5LA 3ZXAC 4CUAA 4WM8A 3M7AA 2DBNA 3MEPA 4MV2A 2IVIB 4YG3A 5EQUA 3OF1A 1VBA2 4A4AA 5T3NA 3T4VA 3BODA 2WNVC 3NNFA 5FDBA 1VB2A 3CMGA 4COZA 2A3YA 1W0NA 5CFDB 1HB1A 3T1LA 4UW6A 5EYXA 2NP0A 4NN0A 5GLVA 1DGRA 1NE6A 1W6PB 5FXZA 4JTOA 4XHBA 2Y6LA 1V70A 1J3PA 3SXWA 3WDXA 1RC6A 4AI0A 4XJZA 1WMXA 3RYRA 4BZ4A 1BXHA 2X53S 1H4GA 3J7NA 5LEJA 4YPJA 1ZZBA 5FZ4A 3OPTA 1COV1 2B46X 1Q8OA 2EICA 4UF0B 3RJRA 4UFMA 1JU4A 4BM8A 3AVSA 2MEV1 2DTWA 2OT7A 5FRAA 3TEXA 1ZYBA 1I6XA 1SCRA 1POV3 2LROA 5A7QA 3JBG3 1QF3A 3IIAA 4CDWB 1GP5A 4BWOA 1NCQA 1AXZA 1WUVA 3Q8EA 4D6RA 4DXZA 1IQDC 1SACA 1CX1A 2D6MA 4CUBA 4XHXA 5E88A 1ZZ6A 3UL2A 1NCRA 3JD71 2JIGA 2E7QA 1XU1A 3PUAA 4Q4W2 1CONA 1R1A1 5L9BA 5JPMB 3O5SA 3UNPA 2DV9A 3CJIB 4IV3A 2BJSA 3AK0A 3MPPG 1KJLA 4GMP3 5DDJ3 5BY5A 2C9AA 4NPMA 1VPHA 4LR4A 3KLSA 4B7EA 3I2IA 5KC5A 3CEWA 2D3PA 4LOSA 1SLIA 2W91A 4MX3A 3WQ0A 2WN2A 4DB5A 4XYXA 5FZAA 4QGLA 1H8VA 1VRH1 1UQXA 3DL3A 3HEIA 3X29B 3O7OA 1LOEA 2W47A 4IEOA 5ANQA 2QQNA 5HCBA 3S5QA 4AQSA 5K9YA 2E7AA 4HVOA 1ND2C 4QD2A 2LM3A 1MQTA 2BYVE 5FMDA 4NOTA 2QE3A 3WP5A 4IEWA 2R063 1QHDA 4V1PA 1OF3A 1WBLA 3ZR5A 3AZYA 4FPLA 2AEZA 1CAWB 1F4HA 4Y26A 1H8TC 2VMEA 3WF2A 3W5MA 1LGCA 5CEHA 4DXSA 4YSFA 4JGYB 1OXCA 1LESA 4J6GA 4AK3A 1E5RA 1VBA1 1OOPB 4A7YA 3FHAA 1Y9GA 2CU5A 2VCAA 4RR3A 2BGCA 3IZOA 5DMYA 3I2FA 2JWPA 4MHRA 3P5BA 1STMA 1PMIA 1V00A 4O9EA 4OUEA 5ABJC 3KGLA 5LA0A 5AFEA 3T0DA 5CZKA 1J59A 1OPMA 1J83A 1X8EA 2ZEWA 3SCFA 3ZSMA 3VKMA 2ZHMA 3DYMA 3I97A 2WLPA 5DG1A 5A3MA 5FLHA 3MIGA 2D43A 5FY0A 4EQVA 2K2SA 4V2WA 3W58A 2LRPA 2DDUA 1QXPA 2Y34A 1W2UA 1U5XA 4YZ4A 1DHKB 2ZTNA 3C2UA 1RUD3 1JU3A 5KHIA 1TMF2 1FPN1 1BJQA 4S2FA 5IVVA 3BU0A 1LHVA 4LOTA 3V64A 4KI5M 5FMBA 5DUVA 3WUCA 4D3WA 1H6YA 1XPWA 2L9LA 5LBCA 1O5UA 4UFHA 4XF9A 3IMNA 1TMF3 5LY1A 2A70A 2UY9A 2DCYA 1C57A 5I0SA 1DGWA 4LBNA 