3M7AA

Crystal structure of saro_0823 (yp_496102.1) a protein of unknown function from novosphingobium aromaticivorans dsm 12444 at 1.22 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
140
structure length
140
Chain Sequence
GGTKTAAEAAAPAVHPVSGLQIVPVTVTGTSGRHVFRSELARTSAEQAKGLMFRTELGDEEGMIFLRNPPDMATFWMRNTVIPLDIIFVGLDRRVMNIAANAVPYDETPLPAAGPTLAVLEINGGLAARLGIKPGDKVEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Saro_0823 (YP_496102.1) a protein of unknown function from NOVOSPHINGOBIUM AROMATICIVORANS DSM 12444 at 1.22 A resolution
rcsb
source organism Novosphingobium aromaticivorans
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
total genus 35
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02643 DUF192 Uncharacterized ACR, COG1430
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1140 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3m7aA01
3PJYA 3M7AA
chains in the Genus database with same CATH superfamily
1W2TA 4CEWB 4XILA 4Q4X1 4RGKA 3H7YA 4PI0A 4AEDB 4L9BA 5CEHA 5LY1A 1W6OA 1FPN2 2E7TA 2RE9A 3B69A 3QACA 5DDJ3 4B4RA 3ZVXA 1BYHA 1WCKA 2FDFA 4Q4V2 5F3IA 3ZN4A 3BIWE 1AR73 4CU7A 4BYYA 2VGDA 1QQP3 1VLNA 5LATA 4IGOA 5T5JA 2G4IA 3ABZA 3ACHA 5T54A 5FZ1A 1UYYA 4Y4YA 1UOJA 2Q0AA 1JYTA 1LGCA 2O0OA 1QY4A 3LOIA 4QMAA 4RR3B 2QNKA 5EJ1B 4LMFA 3RMYA 2Y60A 3T2QA 4ARYA 4UBGA 1CGPA 3PIGA 1H2MA 4QGLA 3O0WA 2YUEA 4XFGA 4YW3A 1UKGA 4BMEA 4ASMB 2OVUA 5JXGA 3WV6A 3GBFA 3T4VA 4F8AA 1QJX2 2WNVB 3OYWA 3PU8A 4PDWC 2KR2A 5EJ3A 3CJIC 2XPJA 2JDZA 3IZOA 2G9FA 3HQXA 3O5SA 1DHKB 3VBOC 5A33B 3ZPYA 3TB0A 4JDOA 3OBZA 1MZ5A 5JXIA 2LS6A 4NIGA 1SZBA 3M3QA 4AEKA 1UXXX 1W99A 2WNVC 1CX4A 2VMFA 1J3PA 3ZFEA 4EN9B 2VO5A 3DKQA 3VKOA 3VD3A 1L3JA 4E4DX 5FYSA 3VDDA 1V00A 1CX1A 3LPGA 5JPNB 3KQRA 3WOGA 3HT1A 1WBLA 3IAQA 4ZXEA 1S0BA 2FDHA 2CU5A 1OVPA 4DFSA 5CA6A 1V6LA 1VMJA 4XC9A 4BQ2A 3ETQA 1XU2A 2V72A 3ZR6A 3PVBB 3OB8A 5ACA1 1WCUA 1P8JA 2VZRA 4LO6B 1RUG1 3PVOA 4IEZA 3UV9A 3B5LB 3WHUA 4D94A 1QU0A 2W94A 1LEDA 2IFRA 2OS2A 3OSDA 3QBQA 1KEXA 3UL2A 3POBA 1E5HA 1O5LA 1PZ8A 2ZGKA 2HH9A 1DYOA 2RS32 1BMV2 1XNAA 4XUOA 3U37A 1UZVA 3A22A 4BA6A 3CKHA 1X82A 1UIJA 2DFBA 3VDAA 1SLCA 1W6MB 4XEZA 1K3IA 2JB4A 5FZMA 4AQ2A 1N3QA 4CDWA 1JYWA 3PUQA 5A70A 3FUQA 3BOPA 1WLCA 3MIEA 2NZ9A 2GC2A 4X8PA 5FLIA 4M3CA 1OOPA 3WNXA 5JOWA 2GH2A 4EWDA 2VOVA 2QQLA 1S2KA 3I2HA 2CV6A 1ZM1A 2RDNA 3CBNA 3GZUC 3WDWA 2WS91 3SMHA 4BQWA 2R32A 2BP6A 3RYPA 2CL2A 3DEMA 3OPTA 4JKMA 4BM8A 2VNOA 3V0BA 5FUIA 2GP5A 1C8NA 1R1A3 2BBAA 3ASIA 5LBFA 5FPUA 3OG2A 5J3UA 1QMJA 5DDJ2 3B02A 5J7MA 3RZKA 1VMHA 1D0GA 3WNNA 1RUI3 5A7OA 1PNGA 1N1YA 1RUD3 3FL7A 5FYYA 3P5BA 1AR72 4E2SA 4KU8A 4RR3C 2VBBA 3IKWA 3TAYA 3VHNA 5FZKA 1VIWB 3K4AA 2DCTA 1VALA 3RJRA 1IS3A 2W87A 1OF4A 1W8TA 4E27A 1PO23 2WO1A 4ZS2A 4B4PA 1W3XA 3THCA 2VMCA 5F3CA 3GNEA 3GALA 2GMEA 1MR5A 4GMP0 4NRMA 3LB9A 2QQUA 3PNAA 2FBEA 2RG4A 2Q8CA 1XNCA 3VBRB 1WLTA 1CZSA 3HPNA 2D44A 2ZGQA 1RUJ3 3NNMA 1LB2A 4HXCA 1KJLA 1CIYA 3T3YA 3I3EA 3MUZ1 1XNDA 2GNBA 3N9LA 4G3YC 2W2IA 3FLTA 4CA9A 1JOBA 4XF4A 1RHI2 2D3RA 1WA6X 4QT6A 2MEV3 3K75B 3VBHB 3VBRA 1XSQA 2RJLA 3GBWA 4DY3A 4BZ4A 4DXRA 3ZOIA 3U07A 3LE0A 5CIRA 3HBKA 3U75A 3ZLIA 2HWF3 3LA3A 4AI9A 2GN7A 3P3NA 4YG0A 2ZHMA 2WS92 1S2BA 2K9ZA 2RR11 2TNFA 1X9TA 1Z7S3 1GZTA 2YC2A 3FMGA 3SLIA 1CESA 5FCCA 1W8NA 1VJ2A 5JOZA 2EAAA 3AZZA 3FUOA 3DL3A 1DYKA 1ZX5A 3U78A 5BNPB 5FQ0A 3AP9A 5CNAA 2VQ0A 4UXAA 3RS6A 2ZXQA 5F3GA 2BDRA 4HETA 2MHFA 1W04A 1OHFA 1QH6A 2F17A 2IXHA 1TMF2 2B4KA 5FLJA 3RJ2X 5JOYA 4Q0UA 4B7KA 5IW0A 2XWBB 3CLPA 1DZQA 2OUHA 1AR61 2P3IA 5FFOC 3NV2A 3AP7A 1M4WA 2R043 4KG0A 4YVSC 4C1WA 5IVVA 1QXRA 4AGGA 2MEV2 1HJFA 3MI8A 4AFMA 3S5AA 4PHZA 3OBTA 2Q1MA 5K9YA 5FRAA 1BEV3 1F9KA 4RFRB 4AFDA 2VCCA 3VDDB 2XJSA 1LR5A 3IB3A 3DKWA 4PCRA 4B8EA 1HDKA 4KGGA 1HXS1 2J7MA 4ET7A 4ZZ5A 2IC1A 3PL0A 4P5HA 3ORJA 3RZMA 2XOMA 4JRLA 2XR4A 2E32A 1MS0A 2WNVA 2JDAA 2WT2A 3H3LA 3OYWB 3ZXEA 4GKXA 1JYIA 4NHMA 1JYXA 1Q8OA 4QX5A 3SKJE 3VHPA 2WZR2 1S0FA 1DLLA 2PAKA 4N9IA 1TG7A 1NYWA 3IN9A 3MW4A 2WNUA 3HNBM 5JZGC 5CFDA 2Q1FA 4PQQA 4O9GA 2ADDA 5KR7A 1PK6A 1BBT1 2RVAA 4IV1C 3MV01 4KBZA 5J09A 2Y6GA 3RWNA 3AYCA 5HBAA 1SACA 2E31A 4XUQA 1W28A 1QXJA 3N9OA 1GV9A 1Z0HA 4GH4A 1LTEA 1V6NA 1DP0A 3PDQA 2BGPA 3IDAA 2GNDA 2K2SA 1LEMA 1YFWA 5FZ0A 4IV3C 1GANA 5C9AC 3ZSLA 5EYXA 1A8MA 1PO11 1KGYA 1NG0A 1SMVA 4UFIA 3ZYIB 4FP2A 2XKOA 1W2UA 1C1FA 4GH4B 1EUTA 1NA1A 4AWDA 5A32A 4L97A 1XJAA 4CUBA 1QJZA 2JDPA 1H1MA 2FDJA 2NN8A 2FD8A 2JG8C 4I01A 3AKQA 2DVDA 5FZAA 4JZRA 5JI7A 5T5LA 4CDQA 1LAJA 3VB9A 3M2MA 3WG1A 2VZ3A 2WQ4A 1VBD1 3T0BA 3H8XA 4AK3A 2AUYA 1WMEA 3MPPG 3NV1A 1WLDA 1LHVA 1ZBE2 4M4RA 4NPMA 3U11A 4COYA 2A70A 3WF1A 1ZBA2 1SEFA 2WO7A 4CXYA 5K4LA 1SPPB 4IEOA 3RZZA 1E5RA 1WA4A 1Y9MA 4I3GA 5GM0A 5LEJA 2VZPA 4DRRA 2RS13 2UURA 5C3SA 3PMEA 2R042 4D7TA 4FBFA 1FXZA 1PMHX 4ARXA 4IV3A 2ADEA 4IEYA 5FXWA 1S0JA 2Y38A 1BZWA 2XJRA 4A6OA 3TOJA 2CWSA 2E6VA 5JDBA 2HJIA 3KHCA 2QTWB 2BBVA 4HANA 3EQEA 2HWC1 4O7XA 3I2IA 2VUCA 4DO0A 1G9AA 3M4FA 4QQOA 3AVSA 1MEC3 1CD3G 4HT1T 3T2TA 1W0NA 1HLCA 3N9QA 3RI9A 4J1XA 5E88A 2BGOA 3K48A 3OF1A 3SH5A 3T08A 1YIPA 