3AYAA

Crystal structure of galectin-3 crd domian complexed with thomsen-friedenreich antigen
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
135
structure length
135
Chain Sequence
MPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for distinct binding properties of the human galectins to thomsen-friedenreich antigen
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
molecule keywords Galectin-3
total genus 31
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ayaA00
1OQ1A 3AZZA 1KITA 2ZGRA 1ULFA 4Y20B 3WDVA 5GLTA 2ZHNA 2B7YA 4Z8BA 1VAVA 2W68A 3RG0A 4FPEA 1AX1A 3SH5A 1UAIA 2DUPA 1AVBA 5T54A 2VU9A 1N1SA 2ENRA 2UWAA 1WD4A 4XTMA 2ERFA 3O5SA 2E6VA 1WW5A 1WCSA 3AZYA 1ENQA 1ULEA 1VALA 2KM2A 2YZ4A 1Q8QA 3M1HA 3BOPA 3W59A 1APNA 5KXCA 1S1AA 4AVSA 1SLLA 3LSDA 1JN2P 1JUIA 4BLJA 4LBNA 4R9DA 4YG6A 2D6MA 1G7YA 5F5QA 3AP9A 1W6NA 3ZSKA 5H9PA 4P9WA 1GZ9A 1MS9A 2C9AA 5DUXA 1IS6A 2PHXA 3AYDA 3QLQA 3D4KA 1LOFC 2ZMNA 3NV1A 1FV2A 1LHOA 1MR5A 2D7FA 1ULCA 3N36A 4PBPA 2DV9A 1S0EA 2ZA9A 1J1TA 4XTPA 4FVVA 4LBLA 4YG3A 5JOZA 2DVBA 3C2UA 1HQLA 1QOOA 2VW1A 3N3HA 3R4UA 3APBA 4BQ1A 1LHVA 1Z0HA 2V73A 1DQ0A 2W52A 3WHTA 1V6OA 4DPNA 3M3CA 1FYUA 3FLTA 1WW6A 4ISRA 1HDKA 3B3QE 4XHBA 1W6PB 2D3PA 2ZKNA 3N7JA 3A0NA 1S0IA 5GLZA 1QNYA 4FPCA 4F83A 4YFWA 5GLWA 3AFKA 4FPYA 5DZEA 1N47A 3IM0A 3RS6A 2D6NA 3POWA 3WDWA 3ASIA 4M3CF 5IK7A 1SLCA 1GLHA 4R9BA 1DLLA 1MS0A 1X50A 3B01A 1FNZA 3IPVA 5CBLA 3NV2A 4BMBA 2YV8A 1FX5A 1GICA 1GKBA 1W6QB 1GV9A 1KDMA 1LGNA 1LGBA 2EAKA 4AGRA 3ZSLA 1V6LA 1WW7A 1QOSA 1MS1A 4PF5A 4FOYA 3WCSA 1LTEA 1Q8VA 1LOEA 4XIKA 5T55A 4ATEA 4DS0A 4BMEA 4CZSA 4UW6A 4IQPA 4Q26A 5H9SA 5IK4A 3GNEA 2P2KA 4L8QA 2SBAA 3POYA 1AJOA 1D0HA 1GZWA 2AUYA 3ILRA 4YFZA 2NZ9A 1KJRA 1V6MA 3ENRA 2WLQA 4JC1A 1W6MA 4TZDA 2A71A 4UW3A 1D2SA 1CN1A 3ZXFA 2PHTA 1WLDA 4BOWA 1C1LA 1YIFA 2W39A 4M3CE 3FLPA 2GNDA 3AXDA 1DBNA 4YGCA 3ZYRA 1SLBA 2ES3A 2A6WA 1F5FA 4WVWA 4DFSA 1CVNA 4Y24A 4XBQA 4PBOA 1WBLA 1IKPA 2NM1A 4NO4A 4PCRA 2A70A 2LALA 4ZKTB 4JCKA 1S0DA 3WDUA 3SNMA 2H0BA 1BYHA 3ZYPA 1OFSA 4AVTA 4C1XA 2EIGA 5DZFA 1UL9A 4FPHA 4KBBA 1A3KA 3MEPA 3ZVXA 4D69A 3VV1A 4UW4A 3ILNA 4YM3A 5DG2A 1UMZA 1W6NB 2VY0A 1DGLA 1DQ1A 5JOXA 5GLVA 1DZQA 5IUQA 2WT0A 3KM5A 4CRQA 1RIRA 1O4ZA 1AXKA 3OGGA 1V00A 5FRAA 1XQNA 1QNWA 1LGCA 2DTWA 4FPKA 4TYSA 2JE9A 3WVJA 2P37A 4XZPA 3V0AA 1ONAA 2WSVA 3INAA 2VW2A 3AYEA 2JDZA 2DVDA 4FPOB 2DU1A 4AVVA 1SACA 4FP2A 3OBTA 5DUVA 1O4YA 2ZHMA 4WZFA 1WUVA 3RMXA 4R9AA 4YGDA 1DFQA 2PHUA 1ENRA 2A6VA 3O0XA 4W65A 4Y1ZA 2PHWA 4DQAA 2CYFA 3CNAA 1QKQA 5HCBA 1JW6A 2E53A 4XJ9A 1QU0A 1HLCA 3AP4A 1LU2A 4P14A 1LOAA 2ARBA 1FAYA 5DXDA 2NN8A 3AZVA 2JECA 1F31A 2DWRA 1MACA 2G4IA 4K20A 3BTAA 3OY8A 3HMYA 4Q1RA 1W0OA 2CNAA 2GNMA 1G8WA 3BODA 4U36A 1W6PA 4FQZA 1QF3A 2WJSA 4YZ5A 5DG1A 3A4UA 1LCLA 3RSJA 4YM2A 2DVGA 4LBOA 1MVEA 1PZ9A 2YMZA 2ZGQA 3B69A 3PVNA 3V0BB 3B9CA 2FMDA 2D3SA 5BYNA 5GALA 2JE7A 1BKZA 1A78A 4YM1A 4I30A 1UZYA 2P3JA 3I8TA 2R16A 2ZMLA 5GM0A 3SH3A 3WDXA 2GNTA 4XILA 5GZFA 5T5JA 2JD4A 4M3CA 2JKBA 3T1MA 4YLZA 4SLIA 4LBQA 3VKFC 4YZ1A 3AP5A 4LBMA 4R9CA 4YZ3A 4Q2FA 5GZEA 3PVEA 2WT1A 3O12A 4GWMA 3UL2A 3USUB 1C1FA 2XB6C 1G9DA 3WOGA 2VW0A 4CTEA 2WT2A 2UWBA 2EXJA 2TEPA 3RQ0A 3GALA 