1LESA

Lentil lectin complexed with sucrose
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
181
structure length
181
Chain Sequence
TETTSFSITKFSPDQQNLIFQGDGYTTKGKLTLTKAVKSTVGRALYSTPIHIWDRDTGNVANFVTSFTFVIDAPSSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKEYDKTSQTVAVEFDTFYNAAWDPSNKERHIGIDVNSIKSVNTKSWNLQNGERANVVIAFNAATNVLTVTLTYPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR, molecular modeling, and crystallographic studies of lentil lectin-sucrose interaction.
pubmed doi rcsb
molecule tags Lectin
molecule keywords LENTIL LECTIN
total genus 27
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature
pdb deposition date 1995-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lesA00
1SACA 2AENA 3MW3A 2A6XA 3ASIA 4R9DA 2YY1A 3AJYA 1AXZA 4DFSA 4XHXA 1W6PB 2EXIA 1BKZA 4XJUA 2OUHA 4Y1VA 2ZGLA 3AYDA 5T50A 3B69A 1R1ZA 3ATGA 5DG2A 2A70A 2D3RA 3PVOA 1LOFC 1MS9A 1S1AA 5T5LA 5H9RA 1MZ5A 4M00A 3OY8A 4AVTA 1Y7BA 2DVFA 4Y20A 3SITA 2R0FA 2ZMKA 2GMPA 1JUIA 1WBLA 2ARXA 5H9QA 3ZSJA 1G9BA 4BMBA 2A3WA 1CIWA 1G9CA 1DLLA 3ZVXA 3WOGA 4XE9A 1AXYA 2WSVA 4YW2A 2AH2A 2ZHMA 5CA6A 1S0CA 2DTYA 2DTWA 2EF6A 4YLZA 2SBAA 3O0VA 3NV2A 4L8QA 5IK7A 2UURA 3ENRA 3RSJA 1DYPA 1JOJA 1A78A 5BYNA 3Q9OA 3A0KA 2CYFA 3V0BB 3RS6A 5GZEA 2ZGTA 1W6QA 5F5QA 2JKBA 1LOFA 1LU1A 4MYEA 1J1TA 4Q26A 4ZXKA 1Z78A 1WW6A 3N7LA 1W6OB 3I4IA 4D69A 3U4XA 4XJZA 2ZHLA 4CTEA 1SLCA 3DGTA 1JYCA 1AX1A 2D6OX 4GA9A 1SBDA 2D6NA 3KM5A 1BXHA 5JMCA 1QDOA 2UWAA 1LHWA 3O12A 1DQ0A 2ENRA 2JE9A 4YM0A 2TEPA 3ZSLA 2JECA 4LBOA 1I3HA 1GZWA 3POSA 4Y1UA 2A71A 4UW3A 1DZQA 3PMEA 5JVVA 1X50A 1WD3A 1DIWA 4AGRA 1MVEA 1HQWA 1RIRA 2ZGNA 2DUQA 1IKPA 1A8DA 3VKLA 4CZSA 4XIKA 1GKBA 4P9WA 4BM8A 4YZ1A 3RRDA 2VXRA 4NOTA 4XTMA 1A3KA 4XBQA 1S0GA 3IM0A 3BTAA 3O0WA 2D6KA 4LBMA 4C1XA 1AX2A 4YFZA 4YW3A 5JDBA 2EXKA 5CAZA 3T2TA 2VW2A 3VV1A 2FMDA 4FP2A 3BOPA 1N1SA 3WZ1A 2AREA 4F83A 1SBEA 1V6NA 4Y1ZA 3AXEA 1DQ5A 5H9SA 1NLSA 2EAKA 5IT6A 2D6PA 1W0OA 4LBQA 4H55A 2A6ZA 2ZGSA 2ZMLA 4BOWA 4DS0A 5CB7A 3LSDA 4KBBA 4XILA 5GLZA 2ZZJA 1LECA 3AZYA 3R05A 2P3JA 5DUVA 4UW6A 4Y1YA 1LEDA 4AVVA 1QNWA 1VAMA 2PHFA 4WVVA 3POWA 5HCFA 1D2SA 1FV3A 4GKYA 4U36A 3D6EA 5EWSA 4FPGA 2D44A 1G9AA 1QOTA 1LODA 3RMYA 3AYEA 4K21A 1BJQA 1UX6A 4XTPA 1N1TA 1N3OA 1SLTA 3M2MA 4LBNA 1CESA 4C1WA 1JXNA 2EALA 2ERFA 4IQPA 4TZDA 1Q8OA 3T1LA 1DHKB 3ZXFA 1KITA 1GNHA 1KQRA 3M3CA 5EYYA 2Q5TA 3IPVA 3FLRA 3FLPA 5JOZA 2NM1A 1CN1A 4P9XA 1UPSA 2DVAA 2ZGUA 4K1ZA 1LHOA 1AXKA 4Y22A 4ISQA 2KM2A 5L73A 1MS0A 3AFKA 4LBLA 3NV3A 4FOVA 2YV8A 3L2YA 2PHWA 2VH9A 4DRRA 1D0HA 1BZWA 3RQ0A 2LTNA 2PELA 2Z42A 2P37A 4RL7A 4BPZA 5EXOA 4FP3A 1UZZA 1IS5A 2LALA 5CNAA 1DYKA 3ZXEA 1WW5A 1JBCA 4AYUA 4BLJA 3SH3A 3AP5A 3AJZA 1DBNA 1QF3A 4WVWA 1N1VA 1CPMA 4DRVA 3JUUA 4XYXA 2UU8A 3QLQA 4UW5A 4PQ9A 5IK8A 4NO4A 1DQ4A 2GMEA 1N1YA 5HCAA 4ATEA 4YW4A 3GNEA 5GLTA 4M3CF 1ZA4A 2PHXA 5H9PA 1GBGA 4BLIA 3SNMA 3WHUA 4YM3A 3ZYPA 2CWMA 2CY6A 2WT2A 4FPOB 3WG4A 3JU9A 2GALA 4JC1A 3AX4A 1W6NB 3VKOA 1UZYA 3ZXJA 1H9WA 2JJ6A 2P3IA 5EYXA 2GNBA 2VW0A 1YXWA 2A7AA 2GN7A 5SV8A 3AP9A 2EIGA 5T5JA 3VUOA 5GM0A 2PHRA 2A3YA 1Q8QA 1HDKA 3V0AB 3SLIA 3NV4A 1LHVA 4HL0A 1SCSA 4YM1A 1C1FA 4UW4A 2DV9A 2D7FA 2ZHKA 4SLIA 1IS6A 1QGLA 4BQ1A 1C57A 1MS4A 2ZGQA 3OY8B 4YZ2A 1V6OA 4XJAA 5FREA 1QKQA 1Q8VA 3ZPYA 1KRIA 4XZPA 3WG2A 1V6MA 4XBNA 3WDTA 2W08A 3ZYRA 4XBLA 1W6MB 4FVVA 5DZGA 2RHPA 3O5SA 4Y1XA 5T55A 4JCKA 4Q8LA 1VLNA 2DYCA 1H30A 1GZCA 1B09A 1ENSA 2CL2A 1AZDA 1Q56A 3FBYA 3LCPA 2OUJA 5E89A 1APNA 3ZXLA 3USUA 4YG3A 1LEMA 3IN9A 4YG6A 1GV9A 1V6IA 1VIWB 2C9AA 4P9YA 5JOXA 2EXJA 4YGEA 4AGGA 3WDYA 1N3QA 3AP7A 5T5PA 1CQ9A 1ULCA 5F9TA 2DVGA 1W0PA 5IUQA 3HN1A 3AZZA 3BODA 4ISRA 2GNTA 5GZDA 3V65A 1WW7A 1GZ9A 1CPNA 2VW1A 2R49A 2WKKA 2WT0A 4Y24A 1LU2A 4PBOA 1U0AA 3MW2A 5GZCA 4Q1PA 3B00A 4GALA 2PHTA 3O0XA 4FQ4A 2ES3A 2ZGMA 3APBA 1LGNA 1HLCA 3B01A 2DU0A 2ZBJA 2YMZA 3WLUA 1MZ6A 1QMJA 1UKGA 3IMNA 1ENQA 1LULA 3T1MA 3OBRA 5IK4A 1CR7A 1LHUA 2DU1A 3M1HA 5DUXA 2FHRA 2UWBA 2I2SA 2WLQA 1JHNA 1FATA 1ULDA 3WHTA 2A6YA 5KXCA 5T52A 4XJWA 3AK0A 4K1YA 4R9BA 3V64A 4ASMB 2W68A 1WLCA 1AX0A 4XMAA 3ZSKA 1F31A 1V6JA 2D3SA 1AJOA 3B9CA 4LBQD 1O4YA 3AXDA 1IS4A 3W59A 1SLBA 5KXEA 1WD4A 1WUVA 4FQZA 1PZ9A 2W39A 4YFWA 5GLWA 2VUAA 1FNYA 3WCRA 2WSUA 1YRZA 5JLVA 3V0BA 4DPNA 2A6VA 5GLVA 2JD4A 2OVUA 1VAVA 3OJBA 3SH4A 1SLLA 1KDMA 2E7QA 2E7TA 3SISA 3OYWA 2DWRA 1OQ1A 2DUOA 2YXSA 2CWSA 1LOGA 1KDKA 1W6OA 2DVDA 1V6KA 2NMNA 1G7YA 2XG3A 2ZGRA 4FOQA 1OFSA 2NMOA 1LJ7A 1GSLA 4YW5A 2EXHA 1IKQA 1W6MA 3H0OA 1GYKA 5T5OA 1QDCA 3UJQA 2P3KA 1ZM1A 1QNYA 1QOOA 3N7JA 3OBTA 1GZWB 2V5YA 4Q27A 1F9KA 4AGVA 1AJKA 3W58A 1N47A 1Q8PA 5DXDA 4YGCA 1GNZA 4LBJA 4YZ3A 3WCSA 2AGSA 3N7MA 4PCRA 1HQLA 1V00A 2OW4A 1LOBA 3ILRA 3A4UA 2DVBA 5GZFA 1Z0HA 2R0HA 3UK9A 3VKMA 4GWNA 3SH5A 2ZKNA 3BIWE 4HANA 1N3PA 1MS3A 4Q1RA 1FAYA 2JDZA 3ILNA 4FPCA 1FYUA 1LHNA 3RG0A 3UL2A 1VALA 1FV2A 1AVBA 1LENA 3WDWA 1S0DA 4FPJA 1C1LA 4YZ4A 1W6PA 3WDVA 1WBFA 2D3PA 2GNMA 3IKWA 2ZGPA 3GALA 3B3QE 1S0EA 2AYHA 1LCLA 2AUYA 2ZGKA 1OKQA 1DQ6A 2R1DA 2NYYA 3MW4A 1SBFA 4R9AA 2AR6A 1NXD1 1S0IA 1WCSA 4LBKA 1PZ7A 