1LESA

Lentil lectin complexed with sucrose
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
181
structure length
181
Chain Sequence
TETTSFSITKFSPDQQNLIFQGDGYTTKGKLTLTKAVKSTVGRALYSTPIHIWDRDTGNVANFVTSFTFVIDAPSSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKEYDKTSQTVAVEFDTFYNAAWDPSNKERHIGIDVNSIKSVNTKSWNLQNGERANVVIAFNAATNVLTVTLTYPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR, molecular modeling, and crystallographic studies of lentil lectin-sucrose interaction.
pubmed doi rcsb
molecule tags Lectin
molecule keywords LENTIL LECTIN
total genus 27
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature
pdb deposition date 1995-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lesA00
1YO8A 4DQAA 3C2UA 3ENRA 3HN1A 1G8WA 3ZXFA 3JUUA 5T5OA 3APBA 3AYAA 2VW2A 1F9KA 1N3OA 1WBFA 1MS3A 4XHXA 2UU8A 3QCWA 2NZ9A 3AFKA 4FOYA 4DS0A 4YM3A 3VKLA 1N3PA 2A5ZA 2ENRA 2UWAA 1BXHA 3RG0A 2VH9A 1G86A 1SBEA 3ZSLA 1GSLA 3OBTA 2P34A 2ZABA 1WUVA 4UW6A 1G9AA 2D6LX 1GZWA 1LESA 1V6OA 2ZA9A 2P3KA 3A0NA 1VAVA 3N7LA 1BJQA 1I3HA 4Q8KA 4GA9A 1LHOA 4HANA 3TB0A 5DG2A 3N3HA 5T54A 1UAIA 2WT1A 5H9PA 3WV6A 4ATEA 1MS8A 2A6ZA 1ENQA 1LOAA 1MS9A 3A0KA 1SLIA 1JHNA 1QNWA 2ZGRA 1UPSA 1OKQA 3POWA 2CNAA 1LENA 4FP3A 5GZDA 3AZVA 1SCRA 2ARXA 4P9YA 1G9CA 2WJSA 1I1EA 3WZ1A 3ZSKA 4YZ5A 1AXYA 2WQZC 5F5QA 4FPJA 4AGRA 1ULFA 2PHXA 4YW4A 2NMOA 1CONA 3JU9A 1WLWA 4Q8LA 5LK5A 5CA6A 2YROA 4JCKA 1J1TA 2AGSA 1JN2P 1SLAA 3LCPA 2YXSA 3POYA 1AJOA 2D3SA 1W6PA 1FAYA 2E51A 1DIWA 3V0BA 5F9TA 3AYCA 4DRVA 1WW6A 4CRQA 1XQNA 1SLLA 2DU1A 4YGCA 4XXAA 4BLJA 4Y1VA 4XJ8A 1Z0HA 3MW4A 3IN9A 5BYNA 3B9CA 4P9XA 4K20A 1FYUA 2W08A 2CTVA 1LOFA 2NM1A 1NLSA 4R9AA 4LBMA 5DZEA 3VKNA 3LSEA 4YZ4A 1N1VA 4YM0A 4YG3A 4PF5A 2A3WA 2DWRA 1LGBA 3O0XA 3WCSA 2I2SA 1CQ9A 4FPYA 4Y1YA 5DUXA 4JC1A 1SACA 3UK9A 3ZSJA 2D6MA 4FPOB 4ISQA 2UWCA 1W6NB 1V6JA 1QOSA 4PCRA 5HCFA 3T1MA 2ZKNA 1UMZA 1WD3A 2ZHLA 3R4UA 3RS6A 3INAA 1KQRA 4AGVA 2XG3A 3OY8A 1HDKA 3OY8B 5T5JA 4BLIA 2WT2A 1AX0A 1PZ8A 2ZGMA 3DUIA 1YXWA 4LBQD 3WDYA 5GZGA 1S0EA 4UW4A 3WDXA 2DUPA 4GALA 1UZZA 4XBLA 1CPNA 2PHUA 3H0OA 1LOEA 2VW0A 3N7JA 3GALA 2NMNA 5GALA 3FFZA 1CJPA 3IPVB 2Z42A 3SH3A 1BQPA 3BODA 1V00A 1N1TA 2ZMNA 4LBJA 1S1AA 3ASIA 3FLPA 1GBGA 4PBOA 5DG1A 3V65A 2ZMLA 4PBPA 1WW7A 2DU0A 1IS6A 1S0DA 1FV2A 1GNZA 2JE7A 2OUJA 1DYKA 5DUWA 3N36A 4DPNA 2ES3A 2XB6C 1LU2A 3AYDA 4BOWA 4XXPA 1ULEA 1WBLA 1RINA 1SLTA 2P37A 2Q5TA 2P3IA 1ULDA 2NN8A 2H0BA 2PHRA 1MR5A 2W39A 1W6QB 4XMIA 3WG2A 2A6XA 2ZGTA 5JOYA 3ILRA 2GALA 1SLBA 4P14A 5GLZA 5FREA 2EALA 3WDWA 3T1LA 4C1XA 3SNMA 1KJLA 1IS5A 2ZGSA 1OFSA 4XE9A 4P9WA 3ZSMA 2C9AA 4FPGA 5CB7A 2A75A 2R16A 3I4IA 4FOWA 1MZ5A 1W6OA 2AUYA 5DZFA 1FV3A 4XMAA 1ZA4A 1N3QA 1WW4A 4LBQA 1OQ1A 4FPFA 1DBNA 1SLCA 2SLIA 4ISRA 1KITA 2A3YA 1N1SA 3ILFA 1AX2A 1MZ6A 5AVAA 2ZGNA 5T5PA 1WCSA 3FLTA 3TAYA 4FVVA 4H55A 4D69A 1MS1A 4ZKTB 1GZWB 2VY0A 3UJOA 1O4ZA 1Y7BA 1G9FA 1Z78A 1ULGA 2AH2A 2DYCA 2ZGPA 2YV8A 4W65A 4Y22B 4HL0A 4YG0A 5GZFA 4XJUA 4XJWA 2LTNA 4WVWA 3A4UA 4U2AA 1MVQA 2TEPA 1PZ7A 4DRRA 5IK4A 4XTMA 1CN1A 1DQ5A 1LHNA 2YY1A 1SFYA 4BQ1A 2R1DA 2EXJA 3NV2A 4FQZA 3W58A 5JVVA 5GLTA 3RQ0A 2EXKA 1S0CA 1DQ4A 4BMEA 4XHBA 3M1HA 1KDKA 1SCSA 4YFWA 4KBBA 3AYEA 5T5LA 3AXDA 4Q26A 4YM1A 2GDFA 4YGDA 3NV3A 4GKXA 4YGEA 2GMEA 4Y26A 5IK8A 4L8QA 4GXLA 3O0VA 2ZGOA 1QDOA 3WUDA 3D5OA 1LEDA 4FPHA 4CTEA 2NYYA 1B09A 4Y20A 3U4XA 4ITCA 3HR9A 2ZGKA 2D6PA 5EXOA 3BOPA 4BPZA 5IUQA 4R9DA 1S0BA 2YZ4A 1MVEA 2D6OX 2P3JA 3CNAA 3RSJA 1BZWA 4YW2A 1UN1A 1C1LA 4FOQA 2B7YA 4LBKA 1ZM1A 3RMYA 2AR6A 1S0JA 4AVVA 1WD4A 3V0AB 4UW3A 1W0OA 3WNXA 1VIWB 2ZMKA 4M3CF 2A3XA 4LBQB 3AJZA 4LBLA 4UW5A 4Y1UA 3ILNA 2ZHNA 3AXEA 2GNTA 4FPEA 4AGGA 1A3KA 1LU1A 1D2SA 1DGLA 2ZBJA 2SBAA 5GLVA 3N35A 3POSA 1Q8SA 3N7MA 4M3CB 1LTEA 5EYXA 1G9BA 2EAKA 2PHTA 3AX4A 4Y1ZA 1QMJA 2FMDA 5IT6A 1JYCA 3ZYRA 1ENRA 1S0GA 3FBYA 3WHTA 3AZYA 4FPKA 5EYYA 1IOAA 4WVVA 1JYIA 3O12A 1QDCA 1RITA 1QKQA 1LEMA 1LOCA 2E53A 3AP7A 3I8TA 5DZGA 3NV1A 1N47A 1AX1A 1KJRA 4OZXA 1UL9A 2V5YA 5IK5A 2JD4A 3D6EA 1AXZA 1X50A 2FHRA 4GWMA 1S0FA 3M2MA 4XTPA 2EF6A 2W52A 3DGTA 2EXHA 3O0WA 4FP2A 4GWNA 3SH5A 3WOGA 2D3RA 1CESA 2LALA 3M3QA 4BM8A 1PZ9A 1AZDA 2JDZA 5KXDA 3M3EA 2JKBA 3MPPG 1GKBA 4Q1PA 3SH4A 3PVEA 1H30A 1CVNA 2D6NA 2WSVA 5H9RA 1TEIA 4XIKA 1MS5A 3WHUA 2JECA 5E89A 2WSUA 4FPCA 3VV1A 1LCLA 2DTYA 2ZHMA 4WZFA 3AZWA 1DYPA 3OJBA 4Q2FA 4AVSA 3N7KA 1S0IA 1VLNA 3AP6A 1LHWA 1WLDA 3B00A 4Y20B 1LOFC 3AP5A 3RMXA 2VXRA 1UX6A 3L2YA 5GLUA 2R49A 3KQRA 4K1YA 1IKQA 2E7TA 3MEPA 5H9SA 1BYHA 3WCRA 4Q1RA 4GKYA 5GJ6A 1AJKA 1JW6A 1W6QA 2OW4A 5HCBA 1YYNA 4K1ZA 4R9CA 3WDTA 4TZDA 1LOBA 1LJ7A 1V6KA 1LOGA 5KXBA 4Y1XA 1DZQA 4YW1A 1V6IA 2A6VA 2PHWA 4WV8A 2A70A 2CY6A 3BIWE 4YG6A 1LECA 2PHFA 3AZZA 3NWKA 5DUVA 5GM0A 3WDVA 3VUOA 3ZXLA 5T50A 2A7AA 5CAZA 1CR7A 1ONAA 1APNA 1DQ6A 4JRAA 2JJ6A 2ZZJA 4Q27A 3BTAA 2UURA 2ARBA 1G7YA 1LODA 2DVBA 3ZXEA 3FUQA 2W68A 1DQ1A 4Y22A 2E6VA 1QNYA 1VAMA 1YRZA 1UZYA 4CZSA 1F5FA 1W6MB 3IMNA 3IPVA 2HYKA 3B01A 1FNZA 5T52A 4YZ2A 2D43A 2WLQA 4I30A 1CPMA 4R9BA 3LSDA 2OVUA 1CIWA 3SITA 1WLCA 3WG3A 1LULA 4MYEA 2VW1A 4XBQA 