2IFWA

Crystal structure of scytalido-glutamic peptidase with a transition state analog inhibitor
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
TVESNWGGAILIGSDFDTVSATANVPSASGGSSAAGTAWVGIDGDTCQTAILQTGFDWYGDGTYDAWYEWYPEVSDDFSGITISEGDSIQMSVTATSDTSGSATLENLTTGQKVSKSFSNESSGSLCRTNAEFIIEDFEECNSNGSDCEFVPFASFSPAVEFTDCSVTSDGESVSLDDAQITQVIINNQDVTDCSVSGTTVSCSYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Scytalidopepsin B
publication title Crystal structure of scytalidoglutamic peptidase with its first potent inhibitor provides insights into substrate specificity and catalysis.
pubmed doi rcsb
source organism Scytalidium lignicola
total genus 44
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.4.23.32: Scytalidopepsin B.
pdb deposition date 2006-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01828 Peptidase_A4 Peptidase A4 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.700 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ifwA00
2IFWA 3TRSB 2IFRA 1S2KA 1Y43B 1S2BA
chains in the Genus database with same CATH superfamily
1IS3A 1YFUA 1O3RA 1ULFA 5FPLA 5FBZA 2LM3A 4M01A 4XVHA 4CCOA 4ZZ8A 1TZOA 4CUGA 4ZZ5A 4QPIB 1U5ZA 2OKXA 3ECQA 2PQQA 5I91A 2QFEA 5L73A 3RZZA 4XEZA 2F4LA 4FP3A 5ERLA 4IEWA 5FREA 2FDJA 4Q4X1 1YLLA 4GA9A 5FQ0B 3PVOA 3R4SA 2EIEA 2WWSA 1ZZ8A 3ZXGA 4Q0QA 4CDWC 4KWJA 4Y20B 5JI7A 3WV6A 5T5LA 1AVBA 3VD7A 1D4M2 4UW5A 1WMXA 1AHSA 2XONA 2ARCA 1GLHA 4ZONA 4MUVA 4QAWA 3GGLA 3LEMA 3VN4A 2EA7A 3O14A 4BIOA 3AXDA 3DKWA 1NZCA 3V65A 3BTZA 4YZ3A 2ZX3A 1UIKA 1HX6A 4HK8A 1LEMA 3V0BA 4Q4V1 1E5RA 3I2FA 1JZ6A 2GMEA 4JGYC 5FK8A 4YW7A 4DZGA 4F8AA 4ZXEA 1PM7A 1EAH3 1LEDA 2IZWA 4FCAA 5A3MA 2OZJA 4JDNA 5GM0A 1QJX1 4FXGB 4B8EA 1TME3 1YFXA 3DEMA 2DCZA 4NAOA 4KGGA 5LEJA 2RDNA 4UFJA 2IWGB 3O0VA 4OFGA 3AYCA 5FP4A 4A3XA 4FQ4A 4ARYA 5JWPA 5JXIA 3RZHA 4HZFA 3LPFA 2ZXQA 1T6BX 2WZR2 1W8TA 5LATA 3SEPA 1LOFA 1TNFA 1WUVA 1CVNA 3ATGA 5KWRA 4KG0A 2K46A 3VKNA 1V9U2 2A5ZA 1VAKA 4XF0A 4CEYA 2D6PA 2DYCA 1RUJ3 2YU1A 3GCXA 3NNMA 1W8UA 3CQOA 2SLIA 2HJIA 3VD4A 1RUOA 4ASMB 5FO7B 3ROUA 3I2DA 4DS0A 3GNEA 3OD0A 3WF2A 1WZXA 4MGTA 3OUIA 1RUD1 5KHHA 3OD4A 1RXFA 3EHKA 4PLNA 3P6BA 1QMJA 5C4WA 4EQVA 3RZGA 4MV2A 1H6XA 2D6OX 1MS3A 3AP4A 4LOTA 2G9FA 1YFWA 2PLV2 3ABZA 4LBLA 4LO4B 2RS52 3P5BA 3NJZA 5CVRA 2IFWA 1WW4A 4GAZA 4D6SA 1W2TA 4FP2A 2JE9A 2OW4A 1FATA 4W65A 3S30A 1CAVA 2ZMKA 3WCRA 2VQAA 4ATEA 1M06G 4D94A 4Y3OA 2E7QA 3M3QA 4NOTA 2GC2A 2R073 4URTA 3D0JA 5EYYA 3VDDA 1X7NA 2ENRA 1X9TA 5IVCA 3BB6A 1I3HA 1ND3C 1LESA 3FFZA 1X8EA 3VZKA 3NAPA 4GJYA 1FT9A 1YQCA 2Q8CA 4LKEA 3ZMOA 4MZUA 2RM22 3QBQA 4GJZA 1RHI3 1QIQA 3D82A 4ORFA 1AR61 5F9TA 1JODA 1SFYA 5I0DA 4FFGA 5CFCA 3ZYFA 2VD7A 1RMU1 1NAEA 1XQNA 2ZEXA 3T0AA 3NJXA 2XKPA 3AX4A 4FTEA 3J8F2 5FFOC 4CDUA 5C9AC 5KR7A 2XHNA 1NLRA 5A1AA 4LKFA 2Y60A 2A3WA 3HEIA 4TSVA 4YGDA 1NCQB 2PHWA 2IXHA 1CD3G 3B3QE 2HBTA 4QHZA 1AYM3 1C3HA 5FXVA 3HN3A 2WQ8A 3VZMA 5C3OA 3N7MA 3BOWA 1PIV2 1NQJA 2XJPA 1N47A 2W52A 1XNDA 3MBWA 2Z2SB 3PJQA 4HG6B 3AYDA 3GZEA 3NV3A 1AXZA 1QOSA 1VBA1 3NO8A 4M3CE 4P08A 2RS13 4Y4RA 5LK5A 2ZZJA 1VBC3 3VKLA 3GBWA 5FYIA 4Z2AA 1GZTA 3FFQA 3N7LA 2UWBA 4EWEA 3VUOA 1V6IA 1RGSA 4DRVA 1IKPA 5F2SA 3TAYA 3H42B 4CDWA 4XOGA 3H3UA 2IXJA 1GOHA 3VBOC 2P3JA 4HKOA 3UNPA 1R082 2AEYA 5LA1A 3LFIA 4DOUA 5C7GA 2IXKA 1DIWA 2A6VA 3WF1A 2UU8A 4JZRA 3TEXA 1RUF2 4EZ4A 3V0AB 5FMOS 1JBCA 1AXKA 4OI2A 3VDAA 5FBJA 1I9RA 1RUH3 4XFHA 3DXUA 1LAJA 4NVPA 4KMQA 2WR9A 1LGNA 1W39A 2JIJA 2RDRA 2WN2A 4JGYA 3MLKA 5LB6A 2D3SA 5DDJ2 5E1RA 3CO2A 3WDYA 1DYOA 1YFYA 3CNAA 4TYSA 1DYKA 4P5HA 5LBBA 1VIWB 1A34A 2R1BA 1CIYA 2GH8A 3SHRA 1L7LA 1CAWB 2HLEA 2FMDA 2VVEA 1TG7A 2XBO2 4XUQA 5GLZA 3L2HA 2FZ2A 2ORZA 5IVJA 2R041 4P9JA 3VZLA 3ZXAC 4AFAA 4Z92B 1A8MA 5D8AB 5HI0A 4TWTA 2UYAA 1W2UA 2Y6FA 2RR13 5C3SA 2DU1A 3ZN5A 3APBA 3M1HA 1RUG1 1OI6A 1MZFA 1E5HA 4FFFA 1Y9GA 2FMYA 3AJZA 5ABJB 3EXUA 3NV1A 4LULA 2VXRA 4JRLA 1UW8A 3MEPA 4GXLA 2G9GA 1QH6A 3DPRB 4BQ4A 3VZOA 1U0AA 3BTAA 3M2MA 3B01A 3KF5A 5A32B 5FUIA 1AUYA 2WT0A 4G3YC 5GZCA 4JQTA 4RQPB 1RIRA 3BIEA 2VNRA 2WN3A 3ZFEB 1YQ5A 2QBXA 4E2SA 1KEXA 5A70A 5H9SA 2BFUS 2JDUA 1QH7A 2L9LA 2HWD3 5IT6A 4X6RB 3TRSB 3MI8A 1IPJA 1EYBA 5I0TA 3I3MA 2GSYA 1PVC2 2OA2A 1ZRDA 5GZGA 1JZ5A 1ENQA 4QB1A 3TYJA 3RZMA 4OCTA 4AL9A 3CBNA 3FLPA 4AVAA 4W50A 5FMCA 4P5YA 3VKMA 5CAZA 3QH6A 5FRAA 3KT7A 3ACFA 4Q5OA 4XFAA 1COV2 1S0CA 1ND3A 3OYWB 1YXWA 1BBT1 1QJFA 4XDQA 4C1WA 1WLCA 1N1TA 4AEDC 4C91A 4PLOA 4UW4A 1VPHA 5JOWA 2I45A 2PHFA 4QX2A 4ZS3A 4BISA 4COYA 1Q8VA 1BJQA 3PIJA 3I2HA 4CEWB 5HCFA 1HQNA 4CCKA 5LRRA 1UOGA 3EBRA 2D97A 4P9YA 4ASKA 3FLTA 2P3YA 2PXJA 3MFCA 1REFA 4DUVA 2WFPA 4HETA 2PHXA 3PU3A 4IEUA 4LBQB 3ZFGA 4XCBA 3ZYPA 3GHMA 4ES9A 2BBVA 1XXNA 2ZPXA 2Q8DA 4XYXA 5FPAA 4K8RB 1J58A 2ZEWA 2JDKA 3LEIA 4N43B 4XC9A 1N3OA 4DXSA 2XDVA 4XACA 3BGAA 4PDWB 1ZBE2 3WG2A 2JEMA 2ZX4A 1GR3A 3TN93 1YUDA 5IK7A 2G19A 2CAVA 2ZGNA 1J84A 4R8HA 4YW1A 1LOAA 1ULGA 3WEZA 4AE2A 1C28A 5DABA 3BCWA 4DQAA 4J6GA 1UMIA 5T3NA 4QD2A 3ZVXA 2VVDA 2W9XA 4L0PA 3NVCA 3NNFA 3SC7X 5HBAA 5IYYA 2XVGA 3WG4A 3VBOA 3HNYM 1OH4A 3DYOA 1LHUA 2OUHA 4HPKB 4JRAA 5BNPB 