3M7AA

Crystal structure of saro_0823 (yp_496102.1) a protein of unknown function from novosphingobium aromaticivorans dsm 12444 at 1.22 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
140
structure length
140
Chain Sequence
GGTKTAAEAAAPAVHPVSGLQIVPVTVTGTSGRHVFRSELARTSAEQAKGLMFRTELGDEEGMIFLRNPPDMATFWMRNTVIPLDIIFVGLDRRVMNIAANAVPYDETPLPAAGPTLAVLEINGGLAARLGIKPGDKVEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein
publication title Crystal structure of Saro_0823 (YP_496102.1) a protein of unknown function from NOVOSPHINGOBIUM AROMATICIVORANS DSM 12444 at 1.22 A resolution
rcsb
source organism Novosphingobium aromaticivorans
molecule tags Structural genomics, unknown function
total genus 35
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02643 DUF192 Uncharacterized ACR, COG1430
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1140 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3m7aA01
3PJYA 3M7AA
chains in the Genus database with same CATH superfamily
1YJKA 2D5FA 3MF9A 1BCXA 3O0WA 3T08A 2PFWA 5FMDA 4AI2A 4MXVA 1DQ1A 4LHSA 5E6HA 1CAWA 1JOJA 1TEIA 2ILMA 3DUIA 4GD4A 3WDUA 3AC0A 5I8TA 1PGL2 4F3JA 4GZ9A 4BA6A 3BODA 1X7NA 3M8LA 3O1PA 4GWMA 4QPGB 1KDMA 5SV8A 3VKLA 3DL3A 3VDAA 4EZ4A 1D4M1 5KHKA 4NAOA 1GWKA 4BQWA 3KCCA 4W4ZA 4YG3A 1OA4A 1LKNA 3NV2A 4IEVA 3PUQA 4Z92B 4RGAA 4QQ2A 4CCDA 3AYCA 4ISRA 4WVZA 2HH9A 4CCLA 1J59A 3QACA 3IMNA 1O59A 1KS5A 4YGCA 3GXUA 4XUNA 4CCKA 1YCIA 4F83A 3WDWA 5KC6A 1UOBA 1EUTA 1XNBA 3IB3A 1FV2A 1YQ8A 2G19A 3KQ4B 4JKMA 5EFUA 4A41A 3LDRA 3ZM8A 1RGSA 3DCQA 3EYPA 1KQRA 1XPWA 4Q0UA 3BIEA 4LBMA 4JHTA 1XNAA 1A3KA 4E2SA 2WLQA 4B1MA 5L7OA 1HRV3 2BRTA 2EIDA 4A44A 2EF6A 2WABA 5IJRA 1NA1C 2GAUA 4CSWA 5EHDA 3TOJA 2RJLA 3S7EA 2KR2A 1DG6A 4NHXA 3MW3A 3SC7X 4L99A 5FJHA 2VQUA 1AHSA 4CP1A 4NIHA 4YG0A 1VAKA 3ES1A 5FFOC 1PMHX 3SNMA 1CD3G 2DVFA 3ACFA 2XDVA 4OVEA 1N3PA 3PNAA 5JOZA 1BXHA 1PMIA 1W8UA 1LRHA 1O6UA 2WWUA 5FO9B 2B7YA 2VQTA 1RJ8A 4XDQA 1NQJA 2VNRA 2EXHA 3ES4A 5L7OB 1LB2A 1HRI3 1V6IA 3F2ZA 1YI9A 3I2KA 1MR5A 3GM8A 1R083 1F9KA 1UXZA 2VXRA 1ENSA 3EXUA 2ZZQA 4MXWA 3N7MA 4Q0QA 5A70A 2Y0IA 1OKOA 4XF1A 2VC9A 3MLKA 4IE6A 4FTEA 2EIEA 3S57A 3SQOA 1W05A 2UU8A 4Q1PA 3AZVA 1YQCA 4W65A 3TWIA 4DUWA 3CNAA 1O8PA 4HANA 4TLGA 1N1TA 3MIEA 5LA2A 1FPN2 3I3BA 4Z2AA 1Y9QA 5FZLA 3U07A 1GICA 2ZKLA 1PZ7A 3GCWA 3LEIA 1Y4WA 1NE6A 4EN8B 5F6KA 3HT2A 1W9TA 1I1EA 2GH2A 3FHQA 2A3WA 2VNGA 3I2OA 4I0WB 3TN92 2VQAA 1HRV1 2I2SA 2B5HA 2PQSA 3N36A 4MXWB 2PHFA 5FZMA 5FZ8A 3ZYPA 2JE7A 4IV3C 1SZBA 4QPIA 3O1TA 2E51A 3H3UA 4LO6B 1UF2C 2W87A 1C4RA 3UKTA 2WJSA 1RUD3 1MZFA 2QZ2A 3FJSA 3MPPG 1C28A 4GMP3 4YLZA 3URFA 4ZZ8A 1OT5A 1ZRCA 1SBDA 2GALA 3VHPA 3IDCB 5CB7A 5C4WA 5LEJA 3UKNA 3BPZA 1MEC3 4XZPA 2Y6JA 2JDMA 1QMJA 2SBAA 1X8MA 2XJVA 3B9CA 5EJZB 4K20A 3V0BB 1Q8OA 1RXFA 2RMU1 3WCRA 2ORZA 4AE2A 3ETPA 5ABJA 1F5FA 3WSOA 1G9FA 2Y6KA 1DIWA 3POIA 2LS6A 3C8XA 4JGZC 1TQ5A 2QDNA 4QPIB 3HQRA 2JE8A 1R081 4L92A 4Q29A 2YGLA 1X9TA 3E5UA 3KWVA 3M3CA 4AW7A 1DYPA 1YI7A 3DYOA 3H42B 3IKWA 4QX2A 1WA6X 4I2OA 2ZXQA 3DPRC 2WNUC 4I0AA 4NOTA 3RVHA 5C4WB 5FZCA 3WW3A 1O7FA 2AEYA 3BYWA 4H55A 2KA3A 3ZPYA 4YGDA 1NY71 1Q8QA 4O9GA 5IK5A 5LRRA 4FPHA 3QBQA 5ABJB 4XHXA 4MO3M 1G9CA 5FYBA 3O5SA 4BCUA 2EICA 2DDUA 1QJEA 4DRRA 1FV3A 3V65A 5FZ3A 3VZJA 4BDVB 4K3UA 4EJRA 2LALA 3GCXA 4SLIA 3U11A 3SEEA 4N43A 4RQPA 5C3QA 3WNMA 4YW6A 1LOFA 4XQ4A 1BBT2 3GF6A 3MIGA 3ZFEC 2VOKA 1GP4A 1HXS3 1BVVA 2RHPA 4N7IA 4HK9A 5I8SA 1FNZA 4XBNA 3GHNA 5LZ6A 1H9PA 2VBBA 1ZZ9A 2NP0A 4AEDA 4GMP1 4XFFA 5FZ6A 3MF6A 3TEYA 1GQGA 2R072 3JXSA 3WF2A 1TNRA 2QQLA 4CA9A 4CPBD 4LORA 3OJBA 2HJIA 1OLQA 1A34A 1Z7S3 2GH8A 2F4LA 2ZX2A 3VHRA 3ZO0B 4CUBA 3OPTA 2B46X 4LIUA 4CDQA 2CDOA 4N43B 2R30A 4RQPB 1PVXA 2VVFA 5C3OA 3WDVA 4YVSC 3JQXA 1W8WA 5F2SA 2AEZA 3M70A 3P1IA 3RG0A 4CDUA 1XOYA 1S4CA 4EQVA 3CO2A 2VMIA 2WNEA 4QB6A 2ARAA 4DINB 2VJXA 5HCFA 3U78A 4DIQA 4JRLA 2XVKA 4QGNA 3ZSLA 4AEDB 1YNAA 3HNBM 4B7EA 4BQ4A 4MGQA 2YU2A 1GYKA 4PBOA 5AFEA 5JSOA 3FLTA 1IHMA 2AACA 3VZMA 3J7MA 5KR7A 3G6JB 2IXHA 2HWC3 3OD4A 1K5JA 4Y24A 4YM2A 5F5IA 1U5ZA 2BWAA 2UYBA 3NKTA 4YW5A 2Z4FA 2RDSA 3A7QA 4OQ9A 3RJ2X 4CDQB 3ZSKA 3VBHA 3TNQA 3KCXA 3ENRA 3J7LA 3KS7A 3VBRC 2VOXA 3PURA 3THPA 5BNNA 4ZKTB 3BTYA 4AZZA 4QU1A 4HKLA 5L9BA 3WX5A 2ZGPA 3IAQA 4AAPA 1D2QA 1QXPA 4XPVA 3WP6A 4AF9A 4IEZA 3BU0A 1UU5A 2XWJB 2VVEA 5GZEA 5K0UA 2ZGRA 5CFCC 1VBA3 1HB3A 1X33A 3JCIA 1UWWA 4Y33A 3MFCA 5BNPA 5I0RA 2FDIA 2ZZJA 2WAAA 5IAXA 3BU7A 4OHXA 2MEV2 4P14A 1TNFA 2PLV2 1OUXA 2I74A 4KWLA 1HIXA 1H2MA 2VZTA 1Y9MA 3ZYJB 5FWEA 1LODA 3WHTA 1CONA 4FQ4A 4XYXA 3LIHA 4LEJA 5BNNB 4Q8KA 4D0QA 4B4PA 3AFGA 3PVNA 3LCPA 2EXIA 4LIVA 4OI4A 4PQQA 4Y1YA 1VBC2 5I0UA 4Q4V3 1D2SA 2YC0A 4Q4X1 5K0UB 2DUPA 5A3TA 1VMJA 4QX5A 1VBE2 4IETA 4E2QA 2PAEA 2VTXJ 5BNPB 1L7LA 3BTXA 3UJOA 1DQ2A 4FT8A 1HLCA 1JZ6A 2OQ6A 2YBSA 3MUY1 2XUEA 1VAVA 2ZAAA 4IXLA 2YYOA 1OHFA 3VZKA 3CJIA 3TNPB 4RS5C 3WG4A 2GMEA 4LBQD 4OUMA 4YVWA 1EYBA 3IZOA 4P9LA 3W5MA 2HWC1 1C1FA 2UWBA 4HKOA 3O0XA 1L7RA 2ZMLA 3MGUA 4CCEA 2BW8A 1RJ7A 4YWAA 4JQRA 3RWNA 5A3UA 5DDJ2 1MQTB 4N8MA 1F2NA 4XOGA 4XBQA 5JZGB 3PL0A 5FP4A 