4XZPA 4YLZA 3PMEA 1W6OB 5GLWA 1MS0A 2CWSA 1HQLA 2DUQA 4XJAA 3RRDA 3SLIA 4K21A 3ZPYA 3AK0A 2RHPA 1DLLA 5CBLA 5JOWA 2D3PA 2AREA 1H9WA 1H9PA 2DTWA 2OUHA 4AWDA 5JMCA 2AENA 3USUB 4XDQA 3NV4A 4XILA 1C57A 1GZCA 5JDBA 4LBOA 1BKZA 1O4YA 3HMYA 3B69A 1HLCA 4XBNA 4YFZA 2WNEA 3R4SA 2DVAA 2NP0A 2BQPA 3PJQA 3QLQA 3WUCA 3MW3A 4YW5A 1IS3A 2CL2A 2WT0A 3IKWA 5L73A 4ATFA 3R05A 4SLIA 4XIOA 5GZCA 4XJ9A 2UWBA 1GZ9A 3AP4A 1LHUA 2ZGQA 1AF9A 1A8DA 3AJYA 3V0BB 4YM2A 3D4KA 1DQ2A 1GLHA 5GZEA 2EIGA 2V73A 1G9DA 1YI7A 5T55A 1Q8PA 4M01A 1W6PB 2VU9A 2ZGUA 4NO4A 2GNBA 3FUOA 3USUA 2KM2A 2A6YA 1QF3A 2YMZA 2ZGLA 1F31A 1C1FA 3SISA 4M3CA 3AP9A 4AVTA 4C1WA 3VKMA 1AXKA 2GMPA 3PVNA 1UKGA 1QOOA 3V64A 1HKDA 1URXA 1VALA 1W0PA 1Q8QA 2CWMA 4DFSA 3PVOA 4IQPA 4YGBA 4ASMB 2EXIA 2C5DA 4RA0A 1ULCA 2ZAAA 2A71A 2D6KA 3UJQA 1IS4A 5JOZA 4Z8BA 3OYWB 1W6NA 4FQ4A 2VUAA 2GNMA 1AVBA 3WDUA 1MACA 3GNEA 2ZHKA 1GICA 2WKKA 3FLRA 3V0AA 5KXEA 1KDMA 4RL7A 1SBFA 1N1YA 2P2KA 1LGCA 1FNYA 5JOXA 1W6MA 3OBRA 1ENSA 2DVGA 1QGLA 1U0AA 4TYSA 4YZ3A 2JE9A 4PQ9A 4Y24A 3M3CA 1FX5A 1JUIA 2ERFA 2D44A 3B3QE 1MS4A 1D0HA 3O5SA 1LGNA 3IM0A 2D7FA 1QU0A 1RIRA 3ZXJA 1R1ZA 4YZ1A 1Q8VA 3ZVXA 1V6LA 3ZXKA 5E88A 2GN7A 3WG1A 4NOTA 1KRIA 4XJZA 3VKOA 3AZXA 1WW5A 2R1BA 5IK7A 1EPWA 2CYFA 4M3CE 1YIFA 1Q56A 4BMBA 4FPLA 1C4RA 3WVJA 2PELA 5DUUA 1DQ0A 4ZXKA 1QOTA 1GYKA 1Q8OA 5EWSA 1LHVA 3WLUA 2DUOA 4F83A 2DV9A 3KM5A 2GNDA 3W59A 5CNAA 5FRAA 2DVDA 1JXNA 2E7QA 5SV8A 1GANA 2A6WA 4AYUA 2AYHA 1DHKB 2DURA 1GNHA 1SBDA 2GMMA 1A78A 5JLVA 3OYWA 1GV9A 4U36A 4XOGA 5DXDA 1V6MA 4M00A 4YW3A 5H9QA 5HCAA 1IKPA 3MW2A 1V6NA 3ATGA 2GN3A 2R0FA 1HQWA 3ZYPA 4LBNA 2G4IA 3T2TA 1FATA 5KXCA 1NXD1 4XYXA 2DVFA 3OGGA 4FOVA 1JBCA 5E8AA 3UL2A 1DFQA 2ZACA 2R0HA 3M3OA 3Q9OA 3WG4A 3OPZA 3VKFC 1JOJA
chains in the Genus database with same CATH superfamily
2DBIA 1JUHA 5CFDC 4DQAA 3C2UA 3JXSA 4BK5A 3APBA 2GAUA 2OZ6A 2W1SA 3AYAA 3LD8A 4HSJA 4IE5A 1F9KA 4LHKA 3Q8EA 3ZYHA 5A6ZA 1L7QA 4XHXA 2FCUA 1VRH3 3QCWA 3HQUA 4B4QA 2B46X 2WWJA 3MIGA 4COYA 2A5ZA 3ZX7A 1RUG1 2E26A 3ZIXA 1G86A 1GWKA 1GSLA 5LW9A 3ON7A 2XHNA 1TME1 2D40A 2P34A 1RUF1 4QPWA 1NX9A 1RJ8A 4OHVA 4CCJA 4PHZA 5LA2A 2D6LX 4BIFA 3VDDB 5HCHA 1UX7A 3DPRB 2XBO2 3N7LA 4LKSA 1I3HA 3MPBA 4Q8KA 3BB6A 1Y9QA 2ZXQA 3N3HA 1UAIA 5BNNB 4RHV2 5IJRA 4MHRA 4ATEA 1MS8A 1MS9A 3A0KA 1H8TA 2OA2A 3WEZA 4E8CA 1QJX1 2RS12 4AFMA 4TXWA 3MLJA 1O4TA 1SFPA 5K0UA 4CSWA 5BNPC 1FPN2 3OGJA 5JIUA 3B5LB 1LENA 3DF0A 5FPUA 4FP3A 3BOWA 4PIYA 3ZN6B 2ARXA 5FYMA 1EUUA 3D0SA 1RUE1 1NCRB 4MXWA 3ZSKA 4YZ5A 1AXYA 4E4DX 3TEZA 1AUYA 5D1IA 4NRPA 2XVLA 5DAPA 2NMOA 5JXIA 4CCEA 1CONA 1E5SA 3JU9A 3POJA 5LK5A 3A7QA 3D82A 3KCCA 5CA6A 1WKYA 1VBE1 2YROA 3T0AA 1SLAA 3RWNA 4DB5A 2YXSA 3POYA 4UBGA 5FZGA 3P5BA 4CPBD 2TBVA 5A7NA 2YC2A 3KCYA 4COUA 4DRVA 3MZHA 1DGWA 2L9LA 2R043 3AVSA 4M0NA 4BLJA 1YLLA 1XSRA 3I2IA 4F8AA 5CKQA 3J7NA 5KBFA 4JV4A 1WMEA 3MW4A 5C5UA 3IN9A 3B9CA 1BK0A 2E63A 1GP4A 1FYUA 2QJVA 2W08A 3VD3A 2EIBA 2FZ1A 2NM1A 3UT0A 2QUOA 3T08A 3VKNA 3LSEA 4YZ4A 1N1VA 3UETA 1OD5A 4YG3A 4PF5A 2ETEA 3B93A 1BEV1 4KL1A 1XOYA 3ZSJA 1SACA 1DDLA 2BOJA 2D6MA 4NPLA 3UGFA 3ZR5A 4LO6B 1W6NB 3PL0A 1V6JA 1QOSA 4PCRA 2JDKA 2ZKNA 4TSVA 3RS6A 3R4UA 1NCQB 1CAVA 2XG3A 2C1FA 1HN1A 1UOFA 3IIIA 4META 1AR72 4LBQD 3DUIA 1YXWA 4AXOA 2ZEXA 3C7HA 1C8NA 4QKNA 4YPJA 3KB5A 3UKVA 2DUPA 3H1WA 4HPKB 5DAWA 5DAXA 5EP9A 4DXZA 1HB1A 1L7LA 3GALA 3MLLA 2NMNA 3KV9A 2YHJA 3SCGA 3E6BA 5GALA 1CJPA 2XLAA 1NLRA 2Z42A 3IPVB 4J6GA 3SH3A 3KZ4C 1BQPA 3AFGA 2VVDA 3BODA 1V00A 5D8AA 2OZJA 3KS7A 3THTA 3TEYA 4LBJA 1GOFA 2MEV3 2X5IC 1GBGA 3H42B 5CZKA 5AC93 5DMYA 3N9OA 1PO23 1R083 3WQ1A 5B4NA 1WW7A 2DU0A 2VMFA 2W92A 1ASJ2 1W0NA 2HWB2 4OYUA 5FCCA 3S0MA 2JE7A 1YQ5A 1W03A 4DPNA 2ES3A 3DYOA 3AYDA 4UFLA 2XWJB 1WBLA 1RINA 2P37A 4PQQA 3WG2A 2PHRA 2H0BA 1MR5A 2VMDA 1W6QB 3WD5A 3UV9A 1IPKA 2A6XA 2W9XA 3NRUA 4Q4Y3 3E1F1 3DKQA 3HIFA 1CIYA 1SLBA 3OBAA 5GLZA 3N9QA 3WINE 2EALA 1VJ2A 2R073 4EN6B 2AC1A 4WM8C 1KJLA 3O1UA 2ZGSA 4P9WA 2XMLA 4FO9A 1PK6C 4FPGA 3HD8B 3WW1A 2G9FA 4L9BA 2A75A 2UY9A 3D8CA 3OGRA 4KGQA 5B2GB 5EJ1B 2AUYA 2J1UA 2WO3A 3LA2A 3CMGA 3P3PA 2DBNA 1OQ1A 4JGYA 1ZNPA 2SLIA 2Y33A 2VOWA 1WA4A 1ZYBA 3ACFA 1F4AA 2MEV2 3TAYA 2WBKA 3U11A 2JDUA 2B9VA 4FVVA 2XDVA 4LLOA 1S4CA 2N7GA 3RRDA 4Y22B 1Z78A 2AH2A 3PIGA 4GMP1 5GZFA 3NO8A 1OQDA 3RZLA 5EPAA 1NY71 3SCFA 3WNKA 2C24A 1JU4A 2EAAA 2PLV2 2GH8A 2VUCA 5J1XA 1DQ5A 2R1DA 3NV2A 3EHKA 2WS91 2RS51 5JVVA 1ND3A 5GLTA 2EXKA 3A23A 4AQ6A 1S0CA 4QKFA 2RMU2 4AEDC 2VGDA 5FKCA 2HWD3 3J26N 4A7KA 5HV0A 4K9SA 4FFHA 2FDKA 1CAWB 3AYEA 4BJ0A 2C6SA 4CEWC 4HG6B 4QDRA 1DU3D 4GKXA 1BLZA 1RUI2 2ZKLA 4Y26A 1YEWA 4L8QA 3IDBB 4LULA 3ZDVA 1QDOA 4WM7C 2G9GA 2WINB 2NYYA 1PO11 4IEQA 3K77A 2VTFA 3WQBA 3HR9A 3BOPA 3FWEA 1OLQA 2BBAA 1SPPB 4QWNA 2Y26A 1S0BA 1XC6A 3HNMA 1OF4A 2V5DA 1GP5A 4LORA 2BP6A 3KVBA 3PUHA 5A7QA 3TNQA 2AR6A 1WD4A 2VZ1A 1W0OA 1X82A 2P4EA 1NA1B 4ZZ8A 1H2KA 1RHI1 3U0ZA 5AFEA 2HEWF 4DEVA 2R042 1O59A 1XRUA 1DZRA 4UT5A 2GNTA 4NAOA 3LAGA 5E6HA 1CAUB 2ZX4A 1A3KA 4LKFA 4D7TA 5IAXA 4BQ4A 4CP0A 3OEAA 2ID4A 5L7OC 1EV12 3N7MA 2B45X 3SKVA 2WR9A 3AX4A 4NWWA 