1LESA

Lentil lectin complexed with sucrose
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
181
structure length
181
Chain Sequence
TETTSFSITKFSPDQQNLIFQGDGYTTKGKLTLTKAVKSTVGRALYSTPIHIWDRDTGNVANFVTSFTFVIDAPSSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKEYDKTSQTVAVEFDTFYNAAWDPSNKERHIGIDVNSIKSVNTKSWNLQNGERANVVIAFNAATNVLTVTLTYPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords LENTIL LECTIN
publication title NMR, molecular modeling, and crystallographic studies of lentil lectin-sucrose interaction.
pubmed doi rcsb
total genus 27
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature
pdb deposition date 1995-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lesA00
5GZFA 3MEPA 3B69A 4BLJA 3Q9OA 1DQ2A 4Q27A 4XXAA 2E7TA 1HDKA 4PF5A 1AF9A 5IT6A 1LOEA 3DGTA 4FPYA 2DVGA 3ZPYA 1MS4A 2KM2A 1UN1A 2H0BA 5JMCA 2A6ZA 4FPJA 1WD3A 1DQ1A 4W65A 4DRRA 1IS6A 4LBKA 4SLIA 1N1SA 1SLIA 2EF6A 3ZXLA 3A0NA 2NP0A 3ILNA 4XIOA 3LSEA 4BQ1A 1MS8A 1ULCA 2R1BA 1WCSA 4M3CF 5DZFA 1MZ5A 5H9SA 5LK5A 5DUVA 4DFSA 5KXCA 3FLRA 1DYPA 1DQ4A 4LBJA 1Q8QA 1V6MA 1VAMA 4Q8LA 4YZ3A 1SLBA 2DVFA 1IOAA 2SLIA 3PJQA 3R4SA 4YFWA 5KXEA 1NXD1 1W6OA 2D43A 1FV3A 5EWSA 1WD4A 4CZSA 1I3HA 1RINA 3V0AA 1LHUA 3N7MA 1YI7A 2DTWA 3ZSKA 4YM3A 1MS3A 3GALA 1GYKA 4LBQD 4XJWA 3VKLA 1WLWA 2ZGLA 1AXZA 1KDMA 4Q2FA 3POWA 4K21A 3HMYA 2D6PA 1SFYA 1LGCA 2A7AA 1LOFA 1LHVA 1V6JA 1LODA 1GBGA 2VXRA 1CVNA 4XHBA 2B7YA 4FOQA 4TYSA 3M3QA 1W6MB 3HR9A 4R9DA 3V0BB 1F31A 2C9AA 1Q8VA 4XZPA 4Y1YA 3SISA 1ULEA 2XB6C 2P34A 3WCSA 2A6VA 3FLTA 2JD4A 4OZXA 4FVVA 5T55A 4PBOA 3SH4A 4ATEA 1VALA 1C57A 2UWAA 1G9DA 2R1DA 1V6OA 4AGGA 2GMMA 1V6LA 1UMZA 1S0EA 1GZWB 1UZZA 3B9CA 2P3JA 2JKBA 1CJPA 1ONAA 2A3WA 4YZ5A 4GWMA 3OBRA 1QNYA 4HL0A 1UAIA 3WG4A 1V6NA 2D7FA 3WHTA 1F5FA 1LU1A 1Q56A 2CTVA 2ZGKA 2ZHKA 2V73A 2ZBJA 4PBPA 1GZ9A 2NN8A 3AX4A 1G9FA 1SLTA 1LEMA 1S0FA 1WBFA 4WV8A 3KM5A 1AZDA 1W6MA 1S0BA 2CY6A 2NMNA 2ZGMA 1QDOA 3FUOA 3NV1A 3V0BA 4GWNA 2YY1A 3VV1A 5DZGA 1SBFA 5GLTA 3WDVA 3ZVXA 3NV4A 5F9TA 3OY8B 1DQ5A 2R49A 1LOBA 1KRIA 5GZEA 5H9RA 2GMPA 4R9BA 2AGSA 2EXKA 3MW4A 1WUVA 2LALA 3PMEA 5FRAA 3M3EA 3RMYA 5DG1A 3BIWE 2DU1A 3GNEA 2ZHMA 3AJYA 1DBNA 3FUQA 2ZGQA 4XJ9A 1GZWA 4AWDA 5EXOA 3TB0A 5T5OA 4YM0A 4LBNA 3W58A 4ISQA 1FATA 3ASIA 1JW6A 1O4ZA 3T1LA 1ENQA 3UK9A 4AVSA 2CYFA 5HCAA 4BM8A 2D3PA 4NOTA 3FBYA 4M00A 3T1MA 1Y7BA 4CTEA 2OW4A 1GANA 1MZ6A 1N1VA 1A8DA 2GNBA 3ILRA 4GA9A 3VKNA 2GN3A 4AGRA 1N3OA 2A5ZA 3IM0A 1EPWA 2PHUA 4YGEA 4RA0A 3AP7A 1RITA 5HCFA 1LGBA 4XJUA 5CNAA 4BMBA 2I2SA 4YM2A 3BODA 1AVBA 3OY8A 1WW7A 2DV9A 1C1FA 1QOOA 2UWCA 4XBLA 3AYDA 1MS0A 1GZCA 1S0GA 1QF3A 2ENRA 2PHWA 1Z78A 2R16A 3I4IA 3WG3A 1ULDA 2CWMA 3A0KA 5CAZA 4ATFA 4BLIA 1GKBA 4U2AA 4YW3A 4XDQA 4M3CB 4MYEA 5GJ6A 1DIWA 1J1TA 1MACA 2PHXA 4YG3A 1AX1A 4FPEA 2EAKA 1GNZA 4XJ8A 2UWBA 2WT0A 1G8WA 5IK4A 3ILFA 1QOTA 4UW6A 4WVVA 1CPMA 4PCRA 3WG2A 1QKQA 3USUB 3ZSLA 3ZXKA 5L73A 1D2SA 3ENRA 2WSUA 1H30A 2P2KA 2VUAA 4FQZA 3N7LA 2WSVA 2EXJA 3FLPA 5BYNA 1DLLA 2DVBA 3N7KA 3R4UA 1AX2A 2WJSA 3AZZA 2WLQA 4TZDA 2WT1A 3AYEA 5DXDA 4XIKA 2ZGRA 5SV8A 2DWRA 2OVUA 2VW2A 2YV8A 4K20A 2AENA 4U36A 1H9PA 1SBEA 4YZ1A 1FYUA 2GNTA 4M3CA 4Y20A 3VUOA 4FPKA 3BOPA 2EALA 1SBDA 4AVVA 4FPCA 1QOSA 5EYYA 5E8AA 4Y1VA 4ZXKA 2D6LX 5DUUA 5CA6A 4YM1A 1BXHA 1HQWA 1LTEA 4XBQA 1ENSA 1SLLA 1SCRA 4LBLA 4Y22B 3USUA 2VU9A 3NWKA 5JVVA 4Z8BA 1CESA 2ZAAA 2GNMA 3AYAA 1QDCA 2ZGOA 2HYKA 3VKFC 1LGNA 4YW5A 3UJQA 3D4KA 4JCKA 2AH2A 2ZKNA 4XTMA 5H9PA 4L8QA 1KDKA 5CB7A 1GLHA 4YG6A 4YFZA 3WUCA 2AREA 3WDXA 3B01A 4R9CA 3OBTA 1QNWA 3AYCA 3OJBA 1WW4A 1GNHA 2ARBA 2A75A 2CNAA 3RRDA 5KXDA 3TAYA 2JE9A 2E6VA 3IPVB 4Q26A 2WT2A 4Y24A 5DUWA 3POYA 4Q8KA 5T5JA 3O0XA 1LOGA 1A3KA 2EIGA 2JDZA 1LOCA 5GLUA 4Y22A 2VW1A 2UURA 1AXKA 4Y26A 3PVEA 3M1HA 2ERFA 1W6NB 1FAYA 2DTYA 3FFZA 1BKZA 2W39A 1BJQA 1KJLA 1N1YA 3M2MA 3WOGA 4BPZA 2DUQA 5DUXA 2AR6A 2PHRA 1N1TA 3WV6A 5IK7A 1ZM1A 3WDYA 1JN2P 2TEPA 1D0HA 5E88A 1GICA 1UX6A 2DVDA 2NYYA 1H9WA 3N36A 1BYHA 3INAA 2D44A 3AFKA 2WNEA 1MS9A 2A71A 1G7YA 1FNZA 1WW6A 3MPPG 4DQAA 5AVAA 1ZA4A 4XILA 3WCRA 1OFSA 2NZ9A 3C2UA 1LHNA 3IPVA 3O0VA 4YGDA 3VKMA 3WUDA 1JYCA 2PHTA 2ZGSA 3D5OA 4ISRA 1V00A 5GLVA 1CONA 1GSLA 1WLDA 3LSDA 4C1XA 2JE7A 3MW2A 4F83A 1WLCA 1YIFA 1MVQA 2AUYA 1JXNA 1O4YA 4Y1ZA 1W6NA 4XBNA 2FMDA 3ZXFA 3AP6A 5H9QA 2VH9A 2ES3A 4NO4A 1MS5A 3RQ0A 2ZGPA 3SH5A 3ZXEA 3W59A 4YZ2A 1SACA 2W68A 3CNAA 4GALA 1G9AA 3ZSMA 5JOXA 4FPLA 4XJAA 4ZKTB 2DVAA 3WDUA 4UW5A 4Y20B 5JOYA 1LCLA 2GDFA 2ZMLA 3OGGA 4XMAA 1IKPA 5FREA 2EXHA 3JUUA 4XJZA 2YZ4A 3D6EA 5DZEA 3ZYRA 1LJ7A 1Q8PA 2D6MA 1LEDA 4FPHA 4YW2A 4P14A 1QMJA 3QCWA 4AYUA 2Z42A 1IS3A 1LOFC 2D6NA 2SBAA 5GLZA 2ZGTA 3WLUA 1CN1A 1BZWA 2E7QA 3AZXA 3PVOA 1JBCA 3IMNA 1JUIA 4AVTA 1GV9A 2ZMNA 3M3CA 3SLIA 1OQ1A 3O5SA 1VIWB 2A3YA 1OKQA 1A78A 3B3QE 4XYXA 1S0JA 4YGBA 3O0WA 1AJOA 3WVJA 2A6WA 3SNMA 3OYWB 5F5QA 1N47A 4I30A 1KQRA 2C5DA 4P9WA 4BMEA 1ENRA 1LHWA 1MR5A 4XHXA 4FPGA 2FHRA 3HN1A 1FNYA 1APNA 3WDTA 4UW3A 2PHFA 4KBBA 1QU0A 3V64A 4XE9A 3N3HA 4LBOA 2VW0A 3AZWA 1MS1A 3ZXJA 3QLQA 3WDWA 4P9YA 3MW3A 4M3CE 2G4IA 4DRVA 3AXDA 