4AFMA 1LRHA 3QCWA 4BH9A 5LY1A 4W6WA 1NYWA 4GWNA 4QQHA 5AFEA 4E8DA 1BYHA 1KDKA 1DGRN 1RUI1 4EN6B 3HQRA 3M3EA 2BVBA 5J37A 1MS9A 4I3GA 1N3QA 2ET1A 1JOBA 2JG9B 1JHNA 3ON7A 2PHRA 1CPMA 5KHGA 1EV13 5FZAA 5LK7B 4E4DX 5FWEA 3EJKA 1WBFA 2RE9A 3MO4A 1YEWA 1AR73 4KI5M 1ZREA 2BGOA 3OG2A 2GP5A 4P9WA 4QQ2A 3MF6A 3T30A 3J9SA 4LBMA 3VZNA 2A75A 1E5IA 2HWE2 1SLIA 5A7OA 1GUIA 2RS31 3KQRA 4GH4C 4RS5B 4YGEA 1IS6A 2NMNA 1A78A 2O14A 3AVRA 5K0UC 4BXFA 3I2OA 4ASLA 2CDOA 1JYXA 2YGMA 3JBG2 4N53B 1OURA 1PGW1 4LA2A 3WINE 2FCUA 2A1XA 2WT1A 3H3ZA 4AVTA 4Q8KA 3JD73 1IKQA 3IZOA 5LA0A 2ZJCA 3FL7A 3U10A 2ZMNA 4IEYA 3FJSA 1EP0A 4W6XA 4Q27A 4IESA 1MQTC 3GALA 5CKQA 3KQ4B 3OY8B 3X29B 4QKFA 3I3DA 4COVA 1UMHA 1QJX2 1GANA 3GHNA 1D0GA 1KXGA 1RXGA 5J1XA 3WHUA 3ES4A 3J7LA 1CZSA 1S0JA 5JVVA 4BLJA 3WQ7A 3OUJA 5FOBB 4RD7A 3A7QA 3LDRA 1CONA 1J1LA 4XFFA 3PJYA 3EMRA 1AL23 2WO1A 4CU9A 4QKDA 3VBUB 2ZGOA 5J09A 4CRQA 1LJ7A 4ZY9A 4AHXA 1QQP3 2PA7A 2QQLA 1D4M1 2VMCA 2W94A 2WQ4A 3AFGA 4PBPA 5B2GB 3N9LA 2PN5A 3ELNA 4K40A 2ZGMA 3BN6A 4UAPA 5ANNA 1VBE3 3POSA 1UY4A 4AEDA 3BU7A 5HV4A 4M3CA 3ETQA 3LKJA 4GWMA 1QJU3 3JCIA 4NWVA 4Y5Z0 3SCGA 2O8OA 4QX5A 2WO2A 1ZRFA 1YYNA 1RC6A 3OBZA 1RJ7A 3RG0A 1TNRA 4PIXA 1N1SA 3G6JB 5A6XA 2VMEA 1GNZA 2DU0A 2QZ2A 3AMHA 3D5OA 1NLQA 5L9BA 1C1LA 4JKLA 2ES3A 3RZLA 2A6XA 4RL7A 3AFKA 2VZUA 5C8WA 2BWAA 1OQDA 3WUCA 3S5AA 1C5IA 4AOCA 3EQEA 2WZR1 1LU2A 3ILFA 2G9ZA 1VBB3 1PK6C 1JI6A 2HBUA 2GNDA 4J25A 2VMIA 5FZ1A 1W8FA 1V9U1 2OUJA 3KWVA 5FYUA 3W20A 1YIPA 3S0MA 1C4RA 1HDKA 1QJY2 2VOTA 2YUEA 4F3JA 1W6NA 1UYYA 3AZZA 1NLSA 4G4FA 3WY6A 3IDEA 4DFSA 3MHZA 2B8MA 3MUY1 3THDA 4A41A 1NXMA 4CEYB 1XC6A 5LZ6A 1SEFA 2B9UA 3QH7A 2VBPA 1HN1A 3VV1A 4LO5B 1CGPA 4IV1C 1W28A 1RUE3 3KV5A 3MIDA 1CWPA 4JDOA 5I93A 1FOD3 2E53A 2JB4A 4HVRA 4IE0A 1Y43B 4WVWA 5FYZA 4C8DA 5BNOB 5L36A 1JZ2A 1SPPA 4LK6A 3U4SA 1J3PA 4CCCA 5JOYA 2RS51 5C4WB 1ODMA 4H7LA 4BDVB 4K9SA 3H1WA 3F95A 4J1WA 1AYM2 4W6YA 2XQRA 3JZVA 4XAAA 3AP5A 2QUOA 2EICA 4MADA 2ID4A 1PO13 4EN8B 4P14A 3UJOA 3AXEA 4LUMA 3VBRC 1W0NA 2IUWA 2W95A 1AYN3 1PMIA 1CJDA 1JUHA 4HT1T 2BP6A 4K1YA 4RGAA 2RM21 2RMU3 5K0UA 1NY72 4B4QA 4UFMA 4WM8C 1O5UA 4NROA 4OQ8A 1SBFA 3N3HA 3ZSEA 1UL9A 3NAPB 4LHLA 4YNIA 4BQXA 5ACA2 2MHFA 2XJTA 1D0HA 3OBRA 3ZN6B 4F83A 3AM2A 1AXYA 3DN7A 1C8M2 1HIXA 3J8F1 4QDRA 1XNBA 4IV3B 1PGL2 5CFCB 3T4VA 1W8NA 4PT6A 3T1MA 2EXHA 4D6QA 1MQTA 4AQTA 3BPSA 5GLWA 2BUKA 5FZCA 2F17A 2WWJA 4CDUB 1RUC3 4KU7A 1NCRB 4L8QA 1X33A 1UZZA 5FKCA 2C26A 3J7NA 4PQQA 5FZIA 4FPEA 4BWOA 5DMYA 1PIV1 1A3KA 3NKTA 1US2A 1U5XA 2Y33A 3FE5A 1FX5A 2OQ7A 3OOXA 3I2JA 2V72A 2Q4SA 4NPLA 1RYYA 1Q8OA 4JHZA 3WF0A 5HXVA 1QOOA 3WUDA 1G9BA 4RGKA 1RUG2 1REDA 2TEPA 1AR83 3ZN4A 4MHUA 4Y1VA 5A3NA 5A7SA 3OJBA 2CWMA 4RR3C 2VQ0A 1GZWA 1SHWB 4XILA 1R081 1HB2A 3KF3A 3K77A 2HWF2 3RYPA 5JPNB 4CDWB 5IFPA 1G9AA 2QE3A 4UFLA 1AR93 1RUF1 3R0RA 4TLGA 3WF3A 1J59A 4AHYA 3WCSA 1F15A 1KS4A 1XYOA 2PAKA 5FY4A 3ZYIB 1UYZA 1OLRA 3BKZA 2P3IA 1G9FA 1NA1A 3GCWA 5BYNA 1G8WA 2VZ3A 4LIVA 5A3LA 1U5IA 4XTPA 3ZR6A 4YWAA 3TOJA 2Y64A 3MZHA 1OBNA 1FI2A 1XJAA 1QY4A 2MEV2 3TEZA 2DVAA 1HB3A 4LNVA 2EIDA 2NYYA 2WZ8A 1OKQA 4JGYB 4QDSA 4YVSC 2XBO1 1POV0 3SCFA 1Z7S1 3BVCA 3ETPA 2BQPA 3N36A 4NIAA 3NV2A 4BHPA 2G4IA 2RG4A 4XETA 4FT8A 2WFF3 2JWPA 3ZLIA 1PK6A 4O65A 1DDLA 1AX0A 2WC2A 2XJSA 5G04L 5FLHA 3PMSA 3M3OA 3O1RA 5FUNA 4IGPA 4LBJA 1NX9A 4MGSA 4BXSV 1IS5A 1HXS2 1VMHA 3O1VA 5GZDA 1PZ8A 3UKVA 2P5BA 3IBMA 4GB33 3PTRB 1I5ZA 3HR9A 5FZ3A 2VMHA 2XQXA 4IV1A 1PVXA 4BCUA 3W9AA 4LO6B 2W1SA 4IE7A 2AREA 1GNHA 3I2KA 1W6MB 1DGRA 2Q1MA 1JYTA 4HVOA 3PTYA 4Y1YA 3AL6A 4PHZA 3SNMA 5FY5A 2DVBA 2GP3A 2DUPA 2VCBA 1MZ6A 1W8OA 4DXTA 1PVC1 1HQLA 1JYWA 4K20A 3PUHA 1DP0A 1UY0A 2A6ZA 3I97A 3USUA 4D0QA 1QNWA 3B02A 2FZ1A 4I0AA 2OYZA 3VL9A 1ASJ3 5KC5A 3O7OA 1COV1 1JU4A 5CKNA 1POV3 3M3IA 4CU7A 2BOIA 4HKLA 3HT1A 1S2EA 3FWEA 4UFIA 2OPWA 3H8XA 2DTWA 2VBDA 3N7JA 2CGPA 2V09A 3JQWA 3VGIA 5SV5A 4IDZA 3JB8A 2DFBA 4B7EA 4XE9A 1FNZA 2GC1A 1W9FA 2WS93 1DG6A 5A33A 3T2PA 5F5IA 3AVSA 2R0HA 1S55A 2CL2A 3I49A 3UGGA 1W06A 3PUSA 2CV6A 4CP9A 2ZA9A 2DUQA 3WXPA 1HV1A 3U37A 5C9AB 4XJWA 2ZX2A 1W6PA 3BI3A 4AEJA 1OFNA 4AI3A 1W8HA 4Q4Y3 1ZBE1 2ARBA 2HWC2 3ZPYA 1TMF2 5F6LB 4QX1A 4XBQA 3WT3A 2LUWA 2WYFA 3IDAA 1IQAA 3MPPG 4LE3A 4IQPA 3IN9A 1JMUB 4QB6A 4TXWA 5HCBA 4GZ9A 2VGDA 3CLPA 4XQWA 2VAUA 2X5IA 1R64A 3UL2A 4D8MA 4Y1XA 5FY0A 1W0OA 3F2ZA 1KJRA 1JOJA 5L19A 3O1OA 1W6QB 1D2QA 2Y6LA 5E8AA 4LKSA 4D7TA 2YU2A 1SMVA 1SLTA 4RR3A 4XMIA 4L97A 4EE2A 2R7EB 3MW3A 5EIYB 1DLLA 2O0OA 4XXAA 1FPN2 2WLPA 3NWKA 1WBLA 5EYXA 2PYTA 3VD9A 1H8VA 1WGPA 4YW4A 4AQSA 4MGQA 3UV9A 1REEA 4RGGA 4BIFA 3UK9A 5C71A 3IKWA 1KITA 2ZS6B 3BYWA 3AZXA 3VBSB 1KGYA 5APAA 4D3WA 4NUBA 5GLUA 2VTFA 1O3TA 2R16A 2JDYA 3LIGA 1DGWX 2VVFA 2W47A 4EN9B 1OVSA 2B4KA 4OMCA 4A7YA 4NMIA 5I8YA 3POEA 4I2OA 3ZM8A 1FXZA 4DIQA 3KM5A 4YVSA 2NQYA 3ZFFC 1G9DA 5FY7A 1S0IA 3PUAA 3C7EA 3PUIA 1PZ9A 2HWE1 1DYPA 1DFQA 2CNAA 1OQ1A 3T1LA 4MXWA 4RYDA 1Y3TA 1ND2B 4BJ0A 5I8SA 2WNOA 2GN3A 2VBBA 2XL7A 4S2DA 5DAXA 3JBG1 1SDWA 5GLTA 2NLRA 4HSJA 3SEEA 5FPZA 4AR2A 5T50A 2E63A 4D7YA 4IEXA 3NL1A 3Q9OA 4XZPA 4DRRA 5HCAA 2ZHMA 1VRH2 