3M7AA

Crystal structure of saro_0823 (yp_496102.1) a protein of unknown function from novosphingobium aromaticivorans dsm 12444 at 1.22 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
140
structure length
140
Chain Sequence
GGTKTAAEAAAPAVHPVSGLQIVPVTVTGTSGRHVFRSELARTSAEQAKGLMFRTELGDEEGMIFLRNPPDMATFWMRNTVIPLDIIFVGLDRRVMNIAANAVPYDETPLPAAGPTLAVLEINGGLAARLGIKPGDKVEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
publication title Crystal structure of Saro_0823 (YP_496102.1) a protein of unknown function from NOVOSPHINGOBIUM AROMATICIVORANS DSM 12444 at 1.22 A resolution
rcsb
source organism Novosphingobium aromaticivorans
total genus 35
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02643 DUF192 Uncharacterized ACR, COG1430
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1140 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3m7aA01
3M7AA 3PJYA
chains in the Genus database with same CATH superfamily
1Y9QA 3CKHA 2A6VA 4LHSA 5DUWA 1MVEA 5BUVA 1S2BA 5E1RA 3PUQA 2VZ1A 1R093 4BHPA 3A21A 3KGLA 1EAH2 1G7YA 2HBTA 1OT5A 1IS3A 1WLTA 1VB4A 3PVEA 5KHHA 4HLTA 4DY5A 5IAVA 3DPRA 1GZTA 2MEV2 4EYUA 3C8XA 1RUG2 2RMU3 1QH6A 1W0NA 4QX8A 4BJ0A 4DRRA 1VALA 3WNXA 5A7PA 4K7JA 4CCLA 3WZ1A 2JDUA 4ZZ8A 2WO2A 2HEYF 2N7GA 5FOJB 1VBC3 5GJ6A 1H8TC 1F4AA 4EROA 3AZZA 1GQPA 5FK8A 1D2QA 3B9IA 4PIXA 5FR3A 3GBFA 1RTVA 3FLPA 3HNMA 1R1A2 3KVAA 5B4XA 2ZGQA 3Q8CA 1JODA 1FOD3 3ACFA 5ACA3 4AI8A 2RDRA 1LJ7A 2PHWA 2D6LX 3EQEA 4YZ4A 4BB3A 4BQXA 3VBUB 3ZFEB 5FPXA 1H4GA 1UOGA 4IGOA 1F2NA 3NV2A 2BERA 2P34A 3MI8A 1MZFA 2RS32 4IEYA 1WCUA 2XH6A 4O7XA 5BNOB 4KG8A 1NA1C 4QX1A 2E26A 1XNCA 2E53A 2JD4A 3BIWE 1UL9A 2A3WA 2Y6KA 3CNAA 3WHTA 1FPN1 3VD9A 2TBVA 1H4HA 1N3QA 2QQOA 4UFKA 2VVEA 1GOHA 3J7LA 3KMHA 4AQSA 3VBOB 1BLZA 2PA7A 2W94A 4LIVA 3HPNA 2ZKLA 2W5FA 3GBWA 4CEWC 3R4SA 3ETPA 4HK8A 4HSJA 3LB9A 2VBPA 2VMFA 1MZEA 2QVSB 4RGGA 1S4CA 1JOJA 4MHRA 4OHVA 1QQP1 5FPAA 3S7EA 1B09A 1FMD3 2DWRA 5C6CA 2NLRA 4QDQA 5HCHA 2RS13 3LGRA 2GMEA 4M01A 1CQ9A 5EFUA 5AVAA 4Y1XA 5FZMA 2BEOA 3NJZA 5CBLA 1PZ9A 1GP4A 2I07B 3AYAA 2WWSA 1PVXA 1VMFA 1XYPA 2D98A 4RA0A 3H42B 3OG2A 2XWBB 1C8M1 4KU7A 4LBOA 3OBRA 4KWUA 1RB8G 2WQ8A 3KQRA 1QJU1 1S2EA 2G9ZA 2JG9B 3AL6A 1JYTA 3OCPA 1VBA3 3OPZA 4CU9A 1UOFA 4N9HA 3VHRA 5K0UC 1N1YA 4XBNA 4JVAA 2C0ZA 1JZ2A 5FZOB 3A7QA 1NE4A 4XHXA 3W9AA 1F15A 2CU5A 2H6BA 1IKPA 4YM0A 2ZOEB 2PFWA 3FC0A 3LF7A 3N9NA 1LHVA 1L7QA 1RUD3 2CSGA 4TWTA 2IXLA 4JQTA 4IV1B 1ULPA 2D43A 1LTEA 4KH9A 4AHXA 2Y6FA 4HN0A 3AZYA 5FZKA 1RUF1 2VM9A 1Q8VA 4LXLA 4PBPA 5EIYB 5FBJA 2CWSA 1W03A 3VBHC 1ZZ6A 1BQPA 4P9WA 5AFEA 1ONAA 2DUQA 5CIRA 5SV8A 2AEYA 3WV6A 4HFSA 1W0PA 3CZUA 3B7MA 3H1MA 5EPAA 3FBMA 3KM5A 4J1XA 1DZRA 2A71A 3RZHA 4XURA 3BYWA 1GUIA 3LWCA 4QPIA 4Y33A 2QQNA 5DAQA 3V64A 1DDLA 5EWSA 1V6NA 2HYXA 1LGNA 4PI0A 3ZXDA 2W9XA 3N7KA 4YW3A 3ZFEA 4QB6A 3ZMNA 1OFSA 2VUJA 4CCCA 3LDBA 2D6OX 3GNEA 5BV6A 2BUKA 3DUIA 4FFHA 3ETQA 3W5MA 4ZS3A 5JZGA 4XF1A 3JXSA 1RXGA 2P5BA 2XLGA 4NRQA 1W6QB 1ZZCA 4NPMA 1S2KA 1LEMA 4DRVA 1G9FA 3DL3A 2WAAA 4XFHA 3H9AA 4BXFA 1WMXA 3LOIA 3JBG1 2J7MA 5FMDA 3PTRB 4COYA 1CAUB 3FHAA 1GWLA 1TNFA 5B2GB 1E5SA 1YHFA 3S5QA 4C90A 2VO5A 1LHUA 1RVF2 2BTVC 2VNVA 2ZX4A 3M1HA 4BA6A 2IC1A 5FKBA 4YGEA 2W2IA 2DV9A 3HT2A 3KGZA 4NRPA 5CZKA 4NIAA 2WZPP 3RJ2X 2C4XA 3ZXEA 5JXHA 4XFFA 2TNFA 4LKEA 2GAUA 3MYXA 1G6NA 4K8RB 5DUUA 1XNKA 4ZU5A 2OT7A 2VL4A 2DURA 1X82A 4MGQA 4CCDA 3BALA 4KL1A 4P9LA 3WG1A 1AL21 2YROA 3LQCA 3WDWA 3VZOA 1S1AA 3E5XA 2JG8A 3IAQA 4FOWA 4RSUA 4KI5M 3THTA 5C4WB 1V9U2 4PCRA 1SACA 3KCYA 3ON7A 4JCKA 1JH5A 1YI7A 1H1AA 3CEWA 4FO9A 3VDBA 1XYNA 2XJSA 1QOOA 2D6MA 4QPYA 1WGPA 1TME1 1UXXX 3LSDA 2XR4A 3HNBM 5C3PA 4P14A 1AL0G 3U10A 1CZSA 2HWD1 4CCMA 3CJIC 1JZ8A 1FPN3 2OX0A 1DF0A 4B4QA 3RWNA 4CP0A 4AFMA 1HRI2 1LHOA 4XCBA 3POJA 5BNNB 2RHPA 2YBSA 4LMFA 3PURA 2A3XA 1H2KA 3ZN4A 5BNQA 2VOKA 5H9QA 4D7YA 3AYCA 1IQDC 5FZDA 1PGW1 2OQ6A 2CL2A 5I8YA 3TOJA 3O12A 3JQWA 1OOPC 1AR61 1DP0A 4A2UA 3LFMA 2DVBA 4IV1A 3B3QE 1XJAA 3A0KA 4JDOA 1T2XA 1UOJA 4C1XA 4RR3C 3AZXA 4OQ8A 4CYDA 1DQ2A 2VGDA 3H8OA 4MGTA 1MEC3 2DVDA 2WLPA 1W8ZA 3OD4A 5FP7A 1WMDA 5GLTA 2WNUA 3THPA 4K9SA 4CP2A 3ZR6A 2JIJA 3NKGA 4YG3A 4DXSA 1WW6A 2Q5TA 4K40A 3AJZA 3C2UA 4MXWB 3NAPC 4IV3C 4XQ4A 4Y4RA 1JMUB 2Q8EA 3WDXA 4B7EA 5JZGC 2VTXA 1GNHA 4YW2A 1LR5A 3MIHA 3MF9A 3WD5A 4CXWA 1FNYA 5CAZA 5H9RA 2OW4A 2VXRA 1V70A 5FUPA 5IUQA 4AZZA 3ELNA 1FX5A 5F32A 2DVGA 5A7OA 5HV0A 1QJU3 4JHZA 2CV6A 4A45A 1BVVA 2WABA 5D8AA 3VBSB 4AHZA 2JECA 5FREA 1I9RA 2DCYA 3SCFA 5K9YA 1VAMA 4DXZA 2VZSA 1NAEA 2ZGRA 3E6DA 4XUNA 2YUEA 3VLBB 4Y5TA 3EXUA 3T4VA 3ZX7A 4ZY9A 5C3RA 2Q0AA 3ZXFA 5FBZA 5BYNA 4EWAA 3LD8A 4RGAA 1O59A 3AP7A 1ULFA 4NHYA 1AVBA 1V6LA 2ENRA 4QQLA 4IEOA 4XW3A 3WQ0A 2AEZA 4GXLA 5JUVA 3TEYA 1ASJ3 4XC9A 3SEPA 1UKRA 4BK4A 5C3SA 5LK7B 4P9YA 2R041 2A75A 2B7YA 1TZOA 1WD4A 5DAXA 2WUHA 5J37A 5FY8A 1H8TB 5F37A 1XU2A 1YJLA 2HWB2 3HVDA 5A80A 1G86A 2B9VA 4FPOB 3ZPYA 5A70A 5GLUA 1CAWB 1POV3 2OQ7A 3Q8AA 4XYXA 1C57A 1C1FA 1QY4A 1J1TA 1PIV1 2VMCA 2VY0A 1GFF2 2X53S 4FPEA 4M3CB 5F5IA 1HB4A 2P1BA 4LHNA 2JJ6A 1DZTA 1YJKA 3RG0A 3IPVB 2VOXA 