1S0BA 2D6PA 5CNAA 1KJLA 5SV8A 2GDFA 2EXIA 1UZZA 5E8AA 3T1LA 4FPGA 5JLVA 1YYNA 4LBJA 4FPLA 1VLNA 5GZGA 3SISA 4C1WA 3U4XA 3VKOA 3B00A 5KXEA 2ZHLA 1Z78A 1B09A 2AREA 4XXAA 1LOGA 1BQPA 2GMMA 5FREA 3V0AB 3MW2A 2VH9A 3R05A 4Q1PA 4XBLA 5T5LA 4Y1VA 4JRAA 4BLIA 1N3PA 2PHRA 2VXRA 4MYEA 4K1YA 1IS4A 3HN1A 1CIWA 1QDOA 1IS3A 1SCRA 3UJQA 1WLWA 1LESA 4AGGA 3Q9OA 2ZGMA 5T50A 2P3IA 2UURA 1A8DA 3V65A 1NLSA 1AF9A 2ZGUA 1BXHA 2AR6A 4ATFA 1SLTA 3UK9A 4XE9A 1AXZA 1DQ4A 2Z42A 1Q8SA 1LODA 2A6YA 1S0GA 1JHNA 5EXOA 3NWKA 2OVUA 1SCSA 1LJ7A 1DQ2A 2A5ZA 2GMEA 2PHFA 3IKWA 4Y1YA 5HCFA 2GMPA 3FUOA 4FOVA 2BQPA 2A75A 2AH2A 1S0FA 2ZHKA 4XJUA 1W6OB 1Q8OA 4XJZA 1Q8PA 5KXBA 1V6NA 1G86A 2GALA 1GSLA 5EWSA 2E7QA 4P9XA 1Y7BA 4FOWA 3V0BA 5F9TA 1LENA 4XBNA 3T2TA 1CR7A 1LHUA 2NP0A 2ARXA 2NMNA 2D6KA 5H9QA 2A3XA 4YW5A 2ZGOA 4ZXKA 2UU8A 2EF6A 4RL7A 3JU9A 3SH4A 2UWCA 4XYXA 4YZ4A 2WQZC 1GZWB 2ZGTA 4FPFA 4GALA 1MS4A 3AYCA 3M2MA 4Q8KA 3OYWB 1JYCA 1DYPA 1AXYA 1CONA 2LTNA 5L73A 4AGVA 3I4IA 5LK5A 3AJYA 1QMJA 2DVFA 2R1DA 2ZGKA 1IKQA 3RMYA 3AYAA 1CQ9A 4HANA 2VUAA 4XDQA 3LCPA 1LECA 2ZBJA 1KRIA 5DUUA 5IK5A 1QOTA 3N7LA 4XJWA 2EXKA 1GZCA 3N7KA 4GA9A 1I3HA 1N1YA 3MW4A 4Q8LA 4XXPA 5CB7A 1TEIA 2WSUA 1HQWA 3SITA 2R0FA 1G9BA 4YW4A 5IK8A 1LHNA 1LEDA 1LU1A 1N1TA 2NMOA 3WUCA 3VUOA 1JOJA 2DTYA 3USUA 1G9FA 2P34A 4Y26A 1S0CA 5DUWA 2XG3A 1OKQA 1MZ5A 3AZXA 2R0HA 4YGBA 2YY1A 1ZA4A 4M01A 1SBEA 2A6ZA 2NYYA 1FNYA 3KQRA 4Y22B 4YW3A 3VKLA 4M3CB 4YW1A 2ZGSA 1KQRA 4WVVA 1AZDA 2E51A 1UN1A 3AJZA 2CWMA 1CESA 3AP7A 2A6XA 2DUOA 3JUUA 3VKMA 5CA6A 4YG0A 1DIWA 2WKKA 3IMNA 1W6OA 3LSEA 5DZGA 2OUJA 3AZWA 1H30A 1HKDA 4K21A 1QDCA 1LOFA 1UPSA 1AX2A 5GLUA 1MS5A 1IS5A 2E7TA 2DURA 3ZXLA 2EALA 2GN3A 2R1BA 3WZ1A 2C5DA 1ZM1A 3ILFA 3M3OA 2ZGNA 3L2YA 4DRRA 1W0PA 4H55A 1LOCA 1WBFA 3UJOA 4Y22A 3WG2A 2CL2A 1UKGA 3MPPG 3ZSJA 2CTVA 4LBKA 1SBDA 4XMIA 3WHUA 1MVQA 3WDYA 1SFYA 3WG4A 1DHKB 5E88A 4BM8A 5T5PA 2A3YA 1MZ6A 1FV3A 1GNHA 1KDKA 3QCWA 1G9AA 1YI7A 4Y1XA 2D3RA 2ZGPA 3NV3A 3DUIA 3M3QA 3AX4A 3BIWE 2DUQA 4XJAA 3POSA 1GYKA 1DQ5A 3PVOA 2DYCA 2HYKA 1AJKA 5E89A 1RINA 5GZCA 5KXDA 2EXHA 2RHPA 1WW4A 2D6OX 1CJPA 2I2SA 1W6QA 2CY6A 3OJBA 3WG1A 4FQ4A 1PZ8A 2AGSA 1SLAA 4YZ2A 3N35A 3IPVB 3OY8B 1I1EA 1H9PA 1SBFA 3OYWA 1DYKA 3ZXJA 4ASMB 1LOBA 3D5OA 3PJQA 3WV6A 1UX6A 2ZABA 1GANA 3OPZA 3W58A 2SLIA 1NXD1 3O0VA 1FATA 4LBQB 5CAZA 2GNBA 3PMEA 4Y1UA 3SLIA 1V6JA 5HCAA 1MS8A 1C57A 4FP3A 3RRDA 5IT6A 3ZPYA 5JMCA 1WD3A 5EYXA 4GWNA 2R49A 3AXEA 1ULGA 3NV4A 3M3EA 2ZMKA 1LULA 1R1ZA 3TAYA 2WNEA 1AX0A 2DVAA 1WLCA 5GZDA 1V6IA 2CWSA 2DU0A 1LHWA 1YXWA 4XHXA 3AK0A 3ATGA 1EPWA 1W6MB 5JDBA 4GKXA 1S0JA 3O0WA 1BJQA 4PQ9A 4ISQA 4AWDA 4XIOA 4YGEA 4AYUA 3WDTA 3OBRA 3ZSMA 3HR9A 4M00A 3FUQA 3H0OA 1N3QA 4K1ZA 1C4RA 2YXSA 1RITA 3A0KA 4GXLA 1F9KA 4UW5A 4YW2A 2PELA 3WNXA 1YO8A 2JJ6A 4WV8A 2P3KA 1Q56A 4U2AA 4P9YA 4XJ8A 2FHRA 4GKYA 1SLIA 1N1VA 5H9RA 1BZWA 2D43A 4XOGA 5EYYA 5JOWA 3ZXEA 5T5OA 2V5YA 3R4SA 3ZXKA 3WG3A 1URXA 1LEMA 1CPMA 1QGLA 1JBCA 3N7MA 2ZGLA 1CPNA 4FPJA 2YROA 5JOYA 4RA0A 1VIWB 4FOQA 4NOTA 4Y20A 2ZZJA 1H9WA 1VAMA 1YRZA 3WCRA 2OUHA 3FFZA 3V64A 1GBGA 4HL0A 2AYHA 1JXNA 2AENA 2ZAAA 4YM0A 3DGTA 3FLRA 5T52A 3MW3A 3WLUA 3FBYA 2ZACA 3AP6A 1ENSA 2W08A 3D6EA 3IN9A 2Q5TA 2D6LX 1V6KA 5AVAA 2GN7A 4OZXA 4Q27A 1ULDA 1U0AA 4LBQD 1DQ6A 5GJ6A 5JVVA 1PZ7A 1G9CA 1GNZA 3VKNA 3WUDA 3TB0A 1N3OA 2D44A 2OW4A 4XMAA 1JYIA 4DRVA 4BPZA 1IOAA 1MS3A 2A3WA 2A7AA 4ITCA