1OT5A 4K6BA 4CDXC 1K12A 3W58A 5JOZA 1Q8SA 5DQ0A 5HCHA 1K45A 1MS8A 3KCYA 3RWNA 4YW2A 3ME2A 3KT4A 4LLOA 4YZ5A 5F7UA 3A23A 4YG3A 3GBGA 4LBKA 3J7HA 3O1MA 5C8CC 4Q4V3 1FMD3 4YW5A 3I3EA 2FCVA 2QTWB 4UBHA 2Y6GA 4MVTA 4A6SA 3O1UA 3CJIC 3WX5A 4Q0SA 1V6KA 4Q4W3 1UIJA 4Y22B 1RVF2 5A3OA 5C33A 1OUXA 1TME1 2JG8A 5A3TA 2C24A 5LA2A 3KCXA 3RPQA 2O1QA 1XSRA 3HD8B 1GZCA 2W5FA 2VC9A 2TBVA 4L92A 3WP6A 2BNMA 4ZS2A 3MV01 2EAKA 1GFF2 4FPLA 4H55A 2ZAAA 4JKMA 1JN2P 4XUOA 3FHIB 1JZ8A 1S0BA 2WAAA 2ZZQA 5DAQA 5FYVA 1SG3A 2AACA 5IVYA 1UD1A 1SZBA 2PHUA 3OEBA 5FYTA 2XH6A 3IIIA 3WHTA 5J7MA 1YNAA 4QGMA 5K4LA 1PNFA 1S1AA 1VB4A 4HONA 3WNPA 2ZTNA 5FZGA 4PIYA 4XFCA 5CBLA 4MOAA 4XMAA 5JMCA 4WVZA 3ZKYA 1YJKA 4P9IA 4AW7A 3RMYA 1ZZ7A 5A6YA 1WW5A 5CG9A 4P9GA 4JHTA 1RUE2 5E16A 1DHKB 4PI0A 4BQ1A 4NN0A 2V4VA 3K51A 1ZRRA 4R9CA 2C1FA 1MS0A 4LE4A 1RUNA 3POIA 3O0XA 1VLNA 1MEC2 3EB7A 4BK5A 2BEOA 2PTMA 4OUSA 4M4PA 1F4AA 1K5MA 2ZGKA 3VHOA 5FMOL 2P2KA 3B94A 1LKNA 3B5LB 1W0PA 5FY8A 1CQ9A 5KHJA 4HN1A 3A22A 3LB9A 1FV2A 3HJRA 4KH9A 1PO12 1QJY1 1RINA 2W91A 1HB1A 3ACLA 4N8MA 2R30A 1URXA 4Y26A 1HJGA 4LBOA 4UYBA 5KXBA 5CIRA 1SLBA 1DZRA 1YQ8A 3LOBA 2R32A 5LBEA 5LY2A 2J1EA 3ES1A 1SBEA 1AR63 3H7JA 5EP9A 3ZFGC 1LTEA 1OLME 5FZOA 1BMV2 3UKTA 4JGZA 5LASA 4GMP1 1YI7A 1RMU3 4TZDA 2W1WA 3BU0A 5FPXA 1RL3A 1UXXX 3HIFA 3VBHB 4ZU5A 3ZSLA 3MPBA 3O5SA 4AI8A 4D69A 1OPMA 3U07A 2UY8A 3GDBA 1F2NA 5B4XA 1IZ3A 2ZEZA 2WDBA 2ARAA 4XF1A 1IPKA 3ZXEA 3LEKA 3KV9A 1AYM1 1ULDA 2D6KA 3MLLA 2DTYA 5A7PA 3FBYA 1VBA3 5CADA 4XHXA 3ZFFA 4XZUG 5DZGA 1QXRA 2X8KA 3A0KA 2GNTA 1R1A2 4HKWA 1NY71 2I07B 1S4CA 3FUQA 4LLFA 5FOJB 2BFUL 3S7IA 2X10A 5LCWL 2W46A 4LQRA 4WM7C 2H6CA 1KS5A 5ACA1 4GH4B 4IEOA 4CYDA 5KXEA 3INAA 1C8M1 4K8FA 3IMNA 1LULA 5H9RA 4NAMA 2WYSA 4L2NA 2JECA 5JI9A 1W2NA 4CDXA 3OPWA 3U78A 1ULEA 4YVWC 3CDZB 2YY1A 4PQ9A 5A1LA 4OULA 1FNYA 2XJQA 4A45A 4E9KA 2JE8A 3KLSA 4QPIC 2ZHNA 5BNNC 4KG8A 1KD7A 3RS6A 4E27A 4AAXA 5C8CA 1MQTB 2WINB 3I7DA 3ZIWA 1Z7S2 1AJKA 4B29A 3VB9A 2HWB3 2W39A 2TUNA 4Y24A 2PHTA 3CJIA 2PAMA 4R9BA 3SXWA 4HMZA 4V2VA 4AGRA 3PLQA 1O7FA 1OMIA 4FQZA 1ALYA 2ZBJA 2WSUA 1XPWA 2WNVB 3E5XA 3QOPA 4FI9A 4AVVA 2R043 1UU5A 3ACHA 1M4WA 3WNMA 3W21A 4N7IA 1WMFA 3THCA 3UT0A 4CPBA 4O9GA 2VCAA 5AFBA 3H1MA 3C7OA 3M7AA 4O7XA 2HWF1 2YBPA 4QGLA 1JTZX 4CXYA 2UURA 3C3VA 5IK4A 1ZZ6A 5FY9A 4JQRA 2BVVA 4ARXA 1O5LA 2VW0A 2BNNA 3SMHA 2XJUA 1JU3A 3E5UA 5CFDC 5CB7A 3HNMA 3N4MA 4FTSA 5BXXA 1PZ7A 4MLOA 2I74A 2VCCA 2KXLA 4AWDA 2NMOA 4GB32 5EWSA 5I0UA 1JHJA 1HRI2 3DGTA 3E97A 2OQ6A 4H2AA 2ET7A 2BERA 2C5DA 2D93A 3UKNA 2MEV1 4IEPA 3VD5A 3VHRA 3PIGA 4NWWA 4YFZA 2YB7A 5LWBA 5AVPA 4XQDA 2JDZA 1PO23 2XJRA 1KFUL 2EXIA 3W5MA 3V64A 2J1UA 2V5YA 5LA9A 1DZQA 2XLAA 4XCAA 5T5OA 5FP7A 1OFSA 5FWJA 5JXHA 3T0BA 2D6NA 5FYMA 1H0BA 1S0EA 1D4VB 5JUVA 3MIGA 2WJSA 3K75B 3ALQA 1QHDA 4LKDA 2VG9A 2K9ZA 5JSPA 1IG3A 2YFUA 1JW6A 4E2GA 1T2XA 1BBT3 1OA2A 1PK6B 3Q8EA 2WO3A 3D8CA 3NQHA 2N7GA 2VW2A 3MGUA 5EZWA 1BEV2 3WNKA 2H0VA 1HXS1 1SFPA 4CCLA 4FAHA 2DCTA 4DY3A 3FMGA 3M8LA 3KZ4C 3OGJA 4CDQA 4IETA 4Y1UA 1SLAA 1BCXA 2R062 4COUA 4R4ZA 1RITA 2LROA 4H14A 3MW2A 5F5AA 2QDNA 4XFBA 2GAUA 3NNJA 1GQGA 2BW8A 3TEYA 2DUOA 4IV1B 4MX3A 1O4TA 1WA4A 1DGLA 1WLTA 3JQXA 5D21A 4X6QB 3MLJA 2WSVA 3ZXKA 5AC92 4QU2A 1NUKA 2DF7A 4CCJA 2VZ1A 4Q0PA 1BXHA 4I09A 4H3WA 2ZX1A 1AJOA 4KNCA 3IPVA 1WKYA 2B5HA 4YW3A 1DQ5A 4Z07A 3SCHA 1UX6A 1W6OB 4QGNA 5FO8B 2FHRA 2RDQA 1JZ4A 1QU0A 3VBRB 2WWUA 3WDWA 3WDVA 2VZQA 2JE7A 3I4IA 3T2QA 4FOVA 4WM7A 1QJZA 5KBFA 2XHKA 5ISLA 1STMA 2Y26A 4OHWA 4QKBA 1LOBA 3D3AA 3WDXA 4CUAA 1YC61 2D3PA 1UPSA 2V4AA 4WM8B 3SKJE 3LSDA 2Y34A 4A2UA 4B4PA 3UYJA 4E2QA 2J1VA 3J4UH 4HANA 3P3PA 4FO9A 3ZSMA 4YVWA 2C6SA 2BYVE 4ZU4A 4CU8A 1JS9A 2XR4A 4QPIA 5BNNA 1Q8QA 4K21A 2EXJA 4YLZA 4CP9B 5IHRA 4FAGA 2HWC1 1TMF1 2VJXA 1QOTA 3OF1A 4LORA 5D2AA 3V56A 5A3UA 3H8UA 2E31A 2W08A 2Y0IA 3POGA 2OS2A 3SH5A 4A42A 3B9IA 1JYNA 4QXKA 2KR2A 5FQ0A 4CA9A 4PBOA 1YI9A 3B7MA 2YGLA 2CGOA 3IIAA 4Y20A 3ACIA 4BOWA 2RS33 1JYVA 3MIHA 3TBDA 3MICA 3ZXJA 2VECA 2A3XA 4LEJA 4QPGB 4DB5A 4QPYA 3NRUA 1H8TC 2R0FA 1GNYA 1HLCA 1H1MA 3MUZ1 1MS4A 1FPN1 3HAGA 4FBFA 2J1TA 4N9IA 5GALA 4WV8A 5A7WA 5CFDA 2E26A 4GALA 3NNGA 2FBEA 1ZBA3 3WOGA 2D6MA 3ZYJB 4ET7A 1QKQA 3FUOA 1EAH2 1LOEA 4I0BA 3DCQA 1I1EA 2ZGLA 1TME2 4META 4UT5A 2XWBB 4KWUA 4BLIA 2B46X 5BNQA 1OLMA 2D3RA 4UI9L 1BVVA 3KGLA 2P6HA 5FZ6A 4CUBA 4NRPA 1ZZCA 3GZUC 4B1LA 1OPOA 4Q4W2 1LHOA 3GYDA 4RSUA 2HYKA 2VUDA 2DVDA 4YPJA 4CPBD 3GJAA 2VOKA 1JOPA 5FYYA 5A1FA 4IEZA 2ILMA 2ATFA 1QQP1 1RUJ2 2D6LX 4IE4A 4MXWB 2IFRA 5DXDA 4WBBA 2AEZA 4AXOA 4YZ4A 3VKFC 4GWJA 1NA1C 1QJEA 3ILNA 2Q30A 1VRH1 4CE8A 2X53S 2Y6KA 3AKQA 3AYEA 4AFBA 3PVBB 2ZEYA 4JTNA 5T5JA 2PFWA 1YRZA 5T5PA 3V0BB 1UF2C 4RQPC 4YG0A 3PUQA 4XJAA 1IQDC 1XYPA 2ZGTA 4OUEA 1UZYA 4XUTA 3WD5A 1BZWA 1EPWA 2JIGA 3JB4C 4NO4A 5C5UA 5F5QA 1GP6A 5EV7A 4KWLA 2KD7A 4QWNA 1VR3A 4A3ZA 2YDEA 3MIEA 1RVF1 5FYSA 1YQ2A 4P9XA 1YCIA 1XE7A 3MFAA 3QD6A 4DEQA 4CP2A 3U4XA 1ST8A 2R072 4GWIA 4DUWA 4JV4A 2Z79A 2D98A 2WZR3 4DNYA 1XNKA 2BPA2 4SLIA 1G6NA 4AG4A 4ZXKA 5CYYA 4INDA 1DQ0A 2DBNA 3LF7A 3O0WA 5IVBA 1OA3A 1RHI2 1V9U3 1OUSA 1XU2A 4TTGA 