1RXFA 4BQ1A 3QH7A 4X6RB 2D5FA 3N36A 3C7HA 1PK6C 1ENQA 2HWF1 1GQPA 1XNDA 2C5DA 2EIBA 3ACHA 4BQ3A 4XDPA 1OVSA 4IEPA 3IIIA 1UY3A 5K4LA 5F3EA 3VBRB 3EHKA 3J7MA 3NAPA 4OHZA 4XEZA 2ZMKA 1B35C 3I54A 2HWD2 1EAH3 5LA9A 4G9SB 4A6OA 3SKJE 3NRUA 2HLEA 5F3CA 3RMYA 3RI9A 3DV8A 5FUNA 3U4SA 4HSLA 1R081 3GCWA 4LUKA 3WDTA 3JBG1 4CUCA 1ASJ2 1BK0A 1F2NA 4LLFA 4N53C 4D6QA 5J48A 3RMXA 1RVF1 5F6LB 3ILFA 3BN6A 4UXAA 2GSYA 1UMZA 3TNQA 1U5YA 4XFBA 4S2DA 4DINB 5IAVA 5E6HA 1VRH2 2QDNA 4XF3A 1GZTA 4AI9A 3A23A 1S0CA 1AR91 2GAUA 3HOBA 5LZ6A 5CVRA 1R1ZA 4GMP1 1LENA 4XJ9A 2QVSB 4CEYA 1CZVA 3OUJA 1TME3 1QIQA 2RJLA 1BEV1 1SFYA 2EXIA 3E6DA 4BA6A 5A3WA 2F4PA 2PQQA 4DY3A 2K46A 2RMU1 1YQ6A 3ZDVA 2D7FA 5C4WC 5IK4A 3N3HA 3R0RA 1FV3A 1SBFA 1B35B 2H6CA 1VALA 1W90A 3FMGA 3HD8B 4H7LA 4A44A 3B7MA 1WW6A 5DXDA 4TTGA 1P8JA 3PJYA 5FZ3A 3DXUA 2YPJA 2D6LX 4L0PA 4RR3B 1Z78A 3WW2A 2A6YA 3J8F1 4UW3A 4CCCA 2H0BA 1UU4A 3N7MA 4HLTA 4JGZB 3RG0A 3VBUC 1CZSA 4NRQA 1D2QA 4J25A 5A3NA 3IDBB 2VNVA 2VO5A 4DY5A 3FE5A 4EN0A 3ZN5A 2XQXA 4L9BA 2WN3A 3LDRA 3KF3A 1AX2A 4HBNA 4BPZA 5JOXA 2RM23 3PVEA 4C1WA 2YROA 1RUI1 3VDCA 3PVOA 4I0AA 1SCSA 3ACIA 3E1F1 2QUOA 5DQ0A 4U2AA 3I2GA 5APAA 3E6CC 5ACA3 1ODNA 2CGNA 4M01A 3WXPA 3LFIA 2VZOA 3UGFA 2PFWA 5KWRA 2ZX4A 1W9FA 1N3OA 4FPYA 5FWEA 5JXIA 4P9JA 2K0GA 5ISLA 2J1VA 1W99A 4QPIA 4Y1ZA 5GLUA 2XL7A 4RHV2 2QJVA 1WKYA 4SLIA 4BB3A 1HQNA 3GBGA 1PM7A 4XJAA
chains in the Genus database with same CATH topology
3ZVXA 5JSRA 1YHFA 2HWD1 1H9PA 1AF9A 3TB0A 3MW3A 2TBVA 1IS4A 1AXYA 1ULFA 3MW2A 5L36A 1O4YA 3MIEA 5CG8A 1N1VA 1DGLA 1U5ZA 3RI8A 1YO8A 1S0IA 1LOGA 3MFAA 1J1TA 1CR7A 4KNCA 2IXJA 4DZGA 1ND3A 3GNEA 2VVEA 4XBLA 1QJY1 2B9UA 2RS51 4FOWA 1FXZA 4ORFA 1DZRA 2GMPA 3OTFA 2D6KA 4XBNA 1RUOA 3WG2A 5FFOC 1WMFA 4XIKA 3EJKA 3RYKA 3PJQA 3USSA 4RL7A 5C8WA 2JD4A 