3ZYIB 4UW4A 1D4VB 5KHIA 1NCQC 3O1SA 2WFF1 3NRUA 4AQ6A 2GDFA 2PELA 1ENQA 1VBA1 1ZBA2 4L9BA 2VZUA 3CJIB 2R6QA 1J58A 3MPBA 3WP5A 4YVWB 1AYM1 2VCMA 2KD7A 1QJX2 1ZRRA 3E6BA 4NRQA 4C1XA 1IS5A 2ES3A 4LKFA 3UNPA 1Y3TA 1OKQA 1RHI1 2JENA 5FZAA 1WCQA 3ZXEA 3RYRA 1PO13 3Q8AA 1DQ4A 3NV1A 1P8JA 2JG9A 3J9SA 4OUSA 1LGBA 2XL7A 3I3QA 4A7ZA 1UQXA 1V6LA 3MUZ1 4BQ3A 2IFWA 2O8QA 5FZ1A 2YUEA 1GFF2 4DQAA 4Q4V1 3WV6A 3AP6A 1V6NA 4AVCA 3S6PA 4IV1C 4X6RB 1ULCA 5C9AC 1WCDJ 2C0ZA 1ENXA 3EHKA 1J3QA 1EY2A 3SH5A 1V9U1 2NLRA 2LROA 4AQSA 4FOQA 4OHVA 1UZVA 5JR2A 2XL9A 3H3LA 2XKOA 2J7MA 1ND3C 2WO1A 1JHNA 4FFHA 1Q8PA 2JG9B 3IIAA 5JCTA 2FDHA 1NKGA 3E5XA 3KD4A 1BK0A 4CXXA 1W8ZA 1W06A 2ATFA 2LUWA 3WR0A 3NNGA 4XMIA 1WMDA 2RR12 4KMQA 4C1WA 4H7LA 4K21A 1E5SA 3KM5A 4QPGC 5FO8B 1Z78A 4FFIA 5L19A 1OF4A 3KMHA 4UW6A 4C90A 3DKWA 4FAGA 2W3JA 2E9QA 2DURA 3HN3A 5FDBA 1IS3A 2E31A 5C3RA 3ABZA 3MYXA 4BZ4A 4LA3A 4LKDA 4FOVA 2VZRA 4Y5SA 3M3EA 4K9SA 4Q4W3 1JUIA 3BPSA 2AC1A 2D40A 4QHZA 5FK8A 3OGRA 3U1XA 5I8YA 1PO11 2D7FA 5G04L 2D6LX 1TVGA 4B29A 2BNNA 1UX7A 2X5IA 2EAAA 4XIKA 3ZIXA 5AC91 1LULA 3DXTA 3NNJA 3Q9OA 2D6KA 3DEMA 4MGZE 4QKDA 1QNWA 2FCVA 3MIDA 4H7MA 4UWDA 1ZVFA 3AJZA 4D6RA 1UAIA 4O61A 1UXXX 2Q1FA 2WUHA 3MHZA 2A6YA 2VZ1A 3IM0A 4HZFA 1VBD2 3WF3A 1GV9A 3ILFA 4GALA 5BNOA 1JU4A 3P3PA 1K5MA 3AKSA 3DKQA 1GOGA 4MH0E 5T3NA 1OOPC 5C6CA 1XE7A 4JV4A 2DUQA 4Q8LA 3ASIA 4Q5OA 4FP2A 1JUHA 2D6OX 2X5IB 5JIUA 2XQXA 5IFTA 4KQ7A 3WQ1A 2PAKA 4COVA 3ACIA 5FXZA 2BBAA 5HBAA 3ETQA 3D82A 4U2AA 2P1BA 1GANA 3K4ZA 2VTXA 3HEIA 3IDAA 3FLPA 2W95A 4KL1A 1PMJX 2P4EA 4FO9A 3U37A 2XJSA 4E4ZA 1NQDA 5JSRA 4QM8A 4NIGA 5FY5A 1CAUA 3OGJA 4QAWA 1RYYA 4Y4RA 5BNOB 3AB0A 4CU9A 2DCJA 1H30A 4MYEA 2VMHA 1YQ6A 1K5MB 1UZZA 2WNVA 5A33A 3LD8A 1W9YA 1CPNA 1W39A 3BIWE 3AZZA 1CJPA 1ENRA 1RUJ2 3AP7A 4NPMA 1AL0G 1AR62 3HQXA 4ZZ5A 1I5PA 4F7ZA 2JG8A 3RZHA 5FYMA 3VGIA 1V00A 1TG7A 3C7GA 3NNMA 3RYKA 3IDBB 2OX0A 4HONA 5DUXA 5L36A 4A3XA 3LZZA 3S0MA 5C8CC 1EPZA 1QJZA 3HOBA 1EV11 5CKMA 1CAUB 1RUG2 3AM2A 4ES9A 3RI9A 1GZ9A 2WO2A 2PTMA 4CDXA 3POJA 3I97A 1ZZ7A 2JDNA 1BK1A 2VXJA 5BNQA 3I8TA 4WVVA 2Z2SB 4XDPA 2WNVB 5A33B 1DF0A 3KSCA 4NRPA 2Q8DA 2PYTA 1Y43B 3C7EA 2WLPA 4A4AA 4KWKA 1JODA 1SFNA 3POFA 1FMD1 2JG8B 4GKXA 2XMLA 3V64A 1HB4A 5FBZA 1Q56A 4E8DA 4ASKA 1LU1A 1FPN3 1RMU2 4DY3A 5GZCA 4PIYA 3VKOA 1QF3A 3VZOA 4CP9A 3R0RA 3T30A 3I3DA 1GBGA 4CDXB 4PF1A 4IEOA 1DQ0A 1VIWB 3B93A 4QDQA 5CU1A 3TN93 3WNPA 4GIQA 4MSVA 4XFCA 3AMHA 4MUVA 1RUH1 3CKHA 5FY0A 3OF1A 3WP4A 5A6XA 4QPIC 4OULA 4TN7A 4Y5TA 4URTA 1ZX5A 2AH2A 1O5LA 4RFT0 5LA0A 4LKEA 3RZGA 4S2HA 3THCA 1ULOA 2OUHA 1LNSA 2GSYA 3FHAA 1RUC2 4ORFA 5B4NA 3K2OA 4DNYA 3IWZA 3ON7A 3SH4A 1ZREA 5C5TA 3WINE 5CFDC 4CP9B 4QGLA 3OSDA 3OYWB 4PF5A 4MGSA 2W46A 3OEBA 4HLTA 3HN1A 1QDCA 4M0NA 5A6ZA 1SEFA 4QX3A 1BJQA 4BM8A 3EMRA 1OURA 2WT2A 3M2MA 3N9PA 1S0GA 1IKPA 1GR3A 2W1SA 1JZ7A 3B7MA 3MFAA 4PDWC 1DLLA 1UYZA 3LWCA 3FN9A 3I59A 1LJ7A 1ULDA 3Q8BA 5FY7A 4LBLA 2OS2A 3CZJA 5JR7B 4LKSA 4L97A 2E32A 3CZUA 5FPLA 1DZRA 2VOTA 3HQUA 5FPZA 4D8MA 5HPOA 5HCAA 3VKMA 4FTBA 3T0AA 1HDKA 5CZKA 1UY4A 4A42A 1NLRA 2HEVF 3FL7A 3O7OA 3G7DA 2BVVA 5FUIA 2XHNA 3CLPA 1BBT3 2DV9A 3RMXA 3D0SA 1JBCA 2O8OA 3ZXJA 1S0JA 1POV3 1AYN2 2R7EB 4QX7A 1N3QA 3AKRA 3BALA 2XLGA 2K0GA 4IDZA 1E5HA 4QHBA 4UFKA 4CEWA 1J1TA 1COV2 4OZOA 2G9FA 1EUUA 3I59B 3KGZA 3M7AA 4CDWA 4N53C 1GOHA 5A7NA 3U75A 1WLTA 2BERA 1YFWA 2R073 2Q1MA 4W6WA 1H1MA 1NE4A 1JTZX 1OVSA 2YFUA 5FZEA 5I93A 1CIYA 1J3PA 1UZWA 4GQ7A 3P5BA 1YIFA 3AVSA 3SCHA 3WDTA 1JZ8A 3CU7A 5JOXA 2QNKA 4XBLA 4LA2A 4P08A 5FXWA 5LATA 5E88A 2PHUA 4P5HA 3LKJA 1H9WA 2WS92 4RN5A 3QCWA 4URAA 4NE9A 2JKXA 3KV4A 4YG6A 3OBRA 3WQBA 3NQHA 4OHZA 2A6ZA 4A6SA 4LHKA 2R062 2A70A 2GN3A 4RR3C 5DAXA 5K4LA 1YWKA 5AFBA 1OQDA 4CDWB 5GLUA 4K8RB 2ADEA 3J8F2 3R4DB 4MZUA 3VD9A 1G9AA 1GSLA 2ZMNA 4E2GA 1MZ6A 2W91A 3WQ7A 1W3XA 3HWJA 4Q4Y2 5DAVA 4EN0A 5L9VA 1U5XA 1UIJA 4HN1A 1W8HA 1EAH1 4QD2A 1KFXL 5JDBA 4PIZA 5FZ0A 4TTGA 1V6JA 2R16A 3LOBA 3VBSB 1YC61 4C91A 4GWNA 3NV4A 4HMZA 3WDXA 1H1AA 1UOGA 4GH4A 3LGRA 3FX3A 5JOYA 2RE9A 1VALA 5BNNC 1LHNA 1Q8VA 2CGOA 3M3IA 2NYYA 1KXGA 2YGMA 2J1VA 1E57A 5T5PA 5CBLA 1ZBE2 1MS0A 3B5LB 1UO9A 1XYPA 3I2GA 4AGVA 3NJVA 2BGPA 5A3WA 1ZNPA 4JDMA 1NOVA 1JMUB 5AVPA 1PGSA 2UURA 2CAUA 1W2UA 4LK6A 3O1RA 2MEV3 2RS13 2PLV3 2QQMA 2E53A 4AR2A 4L8QA 2GN7A 2WFPA 4QKFA 4R9CA 1AXZA 1OLRA 3BB6A 1WBLA 4YGEA 3RI8A 3ZSEA 1ULGA 4IQPA 2ZA9A 2ET1A 1OXCA 3MO4A 2B8MA 2YXSA 5LA9A 5HXVA 3LDBA 4QXHA 1VBC3 2VZVA 2K2SA 2H0BA 2Q5TA 1PIV2 3CIHA 4R9BA 4CUGA 3RDIA 2ZEYA 3M1HA 5GZGA 2ID4A 3AYDA 3DYPA 1PO22 4FOWA 5A1FA 1RUE1 4WV8A 1MQTC 1VBE3 4NHMA 4LUKA 5EJ1B 5JZGC 1VAMA 1OQEA 4QWNA 1W0OA 1CWPA 1XRUA 4WVWA 3VKNA 4A45A 1GP6A 2DUOA 2B39A 1W6OA 2JIGA 1W0PA 3PVEA 1JHJA 1GZCA 1VE0A 1W90A 3V0AA 1CAWB 1NUKA 4V1PA 2A6WA 3W59A 5HXMA 5KXDA 1D7PM 3WUDA 1C5IA 2V73A 1S55A 5F6LB 1OH3A 3IPVA 4DEQA 4PI0A 4P9WA 1C57A 4BLJA 4PHZA 5DDJ3 2VUCA 4BMBA 3AP9A 4I0BA 3RPQA 4EN9B 2EXJA 2W1UA 2W94A 3ACLA 4UOJA 1DQ6A 3BTZA 3ZXLA 1OSGA 2VTFA 4FVVA 2D93A 2J1RA 3CBNA 3K3OA 5EP9A 4AFCA 3RQ0A 4CE8A 1RUI2 4RHV2 3B00A 4MGKE 2Z5WA 1W6OB 4UW3A 1ZBA3 3OOXA 1N1VA 