2FMDA 4INDA 1OH4A 2P17A 2WQ8A 1JYCA 3PURA 1HRV1 4I01A 3RYPA 1M06G 3ZYRA 2WFF1 1VE0A 3WHTA 1ULOA 1VBE3 2RJLA 5EYYA 3SQOA 3WNNA 5FOBB 1JYIA 2K0GA 5IFPA 1LEMA 2XL7A 2E53A 2Y6KA 3AP7A 3OD4A 2VMEA 5A33B 1N47A 4FFFA 2XJTA 3NSTA 4IW3A 4PLNA 1NCRC 1O5LA 2IXKA 5ABJB 4W50A 2XKOA 5CFCB 1UL9A 4KU7A 1ZBE3 3HPNA 3D6EA 3L9JT 2FHRA 1UZWA 2XBO1 2W52A 4GWNA 1KS4A 2ZEYA 4GB31 3KGLA 2LALA 1QJX3 4BM8A 5LBBA 4DINB 1AZDA 3FMGA 5BNNC 2JKBA 3MPPG 1GKBA 4YYOA 2VZSA 2IZWA 2WSVA 3H8UA 2WFPA 3DPRC 3WHUA 2X10A 3VDDC 4DZGA 4PI0A 1UQXA 4IEOA 3FJSA 3RJ2X 1W2TA 4ET7A 3E6CC 1TME3 3LZZA 1YUDA 3N7KA 2ZTNA 1ODMA 2F17A 3H9AA 2B39A 1ZZ7A 3LQCA 3VD7A 1XYNA 1NYWA 1PK6A 1UX6A 3BGAA 1OUXA 2IXCA 5GLUA 3ALQA 5F5AA 5C4WA 2GH2A 3VBUB 1VBE2 1WGPA 2WNOA 5H9SA 1R1A2 1QIQA 1W9SA 3S6PA 4A7YA 4LE4A 3H1MA 5GJ6A 2OW4A 1YYNA 4K1ZA 4NIIA 5IFTA 1RXFA 1LOBA 5A3NA 2E9QA 1ACCA 1ALYA 1IQDC 3HT1A 2FZ2A 4DXRA 3WDVA 3NWKA 4IEWA 4A3ZA 1W8WA 3ZXLA 3SXWA 1OVPA 4QPGB 2KR2A 4JRAA 1GR3A 2WQ4A 4Q27A 5LBFA 3HT2A 4RS5B 1W2OA 4IEZA 4EN9B 2ARBA 4CDXA 2VO5A 3O1VA 4RHV1 3KF5A 2E6VA 4PI2A 4OI2A 5KHGA 4CZSA 1JHJA 2PHLA 1W6MB 4QXCA 4UYBA 1YC61 4ZONA 5L36A 2AZ5A 1JU3A 3KT1A 3DCQA 3WP4A 1RUF2 1AR93 3LSDA 3PU3A 4I0AA 3ZYFA 1W9TA 1YJKA 3C7OA 1YFXA 1WLCA 4H3WA 4RGGA 2YDEA 4MYEA 4QHBA 4AEKA 4ZS3A 4A4AA 3PMEA 4D6SA 1W6OB 5GLWA 1MS0A 2CWSA 1HQLA 4KH9A 4B7KA 3IAQA 4COVA 5CBLA 4FTBA 2HKXA 2AREA 3K4AA 2W46A 3VBSB 2DTWA 1RUJ3 2H0VA 4XDQA 2J1AA 2WFF3 5E16A 4F7ZA 5BNOB 1GZCA 3I2KA 1GQPA 3NVCA 1WMFA 4FAHA 1BKZA 1OA2A 2WABA 3CJIC 1BBT2 4XBNA 3GZUC 4QHZA 1KEXA 1W05A 3PTRB 1NQJA 4NWVA 2BQPA 3PJQA 3QLQA 4KQ7A 3MW3A 4ATFA 1IS3A 5L73A 2VQTA 1CD3G 4N7IA 4SLIA 2WO1A 4R8HA 3KHBA 4TLFA 2HWF2 3VHPA 1JZ6A 2UWBA 4XAAA 1WMDA 1AF9A 2XHKA 4IV3C 2VECA 4JZRA 1DQ2A 3POIA 5T55A 1H8TC 1IPSA 3K48A 4M01A 2PAEA 2QZ2A 2R063 4QB6A 1UNBA 4UXAA 2A6YA 4MV2A 1C1FA 1GOHA 4M3CA 3BIEA 1U5YA 3VKMA 1AXKA 2HBUA 3GCWA 3QBQA 2ZJCA 1ZZCA 3J7MA 4UFMA 1GWMA 1W0PA 2A1XA 4N9IA 5IAVA 3FE5A 1GU3A 3KD4A 1AL22 2CWMA 4JKLA 4DFSA 3M7AA 3PVOA 2O1QA 4V2VA 3PDQA 2Q8CA 1F35A 4LLFA 1VBC3 4NE9A 5IVEA 1UYYA 1EP0A 2A71A 2ZAAA 3J8F3 4Z8BA 5IVVA 2CDOA 3MIBA 2VZOA 3LE0A 1IQAA 1YQCA 2GNMA 4FQ4A 1QJX2 2RS11 3GNEA 2ZHKA 1KFXL 2WKKA 4UF0A 4RGAA 4AFBA 1GP6A 1SBFA 2YU1A 5F2WA 3ZM8A 1ENSA 2BWCA 3LIHA 1ZBE2 2DVGA 1QGLA 1U0AA 4TYSA 1RUOA 1XBFA 2WA4A 2CU5A 3VBOC 1AYN2 4W6XA 1JUIA 1HRI2 1TME2 4AFDA 5JSOA 5FKBA 1PGL2 2FQPA 1LGNA 3IM0A 1Y4WA 3WP3A 5CFCA 4QQLA 3W5MA 3LDRA 4YVWC 4G9SB 1AYM1 5FYYA 1UY2A 1XSQA 1AR73 3RYKA 4M0HA 4G4FA 1SZBA 1GNYA 2VR4A 1R1ZA 2VM9A 4P08A 2Q4SA 3OUJA 3ZXKA 3GJAA 2R6QA 4NOTA 2Z2SB 4BYYA 1EPWA 2CYFA 1DLCA 4GWJA 4O9EA 4CUAA 5FJHA 3RJRA 3WNPA 2JX9A 1K5MA 4PLOA 2BU9A 4QAWA 3V56A 4A6OA 1GFF2 2G9ZA 5HXVA 2DUOA 3WLUA 2Q8EA 1W2UA 3KM5A 2W0XA 5I0RA 5LY2A 5C9AA 5KHJA 2FCVA 1K5MC 3W59A 2VPVA 2Z69A 2DVDA 3CF6E 1JXNA 5FK7A 1STMA 3PMSA 2H6BA 2KXLA 5F39A 1WCKA 4OQ8A 3OEBA 4CDWC 1NAEA 4GD4A 4OCTA 4LE3A 4IEXA 3TEWA 3I3QA 4XOGA 4YW3A 5H9QA 5HCAA 2HWC2 3AMPA 1DZTA 3C8XA 3NNMA 4A41A 5CKMA 2R0FA 2XLGA 3CKHA 5FR3A 1TMF1 3AB0A 3ZYPA 2BNNA 4JGZA 1L3JA 1EAH2 4XYXA 3OGGA 1R081 4KI5M 3WXPA 4IESA 3M3OA 5AC91 3H7YA 2VTXA 4W8JA 1BMV1 2CV6A 3OPZA 1MEC2 3VKFC 1O8PA 1AR81 1JOJA 3LOBA 4GH4C 2ET7A 3P3NA 3HN1A 4K6BA 5T5OA 2VW2A 2JD9A 1PVXA 3MIHA 5A7SA 1OOPB 1WBFA 4E4HA 1QJEA 1GQGA 2RE9A 3IDCB 5A32B 4DS0A 2IVJA 3J9SA 4YM3A 2ILMA 4PIXA 1N3PA 3VBHB 1U5XA 2UWAA 1KS5A 3CJIB 3RG0A 2VH9A 5F6LB 3ZSLA 1LB2A 3KLSA 3OBTA 2IXJA 2VUJA 1WUVA 1G9AA 1HXS1 1ZA7A 4HT1T 1OD3A 1D4VB 1H1IA 1V6OA 3A0NA 1WMXA 1VAVA 2QDRA 3JD71 1EY2A 3OF1A 5F3GA 1YJLA 4HANA 2RG4A 3E5XA 4NR1A 1K5JA 4N8MA 5LY1A 1J58A 5FUPA 1BEV3 4OMDA 4RQPA 2A6ZA 1ENQA 1LOAA 1OH3A 3X29B 3HBKA 1QNWA 5TSWA 2YB7A 3NJVA 3K51A 5ACA1 4GB33 4LO4B 5FYBA 2XH6A 1UPSA 4Z82A 1RUD1 5JWPA 2R062 4LHNA 4N53C 4IEYA 2RS32 5T3NA 3W21A 5J37A 1ZBE1 2WJSA 4E2GA 1CJDA 3TN92 1I1EA 2TUNA 4FFIA 3J7HA 4RFRB 5J96B 2WQZC 4CPBA 3OGSA 4FPJA 2OXBA 1ULFA 5EFUA 4YW6A 2YBSA 2QZ3A 4Q8LA 5BNOC 4CDUA 3LCPA 2AGSA 1JN2P 4IXLA 5K7PA 1AJOA 4NIDA 4RS5C 4Q0SA 1E57A 3SEEA 3VBRB 4NRMA 4DEQA 2HWE1 4CXYA 4QPGC 5FPZA 3AYCA 4E2QA 3ACGA 4HKWA 1F4HA 1Z7S3 4DIQA 3MHZA 4PJYA 3OSDA 2CAVA 2WLPA 3ITQA 3VBFC 1Z0HA 1UXXX 5LRRA 4K20A 2CTVA 1LOFA 1NLSA 4AFAA 4R9AA 3SHRA 2YU2A 1OSGA 3KV6A 4MUVA 1UPIA 4WVMA 3T4HB 2PHDA 1JH5A 1B35C 2DWRA 3HOBA 3I2FA 3I2JA 3T4VA 4XQDA 2WUHA 4Y1YA 4Z1VA 4UF0B 4AQTA 3OUHA 3B02A 4ISQA 1IHMA 4RR3B 2PAKA 2UWCA 1VBB1 2LRPA 1UMZA 4P9JA 3LDKA 4EN0A 3INAA 1AR92 5FY4A 5G04L 3UYJA 4MGKE 4HBNA 2J1TA 5A7PA 3GZEA 5CKNA 5I0UA 4ZU4A 4BLIA 2ZGMA 1PZ8A 1NCQA 4RR3A 2Z79A 2VZ3A 1S0EA 4IEVA 3WDXA 4XUOA 3HBZA 2VC9A 2WAOA 3H0OA 1LOEA 3H3ZA 3PIJA 5EJ3A 4CCLA 2JE8A 1BVP1 1GWLA 4WVMB 1PM7A 5FPBA 4AVCA 1RB8G 5FMOL 4E2SA 4QX8A 4KG8A 4HETA 2ZPXA 2VQ0A 1PNFA 4KWLA 1S1AA 2W1QA 1AYM2 3H8XA 2ZMLA 3A22A 3ZFFB 4IV1B 4R4ZA 5DUWA 2OUJA 5A33A 5JXGA 1UIKA 1LU2A 4HK8A 1COV2 4WBBA 3WF0A 4XXPA 3ZFEB 5JUVA 1NZCA 2NN8A 4HKOA 1DYOA 1UCXA 1R1A3 4OZOA 3IWZA 3ILRA 3VBHC 5BNOA 5K0UC 3Q8AA 3I3MA 1C8M3 5FZOB 5FREA 2Y6GA 2GU9A 1UO9A 5BY5A 5I0DA 5FZDA 4C1XA 3N9NA 3SNMA 1OOPC 