1W6PB 4UAPA 4FFGA 1PM4A 1HB4A 1F4AA 1REDA 1Z7S2 2VMEA 2YBPA 3W5MA 3GCWA 1BK1A 2BQPA 2OT7A 1QJX3 4DXTA 2GU9A 5HCAA 2F6BA 1GOGA 3GDBA 3O1MA 4BQXA 1K12A 1OFNA 3E5QA 5FMOL 5KHIA 3RZHA 2P5BA 3OBAA 1PVC2 3VDCA 2B9VA 2ZAHA 3WQBA 4MGQA 4QPWA 3M3CA 1U5XA 3IBMA 4MYEA 4LBLA 3S5QA 1CPNA 4YZ1A 4NIHA 1DQ5A 3MW3A 4UFKA 1BMV1 3VZKA 5D8AB 1OOPC 2NMOA 4Q4W2 3IWZA 5FIXA 4CCCA 1MVQA 1RJ7A 2XQRA 3WDVA 2BOIA 1JU4A 1RUH1 1AZDA 5GLUA 5IHRA 4IEUA 1LHWA 1GUIA 2QQKA 5ACA3 4IUGA 3S30A 5BNOA 3ES1A 4Q4W3 4XUPA 5DG1A 1UYPA 1NOVA 1QQP2 1CJPA 2FCVA 1W90A 4O61A 5FYZA 2ZZQA 2VOTA 3C2UA 2DVFA 1GU3A 5A7WA 1J1TA 4BQ3A 1GZ9A 1W05A 2JE7A 3NV4A 1VRH1 1W8UA 4IV3B 1UWWA 4WM8A 4XZPA 3DUIA 2J42A 2YC0A 1PIV1 2J1TA 2PTMA 3WEZA 1QJU3 4YZ3A 3VD5A 4E2GA 4N53A 1BJQA 3K4ZA 3SEPA 1FOD2 2ZOEB 2DF7A 1PK6B 3UNPA 2WAAA 4AQ6A 1FNYA 1QNYA 2XVGA 4I0AA 5DAXA 3WCRA 3WNKA 2DVGA 3WW1A 3AXDA 3D0SA 3B9IA 1LNSA 1WCQA 3JZVA 4UBHA 4JDMA 1SDDB 4Q1RA 1C1LA 4BB3A 4EROA 2CGPA 1AHSA 2R6QA 2IVIB 1MS1A 2VBDA 3R0RA 3OD4A 4S2DA 2RDSA 3BODA 1A3KA 3PJQA 3LF7A 3VKMA 1X33A 1CQ9A 1YQ8A 3Q8FA 5JSOA 5LW9A 4IERA 2EA7A 1PZ7A 3J9SA 4YNIA 5BNOC 2Z69A 5GJ6A 5LBEA 1JZ5A 2WLPA 2YROA 1EPZA 4TLFA 4YGBA 3O1SA 2D3PA 3WQ7A 2L9LA 1HXS2 2KXLA 4NAOA 1A34A 2ZGNA 3AP4A 1OD3A 4K6BA 5JXHA 1HRV1 2E7QA 1QJY3 5ABJC 1UZ0A 2WINB 2DCZA 3KCYA 1D4M1 4DXZA 2HWD1 2UU8A 3EB7A 4ATFA 1CAXA 1YQ6A 3LIGA 2WT0A 1PZ9A 1RUC3 1HX6A 2IZWA 4LKDA 5CKMA 3N9PA 3WT3A 2ZAAA 2BV4A 4S2FA 1QWRA 1VBB1 2IXLA 4BOWA 1PGSA 5TSWA 1FOD1 4CDUC 1RUC2 3HAGA 5J1XA 1Q8PA 4KG8A 1GNHA 4EN8B 1C5HA 5FPVA 5CFCB 3LDKA 1WMDA 4PLNA 1MVEA 2ARAA 1XC6A 3DYPA 5EJZB 4UWDA 4XACA 5LA9A 4XXPA 3UGGA 4CDUB 1FMD1 1YQ2A 2ARXA 2D7FA 1GYKA 2CHHA 1POQA 2XKPA 3GBGA 3IMNA 3NVCA 4XDOA 1GWLA 3ON7A 3HOBA 4AEJA 4AVBA 2PAMA 2OKXA 2V09A 1CPMA 2JG8B 3WDUA 1S2EA 1W0PA 3RI8A 4YM2A 2AEYA 3AJYA 3POFA 5FPAA 4RQPA 1Z78A 2R072 2R1DA 5D21A 2Q5TA 1NCRB 5FP7A 3UGHA 4JKKA 3KCCA 2BVVA 2VAUA 3JBG2 4YGDA 3EMRA 4GAZA 5LA0A 2JDNA 4YG6A 3O1OA 2A6WA 4NAMA 4QAWA 2R061 2YDEA 5C33A 1EV12 1DZRA 1NCRC 2IXJA 3H1MA 3Q8CA 5LCWL 4W65A 4Q4Y1 1Y3TA 4XJWA 3WVJA 1OQ1A 2G9GA 3QOPA 5IATA 3ROUA 2VU9A 5IK5A 3KF3A 4BXSV 2P6HA 4OUSA 2IUWA 1CIWA 2C9AA 1W03A 1CZVA 3WF0A 5JZGB 2P37A 4XTMA 3AMQA 5I0TA 3S6PA 3UESA 2P17A 1UN1A 1X8EA 4C0BA 2RM22 4CPBA 5FOBB 1UQXA 1UZWA 2QZ2A 3BKZA 2X53S 2TEPA 2VBPA 5LBBA 2V5YA 3MF9A 5FY0A 3VBUA 1NA1C 1BQPA 1MZFA 3ZMNA 4A4AA 4HONA 4XFAA 1OA3A 5A7SA 4C1XA 5DMYA 5H9QA 4E8CA 3VBFC 1QJFA 4LKFA 1W8OA 4E4HA 4TN7A 5KC5A 3K51A 2XJVA 4IXLA 4ES8A 2V5DA 2AC1A 4D6QA 5K0UB 4F83A 2WZEA 3VV1A 2VR4A 1ZRDA 1H30A 4DNYA 2DUQA 4FPHA 2Q4SA 1QOOA 4QHOA 2BFUL 4OI1A 2WWJA 3FBMA 3OUJA 4BXFA 3BALA 1SCRA 1V6MA 3MLKA 1REFA 4HN1A 2JKXA 4HG6B 1FPN1 1GZCA 3LKJA 1S0GA 2R7EB 1L7LA 1ODMA 4YSFA 4JTNA 1H0BA 2ZKLA 4Q4Y2 2XL9A 3JQXA 4BK5A 1AXYA 3ZSJA 5LZ6A 4Z92B 2W47A 3JD73 1U5IA 1FYUA 2RM23 4B1LA 2ZX2A 4EWAA 2V4VA 1JOPA 1YFYA 4XDPA 2D6NA 4BCUA 2ARBA 1TME1 2ZEXA 3E1F1 4RS5C 3K3NA 5FZ9A 4HZFA 2VD7A 1AUYA 1Y9GA 1V6KA 3P6BA 2Y34A 4MGIE 5H9PA 2WNUB 3C3VA 3EBRA 5CAZA 3ZYPA 4WM7C 1GWMA 3RYRA 3WD5A 1ULEA 4LQRA 3N9NA 1IQAA 1DQ2A 1O59A 2OUJA 4K8RB 1EAH1 2D98A 1ULDA 2ZZJA 2CDOA 5JAXA 2KD7A 3E97A 4LJHA 2ZPXA 3ZXLA 4LBQB 1PO22 3GHNA 2E9QA 3I59A 3NQHA 3OEBA 1IGOA 1O6UA 3MV11 4GJYA 4R9DA 3THTA 2KM2A 1BCXA 2B46X 2WA4A 5C4WC 2BNOA 4BLJA 4YVWC 2JXAA 3RYKA 4MGKE 2H0VA 3K4DA 2D40A 4KNCA 5C6CA 3P1IA 3IM0A 2VUJA 1ZA7A 1DCSA 2RS11 1RUJ2 4PDWB 1K5MC 1QJU2 3WP4A 3ZDVA 3BI3A 3ZKYA 2ZEYA 3VDBA 1F35A 1JBCA 1UY0A 2RMU3 1IPJA 1U12A 1R093 4CDXC 1AR82 2DVAA 4EZ4A 5C5UA 2HWC3 3AB0A 5FOJB 4MUVA 1UD1A 1LU1A 3WNLA 5JI9A 4JTOA 1J3QA 5EPAA 3WY6A 3HD8B 5C3QA 2IVJA 5DAWA 4LO5B 5FYTA 2GSYA 1TME2 3VHRA 2EIEA 1POV1 1UYXA 3ZSKA 4I0WB 3AMPA 1MACA 2I2SA 1BVVA 2WQ8A 2NMNA 1UY4A 5L7OA 3VD4A 3WUDA 2MPFA 3GJAA 5T55A 4J1WA 1O3TA 3NV3A 2DV9A 4LHNA 2PHLA 4CEWA 2VOXA 2BUKA 4BE3A 4F3JA 3DV8A 3N7LA 1UAIA 5FMDA 1XNKA 1NCQA 4OQ8A 1QQP1 4QQ2A 4IGQA 4Q2FA 1G6NA 1D0HA 3FLPA 2G9ZA 5FXZA 1JUHA 1UX6A 3NL1A 1S0IA 4V2VA 2QCSB 3H7JA 4LUMA 2ZJCA 3HMYA 3VD7A 1JODA 5CFDB 3VD9A 4RQPB 5FZEA 1OOPB 5KHGA 3H1YA 4XURA 1LOFA 2N7GA 3VZJA 3THPA 3O1UA 1OPMA 1W9FA 1UZYA 3R6SA 1TE1B 1ULPA 1SLTA 3JQWA 1UX7A 3ZFEB 3HJRA 2X29A 1D4VB 3IDEA 1LOCA 2PHUA 4QX3A 1YRZA 4NO4A 5CG8A 3HN3A 1PIV3 4XBQA 4AI0A 3E6CC 3S57A 2VUDA 4Y20A 2B45X 1EPWA 4IEWA 2RS53 3POYA 3OGGA 2LRPA 1AVBA 4M4PA 4M3CF 2DCJA 3OCPA 2WYFA 2GALA 1ZBA3 2PYTA 4UOJA 4AGRA 2A6ZA 4DIQA 4LE4A 4LXLA 2ZBJA 1NAEA 3MYXA 5A3NA 3FJSA 3THDA 1F4HA 3GGLA 3P3PA 4YLZA 1DU3D 3ZFFC 1VBC3 3PUIA 1LODA 1F5JA 5JSPA 1R083 3U10A 5JZGA 3WG3A 4MH0E 5A3PA 1LOGA 2ORZA 4DMIA 3NJYA 2B9UA 1UPSA 4M0HA 4FT8A 5EP9A 5FYIA 5IVCA 1NT0A 5IVFA 3ELNA 1HRV3 2W5FA 1RUE2 4QPGB 1R082 3UT0A 1H9PA 1XQNA 4BQ1A 3POIA 3RNSA 1YYNA 4Q27A 5FZ8A 1PMJX 4COVA 3I4IA 4AHWA 2HYKA 2HLEA 4META 1CONA 2XBO3 4ZKTB 2OW4A 3M3EA 4BQ5A 3F2ZA 5IYYA 5CU1A 3GXUA 1GOFA 1EV13 2J1EA 4P02B 1FOD3 4JGYA 4XAEA 4LK6A 4Y26A 5G05L 3T1LA 1CR7A 5B4NA 2RS33 1JXNA 3MICA 1DGWA 3ZYHA 1NZIA 4LKEA 4XVHA 2R30A 5GZCA 1RUI1 1S0DA 4MV2A 3WG2A 5F5IA 1Q56A 3POGA 4L8QA 4M01A 4BQYA 2VH9A 1FMD3 2VNVA 4FPYA 1LHOA 4URTA 