2WSVA 4M01A 1ZRFA 5JIAA 5I0DA 1QJX3 4BPZA 1WMFA 3V0AB 4YW1A 2BP6A 2JD9A 2RS11 2F6BA 3L2HA 2ZX1A 2HWF3 4B4QA 4E8CA 1QJFA 5A7WA 4HPKA 3NAPA 4WM7A 1VBB3 2ARBA 2B4KA 4G3YC 3KVBA 1AX2A 2EA7A 3M3QA 2OYZA 4DZGA 1WW7A 3ROUA 1WMEA 2JG9C 1C8M2 3N9NA 1JOBA 4OQ8A 3CQOA 5FBJA 1F4HA 2BYVE 4NMIA 1DBNA 4EV0A 2WZEA 3LA3A 2CWSA 2QZ3A 4HVRA 1XU1A 4K8FA 1H4GA 2B45X 2CWMA 4XETA 2WAOA 3WF1A 3NSTA 4GAZA 1OLMA 3GGLA 3OB8A 4AYUA 2GC0A 1QKQA 5FK7A 1LOGA 3C7OA 1HV1A 3OTFA 4LO7A 4MVTA 2YPDA 5A7WB 4HPKB 2WL1A 4XJ9A 1HN1A 4WM7B 1RTVA 4JRAA 4ZU5A 2XBO2 3LSDA 4GWIA 5J98B 1PZ9A 3Q8FA 4PLNA 2GP3A 3NJYA 2WYSA 3TEXA 4NIIA 1PVC2 5FLHA 4COUA 3KZ4C 4J1XA 4MGIE 4KH9A 4D6SA 2OKXA 1SFPA 1UKGA 3LPFA 4DS0A 1GQHA 3SMHA 4B1LA 2RDRA 2OVUA 2TNFA 3AKPA 5JXGA 3WW4A 2RR13 2XB6C 5FYZA 2G9GA 2C9KA 2ZHMA 5EXOA 2A5ZA 3FBYA 5IVEA 2R0HA 1ZBA1 5FPBA 1W8TA 1WBFA 4EYUA 5A6YA 4BMEA 3N9LA 3NKGA 5KXCA 4WM8C 1JN2P 2JDAA 4RGGA 1BEV2 4AQTA 3J4UH 3K3NA 4J25A 5EIYB 2QFEA 1Q8SA 5IVBA 4FPFA 2HWF1 4EZHA 1PK6A 4BU2A 3VKFC 4DB5A 3T4HB 1VBB1 1RINA 2G4IA 3ZKUA 2FBEA 2P3IA 3PU8A 3S5AA 1U5YA 3FUQA 2RM22 5FYYA 5IVCA 1BHGA 2RDQA 3ALQA 2RS32 2Y6HA 4ISQA 5DAWA 2W0XA 1REDA 4OI0A 1HRI1 4OCTA 2RVAA 3T0BA 1H8TA 3LE0A 3VZLA 1LESA 2PHLA 2IXLA 4GA9A 1AR82 1AR92 4OLLA 5FTTC 1O3SA 2D6PA 1ND2C 1S0EA 3JBG2 4ITCA 4M3CF 1NYWA 2E63A 1VBD3 3ATGA 3K4DA 1GNZA 3NNFA 3WP3A 2IVJA 3CHXA 2HWB2 3GHMA 5DXDA 5D2AA 3RJRA 1VRBA 1HB1A 3PU3A 1PK6B 2R1DA 1WW6A 3KV6A 3HNMA 1TME2 5E89A 3AKTA 5EZWA 3QOPA 1OVPA 2W9XA 2VOWA 2WN3A 4TYSA 1H8TB 4M4PA 4FXKB 3SCFA 1FOD2 1DGWA 4JDNA 4EWDA 2MPFA 3KHCA 4CVUA 1I5ZA 1QJU2 3AYEA 1UYPA 2ZS6B 4LLOA 2E33A 4MLOA 2Q8CA 4AEKA 1NXMA 2CL2A 2DCZA 4FPYA 3KT1A 1NCRA 2NMOA 2D3SA 4PT6A 4AHYA 5CISA 1N1YA 2IWGB 1RUD1 4ZPIA 5GZFA 4CXWA 3OBZA 3VBOC 5IK8A 1YRZA 3USSA 1MZEA 1SCRA 2D44A 2OPWA 1RUJ3 1ST8A 5D8AC 4ZU4A 1MEC1 5FOBB 2DF7A 1XNTA 1AR63 3HJRA 4JGYC 3AP4A 5FPVA 3T2TA 4YFZA 5KXEA 1BLZA 1UY1A 1RL3A 3MLJA 5FZOA 1CR7A 3ZYRA 1GP5A 2JG8C 1H6XA 1XE8A 1ODNA 4QX1A 4OHYA 3RS6A 1GOFA 1A8DA 3CF6E 3E6CC 1AJKA 3JQWA 1RUG3 4LMFA 2J1TA 2PMWB 2BPA2 3MEPA 4GKYA 2FQPA 1NCRB 2R1BA 4TXWA 2F17A 3MLLA 4JC1A 4YGBA 4CDXC 1JYTA 4IE7A 1SLAA 2DVDA 4LO4B 2J22A 5DZEA 1RUNA 4QX8A 2FDKA 4UI9L 3AL5A 2XPJA 4UAPA 1BMV2 1Q3EA 4XJZA 3T3YA 2B42B 3VL8A 4QB2A 1D4M2 2QVSB 3B3QE 5JXIA 2P6CA 2VG9A 4GB33 1E5IA 2HWD3 3UGGA 4LK7A 5FZOB 3GZEA 3ZSMA 1RUF2 2YBKA 1RMU3 2X29A 1JH5A 4Y20A 1QWRA 2IXCA 1CVNA 3H1WA 3X29B 3K51A 3RNSA 3PIJA 4HVOA 1RXGA 4D94A 1N1SA 1SG3A 4CDUB 3PIGA 2QBXA 1UMIA 4O7XA 4YM0A 5EYYA 2JB4A 4CEYA 2GC3A 3WNOA 2DVBA 2LW8A 3LB9A 2BVBA 2C24A 4COYA 4CUAA 1LECA 4F8AA 5A1LA 1HXS1 1NZIA 1CN1A 1ASJ2 1ULEA 3HT1A 1F8VA 5J3UA 3WHUA 4LO8A 1GKBA 1QNYA 1FI2A 1GNHA 1XXNA 2A3YA 2J1UA 2QCSB 2VR4A 3PJQA 4W50A 4X8NA 3ZR5A 1HJFA 1VRH2 3I49A 2NZ9A 1CESA 3VBHB 3BGAA 2PHDA 5FMOS 2IZWA 1NZCA 3ZFGC 2EIBA 1RUC3 1Z7S1 4Y20B 5FXXA 4WVMA 4AL9A 5FP8A 3LA7A 4YNIA 5L73A 5FRAA 5FZ7A 3POSA 3FZ3A 4CEYB 4FPGA 1S2BA 1MS8A 3I2HA 5H9RA 3MI8A 2WWSA 3VBUA 4IGPA 5A3OA 1LHVA 2LM3A 1W2AX 4YPJA 1SDWA 5FKCA 1PM4A 4HG6B 3Q8EA 3WUCA 2BTVC 2WRAA 4A7KA 1PNGA 1W9SA 1ZRIA 4PBPA 3H9AA 4EE2A 2LRPA 5IVYA 4JKKA 2GC1A 1GWMA 3GJAA 4P9YA 5FKBA 5JWPA 1HQWA 1MZ5A 1PGW1 5FYHA 1S0IA 2QTWB 4QB1A 2QQWA 4HXCA 4GB31 4WVMB 5CG9A 2HWD1 1OC1A 1LAJA 4NO4A 3B9IA 5DUUA 4KGGA 3AK0A 1I3HA 2P5BA 3MIHA 3UL2A 4S2FA 3VBUB 5HI0A 4A6OA 4YFWA 2XQRA 3WLUA 2JEMA 3S30A 2WA4A 1O4ZA 5F3EA 4OUEA 1XB9A 3AMPA 3WF4A 5H9PA 2DU1A 2YB7A 1S0BA 3ZYFA 3WDYA 4C8DA 3POBA 1AYN3 1V6KA 5CKQA 1CZTA 4IGQA 4BQ2A 1COV3 2BNMA 2XJTA 2V5DA 1G9BA 2UWAA 3HD8B 3K77A 4GXLA 4HBNA 2UY9A 3APBA 3ZFFA 3VBFC 2L9LA 3N7KA 2WO3A 4Y5Z0 4MADA 1T6GC 1NA1A 2VGDA 3CL1A 4LQRA 4NROA 1YJLA 2XJPA 2ZGMA 4Y1VA 3UGHA 4ET7A 1KFUL 2R49A 2YBPA 2OUJA 2VZOA 3BN6A 4B7KA 4LE4A 4MHRA 1SQ4A 2VULA 2QKDA 3R4UA 1MACA 5FP7A 1WKYA 5TSWA 3I3EA 3ZN5A 4BH9A 1G86A 2WS93 1LOBA 3VBSC 2QQNA 3FUOA 2RV9A 4BQ5A 5C7GA 4EN7B 1KS4A 4XJUA 1YFXA 2R063 1YHFA 4QU2A 3T2OA 3OUJA 1JZ5A 4K1ZA 4CU6A 2ZAHA 5F3IA 3I2FA 2R0FA 3J8F3 4RYDA 2RMU2 3JD72 4LBQA 3ZFFB 4FTSA 4AVSA 1BYHA 2B9UA 4IW3A 4KG0A 1NA1B 4Q4Y3 4EN6B 3T1LA 4PLMA 1UPIA 2CAVA 3WG2A 2BWCA 4NR1A 4XC9A 2CGPA 1WCUA 3OGVA 3N4MA 4NN0A 4COWA 4JTNA 5KWRA 4RA0A 2YZ4A 2OW4A 4XDOA 3IBMA 1UW8A 1S1AA 1S0CA 1Y7BA 4AAXA 1UU6A 3ZN6A 1V6MA 4RFRB 4XAAA 1K42A 3KF5A 3FHIB 3ZVXA 3TBDA 1KJRA 4BHPA 3NVCA 1ZBE3 4B4RA 2VW2A 4XCBA 2UYAA 2C1FA 2IC1A 5J37A 1AYN1 2FMYA 4UBHA 1ZZCA 4Q2FA 5JOWA 4LBQB 1OQ1A 2XLAA 2BGOA 5CVRA 2FD8A 1BKZA 3TYJA 3OUIA 2WBKA 5D1IA 1XJAA 3RZZA 1DGLA 5SV5A 4NHYA 1QH7A 2XGXA 4NWVA 1DHKB 2BUKA 3AYAA 2W08A 4IV3A 4QXBA 5C3PA 1QXJA 4QM9A 2CGNA 3ZXKA 1MS3A 4DXRA 1ZZBA 3ZN6B 2BOJA 4NRMA 1C8NA 2EVXA 3LEGA 2RG4A 1PIV3 1STMA 3KF3A 2ET7A 2AGSA 2WS91 1JU3A 5FZDA 1IZ3A 1PO23 2D43A 1QQP2 5LB6A 1D0GA 1W6NA 1V6OA 5GZDA 2BOIA 1YQ5A 2WZR2 4UFJA 4JDOA 4XJAA 2D98A 4FFFA 5FYCA 3IN9A 1SHWB 2HKXA 4MG2A 1HQLA 1ULPA 2EIGA 1K12A 3J7NA 1UNBA 4JGZA 4XF9A 4NIDA 2OXBA 4FCAA 2A3XA 4IESA 4IV3B 4Q4Y1 1IPJA 1AL22 1XU2A 3QD6A 1W2OA 4HSJA 5FZBA 3VDDA 5LWBA 5JPNB 3PTRB 4IE0A 3UJQA 2HYXA 2XJQA 5F7UA 3W5NA 4J1WA 4K40A 2VMEA 3DPRA 2WNUA 1W6NB 4Z82A 