2CL2A 1LENA 4YW1A 2ZABA 5GZCA 5IK8A 5GLWA 2R0HA 4C1WA 1IS4A 4Y1UA 4XOGA 4GKXA 4Y1XA 3BTAA 1PZ7A 5T5PA 4YG0A 1CQ9A 1PZ8A 2JECA 1MVEA 2E51A 3IKWA 4FOYA 5T5LA 1UL9A 1HLCA 1UPSA 5T50A 3U4XA 2EXIA 4K1YA 1DYKA 4LBMA 4IQPA 4D69A 2A6XA 2P3KA 3OYWA 1I1EA 3WZ1A 1YXWA 2DUPA 3AZYA 4UW4A 3O12A 4ASMB 1JYIA 1ULFA 2D6KA 2RHPA 4LBQB 1JHNA 1LU2A 3RS6A 3B00A 5GM0A 2ZGNA 4JC1A 4JRAA 1C1LA 5DG2A 4Q1RA 2AYHA 3SITA 1VLNA 5GZGA 1PZ9A 1CR7A 1S0DA 2E53A 3AJZA 4FOVA 3RSJA 1LHOA 2W52A 3L2YA 2DUOA 1HKDA 4DS0A 1BQPA 1RIRA 5JLVA 1C4RA 4PQ9A 4DPNA 1CPNA 4XXPA 1ULGA 3SH3A 1DGLA 3AXEA 1VAVA 3I8TA 5GALA 1X50A 2ZHNA 1URXA 4P9XA 5CBLA 4FQ4A 3AP5A 5T52A 4FPFA 2ZGUA 3AZVA 2DU0A 4XMIA 2D6OX 1DFQA 2YXSA 3DUIA 2DYCA 2GALA 3R05A 5JDBA 3A4UA 4YGCA 1N3PA 1W6PB 1AXYA 3N35A 2GMEA 2ZACA 4M01A 4FP3A 2GN7A 1YRZA 1R1ZA 1WW5A 1G9CA 1B09A 4YLZA 3WNXA 1W6QB 3VKOA 1W0OA 1YO8A 4CRQA 1AJKA 2OUHA 1G86A 4LBQA 2ZHLA 3M3OA 1F9KA 4YZ4A 1JOJA 2Q5TA 1N3QA 1WBLA 2DURA 1CIWA 3H0OA 3OPZA 3ZSJA 1G9BA 1V6IA 1KITA 2P37A 1DHKB 2VY0A 3POSA 4BOWA 3NV3A 1DQ0A 1DZQA 4WVWA 1HQLA 4FOWA 4WZFA 4GKYA 2WKKA 3V65A 2V5YA 4AGVA 1LULA 2OUJA 1AX0A 1W0PA 4ITCA 2PELA 3JU9A 5JOZA 2UU8A 2W08A 1DQ6A 1Z0HA 1SCSA 2GNDA 2ZZJA 3N7JA 3T2TA 1S0IA 1FV2A 2CWSA 2YMZA 4YW4A 2R0FA 1LOAA 1XQNA 2XG3A 2P3IA 5KXBA 2A70A 3IN9A 1Q8OA 3KQRA 4RL7A 1S1AA 4XTPA 3LCPA 1FX5A 3AK0A 2JJ6A 1TEIA 1UKGA 2BQPA 2ZA9A 3NV2A 1LECA 2NM1A 1W6PA 3AP4A 1U0AA 5HCBA 3WG1A 1S0CA 5GZDA 1KJRA 5JOWA 2A6YA 3RG0A 2A3XA 3RMXA 3PVNA 1QGLA 1W6QA 2YROA 5IK5A 1IS5A 5EYXA 4FPOB 1V6KA 2ZMKA 4H55A 2D3SA 3APBA 3ATGA 2LTNA 1SLCA 1Q8SA 1SLAA 4GXLA 3UJOA 3ZYPA 5T54A 3WHUA 1LESA 1YYNA 2NMOA 1IKQA 2ARXA 4FP2A 2WQZC 4R9AA 5IUQA 4Q1PA 1W6OB 3AP9A 2D3RA 4K1ZA 3UL2A 1NLSA 4HANA 5E89A 3V0AB 1UZYA
chains in the Genus database with same CATH superfamily
4BLJA 4A3ZA 1CZTA 2VMDA 3B69A 5ABJB 1RUNA 3P3NA 5JUVA 3R4DB 1O8PA 4BU2A 2H6CA 5IT6A 5M0TA 4FPYA 1ASJ2 2DVGA 1SDWA 2FCTA 2JE8A 2KM2A 2RDRA 3J7NA 1HV0A 1OD5A 1YJLA 1YUDA 4IEZA 4LKDA 4RHV1 1UN1A 3LB9A 4KWJA 4W4ZA 4ZPIA 3H8RA 4NHXA 4DRRA 1IS6A 4ZXEA 1X8EA 1OVPA 1AR82 5FZAA 5C3OA 4JDOA 2NLRA 3CZUA 4TWTA 5FPVA 2C6SA 4BQ1A 3FBMA 2LW8A 2Y6HA 5F2WA 2FDKA 1AL22 5DZFA 1WCSA 4AAXA 5EQUA 4OZOA 3KLSA 5JR2A 1DYPA 3LOIA 4CDWB 4LBJA 2ATFA 1BMV2 3UKVA 4Q8LA 4CPBA 1SLBA 2DVFA 2WQ4A 1VPHA 3J8F1 3R4SA 4XUOA 4Z2WA 5IYYA 1W6OA 2B39A 2VVDA 2C24A 2ADEA 4K7JA 3V0AA 2ZJCA 1W3VA 1YI7A 2DTWA 1ZVFA 2HWC2 1BK0A 3K4AA 3JD73 3N7MA 5IAVA 5ABJA 2BWCA 1PHMA 1JZ7A 2CGPA 1AR81 2VM9A 1MQTC 1OFNA 1WLWA 4CDQC 4EQVA 2JDNA 4E2QA 4P5HA 1VBE1 1H4GA 2VCMA 4RS5C 4DIQA 5FZ6A 1LOFA 1LHVA 1V6JA 5CYYA 1S2EA 2MEV2 4IXLA 2AACA 1TMF1 4MGYE 5IVFA 1QEXA 3LWCA 5ACA3 4CDWA 5LBFA 4ATEA 3RI8A 4ZZ8A 5JZGA 1VALA 4CCCA 1LB2A 2UWAA 1WCDJ 3BPZA 1R081 2GMMA 4C8DA 3C7GA 1EV11 2E31A 2HWD3 1GZWB 2K9ZA 5HI0A 3BB6A 4PF1A 2PLV1 4XEZA 3OBRA 2ZEZA 3ZFGC 1UAIA 1FMD3 5FZHA 2W5FA 2D7FA 2JG9C 2WZR2 1RVF3 4Z92B 1JZ8A 4Y5SA 3RZHA 4O9EA 2WBKA 5FYIA 2GH8A 2VZ3A 2G9ZA 3LQCA 2ZBJA 1QJFA 4Q5OA 1GZ9A 5LB6A 1EAH3 3WW3A 3PIGA 4PT6A 4QM9A 1YI9A 2EIBA 3AKTA 3K77A 1YQCA 4BK5A 3KCCA 4XC9A 1AZDA 2NMNA 4ZU5A 4AFBA 1JZ6A 4GWNA 1RHI2 3JBG2 5BY5A 3WDVA 4P9LA 3C3VA 1J1LA 3SHRA 2BNOA 1OC1A 4K6BA 4OYUA 4CCKA 1XRUA 2FZ2A 1KRIA 1QH6A 1ZBA2 1J58A 5H9RA 3ZMNA 4XCBA 1Z7S1 2VCBA 4RHV3 2EXKA 5LASA 4COZA 3PMEA 3M3EA 3RMYA 2WZR1 1WCUA 4N43B 3UV9A 2RJKA 1BEV2 3AJYA 4Y4YA 3LEKA 2ZGQA 1GZWA 3OBAA 4JKLA 5C8CC 1W9YA 4XW3A 4OUSA 1GOFA 4IW3A 4LHLA 2R072 4YM0A 3W58A 4I02A 1PO21 3ES1A 3ASIA 2YC4A 1JUHA 2QQIA 4BK4A 4O65A 4CPBD 4NOTA 2HH9A 5CFCB 2F17A 3HBKA 3U4SA 1GANA 1QJU2 4GA9A 4AGRA 2BFUL 2XMLA 3J8F3 1EPWA 1XOYA 3ZFEB 3I2OA 1ASJ3 2BNMA 4QPIB 4RA0A 5A7NA 2G9FA 5F8PA 3AP7A 4KL1A 2BEOA 3RPQA 1SEFA 4OHYA 2JG8C 1CD3G 3WXPA 2I2SA 4YM2A 2CHHA 1S2BA 1AVBA 1ZRIA 4CU6A 1AR83 1C1FA 4BH9A 3VDBA 3WF2A 3H3UA 2PHWA 3RGBA 3MO4A 4Q29A 3PUAA 3A0KA 1AL23 3W9AA 2ZAHA 1WCQA 2BRTA 2CU5A 4KH9A 4M3CB 4N43A 1GUIA 1GU3A 2PHXA 3PURA 4QXCA 4NVPA 1QJU1 4FPEA 3SEEA 3FHIB 2EAKA 5J1XA 2WT0A 4XUQA 2WZEA 4NHLA 1G8WA 3HIFA 1UXZA 5FFOC 5DAQA 5F5CA 1CPMA 3WG2A 5C8WA 1QKQA 3USUB 5CFCA 5FQ0B 3ZPOA 1JH5A 3IDCB 1S4CA 2P2KA 2R30A 2VUAA 1ND3B 3CEWA 3IBMA 4QX1A 1VBC1 2WSVA 3CO2A 2HBTA 3DECA 3ZFEA 3KD4A 4QPIA 4A6SA 4QXHA 3R4UA 2DFBA 2P3YA 2WJSA 3O14A 2XLFA 3ABZA 1R1A2 3M70A 2WT1A 4XQDA 2BUKA 1D0GA 4JRLA 4TZDA 1WGPA 2YV8A 4U36A 1C5IA 2VULA 2VG9A 2WO1A 1UY2A 1H9PA 4LHSA 5C4WC 3NJZA 2ZX2A 4S2HA 2VOXA 4YZ1A 3BOWA 5J09A 4M3CA 2EICA 4HMZA 2D98A 5SV5A 4TSVA 4AVVA 3U37A 2D93A 4ASKA 1QOSA 2VMFA 4HZFA 1W90A 5EYYA 4E4ZA 3ETPA 2D6LX 3PMSA 4ZXKA 4O9GA 5CA6A 5KHGA 1K5MC 1WMEA 2GC2A 4R4ZA 1COV1 1HQWA 1DGRA 5JIAA 3VHRA 2ET7A 2PA7A 2VUJA 5I93A 5FWEA 3USUA 1VBB1 5L7OC 4Y22B 5FQ0A 5FYBA 3KVBA 4D8MA 1ND3A 4KNCA 5FZGA 4JKKA 1QQP1 2Q8OA 4FTEA 1I6XA 2ZAAA 4DXSA 2WZR3 4AAPA 1CZVA 4DO0A 2WINB 2BBVA 2GSYA 1QDCA 4LO8A 4M4RA 4URAA 2PQSA 5JI7A 1XU2A 3BTYA 3UJQA 1LAJA 1XE0A 1XBFA 5FZDA 2ZKNA 3WQ7A 4XTMA 3K3OA 1JMUB 5CB7A 2J1RA 1YFYA 1AYM2 5JXGA 4IE6A 3F95A 3B01A 2VOTA 1RHI3 3JBG3 4DXZA 1JZ3A 2GAUA 1QJZA 3P6BA 5FY9A 1GNHA 2CNAA 2A75A 4QQLA 4ZHNA 5HCHA 