1IQDC 3KB5A 4YM0A 5A7NA 2UWAA 4JGZB 2VZUA 3ZYJB 4BDVB 5H9RA 3T2PA 5I93A 2FMDA 2WT1A 4XCBA 3DECA 1WUVA 2HWB2 4LBNA 4GZ9A 3BPSA 4YW2A 4MSVA 1R092 4LBQA 4DUVA 4PIZA 1ND3C 4QU1A 2R0FA 1ALYA 2SLIA 3ZDSA 4BPZA 5T3NA 4GMP3 4YVSB 4S2GA 4LULA 4YWAA 4ITCA 5M0TA 2LROA 3JCIA 5FPBA 4XFBA 4XJUA 3ZYRA 1UW8A 4EJRA 1RITA 4RGAA 1GKBA 2VVEA 1VAKA 4RS5B 4COWA 1HQNA 2VZ1A 2QQJA 3S0MA 1IS5A 2R16A 1G9FA 2QJVA 2WABA 1A6CA 1QOTA 5BNPA 1C4RA 2VTFA 3NKGA 5FO8B 1ZRFA 3NJVA 2Y6FA 3LSDA 3D6EA 5KBFA 4QDRA 2VTXJ 3DPRA 2AR6A 1VE0A 2SBAA 1Z7S1 4IEQA 2XJTA 1F2NA 5FYMA 1AYN1 3W59A 3OGSA 5FP8A 3SH4A 4LBJA 1PGW1 4DINB 1OXCA 1TNRA 3C7EA 4CU9A 2QQVA 4DS0A 5A7PA 1HQLA 5FZBA 2AGSA 3VDDC 3POWA 1URXA 1APNA 3Q8BA 2A75A 1WZXA 3TEWA 2JJ6A 2UWBA 1ENSA 4XFIA 4XPVA 3UKNA 1JH5A 3VBOA 3MIBA 3SQOA 4Y1XA 3D3AA 4HL0A 4YM3A 2FDKA 4YVWA 4I30A 4FXGB 1ULCA 5C9AB 4WM8C 2HWF2 2ZEZA 5C8CC 5EYYA 2NPIA 2XL7A 4XF1A 3MIDA 3KT7A 4RL7A 1NA1B 1RUH2 4BMBA 3GYDA 5CKQA 1W6QB 1DGLA 1VPHA 4N53B 3L2HA 1W8HA 1CAVA 1BEV1 1D4M2 4YGEA 1XSRA 1MS3A 5FJKA 4DQAA 3O1RA 3ZR5A 4AHXA 3FN9A 4GKYA 3VBSB 1DZTA 1GP4A 5F6LB 2VE1A 2WIIB 5BNPC 2XJQA 5LBCA 4D0QA 3OOXA 1F8VA 2JENA 1NX9A 4OHXA 2VNRA 3BB6A 3ACGA 1HN1A 2ZCWA 3C7HA 2G1MA 4H7MA 2ENRA 2RM21 4M0NA 1OLRA 3UETA 1G9CA 3W58A 1AR83 2GP3A 4XFHA 4OHVA 3ZM8A 1IG0A 5FZIA 5LK5A 3RZLA 1L7RA 3BU0A 3O12A 1RB8G 1Y43B 2Z2SB 4GB32 2B39A 5FYUA 4Z82A 5EQUA 4Q1PA 4XBLA 5KHHA 3WZ1A 4IESA 1ZRRA 3I3QA 3QCWA 4FPJA 4Q29A 5JCTA 2HKXA 1PGW2 5EHDA 4ZU4A 2GC3A 1AYN2 1RMU3 3VUOA 4UT5A 1FT9A 4W6WA 1H2LA 3O1VA 1QF3A 3B94A 4LBKA 4FAHA 4FOQA 1EYBA 4Q8KA 4LNVA 4NJ4A 4A7ZA 2JE9A 2HEWF 4Y22B 4B7EA 5IJRA 5JMOA 3WQ0A 2W95A 1PO13 5H9SA 5D1IA 3ZFEC 4LHKA 4Q0PA 3VBUC 1RHI1 4MZUA 1SFPA 2XQXA 4W6XA 1NQJA 1OBNA 5FY7A 4KWUA 1H8TA 2ZGOA 1UPIA 4XBNA 2WFF3 2W39A 1SBEA 3LAGA 2X05A 2D6LX 3D8CA 2VPVA 2GNTA 2Y33A 4CVUA 1JU3A 2EALA 2Z42A 4N90A 4P9GA 4IEXA 3M7AA 1I1EA 1G7YA 1O4YA 4ZPIA 2JECA 4CDXA 3A21A 1SLBA 1W06A 5FY1A 2UYAA 4JQRA 4MXWB 2C0ZA 4JAAA 1W6OB 1OUSA 5FK7A 4IW3A 4LO4B 1JMUB 3NSTA 3ZIXA 4Y5SA 1NE4A 5F39A 3WP3A 3ZFFA 3EYPA 1V9U1 4JCKA 1C8M3 1OC1A 4L92A 1LGNA 1KJRA 1MS8A 1SPPA 1TVGA 1KFUL 5A3WA 1C57A 1HW5A 1RC6A 2PHXA 2UY8A 3DXUA 4H14A 4LBQD 2I07B 3G7DA 4OHZA 3USUA 4D7YA 2Y6HA 5BYNA 1Q43A 3VBHA 1OQEA 4XE9A 4XW3A 1GQHA 4Z1VA 2GMPA 2XONA 3KVAA 2OPKA 1HN0A 4FQZA 5F9TA 4JGYB 2XXZA 3V56A 4HSJA 2OIIA 3GZTB 4YGCA 5D8AA 2ILMA 3WHTA 4NPLA 2PMWB 3BOWA 1MEC1 4K8FA 1JZ2A 3O1PA 1STMA 3D82A 1NQDA 2PAEA 3BUCA 1ZA4A 1QKQA 1W8ZA 2HEYF 3I2KA 2XUMA 3ATGA 4A3XA 1PK6C 3BVCA 3IPVB 1ZYBA 1G8WA 2J22A 3A23A 3H3UA 4EE2A 1VR3A 3WF2A 4JV4A 1H4HA 1WLWA 3KZ4C 2YV8A 3ZFGC 5ANNA 5J98B 5HXMA 4IE4A 2YGLA 5DUUA 5C8CA 5CBLA 4LORA 3HIFA 3A7QA 3I7DA 1WW5A 4IEPA 1GOHA 4K40A 1C28A 1UMIA 3M3IA 5HPOA 4RGGA 4NRPA 1O5UA 3J7NA 2DYCA 4MHUA 4NPRA 1MS5A 4A41A 1RUH3 4LA3A 4COUA 1ND2B 1B35C 4KMQA 3W21A 5FKCA 4Q8LA 3H8UA 3LEGA 1OPOA 2PA7A 5EV7A 4K9SA 2HBTA 2OQ6A 4RR3A 4Y33A 5FZCA 2WUHA 4LIUA 1GNYA 1UU4A 4FFFA 4L2NA 3TNPB 1QGLA 4PLOA 5C7GA 1AJOA 1S4CA 2DTWA 3S7IA 3PUSA 3VBUB 2A73B 1R081 3W5NA 2A71A 1NXD1 2YPDA 4NWWA 2C9KA 1J59A 1KDKA 1VRH3 3JD72 2BW8A 3AKPA 5C8CB 3AZWA 2Y64A 2ZGRA 2ZHNA 2ZX1A 2A3XA 1QJU1 5A33A 4Q26A 1DGRN 2J1UA 2YHJA 2BOJA 3LA2A 4OI0A 3ETPA 2CSGA 4H55A 3KQ4B 4UYBA 3OGRA 5DPNA 1AYM1 4MGZE 1CAUA 2WJSA 1S0EA 4EZHA 5FXXA 1W2NA 2B42B 4G4FA 3AMHA 1W9WA 3AYAA 5ANQA 5L9BA 5AVAA 2CGOA 2JX9A 3FHIB 4QXCA 4YG3A 3AMMA 1IS4A 5A6ZA 2LTNA 1NCRA 3ZXAC 4KWJA 3RWKX 4BISA 2RS31 3ACLA 4W50A 3SISA 3CZJA 3H0OA 4KWLA 5BXXA 3KMHA 4Y20B 5L73A 3ZIWA 4W4ZA 4C0HA 2VZTA 1YXWA 4Q5OA 3FLRA 1VRH2 4PT6A 5FY8A 4QB2A 4WVWA 4Q0SA 5A1LA 3I2GA 1QJY1 4TYSA 4CCMA 1R1ZA 4QPGA 2P3JA 1PMIA 1V6OA 2HWD3 5IWFA 1WW7A 4PF5A 1CAVB 4AI1A 2YB7A 2RR12 1RUC1 1VAVA 1ENQA 1DQ0A 5KXDA 1HJGA 2I74A 1UOFA 4EQVA 1DGRA 3UJOA 4D6SA 3U4XA 3LFMA 4RFT0 1UY3A 4D69A 1NY71 1FV2A 1SLAA 3D4KA 4PIYA 5FWEA 1FMD2 2QVSB 1VBB3 2Y26A 4GMP1 3CJXA 5FP4A 4HBNA 1T6BX 3ZYBA 4CEWC 1LGBA 4CXXA 3PMSA 3CJIA 3OD0A 3CEWA 4QQHA 2Y6JA 4QX0A 5EZWA 1FI2A 3B01A 1J84A 2E7AA 4LIVA 3LZZA 5FREA 2O8OA 2P2KA 2WZR3 3NNJA 5KHKA 3PUHA 4LLOA 3TEZA 3VL8A 4BIFA 2VMDA 1AYN3 1RMU2 4XUNA 3E6DA 3MIHA 3VBSC 3JXSA 4CZSA 4FVVA 4AZZA 2HWD2 5GLWA 2E33A 4N53C 3UGFA 1NLRA 2ET7A 2DU0A 4QWNA 3V65A 3JUUA 5CFCC 2WNEA 5DUWA 2XH6A 2VM9A 2C5DA 3BCWA 2DFCA 5FMOS 3RDIA 1XOYA 2R49A 4QKNA 2QQIA 2JIGA 4J6GA 4UF0A 1XNBA 4UW4A 3T1MA 4XOGA 3FE5A 1COV1 3WXPA 1PVXA 1HRV2 2JDKA 4ISQA 1XU1A 1S55A 2ORXA 1V6JA 5FP3A 4RYDA 1PM7A 5A6QA 1ND3B 4Q4Y3 5JSRA 1CWPA 2VCAA 2HYXA 1QJEA 3ZFFB 4CTEA 2JICA 4GB31 1WW6A 4AHZA 2H0BA 4UW3A 1S0CA 4HFSA 2E53A 4YW7A 3IMMA 4O65A 2VUAA 4KI5M 1PO12 1W2AX 1DYPA 1B35A 3WW3A 4FP3A 3O1TA 1PGL1 3ZO0B 1JHNA 1AR91 5HV4A 5AFEA 3IAPA 4PQ9A 3HNMA 4GIQA 1AR81 3DN7A 5K0UA 4ONUA 4V2WA 1WCDJ 3ZN6A 5FDBA 3TEYA 4MVTA 2YU2A 2ZGPA 4OUMA 2BJSA 5DXDA 1F15A 1W9SA 3UYJA 2YU1A 3GM8A 2PHTA 1NXMA 2FHRA 4ZY9A 5IVEA 2QQOA 2HWE1 2A6XA 1WBFA 3ZMOA 3I2JA 3A0KA 1XE8A 5JR7B 5GLTA 3ZN6B 3L9JT 4HPKA 3DYOA 1QOSA 2OPWA 2Y8KA 4RSUA 4UW6A 2G19A 2ZGTA 1OMIA 4AI8A 2ET1A 1N3OA 3GF6A 3AP5A 1YC61 5FQ0B 5CFDC 5LRSA 1O3QA 5FPXA 1B35B 1FPN3 4XJ9A 