3ZDVA 4C0HA 2BDRA 1CAVA 2WQ4A 1UL9A 2X8KA 2ZX0A 2YC2A 3PLQA 5DAPA 4ZY9A 3NJZA 1F35A 5L7OC 2PXJA 1RUI3 2NPIA 4RHV3 1OFNA 3TEWA 2YPJA 5FCCA 1O3TA 4OZXA 5IVFA 2XH6A 3I3MA 3DYMA 2KXLA 3K75B 4KBBA 1W6PA 1UZ0A 4XE9A 4ZXEA 2W47A 3R4SA 2GNMA 4JGZB 4BIFA 3SKJE 5LA1A 3KV5A 1IQAA 4Q4W1 5FUPA 3C7FA 3VDDB 2BFUS 3N9MA 1GUIA 3V56A 3RGBA 4XFBA 2GNTA 4QMAA 2GMMA 1NG0A 3ZXDA 2OPKA 1PGL1 2H0VA 1J84A 3TEZA 3DPRB 4WM7C 1YQ2A 4KWUA 3IAPA 1CAVB 4AEJA 1C8M3 3KLSA 2WR9A 4Y1XA 4XURA 1PIV1 2XOMA 3OBAA 5J1XA 1W8OA 3DECA 3IT8A 1XNDA 3ORJA 5A3LA 5A7OA 1PO21 1SMVA 2W5FA 3BCWA 3PUIA 2ZGTA 2VUDA 5JI7A 5C70A 5IW0A 4Y1UA 1W6PB 4W6XA 4IEUA 4XFAA 5IYYA 3BI3A 4HOOA 3VHNA 4JKLA 4P9JA 5FAXA 2PHTA 1LOEA 1DLCA 4AVBA 5LY1A 5F39A 2UY8A 1HW5A 2JD4A 4V2VA 1G6NA 1W9WA 2V09A 4MOAA 1GZTA 3O12A 1SPPA 5KC5A 4W6YA 4ATEA 5DQ0A 2FMDA 3DV8A 2XBO3 4HFSA 3B94A 2Q0AA 4Q4X2 2XG3A 3U14A 4MX3A 4YZ3A 4XJWA 2VH9A 4O9EA 2R042 1HN0A 4EWAA 1U5IA 3MBWA 1PVC3 3HMYA 4NHKA 2Q30A 2WWJA 3T2PA 5IUQA 3UYJA 4NUBA 1URXA 3AMNA 2YC4A 3VV1A 3RZJA 2J1SA 5FYUA 1RUI1 2WZPP 4RHV1 2VAUA 3VDBA 4ZXKA 1CGPA 3SKVA 4YM3A 2O1QA 5ACA2 3VBRA 2P3JA 3OG2A 3AXDA 3OGGA 1QJY2 2J42A 4XCAA 3ZMNA 5JMOA 4EWEA 1SPPB 4FI9A 3POWA 2XHKA 1BEV3 4WZCA 1L3JA 2JDYA 2R32A 2W1QA 5LRSA 5D21A 4P02B 2NMNA 4KG8A 2CHHA 3CEWA 5C4WC 2X05A 2F4PA 5LK7B 1IGOA 1W0NA 2WFF2 4L0PA 2GP5A 1LGNA 3AZYA 4FPCA 4ASMB 4Y3OA 4Q0VA 2RM23 4UFMA 5ABJC 1AYM2 3KV9A 3VB9A 4HVQA 1SFYA 1LR5A 5F5AA 4FFGA 1JZ3A 1AR83 1AR93 3IDEA 3VBRB 1RHI2 4N9HA 3ACHA 4PI2A 4YZ2A 3JBG3 1UYYA 2ZCWA 4HT1T 1WLDA 2VZPA 4UT5A 1FATA 2ORXA 2Y33A 1HV0A 3C3VA 3E5QA 5DAQA 2HWB3 3NNLA 5A1AA 3MICA 2VUAA 3A0NA 1JYXA 1GWLA 2X09A 3W9AA 1IKQA 5IK4A 2QQIA 1DU3D 1DZTA 2ZEZA 3K46A 1FPN1 5F2WA 1TME3 1LHWA 2XBO1 4ONUA 1CZSA 4AFAA 3CDZB 3VUOA 1QEXA 4LULA 3JZVA 4AEMA 2QJVA 3J26N 3ZYGA 1PVC1 1REFA 3LAGA 4RS5A 4XQDA 1FOD3 4IL7A 4S2DA 2X53S 1V9U2 5GLVA 3CJXA 3TN91 1W3VA 1XNCA 1QJU3 4N43C 4RQPC 1VMFA 4AFDA 1LOFC 1IG3A 1O91A 3PUSA 5L9RA 3KHBA 3M4FA 3GYDA 4NPLA 1BVP1 3AKQA 4ZHNA 1LCLA 5FYIA 3N9QA 4TZDA 4CRQA 3BUCA 2MNGA 5A7SA 2K9ZA 2JDHA 3ZYBA 4XZUG 1ZYBA 2A1XA 2G9ZA 4AEDC 4I3GA 3T4VA 1BEV1 2IVIB 4KU7A 3TAYA 4BJ0A 4BK5A 1WD4A 1NCQA 4FPJA 4BISA 4XF4A 2TUNA 3DGTA 1UD1A 4OYUA 4R52A 2XUMA 4CCMA 5CA6A 5T50A 3N3HA 5IFPA 2XVLA 4LBKA 4RS5B 2WQ8A 3H1MA 3MIBA 2RM21 2P34A 4CDQC 4A3ZA 2EXKA 4IEWA 2Q8EA 1VJ2A 5FLJA 2JDPA 4M4RA 2BV4A 4CEWB 4WBBA 1W28A 1AR81 2VD7A 3HPNA 3I54A 3NJXA 4CDUC 1AX1A 4XILA 4JQTA 2ZTNA 4CP2A 5DN2A 3SXWA 3WW1A 2WSUA 1UY3A 4UF0A 3FWEA 2V4AA 2E7TA 4LBNA 5FMCA 3ZX7A 5ANNA 3TRSB 1AR72 4E27A 2VQ0A 5C5UA 2HEWF 5AC92 4KGQA 1D4M3 4ASLA 4Q0SA 3VZNA 3HIFA 1TME1 1RUF3 5C9AA 4BXFA 1W8FA 3RZKA 5FP3A 5F5QA 1G7YA 1PM7A 2GC2A 3VBHC 1XSQA 1UKRA 5GM0A 1LTEA 2HLEA 4MV2A 2DVAA 2H6CA 2HWE2 2XVGA 3LF7A 1FOD1 1OF3A 3LFIA 4R4ZA 2VZQA 2QQJA 2DCKA 3B02A 1BBT1 1LOCA 1QJU1 1ZA4A 3WW2A 1ND3A 4DFSA 1POV1 1WLWA 5K0UC 1ASJ3 5EQUA 1N3OA 5LY2A 1LU2A 2AR6A 1OLME 3LEKA 4UF0B 4I3PA 5E8AA 4XTMA 5FZHA 4CCOA 5BNPC 3LA2A 2BGCA 3ZR6A 1DCSA 5EWSA 4YZ1A 5A3PA 2R071 1VRH3 3POYA 4RD7A 1QXRA 4UW5A 4DUVA 4Z1VA 5A32A 2GMPA 2GU9A 4KNCA 4NWWA 5C9AB 1JZ2A 5JUVA 5KHHA 4GH4B 4XMAA 4CU8A 5F32A 5LBEA 4QKBA 3FC0A 4O65A 3KT7A 1QH6A 1SACA 2IXJA 4DXZA 5LK5A 2ZMKA 3HR9A 3UV9A 4LHNA 4QT6A 4JHZA 5F8PA 5APAA 1RUOA 1ND3B 4Q1RA 2WQZC 4QX0A 1RITA 4M3CA 4LUMA 1CAXA 2CYFA 5JXJA 3MZHA 3U4SA 2GNDA 1HB2A 1YIPA 3BOPA 3WG1A 3WNKA 5C8WA 3VBUC 5HV4A 1FYUA 1LHUA 4I02A 3VD3A 2Q8OA 5F37A 2QQVA 4PLOA 4MHUA 2P17A 4D7SA 2C6SA 4H14A 2ADDA 3CJIC 1OI6A 5A32B 1O3QA 3D0JA 4YVWC 4ZS2A 1BMV1 3GJBA 2XKPA 1W2TA 2J1EA 4LT5A 3POEA 1EV12 2ZGOA 4XFGA 5H9QA 5GLTA 3WVJA 5A6QA 1R092 3H3ZA 5FZKA 1RUF1 3AP5A 1B09A 1CIWA 4UFHA 3S7IA 1XE0A 1GNYA 1F4AA 3SH3A 2XONA 3ZMOA 2JDZA 4M3CB 2BBVA 1CAXB 4QXCA 4BLIA 3J7HA 1ZRDA 2PAMA 1OOPA 3SCGA 1VLNA 3QLQA 4IEPA 1FMD2 5LBFA 2WT0A 1WD3A 2A71A 5FR3A 4UFLA 3AJYA 1JOPA 3HBKA 1ASJ1 1JYCA 3NO8A 4FPEA 1X8EA 2VW0A 4G9SB 1OA3A 1X36A 1QHDA 1SLCA 2FHRA 2MEV1 2PLV1 3ZXFA 4AI1A 2BQPA 2XLFA 1VRH1 3IPVB 3PUHA 1A78A 3BTAA 2CV6A 2PHWA 2QE3A 5CKNA 1WWYA 3ZFFC 2FDJA 2VCAA 4YM1A 5CAZA 3KGLA 3DXUA 4FQZA 4BB3A 1RUH2 3D6EA 3GZTB 3ST7A 1VBC1 3WZ1A 5BYNA 1NLQA 4GMP0 5FOJB 1GMMA 1OOPB 1TE1B 3D8CA 3I4IA 1XBFA 5JVVA 2ZKNA 2VMCA 3H7JA 1VBE1 3RFRA 3PVOA 5FXVA 4AI8A 4XUPA 3EB7A 4META 2D97A 1R1A2 4XABA 1JYIA 3I2JA 1W99A 2OT7A 2RMU3 2CY6A 2VECA 3JD73 3THTA 4AFMA 1DGRA 5C8CA 3NAPB 4G4FA 1CX4A 4XEZA 3UGFA 4CXYA 2V72A 5CNAA 3VLBB 3GBWA 2VZ3A 5EPAA 2DTYA 4DY5A 5T54A 1UPSA 3C7HA 4E4SA 5DDJ1 3ITQA 2RJ2A 4L11A 4EROA 1SBEA 1QOSA 1US2A 1IPKA 2VW1A 3BOWA 2PA7A 4QGMA 5A3MA 4DMIA 1ALYA 3O1OA 1AF9A 1RVF2 1WW4A 2ZBJA 1W8NA 5DG1A 1FNYA 4DOUA 2DCTA 2P3KA 4CUCA 4HETA 5C8CB 1QJX1 2YHJA 4H2AA 2W39A 5LASA 1SLTA 4ZU7A 1HJGA 4COZA 3V0BA 2GZWA 3WT3A 4OI2A 2VZSA 2OZJA 5GLZA 2GNBA 4IE5A 1XYOA 3WXPA 3ZOIA 1GLHA 1X9PA 1OBNA 3FBMA 5F3CA 5A80A 5H9SA 4M0HA 1H2LA 4XJ8A 4CCCA 2DBNA 2IXIA 3HBZA 2X5IC 4LITA 1LHOA 1JS9A 4XQWA 3H8XA 4UFIA 5FZGA 5M0TA 5I0SA 1DQ5A 1QQP3 1CQ9A 4AVTA 4LE3A 1TMF2 2WNOA 4IEQA 2WZR3 5FWJA 5CADA 4RGKA 3WQ0A 5CFDA 4NJ4A 1LOAA 2Y6FA 2NM1A 5BNOC 4P5YA 4P9XA 2IXKA 