3RDIA 1ZBA3 2E6VA 1UKRA 3POYA 5I91A 5T5JA 3POIA 3TEZA 3O0XA 1BEV3 1A3KA 1O91A 2IXLA 4Q4V2 4AI3A 5GLUA 4Y22A 2UURA 1AXKA 4Y26A 1PGL2 3WEZA 4AR2A 5LCWL 2VOVA 4QX2A 2R073 5L9BA 3CHXA 1HB4A 4Y33A 3AKSA 3MDPA 4LKSA 2XPJA 5DUXA 4AVCA 2X09A 5IK7A 1H2KA 1W9WA 1US2A 3BUCA 2E33A 2WZPP 1WKYA 4URTA 4NIDA 3B9IA 1QJU3 4LA2A 4HG6B 4OHWA 5J3UA 1UZ0A 2MPFA 1D4M1 2Y34A 4QQ2A 5A6ZA 3VZKA 1EUTA 2KA3A 1ZYBA 2RE9A 2YU1A 4QKFA 4XFCA 4NROA 2QQOA 3MPPG 3O1VA 2XJRA 5AVAA 3J26N 3DKWA 3NAPC 3VBUC 4AQ6A 2IXIA 2NZ9A 1UF2C 4N9IA 3ZYBA 1JYVA 1I5PA 3WUDA 4JQTA 4QPWA 4IERA 1W2NA 2XONA 5L36A 1GSLA 1W8ZA 4FCAA 1CGPA 2W87A 2XVGA 3OUIA 3WY6A 4C1XA 4F83A 2UY9A 2CAVA 2ZEYA 1HIXA 4IGOA 4AK3A 5C33A 4XQ4A 4LKFA 3ZXFA 2GP3A 5C6CA 4ET7A 2ES3A 4NO4A 4YSFA 1OLQA 3W59A 4UI9L 3K46A 1YQ6A 3KZ4C 1ZRRA 2Q30A 2VNVA 4Z07A 3CNAA 4K8RB 2J7MA 4GALA 3RFRA 1XSRA 4BYYA 3RZKA 3WW4A 4UW5A 3E97A 3RI9A 4Y4RA 3OGGA 2ZEXA 2C9KA 1R1A3 5FREA 2EXHA 3JUUA 5DZEA 2DFCA 3D6EA 3ZSKA 3EBRA 1KD7A 3IDBB 1Q5OA 3WSOA 2PHLA 3LEMA 4A45A 4NHMA 4B8EA 2QTWB 1LJ7A 2WFF2 4H2AA 4O61A 5FZLA 3QCWA 1XPWA 2B9VA 2KXLA 4CU8A 2VGDA 1RUE1 4PLMA 1CN1A 3DV8A 5HPOA 3QOPA 4W6WA 2WA3A 3ZFFC 3SLIA 2VVFA 1HRI2 4CCDA 5F1RA 1U5ZA 5FZ8A 2QCSB 2W1SA 5FAXA 4TLGA 3WP4A 4CEWC 4LR4A 3WVJA 1BVP1 5FIXA 2J1TA 4P9WA 4EJRA 1OD3A 1LHWA 1MR5A 2P1BA 4LXLA 5DAXA 3HN1A 1FNYA 1CX4A 2E7AA 2RS52 4NIGA 5EPAA 3B7MA 2PHFA 4B4RA 1JYWA 2FCVA 4WBBA 3DF0A 1RUG2 1UX7A 3AZWA 3MPBA 4QKDA 2C4XA 2NPIA 1OUSA 3QLQA 4XUNA 1UY0A 3RYPA 4DRVA 3AXDA 1FPN2 4HONA 1AYM3 2ZABA 3VL9A 5GLWA 2R0HA 1IS4A 2WC2A 4XOGA 1Q43A 4YPJA 4GKXA 4D7YA 1VAKA 4DXRA 3BTAA 1QJX2 2WZ8A 5JXIA 5L9VA 3POBA 1PZ8A 1NCRA 4FFGA 4JVAA 2E51A 4IEPA 4XF4A 1ZX5A 3IKWA 4FOYA 2JKXA 4META 1GOGA 2RS51 5FMCA 5T5LA 1X9TA 1UPSA 5KHJA 4AEKA 4ZONA 2EXIA 1V9U2 2CV6A 1RUG1 1CAWA 4LBMA 3ZIWA 2P3KA 5BNOC 3WZ1A 2XXZA 1YXWA 1JZ5A 2O14A 3AZYA 4XURA 3LE0A 4S2FA 4ASMB 3O1UA 1VRH1 5BNPB 3N4MA 2XKOA 1ULFA 2D6KA 2RHPA 3AMPA 2RDQA 3S7IA 5IATA 4N53B 2WAAA 1NAEA 2ZGNA 3AL6A 4JC1A 5DG2A 1C1LA 5AC92 4HK9A 3PUSA 4QQOA 1QJX1 3SITA 1VLNA 1PZ9A 2E53A 2QUOA 3RZMA 1WZXA 4UFJA 1EUUA 4DS0A 2VR4A 1Y43B 4WVZA 5C7GA 2ZOEB 1ZZBA 1GWMA 4OHZA 2IVIB 3FJSA 4YVSB 3FN9A 3VHPA 3JCIA 4P9XA 1AR72 1DGWA 5AFEA 3HWJA 2UYAA 4NE9A 2ETEA 3IDEA 2JIJA 4WM7B 2KD7A 5FZ9A 1ULOA 4JDNA 4LORA 3IWZA 4QKNA 3ZIXA 4BIOA 3R05A 1KFUL 1POV0 3NQHA 4ASLA 5IVVA 5FO9B 1UU6A 3N35A 5KWRA 5I0TA 2ZACA 3MI8A 1YWKA 3VBRB 4R4XA 1RGSA 4CCJA 1B09A 2Y0OA 1W6QB 3V56A 1D2QA 1E5RA 5BNPA 1POV1 2Q8DA 2OUHA 1G86A 4Q0UA 4E2GA 2ZHLA 4EZ4A 2FDIA 1G9BA 3AVSA 1WBLA 2DURA 1CIWA 2VMIA 4PJYA 1WMDA 3NNLA 2K0GA 2P37A 2VMGA 1UOBA 3POSA 4GAZA 4XAEA 5APAA 4BOWA 5C3SA 2DBIA 5FO8B 2PAKA 1RJ8A 1RXFA 1HQLA 4FOWA 2VMHA 5TSWA 3V65A 1PGW1 3MLJA 4YRDA 4HVOA 3MBWA 1LULA 1S55A 2QFEA 1AX0A 2XLAA 3TOJA 1UYPA 2X05A 4BQ4A 5JOZA 2W08A 4RYDA 3I3DA 3N7JA 4QMAA 3T2TA 2VZOA 3KT1A 3WP5A 2W95A 3ZMOA 3BU0A 3FC0A 4WM7A 4QQHA 4W8JA 4IEWA 2BYVE 5A80A 2XG3A 2P3IA 3IN9A 1Q8OA 4RL7A 1F15A 4GZ9A 2WNUB 1FX5A 1RUF2 1YEWA 4INDA 1UKGA 2WLPA 4AEDC 2BQPA 2ZA9A 5HCBA 1IQAA 1LECA 2B4KA 2NM1A 3SC7X 3E6BA 2J1AA 5GZDA 4Y5TA 3VL8A 5A70A 2A6YA 3RG0A 1TME2 2A3XA 5FY5A 1E5IA 3VBRA 1AYN2 1HRI3 1QGLA 1W6QA 4AI9A 4CUCA 2O8QA 1XYNA 3VBSB 2YGMA 3KT4A 3MLLA 2QQMA 3AC0A 3D82A 4MX3A 3VZNA 5IUQA 3WQ0A 3AP9A 2RS53 4GWIA 4HANA 4J6GA 1VRBA 1IG0A 5J98B 4AI8A 4HXCA 2WYFA 3MEPA 3C7EA 4N7IA 4MSVA 4NPMA 1DCSA 1RUG3 1CAUB 1RUF1 1DQ2A 4IEQA 4P5YA 4Q27A 4XXAA 5I8SA 1HDKA 5AFBA 3KV4A 3DGTA 4XVHA 1NCQB 3PHMA 1FPN3 4E4DX 2G19A 1WD3A 1DQ1A 4W65A 4LBKA 4TXWA 4A7ZA 2WNUA 4FXKB 1IPKA 1N1SA 4SLIA 2EF6A 4LO7A 3VBFC 2OPWA 2EVXA 3VDDC 4E27A 1QJX3 3HT2A 5FPBA 5KR7A 4XIOA 3RZZA 3F2ZA 1DG6A 1MZEA 1YCIA 1IG3A 4M3CF 1H8VA 1XC6A 1F2NA 4QB2A 4XDOA 4GIQA 5FKCA 3VBSA 4DFSA 4CXWA 4D94A 3VZLA 5KXCA 1V9U3 4QPYA 1UY3A 3BI3A 4E8CA 2ZCWA 3T3YA 1VAMA 4YFWA 4Q0VA 1NXD1 1FV3A 1PX4A 1WD4A 5LEKA 3DYOA 3U78A 3IIAA 1I3HA 3JQWA 3D8CA 1ALYA 1OVSA 4YM3A 3AKQA 1MS3A 3KCYA 3Q8FA 1CAUA 1PMIA 3NKGA 4GB31 4LHNA 1NCQA 3RWNA 2ZGLA 3LF7A 1KDMA 2JIGA 1UD1A 4CDXB 4Y3OA 1POV3 3HNMA 3POWA 3ZYGA 2EAAA 3HMYA 3H8OA 2A7AA 2PYTA 1GBGA 3C7HA 1CVNA 1K45A 2B7YA 4FOQA 1AR73 1ND2C 4LUMA 4TYSA 5A3MA 3K48A 5JCTA 4RFT0 1MEC2 1W6MB 3HR9A 5LA2A 1OOPB 1F31A 1VBD2 2C9AA 2H0VA 3JD72 3P5BA 4XZPA 3VHNA 3SISA 5F37A 2P34A 4QDSA 3WCSA 4JGYB 2RS11 4AI2A 2HWE1 4BE3A 4NJ4A 4Q0PA 4B4QA 4QHOA 2R1DA 2XWJB 4RGKA 1PGSA 1V6LA 5JXJA 3MLKA 4FFFA 2O8OA 3U14A 3T2PA 5D8AA 1UZZA 3B9CA 4D7TA 2HWF2 4N7UA 1CJPA 4LHKA 4PIZA 5FY7A 1QXPA 4GWMA 1W3XA 4HL0A 4YVWB 4OVEA 1EPZA 2YFZA 3ZOIA 1F5FA 2J1EA 5ACA2 1Q56A 3MYXA 2CTVA 4JHTA 1W8UA 2JXAA 2X5IC 4PBPA 2NN8A 1NA1B 3AX4A 5FZOB 4Q4W2 4MOAA 1S0FA 5A33B 4JHZA 4WV8A 2X53S 3KM5A 4I0WB 4CVUA 1W6MA 2CY6A 3FUOA 1OOPA 2YBSA 4IEOA 5FYSA 1SG3A 1JU3A 2YY1A 4XQWA 1SBFA 1UY4A 3ZVXA 1B35B 1RUF3 3OY8B 4JGYA 1DQ5A 1L7RA 2R49A 5I0SA 1LOBA 4WM8C 4AVBA 1K42A 4XDPA 1RVF2 3QD6A 3Q8BA 1WUVA 4G4FA 4EYUA 1UU4A 3GBGA 3BIWE 1AYN3 1HQNA 3GNEA 3J4UH 4N8MA 5DG1A 4EWDA 4MGIE 1DBNA 4L97A 4NRPA 3FUQA 4XJ9A 5FTTC 3UGFA 2OT7A 1OF3A 2ZX1A 4UFKA 5A3TA 2H6BA 2YPJA 4YVWA 3TN92 