2ZAAA 3PUSA 3T4HB 1Z7S3 5ABJC 5HCAA 1ZRDA 3GBGA 3J7HA 4QGNA 3WF0A 3GZTB 1NY71 3MFCA 4Q0SA 3U0ZA 1LRHA 4GKYA 5FZ9A 1SPPB 3ROUA 1XOYA 4AEDB 2ZHLA 4XFIA 1EAH1 3H7YA 2VECA 3RI9A 3J8F3 2IVJA 1NA1B 4J6GA 3V0AA 2A1XA 4U36A 4HMZA 4A44A 5I93A 2BJSA 3ST7A 4BXSV 2D5HA 3I54A 2EICA 1EP0A 4Q4X2 4WBBA 1VBE3 5JMOA 4B8EA 2JKXA 3IAPA 2E63A 1JZ3A 1IPKA 1GYKA 1KRIA 1NE6A 4RS5C 2WWUA 3MIDA 4NJ4A 4CEWB 2J42A 3ILRA 3K2OA 1F35A 1H8VA 2ZMNA 4LEJA 2BNOA 3QBQA 1W99A 4QWNA 3T30A 1OVPA 2LROA 2KD7A 2LTNA 1R1A1 4Y1UA 1OC1A 2FZ2A 2DFCA 1DQ5A 1AL23 1J83A 2WNVA 4NPRA 2J1AA 3CL1A 1SBDA 2EIBA 1UMZA 1H9WA 3Q8BA 1LAJA 5F7UA 4QDRA 1SFYA 1IG3A 4LBJA 3VBFA 1UCXA 3PHMA 2FDGA 3ENRA 5FY1A 1Y9GA 4JC1A 2RS31 4AFBA 4EJRA 2E7TA 4L0PA 1C5IA 4XUOA 4WVZA 1S0IA 2QKDA 3OOXA 4AHWA 4EN7B 4OCTA 3WXPA 2AH2A 3D3AA 3PNAA 2ZMKA 2EXHA 5FZLA 3VN4A 1QHDA 4XDQA 4GJZA 3VBSA 2VOWA 1N47A 4M00A 4I09A 3SH5A 4W4ZA 1P8JA 3GCWA 2OZ6A 3N9MA 3S57A 2XLFA 3FFQA 1QDOA 4GMP1 3UETA 2GSYA 3DYOA 1RL3A 4CEYA 3C7FA 3LZZA 2NPIA 1FV3A 4NIIA 2OKXA 4CZSA 2W1UA 3D4KA 3B9CA 2FDJA 4QQ2A 4Y26A 2XJVA 4XILA 4L99A 3A23A 4LTAA 5FP8A 2XLAA 2W47A 3MDPA 2ZGLA 3VBHB 2DCZA 5BXXA 2CGNA 5A6ZA 1OURA 2ZMLA 3VBRC 4META 2RM22 3W20A 2ZCWA 1KGYA 3N3HA 3AVSA 4G3YC 1GZWB 4HZFA 4A7KA 5FQ0A 5L7OC 5C70A 4QXHA 1Q8SA 1MZ5A 5FKCA 5A7SA 2OUJA 2WQ4A 3POFA 3EBRA 2TUNA 3FN9A 3NWKA 1OQDA 3AYEA 4HPKA 4R9BA 2I74A 1A8DA 2A73B 1X50A 5A7NA 1MZ6A 3LEIA 1NKGA 2HWF3 1YCIA 3B00A 2VU9A 3H7JA 3IKWA 3E5UA 1W04A 4Q0PA 2VZUA 3OGSA 5FP3A 5T5JA 3GHNA 2XBO2 4RQPB 2ZEYA 4CP9B 1W6NA 2WINB 2R063 2W52A 5F3EA 2XVKA 1OH3A 3JQXA 3AZWA 2YDEA 4ZXEA 2ID4A 3CLPA 3LDRA 3O5SA 1PK6A 1PNFA 1VB2A 3BN6A 1UIJA 3I4IA 3LFIA 4NAOA 3RYRA 2PHFA 2PHLA 4W65A 4DUWA 4CVUA 4K1ZA 4S2HA 5JAXA 2BWAA 2R043 4QKNA 5EQUA 4MVTA 4URAA 5EJZB 5F3CA 1UOBA 3FE5A 3PUHA 2EF6A 2D44A 1COV2 1JYVA 4D69A 1AR91 3RVHA 4B7KA 1MS3A 4GB32 1QH7A 1HB1A 2XOMA 3K75B 2B46X 3I49A 2FDIA 4NWVA 3ILNA 1FNZA 3H0OA 4QPIC 5GLWA 2JKBA 3CMGA 3PDQA 3LCPA 3WP6A 3WNNA 5BNPA 5AC92 1BEV2 3M3EA 2RR13 1J84A 3ACHA 4QPWA 5SV5A 4DQAA 3KV5A 1DGRA 4GWMA 3J7NA 4JRLA 5APAA 2Z69A 3O14A 5FV3A 4B29A 4YSFA 2ERFA 2VNOA 3USUA 1HQLA 2Q8OA 1AZDA 1FV2A 1F4HA 1L7RA 3VZMA 4KBZA 1QJY3 2Y60A 1W9YA 3HR9A 4AVAA 3UGHA 2QDNA 2ZKNA 1H0BA 1W2UA 2PQQA 3JCIA 3LAGA 4NHKA 1CZTA 2WZEA 4RHV3 2UWCA 5KHIA 5EYXA 3U07A 4CE8A 4DMIA 2ILMA 1UW8A 1L7LA 3QH6A 4FFFA 1RVF1 1PMIA 1UAIA 2XDVA 4ZHNA 1VAVA 1LB2A 1GMMA 2R7EB 1OOPB 3IBMA 2RDSA 4XJ9A 2HWE3 3AL5A 4MGIE 1S0DA 4RR3B 5IVVA 1OHFA 1PGSA 3ZR5A 4CRQA 3EMRA 2XJQA 3NV4A 1KDKA 5DUXA 4QXBA 5JSPA 3MUY1 1HQNA 2EIDA 3PIGA 2JG8C 5LBCA 4C1WA 2CHHA 1CAXB 1AX0A 1ENQA 3CQOA 1V9U1 3OF1A 4IE0A 2IXJA 4IV3B 4N53C 4N43B 4XMIA 1RUJ2 4AI2A 3VD5A 1EV13 3LA7A 4PDWA 4DPNA 3AP4A 5FUIA 2W87A 3G6JB 2BVVA 2JDMA 4PF1A 4ZPIA 2W39A 4IQPA 4QU1A 3AZVA 3DF0A 3AJYA 1DQ4A 4H7LA 5FCCA 2J1SA 4IEUA 4Q8LA 2K46A 4PQ9A 1L3JA 4PHZA 4AI0A 5E8AA 4GMP3 5LBBA 2NM1A 3OY8B 4COVA 2AENA 4XDOA 5FYZA 3RJRA 3S5AA 3H50A 1GU3A 3OBZA 5CISA 3BTZA 4XZPA 2KM2A 3J7MA 1HXS2 1MS8A 1Y4WA 3I2DA 4BQ2A 5FUNA 1SLCA 3MFAA 2PMWB 4FPLA 4UW3A 1RUH2 4QXCA 5J3UA 1GP5A 1QDCA 1W9SA 2ZGNA 4FOVA 3HN3A 1AXYA 2WNUC 1RHI3 4CUAA 3BPZA 4NE9A 3C3VA 5EP9A 4TXWA 4ARYA 4YM1A 1KS5A 1SBFA 4AYUA 1AUYA 4BOWA 3OBAA 4AE2A 2P3IA 1OLME 1PX4A 5G05L 3AMNA 2ADDA 3ZFGA 3V0BB 2IUWA 5DDJ1 5C33A 5I0RA 1UPIA 1V6IA 2PAKA 5FWEA 3MPBA 3SKVA 1UIKA 2DCKA 1YQ6A 4H7MA 5D1IA 4Z92B 2RE9A 4UOJA 1KS4A 5F5CA 1Z0HA 3WDYA 4YVWA 1OLMA 1GQHA 1YEWA 5TSWA 5GZFA 2EAAA 3DECA 4WM8C 1YRZA 4NHMA 5FPZA 1BKZA 4QPGC 5FO8B 5L7OB 1D2SA 2BNNA 2WRAA 1F9KA 3ECQA 3OEBA 3KWVA 1NZCA 4I01A 3T09A 1PO22 4C8DA 2P3KA 2HEVF 3CU7A 4QHZA 2WIIB 5E88A 1D0GA 3G7DA 4IXLA 1AR71 2AYHA 2B8MA 2VUAA 5A32B 3HAGA 4DEQA 1W39A 1YQ8A 3DKWA 2KA3A 4RS5B 2QFEA 4COWA 1REDA 3HT1A 4PLNA 1HW5A 1BYHA 3JU9A 5FY7A 1NZIA 5LCWL 1GZ9A 4LR4A 4YZ1A 2HWB1 1AR93 2JDZA 2ZGUA 3QLQA 2ZXQA 4ES9A 3RMXA 5LA2A 5ISLA 3BTYA 2YPJA 2R072 3ZYBA 1QXPA 5EV7A 2WR9A 5CFDC 4JDNA 5LEJA 4ORFA 1RMU2 2B5HA 4LQRA 1RXFA 3WUCA 1NX9A 3SCGA 1H6XA 2BGPA 1X7NA 3I3EA 5JOYA 1O3QA 1UXZA 2C1FA 3HN1A 4JGZC 4BQ3A 4ET7A 2CWMA 2J1VA 3JD71 1BCXA 3ZSEA 2Q8CA 3O1SA 1V00A 4LLOA 2BFUS 4XFCA 2ZZJA 2KR2A 2GDFA 2Y6HA 3BU0A 4UI9L 2YV8A 2ZHMA 5FO9B 5EZWA 1V6JA 3I7DA 3ZFFC 3BKZA 4Q4X1 2WO7A 1MPXA 2MPFA 1MS0A 3OGRA 1QWRA 3RPQA 4A3XA 5A3UA 5CADA 3MV11 2Q8DA 1MS5A 2R0HA 2QQMA 4R4ZA 2WS92 4BU2A 2WFF3 3GXUA 4TN7A 4AQ2A 5HBAA 1NG0A 3NSTA 4CDXA 1I3HA 1S0FA 3LOBA 2NMNA 2UY8A 3DXUA 1F8VA 2GC3A 4C0BA 3AMQA 1SEFA 4WM7A 4E4SA 4E8CA 4FAHA 3PVNA 3TN92 4CDUA 4YG0A 2F17A 1R1ZA 1VRH3 1DGLA 1AYM3 2ES3A 1ACCA 2V4VA 1QF3A 2D6NA 4URTA 5ANQA 4M3CF 4QMAA 1W3XA 4OMCA 3VBRB 4AVBA 5FYYA 4DFSA 1JYCA 4F83A 2C5DA 1IKQA 1W6OA 2GNTA 4FXGB 3WF1A 4NHXA 4Q1RA 1CIYA 1KD7A 1QJX2 3B93A 3TEZA 5JI9A 2LUWA 3N36A 3I3BA 3S7IA 3I2JA 1LHNA 4I2OA 2XPJA 1URXA 2PLV2 2X5IB 3HQUA 3MIEA 4XF4A 5D2AA 1HQWA 1RC6A 1WLCA 2RJKA 4JDMA 5IK8A 2Y26A 3POEA 1PO13 1DGWX 1HRV3 2Z4FA 5T54A 2VE1A 4OUMA 5DXDA 1JHNA 2XL7A 4BM8A 3H8RA 5JIUA 1XXNA 5FYHA 1OA3A 1M4WA 4KWJA 3AP9A 3SH3A 1RINA 3N4MA 1J59A 4AOCA 2X10A 4LBQA 5A3MA 4CEYC 4YZ5A 5C8CC 5CFCC 5A7WA 1YFYA 