3AYAA

Crystal structure of galectin-3 crd domian complexed with thomsen-friedenreich antigen
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
135
structure length
135
Chain Sequence
MPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galectin-3
publication title Structural basis for distinct binding properties of the human galectins to thomsen-friedenreich antigen
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ayaA00
1W6PB 4M3CB 2NN8A 4PBPA 4AGVA 5T52A 1SBEA 1NLSA 2LALA 2NZ9A 3FFZA 1DQ4A 1GICA 4Q8KA 2W68A 4FOYA 4FVVA 4UW5A 3NV3A 1FV2A 5DUWA 1JN2P 3WHUA 3POWA 3ZVXA 4LBMA 4YW2A 1RITA 4DFSA 2UWBA 3N36A 3N7MA 4P14A 3N7LA 3WDYA 1N3QA 2WSVA 2E6VA 1R1ZA 2ZGKA 1SLTA 3PJQA 4P9XA 3WG1A 5HCBA 2ARBA 3B9CA 4XJUA 2D6MA 4TZDA 4GKYA 2DWRA 1O4ZA 3O0WA 1MR5A 4M3CE 1LECA 4XHXA 4Y1VA 1QNWA 3PVOA 1SLLA 5JLVA 1LHUA 2A6YA 1SBFA 3AXEA 4P9WA 1S0IA 5F9TA 5EXOA 5IK5A 4YW5A 1W6NA 2WKKA 4BPZA 1LHWA 4K20A 2EAKA 3VKLA 2AYHA 3WDUA 1LHVA 5EWSA 3ZXJA 4GALA 4NO4A 2V73A 4LBLA 1AX0A 5GLWA 4Y20A 1N1VA 4Y1ZA 3Q9OA 2AENA 1LGBA 1N1TA 5DUVA 2VW0A 5GM0A 2C9AA 4YG6A 3A4UA 2D6PA 3NV2A 4M01A 3WUCA 1S0DA 5DUUA 2VW2A 2W39A 3ZYRA 2EF6A 2ZMLA 4ZKTB 1GBGA 2DVGA 3AP4A 1Z0HA 4K1YA 4BQ1A 2EXHA 2YROA 2YMZA 3UK9A 3T2TA 3D6EA 2Z42A 2WT0A 2PHXA 3USUB 5JOWA 4FPFA 4BLIA 4YGEA 1WLDA 4XYXA 4XJ9A 3RG0A 1S0FA 2ERFA 1GLHA 2YV8A 3LCPA 2JE7A 5AVAA 2OW4A 1MVQA 3UL2A 4Q1PA 1FATA 3WNXA 3RS6A 1UZZA 1Y7BA 2A6ZA 3ASIA 3SH3A 2CL2A 2ZGTA 1W6QB 4Y1UA 2D43A 3RSJA 1GNHA 4Y24A 3MW2A 2CYFA 2KM2A 3HMYA 1ULGA 1ULDA 2EXIA 5JDBA 1OFSA 2PHRA 3FLPA 1D0HA 3R05A 5IK8A 2CTVA 2WSUA 1Q8PA 2HYKA 4M00A 2PELA 4AVTA 1IS4A 3SISA 2ZAAA 2A6XA 4XTMA 4YFWA 2UWCA 5T50A 1LCLA 4YZ1A 3PMEA 4BLJA 1U0AA 3W58A 2JJ6A 3AZYA 3INAA 5CNAA 4XBLA 1SCSA 1V6IA 2PHFA 4GKXA 2VUAA 4H55A 5GALA 4CTEA 4DQAA 3ILFA 3RQ0A 3OGGA 3AFKA 1Q56A 2Q5TA 3DGTA 1CONA 3QLQA 1OQ1A 5E88A 4XDQA 1AXKA 1GNZA 2ENRA 4F83A 4XHBA 1JYCA 3WLUA 1HDKA 1ONAA 2A70A 1LGNA 3VKOA 3IPVA 2ES3A 5T5PA 1EPWA 1DQ1A 1LOGA 1KJRA 4XIKA 3ILNA 1YRZA 3B00A 1DGLA 5T54A 4CRQA 5HCAA 4YG3A 4GXLA 1JW6A 5LK5A 3HR9A 3VKNA 1QOOA 1AXZA 3W59A 3OBRA 1A78A 2JD4A 4XOGA 4BMBA 1GZWB 1DHKB 4Y26A 2I2SA 1GSLA 4PF5A 3OY8A 2DVFA 1J1TA 1DQ5A 1WD3A 1F31A 4AVVA 2D6OX 2JE9A 3A0KA 2FMDA 3AP5A 1VIWB 3AX4A 3AYEA 2DTYA 1PZ9A 3V0BB 1X50A 1IS3A 4M3CF 1WCSA 2WT2A 2D6NA 2ZHNA 4DRVA 1CQ9A 3WDTA 1FX5A 1V6OA 4FPYA 4YZ4A 3ZYPA 1C1FA 4ISQA 3LSDA 1LOFA 3WZ1A 2EIGA 1JHNA 2SBAA 3MPPG 4FPCA 1FNZA 4FPKA 1MS4A 1G9DA 1KRIA 1ULCA 1Q8VA 3FBYA 4YM1A 4NOTA 1MS0A 1MS5A 1WW7A 2GNMA 2D3SA 1WBFA 1UPSA 5T5OA 2DYCA 2H0BA 1HQWA 3ENRA 3AJZA 1IOAA 3AP6A 1RIRA 1S1AA 3HN1A 4FPGA 2DVBA 1LESA 3SNMA 4XXPA 3O0XA 4XJWA 2SLIA 3ZSJA 4XMIA 4LBQB 1D2SA 4YW1A 4UW3A 1S0GA 1LOAA 1CJPA 4R9BA 4ISRA 3PVEA 5IK4A 3WHTA 5IT6A 5KXCA 4UW4A 2ZABA 4FP2A 2GALA 1IS5A 4P9YA 3WCRA 4DS0A 5T55A 4BM8A 2W52A 2BQPA 1N3OA 3O0VA 2D3RA 3B69A 2A7AA 1YXWA 1MACA 2C5DA 1NXD1 1DZQA 4YM3A 1PZ8A 1V6NA 2DU0A 2V5YA 2GDFA 3B3QE 4WV8A 3WVJA 3AYDA 3NV1A 5GZDA 4DRRA 1LGCA 2D6KA 2P3JA 1BXHA 3RRDA 3AJYA 3FUQA 1A3KA 4XBNA 1S0JA 1SLIA 2VY0A 3V64A 5KXBA 5GJ6A 4AYUA 1W6OB 1OKQA 2WNEA 5DG2A 1SACA 2VW1A 5EYXA 2R49A 3M3EA 5T5JA 1V00A 4XBQA 2NM1A 3V0AA 2A3WA 5GLZA 3MEPA 4C1WA 2A5ZA 1QOSA 2ZACA 1G8WA 2W08A 4K21A 4XJZA 5GLUA 5BYNA 4YZ3A 1CESA 2EXKA 3NWKA 1VLNA 4YFZA 1G9BA 2ZGRA 1KDMA 1WW4A 4WVVA 1LULA 2R0HA 2XB6C 3ZXKA 1N47A 2DU1A 5GZCA 1G7YA 3ZPYA 2YY1A 1PZ7A 3IM0A 5E8AA 3M3OA 4XZPA 1Q8OA 2XG3A 1HLCA 4FPHA 5H9QA 2GNBA 2R1DA 1IS6A 2ZGMA 5H9PA 1DYKA 4FPEA 1VAMA 2R0FA 1S0CA 1CPNA 1LHOA 4PQ9A 2ZMKA 2JKBA 1LHNA 4MYEA 1LEMA 4YGCA 4BMEA 2NP0A 2A71A 1WUVA 2D44A 3WG4A 5JOZA 4GWMA 1TEIA 3AXDA 2NMNA 5JVVA 4FQZA 1AJKA 3N7JA 1LOBA 4XMAA 1W6MA 1H9PA 2OUHA 1AX2A 3ZXEA 3WCSA 3WOGA 1APNA 1FAYA 1KQRA 4YGBA 1N1YA 1W6NB 4XE9A 5JOYA 5DG1A 1KITA 1CN1A 4XXAA 2YXSA 2D6LX 2GNTA 2R1BA 2TEPA 3O12A 4PCRA 5CAZA 4Y22A 5KXEA 4U36A 4ZXKA 3TB0A 1RINA 2DVAA 2PHTA 1W0OA 1LODA 3APBA 4UW6A 4Y20B 3AYAA 1SLAA 2JDZA 1QOTA 1XQNA 1S0EA 1G9AA 1V6MA 3OPZA 1UMZA 4RA0A 2D3PA 4Y1YA 5L73A 5FREA 5F5QA 2YZ4A 4Z8BA 4YG0A 1C57A 2DVDA 3NV4A 3T1MA 1WW6A 4FOVA 1VAVA 3AZXA 4Q27A 1Q8QA 3WDWA 4RL7A 3ZSMA 3WUDA 1UAIA 1ZA4A 2P2KA 1AVBA 5DZGA 1V6LA 3UJQA 1QDOA 1AF9A 1Z78A 4ASMB 5CB7A 3BTAA 1H9WA 3IMNA 3UJOA 3MW4A 3M2MA 1ULFA 4YGDA 1AJOA 2P3IA 4LBNA 1ZM1A 4YM0A 1LU2A 1AZDA 1MVEA 3WDVA 1C1LA 2A6WA 1GV9A 3OJBA 4XIOA 4BOWA 1BJQA 2LTNA 3GALA 3USUA 2WLQA 2WJSA 3RMXA 3ZSKA 4DPNA 4XJAA 5H9SA 1YI7A 3B01A 1SFYA 4LBQD 4YZ5A 5IK7A 5H9RA 1MS8A 3WV6A 1SCRA 5IUQA 3AK0A 2PHWA 4Q2FA 1KJLA 3D5OA 1ULEA 2ZHKA 4IQPA 1FV3A 2AGSA 1GYKA 2ZA9A 4FQ4A 3VKMA 3OYWA 4GA9A 2ZGOA 4Q8LA 2D7FA 1G86A 3FLRA 1LU1A 3BODA 4XJ8A 1YO8A 5GLTA 1DQ6A 2DTWA 1KDKA 4WZFA 1JYIA 1I3HA 2WQZC 3H0OA 3R4SA 2WT1A 3I8TA 2ZGPA 1LTEA 1S0BA 4AWDA 1B09A 2DUQA 1Q8SA 1MZ5A 4PBOA 1G9FA 3VV1A 4I30A 3CNAA 1W6MB 4D69A 3I4IA 1ENQA 4FPJA 4JC1A 2CWSA 5GZGA 2ZGUA 4ATEA 1I1EA 3C2UA 5EYYA 2ZZJA 3IPVB 4W65A 2ZKNA 2A3XA 2E51A 3MW3A 4LBJA 1LOEA 1UKGA 3SH4A 2ZGNA 3IN9A 3RMYA 3ZXFA 4U2AA 2ZBJA 3N7KA 1DYPA 4Y22B 2A6VA 