3UK9A 4AVSA 5BNNB 2CYFA 1W8OA 4BM8A 1F8VA 4C0HA 4M00A 2OW4A 5FCCA 2YHJA 1NA1A 1A8DA 2GNBA 3ILRA 4RHV2 5FZOA 3VKNA 1AR91 2A5ZA 4LQRA 3IM0A 3ACGA 2RDSA 4AZZA 5BV6A 5A33A 3VBOB 4FBFA 1UIKA 1C28A 2YPDA 5FOBB 5HCFA 2B8MA 1GMMA 3EB7A 4XJUA 4BMBA 5LRSA 2R061 3B5LB 3QACA 3CQOA 2BDRA 1B35A 1BVVA 3KVAA 4CP0A 3OY8A 1WW7A 1JTZX 1AR61 4XBLA 2VZVA 1Y3TA 4JAAA 1UMHA 1GZCA 1GZTA 1QF3A 2B46X 2ENRA 2ORXA 3I4IA 3TN91 3FE5A 3MV01 2XHKA 4BLIA 4YW3A 3MIBA 4PIXA 4MYEA 4PDWC 1DIWA 1O3RA 1PIV1 1AX1A 3J8F2 3WINE 5CU1A 5LZ6A 3PJYA 5BNNA 5FMOL 3ILFA 4UW6A 3ZXKA 4RQPB 4PCRA 4UF0B 1A6CA 4MGQA 3T4VA 3U11A 3ROUA 3A23A 4HKWA 4L9BA 3HQUA 1NXMA 1VBE2 1DLLA 3VBOA 4JGZC 3N7KA 1AX2A 1OI6A 3EMRA 1OQEA 3AYEA 2JDUA 3P1IA 5FYMA 3THPA 3SCGA 5JZGB 2DWRA 2OVUA 4K20A 1UOGA 1TMF2 4CDWC 3HVDA 3MUZ1 4LNVA 1FYUA 1MEC3 1VBD3 2QQLA 5J36A 4Y20A 4AQ2A 2BTVC 1JZ4A 1XSQA 3T4HB 5A1AA 2EALA 3H42B 1T6GC 3KV6A 1SBDA 2OXBA 1XE7A 2QQPA 5EFUA 1R082 5EJ3A 1RUJ1 1EV12 4YM1A 5GKAC 3VZMA 2VBPA 1BXHA 1LTEA 1IPJA 4RQPA 2MNGA 2PLV2 3N9OA 4GJYA 1SCRA 2YDEA 4JZRA 4KWUA 4UF0A 4UT5A 4CCOA 2HWF3 5KHKA 3PU3A 5JVVA 1TQ5A 5D1IA 4Z8BA 1MQTB 4X6RB 2AEZA 2Z4FA 1C5HA 1XNTA 3GZTB 4MHRA 5F5AA 3VKFC 3B93A 2EIDA 3O1RA 2C0ZA 2AH2A 2WO2A 3NMBA 1SPPB 4Q4W3 2R6QA 5H9PA 1NE6A 4JQRA 4S2GA 3O1OA 4A42A 4YG6A 2AREA 2Q1MA 4P00B 2CGNA 1Z7S2 2IVJA 3PUHA 3OOXA 1AR93 1SMVA 2Y6JA 4AEJA 3OGRA 4OULA 2JE9A 5KXDA 3IPVB 3BKZA 4Q26A 4Y24A 2BU9A 5DUWA 2PFWA 4GH4B 3WW1A 1TZOA 4XAAA 4X6QB 1LOGA 2WWJA 1AUYA 3AFGA 4F8AA 5JI9A 2EIGA 2VZUA 1LOCA 2WNVC 5FPZA 1OKOA 1PO22 1AR63 3LEIA 2BGCA 5FP8A 5FZ4A 1OLMA 2ERFA 1W6NB 4KG8A 1BKZA 3VD3A 1MQTA 3CZJA 3TN93 3ZFGB 4D3WA 2WNOA 4NN0A 4NR1A 2F4LA 4BPZA 4LEJA 2JG9B 5LW9A 4QDRA 3H1YA 4HFSA 3T2OA 1N1TA 2YC0A 1ZM1A 3GDBA 4MHUA 3WDYA 1XU1A 1D0HA 3GHMA 5E88A 3IMMA 3KF5A 2JB4A 1SPPA 2RG4A 1Q3EA 4CDUB 3INAA 2D44A 2W1QA 3AFKA 3HD8B 1G7YA 1WW6A 4RGGA 2QBXA 2LS6A 2X10A 4N43C 4DQAA 2P5BA 3OD4A 4G9SB 4FXGB 3X29B 5A3NA 2XWBB 2BZDA 1PO11 4XF0A 3IPVA 1UOFA 5IW0A 4E4SA 2ZGSA 4GH4A 4KBZA 1V00A 4N9HA 5LBBA 5FXVA 1V70A 1RUD1 3LSDA 4A2UA 3RZGA 3O1TA 4MGZE 3CLPA 5J96B 1YFWA 4EWEA 1PM7A 1YIFA 2ID4A 1BHGA 1MVQA 4CP1A 4ONUA 5C8CB 1JOBA 4Y1ZA 1W6NA 3LA7A 1TNFA 2FMDA 4ZU4A 4E2SA 2Y6KA 3AP6A 2CGOA 5H9QA 3ZFGA 4MH0E 3ZFEC 2JG9A 4L99A 3SH5A 5CVRA 2ZGPA 4OFGA 4YZ2A 1C8M1 1VBC2 3ZR6A 3PDQA 1CAXB 1G9AA 5JOXA 4FPLA 5A3LA 4QB6A 2DVAA 1VBE3 1H2LA 4CDUA 2GDFA 2PAMA 3KHBA 5DQ0A 5CADA 2FDJA 4HETA 1J3PA 2RJ2A 2XJQA 3NL1A 4XJZA 1TMF3 2PTMA 3ZYRA 2ZX0A 3D3AA 4CP2A 2XJSA 5DAVA 2D6MA 2N7GA 1IPSA 5A7OA 4YW2A 4CUBA 2BOIA 1QMJA 4COWA 1PK6B 2Z42A 3TEYA 3DPRC 5C8CA 4BISA 3KV5A 2EIEA 1R083 1BZWA 1TNRA 2E7QA 1COV2 3MF9A 3TNPB 2VTFA 4BWOA 1ND3C 5DDJ1 1EV13 1GV9A 2ZMNA 1VBB2 2UYBA 2A3YA 3KCXA 5A1LA 3O1MA 4XYXA 1S0JA 2PLV3 2P6CA 4YGBA 1QQP2 1NQJA 2ZTNA 4V2VA 3RWKX 1CAXA 1AJOA 4XFHA 4B3NA 2DBNA 4IV1C 1I5ZA 2Y6FA 4I30A 2YG0A 1KQRA 1CZSA 2IC1A 3J7LA 1ENRA 5C3QA 3CU7A 3I97A 4PQQA 1APNA 1OSGA 4KU7A 3WD5A 4HT1T 1QU0A 3N9MA 4NPLA 5FY8A 5FZ7A 1UYYA 3LAGA 1FT9A 1X7NA 3ZXJA 2BOJA 2VBDA 4CXXA 4AFDA 4P9YA 4UYBA 4CCNA 3MW3A 4M3CE 2G4IA 5C4WB 4P08A 4EN0A 4FTBA 4LK6A 1OMIA 4D6SA 4Q4X1 5IK8A 1GWKA 1VE0A 3J7HA 2CDPA 4CA9A 3KGLA 1PK6A 1Z7S3 5FLHA 3ZX7A 2LM3A 1W9SA 4Y1XA 5B4NA 3A7QA 3MFCA 4D7SA 1MVEA 5DN2A 1GNYA 1OF4A 2RDNA 1BBT1 1UL9A 3LIHA 3W21A 3U4XA 1PO23 4K1YA 4QX3A 1NYWA 4IQPA 2BFUS 5I8YA 4MVTA 2VUDA 4YW7A 3NNJA 4ZY9A 1W39A 4RGAA 4UW4A 3O12A 5HV4A 2Y0IA 1JYIA 3GJBA 4LBQB 1LU2A 3R6SA 5IHRA 1D4M2 2HKXA 3KQ4B 5FY4A 5GM0A 1REEA 4I0BA 4LUKA 2Y6LA 4Q4Y1 3I3EA 3MFAA 3OGSA 4FOVA 1S0DA 5C4WA 4COYA 1UCXA 3HT1A 3ZN4A 1T6BX 3L2YA 1KGYA 4J1WA 2ARAA 3T0AA 1H4HA 2VNOA 1CPNA 4XXPA 1ZRDA 1DGLA 4R52A 3GCXA 1IZ3A 2HEWF 1RMU1 1O8SA 2RMU1 2VOWA 2VTXJ 2ZHNA 3AP5A 3I7DA 3MGUA 4IEYA 1HN0A 4FPFA 1ST8A 2DU0A 2XL9A 2GP5A 3C7OA 2CDOA 4XMIA 1Y9GA 3M8LA 2DCTA 1EYBA 2DYCA 2GALA 5JR7B 5JDBA 5L7OA 3ELNA 3RJ2X 5I0RA 4C91A 4CUGA 3BIEA 1AXYA 3OEAA 3ZYJB 4M01A 2V09A 4FP3A 4JDMA 2VJXA 5BNQA 1YO8A 4CRQA 2VZQA 1AJKA 4LBQA 1VBC3 3B94A 2Q5TA 2ZX3A 2HJIA 5F3GA 4UBGA 2PQQA 1KITA 4GQ7A 5DDJ3 3OBZA 5IFPA 3T2QA 1DQ0A 1DZQA 4W6YA 4WVWA 3NW4A 2WKKA 3POEA 1XNCA 2V5YA 4MXVA 4AGVA 2ZXQA 2HYXA 3UYJA 1WWYA 3NAPB 4AHYA 2PELA 5EP9A 1NLRA 4XF3A 3TEWA 3GM8A 4H7LA 1ODNA 4YW4A 2YMZA 4A4AA 5LWBA 4EZHA 1RUE2 1O59A 3J7MA 1U5IA 3AK0A 2JJ6A 3E6CC 3WG1A 1COV3 3RZLA 1VBB3 3BVCA 4Q4X3 3T0DA 2YROA 1QQP3 3APBA 3ATGA 1X82A 3NNMA 3AMNA 1SLAA 4GXLA 3UJOA 2YBPA 2WWUA 1LESA 4QDQA 5DAWA 4R9AA 2ARXA 4COVA 5FZIA 4IEXA 2D3RA 3K2OA 1CWPA 1BBT3 4JTNA 4QAWA 1W9FA 2XJUA 3S5QA 2QQKA 5KC5A 1UZYA 3BTXA 3O7OA 4CEYC 4OUMA 1ZZ7A 4CU9A 2IXHA 3Q9OA 1NCRB 1OQDA 1S2KA 1UZVA 2QNKA 3NAPA 3VD4A 4UFIA 4PF5A 1AF9A 1G6NA 3H1MA 4EN7B 1Y9QA 5E6HA 3ZPYA 4OHVA 2QQUA 3U07A 3KSCA 5JMCA 4FPJA 1CAWB 4V1PA 3FFQA 5FYHA 1SLIA 5A3OA 2TBVA 4FAHA 3A0NA 4XCAA 5F7UA 4DZGA 2NP0A 1RC6A 3LSEA 1MS8A 4LOTA 4A7YA 5KBFA 2UY8A 3ZFFB 5LRRA 1ULCA 1MZ5A 4A41A 4BB3A 4FFHA 5H9SA 5DUVA 3I54A 1W2AX 1DQ4A 4XF1A 2QKDA 2VZPA 2BVBA 1JS9A 4UWDA 2Q1FA 3AL5A 4YZ3A 5FP9A 1VRH2 1ULPA 3PJQA 4SBVA 1VB4A 2D43A 3JQXA 5EWSA 3S6PA 2AC1A 