2W52A 1MACA 3WDUA 1KJRA 1BYHA 2E6VA 2B7YA 2VU9A 4XJ9A 2XB6C 3CNAA 1TEIA 3POYA 2UWCA 2ZMNA 3ZXKA 2ZHNA 2GMMA 3QCWA 3WNXA 3C2UA 3AYAA 5GJ6A 1QOSA 3DUIA 3N35A 4Q8KA 4I30A 1ONAA 1LGCA 1CONA 2G4IA 1O4ZA 3WG3A 1UL9A 1AF9A 2E51A 2ZAAA 4GKXA 4FPYA 1FX5A 2E53A 4M3CB 4XIOA 5HCBA 3WV6A 4TYSA 2VY0A 1JN2P 1DQ1A 3I8TA 4M3CE 5GZGA 1FNZA 2GN3A 1W6QB 3M3QA 1MVQA 4FOWA 5E8AA 3TB0A 3UJOA 1XQNA 4FPEA 2R16A 1GLHA 1LTEA 2HYKA 5E88A 2SLIA 4XJ8A 3USUB 3WUCA 3M3EA 3AP4A 2ARBA 2P2KA 3MEPA 1ULEA 2A75A 4RA0A 2GDFA 1LOCA 2NZ9A 2WNEA 4Y22B 5FRAA 4PBPA 4YZ5A 3D4KA 4XDQA 1JYIA 3AP6A 3NV1A 4P14A 3M3OA 1UN1A 4BMEA 4Z8BA 1YIFA 2PHUA 1ENRA 1IOAA 4FPFA 3OGGA 3INAA 2D43A 2C5DA 1SLAA 3WVJA 2R1BA 3KQRA 1MS1A 4GWMA 1G9DA 4XOGA 4AWDA 1ULGA 1UMZA 4ZKTB 4W65A 4XXPA 3PJQA 4R9CA 5T54A 4M01A 3PVNA 1WLWA 4FPHA 3VKNA 4XMIA 3OPZA 1H9PA 1DFQA 1SFYA 4FPKA 1F5FA 1SCRA 1V6LA 3VKFC 1CVNA 3WG1A 2BQPA 1LOEA 4YG0A 1DQ2A 4GXLA 5DG1A 1Q8SA 3FFZA 2NP0A 3V0AA 2A5ZA 2A6WA 3FUQA 1JW6A 1SLIA 4Y20B 1LGBA 4YGDA 2YROA 1QU0A 3AYCA 1YYNA 3MPPG 4FOYA 4LBQB 1MR5A 1W6NA 1I1EA 4ITCA 4JRAA 1WW4A 1IS3A 1LESA 2WJSA 4FPLA 1EPWA 2WT1A 2DUPA 3PVEA 3LSEA 1ULFA 1UAIA 4K20A 1CJPA 4AVSA 3RMXA 3A0NA 3FLTA 5CBLA 3WDXA 2JE7A 5DUWA 5GALA 1G86A 2D6MA 1MS5A 2NN8A 2P34A 3AZXA 4M3CA 4Y26A 2GNDA 2YZ4A 5JOWA 4WZFA 4PF5A 5KXDA 5IK5A 3R4UA 1GANA 3IPVB 3AZVA 4U2AA 1RINA 1LOAA 4YM2A 5DZFA 4OZXA 4WV8A 2ZA9A 4CRQA 1WLDA 2V73A 3OYWB 1GICA 3ZSMA 5GLUA 5JOYA 4YGBA 1URXA 1PZ8A 3N36A 2DURA 3TAYA 3N3HA 3WUDA 4DQAA 1HKDA 1BQPA 1G9FA 1S0JA 3NWKA 4YW1A 3N7KA 5DZEA 1S0BA 1S0FA 1YO8A 2WQZC 2ZABA 1DGLA 2D6LX 2A3XA 2CNAA 2CTVA 5DUUA 1KJLA 5AVAA 3AZWA 3D5OA 3R4SA 1G8WA 1YI7A 2ZACA 4ATFA 5LK5A 3ILFA 2ZGOA 3FUOA 2H0BA 3HR9A 5KXBA 4Q2FA 1C4RA 1RITA 3HMYA 4XXAA 4XHBA 1MS8A
chains in the Genus database with same CATH superfamily
4XW3A 2QFEA 4YVSB 5DAVA 3MW3A 5LBEA 1JI6A 4R9DA 3VD4A 1QJX2 3NW4A 4Z82A 1J59A 1AXZA 3MHZA 2WA4A 3ZFGC 3SEPA 4JQRA 1BKZA 2OUHA 1W90A 4QDRA 3N9QA 3AYDA 3B69A 2PFWA 4B1LA 1YLLA 1PO13 4IXLA 4CXXA 4X6RB 3NNLA 4ZZ5A 1M06G 1LOFC 4JGYA 4AFMA 1DZRA 1OUXA 5T5LA 4YW7A 4XF4A 1VBC3 2G9FA 3OGRA 3OY8A 1SPPB 3AMMA 1QHDA 2DVFA 2JXAA 2WC2A 5CYYA 3SITA 4BH9A 1JUIA 1NA1C 1WBLA 5H9QA 5IVCA 4E2GA 3K77A 3KV6A 2Y8KA 1J83A 4XDPA 4IW3A 1VAKA 1G9CA 3VDDA 5FPBA 1OVPA 1CZTA 1US2A 1S0CA 1REDA 2DTWA 3J7LA 5F6LB 3H8RA 1K5MA 3RSJA 4BISA 1JOJA 5FYCA 2PHLA 4PIZA 4CU8A 2YU2A 3BTZA 1QXRA 2CYFA 3V0BB 2ZGTA 1W6QA 4QPYA 5FYSA 4Q26A 3VBHC 3SQOA 2OQ6A 5L7OC 4URAA 1W6OB 3IBMA 3TNPB 2XXZA 5F5AA 4D69A 5FO9B 2ZHLA 4CTEA 2D6OX 1SBDA 4CDXC 1ZZ8A 2LRPA 1OQDA 3CJIA 2GC3A 4Q4X2 1LHWA 3O12A 1DQ0A 4QX8A 5D8AB 2FCUA 3IIIA 2G19A 1GZWA 1OMIA 3POSA 4PDWB 1H8TA 4UW3A 2X53S 1DZQA 2ZX1A 3MIFA 3PMEA 5EJ3A 5A7WB 3I97A 4ONUA 3BTYA 1DIWA 3VLBB 1MVEA 4AGRA 5C7GA 4Q4X1 1X9PA 3C8XA 1PVC3 3RNSA 3K46A 1RIRA 2JDMA 4MUVA 2DUQA 3VKLA 1HX6A 1Y4WA 5CFDB 3DPRB 4XIKA 4ES9A 4NAOA 3RRDA 2VXRA 4NOTA 5A1LA 2VOXA 4NAMA 1A3KA 5FQ0B 2KR2A 1S0GA 3BTAA 3O0WA 1S2BA 4LBMA 4C1XA 1AX2A 1K45A 1US3A 1XYOA 1PIV2 2PXJA 2VW2A 3PTRB 3F95A 4JV4A 3T2TA 3WW3A 1DGWX 1NCRA 2VCMA 3R0RA 4V2WA 1N1SA 4RQPB 4F83A 4Y5Z0 1H1AA 3AXEA 4KWLA 2Q8CA 2CDPA 2VMEA 4LBQA 3MFAA 3JB8A 2A6ZA 2ZGSA 3GHMA 4RR3B 4XILA 5FXWA 4EN7B 3AZYA 1W9WA 3PURA 4UFKA 1NOVA 1XNAA 3ZKUA 1UOGA 4LHSA 4QPGB 4UW6A 4OUSA 4Y1YA 5CKNA 1QNWA 3POWA 3BU0A 1COV3 4HG6B 4HKWA 4S2FA 1D2SA 3U14A 1ZBA3 3NJXA 3E5QA 4IEVA 5JI7A 2D44A 1RUJ1 1G9AA 1S55A 1LODA 1UCXA 3AYEA 1IPSA 4Q4W1 2RJ2A 3BGAA 1AR82 1SLTA 3HT1A 1K42A 2N7GA 3AVSA 3RYRA 3ST7A 4C1WA 2ERFA 4IQPA 1Q8OA 3T1LA 1DHKB 4UBHA 1KQRA 3ZN6A 5EYYA 2B8MA 2Q5TA 2IXIA 5JOZA 1OBNA 4HVRA 4YVWC 3LFIA 1UPSA 2DVAA 4H7MA 2HEVF 4Y22A 2VNRA 3ZMOA 1K3IA 3NJZA 3L2YA 5CFCC 3T0DA 5A7NA 3GXUA 3AL6A 1EAH2 3N4MA 2JDPA 4X8PA 1JYXA 3JCIA 3ZDSA 1H1MA 4RL7A 1SDWA 4AI9A 1XE8A 3AKSA 5EXOA 3ZM8A 4C0HA 4GMP0 3ZXEA 1WW5A 5C3OA 1POV3 4EJRA 4LA2A 2W95A 4C90A 3J8F1 4LPLA 1RVF3 1PMHX 2CGNA 1CPMA 4DRVA 2RR11 5JPNB 1XSQA 4Y5TA 4JRLA 1IQAA 1SHWB 5IK8A 3IB3A 4ATEA 1UXZA 4YW4A 4M3CF 4AI1A 2AACA 5H9PA 3ZXDA 4E2SA 2WAAA 2Y64A 4HKOA 1RUNA 3SNMA 2ZX4A 1IG0A 4A44A 1QJX1 5AC92 1PGL2 4D94A 2KXLA 1SEFA 2XBO3 3JU9A 2XL9A 3LDKA 4JAAA 2P3IA 3LEGA 1YXWA 1PMIA 2A7AA 2GN7A 3HT2A 5SV8A 5GM0A 2PHRA 1W8NA 3GM8A 1Q8QA 3H1MA 4HPKB 3LA2A 5APAA 1NCRC 1LHVA 1X33A 1YJKA 3H3UA 1SCSA 2ZEYA 4YM1A 1C1FA 4UW4A 2P1BA 3VHPA 3VZJA 2DV9A 4IV3A 4QDSA 4IE5A 1QGLA 5FZ1A 1CJDA 1AL22 1QJY3 3OUHA 3ZYGA 2ZGQA 4COUA 5A3TA 5ABJA 4FO9A 4B4PA 5BNOB 4IE4A 4AQSA 5F37A 1XPWA 1RUG1 4A7KA 2BV4A 4MADA 2PLV1 2EVXA 3AKPA 4O65A 3AMNA 3RZGA 4V2VA 4XBLA 2FDGA 4LE3A 4FVVA 5DZGA 2RHPA 4C8DA 3A21A 4QHZA 3EHKA 1UY3A 2JD9A 2BBVA 4P9JA 2QQNA 2PLV2 4Y4YA 4QQHA 5FKCA 3MIEA 1Q56A 2Q1MA 3LCPA 5A3OA 4J6GA 2CU5A 4IESA 2PAEA 3HD8B 4YG6A 1GV9A 5FO8B 4Q4Y1 4COYA 3WP4A 1BK1A 4NHXA 5DDJ2 4AGGA 3WDYA 2W5FA 1XNTA 2BFUL 3BN6A 3THPA 1GWMA 4NPLA 1S2EA 4R8HA 4LITA 5FWEA 2GNTA 4CDWC 4CCLA 5BNPC 3V65A 1A6CA 1TZOA 1WW7A 4COWA 1CPNA 1L7RA 2VW1A 4E8CA 1ZRDA 1OPOA 4H2AA 4CDQA 3E1F1 1B35C 1LU2A 5FK7A 4KWKA 4N53A 2VGDA 3APBA 3WW1A 1F35A 2BZDA 5C9AB 3JZVA 3PUAA 1VBD1 4L97A 