4FPLA 5GLVA 3ZSLA 1SLCA 3IKWA 3L2YA 5KXDA 5DUXA 4LBOA 1LEDA 1O4YA 1JXNA 1AX1A 3AP9A 2R16A 5FRAA 1YIFA 2ZMNA 3M3CA 3D4KA 4LBKA 1V6KA 2B7YA 5DXDA 2CNAA 3OY8B 1N3PA 2GNDA 2GN7A 3VKFC 1WW5A 5GZEA 2CWMA 2JECA 1JOJA 1GZWA 1GANA 1QF3A 2P34A 2VH9A 4C1XA 1JBCA 1MS3A 2FHRA 5JOXA 3POYA 2NMOA 1QKQA 1CIWA 1UZYA 4Y1XA 4YW3A 1SLBA 2A75A 4L8QA 4ITCA 3PVNA 1UN1A 4K1ZA 3ATGA 3V0BA 3M1HA 1F9KA 2DUOA 1CPMA 2E53A 2A3YA 1FYUA 1DBNA 1DFQA 4FOQA 3M3QA 4WVWA 3SLIA 3R4UA 1QNYA 3VUOA 1W6PA 2NYYA 4M3CA 1UL9A 3SH5A 2ARXA 1AXYA 1MS1A 4AVSA 2ZHMA 5HCFA 1SBDA 2GMPA 2UU8A 3DUIA 4HANA 3KM5A 3JUUA 1C4RA 2UURA 5E89A 1GZ9A 1VALA 3U4XA 2DV9A 3OYWB 3WG3A 1QGLA 1IKPA 4R9DA 1ENSA 1LOFC 3N35A 5GZFA 2AH2A 4R9AA 5JMCA 1ENRA 1BKZA 1BZWA 1WLWA 1LJ7A 4AGRA 3AP7A 3BIWE 4Q26A 4FP3A 3AYCA 4FPOB 4JRAA 1QDCA 1G9CA 2GMEA 1MS9A 4GWNA 1DLLA 2DUPA 1W0PA 2DURA 3AZVA 3BOPA 4LBQA 1CVNA 4R9CA 4SLIA 2ZGSA 1UX6A 3O5SA 2ZGQA 5CBLA 1H30A 4HL0A 3WG2A 3OBTA 4YZ2A 1WBLA 1CR7A 2P37A 1URXA 1WLCA 2EXJA 3KQRA 4XTPA 5DZFA 3GNEA 1DIWA 3SITA 4ATFA 2P3KA 3A0NA 4FOWA 1JUIA 3AZWA 1DQ2A 4XILA 2PHUA 1WD4A 2GN3A 2UWAA 1GKBA 1IKQA 3JU9A 3ILRA 4TYSA 2CY6A 3POSA 1MZ6A 1FNYA 4YM2A 4AGGA 1BQPA 2GMMA 1F5FA 2E7QA 2AUYA 4CZSA 5CA6A 2ZGLA 1DQ0A 3ZXLA 2ZHLA 5DZEA 1QMJA 1LOCA 1YYNA 3N3HA 3V0AB 1HKDA 2E7TA 1W6OA 3QCWA 2G4IA 5SV8A 2VXRA 4YLZA 1QU0A 3WDXA 2VU9A 3FUOA 2EALA 3LSEA 2OVUA 3FLTA 3T1LA 1V6JA 4YW4A 1A8DA 1LENA 1HQLA 3AZZA 4JCKA 2AR6A 2AREA 1W6QA 4KBBA 2OUJA 3TAYA 1GZCA 4OZXA 1BYHA 5T5LA 1N1SA 3V65A 4Q1RA 2RHPA
chains in the Genus database with same CATH superfamily
4NHXA 4A2UA 4AI3A 2D5HA 2LALA 1AR73 2JIJA 1PMJX 1WLTA 2W68A 5LBEA 5BNPB 4P02B 1ZZ7A 1FV2A 4UW5A 3POWA 4YW2A 1YQ6A 4OQ8A 3WQ0A 1N3QA 2BVBA 2MPFA 1PO21 2VBDA 1XNKA 1SLTA 4P9XA 2PLV3 1QXJA 2QQMA 4CPBA 1IPKA 3LIGA 4TLGA 4GKYA 2DWRA 1O4ZA 2RS12 1MR5A 3O0WA 4ES9A 3GJBA 5BPXA 5JLVA 1LHUA 3MIHA 1GOGA 4XABA 5BNPC 4CXYA 5F9TA 4QXCA 1ZREA 1NAEA 1QWRA 4YW5A 1W6NA 4UXAA 4RGAA 4YPJA 4A41A 4X6RB 4BPZA 3WDUA 2GC3A 4OI4A 3BALA 2DBIA 1W39A 4LBLA 4I09A 1MEC1 3NKGA 4QM9A 5A1FA 2X29A 1JYTA 2NQYA 3KVBA 3ZPOA 1RHI1 2FDJA 1PX4A 5FKBA 1HRI2 1RUD2 3WUCA 1MQTA 2WLPA 3LDKA 1ST8A 4AZZA 1HXS2 2EF6A 1EUUA 1GBGA 2BERA 2RM22 4K1YA 5C4WB 5JIUA 4CPBD 2D5FA 3WNOA 1VRBA 5HCHA 4H7LA 4IE5A 5LY2A 1Y3TA 2O0OA 2JG8B 4PI2A 2VXJA 2IC1A 1AR71 5D1IA 4LT5A 2FCUA 4D3WA 3EO6A 3I3EA 4YGEA 4ZZ8A 4LITA 3Q8FA 2OA2A 2O14A 4AEJA 2IUWA 4HN0A 3RFRA 1UIKA 2R063 2J22A 2Y6KA 3LCPA 2W91A 3VD4A 2OW4A 2V4VA 5D21A 2PLV1 3UL2A 5C4WC 1FATA 3RS6A 4TWTA 2YGLA 2JG8C 1PK6A 1GNHA 2BFUL 2JB4A 3P3PA 5LA9A 3R6SA 3ES4A 2YU1A 3A22A 5FLJA 5FYHA 3ES1A 5F6LB 1ULDA 5J3UA 1JZ6A 1OFSA 3R05A 1OD5A 3CMGA 4RQPB 3I2JA 2VULA 5FZAA 1ZZ9A 4QX0A 1CAVB 2WSUA 5CIRA 5A3MA 3ZX7A 3HQRA 3OPTA 1H1MA 2RE9A 3T2OA 2WZR3 3E1F1 4BA6A 2RDNA 1LCLA 4PF1A 5FPXA 1XB9A 3VZMA 5FPUA 2JJ6A 3VBOB 5CADA 5CNAA 4Y5Z0 1RUC2 4XBLA 2P4EA 1V6IA 4RQPC 5FQ0B 1H8TB 1ENXA 3ILFA 4E2GA 4URTA 3AFKA 2ZOEB 1ZBA3 3DGTA 1CONA 3FHAA 3QLQA 2VZ3A 4P5YA 1GNZA 2ENRA 4F83A 3NKTA 3NNGA 3M7AA 2XWBB 2Y6JA 3VBOC 2W3JA 2ES3A 5T5PA 4A7KA 1EPWA 3K4ZA 1YRZA 3B00A 5T54A 5HCAA 5FYMA 1ASJ3 4YG3A 4GXLA 1H8TC 5A3PA 4H7MA 2YC0A 2Q8OA 2BUKA 5ERLA 1VAKA 4D8MA 1O8PA 2R061 3HR9A 3MIEA 3VKNA 1QOOA 2O8OA 1W2TA 1RUH3 1X8MA 1YC61 4CEWB 1QJU2 3I54A 1GZWB 3WNLA 2I2SA 1GSLA 3H3UA 4PF5A 3OY8A 1JUHA 2DVFA 4RS5A 3ZFEB 1WD3A 4MADA 4AVVA 2ARCA 3KV9A 2FBEA 4WM8A 3KVAA 2L9LA 1VIWB 1ND2B 4GAZA 3B9IA 4OHXA 2K46A 2VQUA 5CISA 2WZR1 4M0NA 2ZHNA 4FCAA 3IDBB 4DEQA 4AI1A 3M70A 4CEWC 1V6OA 4C8DA 2G9GA 3KCXA 4ISQA 2B46X 1POQA 3ZFEC 4ARYA 2EIGA 1JHNA 2SBAA 2VTXA 1GFF2 1FNZA 3MPPG 4I0AA 2PN5A 3PLQA 3BCWA 3FBYA 1BLZA 4QQPA 1MS0A 5LBFA 1ND2C 1NX9A 2GNMA 1UYZA 2GP5A 4ORFA 2DFBA 5DAXA 2D3SA 4BQXA 1JODA 1UPSA 2JKXA 2DYCA 2H0BA 1O91A 3T2QA 2DBNA 2RDQA 3GGLA 3MF6A 4WZCA 5DQ0A 5CKNA 3LA2A 5F5CA 5KHIA 1ND3B 1LESA 1NYWA 1A34A 4XXPA 3O0XA 4D6SA 2SLIA 2K9ZA 3JD73 3ZSJA 5C8CA 1ASJ1 1SEFA 3LWCA 1PVC3 1RL3A 1D2SA 2ZEZA 5A7OA 1S0GA 1W03A 1LOAA 4EN0A 3PVEA 2Z2SB 4JX0A 5FZ0A 4FP2A 4Q4X2 1D7PM 5KHHA 1RUH1 1IS5A 3VZKA 2W52A 4L2NA 4XUPA 3HNMA 3MDPA 4KU8A 2A7AA 1YXWA 2R7EB 1ND3C 1UY2A 3HPNA 5FP8A 1C5HA 5JPNB 2R6QA 4JZRA 3B3QE 4OMCA 2UY9A 4KMQA 2XBO2 3K46A 3J9SA 3N9LA 2IXHA 4IDZA 1W28A 1DGWX 1GUIA 3WXPA 3HAGA 3KD4A 3I2OA 1BCXA 2VY0A 5KXBA 3WNPA 5GJ6A 4A7YA 4AYUA 1VBD2 3ZFGB 4JHTA 3POIA 4YVWB 5DG2A 3VDDA 1SACA 2VW1A 4DINB 5A3NA 1X7NA 3JBG3 5D2AA 2EIDA 3M3EA 1IHMA 3PNAA 1J83A 3P5BA 2OX0A 2YDEA 4CUBA 2NPIA 3V0AA 2I45A 3DPRB 1JZ3A 4C1WA 3MLJA 4FFFA 1QOSA 3UKVA 3S5QA 4CDWB 5LRSA 2G1MA 3WF4A 5FZLA 1CESA 4YVSA 2X05A 3OEAA 1ZZCA 4F8AA 5A6YA 1KDMA 3ZFGC 4DXZA 4AI8A 4YVWC 1LULA 1ZBE1 1PGSA 2BJSA 1L7RA 3JD71 1D4M2 3ZXKA 3RVHA 4CDUB 5K8SA 1JH5A 5EQUA 2V5DA 1LAJA 1PVC1 3ZPYA 5A3LA 2JICA 5A3UA 1NLQA 3DPRC 3OUJA 4KH9A 4XZPA 2ZXQA 5L7OA 2XG3A 4CDWC 1WCKA 2WN3A 4FPHA 2HLEA 1UY4A 3ACHA 2ZGMA 1MZEA 1T6GC 1VBB3 4KGGA 4WBBA 3TYJA 5JXJA 2R0FA 1S0CA 5J96B 4HKLA 1CPNA 1S55A 2ET1A 1BK0A 1W8HA 2HWB2 2ZMKA 3N9MA 2Q8CA 1LEMA 1W8OA 1AR92 2VPVA 4CDUC 4NRQA 3O1SA 3J8F3 