chains in the Genus database with same CATH superfamily
1RUE3 2Q1MA 3AZZA 4N43B 4QXKA 1KITA 2PQQA 4B8EA 3WDVA 5J09A 2Y6FA 3NNFA 4IE5A 4NE9A 3H42B 3N9MA 2V4VA 3ZYHA 2W68A 4INDA 4LKDA 5GKAC 3W21A 1L3JA 4FPEA 2J1SA 3SH5A 1AVBA 1UX7A 3AMMA 2JDKA 4N53C 3CMGA 5T54A 5KBFA 2CAVA 5IYYA 1UU6A 3NJVA 4NIAA 1JH5A 2XUEA 1WCSA 3KCYA 3M1HA 2WL1A 3NAPA 3W59A 5HCHA 2BVBA 3HNBM 4ZZ8A 1RUC3 4BLJA 4K40A 1X8EA 5JSRA 1ZRFA 3AP9A 2VULA 2PLV1 3QOPA 3ROUA 5ERLA 2PTMA 1GNYA 4MGZE 1PMJX 2XDVA 3H1MA 4XF9A 5A7WA 2W1SA 1J1LA 4KL1A 3AYDA 4DEVA 1NCRA 1PK6A 2ZMNA 1UYXA 3IDCB 1W2AX 2HBUA 4ZY9A 4D94A 4MX3A 4ZPIA 1S0EA 1SHWB 2J22A 2ZA9A 5FMDA 1J1TA 3MFAA 3TOJA 5JIAA 4D3WA 3RZJA 1HQLA 1EUUA 1VMFA 2YC4A 1Z0HA 2V73A 5C5UA 4JTNA 2KD7A 1DQ0A 2I07B 2WN3A 2VXJA 3HD8B 1FYUA 3M3CA 3FLTA 5FKCA 1O5LA 5KC5A 4FTBA 1Y9QA 4SBVA 4JKMA 2BNOA 2D3PA 5A1AA 3FN9A 1B35C 4OZOA 1S0IA 1K3IA 4CXYA 4F83A 5BNOA 5GLWA 2IC1A 2WIIB 4AQ6A 4B3NA 5F3EA 1BLZA 3ZFFA 2XL7A 4ZONA 2J1AA 1VBE2 2R30A 3A7QA 4MOAA 3ES4A 1DLLA 1HX6A 1MS0A 1VBC3 1X50A 1XNCA 2IZWA 3NQHA 4JGYB 1RUD1 5IJRA 1WGPA 4N9HA 4ZXEA 3ZO0B 4FFIA 1PO13 5C6CA 4NPRA 3O1SA 1STMA 4UOJA 2PLV2 1FX5A 1ZA7A 1JMUB 1W6QB 1YNAA 1YIPA 4DO0A 2DCYA 1LGBA 1UYZA 1CZTA 1XE0A 4H7MA 2WFF3 4L97A 2EIEA 1IPKA 3VL8A 1HXS2 4L11A 5C33A 1DZTA 1OF4A 1CAVA 3JD71 2X09A 4E4ZA 1ZBE3 4CZSA 3S30A 2PYTA 3VDBA 1WMEA 3CJIA 2WAAA 2WO2A 5H9SA 2RS31 4RHV3 5IK4A 3GNEA 2P2KA 2YPDA 4L8QA 4RS5C 5DAPA 5IAXA 4DEQA 2J7MA 2JB4A 3ILRA 3HNYM 4YYOA 3TEWA 3LF7A 1O3RA 4Q4W1 3F95A 4JC1A 2Q8EA 1ZZ7A 2A71A 1HIXA 1LRHA 1GOHA 4NJ4A 2PHTA 1YIFA 2Z4FA 2PQSA 1AR61 4MV2A 2GNDA 3F2ZA 3AXDA 3PL0A 4Q4V1 3ON7A 4YGCA 1SLBA 1TNFA 2A6WA 2IXKA 4RR3A 2IXIA 4OI1A 4DFSA 1CVNA 1XU2A 4Y24A 4AF9A 4PBOA 1O7FA 4AFCA 2XVGA 5AC91 2B9UA 4FTEA 1ND2A 1NKGA 5FYMA 3GBFA 2GH8A 5IVYA 4N7IA 5FK8A 1DDLA 2D5FA 1PO23 3NAPC 4OHVA 3SNMA 3ZYPA 4N43C 5A3NA 2ZS6B 5DZFA 3BVCA 5JR2A 1A3KA 4NHYA 4XAEA 1XYNA 3GM8A 5A6YA 2PFWA 1OQEA 3I2IA 3LPFA 4FT8A 3E6CC 2EICA 2R073 4PQQA 5DG2A 4LLFA 3WNKA 3HN3A 2JD9A 4WM7A 5JMOA 2P17A 2WT0A 4E4DX 1HJGA 4IEVA 3KLSA 4QD2A 1O4ZA 1AXKA 4NAMA 3MUZ1 4LUKA 1PMHX 1DG6A 4NHLA 1QNWA 4FPKA 5FZMA 4PDWA 5I0UA 1U12A 2P37A 2RS32 4XACA 4XZPA 1ONAA 2WSVA 4EJRA 3JBG2 3KS7A 5FYZA 4XW3A 3TN91 4TTGA 2LROA 4BB3A 2DU1A 4UI9L 5DAXA 4AVVA 3OSDA 1IG0A 1ASJ1 1SACA 3IB3A 3RVHA 3UV9A 5C8CB 2C24A 2VTXA 4WZFA 4Q4W2 4R52A 5C8CC 4GH4C 4R9AA 5JIUA 4JGZC 1YQ5A 4KGGA 4GJZA 3H3ZA 4QU2A 2CYFA 1GQPA 2FDIA 2DBNA 5IVFA 1JW6A 1JYVA 1BBT1 4XJ9A 4ARYA 4P5YA 1RJ8A 4LO6B 3AP4A 4LULA 1PIV1 1LOAA 5AC92 1FAYA 2NN8A 5FZ6A 4NN0A 1POV3 2DWRA 2G4IA 3MV01 2XWBB 2NLRA 3BTAA 3OY8A 5LBEA 2WZEA 2CNAA 4RSUA 1QJEA 2O14A 3O14A 5B4XA 1UOJA 3LEMA 1O3TA 1MVEA 1D0GA 5CFDA 2ZGQA 3V0BB 1AR91 3QACA 2D3SA 1JZ3A 4PDWC 3T2QA 5FY5A 4Y4RA 5LA9A 2YDEA 1UZYA 2P3JA 3I8TA 1UF2C 2ZMLA 2GNTA 4XILA 4B4RA 4D7YA 2VCCA 1VBE3 2YG0A 2R062 1H2NA 2J42A 1WWYA 4RS5A 3VKFC 3BCWA 1BBT3 2B45X 4JHTA 3VBHA 3AP5A 4LBMA 3RZMA 4Q2FA 3WW4A 1H8VA 3H7JA 3HNMA 3ZYJB 4LLOA 4XDOA 2VCBA 3UL2A 5C9AB 4HETA 1CZSA 