4AI9A 1RYYA 2VNGA 1OFSA 5D8AC 4AEMA 5I0TA 5CFCC 2PXJA 4W4ZA 1UOJA 1MEC3 2VOVA 5LB6A 2ZOEB 3WF4A 3MIDA 2PA7A 1W6OA 2QQKA 1FMD1 3IMMA 4XMAA 1N3QA 1WW4A 3KGZA 4FPFA 1DBNA 1R093 2ARAA 3ZR6A 2A3YA 1RUG2 3ZLIA 1N1SA 4O65A 1DGRA 5IW0A 1RVF2 2ZGNA 4NMIA 5T5PA 3GGLA 3FL7A 1UKRA 4Q4X3 3JD72 2PFWA 5BNNA 1OT5A 3VZNA 4D69A 1MS1A 3OTFA 1O4ZA 2CGPA 1RL3A 4W65A 4OUEA 1RMU3 4AEDA 4CDXB 2ARCA 1PO21 1XXNA 2LTNA 3VDDA 4CEWB 2VZTA 3CJIA 3A4UA 1SDWA 5C33A 1QJU3 3VBHA 5IK4A 4XTMA 1CN1A 1LHNA 4BQ1A 4I0BA 5CIRA 1S2EA 2EXJA 3W58A 4QU1A 5FY7A 2YPDA 3RQ0A 3CO2A 3RZZA 3KCXA 5KWRA 1C8M2 3KF3A 3OOXA 2RS13 4NN0A 3CIHA 4KBBA 3ZOIA 1ZBA3 4LO7A 2XJRA 2XWBB 2GDFA 2RS33 3NV3A 1T2XA 4YGEA 5FZEA 4ZZ5A 2GMEA 5J36A 5D21A 2AACA 3H3LA 1PVC2 4GXLA 5BUVA 3O0VA 3WUDA 3WF3A 5JZGA 2MNGA 3IBMA 5CVRA 1B09A 1EAH1 4JGYC 4ITCA 5EXOA 2D6PA 3ABZA 2FMYA 4I09A 4R9DA 4XFBA 4A6SA 5C70A 2YZ4A 4L0PA 1MVEA 1DGRN 2D6OX 3RZKA 4YW2A 3LPGA 4FOQA 1ZM1A 2W94A 1AR61 1HV0A 3DXTA 4UW3A 3WNXA 1RUH2 4V2WA 2WWUA 4UFHA 3K46A 4A2UA 4DUWA 1ST8A 3AJZA 2XJPA 1J59A 1RUH1 4OHXA 3ILNA 3WX5A 1PIV2 3AXEA 1W8NA 3R6SA 2Y8KA 4NUBA 4RGKA 4FPEA 4AGGA 1D2SA 1DGLA 3TOJA 4AVBA 4GMP0 2ZBJA 2K9ZA 3N35A 4BH9A 1IZ3A 1Q8SA 4C8DA 4AI0A 3VD4A 5DABA 1AL23 1O3TA 4XDOA 1VBA1 5JZGB 3MDPA 1R64A 4R4XA 2YBKA 1REEA 1QDCA 5FLHA 4EE2A 4IGPA 1LOCA 1W8TA 2JDMA 3I8TA 4GQ7A 5DZGA 5KR7A 2B8MA 3NV1A 2VMCA 1X9TA 1VRH2 3M70A 4FTEA 5FZLA 1VMJA 2EIDA 5IK5A 2JD4A 5JMOA 5HXMA 5ANQA 1O7FA 2OS2A 5DN2A 1S0FA 1UY3A 2H6CA 4CEWA 3WOGA 3WQ7A 3SH5A 3POFA 2BYVE 4E8DA 2D3RA 1CESA 3M3QA 4OFGA 4QPYA 4MGSA 1JYXA 1PZ9A 4Q4W3 4L99A 2XR4A 1ZX5A 1WLTA 4IE6A 4LNVA 4YVSC 5C3PA 5KXDA 1KFUL 2MPFA 4HKLA 4Q1PA 3KT7A 1US2A 2D6NA 1JODA 1TEIA 4XIKA 1MS5A 2J22A 3AMHA 3RNSA 3VV1A 1AHSA 1UOBA 4FPCA 4ONUA 1LCLA 5I8SA 5L9VA 2QQVA 4MGQA 1FMD2 4WZFA 1CAVB 1RUF3 3AZWA 3OJBA 1ASJ3 1QJY3 2HWB3 3C3VA 3CBNA 2P5BA 3I3BA 4PIZA 5FV3A 4AVSA 4OI0A 5EJZB 2X5IB 2QNKA 1AR82 1MZEA 4BK4A 3KQRA 4BU2A 1IKQA 3MEPA 4W6YA 3LEMA 4Q1RA 1SFNA 4LEJA 4QGNA 5HCBA 5FZOA 1TMF2 3WDTA 2PAMA 4CXXA 1YI9A 2UY8A 3TYJA 1H8VA 5KXBA 4Y1XA 3MGUA 4YW1A 2A6VA 2W1UA 4WV8A 4YG6A 5DDJ2 4AEJA 4R52A 2D97A 4BQ5A 2PHFA 5GM0A 2WRAA 1ND3B 4JDNA 1HIXA 5T50A 2A7AA 3OD0A 1CR7A 3U10A 1FOD2 4JTOA 1APNA 1DQ6A 1WWYA 1JYTA 4IV1A 1JZ2A 4YARA 2ZZJA 1EAH3 1F15A 4C0BA 3BTAA 1Z7S2 3HNBM 2EA7A 4AK3A 2QQPA 1D4M2 4QMAA 3FUQA 4MXVA 4D3WA 4Y22A 1QNYA 1UZYA 1F5FA 5LBCA 3B01A 5T52A 2D43A 2K2SA 4I30A 4R9BA 4MH0E 2Y6LA 3WP6A 4MXWB 3LOIA 4XBQA 1RUC3 4YLZA 5C7GA 5C4WC 1OMIA 3RVHA 5C3RA 1W8FA 3HQXA 4Y3OA 1X8EA 3ZPOA 3ZFGA 2JEMA 3VBUC 5K0UB 2RR13 3NNGA 1H1MA 1A34A 1G6NA 3JB8A 4EJRA 5FY9A 1UF2C 5IVCA 1J3RA 1H9WA 1H9PA 1VB4A 1XE7A 2VCMA 4AWDA 5JMCA 1H0BA 1AR62 3TRSB 3UNPA 4LJHA 4GJYA 4XILA 2LUWA 4BXSV 1E5RA 4COZA 2VQUA 4CYDA 2BWAA 2WZR3 4S2HA 3HMYA 5KC5A 2BFUS 2BGCA 4ZS2A 2LW8A 1PM4A 5CEHA 5C8WA 3NNLA 4O61A 5FBJA 3RGBA 1TZOA 4HN1A 2ZEWA 2JIGA 3NL1A 5BNPB 2BV4A 1Y9GA 4MHUA 1LHUA 4XUQA 2XL9A 4Y5Z0 3V0BB 4IERA 1L7RA 2CGOA 3U07A 1DP0A 5J98B 4URTA 3ZXDA 2VU9A 1F5JA 4NO4A 2UYBA 4P9LA 4K40A 3WF2A 4OULA 3USSA 3LWCA 3FUOA 4CP9B 4RD7A 4C1WA 2ZGLA 5A6QA 4CDUB 4HPKA 3TN93 3KQ4B 3PVNA 3RPQA 5FYTA 4XCBA 5A1LA 1HKDA 1K3IA 1PO13 1VALA 3AMQA 1C28A 1Q8QA 2QQWA 2D5FA 2RM21 1V9U2 2ZZQA 1M4WA 4IQPA 3HQRA 3I2HA 3K2OA 2HWF1 1ND3C 5F3EA 3OPWA 4RA0A 4QQHA 5FFOC 3UJQA 1IS4A 4ES8A 2KA3A 1RVF1 5JOZA 2WDBA 3NW4A 3LIGA 1W6NA 5A3OA 3WDUA 2HWD1 5F37A 2QQOA 5KXEA 5HPOA 1N1YA 1AYN1 3I59B 2QQUA 2VOTA 1UYXA 2BFUL 4LHSA 1RVF3 3VBFB 5JOXA 3OBRA 3BKZA 3KV5A 4NHMA 1JYVA 1NT0A 1QXRA 1US3A 2HWC3 2XONA 2JE9A 4GAZA 2HWF3 4TWTA 4XF9A 4AR2A 4PT6A 4PQ9A 5APAA 5FYZA 4NJ4A 1PGW1 2QE3A 1K12A 1I5PA 3E5UA 5LK7B 1W2AX 3KMHA 4RYDA 1RIRA 3S7EA 4UFJA 3WQ0A 2PLV3 4KWKA 2YYOA 2WIIB 1Q8VA 4JHTA 5A32A 1V6LA 3VZKA 1RUI3 2GN7A 4KU8A 4XJZA 3VKOA 2VCAA 1F8VA 3WNMA 5FZ4A 5IK7A 5K8SA 2DFBA 4XC9A 4XFIA 1YIFA 3LB9A 4FPLA 1C4RA 3ZMNA 2PELA 3D0JA 4IETA 2BRTA 1DG6A 4AEDB 1PMIA 2JDHA 2PYTA 2ZX3A 4PF1A 3BTZA 1LHVA 3CEWA 3VD5A 3GDBA 3VN4A 4EWAA 1W9FA 4NRQA 1VMHA 1NCRA 4DXSA 4FAGA 3QOPA 2Y6FA 2R071 2E7QA 2A6WA 4AYUA 3GZAA 2AYHA 1DHKB 1GNHA 2WZR1 1H1AA 4MADA 4Q4Y1 3JBG3 3OYWA 1QQP2 4U36A 1YFUA 3RFRA 5DXDA 1MPXA 1V6MA 3ATGA 5HV4A 3AKTA 4XACA 4AE2A 1HW5A 2FDIA 2LROA 2V72A 3L2HA 3T2TA 5KXCA 1FATA 3P6BA 3RI9A 1NXD1 2DVFA 4FOVA 1SDDB 2P6CA 3DPRA 3PHMA 5E8AA 1DFQA 2VD7A 4IDZA 3I97A 1OPOA 2R0HA 4DY5A 2VMHA 4PDWC 5E1RA 2J42A 2CAUA 1O91A 4K8FA 1YO8A 3NKTA 1RUD3 3VL9A 1CAWA 1G8WA 2VZPA 3QH6A 1JOBA 3EB7A 2JWPA 1ZZBA 2WA3A 3MICA 4AAPA 3OUIA 4XVHA 4WVZA 2QQLA 2RMU1 5FZBA 4H14A 3C7EA 4V1PA 2D93A 4CCKA 5LA0A 3ME2A 2CGNA 2F4PA 1LKNA 1XU1A 1UZ0A 2VAUA 3P1IA 4IEUA 4LUMA 2IVIB 3JD73 3ZFFA 1BXHA 5IHRA 4K8RB 2GP5A 1H2NA 2ZABA 1UMHA 5KC6A 5J7MA 1H4GA 2QCSB 4CU8A 2ZA9A 3B9IA 4FXKB 5F7UA 5JZGC 5M0TA 4XFFA 3I59A 3VBFA 3ZDSA 1BJQA 3AVRA 3I7DA 4J1WA 3TB0A 2IFRA 4DNYA 2Y6HA 4XPVA 5DG2A 2W95A 3VHRA 5LEJA 2WT1A 2Z4FA 1HQNA 5H9PA 3WV6A 2XPJA 4Q4X2 2ZGRA 1BBT3 4Q4V1 4BZ4A 3POWA 1RMU2 3DYPA 3LFIA 4X6RB 1YQ8A 3LEIA 5GZDA 3AZVA 1SCRA 4P9YA 2XUEA 4JQRA 4Y4RA 1QJU2 1BHGA 4AF9A 1G9CA 1OKOA 3WZ1A 4BQ3A 