3GZEA 5FJKA 3NNFA 4H14A 3Q8CA 1RINA 4HKLA 2BGOA 4B1MA 1ZZCA 1D4M3 4NPRA 1R091 2IZWA 5FZ3A 2VC9A 3PLQA 5JMOA 3NSTA 4LBQD 4XJWA 4HLTA 1GQHA 3HNYM 4QT6A 1XNAA 4LJHA 4Q2FA 3POJA 1L3JA 4Z2AA 1GWLA 1FOD2 4K21A 2P4EA 2W47A 1SFYA 4Q0QA 1H2NA 4HPKB 1PMJX 2IWGB 4Y5Z0 1LODA 1O5LA 4XHBA 2JICA 2W91A 3ALQA 5LBEA 3I2JA 2WR9A 3ZFFA 4R9DA 3V0BB 1J59A 1HRV1 3RJRA 2Q8EA 1JI6A 2CSGA 4Y1YA 2QZ2A 3ZSEA 4XUPA 3U0ZA 3WNOA 5BNPC 1OURA 4CEWA 4GWJA 4N53C 3SH4A 3VZJA 5IVBA 2X8KA 3LA3A 4D6QA 1C57A 5FYVA 4P9GA 1F35A 1HN1A 2OQ7A 2XVLA 4YNIA 1QJY2 3LEGA 4AGGA 1ZBE1 1UMZA 1FOD1 2OYZA 3D0JA 1O3SA 2A3WA 5FYZA 4YZ5A 1GOHA 3VD5A 4YVSC 4DXTA 1PGW2 4PHZA 3WHTA 3PIJA 1LU1A 2ZGKA 5J48A 2ZHKA 2V73A 5EZWA 3T09A 5F3IA 1LRHA 2F6BA 4HPKA 4EN9B 2W3JA 5C5TA 1G9FA 2QZ3A 3OG2A 1SLTA 3ZKYA 2PAEA 5DABA 2QQVA 3CF6E 1S0BA 3MUY1 3V0BA 2ZGMA 2ILMA 1QJY1 3DEMA 4XF9A 3VBRC 2Q1ZB 1RUE3 4I3PA 5GLTA 4NWVA 5LA0A 3W5NA 2A1XA 5F9TA 1L7QA 3THTA 4EWAA 1JODA 3E1F1 1JYTA 1SFNA 2OPKA 1RJ7A 3S57A 2DU1A 4XABA 3UT0A 5A6QA 2VPVA 3HJRA 5G04L 5IVYA 5C70A 4AWDA 2B5HA 4H3WA 4KGGA 3SCFA 4KGQA 5HBAA 3EO6A 4ISQA 2R041 3T1LA 3P3PA 2GC0A 5CKQA 2D3PA 2TUNA 4X8NA 3FBYA 1RB8G 3T1MA 3Q8AA 1Y7BA 1OLRA 3ZXGA 4CTEA 1W06A 3HN3A 5JIUA 1N1VA 1CX1A 5FYYA 2XQRA 2GN3A 1N3OA 3B02A 3NVCA 3CMGA 2PHUA 4XETA 5DAPA 4OMCA 1ENXA 3VN4A 4ZZ5A 1YQ8A 3PU8A 1RITA 1NY72 3CJIC 2X29A 3GF6A 5CNAA 1LR5A 3O1PA 3BODA 1VR3A 1DYOA 1R093 2VMEA 4TTGA 1XB9A 3UKTA 2BBAA 2DV9A 2UWCA 3OEBA 1QIQA 4AHWA 2R16A 5LATA 1NG0A 1Z78A 2VO5A 2CWMA 5CAZA 2Y26A 4W6XA 1H8TC 2RM21 1GKBA 3KT7A 4U2AA 4XDQA 5FXWA 3ZDVA 3K51A 5JPMB 3UNPA 5F6LB 4HOOA 4OMDA 3IZOA 4YG3A 1UWWA 4FFIA 2V4VA 2P17A 3VZOA 1VRH3 2G1MA 2RR11 3I2KA 3WR0A 3E6DA 1W28A 4XJ8A 1GP4A 2UWBA 2LROA 5T3NA 3H7YA 1HRV3 1NCQC 1X36A 5FPAA 1NY71 1CAVB 1QOTA 3GJAA 4WVVA 4MGKE 4GB32 5FDBA 4ES9A 1ZREA 5L73A 1D2SA 3ENRA 2RV9A 3LFIA 2ZS6B 4FQZA 4AFMA 3GYDA 4DY5A 5C9AC 3N7LA 4NIIA 3FLPA 2RVAA 4QX5A 1U5YA 3ACFA 3I59B 4EROA 3SXWA 3AZZA 1FOD3 3PTYA 2VVEA 4CCEA 2B42B 2WWSA 2ZGRA 1ODMA 1QH7A 2VW2A 4LIUA 1M06G 4AE2A 2AENA 3VDDB 5E16A 1EY2A 3K3NA 1ZRFA 5L9RA 4GMP1 5CFDB 5CZKA 5D8AB 5LK7B 2RS12 3VUOA 1HJGA 2RS31 4FPKA 1ZZ6A 3VBHB 1O4TA 5IJRA 3BOPA 5LBCA 5ISLA 2HWE2 4DNYA 4QPGC 5K0UB 4BZ4A 5E8AA 1OXCA 4Y1VA 3ETQA 4PLNA 2QQWA 4QHZA 2BW8A 1QJY3 3A22A 4XBQA 2BVVA 1CAVA 5KC6A 1J3QA 2VCCA 2LUWA 4LBLA 3ZN6B 4CDXC 5A1FA 2E63A 1NX9A 5IVEA 3AKRA 3L9JT 5HXMA 1D4VB 2XJVA 4ZU7A 1CESA 2GNMA 1WMXA 3I59A 2WFPA 1KEXA 2ZGOA 2GC1A 3ZXAC 2VL4A 1VBA2 2ZEWA 3D4KA 4LITA 4LT5A 3MIHA 4P9IA 1UMIA 4CCLA 1RL3A 3K75B 4JGYC 1W99A 3VDDA 2E9QA 4CU7A 3H50A 2R043 4GD4A 3WF0A 1KDKA 3CL1A 1GLHA 5CFDA 4YFZA 3I2HA 3WUCA 3WDXA 1WMFA 3LZZA 3VBHA 4R9CA 1QNWA 3AYCA 3OJBA 1XJAA 5F5IA 3RRDA 2ARBA 5FZFA 3ZYHA 5LA9A 5K0UA 2W0XA 2VQUA 3TAYA 3URFA 2WT2A 4AXOA 2W92A 3H8XA 2Y6GA 4OQ9A 4IGPA 5EHDA 3DKQA 4QM8A 4RFRB 4TLFA 3OUHA 3RYKA 1J83A 4IETA 5ANNA 5FO7B 4BQ3A 5A7QA 3ZN6A 1DP0A 1HB3A 1VBA1 4XFGA 4XUTA 4NHYA 4AF9A 3M1HA 2DTYA 2VQTA 2R32A 2W39A 3BALA 4AQTA 1N1YA 3RYRA 3M2MA 2RM23 3WOGA 2DUQA 1O7FA 1SQ4A 4RR3B 1OBNA 3WV6A 1Y4WA 1AR92 3NJXA 1RUC1 4LULA 1JN2P 2D5HA 2TEPA 4XZUG 3S5AA 1UX6A 2QVSB 1F5JA 4IGQA 4IV3C 4QXKA 2FD8A 1H9WA 4JKMA 5CISA 2R062 1W2UA 3LD8A 1RXGA 1RUI1 1AR62 3K4DA 5A7WB 5IWFA 3I2GA 3WCRA 1KFXL 1OFSA 4WM8B 1LHNA 5EJZB 3VKMA 5I8TA 3TNQA 3NJVA 1PIV2 1W2TA 2QDNA 5GLVA 1CONA 1WLDA 1ZA7A 4AEMA 5BNNC 2JE7A 3MW2A 2IFWA 4IEVA 3CJXA 2AUYA 4QU1A 1O4YA 1SHWB 4XBNA 4AI0A 4NRMA 2YFUA 3E5QA 1UPIA 1ACCA 4L2NA 4HSLA 3RQ0A 1MS5A 3QH6A 3HQRA 4RR3A 3IB3A 3VBOC 1H6YA 4YYOA 4IL7A 3ZXEA 4DEQA 4GB33 1SACA 1US3A 1W0NA 2W68A 2AZ5A 1UW8A 3ZSMA 4XJAA 4ZKTB 3LOBA 2HWD1 1GQGA 3WDUA 4Y20B 2ZPXA 4L0PA 4BQ5A 4E9KA 1LCLA 2ZMLA 2GU9A 1FMD1 3IAPA 2JWPA 5A7WA 3BN6A 3ZYPA 3MHZA 5ABJC 4B7KA 2PXJA 5DMYA 5IVJA 1GP6A 2YZ4A 5FYCA 4WM8A 1W9TA 1DDLA 5ANQA 4HK8A 4NAMA 4MO3M 3K4ZA 2XUEA 1EAH1 2K2SA 5FZ0A 4FPHA 3W20A 2XBO1 3E5XA 3PNAA 2RS13 5FYTA 2WAOA 4P14A 4PDWB 4AYUA 3DXTA 2VUCA 1K5JA 1LOFC 2HWE3 2D6NA 1RUJ2 2SBAA 4RQPC 5GLZA 2XGXA 3WLUA 3EXUA 4S2DA 3QBQA 2FDFA 1JBCA 3KHCA 4AVTA 1OQ1A 1VIWB 2D97A 2I07B 1A78A 2VE1A 1W8WA 3GGLA 1NLQA 3O0WA 1NQDA 1DU3D 2A6WA 3SNMA 5JZGC 4IE4A 4LE4A 5F5QA 1N47A 3N9LA 3MICA 5FLIA 5FKBA 4BMEA 2VNRA 1XNDA 2YB7A 5F32A 4JGZB 5FR3A 5I0DA 4UW3A 4KBBA 3OPWA 1O6UA 1NUKA 5FZ1A 1W2OA 3EHKA 1VBA3 4D6RA 4DEVA 2JDMA 5FXZA 3AM2A 2VECA 5A3PA 4MZUA 1MZFA 1LNSA 2VZTA 1ASJ1 5GZCA 4IE0A 1RUC3 4PDWA 3UESA 3JXSA 3ZR5A 4Y1UA 3H3ZA 4CDQB 4BQXA 1PZ7A 5T5PA 1Y9MA 5A7SA 4RS5B 4LO6B 1RUI3 5T50A 3GHNA 4AFAA 1AL21 2PHDA 4BQYA 3LA2A 2WN2A 4IDZA 3EQEA 3SCHA 4D69A 2A6XA 4P9JA 1I1EA 4YW6A 2FDGA 1UY1A 1BMV1 2DUPA 1UU5A 1TG7A 4UBHA 1H1AA 1H1IA 2DCZA 2I74A 2FZ1A 4JGZA 1NE4A 4YARA 1JHNA 4Q0SA 3D0SA 2XLGA 5LA1A 4Z1VA 5E1RA 4JRAA 4Q1RA 2HWC1 2AYHA 3ORJA 3AJZA 5EV7A 2R063 2FQPA 5BXXA 3WNLA 2WABA 5JSRA 5JWPA 2DUOA 3POGA 1HKDA 1YFUA 4GH4C 1RIRA 3U1XA 2Z69A 3I49A 2VTXA 4IE5A 4PQ9A 1PO12 1YC61 3WQBA 1JYXA 4J1XA 1XE8A 1C3HA 3I8TA 4CDQA 5GALA 4NWWA 1URXA 1RUD2 5CBLA 2YGLA 1DGWX 3DYMA 2ZGUA 1E5HA 1OA2A 1PIV3 4O7XA 1POQA 4RS5A 2MEV1 5FMOS 5FMBA 3WF1A 