2D6OX 3WG3A 4QQLA 4E2SA 2PAKA 2VOVA 5DDJ1 1PK6B 2OPKA 2YC0A 1O3TA 1BBT3 1ULEA 1F5FA 3O12A 2PHDA 1HQWA 3MIDA 2HEYF 1O91A 2EALA 4JVAA 3EO6A 4BCUA 1RTVA 2DWRA 4PJYA 4GKXA 4AEJA 1UX6A 3R05A 2E53A 4GB33 3CF6E 4G3YC 3EBRA 1N47A 3ILNA 4IEQA 1PVC2 1LOCA 3VDDC 2XH6A 1TME1 5JR7B 3ZSKA 5AVPA 1Q8SA 4FTEA 1G8WA 3S30A 1OA4A 3BOPA 3POYA 1UKRA 2ILMA 4AI2A 1X82A 3AJZA 3WDUA 1QOTA 4PF5A 4COWA 4WM7C 5T50A 4W65A 4JGYA 4L99A 1D4VB 1QJU1 1YYNA 1UPIA 5GJ6A 2JG9A 3A0KA 4YG0A 3VBRA 4RA0A 4I01A 3EQEA 1JOJA 1ZBA3 1ZZCA 1VBB3 3DGTA 4CDWA 2XJSA 4GXLA 4RGAA 3AKPA 1QNYA 3GZTB 4CDWC 1PO23 2DVGA 2IZWA 4RHV1 3ZFGA 1POV0 2IC1A 2VOWA 1PGL2 3T1MA 2LTNA 3WW3A 5E8AA 5FQ0A 2JG9C 3KGZA 1PZ8A 1VR3A 3VBHA 5ACA1 4U36A 4LO8A 3GF6A 3KCCA 2W39A 1AUYA 2XVLA 4K7JA 4PIXA 3VDDB 2HWD3 1RHI2 1YUDA 5C8CA 2DURA 4N7UA 1QJY2 4YGBA 1WW4A 2C1FA 1BVVA 1ZA4A 2SLIA 5T5OA 4QGNA 4YARA 3VGIA 4AVSA 5L7OA 2TUNA 3A4UA 1ZVFA 3UJQA 4AQ2A 2XPJA 1UD1A 1RHI3 2QZ3A 4KL1A 3RS6A 5JSPA 4K8FA 1PNFA 3AXDA 4ZU5A 4XQWA 5GZEA 3WHUA 5AC92 1JH5A 4HPKA 4KG0A 1HX6A 4C90A 1Z7S1 1J3RA 4M3CB 4IQPA 1FOD3 5CIRA 1X33A 4XF0A 3M3QA 3ZXFA 3IPVA 3FLTA 4FO9A 2ERFA 3AKRA 4JRLA 1U5IA 3VZKA 2ARXA 3H50A 4Q2FA 4AI3A 1R093 2NLRA 1GKBA 3D4KA 1GFF2 1PGW2 2CGOA 3C3VA 4UBHA 3THTA 5IK5A 5D8AC 1RUE2 3JQWA 4GIQA 2A6XA 2XVGA 1JYCA 4RS5B 4I3PA 3DPRC 1S0EA 1XNBA 1IZ3A 1PNGA 1FOD1 2ZGPA 3VUOA 2E9QA 4TSVA 2GDFA 1JW6A 2ETEA 1MS4A 2VPVA 1Q3EA 5JZGA 5K8SA 1OQEA 5C8CC 1GLHA 1BQPA 2IWGB 4COUA 1RMU3 3PHMA 4KU7A 1HRV1 3WQ7A 1RUG2 5GALA 1OD5A 5FO8B 1RGSA 3TWIA 4I02A 1ZZ8A 4OHVA 1PIV3 3KQRA 1BK1A 2GZWA 4LEJA 3TN92 4LUMA 4E4DX 1EV12 2HEWF 2OUJA 5AFBA 1OFNA 5SV5A 4LE3A 2FZ1A 1H9WA 3ETQA 2WZR2 3HIFA 3H8UA 1W39A 2W68A 4OUMA 1B09A 3MDPA 5LK5A 3CLPA 2ZJCA 2DFBA 2JENA 3GBWA 3U07A 4CDUB 4K9SA 3MF6A 3M3EA 4QQ2A 4LA2A 2R061 4OI0A 2I07B 