4A2UA 3JD71 1K5MC 5I0TA 1MS1A 5BUVA 3U0ZA 3P3NA 1Y9GA 5ISLA 4KWJA 1AL23 1UMZA 3NW4A 1QOTA 2CU5A 2VL4A 2ZHNA 4FP3A 1VP6A 5FREA 3OEAA 2CTVA 4AHXA 3VDDC 4GULA 1KITA 4Q26A 3I2IA 3SEPA 4IGOA 1X82A 2OA2A 1H6YA 1ULFA 1S2EA 2DCYA 2ZGKA 2Y60A 4PDWA 3LDKA 3H8RA 4QQLA 3MDPA 2RS52 1H1IA 2RR11 3NMBA 4BE3A 5DG2A 5IATA 2VBPA 5FUNA 4R9DA 4BIOA 5CFDB 2JJ6A 3FLRA 5F9TA 1I9RA 1UCXA 3WF0A 3JU9A 3O14A 1EAH2 3MW2A 1VB4A 1W04A 2D6MA 2YV8A 3VN4A 3KCYA 3MV01 1APNA 3VD7A 1KEXA 1YO8A 4AGGA 4YZ5A 1JYNA 2JIJA 3LIGA 4YRDA 3LQCA 4XF3A 1T6BX 4R9AA 2WNVC 5JPMB 4Y1ZA 3SLIA 2ZPXA 5AVAA 4YSFA 4LPLA 3TB0A 1ZM1A 2W1WA 4U36A 3E6DA 4WZFA 3N35A 4AI3A 4NAMA 3LFMA 2O0OA 4PDWB 1WZXA 1BZWA 4LBOA 1MS9A 1YFYA 4TWTA 1H2KA 2OZ6A 2Y26A 4N53A 2WYFA 5IWFA 2Z69A 1X50A 2PHRA 1AJOA 2VMFA 3FFZA 1IOAA 1OA2A 1QQP1 2BNOA 2ENRA 3K4AA 4AGRA 2WZR1 2D6NA 3M3OA 3RWKX 4NIAA 1VBD1 2JICA 2BEOA 3FFQA 2W68A 2X10A 3ECQA 5CYYA 5G05L 4LR4A 1REEA 3LEMA 4FPLA 1XSRA 5I91A 5HCBA 4P9GA 5GKAC 3LSEA 3WOGA 2E6VA 1C1LA 3OBTA 2C26A 2VPVA 2XXZA 4Q4X3 4LLFA 1JW6A 1AL21 1MPXA 1RUE2 2A73B 3OD0A 5T55A 4RR3A 2R043 1W6MA 4XUOA 3S5QA 3LPGA 4N53B 5IK7A 2ZEXA 4AI0A 1CPMA 2RJKA 5FLIA 5CG8A 5FZ4A 2CDPA 3KB5A 4HSLA 5FIXA 2W2IA 4E4DX 3A0KA 5ACA3 3R6SA 4SBVA 2WINB 1QJY3 1VMHA 2ARXA 1B35A 2ZGQA 4QXKA 5FYSA 3CMGA 4NHLA 4DXTA 1JXNA 4S2GA 1OPOA 3Q8CA 1RUJ1 3L9JT 4CU7A 4QPYA 4CCJA 3GBFA 4CPBA 1AR61 2B9VA 2WIIB 3NWKA 2I07B 4RR3B 5GJ6A 1W6MB 4YYOA 4FAHA 1SDDB 3N7LA 4D69A 2WFF3 5FY4A 2FZ2A 1OFSA 3FE5A 3ILRA 3B69A 4JAAA 2XJRA 1AYM3 1SCSA 1RUG1 1KGYA 4XFIA 1OPMA 2RS12 3P6BA 3AMQA 2BU9A 4J6GA 4AXOA 4MGYE 1RHI3 3D4KA 4P9IA 3WNXA 1MVQA 5K9YA 1B35B 1PNFA 3PVBB 4BOWA 2EAKA 3AZWA 1QU0A 5HCHA 4BXSV 3AL6A 2CNAA 4QDSA 3UKVA 4K6BA 4B8EA 1R1ZA 2JX9A 2WKKA 1DGWX 2MHFA 4CCNA 1W9FA 3ILNA 3QH6A 2SLIA 4LO5B 4YW2A 1MQTA 3PMSA 4QQHA 4Y4YA 3PJYA 3A22A 5A3NA 2UWCA 3EJKA 5JZGA 3ELNA 1S0FA 4ZS3A 1RMU1 1POQA 4E9KA 1WA4A 2R041 1W03A 1DGRN 5JLVA 4AQ2A 4PJYA 2H6BA 4FBFA 1G9DA 1V9U3 1RIRA 3MIFA 3HVDA 1NAEA 1OD5A 4M00A 3E1F1 4ARYA 1H2NA 5ERLA 2AUYA 3ZLIA 4HK8A 4XHBA 4TSVA 2LTNA 4AOCA 4CYDA 2ZOEB 2ZX3A 5ACA1 3UK9A 1PX3A 5BV6A 5IHRA 1QJY1 5DUWA 4JTOA 4CEWC 1KDKA 4QHOA 3O1VA 3RYPA 3N9OA 2VMGA 1Z0HA 4NPRA 2HYKA 4CDWC 1H4HA 1TZOA 2DU0A 3THDA 2Z79A 3OY8A 5A7QA 1HRV2 1R64A 1RUC1 4DPNA 2Q1ZB 1IG0A 3ACGA 3ZXGA 5LEKA 2HBTA 4I09A 4K1YA 3R05A 3UETA 3WEZA 4FPOB 3PDQA 4N9IA 3RSJA 1XNKA 3H8UA 1LEMA 1SBFA 1YUDA 3W58A 4AG4A 1RB8G 5BXXA 1YEWA 2ZX4A 2VUJA 2VO5A 1QY4A 2Y64A 5HV0A 1U12A 3A21A 3T09A 1GU3A 4MGTA 2HWF2 4XTPA 5EYXA 1S2KA 2WO7A 3WNNA 1J83A 5ANQA 4ZONA 1VBB2 1T2XA 5KHGA 5DZGA 4AVVA 4DEVA 2RDNA 1LGCA 3OY8B 1F31A 1FAYA 5JMCA 1AR73 5DPNA 1WW5A 4XACA 3USUA 5AC93 1HRI2 4N7UA 5IVVA 4XUQA 5FY1A 4AFBA 4LOSA 1HQNA 5K7PA 1R082 2VMDA 2ZHKA 3GZUC 3K48A 3AVRA 1UMHA 1EP0A 1MVEA 1OUSA 2TEPA 1IS6A 2HWE3 4GH4C 2ARCA 4XVHA 3I7DA 4D7TA 1JYVA 4R8HA 4XW3A 3ME2A 2YROA 3NL1A 4YW7A 1GZWA 4INDA 2V4VA 1KJLA 1NY72 5C71A 2VOVA 5FZIA 2IUWA 1COV1 1NXD1 2DYCA 4RL7A 4N90A 3USUB 4Q0PA 2WC2A 4DRVA 1Q43A 1UOJA 5B4XA 4LXLA 3H1YA 4IUGA 5FMOL 1L7QA 2P37A 3DN7A 1V70A 3EBRA 3AXEA 4JZRA 3ZKYA 2E26A 4WM8A 3KT4A 1RUD2 3AX4A 3F95A 4AHZA 1GZWB 1UU4A 5DABA 3E97A 2QQPA 5JAXA 2R061 3A4UA 2J1AA 3GDBA 4YARA 3T2QA 1MEC2 3H8OA 1DYOA 5FMBA 1CX1A 3ZDSA 1S0DA 1WCSA 1J3RA 3POGA 3W20A 4AWDA 3B01A 4RSUA 2FZ1A 1Q5OA 2ZGUA 3J8F1 2VVDA 3PUAA 4C0BA 1UX6A 5F1RA 1SLLA 4JVAA 2VU9A 2FDGA 1AR71 2JWPA 4L2NA 5DZFA 1EV13 4LNVA 3ZPOA 2WT1A 5BY5A 2ZEWA 4Z8BA 4NVPA 1ND2A 1R093 2A7AA 5C33A 1XC6A 1ZZ8A 3O0VA 4WM8B 3MW4A 1I6XA 1VPHA 4LJHA 3ZYHA 1IQDC 2VM9A 2HWE1 4QQOA 3UESA 4BQYA 2Y0OA 5DMYA 2ZACA 3EQEA 3O1MA 4LHLA 2WDBA 3PHMA 2VCBA 1FMD3 1ZBE1 2AYHA 5KBFA 5F5CA 1F15A 2V5YA 1YFUA 2AZ5A 1UY2A 1C3HA 1DP0A 2NN8A 2W92A 3KQRA 4A7YA 4HKWA 3GZAA 3VD4A 3RZMA 3PMEA 2BZDA 4XIOA 1O8SA 2Y34A 1JZ4A 1NT0A 3OPWA 1EPWA 3QH7A 1ND2B 3SHRA 5FV3A 3ZFEA 1PZ8A 1DFQA 3AZXA 3NAPC 5FJKA 5GALA 4XFHA 5KHJA 2WNUB 1OH4A 1HXS2 1UIKA 1ZZ6A 5LCWL 2C9AA 1IS4A 1RUH3 3MV11 5E1RA 5FYVA 3VBOA 4AHWA 1AUYA 4OI1A 1OMIA 3HAGA 1AVBA 2K46A 1H8VA 2C4XA 5B2GB 4Q27A 3SITA 3PTYA 5D8AA 4OMDA 4LBJA 4BWOA 4JGYA 1YXWA 2QQKA 1KRIA 1R1A3 1Z7S2 2IFRA 1FX5A 2P3YA 1O5UA 3BKZA 4YVSA 1QGLA 1UZYA 4I30A 4QDRA 4CP0A 2YMZA 3ZFEB 4AVAA 2FCTA 2JXAA 2QQUA 4PIXA 3O1UA 2BJSA 4OHWA 1UN1A 2JECA 4KU8A 5FP9A 1R091 3VBOB 2Y6LA 1KD7A 1WMXA 2DFCA 4QPWA 4Y26A 3VDCA 1YYNA 2PQQA 2FDFA 1WGPA 4UBGA 5D8AB 2YY1A 5E16A 4JGYB 5F3GA 1QIQA 1RVF3 1K45A 5C3SA 3VHOA 1PGW2 2HWC2 2OIIA 4QKNA 4YW3A 1ZA7A 5J48A 1QDOA 4D6QA 3RZLA 4GB32 2HWD2 2P2KA 4YVSB 5LBCA 1A6CA 3IIIA 4IEXA 1H0BA 3FMGA 1LENA 2JDUA 3D3AA 2DBIA 2P6HA 4AK3A 1D0HA 3ZN4A 3INAA 4JX0A 1A8MA 3ZIWA 1JI6A 5T52A 3OYWA 5CFCA 3WCSA 4UYBA 4D3WA 5FQ0A 5FZFA 1POV0 4OFGA 1PK6C 1O4TA 1VBA2 4Y22A 1DYKA 1E5RA 2I45A 1CZVA 2DFBA 5A7PA 2RS33 3A23A 1C8M1 2YFZA 4GJYA 4X8PA 2A6VA 2ZGSA 3L2YA 4BYYA 4XF0A 3WD5A 1QOOA 4KI5M 4LTAA 3KVAA 1H8TC 1N47A 1BQPA 5FO7B 1TMF3 3ZFGA 2JDKA 1AXYA 1MS4A 5LW9A 3T0DA 2VCCA 2YDEA 1R1A1 1HKDA 1PX4A 4LOTA 5CFCB 1XYNA 4I01A 3JB4C 4IEYA 4P00B 4Q4V2 1SLIA 2A6XA 5FQ0B 4ARXA 1O4YA 4K7JA 3GNEA 4Y22B 4XUTA 4HL0A 3H50A 5KXBA 