5L9VA 5FY4A 3AKTA 3UESA 1MS9A 2ZGOA 2A3YA 3K48A 4CDWB 2QBXA 3J26N 1SCSA 1UX7A 4BQ4A 2WZR2 1Q8OA 5B4NA 4UW6A 4CDQB 3MIBA 4GA9A 5E89A 3RSJA 3USSA 2DFBA 2B39A 1TMF3 1EPWA 3HJRA 4RYDA 4AFDA 2WA3A 2VUCA 1K5MA 2DDUA 1J58A 3AMPA 1E5RA 5DMYA 4UBHA 1E5HA 2E32A 3NQHA 5FZFA 3T3YA 4BQ1A 1B35A 3MUZ1 5EYYA 4Q8KA 5KHJA 3I8TA 5DDJ3 2FCTA 3IWZA 3H8UA 5IVJA 3ZKUA 1LOFA 2IXKA 2E33A 3N9QA 1QIQA 2VC9A 2FDHA 2V09A 3UT0A 3OUHA 1A3KA 1ODMA 2YC0A 4O65A 4AGVA 3TRSB 1CN1A 3UGGA 1F31A 1R64A 1S0BA 1NQDA 2BWCA 2R30A 4FPHA 4HVOA 4R9DA 1UY0A 2XBO1 4YPJA 3RZLA 4QKBA 4E9KA 1ULOA 1ZBA3 2Z2SB 2G1MA 1DG6A 1BMV2 4KQ7A 2Z5WA 3SITA 2BPA2 1PK6C 4OI4A 2JE8A 5FYVA 2LW8A 3AKQA 5F8PA 2HKXA 1AR73 4E2QA 4LKSA 3NJVA 2CDOA 3FLTA 1X8MA 2VR4A 3ZOIA 1HJGA 4PIYA 1RUNA 1RUC2 2PAMA 4XUTA 2QUOA 4Q4W3 3S0MA 4QX7A 5JPMB 3RMYA 3NNLA 5T50A 1C5HA 3VDDC 3ACGA 4A7ZA 5FZCA 5FLHA 2Y6LA 1W6MA 4GB31 1HKDA 4CCEA 5L36A 1CAVA 2VH9A 3KV4A 3N9OA 3OYWB 5EJ1B 4FT8A 5LWBA 3NKTA 4N90A 5IT6A 5J96B 1WA4A 1NCQC 4IGPA 2ZGPA 1ND2A 1NCRB 3UK9A 2LM3A 4PQQA 1WBFA 5T5OA 4N53B 1UF2C 5IFPA 2VQAA 4LBKA 2DUPA 1S0JA 4D0QA 5AC91 5J1XA 2EXJA 4K8FA 4EV0A 1EY2A 3JD73 4JZRA 1WMEA 4P02B 4P5HA 4MUVA 4IE4A 3EB7A 2IFWA 4K1YA 4W6YA 3GHMA 4GWNA 3WG3A 1RUI3 2W95A 3J9SA 2X5IA 4YVSC 4DXRA 3O1TA 2R6QA 4CSWA 1ZBE3 2RS52 4Q4X3 4AVTA 4DINB 4INDA 4AQTA 3ZYHA 1V6MA 4Q0VA 2JXAA 3I59B 1SZBA 2GH2A 4XJ8A 1REFA 3D6EA 5FZIA 3ZVXA 3VDCA 2BW8A 1AXZA 4R9AA 3U75A 4LHLA 1FXZA 2D97A 2GNDA 5CG8A 4CUGA 4IEPA 5KBFA 1SDDB 2VMDA 4RD7A 2Y38A 2LRPA 3VBUA 3U78A 2UURA 2QZ3A 3KT7A 3KCXA 5HXVA 3ES1A 2VCMA 3M3OA 1X9TA 4CDQA 3RYKA 3P1IA 1RUJ1 3I3QA 4GH4B 1UY2A 2WYSA 3HQRA 3T1MA 1QOTA 3U11A 4BE3A 1NQJA 1S0GA 4Q4V1 3WCRA 5BNOA 2WSVA 2XQRA 3C7HA 4QX0A 5C7GA 3GALA 3FUQA 2ORXA 2W1WA 5L19A 2ZS6B 4KBBA 2HWC2 3GJAA 2Y64A 1W28A 2H0BA 3K3NA 1PVC2 3D0JA 1D4M2 2AC1A 1CWPA 1UN1A 1VRBA 2RJ2A 1GQGA 3VBOA 3ZIWA 1UYZA 4FP3A 3AM2A 2JWPA 1VBB1 2WT1A 4WM8B 1YQ2A 2VQ0A 4N9IA 1WCKA 4QPGB 2ZACA 1I5PA 3SQOA 1RIRA 3PIJA 1HDKA 2CNAA 4Y1VA 3ALQA 1W8UA 3AMHA 1TQ5A 3MV01 1HXS1 1RUH1 3BPSA 1OUXA 1G8WA 1Y9MA 5C9AC 4LO4B 1LEDA 3UKNA 1ULCA 4NVPA 2IFRA 2R1BA 4QDSA 2JE9A 4TTGA 3H1WA 5A3WA 5FZEA 2Q30A 3TB0A 5EHDA 3WQ7A 1DQ0A 1J3PA 1W9WA 2KXLA 2ATFA 2X29A 1PM4A 4NR1A 1LOCA 3LEGA 5LY1A 5JOWA 3ZFGC 1K42A 3T0AA 4K6BA 4ZONA 2JG9A 1XNBA 5CFDB 3GZEA 4MGSA 4OMDA 1ULEA 5FIXA 3MW3A 5JCTA 5J98B 4Q26A 3DN7A 2BQPA 3IT8A 1WA6X 1AYN1 5FZOA 5A1FA 5KXDA 4JGZB 3VV1A 1UY1A 1R092 2DVAA 2ZPXA 4HVRA 1ZRCA 2GN3A 2JEMA 4LBNA 4UFMA 3TAYA 3P3PA 3TEXA 1JXNA 4IL7A 4TLGA 5A6XA 1QQP3 5LZ6A 3RS6A 2YFZA 4EWEA 4UT5A 3ZFFB 1MQTC 3VZJA 1PO21 1AJOA 1YQCA 3IM0A 3WDTA 4NHLA 3VHPA 1A8MA 3NJXA 2OVUA 2OIIA 1CGPA 1PGL2 3LKJA 1JHJA 1UQXA 3SLIA 5DAVA 1VBC2 4QGLA 3FWEA 1ZRRA 3RNSA 5F9TA 4AF9A 3POBA 4GB33 1C8M3 4ISRA 4AGRA 2D3SA 3WOGA 1N3OA 4C0HA 5C8WA 2FHRA 3AP5A 1AF9A 4QAWA 5K4LA 5LK5A 5ACA2 2R071 4XFBA 3WW4A 2DVFA 2R49A 4X8PA 4CU8A 3ZYIB 1RMU1 4F8AA 1CPNA 1RJ8A 2R0FA 4IEXA 4FI9A 1YYNA 2XHNA 2D3PA 3W5NA 3POGA 1O8SA 1YXWA 2P4EA 4S2FA 4XXPA 4Y20B 4LT5A 4HBNA 4GH4A 2RJLA 4XUPA 1E5IA 2PYTA 5FZ0A 1JYNA 1W6QA 1WW5A 3IIIA 1HN1A 5FP4A 1RUF3 3D82A 1QJEA 3NNMA 4BLIA 1WCSA 1H9PA 3MBWA 1IS6A 1CAUA 1UYXA 1VBD1 1ZA4A 1APNA 2EALA 4QD2A 2BRTA 1BBT2 1A6CA 4LE4A 4CU6A 2WS91 1W0OA 5DUVA 4CTEA 5GLVA 5FWJA 1C1LA 1UKGA 3GCXA 2W0XA 4FPFA 3UKTA 3O0XA 5CNAA 4JTOA 4CDXC 5KHGA 3AP6A 1QKQA 5FDBA 4UAPA 3H3UA 3POYA 4GJYA 1BJQA 4H55A 4JGYC 2OUHA 1SBEA 1FMD2 1ND3C 4XF0A 5FYSA 3TN91 5J7MA 2VBBA 1V6KA 2X8KA 1W2TA 3GYDA 4JX0A 2Y33A 5I8SA 4BLJA 1LULA 2D93A 5C4WA 2J1EA 1D0HA 3E6BA 4NOTA 2NYYA 5KXBA 3KV6A 3AKPA 1STMA 1TEIA 4YM3A 4I0AA 1EYBA 1SG3A 4HONA 1OPOA 4Q4V3 1FYUA 4QB1A 5CA6A 1Q56A 2JDNA 1SFPA 2PLV1 3DPRC 3VD7A 1OMIA 2MEV1 4AEKA 1RUG1 1HLCA 3JBG3 5KXCA 2B45X 1VBA2 3RZZA 3M3QA 4FOYA 4YW5A 3LEMA 1DLLA 2OS2A 4DB5A 2O8QA 1R082 2R16A 1VBB3 1KDMA 4V2WA 5BNNA 4WZFA 2Y0IA 3O0VA 4AR2A 5F5AA 5GKAC 2WO3A 5JXGA 4MG2A 3ZLIA 5FZ1A 3D0SA 2FCUA 5JOXA 4LITA 3AC0A 1NOVA 3X29B 4LUKA 3M3CA 3KSCA 5FMOS 5FTTC 2FDFA 1LENA 1SFNA 3RWKX 5JMCA 2BFUL 1O91A 2XKPA 2IVIB 2VZOA 4MXWA 3BI3A 2WZR1 2PHTA 3R4UA 1QXRA 4HVQA 1TME3 4FOQA 3VDDB 3N35A 4EWDA 1ZZ7A 3LSEA 4UYBA 1OKOA 4XETA 4E2SA 4KGGA 2XJUA 4AEMA 4ZU7A 4IEQA 1A34A 1KQRA 2HWD3 2P3JA 4HN1A 1B35C 1WCDJ 2GC1A 4QU2A 3BIEA 1Y3TA 3IB3A 4XOGA 5K0UB 1O7FA 3J4UH 1JBCA 1LOFC 2UYBA 1NCQB 1HX6A 3TNQA 2ZX0A 1PX3A 4OUEA 3I2OA 5ERLA 3SCHA 1KEXA 2JB8A 1AYN3 2WSUA 3N7JA 1XU1A 5A6YA 2W68A 2SBAA 4CPBA 4PLOA 1UU5A 3JB4C 4L11A 3BGAA 1AR63 4XTPA 1U12A 5G04L 4AAPA 4XF9A 4Q5OA 1DLCA 3ZM8A 4YVSB 5BY5A 5J36A 1OSGA 2BP6A 2C6SA 4M3CE 5FYBA 5KR7A 1WKYA 1OPMA 4YARA 2Z79A 3WW1A 3T2TA 4NIDA 2HYKA 2QQUA 3VKNA 3PU3A 3KF5A 4NUBA 1UO9A 3JZVA 1H8TA 1XB9A 4BQ5A 2VJXA 3IDBB 4NPLA 4YM2A 2O1QA 2ETEA 2Y6GA 2YC2A 3L2YA 1CAWA 3AKSA 2F4PA 3VKLA 1GR3A 3I2KA 4M3CA 2B9UA 1WCQA 2WT0A 1CD3G 2VXJA 1DBNA 3R4DB 4L8QA 5CYYA 3U1XA 1BHGA 3WP5A 1JU3A 2GN7A 3IPVA 4FQZA 4OUSA 3ZDSA 4YFZA 1DHKB 2VVDA 4YRDA 5IVEA 3PTYA 1YLLA 3DGTA 4HXCA 2GP5A 3NV1A 1SPPA 4AEDA 2GP3A 5DZEA 4HL0A 2IXCA 2NMOA 4MXVA 1KFXL 2DCJA 4ASKA 4CUCA 3ZYFA 1NA1A 1XPWA 2WQZC 4S2DA 5IYYA 