4XURA 5H9QA 2RVAA 2ZKNA 4OI4A 4CXXA 1U5YA 3WQBA 1UNBA 4CEWC 5C3QA 2CWSA 2ERFA 3WG1A 4EYUA 3WW4A 5F3CA 1Q43A 3PNAA 2B45X 4N9HA 2UWAA 5G05L 3T08A 3S6PA 1HRV3 1LU1A 2QDRA 5C3RA 1CIWA 3M70A 2ZGSA 5JZGC 2VUCA 1XNTA 1VAVA 1Y9QA 1RUE1 2CDPA 4A7KA 5F39A 3HBKA 2PLV3 3T2OA 5FXXA 4N43C 1SLCA 1MS5A 1DCSA 2RS53 3ZSJA 1MEC1 5J3UA 1CAVB 3H7YA 3POWA 1F5JA 4HN0A 4XF4A 3UESA 3VLBB 2RS12 3ZXLA 3POBA 1VBC2 3A21A 3VDDB 1CJPA 2AUYA 5DN2A 3VZJA 2VUJA 2XGXA 5FXZA 5FPUA 3NSTA 5K8SA 3VKOA 5J48A 1PO11 3JUUA 3L9JT 3HQXA 4AI2A 2VXJA 4J1XA 1W03A 5L7OC 2RM23 4AYUA 3KHBA 1MZ5A 1RTVA 1AZDA 2JX9A 1YQ6A 5E89A 3KHCA 2A73B 1BMV1 2UYBA 4CXWA 1H8TA 1O8SA 2VOVA 4AF9A 3T3YA 5DZFA 3QACA 3V0AA 2WZEA 3O12A 1YHFA 3J8F3 1WLDA 1PGSA 2VQUA 4LXLA 1H9PA 1O4YA 1RUH2 2JKBA 5FZ8A 4HXCA 3SISA 1DU3D 3PMEA 2EF6A 2E51A 3C7FA 3THPA 2J1AA 1H2MA 4KBBA 4RHV3 2JG9C 1C5HA 1VMJA 2X5IC 3POJA 2QQPA 1N1VA 1RUC1 1DQ6A 1PIV3 2RHPA 3WW1A 5FYHA 1QDOA 2OZ6A 2HWB2 1E5SA 4XUPA 2AZ5A 2VNGA 5GKAC 3LWCA 1LHNA 3ZSKA 3RI9A 1GP4A 1UY2A 4B3NA 1X50A 1R1A1 2E9QA 1ZZBA 2RR12 4KBZA 2BRTA 4X8PA 5H9PA 1CX1A 1GQPA 4XW3A 2VMGA 5F5CA 3VDBA 2VNVA 1C57A 4CTEA 4FSJA 1SCSA 2ORXA 2XPJA 1N3PA 3NV4A 1WCUA 1UOFA 2WBKA 1WD3A 2P17A 3THTA 1R083 5JIAA 5ABJA 2BDRA 4FPKA 3BTXA 4OZOA 2Q0AA 2ZMLA 4CUCA 4B7KA 3DPRA 4UFHA 3I3QA 4BQ2A 1VBD3 1VMFA 1YO8A 3M4FA 1AR91 5FK7A 4COWA 1GV9A 3AZYA 4RQPA 4AEKA 5LBCA 4CDXB 3ZFEA 3CKHA 2HWD2 2QJVA 4XQ4A 3FC0A 5DDJ3 4AQ2A 4Z2WA 2B39A 1LHVA 1JH5A 1IPSA 1LENA 1VAMA 3Q8CA 3HNBM 4R9DA 5C8CB 2WT2A 2FDGA 3VBUC 1IOAA 4A4AA 5L9VA 1IHMA 2XBO3 4S2FA 5DG2A 1F35A 1NT0A 3ENRA 4GD4A 5FTTC 1UN1A 4TN7A 1PO22 5DPNA 1L3JA 2WRAA 3I54A 3OGVA 3HOBA 1U12A 5FR3A 4XFIA 5L9RA 4BMEA 3OYWA 3AMNA 1QWRA 3GJBA 4LJHA 3E6BA 3T4HB 2IXIA 1VB2A 3KB5A 5CU1A 5A80A 4CEWA 3T09A 1S2BA 1VRBA 2PQSA 5JLVA 3RZKA 2G1MA 1WMDA 1GZ9A 3I59A 1NQDA 4IGQA 1HV0A 2Y38A 2Y6JA 4GB31 2JD4A 5F3IA 1HRI1 4LBQA 3IT8A 5BV6A 5JZGA 2JG8C 4Q2FA 3AMPA 2GNMA 2PHDA 4WVVA 3BALA 2KA3A 4NJ4A 1LOCA 4N43A 2P37A 4PDWA 1JYIA 1V0AA 4XDOA 3TN92 1PVC3 3AYAA 4LA3A 1H2LA 2VE1A 5FO9B 1QF3A 1JXNA 3Q8AA 3HN1A 1OC1A 2A71A 3AZVA 3SH4A 4IEVA 4Q1PA 4QX8A 3O1TA 3NNLA 4HK9A 2C4XA 4PF1A 1ND3B 1DLCA 5CKMA 3VBFC 1COV3 4R9AA 1ENSA 2ZAHA 3WSOA 1DQ4A 1LECA 5FKBA 4FPGA 2W1QA 4E4HA 3ZYBA 5L7OA 3D0SA 1JZ3A 1BEV1 2V73A 5A3WA 3WNOA 1OQEA 2BV4A 2VZPA 1W3VA 2LRPA 4WZCA 4CSWA 1GYKA 2WNUC 2R061 4FVVA 3KGZA 3GM8A 3ZFGB 3ZYGA 5BNOC 4CZSA 4GULA 2CHHA 1K5MC 1LR5A 4IW3A 1R093 1MACA 3C8XA 1ULCA 1PMHX 1EV12 1SCRA 2JG9A 4IUGA 4DINB 2VOWA 2QQIA 5IVFA 5AC91 1Q8PA 1AR72 1ZBE3 3GZAA 5JIUA 4KGQA 3DF0A 3MF9A 2E32A 1V6OA 3ACGA 3MDPA 4CCMA 5CEHA 1I6XA 3DV8A 4R4XA 4ITCA 1RJ8A 2GDFA 4IE6A 2XOMA 1X82A 3J7MA 4C90A 4JGZC 3CZJA 1BQPA 2NP0A 5FZMA 1B35C 3VBOB 5IJRA 1BVP1 1WMEA 3N9NA 4FFIA 2WLQA 3JD72 2QCSB 3PDQA 1WCSA 4ZKTB 3KMHA 1XYNA 3N9OA 4A44A 4NIHA 2D40A 1OKOA 1UCXA 3H50A 4GKYA 4WM7B 5FCCA 2YZ4A 3POFA 5FJHA 5FXWA 2UWCA 5C3PA 5C5TA 3N9MA 4S2GA 5FLJA 4C1XA 2E7AA 1NCRC 2J1RA 1WW7A 2YPJA 3LIHA 3BUCA 4YGCA 1QGLA 1V6NA 1ZBA2 3LDBA 4RS5C 4YVWB 3WF4A 4XIKA 2ADEA 4P00B 5DG1A 4Q4X3 4OHVA 2QQNA 1CAUA 1CPNA 2QZ3A 3PURA 2VZSA 3DXTA 2A3YA 1AF9A 3FHQA 1CZTA 1AL22 1S0GA 2YPDA 4PF5A 1ZZ9A 3URFA 5FMBA 3WNLA 4CP0A 5BNNB 1C8NA 3DECA 3VBUA 5FZDA 4AZZA 1H9WA 1QQP2 1XNAA 2HWE3 1DQ1A 2QQMA 3WP5A 1W05A 4N90A 2QQUA 3IMMA 1H30A 1VBE2 2ADDA 2RJ2A 3JBG3 4I01A 3C2UA 3PL0A 1UWWA 4M4RA 4XF3A 2Z5WA 3HQUA 4Q29A 2XG3A 4UFKA 5A6QA 5JR2A 4Z1VA 2A6WA 1UAIA 4QT6A 1J1TA 1QJU2 1L7RA 2JDMA 2SBAA 4UW6A 3SH3A 4YM3A 2RDSA 1K42A 2MPFA 2YBSA 2K0GA 2WQZC 3NJVA 1H1IA 3E5QA 1UOBA 4UF0A 3RVHA 5GJ6A 5E6HA 3U1XA 1QJX3 5A7WB 1EAH1 2VL4A 4OMDA 5CFDB 5A6ZA 2D7FA 2WA3A 2ZCWA 5FZ7A 4BQYA 1HQWA 3NW4A 4JCKA 4AI1A 1FMD1 2WZPP 2QNKA 4B4RA 4XFGA 1V6JA 3SLIA 5F1RA 4N7UA 4E4SA 5FIXA 1ZA7A 3R05A 5FMDA 3USSA 2CYFA 1NE4A 1H1AA 4OYUA 2D5HA 4DXZA 4EWAA 3IAPA 4Q4W1 4QMAA 2RJKA 1VBB2 4S2HA 4XHBA 2WO7A 4AI0A 1WWYA 2GZWA 2WKKA 1MR5A 1ACCA 5DUVA 3LE0A 2VZRA 4EZHA 2YBKA 3C7HA 1RUJ1 3P3NA 3K46A 4GMP0 3VBFA 4QX7A 5F3GA 2HEVF 4AEDB 1CR7A 4GIQA 3FHAA 1RUD3 5BPXA 2R1DA 5EHDA 4AGGA 4K1ZA 5B4NA 3IDCB 1OXCA 5T54A 1OA4A 4M3CB 1MS1A 4DY5A 3QLQA 4ISRA 2GH2A 4PIZA 3PU8A 1SACA 2XB6C 4K7JA 4LBQD 1FOD2 3LGRA 2WNUA 4Z82A 2A70A 3ZYRA 3ILRA 4U2AA 3ZPOA 5BNOA 4HLTA 1HRV2 2E6VA 1IS4A 2OPKA 3RJRA 3WLUA 3LSEA 1KFXL 3SITA 2ZACA 2CSGA 4EWDA 1ULPA 5BY5A 2JICA 2X29A 3IM0A 5C70A 3LEGA 1OLQA 3E1F1 1XBFA 3SKVA 4JTOA 4CCEA 4CCDA 2R071 3DKQA 1CAXA 4BQWA 2JDAA 4UBGA 1X36A 5FZBA 1AYN2 2JENA 2GALA 1S2KA 5KXDA 2VTXA 5EFUA 2FQPA 5FYCA 2RMU2 1RHI1 2XKOA 2IXCA 4ONUA 4WVMA 1V00A 4LOSA 4YM2A 1QJY3 3B9CA 1W6NB 2R49A 3N9PA 3ZXDA 4CDQC 2BNOA 3W59A 1B35A 3VL8A 1PX3A 2BGCA 5AVAA 5IK8A 2BOJA 3OGSA 4LITA 4LUKA 1CX4A 2HEWF 3ZN6A 2Q1ZB 2YHJA 3I2GA 3DYPA 4GMP3 3HT2A 5JR7B 1VP6A 2W0XA 1VALA 3KVBA 3OEAA 4IV3A 3ZOIA 1UQXA 4BQ3A 4AHWA 4FPCA 5IFTA 2OIIA 5F8PA 4OHXA 1SPPB 1RUC2 3AZWA 2WUHA 4EJRA 2QQVA 5FZFA 1NCRA 4CCNA 3K3OA 4RS5A 3H9AA 2J1SA 2V5DA 1XSQA 2D44A 4RHV2 4PCRA 1TQ5A 1GWMA 2RS11 4K3UA 4FOYA 4QHBA 1VBC1 4L9BA 4YARA 1WLWA 4NRMA 3H8RA 3OB8A 1AR82 3AKPA 5K7PA 5F32A 1OOPC 1MPXA 4OI1A 4BK4A 5K0UB 