2RDRA 3UKNA 5F5QA 1J3PA 3JZVA 4CDXC 4I3PA 1H6XA 1X7NA 3ZYJB 1H4HA 3N4MA 1CX4A 1ZREA 1WLWA 3FX3A 3VD9A 1WCDJ 3NKGA 2JDNA 4ARYA 4B4RA 2P1BA 1C5HA 1J1TA 3GF6A 4YVWB 5BV6A 3BUCA 1W8ZA 3PTYA 3BPSA 2E51A 5A7WB 3V0BA 2XGXA 3U37A 5FP8A 4LT5A 2JDYA 5F9TA 1WW6A 3T2QA 5BNPA 1SLLA 1RHI2 2BERA 2PN5A 4DUVA 4JHZA 1RUNA 1V0AA 4Y1VA 2BZDA 4D94A 3MF9A 2RJ2A 4EN8B 5A3WA 2WAAA 2HEYF 4P9XA 4XFCA 4K3UA 1E5HA 1JOPA 5D8AB 1SMVA 4LIVA 1RXGA 2WN3A 5DZEA 5C8CC 3VBRA 1W04A 1JS9A 2A3WA 2VCCA 1CGPA 3WCSA 2I2SA 1CQ9A 4FPYA 3UK9A 4JC1A 3TBDA 1QQP1 4Q0VA 5C5TA 1VP6A 1W3VA 4NROA 2RDQA 3I54A 3T09A 3I3EA 4HVRA 1AR71 3ZFGB 2W91A 2JG9C 3T1MA 1WD3A 2ZHLA 1VBA3 4CVUA 4KMQA 1KQRA 1EV13 4AGVA 5FPVA 3GJBA 4LHLA 4NAMA 4IV1C 3OY8A 2QKDA 5FP4A 5FP3A 4BQ2A 2JG9A 1UD1A 2WS92 4XFHA 4EQVA 3IIAA 5FWEA 5T5JA 2WT2A 4QPIA 3WDYA 2HWC1 2Y64A 4G3YC 5GZGA 1OLRA 1OQEA 1WA6X 2W2IA 5JR7B 4GALA 1BK1A 1CPNA 2PHUA 3THCA 2W47A 3AKSA 3E5QA 2VOXA 3K75B 3N7JA 1W8HA 4Q4W2 2YFZA 1NG0A 3FFZA 4ZXEA 1S2BA 2WN2A 3GXUA 5F3IA 5FBZA 4IGOA 3WT3A 3UESA 1N1TA 3POGA 4HVOA 3ZFEA 1VBC1 3CJXA 3ASIA 3FLPA 4WM8A 3VDCA 5DG1A 3T3YA 2TNFA 1RGSA 4PBPA 2JIJA 4B1MA 1UIJA 1VBD1 2O8OA 1GZTA 1NOVA 3AL6A 3URFA 1IS6A 5F2SA 5C9AC 2BW8A 1GNZA 4LKEA 3IDAA 2JENA 4L11A 2XB6C 2OQ6A 3KSCA 3SEPA 3S57A 4BQWA 1SLTA 4LXLA 4C0HA 2I07B 2P3IA 4MO3M 4XMIA 3ZFFC 1CAXA 3PUAA 3W5NA 4XF3A 1JZ8A 2WC2A 3T0BA 5JOYA 3S7IA 1QWRA 2WO7A 5ACA2 2QQJA 4P14A 2QFEA 5A7OA 3ETQA 1QH6A 3Q8BA 3WDWA 3T1LA 5LRSA 2X5IA 3CU7A 2D98A 3BU7A 2BEOA 4XE9A 4AVAA 2C9AA 3HAGA 5CB7A 3S30A 3I4IA 2RM22 4FOWA 1KD7A 4A42A 1MZ5A 1RMU1 5C3SA 1FV3A 1Y9MA 1RTVA 1VR3A 1QXPA 4ZU7A 4LBQA 4XABA 5F1RA 1KITA 4Q4X1 4EN7B 1AX2A 1MZ6A 1VBC2 4UWDA 5AVAA 3E6DA 4GWIA 3N9PA 4KGGA 3FLTA 2J1EA 4Q0QA 1GOGA 5EHDA 3NJXA 4CCMA 1C5IA 2CHHA 4RFT0 1XNAA 4CDWA 5C9AB 3UJOA 1Y7BA 1G9FA 4GB32 1HX6A 2ZGPA 4YG0A 5CG8A 3DL3A 1H6YA 1VBD3 2XVKA 1JTZX 3HWJA 2E31A 4MLOA 4XJWA 1ZVFA 5CU1A 4WVWA 1COV3 1W8UA 4S2DA 4U2AA 1PZ7A 2GC0A 5FXVA 2WNVB 5A3PA 5FZHA 4CEYA 1MQTC 4LKDA 4WZCA 4BA6A 4Q5OA 3BTYA 3I3DA 4ES9A 1DQ4A 4XHBA 3M1HA 2J1VA 4ZU5A 1MZFA 5FQ0A 3K4DA 1WZXA 3THPA 5FJKA 3U4SA 5J48A 2Q30A 2VMIA 3AXDA 5T5LA 4Q26A 4NPMA 5JSPA 4YM1A 5C3OA 5JAXA 2VBDA 4JKKA 4J1XA 1YHFA 2K46A 3DECA 5LEKA 4CDQC 3EQEA 4FFGA 5FP7A 5CADA 1QXJA 3FN9A 4C90A 3D5OA 1LEDA 4FPHA 4CTEA 1EV11 2HLEA 4Y20A 2ZGKA 5L7OA 4BPZA 2ZEZA 5DAQA 5IUQA 4AW7A 1O3QA 3WW4A 3JBG2 2P3JA 4XDPA 1BZWA 2X8KA 1UN1A 2VOKA 1C1LA 5FK8A 3RMYA 2W1WA 3CZUA 4HSLA 3Q8CA 1ODNA 1VIWB 5FZCA 2ZMKA 3AMNA 4CE8A 4N53B 2R7EB 3BN6A 4RQPB 2ZHNA 1ULPA 4CUBA 2HBTA 4P02B 4GH4B 4DOUA 1MQTA 3LGRA 5IATA 4FTSA 1LU1A 5JSRA 2DCJA 2FDJA 1T6BX 1U12A 1F2NA 2SBAA 3POSA 2VL4A 5GLVA 5LATA 5A6XA 3GYDA 4A44A 4B7EA 1PIV1 1QJY1 2Y0OA 4M3CB 4SBVA 1BMV2 5FZIA 2AEYA 1QMJA 4IGQA 1RUE2 3ZFGC 1ENRA 5DDJ1 3RZGA 1S0GA 5LZ6A 5C3QA 3AZYA 1SHWB 5F5IA 4FPKA 1IOAA 4QM8A 4WVVA 3O12A 4Q4V2 1RITA 3ZKYA 2JG8B 3WW2A 1XB9A 1BVVA 4UOJA 1GQHA 3NQHA 1AX1A 5FP9A 1KJRA 2V5YA 1PVC1 4EZ4A 1NQDA 3DYMA 4HN0A 1X50A 5C71A 4Q0UA 4B1LA 3T2OA 3O0WA 1W9WA 4D6QA 1RJ7A 5JI7A 1HRI3 4AQSA 2WZ8A 4JGZB 5A6YA 2VUDA 4MGYE 3HN3A 1OBNA 4NVPA 4CCCA 1D4M3 2RJKA 4KWJA 2X29A 5CFDA 5JR2A 3K3OA 3LA7A 2DCTA 5DAVA 3VBSA 2EICA 3F95A 3M3EA 4LPLA 4GIQA 3SH4A 3PVEA 4BWOA 5H9RA 3GBGA 2GC2A 4MGTA 1J83A 2JECA 5E89A 4B3NA 3NAPC 4DUXA 1ZRRA 5FYIA 2VNOA 3MBWA 2DTYA 1ZRCA 4PLMA 4XEZA 3SKJE 2KD7A 4D7SA 1XNKA 5FZAA 2X53S 4CDQA 1VAKA 4QD2A 2FD8A 3AP6A 1LHWA 1UMIA 1WLDA 3B00A 1LOFC 2X05A 3RMXA 2VXRA 3VHOA 4QKBA 1A6CA 3VGIA 3OB8A 4K1YA 1K5MB 4J25A 4XF1A 1TVGA 2VXJA 3LPFA 3RZJA 1IPJA 3WCRA 4Q4V3 4GKYA 1BBT1 1AJKA 5BPXA 1REFA 3IDEA 4R9CA 3WP5A 1RHI3 4NHYA 3ZMOA 5A3TA 1NKGA 1LJ7A 2YUEA 3R4DB 1V6KA 4BE3A 4PDWB 2Q0AA 1DZQA 4HLTA 2PHWA 3IAPA 1QEXA 2CY6A 4X8PA 1LECA 3AZZA 3ZN5A 5FTTC 1FPN1 2WZR2 5KHHA 1ONAA 3O7OA 4RN5A 4LK7A 1UU6A 2FDFA 2JJ6A 2XJSA 1XJAA 3PUSA 1PHMA 4QQPA 4HXCA 2DVBA 4QX7A 2W68A 1DF0A 3NMBA 5CG9A 1VAMA 1HV1A 5IVBA 4MG2A 1ND2C 1XYPA 3LEKA 3FBMA 1ZBA1 3IMNA 3IPVA 1Y3TA 1HRV2 1FXZA 1W3XA 2RMU3 4EWEA 3EXUA 4YZ2A 3G7DA 2BPA2 2WLQA 3EO6A 4JAAA 1PK6B 4X8NA 4XUTA 5HI0A 1K45A 2OVUA 5JXJA 1CIWA 3PJYA 3U78A 1LULA 4N43A 1SEFA 3D3AA 3K4ZA 5LA1A 1LR5A 4DXTA 4XJAA 4UAPA 3ZPYA 3FC0A 3KWVA 4K21A 3AK0A 2WWSA 4GMP3 2ORXA 4N9HA 3BCWA 3BTXA 5JOWA 1UYZA 2R32A 2XXZA 3ETPA 4MOAA 3ZKUA 2AENA 1UY1A 2NQYA 3MV01 5DDJ3 1C57A 2W3JA 3BYWA 1BEV2 3KVAA 4MGZE 5JDBA 3JBG1 4CCNA 1TNRA 2HJIA 3FZ3A 3VBSC 1O4YA 4QX3A 3ELNA 5FYCA 1D7PM 1PIV3 3R4SA 2DVAA 2NP0A 1JZ5A 2CL2A 2WT0A 3IKWA 2C9KA 3R05A 1NE4A 4XJ9A 1PO22 1W99A 4EV0A 3DXUA 2ZGQA 1AYN3 1NZIA 1A8DA 1J84A 1NLQA 2DDUA 2EVXA 3M4FA 3PUIA 4Q4Y2 5A3MA 4QKDA 5FZ7A 2YC0A 4YM2A 3D4KA 3HEIA 3C7GA 5GZEA 1G9DA 2VVEA 2XQXA 2Y38A 2ZGUA 2ZX2A 2XQRA 2RS52 3AM2A 2GNBA 4IUGA 3SISA 4E9KA 5I93A 4OI1A 4A3XA 2B4KA 3AP9A 2PLV1 3DKWA 3T2PA 1W90A 2CSGA 5DQ0A 1J3QA 2BVBA 4QM9A 1AL0G 1XNCA 5A1FA 1URXA 1O3SA 2JXAA 1PGSA 4CEYC 1W39A 1CAUA 2AEZA 4OUSA 4CP2A 1FI2A 2I74A 1JYWA 4YGBA 3CQOA 2XOMA 4ASMB 4LOSA 2EXIA 2MEV1 2VG9A 3JQXA 1JZ4A 2D6KA 4IL7A 4LA2A 1NA1A 3ACLA 4OLLA 4ZHNA 2VUAA 1AVBA 1KGYA 3FLRA 1GICA 