5FPUA 1W8TA 1D4VB 4H3WA 4I0WB 4Y1ZA 1FPN2 3ZYRA 2B4KA 2J1RA 1ZVFA 3A0NA 3K77A 3SEEA 2RS51 1W2NA 5C3QA 1U0AA 2LS6A 1VBD3 2CY6A 4OVEA 3UGFA 1ENRA 4LK7A 2BGOA 3WF3A 3RYPA 4Z8BA 5IJRA 1ZRIA 2JICA 1CVNA 2ET1A 2R1DA 2WS93 1JZ5A 4CEWA 1UYPA 1XNAA 2ZGMA 1U5XA 4P9JA 1LGCA 5H9SA 4CXYA 1CESA 4NIGA 4GZ9A 4FPGA 1XNDA 5LASA 1US2A 3BODA 1PIV3 2QTWB 1CX4A 4OHZA 3WUDA 4JKMA 3CHXA 2XG3A 2Q1MA 2J22A 3PVOA 4FCAA 3ZSMA 1KITA 3OTFA 3VZKA 5CEHA 2YHJA 3HWJA 3DYPA 1MEC2 3UJQA 4AEJA 5T55A 4EN6B 1VR3A 4FPKA 5HPOA 3VBUC 3ZFEC 4ASLA 3B5LB 3MIGA 1ZZ8A 1GICA 1ZZBA 2ORZA 4NAMA 5FP9A 4ZS2A 1OKQA 2QDRA 2OZJA 2VCAA 3MLJA 1J3RA 1EAH3 2VCCA 4PIZA 4B3NA 3RRDA 3BU7A 4XCAA 3CJIB 1O4TA 3ZN6B 2MEV3 2O8OA 1RUG3 1QJU2 4FSJA 3KZ4C 3WR0A 5FAXA 1BZWA 2BBVA 2YFUA 1D4M1 2E51A 1REEA 2B42B 2QJVA 2L9LA 3C7OA 3NVCA 5H9PA 4GD4A 3VBOC 3WINE 4AW7A 4B4RA 4N8MA 3P5BA 4CP1A 1UYYA 3O0WA 3VKMA 1ZYBA 2G4IA 4Y22B 1OA4A 3WEZA 4WVMB 1R1A3 2AGSA 2PELA 4UFIA 1MQTB 4XZUG 5I0UA 1HN0A 3KF3A 3VHNA 2VULA 4DNYA 1BXHA 4K21A 1GSLA 1QOSA 1SCRA 1ASJ2 4UF0B 3E97A 4W6WA 3VBHA 3VZNA 2XB6C 3NAPB 1Y7BA 5FZHA 5A3PA 1ULDA 4MADA 4E4DX 3EO6A 1NT0A 2RS33 4XJWA 1GZWA 5GM0A 4JV4A 2F6BA 1YC61 4LPLA 1RGSA 4FFIA 4IE6A 4W6XA 1O5LA 1YIFA 2E31A 2VQTA 5IVCA 3SISA 3DEMA 3OBTA 4BZ4A 2DU1A 2AR6A 4D7TA 2RDNA 4QHOA 4OHXA 1N3PA 3M2MA 2XXZA 1Z7S2 1HRI1 1OF3A 1AR82 2CGOA 2EVXA 4GQ7A 4LO8A 4RQPA 5F2WA 4CP9A 4ISQA 3ATGA 4M0NA 1Q43A 2FBEA 3J8F2 3LA2A 4IV1C 4K3UA 1E57A 5FJHA 4Z1VA 5JXJA 2ET7A 2VW0A 2K0GA 3MW2A 1VBE2 2D40A 5AVPA 5BPXA 2F4LA 1V0AA 1PGL1 4XUQA 3V56A 4MO3M 2K9ZA 3MIFA 3U4SA 3FBYA 1VBC1 4YZ2A 1XE7A 1ZM1A 1W8FA 2DBNA 5HXMA 1QNYA 2AREA 4TLFA 2ZX3A 4XIOA 3WQBA 2IZWA 3POSA 4JGYB 3Q9OA 3GZUC 4QHBA 5ACA1 1AL22 5D8AC 5GZCA 5LA0A 3AVRA 4X6RB 5ABJB 3PL0A 4FP2A 4GIQA 2XVGA 2VZPA 2OPWA 5FYUA 1FT9A 3BB6A 4OFGA 3ZPOA 2YMZA 3FHQA 4AGGA 1LCLA 5IK4A 1H6YA 4NROA 3WP3A 5F1RA 1OUSA 5KHKA 1S0CA 1UPSA 1T6BX 3LPFA 2WO1A 5LB6A 3T08A 4Z2WA 3M3IA 2E7QA 3DPRB 3Q8EA 1IQAA 2VOTA 4A6OA 1ZX5A 3CJIA 4D6QA 4QXKA 5LA1A 1IOAA 1PHMA 3EYPA 3NJYA 1DFQA 1OXCA 3JUUA 2GU9A 4IE5A 1EUTA 4AHYA 1ALYA 4UFJA 4AXOA 4LKDA 3K4DA 5FXVA 1FAYA 3FJSA 3PMEA 3ZN5A 3ZXKA 2OPKA 3ES4A 1BBT1 1K12A 4UW4A 3KS7A 4OLLA 1W8OA 4I3GA 1ODNA 1PGW2 4XJZA 3T0DA 1HJFA 1H2MA 1RUE2 4SBVA 1YO8A 1OOPA 4YZ3A 4D6SA 4NN0A 1UMIA 4B1LA 4IEZA 2V4AA 1AJKA 4RR3A 4XIKA 2RDQA 4AAXA 4CCJA 1FMD1 3SC7X 2JENA 1JI6A 4UFLA 2GALA 3T0BA 1UY4A 3TWIA 5FZ7A 1UZ0A 1CAXA 5FPBA 4IV3A 4LK6A 2TEPA 1GWKA 2UY9A 4N43A 2ZGSA 4NWWA 4Y3OA 4YYOA 1JYXA 3ZO0B 5DG2A 3WT3A 3ZSLA 4AWDA 4YNIA 1A78A 5I8TA 3NNFA 3HMYA 3HQXA 1W90A 1OLQA 4LA2A 2VMIA 4QM8A 2JDPA 3K51A 1TG7A 3F95A 5HV4A 1UZYA 2EIEA 4ZXKA 5AFBA 2HWF2 2ZEWA 3VKOA 2VMEA 4COUA 3A4UA 1RJ7A 1R081 3SXWA 3I2FA 4G9SB 4CA9A 1RVF3 4D8MA 3ZDVA 3OY8A 1S55A 4OI0A 2R062 3ZIXA 2QQJA 5FJKA 4MX3A 1POQA 2YXSA 1YFXA 5FMCA 4UXAA 4IW3A 1ENSA 2WBKA 4JRAA 4CCKA 4LO5B 4DXTA 1O3TA 4YLZA 4AG4A 3B69A 2WNVC 1KXGA 1O4YA 1U5YA 1V9U3 1ZA7A 2R042 2Y6JA 1LOGA 3JB8A 2X09A 4H14A 4M4PA 2VW1A 3AKRA 2DTYA 4XQDA 3VBFC 1KJRA 5IW0A 2P6CA 4CXXA 1IGOA 1OI6A 3C7GA 4YG6A 5ANNA 3POIA 5FPVA 2YYOA 3V0BA 4MGYE 4L92A 4LULA 2YPDA 3T2QA 2ZZQA 5IAXA 5FY0A 2JDHA 3N9PA 1DQ6A 1WW7A 3WNLA 1SMVA 2I45A 1QEXA 1QNWA 2NZ9A 4UWDA 3VBSC 1HIXA 3VL9A 2W3JA 1V6OA 2D6KA 1HRI3 2PHRA 1UMHA 2A6WA 3WNMA 2WWJA 1NY72 3VD3A 4BDVB 1LU2A 4A4AA 5L73A 2RR12 1W8NA 5L7OA 1PZ8A 4A6SA 2PAEA 1WD3A 2WJSA 3ACIA 3OPWA 3VD4A 1O3RA 5FZBA 1IPSA 5FXZA 4A7YA 3GJBA 5C3OA 1QJY2 3KLSA 2XGXA 4KNCA 4S2GA 4CCNA 3MF6A 4RHV2 5A32A 1GV9A 3AMMA 2WLQA 3PU8A 1XE0A 2RM21 4Q4Y2 4RS5A 4XJAA 1OD3A 2ZGKA 1UU6A 3L9JT 1WLDA 1PMJX 1MACA 2GC2A 3IMNA 3N7LA 3OB8A 2ZHNA 4E4HA 2A6ZA 2HWE2 2VPVA 4W8JA 3WVJA 4QPIB 3H1YA 3K46A 1W3VA 2C24A 3KHCA 1W9TA 2D7FA 4XHBA 3WG4A 4Q0UA 1QGLA 4Q27A 1PMHX 3RDIA 4M4RA 3CDZB 3LIGA 1LESA 4HOOA 5FMOL 2ARAA 1N1VA 4KMQA 4WV8A 1EV12 4ONUA 1VMHA 4AEDC 5JZGB 4EZHA 1GKBA 4SLIA 2W91A 2UYAA 3VUOA 1XE8A 3DYMA 3AX4A 3MGUA 1X8EA 3D5OA 5FZ6A 3MHZA 5GLZA 4YW7A 2BGCA 1OD5A 3DXTA 3NMBA 1OH4A 2V5DA 2XJTA 5C71A 4RFRB 5LATA 1BBT3 2OA2A 5F5QA 1G9BA 1COV1 4XMAA 3VDAA 2HWB3 4F7ZA 4N7IA 4CCOA 3LE0A 2ZGTA 4GULA 5DZGA 2J1UA 3OSDA 2ZX1A 4I3PA 4B4PA 3P3NA 3W59A 4AVCA 3KT4A 1YFUA 1POV0 5I0DA 1U5IA 5K7PA 4FAGA 3KVBA 1H1IA 1OVSA 2V5YA 2VG9A 2VZQA 2OYZA 3R6SA 5IK7A 3AXEA 1MEC1 4AFAA 2MNGA 2JG8B 4LBLA 1RHI2 1Y43B 3URFA 2JDKA 3VBRA 5BNPC 2JX9A 1BEV1 1OA2A 3U14A 4LBMA 2XMLA 4L2NA 3WDVA 1H2LA 1JN2P 5L9BA 3RZMA 3WNKA 2VAUA 4D7SA 3S30A 2ARBA 4Q0QA 3RZJA 4BH9A 4JHTA 4DOUA 3I3MA 3KHBA 4L9BA 2WN3A 3H3ZA 2GC0A 4R9CA 3FLRA 2K2SA 2QQKA 1GWMA 5EXOA 1JW6A 3QACA 1MVQA 1XQNA 1R083 2VMHA 5FY9A 5F6LB 2G9FA 2ARCA 3QD6A 4U2AA 4HKWA 3FMGA 1CIWA 2QQWA 4BWOA 3POWA 4P08A 3ITQA 5DAPA 2DBIA 4A41A 3NL1A 2FQPA 2JD9A 4HK9A 2NN8A 5FZ3A 1JYWA 5CB7A 4ASMB 1MS1A 4FQ4A 1EUUA 4AVVA 4MGZE 4CDWA 3WLUA 2P37A 2WNUB 3QOPA 2WKKA 1ASJ1 3NV3A 5T5PA 4GALA 2WL1A 4MV2A 3PLQA 4PDWC 4TZDA 1EPZA 1JU4A 5M0TA 3OGVA 4UFHA 1AR92 2XJRA 3VL8A 3NO8A 5I0TA 4I0BA 1LOAA 5A3LA 3HBKA 5FMBA 1POV1 1DIWA 3ZKYA 1CJDA 1JUIA 1LU1A 4HT1T 1UWWA 3H3LA 3OJBA 3Q8FA 1UU4A 1GNZA 3ORJA 5D8AB 5K8SA 1DYKA 4IEVA 