1WCKA 3UK9A 3GHMA 1EYBA 4XDQA 4Y1YA 1ZRCA 4R9CA 3R6SA 1ZZ9A 2E6VA 1ALYA 4S2GA 1BBT2 1OOPC 3M3CA 4YM0A 4Z92B 1LHWA 3ZXGA 1V6LA 1FAYA 3IDCB 4FOQA 1ZBE1 2ET1A 1J1LA 3S0MA 1M06G 3WHTA 1O5LA 3IWZA 4QM8A 4XMAA 4IETA 5E1RA 3O0WA 2Y26A 4R4XA 2CWMA 1RIRA 2WZR3 3ASIA 1QH6A 4AE2A 1YWKA 2QZ2A 2YZ4A 2WQ4A 1QOSA 3TNPB 1G9DA 2FMDA 3CL1A 4N9IA 1SBEA 1ENRA 5FO9B 1AR81 4NR1A 3VBFB 5FLJA 4Y24A 3G6JB 1RUC1 3AFGA 4Q0SA 4Y20A 3U4XA 3FBMA 3MPBA 2JG9B 1LHUA 2ZAHA 4XFHA 3AYCA 2PA7A 1H1AA 4MH0E 4A3XA 1QDCA 1YFUA 4AFBA 1QJY3 4MGKE 1NCQC 1RUF2 2BFUS 3B5LB 3MW4A 4HPKB 4CDQB 1Q43A 1LEMA 4XIOA 5HBAA 2YGMA 1S55A 1IHMA 3SCHA 4IL7A 1HXS1 3OYWA 2OYZA 4CP0A 5KXCA 3E5QA 1RUF3 3ZIWA 1I5ZA 4ITCA 2R1BA 2E7TA 1FMD2 2JEMA 3B9IA 4R9AA 5CFCC 1QJX3 2BTVC 2JJ6A 4LO7A 1QXRA 2R6QA 5L73A 3VN4A 1REEA 2WL1A 1YIFA 2YYOA 4J1WA 4LO4B 4Y1UA 2B42B 1Y43B 5J09A 3AYEA 5FPXA 3VKNA 2VVFA 2WZPP 3VV1A 4JRAA 4NO4A 4WM8C 4FCAA 3WX5A 5EFUA 1G9AA 2ZHNA 1JBCA 5KHGA 5F5QA 4AI8A 4MZUA 1LCLA 4M3CA 4GH4B 1IPKA 1C1FA 1RUH1 2PHXA 3P3PA 1YI9A 3LA2A 4YM1A 1PO12 3WCSA 4BLJA 5C33A 4AEDA 4FBFA 3ZFGC 1ND3B 2UU8A 2KM2A 1WLDA 4S2HA 4X6QB 4EV0A 1PO13 1RUC2 4I0BA 5KC6A 4FPEA 1JUIA 2CAVA 2O8QA 3I4IA 1DBNA 2VUAA 1QXJA 3FLPA 2UWAA 3BTAA 2K9ZA 5FQ0B 3ENRA 4Y20B 1AL23 4BIFA 4Q0QA 2RHPA 4IEXA 1C3HA 1R092 4FOYA 3L2HA 3OJBA 1DF0A 2YXSA 1O3SA 1OSGA 2JICA 1HXS2 4ISRA 1C4RA 1MVQA 3WY6A 1XNCA 2NMOA 5J7MA 4HZFA 4XW3A 5I0TA 4B8EA 3O14A 1AR83 2XB6C 4Q8KA 3E6BA 4KGGA 5BYNA 1X36A 3M2MA 3VL8A 2IXHA 5FBZA 1S1AA 4M0HA 1MS9A 5CFCB 1XQNA 3ZXDA 1AR62 2VG9A 1AHSA 1MS5A 2GN7A 2WFF1 3WNXA 3JBG2 1N1TA 4ISQA 4YGCA 3VKLA 1DU3D 1V6OA 1VLNA 5ABJA 1RB8G 1NY71 4BOWA 3EXUA 4C0BA 4WM8B 4AFCA 4DPNA 4COVA 5BNOB 4FPFA 2WJSA 3FWEA 2ZA9A 1QU0A 4WVVA 1WMEA 3PMEA 1RITA 4K1ZA 5T55A 2ZKLA 4N90A 4RQPA 2BWCA 2YHJA 1A78A 2Y38A 4YG6A 