4WM8C 1GWLA 2EAAA 4UFLA 4AI3A 2WFF1 2YGMA 5SV5A 5F7UA 5FMDA 1UKGA 2FDJA 3NMBA 1LULA 1WCKA 4OHZA 1P8JA 1RUJ3 3OBRA 3T1MA 5IK4A 5A32B 5DMYA 2R073 2WLQA 2L9LA 1UYZA 1W3XA 3WNLA 1FATA 3ZYJB 1VRH1 3S57A 3U78A 1EAH3 4R9BA 5IAXA 1QH7A 2W68A 1WLCA 4CXWA 2WNUA 2HJIA 3WQ1A 2BTVC 3CKHA 4GIQA 4W4ZA 1C5IA 2JDYA 1WWYA 4H3WA 2B9VA 1TG7A 3H9AA 5FV3A 4PIYA 5KBFA 1W04A 3AM2A 3POJA 3W59A 1SLBA 4CEYA 4UFMA 1PZ9A 4P9GA 4YFWA 2ZX3A 5HV0A 3WCRA 2WSUA 1YRZA 4RS5C 1JZ4A 1JYTA 4DPNA 2A6VA 4E4SA 1W8WA 1SZBA 1VAVA 3OJBA 4MLOA 1SLLA 1KDMA 2E7QA 2E7TA 4Q4Y2 4PLOA 4XABA 4XCBA 2YXSA 5F3EA 2VMFA 1UU5A 1KDKA 1SMVA 2O8QA 1E5IA 1V6KA 4Z1VA 3HQXA 3KSCA 3I2FA 1OFSA 2VQAA 1OT5A 1LJ7A 1GSLA 2D5HA 4EWDA 3GZTB 2VTXA 4DXRA 3UJQA 1H8TC 1YQ6A 2JB8A 3EBRA 3ZXGA 1CIYA 2F4PA 3P1IA 2W2IA 3T2OA 1D2QA 5CU1A 1O59A 4V1PA 5KHKA 1Q8PA 1WCDJ 4LIVA 3WCSA 1QH6A 1UOBA 2ET7A 2YBSA 3I54A 2OW4A 3MPBA 4TSVA 3MIGA 4BB3A 2VTXJ 1UY4A 2DVBA 3VBSA 2QQMA 4AI0A 5C6CA 4PQQA 3UK9A 4GWNA 4LXLA 3VB9A 5CISA 2Q8DA 3ELNA 3LPFA 3SKJE 4LUKA 3VHNA 2GC2A 2QQUA 1JS9A 2XHNA 2WZR2 3UL2A 2P6HA 1R1A3 1FPN3 1GQPA 2K9ZA 2Q0AA 4OMCA 1D4VB 2FZ1A 2W94A 5JZGB 5J37A 1W6PA 1W9FA 1WBFA 3JQWA 2GNMA 4PLNA 4BXFA 2RDNA 5FQ0A 2FDKA 2ZGPA 4DNYA 5AC91 1LCLA 4HONA 3ZOIA 4DEVA 1OKQA 1DQ6A 5LA9A 1SBFA 4QB1A 2AR6A 2Y6HA 4CE8A 4GQ7A 2B7YA 2XKOA 1C8M2 2BW8A 4XJ9A 5A33B 1PM4A 3M7AA 1AYM2 4CUAA 4LEJA 3OCPA 3VBOB 4DMIA 1HN1A 2QQPA 1AL0G 1MQTB 2VCCA 2GU9A 3LFMA 3ZXKA 2VQ0A 2GMMA 2ZHNA 3MIHA 2JG9B 4ZS3A 3HQUA 5GJ6A 5FJKA 2ARAA 3N35A 3TN92 3WSOA 1AUYA 3KT4A 4I30A 4BQWA 4QPGA 5D1IA 4GKXA 3CQOA 2BFUS 4FPYA 2E53A 5HCBA 4CEYC 2XGXA 5EIYB 1NUKA 4IEWA 1YQ2A 5DABA 4EYUA 1DQ1A 4M3CE 3ZO0B 5BNNA 2WNVC 1MVQA 4EN6B 5E8AA 5FY1A 3OPWA 3PMSA 5IJRA 4LKDA 1GOHA 2X05A 3ACHA 4RGKA 5LBBA 4AE2A 1IPJA 4BXSV 1BVVA 2AEYA 3BVCA 4QPIC 2HYKA 3A7QA 3IWZA 4AFBA 3M3EA 4DUWA 4KGQA 2ARBA 2PHDA 3FL7A 3MEPA 1RUI3 2GDFA 2HLEA 2NZ9A 2WNEA 3KT1A 4Y22B 4MZUA 4YZ5A 4PI0A 1H2MA 2VMGA 1H6XA 1Y3TA 1JYIA 4AHZA 1OA4A 1KFUL 1RHI1 4QKBA 5KHGA 4LO8A 1YIFA 1ZX5A 2XJUA 4MXVA 2PAKA 1ENRA 1IOAA 4FPFA 4LR4A 5FZFA 3WVJA 2R1BA 3BU7A 4Q0QA 4YW6A 1G9DA 4XOGA 4AWDA 1ULGA 2QDRA 1AR83 1C8M1 1ZBE1 4XXPA 3PJQA 2OPWA 4M4RA 4J1XA 2QDNA 2Y34A 5IWFA 2VOTA 1FPN1 1WLWA 3PVNA 4FPHA 4KNCA 3WY6A 4AF9A 5LW9A 5FP4A 3O1MA 4ZXEA 1I9RA 3KCYA 4FPKA 1COV2 1F5FA 1WZXA 2GP5A 3VKFC 1J3PA 2XJTA 1W99A 1C3HA 4NWWA 5FLJA 3O1TA 3K75B 1V9U2 5JXJA 2A6WA 3FUQA 1RXFA 1HJGA 1HXS3 2VZQA 3E5XA 2WO1A 3GBFA 3Q8BA 2VR4A 4GAZA 1DF0A 3M70A 1POQA 2BWAA 4K6BA 3LDRA 3EO6A 4ITCA 4JRAA 1XOYA 4XF0A 1Q3EA 1CZSA 3W21A 4QPIB 2W1UA 3JBG3 2DUPA 3PVEA 3RWNA 3KB5A 3K48A 4BWOA 1E5SA 1ST8A 4J1WA 4AEKA 5FPXA 1GNYA 2WNVB 1PO21 4X6QB 4AAPA 2RR12 4MV2A 3Q8FA 1MS5A 2NN8A 2P34A 2WRAA 3NNMA 4IE7A 2YZ4A 4SBVA 1UO9A 3KV4A 5JI9A 1W28A 1GQGA 4NHYA 1D4M2 2QCSB 1ND3C 3DF0A 4U2AA 3IDEA 5IK5A 1X82A 4CA9A 2VTFA 4GB33 4TN7A 2ZEZA 4XUPA 3UGHA 4CRQA 2R32A 2V73A 3OYWB 3ZYIB 3I3QA 5GLUA 2IXLA 3VBOC 5JOYA 5JMOA 5LA1A 1RB8G 5T54A 2GAUA 1UIKA 1HKDA 1BQPA 4GD4A 1G9FA 3LOBA 2R30A 3NWKA 3P6BA 5ACA3 1X8EA 5DZEA 1S0BA 2GC1A 4DIQA 1NXMA 2XWJB 4CDUB 2D97A 5DUUA 2XLFA 3VBFB 4JKMA 3WP6A 3BUCA 3AZWA 2VXJA 3D5OA 2ZACA 4ATFA 5LK5A 4AQ6A 3VZNA 3EYPA 3SEEA 3BOWA 1LR5A 3ZYHA 3UV9A 2DCYA 1T6BX 4F7ZA 2KA3A 2FZ2A 5EQUA 1XNKA 3NRUA 5FZOA 5A80A 1VJ2A 1WKYA 4CYDA 1OF3A 1VBE2 3ASIA 1NY71 3AB0A 3BB6A 3O1PA 3PIJA 1AHSA 2EXIA 2PN5A 4QMAA 1I5PA 2HWF3 2W1WA 2ZGLA 1X36A 2K0GA 4Y1VA 3AKQA 1R1ZA 4JZRA 3ATGA 5C9AA 2RS51 2X5IA 3UGFA 2JICA 1HW5A 1X7NA 3PU8A 1U5ZA 2GP3A 4QT6A 4DXSA 2JG8A 3WNOA 4EN9B 2FDFA 1MZ5A 4M00A 5ABJB 4AVTA 1Y7BA 1A34A 3EMRA 3SCHA 2ZMKA 4ORFA 5LBFA 5C3QA 1G9BA 2JX9A 3RVHA 5FYBA 4GB31 1NZIA 2GC0A 4GWIA 1PGW2 2AH2A 5CA6A 3TBDA 2DTYA 4YLZA 1YFXA 2VL4A 1RVF2 3O0VA 1PGL1 5FYVA 3LKJA 1JMUB 5KHIA 1A78A 4EN0A 5BYNA 3LF7A 5FFOC 2DBNA 2PQSA 3A0KA 1SQ4A 2XUEA 3E6DA 4LO4B 2UYAA 5FXXA 5GZEA 3RS6A 4BU2A 5F3CA 4WVZA 1YNAA 4D8MA 5BV6A 1LU1A 1RUH3 1RUOA 1RUC1 3GYDA 4J25A 1WW6A 3VBUC 5DAWA 1HIXA 3N9OA 4XJZA 4WM7C 3VD5A 4S2GA 2P5BA 4GA9A 5CKMA 2B42B 5ERLA 3TNQA 5JMCA 1HJFA 4CCDA 1H1IA 2UWAA 4E8DA 2ENRA 2JE9A 1OOPB 1XYNA 2O8OA 2TEPA 1OSGA 4YRDA 3K51A 1I3HA 5K4LA 4CU9A 3S7EA 5FLIA 5JVVA 5LA2A 4Z07A 4AVBA 3LD8A 4XETA 4MG2A 1WD3A 4CCEA 4RS5A 1HN0A 1OD5A 1NE4A 1CAXA 2MEV3 3GHNA 4NIAA 3X29B 4E27A 2QE3A 2BOIA 2D93A 4QX7A 5C9AC 3I59B 5HI0A 4XTMA 3FN9A 2Y6FA 3IM0A 1BEV3 1D4M3 5JDBA 5LY1A 2EXKA 3KMHA 2R071 3GDBA 3K4ZA 3OB8A 4B7KA 1PK6C 4IGOA 3EXUA 3BOPA 1HB3A 4UT5A 3WZ1A 1NA1A 1RVF1 5FK8A 1W2UA 2VVDA 4Y1ZA 1DQ5A 4RHV2 4JHZA 3T09A 5IT6A 2D6PA 3FFQA 4BOWA 4PLMA 2FDHA 2EICA 4GH4C 1HB2A 2CSGA 3ABZA 3IIAA 5I8YA 5DUVA 4MGSA 3ZIXA 4IL7A 4XFBA 1VAMA 1BK0A 5A70A 4BQ2A 2Y60A 5HCFA 3EB7A 3P3PA 2JIGA 4R4ZA 5EWSA 3OTFA 4UAPA 3ETPA 3SKVA 1ZRCA 4FAGA 3RJ2X 1QJEA 4K21A 4ZS2A 1W39A 2VMHA 4O61A 3WW2A 4BQ5A 1CESA 4N90A 3VDDC 5F5CA 3UETA 3T0BA 5CVRA 2BNNA 3ZXFA 1LRHA 4N9IA 1PO23 2DFCA 2J1AA 3FLRA 3IPVA 4MHUA 5FPVA 3NJYA 4KWUA 1HV1A 1VBE1 4K1ZA 2ZZQA 4W6YA 3P5BA 5L73A 5LEJA 1MS0A 1TME3 3AFKA 3GJAA 3BPZA 4LBLA 3VBSB 3NV3A 4FFIA 3I3MA 3WNMA 4KL1A 3MIBA 4DRRA 5JR7B 