3LEKA 2ZAHA 3E6CC 1YNAA 2FCVA 5KC6A 1GP6A 1Z7S1 4Q2FA 4OI2A 4PLMA 1NUKA 1AR81 3NW4A 2XL9A 1BK0A 4RQPC 1Q3EA 4AFCA 5JI7A 3PJQA 3SMHA 2YBKA 4QKDA 3J8F1 2QQVA 4FXKB 3VB9A 1DQ1A 4EE2A 1QJFA 2HEWF 4J1WA 2BU9A 4IE7A 1ZRFA 1AX2A 2VQUA 2IXHA 2A70A 1Q8PA 3A22A 1VBE1 4OZOA 5FXWA 3WX5A 5JOZA 3KQ4B 2RM23 3LA3A 4IDZA 1UD1A 3F2ZA 2QZ2A 2WFF2 3RZGA 1SLIA 4FFGA 1T6GC 1VJ2A 3LPGA 2R32A 3KT1A 3DKQA 4RGKA 4MHUA 3NNGA 4YW4A 4GWJA 4XVHA 2YGLA 1YIPA 2NQYA 5J48A 3OYWA 2WZ8A 5DZFA 5KWRA 1JZ4A 1O5UA 3MEPA 1VRH2 1X33A 1ZNPA 1SQ4A 1AYM2 3RGBA 3LIHA 1AHSA 1NCRA 4LO7A 2ZTNA 4N53A 5F2SA 4YVWC 3MO4A 3CO2A 2D6PA 2WYFA 5JR2A 1RITA 2XBO3 2WAOA 2JDYA 3BOPA 3MLKA 3WDUA 5J09A 2YY1A 4AI3A 3BTXA 1WBLA 2I2SA 2W92A 3V0AB 4E4ZA 2EA7A 4I30A 2RMU2 4B1MA 4BPZA 3WG2A 3VHOA 1PO12 4YGBA 5LBFA 3OUJA 1HRV2 2YB7A 2DYCA 3PJYA 1TVGA 3IDCB 1PM7A 3IZOA 1LOEA 1XYOA 3I59A 3K3OA 1COV3 1CZVA 5LW9A 1FI2A 1TNRA 3SHRA 1RUE1 1BK1A 2WA4A 5FO7B 3SKJE 1J1LA 3WQ1A 3I2GA 2YGMA 2ZHKA 3ZSJA 1WWYA 4TYSA 2CAVA 4NO4A 4UW5A 2ZX2A 1FOD2 1WW4A 4P9IA 4V1PA 3IDAA 1XSRA 1W8HA 2UU8A 1H30A 5FYMA 2VZ3A 3ZYGA 2WNVB 3WP4A 2V73A 3K4AA 5FZGA 4Y24A 2ZBJA 5AC93 3CF6E 1BEV3 4YGCA 4N43C 4AQ6A 3VBFB 4FTSA 4UBGA 4BIOA 3WSOA 1TMF2 4DS0A 1C3HA 1I5ZA 5IWFA 1OFNA 3FHIB 3M4FA 2DF7A 5DDJ2 5T3NA 4GKXA 5A33B 1G9CA 4QM9A 4AK3A 2VOVA 5FY5A 1C4RA 4KG0A 4LIUA 4MZUA 4ZKTB 2HWF1 2XJPA 5FLIA 4R8HA 1J3QA 4WM8A 5D21A 4QPGA 4CEYB 5CFCB 5C8CB 5LEKA 2AZ5A 2R061 2W1QA 3O1VA 2ZABA 3B02A 1GOGA 4LBQD 1QU0A 1ZBA2 5FZ4A 4BMEA 4WM7C 4DY3A 4IETA 2GMPA 3TNPB 2PQSA 4CDUC 3K4ZA 4RFT0 4MYEA 2FZ1A 2RS12 1AR72 2GZWA 3B94A 5LRRA 5JSRA 1YWKA 4YGDA 4I02A 2CTVA 1LKNA 2ZA9A 1RUJ3 3ACLA 3GM8A 3TBDA 4Q4W2 2H6CA 1WUVA 3N7MA 2VTXJ 2WNEA 2DTWA 1QJX1 4O61A 4DZGA 1QXJA 2ARXA 1K3IA 3MW4A 3R0RA 2GNBA 5FQ0B 3ASIA 4WVVA 3SNMA 2FMYA 2HBUA 1LGBA 2PHXA 3O7OA 3QCWA 1JS9A 3HIFA 4N7UA 4XBLA 5FZAA 2Q4SA 4BISA 5FLJA 3AB0A 5IFTA 4HG6B 1I6XA 4HPKB 5CFDA 1SLTA 1VP6A 3O1MA 3T2OA 1GANA 1YFWA 1O6UA 2VZVA 5CKMA 4IERA 5IK5A 3CZJA 1N1TA 1JOPA 1AR83 4JGZA 1JUHA 3NRUA 3JD72 2PN5A 4XF3A 1Q5OA 1W6NB 2RR11 2A7AA 3THCA 1RUD2 4FBFA 2Y8KA 2BVBA 4GMP0 1UZZA 2PTMA 4L97A 1DCSA 4Q29A 5EJ3A 3V65A 5C5TA 5FOBB 4XACA 1JZ6A 4OULA 1RUI2 3APBA 1G9AA 1HXS3 3PMSA 3ZFFA 3ZXJA 1PK6B 1W6PB 4Z07A 1RUH3 3H8XA 1QJY1 3AXDA 1ZBE2 2CGPA 3RQ0A 5FYIA 2WFPA 2Q1FA 2BNMA 2WN2A 3FX3A 5LBEA 4DIQA 4P9GA 3FL7A 4PBOA 3C7EA 4RHV1 1G9DA 1UZWA 1NLQA 1O8PA 2YBPA 4FVVA 3I2HA 4MH0E 4Q4Y1 4P9XA 2J1TA 2W08A 3BTAA 4RN5A 2W1SA 4PJYA 1K5MC 3MICA 5C5UA 2YC4A 4XFAA 2XWJB 4MLOA 1TE1B 2HWE1 1HV0A 1I1EA 4WZCA 5F3IA 4TSVA 4PF5A 3MPPG 5FYCA 2VW2A 3IDEA 5JDBA 3HD8B 2VTFA 1JOBA 1NLRA 4XQWA 5BNPB 5KC5A 1W2AX 2BZDA 1F5JA 5E16A 1OQ1A 2G9GA 4Y20A 3UKVA 4XAEA 4QQOA 1EV11 1NLSA 2ADEA 4QKFA 4QT6A 3WNOA 4F3JA 2BBAA 3D8CA 3T2PA 4DO0A 3E5QA 3USUB 1NYWA 2Q1ZB 4EQVA 1AXKA 1K5JA 2VD7A 3L2HA 1BMV1 1PO23 2YU1A 2IXIA 1SLAA 3O1OA 5A33A 3CBNA 4BMBA 1GOFA 1W9FA 4XBQA 3AFGA 2XUMA 2XUEA 3MLLA 3OGGA 4E27A 1RUC1 4Q1PA 2X05A 5HI0A 3O1PA 2PXJA 1IPJA 1XNTA 1DYPA 5FFOC 1DGRN 2YG0A 5A6QA 2QNKA 1DU3D 1KFUL 1RUE3 4P5YA 5C8CA 5CFCA 2O14A 1CONA 2R073 5GZDA 5IHRA 1UY3A 1IZ3A 4NMIA 3WY6A 5E6HA 2WNOA 1RMU3 4GAZA 1CJPA 1OF4A 1ND2C 3T1LA 5KXEA 1JYIA 4LO6B 4MGKE 1RHI1 2VNRA 1QMJA 2A6YA 5T5LA 3BVCA 4PDWB 4E2GA 4D6RA 4ZU4A 4QX5A 4X8NA 4A3ZA 4EN9B 3KV9A 4Y4YA 2VCBA 4H2AA 3ABZA 4LA3A 4D94A 1XC6A 2X5IC 4QGMA 3O1RA 3FZ3A 1VPHA 3QH7A 2UWBA 3THDA 2VZTA 3VKFC 4BIFA 3UNPA 3INAA 2CYFA 2O0OA 4Z82A 2SLIA 4FPYA 4XEZA 1RUOA 1W05A 4BQWA 4BYYA 1ZZ9A 5IVFA 4BK5A 1LODA 5JSOA 4DEVA 1W2OA 1ULGA 1SDWA 4LE3A 3ZXAC 4LOSA 1XSQA 1QQP2 4LLFA 3TN93 4QQHA 1W6PA 1HB2A 2BV4A 3KD4A 5C9AB 2G19A 4PT6A 5F6KA 4CDWC 3GF6A 2MHFA 2JIGA 5CVRA 1LOBA 2QCSB 1D7PM 1LNSA 4FPCA 3CIHA 2Y0OA 3FUOA 2LALA 2P17A 3KB5A 3WF2A 4CDQC 4AL9A 1QJX3 4YW6A 3VDDA 4XABA 4HKLA 4O9GA 3UV9A 1GZCA 1C8M2 5BNOC 4EZ4A 2PLV3 4NIHA 2VMGA 3ZFGB 5LRSA 3UJOA 3PVBB 5JLVA 5K0UA 3W21A 2HWC1 1S0EA 5GZGA 1NCQA 1PVC1 4OHWA 3U37A 5A3TA 5IATA 4XTMA 5FK7A 5A3OA 1SHWB 4FPJA 5DQ0A 2VUDA 4YVWB 5LA9A 2VNGA 2C9AA 4RL7A 5DPNA 4XFGA 1IG0A 4IGQA 5JXIA 3HNYM 3OEAA 3I2IA 2A5ZA 4YVSA 1RUF2 3HOBA 3SH4A 5F39A 3ZXLA 1OBNA 2Z42A 5HCBA 2GMMA 4DUVA 2QQIA 2EXKA 1UNBA 3ILFA 1C8NA 1GLHA 1O3SA 3KCCA 4GWIA 4LUMA 2IWGB 2WZR3 2VZRA 4LJHA 4NRMA 1AX1A 3RZKA 3WF4A 1NXD1 4Q4Y3 3WHUA 4D3WA 4P00B 2XHKA 1WLWA 4XDPA 1VLNA 2BOIA 2WFF1 4BQYA 5FYTA 5A1LA 4ES8A 3P6BA 5FRAA 2JE7A 4KU8A 4YFWA 1LHWA 3LDKA 4Y5Z0 5JVVA 4OHYA 3AK0A 3M7AA 1US3A 2GH8A 2XKOA 4ITCA 4ARXA 2JG9C 2CAUA 2ZEZA 3OUIA 1VRH1 2PHUA 3I3DA 1AYM1 1HB3A 3HEIA 3BCWA 4XXAA 5FXXA 1NXMA 1IS4A 2E6VA 2RVAA 1NCRC 5DN2A 1DZQA 2BDRA 3B01A 1O4ZA 2HH9A 1UX6A 1SLLA 4JKLA 2DUOA 1R091 3EJKA 4KWKA 3ZSKA 3AYDA 3VGIA 4XAAA 1RYYA 2XONA 3U4XA 2QQPA 1DYOA 4Q4V2 2C26A 4LHKA 4IUGA 4R4XA 3NNJA 2AACA 4WVWA 5DG1A 1N1SA 4XPVA 4YWAA 3AFKA 3N9LA 2RMU1 3JBG2 1MS4A 3TYJA 4ATEA 1YUDA 5CKNA 2AUYA 1Q8QA 3BUCA 3M8LA 1PO11 4EN8B 2VBDA 1JTZX 3E1F1 5CG9A 1HRV1 1WZXA 4IESA 1ENXA 4O9EA 1RUC3 1VBB2 4OZXA 1WMFA 3GDBA 5FPLA 3OGJA 5GALA 3WW3A 4A42A 4MOAA 4CDXB 3GZAA 2P6HA 2PHDA 1OQEA 2QQLA 3ZMOA 2ZEXA 1PNGA 1MR5A 2H0VA 4AI9A 