4IV1B 1S0FA 4IXLA 5I0UA 3AMHA 3VZMA 4YVWA 2ZX2A 3NO8A 1GBGA 4Q1PA 3RDIA 5JCTA 3I59B 4BIOA 5C8CB 2ATFA 3D6EA 3M70A 2HWB2 4XJ8A 1ZRRA 2RS53 4HK8A 4Q26A 5JLVA 4IEYA 1YRZA 2A6VA 2XKOA 4Q4X3 1KITA 1NCRB 5EYYA 5BNNB 1CAXB 4AEMA 2MHFA 3S7IA 2VNRA 2FBEA 3CJIA 3MF9A 2WWSA 3PTYA 4KWKA 5T5PA 4HN0A 1REFA 1DQ4A 3BALA 1S2BA 3ZFGB 1RL3A 1RUJ2 4PBOA 3H1YA 4LE4A 4OULA 5KHKA 1KS4A 1W6OA 1JUHA 3GHNA 3KZ4C 1Y3TA 2D98A 4XF4A 2BNNA 4J1XA 5EWSA 3CJXA 4B4RA 1M4WA 4AVVA 1R1A2 1WLTA 2WKKA 3I7DA 4Q0UA 3D0SA 4XFIA 1YFYA 3ZYGA 4FVVA 1H4HA 4E4ZA 3N7JA 2XL9A 2Q8OA 5JDBA 1DZQA 5HCFA 2OA2A 2RS52 2EA7A 5L7OC 4CDQA 3ECQA 3URFA 1S0GA 1UW8A 3K48A 3RNSA 2GC0A 3B01A 1AYM3 4Q27A 1GQHA 4AEDB 5BNOA 1MZ5A 2CTVA 1NOVA 2R1DA 5BNOC 1FI2A 4GALA 1QOOA 1AZDA 3WZ1A 4N43C 2D6NA 2A7AA 3DN7A 1OPOA 3O0VA 1HW5A 3WR0A 2MPFA 2H6BA 1GV9A 1C1LA 1VAVA 4RHV3 4EN8B 2ZAAA 2BFUL 4IV1C 5J98B 3M4FA 2HWB1 4Q1RA 2WNEA 4Y1VA 3RZZA 2RR11 1D4M2 3KD4A 1PIV1 1W6MA 4MLOA 2DVAA 1YFWA 1N3PA 1RJ8A 3AZVA 3MZHA 2AREA 2GH8A 2VOKA 5CAZA 5HXVA 4Q4V2 1WGPA 1CJDA 2VQ0A 3J4UH 2ZGUA 1QDOA 4WZCA 3TN93 4OVEA 3SITA 4JC1A 1QJU2 2DUQA 1MZ6A 3ZPYA 4FPJA 4EWDA 1PZ9A 1SLTA 1RUG1 1BZWA 2MEV3 4RSUA 2XJRA 3UKVA 5BNPB 1TEIA 3WD5A 2O0OA 1XYNA 3ZXKA 2KA3A 2FHRA 3RYPA 1W6OB 2R0FA 3SH5A 4KBBA 1LGBA 1BCXA 2FQPA 4ZXKA 3FLRA 4QX5A 1ZNPA 2IXCA 3QACA 1PGL1 1LR5A 4KU8A 1D4M3 1QNWA 1QQP1 4AFMA 4LBLA 3WLUA 3WDYA 4LLOA 5JPNB 1H8TA 1WLCA 1B35A 2AGSA 5E89A 4QPGB 2CAUA 1WCDJ 1AR63 1VBE1 5FPZA 2QDRA 2JG8B 4HFSA 1YFXA 2P34A 5CNAA 2GNBA 4AFDA 4JGZA 4QQOA 3D8CA 2P17A 2R043 5KHHA 1NE4A 1LHOA 1MZFA 1BEV2 1AX0A 3MFCA 5FREA 5B2GB 3THPA 1GZWA 1W6PA 3WQ1A 3N4MA 1A8DA 2R073 2NPIA 1REDA 2BW8A 4MSVA 3V65A 1FYUA 1LRHA 1ZBA2 1AYM1 3H9AA 1HRV3 5A33B 4K20A 4GA9A 4O9GA 2OW4A 2WT2A 3OY8A 1UCXA 3WOGA 4P9GA 3OGGA 1ZRFA 4X8PA 2MNGA 2XLAA 2ZGRA 