1WMEA 1ZZ7A 4XUTA 1EYBA 2Z42A 3DKWA 4BPZA 1VBE3 4L11A 5A7PA 4XF1A 5FY8A 2BWCA 4Q29A 4MVTA 1IS5A 2LALA 2XLAA 3NVCA 3W9AA 5IVJA 2B45X 3JD73 3JQXA 1DBNA 1PHMA 5DQ0A 4MOAA 5JZGA 1QF3A 4WVWA 2FD8A 1RL3A 4H14A 1VBA3 3JUUA 3PUHA 2Q8OA 1W8OA 2QKDA 2UU8A 3KVAA 4JX0A 1ZRFA 1JHJA 4IV3C 4UW5A 1OA3A 1BBT1 3BIEA 5CFDA 5HCAA 1QEXA 1NLRA 3GNEA 2VBDA 5ACA2 1ZA4A 2PHXA 4XDOA 3QD6A 4BLIA 2BVVA 4YM3A 2QZ2A 1R083 2YBKA 4NROA 3MV11 3KWVA 1REEA 1AR72 3LIHA 1VBC2 3WG4A 5E1RA 4CU6A 1EV12 1OF4A 2EIEA 4M0NA 2OX0A 3AX4A 1UZYA 4NRQA 1H9WA 2HBUA 3AL5A 4RQPA 1UZWA 4GULA 3VUOA 1T6GC 1W8HA 3AC0A 4IEXA 5FZCA 1CAUA 2A3YA 3NSTA 3KCXA 1HDKA 4CVUA 4UFIA 3HN3A 2VOKA 5M0TA 1AYM3 2W9XA 3CZUA 3J8F3 2D7FA 1J84A 1OC1A 3FHAA 1IS6A 3K4DA 5FZ0A 1C57A 3GBWA 1ND2B 4Q0PA 4YVWB 1MS4A 2UYBA 3NJVA 4AEDA 4P08A 4XJAA 2TBVA 1RJ7A 1Q8VA 3ZPYA 4XZPA 3WG2A 4XBNA 3MIDA 3PU3A 1WA4A 3KCCA 3BYWA 1LB2A 4N43A 3WEZA 1VBA1 3IZOA 1H2NA 4CDWA 3WT3A 1D4M1 1W2AX 4Q4V1 3GZAA 4XEZA 5T55A 5L36A 1YFYA 2JDKA 3D3AA 3HAGA 4JKLA 1Q43A 5FYZA 4QD2A 3KV5A 5JSOA 2J1UA 2CL2A 4OLLA 4BA6A 4JDMA 1ND3A 2OUJA 4CCMA 2VQTA 4C0BA 3USUA 4BK5A 2C9AA 5F5IA 4RR3C 2Z2SB 3URFA 4KI5M 4YGEA 2YC2A 5JWPA 3AP7A 4NIGA 3M4FA 1CQ9A 4BQYA 1AR91 2DCKA 5IUQA 1W8UA 4ET7A 3ACGA 4AEMA 3AVRA 4N53C 5GZDA 5C70A 1GZ9A 1ZVFA 2F6BA 4AHXA 4OQ8A 2PMWB 2R49A 2WKKA 3UT0A 4RD7A 4JDNA 1BMV1 4PBOA 4HETA 2VO5A 1ND2C 2VOVA 3KQ4B 1NCQB 3B00A 3MW2A 3OUIA 4GALA 4Q1PA 2ES3A 2B4KA 2ZGMA 5L19A 4AHYA 3RZJA 1SDDB 4IDZA 1XC6A 3RPQA 2TUNA 4W6XA 3DPRC 2AEZA 3T2QA 3B93A 2KD7A 4NIIA 1LHUA 2WUHA 4D6QA 2UWBA 1QXPA 2I2SA 1JHNA 1ULDA 4NE9A 2E63A 3PDQA 4Q4Y3 4DOUA 1RHI2 5T52A 2I07B 4XJWA 3AK0A 5A1AA 2X09A 4QM9A 4NMIA 3V64A 2QVSB 4ZY9A 2WN2A 1AX0A 2ZCWA 1OLQA 4CDXB 3PUQA 3T3YA 2BYVE 4K8FA 1OI6A 2YU1A 1O4YA 3S5QA 3TOJA 1IHMA 3WQ0A 3DN7A 3LWCA 5AVPA 2W39A 3OEAA 4IV3B 2VUAA 5GLWA 1FNYA 3VBHB 5J96B 5L7OB 4XACA 2RM22 4UWDA 4G9SB 4XUQA 3CDZB 5GLVA 5IVBA 2OVUA 1HRV3 2D5FA 2V4VA 2YHJA 3CZJA 2RS53 3OYWA 2XPJA 3O1VA 1LOGA 3RGBA 2VCBA 2WZEA 1G7YA 2XG3A 4MGKE 4FOQA 4EZ4A 5I0DA 1ODNA 2C9KA 3MLLA 3VZLA 3H0OA 2E26A 1GYKA 1F2NA 1QDCA 3RYPA 1W8FA 1K5JA 3VBFA 1ZM1A 4E2QA 2RS11 1QNYA 3LE0A 3VBSC 2VZRA 3DL3A 1QOOA 3N7JA 2V5YA 4JHTA 5JUVA 4Q27A 2DCJA 1F9KA 3DKQA 3MO4A 3ZYFA 1KGYA 2BGOA 4NJ4A 2DDUA 5FZOB 4PCRA 1V00A 3ILRA 1LOBA 3A4UA 4CSWA 3EJKA 4NVPA 3RWKX 2I74A 1POV1 4DY5A 1AL23 2ZKNA 3BIWE 4HANA 1FI2A 1EV13 1JH5A 1N3PA 1LNSA 1MS3A 5FZ3A 3HBKA 4Q1RA 4CUBA 1KS5A 4OFGA 2LROA 1FYUA 4NN0A 4NUBA 2VAUA 1AVBA 1LENA 4FPJA 3D8CA 4X8NA 4YNIA 2WZ8A 4BQ4A 4YZ4A 4XFCA 1RJ8A 2J7MA 4QGLA 4GH4B 3WDVA 3H42B 2RM23 4IEQA 3IKWA 3VGIA 3ZXAC 1XE0A 3GALA 4FTEA 2VD7A 4G4FA 1VBA2 4FFGA 4QAWA 1REFA 3FMGA 3TEZA 2BDRA 2R1DA 2NYYA 4LK6A 4AZZA 4CCJA 1PGW1 1S0IA 4IE6A 4LQRA 1PX3A 4LBKA 4LO7A 5FMBA 1PK6B 1WMFA 3F2ZA 1BYHA 2E6VA 4QXHA 3DYOA 2VQUA 2G9ZA 1TEIA 3G6JB 3POYA 4K40A 5FYTA 5GKAC 1H8VA 1BHGA 1AYN3 3I2KA 1YQ8A 1Y43B 3C2UA 1PM7A 5CG9A 4UYBA 2XUMA 3S30A 3SMHA 2YPJA 4XQ4A 3ZN4A 3WG3A 1UL9A 4M3CB 1ZBA2 1ZNPA 2R041 4MHRA 4NRMA 3FHQA 5LRRA 3TRSB 4IGQA 2XR4A 2WFF2 1JN2P 3I8TA 2GN3A 1EPZA 1OOPC 1W6QB 3OBZA 3RYKA 2W47A 3TB0A 2XJVA 4IEUA 5L9BA 3UJOA 3PUSA 1O8PA 4BK4A 2D40A 3SC7X 1JYNA 2R072 2H6BA 4LOSA 3OG2A 4MGTA 1NAEA 1H4HA 2SLIA 4XJ8A 1RUI1 3WUCA 1VRH2 5TSWA 4AVCA 4ZU7A 3AP4A 4Q5OA 1UIJA 5BXXA 2P2KA 2HWC3 4GMP1 1LOCA 3C7FA 4LKSA 5J3UA 3CBNA 4FCAA 1CGPA 3H50A 4COVA 4OUEA 3FBMA 4XDQA 3AP6A 4Z8BA 2QQOA 3I59A 1UN1A 3ES1A 5DDJ1 4BMEA 2PHUA 4PDWA 1H8TB 2JB4A 2VM9A 1ASJ3 3J7HA 3OGGA 4N9HA 1M4WA 3J8F2 2C5DA 4OYUA 1YFUA 3JBG1 3VDAA 1UU6A 3KQRA 1GOFA 2IXJA 2RS31 3UNPA 4W65A 5DAQA 1RUC2 3P3NA 1BBT2 4R9CA 3WW4A 3VKNA 1TMF3 2XQRA 2HWE3 4XFFA 4XMIA 1L7QA 4BHPA 4KG0A 5C4WC 4KQ7A 2WO2A 4AAXA 4KU7A 4F3JA 1SFYA 1GU3A 4XF9A 3VDBA 1H2KA 4XFHA 1OLMA 5ABJC 1LOEA 2OT7A 2P4EA 4ES8A 1DQ2A 5DG1A 4LK7A 5KC5A 3V0AA 3CLPA 1SLIA 3H7JA 3N9MA 4Y20B 5J98B 4NWVA 4P9LA 1QU0A 4LBQB 4FOYA 3MPPG 1PNFA 1I1EA 1MR5A 1AR92 4DZGA 2H0VA 1E57A 4QX0A 1AR81 1GFF2 1CAVB 2RS12 5AFBA 2ZX2A 3H3LA 3U4SA 4ZHNA 2WBKA 1JODA 1NX9A 5BNQA 1SFNA 1EPWA 2WT1A 4NHLA 5A33A 1RUH1 1JTZX 1CWPA 1UAIA 4K20A 5IW0A 3D82A 4A3ZA 3RMXA 1ZZ6A 3QACA 5IFTA 4RFT0 3ZLIA 3ETQA 1VMFA 4UBGA 2VBBA 2IC1A 1VP6A 5A3WA 2D98A 5FZGA 1ND2A 3AZXA 3J26N 2WR9A 4Y26A 3VBFC 4Z2WA 4RFRB 2B9UA 4FXKB 4QQ2A 4PF5A 3ZN6B 4FBFA 3O1UA 2VMCA 3R4UA 4YM2A 3AZVA 5DZFA 1LOAA 4AEDC 3PUIA 1UYYA 5EZWA 4OCTA 1R64A 2DFBA 4GWJA 4QQPA 4CDWB 1WLDA 3L2HA 1YCIA 4HN0A 3VZOA 3ZSMA 2HWB3 1IGOA 2QQKA 2EIBA 4YGBA 1PZ8A 1EV11 1XBFA 3N36A 2DURA 3VHRA 4CU7A 2WABA 1MZFA 1WGPA 1PVC2 1S0JA 3WF2A 1VPHA 3N7KA 4QKFA 3ZFGA 1ND3B 1S0FA 4ZONA 2Y26A 2ZPXA 2ZABA 2A3XA 2CNAA 5A7QA 4BYYA 5CFCA 2A73B 1G8WA 3R4SA 4DY3A 3ILFA 2RS33 3FUOA 2Q30A 4A6SA 2H0BA 4HXCA 4ASLA 5KXBA 1Z7S2 4XXAA 3J7MA 3ZSEA 4XHBA 1MS8A 3M3OA 4DB5A 1SACA 2R043 5BNPA 2QUOA 5DPNA 5FDBA 5DN2A 4QGMA 3I2JA 3AJYA 4AEJA 3BCWA 4XJUA 4NRPA 3N9PA 5T50A 3WX5A 3O1SA 3O14A 5F1RA 1YC61 2A70A 1PO12 3UKTA 1AR61 3MLKA 4MSVA 2D3RA 2BU9A 4QX3A 1MS9A 2IVJA 1ZRIA 2DF7A 3LEIA 4FT8A 4XVHA 4Z2AA 3FE5A 4QXCA 5FY9A 1VB2A 2R0FA 4I0WB 3ZKYA 2GMPA 1WA6X 