1CAXB 1RUF2 1IOAA 1CAWB 4YW5A 5A80A 1GWKA 4XF9A 2XB6C 2WNOA 5FYHA 2OYZA 5BPXA 4Z8BA 3F95A 3POSA 4AI3A 1QEXA 1JOJA 1WW4A 3EHKA 1RHI3 5FKBA 4LHLA 3VBHC 4B3NA 1TME3 4OULA 4EWEA 1YEWA 3MEPA 2OX0A 2QQMA 4P9XA 4YZ5A 3OUHA 2VW2A 4P9WA 2BTVC 4QB6A 2WFF1 4W6YA 3ZFGB 5C71A 3ZSEA 3POEA 1DGWX 1ZREA 4FTSA 4CE8A 4YW4A 5FUNA 1SDWA 3VKLA 4TSVA 1NZCA 2RMU2 2ARCA 5J48A 2JG9C 1VBE2 3LDBA 4XUTA 3I8TA 4FPFA 2F4LA 5FZOA 4AVTA 2JG8A 1DIWA 5LASA 2FCTA 3WDTA 4P9LA 4YZ4A 1H1AA 2DURA 1JYCA 5T50A 5FBJA 2H6BA 3AX4A 3EJKA 1X9PA 2NQYA 1C8M1 3WF4A 3WCSA 5FZOB 5ACA2 1VBD2 2YBKA 1RUNA 4QGNA 4FOVA 4LUKA 2D97A 1KQRA 1AX1A 2B7YA 1LECA 1C3HA 3RG0A 2BEOA 4MLOA 4XQDA 2R062 1R091 5C4WA 2VZOA 3LGRA 3AJZA 4YVWB 4AQSA 4RQPC 3U1XA 4XHXA 4RHV1 1BEV2 2ETEA 3JB4C 2MNGA 4PLMA 2VXRA 1A78A 3J8F1 2BZDA 1W9TA 1DQ1A 4B29A 2EXHA 4OHYA 1LULA 3H9AA 4MHRA 4QD2A 5FBZA 3FC0A 4GD4A 4CDQC 1QDOA 3VKNA 3O0XA 3NNLA 1T6GC 1YJLA 3MHZA 2HBUA 5IK4A 4DZGA 5K8SA 1V6IA 1LRHA 2NYYA 2WFF2 3M1HA 3SITA 4UFLA 5L36A 2YMZA 1YI9A 3HNYM 4OLLA 1R1A2 1ULGA 4JHZA 2ZX0A 4DOUA 2PHWA 1ZRIA 2WWSA 4FO9A 4GA9A 5F5QA 1LESA 4CDUA 1Q5OA 4HOOA 5HCHA 4CSWA 1MQTB 2XLGA 3I54A 4YFZA 3SCGA 3FFZA 4O9EA 4NUBA 1SFYA 2DBNA 1B09A 4H7LA 1ST8A 3BTXA 1YJKA 3AC0A 5L7OC 1OQDA 2W46A 3DYMA 3MPBA 5FJHA 1AXZA 4QPGC 3INAA 5HXVA 4P5YA 1GP6A 4N7UA 3SKVA 1GICA 1BK0A 2X09A 4YW6A 1JW6A 2XLAA 3ECQA 4W8JA 3WNMA 4DEVA 1OLMA 3MFCA 2X5IB 5IUQA 1O91A 2A3WA 2WO3A 3M8LA 5FWJA 3LOBA 4NOTA 4QPIA 3RSJA 4OUEA 1K5MB 1WMFA 2B8MA 3ZXFA 1RUG2 3J7MA 1YNAA 4LO8A 1VBA1 2RDRA 5AVPA 3TNQA 2QUOA 2GAUA 1CJDA 4FFHA 1QXPA 3CJIB 4IEVA 4X6QB 3BTAA 3RVHA 1K45A 2BFUS 2RS51 2XDVA 5CKNA 3ZXGA 1XE0A 5FTTC 4FFIA 4PBOA 1ZBA1 3ITQA 2F4PA 2CY6A 1ZZ9A 2VULA 1K5JA 3KS7A 4E2QA 2IFWA 5F2SA 4LR4A 2ERFA 3KF5A 3H1WA 5FK8A 4XTPA 3EXUA 3NJZA 5DAPA 4EYUA 2ZGSA 4CCNA 1HIXA 2W0XA 1GP5A 3N35A 3V0AB 1VBC1 1W0OA 1YFUA 3IDCB 3K3OA 4YVSA 3VKFC 4EV0A 4FXKB 2R073 2LM3A 1HV0A 2A7AA 1JYVA 1KDMA 1E57A 3PUAA 2EIDA 4I0BA 1BLZA 3OEAA 4QPIC 2LW8A 4XDQA 5DG2A 3M3OA 4WVVA 3B7MA 1PGL2 3ZXJA 2HEVF 5IK8A 1AL23 4Y1UA 2VW0A 1F5FA 2GZWA 4L99A 1UY1A 5IT6A 1S1AA 1W6PA 5LA2A 4DB5A 1SLLA 1YI7A 1SFNA 2K46A 4OZXA 4Y24A 2O1QA 2HWE2 4XABA 2JE8A 4RA0A 2XBO1 3W9AA 4MADA 4Q4V3 5GZDA 2NLRA 4S2HA 1PX4A 2PXJA 4QQLA 4BK4A 3CQOA 1EV11 4CU8A 2BERA 4PF1A 3AP6A 3MGUA 3DF0A 4K7JA 2ZX4A 3K77A 1ZZCA 5A1FA 2HWB1 2J1VA 1YQ5A 3KV9A 1XBFA 1RXFA 3LQCA 2FCUA 3NAPB 4E9KA 3T09A 2CTVA 4JC1A 5C3OA 1GR3A 1OKOA 4FTEA 5AC92 2WZR1 1ULOA 1YUDA 5T5OA 5L19A 4L0PA 2ZHKA 5DAQA 2ATFA 1LU2A 1ZBE1 2RS52 3FFQA 3U0ZA 2Q8DA 4WM7A 3KV6A 4CDXB 4U2AA 3N9MA 2ZX3A 5FYBA 2A1XA 1ACCA 4RS5A 1XYPA 4MX3A 3H8OA 2VG9A 5K0UC 3CMGA 2W1QA 2W08A 4LE3A 1RVF2 3WDYA 2W92A 2CGNA 2QDRA 3Q9OA 3ZFGA 1H8TB 5BNQA 2WYSA 1ZRCA 4BHPA 4NROA 4OMCA 2XMLA 3GHMA 5BNNB 4CEYC 3GZAA 4OFGA 3VBRC 3ZYFA 4ES9A 2D93A 3RGBA 4CDWB 5IVJA 3BTYA 4Y5TA 5F32A 1AR62 2EXKA 3S7EA 1SCSA 4GB33 3T0AA 1NE6A 1HRI3 3KT4A 4AVVA 4D3WA 2P6CA 4A44A 1G9BA 5DQ0A 2VQUA 2XJUA 3WR0A 2CAVA 5IAXA 3VZOA 2GN3A 5E89A 2AH2A 1HB3A 5IK7A 2WKKA 1AR93 1OUXA 1GBGA 3FHAA 4XMIA 2CDPA 3DXTA 3FX3A 1W6QA 2BVBA 4HMZA 1TEIA 2A5ZA 4M3CB 5A1AA 5F37A 1Q8SA 2HWE3 1RUF1 2XVKA 3N36A 4PDWA 3PURA 3ZX7A 5GZGA 5J36A 2TUNA 4FQ4A 1BXHA 2Y0OA 4LT5A 2RV9A 4A7YA 5LA1A 2AENA 2D6OX 1RVF1 3LD8A 3OTFA 5IVBA 3WW4A 4QM9A 2EF6A 1SLIA 3SNMA 5FZGA 3TN92 1I3HA 1UOGA 4HKLA 2RS12 4BWOA 3AFKA 1AF9A 2XG3A 4XHBA 4M00A 3OBRA 3E5UA 3HVDA 1QHDA 5I8SA 1N1VA 1NCQC 4OZOA 3G6JB 1YO8A 2VMIA 2OZ6A 4GWJA 4LBMA 4WVMA 4ZXKA 1O3SA 1IS6A 2O14A 4QXKA 4P00B 4AAXA 1PVC3 2DDUA 3N3HA 4GJZA 2W52A 2RHPA 4P9IA 4A45A 4OVEA 1ND2A 4WZCA 4NIAA 2J1SA 3AFGA 2YFZA 2DBIA 1AX2A 1G9DA 1VB4A 2YFUA 1OI6A 3KHBA 4MGTA 1RMU1 2ZGMA 4XETA 2P1BA 5HCFA 5EIYB 1J3RA 3JBG1 3MF6A 4AL9A 1GQPA 2A6YA 3AYDA 3NJXA 3VHOA 4D8MA 2EIGA 5T52A 2W9XA 1RTVA 3DCQA 5A3TA 4FPEA 4WM8B 5D2AA 1H8TC 3TRSB 4AFBA 4D7SA 5F7UA 5HI0A 3VBOB 5F1RA 1N47A 1X36A 1VMFA 2JEMA 3K46A 4QM8A 2XVLA 5BNOB 4OI2A 5KXEA 1K5MA 3AZVA 4QHBA 4AQTA 4CP2A 1IPKA 3WSOA 1F31A 5JWPA 5FUPA 4CCLA 1DF0A 2QQNA 2WN3A 2YC4A 3OGVA 4AXOA 4LTAA 4DRVA 4GWMA 4IQPA 3V0AA 3AYEA 2IXKA 3ACFA 3NRUA 3CF6E 4HPKB 4R4XA 3I97A 5ABJA 3A4UA 1JI6A 1L7QA 3I2DA 4YPJA 3DPRC 5SV5A 3TEXA 3TN91 5CADA 4E4ZA 2EVXA 4XQ4A 4LLFA 3ES4A 2E26A 3VGIA 2A3YA 1YQCA 4DUWA 3ME2A 1DLCA 4JX0A 1IPSA 1I5ZA 2C26A 1IHMA 2E51A 2P3YA 3MW2A 3OPZA 3N4MA 3T4HB 1OLQA 1CN1A 2ZTNA 5JOXA 3NO8A 4MXWA 4XCAA 1V9U3 4X6RB 5FPZA 5LB6A 1KD7A 4A3ZA 3H50A 5DDJ1 4Y3OA 4YRDA 3ST7A 1US2A 4GWNA 2BWCA 2K0GA 5DABA 3H8RA 3PHMA 3BTZA 1OSGA 3O14A 5DZEA 3B9CA 4CUAA 5C8WA 2DVBA 4UW5A 3I3MA 4FOWA 5E16A 1MZEA 5C70A 2VNGA 4CYDA 5GZFA 3X29B 5C4WB 3AKSA 4NHYA 4JQTA 2VVDA 3AZYA 4QU2A 4QB1A 1SHWB 5FY4A 2ZGUA 2D5HA 1QH7A 1ENXA 3EO6A 4IE0A 4QGMA 4LHSA 4ZONA 1OD5A 4CCEA 1UO9A 4FPOB 3U14A 3LDRA 4CCKA 3BIEA 1AL0G 3KD4A 1LOBA 1I5PA 5FZLA 4EN6B 4WM7B 2IWGB 5JXJA 4XFFA 2WNUC 3BGAA 2QQPA 3GZEA 1JZ7A 4QQPA 1VBA3 3VBFA 4FAGA 5J96B 1AXKA 3CDZB 1YCIA 1SBDA 4LPLA 5APAA 2WDBA 2VTXA 3C8XA 3LWCA 4WZFA 4I09A 4AR2A 3ILRA 4INDA 5FMBA 3IIIA 4NIDA 1UY2A 1ENRA 4ORFA 5C3PA 5I0DA 4A42A 4HVRA 5FLHA 4NHXA 4XJAA 4MGSA 4DUXA 