4FPYA 1WW6A 3FZ3A 3AK0A 4OUMA 2R6QA 4I02A 4XJUA 4XAEA 1VJ2A 2VU9A 1B09A 5ACA3 1AR92 2B9VA 2VM9A 1C8M3 5LW9A 4UWDA 2O8QA 2MNGA 1RUH1 1BKZA 1LHWA 2HYXA 1H8TB 4OHYA 1H4GA 3VBSC 4Y33A 2PMWB 1EY2A 1VBD2 2VZVA 4QB2A 3FLRA 1UXZA 4BU2A 5KHKA 4MGZE 3R4UA 2VMDA 4Y5TA 4Q8LA 3AKRA 1MVQA 3C7GA 2LS6A 2VUAA 5DAPA 5JMOA 1YIFA 4NE9A 2HWB1 3TNPB 3HVDA 4EROA 1A8DA 3S7EA 5GZFA 4URAA 5CG8A 2OT7A 2C0ZA 2ZABA 4E8CA 2WFF2 3IDBB 1W3XA 4XJZA 2RR11 1ND2C 1RUG3 5T55A 2CY6A 1ZA4A 3WP3A 3H3LA 3HWJA 3ZYHA 2VNOA 1GZWB 2VY0A 3KCCA 4IL7A 5FZ0A 2ZGPA 5A3PA 5IAXA 1PGL1 2IVJA 4LTAA 2HWF3 2W87A 3AB0A 5FZ9A 1E57A 4AHZA 4FPFA 5FJKA 1A6CA 5F2WA 3ITQA 2D43A 3ORJA 4QXBA 5FV3A 3IB3A 3BOPA 2AH2A 1UOJA 1N1YA 2H6BA 2XLGA 1NA1B 1S0DA 3PVNA 5DUXA 2H0BA 4I3PA 4CP1A 5LRSA 2W1UA 3NMBA 2Z4FA 5FP3A 1W6MA 2VR4A 1XE0A 2Y0OA 5EJZB 2BU9A 2HWD1 1UKGA 4DO0A 1G9CA 1UX7A 1US3A 4EV0A 5DZEA 2Z42A 4UOJA 1G86A 4FOQA 3N7KA 4LHNA 2BWCA 1HW5A 2MEV3 4AI9A 1YWKA 3OBAA 3TB0A 4AFDA 3JXSA 2YG0A 1XOYA 3E6DA 3A4UA 4GQ7A 2I2SA 1ASJ2 1PO21 1UMZA 1W9YA 3VHNA 3CEWA 1V6LA 4Q26A 2XWJB 4YSFA 5CNAA 1Q3EA 2ETEA 1ZM1A 1PNGA 2BJSA 2GMPA 3HBZA 3ZFFB 4DMIA 4NIGA 4Q0VA 5EXOA 3POYA 2YC2A 4YFWA 1GMMA 3UETA 4AFCA 4EN7B 4Y5SA 3ZO0B 5I8TA 1O3QA 1GOFA 1XNCA 1HN0A 1SBDA 4NHMA 1HXS3 2WS92 5A7QA 3KVAA 1LGBA 1LCLA 1GWLA 4HBNA 4I0WB 1AX1A 1CZVA 4AK3A 2XMLA 1NXD1 3U0ZA 2AC1A 5FPBA 1O3SA 4XUNA 1UZ0A 4RFRB 1JZ7A 3I2IA 4FFHA 1D7PM 3I59B 5EJ1B 2UY9A 3LA2A 5C9AA 4Q4Y2 1SLLA 5IK5A 2E33A 5A7NA 1R092 5JZGB 3TN91 2JJ6A 4YZ1A 2FD8A 5C6CA 2PELA 3USUB 4XJ8A 3U75A 4AEMA 2JD9A 2F6BA 1EPZA 4OZXA 1NOVA 2J22A 5FAXA 3UGFA 3K4AA 4C0HA 3JU9A 3LD8A 4LMFA 3VHPA 1F31A 4ZHNA 1W6QA 1OOPA 2J7MA 4V2WA 1DQ2A 3RSJA 1UU4A 2JDHA 4JAAA 5FPVA 3AC0A 2Q8OA 2FDKA 3S57A 1ENXA 2ZHKA 1NCQC 1RUI3 4RA0A 3G7DA 5A33B 5L7OB 4YYOA 3VBHC 1W90A 2GN7A 4LPLA 3HMYA 4IE5A 5T52A 1L7QA 2KM2A 2QQJA 1ULOA 2EALA 1LB2A 5D1IA 4BZ4A 4C0BA 3AMQA 3VBSA 1W6PB 2JDPA 1EV11 1O91A 3MV11 1O4ZA 4CVUA 2VULA 1ZRCA 2WIIB 4COZA 1AR71 1SQ4A 2HWC3 4LO7A 1TMF3 2WA4A 4P9LA 4FTBA 1UU6A 4QX3A 1ZYBA 4Q4X2 3SQOA 2X5IB 3LAGA 3DL3A 5FY1A 2QQKA 3B00A 2AGSA 4AVCA 3GZTB 3AMMA 3EO6A 1W2AX 5FZKA 4IEQA 5DUUA 1ND2A 3KT1A 3N35A 2RV9A 1BK1A 1DF0A 3MW4A 1OH3A 1FV3A 4RR3B 1ZNPA 5CA6A 1NZIA 5JPMB 4ZPIA 1W9TA 5FP8A 2PHLA 5M0TA 3JD71 1QEXA 2DCYA 4HOOA 1W9WA 3ZIXA 1IGOA 1FPN3 1W2OA 3A0NA 4KWKA 4LHSA 3RJ2X 5JDBA 3ASIA 3K4ZA 3LCPA 3OGGA 4MGIE 4QXHA 3B69A 2AR6A 4Q4V2 5FZEA 1FMD2 3O1SA 2LTNA 2LW8A 4IXLA 3W5NA 3OUHA 4NPRA 2OVUA 1ONAA 1Q5OA 1ZBA1 2BBAA 1W04A 2BGPA 4I30A 4BE3A 3EYPA 3LDKA 5IAVA 5D8AC 1J3RA 2VO5A 4LK7A 1AL21 1JUIA 3WZ1A 1Z78A 4XJ9A 3DUIA 4YVSB 4Y22A 2IC1A 4JVAA 4L99A 2WNVC 1CAUB 2W2IA 1D4M3 2W68A 4W4ZA 1GWKA 1PX4A 2Q8EA 1AX2A 4NHXA 2OX0A 4FXKB 2K2SA 1SFNA 5ABJC 1KQRA 4FPHA 3RMXA 3LQCA 2B42B 2VOXA 4DXRA 1VBE1 3DPRC 1KRIA 5I0RA 1S0FA 2W92A 4AQ6A 5FDBA 2GU9A 2VMFA 2CTVA 4BB3A 1LODA 3ZKUA 5EQUA 3GF6A 1J3QA 4D6RA 1QJU1 5J36A 3ZFEC 2QKDA 5LBFA 1VRH3 4E4ZA 1XU1A 1Q56A 4RN5A 4X8NA 2YC4A 1RUD2 4BYYA 4UW3A 5HV0A 1CESA 4Y1ZA 5FZLA 4BQ5A 2QQWA 4XPVA 1GSLA 4LT5A 4QKNA 2DVFA 1PHMA 1UZVA 1UO9A 1V6MA 4IGOA 3ZMNA 4YG6A 5HXMA 5FZHA 1GU3A 1POQA 5ANQA 3CIHA 1W9SA 4UF0B 3LFMA 5JCTA 1SDDB 4NHKA 1WA6X 1NKGA 1F8VA 3ZX7A 3OTFA 2DWRA 4M0HA 2JG8B 4QX0A 1RVF3 4ISQA 1UYXA 1W99A 4MYEA 3BODA 1VBB1 4XBLA 1QNYA 3KS7A 2JXAA 2JB8A 3WG3A 2VZTA 4V1PA 5KXCA 1TE1B 3UJQA 3ST7A 2J42A 4OHZA 3NJYA 3J26N 1APNA 3L2YA 3CHXA 3Q8BA 2P1BA 2WAOA 4L11A 4CU6A 5JXGA 1AR62 4ATFA 3S5QA 3RNSA 2A7AA 3ZXFA 1RMU2 2VH9A 3VBFB 4MG2A 1DGWA 2ZKLA 4BM8A 3WNXA 3O1PA 2XXZA 1NCQA 2Q1FA 1YJLA 4YRDA 5KHIA 2A6YA 1FOD1 3AP6A 3CZUA 1I5PA 3VBHA 5JSOA 4OI0A 4PDWC 2ZX0A 1PM4A 3I3BA 1HRV1 4KL1A 5IVVA 5IATA 2WNUB 3GBFA 2ZGQA 4AVBA 4NPMA 3WP4A 5I0SA 4NRQA 3TNQA 4R52A 1MEC3 2PLV1 1K5MB 3RQ0A 2FDIA 4PLMA 1ZRIA 1FYUA 1VBA2 4HVQA 1UKRA 2XUMA 1BLZA 2ZGRA 3OGRA 5IVEA 5EJ3A 1AYN1 4LHKA 5FUPA 3RYRA 5HPOA 4W8JA 1OD5A 3RFRA 4DEVA 2ARXA 2XL9A 1UYPA 4BPZA 2RMU1 5BNPC 1CAXB 1GP5A 1OF4A 3OBTA 5EPAA 3KD4A 2QVSB 3PVEA 2FDHA 4MGYE 3LZZA 1H4HA 5FZOB 4WVMB 1OVPA 1UPIA 4JGZB 5KC6A 1TVGA 4GH4A 4M00A 1MZEA 4AVSA 2GC0A 5J98B 4GKXA 1B35B 3WQ0A 2XJVA 3I8TA 2VCMA 1F5FA 3CMGA 3H0OA 4ES8A 5JOXA 3T0DA 3D4KA 1D2SA 1GBGA 3R4DB 4RFT0 4QHOA 1XB9A 4FPOB 5JAXA 1CAWA 2GNBA 3K3NA 2AYHA 4QDQA 1GOGA 4AGVA 4XTMA 1PMJX 4RHV1 1LGCA 3KV6A 4G9SB 5D8AA 4A7ZA 1O6UA 3RGBA 4XIOA 2YROA 2JKXA 4PI2A 2JDNA 2EXKA 1HJFA 4MSVA 2NN8A 1G7YA 3AKTA 1ODNA 4OVEA 4N53C 2R042 2VTXJ 2WNVA 3U11A 1AR81 2HH9A 4U36A 2ZHLA 1OD3A 3TEWA 1R1A3 1NE6A 1QXPA 5BUVA 3UGHA 3TWIA 4BA6A 2D5FA 4NIDA 4XABA 4QPGC 1RUF3 1ZX5A 4Q0UA 1QDCA 5LEKA 5A32A 3AL5A 3WNNA 4QU1A 4OQ9A 2CGNA 4HL0A 3CJXA 3RI8A 3KSCA 2WABA 2P4EA 5GZEA 5F37A 2DVGA 1Y9MA 4NHYA 4MGKE 2DURA 2DDUA 4AAPA 1GQHA 1VBD1 2YMZA 1KJLA 4MH0E 4WZFA 1KDMA 1VE0A 2NM1A 4KQ7A 4NHLA 5DAWA 1UY3A 4QQOA 1X8MA 4QQLA 2EVXA 2XLFA 1HB4A 1Z7S3 2CU5A 1WCDJ 4H7MA 2IXLA 1EUUA 2HEYF 2YYOA 3CJIB 1XRUA 1AL0G 3FX3A 3WQ1A 1DZTA 2P6CA 2YFZA 5DDJ1 2NZ9A 4MHRA 5J96B 2E7TA 4LIUA 1DBNA 2HKXA 2WFF1 3OSDA 3CL1A 1XE8A 2AENA 3R6SA 1OSGA 4Q1RA 2YC0A 3U14A 3FN9A 4XDPA 2FDFA 4QXCA 4LO8A 1BBT2 3OCPA 2X05A 1ZVFA 