1TEIA 4XMAA 1W6MA 1H9PA 2QQUA 3ZN6A 4DEVA 3ZXEA 1FMD2 5IHRA 1NA1B 2W95A 4PT6A 1Q3EA 1N1YA 1QJY2 4YGBA 5FO7B 2WRAA 4EWAA 3DV8A 4KU7A 1HRV2 2TEPA 4RGGA 3MIDA 5LB6A 1BMV2 3GZTB 2RR11 1REDA 3JBG1 4LJHA 5A7NA 5A1LA 3O7OA 2Y26A 4BIFA 4QQOA 2PHTA 4NWVA 1PGL2 4HMZA 4AI9A 2HWC3 1AYM3 1Y9GA 1GWKA 3EHKA 1DGWA 5IWFA 4Q0UA 1VBA2 2YZ4A 4GH4A 3S7IA 4Z8BA 5EIYB 4MG2A 3G6JB 3U4SA 2FD8A 3NAPB 2QKDA 3R0RA 4OHVA 4RL7A 1UAIA 1ZA4A 2P2KA 1AVBA 1SPPB 4PLNA 5CB7A 5IFPA 5FMOL 1OQDA 2RDSA 1B35B 1ULFA 4YGDA 4N43A 1VBB1 4L92A 3KHCA 2WQ8A 4YM0A 3MHZA 1W9YA 1GV9A 3VBFA 1OSGA 4XIOA 4BOWA 1BJQA 3GALA 1STMA 2WLQA 2WJSA 1W3XA 5G05L 3RMXA 4XJAA 1YI7A 3NAPC 3D8CA 3J8F1 4AXOA 1O8SA 1IZ3A 4PIXA 2YPJA 3D5OA 4LMFA 1B35C 2ZHKA 3LEMA 5BV6A 1UIJA 4IQPA 4FQ4A 1GYKA 4MZUA 5K4LA 3ZXAC 3OYWA 1JOBA 4QGLA 4RHV2 2ZGOA 4Q8LA 1O3RA 2GU9A 4R4XA 2WIIB 1G86A 3FC0A 2WWSA 3FLRA 3BODA 5JXGA 3WNKA 1JZ4A 4S2FA 5HI0A 4BQ4A 2Z4FA 1KDKA 1S2KA 1I3HA 2HWC1 2JX9A 1AYM1 3R4SA 5FUNA 2P6CA 1NQDA 2VZVA 3I8TA 1UWWA 1B09A 2WZPP 3J26N 2VZRA 2GH8A 1H2MA 5FK8A 1ENQA 4JC1A 1K42A 2VJXA 3HQUA 4MXVA 4IL7A 4ATEA 3C2UA 4EV0A 2WO1A 3IPVB 3HEIA 2ZKNA 4W65A 4BB3A 4LBJA 4CDQB 5JI9A 1PO12 3OB8A 3KGLA 3I2KA 4MGKE 3H9AA 3MO4A 2YHJA 2IFRA 2XQXA 4Y22B 1KS5A 1JZ7A 2GSYA 3AVRA 1SLCA 2YFUA 3SEEA 4AL9A 3IKWA 3IT8A 2Y8KA 5KXDA 1XOYA 5DUXA 4LBOA 1LEDA 1JXNA 5FZGA 4YNIA 3M3CA 4CDQC 1V6KA 1RJ8A 4Y5TA 1N3PA 2LM3A 3AMQA 4MGZE 2GN7A 1XE8A 1AHSA 4IEQA 4JTOA 1YHFA 3TWIA 4AEKA 2D97A 2V4AA 5JI7A 2JECA 1XXNA 2HWF3 2P34A 2XXZA 3M3IA 1UQXA 2VH9A 4META 3ZM8A 4JDNA 3U0ZA 1R092 2IWGB 1JBCA 3HT1A 4OI2A 4YW3A 4Y1XA 3W21A 1BEV3 4GJZA 4XFIA 3RNSA 2ARAA 1UW8A 2A75A 1Q5OA 3B5LB 3C7OA 3I7DA 3V0BA 4E9KA 4XFCA 4NRPA 3M1HA 1R64A 4E4HA 1CPMA 2A3YA 2H6BA 1DFQA 3ZYIB 3M3QA 2RMU2 3R4UA 3KV6A 1JS9A 1QNYA 2EICA 1W6PA 3HBZA 1UL9A 1VR3A 1AXYA 5C7GA 5HCFA 3SKVA 1SBDA 2UU8A 1RVF2 3KM5A 2VOXA 3VL9A 5CKQA 2XL9A 2UURA 3U4XA 3LDBA 3ACGA 5C3PA 1QGLA 1IKPA 1OUXA 4DXTA 3N35A 4KQ7A 1UOBA 5JMCA 2XJUA 1RJ7A 4D7YA 4HT1T 3ZYJB 3AP7A 3BIWE 4Q26A 1W2UA 5KWRA 4Q0VA 3BTZA 1OLME 2ET7A 2GMEA 4XFBA 1HW5A 1SZBA 2VM9A 5EHDA 5FPVA 2ZTNA 4LBQA 5A3OA 4URAA 2JDHA 4NHLA 5FZBA 4HFSA 1H30A 3WG2A 1YEWA 2P37A 1URXA 1WLCA 2EXJA 2XDVA 1AYN3 4JAAA 4XTPA 4Z82A 5FP7A 1DGRN 5FIXA 2P3KA 3WY6A 1EY2A 1LR5A 4D6RA 1JUIA 3AB0A 1XNDA 2HWF1 1DQ2A 3LA3A 2GN3A 2P6HA 1GKBA 4NIAA 3JB4C 4RN5A 5LZ6A 2VQAA 1GWLA 4JGYA 4AK3A 5A32B 1W9TA 2C24A 3FX3A 3PTRB 3OD4A 5LBBA 5KHKA 5F6KA 3POSA 1BBT3 4NIGA 1C8M3 4JTNA 4GMP0 4Q4W3 4Q0QA 4AGGA 4CU7A 1BQPA 1CAWB 3D0SA 2XVKA 1VB2A 3GCXA 3QACA 5HXVA 3RGBA 1AR63 4Y4RA 4CZSA 5AFBA 1J59A 3UESA 5DZEA 1L7LA 1LOCA 1YYNA 2QQOA 1WMXA 4AFMA 5CFDA 4XAAA 5FZFA 3VBHB 4YLZA 1QU0A 5IAXA 3I97A 2LRPA 3LSEA 4MLOA 5A7WA 1D2QA 2ATFA 2ZZQA 4IV3A 5K0UB 3PUAA 4NWWA 2VMCA 3GBFA 3AZZA 2ZS6B 3O1MA 2FDKA 2W92A 2XLFA 5FJKA 4MHRA 4YYOA 3KCCA 1I5ZA 2ADEA 4KBBA 4IEWA 3TAYA 1GZCA 3LE0A 4OZXA 4UF0B 3VN4A 1OVPA 3ZXGA 3VBHC 5G04L 5CVRA 4NIDA 2P1BA 2VZUA 2XOMA 1OPMA 4SBVA 4EYUA 3FZ3A 4I0BA 4K9SA 1X9TA 1GICA 5K0UC 2PQSA 3MUY1 1AYN1 3NV3A 4FVVA 4LKFA 1RXFA 1D0GA 4LORA 4P14A 2JG9A 1H0BA 2TBVA 2WSVA 4IEOA 1UO9A 2MNGA 1GR3A 4LPLA 1XNCA 5ANQA 4YRDA 5CG8A 3ZLIA 2VMDA 2YG0A 3N9PA 4KI5M 2BVVA 3LB9A 2D6MA 3I2DA 4XJUA 5I0TA 3GZUC 3SCFA 1BBT1 4Q4W1 1UD1A 2VR4A 5FYSA 1SBFA 5JR2A 3NJYA 3C3VA 1X36A 1RUJ2 2HJIA 4P9WA 4J25A 1AR61 5EXOA 1VMFA 2JDUA 1ZA7A 3PU8A 1BVVA 1TME3 2QJVA 2WC2A 4XC9A 1LHWA 2QQNA 3U75A 1GZTA 2EAKA 3VKLA 2AYHA 5B2GB 5F3GA 3T0BA 3ZXJA 3G7DA 4GALA 4NO4A 2OXBA 2V73A 3WF2A 3IB3A 2WWUA 5GLWA 1EV11 5EJ3A 1KFUL 3AKPA 3OBZA 1ZBA2 4Y20A 1G6NA 3WX5A 4Y1ZA 1YFUA 4XFGA 1RUF2 5JZGB 2C9AA 2CV6A 3NV2A 4M01A 1NOVA 4O65A 3DKWA 4NUBA 4PQQA 3I2FA 1RUG3 1W8UA 3NSTA 2W39A 4NHMA 3AKRA 2ZMLA 4XFHA 4BWOA 3A21A 3VD9A 2DVGA 3AP4A 2QZ3A 2UYAA 2VUCA 2YROA 2JDYA 2YMZA 1RB8G 4FBFA 5D8AB 1QJX1 3T4HB 3D6EA 3ITQA 2PHXA 3KV5A 4FPFA 5JOWA 5JZGC 3M8LA 4N53A 2GC0A 3BOWA 4DMIA 4ES8A 1S0FA 2WNUB 4L9BA 5FAXA 2WR9A 5CYYA 3I3BA 2QFEA 1Y7BA 2A6ZA 1ZRFA 2HYXA 3K4DA 4LE3A 2CL2A 1W6QB 4Y1UA 1RTVA 2BYVE 2WNVA 1HN0A 3K4AA 5D8AC 4COVA 2ZEYA 2VMEA 5B4NA 2CYFA 2ZEWA 3HMYA 4XF1A 3VBRA 3ZFFB 4HVOA 1R1A2 4CDXA 4ZZ5A 1D0HA 5JPMB 1JYNA 2WNUC 1Q8PA 2PHDA 4LO8A 5AC92 1TME1 1OT5A 2EIBA 2ZAAA 3ZDSA 1TNFA 3LPGA 1E5HA 5T50A 4XCAA 3ZYGA 1KFXL 3BVCA 4BLJA 3N4MA 3S0MA 3HOBA 1X33A 3J7MA 3ZFFC 3QH7A 2PHFA 4GKXA 2VUAA 5ACA3 1EUTA 5FZMA 3ZR6A 2Y0IA 2B45X 3JQXA 4EWEA 2WYSA 4N7UA 1RUG1 3FL7A 5LASA 4E2QA 3NNJA 5LCWL 1JYCA 2CSGA 2VC9A 1ONAA 2A70A 2J1VA 3JQWA 1K5MB 1PVC2 2ZJCA 4DZGA 1DQ1A 5ABJA 1NQJA 2BTVC 3VBUB 1V9U3 3ILNA 4CRQA 2VNVA 4QDRA 2DCKA 3K3OA 5LK5A 5FY5A 1K5JA 3MGUA 4TTGA 2VVEA 2IXJA 2B8MA 1Y4WA 4CUCA 1AXZA 1F4AA 1NY71 2XQRA 1K3IA 5JUVA 2E33A 1MQTB 4W6XA 4I0WB 4DIQA 1K5MC 2JD4A 4BMBA 2WFF3 4CP9A 4XURA 5T3NA 4CUAA 3PL0A 3VBUC 1F31A 4F7ZA 2Y0OA 1OLRA 3AP5A 3AYEA 2DTYA 3HJRA 1X50A 5FMOS 4Y4YA 1RUE3 5FMDA 3AKSA 3MV11 3EYPA 5FZOA 2RS51 2WDBA 4K6BA 4NE9A 2R32A 5BNOB 4A42A 1CX1A 4QX3A 3O1PA 1DU3D 3LEKA 3WDTA 3ZIXA 2YBPA 2WWJA 3ZMOA 3LSDA 4OUSA 5ACA1 5E6HA 4FPKA 4FPCA 