1XNTA 1HJFA 3F2ZA 4XW3A 1KDMA 5FY0A 4BQYA 4QGMA 1FNYA 3CLPA 1W6MA 1SPPA 4QXHA 2E32A 2BBVA 4YZ3A 5EZWA 1COV1 2WZEA 5I91A 4HVQA 4W6WA 1FX5A 4CU7A 2DF7A 2ERFA 3B3QE 5IVJA 1MS4A 3CHXA 1D0HA 2QQMA 3O5SA 4QPGA 1YFYA 2D7FA 3G6JB 4JDOA 1QU0A 1O6UA 3MIEA 1VBB3 3ZXJA 3VHNA 5FDBA 5L19A 4CUCA 1OOPA 4CDUC 4YVSA 3AC0A 5IVFA 1P8JA 5E88A 3VZOA 3WG1A 1KRIA 3LFMA 1O8SA 1WW5A 2R1BA 1HXS2 3THDA 2HH9A 1CX1A 1Q56A 4BMBA 3EBRA 4XAEA 4ARXA 3ACIA 3OG2A 1DQ0A 3VZLA 5K9YA 2VULA 3M3IA 4JX0A 5C4WB 4QB1A 1QOTA 1GYKA 2BGPA 5DPNA 3O1SA 3JCIA 4GJZA 4XFGA 2DV9A 2GNDA 2WYFA 5KHKA 2Y34A 1OC1A 1Z7S1 2QQNA 5CNAA 5JPMB 1GANA 5EIYB 2P6HA 1POQA 2DURA 2J1RA 4MX3A 2HWE3 1A78A 5JLVA 1PMHX 5F8PA 3GZTB 3VLBB 3ZIWA 3S5AA 3BU0A 2F4LA 4NIAA 1HB4A 4M00A 1ZZ6A 4MSVA 1IKPA 1WCUA 5AC92 5JIAA 3EYPA 1W28A 2GN3A 1JMUB 5GKAC 1LAJA 1FOD3 1HQWA 2BTVC 2R072 4FT8A 4LOTA 2R30A 4ASLA 2RR11 5FYHA 1QJZA 4WM7A 1FPN3 1JBCA 1YIPA 5A3LA 5L7OB 5CYYA 4TTGA 2B5HA 2ZACA 1YWKA 3O1PA 2ZS6B 3WG4A 4AVVA 1RUC1 2E7AA 3PNAA 1ZRIA 4BHPA 2OPKA 5ABJA 3ENRA 3ZXFA 1IG0A 3JUUA 5ACA3 4IE7A 4OVEA 5BNQA 4C91A 1R092 3LA3A 1N3OA 3TEXA 4H7MA 2WL1A 1MS3A 5ABJC 2UU8A 2DFCA 2NZ9A 1XPWA 2W87A 1NA1C 3AFKA 1UYPA 3CDZB 4FOYA 5FZFA 4AFCA 3VKLA 4LQRA 1BCXA 2ENRA 2VZQA 4XETA 1SBEA 4CEYB 4Y4YA 5FUNA 4OHWA 5FMOS 3MYXA 2B42B 4UW6A 4XFAA 5G05L 3RI8A 4DMIA 4OI4A 2XJQA 3GBFA 1GZWA 1LESA 2P3KA 5JXHA 4WM7B 4AOCA 4OHZA 3MI8A 4GULA 1RUG3 3AL5A 4CP1A 4GA9A 4H2AA 1LHOA 4HONA 4TLGA 1X9PA 4XURA 5T54A 1EUTA 4UBHA 3MUZ1 4AI3A 1VRH1 1Q43A 1D4M1 1SLIA 1JHNA 2HWD2 1OFNA 1UWWA 1X8MA 3MO4A 4IV3A 1HRI1 4LR4A 5LASA 1OXCA 2ZX1A 1OKQA 4P00B 2CNAA 5A70A 4BXFA 1O5UA 4LUKA 3CZJA 3NJYA 3T30A 4CU6A 3MV11 4N43B 5A80A 3ZXAC 2J7MA 3PLQA 2PHXA 4YW4A 1ASJ1 2HWB1 2IUWA 2BDRA 3OBZA 4I3GA 2YPJA 4QX0A 5EV7A 1TMF3 4BIOA 1YNAA 2GC3A 1NUKA 1UXZA 4FI9A 3R0RA 4JCKA 4HOOA 4EWDA 5I8YA 2D3SA 1W6PA 1FAYA 3ZYGA 1DIWA 2WO2A 4YVSB 4CRQA 1U5IA 1XQNA 1AL21 1XNDA 1Y43B 4Q4W1 2DU1A 2Y60A 3MFAA 4HMZA 4YGCA 4XXAA 2C4XA 5FXZA 4CCOA 3I2GA 3UKTA 3I2DA 1XNBA 2VQAA 2V4AA 3H3UA 3MIFA 2I45A 2XBO3 2X09A 4LO8A 4XJ8A 4YW7A 4H7LA 3W9AA 1YFWA 2QVSB 5BYNA 4LO5B 4Z2WA 1PMJX 4I2OA 4WM8B 4LBMA 3BI3A 1RUH3 3MF6A 2RV9A 4LTAA 4YM0A 4QX5A 5FY8A 1LGBA 2PQSA 3O0XA 2JICA 3LDBA 1FT9A 3AKQA 4QXBA 3NAPA 5DUXA 4FPOB 3U1XA 4QPIC 3ZYBA 5HCFA 4M4RA 5A3UA 4HK9A 4JGYB 4P5HA 2RDNA 2ZAHA 3ZN6A 3ZO0B 3O14A 1HDKA 3E97A 3ES1A 1I6XA 3OY8B 4KWUA 4QU2A 4TN7A 5FPAA 4B8EA 1VBB2 4YSFA 1AX0A 2V4VA 5SV5A 3GHMA 2BNOA 3NNJA 3I49A 2ADEA 2VZUA 4NIGA 5FO7B 4K7JA 4N43C 4UW4A 1YQ2A 4JGZC 4O9GA 1UZZA 4XBLA 1XE8A 3Q8FA 2WNUA 2OT7A 2VW0A 4P9IA 1EPZA 2OKXA 1UW8A 5FXXA 2VJXA 2VCBA 4QQ2A 2ZCWA 2VZRA 1AR63 4XQWA 1RUJ2 1SG3A 3J8F1 4RS5A 2ZMNA 3UGHA 1Q3EA 4PBOA 2JDAA 3EJKA 5AVPA 3V65A 4XF0A 1PGL1 1VPHA 3ACHA 1S0DA 1FV2A 3NNFA 1FOD1 5FZ1A 1DYKA 3N36A 3AKRA 4HZFA 4BOWA 4QX1A 1ULEA 2HWE2 2OPWA 3SCHA 2Q5TA 2W39A 2NPIA 1ULDA 2Z5WA 4P9GA 1UZVA 3WR0A 1V70A 3FHAA 3LEGA 2ZGTA 2B9UA 3N9LA 2VTXJ 4XZUG 4F3JA 1CZVA 2GALA 4OUMA 3O1MA 5FMCA 2GC1A 4FSJA 3VBUA 4A7ZA 3JQWA 1PGW2 3POEA 4YWAA 3T0DA 2RS53 2WS93 1IS5A 4I0WB 3ECQA 4JDMA 2Q8OA 3MUY1 3ZSMA 3UGGA 3HNYM 4CUGA 2R16A 1H2LA 4LIUA 5B4XA 5I8TA 4XQ4A 4Y5SA 4URAA 5IVYA 5DZFA 3J4UH 1LRHA 1ZA4A 3I2OA 1C8M1 2J1SA 1SLCA 1GUIA 4ISRA 4MVTA 3RZMA 2JDPA 2YBPA 1R1A1 3ILFA 2FBEA 1NCQC 1WCSA 2E33A 1RUJ1 3VDBA 1TQ5A 3DV8A 4AI2A 2IFWA 1UY4A 4H55A 1V9U1 3KV4A 4AL9A 1GZWB 2VY0A 4ZKTB 1ULGA 2DYCA 2XKPA 4L97A 2YV8A 3NJZA 2VZVA 4HL0A 4XJUA 3A21A 4IEPA 3AMMA 4X6QB 1MVQA 2Q1MA 1T6GC 2IXHA 2TEPA 2F6BA 4DRRA 2YY1A 4LMFA 3VZMA 4BISA 1SFYA 5FUIA 4FQZA 4JVAA 5I0SA 2BNMA 4E4SA 1AR91 2V09A 5FQ0B 3WNOA 4BMEA 4JQTA 1KDKA 1SCSA 5J3UA 4YFWA 4XCAA 4I02A 4QQOA 2OX0A 2P3YA 5LA9A 1HJGA 2BUKA 4OQ9A 4YGDA 3ZYIB 3H8RA 1D0GA 2VBBA 1SQ4A 5IK8A 1H2MA 3H8OA 2JKXA 3ZFEC 3FHQA 2ZGOA 1A8MA 1OLMA 2RM23 3OPTA 2NLRA 5KHIA 1ZRFA 2ADDA 4P5YA 2RR12 5F3CA 5FYSA 5EQUA 3U4XA 3K3NA 1OURA 2IXIA 3AKPA 5ERLA 4AHYA 4CDQB 4RR3C 3POBA 2HEVF 5AFBA 3CNAA 4LITA 3RSJA 4DO0A 3ES4A 1QQP3 2B7YA 4LBKA 3V0AB 1S0JA 5F5CA 3IT8A 1ZZ8A 1B35B 5FMBA 1JI6A 4QDSA 1POV3 1UU5A 4M3CF 2A3XA 1YQ6A 4LBQB 4UW5A 4LBLA 1IGOA 2LS6A 4Y1UA 3O1OA 3WSOA 3RWKX 1YCIA 5CFDB 2ET1A 2DCKA 2WNVC 1IG3A 1DGWX 2DCYA 4ORFA 5CISA 3HVDA 5FYUA 1I5ZA 2G1MA 2GSYA 3H7JA 1ZZ9A 4N7UA 2OIIA 4YNIA 1LTEA 5EYXA 5A1AA 1G9BA 4FXGB 1TG7A 2EAKA 2PHTA 4Y1ZA 2FDHA 5IT6A 2GP3A 1HB3A 3VBRC 4Z92B 2ZX0A 1D2QA 3FBYA 2JG8A 3OCPA 2JB4A 1GMMA 1RUD2 5FZ6A 5JPNB 5FY5A 1QKQA 2D5HA 2O14A 5FZ8A 4NPRA 3U14A 4AHZA 1PO12 1CZTA 3LKJA 4OZXA 5L9BA 4UFIA 1UU4A 1AXZA 5FZ9A 3WF1A 4GWMA 3M2MA 5FZKA 4XTPA 2EF6A 3DGTA 2EXHA 4FP2A 2A73B 4KNCA 1UY0A 2G19A 4AQ2A 4GH4A 3H1YA 4D7YA 2JDZA 3IZOA 2UYAA 4N53A 4UI9L 1H30A 1CVNA 1REDA 2VMGA 1UOGA 1W8OA 5ISLA 1HRV3 4QX2A 1NXMA 2WSUA 2YGMA 2JG9B 1NY72 1HXS3 3B7MA 3OGVA 5L9RA 2ZHMA 1ZRDA 1DYPA 3ORJA 4Q2FA 5FPLA 3J7LA 3GBWA 3IB3A 1S0IA 3FFQA 1VLNA 2W5FA 1RUC2 5C6CA 1RUE3 4Y20B 3AP5A 4M4PA 3L2YA 2R49A 3SMHA 2E7TA 1HB2A 2QDNA 1BYHA 1LNSA 4HFSA 3WW3A 3GHNA 1JW6A 1W6QA 2C26A 5IYYA 4TZDA 4JTNA 4BQXA 1POV1 1W06A 5FLJA 1NE6A 4JRLA 4AHXA 1LOGA 5FZMA 4KG0A 2QQIA 