1SBFA 1VBC2 2WQZC 4OYUA 1W8FA 5GLZA 1UOBA 1UNBA 2A6VA 2VZSA 4XAAA 5BNNA 4ZHNA 2WO2A 4R52A 3HQRA 1W6NB 4Y5Z0 1GLHA 4U36A 1I6XA 4IDZA 1IKQA 4P14A 1IG3A 3URFA 1XYOA 1V0AA 1ZZBA 4C90A 1JZ3A 2R071 3OJBA 3WF3A 1PNFA 5AC93 2P3KA 1H8VA 1KS4A 1KXGA 1OURA 2EXJA 3C7OA 4LOTA 4CP0A 2IXIA 2ZACA 5DN2A 3UJQA 2E63A 2C6SA 1XXNA 1DQ6A 2UWCA 2VXJA 3PJYA 1AYM3 1KS5A 5I0SA 3POJA 3VL9A 3DPRB 4JKLA 4QDQA 1COV2 1JS9A 4LA2A 2JDHA 1MQTC 1RINA 3DGTA 3KT1A 1RGSA 1TQ5A 5IFTA 3WG4A 2GC0A 1DQ4A 4COZA 1VBE3 5FPLA 4WVZA 3QH7A 3R05A 1RUE1 4XMAA 3JB8A 4YARA 1QDCA 2EICA 1FX5A 4GH4C 4LEJA 5A6YA 1NCQB 4XIKA 3RQ0A 3KGLA 5C3RA 2C24A 5BNNC 1RUD1 4ZS3A 4TWTA 1MPXA 5IVYA 1ZVFA 4AG4A 2EIBA 2V73A 2FMYA 4HSLA 3PU3A 4NMIA 4QDSA 4DPNA 1GZWA 2CAUA 1W6MA 5CYYA 4Y1YA 4AEMA 1E5SA 3OGJA 2WL1A 3HWJA 1PO21 3QH6A 4Q0VA 5LY2A 3VZLA 3WP6A 1AX0A 4XYXA 3AMNA 4DEQA 1N1SA 3ILNA 5B4XA 2WRAA 3H3ZA 2ZS6B 4OHWA 3OY8B 4K3UA 2H6CA 2XBO2 5A3OA 3RPQA 4J25A 3MIFA 1E5IA 3WNOA 4HK9A 5DUVA 3QLQA 1M06G 5FZ3A 1Q8QA 2DCKA 3FHQA 2JB8A 4NHKA 3H42B 3SH3A 3CZUA 3MLJA 4N43A 1BKZA 2BU9A 4YYOA 2JIJA 1VBA2 4BIOA 2JKBA 4DY5A 1AL22 2Y0IA 4M3CE 4IE5A 4CUCA 4QX1A 2JD9A 4AW7A 5CG9A 4XJZA 4KWKA 2RR13 3Q8AA 1HRI1 3BN6A 4FPGA 3B00A 1HRI2 1WD3A 5JMCA 3IT8A 4JGZA 1DDLA 3TBDA 2PELA 2JWPA 3HQUA 2BNMA 2O8QA 1VBB2 3D5OA 1BBT2 1O7FA 2VQAA 3LPFA 4K1ZA 1QNWA 4CDWC 1JZ8A 3KV5A 1H4GA 4ATEA 1LOEA 3V0BB 5ABJB 3WX5A 1IKPA 3E5XA 4QXBA 1ASJ1 2ZEWA 1TMF3 2ZKNA 3K2OA 2BNNA 2GDFA 1WGPA 4TXWA 1C5IA 1COV3 1UYZA 4AVSA 5I0RA 1Y7BA 1RUF3 3JU9A 3UK9A 1REEA 2RDQA 4XZUG 1H9WA 2KA3A 4LBOA 2ZABA 2WC2A 1RVF3 2DUOA 5GZEA 3VLBB 2WFPA 1H1IA 1UU5A 5FZ7A 2X10A 3IDBB 3USUB 4CRQA 3IIAA 1ND2C 5IFPA 3Q8EA 1ULFA 3LA7A 4N9HA 4CPBD 5FO9B 2WWUA 4BQ4A 5KC6A 2XLFA 1UMZA 3NNFA 4K20A 3LFIA 1FV3A 3RRDA 2VC9A 5FR3A 4RHV2 2VMHA 1GFF2 4QPYA 2VOWA 2WAOA 5CVRA 1RYYA 2BWAA 2D6KA 5KXBA 2W68A 4CEYB 2W1UA 3MIGA 2Z5WA 4AAPA 1W3VA 1GMMA 4UFJA 4IGPA 5FV3A 3FBYA 2D6PA 4P08A 3FZ3A 1DFQA 4IE6A 4NR1A 3ZXDA 4EN7B 4QXHA 4AFCA 4NHLA 1YHFA 1J1LA 1UZZA 5A3UA 4DXSA 2AREA 3I3DA 4LO7A 1H2NA 2DU1A 5JLVA 2BPA2 1RUD2 2AACA 1LHUA 2P34A 3HR9A 4XQWA 4YW1A 5FY9A 3JBG3 3N7JA 3KSCA 3C7GA 3KGZA 3VBFB 4X8NA 2W91A 5L7OB 5F5CA 1O4TA 1W8WA 3SCHA 5D8AC 2VL4A 3LEIA 4JGYC 4QKBA 3I2OA 1PHMA 3IPVA 3T30A 3NAPC 4HVQA 1IZ3A 4B4QA 2Y6LA 2PQSA 3OPWA 3CO2A 5EXOA 3MZHA 2FDGA 2P4EA 5J37A 1AJKA 2HWC2 5DUXA 5T5PA 2QQWA 3LIHA 1O3RA 4AEDC 5EWSA 1LHNA 4URAA 1XPWA 2J1RA 1T2XA 2FZ1A 1D2SA 4L11A 4HK8A 5A32B 1YLLA 2EAKA 1JZ4A 2Z79A 5HV0A 1AR92 4FI9A 3TN93 1MS9A 3J7LA 1C8M2 5FZFA 5LWBA 1VRBA 5CB7A 1JTZX 4K21A 2WZ8A 2YG0A 3U4SA 3UKTA 4KU7A 4FSJA 4FCAA 1OKQA 3CNAA 4AEDA 1W9YA 2Z4FA 5L9VA 1CAUB 4CXWA 3BYWA 4A6SA 1RUI2 3AKTA 4QPIB 3I59B 3AVRA 5KXCA 2RJ2A 5CFCA 3FWEA 1LOAA 1ODNA 2PN5A 1UF2C 2PHDA 4E8DA 1ZNPA 1XE7A 4Z2WA 3VBSA 1R64A 3GJBA 4BH9A 1K42A 1RUOA 1W39A 1BHGA 1X7NA 2LUWA 4PBPA 2QZ3A 4TLGA 4RHV3 1OFSA 4SLIA 4Y1VA 4LOSA 2YXSA 1D7PM 2FZ2A 1ASJ2 2ID4A 3J8F3 4QHZA 3T2OA 5KWRA 1SG3A 4AVCA 3KV4A 5F8PA 4AHYA 4AGVA 3KLSA 4IV1A 1U0AA 1UU6A 2FQPA 2XHNA 4HN0A 4XFCA 3B3QE 3M70A 2PLV3 1RXGA 4MGYE 4WVMB 5GLVA 4ASKA 3N7MA 3CL1A 4HVOA 4YZ2A 3PLQA 4Y22A 1QJX1 3MO4A 2OA2A 1HKDA 2RJKA 1QIQA 2VOKA 2YGMA 3AK0A 2GMMA 4Q4X3 4A2UA 1GZWB 2GH8A 1PIV2 3MLLA 4IE7A 4NWVA 4PI2A 5FO7B 4AOCA 4QKDA 4LITA 5F2WA 2TBVA 4I3PA 1VB2A 1TNFA 1MEC2 3SHRA 1LKNA 1WMXA 4HLTA 2WSUA 1AR71 3OUIA 4XXAA 4IL7A 2YBSA 4AYUA 2NP0A 2X5IC 4CDQB 4MG2A 5G04L 4KBBA 2ZMKA 3LEMA 4OI4A 4Y4RA 1Q3EA 2VZQA 3SCFA 2Q30A 1HB2A 4ZU5A 3WINE 1U5ZA 2JD4A 4Y1ZA 3RMXA 2EXIA 1OLME 5ISLA 1UCXA 1OH3A 2AYHA 5DAVA 4ZU7A 3O0VA 4Q4W1 2BGCA 1FATA 4AI2A 4QX7A 5SV8A 3WP5A 2Y6KA 4ZZ8A 5I8YA 4WV8A 3BPZA 5AC91 1X50A 1POV0 2DWRA 3B93A 3NMBA 4C8DA 3ILFA 4UI9L 1D2QA 4SBVA 3KM5A 5JPMB 3W20A 2ZA9A 4OQ9A 4Z07A 1JZ6A 4FPCA 4CCDA 4GULA 4GQ7A 2XJPA 5A7WB 1LCLA 3PVEA 3AM2A 2Q8OA 4XIOA 1EUUA 2JG9B 5FZ4A 1ZZ7A 4IETA 2VZVA 3WNPA 5FY5A 2VJXA 2C1FA 3WUCA 2GNMA 5JIAA 5LK7B 4CU6A 3SC7X 2QDNA 4H3WA 1OVSA 1VBE1 4I02A 2JG9A 1Q8VA 1KITA 1WWYA 2WLQA 3AZXA 4ISRA 4JHTA 4KGQA 2XHKA 4OMDA 1RUG3 2Q8EA 1RUE3 4P9JA 4RD7A 3WW2A 4AF9A 4CEYA 4N43C 1KFXL 4FPKA 1VAMA 3HEIA 4OCTA 5FP9A 5A3LA 1UXZA 4RN5A 2ZGLA 1UL9A 5DZFA 5BV6A 1DBNA 4XF0A 4MOAA 4R9AA 3O7OA 3ZKUA 2DTYA 2ZHLA 4CP9A 5IAVA 3R4SA 5FYCA 4XF3A 3J7HA 3PIJA 4GALA 2PLV2 1AL21 1OA2A 1U5YA 3I49A 4YFWA 2J1AA 2VY0A 4GWIA 1D4M3 4K1YA 5LEKA 5FMCA 1MS4A 2VMGA 2VCBA 3QD6A 5E1RA 1G86A 2OXBA 2JDYA 1RL3A 3ZPOA 1TZOA 4HKOA 5BUVA 3J26N 1O8SA 1GSLA 3KVBA 3ZYGA 4Q4V1 2JDMA 4GXLA 1LENA 1XRUA 2UY9A 4UFMA 4XJ8A 2WS93 5GALA 1YIFA 5C9AA 4P9YA 1R1A1 2YY1A 5A3MA 2I45A 2HWB3 3PVNA 4YM1A 2D3SA 3AKRA 3NKTA 3ACIA 3ALQA 1QJY2 5A7QA 1LOFC 3MBWA 4JVAA 4Q0QA 2WA3A 4MXVA 5JR2A 3L2YA 1O4ZA 5L9RA 2NM1A 3HN1A 4R9CA 5C5TA 4LKSA 2QKDA 3T0DA 5JVVA 1ZBE3 3APBA 4EN0A 2VW1A 1VP6A 1YWKA 2CNAA 3HBZA 3NWKA 5EFUA 5F5AA 5K7PA 1EAH2 2Q1ZB 4NE9A 4A7KA 4B1MA 2WN2A 3UKVA 4C91A 2WZPP 1HV1A 3D0JA 4N8MA 1BVP1 3MFAA 5CZKA 3I2FA 4IV1B 5JUVA 2WR9A 4UF0B 2OZJA 4N7IA 3CIHA 1H6XA 2QE3A 1ASJ3 1RUJ1 1TMF1 4NRQA 3OY8A 5DZGA 3CU7A 3LEKA 1NKGA 2R063 2UYBA 1OT5A 1LJ7A 2MEV1 4FOYA 3E6BA 2ES3A 3WLUA 