4GB32 4S2GA 3ZMNA 2GP3A 4YM1A 4GD4A 5DAWA 3ZYHA 1MS5A 3ST7A 1UOFA 4IEUA 2OZJA 3H3LA 1AL0G 1WBFA 1O3SA 2W1QA 5BNOC 3URFA 1HQWA 1A6CA 1OOPB 4MXWA 3AP6A 1RIRA 4KG8A 2BOIA 2BOJA 2DVBA 1V9U1 3H7YA 3OGVA 4EWDA 5I93A 3J4UH 1CJPA 3VHPA 4ISRA 5FPAA 2XKPA 4QB1A 3RI9A 4UW4A 2ZABA 3WHTA 2B9UA 2GALA 5KXCA 4P9YA 5ISLA 3WCRA 4DS0A 2E9QA 4IV1A 3MIFA 5IVEA 3TNPB 1OOPC 3HT2A 2WFF1 3B69A 1MACA 3VDAA 1AR81 4MUVA 1YUDA 4YM3A 1V6NA 3THCA 4BZ4A 1NT0A 4HPKA 3RZMA 3HN3A 1PMHX 4WV8A 4B7KA 3NV1A 5GZDA 2W2IA 1RUE1 2F4LA 3RZHA 3IMMA 3T3YA 2VOTA 3GXUA 5A1AA 3FUQA 1A3KA 4XBNA 2VZSA 2OT7A 1SLIA 4FAGA 3OF1A 3V56A 3V64A 3GYDA 1W6OB 1OKQA 1VBE3 3SXWA 2QQLA 3VHNA 1XRUA 3POEA 4QKFA 2HWC2 4HETA 5EYXA 2OZ6A 4OHWA 2VMIA 4UFLA 4BIOA 1AUYA 3N9QA 4XF4A 5T5JA 3T08A 4QGNA 5AFEA 4RS5B 5GLZA 3TN92 1FPN2 4AGVA 2ZACA 1XSRA 4B8EA 2W08A 4GJYA 4XJZA 2F17A 3I59A 2DCTA 4JDMA 1ACCA 3ON7A 2EXKA 3NWKA 1JYWA 5CFCA 4S2HA 2Y6GA 2R072 4WVVA 4ASKA 1O5UA 1UCXA 3B02A 4AI0A 1OF4A 1G7YA 1XE0A 5FY8A 1PZ7A 1UU5A 3MZHA 4RS5C 4Z07A 3KHBA 1OFNA 4BQ3A 5LK7B 1QJEA 3LEGA 2GNBA 2R1DA 2J1TA 4OZOA 3PU3A 1C3HA 1XYPA 4GWJA 4TSVA 4Z2AA 5IFTA 1R082 2B42B 1CZVA 2MEV2 3OG2A 4RR3B 4X8PA 1LHNA 5C70A 4V1PA 4IE6A 4YGCA 4BQ5A 5BNPA 5K7PA 2NP0A 2D44A 2GZWA 1IGOA 5IVVA 5JOZA 3Q8EA 3AXDA 1QH7A 2E63A 3MV01 4FT8A 3NJXA 4AEDA 5C8CB 2OUHA 5JXIA 1AX2A 4XUOA 4CEYA 5CZKA 1DLCA 3M4FA 4QPIB 3POGA 1FAYA 2HWD1 4IGPA 1P8JA 3ZYBA 1UY3A 3AVSA 4RR3C 1DDLA 1VBE1 1EAH2 3AL6A 4XXAA 2J1RA 5FY9A 3PJYA 4DUWA 2DCZA 1QQP3 3O12A 2BBAA 1YFWA 4PCRA 4FTEA 1UY1A 4U36A 3TB0A 1RINA 2DVAA 1LODA 3MBWA 3O14A 1SLAA 3P1IA 2H6CA 5C8CC 1QOTA 3EBRA 3HWJA 1XQNA 1OURA 1S0EA 2VCAA 3OPZA 5FMBA 4QPIC 5FREA 5F5QA 1S2EA 4QKBA 4YG0A 5F5AA 4NN0A 2DVDA 3NV4A 4CCOA 4FOVA 5BNNB 1VAVA 4O9GA 4CXWA 1KGYA 3MUZ1 5FV3A 5DZGA 2W5FA 1XJAA 4N9HA 2V09A 4ASMB 3NNMA 2F4PA 2WBKA 1Z7S3 4IUGA 4Z1VA 5JCTA 3VDDB 1H9WA 5C4WA 3UJOA 4IERA 4LR4A 4PDWA 1ZM1A 5C3OA 2JG8A 3AMHA 1MVEA 3HQXA 3WDVA 3OJBA 4NR1A 4MOAA 4DY3A 1M4WA 3BN6A 4GQ7A 4WM7A 5BNNC 3B01A 3PMSA 1SFYA 1MS8A 1SCRA 3MYXA 2YU2A 4KWJA 2HWF2 4Q2FA 5HPOA 4XETA 1KJLA 1VE0A 4P9LA 2FQPA 2WA3A 5F39A 1BEV2 1FV3A 2ZA9A 3DF0A 4LIVA 4P00B 1AL23 2YB7A 4ZS3A 1J1LA 2YBKA 3VKMA 3IAPA 4RYDA 4NPLA 1ZBE3 1QQP1 5I0DA 4IE7A 4HK9A 2X8KA 3CQOA 4HSJA 1FI2A 2DCYA 4XJ8A 4FAHA 3ZDVA 1OMIA 1UZWA 4PI0A 3RDIA 2RJ2A 5F7UA 4UFIA 4WZFA 3E97A 3FWEA 4NIIA 2WQZC 3H0OA 2VBBA 4MGYE 4AQTA 1REEA 4QPGB 4A45A 3VBOA 2DUQA 1W06A 1MZ5A 5A7PA 3CNAA 1W6MB 3LFIA 4QKNA 4QX8A 2NLRA 1DG6A 3ZN6B 2CWSA 2ZGUA 2VUJA 1H8TA 4CCLA 4HZFA 2UYBA 5EYYA 1RMU3 2A3XA 3MW3A 1H1IA 2XJPA 1RUI2 1UKGA 1J84A 5FUIA 1Z7S1 3SH4A 3U11A 3ZR5A 5A80A 2WUHA 3IN9A 5FZIA 3RMYA 3ZXFA 2HEWF 2IFWA 1VMJA 2XJRA 5JIAA 4A3ZA 4QPGC 2CGPA 1VRH2 4D94A 2A6VA 2WS92 3LDRA 4I3GA 5FMCA 3KZ4C 3BI3A 1QY4A 3L2YA 4JV4A 2RV9A 1UU6A 3VHOA 2B9VA 4FFGA 1AX1A 3AP9A 5FRAA 1YIFA 2RR13 3GDBA 3OD0A 4GH4B 1GP5A 4HKWA 4O7XA 2B7YA 2JDPA 4KNCA 4QB6A 3WF3A 3KS7A 4ZHNA 4Q5OA 3N9OA 4Q4V3 1XU1A 1PM4A 3KF5A 1FOD2 5FYVA 4KWUA 4CEWA 1WW5A 5GZEA 3UKNA 5AVPA 1AL21 1GZWA 1US3A 4HK8A 1C8M2 3J7NA 3ZFEA 5JOXA 2Q0AA 3I49A 1UZYA 4N43B 1EP0A 1QJFA 4PLOA 1WKYA 3EJKA 4JGZB 4L8QA 2QUOA 5FZ7A 2HWE2 1IPJA 3ATGA 1ND2A 1BHGA 2XKOA 1ODMA 2PYTA 4UFJA 1F9KA 2XR4A 4V2WA 1GP4A 1YJLA 2R042 2JDAA 4UI9L 5FYYA 5LA1A 4FFIA 1NE4A 2G19A 3WF0A 2NYYA 4M3CA 4MVTA 1RUNA 1TVGA 1RXGA 5F3CA 4AI2A 4OQ9A 5FZ4A 1O59A 3DUIA 5TSWA 3ZYFA 4N43C 5DDJ1 3JUUA 4JGZC 5E89A 1UZVA 5FKCA 4B1MA 3H8RA 1RMU1 1NKGA 3OYWB 4IE4A 1UXZA 3BTYA 4R9DA 5HXMA 1LOFC 2X10A 5GZFA 4R9AA 1ENRA 1LNSA 2O1QA 2C9KA 1WLWA 2RS13 1V0AA 4FP3A 2F6BA 1W8ZA 1K45A 1ND3A 3MF9A 5HV4A 1DCSA 1H2LA 1F4HA 1MS9A 1HIXA 1W0PA 5F8PA 3BOPA 4R9CA 4SLIA 2ZGSA 5CBLA 2BNMA 3H1MA 3OBTA 4HL0A 1CR7A 2HEYF 4QPWA 3PHMA 2Y6HA 3GNEA 4Q4V1 3SITA 2TUNA 4OHYA 3POBA 2BU9A 1NA1C 3AZWA 1PGW1 4XILA 2PHUA 2VGDA 1WD4A 1J3PA 1YWKA 3GCWA 1PIV2 4OLLA 1IKQA 3WW4A 1RUD3 3E6DA 3ILRA 2E31A 4TYSA 3I2IA 5CKMA 4AHWA 4Q4Y2 1HXS3 4BQ2A 3AL5A 2RM23 4CCKA 4YM2A 4UBGA 3TEXA 1F5FA 1ZZ8A 2VCBA 3ZXLA 4LULA 4UT5A 4IETA 1LRHA 3VD5A 1COV2 2WA4A 1HKDA 3N3HA 2E7TA 2WAOA 3ZFGA 5FY0A 2FZ2A 5A6XA 5EJ1B 4E8DA 3GHMA 4YVWA 4K40A 4A4AA 4K8RB 4YW6A 5A7SA 3FUOA 2XHNA 5F37A 2PHLA 4CUGA 2HEVF 3FLTA 3T1LA 4CCCA 1V6JA 2Z79A 1H1AA 2XJVA 5FBZA 4CDWA 3U37A 4RGKA 3FMGA 2OPKA 1IQAA 3MICA 2RS11 3CO2A 2AREA 3ETPA 1JMUB 4ZU4A 4GMP3 4JKMA 4QHBA 3VDBA 1BYHA 3VD7A 4CDUA 3ACFA 3V65A 2DDUA 1W6PB 1VBC2 3EMRA 1HV0A 2NN8A 2VNOA 4G3YC 2NZ9A 4PBPA 1J3QA 4XCBA 3FFZA 3ZOIA 1W8FA 1WCQA 1JI6A 3FBMA 3J7LA 2LROA 4Q8KA 3ACLA 5DUWA 5FY4A 1JN2P 3K77A 4EROA 3ZVXA 4AFCA 1RITA 2UWBA 3N7MA 3N7LA 5FXVA 4LTAA 2E6VA 5DABA 1R1ZA 2ZGKA 2XONA 1A8MA 3SC7X 1RUD1 3B9CA 4TZDA 3TNQA 3GZAA 4LHKA 1HXS1 1LECA 4M3CE 3E5UA 1UNBA 3PVOA 1SLLA 4XUTA 2RM21 2VCCA 2WO2A 2VAUA 3LGRA 2A6YA 2FCTA 3MFCA 3DYOA 4XFAA 5FTTC 1CJDA 1WMEA 3AXEA 4BISA 4OCTA 1S0IA 3KF3A 1TQ5A 2WFPA 3CDZB 2DFCA 2P5BA 5FZEA 2FDGA 5LATA 4K20A 3POFA 5K9YA 5ACA2 5EWSA 3CJIB 2B4KA 3OEBA 4UWDA 1GP6A 1ULPA 1ZVFA 4KGQA 1X8EA 1N1VA 4OI0A 1PO22 3Q9OA 2AENA 4I3PA 4WVZA 4B29A 