4CEWB 2Y0OA 4RFT0 1QH7A 4QPIC 2RR12 1X8MA 2G9GA 1YI7A 3HR9A 2ET7A 1XYOA 4AI1A 1GNHA 2DU1A 1V9U2 3U0ZA 2TEPA 1H2MA 3HBZA 5JVVA 2ZHKA 1BKZA 3D5OA 1RINA 3AKTA 2ZGOA 1ULCA 3WUDA 2BVVA 5BNPA 4HKOA 4I09A 3PVBB 2YV8A 3TYJA 5BNPC 1YXWA 3IN9A 1CD3G 1NXMA 1JHNA 1UAIA 2CL2A 5KXDA 3JUUA 3ES4A 1QQP2 4CDXB 3NKGA 3S6PA 4JGYC 3AM2A 1O7FA 4P9YA 1APNA 2A73B 5C9AB 3N35A 3NL1A 5CFCA 1LHNA 5JMCA 3J26N 2HWF2 2FMYA 4R9DA 1YJLA 1MS3A 4HL0A 1VBB2 3TN91 2A6ZA 3OD0A 1FMD1 3LZZA 3AZWA 2D40A 1AR71 3KS7A 2XJTA 1I9RA 1VBA3 2WZR1 5F6KA 2E51A 3FHIB 1OQDA 4AEKA 4Y22A 1VBE2 1VBC1 2ZS6B 2ZGLA 4F8AA 4ASMB 1IQAA 1C8M2 1Q8PA 2X5IB 4YZ1A 2EXKA 5C6CA 2SBAA 4HANA 4GH4C 2VULA 2ZZQA 4AGRA 2R30A 2NYYA 4GMP0 2QNKA 4B3NA 1RUH3 4MXVA 1LOFC 4QM9A 4FPHA 1S0BA 4K6BA 2DVDA 5T5JA 3I59A 5LEKA 4LTAA 3TBDA 3H1WA 1TME2 1RUH2 1LB2A 3MIHA 2ZMLA 3MIFA 4LO5B 3VBRC 2Q1MA 4ZU7A 5FMOS 4FXKB 2VH9A 1LULA 1QJX2 4GH4A 3TRSB 4AHYA 1KRIA 2W0XA 4EN9B 2RM22 1VBC3 3NV4A 1SLLA 5BNNC 1DGRN 3P3NA 2QFEA 5I0RA 4AHZA 3T2TA 2EVXA 3B69A 3RJ2X 3WW1A 1OMIA 1XE7A 1V9U1 3SMHA 1C8NA 3B93A 4G4FA 3VDDA 1Q8QA 1HIXA 4IERA 5F1RA 1COV2 1PGSA 2GNTA 2A6WA 3IM0A 2VW2A 1JYIA 2GMMA 4ATFA 1LU1A 4H7MA 1LKNA 2XJQA 3UKTA 5BUVA 2WFPA 5C9AA 1NQDA 1VBB1 4JDMA 2XG3A 1I3HA 2YGLA 4JQRA 4MVTA 4TYSA 1DDLA 1AR72 3KCXA 3MIBA 1DIWA 1HDKA 1OQ1A 2D93A 2GNMA 4FTSA 3AP7A 1O4TA 1GZWB 1A6CA 3K51A 3N7LA 4OHXA 2PHTA 4B4QA 2VOXA 1H2KA 3DF0A 1LU2A 3UV9A 2WT1A 3ZFFB 1BEV3 5JAXA 3QD6A 3V0BB 3VZLA 3V0AB 4PLNA 1NZCA 5LRSA 1FNZA 1QY4A 3IDEA 3NV3A 2NN8A 2VMGA 1URXA 4YVSC 3VHNA 3VHOA 3LOBA 4FOVA 3SH3A 4D69A 4DS0A 1SBDA 4HMZA 2BQPA 3AKQA 4N7IA 4NVPA 1CN1A 2R041 4TWTA 1CAVB 1C5HA 1DYPA 3IT8A 1CPMA 1NYWA 3LCPA 1PVC1 1PO22 3VKOA 3AP6A 1UPSA 5K0UA 3PLQA 2PAEA 1ZBE3 1XRUA 3AFKA 1SLAA 3D82A 3O0XA 4MXWB 4LULA 1GANA 3AP4A 1DQ2A 1F31A 1QJX1