3O1RA 1V6IA 3WY6A 2WFF2 1E5IA 2A70A 3BIWE 2HYXA 4QDQA 4UFKA 5DUVA 4O7XA 4AZZA 4GZ9A 3VUOA 2VNVA 5ANNA 1ND2B 5CAZA 1K42A 1TNFA 2WNVA 4IE4A 3BPZA 3QACA 2UURA 2VE1A 1G7YA 1LODA 3ZXEA 2JB8A 1DQ1A 2OQ7A 5A7WA 1YRZA 4AAXA 4CDWB 2QBXA 1OF3A 4YVWA 1VRBA 1QH7A 1XE0A 3ROUA 2HYKA 1FNZA 3N9MA 1Q5OA 4KBZA 1VBA2 4COWA 5C8CB 1CPMA 2Q1FA 4Q29A 2WNUB 3MFCA 3ZN4A 3M8LA 4Q0PA 4MGIE 1U5ZA 4ZPIA 2Y6JA 3SITA 3WG3A 3GCXA 2VW1A 1TE1B 3LF7A 1AR83 2LM3A 3PVBB 4XZPA 2YG0A 1O3RA 5K4LA 1PVC3 3PUQA 2DUQA 4QGLA 5JI9A 2ORZA 3SLIA 3ST7A 3RZHA 4Z07A 2RHPA 1POV0 1DLLA 4NHKA 1JZ3A 2O8QA 1V9U3 2D3PA 5D2AA 4CU9A 3O1TA 1RUI1 1OA3A 2OUHA 1PNGA 1CZSA 3USUB 5FY1A 3NAPB 1W2NA 3NV4A 4FCAA 3CL1A 1AYM3 5FLIA 4B29A 4LBOA 4S2FA 3S5QA 4CA9A 1CAXB 4MZUA 4QB2A 4L2NA 5FZ0A 3B69A 1HLCA 3C7FA 3VBOB 2WNEA 4CCDA 4YFZA 4BDVB 3QD6A 3EMRA 3WUCA 4YW5A 2VVFA 5FMDA 4QXKA 2EIEA 2RVAA 4XIOA 5GZCA 4QHOA 5F6KA 3TWIA 1GZ9A 4PDWA 3ZSEA 3AP4A 4DY3A 5JCTA 5FAXA 3AJYA 1ENXA 3VB9A 3VBOA 2PQQA 1GLHA 2WNUC 2EIGA 2V73A 3PU8A 1YI7A 1J1LA 1Q8PA 4NIHA 1W6PB 4D6RA 2PTMA 3JB4C 3USUA 2KM2A 2JG8C 1QF3A 2Q1ZB 2YMZA 1F31A 5FO9B 4AHWA 4IE0A 4AVTA 4FBFA 2GMPA 4BB3A 2XUMA 1WCQA 1PX4A 5F32A 1UKGA 1QOOA 2IC1A 1VB2A 1EYBA 2YFUA 5BXXA 3V64A 5LBEA 1W9YA 3ZXGA 4QPIB 2WYSA 4AG4A 3QH7A 4CXWA 1KXGA 1OHFA 3TN91 3SC7X 2DCZA 2XVGA 1RC6A 4Y33A 3KT4A 2RS31 2YGLA 2BJSA 2C5DA 1ULCA 2R061 4YRDA 1H8TB 3OYWB 4XUPA 4AI8A 1B35A 3DEMA 1CWPA 4IV3B 1MACA 2OYZA 3V0AA 5C8CA 2FCTA 3B94A 5FZ3A 4RL7A 2Y0IA 1XYOA 2P2KA 4JKMA 2XLFA 1LGCA 4L92A 4RQPC 1OA4A 2XJVA 2WZPP 1S2KA 1X33A 2YC4A 3VDAA 2QTWB 3MLKA 4D0QA 1QJU1 2IWGB 5J09A 4Y24A 3M3CA 2C0ZA 3RDIA 2BOIA 5LCWL 1OPMA 4BCUA 4LK6A 4Z2AA 2IXLA 2D44A 5FOJB 3BALA 5FWJA 1VBD2 3GM8A 4QT6A 2RDSA 1ND2A 4D8MA 1QHDA 4B4PA 4S2GA 4YZ1A 3KHCA 3ZVXA 1OVSA 4A45A 3RYRA 5FPXA 4XF4A 4ASKA 5FO8B 2CDPA 4EROA 1R091 3AZXA 5FIXA 2ATFA 1PX3A 1JZ7A 4M3CE 1FMD3 4EZHA 3U75A 1QJY2 3WVJA 1ZBA2 5DUUA 5FXWA 1MEC1 2GZWA 5IWFA 1OUSA 4ZXKA 3VZJA 1Q8OA 5EWSA 3VL8A 4F83A 1I9RA 1R082 3DN7A 1MQTB 3J8F2 1OI6A 2Q8DA 4AI1A 1OLME 1S55A 5FRAA 3FHIB 3TNPB 4LA3A 2R041 1QY4A 5SV8A 1HN0A 2VBPA 5LWBA 1SBDA 4NHLA 2GMMA 4NHXA 3HJRA 4ZY9A 4OHYA 1GV9A 2VNRA 2XJUA 4E27A 4XUNA 4RHV3 2BVVA 1DCSA 2BGOA 1V6NA 1VMFA 3BVCA 3MW2A 4E4ZA 4N90A 2PMWB 3W20A 1JYNA 4LBNA 2G4IA 1XU2A 3WNLA 5FYVA 1QJFA 5HBAA 2FDGA 3UL2A 4RSUA 3Q9OA 4EYUA 2MHFA 2O0OA 1C3HA 4AGRA 1X36A 4OMCA 4CP9A 4Y5TA 3H50A
chains in the Genus database with same CATH topology
1JUHA 5CFDC 4DQAA 3C2UA 3APBA 2GAUA 2OZ6A 3AYAA 4HSJA 4LHKA 1F9KA 4XHXA 3QCWA 1VRH3 4B4QA 2B46X 3MIGA 4COYA 2A5ZA 3ZX7A 1RUG1 3ZIXA 1G86A 1GSLA 1TME1 2D40A 2P34A 1RUF1 1RJ8A 4OHVA 2D6LX 4BIFA 3VDDB 3DPRB 2XBO2 3N7LA 1I3HA 3MPBA 4Q8KA 3BB6A 1Y9QA 3N3HA 1UAIA 5BNNB 4RHV2 4ATEA 1MS8A 1MS9A 3A0KA 1H8TA 2OA2A 1QJX1 2RS12 4AFMA 3MLJA 1O4TA 5K0UA 5JIUA 5BNPC 1FPN2 3OGJA 3B5LB 1LENA 3DF0A 4FP3A 3BOWA 4PIYA 3ZN6B 2ARXA 3D0SA 1RUE1 1NCRB 4MXWA 3ZSKA 4YZ5A 1AXYA 4E4DX 1AUYA 5D1IA 2XVLA 2NMOA 1CONA 3JU9A 5LK5A 3D82A 3KCCA 5CA6A 2YROA 1VBE1 1SLAA 3RWNA 4DB5A 2YXSA 3POYA 4UBGA 2TBVA 3KCYA 4COUA 4DRVA 3MZHA 1DGWA 4M0NA 2R043 4BLJA 1YLLA 4F8AA 5KBFA 4JV4A 1WMEA 3MW4A 3IN9A 3B9CA 2E63A 1FYUA 2QJVA 2W08A 2FZ1A 2NM1A 2QUOA 3VKNA 3LSEA 4YZ4A 1N1VA 1OD5A 4YG3A 4PF5A 2ETEA 3B93A 1BEV1 4KL1A 3ZSJA 1SACA 1DDLA 2D6MA 4LO6B 1W6NB 1V6JA 1QOSA 4PCRA 2ZKNA 4TSVA 3RS6A 3R4UA 1NCQB 1CAVA 2XG3A 2C1FA 4META 1AR72 4LBQD 3DUIA 1YXWA 4AXOA 1C8NA 3KB5A 3UKVA 2DUPA 3H1WA 4HPKB 4DXZA 3GALA 3MLLA 2NMNA 3SCGA 2YHJA 3E6BA 5GALA 1CJPA 2XLAA 1NLRA 2Z42A 3IPVB 4J6GA 3SH3A 3KZ4C 1BQPA 3AFGA 2VVDA 3BODA 1V00A 5D8AA 2OZJA 3KS7A 3THTA 4LBJA 2MEV3 2X5IC 1GBGA 5AC93 1PO23 1R083 3WQ1A 1WW7A 2DU0A 1ASJ2 2HWB2 5FCCA 3S0MA 2JE7A 4DPNA 2ES3A 3AYDA 2XWJB 1WBLA 1RINA 2P37A 3WG2A 2PHRA 2H0BA 1MR5A 1W6QB 3WD5A 3UV9A 1IPKA 2A6XA 4Q4Y3 3HIFA 1SLBA 5GLZA 3WINE 2EALA 1VJ2A 2R073 4EN6B 4WM8C 1KJLA 2ZGSA 4P9WA 4FO9A 1PK6C 4FPGA 3HD8B 3WW1A 2G9FA 4L9BA 2A75A 2UY9A 3D8CA 4KGQA 5B2GB 2AUYA 3LA2A 3P3PA 4JGYA 1OQ1A 1ZNPA 2SLIA 2VOWA 1WA4A 1ZYBA 2MEV2 3TAYA 3U11A 4FVVA 4LLOA 2N7GA 3RRDA 4Y22B 1Z78A 2AH2A 4GMP1 5GZFA 3NO8A 1OQDA 1NY71 3SCFA 2EAAA 2PLV2 2GH8A 1DQ5A 2R1DA 3NV2A 3EHKA 2WS91 2RS51 5JVVA 1ND3A 5GLTA 2EXKA 4AQ6A 1S0CA 2RMU2 4AEDC 2VGDA 4A7KA 2HWD3 3J26N 4K9SA 1CAWB 3AYEA 4CEWC 1DU3D 4GKXA 1RUI2 2ZKLA 4Y26A 4L8QA 3IDBB 4LULA 1QDOA 4WM7C 2G9GA 2WINB 2NYYA 1PO11 4IEQA 3HR9A 3BOPA 3FWEA 1OLQA 2Y26A 1S0BA 3TNQA 2AR6A 1WD4A 1W0OA 1X82A 3U0ZA 1NA1B 1H2KA 1RHI1 5AFEA 2HEWF 2R042 1XRUA 1DZRA 2GNTA 3LAGA 1CAUB 2ZX4A 1A3KA 4D7TA 4CP0A 5L7OC 1EV12 3N7MA 2B45X 3AX4A 4NWWA 2FMDA 4INDA 2P17A 1M06G 1JYCA 4I01A 1HRV1 3RYPA 3ZYRA 2WFF1 3WHTA 1VBE3 2RJLA 5EYYA 5FOBB 1JYIA 2K0GA 1LEMA 2XL7A 2E53A 3AP7A 3OD4A 5A33B 1N47A 2XJTA 3NSTA 4PLNA 1NCRC 1O5LA 2IXKA 5ABJB 2XKOA 5CFCB 1UL9A 4KU7A 1ZBE3 3D6EA 3L9JT 2FHRA 2XBO1 2W52A 4GWNA 1KS4A 4GB31 3KGLA 2LALA 1QJX3 4BM8A 4DINB 1AZDA 3FMGA 5BNNC 2JKBA 3MPPG 1GKBA 4YYOA 2IZWA 2WSVA 3H8UA 2WFPA 3DPRC 3WHUA 3VDDC 4DZGA 4IEOA 3FJSA 3RJ2X 3E6CC 1TME3 3LZZA 1YUDA 3N7KA 2ZTNA 3H9AA 2B39A 1ZZ7A 1XYNA 