4B7EA 4I01A 4YG6A 1QJU3 2D6PA 3CZUA 2V72A 4LIUA 3WD5A 1S0DA 3BUCA 5DUUA 2VW2A 3U10A 4NAMA 4CVUA 3ZYRA 4GMP1 4ZKTB 1Z0HA 5FP3A 2OYZA 4BE3A 4DB5A 4RSUA 4BQ1A 1BK1A 3CJIC 1ZRCA 3K75B 3UK9A 3T2TA 1RGSA 3IDCB 3KMHA 2WT0A 3USUB 2CGOA 2W46A 1OVSA 3KSCA 4C91A 1B35A 1UOGA 4CYDA 4XJ9A 1I6XA 5A7WB 4QX2A 3H1WA 2OQ6A 4BCUA 1Q43A 4YARA 1GLHA 1XYOA 2ORZA 1MEC2 2W1UA 4IV3B 5F3EA 5LBCA 3VLBB 1MVQA 1YQ8A 4I2OA 3WNXA 3NRUA 2VZOA 2A73B 1VMHA 1UZZA 3ASIA 3BU0A 1RHI2 1YQCA 3DYMA 1UY0A 3NQHA 2JDNA 2XPJA 2BFUS 4IEZA 4Y24A 1ZZ6A 3B93A 3AMMA 5DAQA 2J42A 1ULGA 5JDBA 2EXIA 2VQ0A 4LO7A 3NO8A 2OIIA 1QEXA 2D98A 4M00A 4AVTA 4AAPA 4IV3C 2VMFA 4HLTA 1AR72 2A6XA 3IBMA 3P3NA 3PUHA 2UWCA 4XAEA 4XTMA 1CAUB 4YFWA 4YZ1A 3GZEA 3W58A 2JG9B 5FO9B 2XGXA 3AZYA 1E5SA 4KG0A 1SCSA 4Q4X3 5KHJA 3GM8A 3AFGA 2AACA 2PLV2 2CGNA 1QJU1 1CGPA 4LLFA 2RVAA 1ODNA 2Q4SA 3VDCA 3PUQA 3IDEA 5FWEA 2Q5TA 3E6BA 4JKKA 5E88A 4CCNA 4XDQA 1AXKA 2BNNA 3UYJA 3O1TA 1CZTA 2LS6A 1SDDB 1OI6A 3WLUA 1HDKA 1LGNA 2FCVA 3VKOA 1GU3A 1UOJA 1O7FA 2JG9C 3IPVA 3MFAA 3WP3A 4CDQA 2BPA2 5CEHA 1WMDA 5A33A 4EE2A 2VQTA 2VD7A 2Y6FA 4QQ2A 4CU8A 4IEVA 1JW6A 5FR3A 1X9PA 2GH2A 1VBD3 5C5TA 4ZPIA 1OC1A 3S5AA 4LUMA 3HD8B 1A78A 3WQBA 4XQWA 5J36A 3UGGA 1W9SA 1EV13 2QDRA 3ZKYA 3NNFA 5FFOC 3BPZA 2WAAA 2JE9A 2XHKA 3A0KA 2FMDA 3PIGA 4QT6A 3AX4A 2BWAA 4LHLA 1GQHA 3J7HA 4QHOA 3OGRA 2VMGA 5IW0A 3THPA 4AAXA 2IVJA 2WT2A 4EZHA 1D4M3 2D6NA 4ONUA 1YLLA 4DRVA 2ZX1A 1CQ9A 1YFXA 5ANNA 3ACIA 4FPYA 4J6GA 1QJX3 2BNOA 1GOFA 2ILMA 4GZ9A 2XVLA 3LFMA 2VOVA 4Q4X1 2R062 5L36A 3T0AA 5DN2A 1W8TA 4B4PA 2HWB3 3H8UA 3VBRB 2FDHA 2QTWB 4UYBA 1AR93 4W6WA 4CDXB 4I02A 5KC5A 2W94A 4BQYA 2PTMA 1POV0 3TEWA 1IOAA 2XBO1 1S1AA 3VHRA 3X29B 5F32A 1NCQB 4C0HA 4HG6B 4XJWA 1FMD3 2WZR2 5FY1A 1XNBA 3MPBA 5LA2A 1UKRA 1QJY3 4RD7A 4YW1A 1VBD1 3DN7A 2VZTA 4R4ZA 4CDXC 3WNMA 2BDRA 3OPWA 3ZN5A 1IG0A 2WL1A 5T55A 5FZ3A 2PAKA 3O0VA 1HB4A 2VE1A 2D3RA 4H3WA 4AHZA 4CSWA 1UPIA 5HBAA 4MGTA 1NCQC 4W50A 4NHKA 1NXD1 4WVMB 4LUKA 1DZQA 2VBPA 1PZ8A 3KWVA 3QOPA 4QXKA 2QQVA 3WINE 4B4QA 4CCJA 3WVJA 4N90A 4DRRA 5FUPA 1LGCA 4UFMA 1Y9MA 4QXHA 2H0VA 1D4M1 4KL1A 4TLFA 4NMIA 3AJYA 5C9AB 5A32A 1XYNA 1YIPA 1ASJ2 2CHHA 5FO8B 4CCDA 4LK6A 3UGFA 4IEXA 3AMPA 3KCYA 2WNEA 3BU7A 3U14A 1RUH2 1W9WA 4FTBA 2HKXA 4PIZA 1V00A 4LA2A 2XLAA 2HWB1 2NM1A 2WABA 2XJSA 3BYWA 3NNLA 2A3WA 1CAXB 1PM7A 4LO6B 5F3IA 2A5ZA 1AR91 5JSOA 1G8WA 4K21A 5L9BA 5GLUA 4EZ4A 2VMHA 1OPOA 3VBHA 5BYNA 4YZ3A 2GAUA 5C9AC 5F5IA 3E6CC 1VLNA 4YFZA 3POJA 1G9BA 2ZGRA 3NJVA 4UFKA 4XPVA 5K0UA 5FYCA 5IVCA 1EYBA 2R0HA 2XB6C 1FMD1 1N47A 5GZCA 2JD9A 1QJY1 3QD6A 4RHV3 4D7SA 1ZZBA 2CU5A 5FZHA 3BPSA 4UF0A 5H9QA 1BMV1 1IS6A 1YJKA 2RS53 2XJQA 5H9PA 1DYKA 4FPEA 2BEOA 3U07A 5FK7A 5EFUA 4QU1A 1PGL1 4PQ9A 4MYEA 4LQRA 4BMEA 5EV7A 1U12A 1SQ4A 1VBA1 4BK5A 5J7MA 4MXWB 3FHQA 5JVVA 1AJKA 1SFNA 4IE0A 2Y34A 4Z92B 3VL8A 2PXJA 1DZTA 2C0ZA 4EJRA 1ZBE2 1W8WA 1O3QA 2PQQA 2IXIA 3JD72 3WOGA 3FN9A 1APNA 1IQDC 2VUDA 4FO9A 1PO13 1W6NB 4HVRA 4QWNA 4XE9A 3ZXDA 4D7TA 1JTZX 4QX5A 1C28A 2YXSA 2JDMA 2D6LX 2K2SA 2Y33A 2D93A 4IV1B 3RWNA 5CAZA 5KXEA 4HVQA 2Q1FA 1W0OA 2JXAA 3APBA 5LW9A 5FLHA 3IWZA 4BU2A 2E26A 2JDZA 3MI8A 5C3QA 1J58A 5JWPA 4RA0A 1UMZA 3T30A 5L73A 4TXWA 3DEMA 1C57A 2ORXA 2XLGA 3T1MA 1H8VA 1WW6A 1AR83 1F5JA 3K3NA 4B3NA 3AZXA 5JZGA 4IV1C 4AEMA 4YSFA 4P9GA 3WUDA 4W4ZA 3E5XA 3UJQA 4RHV1 1AF9A 1R093 4M4PA 4CCMA 2VOKA 3IMNA 3M2MA 3RWKX 3A7QA 4FI9A 5LA0A 3TEYA 4LEJA 2Y64A 1MQTC 1LU2A 1AZDA 1OH3A 2RR12 1C1LA 2A6WA 2VZQA 3JBG2 4P9IA 3THTA 2LTNA 3ZSKA 1OKOA 5IAVA 2RMU3 5H9SA 3VBSA 5IK7A 1GQGA 5H9RA 5L19A 1D4VB 1WCDJ 1U5ZA 2WNUA 1PK6B 5IUQA 1HQNA 5CFCB 4K3UA 4E4SA 2PHWA 3R4DB 1RVF3 3ORJA 2J7MA 3RZKA 1ULEA 2C1FA 4KBZA 2AGSA 3OUIA 4HSLA 1NZCA 2VL4A 1HJFA 2LUWA 1PO11 3PIJA 3ZFFA 4CP0A 1ULOA 2P3YA 5A3TA 2D7FA 4YW7A 1PNFA 1LU1A 5GLTA 2ZPXA 1HV1A 1VBB2 3C7EA 1PK6C 5CFCC 4E27A 5JSPA 1MZFA 5LEKA 5I0UA 4AFBA 3S6PA 1NCRA 5DAVA 1M06G 5BUVA 4N9IA 4AWDA 3J8F2 4XEZA 1G9FA 4AEDB 4AHXA 4AVAA 4FPJA 3CL1A 4M0HA 4CEYB 5GZGA 2VTXJ 1UMIA 1I1EA 4AFDA 1UX7A 2ZZJA 2AC1A 3O1VA 1TMF3 1DYOA 4EN8B 5IYYA 1R091 3OGJA 1LOEA 3Q8BA 1PHMA 4J1WA 4LKEA 2CAUA 2ZBJA 1S4CA 3N7KA 4CP1A 3DXUA 2X5IA 3L2HA 5J09A 1K5MA 1PVXA 1QIQA 4O61A 5FZ6A 5FY7A 5GLVA 3ZSLA 2HWD3 4AEDC 4DOUA 4E8CA 3VBUA 2RMU1 3LQCA 4V2VA 4CEYC 3RZJA 1O4YA 2KA3A 1AYM2 2R30A 1YQ5A 2R16A 2RS33 2ZMNA 4EN6B 2YGMA 1KXGA 5DXDA 1YFYA 2CNAA 5FOBB 1RVF1 3MIBA 3OY8B 3FFQA 2GNDA 4C0BA 3C8XA 4EN9B 3VKFC 4COUA 2VOWA 4WM8B 5I8TA 4ASLA 3B94A 4OHZA 3WR0A 1JOJA 1GANA 4D0QA 5J48A 2FHRA 3LIHA 3POYA 1CIWA 2HBTA 4PDWB 3ME2A 2JB8A 3LPFA 3KT7A 2BRTA 4K1ZA 4AVCA 5IVJA 2TNFA 5L9RA 4N8MA 4WM7B 3S57A 2DUOA 1ZRRA 3GJAA 4MV2A 1OUSA 1DBNA 4MGIE 4FOQA 4WVWA 3SLIA 3WT3A 5BNOA 5EP9A 1SG3A 4WM8C 1QHDA 3VUOA 2W0XA 1U5XA 1MS1A 1W04A 2ZHMA 3IZOA 1GWMA 4HANA 2Q30A 4OFGA 1XNAA 1C5IA 1F35A 4PDWC 2WYFA 1V70A 2I07B 1TMF1 2DV9A 3WF1A 4WM7C 4IESA 2AH2A 1FT9A 1BKZA 4B1LA 3WQ7A 2YPDA 1JZ8A 4HONA 4AGRA 1OOPA 2WN2A 2WINB 5JSRA 5F1RA 2OQ7A 4AHYA 1RUJ3 4R52A 4HXCA 4AOCA 3HBKA 4GWNA 1DLLA 1SHWB 2DURA 2RS31 1CVNA 