2FDIA 4NIIA 5KHJA 1J83A 3AL5A 2JDUA 3ENRA 1X8MA 2HWF1 3VZNA 1RJ8A 3SXWA 3ZN5A 2B5HA 2BRTA 4JDNA 2CYFA 3RZJA 3HT2A 2W1WA 1JN2P 1HQWA 5FZDA 4FTBA 1ZZ8A 3TWIA 1EY2A 3RZGA 2X5IA 1W6NA 4NN0A 5FZ6A 2V4AA 4H2AA 3ZXKA 4ASLA 4BJ0A 1US3A 3GCXA 1AR63 4Z2AA 4I2OA 3PTYA 4FPLA 4CCJA 1UIKA 1YFXA 2D5FA 2R041 5I91A 3C7FA 4CUGA 3R4DB 2ZMLA 1N1TA 1XB9A 2YYOA 1WCSA 1NLQA 4WBBA 3PTRB 1ZZ6A 4BLIA 4QX8A 1NLSA 3R4UA 4NVPA 5FXVA 1NUKA 1ONAA 2QBXA 3A0NA 4R4ZA 5E8AA 1I9RA 2CWMA 1NY72 1CAWA 1PX3A 1Y4WA 2PHRA 4JRAA 3V64A 3VZMA 4AFAA 1AYM2 4KL1A 1MQTA 1HXS3 2XUEA 4AE2A 3NNGA 1A8DA 2VQTA 5F3EA 3TYJA 4TTGA 5E6HA 4HKWA 3SEEA 3MUY1 4Q4X2 2D6MA 1EP0A 1XYNA 5LRRA 3JD71 2QFEA 3NW4A 5I8TA 1N3PA 1Y9QA 1OF3A 2PFWA 4KH9A 2D43A 5FZHA 1O8PA 5ERLA 3USSA 5JIUA 1ND3A 2VECA 2X8KA 1W2OA 5A6XA 4AVAA 2XGXA 3AL6A 1GQGA 3WDXA 2XWJB 5AFBA 3J8F2 1PVC1 2YPJA 5FAXA 3MDPA 2IXCA 2R0HA 3BU7A 3J4UH 1GNZA 4V1PA 1SQ4A 4UFHA 1BBT3 1UKRA 4PJYA 1CVNA 1V70A 5BY5A 2C4XA 1FAYA 2VVFA 5F6KA 4CP1A 5CISA 1DG6A 1EAH3 2PQQA 5HCBA 1WKYA 1OH4A 4QX2A 1KRIA 1HB1A 3LCPA 4BU2A 4D6RA 4QKFA 4R9BA 4MO3M 3ZSMA 5FYVA 4KQ7A 1JYNA 1FNZA 2VCMA 1H6YA 1MZ6A 2DCYA 2R1BA 2LALA 2WBKA 3CHXA 1RIRA 4CP9B 3KCXA 4N43B 1JUIA 2OQ7A 2BYVE 5GKAC 1V9U2 2RMU1 3KWVA 2ZMNA 2W1SA 1CZTA 1H2KA 3NAPA 4LK7A 4E4SA 1JHJA 4CCOA 4PIXA 3LSEA 2W3JA 3AXEA 2AZ5A 3N7KA 4F7ZA 4JGZC 4R8HA 1UMHA 2GC1A 1VBD3 3WQ1A 2YZ4A 2WSVA 3VN4A 2AEZA 1WD4A 5I0UA 1J58A 3I3BA 4G9SB 1POV3 1OA4A 1XNTA 3RFRA 5B2GB 2PHFA 2PLV1 2DUPA 4TZDA
chains in the Genus database with same CATH topology
4CEWB 4XILA 4Q4X1 3H7YA 4AEDB 4L9BA 1W6OA 1FPN2 2E7TA 2RE9A 3B69A 3QACA 5DDJ3 4B4RA 3ZVXA 1BYHA 1WCKA 4Q4V2 3ZN4A 3BIWE 1AR73 4BYYA 2VGDA 1QQP3 1VLNA 5T5JA 2G4IA 5T54A 4Y4YA 2Q0AA 1LGCA 2O0OA 1QY4A 3LOIA 4QMAA 4RR3B 2QNKA 3RMYA 4UBGA 1CGPA 1H2MA 4QGLA 3O0WA 2YUEA 4XFGA 4YW3A 1UKGA 4BMEA 2OVUA 3WV6A 3GBFA 4F8AA 1QJX2 2WNVB 3OYWA 4PDWC 5EJ3A 3CJIC 2XPJA 2JDZA 3VBOC 2G9FA 3HQXA 3O5SA 1DHKB 5A33B 3ZPYA 3TB0A 4JDOA 1MZ5A 4AEKA 3M3QA 2WNVC 1CX4A 3ZFEA 1J3PA 4EN9B 3VKOA 4E4DX 1L3JA 3VDDA 1V00A 5JPNB 3KQRA 3WOGA 3HT1A 1WBLA 1S0BA 4DFSA 5CA6A 1V6LA 3ETQA 1XU2A 3PVBB 5ACA1 4LO6B 1RUG1 3PVOA 4IEZA 3UV9A 3B5LB 3WHUA 4D94A 1QU0A 1LEDA 2IFRA 3QBQA 3UL2A 1O5LA 1PZ8A 2ZGKA 2RS32 1BMV2 4BA6A 1X82A 1UIJA 2DFBA 1SLCA 1W6MB 4XEZA 4AQ2A 4CDWA 1N3QA 3FUQA 3BOPA 1WLCA 3MIEA 2NZ9A 2GC2A 4X8PA 5FLIA 4M3CA 1OOPA 3WNXA 5JOWA 2GH2A 4EWDA 2VOVA 1S2KA 2CV6A 1ZM1A 3GZUC 3WDWA 2WS91 3SMHA 2R32A 3RYPA 2CL2A 4BM8A 2VNOA 3V0BA 1C8NA 1R1A3 3ASIA 5J3UA 1QMJA 5DDJ2 3B02A 5J7MA 1D0GA 1RUI3 1PNGA 1N1YA 1RUD3 1AR72 4E2SA 4KU8A 4RR3C 3IKWA 3TAYA 3VHNA 1VIWB 2DCTA 1VALA 3RJRA 1IS3A 4E27A 1PO23 4B4PA 3GNEA 3GALA 2GMEA 1MR5A 4GMP0 3LB9A 3PNAA 2FBEA 1XNCA 3VBRB 1WLTA 2D44A 2ZGQA 1RUJ3 1LB2A 1KJLA 1XNDA 2GNBA 4G3YC 3FLTA 4XF4A 1RHI2 2D3RA 4QT6A 2MEV3 3VBHB 3VBRA 2RJLA 3GBWA 4DY3A 4BZ4A 3U07A 5CIRA 2HWF3 3LA3A 2GN7A 3P3NA 4YG0A 2ZHMA 2WS92 1S2BA 2K9ZA 2RR11 2TNFA 1Z7S3 3FMGA 3SLIA 1CESA 5FCCA 5JOZA 1VJ2A 2EAAA 3AZZA 3FUOA 3DL3A 1DYKA 1ZX5A 5BNPB 5FQ0A 3AP9A 5CNAA 2VQ0A 4UXAA 3RS6A 4HETA 2MHFA 1OHFA 1QH6A 2IXHA 1TMF2 5FLJA 3RJ2X 5JOYA 4Q0UA 4B7KA 2XWBB 3CLPA 1DZQA 2OUHA 1AR61 2P3IA 5FFOC 3NV2A 3AP7A 1M4WA 2R043 4KG0A 4YVSC 4C1WA 1QXRA 4AGGA 2MEV2 3MI8A 4AFMA 3OBTA 2Q1MA 5K9YA 5FRAA 1BEV3 1F9KA 4AFDA 3VDDB 2XJSA 1LR5A 4PCRA 3DKWA 4B8EA 1HDKA 4KGGA 1HXS1 2IC1A 4P5HA 4JRLA 1MS0A 2WNVA 2WT2A 3OYWB 3ZXEA 4GKXA 1JYIA 4NHMA 1Q8OA 4QX5A 3VHPA 2WZR2 1S0FA 1DLLA 2PAKA 4N9IA 1NYWA 3IN9A 3MW4A 2WNUA 5JZGC 5CFDA 4O9GA 1PK6A 1BBT1 4IV1C 5J09A 5HBAA 3RWNA 3AYCA 1SACA 1QXJA 1GV9A 1Z0HA 4GH4A 1LTEA 1V6NA 2GNDA 2K2SA 1LEMA 1YFWA 4IV3C 1GANA 5C9AC 3ZSLA 5EYXA 1A8MA 1PO11 1SMVA 1NG0A 3ZYIB 4FP2A 2XKOA 1W2UA 1C1FA 4GH4B 1NA1A 4AWDA 5A32A 4L97A 1QJZA 1H1MA 2NN8A 2JG8C 4I01A 3AKQA 2DVDA 5JI7A 5T5LA 4CDQA 3WG1A 3M2MA 2WQ4A 1VBD1 4AK3A 2AUYA 1WMEA 3MPPG 3NV1A 1WLDA 1LHVA 1ZBE2 4COYA 3U11A 2A70A 1ZBA2 1SEFA 4IEOA 3RZZA 1WA4A 4I3GA 5GM0A 5LEJA 4DRRA 2RS13 2UURA 3PMEA 2R042 4D7TA 4FBFA 1FXZA 4IV3A 4IEYA 1S0JA 2Y38A 1BZWA 2XJRA 3TOJA 2CWSA 2E6VA 5JDBA 2HJIA 2BBVA 4HANA 3EQEA 2HWC1 1G9AA 3M4FA 4QQOA 1MEC3 1CD3G 4HT1T 3T2TA 1HLCA 3RI9A 4J1XA 5E88A 3K48A 3OF1A 3SH5A 1YIPA 1W6PB 1REDA 1Z7S2 1BK1A 2BQPA 1QJX3 2GU9A 5HCAA 2F6BA 1OFNA 3E5QA 5FMOL 5KHIA 1PVC2 2ZAHA 3M3CA 1U5XA 3IBMA 4MYEA 4LBLA 4YZ1A 1CPNA 1DQ5A 3MW3A 1BMV1 3VZKA 5D8AB 1OOPC 2NMOA 4Q4W2 3IWZA 1MVQA 1RJ7A 3WDVA 1RUH1 1AZDA 5GLUA 4IEUA 1LHWA 5ACA3 3S30A 5BNOA 3ES1A 4Q4W3 5DG1A 1NOVA 1QQP2 1CJPA 2ZZQA 3C2UA 2DVFA 1J1TA 1GZ9A 2JE7A 4XZPA 3NV4A 1VRH1 4IV3B 4WM8A 3DUIA 2YC0A 1PIV1 2PTMA 1QJU3 4YZ3A 4E2GA 4N53A 1BJQA 1FOD2 2ZOEB 2DF7A 1PK6B 4AQ6A 1FNYA 1QNYA 2XVGA 4I0AA 3WCRA 2DVGA 3WW1A 3AXDA 3D0SA 3B9IA 3JZVA 4UBHA 4JDMA 4Q1RA 1C1LA 4EROA 2CGPA 1AHSA 2R6QA 1MS1A 3R0RA 3OD4A 4S2DA 3BODA 1A3KA 3PJQA 3VKMA 1X33A 1CQ9A 5JSOA 4IERA 2EA7A 1PZ7A 3J9SA 4YNIA 5BNOC 2Z69A 5GJ6A 2WLPA 2YROA 1EPZA 4TLFA 4YGBA 2D3PA 3WQ7A 1HXS2 2KXLA 2ZGNA 3AP4A 4K6BA 1HRV1 2E7QA 1QJY3 5ABJC 2WINB 3KCYA 2DCZA 1D4M1 4DXZA 2HWD1 2UU8A 4ATFA 1CAXA 2WT0A 1PZ9A 1RUC3 1HX6A 2IZWA 3WT3A 