4NUBA 2YXSA 1GR3A 1OLME 2VZRA 2WNVB 4EN6B 3THCA 3A4UA 4K3UA 3UGHA 2BGPA 3W5MA 1DZTA 1W6PB 3T08A 1QXRA 2GMEA 5FPUA 1C8M2 2ADDA 1PVC2 2XBO3 3FL7A 3WNNA 5EIYB 4MLOA 4YLZA 1G9CA 2Y33A 1W0OA 4CDUC 3OPTA 4OQ8A 3M3OA 1OHFA 4YZ4A 4OI0A 4XFIA 1JOJA 2JX9A 3OPZA 4AHZA 1T2XA 1V6IA 1JYNA 4HVQA 2AEYA 5FZEA 3NV3A 4GKYA 5CFCC 4AG4A 1HB1A 3NKTA 4NMIA 2OUJA 2JEMA 3ST7A 2UU8A 2GNDA 2ZZJA 4QPIC 5FK8A 4OI4A 1PVC1 2B45X 2WUHA 2VCAA 3M7AA 3ZYFA 4CCMA 5KXBA 3DCQA 4R8HA 4PI0A 1S1AA 4XTPA 2XKPA 2WNVA 3LCPA 3OF1A 1KS4A 2J1SA 2O1QA 1RUJ3 2VZSA 1TEIA 2Z2SB 3PVBB 4QX7A 5DDJ2 5FYUA 1RHI1 3JBG1 3WNPA 3NV2A 4BIFA 1W6PA 4ARYA 2JG8B 3OUJA 3S0MA 1ZBA1 5IK5A 1O5UA 2XDVA 4LPLA 4QHBA 4HKOA 3DYPA 1W8NA 2LTNA 2VQ0A 1SLCA 1Q8SA 1BEV1 4QWNA 5G05L 1YYNA 4FP2A 5KHIA 3I2DA 3H8UA 3NJYA 2Q4SA 2IUWA 2Z79A 3H3LA 2R071 5CIRA 4NIAA 2OA2A 5E89A 4BQ2A 4KG0A 3VDCA 2L9LA 3GALA 5GZFA 3TYJA 1PK6C 1K12A 2E7TA 2K46A 1LOEA 3AMMA 1WA4A 4Q4X2 5FXXA 3T30A 1MS4A 2VZ1A 3VHOA 2H0BA 2A6ZA 1VJ2A 2WDBA 3PUQA 2XOMA 3ES4A 3I3MA 3UKNA 3DPRB 3ZXLA 2HWC3 3BU7A 3ILNA 1BBT2 4DINB 2JG8A 3ITQA 2V5DA 4LOSA 3TWIA 3WNMA 2OQ6A 1XNKA 2R1BA 3PTRB 2JDAA 1V0AA 2IFRA 3IDAA 5FV3A 5LK5A 4AQSA 5FPLA 4QXBA 4ZS2A 3ZN5A 1VMFA 1XYOA 2R7EB 3FLRA 2C1FA 3GZUC 2V4AA 5JXHA 3MIFA 3KS7A 1MPXA 1Q8QA 1V6MA 2BERA 4KWKA 4QX8A 3H9AA 1IOAA 2SLIA 3HOBA 4IV1B 3SQOA 1NZIA 5KXEA 2MEV3 4CXYA 1H2MA 4CZSA 1UNBA 5B2GB 1YHFA 1LHUA 4Q4Y2 4LE3A 1K3IA 5JPNB 3RZJA 4RN5A 1AL0G 1GYKA 2HEYF 2BJSA 3VKLA 1K5MB 4IEUA 1FXZA 2Y38A 1AXZA 3AMHA 2XL7A 3RVHA 3OSDA 5FZKA 5L7OB 2OZ6A 3WNKA 2J1VA 5FK7A 5C71A 2BWAA 2D6PA 1PO13 1RMU2 2RMU2 3WW2A 1LGCA 1W8HA 4L11A 2VXRA 3DPRA 1R1A1 2JDPA 1RUD3 1OH4A 1ZZ9A 1IQDC 3M3QA 3WQ1A 2FCUA 3KMHA 1Q8VA 1REDA 3GCWA 1ULEA 2XB6C 4FO9A 2Y8KA 3R0RA 3PUIA 2A6VA 3FLTA 4HN0A 2JD4A 4OZXA 4FVVA 5T55A 3O1SA 4P02B 4PBOA 4UXAA 1KS5A 4BA6A 3LDKA 4BHPA 4IV1A 1OPOA 1C8M3 1HV1A 1PVC3 2VAUA 3I2FA 2WIIB 5HXVA 3AKPA 3CIHA 5A3WA 1G9DA 1V6OA 2W46A 1S0EA 2D40A 3G7DA 4Z82A 3THDA 3UGGA 3ACHA 1DLCA 3VD9A 3MIGA 2P3JA 2JKBA 1JHJA 5JSPA 1ONAA 1YJKA 1QNYA 4HVRA 1K5MA 5CKMA 3WG4A 1V6NA 5IFTA 3LGRA 1E57A 4GULA 5CG8A 4WZCA 3C7FA 5FP7A 4NIHA 1I9RA 4C90A 2ZKLA 5K8SA 5CG9A 1H0BA 2WL1A 4J25A 4LO5B 2EA7A 2W1WA 3C8XA 4A7KA 2CAUA 1LEMA 2GZWA 5JSOA 3I3QA 3GBWA 1WBFA 3OCPA 4AVAA 1PVXA 1X9PA 1UYXA 2V72A 4LMFA 1KXGA 4ORFA 4F7ZA 1QDOA 3NV1A 4HBNA 3VV1A 5DZGA 4EN8B 4TN7A 4CP9B 3NV4A 1AYM1 3KF3A 5JAXA 4DOUA 4MADA 5GZEA 3MV11 2GMPA 1PNGA 4PI2A 2AGSA 4R9BA 3MW4A 5FRAA 2LALA 1RTVA 1LKNA 2O0OA 5A7PA 2ZHMA 2ARCA 1PM4A 5C5UA 3VBUB 1UIJA 3MIEA 1M4WA 5EXOA 3TB0A 5T5OA 4BXSV 5FWJA 4Q4V1 4LBNA 3OGVA 1FATA 1JW6A 1O4ZA 2MHFA 1ENQA 2VNGA 1PGL1 2G9GA 5HCAA 4CUAA 3GBFA 3KGZA 2ZZQA 1R64A 2DCJA 3IIIA 4NHKA 3ME2A 1MZ6A 2P6HA 2PN5A 2NQYA 4YGEA 4CYDA 4JTOA 3ECQA 3EYPA 2QQNA 4HN1A 3WX5A 2XJPA 2PMWB 1LGBA 3BCWA 4MG2A 1U12A 4CP9A 1QOOA 1PX3A 4HSJA 2YYOA 4KWLA 3AYDA 1MS0A 1S0GA 2JENA 5FUPA 3WG3A 1ULDA 4UFLA 5FMDA 3ZO0B 4F3JA 4QB1A 2HLEA 4D0QA 5J7MA 2QE3A 5GJ6A 2BV4A 2ET1A 1J1TA 1MACA 2FBEA 3TEXA 3VBUA 1UO9A 1CJDA 4QQPA 1GNZA 4N90A 1NCRC 1HX6A 3N9QA 4I3GA 3MIDA 1R092 4BJ0A 5IK4A 3ZSLA 2JDHA 4Q4Y3 5FOJB 4LO4B 4KQ7A 4CEYB 2WSUA 1H30A 1E5SA 1W05A 5F39A 4H7MA 4LTAA 2EXJA 5BYNA 3BGAA 3L2HA 2DVBA 4QKBA 2BNNA 1NOVA 1YNAA 3AVRA 5I0UA 3LIGA 5A3UA 4CEWB 3SKJE 4ZS3A 2WLQA 2BPA2 3LDRA 1RMU3 2RMU3 3DXUA 5DXDA 4XIKA 1GQPA 4E8DA 2XUMA 5SV8A 2F4PA 2J1UA 4LKEA 1C8NA 3ON7A 3TRSB 1UZWA 1HRV2 1SBEA 3QH7A 1F4HA 2GNTA 1W8TA 5FP3A 3FHAA 4FTSA 4FT8A 2WFF1 4RD7A 4COUA 2W94A 4NAOA 3T0BA 1A8MA 1F4AA 3M3IA 3OGJA 4FPCA 5FY1A 3M4FA 1ZBE2 5FBJA 3ZM8A 1ZRCA 5DUUA 4CE8A 1TVGA 3PL0A 1JOPA 2Y64A 1ENSA 4ARXA 1SLLA 1DF0A 3NO8A 4CEYA 1ZZ8A 1HRI1 4UOJA 4X8PA 2VU9A 1QY4A 3NWKA 4OLLA 3HAGA 2QJVA 1HB2A 1L7LA 2HWB2 3FMGA 3AYAA 5CEHA 2HYKA 3HBZA 4L92A 2WS92 3ACLA 1LGNA 4YW5A 1YQ2A 2RJLA 3LKJA 2DCKA 1IGOA 5BNOB 4Q4V3 1W03A 4JCKA 5ERLA 2OKXA 1XNBA 3ACIA 1SFPA 2OZJA 2IXCA 2HBUA 4L8QA 4MXWB 5F2SA 1O3QA 2YUEA 2FMYA 1W04A 4QD2A 5D2AA 5BUVA 1FPN1 1RUH2 4WVMB 3OBTA 3J9SA 1WW4A 2LRPA 3MF6A 4OCTA 1WA6X 2VMCA 1UYZA 1OT5A 3HPNA 1QXJA 4I09A 2HEVF 1AHSA 3DL3A 2WO7A 1VMJA 4Q8KA 4KU8A 4WM7C 5LY2A 2HWB1 4LA3A 4DUXA 4IUGA 3KV9A 3VDAA 3ZDSA 2JDZA 3LFMA 2WS91 1XYPA 2VW1A 4EV0A 3I2IA 2R042 3PVEA 4LK7A 3WF3A 4ATFA 2W9XA 4QX0A 2E32A 4C0BA 4CSWA 1FAYA 3FFZA 1BJQA 1KJLA 1V9U1 3GXUA 4KMQA 4RSUA 4OI2A 2TNFA 4FAGA 2AR6A 2PHRA 3N9PA 3ZKUA 5A6YA 2DCYA 1DGRN 1RUH1 1GICA 2DVDA 2NYYA 1X33A 4JX0A 3UETA 3WT3A 5BNOA 2ORZA 1NKGA 3N36A 1BYHA 1QWRA 2WN3A 4MXWA 5AC91 2WNEA 1MS9A 2A71A 1CIYA 1FNZA 4A3XA 4JV4A 1RUOA 4WVMA 1OH3A 4IESA 1ZA4A 4XILA 4BDVB 2RM22 3C2UA 2W1UA 4N53A 4QU2A 1HJFA 3O0VA 4YGDA 1JYCA 2PHTA 3D5OA 4ISRA 2BP6A 4W50A 1AR71 5C3PA 2DF7A 2KR2A 3VB9A 1X8MA 4FSJA 4GJZA 2J22A 2WNUC 2RR12 1WLCA 4DUWA 5FUIA 1J3RA 4AI1A 1JXNA 4QGNA 4UAPA 4QGMA 4DUVA 4B4PA 3OB8A 1BLZA 2Y60A 3KWVA 4YVSA 2VH9A 4DY3A 3E5UA 4OUEA 5A32B 1WCKA 2YBKA 4UFHA 3SMHA 3VBSC 2WFF3 5D21A 5AVPA 4AEDB 4K8FA 1PNFA 5KHHA 5JOYA 1YLLA 3NNGA 4BCUA 1NT0A 5FY0A 3ZLIA 3FZ3A 4XMAA 1IKPA 3CJIB 3H1WA 3OTFA 4AOCA 3U75A 5IAXA 3HNBM 2Q8CA 2RS32 2Z5WA 