1W8TA 1RUG2 3T4HB 1ZREA 3ZSJA 4LIUA 2A3WA 1FOD3 2NLRA 1CIWA 3KLSA 4N43B 3W20A 5FZMA 4RHV3 2WSVA 4BJ0A 2HBTA 3J7NA 4CP2A 4LE4A 2ZHMA 4QM8A 3HIFA 1R1A1 4LNVA 2CAUA 1OPMA 2NQYA 1TME1 3TN91 4QXKA 5IK7A 4I3PA 2UURA 3ENRA 4Y3OA 3GZEA 3ZFFA 5BNOA 1Y9MA 2HWE2 1UX7A 1TMF2 3B9IA 5FUNA 1JYWA 3FX3A 3Q9OA 3NNJA 2F4LA 3J9SA 2C24A 5F5QA 5A3MA 4MYEA 4Q0UA 1J1TA 4ZXKA 1Z78A 2YGLA 4IV1A 4QKDA 2VNGA 2XDVA 3U4XA 3WQBA 1V9U1 2P17A 3CMGA 1SLCA 5L9RA 1JYCA 1AX1A 1PIV3 4CCCA 2D6NA 5KHHA 1BXHA 1QQP1 3B02A 4XCAA 1BMV2 3ACLA 2BBAA 3ZSLA 4QXBA 1NCQA 2FDIA 2BJSA 3R4DB 4NHMA 4Y1UA 1X50A 1PO11 5KWRA 4W50A 2W0XA 4CDUA 2CV6A 4RSUA 1NCQC 4S2HA 3U10A 4B4QA 3ZMNA 2ZGNA 1IKPA 4AI2A 4L92A 2WO7A 4XC9A 4P9WA 4BM8A 1QWRA 4N53B 2VZTA 2PYTA 5FJHA 4M0HA 4FFHA 4Q4X3 2GSYA 5FCCA 4LUMA 3UESA 3B7MA 4YW3A 5A3NA 2ET1A 2HWF2 2Y6GA 4FP2A 3RJRA 3W5MA 3I3DA 3RZKA 3PHMA 1SBEA 1XB9A 1V6NA 1ZZ9A 1NLSA 1UD1A 3OD4A 4QHOA 1F15A 3USSA 1GZTA 2X5IB 5FZAA 4H55A 4ZPIA 4MGIE 4DS0A 2QQLA 3DYPA 1OD3A 1MEC2 1UZVA 3K3OA 1QJFA 3C7HA 3MICA 4KBBA 2VJXA 3CF6E 5B4XA 5JZGC 5CZKA 1UY1A 1LEDA 4AVVA 2VC9A 2XJQA 3DV8A 5FYMA 4RQPC 1IQDC 4W6WA 4GKYA 3T08A 3D6EA 5EPAA 5E6HA 1ACCA 1RUE1 4P00B 1QOTA 2BNOA 2R042 4ARYA 4AW7A 1UX6A 2EA7A 3M2MA 1N3OA 3LEKA 2XL7A 3KGZA 5BUVA 2XBO1 1JXNA 1EY2A 1RC6A 2Q8EA 4RGAA 4OI4A 1GNHA 4CXYA 3M3CA 5LZ6A 5LK7B 1UNBA 4EQVA 2OQ7A 4P9XA 1TNRA 4TWTA 4YYOA 3WF3A 1O3QA 2XJRA 1AXKA 1SG3A 1MEC3 2IUWA 5F39A 5FZKA 3LGRA 3TN93 1RMU1 2YBPA 4FOVA 2YV8A 2EIDA 3KF3A 4D6SA 1ENXA 4IEPA 3RQ0A 1XYPA 2PELA 4EWEA 3QH7A 1XXNA 2ZEXA 1QQP3 2VZ1A 2P37A 1QJU3 2MPFA 4FP3A 1UZZA 5K8SA 1RMU2 1YI9A 4MXWB 5CNAA 3O7OA 1DYKA 5T3NA 3SHRA 1JBCA 4AYUA 2Q1FA 1VR3A 3AP5A 1IG3A 3AJZA 3OUJA 4LMFA 4QU2A 3SH3A 5KHJA 3JBG2 1DGRA 1F5JA 3NAPA 4UFHA 1J3QA 4RS5B 4XYXA 4E4HA 1CAXB 2R061 4HT1T 1N1YA 1ASJ1 3M8LA 1ZBA1 5GLTA 5JXGA 4KBZA 3I2IA 5C8WA 4QX5A 2MNGA 3ES4A 1NZCA 4BQXA 2H6CA 1NY72 4EE2A 4OMDA 1UPIA 5FLHA 3HNBM 3ZYPA 4ARXA 2CWMA 4BDVB 3FC0A 2WT2A 1ASJ2 2HWC1 3ZFEC 4C91A 4JDOA 3RI9A 5EFUA 5ACA1 4Q4W3 3E97A 2PAMA 3WF4A 4XAAA 5EYXA 5C71A 1XJAA 1UZ0A 2GNBA 2RJLA 1W06A 1NA1B 4AQTA 1TE1B 1SPPA 2EIGA 3AP9A 2CHHA 2XHKA 1RUF3 1TQ5A 3SLIA 3V0AB 3NV4A 2E9QA 5FZ7A 3M3IA 2ZTNA 2MHFA 4WM8B 2JDUA 3VDDB 1MQTA 2ZHKA 4SLIA 4P5HA 1U5IA 2PTMA 2OZ6A 4BQ1A 2YC0A 4FSJA 3E6CC 1XNDA 4YZ2A 1B35B 1V6OA 2QQVA 1W8ZA 5FREA 1BBT3 1QKQA 3VD9A 1KRIA 1C8NA 3WDTA 4K3UA 3VD7A 4FTBA 1RUI2 2W08A 4YVSC 2RR13 5FR3A 1W6MB 3ZPOA 3TEWA 2C6SA 1W9TA 2RJKA 2WWUA 1FOD2 4Y1XA 3I49A 4LTAA 4Q8LA 3WF0A 5K7PA 4IEOA 1E5HA 2RDRA 4CP1A 1B09A 1S2KA 1AZDA 1I5ZA 5DAXA 1GP5A 5E89A 1APNA 2MEV1 4YG3A 2BEOA 4P9YA 2G9GA 5LY2A 2ZOEB 5E16A 4BIOA 1CZVA 4R4XA 2DVGA 1W0PA 2YG0A 3HN1A 5FZBA 3AZZA 3BODA 5A7WA 5LEKA 4OQ9A 3PJYA 4CUGA 1COV1 1MEC1 3AMPA 4LORA 1JZ5A 2WS91 5BNOC 3POBA 2ZS6B 4LHKA 3WP5A 4Y24A 3TEXA 3H8OA 1O7FA 5FO7B 2PHTA 4FQ4A 2BUKA 1LGNA 3WXPA 1HLCA 3B01A 2DU0A 1J3RA 2ZBJA 5K0UA 3WLUA 5JR2A 1MZ6A 2YUEA 3RZHA 1QMJA 3Q8CA 2WNUC 4I3GA 2OKXA 1F4HA 1VB4A 3ON7A 5JXIA 1YUDA 2BVBA 1NCRB 2VOWA 1ENQA 5KC6A 5F8PA 1CR7A 3M1HA 2DU1A 4MGQA 3CU7A 2ZXQA 2VNVA 2JIJA 3WHTA 5KXCA 4WM7B 2WDBA 5FTTC 2WFPA 2C0ZA 4RR3A 2W3JA 2WN3A 3VBUB 2WZR3 2E31A 4CCOA 4FTSA 5JCTA 3ZSKA 3I2OA 2LUWA 2IZWA 5BY5A 4XFGA 1CAUB 2Y6JA 3IDAA 1V6JA 2D3SA 2W91A 4LBQD 2K2SA 2VVFA 2B46X 2WWSA 2QNKA 3BALA 5KXEA 2V4AA 2BNMA 1WD4A 3LAGA 2JE8A 4RYDA 4O9GA 2PLV3 2RV9A 2JD4A 4YVWA 3SISA 1DZTA 2YYOA 1UMIA 1UY2A 2DWRA 2DUOA 4KH9A 1TMF1 4BQ3A 3A23A 1GMMA 3KT7A 2X29A 2ZGRA 4PT6A 2OYZA 2NMOA 4MGYE 4YW5A 2EXHA 2VMIA 2JWPA 1PGSA 4RN5A 5T5OA 4QDQA 2PA7A 5CFCB 2P3KA 1VBB3 1Y9GA 1CAWB 3JD72 2ZEWA 5AFEA 4LKEA 3UKNA 4GJZA 1O4TA 2R063 5B2GB 4W8JA 1GNZA 1CD3G 4LBJA 2ZX0A 2AGSA 3N7MA 3DXTA 1HQLA 4YZ3A 3KZ4C 1EUTA 3H8XA 5FXZA 1NYWA 5FIXA 4EWAA 1BLZA 2ZAHA 5GZFA 4Q0SA 2ID4A 2RVAA 5K0UC 2FCVA 1OA2A 5F32A 3SH5A 1IPKA 2CGPA 4B29A 2RS52 1R1A2 5J48A 4XQWA 1ZZBA 3ILNA 4I0BA 5AC93 4FPCA 5I0UA 3FZ3A 4KG8A 4QB6A 4WVMB 3RG0A 1VALA 1JOPA 1FV2A 3LIGA 1W0NA 5FOJB 2GZWA 4QPGC 3WDWA 1VRBA 4OHVA 1UXXX 3RZZA 4CDUC 2HWD3 2WYFA 3LQCA 1C1LA 4P9IA 3VL8A 1FMD3 1XU2A 2HEYF 5FPUA 4JTNA 2BP6A 2Y0OA 3G7DA 1YWKA 5A6XA 2ZGKA 2HYXA 5FBJA 3OBAA 1MACA 1FXZA 1KJRA 3WDUA 2IXKA 4G3YC 4Z92B 3C7OA 4Y33A 2XB6C 2C1FA 4CPBA 1RUD3 2W1SA 2ZMNA 5LBCA 4CEWA 2B5HA 3I2HA 3I2DA 5A3PA 3WNXA 1NT0A 3AYAA 1QOSA 3DUIA 4Q8KA 1RUE2 4QHBA 1ONAA 5CFDC 4IV1B 1CONA 2G4IA 1O4ZA 2ORXA 3OGSA 5FAXA 1DG6A 5L7OA 4LKFA 1FT9A 3WV6A 4NHKA 4WZCA 5C3PA 4LT5A 4TYSA 2VY0A 4UXAA 4PDWC 3HJRA 4LLOA 2E7AA 3GGLA 1FNZA 4KWJA 3FWEA 3M3QA 4FOWA 3WINE 5A6ZA 1RUF2 4GMP3 3I2GA 4Q4V2 3KV9A 5IYYA 1XQNA 4FPEA 1X8MA 2J1VA 1GLHA 1AR63 4I02A 2Y33A 4UI9L 4I2OA 2VCAA 2OA2A 2A75A 2VBPA 3DYMA 4RA0A 4FAHA 5FP8A 2YFUA 1ZRRA 3ZFEA 5FRAA 1EUUA 3N9LA 2XVLA 1RGSA 3HEIA 5GZGA 2X8KA 3D4KA 3O1RA 1DCSA 1NQDA 4B3NA 4ASKA 3LZZA 2BGPA 3INAA 2D43A 3CJIC 4HLTA 4TTGA 4PIXA 4CP9B 3WR0A 2IXHA 1MS1A 4HK8A 2RMU1 3KHBA 2GH8A 1O3SA 1DP0A 4XPVA 2W1QA 3PNAA 4M01A 4E9KA 5FWJA 3NAPB 3NAPC 1RUD1 3ZX7A 4D6RA 1DFQA 4Y4RA 2RS32 1V6LA 3OD0A 4OUMA 5FYHA 5FUIA 1QQP2 1O3TA 3B5LB 2ETEA 1D0GA 4JGZA 1NG0A 