1XBFA 3VZLA 1M06G 3RFRA 1ST8A 4WM7B 5JPNB 2VVFA 1ND3B 4FTEA 2BYVE 3HBZA 3OD0A 4XJUA 4CDUB 5A3NA 1FOD1 4KGQA 2YU2A 2ZJCA 5IVBA 4OI1A 5C9AA 1GNYA 4HSLA 2JDAA 2E9QA 2FD8A 2GNMA 4AVSA 1KJLA 1W6OB 3RI8A 2NP0A 2RV9A 4W50A 5JIAA 1TME2 4GH4C 1TMF1 4C91A 5CU1A 2D5FA 2XQXA 4IEWA 2HWD2 4YW1A 3ZN6A 3ME2A 2DCTA 3TEWA 1GBGA 5DAWA 4AI1A 2RS53 1JZ7A 3ZXGA 5F3GA 1X9PA 3WNPA 4JTNA 4LORA 4G4FA 4CUBA 5A7QA 4HKOA 1BVP1 4JKKA 2OXBA 2JB4A 1AYN2 4QB2A 4CU7A 1C28A 4PI2A 4LBQB 3UYJA 1AR62 4ZZ5A 4Y22A 5A7WB 4XE9A 5I91A 4WVMA 1ZBA1 1VIWB 1MQTA 4LOTA 4QQPA 1LECA 2QE3A 2XVLA 3R05A 1X36A 5JWPA 4HETA 4UF0A 2RS11 5CKQA 5LY2A 5ABJA 1CPMA 2EIGA 3NAPA 5C4WC 3UL2A 3S6PA 1K45A 3IIAA 1OLRA 2A6XA 2UWAA 5T52A 4Q4W1 2EAKA 1K5MB 1SLBA 3DV8A 4V2VA 4LNVA 1U5ZA 4EN0A 1B35B 4OYUA 5JR7B 1PZ7A 3EHKA 4MSVA 4QX2A 4Y1YA 1XRUA 3GGLA 2HWC3 2Y34A 1VBA1 5FZ8A 1PVC3 2W46A 5DABA 3O1UA 1D4M3 1HV1A 3FFZA 2EXIA 2CDPA 4M0HA 1QJZA 2P2KA 2D3RA 4KWLA 5BNNC 3M70A 2V72A 2WT2A 4DUXA 4Y5SA 3OPTA 3BOWA 3W58A 3PUIA 4CPBD 3ZYPA 4BCUA 1RUD1 2WC2A 1Z78A 1YI9A 2C9KA 1W06A 2WDBA 4X6QB 5HCFA 1DGWA 4HANA 5I0SA 1RUI1 2E7AA 2BOJA 3CJXA 3IMMA 4R52A 4QX3A 5IVYA 4ATFA 1F5FA 4OQ9A 2HLEA 1ZBE1 3ZYJB 4Z2AA 1VBD2 1YQ5A 1H2NA 2HJIA 5GZEA 2FMDA 1UZVA 2FDKA 2DU0A 4JAAA 1FATA 3IN9A 1VE0A 4E8DA 1IHMA 5L9RA 3WW2A 1CR7A 5A1AA 2RG4A 3WCSA 1W6MB 4LKFA 1PIV2 1CX1A 1H1MA 3MZHA 4JQRA 1W8WA 4JGYA 1CAVB 1ZREA 1VAKA 1ND3A 1VMJA 4J25A 4COZA 1IS5A 4FTBA 3I97A 3DCQA 2P3YA 2YZ4A 1ND2B 4K20A 3PUAA
chains in the Genus database with same CATH topology
1Y9QA 2A6VA 5DUWA 1MVEA 5BUVA 1S2BA 5E1RA 1R093 4BHPA 3KGLA 1EAH2 1G7YA 1IS3A 1WLTA 1VB4A 3PVEA 5KHHA 4HLTA 4DY5A 3DPRA 2MEV2 1RUG2 2RMU3 1QH6A 4DRRA 1VALA 3WNXA 4K7JA 3WZ1A 2HEYF 2N7GA 5FOJB 1VBC3 5GJ6A 1H8TC 4EROA 3AZZA 1D2QA 3B9IA 4PIXA 3GBFA 1RTVA 3FLPA 1R1A2 2ZGQA 5ACA3 1FOD3 4AI8A 1LJ7A 2PHWA 2D6LX 3EQEA 4YZ4A 3VBUB 3ZFEB 5FPXA 1H4GA 1F2NA 3NV2A 2P34A 3MI8A 1MZFA 2RS32 4IEYA 2XH6A 5BNOB 4KG8A 1NA1C 1XNCA 2E53A 2JD4A 3BIWE 1UL9A 2A3WA 3CNAA 3WHTA 1FPN1 2TBVA 1H4HA 1N3QA 2VVEA 3KMHA 4AQSA 3VBOB 2PA7A 2ZKLA 3GBWA 4CEWC 3R4SA 4HSJA 4HK8A 3LB9A 1MZEA 2QVSB 4RGGA 1JOJA 4OHVA 1QQP1 3S7EA 1B09A 1FMD3 2DWRA 5C6CA 2NLRA 2RS13 3LGRA 2GMEA 4M01A 1CQ9A 5EFUA 5AVAA 4Y1XA 2BEOA 3NJZA 5CBLA 1PZ9A 2I07B 3AYAA 2WWSA 1PVXA 1XYPA 2D98A 4RA0A 4KU7A 2XWBB 1C8M1 4LBOA 3OBRA 1RB8G 3KQRA 1QJU1 2JG9B 3OCPA 1VBA3 3OPZA 5K0UC 4N9HA 3VHRA 1N1YA 4XBNA 4JVAA 2C0ZA 1NE4A 4XHXA 3W9AA 2H6BA 1IKPA 4YM0A 2ZOEB 2PFWA 3FC0A 1LHVA 1RUD3 4TWTA 2IXLA 4IV1B 2D43A 1LTEA 4KH9A 4AHXA 4HN0A 3AZYA 1RUF1 1Q8VA 4PBPA 2CWSA 3VBHC 1ZZ6A 1BQPA 4P9WA 5AFEA 1ONAA 2DUQA 5CIRA 5SV8A 3WV6A 4HFSA 1W0PA 3B7MA 3H1MA 3FBMA 3KM5A 4J1XA 1DZRA 2A71A 3LWCA 4QPIA 3V64A 1DDLA 5EWSA 1V6NA 1LGNA 3ZXDA 3N7KA 4YW3A 3ZFEA 3ZMNA 1OFSA 2VUJA 2D6OX 3GNEA 5BV6A 2BUKA 3DUIA 3ETQA 5JZGA 4XF1A 2XLGA 1W6QB 1ZZCA 1S2KA 1LEMA 4DRVA 1G9FA 3DL3A 4XFHA 3H9AA 3LOIA 3JBG1 4COYA 1CAUB 1TNFA 5B2GB 1YHFA 4C90A 1LHUA 1RVF2 2BTVC 2ZX4A 3M1HA 4BA6A 2IC1A 4YGEA 2DV9A 3HT2A 3KGZA 3RJ2X 2WZPP 3ZXEA 4XFFA 2TNFA 2GAUA 3MYXA 1G6NA 5DUUA 1XNKA 4ZU5A 2DURA 1X82A 3BALA 4KL1A 4P9LA 3WG1A 1AL21 2YROA 3WDWA 3VZOA 1S1AA 3E5XA 2JG8A 4FOWA 4RSUA 5C4WB 3THTA 1V9U2 4PCRA 1SACA 3KCYA 4JCKA 1JH5A 1YI7A 1H1AA 3CEWA 4FO9A 1XYNA 2XJSA 1QOOA 2D6MA 4QPYA 1WGPA 1TME1 3LSDA 4P14A 1AL0G 3U10A 2HWD1 3CJIC 1FPN3 1DF0A 4B4QA 3RWNA 4CP0A 4AFMA 1HRI2 1LHOA 5BNNB 2RHPA 2A3XA 1H2KA 3ZN4A 5BNQA 2VOKA 5H9QA 4D7YA 3AYCA 1PGW1 2CL2A 5I8YA 3TOJA 3O12A 3JQWA 1OOPC 1AR61 4A2UA 2DVBA 4IV1A 3B3QE 3A0KA 4JDOA 4C1XA 4RR3C 3AZXA 4CYDA 1DQ2A 2VGDA 1MEC3 2DVDA 2WLPA 3OD4A 3THPA 1WMDA 5GLTA 2WNUA 4K9SA 4CP2A 3NKGA 4YG3A 1WW6A 2Q5TA 4K40A 3AJZA 3C2UA 4MXWB 3NAPC 4IV3C 4XQ4A 3WDXA 1GNHA 4YW2A 1LR5A 3MIHA 3MF9A 3WD5A 5CAZA 1FNYA 5H9RA 2OW4A 2VXRA 1V70A 5IUQA 3ELNA 1FX5A 2DVGA 1QJU3 2CV6A 1BVVA 4AHZA 5D8AA 3VBSB 2JECA 5FREA 1I9RA 2DCYA 3SCFA 5K9YA 1VAMA 4DXZA 2ZGRA 3E6DA 2YUEA 3VLBB 3EXUA 3ZX7A 2Q0AA 3ZXFA 5FBZA 5BYNA 4EWAA 4RGAA 3AP7A 1ULFA 1AVBA 1V6LA 2ENRA 4QQLA 4IEOA 4XW3A 3WQ0A 4GXLA 1ASJ3 1UKRA 5LK7B 4P9YA 2R041 2A75A 2B7YA 1WD4A 5J37A 1H8TB 1XU2A 1YJLA 2HWB2 3ZPYA 1G86A 4FPOB 5GLUA 1CAWB 1POV3 4XYXA 1C57A 1C1FA 1QY4A 1J1TA 1PIV1 2VY0A 2X53S 1GFF2 4FPEA 4M3CB 4LHNA 2JJ6A 1DZTA 1YJKA 3RG0A 3IPVB 2VOXA 2ZAAA 5HCAA 1Z7S3 5ABJC 1ZRDA 3GBGA 4QGNA 3GZTB 1NY71 3MFCA 4Q0SA 3U0ZA 1LRHA 4GKYA 3ROUA 4AEDB 2ZHLA 4XFIA 1EAH1 3H7YA 2VECA 3RI9A 3J8F3 1NA1B 4J6GA 3V0AA 4U36A 4HMZA 5I93A 3ST7A 2D5HA 3I54A 1EP0A 4Q4X2 4WBBA 1VBE3 4B8EA 2E63A 1IPKA 1GYKA 1KRIA 1NE6A 4RS5C 3MIDA 4CEWB 3ILRA 1H8VA 2ZMNA 4LEJA 2BNOA 3QBQA 2LTNA 1R1A1 4Y1UA 2FZ2A 1DQ5A 2DFCA 1AL23 2WNVA 4NPRA 3CL1A 1SBDA 1UMZA 1H9WA 1SFYA 3VBFA 4LBJA 1UCXA 3PHMA 3ENRA 4JC1A 2RS31 4AFBA 4EJRA 2E7TA 1C5IA 4WVZA 1S0IA 2QKDA 4AHWA 4EN7B 3WXPA 2AH2A 3PNAA 2ZMKA 2EXHA 3VN4A 1QHDA 4XDQA 3VBSA 2VOWA 1N47A 4M00A 4I09A 3SH5A 2OZ6A 2XLFA 3FFQA 1QDOA 4GMP1 2GSYA 1RL3A 4CEYA 3LZZA 2NPIA 1FV3A 4CZSA 3D4KA 3B9CA 4Y26A 4QQ2A 2XJVA 4XILA 4L99A 4LTAA 2XLAA 3MDPA 2ZGLA 3VBHB 2DCZA 5BXXA 2CGNA 2ZMLA 3VBRC 4META 2RM22 2ZCWA 3N3HA 4G3YC 1GZWB 