1Q8PA 2XVKA 1LEDA 1H8TB 5C3RA 5LEJA 1IHMA 3CDZB 4UFMA 5FZMA 4A44A 3CBNA 2JDYA 5FUNA 1OA3A 1OUXA 1IS3A 1RYYA 3WP6A 3WF4A 1VP6A 3HQXA 2ZGTA 3AMQA 3WP3A 2XQXA 2VBBA 1ZNPA 3CKHA 3AZXA 3PVOA 1ZBE3 3IMNA 1JUIA 1VMHA 2FDHA 3M3CA 4GMP0 1HW5A 3O5SA 4MV2A 5A32A 1OKQA 3USSA 3B3QE 2DDUA 3NRUA 3U10A 3OD0A 3DN7A 3VBFB 1TME1 4AEDA 1AYN1 3H7JA 4B1LA 1D7PM 5C9AB 2QDRA 5K7PA 3MZHA 1HXS2 2VOKA 3OYWB 2YC2A 4B29A 2C5DA 3S7EA 2HWB3 4XHXA 3WDTA 4FPGA 2FHRA 3VD7A 5B4XA 2JB8A 3CJIA 3V64A 2W2IA 2XHNA 2WS93 5CFDC 4XE9A 5D8AC 2D5FA 2GH2A 3BPSA 3N3HA 4LBOA 2VW0A 3VBHC 1MS1A 4LIVA 2XR4A 4K40A 3WDWA 3RNSA 5K0UC 1YQ5A 4M4PA 4QGLA 5FJHA 5J37A 1H8TA 2CL2A 1LENA 4OI1A 3HEIA 5F6KA 4I01A 4KI5M 4YW1A 4BQWA 1RUH3 4C1WA 2OIIA 5CKNA 5FZCA 1SZBA 3SKVA 1O3TA 3FX3A 4QPGB 4A6OA 1UOJA 1XXNA 4YG0A 1CQ9A 1HXS1 2JECA 3S30A 4DMIA 5AC93 1OOPC 1JU4A 2E26A 2QQJA 4FI9A 4XFAA 1HLCA 1OA4A 2JDKA 4G3YC 3VBFA 3ZYIB 1J84A 3Q8EA 4AHXA 1ND2B 1DYKA 1GFF2 5L19A 1UQXA 5FBZA 5C9AA 1BCXA 3OYWA 4K9SA 1RUC2 2XH6A 1JZ2A 1STMA 1EP0A 3POFA 2IXJA 2ZX4A 2I45A 3RS6A 4XACA 2C26A 3B00A 3A21A 1H1MA 4MGSA 5FZBA 4B7EA 2YU2A 4I2OA 4YVWC 3JZVA 1RUI2 2A73B 3TBDA 2WQ8A 1CR7A 5GZGA 3RSJA 3BYWA 1LHOA 1VB2A 1W8FA 2W52A 4XPVA 1BQPA 5JLVA 1C4RA 3N9NA 4DPNA 1ULGA 3SH3A 1NA1C 3VLBB 3AXEA 1P8JA 1VAVA 1SDDB 4QPGA 1X50A 5F3EA 1QHDA 2J42A 5K4LA 4FQ4A 5T52A 3LPGA 4MGTA 3AZVA 3FWEA 2VXJA 1TE1B 2D6OX 2X5IB 4LLFA 1FI2A 1DFQA 4DB5A 2OX0A 3DUIA 4BXFA 1B35C 1MEC1 1OPMA 2RR13 4RR3C 1QJEA 4CDXA 4XFBA 4YGCA 4AFCA 1VBD1 1ND2A 3JD71 1N3PA 3EJKA 1YIPA 5LY1A 3SEPA 2GN7A 1YRZA 1R1ZA 1WW5A 1UXXX 1H6XA 1NZCA 3WNXA 3VKOA 2VD7A 5DPNA 1GP5A 3VGIA 2HWD2 1F9KA 3JB4C 3LDBA 3H0OA 1N3QA 2Q0AA 4V2WA 3ZSJA 3LPFA 4AW7A 2XJTA 4IV3B 4ES8A 1FMD2 1DHKB 2HWF1 2VY0A 2IXKA 4OHXA 4WZFA 5FPXA 4M0NA 1PMHX 1TME3 3KB5A 5ACA1 1W0PA 1EAH2 4GMP3 4ITCA 2XBO2 3JU9A 2OS2A 4EE2A 1DQ6A 1Z0HA 1SCSA 3JB8A 2RS33 1S0IA 1FV2A 2CWSA 4Q4W1 4E4HA 2R0FA 1LOAA 1XQNA 2X5IA 3GZAA 3I3BA 4MUVA 2A70A 2WA4A 4AL9A 3KQRA 4XFFA 5FP4A 2WO3A 4I0AA 1YFXA 3G6JB 2JD9A 5IVCA 3BTZA 4LLOA 3AP4A 4M0HA 5A6XA 1U0AA 1DZRA 1S0CA 1KJRA 2WRAA 5HV0A 5JOWA 4PLOA 2WYSA 3RMXA 3PVNA 3AB0A 1RVF1 5BPXA 1IS5A 5EYXA 4FPOB 1V6KA 2ZMKA 4YWAA 4H55A 3FHQA 2D3SA 4NRQA 5K9YA 2GC3A 1BK1A 3ZXDA 3IT8A 1REFA 5EJ1B 2VQAA 5T54A 1WLTA 2NMOA 3WHUA 4IV3A 1IKQA 1HXS3 2WQZC 1A34A 4Q1PA 2B9UA 1W6OB 3IAQA 4K1ZA 3UL2A 1NLSA 4IE7A 5FLJA 4PIYA 5F3CA 1U5XA 3V0AB
chains in the Genus database with same CATH topology
4BLJA 1RUNA 3B69A 5ABJB 3P3NA 3R4DB 2H6CA 5IT6A 4FPYA 1ASJ2 2DVGA 1SDWA 2KM2A 4RHV1 1HV0A 1OD5A 1YJLA 1YUDA 4IEZA 3VL8A 1UN1A 3LB9A 4KWJA 4DRRA 1IS6A 1X8EA 1AR82 4JDOA 2NLRA 4TWTA 4BQ1A 3FBMA 1AL22 5DZFA 1WCSA 3KLSA 1DYPA 3LOIA 4CDWB 4LBJA 2ATFA 1BMV2 3UKVA 4Q8LA 1SLBA 2DVFA 2WQ4A 3J8F1 3R4SA 4Z2WA 1W6OA 2B39A 2VVDA 4K7JA 3V0AA 2ZJCA 3N7MA 1YI7A 2DTWA 1ZVFA 2HWC2 3ZSKA 5ABJA 3JD73 2CGPA 2BWCA 1PHMA 1AR81 1MQTC 1OFNA 1WLWA 4CDQC 4E2QA 4P5HA 1VBE1 1H4GA 4RS5C 1LOFA 1LHVA 1V6JA 2MEV2 4IXLA 1TMF1 4MGYE 3LWCA 5ACA3 4CDWA 4ATEA 3RI8A 5JZGA 1VALA 1LB2A 2UWAA 1WCDJ 3BPZA 1R081 2GMMA 1EV11 2HWD3 1GZWB 2K9ZA 5HI0A 3BB6A 2PLV1 4XEZA 3OBRA 3ZFGC 1UAIA 1FMD3 2D7FA 2JG9C 2WZR2 1RVF3 4Z92B 4O9EA 2GH8A 2ZBJA 1GZ9A 1EAH3 3WW3A 4QM9A 1YI9A 3AKTA 3KCCA 1AZDA 2NMNA 4ZU5A 4AFBA 4GWNA 1RHI2 3JBG2 5BY5A 3WDVA 4P9LA 3C3VA 1J1LA 3SHRA 2BNOA 4K6BA 2FZ2A 1XRUA 1KRIA 1QH6A 1ZBA2 1J58A 5H9RA 3ZMNA 1Z7S1 4RHV3 2EXKA 4COZA 3PMEA 3M3EA 3RMYA 2WZR1 4N43B 3UV9A 2RJKA 1BEV2 3AJYA 4Y4YA 2ZGQA 1GZWA 5C8CC 4XW3A 4OUSA 4LHLA 2R072 4YM0A 3W58A 4I02A 1PO21 3ES1A 3ASIA 1JUHA 4NOTA 5CFCB 1GANA 1QJU2 4GA9A 4AGRA 2BFUL 3J8F3 1EPWA 3ZFEB 1ASJ3 2BNMA 4QPIB 4RA0A 3RPQA 2G9FA 3AP7A 4KL1A 2BEOA 1SEFA 4OHYA 2JG8C 1CD3G 3WXPA 2I2SA 4YM2A 1S2BA 1AVBA 1AR83 1C1FA 4BH9A 3H3UA 2PHWA 4Q29A 3A0KA 1AL23 3W9AA 2ZAHA 4N43A 4KH9A 4M3CB 2PHXA 4NVPA 1QJU1 4FPEA 3FHIB 2EAKA 2WT0A 4NHLA 1G8WA 3HIFA 5FFOC 3WG2A 1CPMA 5C8WA 1QKQA 3USUB 5CFCA 5FQ0B 1JH5A 3IDCB 2P2KA 2R30A 2VUAA 3CEWA 1ND3B 3IBMA 1VBC1 2WSVA 3CO2A 3ZFEA 3KD4A 4QPIA 3R4UA 2DFBA 2WJSA 3O14A 2XLFA 3M70A 1R1A2 4XQDA 2WT1A 4TZDA 2BUKA 1D0GA 4JRLA 1WGPA 2YV8A 4U36A 1C5IA 2VULA 2VG9A 1H9PA 5C4WC 3NJZA 2ZX2A 4S2HA 2VOXA 4YZ1A 3BOWA 5J09A 4M3CA 4HMZA 2D98A 5SV5A 4TSVA 4AVVA 2D93A 1QOSA 4HZFA 5EYYA 4E4ZA 4ZXKA 2D6LX 3PMSA 5CA6A 4O9GA 5KHGA 1K5MC 1WMEA 2GC2A 4R4ZA 1COV1 1HQWA 1DGRA 5JIAA 3VHRA 2ET7A 2PA7A 2VUJA 5I93A 3USUA 1VBB1 5L7OC 4Y22B 5FQ0A 1ND3A 4KNCA 1QQP1 2Q8OA 4FTEA 1I6XA 2ZAAA 2WZR3 2BBVA 2WINB 2GSYA 1QDCA 4LO8A 5JI7A 1XU2A 3UJQA 2ZKNA 3WQ7A 4XTMA 5CB7A 1YFYA 1AYM2 3B01A 4DXZA 1RHI3 3JBG3 2GAUA 1QJZA 1GNHA 2CNAA 2A75A 4QQLA 3RDIA 1ZBA3 2E6VA 1UKRA 3POYA 5I91A 5T5JA 3O0XA 1BEV3 1A3KA 1O91A 2IXLA 4Q4V2 4AI3A 5GLUA 4Y22A 2UURA 1AXKA 4Y26A 1PGL2 2VOVA 2R073 3AKSA 3MDPA 2XPJA 5DUXA 4AVCA 5IK7A 1H2KA 2WZPP 4URTA 3B9IA 1QJU3 4LA2A 4OHWA 5J3UA 2MPFA 1D4M1 4QQ2A 3VZKA 2KA3A 1ZYBA 2RE9A 4XFCA 3MPPG 2XJRA 5AVAA 3J26N 3DKWA 3NAPC 3VBUC 4AQ6A 2IXIA 2NZ9A 1UF2C 4N9IA 3WUDA 4IERA 5L36A 1GSLA 4FCAA 1CGPA 2XVGA 3WY6A 4C1XA 4F83A 2UY9A 2CAVA 1HIXA 4AK3A 5C33A 4XQ4A 3ZXFA 5C6CA 