2VZUA 4JGYB 5FPLA 5A6YA 2YC4A 3C7GA 2NP0A 1F8VA 2A5ZA 1DGRN 3IAPA 1HB1A 1SFPA 1O91A 4AI8A 1LGBA 1OLME 2ZJCA 1VMHA 3HVDA 2YROA 4YGDA 3WF1A 1ULPA 4QKNA 5HXMA 3J4UH 3IAQA 2FQPA 1I6XA 1WW4A 2J1RA 5A6QA 5A3LA 1LESA 3WNNA 4FPLA 5FMCA 3S0MA 3I7DA 2WZPP 4CEYB 3LSEA 4AVAA 3POFA 2WIIB 1YIPA 4L99A 5FYIA 3IDCB 1CJPA 5C3RA 3GCWA 3A0NA 1AL21 1K5MB 4QU1A 4QX1A 5CBLA 3WDXA 1KD7A 1IZ3A 1EP0A 1DYOA 5DUWA 3TWIA 1G86A 1XE7A 1JZ2A 1UWWA 1OQEA 2JG9C 5FOBB 2D6MA 5LB6A 2BGCA 4FFFA 4M3CA 3V56A 5JOWA 1MQTC 2GNDA 2IXCA 3IPVB 1J58A 4N7IA 4OZXA 4MXWA 5A7SA 3E6BA 3PTYA 4EZHA 2Z5WA 2RS13 1O8SA 3VHOA 3BTXA 5FKBA 1GICA 3POGA 1AR93 2VUCA 4NIHA 3ROUA 1URXA 4QWNA 1YQ5A 3N3HA 3WUDA 1RHI3 4DQAA 3VZMA 4NPMA 3DEMA 2O1QA 5I8TA 3SCGA 1TME2 4YARA 4NR1A 1PMJX 1AYM1 1JOBA 2WQZC 1BEV1 4A42A 1W2TA 2DBIA 2CTVA 1E5RA 5AVAA 4CCKA 5GZCA 2JKXA 4OZOA 3NO8A 2XBO2 4LA3A 4UFJA 3DPRA 4IE0A 5F3IA 3S5AA 1HV0A 3VZKA 3HR9A 1MZEA 2YPDA 1RITA 4LO5B 3HMYA 2WAOA 1WMDA 3THDA 1BEV2 3BI3A 2AENA 2Z69A 4LHNA 5HXVA 5J36A 2A6XA 1XRUA 1TVGA 1QJX3 2YY1A 3VL9A 5C8CA 1J1LA 4DFSA 4XHXA 2ORZA 1W6PB 1OURA 2WO3A 1O5UA 5A7OA 4FI9A 4UF0B 3MI8A 5J7MA 5K0UB 2YFZA 3ALQA 1UW8A 5DG2A 4WM8A 3K2OA 2HWD1 1BVP1 2WZR1 3PVOA 1S1AA 5H9RA 1R091 1RUF1 4XUOA 2XH6A 1DLCA 1GOGA 4KGGA 4MGZE 4Y20A 4JGZC 2VULA 2ARXA 1KXGA 2JG8C 4BMBA 3ZIWA 1H6YA 1V9U3 3VBUA 2VZVA 4A4AA 2JG9A 1DLLA 4HKLA 1V70A 3ZVXA 3WOGA 5IFPA 4XE9A 1AXYA 2R6QA 4FXGB 4PJYA 4YW2A 3OGJA 1R081 3UKVA 2RM21 1KEXA 2EF6A 2Y38A 2SBAA 5D2AA 5EHDA 4L8QA 2Y6KA 3NV2A 1OKOA 2UY9A 1DYPA 3U07A 3ZR6A 4HFSA 2MEV2 2QJVA 5FZ9A 5B4NA 3OF1A 4BCUA 4HK9A 2JKBA 1LOFA 1AYN2 4N8MA 2O0OA 2R7EB 4A3XA 1G6NA 1ODMA 5CKQA 3CEWA 3N7LA 1VBC1 3I4IA 2XWBB 1C5HA 3MFCA 2VG9A 3DGTA 5EJ1B 5FZIA 1T2XA 1NQJA 3KM5A 4AFCA 5F2WA 4CUCA 3AKRA 1QDOA 5I93A 1S4CA 2BRTA 4YM0A 1CAWA 2JECA 4LBOA 3MDPA 4BZ4A 3KD4A 4TXWA 5L9VA 2A71A 3MV01 5HV4A 3AMHA 2W92A 4Q0VA 1RUH2 3H1WA 3ZFFC 4XFAA 2UY8A 3A22A 1HQWA 3JB4C 1PVXA 1RXGA 4QB2A 1A8DA 1WLTA 4MX3A 4CZSA 4DUVA 4D3WA 3RZMA 3VBRB 1GKBA 3PLQA 1UOJA 5FZ4A 3U11A 2C4XA 4YZ1A 5A3UA 5J09A 5FBZA 3B94A 2P3YA 2WYSA 4XF3A 5BNPB 3DCQA 4IERA 4XBQA 2Y6LA 1JZ6A 5CEHA 1YJLA 2K46A 5LA0A 2D6KA 4BE3A 4XURA 4A41A 4YFZA 4ZU4A 4DXZA 2FBEA 2PQQA 5CAZA 2IFRA 3VV1A 3IT8A 2VVEA 2XQXA 1QJZA 2FMDA 4F8AA 3GZUC 2RE9A 5FY7A 2XOMA 2AREA 4KU8A 3ZN5A 5FYUA 5C4WA 2VUDA 1NKGA 2VE1A 4HPKA 2HWB2 5H9SA 2EAKA 4HVQA 4WBBA 1W0OA 2HEWF 1DDLA 1PVC1 2ZMLA 5CB7A 4N7UA 3LSDA 5F3GA 2J1EA 5GLZA 2XMLA 2ZZJA 4EV0A 1LECA 3R05A 2V72A 1OLRA 2P3JA 3VD3A 4CDXA 1JZ8A 4HZFA 4LHLA 2PHFA 2Z4FA 4WVVA 4CP0A 1HRV1 5IVEA 3OSDA 1PNGA 1FV3A 1XSRA 2F17A 2VUJA 2WWJA 2WNVA 4TLGA 4U36A 4FPGA 5F2SA 5FPZA 4QX2A 3MUY1 3VBHA 4IUGA 3MF6A 3RMYA 3TEYA 1NE6A 1JU4A 2A1XA 1BJQA 4XTPA 1N1TA 3C7EA 3C3VA 1HRV2 3H3ZA 4LBNA 3VN4A 2EALA 4TZDA 4AFAA 2OIIA 2OS2A 4NIDA 1KITA 3RI8A 1ZZCA 3FLPA 3GJBA 5EJZB 2NM1A 1CN1A 1WMXA 2ADEA 1CX1A 4AG4A 1JZ3A 1QJU1 2ZGUA 4AHWA 1LHOA 1AR62 4ISQA 2KM2A 2XKPA 4JTOA 2GH2A 5JSPA 2PHWA 2HKXA 2VH9A 1D0HA 1BZWA 5CADA 2LTNA 2VZ3A 5EV7A 1DGWA 2WA3A 3O1OA 4OVEA 4GB32 1RTVA 2WL1A 4WVMA 1WCQA 4DO0A 4BLJA 4OI1A 1FMD1 4I01A 1UMHA 5BNNC 3ZFEB 4QQLA 1RUE3 2W46A 1N1VA 5JIUA 1RUC3 1ZBE3 3R6SA 5HCHA 2RMU2 3HPNA 3MF9A 5JXHA 3LA7A 3QLQA 3E5UA 4PQ9A 5BPXA 1Z7S1 3DECA 3LEMA 1DQ4A 1HQNA 1RUD2 2GMEA 4NO4A 4CP9A 4I09A 4YPJA 3CL1A 3FJSA 1RUG3 3MBWA 5IVFA 1GBGA 1OUSA 3WHUA 5A32A 4H7LA 4GH4A 2CY6A 4FPOB 5EP9A 1HB4A 2GALA 4JC1A 5CG8A 1W6NB 3VKOA 3ZXJA 2JG8B 2JJ6A 3AMQA 4L2NA 2VW0A 5FP3A 3ZDVA 5C8CC 5T5JA 4COZA 5HBAA 4JGZB 4MH0E 1W9YA 1PK6A 3Q8EA 1OH3A 2RDSA 2ARCA 4HVOA 3RZLA 2FCTA 4HL0A 3HBZA 1F4AA 4M4PA 4INDA 4E4ZA 1U12A 2YDEA 3VDCA 1XU1A 1ALYA 1YFWA 2J1TA 2X10A 3HWJA 3IMMA 3NQHA 3OY8B 1STMA 4PI2A 4K9SA 1UF2C 1W3VA 4ZU5A 1V6MA 2JEMA 3ORJA 2V09A 2YB7A 3ZYRA 1X9TA 3NKGA 1FMD2 3IDBB 1JZ7A 3O5SA 4LJHA 1JYVA 3KF5A 4JCKA 1VLNA 2DYCA 3KS7A 1H30A 5FY0A 3T2PA 3U0ZA 1VBB2 4URTA 2VZOA 5FY4A 1GZCA 2LW8A 1ENSA 1OHFA 3FBYA 4QQOA 4IEZA 4GJYA 4RHV1 5FZLA 3ZXLA 4YSFA 1FOD1 1LEMA 3IN9A 1VIWB 1OFNA 1V6IA 4P5YA 4R52A 5JOXA 2WLPA 4DEQA 1UU4A 3H8UA 1WCUA 2EXJA 2X5IC 1N3QA 4OHWA 5T5PA 1ULCA 2HWB1 3ZR5A 5F9TA 5JSRA 3ME2A 4ISRA 1R082 3RFRA 5FZDA 5JPMB 4YVSA 1VBD2 3ITQA 1CX4A 3DXUA 5ANQA 5G05L 2WT0A 2XVGA 1QIQA 5I0SA 3S7IA 1U0AA 5FY5A 4A7YA 3THCA 4XUNA 1UYPA 2QTWB 2ATFA 3O0XA 2CAVA 4XAEA 3AFGA 4Y5SA 2XJPA 2YMZA 2WS92 3CHXA 2WS93 3TYJA 3T30A 1GQHA 4BIFA 3HNMA 4CCNA 2BPA2 1K5MC 4OI2A 5D8AC 2VECA 1RYYA 3IMNA 2AC1A 3POEA 4MO3M 5DUXA 2FHRA 1U5YA 5C8CB 1C8M3 4Q4V3 2A6YA 4CPBD 4OHYA 1BCXA 4K1YA 5IVVA 2HH9A 1A8MA 3I3EA 4LLFA 4XMAA 3OOXA 3VBOA 3H7YA 4AOCA 1F31A 3ECQA 1CAVA 1AJOA 3B9CA 3CJXA 1VBB1 5FZ6A 3AXDA 4D7YA 1IS4A 4JGYC 4JQTA 1ZA7A 2JDHA 4JKKA 3UYJA 2JDNA 1WUVA 4FQZA 5HPOA 1PO22 1VE0A 5JAXA 5JLVA 3V0BA 1YHFA 3SH4A 4O7XA 1OQ1A 3PIGA 1B35A 3T0AA 3U75A 5BNNB 4AR2A 3FHIB 1H4GA 2CWSA 1W6OA 2DVDA 4D7SA 1PIV1 2NMNA 4A7ZA 4OULA 1HRI3 2ILMA 1IKQA 1W6MA 3LA3A 4PF1A 1AR71 3WD5A 4AL9A 5ISLA 2VMDA 2HWC2 3CJIB 4EN8B 3NKTA 2O14A 4N43C 1VRH3 3AKTA 3GF6A 3LPGA 4HN1A 5D8AA 5FZHA 3RDIA 4B4RA 3OBTA 1GZWB 1HXS2 3BPSA 2HWD2 3MUZ1 4AGVA 