4HZFA 4A7KA 5FQ0A 1Q8SA 1MZ5A 2OUJA 2WQ4A 3EBRA 2TUNA 3NWKA 1OQDA 3AYEA 4HPKA 4R9BA 2I74A 1A8DA 2A73B 1X50A 1MZ6A 2HWF3 3B00A 1YCIA 3H7JA 2VU9A 3IKWA 3E5UA 4Q0PA 5T5JA 3GHNA 2XBO2 4RQPB 1W6NA 2WINB 2R063 2W52A 2XVKA 3JQXA 3AZWA 2YDEA 3CLPA 3O5SA 1PK6A 1PNFA 1VB2A 1UIJA 3I4IA 3RYRA 2PHFA 2PHLA 4W65A 4K1ZA 4S2HA 5JAXA 2BWAA 2R043 4MVTA 3FE5A 2EF6A 2D44A 1COV2 4D69A 1AR91 4B7KA 1MS3A 4GB32 1QH7A 2B46X 4NWVA 3ILNA 1FNZA 3H0OA 4QPIC 5GLWA 2JKBA 3LCPA 3WP6A 5BNPA 5AC92 1BEV2 3M3EA 2RR13 5SV5A 4DQAA 1DGRA 4GWMA 4B29A 4JRLA 5JZGC 2Z69A 3O14A 4YSFA 2ERFA 2VNOA 3USUA 1HQLA 2Q8OA 1AZDA 1FV2A 3VZMA 1QJY3 3HR9A 4AVAA 2QDNA 2ZKNA 1H0BA 1W2UA 2PQQA 3JCIA 3LAGA 4NHKA 4RHV3 5KHIA 2UWCA 5EYXA 3U07A 4DMIA 2ILMA 1UW8A 3QH6A 1RVF1 1PMIA 1UAIA 1LB2A 1VAVA 1OOPB 3IBMA 4XJ9A 2HWE3 4MGIE 1S0DA 4RR3B 1OHFA 1PGSA 4CRQA 2XJQA 3NV4A 1KDKA 5DUXA 5JSPA 1HQNA 2JG8C 4C1WA 1CAXB 1AX0A 1ENQA 3OF1A 1V9U1 4IV3B 4N53C 2IXJA 4N43B 4XMIA 4AI2A 1RUJ2 1EV13 3LA7A 4PDWA 4DPNA 3AP4A 3G6JB 2BVVA 2W39A 4IQPA 3AZVA 3DF0A 3AJYA 1DQ4A 4H7LA 5FCCA 4IEUA 4Q8LA 4PQ9A 1L3JA 4AI0A 5E8AA 4GMP3 2NM1A 3OY8B 4COVA 2AENA 3RJRA 3H50A 4XZPA 2KM2A 1HXS2 1MS8A 3I2DA 1SLCA 3MFAA 4FPLA 4UW3A 5J3UA 1RUH2 1QDCA 4FOVA 2ZGNA 1AXYA 2WNUC 1RHI3 3BPZA 3C3VA 4YM1A 1KS5A 1SBFA 4AYUA 1AUYA 4BOWA 4AE2A 2P3IA 3AMNA 3ZFGA 3V0BB 5DDJ1 5C33A 5I0RA 1UPIA 1V6IA 2PAKA 3MPBA 4Z92B 1UIKA 2DCKA 5D1IA 4H7MA 2RE9A 1KS4A 1Z0HA 3WDYA 4YVWA 5TSWA 1GQHA 5GZFA 2EAAA 4WM8C 1YRZA 4NHMA 5FPZA 1BKZA 4QPGC 5FO8B 5L7OB 1D2SA 2BNNA 1F9KA 3ECQA 1NZCA 4I01A 1PO22 2P3KA 2HEVF 3CU7A 5E88A 2WIIB 1D0GA 3G7DA 4IXLA 1AR71 2AYHA 2B8MA 2VUAA 5A32B 3HAGA 1W39A 3DKWA 2KA3A 4RS5B 2QFEA 4COWA 1REDA 3HT1A 4PLNA 1HW5A 1BYHA 3JU9A 1GZ9A 4LR4A 4YZ1A 2HWB1 1AR93 2JDZA 2ZGUA 3QLQA 4ES9A 3RMXA 2YPJA 2R072 1QXPA 5EV7A 5LEJA 5CFDC 4JDNA 4ORFA 1RMU2 2B5HA 3WUCA 3SCGA 1X7NA 5JOYA 1O3QA 2C1FA 3HN1A 4JGZC 2CWMA 3JD71 1BCXA 3ZSEA 1V00A 4LLOA 2BFUS 4XFCA 2ZZJA 2GDFA 2YV8A 2ZHMA 5FO9B 5EZWA 1V6JA 3I7DA 3ZFFC 4Q4X1 2MPFA 4A3XA 1MS0A 3RPQA 1QWRA 5CADA 1MS5A 2R0HA 4R4ZA 2WS92 2WFF3 4AQ2A 5HBAA 1NG0A 3NSTA 4CDXA 1I3HA 1S0FA 3LOBA 2NMNA 2UY8A 1F8VA 2GC3A 4C0BA 3AMQA 1SEFA 4WM7A 4E4SA 4FAHA 3PVNA 3TN92 4CDUA 4YG0A 1R1ZA 1VRH3 1DGLA 1AYM3 2ES3A 1QF3A 2D6NA 4URTA 4M3CF 4QMAA 3VBRB 4AVBA 4F83A 4DFSA 1JYCA 2C5DA 1IKQA 1W6OA 2GNTA 4FXGB 4Q1RA 1KD7A 1QJX2 3B93A 5JI9A 2LUWA 3N36A 3S7IA 1LHNA 4I2OA 2XPJA 1URXA 2PLV2 2X5IB 4XF4A 3MIEA 1HQWA 1RC6A 1WLCA 2RJKA 4JDMA 5IK8A 2Y26A 1PO13 1DGWX 1HRV3 5T54A 4OUMA 5DXDA 1JHNA 2XL7A 4BM8A 5JIUA 1XXNA 1OA3A 1M4WA 4KWJA 3AP9A 3SH3A 1RINA 3N4MA 1J59A 4LBQA 5A3MA 4CEYC 4YZ5A 5C8CC 5CFCC 1YFYA 3AKTA 1MS9A 2ZGOA 2A3YA 3K48A 4CDWB 3J26N 1SCSA 2WZR2 1Q8OA 4UW6A 4CDQB 3MIBA 4GA9A 5E89A 3RSJA 3USSA 2DFBA 2B39A 1TMF3 1EPWA 4AFDA 2WA3A 1K5MA 3AMPA 1J58A 4UBHA 4BQ1A 1B35A 4Q8KA 5EYYA 5KHJA 3I8TA 5DDJ3 3IWZA 3H8UA 1LOFA 2IXKA 2V09A 1A3KA 2YC0A 4AGVA 3TRSB 1CN1A 1F31A 1S0BA 1NQDA 2BWCA 2R30A 4FPHA 4HVOA 4R9DA 2XBO1 4E9KA 1ZBA3 2Z2SB 1DG6A 1BMV2 4KQ7A 2Z5WA 3SITA 2BPA2 1PK6C 4OI4A 3AKQA 2HKXA 1AR73 4E2QA 3FLTA 1X8MA 4PIYA 1RUNA 1RUC2 2PAMA 2QUOA 4Q4W3 3S0MA 5JPMB 3RMYA 5T50A 1C5HA 3VDDC 4A7ZA 5FLHA 1W6MA 4GB31 1HKDA 5L36A 1CAVA 2VH9A 3OYWB 4FT8A 3NKTA 4N90A 5IT6A 5J96B 1WA4A 1NCQC 2ZGPA 1ND2A 1NCRB 3UK9A 2LM3A 1WBFA 5T5OA 4N53B 1UF2C 2VQAA 4LBKA 2DUPA 1S0JA 5AC91 2EXJA 4K8FA 4EV0A 1EY2A 3JD73 1WMEA 4P5HA 4MUVA 4W6YA 2IFWA 4K1YA 3GHMA 4GWNA 3WG3A 1RUI3 3J9SA 2X5IA 4YVSC 2R6QA 1ZBE3 2RS52 4Q4X3 4AVTA 4DINB 4INDA 4AQTA 1V6MA 4Q0VA 2JXAA 3I59B 2GH2A 4XJ8A 1REFA 3D6EA 3ZVXA 2BW8A 1AXZA 4R9AA 4LHLA 1FXZA 2D97A 2GNDA 5CG8A 4IEPA 5KBFA 4RD7A 2Y38A 3VBUA 2UURA 2QZ3A 3KT7A 3KCXA 5HXVA 3ES1A 3M3OA 4CDQA 3RYKA 1RUJ1 4GH4B 3T1MA 1QOTA 3U11A 4BE3A 1NQJA 1S0GA 4Q4V1 3WCRA 5BNOA 2WSVA 3GALA 3FUQA 5L19A 2ZS6B 4KBBA 2HWC2 2H0BA 1PVC2 3D0JA 1D4M2 1UN1A 3VBOA 3ZIWA 1GQGA 4FP3A 3AM2A 1VBB1 2WT1A 4WM8B 2VQ0A 4N9IA 1WCKA 4QPGB 2ZACA 1RIRA 1HDKA 2CNAA 4Y1VA 3ALQA 3AMHA 1TQ5A 1HXS1 1RUH1 1G8WA 5C9AC 4LO4B 1LEDA 3UKNA 1ULCA 4NVPA 2IFRA 2R1BA 2JE9A 3H1WA 2Q30A 3TB0A 3WQ7A 1DQ0A 1J3PA 2KXLA 2ATFA 2X29A 4NR1A 1LOCA 5JOWA 3ZFGC 4K6BA 2JG9A 1XNBA 5CFDB 1ULEA 5JCTA 3MW3A 5J98B 4Q26A 3DN7A 2BQPA 3IT8A 1AYN1 5KXDA 4JGZB 3VV1A 1R092 2DVAA 2ZPXA 4HVRA 1ZRCA 2GN3A 2JEMA 4LBNA 3TAYA 3P3PA 1JXNA 4IL7A 1QQP3 3RS6A 4EWEA 3ZFFB 1MQTC 3VZJA 1PO21 1AJOA 3WDTA 3IM0A 4NHLA 3VHPA 1A8MA 2OVUA 2OIIA 1CGPA 1PGL2 3LKJA 3SLIA 1VBC2 4QGLA 3FWEA 1ZRRA 3RNSA 5F9TA 4AF9A 4GB33 1C8M3 4ISRA 4AGRA 2D3SA 3WOGA 1N3OA 4C0HA 5C8WA 2FHRA 3AP5A 1AF9A 5LK5A 5ACA2 2R071 4XFBA 3WW4A 2DVFA 2R49A 4X8PA 3ZYIB 1RMU1 4F8AA 1CPNA 1RJ8A 2R0FA 4IEXA 1YYNA 2D3PA 1YXWA 4S2FA 4XXPA 4Y20B 4LT5A 4HBNA 4GH4A 2RJLA 2PYTA 1W6QA 1WW5A 1RUF3 3D82A 4BLIA 1WCSA 1H9PA 1IS6A 1CAUA 1VBD1 1ZA4A 1APNA 2EALA 4QD2A 1BBT2 1A6CA 4LE4A 2WS91 1W0OA 5DUVA 4CTEA 5GLVA 1C1LA 1UKGA 4FPFA 2W0XA 3UKTA 4CDXC 3O0XA 5CNAA 4JTOA 5KHGA 3AP6A 1QKQA 5FDBA 3H3UA 3POYA 4JGYC 1BJQA 4H55A 2OUHA 1SBEA 1FMD2 1ND3C 4XF0A 3TN91 5J7MA 1V6KA 2X8KA 3GYDA 5I8SA 4BLJA 1LULA 2D93A 5C4WA 1D0HA 3E6BA 4NOTA 2NYYA 5KXBA 