1OA2A 1UX6A 2J1SA 2GC1A 3BGAA 3IIAA 3L9JT 3MLKA 1HB3A 4YZ2A 4NHYA 1WBLA 2K0GA 3LKJA 2VO5A 1DIWA 3KT1A 1W0NA 2WNOA 4N7IA 2EAAA 5FYUA 2UWAA 2WQ4A 3K51A 1O3TA 1H2KA 1RUF3 2E32A 4COYA 4Q0SA 1JZ2A 1W8NA 3BIEA 1JYXA 3ABZA 4NAOA 5FZ9A 2CY6A 5FYZA 1W2NA 2VZ1A 3NVCA 1FNYA 4QU2A 1TG7A 1WMFA 5C6CA 5IJRA 3ELNA 3FJSA 2GMMA 4NROA 2E7QA 2AUYA 2WZ8A 5I0SA 4FXGB 3RJRA 3ZO0B 4PIYA 1XNTA 3V0AB 2ZX4A 1W6OA 1J3RA 1RYYA 3CU7A 1CWPA 5C33A 2KD7A 5SV8A 4OVEA 3AM2A 2VXRA 4L99A 5B4XA 3WDXA 2VU9A 4YVSB 2EALA 2OVUA 2FDFA 2IXKA 4YW4A 2P17A 3VDDC 3OGSA 3DECA 1A8DA 1LENA 1HQLA 3MIGA 4PHZA 1NXMA 4G9SB 4Z2WA 5FZKA 2QDNA 1H6YA 1R1A3 5L7OB 2QQPA 4P5HA 1RUJ1 5T5LA 1N1SA 5LWBA 4RQPA 2X53S 4YVSC 4QGMA 5M0TA 5AC93 4M3CB 3VZNA 1CAVA 1SFPA 5T52A 1SBEA 1NLSA 3I3QA 3WEZA 4CA9A 1DQ4A 3CLPA 3Q8AA 4HBNA 4INDA 4FOYA 3WHUA 3KT4A 4XDOA 1TZOA 1REFA 1WZXA 4LBMA 4OULA 3VD3A 4DFSA 1ALYA 3N36A 3CIHA 1PX3A 1ZBA1 2AEZA 2YBSA 3WDYA 5IVBA 4RR3A 5L7OC 1RUF1 3PJQA 3WG1A 4AQ6A 3E5QA 5HCBA 3F95A 2ARBA 4LKSA 5DDJ3 4LOSA 5FQ0A 3NJZA 1H2NA 5FP4A 4CCEA 2CDOA 1W05A 4Y1VA 1XE7A 4XHXA 2W87A 1QNWA 2VECA 4QB2A 5A7QA 4ZU7A 4FTSA 3K48A 2XH6A 4Y33A 2E7AA 2I74A 5IK5A 5A6ZA 5FBJA 4QPIA 3K2OA 3VB9A 2WKKA 5FYIA 3WP6A 3H8OA 1H6XA 1CD3G 3HNYM 2LW8A 1LHVA 1O6UA 3U78A 4GWIA 1AYN2 4LO4B 4Y5SA 4BJ0A 3SKJE 1AX0A 3C7HA 3IDAA 4QQLA 1UF2C 2BWCA 2IXCA 3NW4A 2MHFA 3CZJA 2FZ1A 5I91A 5DUVA 1LGBA 1N1TA 5GM0A 2VW0A 3BKZA 3ECQA 3A4UA 4QD2A 2VVDA 3OSDA 3H8XA 1OA4A 3GBWA 3WNNA 4DNYA 1BBT2 1L3JA 3ALQA 4Q4W2 1R1A1 5CU1A 4CU6A 2QE3A 4W6YA 3CHXA 5BNNA 3DKQA 2Q8DA 2EXHA 4QKDA 4BXSV 2Q8EA 5AC91 1AR62 3USSA 1IG3A 2YFZA 3DXTA 4GH4C 3VBFB 2Z42A 3ZN4A 4BLIA 2ETEA 2WO7A 1WLDA 4BHPA 4XYXA 3RG0A 1E5RA 1T2XA 2ERFA 4AE2A 4AG4A 2YV8A 1EV12 1KD7A 1QJZA 2JE7A 1NUKA 5AVAA 4GB33 4ZY9A 4Q1PA 3LA7A 1NLRA 1RUOA 3UKTA 3Q8CA 4ARXA 3LOBA 3SH3A 4H2AA 4XDPA 2ZGTA 3RSJA 2D43A 2DCJA 3HVDA 3VBFC 1LB2A 4A44A 1OLQA 3MW2A 2KM2A 5E16A 2N7GA 2Y60A 4LHNA 5FPBA 3FLPA 2PHRA 4LOTA 4NPRA 5IK8A 4NIHA 1XU2A 1EPZA 2CTVA 2RG4A 3PURA 2HYKA 4P08A 3F2ZA 2PELA 1QJX2 1US2A 2EA7A 1IS4A 3SISA 4L0PA 4XF0A 2VTFA 1QH6A 2YC2A 3PMEA 1U0AA 4BYYA 4MH0E 2OKXA 4DY5A 2FDIA 3INAA 2QQJA 1UYPA 4J1XA 1I5PA 2ZEXA 4H55A 1DGRA 2RJLA 4NPMA 5GALA 4QPGA 4QX7A 4CTEA 3RQ0A 3O1UA 2G9ZA 4FSJA 5IVYA 3OGGA 3KLSA 1Q56A 1OQ1A 2HH9A 3GHNA 4XHBA 1ZRIA 5DPNA 3SHRA 1ZRDA 2D40A 3C7FA 1HRI3 3D3AA 1PMIA 1S2BA 1WGPA 1LOGA 3AMNA 2PAEA 1KJRA 1NG0A 4XIKA 2ADDA 3IIIA 1OF3A 1TME2 1DGLA 4KWKA 3W5MA 1KEXA 4M4RA 1OBNA 1DZRA 1GNYA 2B5HA 4AVBA 1IPSA 1KRIA 1UZ0A 2QQIA 4OMDA 1WA6X 2AEYA 4O9EA 1QXPA 3LF7A 4JRLA 1HJGA 4GB31 2PMWB 3RZZA 3W59A 3OBRA 4XQDA 2JDKA 5J37A 3NMBA 4S2DA 3KB5A 4XOGA 2XUEA 1DHKB 1O4TA 1XC6A 1FPN3 2BV4A 3OTFA 4Y26A 3TN93 3DPRA 3UNPA 1RUG2 2VVFA 4NVPA 1J1TA 2BW8A 3U1XA 1DQ5A 1ZX5A 3A23A 4KWLA 2Q1MA 2D6OX 3S30A 4EQVA 3ZKUA 1UU4A 1PZ9A 3V0BB 2R073 1IS3A 1F15A 1XBFA 2JIGA 4IEPA 4M3CF 3WP5A 1WCSA 5JAXA 2DF7A 3EB7A 5JXHA 2VCMA 1PNGA 4JGZA 1KS4A 1FX5A 4YZ4A 3T0DA 3ZYPA 2XL7A 1C1FA 5EJZB 2ZCWA 2IZWA 2WO3A 1LOFA 4HKOA 3WZ1A 2XUMA 3WW1A 1NY72 1MS4A 2VNGA 1R083 4HN1A 4HOOA 1ULCA 1Q8VA 4XZUG 1G9DA 2Y6LA 4NOTA 1RUC3 2MEV3 1WW7A 2QZ2A 4MGQA 1E5IA 1OLMA 1H4HA 3OOXA 4QQHA 5FJHA 3ROUA 1VB4A 5T5OA 3RJ2X 2IXLA 2J1EA 1HRI1 2JE8A 3ENRA 3GF6A 3AJZA 5A70A 3HN1A 4FPGA 5L9VA 4XFFA 5C8WA 1BVP1 1U5IA 2QVSB 3SNMA 3I2HA 4E4DX 2VZPA 2XVGA 2QCSB 3JCIA 4XMIA 3D0JA 2RS52 2BGPA 4LBQB 1NA1A 5KR7A 1W99A 4UW3A 4IXLA 4R9BA 1EAH3 4F3JA 5IK4A 5LEJA 5IT6A 2XMLA 2C6SA 5FZCA 1HB2A 4BM8A 3CKHA 3EQEA 3C7GA 2BQPA 5C71A 1N3OA 3LAGA 3TN91 1CX4A 5FCCA 1FPN1 2C5DA 3CF6E 5J1XA 1JHJA 4JGYB 2DU0A 2V5YA 4L11A 1NE6A 3W20A 2QBXA 1RC6A 1F2NA 2EIEA 2GDFA 3VZLA 4QPYA 3AYDA 5A33B 1POV3 4XF9A 2R071 2G9FA 5A3WA 1T6BX 2D6KA 2JENA 5A6QA 2IVIB 4R8HA 1GOHA 2P3JA 3BTXA 1BXHA 3RRDA 1V9U2 1VPHA 1OH4A 1UYYA 3NAPA 5FPZA 1S0JA 5BXXA 1ZNPA 3VZOA 1SPPA 3LEIA 3RYKA 5DAPA 5CFDB 4CE8A 3N9NA 3FHIB 5FZ1A 4JGYC 3I3DA 3WW3A 2HBUA 2R49A 1R081 4BH9A 3RZLA 1RUC1 2MEV1 3TOJA 2WFF2 2UY8A 3MEPA 4CU9A 3PUSA 3KGZA 1AR82 5APAA 4CXXA 4BQWA 4X8NA 1SMVA 3PVBB 5BY5A 2BZDA 3P6BA 3UV9A 3TEZA 1GQPA 2QQKA 1W90A 4Y3OA 1WW4A 4XF3A 5CFDC 5FP9A 2FMYA 1RUE2 5LY1A 2DU1A 3FE5A 4JKLA 4PLMA 1OD3A 2YY1A 4ZU5A 1JYVA 3IM0A 5E8AA 1EAH1 3M3OA 1UXXX 1Q8OA 4DUXA 1HLCA 1QXRA 2QNKA 1K12A 1ZYBA 4LE4A 1VAMA 2QQWA 5DMYA 4MGSA 4YWAA 1LHOA 2KXLA 5C5UA 4OUEA 1E57A 2JKBA 4QHZA 2A71A 1WUVA 1HB1A 2OPWA 3H42B 4ET7A 3BB6A 3OUHA 3WG4A 4GWMA 2NMNA 1POV1 4GULA 4FQZA 3N7JA 1LOBA 4NJ4A 3RYRA 5KC6A 1U5YA 4XW3A 3SMHA 2CDPA 3WCSA 2PA7A 4AW7A 3KV4A 1RUI3 1KQRA 3WW2A 4A6OA 2XBO3 5JOYA 2C4XA 5DG1A 1HN1A 1KITA 1CN1A 3NL1A 5FXZA 4AF9A 2GNTA 2R1BA 1VRH3 2OS2A 2WS93 3O1RA 5FZ8A 4Y22A 2Y38A 2KR2A 5E1RA 4ZXKA 2BBVA 3H50A 4ZXEA 4NRMA 3RYPA 2J1UA 4PJYA 4Q29A 4UW6A 4Y20B 3AYAA 1XPWA 2B39A 1Y9QA 3JXSA 3CJIA 4C90A 1G9AA 1V6MA 5IATA 4XUQA 2D3PA 3D82A 4Y1YA 1JU4A 1TMF2 4XBQA 1YCIA 3O1OA 1JU3A 4A3XA 4QX1A 4ZS2A 4CP2A 2EVXA 3SCGA 1FOD3 4Q27A 1BEV1 1Q8QA 2PAMA 4LHSA 3WDWA 3ZSMA 1V6LA 2YUEA 1QDOA 3DCQA 3HNBM 1Z78A 3JB8A 3B7MA 2HWD2 2ID4A 2XJTA 