1DGWX 1SEFA 3EBRA 2EXJA 3BB6A 4E2QA 3SMHA 4HVQA 3OUHA 3N9NA 2P4EA 2VTFA 2EXIA 5BNQA 2D98A 1UZZA 1MQTA 1XB9A 3VZOA 3LB9A 1JUHA 1D4M1 4LBJA 1UMIA 5GZGA 4MH0E 1OLRA 2OA2A 3GCWA 2RS13 1OH4A 4B4PA 3WP3A 4N43A 2DCKA 3FZ3A 1FI2A 1NA1B 1JZ6A 1HB4A 1SDWA 2Q4SA 5HXMA 3WSOA 1G6NA 2VH9A 3R05A 5T5LA 3FX3A 4AW7A 1AR92 4PT6A 1X33A 3NMBA 4JRAA 2QFEA 4QPIA 5E1RA 4QPWA 3RWKX 3C7OA 4AHZA 3ELNA 3HN1A 5IHRA 3O1TA 1SCRA 3UJQA 3Q9OA 3L9JT 5T50A 4QHBA 1Q5OA 2P3IA 1K5MA 2UURA 3DPRA 3VBOB 5AC93 5JUVA 3ZM8A 5ISLA 1Y3TA 4RFRB 1ND2C 4XE9A 5FZCA 2Z42A 2A6YA 4CUCA 1PX4A 3NWKA 2OVUA 1XE8A 1UY1A 4LE3A 2PHFA 1MPXA 4CEWC 3FUOA 2XUMA 3KT7A 1S0FA 2YUEA 1Q8PA 4RFT0 1A6CA 2B5HA 1GSLA 2CDPA 2GALA 5EWSA 2R041 4P9XA 1Y7BA 4FOWA 1XBFA 5F9TA 1LENA 2VUDA 4IE6A 1CR7A 2XQRA 3H7YA 1NCQC 2XGXA 3IT8A 4NVPA 3VD7A 5FWJA 2WUHA 3B02A 2Q0AA 4YW5A 2ZGOA 4ZXKA 3B94A 2DCJA 3VBUC 3DPRB 1PVC1 3I54A 4XYXA 3VBSA 2OYZA 3PMSA 4AI9A 4Q8KA 1DYPA 3ZOIA 5LK5A 5LY1A 2VCAA 2UYBA 4N8MA 5CZKA 4CP9B 4HANA 3BTXA 1F4AA 2BGPA 5IK5A 3N7LA 4HSJA 3VD9A 4MXWB 1PO11 3A23A 3PDQA 1RXFA 4GA9A 4CXWA 4LEJA 1I3HA 3VBOC 1NOVA 3I59B 3FWEA 4QXCA 5J3UA 2HWD3 2GP5A 4Q8LA 5FZ3A 1VBA3 4EN8B 5FYSA 2WSUA 3I3QA 4AEKA 1LHNA 1QJU2 1N1TA 2DFBA 2NMOA 2W2IA 4JX0A 4LR4A 4NR1A 3NJYA 5B2GB 1X8MA 1G9FA 3E1F1 5K0UA 2MHFA 1W9SA 1DGWA 1CAXA 3AZXA 3WNPA 5IFPA 5HXVA 2R0HA 5F39A 1REFA 1ZA4A 2WNVB 1GMMA 2KA3A 1XNBA 4Y22B 1NCQB 1VRH1 4GQ7A 4M3CB 5FYCA 4YW1A 1JI6A 5A33A 2WZR2 4XUPA 4HN1A 4Q4Y3 3VBUB 4A42A 2AEZA 4OHYA 4XF4A 4BHPA 2V09A 2OS2A 3BOWA 2WKKA 4YG0A 5C3OA 5CADA 1H30A 1HKDA 4K21A 3MF9A 1VJ2A 1UPSA 2CGNA 2YU1A 5GLUA 2E7TA 3J7NA 2BV4A 1AYM3 2GN3A 5FZOB 3CEWA 2V5DA 3L2YA 5C3SA 1LR5A 1PO12 3U75A 4Y22A 2WNVA 4LBKA 4QKNA 1SBDA 2VMCA 3C3VA 1SFYA 5FLIA 1CAXB 4QX1A 4H14A 1TMF3 1KDKA 3ECQA 1NY71 2W94A 4Y5Z0 4R4ZA 5ABJA 3U07A 2D3RA 3M3QA 1CGPA 3H50A 4BCUA 1DP0A 4Y33A 1GYKA 1DQ5A 2HEVF 1T2XA 4O61A 2DYCA 3LWCA 5E89A 2O8OA 4NIDA 1RINA 3VBRB 2RHPA 2QQUA 2D6OX 2I2SA 1CJPA 2WS93 4W6WA 3P1IA 4HPKB 1AYN3 5A80A 4K8RB 1I5PA 5ANNA 3WG1A 3PTYA 4CP9A 3EB7A 4Z2AA 3RI9A 3N35A 3J26N 4BJ0A 4I2OA 1NUKA 3ZXJA 2JDHA 1LOBA 5FZKA 4BQ3A 1YI9A 2MNGA 2QKDA 2A1XA 4UFMA 1W8FA 4GJYA 4ET7A 4QWNA 3K46A 2AEYA 1NXD1 4CEWA 4Y1UA 4O9GA 2W1QA 3AMHA 1ZZ9A 1C57A 3HIFA 5IT6A 3ZPYA 3GZAA 4Y3OA 1HRI2 1QIQA 3PURA 3AXEA 1ULGA 3LEGA 5LRRA 1R1ZA 2WNEA 2HWD1 1W8ZA 5FZ8A 3RPQA 2A73B 2DU0A 1LHWA 2XJVA 4XHXA 3SCFA 4A41A 1ZBA1 1QH7A 5A7QA 4IE4A 4GKXA 3CO2A 3O0WA 1BJQA 3J8F2 1SFPA 4XIOA 2XVLA 4A6OA 3OEBA 1RVF1 5FXWA 3ZN6A 5FQ0A 4Y5SA 3H0OA 3SCHA 4J1WA 3A0KA 4Q29A 2W47A 3WEZA 1PVC3 1PM7A 2VNRA 3HT1A 1YO8A 3Q8CA 1OA2A 4XJ8A 1SPPB 4P9YA 4URTA 2FHRA 4GKYA 3POFA 1IPJA 1L7RA 1BZWA 5DAQA 3TWIA 5JXJA 2GC3A 5JOWA 2JEMA 2WO7A 5T5OA 1EAH1 3B9IA 3NNGA 5ACA1 3ZXKA 4HBNA 1URXA 3WG3A 1O5UA 1Z7S2 3N7MA 2JKXA 4AK3A 5A32A 3NNJA 5DDJ2 3VB9A 4Y20A 1C8M1 1JOBA 2OUHA 3MBWA 2WZPP 2P6CA 4HL0A 5C5TA 2VZSA 2Z69A 1TMF2 1JXNA 4AXOA 5LZ6A 3KCXA 4Q0SA 4YM0A 3FLRA 1J3RA 3LKJA 3WQ1A 4DUXA 4FXKB 1X9TA 3AP6A 3D6EA 2P6HA 1UZ0A 3H1YA 4GMP1 5FYYA 1GOGA 4OLLA 5AVAA 2GN7A 4OZXA 4Q27A 3AMPA 4S2HA 3WP5A 2WFF2 2C6SA 1ULDA 2W87A 2Y6LA 2YBSA 3G7DA 3EJKA 4MLOA 4QQOA 4X6RB 5C9AC 2B4KA 4XETA 1PZ7A 4KU7A 4TSVA 1UQXA 5CFDC 3TEYA 