3AKPA 1TEIA 4YM3A 4I0AA 1EYBA 1OPOA 4Q4V3 1FYUA 5CA6A 1Q56A 2PLV1 3DPRC 1OMIA 2MEV1 4AEKA 1RUG1 1HLCA 3JBG3 5KXCA 2B45X 1VBA2 3RZZA 3M3QA 4FOYA 4YW5A 1DLLA 4DB5A 2O8QA 1R082 2R16A 1VBB3 1KDMA 5BNNA 4WZFA 2Y0IA 3O0VA 5GKAC 3D0SA 5JOXA 1NOVA 3X29B 4LUKA 3M3CA 3KSCA 5FMOS 5FTTC 1LENA 1SFNA 5JMCA 2BFUL 1O91A 2XKPA 4MXWA 2WZR1 2PHTA 3R4UA 1QXRA 4HVQA 1TME3 4FOQA 3VDDB 3N35A 4EWDA 1ZZ7A 3LSEA 4XETA 4E2SA 4KGGA 2XJUA 4AEMA 4ZU7A 4IEQA 1KQRA 2HWD3 2P3JA 4HN1A 1B35C 1WCDJ 2GC1A 4QU2A 1Y3TA 4XOGA 5K0UB 1O7FA 3J4UH 1JBCA 1LOFC 2UYBA 1NCQB 1HX6A 3TNQA 2ZX0A 3SCHA 1AYN3 2WSUA 3N7JA 1XU1A 2W68A 2SBAA 4PLOA 1UU5A 3JB4C 4L11A 1AR63 4XTPA 1U12A 4XF9A 4YVSB 5BY5A 5J36A 1OSGA 4M3CE 4YARA 1OPMA 2Z79A 3WW1A 3T2TA 2HYKA 3VKNA 3JZVA 1H8TA 3IDBB 4YM2A 2O1QA 2ETEA 3L2YA 1CAWA 3AKSA 2F4PA 3VKLA 1GR3A 4M3CA 2B9UA 2WT0A 1CD3G 1DBNA 3R4DB 4L8QA 3WP5A 2GN7A 3IPVA 4FQZA 4OUSA 3ZDSA 4YFZA 1DHKB 2VVDA 4YRDA 3PTYA 1YLLA 3DGTA 3NV1A 4AEDA 5DZEA 4HL0A 2IXCA 2NMOA 4MXVA 1KFXL 2DCJA 1NA1A 2WQZC 4S2DA 1D4VB 4H3WA 4I0WB 4Y1ZA 1FPN2 3ZYRA 1ZVFA 3A0NA 2RS51 1U0AA 1VBD3 2CY6A 4OVEA 1ENRA 3RYPA 4Z8BA 2JICA 1CVNA 2ET1A 2R1DA 2WS93 4CEWA 2ZGMA 1U5XA 4P9JA 1LGCA 5H9SA 1CESA 4FPGA 1XNDA 3BODA 1PIV3 1CX4A 4OHZA 3WUDA 2XG3A 2Q1MA 3PVOA 4FCAA 3ZSMA 1KITA 3OTFA 3VZKA 2YHJA 3HWJA 1MEC2 3UJQA 4AEJA 5T55A 4EN6B 1VR3A 4FPKA 3VBUC 3ZFEC 4ASLA 3B5LB 3MIGA 1ZZ8A 1GICA 1ZZBA 1OKQA 2QDRA 2OZJA 3MLJA 1J3RA 1EAH3 4PIZA 4B3NA 3RRDA 3BU7A 3CJIB 1O4TA 3ZN6B 2MEV3 2O8OA 1RUG3 1QJU2 4FSJA 3KZ4C 3WR0A 5FAXA 1BZWA 2BBVA 1D4M1 2E51A 1REEA 2B42B 2QJVA 3VBOC 3WINE 3NVCA 5H9PA 4AW7A 4B4RA 4CP1A 3O0WA 3VKMA 1ZYBA 2G4IA 4Y22B 1OA4A 4WVMB 1R1A3 2AGSA 2PELA 1MQTB 5I0UA 3VHNA 2VULA 4DNYA 1BXHA 4K21A 1GSLA 1QOSA 1SCRA 1ASJ2 3E97A 4W6WA 3VBHA 3VZNA 2XB6C 3NAPB 1Y7BA 1ULDA 4E4DX 3EO6A 2RS33 4XJWA 1GZWA 5GM0A 4JV4A 2F6BA 1RGSA 4W6XA 1O5LA 1YIFA 3SISA 3OBTA 4BZ4A 2DU1A 2AR6A 4D7TA 4OHXA 1N3PA 3M2MA 1Z7S2 1HRI1 1AR82 2CGOA 2EVXA 4GQ7A 4LO8A 4RQPA 4ISQA 3ATGA 4M0NA 1Q43A 2FBEA 3J8F2 3LA2A 4IV1C 4K3UA 1E57A 4Z1VA 2ET7A 2VW0A 2K0GA 3MW2A 1VBE2 2D40A 5AVPA 5BPXA 1PGL1 3V56A 2K9ZA 3MIFA 3FBYA 1VBC1 4YZ2A 1XE7A 1ZM1A 1QNYA 2AREA 4TLFA 2ZX3A 4XIOA 2IZWA 3POSA 4JGYB 3Q9OA 3GZUC 4QHBA 5ACA1 1AL22 5D8AC 5GZCA 4X6RB 5ABJB 4FP2A 4GIQA 2XVGA 1FT9A 3BB6A 4OFGA 4AGGA 2YMZA 1LCLA 5IK4A 3WP3A 5F1RA 5KHKA 1S0CA 1UPSA 4Z2WA 3M3IA 2E7QA 3DPRB 1IQAA 1ZX5A 3CJIA 4QXKA 1IOAA 1PHMA 1DFQA 3JUUA 2GU9A 4AHYA 1ALYA 4AXOA 1FAYA 3FJSA 3PMEA 3ZN5A 3ZXKA 2OPKA 3ES4A 1BBT1 4UW4A 3KS7A 4OLLA 4I3GA 1PGW2 4XJZA 1H2MA 1RUE2 4SBVA 1YO8A 1OOPA 4YZ3A 4NN0A 4IEZA 1AJKA 4RR3A 4XIKA 1FMD1 2JENA 2GALA 3TWIA 1CAXA 4IV3A 2TEPA 2UY9A 4N43A 2ZGSA 4NWWA 4YYOA 3ZO0B 5DG2A 3WT3A 3ZSLA 4AWDA 4YNIA 1A78A 5I8TA 3HMYA 3HQXA 1OLQA 4LA2A 2VMIA 4QM8A 3K51A 1UZYA 4ZXKA 5AFBA 2HWF2 3VKOA 4COUA 3A4UA 1RJ7A 1R081 3SXWA 4G9SB 1RVF3 3OY8A 1S55A 4OI0A 2R062 3ZIXA 4MX3A 2YXSA 1YFXA 4UXAA 1ENSA 4JRAA 4LO5B 1O3TA 4YLZA 4AG4A 3B69A 2WNVC 1KXGA 1O4YA 1U5YA 1V9U3 2R042 1LOGA 3JB8A 4H14A 2VW1A 3AKRA 2DTYA 4XQDA 3VBFC 1KJRA 1IGOA 1OI6A 4YG6A 2YYOA 3V0BA 4MGYE 4L92A 4LULA 2ZZQA 1DQ6A 1WW7A 1SMVA 2I45A 2NZ9A 1QNWA 3VBSC 1HIXA 3VL9A 1V6OA 2D6KA 1HRI3 2PHRA 2A6WA 1NY72 1LU2A 5L73A 2RR12 5L7OA 1PZ8A 2PAEA 1WD3A 2WJSA 1O3RA 4A7YA 1QJY2 3KLSA 2XGXA 4KNCA 4S2GA 3MF6A 4RHV2 5A32A 1GV9A 3AMMA 2WLQA 2RM21 4Q4Y2 4RS5A 4XJAA 2ZGKA 1UU6A 3L9JT 1WLDA 1MACA 2GC2A 3IMNA 3N7LA 2ZHNA 2A6ZA 2HWE2 2VPVA 3WVJA 4QPIB 3H1YA 4XHBA 2D7FA 3WG4A 4Q0UA 1QGLA 4Q27A 3RDIA 1LESA 5FMOL 1N1VA 4WV8A 1EV12 4ONUA 4AEDC 5JZGB 1GKBA 4SLIA 2UYAA 3VUOA 1XE8A 3AX4A 3MGUA 1X8EA 3D5OA 5GLZA 2BGCA 1OD5A 2XJTA 1BBT3 2OA2A 5F5QA 1G9BA 1COV1 4XMAA 2HWB3 4F7ZA 4N7IA 2ZGTA 4GULA 5DZGA 2ZX1A 4I3PA 4B4PA 3P3NA 3W59A 4AVCA 3KT4A 1YFUA 1POV0 1U5IA 5K7PA 4FAGA 5IK7A 1H1IA 2V5YA 2VG9A 2OYZA 3R6SA 3AXEA 1MEC1 4AFAA 2MNGA 2JG8B 4LBLA 1RHI2 1Y43B 3URFA 3VBRA 5BNPC 2JX9A 1BEV1 1OA2A 4LBMA 4L2NA 3WDVA 1H2LA 1JN2P 4D7SA 3S30A 2ARBA 4Q0QA 4BH9A 4DOUA 4L9BA 3H3ZA 2GC0A 4R9CA 3FLRA 2K2SA 5EXOA 1JW6A 3QACA 1MVQA 1XQNA 1R083 2VMHA 5F6LB 2G9FA 3QD6A 4U2AA 4HKWA 3FMGA 1CIWA 4BWOA 3POWA 3NL1A 2FQPA 4HK9A 2NN8A 5CB7A 4ASMB 1MS1A 4FQ4A 4AVVA 4MGZE 4CDWA 3WLUA 2P37A 2WNUB 3QOPA 2WKKA 1ASJ1 3NV3A 5T5PA 4GALA 2WL1A 4MV2A 3PLQA 4PDWC 4TZDA 1EPZA 2XJRA 1AR92 3VL8A 3NO8A 5I0TA 4I0BA 1LOAA 5A3LA 1POV1 1DIWA 1CJDA 1JUIA 1LU1A 4HT1T 3OJBA 1UU4A 1GNZA 5D8AB 5K8SA 1DYKA 4IEVA 3E6CC 2ZAHA 1YNAA 5KC6A 1Z7S1 4Q2FA 4OI2A 4PLMA 1AR81 3NW4A 2XL9A 4RQPC 1Q3EA 4AFCA 5JI7A 3PJQA 3SMHA 3J8F1 4FXKB 1DQ1A 2HEWF 4J1WA 1ZRFA 1AX2A 2IXHA 2A70A 1Q8PA 1VBE1 3WX5A 5JOZA 2RM23 3LA3A 1UD1A 2QZ2A 2WFF2 1SLIA 1T6GC 1VJ2A 2R32A 3KT1A 4YW4A 2YGLA 1YIPA 2NQYA 5J48A 3OYWA 5DZFA 5KWRA 1O5UA 3MEPA 1VRH2 1X33A 1ZNPA 1SQ4A 1AYM2 1AHSA 1NCRA 4LO7A 2ZTNA 4N53A 4YVWC 3CO2A 2D6PA 1RITA 2XBO3 3BOPA 3MLKA 3WDUA 5J09A 2YY1A 4AI3A 1WBLA 2I2SA 3V0AB 4E4ZA 2EA7A 4I30A 2RMU2 4BPZA 3WG2A 3VHOA 1PO12 4YGBA 1HRV2 2DYCA 3PJYA 3IDCB 1PM7A 1LOEA 1XYOA 3I59A 1COV3 1FI2A 1TNRA 3SHRA 1RUE1 1BK1A 2WA4A 5FO7B 1J1LA 3WQ1A 2YGMA 2ZHKA 3ZSJA 4TYSA 4UW5A 2CAVA 4NO4A