3AJYA 4Z8BA 3LOIA 5JXJA 4JX0A 2P3KA 3BTYA 1WD4A 3K2OA 4YM0A 1BHGA 2RJLA 4A6OA 3BIWE 3D6EA 2P34A 1TEIA 1Y7BA 2VZOA 5JSRA 3H8OA 1GKBA 1LNSA 4Y4YA 1OHFA 2BZDA 4HSLA 1GICA 2C9AA 2PAEA 3RWKX 3WDTA 2C9KA 4EN0A 4JKKA 2YV8A 3VD3A 3IWZA 1HRI3 3GXUA 2EIGA 2DCJA 1P8JA 2WNEA 4QPWA 1K3IA 3PHMA 4JC1A 3CF6E 1OF3A 1O8PA 2VPVA 1H2NA 4FOWA 3B93A 3ZDSA 4YGBA 3HPNA 2DV9A 4BMBA 1LOFC 3LPGA 2X09A 1FAYA 2VW1A 2WL1A 1ASJ1 2Y6HA 4QQPA 2FCTA 4MXVA 5TSWA 3WW3A 1Y4WA 4ZU7A 1POV1 2EAAA 1V70A 4F7ZA 4DUXA 2XVLA 2Y8KA 4KU8A 4CEYC 3WW2A 3E6CC 2YXSA 5DUWA 4HPKA 2B7YA 4XXPA 5F6KA 5BNPA 3Q8FA 1W8ZA 1W6OA 3LA3A 1NG0A 3NKGA 4O9EA 3ZDVA 5E88A 1H6YA 3K4DA 3VBRA 3P1IA 3RYKA 1Z0HA 2DCKA 5IWFA 2QQOA 4UXAA 4XBNA 5CZKA 1BEV3 2ZOEB 3FBMA 4FPJA 2WS91 4P02B 1BK0A 4MO3M 2OXBA 4QM9A 5FYBA 2EIBA 4M3CF 4YW6A 1O59A 4XF9A 3T2TA 4CDQB 1F9KA 1K5JA 3RZJA 5C4WC 2DBIA 4M0NA 4WM8A 2F4PA 2IVIB 1F4HA 1J83A 2LALA 2W3JA 2R063 3H1YA 3BPZA 4PJYA 1CN1A 1RUI2 2Z69A 4TLFA 3IAQA 3CU7A 2XUEA 3OPZA 2XVKA 5SV8A 3LA7A 4Q4Y1 1WCQA 4OLLA 3M3CA 1EUTA 1R091 5IW0A 5DAVA 3ZR5A 3MIBA 3WVJA 3DYMA 2BTVC 2CAUA 3K48A 4IERA 3AKSA 5FLIA 3VDCA 1QXJA 2TNFA 4JDMA 5AC93 1MVEA 2NPIA 3VDDC 5FP9A 1X9PA 4LBNA 1IG0A 3RDIA 4YZ2A 1WCKA 1JYCA 1LOGA 4NR1A 4YM1A 5GLVA 1W8WA 4NIIA 1C1FA 4N53A 3NAPC 3IPVB 3WR0A 3AP7A 1ENRA 1UY1A 2RS32 3RRDA 3WDUA 4DPNA 5CISA 3AP9A 2DFCA 2ZGUA 1T6GC 2VQTA 2GC3A 4IV3C 5F3EA 5FZ4A 1HKDA 3OPTA 5CFCC 1PGW2 3MIFA 5K9YA 1H2KA 3KV4A 3N9QA 2GMMA 4QPGA 4D7SA 1OOPB 4QM8A 1UZWA 3OY8A 3MYXA 4O61A 4HFSA 4CDUC 4B1MA 5IUQA 1R1ZA 2Q5TA 1RB8G 4SBVA 4LR4A
chains in the Genus database with same CATH topology
1IS3A 1YFUA 1O3RA 1ULFA 5FBZA 2LM3A 4M01A 4QPIB 1U5ZA 3ECQA 2PQQA 5I91A 2QFEA 5L73A 3RZZA 4XEZA 4FP3A 4IEWA 5FREA 4Q4X1 1YLLA 4GA9A 5FQ0B 3PVOA 3R4SA 2WWSA 3ZXGA 1ZZ8A 4Q0QA 4CDWC 4KWJA 4Y20B 5JI7A 3WV6A 5T5LA 1AVBA 1D4M2 4UW5A 1AHSA 1GLHA 4MUVA 3VN4A 2EA7A 3O14A 4BIOA 3AXDA 3DKWA 1NZCA 3V65A 4YZ3A 2ZX3A 1UIKA 1HX6A 4HK8A 1LEMA 3V0BA 4Q4V1 2GMEA 4JGYC 4DZGA 4F8AA 1PM7A 1EAH3 1LEDA 2IZWA 4FCAA 5A3MA 2OZJA 4JDNA 5GM0A 1QJX1 4FXGB 4B8EA 1TME3 1YFXA 2DCZA 4KGGA 5LEJA 2IWGB 3O0VA 4OFGA 3AYCA 4A3XA 5JWPA 4FQ4A 4HZFA 2WZR2 1LOFA 1TNFA 1WUVA 1CVNA 3ATGA 5KWRA 4KG0A 3VKNA 1V9U2 2A5ZA 1VAKA 4XF0A 4CEYA 2D6PA 2DYCA 1RUJ3 2SLIA 2HJIA 1RUOA 4ASMB 5FO7B 3ROUA 3I2DA 4DS0A 3GNEA 3OD0A 1RUD1 5KHHA 3OD4A 3EHKA 4PLNA 5C4WA 1QMJA 4MV2A 2D6OX 1MS3A 3AP4A 2G9FA 1YFWA 2PLV2 4LBLA 4LO4B 2RS52 3NJZA 5CVRA 2IFWA 1WW4A 4FP2A 2JE9A 2OW4A 1FATA 4W65A 3S30A 1CAVA 2ZMKA 3WCRA 2VQAA 4ATEA 1M06G 4D94A 2E7QA 3M3QA 4NOTA 2GC2A 2R073 4URTA 3D0JA 5EYYA 3VDDA 1X7NA 2ENRA 3BB6A 1I3HA 1ND3C 1LESA 3FFZA 1X8EA 3VZKA 3NAPA 1FT9A 3ZMOA 4MZUA 2RM22 3QBQA 4ORFA 1RHI3 3D82A 1AR61 5F9TA 1SFYA 5CFCA 1RMU1 1XQNA 2XKPA 3AX4A 4FTEA 3J8F2 5FFOC 4CDUA 5C9AC 1NLRA 2A3WA 4TSVA 4YGDA 1NCQB 2PHWA 2IXHA 1CD3G 3B3QE 4OI0A 1AYM3 1C3HA 3VZMA 3N7MA 3BOWA 1PIV2 1NQJA 2XJPA 1N47A 2W52A 1XNDA 3PJQA 2Z2SB 3AYDA 3NV3A 4YM2A 1AXZA 1QOSA 1VBA1 3NO8A 4M3CE 5LK5A 2RS13 2ZZJA 1VBC3 3VKLA 3GBWA 3FFQA 3N7LA 2UWBA 4EWEA 3VUOA 1V6IA 1RGSA 4DRVA 1IKPA 3TAYA 4CDWA 4XOGA 3H3UA 2IXJA 3VBOC 2P3JA 4HKOA 1R082 4DOUA 2IXKA 1DIWA 2A6VA 2UU8A 1RUF2 3V0AB 5FMOS 1JBCA 1AXKA 4OI2A 1I9RA 1RUH3 4XFHA 4NVPA 1LGNA 1W39A 4JGYA 3MLKA 3WDYA 2D3SA 5DDJ2 5E1RA 3CO2A 1YFYA 3CNAA 4TYSA 1DYKA 4P5HA 1VIWB 2R1BA 2GH8A 3SHRA 1CAWB 2VVEA 2FMDA 2XBO2 5GLZA 3L2HA 2FZ2A 2R041 4P9JA 3VZLA 3ZXAC 4AFAA 4Z92B 1A8MA 5D8AB 5HI0A 4TWTA 2UYAA 1W2UA 2RR13 2DU1A 3ZN5A 3APBA 3M1HA 1RUG1 1OI6A 1MZFA 2FMYA 3AJZA 5ABJB 3EXUA 3NV1A 4LULA 2VXRA 4JRLA 1UW8A 3MEPA 4GXLA 2G9GA 1QH6A 3DPRB 3VZOA 1U0AA 3BTAA 3M2MA 3B01A 5A32B 1AUYA 2WT0A 4G3YC 5GZCA 4RQPB 1RIRA 2VNRA 3ZFEB 4E2SA 5H9SA 2BFUS 1QH7A 2HWD3 5IT6A 4X6RB 3TRSB 3MI8A 1IPJA 1EYBA 5I0TA 2GSYA 1PVC2 2OA2A 1ZRDA 5GZGA 1ENQA 3TYJA 4AVAA 3FLPA 3VKMA 5CAZA 3QH6A 5FRAA 3KT7A 4XFAA 1COV2 1S0CA 1ND3A 3OYWB 1YXWA 1BBT1 4XDQA 4C1WA 1WLCA 1N1TA 4AEDC 4C91A 4PLOA 4UW4A 5JOWA 2I45A 2PHFA 4COYA 1Q8VA 1BJQA 4CEWB 5HCFA 1HQNA 5LRRA 3EBRA 2D97A 4P9YA 3FLTA 3MFCA 1REFA 2WFPA 4HETA 2PHXA 4IEUA 4LBQB 3ZFGA 3ZYPA 4ES9A 3GHMA 2BBVA 1XXNA 2ZPXA 4XYXA 1J58A 4N43B 1N3OA 4PDWB 3WG2A 1ZBE2 2JEMA 2ZX4A 1GR3A 3TN93 1YUDA 5IK7A 2CAVA 2ZGNA 4R8HA 4YW1A 1LOAA 1ULGA 4AE2A 1C28A 3BCWA 4DQAA 4J6GA 5T3NA 4QD2A 3ZVXA 2VVDA 3NVCA 5HBAA 2XVGA 3WG4A 3VBOA 4HPKB 1LHUA 2OUHA 4JRAA 5BNPB 4AFMA 1LRHA 3QCWA 4BH9A 4W6WA 1NYWA 4GWNA 4QQHA 5AFEA 1BYHA 1KDKA 1DGRN 1RUI1 4EN6B 3M3EA 2BVBA 5J37A 1MS9A 4I3GA 1N3QA 2ET1A 5KHGA 2JG9B 1JHNA 2PHRA 1CPMA 1EV13 5LK7B 4E4DX 3EJKA 1WBFA 2RE9A 1AR73 1ZREA 4P9WA 4QQ2A 3MF6A 3J9SA 4LBMA 3VZNA 2A75A 2HWE2 1SLIA 2RS31 3KQRA 4GH4C 4YGEA 1IS6A 2NMNA 1A78A 5K0UC 4ASLA 2YGMA 3JBG2 4N53B 1PGW1 4LA2A 3WINE 2WT1A 3H3ZA 4AVTA 4Q8KA 3JD73 1IKQA 2ZJCA 3U10A 2ZMNA 4IEYA 3FJSA 1EP0A 4W6XA 4Q27A 4IESA 1MQTC 3GALA 3OY8B 3X29B 4COVA 1QJX2 1GANA 3GHNA 1D0GA 1KXGA 3WHUA 3ES4A 1S0JA 5JVVA 4BLJA 3WQ7A 5FOBB 4RD7A 1CONA 1J1LA 4XFFA 3PJYA 1AL23 3VBUB 2ZGOA 5J09A 4CRQA 1LJ7A 4AHXA 1QQP3 2PA7A 1D4M1 3AFGA 2WQ4A 4PBPA 5B2GB 2PN5A 3ELNA 4K40A 2ZGMA 1VBE3 3POSA 4AEDA 3BU7A 