3BTAA 3PUIA 3S7EA 3THDA 4BXFA 1VBE2 3MW4A 4N53B 1AJOA 2P3IA 4LBNA 3UETA 4QAWA 2HWE3 4XVHA 3RZGA 2RS32 4XQ4A 5F2SA 3AKTA 3PDQA 4JQRA 5GKAC 4A7ZA 3USUA 1LKNA 4DPNA 2ZX2A 2R043 4LO5B 1TE1B 3T4VA 4LLOA 4LBQD 4YZ5A 3WV6A 1VJ2A 2W9XA 2WNVB 5FZDA 5LRRA 5BNQA 3AK0A 3SEPA 5I0RA 2WZEA 1OXCA 1O5LA 4N53C 3WP4A 3CJXA 4COZA 3JZVA 3I3MA 1RUI1 1HX6A 4GA9A 3HIFA 1CZSA 2XWJB 1VRH1 2WS91 4FXKB 5FWJA 1YO8A 2WNVC 4QMAA 2PFWA 1DQ6A 4OUMA 2DTWA 3CBNA 3KQ4B 3VBRC 1JOPA 1JYIA 1UMHA 1HRV3 1CAUA 2WT1A 3PTYA 4W8JA 2ZGPA 1LTEA 4RFT0 1S0BA 2Q1ZB 2JWPA 1Q8SA 4PBOA 3MLLA 3VV1A 4I30A 1VP6A 4D69A 3I4IA 4AQSA 1FOD1 3GBGA 2ZKLA 5EZWA 5JMOA 4G4FA 1VBA3 1YQ2A 5FYBA 3VGIA 1C8M1 2E51A 1WCUA 1C8NA 4XUNA 5EPAA 4MX3A 1PIV3 3H7JA 5ABJB 1OHFA 2ZGNA 2ZX0A 4U2AA 2VNRA 1DYPA 1QQP2 4Q4Y3 2HWE1 1F8VA 4FPLA 1H4GA 1YNAA 4H14A 4IGQA 2J1AA 3VZJA 4AFAA 2R041 2A1XA 2W1SA 4E4ZA 1CAWA 1TNRA 4MO3M 1NZIA 4JDOA 4DXSA 1COV3 5I8SA 4L97A 3ZSEA 1W3VA 3D4KA 4LBKA 4CP9B 2VG9A 5FXXA 5ABJC 2C26A 2O8QA 4BDVB 5C3RA 4IW3A 4AQ2A 4UOJA 4D6QA 2CWMA 1QF3A 4C1XA 1MS3A 1Z7S2 2YYOA 2NMOA 1QKQA 5FZOB 3SQOA 5FDBA 1SLBA 4P9JA 5KBFA 3DYPA 3PVNA 1UN1A 4ITCA 5FPLA 4MSVA 3LD8A 4FFHA 2E53A 3VBSB 1FYUA 1HRV1 5I8YA 3WQ1A 1VBC3 4AR2A 1DP0A 1CIYA 3SH5A 2ARXA 1W2OA 4IEYA 4ZONA 4AVSA 4COWA 2GMPA 5CG9A 2RDRA 4JQTA 1C4RA 1GZ9A 1VALA 1GMMA 2CAVA 4IGOA 3UT0A 3WG3A 1AL22 1ENSA 1PIV1 5FYTA 4DXRA 3IAQA 1X82A 3RI8A 3VBSC 3I2GA 4XACA 1BZWA 3W5NA 1LJ7A 3QH6A 3EXUA 4LA3A 3H1YA 4Q4Y1 5C3SA 3AYCA 4FPOB 1NCQA 4JRAA 1QDCA 1NCRB 1UYXA 4GIQA 1G9CA 2DUPA 4TN7A 3AKQA 4A6SA 3AZVA 3TRSB 4K7JA 3UGHA 1COV1 1XSQA 3OCPA 3T2PA 2ZAHA 3O5SA 4QDSA 2ZGQA 4QM8A 2Z69A 3T09A 4B4RA 5KHGA 2YC4A 2GC2A 3KQRA 4BK4A 4DQAA 5FOJB 5IVFA 5DZFA 3TBDA 4ATFA 5FXWA 1WWYA 4OYUA 3AC0A 3A0NA 3OBAA 2W1WA 4FOWA 4HPKB 5DDJ2 5J98B 1RMU2 3LOIA 5SV5A 1PO23 4Q0PA 1NCRC 4E2SA 4DUVA 4WVMA 2BGCA 4RFRB 2BP6A 3JU9A 2X5IB 3ZIWA 2X09A 1WA4A 2JEMA 2Z5WA 4UAPA 1I9RA 4MHUA 3SCHA 1MZ6A 5FLIA 1OA3A 1SDWA 3H3ZA 5JR7B 4QDQA 1JZ5A 5CA6A 5C9AA 2ZGLA 1DQ0A 4UFHA 1VBC1 4QXBA 3ETQA 2ZHLA 1QMJA 5D8AA 4OI1A 1DF0A 1W2AX 3QCWA 2G4IA 3DL3A 3LZZA 3I59B 2X5IC 1OQEA 2BGOA 4Q4V2 3RPQA 4K8FA 4UBHA 1FXZA 1MEC3 4X6QB 4LK7A 4LKDA 1PGW2 1CAXA 3QBQA 3W9AA 3WSOA 1RHI3 4JCKA 1YI9A 1L7QA 4EN7B 4JVAA 2AR6A 1MPXA 2AZ5A 1W6QA 4JHZA 5F2WA 4DO0A 1W9FA 4LXLA 2OUJA 3CEWA 2RJKA 2ZX3A 4LNVA 1Y43B 2W47A 4Q1RA 5HV0A 2RHPA
chains in the Genus database with same CATH topology
4A2UA 4AI3A 2D5HA 2LALA 1AR73 1WLTA 2W68A 5BNPB 4UW5A 1ZZ7A 1FV2A 3POWA 4YW2A 3WQ0A 1N3QA 2BVBA 2MPFA 1PO21 1XNKA 1SLTA 4P9XA 2PLV3 1QXJA 1IPKA 4GKYA 2DWRA 1O4ZA 2RS12 1MR5A 3O0WA 4ES9A 5BPXA 5JLVA 1LHUA 3MIHA 5BNPC 5F9TA 1ZREA 1QWRA 4YW5A 1W6NA 4UXAA 4RGAA 4X6RB 4BPZA 3WDUA 2GC3A 4OI4A 3BALA 1W39A 4LBLA 4I09A 1MEC1 3NKGA 4QM9A 2X29A 2NQYA 1RHI1 1HRI2 1RUD2 3WUCA 1MQTA 2WLPA 1HXS2 2EF6A 1GBGA 2RM22 5C4WB 4K1YA 5JIUA 2D5FA 4H7LA 1Y3TA 2O0OA 2JG8B 2IC1A 1AR71 5D1IA 4LT5A 4D3WA 3EO6A 4YGEA 2OA2A 4AEJA 4HN0A 1UIKA 2R063 3LCPA 2OW4A 5C4WC 3UL2A 2PLV1 1FATA 3RS6A 4TWTA 2YGLA 2JG8C 1PK6A 1GNHA 2BFUL 3P3PA 3R6SA 3ES4A 5FLJA 3ES1A 5F6LB 1ULDA 5J3UA 1OFSA 3R05A 1OD5A 4RQPB 2VULA 5A3MA 1ZZ9A 5CIRA 1CAVB 2WSUA 3ZX7A 1H1MA 2RE9A 2WZR3 4BA6A 1LCLA 5FPXA 3VZMA 2JJ6A 3VBOB 5CADA 5CNAA 4Y5Z0 1RUC2 4XBLA 1V6IA 4RQPC 5FQ0B 1H8TB 1ENXA 3ILFA 4E2GA 4URTA 3AFKA 2ZOEB 1ZBA3 3DGTA 1CONA 3QLQA 1GNZA 2ENRA 4F83A 3NKTA 3M7AA 2XWBB 3VBOC 4A7KA 2ES3A 5T5PA 1EPWA 1YRZA 3B00A 5T54A 5HCAA 1ASJ3 4YG3A 4GXLA 1H8TC 4H7MA 2YC0A 2Q8OA 2BUKA 1VAKA 2R061 3HR9A 3MIEA 3VKNA 1QOOA 2O8OA 1RUH3 1X8MA 4CEWB 1QJU2 3I54A 1GZWB 2I2SA 1GSLA 3H3UA 4PF5A 3OY8A 1JUHA 2DVFA 4RS5A 3ZFEB 1WD3A 4AVVA 2FBEA 4WM8A 1VIWB 1ND2B 3B9IA 4OHXA 2WZR1 4M0NA 2ZHNA 4FCAA 3IDBB 4CEWC 4AI1A 3M70A 1V6OA 2G9GA 3KCXA 4ISQA 2B46X 3ZFEC 2EIGA 1JHNA 2SBAA 3MPPG 1GFF2 1FNZA 4I0AA 2PN5A 3PLQA 3BCWA 3FBYA 4QQPA 1MS0A 1ND2C 2GNMA 4ORFA 2DFBA 2D3SA 1UPSA 2DYCA 2H0BA 1O91A 3MF6A 4WZCA 3LA2A 5KHIA 1ND3B 1LESA 1NYWA 4XXPA 3O0XA 5C8CA 2SLIA 2K9ZA 3JD73 3ZSJA 1ASJ1 1SEFA 3LWCA 1PVC3 1RL3A 1D2SA 1S0GA 1LOAA 4EN0A 3PVEA 2Z2SB 3VZKA 5KHHA 4FP2A 4Q4X2 1RUH1 1IS5A 2W52A 4L2NA 3MDPA 4KU8A 2A7AA 1YXWA 1ND3C 1C5HA 5JPNB 2R6QA 3B3QE 2UY9A 2XBO2 3J9SA 2IXHA 1DGWX 3WXPA 3HAGA 3KD4A 1BCXA 2VY0A 5KXBA 4A7YA 5GJ6A 4AYUA 1VBD2 3ZFGB 4YVWB 5DG2A 3VDDA 1SACA 2VW1A 4DINB 1X7NA 3JBG3 3M3EA 1IHMA 3PNAA 2YDEA 3V0AA 2NPIA 2I45A 3DPRB 4C1WA 3MLJA 3UKVA 1QOSA 4CDWB 5LRSA 1CESA 4YVSA 1ZZCA 4F8AA 1KDMA 3ZFGC 4DXZA 4AI8A 4YVWC 1LULA 1ZBE1 1PGSA 3JD71 1D4M2 3ZXKA 4CDUB 5K8SA 1JH5A 1PVC1 3ZPYA 5A3LA 2JICA 3DPRC 4KH9A 4XZPA 5L7OA 2XG3A 4CDWC 1WCKA 4FPHA 2ZGMA 1MZEA 1T6GC 1VBB3 4KGGA 4WBBA 3TYJA 2R0FA 1S0CA 5J96B 4HKLA 1CPNA 1S55A 2ET1A 2HWB2 2ZMKA 1LEMA 2VPVA 1AR92 4CDUC 3J8F3 1TEIA 4XMAA 1W6MA 1H9PA 3ZN6A 3ZXEA 1FMD2 1NA1B 1Q3EA 1N1YA 1QJY2 4YGBA 5FO7B 4EWAA 3DV8A 4KU7A 1HRV2 2TEPA 4RGGA 3MIDA 1BMV2 3GZTB 2RR11 1REDA 3JBG1 3O7OA 2Y26A 4BIFA 4QQOA 2PHTA 4NWVA 1PGL2 4HMZA 2HWC3 1AYM3 3EHKA 1DGWA 4Q0UA 1VBA2 2YZ4A 4GH4A 3S7IA 4Z8BA 3G6JB 3NAPB 2QKDA 3R0RA 4OHVA 