2ZAAA 4S2FA 1QWRA 1VBB1 2IXLA 4BOWA 1PGSA 5TSWA 1FOD1 4CDUC 1RUC2 3HAGA 1Q8PA 4KG8A 1GNHA 4EN8B 1C5HA 5CFCB 1WMDA 4PLNA 1MVEA 4XXPA 4CDUB 1FMD1 2ARXA 2D7FA 1GYKA 3GBGA 2XKPA 3IMNA 3NVCA 4AEJA 4AVBA 2PAMA 2V09A 1CPMA 2JG8B 3WDUA 1W0PA 3RI8A 4YM2A 3AJYA 4RQPA 1Z78A 2R072 2R1DA 2Q5TA 1NCRB 3KCCA 2BVVA 3JBG2 4YGDA 4YG6A 2A6WA 2R061 2YDEA 5C33A 1EV12 1DZRA 1NCRC 2IXJA 3H1MA 4W65A 4Q4Y1 1Y3TA 4XJWA 3WVJA 1OQ1A 2G9GA 3QOPA 3ROUA 2VU9A 5IK5A 4OUSA 1CIWA 2C9AA 5JZGB 2P37A 4XTMA 3AMQA 5I0TA 3S6PA 4C0BA 2P17A 1UN1A 1X8EA 2RM22 5FOBB 2QZ2A 2X53S 2TEPA 2V5YA 3MF9A 3VBUA 1NA1C 1MZFA 1BQPA 3ZMNA 4XFAA 1OA3A 4C1XA 5H9QA 3VBFC 5KC5A 3K51A 2XJVA 4IXLA 4ES8A 5K0UB 4F83A 3VV1A 1ZRDA 1H30A 4DNYA 2DUQA 4FPHA 2Q4SA 1QOOA 2BFUL 4OI1A 3FBMA 3BALA 1SCRA 1V6MA 3MLKA 1REFA 4HN1A 1FPN1 1GZCA 3LKJA 1S0GA 4YSFA 4JTNA 1H0BA 2ZKLA 4Q4Y2 2XL9A 3JQXA 4Z92B 1AXYA 3ZSJA 3JD73 1U5IA 1FYUA 2RM23 2ZX2A 4EWAA 1YFYA 2D6NA 4BCUA 2ARBA 1TME1 4RS5C 4HZFA 1AUYA 1V6KA 4MGIE 5H9PA 2WNUB 3C3VA 3EBRA 5CAZA 3ZYPA 4WM7C 3RYRA 3WD5A 1ULEA 1IQAA 1DQ2A 2OUJA 1EAH1 2D98A 1ULDA 2ZZJA 5JAXA 3E97A 2ZPXA 3ZXLA 4LBQB 1PO22 3GHNA 2E9QA 3I59A 3THTA 4R9DA 1IGOA 4CDXA 1F8VA 2KM2A 1BCXA 2B46X 2WA4A 5C4WC 2BNOA 4BLJA 4YVWC 2JXAA 3RYKA 4MGKE 2H0VA 2D40A 4KNCA 5C6CA 3IM0A 2VUJA 2RS11 3WP4A 1RUJ2 4PDWB 1K5MC 1QJU2 1JBCA 2RMU3 1IPJA 1U12A 1R093 4CDXC 1AR82 2DVAA 2HWC3 3AB0A 5FOJB 4MUVA 1UD1A 1LU1A 5JI9A 4JTOA 1J3QA 3WY6A 3HD8B 4LO5B 2GSYA 1TME2 3VHRA 1POV1 3ZSKA 4I0WB 3AMPA 1MACA 2I2SA 1BVVA 2NMNA 5L7OA 3WUDA 2MPFA 5T55A 4J1WA 1O3TA 3NV3A 2DV9A 4LHNA 2PHLA 4CEWA 2VOXA 2BUKA 4BE3A 4F3JA 3DV8A 3N7LA 1UAIA 1XNKA 1NCQA 1QQP1 4QQ2A 4Q2FA 1G6NA 1D0HA 3FLPA 1JUHA 1UX6A 3NL1A 1S0IA 2QCSB 3H7JA 4LUMA 2ZJCA 3HMYA 5CFDB 4RQPB 1OOPB 5KHGA 3H1YA 1LOFA 2N7GA 3VZJA 3THPA 1OPMA 1UZYA 3R6SA 1TE1B 3JQWA 1SLTA 3ZFEB 2X29A 1D4VB 3IDEA 1LOCA 2PHUA 1YRZA 4NO4A 5CG8A 4XBQA 1PIV3 4AI0A 3E6CC 4Y20A 2B45X 1EPWA 4IEWA 2RS53 3POYA 3OGGA 1AVBA 4M3CF 2DCJA 3OCPA 2GALA 1ZBA3 2PYTA 4AGRA 2A6ZA 4LE4A 2ZBJA 3MYXA 3FJSA 3ZFFC 3P3PA 4YLZA 1DU3D 1VBC3 1LODA 1F5JA 5JSPA 1R083 3U10A 5JZGA 3WG3A 4MH0E 1LOGA 4DMIA 2B9UA 1UPSA 4M0HA 4FT8A 3ELNA 1HRV3 4QPGB 1RUE2 1R082 1H9PA 1XQNA 4BQ1A 3RNSA 1YYNA 4Q27A 4COVA 3I4IA 4AHWA 2HYKA 4META 1CONA 2XBO3 4ZKTB 2OW4A 3M3EA 5CU1A 1EV13 1FOD3 4JGYA 4Y26A 3T1LA 1CR7A 2RS33 1JXNA 3MICA 1DGWA 2R30A 5GZCA 1RUI1 1S0DA 4MV2A 3WG2A 1Q56A 4L8QA 4M01A 2VH9A 1FMD3 4FPYA 1LHOA 4URTA 4YM0A 3KB5A 3ZYJB 2UWAA 4JGZB 5I93A 5H9RA 2FMDA 2WT1A 1WUVA 2HWB2 4LBNA 4YW2A 4MSVA 1R092 4LBQA 4PIZA 1ND3C 2R0FA 1ALYA 2SLIA 3ZDSA 4BPZA 5T3NA 4GMP3 4YVSB 4S2GA 4LULA 4ITCA 3ZYRA 3JCIA 4EJRA 4XFBA 4XJUA 1UW8A 1RITA 4RGAA 1GKBA 2VVEA 1VAKA 4RS5B 4COWA 1HQNA 3S0MA 1IS5A 2R16A 1G9FA 2QJVA 5FO8B 1A6CA 1QOTA 5BNPA 1C4RA 3NKGA 1ZRFA 3LSDA 3D6EA 5KBFA 3DPRA 2AR6A 2SBAA 1Z7S1 4IEQA 2XJTA 1F2NA 1AYN1 3W59A 3SH4A 4LBJA 1PGW1 4DINB 1TNRA 4DS0A 1HQLA 3VDDC 2AGSA 3POWA 1URXA 1APNA 2A75A 2JJ6A 2UWBA 1ENSA 4XFIA 4XPVA 3UKNA 1JH5A 3MIBA 4Y1XA 4HL0A 4YM3A 4YVWA 4I30A 4FXGB 1ULCA 5C9AB 4WM8C 2HWF2 5C8CC 5EYYA 2NPIA 2XL7A 4XF1A 3MIDA 3KT7A 4RL7A 1NA1B 1RUH2 4BMBA 3GYDA 1W6QB 1DGLA 4N53B 3L2HA 1CAVA 1BEV1 1D4M2 4YGEA 4DQAA 1MS3A 4AHXA 4GKYA 3VBSB 1DZTA 5F6LB 2WIIB 5BNPC 2XJQA 2JENA 4OHXA 2VNRA 3BB6A 2ZCWA 4H7MA 2ENRA 2RM21 4M0NA 1OLRA 1G9CA 3W58A 1AR83 4XFHA 4OHVA 5LK5A 3O12A 1RB8G 1Y43B 2Z2SB 4GB32 2B39A 4Z82A 4Q1PA 4XBLA 5KHHA 3WZ1A 4IESA 1ZRRA 3QCWA 4FPJA 4Q29A 5JCTA 2HKXA 1PGW2 4ZU4A 2GC3A 1AYN2 1RMU3 3VUOA 1FT9A 4W6WA 1H2LA 1QF3A 3B94A 4LBKA 4FAHA 4FOQA 1EYBA 4Q8KA 4LNVA 4A7ZA 2JE9A 2HEWF 4Y22B 4B7EA 3WQ0A 5H9SA 1PO13 5D1IA 3ZFEC 4LHKA 4Q0PA 3VBUC 1RHI1 4MZUA 4W6XA 1NQJA 1H8TA 2ZGOA 1UPIA 4XBNA 2WFF3 2W39A 1SBEA 3LAGA 2D6LX 3D8CA 2VPVA 2GNTA 2EALA 2Z42A 4N90A 4P9GA 4IEXA 3M7AA 1I1EA 1G7YA 1O4YA 2JECA 1SLBA 2UYAA 4JQRA 4MXWB 2C0ZA 4JAAA 1W6OB 4LO4B 3NSTA 3ZIXA 3WP3A 1NE4A 3ZFFA 1V9U1 4JCKA 1C8M3 4L92A 1LGNA 1MS8A 1KJRA 1KFUL 1C57A 1HW5A 1RC6A 2PHXA 2UY8A 4H14A 4LBQD 4D7YA 2I07B 3G7DA 4OHZA 3USUA 5BYNA 1Q43A 3VBHA 1OQEA 4XE9A 4XW3A 1GQHA 4Z1VA 2GMPA 2OPKA 5F9TA 4FQZA 4JGYB 3V56A 4HSJA 2OIIA 3GZTB 4YGCA 5D8AA 2ILMA 3WHTA 3BOWA 1MEC1 4K8FA 3D82A 1NQDA 2PAEA 1ZA4A 1QKQA 2HEYF 2XUMA 3ATGA 4A3XA 1PK6C 3IPVB 1ZYBA 1G8WA 3H3UA 1VR3A 4JV4A 1H4HA 1WLWA 3KZ4C 2YV8A 3ZFGC 5J98B 2YGLA 5DUUA 5C8CA 5CBLA 3HIFA 3I7DA 1WW5A 4IEPA 4K40A 1C28A 3M3IA 4RGGA 1O5UA 2DYCA 4NPRA 1MS5A 1RUH3 4LA3A 4COUA 1ND2B 1B35C 4Q8LA 3H8UA 1OPOA 2PA7A 5EV7A 4K9SA 4RR3A 1UU4A 4L2NA 3TNPB 1QGLA 4PLOA 1AJOA 2DTWA 3S7IA 3VBUB 2A73B 1R081 2A71A 1NXD1 4NWWA 1J59A 1KDKA 1VRH3 3JD72 3AKPA 2BW8A 5C8CB 3AZWA 2ZGRA 2ZX1A 2ZHNA 2A3XA 1QJU1 5A33A 4Q26A 1DGRN 2YHJA 3LA2A 4OI0A 4H55A 1AYM1 4MGZE 1CAUA 2WJSA 1S0EA 2B42B 4G4FA 3AMHA 3AYAA 5AVAA 2CGOA 2JX9A 3FHIB 4YG3A 3AMMA 1IS4A 2LTNA 1NCRA 3ZXAC 4KWJA 2RS31 3ACLA 3SISA 3H0OA 4KWLA 5BXXA 3KMHA 4Y20B 5L73A 3ZIWA 4C0HA 1YXWA 3FLRA 1VRH2 4WVWA 4Q0SA 1QJY1 4TYSA 1R1ZA 4QPGA 2P3JA 1PMIA 1V6OA 2HWD3 1WW7A 4PF5A 1CAVB 4AI1A 2RR12 1RUC1 1VAVA 1ENQA 1DQ0A 5KXDA 2I74A 1DGRA 3UJOA 3U4XA 4RFT0 4D69A 1NY71 1FV2A 1SLAA 