4M3CA 3ETQA 3LKJA 4GWMA 1QJU3 3JCIA 4NWVA 4Y5Z0 3SCGA 2O8OA 4QX5A 1ZRFA 1YYNA 1RC6A 1RJ7A 3RG0A 1TNRA 4PIXA 1N1SA 3G6JB 1GNZA 2DU0A 2QZ2A 3AMHA 3D5OA 1C1LA 2ES3A 2A6XA 4RL7A 3AFKA 5C8WA 2BWAA 1OQDA 3WUCA 1C5IA 3EQEA 2WZR1 1LU2A 3ILFA 1VBB3 1PK6C 2GNDA 2VMIA 1V9U1 2OUJA 3S0MA 1YIPA 1C4RA 1HDKA 1QJY2 2YUEA 4F3JA 1W6NA 3AZZA 1NLSA 4G4FA 3WY6A 3IDEA 4DFSA 2B8MA 4CEYB 1NXMA 1SEFA 2B9UA 3QH7A 3VV1A 4LO5B 1CGPA 4IV1C 1RUE3 3MIDA 4JDOA 5I93A 1FOD3 2E53A 4HVRA 4WVWA 1Y43B 5L36A 5BNOB 1J3PA 5JOYA 2RS51 5C4WB 4H7LA 4K9SA 3H1WA 4J1WA 1AYM2 4W6YA 3JZVA 3AP5A 2QUOA 1PO13 4EN8B 4P14A 3UJOA 3AXEA 4LUMA 3VBRC 1AYN3 1PMIA 1CJDA 1JUHA 4HT1T 4K1YA 4RGAA 2RM21 2RMU3 5K0UA 1NY72 4B4QA 4WM8C 1O5UA 1SBFA 3N3HA 3ZSEA 1UL9A 3NAPB 4LHLA 4YNIA 5ACA2 2MHFA 2XJTA 1D0HA 3OBRA 3ZN6B 4F83A 3AM2A 1AXYA 3DN7A 1C8M2 1HIXA 3J8F1 1XNBA 4IV3B 5CFCB 3T1MA 2EXHA 1MQTA 4AQTA 5GLWA 2BUKA 4CDUB 1RUC3 4KU7A 1NCRB 4L8QA 1X33A 1UZZA 4BWOA 4FPEA 1PIV1 1A3KA 3NKTA 1U5XA 3FE5A 1FX5A 2Q4SA 1Q8OA 5HXVA 1QOOA 3WUDA 1G9BA 1RUG2 1REDA 2TEPA 1AR83 3ZN4A 4Y1VA 3OJBA 2CWMA 4RR3C 2VQ0A 1GZWA 4XILA 1R081 2HWF2 3RYPA 5JPNB 4CDWB 1G9AA 2QE3A 1AR93 1RUF1 3R0RA 1J59A 4AHYA 3WCSA 1KS4A 1XYOA 2PAKA 3ZYIB 1OLRA 2P3IA 1G9FA 1NA1A 5BYNA 1G8WA 5A3LA 1U5IA 4XTPA 3TOJA 3MZHA 1FI2A 1QY4A 2MEV2 2DVAA 4LNVA 2NYYA 1OKQA 4JGYB 4YVSC 2XBO1 1POV0 3SCFA 1Z7S1 4BHPA 3N36A 2BQPA 3NV2A 2G4IA 4XETA 4FT8A 2WFF3 1PK6A 1DDLA 1AX0A 2WC2A 2XJSA 5FLHA 3PMSA 3M3OA 4LBJA 1IS5A 1HXS2 5GZDA 1PZ8A 3UKVA 3IBMA 4GB33 1I5ZA 3HR9A 2VMHA 4IV1A 1PVXA 4BCUA 3W9AA 4LO6B 2AREA 1GNHA 1W6MB 1DGRA 2Q1MA 4HVOA 3PTYA 4Y1YA 3SNMA 2DVBA 2DUPA 1MZ6A 1PVC1 1HQLA 4K20A 2A6ZA 3USUA 1QNWA 3B02A 2FZ1A 4I0AA 2OYZA 3VL9A 1ASJ3 5KC5A 3O7OA 1COV1 1POV3 3M3IA 4HKLA 3HT1A 3FWEA 2DTWA 3N7JA 2CGPA 2V09A 3JQWA 3VGIA 5SV5A 3JB8A 2DFBA 4B7EA 4XE9A 1FNZA 2GC1A 2WS93 1DG6A 5A33A 2R0HA 1S55A 2CL2A 2CV6A 2ZA9A 2DUQA 3WXPA 1HV1A 5C9AB 4XJWA 2ZX2A 1W6PA 4AEJA 1OFNA 4AI3A 4Q4Y3 1ZBE1 2ARBA 2HWC2 3ZPYA 1TMF2 5F6LB 4XBQA 3WT3A 2LUWA 3MPPG 5HCBA 1IQAA 4LE3A 4IQPA 3IN9A 4XQWA 2VGDA 3CLPA 3UL2A 2X5IA 4Y1XA 1W0OA 1KJRA 1JOJA 5L19A 1W6QB 1D2QA 5E8AA 4D7TA 1SMVA 1SLTA 4RR3A 4XMIA 4L97A 3MW3A 1DLLA 2O0OA 4XXAA 1FPN2 2WLPA 3NWKA 1WBLA 5EYXA 2PYTA 1H8VA 1WGPA 4YW4A 4AQSA 3UV9A 1REEA 4RGGA 4BIFA 3UK9A 3IKWA 1KITA 2ZS6B 3VBSB 3AZXA 4D3WA 5GLUA 1O3TA 2R16A 1DGWX 2VVFA 4EN9B 4A7YA 5I8YA 4I2OA 1FXZA 3KM5A 4YVSA 2NQYA 3ZFFC 1G9DA 1S0IA 1PZ9A 2HWE1 1DYPA 1DFQA 2CNAA 1OQ1A 3T1LA 4MXWA 1Y3TA 1ND2B 5I8SA 2GN3A 2XL7A 4S2DA 3JBG1 1SDWA 5GLTA 2NLRA 4HSJA 5FPZA 5T50A 2E63A 4D7YA 4IEXA 3NL1A 3Q9OA 4XZPA 4DRRA 5HCAA 2ZHMA 1VRH2 4CDXC 4K6BA 5JOZA 3W58A 1Q8SA 1MS8A 3KCYA 3RWNA 4YW2A 3ME2A 3KT4A 4LLOA 4YZ5A 4YG3A 3GBGA 4LBKA 5C8CC 4Q4V3 1FMD3 4YW5A 4UBHA 4MVTA 3CJIC 3WX5A 4Q0SA 1V6KA 4Q4W3 1UIJA 4Y22B 1RVF2 5C33A 1TME1 2JG8A 3KCXA 2O1QA 3HD8B 4L92A 1GZCA 3WP6A 2TBVA 2BNMA 2EAKA 1GFF2 4FPLA 4H55A 2ZAAA 1JN2P 3FHIB 1S0BA 2ZZQA 1UD1A 2PHUA 3WHTA 2XH6A 5J7MA 1YNAA 4QGMA 1PNFA 1S1AA 1VB4A 2ZTNA 4PIYA 4XFCA 5CBLA 4XMAA 5JMCA 4WVZA 1YJKA 4P9IA 4AW7A 3RMYA 1ZZ7A 5CG9A 1WW5A 4P9GA 1RUE2 5E16A 1DHKB 4BQ1A 4NN0A 3K51A 1ZRRA 4R9CA 2C1FA 1MS0A 4LE4A 1RUNA 3O0XA 1VLNA 1MEC2 2BEOA 2PTMA 4OUSA 2ZGKA 1K5MA 3VHOA 5FMOL 2P2KA 3B94A 1LKNA 3B5LB 1W0PA 1CQ9A 5KHJA 4HN1A 3LB9A 1FV2A 4KH9A 1PO12 1QJY1 1RINA 4Y26A 3ACLA 5KXBA 2R30A 1URXA 4LBOA 5CIRA 1SLBA 1DZRA 3LOBA 2R32A 3ES1A 1SBEA 1AR63 3H7JA 3ZFGC 1LTEA 1BMV2 3UKTA 4JGZA 4GMP1 1YI7A 1RMU3 4TZDA 5FPXA 1RL3A 3HIFA 3VBHB 4ZU5A 3ZSLA 3MPBA 3O5SA 4AI8A 4D69A 1OPMA 3U07A 2UY8A 1F2NA 1IZ3A 4XF1A 1IPKA 3ZXEA 1AYM1 1ULDA 2D6KA 3MLLA 2DTYA 5CADA 3FBYA 1VBA3 4XHXA 3ZFFA 5DZGA 1QXRA 2X8KA 3A0KA 2GNTA 1R1A2 4HKWA 1NY71 2I07B 3FUQA 4LLFA 5FOJB 2BFUL 3S7IA 4WM7C 2H6CA 1KS5A 5ACA1 4GH4B 4IEOA 4CYDA 5KXEA 3INAA 1C8M1 4K8FA 3IMNA 1LULA 5H9RA 4L2NA 2JECA 5JI9A 4CDXA 1ULEA 4YVWC 2YY1A 4PQ9A 4OULA 1FNYA 2XJQA 4E9KA 3KLSA 4QPIC 2ZHNA 5BNNC 4KG8A 1KD7A 3RS6A 4E27A 5C8CA 1MQTB 2WINB 3I7DA 3ZIWA 1Z7S2 1AJKA 4B29A 2HWB3 2W39A 2TUNA 4Y24A 2PHTA 3CJIA 2PAMA 4R9BA 3SXWA 4HMZA 4AGRA 3PLQA 1O7FA 1OMIA 4FQZA 1ALYA 2ZBJA 2WSUA 2WNVB 3E5XA 3QOPA 4AVVA 2R043 1UU5A 1M4WA 4N7IA 1WMFA 4O9GA 5AFBA 3H1MA 3M7AA 2HWF1 4QGLA 1JTZX 2UURA 3C3VA 5IK4A 1ZZ6A 4JQRA 2BVVA 1O5LA 2VW0A 2BNNA 3SMHA 2XJUA 3E5UA 5CFDC 5CB7A 3N4MA 4FTSA 5BXXA 1PZ7A 4MLOA 2I74A 2KXLA 4AWDA 2NMOA 4GB32 5EWSA 5I0UA 1HRI2 3DGTA 3E97A 2ET7A 2D93A 2C5DA 3UKNA 2MEV1 4IEPA 3VHRA 4NWWA 4YFZA 5AVPA 4XQDA 2JDZA 1PO23 2XJRA 1KFUL 2EXIA 3V64A 2V5YA 1DZQA 2XLAA 5T5OA 1OFSA 2D6NA 1H0BA 1S0EA 1D4VB 3MIGA 2WJSA 3ALQA 1QHDA 2VG9A 2K9ZA 5JSPA 1JW6A 4E2GA 1BBT3 1OA2A 1PK6B 3D8CA 2N7GA 2VW2A 3MGUA 5EZWA 1BEV2 2H0VA 1HXS1 4FAHA 2DCTA 4DY3A 3FMGA 3M8LA 3KZ4C 3OGJA 4CDQA 4IETA 4Y1UA 1SLAA 1BCXA 2R062 4COUA 4R4ZA 1RITA 4H14A 3MW2A 2QDNA 4XFBA 2GAUA 1GQGA 2BW8A 2DUOA 4IV1B 4MX3A 1O4TA 1WA4A 1DGLA 1WLTA 3JQXA 4X6QB 3MLJA 2WSVA 3ZXKA 5AC92 4QU2A 2DF7A 4Q0PA 1BXHA 4I09A 4H3WA 2ZX1A 1AJOA 4KNCA 3IPVA 2B5HA 4YW3A 1DQ5A 4Z07A 3SCHA 1UX6A 1W6OB 4QGNA 5FO8B 2FHRA 1QU0A 3VBRB 3WDWA 3WDVA 3I4IA 2JE7A 4FOVA 4WM7A 1QJZA 5KBFA 