5LEKA 2CGPA 1QJX3 5JR7B 1UPIA 3TB0A 2OW4A 5A3OA 4XMAA 3T0BA 2C9KA 1C3HA 2A3WA 3KB5A 3PIJA 4ITCA 1LNSA 1OQ1A 3MLLA 2XH6A 4P9JA 2ZGRA 5F5CA 4JQRA 5GLTA 2ZHNA 2WZR3 2R043 1W9YA 1YQ2A 3VHRA 2VZOA 3WINE 4W4ZA 2LRPA 3C7HA 2QQMA 5I8TA 2DUPA 3MIBA 1HXS3 3GZUC 2VU9A 5KWRA 3DYMA 1WD4A 1WMFA 1NQJA 1PK6B 2YHJA 5JI7A 2Y34A 2E6VA 2OZJA 5T3NA 2JB8A 3AZYA 1ENQA 1VALA 4UF0B 1UU4A 2ZJCA 5FPLA 5FYIA 1X7NA 5DDJ1 2ZX3A 3ZLIA 1S1AA 4CUGA 4WM8C 1SLLA 2W1UA 1HN1A 3LSDA 1P8JA 1GQHA 4TLFA 1WLTA 5F5QA 5H9PA 3EQEA 2E7AA 2JICA 1EV13 1BEV3 3R4DB 1I5ZA 2O8QA 1IS6A 2PHXA 3FHAA 3POBA 3QLQA 2X29A 3NW4A 4JAAA 3RFRA 2WLPA 3GZTB 1TQ5A 4BK5A 5DDJ3 5C71A 5FZIA 2XMLA 4PLMA 4QPGA 3N36A 3ZFEB 1ULCA 2NPIA 1O3SA 5F3IA 1MEC3 2I45A 1XSRA 3GHNA 5FMOS 4Q4V2 2VW1A 4PIXA 1Y9GA 2MEV1 4CA9A 2JDUA 2YFZA 2E32A 2ZEYA 1K45A 2W52A 2W9XA 4Q4W3 4QB2A 4FXGB 3WF0A 4DZGA 4DPNA 3HVDA 3FBMA 3WY6A 2RS12 1WW6A 2BBAA 3N9OA 4XCBA 4ISRA 3B3QE 4F7ZA 4XHBA 1AL21 4LO7A 1PIV3 2RS33 4V2WA 1QNYA 3UETA 3ZN6B 2IXLA 1TE1B 3LAGA 1VBD1 4QKBA 1OLQA 4CSWA 2YPJA 2YB7A 5F6LB 1YCIA 2D6NA 4CDUA 3UESA 5BNPB 4UF0A 1X9PA 1BVVA 1E5SA 1SMVA 4JV4A 4GMP3 1E5RA 3B01A 5FFOC 2IFRA 2IFWA 1W0NA 4IEQA 1JU4A 1XNTA 2VAUA 2VVDA 4BMBA 3POEA 4RN5A 3IDEA 2ID4A 4IE0A 1GV9A 1GU3A 3S5QA 4RGGA 2EAKA 3PLQA 3AVRA 4AGRA 1CAUB 1U5IA 1UMHA 2RDNA 4HKLA 3WNMA 3S0MA 4QPGC 3WP4A 3BTYA 5F3GA 3OGVA 3RYKA 4XIKA 4ATEA 4NPLA 1VRBA 3M8LA 4CEWB 5FY1A 2QQNA 4UW6A 5F1RA 2OT7A 4UFLA 3LE0A 2BW8A 3RWNA 3I3BA 3POYA 1PO22 1IPSA 1QJY1 1GZWA 4QKDA 5CYYA 2AUYA 2D40A 4YFZA 3M4FA 2BEOA 2VMEA 3HJRA 4D6QA 4Z2WA 1TG7A 3POGA 2YU2A 4META 2X5IA 4XZUG 4TZDA 4BOWA 1D2SA 1CN1A 1ZRDA 1ODNA 5FPVA 4B7KA 5FYTA 3NVCA 4Q4X3 1WMDA 4TWTA 1MEC1 1VBD2 4BQYA 3I2GA 3LA7A 5FMOL 4JKKA 4XBQA 4XQWA 3RI8A 1WBLA 1J3PA 4NO4A 5FLHA 3GZEA 4CEYA 1TME2 1HB2A 4UXAA 4YVSB 1EV11 2H0BA 1BYHA 5LBBA 3WDUA 1OFSA 4QB1A 1RB8G 1IHMA 3ZX7A 3ZYBA 1POV0 2DF7A 1UL9A 1RUH2 3UKNA 1JZ4A 4WVMB 3BYWA 5DAVA 3ILNA 4H3WA 2Y0OA 4IV3A 1SPPA 4OVEA 1ULPA 1H2MA 1W6NB 5JSPA 1DQ1A 5JOXA 4LMFA 1W3VA 1DZQA 3MFCA 3WQ0A 2HKXA 2VOWA 5IUQA 4GULA 1UOGA 1FMD2 4AI0A 2BVVA 3FL7A 1V00A 5FRAA 1XQNA 2C1FA 2DTWA 2XJSA 1OPMA 2RS52 3KV4A 3LZZA 4HKWA 4IV1A 2IVJA 4M4PA 3V0AA 5ACA3 3AYEA 1UIJA 2JDZA 4HLTA 3P5BA 4KMQA 1QJY2 4CP1A 5I0RA 4P9IA 1HB3A 4QX3A 2ZTNA 2WYFA 2ZHMA 5C8CA 3IAPA 2YGLA 3DEMA 4Z07A 3H3UA 4CDXC 1UY3A 1VBC1 4S2FA 5FOBB 1MQTC 3UKTA 5CFCB 5K8SA 3ZMNA 2B42B 4DY5A 4ORFA 2BYVE 4Q0QA 4Z82A 1QU0A 3DCQA 3QD6A 4K8FA 1O59A 1V70A 2F4LA 2VBPA 5FCCA 4P14A 4L2NA 1TME1 2JECA 3UGHA 1F31A 2RR11 4ONUA 3M7AA 5FMBA 3HMYA 1EV12 4Q1RA 3BALA 4BQ4A 1W0OA 2XVKA 2E31A 3BODA 1EPZA 1W6PA 1H4GA 3T0AA 5DG1A 5LASA 1TZOA 1OA4A 1COV1 4NHKA 1PM4A 3MDPA 2YMZA 1PZ9A 1QXPA 1DU3D 1W9FA 5IVBA 3VZLA 1YWKA 5GALA 4MO3M 5I0TA 2JE7A 2HEWF 1AR82 5FYHA 1A78A 1AYM1 5FPBA 1M4WA 4YM1A 3SKJE 5G05L 4FI9A 1HRV1 2VQTA 5EV7A 4ASLA 2R16A 2R042 4UFHA 3WDXA 3E6BA 2JD4A 1OH3A 4V1PA 4ZU4A 3T1MA 3CQOA 4KWUA 4OCTA 5HV4A 2ADDA 4SLIA 4LBQA 4I0AA 4LO5B 5A3PA 5A6XA 3KT1A 5KHGA 4XF1A 5A7SA 1FPN1 4MSVA 1NZCA 1O8SA 1PVC2 2WT1A 3AKSA 1L7LA 2V4AA 3PVEA 2J1RA 3MYXA 1C1FA 1W2OA 1C5HA 2H0VA 3FC0A 4COUA 1YFUA 4IETA 3OUIA 2WT2A 2QQLA 5F5IA 3I2FA 2TEPA 3RQ0A 2D6PA 5D1IA 4AAXA 1KJLA 