1NYWA 1PK6A 1UX6A 5GLUA 2IXCA 3VBUB 3ALQA 5C4WA 2GH2A 1VBE2 1WGPA 5H9SA 1R1A2 3S6PA 4A7YA 4LE4A 3H1MA 5GJ6A 2OW4A 1YYNA 4K1ZA 1LOBA 2E9QA 1ALYA 3HT1A 2FZ2A 3WDVA 3NWKA 4IEWA 3ZXLA 3SXWA 4QPGB 4JRAA 1GR3A 2WQ4A 4Q27A 3HT2A 4RS5B 4IEZA 4EN9B 2ARBA 4CDXA 4RHV1 2E6VA 4OI2A 5KHGA 4CZSA 2PHLA 1W6MB 5L36A 2AZ5A 3KT1A 3WP4A 1RUF2 1AR93 3LSDA 4I0AA 1YJKA 1YFXA 1WLCA 4H3WA 4RGGA 2YDEA 4MYEA 4QHBA 4AEKA 3PMEA 1W6OB 5GLWA 1MS0A 2CWSA 1HQLA 4KH9A 4B7KA 4COVA 5CBLA 4FTBA 2HKXA 2AREA 3VBSB 2DTWA 1RUJ3 2H0VA 4XDQA 2WFF3 5E16A 4F7ZA 5BNOB 1GZCA 3NVCA 1WMFA 4FAHA 1BKZA 1OA2A 3CJIC 1BBT2 4XBNA 3GZUC 1NQJA 4NWVA 2BQPA 3PJQA 3QLQA 4KQ7A 3MW3A 4ATFA 1IS3A 5L73A 1CD3G 4N7IA 4SLIA 4R8HA 4TLFA 2HWF2 3VHPA 2UWBA 1WMDA 1AF9A 2XHKA 4IV3C 2VECA 1DQ2A 5T55A 1H8TC 3K48A 4M01A 2PAEA 2QZ2A 2R063 4UXAA 2A6YA 4MV2A 1C1FA 4M3CA 1U5YA 3VKMA 1AXKA 3QBQA 2ZJCA 1ZZCA 1W0PA 4N9IA 3FE5A 3KD4A 1AL22 2CWMA 4DFSA 3M7AA 3PVOA 2O1QA 4LLFA 1VBC3 1EP0A 2A71A 2ZAAA 3J8F3 4Z8BA 3MIBA 1IQAA 4FQ4A 2GNMA 1QJX2 2RS11 3GNEA 2ZHKA 1KFXL 2WKKA 4RGAA 4AFBA 1SBFA 1ENSA 2BWCA 1ZBE2 2DVGA 1QGLA 1U0AA 4TYSA 1RUOA 2WA4A 3VBOC 1AYN2 4W6XA 1JUIA 1HRI2 1TME2 4AFDA 5JSOA 1PGL2 2FQPA 1LGNA 3IM0A 3WP3A 5CFCA 4QQLA 4YVWC 4G9SB 1AYM1 1AR73 3RYKA 4M0HA 4G4FA 1R1ZA 2Q4SA 3ZXKA 2R6QA 4NOTA 2Z2SB 4BYYA 1EPWA 2CYFA 4O9EA 3RJRA 2JX9A 1K5MA 4PLOA 3V56A 1GFF2 3WLUA 5HXVA 2DUOA 5I0RA 1W2UA 3KM5A 2W0XA 5KHJA 5C9AA 1K5MC 3W59A 2VPVA 2Z69A 2DVDA 3CF6E 1JXNA 3PMSA 2H6BA 2KXLA 1WCKA 4CDWC 4LE3A 4IEXA 4XOGA 4YW3A 5H9QA 5HCAA 2HWC2 3AMPA 1DZTA 2R0FA 2XLGA 1TMF1 3AB0A 3ZYPA 2BNNA 4JGZA 1L3JA 1EAH2 4XYXA 3OGGA 1R081 3WXPA 4IESA 3M3OA 5AC91 3H7YA 1BMV1 2CV6A 3OPZA 1MEC2 3VKFC 1AR81 1JOJA 3LOBA 4GH4C 2ET7A 3P3NA 3HN1A 4K6BA 5T5OA 2VW2A 1PVXA 3MIHA 1OOPB 1WBFA 1GQGA 2RE9A 3IDCB 5A32B 4DS0A 4YM3A 3J9SA 2ILMA 4PIXA 1N3PA 3VBHB 1U5XA 2UWAA 1KS5A 3CJIB 3RG0A 2VH9A 5F6LB 3ZSLA 1LB2A 3KLSA 3OBTA 2IXJA 2VUJA 1WUVA 1G9AA 1HXS1 4HT1T 1D4VB 1H1IA 1V6OA 3A0NA 1VAVA 2QDRA 3JD71 1EY2A 3OF1A 1YJLA 4HANA 3E5XA 4NR1A 1J58A 1BEV3 4RQPA 2A6ZA 1ENQA 1LOAA 3X29B 1QNWA 5TSWA 3K51A 5ACA1 4GB33 4LO4B 2XH6A 1UPSA 4Z82A 1RUD1 5JWPA 2R062 4LHNA 4N53C 4IEYA 2RS32 5T3NA 5J37A 1ZBE1 2WJSA 4E2GA 1CJDA 3TN92 1I1EA 2TUNA 5J96B 2WQZC 4FPJA 1ULFA 5EFUA 2QZ3A 4Q8LA 5BNOC 4CDUA 3LCPA 2AGSA 1JN2P 4IXLA 5K7PA 1AJOA 4RS5C 4Q0SA 1E57A 3VBRB 2HWE1 4QPGC 5FPZA 3AYCA 4E2QA 4HKWA 1Z7S3 4PJYA 2CAVA 2WLPA 3VBFC 1Z0HA 5LRRA 4K20A 2CTVA 1LOFA 1NLSA 4AFAA 4R9AA 3SHRA 1OSGA 4MUVA 1UPIA 4WVMA 2PHDA 1JH5A 1B35C 2DWRA 4XQDA 4Y1YA 4Z1VA 4AQTA 3B02A 4ISQA 1IHMA 4RR3B 2PAKA 2UWCA 1VBB1 1UMZA 4P9JA 4EN0A 3INAA 1AR92 4MGKE 4HBNA 5I0UA 4ZU4A 4BLIA 2ZGMA 1PZ8A 1NCQA 4RR3A 2Z79A 1S0EA 4IEVA 3WDXA 3HBZA 3H0OA 1LOEA 3H3ZA 5EJ3A 1BVP1 4WVMB 1PM7A 4AVCA 1RB8G 5FMOL 4E2SA 4KG8A 4HETA 2ZPXA 2VQ0A 1PNFA 4KWLA 1S1AA 1AYM2 2ZMLA 3ZFFB 4IV1B 4R4ZA 5DUWA 2OUJA 5A33A 1UIKA 1LU2A 4HK8A 1COV2 4WBBA 4XXPA 3ZFEB 1NZCA 2NN8A 4HKOA 1UCXA 1R1A3 3IWZA 3ILRA 3VBHC 5BNOA 5K0UC 1C8M3 5FREA 2GU9A 5BY5A 4C1XA 3SNMA 1OOPC 2VNGA 1OFSA 5D8AC 4AEMA 5I0TA 5CFCC 1MEC3 2VOVA 2ZOEB 3MIDA 2PA7A 1W6OA 1FMD1 4XMAA 1N3QA 1WW4A 3KGZA 4FPFA 1DBNA 1R093 2A3YA 1RUG2 1N1SA 1DGRA 1RVF2 2ZGNA 5T5PA 1UKRA 4Q4X3 3JD72 2PFWA 5BNNA 3VZNA 4D69A 1MS1A 3OTFA 1O4ZA 2CGPA 1RL3A 4W65A 1RMU3 4AEDA 4CDXB 1PO21 1XXNA 2LTNA 3VDDA 4CEWB 3CJIA 3A4UA 1SDWA 5C33A 1QJU3 3VBHA 5IK4A 4XTMA 1CN1A 1LHNA 4BQ1A 4I0BA 5CIRA 2EXJA 3W58A 3RQ0A 3CO2A 3RZZA 3KCXA 5KWRA 1C8M2 2RS13 4NN0A 4KBBA 1ZBA3 4LO7A 2XJRA 2XWBB 2GDFA 2RS33 3NV3A 4YGEA 2GMEA 5J36A 1PVC2 4GXLA 5BUVA 3O0VA 3WUDA 5JZGA 2MNGA 3IBMA 5CVRA 1B09A 1EAH1 4JGYC 4ITCA 5EXOA 2D6PA 2FMYA 4I09A 4R9DA 4XFBA 2YZ4A 1MVEA 1DGRN 2D6OX 4YW2A 4FOQA 1ZM1A 1AR61 1HV0A 4UW3A 3WNXA 1RUH2 4A2UA 3AJZA 2XJPA 1J59A 1RUH1 4OHXA 3ILNA 3WX5A 1PIV2 3AXEA 3R6SA 4FPEA 4AGGA 1D2SA 1DGLA 3TOJA 4AVBA 4GMP0 2ZBJA 2K9ZA 3N35A 4BH9A 1IZ3A 1Q8SA 4AI0A 1AL23 1O3TA 1VBA1 5JZGB 3MDPA 4R4XA 1REEA 1QDCA 5FLHA 1LOCA 4GQ7A 5DZGA 3I8TA 2B8MA 3NV1A 1VRH2 3M70A 4FTEA 5IK5A 2JD4A 1O7FA 1S0FA 4CEWA 2H6CA 3WOGA 3WQ7A 3SH5A 2BYVE 2D3RA 1CESA 3M3QA 4OFGA 4QPYA 1PZ9A 4Q4W3 4L99A 1ZX5A 1WLTA 4LNVA 4YVSC 5KXDA 1KFUL 2MPFA 4HKLA 4Q1PA 3KT7A 2D6NA 1TEIA 4XIKA 1MS5A 3RNSA 3AMHA 3VV1A 1AHSA 4FPCA 5I8SA 4ONUA 1LCLA 1FMD2 4WZFA 1CAVB 1RUF3 3AZWA 3OJBA 1ASJ3 1QJY3 2HWB3 3C3VA 4OI0A 4AVSA 4PIZA 2X5IB 2QNKA 1AR82 1MZEA 3KQRA 1IKQA 3MEPA 4W6YA 4Q1RA 1SFNA 4LEJA 4QGNA 5HCBA 1TMF2 3WDTA 2PAMA 1YI9A 2UY8A 3TYJA 1H8VA 5KXBA 4Y1XA 3MGUA 4YW1A 2A6VA 4YG6A 4WV8A 5DDJ2 4AEJA 4R52A 2D97A 2PHFA 5GM0A 1ND3B 4JDNA 1HIXA 5T50A 2A7AA 3OD0A 1CR7A 3U10A 1FOD2 4JTOA 1APNA 1DQ6A 4IV1A 4YARA 2ZZJA 1EAH3 4C0BA 3BTAA 1Z7S2 4AK3A 2EA7A 2QQPA 1D4M2 4QMAA 3FUQA 4MXVA 4D3WA 4Y22A 1QNYA 1UZYA 1F5FA 3B01A 5T52A 2D43A 2K2SA 4I30A 4R9BA 4MH0E 3WP6A 4MXWB 3LOIA 4XBQA 1RUC3 4YLZA 5C4WC 1OMIA 3HQXA 1X8EA 3ZFGA 2JEMA 3VBUC 5K0UB 2RR13 1H1MA 1G6NA 3JB8A 4EJRA 1UF2C 1J3RA 1H9WA 1H9PA 1VB4A 1XE7A 4AWDA 5JMCA 1H0BA 1AR62 3TRSB 4XILA 2LUWA 4COZA 4CYDA 2BWAA 2WZR3 4S2HA 3HMYA 5KC5A 2BFUS 2BGCA 5C8WA 4HN1A 3NL1A 5BNPB 4Y5Z0