3SISA 1PHMA 3VL9A 2YU1A 4D7YA 5CEHA 1DZQA 2E7QA 4HN0A 1F5JA 1IPSA 1VB2A 1W6QA 2VNOA 2DVGA 4M3CE 5IAVA 5J09A 3RRDA 2RS53 3N7JA 4V2WA 3BVCA 3ZFGB 3H7YA 4CTEA 4BQXA 3HNYM 1RVF1 3LOIA 5BPXA 1FT9A 2O14A 1YLLA 1EAH3 2JE9A 5JSPA 2DTWA 1NCRC 5JXHA 4FSJA 5GLWA 2ERFA 3T1MA 1HX6A 1C5HA 1GQPA 1O3RA 5J7MA 1V0AA 2D3PA 1M4WA 4ES8A 3GBGA 4TLFA 3U4XA 2D3RA 4FOYA 5FYTA 2Y8KA 2BFUL 3H0OA 3U10A 1W2NA 3JB8A 1ONAA 2Y6GA 4GJZA 4CZSA 1U0AA 1WCKA 3DF0A 2VE1A 1W6QB 2VBDA 4PCRA 5FZ9A 1AXKA 2D5HA 3D5OA 3NV3A 2AENA 5T5JA 3OPZA 2C5DA 2RS31 5CIRA 2G1MA 1ODMA 3WY6A 2QQOA 2AREA 3VBFA 2Y38A 1AR91 4DUXA 1TMF1 5FPXA 2FCUA 3EO6A 3JBG1 1PO12 4H3WA 1DDLA 1RC6A 3OCPA 5IT6A 3IMMA 3ZXAC 3VD5A 1LEDA 2PHXA 2Q4SA 2OQ7A 1NCQB 3W21A 4Z2WA 1AZDA 2HWB1 2WN2A 2XR4A 4XXPA 4BK4A 4B3NA 3GALA 1K3IA 2ETEA 4W8JA 3WG3A 3VBSA 4OMCA 2XJUA 2QDRA 2ZJCA 4JCKA 5J96B 4IV1A 1FXZA 5FPUA 1J1LA 1UOFA 1XQNA 2HEYF 1RUE3 4FPKA 2VNVA 2CSGA 4R4XA 5FY9A 1OD3A 2ZHLA 5T5LA 4BQ1A 2N7GA 1G8WA 2WZ8A 4PQ9A 4YW4A 4Z07A 4DO0A 2VY0A 3C2UA 5FY8A 4DXSA 3RMYA 2E7AA 1US3A 1WLCA 5IVJA 1NLSA 2A75A 5FPAA 3UT0A 3VBFB 1UY0A 3AFKA 4IE4A 4ATFA 1SLBA 2RS51 2W52A 2ZGLA 4FXGB 2JB8A 4CEYC 5K8SA 2NQYA 4YZ4A 3JUUA 2HBUA 2PN5A 2YG0A 4IERA 4KBZA 3ZSJA 1NX9A 2JKBA 2QUOA 2ZABA 4UXAA 1UYXA 2KM2A 1M06G 3OGSA 5J36A 4XXAA 1B35C 4IV1B 3WNLA 1CJDA 2EALA 2ZGNA 4E4HA 1AX0A 4QQPA 4QPGA 2XWBB 4XAEA 1MS5A 4X6QB 5EJ3A 5EV7A 1WUVA 5DUVA 1JYWA 2DWRA 2Z42A 5LBBA 1VR3A 1ACCA 4AI9A 5T5OA 3I2DA 5JI9A 2TBVA 3AMMA 2WA3A 4GWJA 3OUHA 4Q4W2
chains in the Genus database with same CATH topology
1YJKA 2D5FA 3MF9A 1BCXA 3O0WA 2PFWA 4AI2A 4MXVA 1DQ1A 1CAWA 1JOJA 1TEIA 2ILMA 3DUIA 3WDUA 1PGL2 5I8TA 4F3JA 4BA6A 3BODA 1X7NA 3M8LA 4GWMA 4QPGB 1KDMA 5SV8A 3VKLA 3DL3A 1D4M1 5KHKA 3KCCA 4YG3A 1OA4A 1LKNA 3NV2A 4IEVA 4Z92B 4RGAA 4QQ2A 3AYCA 4ISRA 4WVZA 1J59A 3QACA 3IMNA 4YGCA 1KS5A 1YCIA 4F83A 3WDWA 5KC6A 1XNBA 1FV2A 5EFUA 1RGSA 1KQRA 4Q0UA 4LBMA 1A3KA 4E2SA 2WLQA 5L7OA 1HRV3 2EF6A 1NA1C 2GAUA 3TOJA 2RJLA 3S7EA 1DG6A 3MW3A 4L99A 1AHSA 4CP1A 4YG0A 1VAKA 3ES1A 5FFOC 1CD3G 2DVFA 4OVEA 1N3PA 3PNAA 5JOZA 1BXHA 1PMIA 1LRHA 5FO9B 2B7YA 4XDQA 1RJ8A 1NQJA 2VNRA 2EXHA 3ES4A 5L7OB 1LB2A 1HRI3 1V6IA 1YI9A 1MR5A 1R083 1F9KA 2VXRA 1ENSA 3EXUA 2ZZQA 4MXWA 3N7MA 4Q0QA 2Y0IA 4XF1A 3MLKA 4FTEA 2UU8A 4Q1PA 3AZVA 4W65A 3TWIA 3CNAA 4HANA 1N1TA 3MIEA 1FPN2 1Y9QA 3U07A 1GICA 2ZKLA 1PZ7A 1NE6A 4EN8B 5F6KA 3HT2A 1I1EA 2GH2A 2A3WA 2VNGA 4I0WB 3TN92 2VQAA 1HRV1 2I2SA 2B5HA 3N36A 4MXWB 2PHFA 3ZYPA 2JE7A 4IV3C 4QPIA 2E51A 3H3UA 4LO6B 1UF2C 1C4RA 3UKTA 2WJSA 1RUD3 1MZFA 2QZ2A 3FJSA 3MPPG 1C28A 4GMP3 4YLZA 3URFA 1ZRCA 1SBDA 2GALA 3VHPA 3IDCB 5CB7A 5C4WA 5LEJA 3UKNA 3BPZA 1MEC3 4XZPA 1QMJA 2SBAA 1X8MA 2XJVA 3B9CA 3V0BB 4K20A 1Q8OA 2RMU1 3WCRA 4AE2A 5ABJA 1F5FA 1G9FA 1DIWA 4JGZC 1TQ5A 2QDNA 4QPIB 1R081 4L92A 4Q29A 2YGLA 3E5UA 3M3CA 4AW7A 1DYPA 1YI7A 3IKWA 4I2OA 3DPRC 2WNUC 4I0AA 4NOTA 5C4WB 3WW3A 1O7FA 4H55A 2KA3A 3ZPYA 4YGDA 1NY71 1Q8QA 4O9GA 5IK5A 5LRRA 4FPHA 3QBQA 5ABJB 4XHXA 1G9CA 4DRRA 3O5SA 4BCUA 4EJRA 1FV3A 3V65A 3VZJA 4K3UA 2LALA 4SLIA 3U11A 4N43A 4RQPA 1LOFA 4XQ4A 1BBT2 3GF6A 3MIGA 3ZFEC 2VOKA 2RHPA 1HXS3 1BVVA 4N7IA 4HK9A 5I8SA 1FNZA 4XBNA 3GHNA 1H9PA 1ZZ9A 2NP0A 4AEDA 4GMP1 4XFFA 3MF6A 1GQGA 2R072 1TNRA 3OJBA 2HJIA 1OLQA 1Z7S3 2GH8A 2ZX2A 3VHRA 3ZO0B 2B46X 4CDQA 4N43B 2R30A 4RQPB 1PVXA 2VVFA 3WDVA 4YVSC 3JQXA 3M70A 3RG0A 4CDUA 3CO2A 2VMIA 2WNEA 4DINB 5HCFA 4JRLA 2XVKA 4QGNA 3ZSLA 4AEDB 1YNAA 4B7EA 4PBOA 1GYKA 5JSOA 5AFEA 3FLTA 1IHMA 3VZMA 3G6JB 2IXHA 2HWC3 3OD4A 4Y24A 4YM2A 4YW5A 1U5ZA 2BWAA 2UYBA 3NKTA 3RJ2X 4CDQB 3ZSKA 3VBHA 3TNQA 3KCXA 3ENRA 3KS7A 3VBRC 5BNNA 2VOXA 3THPA 4ZKTB 4HKLA 3WX5A 2ZGPA 1D2QA 1QXPA 4XPVA 3WP6A 4AF9A 4IEZA 1UU5A 2XWJB 2VVEA 5GZEA 5K0UA 2ZGRA 5CFCC 1VBA3 1X33A 3JCIA 5BNPA 3MFCA 5I0RA 2ZZJA 3BU7A 4OHXA 2MEV2 4P14A 1TNFA 2PLV2 2I74A 4KWLA 1HIXA 1H2MA 3ZYJB 1LODA 3WHTA 1CONA 4FQ4A 4XYXA 4LEJA 5BNNB 4Q8KA 4B4PA 3AFGA 3PVNA 3LCPA 2EXIA 4OI4A 4Y1YA 1VBC2 5I0UA 4Q4V3 1D2SA 2YC0A 4Q4X1 5K0UB 2DUPA 4QX5A 1VBE2 4IETA 4E2QA 2PAEA 5BNPB 3UJOA 1DQ2A 4FT8A 1HLCA 1VAVA 2ZAAA 4IXLA 2YYOA 1OHFA 3VZKA 3CJIA 3TNPB 4RS5C 3WG4A 2GMEA 4LBQD 4OUMA 4YVWA 1EYBA 4P9LA 2HWC1 1C1FA 2UWBA 4HKOA 3O0XA 2ZMLA 3MGUA 2BW8A 1RJ7A 4JQRA 3RWNA 5DDJ2 1MQTB 1F2NA 4XOGA 4XBQA 5JZGB 3ZYIB 4UW4A 1D4VB 5KHIA 1NCQC 2WFF1 4AQ6A 2GDFA 2PELA 1ENQA 1VBA1 1ZBA2 4L9BA 3CJIB 2R6QA 1J58A 3MPBA 3WP5A 4YVWB 1AYM1 4C1XA 1QJX2 1ZRRA 3E6BA 1IS5A 2ES3A 1Y3TA 1OKQA 1RHI1 2JENA 3ZXEA 3RYRA 1PO13 1DQ4A 3NV1A 2JG9A 3J9SA 4OUSA 1LGBA 2XL7A 4A7ZA 1V6LA 2IFWA 2O8QA 2YUEA 1GFF2 4DQAA 4Q4V1 3WV6A 3AP6A 1V6NA 4AVCA 3S6PA 4IV1C 4X6RB 1ULCA 5C9AC 1WCDJ 2C0ZA 1ENXA 3EHKA 1J3QA 1EY2A 3SH5A 1V9U1 2NLRA 4AQSA 4FOQA 4OHVA 2XL9A 2XKOA 1ND3C 1JHNA 1Q8PA 2JG9B 3IIAA 5JCTA 3E5XA 3KD4A 2ATFA 2LUWA 3WR0A 4XMIA 1WMDA 2RR12 4C1WA 4H7LA 4K21A 3KM5A 4QPGC 5FO8B 1Z78A 5L19A 4UW6A 3KMHA 4C90A 3DKWA 4FAGA 2E9QA 2DURA 5FDBA 1IS3A 3MYXA 4BZ4A 4LA3A 4FOVA 3M3EA 4K9SA 4Q4W3 1JUIA 2D40A 5I8YA 1PO11 2D7FA 2D6LX 4B29A 2BNNA 2X5IA 2EAAA 4XIKA 3ZIXA 5AC91 1LULA 3Q9OA 2D6KA 4MGZE 1QNWA 3MIDA 4H7MA 1ZVFA 3AJZA 1UAIA 