5SV8A 1H1IA 2GDFA 1ND3A 4AEDC 4QB6A 2JG8C 2WWSA 2OXBA 2VZTA 3EXUA 2WFPA 4G3YC 4Z1VA 5C3RA 1YYNA 3BPZA 4HONA 3RJRA 4FPLA 1RUE1 3U4XA 3VHPA 3VKOA 1OUSA 4DIQA 2VMGA 4XXAA 3D82A 2KR2A 1X36A 4O7XA 2GMMA 4CP0A 2F17A 3V0AB 3MW2A 1VBB2 1OXCA 4XBLA 3GBGA 2WA3A 1QY4A 2C0ZA 1UWWA 1N3PA 4J25A 4LXLA 2R072 2PHRA 2VXRA 1ZBE2 4K1YA 3MLJA 1AR81 1IS4A 4MUVA 2FDJA 1CIWA 3UKVA 4E27A 4KG0A 4AGGA 4XFAA 3IDBB 4LUMA 5KHKA 4OQ8A 3V65A 1NLSA 4LKEA 1BXHA 4AFBA 3CL1A 3OGSA 3UK9A 4UFIA 5K0UB 1AXZA 4ZZ5A 3PUSA 5EXOA 4YRDA 4AHYA 2HWE1 1LJ7A 2A5ZA 5HCFA 5F32A 4Y1YA 1RUJ2 2A75A 1UU5A 2LW8A 2ZHKA 1GFF2 1W6OB 2WRAA 4XJUA 1M06G 3RZLA 1V6NA 4AFAA 1UYYA 2RJLA 2PHDA 3VBHC 1OD3A 3T2TA 1F35A 1RUG2 2Q1ZB 5H9QA 2A3XA 4XQDA 3QH7A 2IXJA 3I2JA 3VBUA 2YGMA 1QHDA 2UU8A 3ZPOA 4A7YA 4OQ9A 2B39A 1OURA 4AQTA 4K9SA 5IVCA 2BUKA 4LOSA 3DECA 4A4AA 1C28A 1GZWB 1FPN3 4B7EA 4IDZA 5EJ3A 3AYCA 4Q0PA 5L7OA 2JG9A 4H7LA 4YNIA 1JYCA 5FP4A 1AXYA 2LTNA 5L73A 1FXZA 3AJYA 5A70A 1PVXA 2VUAA 4MGQA 4XDQA 3J4UH 3LCPA 1LECA 1KRIA 1RMU2 2P1BA 3FMGA 5LBFA 3LA3A 4CCCA 1GZCA 3B5LB 2QE3A 3MIEA 3P3NA 5L9VA 5FP9A 3I59A 3OPWA 3MW4A 4PJYA 1NLQA 2FDKA 1RJ7A 1G9BA 2K0GA 3ZFFC 5J98B 5C3QA 4KH9A 4AVCA 4MGTA 1PNGA 4I0BA 1UD1A 4B29A 1CD3G 2XLGA 1QJY3 4FFFA 4YGBA 4GAZA 1FT9A 1SBEA 2A6ZA 4COYA 1FNYA 4ZS3A 2BPA2 3LIGA 4YW3A 4LIVA 4C90A 2ZGSA 2H6BA 4JVAA 1JU3A 3IMMA 1CESA 4OMDA 4L9BA 3VKMA 1YQCA 2HWE3 1ZZ8A 1WA6X 4WM8B 1H6YA 2OUJA 3AZWA 2VNVA 3MIDA 5A6ZA 3GHMA 1NXMA 1AX2A 1US2A 5A3WA 1IS5A 2DURA 3HQUA 3WZ1A 2C5DA 4UBHA 5G04L 4DOUA 1CWPA 5IVVA 1W0PA 4AE2A 5FZHA 4P08A 5AFBA 4FTSA 1W06A 1UKGA 4XFHA 2CTVA 2B8MA 2BFUL 1UZWA 2JENA 3WDYA 4DMIA 3KGZA 2YYOA 2JG8A 5FV3A 1DHKB 5JPMB 3OEAA 1MZ6A 1FV3A 1GNHA 4HFSA 4L92A 2NQYA 3GDBA 4NIGA 4QPIB 3DYOA 4G4FA 3SKVA 3ZR5A 2VGDA 3NV3A 4XC9A 1S55A 4RS5B 5FZGA 4D6RA 4LPLA 4DNYA 5LCWL 1JZ8A 3BIWE 2WNUA 3PVOA 2GAUA 4NAOA 1R092 5FLJA 5FUPA 2W3JA 4NRPA 3THCA 1WW4A 3VBRA 1J58A 1AL0G 1D2QA 2JIJA 4FQ4A 1XYPA 2AGSA 1V9U1 1SLAA 3FE5A 4CCDA 3J9SA 4M4RA 4YZ2A 1PGSA 2Z5WA 2Y6KA 3IPVB 4EROA 4V2VA 1I1EA 1VE0A 3Q8BA 1DYKA 2BU9A 3PJQA 2O0OA 1HN0A 3OPZA 3W58A 3ACHA 2Y64A 1UY4A 2JG9C 2SLIA 3QH6A 4FAGA 1CZVA 3BKZA 3IIIA 3PMEA 4AL9A 3EYPA 4M0NA 4HT1T 5I8SA 1CAVB 5HCAA 4N90A 4N53B 3ZN4A 1RUI1 4UYBA 4FP3A 5IAVA 1F15A 2GSYA 5JCTA 2VVFA 2BNMA 4WBBA 1WD3A 2ZX1A 5F2SA 3VLBB 4GWNA 2R49A 1DYOA 2W46A 1KS4A 1H6XA 3M3EA 4IGOA 1LULA 4JKLA 1OVSA 4QAWA 3TAYA 1XXNA 1AX0A 3PIGA 4OI2A 2DVAA 4YSFA 4A45A 3HT2A 4OUSA 3BU0A 3OD0A 3RZKA 2XBO2 3CF6E 5GZDA 5FTTC 1YXWA 2XONA 5A6QA 2WNOA 5SV5A 1PX3A 1S0JA 4W8JA 3ZFGC 1W3XA 4MGYE 3AB0A 4ISQA 5LB6A 2XQXA 1QJX1 4YGEA 3THTA 4AWDA 1CX1A 3WDTA 4EZ4A 3OBRA 3WQBA 4M00A 3FUQA 4OFGA 3HOBA 4NHMA 5FZ0A 1N3QA 1BVP1 1RITA 2VM9A 2ZZQA 1VMJA 5AFEA 2OZ6A 1EYBA 2VZVA 3WNXA 4CCOA 2JJ6A 3VZMA 4U2AA 2VNGA 1SLIA 1N1VA 3LGRA 4HK8A 2JWPA 5H9RA 2K2SA 3THDA 2R063 3ZYFA 1OFNA 2E26A 2D43A 3RNSA 4XOGA 5EYYA 2DFCA 1R1A3 3DXTA 3LEKA 5LBCA 3ZXEA 3TN93 1H2LA 2VZ3A 3KV9A 4A7KA 3C7EA 5JAXA 4W50A 1LEMA 3AKQA 1JBCA 1AR93 5DN2A 1CPNA 3N9QA 3WD5A 2OPKA 4IV1C 4DXSA 4FPJA 3HAGA 5FY9A 5JOYA 1QWRA 3PJYA 1GOFA 2ARAA 3NJZA 4Y5TA 4NOTA 1TNRA 1XYOA 2QNKA 3WCRA 4Y4YA 3TEZA 2BP6A 1SDDB 3FFZA 3T08A 1GBGA 2RJKA 1BK0A 