2XHKA 2Y26A 4OHWA 1LOBA 3WDXA 2D3PA 1UPSA 4WM8B 4B4PA 4A2UA 3LSDA 4E2QA 3J4UH 4HANA 3P3PA 4FO9A 3ZSMA 4YVWA 2BYVE 4ZU4A 4QPIA 5BNNA 1Q8QA 4K21A 2EXJA 4YLZA 4FAGA 2HWC1 1TMF1 1QOTA 3OF1A 3V56A 3H8UA 2W08A 2Y0IA 3SH5A 3B9IA 4QXKA 5FQ0A 4PBOA 1YI9A 3B7MA 2YGLA 2CGOA 3IIAA 4Y20A 4BOWA 2RS33 3MIHA 3TBDA 3MICA 3ZXJA 2VECA 2A3XA 4LEJA 4QPGB 4DB5A 4QPYA 1H8TC 2R0FA 1HLCA 1H1MA 1MS4A 1FPN1 3HAGA 4FBFA 4N9IA 5GALA 4WV8A 5CFDA 4GALA 2FBEA 1ZBA3 3WOGA 2D6MA 3ZYJB 1QKQA 3FUOA 1EAH2 1LOEA 4I0BA 1I1EA 2ZGLA 1TME2 4META 2XWBB 4BLIA 2B46X 5BNQA 2D3RA 1BVVA 3KGLA 1ZZCA 3GZUC 1OPOA 4Q4W2 1LHOA 3GYDA 4RSUA 2HYKA 2DVDA 2VOKA 4IEZA 2ILMA 2ATFA 1QQP1 1RUJ2 2D6LX 4MXWB 2IFRA 5DXDA 4WBBA 4AXOA 4YZ4A 3VKFC 1NA1C 3ILNA 2Q30A 1VRH1 2X53S 3AKQA 3AYEA 4AFBA 3PVBB 4JTNA 5T5JA 2PFWA 1YRZA 5T5PA 3V0BB 1UF2C 4RQPC 4YG0A 4XJAA 1XYPA 2ZGTA 1UZYA 3WD5A 1BZWA 1EPWA 3JB4C 4NO4A 5F5QA 5EV7A 4KWLA 1VR3A 2YDEA 3MIEA 1RVF1 4P9XA 1YCIA 1XE7A 3MFAA 3QD6A 4CP2A 3U4XA 2R072 4JV4A 2Z79A 2D98A 2WZR3 4DNYA 1XNKA 2BPA2 4SLIA 1G6NA 4AG4A 4ZXKA 4INDA 1DQ0A 3O0WA 1OA3A 1RHI2 1V9U3 1XU2A 5H9QA 2ZKNA 4OI4A 1U5YA 4CEWC 2CWSA 2ERFA 3WG1A 3WW4A 1Q43A 3PNAA 2B45X 4N9HA 2UWAA 3S6PA 1HRV3 1LU1A 2QDRA 1CIWA 3M70A 2ZGSA 5JZGC 1VAVA 1Y9QA 1RUE1 4A7KA 2PLV3 4N43C 1SLCA 1MS5A 2RS53 3ZSJA 1MEC1 5J3UA 1CAVB 3H7YA 3POWA 1F5JA 4HN0A 4XF4A 3VLBB 2RS12 3ZXLA 1VBC2 3VDDB 1CJPA 2AUYA 3VZJA 2VUJA 2XGXA 3NSTA 5K8SA 3VKOA 5J48A 1PO11 3JUUA 3L9JT 3HQXA 4AI2A 4J1XA 5L7OC 2RM23 4AYUA 1MZ5A 1RTVA 1AZDA 2JX9A 5E89A 2A73B 1BMV1 2UYBA 1H8TA 2VOVA 4AF9A 5DZFA 3QACA 3V0AA 3O12A 1YHFA 3J8F3 1WLDA 1PGSA 1H9PA 1O4YA 1RUH2 2JKBA 3SISA 1DU3D 3PMEA 2EF6A 2E51A 3THPA 1H2MA 4KBBA 4RHV3 2JG9C 1C5HA 2X5IC 2QQPA 1N1VA 1RUC1 1DQ6A 1PIV3 2RHPA 3WW1A 1QDOA 2OZ6A 2HWB2 2AZ5A 2VNGA 5GKAC 3LWCA 1LHNA 3ZSKA 3RI9A 4B3NA 1X50A 1R1A1 2E9QA 1ZZBA 2RR12 4X8PA 5H9PA 4XW3A 2VMGA 1C57A 4CTEA 4FSJA 1SCSA 2XPJA 1PGL2 1N3PA 3NV4A 3THTA 1WD3A 2P17A 1R083 5JIAA 5ABJA 4FPKA 2Q0AA 2ZMLA 4B7KA 3DPRA 1VBD3 1YO8A 3M4FA 1AR91 4COWA 1GV9A 3AZYA 4RQPA 4AEKA 4CDXB 3ZFEA 2HWD2 2QJVA 4XQ4A 3FC0A 5DDJ3 4AQ2A 4Z2WA 2B39A 1LHVA 1JH5A 4R9DA 1LENA 1VAMA 5C8CB 2WT2A 3VBUC 1IOAA 1IHMA 2XBO3 4S2FA 5DG2A 3ENRA 5FTTC 1UN1A 1PO22 1L3JA 3I54A 1U12A 4XFIA 4BMEA 3OYWA 3AMNA 1QWRA 3E6BA 2IXIA 1VB2A 3KB5A 5CU1A 4CEWA 1S2BA 5JLVA 1WMDA 1GZ9A 3I59A 1NQDA 1HV0A 2Y38A 4GB31 2JD4A 1HRI1 4LBQA 3IT8A 5BV6A 5JZGA 2JG8C 4Q2FA 3AMPA 2GNMA 2PHDA 4WVVA 3BALA 2KA3A 1LOCA 4N43A 2P37A 4PDWA 1JYIA 3TN92 1PVC3 3AYAA 4LA3A 1H2LA 5FO9B 1QF3A 1JXNA 3HN1A 2A71A 3AZVA 3SH4A 4IEVA 4Q1PA 4HK9A 1ND3B 3VBFC 1COV3 4R9AA 1ENSA 2ZAHA 1DQ4A 1LECA 4FPGA 5L7OA 3D0SA 1BEV1 2V73A 1OQEA 4WZCA 1GYKA 2WNUC 2R061 4FVVA 3KGZA 3ZFGB 3ZYGA 5BNOC 4CZSA 4GULA 1K5MC 1LR5A 1R093 1MACA 1ULCA 1EV12 1SCRA 2JG9A 4DINB 2VOWA 5AC91 1Q8PA 1AR72 1ZBE3 3GZAA 5JIUA 4KGQA 3DF0A 3MF9A 1V6OA 3MDPA 1I6XA 3DV8A 4R4XA 4ITCA 1RJ8A 2GDFA 1X82A 4C90A 4JGZC 1BQPA 2NP0A 1B35C 3VBOB 1BVP1 1WMEA 2WLQA 3JD72 2QCSB 1WCSA 4ZKTB 3KMHA 1XYNA 2D40A 1UCXA 3H50A 4GKYA 4WM7B 5FCCA 2YZ4A 2UWCA 4S2GA 5FLJA 4C1XA 2E7AA 1NCRC 1WW7A 2YPJA 4YGCA 1QGLA 1V6NA 1ZBA2 4RS5C 4YVWB 4XIKA 5DG1A 4Q4X3 4OHVA 1CAUA 1CPNA 2QZ3A 2A3YA 1AF9A 1AL22 1S0GA 4PF5A 3URFA 1ZZ9A 4CP0A 5BNNB 1C8NA 3VBUA 1H9WA 1QQP2 2HWE3 1DQ1A 3WP5A 4N90A 1H30A 1VBE2 3JBG3 4I01A 3C2UA 4XF3A 2Z5WA 4Q29A 2XG3A 4Z1VA 2A6WA 1UAIA 4QT6A 1J1TA 1QJU2 2SBAA 3SH3A 4UW6A 4YM3A 2MPFA 2K0GA 2WQZC 1H1IA 3E5QA 5GJ6A 1QJX3 1EAH1 5CFDB 2D7FA 2WA3A 2ZCWA 1HQWA 3NW4A 4JCKA 4AI1A 1FMD1 2WZPP 2QNKA 4B4RA 4XFGA 1V6JA 3SLIA 5F1RA 4N7UA 4E4SA 3R05A 3USSA 2CYFA 1NE4A 1H1AA 4DXZA 2D5HA 4EWAA 4Q4W1 4QMAA 2RJKA 1VBB2 4S2HA 4XHBA 4AI0A 2GZWA 2WKKA 1MR5A 5DUVA 1RUJ1 3P3NA 3VBFA 4GMP0 2HEVF 4AEDB 1CR7A 4GIQA 1RUD3 5BPXA 2R1DA 4AGGA 4K1ZA 3IDCB 5T54A 1OA4A 4M3CB 1MS1A 4DY5A 3QLQA 4ISRA 2GH2A 4PIZA 1SACA 2XB6C 4K7JA 4LBQD 1FOD2 3LGRA 2WNUA 4Z82A 2A70A 3ZYRA 3ILRA 4U2AA 5BNOA 4HLTA 1HRV2 2E6VA 1IS4A 2OPKA 3RJRA 3WLUA 3LSEA 1KFXL 3SITA 2ZACA 4EWDA 5BY5A 2JICA 2X29A 3IM0A 1OLQA 4JTOA 2R071 1CAXA 4UBGA 1X36A 1AYN2 2JENA 2GALA 1S2KA 5KXDA 5EFUA 2FQPA 2RMU2 1RHI1 2XKOA 2IXCA 4ONUA 4WVMA 1V00A 1QJY3 3B9CA 1W6NB 2R49A 3ZXDA 4CDQC 2BNOA 3W59A 1B35A 3VL8A 5IK8A 2BGCA 5AVAA 4LUKA 1CX4A 2HEWF 3ZN6A 2Q1ZB 2YHJA 4GMP3 3HT2A 5JR7B 1VP6A 2W0XA 1VALA 4IV3A 4AHWA 4FPCA 2OIIA 4OHXA 1RUC2 3AZWA 4EJRA 1NCRA 4RS5A 3H9AA 2D44A 4RHV2 4PCRA 1TQ5A 2RS11 4K3UA 4FOYA 4QHBA 1VBC1 4L9BA 4YARA 1WLWA 1AR82 3AKPA 5K7PA 1OOPC 4OI1A 5K0UB 4FPYA 1WW6A 3FZ3A 3AK0A 4OUMA 2R6QA 4I02A 4XJUA 1VJ2A 2VU9A 1B09A 5ACA3 1AR92 1C8M3 2O8QA 2MNGA 1RUH1 1BKZA 1LHWA 1H8TB 4OHYA 1H4GA 3VBSC 1EY2A 1VBD2 3FLRA 5KHKA 4MGZE 3R4UA 4Q8LA 3AKRA 1MVQA 2VUAA 1YIFA 2HWB1 3TNPB 4EROA 1A8DA 3S7EA 5GZFA 5CG8A 2ZABA 2C0ZA 2WFF2 3IDBB 4XJZA 2RR11 1ND2C 1RUG3 5T55A 2CY6A 1ZA4A 3WP3A 3HWJA 2VNOA 1GZWB 2VY0A 3KCCA 4IL7A 2ZGPA 1PGL1 4LTAA 2HWF3 3AB0A 1E57A 4AHZA 4FPFA 1A6CA 2D43A 3BOPA 2AH2A 1N1YA 2H6BA 2XLGA 1NA1B 1S0DA 3PVNA 5DUXA 2H0BA 4I3PA 4CP1A 5LRSA 1W6MA 2Y0OA 2HWD1 1UKGA 1G9CA 4EV0A 5DZEA 2Z42A 1G86A 4FOQA 3N7KA 4LHNA 2BWCA 1HW5A 2MEV3 <