2A6YA 3IM0A 4HZFA 5BNOA 1VBD2 1GV9A 3ILFA 4GALA 3P3PA 1K5MA 3AKSA 4MH0E 5T3NA 1OOPC 5C6CA 1XE7A 4JV4A 2DUQA 4Q8LA 3ASIA 4FP2A 1JUHA 2D6OX 2X5IB 5JIUA 4KQ7A 3WQ1A 2PAKA 4COVA 5HBAA 3ETQA 3D82A 4U2AA 1GANA 4KL1A 4AG4A 4E4ZA 3FLPA 4FO9A 5JSRA 2XJSA 1NQDA 4QM8A 1CAUA 3OGJA 5BNOB 3AB0A 2DCJA 1H30A 4MYEA 2VMHA 1K5MB 1UZZA 2WNVA 5A33A 1CPNA 1W39A 3BIWE 3AZZA 1CJPA 1ENRA 1RUJ2 3AP7A 1AL0G 1AR62 3HQXA 4F7ZA 2JG8A 3VGIA 1V00A 3RYKA 3IDBB 5DUXA 5L36A 4A3XA 3LZZA 3S0MA 5C8CC 1EPZA 1QJZA 1EV11 1CAUB 1RUG2 3AM2A 4ES9A 3RI9A 1GZ9A 2PTMA 4CDXA 1ZZ7A 1BK1A 5BNQA 3I8TA 4WVVA 2Z2SB 2WNVB 5A33B 1DF0A 3KSCA 2PYTA 1Y43B 2WLPA 4KWKA 1SFNA 1FMD1 2JG8B 4GKXA 3V64A 5FBZA 1Q56A 1LU1A 1FPN3 1RMU2 4DY3A 5GZCA 4PIYA 3VKOA 1QF3A 3VZOA 3R0RA 1GBGA 4CDXB 4IEOA 1DQ0A 1VIWB 3B93A 5CU1A 3TN93 4GIQA 4MSVA 4XFCA 3AMHA 4MUVA 1RUH1 3OF1A 3WP4A 4QPIC 4OULA 4URTA 1ZX5A 2AH2A 1O5LA 4RFT0 4S2HA 2OUHA 2GSYA 4ORFA 1RUC2 4DNYA 3IWZA 3SH4A 1ZREA 3WINE 5CFDC 4QGLA 3OYWB 4PF5A 4HLTA 3HN1A 1QDCA 4M0NA 1SEFA 1BJQA 4BM8A 2WT2A 3M2MA 1S0GA 1IKPA 1GR3A 3B7MA 3MFAA 4PDWC 1DLLA 3LWCA 3I59A 1LJ7A 1ULDA 4LBLA 5JR7B 4L97A 1DZRA 5FPZA 5HCAA 3VKMA 4FTBA 1HDKA 1NLRA 2HEVF 3O7OA 3G7DA 2BVVA 3CLPA 1BBT3 2DV9A 3RMXA 3D0SA 1JBCA 2O8OA 3ZXJA 1S0JA 1POV3 1AYN2 1N3QA 3AKRA 3BALA 2XLGA 2K0GA 4QHBA 4CEWA 1J1TA 1COV2 2G9FA 3I59B 3KGZA 3M7AA 4CDWA 4N53C 1WLTA 1YFWA 2R073 2Q1MA 4W6WA 1H1MA 1NE4A 1JTZX 5I93A 1J3PA 4GQ7A 3SCHA 1YIFA 3WDTA 3CU7A 5JOXA 2QNKA 4XBLA 4LA2A 5E88A 2PHUA 4P5HA 3LKJA 1H9WA 2WS92 3QCWA 4YG6A 3OBRA 4OHZA 2A6ZA 4LHKA 2R062 2A70A 2GN3A 4RR3C 1YWKA 5AFBA 1OQDA 4CDWB 5GLUA 3J8F2 3R4DB 4MZUA 1G9AA 1GSLA 2ZMNA 4E2GA 1MZ6A 3WQ7A 3HWJA 4Q4Y2 4EN0A 1U5XA 1UIJA 4HN1A 1EAH1 4QD2A 1KFXL 5JDBA 4PIZA 1V6JA 2R16A 3LOBA 3VBSB 4C91A 4GWNA 3NV4A 4HMZA 3WDXA 1H1AA 4GH4A 3LGRA 3FX3A 5JOYA 2RE9A 1VALA 5BNNC 1LHNA 1Q8VA 2CGOA 3M3IA 2NYYA 1KXGA 2YGMA 1E57A 5T5PA 5CBLA 1ZBE2 1MS0A 3B5LB 1XYPA 4AGVA 1ZNPA 4JDMA 1NOVA 5AVPA 1PGSA 2UURA 2CAUA 1W2UA 2MEV3 2RS13 2PLV3 2E53A 4L8QA 2GN7A 2WFPA 4R9CA 1AXZA 1OLRA 3BB6A 1WBLA 4YGEA 3RI8A 3ZSEA 1ULGA 4IQPA 2ZA9A 2ET1A 2B8MA 2YXSA 5HXVA 1VBC3 2K2SA 2H0BA 2Q5TA 1PIV2 4R9BA 3RDIA 3M1HA 5GZGA 3AYDA 1PO22 4FOWA 1RUE1 4WV8A 1MQTC 1VBE3 4NHMA 4LUKA 5JZGC 1VAMA 1OQEA 1W0OA 1XRUA 4WVWA 3VKNA 2DUOA 2B39A 1W6OA 1W0PA 3PVEA 1GZCA 3V0AA 1CAWB 4V1PA 3W59A 2A6WA 5KXDA 3WUDA 1C5IA 2V73A 1S55A 5F6LB 3IPVA 4P9WA 1C57A 4BLJA 5DDJ3 4BMBA 3AP9A 4I0BA 3RPQA 4EN9B 2EXJA 3ACLA 1DQ6A 3ZXLA 1OSGA 4FVVA 4AFCA 2D93A 3RQ0A 1RUI2 4RHV2 3B00A 4MGKE 2Z5WA 1W6OB 4UW3A 1ZBA3 1N1VA 2WSVA 4M01A 1ZRFA 5JIAA 1QJX3 4BPZA 1WMFA 3V0AB 4YW1A 2RS11 2F6BA 3L2HA 2ZX1A 2HWF3 4B4QA 4HPKA 3NAPA 4WM7A 1VBB3 2ARBA 4G3YC 1AX2A 2EA7A 3M3QA 2OYZA 4DZGA 1WW7A 3ROUA 1WMEA 2JG9C 1C8M2 2BYVE 4EV0A 1DBNA 3LA3A 2CWSA 2QZ3A 4HVRA 1XU1A 4K8FA 1H4GA 2B45X 2CWMA 4XETA 3NSTA 4AYUA 2GC0A 1QKQA 1LOGA 1HV1A 3OTFA 4LO7A 4MVTA 4HPKB 2WL1A 4XJ9A 4WM7B 4ZU5A 1RTVA 4JRAA 2XBO2 3LSDA 5J98B 1PZ9A 4PLNA 1PVC2 5FLHA 4COUA 3KZ4C 4J1XA 4MGIE 4KH9A 4DS0A 1UKGA 1GQHA 3SMHA 2TNFA 2OVUA 3AKPA 3WW4A 2RR13 2XB6C 2G9GA 2ZHMA 5EXOA 2A5ZA 3FBYA 2R0HA 1ZBA1 1WBFA 4BMEA 3NKGA 5KXCA 4WM8C 1JN2P 4RGGA 1BEV2 4AQTA 3J4UH 2QFEA 1Q8SA 4FPFA 2HWF1 1PK6A 4DB5A 3VKFC 1VBB1 1RINA 2G4IA 2FBEA 2P3IA 1U5YA 3FUQA 2RM22 3ALQA 4ISQA 2RS32 4OI0A 2W0XA 1REDA 1HRI1 3VZLA 1H8TA 1LESA 2PHLA 2IXLA 4GA9A 1AR82 1AR92 4OLLA 5FTTC 1O3SA 2D6PA 1ND2C 1S0EA 3JBG2 4ITCA 4M3CF 1NYWA 2E63A 1VBD3 3ATGA 1GNZA 3WP3A 2HWB2 3GHMA 5DXDA 3RJRA 1PK6B 2R1DA 1WW6A 1TME2 5E89A 3AKTA 5EZWA 3QOPA 2VOWA 4TYSA 1H8TB 4FXKB 3SCFA 1FOD2 1DGWA 4JDNA 4EWDA 2MPFA 1I5ZA 1QJU2 3AYEA 2ZS6B 4LLOA 4MLOA 4AEKA 1NXMA 2CL2A 2DCZA 4FPYA 3KT1A 1NCRA 2NMOA 2D3SA 4AHYA 1N1YA 2IWGB 1RUD1 5GZFA 3VBOC 5IK8A 1YRZA 3USSA 1MZEA 1SCRA 2D44A 5D8AC 1RUJ3 4ZU4A 1MEC1 5FOBB 2DF7A 4JGYC 1AR63 3T2TA 4YFZA 3AP4A 5KXEA 1RL3A 3MLJA 1CR7A 3ZYRA 2JG8C 1XE8A 4OHYA 3RS6A 1A8DA 3CF6E 3E6CC 1AJKA 3JQWA 1RUG3 2BPA2 3MEPA 4GKYA 2FQPA 1NCRB 2R1BA 3MLLA 4JC1A 4YGBA 4CDXC 1SLAA 2DVDA 4LO4B 5DZEA 1RUNA 2XPJA 1BMV2 1Q3EA 4XJZA 2B42B 3VL8A 1D4M2 2QVSB 3B3QE 2VG9A 4GB33 2HWD3 3ZSMA 1RUF2 1RMU3 2X29A 1JH5A 4Y20A 1QWRA 2IXCA 1CVNA 3H1WA 3X29B 3K51A 3RNSA 4HVOA 4D94A 1N1SA 4CDUB 5KHGA 4YM0A 5EYYA 4CEYA 2GC3A 2DVBA 3LB9A 4COYA 2BVBA 1LECA 4F8AA 1HXS1 1ULEA 1CN1A 1ASJ2 3HT1A 1F8VA 5J3UA 3WHUA 4LO8A 1GKBA 1QNYA 1FI2A 1GNHA 1XXNA 2A3YA 3PJQA 2QCSB 4X8NA 1VRH2 2NZ9A 1CESA 3VBHB 2PHDA 5FMOS 2IZWA 1NZCA 3ZFGC 1RUC3 1Z7S1 4Y20B 4WVMA 3LA7A 4YNIA 5L73A 5FRAA 3POSA 3FZ3A 4CEYB 4FPGA 1S2BA 1MS8A 5H9RA 3MI8A 2WWSA 3VBUA 1LHVA 2LM3A 1SDWA 3WUCA 2BTVC 4A7KA 1PNGA 4PBPA 3H9AA 5JWPA 2GC1A 4P9YA 1HQWA 1MZ5A 1PGW1 1S0IA 5CG9A 4WVMB 4GB31 2HWD1 4NO4A 3B9IA 5DUUA 4KGGA 3AK0A 1I3HA 3MIHA 3UL2A 4S2FA 3VBUB 5HI0A 4YFWA 3WLUA 2JEMA 3S30A 2WA4A 1O4ZA 3AMPA 5H9PA 2DU1A 1S0BA 3WDYA 1AYN3 1V6KA 1COV3 2BNMA 2XJTA 2UWAA 3HD8B 4GXLA 4HBNA 2UY9A 3APBA 3ZFFA 3VBFC 3N7KA 4Y5Z0 1T6GC 1NA1A 2VGDA 3CL1A 1YJLA 2XJPA 2ZGMA 4Y1VA 1KFUL 2R49A 2OUJA 4B7KA 4LE4A 1SQ4A 2VULA 2QKDA 3R4UA 1MACA 3ZN5A 5TSWA 5KWRA 4BH9A 1G86A 2WS93 1LOBA 3VBSC 3FUOA 