3D4KA 4PIYA 1FMD2 2QVSB 1VBB3 2Y26A 4GMP1 3CJXA 4HBNA 4CEWC 1LGBA 3PMSA 3CJIA 3OD0A 3CEWA 4QQHA 5EZWA 1FI2A 3B01A 2E7AA 3LZZA 5FREA 2O8OA 2P2KA 2WZR3 5KHKA 4LLOA 3VL8A 4BIFA 1AYN3 1RMU2 3E6DA 3MIHA 3VBSC 4CZSA 4FVVA 2HWD2 5GLWA 4N53C 1NLRA 2ET7A 2DU0A 3V65A 3JUUA 5CFCC 2WNEA 5DUWA 2XH6A 2C5DA 3BCWA 2DFCA 5FMOS 3RDIA 3T1MA 2R49A 4J6GA 1XNBA 4UW4A 4XOGA 3FE5A 1COV1 3WXPA 1PVXA 1HRV2 4ISQA 1XU1A 1S55A 1V6JA 1PM7A 5JSRA 1ND3B 4Q4Y3 3ZFFB 4CTEA 2JICA 4GB31 1WW6A 4AHZA 2H0BA 4UW3A 1S0CA 4HFSA 2E53A 2VUAA 1PO12 1DYPA 1B35A 3WW3A 4FP3A 1PGL1 3ZO0B 1JHNA 1AR91 5AFEA 4PQ9A 4GIQA 1AR81 3DN7A 5K0UA 4ONUA 1WCDJ 3ZN6A 5FDBA 4MVTA 2ZGPA 4OUMA 5DXDA 2PHTA 1NXMA 2FHRA 2HWE1 2A6XA 1WBFA 3ZMOA 3A0KA 1XE8A 5JR7B 5GLTA 3ZN6B 3L9JT 4HPKA 1QOSA 4RSUA 4UW6A 2ZGTA 1OMIA 4AI8A 2ET1A 1N3OA 3GF6A 3AP5A 5FQ0B 5CFDC 5LRSA 1O3QA 5FPXA 1B35B 1FPN3 4XJ9A 1CAXB 1RUF2 1IOAA 1CAWB 4YW5A 4XF9A 2XB6C 2OYZA 5BPXA 4Z8BA 3POSA 4AI3A 1JOJA 1WW4A 3EHKA 1RHI3 4LHLA 3VBHC 4B3NA 1TME3 4OULA 4EWEA 3MEPA 4YZ5A 4P9XA 2VW2A 4P9WA 2BTVC 2WFF1 4W6YA 3ZFGB 3ZSEA 1DGWX 1ZREA 4FTSA 4YW4A 1SDWA 3VKLA 4TSVA 1NZCA 2RMU2 5J48A 2JG9C 1VBE2 3I8TA 4FPFA 4AVTA 2JG8A 1DIWA 3WDTA 4P9LA 4YZ4A 1H1AA 2DURA 1JYCA 5T50A 2H6BA 3AX4A 3EJKA 2NQYA 1C8M1 3WCSA 5ACA2 1VBD2 1RUNA 4QGNA 4FOVA 4LUKA 2D97A 1KQRA 1AX1A 2B7YA 1LECA 1C3HA 3RG0A 2BEOA 4MLOA 4XQDA 2R062 1R091 5C4WA 3LGRA 4YVWB 3AJZA 4AQSA 4RQPC 4XHXA 4RHV1 1BEV2 2ETEA 3JB4C 2MNGA 4PLMA 2VXRA 1A78A 3J8F1 4B29A 1DQ1A 2EXHA 4OHYA 1LULA 3H9AA 4QD2A 5FBZA 3FC0A 4CDQC 1QDOA 3VKNA 3O0XA 1T6GC 1YJLA 5IK4A 4DZGA 5K8SA 1V6IA 1LRHA 2NYYA 2WFF2 3M1HA 3SITA 5L36A 2YMZA 1YI9A 4OLLA 1R1A2 1ULGA 2ZX0A 4DOUA 2PHWA 2WWSA 4FO9A 4GA9A 5F5QA 1LESA 4CDUA 1Q5OA 1MQTB 2XLGA 3I54A 4YFZA 3SCGA 3FFZA 4O9EA 1SFYA 1B09A 4H7LA 1YJKA 5L7OC 1OQDA 3MPBA 1AXZA 4QPGC 3INAA 5HXVA 4N7UA 1GICA 1JW6A 2XLAA 3ECQA 3MFCA 2X5IB 5IUQA 1O91A 2A3WA 3LOBA 3M8LA 4NOTA 4QPIA 3RSJA 1K5MB 1WMFA 2B8MA 3ZXFA 1RUG2 1YNAA 4LO8A 1VBA1 5AVPA 3TNQA 2QUOA 2GAUA 1CJDA 4IEVA 1QXPA 3CJIB 4X6QB 3BTAA 2BFUS 2RS51 3ZXGA 5FTTC 4PBOA 1ZBA1 2F4PA 2CY6A 1ZZ9A 2VULA 3KS7A 4E2QA 2IFWA 4LR4A 2ERFA 3H1WA 4XTPA 3EXUA 3NJZA 2ZGSA 1HIXA 2W0XA 3N35A 3V0AB 1VBC1 1W0OA 1YFUA 3IDCB 4YVSA 3VKFC 4EV0A 4FXKB 2R073 2LM3A 1HV0A 2A7AA 1KDMA 1E57A 4I0BA 4QPIC 4XDQA 5DG2A 3M3OA 4WVVA 3B7MA 1PGL2 3ZXJA 2HEVF 5IK8A 1AL23 4Y1UA 2VW0A 1F5FA 2GZWA 4L99A 5IT6A 1S1AA 1W6PA 4DB5A 1SLLA 1YI7A 1SFNA 4Y24A 4OZXA 2O1QA 2HWE2 4RA0A 2XBO1 3W9AA 4Q4V3 5GZDA 2NLRA 4S2HA 4QQLA 1EV11 3AP6A 3MGUA 3DF0A 4K7JA 2ZX4A 1ZZCA 2HWB1 3NAPB 4E9KA 2CTVA 4JC1A 1GR3A 4FTEA 5AC92 2WZR1 5L19A 1YUDA 5T5OA 2ZHKA 2ATFA 1LU2A 1ZBE1 2RS52 3FFQA 3U0ZA 4WM7A 4CDXB 4U2AA 2ZX3A 4RS5A 1XYPA 4MX3A 2VG9A 5K0UC 2W08A 4LE3A 1RVF2 3WDYA 3Q9OA 2CGNA 2QDRA 3ZFGA 5BNQA 1H8TB 1ZRCA 4BHPA 3GHMA 5BNNB 4CEYC 3GZAA 4OFGA 3VBRC 4ES9A 2D93A 4CDWB 1AR62 2EXKA 3S7EA 1SCSA 4GB33 1NE6A 1HRI3 3KT4A 4AVVA 4D3WA 1G9BA 2XJUA 3WR0A 2CAVA 3VZOA 2GN3A 5E89A 2AH2A 5IK7A 2WKKA 1AR93 1GBGA 4XMIA 3FX3A 1W6QA 2BVBA 4HMZA 1TEIA 2A5ZA 4M3CB 1Q8SA 2HWE3 1RUF1 2XVKA 3N36A 4PDWA 3ZX7A 5J36A 5GZGA 2TUNA 4FQ4A 1BXHA 2Y0OA 4LT5A 4A7YA 2AENA 2D6OX 1RVF1 3OTFA 3WW4A 4QM9A 2EF6A 1SLIA 3SNMA 3TN92 1I3HA 4HKLA 2RS12 4BWOA 3AFKA 1AF9A 2XG3A 4XHBA 4M00A 3OBRA 3E5UA 1QHDA 5I8SA 1N1VA 1NCQC 3G6JB 1YO8A 2VMIA 2OZ6A 4LBMA 4WVMA 4ZXKA 1O3SA 1IS6A 4QXKA 1PVC3 3N3HA 2W52A 2RHPA 4P9IA 4OVEA 1ND2A 4WZCA 3AFGA 1AX2A 1G9DA 1VB4A 1OI6A 1RMU1 2ZGMA 4XETA 5HCFA 1J3RA 3JBG1 3MF6A 2A6YA 3AYDA 3VHOA 2EIGA 5T52A 1RTVA 4FPEA 4WM8B 3TRSB 1H8TC 4AFBA 4D7SA 5HI0A 3VBOB 5F1RA 1N47A 1X36A 2JEMA 4QM8A 2XVLA 5BNOB 4OI2A 5KXEA 1K5MA 3AZVA 4QHBA 4AQTA 4CP2A 1IPKA 1F31A 5JWPA 1DF0A 4AXOA 4LTAA 4DRVA 4GWMA 4IQPA 3V0AA 3AYEA 2IXKA 4HPKB 3CF6E 4R4XA 5ABJA 3A4UA 3I2DA 3DPRC 5SV5A 3TN91 5CADA 4E4ZA 2EVXA 4XQ4A 4LLFA 3ES4A 3VGIA 2A3YA 3ME2A 1I5ZA 1IHMA 2E51A 3MW2A 3OPZA 3N4MA 2ZTNA 1CN1A 1OLQA 5JOXA 3NO8A 4MXWA 1V9U3 4X6RB 5FPZA 1KD7A 3H50A 5DDJ1 4YRDA 3ST7A 4GWNA 2BWCA 2K0GA 3PHMA 1OSGA 3O14A 5DZEA 3B9CA 5C8WA 2DVBA 4UW5A 4FOWA 5E16A 1MZEA 2VNGA 4CYDA 5GZFA 3X29B 5C4WB 3AKSA 2VVDA 3AZYA 4QU2A 2ZGUA 2D5HA 1QH7A 1ENXA 3EO6A 4QGMA 1OD5A 4FPOB 1AL0G 3KD4A 1LOBA 4EN6B 4WM7B 2IWGB 4XFFA 2WNUC 2QQPA 4QQPA 1VBA3 3VBFA 4FAGA 5J96B 1AXKA 1YCIA 1SBDA 3LWCA 4WZFA 4I09A 3ILRA 4INDA 4ORFA 1ENRA 4HVRA 5FLHA 4XJAA 1SBFA 1VBC2 2WQZC 5GLZA 2A6VA 5BNNA 4R52A 1W6NB 4Y5Z0 1GLHA 4U36A 1I6XA 1IKQA 4P14A 3URFA 1XYOA 1ZZBA 4C90A 2R071 3OJBA 5AC93 1PNFA 2P3KA 1H8VA 1KS4A 1KXGA 2EXJA 4CP0A 2IXIA 2ZACA 3UJQA 2E63A 1XXNA 1DQ6A 2UWCA 3PJYA 1AYM3 1KS5A 5I0SA 3VL9A 3DPRB 1COV2 4LA2A 1MQTC 1RINA 3DGTA 3KT1A 1RGSA 1TQ5A 3WG4A 2GC0A 1DQ4A 4COZA 1VBE3 4WVZA 3QH7A 3R05A 1RUE1 4XMAA 3JB8A 4YARA 1QDCA 1FX5A 4GH4C 4LEJA 1NCQB 4XIKA 3RQ0A 3KGLA 5BNNC 1RUD1 4TWTA 1ZVFA 4AG4A 2V73A 2FMYA 4HSLA 4DPNA 1GZWA 2CAUA 1W6MA 4Y1YA 4AEMA 3OGJA 2WL1A 3HWJA 1PO21 3QH6A 4Q0VA 3VZLA 3WP6A 1AX0A 4XYXA 3AMNA 1N1SA 3ILNA 3H3ZA 2ZS6B 4OHWA 3OY8B 4K3UA 2H6CA 2XBO2 3RPQA 3MIFA 4HK9A 5DUVA 3QLQA 1M06G 1Q8QA 2DCKA 4NHKA 3SH3A 3MLJA 4N43A 1BKZA 4YYOA 1VBA2 4BIOA