2W87A 4AQ2A 1AJKA 3W58A 4D0QA 1R092 1N47A 5DXDA 5A1FA 4S2DA 4YGCA 4ASMB 4AXOA 2AZ5A 3ZFGB 2WFF3 2VNOA 1W05A 4NPRA 4IETA 3K3NA 2CDOA 3OGVA 2LS6A 2ZKLA 3ACFA 1RUJ2 3D0JA 1Z0HA 1H0BA 2R0HA 2RDQA 3VKMA 3ZYBA 2JDAA 5DAPA 1GP4A 4UF0A 2G1MA 2QQJA 1FAYA 2JDZA 4I0AA 4GZ9A 1LHNA 3LDBA 2P6CA 2E32A 1K12A 1H2LA 1YEWA 1QXJA 2R062 3U37A 4XZUG 4A45A 1S0DA 1RMU3 2LM3A 2WNOA 4IV1C 5G04L 3JXSA 5IHRA 1QJU2 4KMQA 3D0SA 2D3PA 4JVAA 3B3QE 1S0EA 2AYHA 3LB9A 2AUYA 2NPIA 2WQ8A 4K8RB 4R9AA 3MW4A 4A6OA 1NXD1 1O6UA 1WCSA 5DDJ3 5FMOL 1PZ7A 2W52A 1XNCA 1R093 1ZYBA 5IAVA 4WM7A 4EROA 3QH6A 2VU9A 5C3SA 4QPIA 3CNAA 5FZ8A 4YWAA 4D7TA 1AR73 2HWE1 2Q1ZB 3EQEA 1UYXA 1KFXL 1XNBA 2UWCA 2Y0IA 4UOJA 4DUXA 5I91A 1OH4A 2OZJA 3QCWA 5FZEA 2OPKA 3OEBA 3VBRC 3K4AA 3L9JT 1HRI2 4AEDB 5IATA 4META 5C33A 1MPXA 1LGCA 1V0AA 4AFDA 1AF9A 2E51A 1QJY1 2ZAAA 4HMZA 1FX5A 2E33A 4Q4W2 4XIOA 4CEWC 3MZHA 4XQDA 2JENA 3SXWA 3ZFFB 2VZSA 2DCZA 4DINB 2QQIA 1HRI1 5LCWL 1O5LA 2Q4SA 2B39A 3WP3A 1QJY2 3KHCA 1UY0A 3HNYM 3BKZA 1L7LA 2R16A 1LTEA 4QPWA 4LO6B 5LATA 5E88A 5IVYA 3USUB 1W03A 3MLJA 4HSJA 1UKRA 4OI0A 4B7EA 1LKNA 1ULEA 5FUPA 3THTA 4O9EA 3NNFA 2FMYA 2V5DA 3MGUA 2QBXA 4PBPA 4CDQC 3VBRA 4DXTA 4A2UA 2XJSA 3NV1A 4P14A 1C28A 3PVBB 2OXBA 1FPN2 2BERA 5C5TA 5FXVA 1JU3A 1SLAA 3WQ7A 1JUHA 4TLFA 4GWMA 1POV0 5LWBA 3QOPA 1DU3D 1UMZA 3NL1A 4ZKTB 1AYN1 5FMOS 2J22A 5C4WB 2J42A 4B8EA 1NLQA 1W9SA 3W5NA 3SCFA 4ZZ8A 3OPZA 1H9PA 1KS4A 4E4DX 1TNFA 4IEYA 1SCRA 1CVNA 1GUIA 1D7PM 1VBD3 2XONA 4CDQB 1Y9QA 2BQPA 3WG1A 5CIRA 1OXCA 4YG0A 2XVKA 3HOBA 2IWGB 4GXLA 3N9NA 3JD71 1Q8SA 3FFZA 1LAJA 4K7JA 1JW6A 2VPVA 2CGOA 4L9BA 5LRSA 3AYCA 4QGNA 1YYNA 1W6NA 1EAH1 2RMU3 5I0RA 3PL0A 1IS3A 3NNGA 2WJSA 5C5UA 5FYYA 1HXS1 3S6PA 4PHZA 5I8SA 5LASA 1YQCA 1ULFA 3ACIA 3HQRA 1GR3A 3KGLA 1PX4A 4RGGA 2QZ3A 4IGPA 4AVSA 4CEWB 2J1SA 2IVIB 3T4VA 3FLTA 4OHXA 2WNUB 2JE7A 4P02B 3OPTA 4AK3A 1W2NA 5GALA 3CIHA 4LULA 2ADDA 5FP9A 2RG4A 3CO2A 5KR7A 2VZPA 1GWKA 1W2OA 2I45A 3I3BA 5ANNA 3GCXA 3WNPA 2WINB 1O3RA 5JIAA 4WZFA 4XFIA 3LOIA 2TNFA 5K9YA 1VMJA 5KXDA 2XLGA 1GANA 5F6KA 1Q5OA 1RINA 4LOTA 2DCTA 3POIA 4HOOA 5D21A 5I0TA 4WV8A 1UQXA 2HWF1 2ZA9A 4B1MA 1ZBE2 2QQWA 1UOFA 3QBQA 3U1XA 1L3JA 1OVSA 3TAYA 1OOPA 3H1YA 1GP6A 3Q8AA 5FP7A 3UGGA 3WNKA 1U5XA 4YW1A 4L0PA 1ULOA 1YO8A 2Z79A 1DGLA 2D6LX 1QY4A 1KJLA 2BOJA 3MYXA 1YI7A 5FPAA 2ZGOA 2IFWA 4HSLA 3KVBA 4HBNA 4Q2FA 2C26A 5J1XA 1C4RA 1Z7S3 3GBGA 2WQ4A
chains in the Genus database with same CATH topology
4XW3A 2QFEA 4YVSB 3MW3A 4R9DA 1QJX2 3NW4A 4Z82A 1J59A 1AXZA 2WA4A 3ZFGC 4JQRA 1BKZA 2OUHA 3AYDA 3B69A 2PFWA 1YLLA 1PO13 4IXLA 4X6RB 1M06G 1LOFC 4JGYA 4AFMA 1DZRA 5T5LA 4XF4A 1VBC3 2G9FA 3OY8A 3AMMA 1QHDA 2DVFA 2JXAA 2WC2A 3SITA 4BH9A 1JUIA 1NA1C 1WBLA 5H9QA 4E2GA 1G9CA 1VAKA 3VDDA 1S0CA 1REDA 2DTWA 5F6LB 1K5MA 3RSJA 1JOJA 2PHLA 4PIZA 1QXRA 2CYFA 3V0BB 2ZGTA 1W6QA 4QPYA 3VBHC 4Q26A 5L7OC 1W6OB 3IBMA 3TNPB 4D69A 5FO9B 2ZHLA 4CTEA 2D6OX 1SBDA 4CDXC 1ZZ8A 1OQDA 3CJIA 2GC3A 4Q4X2 1LHWA 3O12A 1DQ0A 5D8AB 3POSA 1GZWA 1OMIA 4PDWB 1H8TA 4UW3A 2X53S 1DZQA 2ZX1A 3MIFA 3PMEA 5EJ3A 4ONUA 1DIWA 3VLBB 1MVEA 4AGRA 4Q4X1 1PVC3 3RNSA 1RIRA 4MUVA 2DUQA 3VKLA 1HX6A 5CFDB 3DPRB 4XIKA 4ES9A 3RRDA 2VXRA 4NOTA 2VOXA 1A3KA 5FQ0B 1S0GA 3BTAA 3O0WA 1S2BA 4LBMA 4C1XA 1AX2A 1XYOA 1PIV2 2VW2A 3T2TA 4JV4A 3WW3A 1DGWX 1NCRA 3R0RA 1N1SA 4RQPB 4F83A 4Y5Z0 1H1AA 3AXEA 4KWLA 4LBQA 3MFAA 3JB8A 2A6ZA 2ZGSA 3GHMA 4RR3B 4XILA 4EN7B 3AZYA 1NOVA 4QPGB 4UW6A 4OUSA 4Y1YA 1QNWA 3POWA 1COV3 4HKWA 4S2FA 1D2SA 1ZBA3 3E5QA 4IEVA 5JI7A 2D44A 1RUJ1 1G9AA 1S55A 1LODA 1UCXA 3AYEA 4Q4W1 3HT1A 1AR82 1SLTA 2N7GA 3RYRA 3ST7A 4C1WA 2ERFA 4IQPA 1Q8OA 3T1LA 1DHKB 4UBHA 1KQRA 3ZN6A 5EYYA 2B8MA 2Q5TA 2IXIA 5JOZA 4HVRA 4YVWC 1UPSA 2DVAA 4H7MA 2HEVF 4Y22A 2VNRA 3ZMOA 3NJZA 3L2YA 5CFCC 1EAH2 3N4MA 4X8PA 3JCIA 3ZDSA 1H1MA 4RL7A 1SDWA 1XE8A 3AKSA 5EXOA 4C0HA 4GMP0 3ZXEA 1WW5A 1POV3 4EJRA 4LA2A 4C90A 3J8F1 1RVF3 2CGNA 1CPMA 4DRVA 2RR11 5JPNB 4JRLA 1IQAA 5IK8A 4ATEA 4YW4A 4M3CF 4AI1A 5H9PA 3ZXDA 4E2SA 4HKOA 1RUNA 3SNMA 2ZX4A 5AC92 1QJX1 1PGL2 4D94A 2KXLA 1SEFA 2XBO3 3JU9A 2XL9A 4JAAA 2P3IA 1YXWA 1PMIA 2A7AA 2GN7A 3HT2A 5SV8A 5GM0A 2PHRA 4HPKB 1Q8QA 3H1MA 3LA2A 1NCRC 1LHVA 1X33A 1YJKA 3H3UA 1SCSA 4YM1A 3VZJA 1C1FA 4UW4A 3VHPA 2DV9A 4IV3A 1QGLA 1CJDA 1AL22 1QJY3 3ZYGA 2ZGQA 4COUA 5ABJA 4FO9A 4B4PA 5BNOB 4AQSA 1RUG1 4A7KA 2PLV1 2EVXA 3AKPA 3AMNA 4XBLA 4LE3A 4FVVA 5DZGA 2RHPA 3EHKA 2BBVA 4P9JA 2PLV2 4Y4YA 4QQHA 3MIEA 1Q56A 2Q1MA 3LCPA 4J6GA 4IESA 2PAEA 3HD8B 4YG6A 1GV9A 5FO8B 4Q4Y1 4COYA 3WP4A 1BK1A 5DDJ2 4AGGA 3WDYA 2BFUL 3THPA 4R8HA 4CDWC 2GNTA 5BNPC 3V65A 1A6CA 1WW7A 1ZRDA 4COWA 1CPNA 2VW1A 1OPOA 4CDQA 1B35C 1LU2A 4KWKA 4N53A 2VGDA 3APBA 3WW1A 5C9AB 3JZVA 4L97A 1VBD1 4WM8C 2EAAA 4AI3A 2WFF1 2YGMA 5SV5A 1UKGA 1LULA 1WCKA 4OHZA 3T1MA 1RUJ3 3OBRA 5IK4A 5A32B 2R073 2WLQA 1FATA 3ZYJB 1VRH1 1EAH3 4R9BA 1QH7A 2W68A 1WLCA 2WNUA 2HJIA 3WQ1A 2BTVC 4GIQA 1C5IA 4H3WA 3H9AA 4PIYA 5KBFA 3AM2A 3W59A 1SLBA 4CEYA 1PZ9A 4P9GA 4YFWA 2ZX3A 3WCRA 2WSUA 1YRZA 4RS5C 4DPNA 2A6VA 4E4SA 4Q4Y2 1VAVA 3OJBA 4MLOA 1SLLA 1KDMA 2E7QA 2E7TA 4PLOA 2YXSA 