1UO9A 2AYHA 3NL1A 2MEV2 1BEV2 1R1A1 2AENA 2GC0A 5FPZA 2ZAAA 3VBSC 1GP5A 4QPYA 1UXXX 2ZACA 3FBYA 4O65A 3RYPA 3VBSB 1W28A 2HBTA 3IN9A 2FBEA 1RUD3 3ETQA 2ZAHA 3NAPB 1QJU1 3KHCA 1NCRC 3PUHA 1DQ6A 1V9U3 5JVVA 2WNUC 5EIYB 5FWEA 3C8XA 3CJIB 4CCLA 1G9CA 3RDIA 1O4TA 3ZSEA 1JYIA 1EUTA 4Q4X1 2AC1A 1W04A 2E33A 1E57A 2A7AA 2WZ8A 4TXWA 3VHNA 1NZIA 3KF5A 3VGIA 5CFCA 2Q8OA 1T6BX 1D4M3 4QPIC 3DV8A 2WZR1 3VDDB 1V0AA 4BWOA 4PLNA 2VTXJ 1VAVA 2WWJA 4RR3C 3U0ZA 4IXLA 3RG0A 4XCAA 1AX1A 3T4VA 5FXVA 1NYWA 3BIEA 1B35A 2XHNA 1JS9A 1N1SA 2UWAA 3DPRC 3VBOA 3W5NA 4KGQA 3B93A 3ZYGA 3O5SA 4AHWA 5DABA 4IV1B 2WBKA 1ENXA 2KM2A 1W8OA 2WC2A 3ETPA 3K51A 2PAKA 1APNA 1OI6A 1Y9MA 2GC2A 2JDYA 3HBZA 1NA1C 4XABA 1ZRIA 4AVSA 5ABJB 1BMV1 1GZTA 1I9RA 1G7YA 2D6MA 3FHIB 2VG9A 1W6NA 3NKGA 4GMP0 1BEV1 1R1A2 3AFGA 2C9AA 5DUXA 1RUF2 3O1PA 1PO21 1NG0A 3C7GA 4C8DA 1QXJA 3WF1A 4YPJA 1LOFC 2WQ8A 1FV2A 1MR5A 1NY72 2D7FA 2XXZA 3IDAA 4PBPA 4E8CA 4CEYB 4E2GA 1AYN1 4XTPA 1ND3C 4RD7A 4AEDA 4CCMA 2DVBA 4EYUA 3C2UA 5JOZA 1QOOA 1J84A 3N3HA 3R4UA 1OOPB 4BQ1A 3AMNA 2LM3A 1LAJA 3U4SA 2W92A 2XJPA 5BPXA 4E2SA 2CSGA 2UYAA 3CHXA 3JD72 4XFFA 1V6OA 4AI2A 2VUCA 3BI3A 4AR2A 3MLKA 4QGNA 1HDKA 4BQWA 2VC9A 5FR3A 1JYXA 3ZIWA 4IERA 5A7WB 1W8HA 3N7JA 4N53A 5I93A 3A0NA 2ET1A 1PMIA 4FPCA 4YFWA 5FZ4A 1XE7A 2FDGA 4FPYA 5DZEA 1N47A 2BDRA 3AVSA 3RS6A 3ES1A 3POWA 3RZZA 3ASIA 2BFUS 4M3CF 1GWMA 1RVF3 3LDRA 3WDWA 1GLHA 4R9BA 4CXXA 5A7PA 2RV9A 5FP3A 3IPVA 1NAEA 3ACGA 4IEXA 2RS51 1OF3A 3SCGA 4Q0VA 4TYSA 2YV8A 4C0BA 1GICA 1GKBA 3PVBB 5DMYA 3UGGA 1KDMA 1NX9A 1Q3EA 2PN5A 4RHV2 4CU8A 1C8M3 3KCCA 5APAA 4BQXA 1H4HA 4PF1A 4XUOA 1JOPA 1LTEA 1Q8VA 2VOTA 2PAEA 1LOEA 4QM8A 5FPAA 1VBC2 5T55A 2FCTA 4UFJA 2W1WA 3MF6A 3T4HB 4KQ7A 1ZBA2 3H8UA 1BK1A 4NRQA 5EPAA 1EAH3 5FBJA 1GR3A 1HB1A 3I97A 5IWFA 3ZDVA 4D7SA 5J1XA 2PXJA 1D0HA 1W2TA 2PMWB 4XEZA 4I01A 2NZ9A 4CUBA 5FO7B 1H1AA 1KJRA 1V6MA 2RR12 2Y38A 3LQCA 4QX0A 2FCVA 2G9GA 5L7OC 3VD5A 3JBG1 3TN92 3TNPB 3JB4C 1JZ2A 4A2UA 4K3UA 1DBNA 2WS92 5LATA 2ET7A 2ES3A 3H3LA 4S2DA 1F5FA 2ZX4A 2YFUA 3RJ2X 4WVWA 3Q8EA 1F8VA 3CKHA 4OI0A 2ZPXA 1WKYA 3PUQA 3SEEA 2A70A 3CZUA 2VMIA 2LALA 1W90A 4CCNA 5ACA2 5JZGC 5LA1A 4NROA 2YC0A 1S0DA 2HYXA 4JCKA 3O1OA 1BBT2 4GD4A 3VZKA 4AVTA 1W2NA 2EIGA 4C1XA 5FY8A 1XC6A 4CDUC 3MEPA 5BY5A 1RUC1 3LDBA 4D69A 3URFA 1PGL1 3VV1A 4UW4A 4RHV1 3WF4A 2B9VA 4YM3A 3OB8A 1TMF1 1UMZA 3TRSB 1RUNA 1DGLA 1VBA2 1VPHA 4CRQA 1RIRA 3VL9A 4AOCA 4BIFA 4OYUA 3K4AA 3E5XA 4GIQA 1PGW2 4IW3A 4A3ZA 3WVJA 1W8WA 4NWWA 2VQAA 3INAA 2ADEA 3S5AA 4XUTA 4GWJA 4CDWA 1Z7S3 2DVDA 1KXGA 3KHBA 4FPOB 4HZFA 4FP2A 2QQOA 4QQLA 5DUVA 1NT0A 1WUVA 3RMXA 5F37A 2JX9A 4YGDA 4Q4Y2 3K75B 2FDHA 1DFQA 1ENRA 2PHWA 3E97A 2HJIA 1DGRA 3CNAA 3OPTA 1QKQA 1GP4A 5TSWA 2E53A 3POJA 4BISA 4X8NA 1HLCA 4KWLA 4IL7A 1LU2A 1VBB1 3BN6A 1VRH3 2VZ1A 4B1LA 5CIRA 3S7IA 4BXFA 2ARBA 3R0RA 5JZGB 3GJBA 5DXDA 3TYJA 1CX4A 1ZBA3 5HI0A 3VBHB 5CG9A 2P3YA 4R4XA 2GNMA 1TVGA 4JDMA 3M70A 3H8RA 1W9TA 3O7OA 3A4UA 1RUC2 4ZS2A 1K42A 1LCLA 1RUH3 4OUMA 1OMIA 3DKWA 2VL4A 3OD4A 1HQNA 1T6GC 2YBPA 4LBOA 1OHFA 2DBIA 2HH9A 5I91A 3PVNA 4IESA 3B9CA 1JZ5A 2FMDA 1ASJ2 4JGYA 3FJSA 4AEMA 2RMU3 4I30A 2XPJA 5A33B 2ZEXA 2ZXQA 3HPNA 5JI9A 4LKFA 2HWC3 3IAQA 3VBFC 5C70A 5GZFA 