4EN7B 1KS4A 4XJUA 1YFXA 2R063 1YHFA 4QU2A 4K1ZA 2ZAHA 2R0FA 3J8F3 2RMU2 3JD72 4LBQA 3ZFFB 4FTSA 4AVSA 1BYHA 2B9UA 4KG0A 4Q4Y3 1NA1B 4EN6B 3T1LA 4PLMA 1UPIA 2CAVA 3WG2A 2BWCA 4NR1A 2CGPA 3N4MA 4NN0A 4COWA 4JTNA 4RA0A 2YZ4A 2OW4A 3IBMA 1UW8A 1S1AA 1S0CA 1Y7BA 1UU6A 3ZN6A 1V6MA 3ZVXA 3FHIB 3TBDA 1KJRA 4BHPA 3NVCA 1ZBE3 4B4RA 2VW2A 2UYAA 2C1FA 2IC1A 5J37A 1AYN1 2FMYA 4UBHA 1ZZCA 4Q2FA 5JOWA 4LBQB 1OQ1A 2XLAA 5CVRA 1BKZA 3TYJA 5D1IA 3RZZA 1DGLA 5SV5A 1QH7A 2XGXA 4NWVA 1DHKB 2BUKA 3AYAA 2W08A 4IV3A 1QXJA 4QM9A 2CGNA 3ZXKA 1MS3A 1ZZBA 3ZN6B 1C8NA 2EVXA 1PIV3 2ET7A 2AGSA 2WS91 1IZ3A 1PO23 2D43A 1QQP2 1D0GA 1W6NA 1V6OA 5GZDA 2WZR2 4JDOA 4XJAA 2D98A 3IN9A 2HKXA 1HQLA 2EIGA 4XF9A 4JGZA 4FCAA 2A3XA 4IESA 4IV3B 4Q4Y1 1IPJA 1AL22 1XU2A 3QD6A 3VDDA 4HSJA 5JPNB 3UJQA 2XJQA 4J1WA 4K40A 3DPRA 2WNUA 1W6NB 4Z82A 4C0HA 1G9BA 2WQ4A 1CAVA 2X8KA 1UL9A 2ZX0A 3PLQA 3NJZA 5L7OC 1RUI3 2NPIA 4RHV3 1OFNA 1O3TA 2YPJA 5FCCA 4OZXA 2XH6A 2KXLA 4KBBA 1W6PA 4XE9A 3R4SA 2GNMA 4JGZB 4BIFA 1IQAA 4Q4W1 3VDDB 2BFUS 3V56A 4XFBA 2GNTA 4QMAA 2GMMA 1NG0A 3ZXDA 2OPKA 1PGL1 2H0VA 3DPRB 4WM7C 4AEJA 1CAVB 1C8M3 3KLSA 4Y1XA 1PIV1 3IT8A 1XNDA 5A3LA 1PO21 1SMVA 3BCWA 2ZGTA 5JI7A 4Y1UA 1W6PB 4W6XA 4IEUA 4XFAA 3VHNA 4P9JA 5FAXA 2PHTA 1LOEA 4AVBA 2UY8A 1HW5A 2JD4A 1G6NA 2V09A 3O12A 5KC5A 4W6YA 4ATEA 2FMDA 3DV8A 2XBO3 4HFSA 3B94A 2Q0AA 4Q4X2 2XG3A 4MX3A 4YZ3A 4XJWA 2VH9A 4O9EA 2R042 4EWAA 1U5IA 1PVC3 3HMYA 4NHKA 2Q30A 5IUQA 1URXA 3AMNA 3VV1A 1RUI1 2WZPP 4RHV1 4ZXKA 1CGPA 4YM3A 2O1QA 5ACA2 3VBRA 2P3JA 3AXDA 3OGGA 1QJY2 3ZMNA 4EWEA 3POWA 2XHKA 1BEV3 4WZCA 1L3JA 2R32A 5LRSA 2NMNA 4KG8A 3CEWA 5C4WC 2F4PA 5LK7B 1IGOA 2WFF2 1LGNA 3AZYA 4FPCA 4ASMB 4Q0VA 2RM23 5ABJC 1AYM2 4HVQA 1SFYA 1LR5A 1AR83 1AR93 3IDEA 3VBRB 1RHI2 4N9HA 4YZ2A 3JBG3 2ZCWA 4HT1T 1WLDA 1FATA 3C3VA 3E5QA 1HV0A 2HWB3 3MICA 2VUAA 3A0NA 3W9AA 1IKQA 5IK4A 1DU3D 1DZTA 1FPN1 1TME3 1LHWA 2XBO1 4ONUA 4AFAA 3VUOA 4LULA 3JZVA 4AEMA 2QJVA 3J26N 3ZYGA 1PVC1 1REFA 3LAGA 4RS5A 4XQDA 1FOD3 4IL7A 4S2DA 2X53S 1V9U2 5GLVA 3CJXA 3TN91 1XNCA 1QJU3 4N43C 4RQPC 4AFDA 1LOFC 1O91A 3M4FA 3GYDA 1BVP1 3AKQA 1LCLA 4TZDA 4CRQA 2MNGA 2K9ZA 1ZYBA 4AEDC 4I3GA 3TAYA 1BEV1 4KU7A 1WD4A 1NCQA 4FPJA 4XF4A 2TUNA 3DGTA 1UD1A 4R52A 2XUMA 5CA6A 5T50A 3N3HA 2XVLA 4LBKA 4RS5B 3H1MA 3MIBA 2RM21 2P34A 4CDQC 2EXKA 4IEWA 1VJ2A 5FLJA 4CEWB 4WBBA 1AR81 3I54A 4CDUC 1AX1A 4XILA 2ZTNA 4CP2A 3SXWA 3WW1A 2WSUA 3FWEA 2E7TA 4LBNA 3ZX7A 3TRSB 1AR72 4E27A 2VQ0A 2HEWF 5AC92 4KGQA 1D4M3 4ASLA 4Q0SA 3VZNA 3HIFA 1TME1 1RUF3 5C9AA 5F5QA 1G7YA 1PM7A 2GC2A 3VBHC 1UKRA 5GM0A 1LTEA 4MV2A 2DVAA 2H6CA 2HWE2 2XVGA 4R4ZA 1FOD1 2DCKA 3B02A 1BBT1 1LOCA 1QJU1 1ZA4A 3WW2A 1ND3A 4DFSA 1POV1 1WLWA 5K0UC 1ASJ3 1N3OA 1LU2A 2AR6A 5E8AA 4I3PA 4XTMA 5BNPC 3LA2A 2BGCA 5EWSA 4YZ1A 2R071 1VRH3 3POYA 4RD7A 1QXRA 4UW5A 4Z1VA 5A32A 2GMPA 2GU9A 4KNCA 4NWWA 5C9AB 5KHHA 4GH4B 4XMAA 3FC0A 3KT7A 1QH6A 1SACA 2IXJA 4DXZA 5LK5A 2ZMKA 3HR9A 3UV9A 4LHNA 4QT6A 1RUOA 1ND3B 4Q1RA 2WQZC 1RITA 4M3CA 4LUMA 1CAXA 2CYFA 3MZHA 2GNDA 1YIPA 3BOPA 3WG1A 5C8WA 3VBUC 1FYUA 1LHUA 4I02A 2Q8OA 4PLOA 4D7SA 2P17A 4H14A 3CJIC 1OI6A 5A32B 1O3QA 3D0JA 4YVWC 1BMV1 2XKPA 4LT5A 1EV12 2ZGOA 4XFGA 5H9QA 5GLTA 3WVJA 1R092 3H3ZA 1RUF1 3AP5A 1B09A 1CIWA 3S7IA 3SH3A 3ZMOA 2JDZA 4M3CB 2BBVA 1CAXB 4BLIA 1ZRDA 2PAMA 1OOPA 3SCGA 1VLNA 3QLQA 4IEPA 1FMD2 2WT0A 1WD3A 2A71A 3AJYA 3NO8A 1ASJ1 1JYCA 4FPEA 1X8EA 2VW0A 4G9SB 1OA3A 1X36A 1QHDA 1SLCA 2FHRA 2MEV1 2PLV1 3ZXFA 4AI1A 2BQPA 2XLFA 1VRH1 3IPVB 1A78A 3BTAA 2CV6A 2PHWA 2QE3A 3ZFFC 4YM1A 5CAZA 3KGLA 4FQZA 1RUH2 3D6EA 3GZTB 3ST7A 1VBC1 3WZ1A 5BYNA 4GMP0 5FOJB 1OOPB 1TE1B 3I4IA 3D8CA 5JVVA 2ZKNA 3H7JA 1VBE1 3PVOA 4AI8A 4META 2D97A 1R1A2 1JYIA 2RMU3 2CY6A 2VECA 3JD73 3THTA 4AFMA 1DGRA 5C8CA 3NAPB 4G4FA 1CX4A 4XEZA 5CNAA 3VLBB 3GBWA 2DTYA 4DY5A 5T54A 1UPSA 4E4SA 5DDJ1 4L11A 4EROA 1SBEA 1QOSA 1IPKA 2VW1A 3BOWA 2PA7A 4QGMA 5A3MA 4DMIA 1ALYA 1AF9A 1RVF2 1WW4A 2ZBJA 5DG1A 1FNYA 4DOUA 2DCTA 2P3KA 4HETA 5C8CB 1QJX1 2YHJA 2W39A 1SLTA 4ZU7A 4COZA 3V0BA 2GZWA 3WT3A 4OI2A 2OZJA 5GLZA 2GNBA 1XYOA 3WXPA 1GLHA 3FBMA 5H9SA 4M0HA 1H2LA 4XJ8A 2IXIA 3HBZA 2X5IC 1LHOA 4XQWA 5I0SA 1DQ5A 1QQP3 1CQ9A 4AVTA 4LE3A 1TMF2 4IEQA 2WZR3 5CADA 3WQ0A 5CFDA 1LOAA 2NM1A 5BNOC 4P9XA 2IXKA 4A2UA 3JD71 1K5MC 5I0TA 1MS1A 5BUVA 3U0ZA 3P3NA 4KWJA 1AL23 1UMZA 3NW4A 1QOTA 2ZHNA 4FP3A 1VP6A 5FREA 2CTVA 4AHXA 3VDDC 4GULA 1KITA 4Q26A 1X82A 2OA2A 1ULFA 2ZGKA 2DCYA 4PDWA 4QQLA 3MDPA 2RS52 1H1IA 2RR11 4BE3A 5DG2A 4R9DA 4BIOA 5CFDB 2JJ6A 3FLRA 5F9TA 1I9RA 1UCXA 3JU9A 3O14A 1EAH2 3MW2A 1VB4A 2D6MA 2YV8A 3VN4A 4AGGA 3KCYA 4YZ5A 1APNA 1YO8A 4YRDA 4XF3A 4R9AA 2WNVC 5JPMB 4Y1ZA 3SLIA 2ZPXA 5AVAA 4YSFA 3TB0A 1ZM1A 4U36A 3E6DA 4WZFA 3N35A 4AI3A 2O0OA 4PDWB 1BZWA 4LBOA 1MS9A 1YFYA 4TWTA 1H2KA 2OZ6A 2Y26A 4N53A 2Z69A 1X50A 2PHRA 1AJOA 3FFZA 1IOAA 1OA2A 1QQP1 2BNOA 2ENRA 4AGRA 2WZR1 2D6NA 3M3OA 1VBD1 2JICA 2BEOA 3FFQA 2W68A 3ECQA 4LR4A 1REEA 4FPLA 5I91A 5HCBA 4P9GA 5GKAC 3LSEA 3WOGA 2E6VA 1C1LA 3OBTA 2VPVA 4Q4X3 4LLFA 1JW6A 1AL21 1RUE2 2A73B 3OD0A 5T55A 4RR3A 2R043 1W6MA 4N53B 5IK7A 4AI0A 1CPMA 2RJKA 5FLIA 5CG8A 4HSLA