1UU5A 1KDKA 1SMVA 2O8QA 1V6KA 4Z1VA 3HQXA 3KSCA 1OFSA 2VQAA 2D5HA 1LJ7A 1GSLA 4EWDA 3GZTB 3UJQA 1H8TC 3EBRA 3ZXGA 2F4PA 1D2QA 5CU1A 4V1PA 5KHKA 1Q8PA 1WCDJ 3WCSA 1QH6A 2ET7A 3I54A 3MPBA 4TSVA 2OW4A 3MIGA 2DVBA 3VBSA 4AI0A 3UK9A 4GWNA 3ELNA 3VHNA 4LUKA 2GC2A 2WZR2 3UL2A 1R1A3 1FPN3 2K9ZA 2Q0AA 5JZGB 1D4VB 2FZ1A 5J37A 1W6PA 1WBFA 3JQWA 2GNMA 4PLNA 5FQ0A 2ZGPA 4DNYA 5AC91 1LCLA 1OKQA 1DQ6A 1SBFA 2AR6A 4GQ7A 2B7YA 2XKOA 1C8M2 2BW8A 4XJ9A 5A33B 3M7AA 1AYM2 2QQPA 4LEJA 3OCPA 3VBOB 4DMIA 1AL0G 1MQTB 3ZXKA 2GU9A 2VQ0A 2GMMA 2ZHNA 3MIHA 2JG9B 5GJ6A 3TN92 3N35A 1AUYA 3KT4A 4I30A 4QPGA 5D1IA 4GKXA 2BFUS 4FPYA 2E53A 5HCBA 4CEYC 2XGXA 4IEWA 1DQ1A 4M3CE 3ZO0B 5BNNA 2WNVC 1MVQA 4EN6B 5E8AA 3PMSA 4AE2A 1IPJA 1BVVA 4QPIC 2HYKA 3IWZA 4AFBA 3M3EA 4KGQA 2ARBA 2PHDA 3MEPA 1RUI3 2GDFA 2NZ9A 2WNEA 3KT1A 4Y22B 4MZUA 4YZ5A 1H2MA 2VMGA 1Y3TA 1JYIA 4AHZA 1OA4A 1KFUL 1RHI1 5KHGA 4LO8A 1YIFA 1ZX5A 2XJUA 4MXVA 2PAKA 1ENRA 1IOAA 4FPFA 4LR4A 3WVJA 2R1BA 3BU7A 4Q0QA 1G9DA 4XOGA 4AWDA 1ULGA 2QDRA 1AR83 1C8M1 1ZBE1 4XXPA 3PJQA 4J1XA 2QDNA 5T54A 4AF9A 3PVNA 1FPN1 1WLWA 4FPHA 4KNCA 3WY6A 1I9RA 3KCYA 4FPKA 1COV2 1F5FA 3VKFC 1J3PA 2XJTA 1C3HA 4NWWA 5FLJA 1V9U2 2A6WA 3FUQA 1HXS3 3GBFA 3E5XA 1DF0A 3M70A 2BWAA 4K6BA 3EO6A 4ITCA 4JRAA 4XF0A 1Q3EA 4QPIB 3JBG3 2DUPA 3PVEA 3RWNA 3KB5A 3K48A 4BWOA 4J1WA 4AEKA 5FPXA 2WNVB 1PO21 4X6QB 2RR12 4MV2A 5C6CA 1MS5A 2NN8A 2P34A 4SBVA 2YZ4A 5JI9A 1GQGA 5IK5A 1D4M2 2QCSB 1ND3C 3DF0A 4U2AA 3IDEA 1X82A 4GB33 4CRQA 2R32A 2V73A 3OYWB 3ZYIB 5GLUA 1RB8G 2IXLA 3VBOC 5JOYA 2GAUA 1UIKA 1HKDA 1BQPA 3LOBA 1G9FA 2R30A 3NWKA 5ACA3 1X8EA 5DZEA 1S0BA 2GC1A 1NXMA 2XWJB 4CDUB 2D97A 5DUUA 2XLFA 3VBFB 3WP6A 3AZWA 3D5OA 2ZACA 4ATFA 5LK5A 4AQ6A 3VZNA 3BOWA 1LR5A 3UV9A 2DCYA 2FZ2A 4F7ZA 2KA3A 1XNKA 1VJ2A 4CYDA 1VBE2 3ASIA 1NY71 3AB0A 3BB6A 1AHSA 2EXIA 2PN5A 4QMAA 2HWF3 4Y1VA 2ZGLA 1X36A 2K0GA 3AKQA 1R1ZA 5C9AA 3ATGA 2RS51 2X5IA 2JICA 1HW5A 1X7NA 1U5ZA 4QT6A 2JG8A 4EN9B 1MZ5A 4M00A 5ABJB 4AVTA 1Y7BA 3SCHA 2ZMKA 4ORFA 1G9BA 2JX9A 4GB31 2GC0A 1PGW2 2AH2A 5CA6A 3TBDA 2DTYA 4YLZA 1YFXA 1RVF2 3O0VA 1PGL1 3LKJA 5KHIA 1A78A 4EN0A 5BYNA 5FFOC 5HBAA 3A0KA 1SQ4A 3E6DA 4LO4B 3RS6A 2UYAA 5GZEA 4WVZA 1YNAA 5BV6A 1RUOA 1LU1A 1RUH3 1RUC1 3GYDA 1WW6A 3VBUC 1HIXA 4XJZA 4WM7C 4S2GA 4GA9A 2B42B 3TNQA 5JMCA 1H1IA 2UWAA 2ENRA 2JE9A 1OOPB 1XYNA 2O8OA 2TEPA 1OSGA 4YRDA 3K51A 1I3HA 3S7EA 5FLIA 5JVVA 4AVBA 4Z07A 4XETA 1WD3A 4RS5A 1OD5A 1NE4A 1CAXA 2MEV3 3GHNA 3X29B 4E27A 2QE3A 2D93A 5C9AC 3I59B 5HI0A 4XTMA 3IM0A 1BEV3 1D4M3 5JDBA 2EXKA 3KMHA 2R071 4B7KA 1PK6C 3EXUA 3BOPA 3WZ1A 1NA1A 1RVF1 1W2UA 2VVDA 4Y1ZA 1DQ5A 4RHV2 5IT6A 2D6PA 3FFQA 4BOWA 4PLMA 4GH4C 3IIAA 5I8YA 5DUVA 3ZIXA 4IL7A 4XFBA 1VAMA 5HCFA 3P3PA 4R4ZA 5EWSA 3OTFA 1ZRCA 4FAGA 3RJ2X 4K21A 3WW2A 1W39A 2VMHA 1CESA 4N90A 3VDDC 3ZXFA 5CVRA 2BNNA 1LRHA 4N9IA 1PO23 2DFCA 3IPVA 3FLRA 1HV1A 1VBE1 4K1ZA 2ZZQA 4W6YA 5L73A 5LEJA 1MS0A 1TME3 3AFKA 4LBLA 3BPZA 3VBSB 3NV3A 4KL1A 3MIBA 4DRRA 5JR7B 1WMEA 1ZZ7A 1EYBA 2Z42A 3DKWA 4BPZA 1VBE3 4L11A 4XF1A 2BWCA 4Q29A 4MVTA 1IS5A 2LALA 2XLAA 3NVCA 3W9AA 2B45X 3JD73 3JQXA 1DBNA 1PHMA 5JZGA 1QF3A 4WVWA 1RL3A 4H14A 1VBA3 3JUUA 2Q8OA 2QKDA 2UU8A 1ZRFA 4IV3C 4UW5A 1OA3A 1BBT1 5CFDA 5HCAA 1NLRA 3GNEA 5ACA2 1ZA4A 2PHXA 3QD6A 4BLIA 2BVVA 4YM3A 2QZ2A 1R083 1REEA 1AR72 1VBC2 3WG4A 5E1RA 1EV12 4M0NA 3AX4A 1UZYA 1H9WA 4RQPA 4GULA 3VUOA 1T6GC 4IEXA 1CAUA 2A3YA 3NSTA 3KCXA 1HDKA 2VOKA 1AYM3 3J8F3 2D7FA 1IS6A 1C57A 3GBWA 1ND2B 4Q0PA 4YVWB 1MS4A 2UYBA 4AEDA 4XJAA 2TBVA 1RJ7A 1Q8VA 3ZPYA 4XZPA 3WG2A 4XBNA 3MIDA 1WA4A 3KCCA 1LB2A 4N43A 1VBA1 1H2NA 4CDWA 3WT3A 1D4M1 4Q4V1 4XEZA 3GZAA 5T55A 5L36A 1YFYA 3HAGA 1Q43A 4QD2A 5JSOA 2CL2A 4OLLA 4BA6A 4JDMA 1ND3A 2OUJA 4C0BA 3USUA 2C9AA 4RR3C 2Z2SB 3URFA 4YGEA 5JWPA 3AP7A 3M4FA 1CQ9A 1AR91 2DCKA 5IUQA 4AEMA 4N53C 5GZDA 1GZ9A 1ZVFA 2F6BA 4AHXA 2R49A 2WKKA 4RD7A 4JDNA 1BMV1 4PBOA 4HETA 1ND2C 2VOVA 3MW2A 1NCQB 3B00A 4GALA 4Q1PA 2ES3A 2ZGMA 5L19A 4AHYA 3RPQA 2TUNA 4W6XA 3DPRC 3B93A 1LHUA 2UWBA 1QXPA 2I2SA 1JHNA 1ULDA 4Q4Y3 2E63A 4DOUA 1RHI2 5T52A 2I07B 4XJWA 3AK0A 4QM9A 3V64A 2QVSB 1AX0A 2ZCWA 1OLQA 4CDXB 2BYVE 4K8FA 1OI6A 1O4YA 3TOJA 1IHMA 3WQ0A 3DN7A 3LWCA 5AVPA 2W39A 4IV3B 5GLWA 2VUAA 5J96B 1FNYA 3VBHB 5L7OB 2RM22 5GLVA 4G9SB 2OVUA 1HRV3 2D5FA 2YHJA 2RS53 3OYWA 2XPJA 1LOGA 1G7YA 2XG3A 4MGKE 4FOQA 3MLLA 3VZLA 3H0OA 1GYKA 1F2NA 1QDCA 3RYPA 3VBFA 1ZM1A 4E2QA 2RS11 1QNYA 3VBSC 3DL3A 1QOOA 3N7JA 2V5YA 4Q27A 2DCJA 1F9KA 4PCRA 1V00A 3ILRA 1LOBA 3A4UA 3EJKA 4NVPA 2I74A 1POV1 4DY5A 1AL23 2ZKNA 3BIWE 4HANA 1FI2A 1EV13 1JH5A 1N3PA 1MS3A 4Q1RA 1KS5A 4OFGA 1FYUA 4NN0A 1AVBA 1LENA 4FPJA 3D8CA 4X8NA 4YNIA 4YZ4A 4XFCA 1RJ8A 4QGLA 4GH4B 3WDVA 2RM23 4IEQA 3IKWA 3VGIA 3ZXAC 3GALA 4FTEA 4G4FA 1VBA2 1REFA 3FMGA 2R1DA 2NYYA 1PGW1 1S0IA 4LO7A 4LBKA 1PK6B 1WMFA 1BYHA 2E6VA 1TEIA 3G6JB 3POYA 4K40A 5GKAC 1H8VA 1AYN3 1Y43B 3C2UA 1PM7A 5CG9A 2XUMA 3S30A 3SMHA 2YPJA 4XQ4A 3ZN4A 3WG3A 1UL9A 4M3CB 1ZBA2 1ZNPA 2R041 5LRRA 3TRSB 2WFF2 1JN2P 3I8TA 2GN3A 1EPZA 1OOPC 1W6QB 3RYKA 3TB0A 2XJVA 4IEUA 3UJOA 2D40A 2R072 2H6BA 1H4HA 2SLIA 4XJ8A 1RUI1