2ES3A 4NO4A 4YSFA 1OLQA 3W59A 3KZ4C 1ZRRA 2Q30A 4Z07A 3CNAA 4GALA 4BYYA 3WW4A 4UW5A 3E97A 3RI9A 3OGGA 1R1A3 5FREA 2EXHA 3JUUA 5DZEA 2DFCA 3D6EA 3EBRA 1KD7A 3IDBB 1Q5OA 2PHLA 4B8EA 4NHMA 1LJ7A 2WFF2 3QCWA 2KXLA 2VGDA 1RUE1 4PLMA 1CN1A 3DV8A 3QOPA 4W6WA 2WA3A 3ZFFC 3SLIA 2VVFA 1HRI2 5F1RA 1U5ZA 2QCSB 5FAXA 3WP4A 4CEWC 4LR4A 3WVJA 1BVP1 4P9WA 4EJRA 1LHWA 1MR5A 3HN1A 1FNYA 1CX4A 2E7AA 2RS52 3B7MA 2PHFA 4B4RA 4WBBA 3DF0A 1RUG2 3AZWA 3MPBA 2NPIA 3QLQA 3RYPA 4DRVA 3AXDA 1FPN2 1AYM3 2ZABA 3VL9A 5GLWA 2R0HA 1IS4A 2WC2A 4XOGA 1Q43A 4GKXA 4D7YA 1VAKA 3BTAA 1QJX2 1PZ8A 1NCRA 4JVAA 2E51A 4IEPA 4XF4A 1ZX5A 3IKWA 4FOYA 5T5LA 4META 2RS51 1UPSA 5KHJA 4AEKA 2EXIA 1V9U2 2CV6A 1RUG1 1CAWA 4LBMA 3ZIWA 2P3KA 5BNOC 3WZ1A 1YXWA 3AZYA 4S2FA 4ASMB 1VRH1 5BNPB 3N4MA 2XKOA 1ULFA 2D6KA 2RHPA 3AMPA 3S7IA 4N53B 2ZGNA 5AC92 4JC1A 5DG2A 1C1LA 4HK9A 4QQOA 1QJX1 3SITA 1VLNA 1PZ9A 2E53A 2QUOA 4DS0A 4WVZA 1Y43B 2ZOEB 1ZZBA 4OHZA 3FJSA 4YVSB 3VHPA 3JCIA 4P9XA 1AR72 1DGWA 5AFEA 3HWJA 2UYAA 2ETEA 3IDEA 4WM7B 4JDNA 3IWZA 3ZIXA 3R05A 1KFUL 1POV0 4ASLA 5FO9B 1UU6A 3N35A 5KWRA 5I0TA 2ZACA 3MI8A 1YWKA 3VBRB 4R4XA 1RGSA 1B09A 2Y0OA 1W6QB 3V56A 1D2QA 5BNPA 1POV1 2OUHA 1G86A 4Q0UA 4E2GA 2ZHLA 1G9BA 1WBLA 2DURA 1CIWA 2VMIA 4PJYA 1WMDA 2K0GA 2P37A 2VMGA 3POSA 5FO8B 4BOWA 2PAKA 1RJ8A 1HQLA 4FOWA 2VMHA 5TSWA 3V65A 1PGW1 3MLJA 4YRDA 4HVOA 1LULA 1S55A 2QFEA 1AX0A 2XLAA 3TOJA 5JOZA 2W08A 3T2TA 3N7JA 4QMAA 3KT1A 3WP5A 3ZMOA 3FC0A 4WM7A 4QQHA 4IEWA 2BYVE 2XG3A 2P3IA 3IN9A 1Q8OA 4RL7A 2WNUB 1FX5A 1RUF2 4INDA 1UKGA 2WLPA 4AEDC 2BQPA 2ZA9A 5HCBA 1IQAA 1LECA 2NM1A 3E6BA 5GZDA 2A6YA 3RG0A 1TME2 2A3XA 3VBRA 1AYN2 1HRI3 1QGLA 1W6QA 2O8QA 1XYNA 3VBSB 2YGMA 3KT4A 3MLLA 3D82A 4MX3A 3VZNA 5IUQA 3WQ0A 3AP9A 2RS53 4HANA 4J6GA 4AI8A 5J98B 4N7IA 3MEPA 4MSVA 1RUG3 1RUF1 1CAUB 1DQ2A 4IEQA 4Q27A 4XXAA 5I8SA 5AFBA 1HDKA 3DGTA 1NCQB 3PHMA 1FPN3 4E4DX 1WD3A 1DQ1A 4W65A 4LBKA 4A7ZA 2WNUA 4FXKB 1IPKA 1N1SA 4SLIA 2EF6A 4LO7A 3VBFC 4E27A 2EVXA 3VDDC 1QJX3 3HT2A 4XIOA 3RZZA 1DG6A 1MZEA 1YCIA 4M3CF 1H8VA 1F2NA 3VBSA 4GIQA 4DFSA 4D94A 5KXCA 3VZLA 1V9U3 4QPYA 2ZCWA 1VAMA 4YFWA 4Q0VA 1NXD1 1FV3A 1WD4A 5LEKA 3IIAA 1I3HA 3JQWA 3D8CA 1ALYA 4YM3A 3AKQA 1MS3A 3KCYA 1CAUA 1PMIA 3NKGA 4GB31 4LHNA 1NCQA 3RWNA 2ZGLA 1KDMA 1UD1A 4CDXB 1POV3 3POWA 3ZYGA 2EAAA 3HMYA 2A7AA 2PYTA 1GBGA 1CVNA 2B7YA 4FOQA 1AR73 1ND2C 4LUMA 4TYSA 5A3MA 3K48A 5JCTA 4RFT0 1MEC2 1W6MB 3HR9A 1OOPB 1F31A 1VBD2 2C9AA 2H0VA 3JD72 4XZPA 3VHNA 3SISA 2P34A 3WCSA 4JGYB 2RS11 4AI2A 2HWE1 4BE3A 4B4QA 4Q0PA 2R1DA 2XWJB 1PGSA 1V6LA 3MLKA 2O8OA 5D8AA 1UZZA 3B9CA 4D7TA 2HWF2 4N7UA 1CJPA 4LHKA 4PIZA 1QXPA 4GWMA 4HL0A 4YVWB 4OVEA 1EPZA 1F5FA 5ACA2 1Q56A 3MYXA 2CTVA 2JXAA 2X5IC 4PBPA 2NN8A 1NA1B 3AX4A 4Q4W2 1S0FA 5A33B 4WV8A 2X53S 3KM5A 4I0WB 1W6MA 2CY6A 3FUOA 1OOPA 4IEOA 2YY1A 4XQWA 1SBFA 3ZVXA 1B35B 1RUF3 3OY8B 4JGYA 1DQ5A 2R49A 5I0SA 1LOBA 4WM8C 4AVBA 1RVF2 3QD6A 1WUVA 4G4FA 1UU4A 3GBGA 3BIWE 1AYN3 1HQNA 3GNEA 3J4UH 5DG1A 4EWDA 4MGIE 1DBNA 4L97A 3FUQA 4XJ9A 5FTTC 2ZX1A 2H6BA 2YPJA 4YVWA 3TN92 3UK9A 4AVSA 5BNNB 2CYFA 4BM8A 1F8VA 4C0HA 4M00A 2OW4A 5FCCA 2YHJA 1NA1A 1A8DA 2GNBA 3ILRA 4RHV2 3VKNA 1AR91 2A5ZA 3IM0A 5BV6A 5A33A 3VBOB 4FBFA 1UIKA 1C28A 5FOBB 5HCFA 2B8MA 5LRSA 4XJUA 4BMBA 2R061 3B5LB 3QACA 1BVVA 1B35A 4CP0A 3OY8A 1WW7A 1JTZX 1AR61 4XBLA 1Y3TA 4JAAA 1GZCA 2B46X 1QF3A 2ENRA 3I4IA 3TN91 3FE5A 2XHKA 4BLIA 4YW3A 3MIBA 4PIXA 4MYEA 4PDWC 1DIWA 1O3RA 1PIV1 1AX1A 3J8F2 3WINE 5CU1A 3PJYA 5BNNA 5FMOL 3ILFA 4UW6A 3ZXKA 4RQPB 4PCRA 1A6CA 3U11A 3ROUA 4HKWA 4L9BA 1NXMA 1VBE2 1DLLA 3VBOA 4JGZC 3N7KA 1AX2A 1OI6A 1OQEA 3AYEA 5JZGB 3THPA 3SCGA 2DWRA 2OVUA 4K20A 1TMF2 4CDWC 4LNVA 1FYUA 1MEC3 1VBD3 5J36A 4Y20A 4AQ2A 2BTVC 2EALA 1T6GC 1SBDA 1XE7A 2QQPA 5EFUA 1R082 5EJ3A 1RUJ1 1EV12 4YM1A 5GKAC 3VZMA 1BXHA 1LTEA 1IPJA 4RQPA 2PLV2 2MNGA 1SCRA 2YDEA 2HWF3 5KHKA 5JVVA 1TQ5A 5D1IA 4Z8BA 1MQTB 4X6RB 1C5HA 3GZTB 3VKFC 3B93A 2C0ZA 2AH2A 4Q4W3 2R6QA 5H9PA 1NE6A 4JQRA 4S2GA 4YG6A 2AREA 2Q1MA 2CGNA 1Z7S2 1AR93 1SMVA 4AEJA 5KXDA 4OULA 2JE9A 3IPVB 4Q26A 4Y24A 5DUWA 2PFWA 4GH4B 3WW1A 4X6QB 1LOGA 3AFGA 1AUYA 4F8AA 5JI9A 2EIGA 1LOCA 2WNVC 5FPZA 1PO22 1AR63 2BGCA 2ERFA 1W6NB 4KG8A 1BKZA 1MQTA 3TN93 3ZFGB 4D3WA 4NN0A 4NR1A 4BPZA 4LEJA 2JG9B 3H1YA 4HFSA 1N1TA 2YC0A 1ZM1A 3WDYA 1XU1A 1D0HA 3GHMA 5E88A 1Q3EA 4CDUB 3INAA 2D44A 3AFKA 3HD8B 1G7YA 1WW6A 4RGGA 4N43C 4DQAA 3OD4A 4G9SB 4FXGB 3X29B 2XWBB 4XF0A 1PO11 3IPVA 4E4SA 2ZGSA 4GH4A 1V00A 4N9HA 1V70A 1RUD1 3LSDA 4A2UA 4MGZE 3CLPA 5J96B 1YFWA 4EWEA 1PM7A 1YIFA 1MVQA 5C8CB 4CP1A 4ONUA 4Y1ZA 1W6NA 3LA7A 1TNFA 2FMDA 4ZU4A 4E2SA 3AP6A 2CGOA 5H9QA 3ZFGA 4MH0E 3ZFEC 2JG9A 4L99A 3SH5A 5CVRA 2ZGPA 4OFGA 4YZ2A 1C8M1 1VBC2 1CAXB 1G9AA 5JOXA 4FPLA 5A3LA 2DVAA 1VBE3 1H2LA 4CDUA 2GDFA 2PAMA 5CADA 4HETA 1J3PA 3NL1A 2XJQA 4XJZA 1TMF3 2PTMA 3ZYRA 2ZX0A 4CP2A 2XJSA 2D6MA 2N7GA 4YW2A 1QMJA 4COWA 1PK6B 2Z42A 3DPRC 5C8CA 1R083 1BZWA 1TNRA 2E7QA 1COV2 3MF9A 3TNPB 4BWOA 1ND3C 5DDJ1 1EV13 1GV9A 2ZMNA 1VBB2 2UYBA 2A3YA 3KCXA 4XYXA 1S0JA 2PLV3 4YGBA 1QQP2 1NQJA 2ZTNA 1CAXA 1AJOA 4XFHA 4B3NA 4IV1C 1I5ZA