4RL7A 1UAIA 1ZA4A 2P2KA 1AVBA 4PLNA 5CB7A 5FMOL 1OQDA 1B35B 1ULFA 4YGDA 4N43A 1VBB1 4L92A 4YM0A 3VBFA 1GV9A 4BOWA 1OSGA 4XIOA 1BJQA 3GALA 2WLQA 2WJSA 3RMXA 4XJAA 1YI7A 3NAPC 3D8CA 3J8F1 4AXOA 1IZ3A 4PIXA 2YPJA 3D5OA 1B35C 2ZHKA 5BV6A 1UIJA 4IQPA 4FQ4A 1GYKA 4MZUA 3ZXAC 3OYWA 4QGLA 4RHV2 2ZGOA 4Q8LA 1O3RA 2GU9A 4R4XA 2WIIB 1G86A 3FC0A 2WWSA 3FLRA 3BODA 4S2FA 5HI0A 1KDKA 1S2KA 1I3HA 2HWC1 2JX9A 1AYM1 3R4SA 3I8TA 1NQDA 1B09A 2WZPP 3J26N 2GH8A 1H2MA 1ENQA 4JC1A 4MXVA 4ATEA 4IL7A 3C2UA 4EV0A 3IPVB 4W65A 2ZKNA 5JI9A 4LBJA 4CDQB 1PO12 3KGLA 4MGKE 3H9AA 2YHJA 2IFRA 4Y22B 1KS5A 2GSYA 1SLCA 3IKWA 3IT8A 5KXDA 5DUXA 4LBOA 1LEDA 1JXNA 4YNIA 3M3CA 4CDQC 1V6KA 1RJ8A 1N3PA 2LM3A 3AMQA 4MGZE 2GN7A 1XE8A 1AHSA 4IEQA 4JTOA 1YHFA 3TWIA 4AEKA 2D97A 5JI7A 2JECA 1XXNA 2HWF3 2P34A 3M3IA 2VH9A 4META 3U0ZA 4JDNA 1R092 2IWGB 1JBCA 3HT1A 4OI2A 4YW3A 4Y1XA 1BEV3 4XFIA 3RNSA 1UW8A 2A75A 1Q5OA 3B5LB 3I7DA 3V0BA 4E9KA 4XFCA 3M1HA 1CPMA 2A3YA 2H6BA 1DFQA 3ZYIB 3M3QA 2RMU2 3R4UA 1QNYA 1W6PA 3HBZA 1UL9A 1VR3A 1AXYA 5HCFA 1SBDA 2UU8A 1RVF2 3KM5A 2VOXA 3VL9A 2XL9A 2UURA 3U4XA 1QGLA 1IKPA 3N35A 4KQ7A 5JMCA 2XJUA 1RJ7A 4D7YA 4HT1T 3ZYJB 3AP7A 3BIWE 4Q26A 1W2UA 5KWRA 4Q0VA 2ET7A 2GMEA 4XFBA 1HW5A 2ZTNA 4LBQA 4NHLA 4HFSA 1H30A 3WG2A 2P37A 1URXA 1WLCA 2EXJA 4JAAA 1AYN3 4XTPA 4Z82A 3WY6A 1G9CA 1DGRN 2P3KA 1EY2A 1LR5A 1JUIA 3AB0A 1XNDA 2HWF1 1DQ2A 3LA3A 2GN3A 1GKBA 3JB4C 2VQAA 4JGYA 4AK3A 5A32B 5KHKA 3FX3A 3OD4A 5F6KA 3POSA 1BBT3 1C8M3 4JTNA 4GMP0 4Q4W3 4Q0QA 4AGGA 1BQPA 1CAWB 3D0SA 2XVKA 1VB2A 3QACA 5HXVA 4CZSA 5AFBA 1AR63 5CG9A 1J59A 5DZEA 1LOCA 1YYNA 4AFMA 5CFDA 3VBHB 4YLZA 1QU0A 3LSEA 4MLOA 1D2QA 2ATFA 2ZZQA 4IV3A 5K0UB 4NWWA 3GBFA 3AZZA 2ZS6B 2XLFA 4YYOA 3KCCA 1I5ZA 4KBBA 4IEWA 3TAYA 1GZCA 3ZXGA 4OZXA 3VN4A 3VBHC 5CVRA 4SBVA 1OPMA 3FZ3A 4I0BA 4K9SA 5K0UC 1GICA 4FVVA 1AYN1 3NV3A 1D0GA 4P14A 2JG9A 1H0BA 2TBVA 2WSVA 4IEOA 2MNGA 1GR3A 5CG8A 1XNCA 4YRDA 2BVVA 3LB9A 2D6MA 3I2DA 4XJUA 5I0TA 3GZUC 3SCFA 1BBT1 4Q4W1 1UD1A 1SBFA 3C3VA 1X36A 1RUJ2 2HJIA 4P9WA 1AR61 5EXOA 1BVVA 1TME3 2QJVA 2WC2A 1LHWA 2EAKA 3VKLA 2AYHA 5B2GB 3ZXJA 3G7DA 4GALA 4NO4A 2V73A 5GLWA 1EV11 5EJ3A 1KFUL 3AKPA 3WX5A 1ZBA2 4Y20A 1G6NA 4Y1ZA 1YFUA 4XFGA 1RUF2 5JZGB 2C9AA 2CV6A 3NV2A 4M01A 1NOVA 3DKWA 1RUG3 3NSTA 4NHMA 2W39A 4XFHA 3AKRA 2ZMLA 4BWOA 2DVGA 3AP4A 2QZ3A 2UYAA 2YROA 2YMZA 1RB8G 4FBFA 5D8AB 1QJX1 3D6EA 2PHXA 5JOWA 4FPFA 5JZGC 3M8LA 4N53A 2GC0A 3BOWA 4DMIA 4ES8A 1S0FA 2WNUB 4L9BA 5FAXA 2QFEA 1Y7BA 2A6ZA 1ZRFA 4LE3A 2CL2A 1W6QB 4Y1UA 1RTVA 2BYVE 2WNVA 5D8AC 4COVA 2CYFA 3HMYA 4XF1A 3VBRA 3ZFFB 4HVOA 1R1A2 4CDXA 1D0HA 5JPMB 2WNUC 1Q8PA 2PHDA 4LO8A 5AC92 1TME1 2ZAAA 3ZDSA 1TNFA 5T50A 3ZYGA 1KFXL 3N4MA 4BLJA 3S0MA 1X33A 3ZFFC 3QH7A 2PHFA 4GKXA 2VUAA 5ACA3 2Y0IA 2B45X 3JQXA 4EWEA 4N7UA 1RUG1 4E2QA 1JYCA 1ONAA 2A70A 3JQWA 1K5MB 1PVC2 2ZJCA 4DZGA 1DQ1A 5ABJA 1NQJA 2BTVC 3VBUB 1V9U3 3ILNA 4CRQA 2DCKA 5LK5A 3MGUA 2VVEA 2IXJA 2B8MA 1AXZA 1NY71 1MQTB 4W6XA 4I0WB 1K5MC 2JD4A 4BMBA 2WFF3 5T3NA 3VBUC 1F31A 4F7ZA 2Y0OA 1OLRA 3AP5A 3AYEA 2DTYA 1X50A 5FMOS 4Y4YA 1RUE3 3AKSA 2RS51 4K6BA 2R32A 5BNOB 1DU3D 3WDTA 3ZIXA 3ZMOA 3LSDA 4OUSA 5ACA1 4FPKA 4FPCA 4GB32 4S2GA 3ZMNA 4YM1A 1MS5A 3ST7A 4IEUA 2OZJA 1AL0G 1WBFA 1O3SA 5BNOC 3URFA 1HQWA 1A6CA 1OOPB 4MXWA 3AP6A 1RIRA 4KG8A 2DVBA 1V9U1 3H7YA 4EWDA 5I93A 3J4UH 1CJPA 3VHPA 4ISRA 3WHTA 2XKPA 3RI9A 5KXCA 4UW4A 2ZABA 4FTBA 2B9UA 2GALA 4P9YA 3WCRA 4DS0A 2E9QA 4IV1A 3MIFA 3TNPB 1OOPC 3HT2A 2WFF1 3B69A 1MACA 1AR81 4MUVA 1YUDA 4YM3A 1V6NA 4BZ4A 4HPKA 4WV8A 4B7KA 3NV1A 5GZDA 1RUE1 3FUQA 1A3KA 4XBNA 4FAGA 1SLIA 3OF1A 3V56A 3V64A 3GYDA 1W6OB 1OKQA 1VBE3 3SXWA 3VHNA 1XRUA 2HWC2 4HETA 5EYXA 2OZ6A 4OHWA 2VMIA 4BIOA 1AUYA 4XF4A 5T5JA 4QGNA 5AFEA 4RS5B 5GLZA 3TN92 1FPN2 2ZACA 4B8EA 2W08A 4XJZA 3I59A 2DCTA 4JDMA 2EXKA 3NWKA 5CFCA 4S2HA 2R072 4WVVA 1O5UA 1UCXA 3B02A 4AI0A 1G7YA 1PZ7A 1UU5A 3MZHA 4RS5C 4Z07A 1OFNA 5LK7B 2GNBA 2R1DA 1C3HA 1XYPA 4TSVA 1R082 2B42B 2MEV2 4RR3B 4X8PA 1LHNA 4V1PA 4YGCA 5BNPA 5K7PA 2NP0A 2D44A 2GZWA 1IGOA 5JOZA 3AXDA 1QH7A 2E63A 4FT8A 4AEDA 5C8CB 2OUHA 1AX2A 4CEYA 3M4FA 4QPIB 1FAYA 2HWD1 1DDLA 4RR3C 1VBE1 1EAH2 4XXAA 3PJYA 2DCZA 1QQP3 3O12A 1YFWA 4PCRA 4FTEA 4U36A 3TB0A 1RINA 2DVAA 1LODA 3O14A 1SLAA 5C8CC 2H6CA 1QOTA 3EBRA 3HWJA 1XQNA 1S0EA 3OPZA 4QPIC 5FREA 5F5QA 4YG0A 4NN0A 2DVDA 3NV4A 4FOVA 5BNNB 1VAVA 4O9GA 5DZGA 4N9HA 2V09A 4ASMB 5JCTA 2F4PA 1Z7S3 4Z1VA 3VDDB 1H9WA 5C4WA 3UJOA 4IERA 4LR4A 4PDWA 1ZM1A 2JG8A 3AMHA 1MVEA 3HQXA 3WDVA 3OJBA 4NR1A 4DY3A 1M4WA 4GQ7A 4WM7A 5BNNC 3B01A 3PMSA 1SFYA 1MS8A 1SCRA 3MYXA 4KWJA 2HWF2 4Q2FA 4XETA 1KJLA 4P9LA 2FQPA 2WA3A 1BEV2 1FV3A 2ZA9A 3DF0A 1AL23 3VKMA 1J1LA 1ZBE3 1QQP1 4HK9A 2X8KA 4HSJA 1FI2A 2DCYA 4XJ8A 4FAHA 1OMIA 3RDIA 4WZFA 3E97A 3FWEA 2WQZC 3H0OA 4MGYE 4AQTA 1REEA 4QPGB 3VBOA 2DUQA 1MZ5A 3CNAA 1W6MB 2NLRA 1DG6A 3ZN6B 2CWSA 2ZGUA 2VUJA 1H8TA 4HZFA 2UYBA 5EYYA 1RMU3 2A3XA 3MW3A 2XJPA 1H1IA 1RUI2 1UKGA 3SH4A 1Z7S1 3U11A 3IN9A 3RMYA 3ZXFA 2HEWF 2IFWA 5JIAA 2XJRA 2CGPA 4QPGC 1VRH2 4D94A 2A6VA 2WS92 4I3GA 3KZ4C 1QY4A