5T5JA 4M3CA 5KHIA 4OMCA 2E9QA 2XL9A 2BWCA 1A8MA 2VBDA 3J7LA 4YLZA 5EJZB 2QZ2A 2WABA 5FY4A 5K0UC 5L36A 1D7PM 4YZ1A 3W20A 2WWUA 4CPBD 2ILMA 2XJRA 3O12A 4GWMA 4AVAA 2RDQA 2X10A 4YVSA 2VW0A 4GB32 4CP2A 4CTEA 1G9DA 3IIAA 4LKSA 3DF0A 1AL22 3BU7A 1ODMA 4RQPB 5BNNC 1S0BA 2OQ6A 4COVA 2ZX0A 1U5XA 3DXUA 4QU1A 5I0SA 3WX5A 2RDRA 4FPGA 5JLVA 1RMU1 3OGJA 5A3LA 4C0HA 3SISA 4CDQB 2RM23 3B00A 2ZHLA 4HOOA 2AREA 3AKTA 3ZYIB 1LOGA 3ZKUA 3WF3A 2WN2A 4QQPA 3MPBA 4DXZA 4YVWB 4JGYC 4QHOA 4LQRA 4BLIA 4CCKA 3ZXDA 2KXLA 3MHZA 1XOYA 2E63A 2VO5A 5JXIA 4YVWC 3LOBA 5FYUA 1NE6A 2Z2SB 1IQDC 4AFMA 1QDOA 1AR83 2XJQA 3ZFGB 2ZGUA 3U11A 4ATFA 1REDA 4A44A 3ZIXA 1S0GA 3PUIA 1JHNA 2QBXA 5K4LA 3ST7A 1SCSA 2GMEA 1DQ2A 4D8MA 5KHJA 1QQP2 3IKWA 5BV6A 1ZZCA 2GMPA 5F5AA 5D21A 4FOVA 4MHUA 1O8PA 4WM8A 1Q8OA 5BNNA 2QVSB 1D4M2 4LOTA 4RQPC 5BNNB 3WNOA 2CGOA 3VN4A 4RR3B 5FYVA 2E7QA 4CU9A 2VZQA 3LPGA 5FUIA 1I6XA 4XBNA 3DYPA 3ZXAC 2NP0A 4CYDA 1MEC2 2NMNA 1DLCA 5BXXA 4B4QA 4LHSA 3ACLA 5FOJB 4QMAA 3JU9A 5J36A 3SH4A 2UWCA 4YZ4A 5F6KA 4EE2A 4FPFA 5BNPC 4OULA 4QXBA 2WR9A 1MS4A 1NLRA 3OYWB 4K7JA 2HWF1 4IGPA 4OHZA 1XNDA 1QJU3 3KZ4C 3OUJA 3U10A 1QMJA 2R1DA 2IUWA 4QGLA 5IVJA 1WCUA 4YVWA 4GH4A 3CU7A 4LTAA 5EP9A 2FCUA 5FY0A 2VNOA 1OQDA 3V56A 5I0DA 5J48A 1QOTA 4W6XA 4PIYA 4XJWA 3N9PA 1W8NA 2EXKA 1H8TA 3VD3A 3N7KA 4QPGB 1R091 4DY3A 2X5IC 3X29B 2LS6A 4QDSA 4KWJA 5A3TA 1N1YA 3D3AA 4Z92B 4XXPA 2BOIA 5L9BA 5CB7A 1TEIA 1HQWA 3NRUA 2R0FA 3NNLA 4P02B 4YW4A 5IK8A 4B1MA 1K5MB 1LEDA 1LU1A 3WUCA 2WINB 5EHDA 1JOJA 1EY2A 1OSGA 1YUDA 4P9GA 4Y26A 5JXGA 5M0TA 2J1EA 2VZRA 5FO8B 1RUJ3 1AUYA 1AL23 3NNMA 1MZ5A 5CG8A 4FBFA 2VCMA 1CAWA 2RR13 2XLFA 4C91A 5KC6A 4M01A 1NCQA 1XJAA 5KR7A 3KQRA 3LOIA 3VKLA 3WNLA 2VQ0A 1NA1A 3L2HA 1GP6A 1KQRA 1XSQA 1AZDA 5A3UA 3ITQA 5HV0A 3ORJA 2Y8KA 3JD73 4QX2A 4IUGA 4DUVA 1FOD2 3AP7A 2DUOA 3JUUA 3WW2A 3VBFA 1W2UA 1US3A 4UT5A 1W6OA 3LSEA 2X8KA 3OCPA 1SFNA 1AR73 4QDRA 5CFDB 4MG2A 5FDBA 2FDFA 4A3XA 1QDCA 1ASJ3 1LOFA 3VDCA 1XPWA 4LHKA 1MS5A 3RYRA 3ZXLA 1UYPA 3S6PA 1C5IA 1XRUA 3GBWA 2F4PA 1U5ZA 3LA2A 5FMCA 4F8AA 1ZM1A 3ILFA 3M3OA 2ZGNA 3A21A 4H55A 2VE1A 4DINB 5C4WB 2X5IB 3WG2A 3MPPG 3O1MA 4BK4A 3M3IA 2OPWA 3HQRA 4XMIA 2HWB1 3U37A 1MVQA 2BTVC 4BM8A 3EMRA 1K5MC 2A3YA 4NWVA 4BXSV 5A1FA 3QCWA 1YI7A 2IVIB 5JZGA 4Y1XA 1ACCA 1VRH2 2QQWA 2BGCA 2RVAA 3DUIA 3KVAA 2JDPA 2QZ3A 1HV0A 3MUY1 3VDDC 3LD8A 4AEJA 3PU3A 4XJAA 3POSA 4OUEA 4EQVA 3CJXA 4D7TA 1AR72 1VB2A 2HYKA 5GZCA 2GP3A 4NUBA 3AKPA 1O3QA 2ARCA 4CDXB 2JE8A 4KG8A 1ZZ6A 2CY6A 2XWJB 5FZDA 4GH4B 2D93A 4P00B 2QQKA 4S2GA 1FOD1 2BNNA 2GU9A 1QH6A 3K3NA 3IBMA 3OY8B 4HVRA 5C3PA 1SBFA 3OYWA 4ASMB 1EP0A 3D5OA 2D97A 4CDUB 1VBE1 2RE9A 3H9AA 1UX6A 2CU5A 1GANA 1GQGA 2ZABA 1HRI3 4E8DA 2PHLA 1UXZA 1RUD2 3O0VA 4LBQB 4P5HA 5CAZA 1WCQA 4FO9A 1OLMA 1MS8A 4HVOA 1B35B 4HN0A 2K46A 5EZWA 5IATA 1R64A 3TNQA 1YQ6A 1ZBE1 5EYXA 5FK7A 4LIUA 1ZNPA 1HXS1 3NV4A 2CHHA 2ZMKA 5EJ1B 2YC2A 3KVBA 3H8XA 4ZU5A 1V6IA 2L9LA 4PDWB 5FZ7A 2O1QA 4YW6A 1EPWA 3KSCA 1POV1 5JDBA 2HWE2 4XQ4A 1OLME 3MI8A 5A7NA 4PQ9A 4EN0A 3ZFGA 1C8NA 2XHKA 3JCIA 4Q4V3 3ZSMA 5IVEA 3ZFEC 4J1XA 3KWVA 3ZMOA 2ZCWA 4GXLA 2YXSA 4W6YA 4UW5A 1F9KA 1GUIA 3OF1A 2QQJA 5K7PA 1RUG1 2RDSA 4MZUA 4D0QA 1Q56A 1IG3A 3I3MA 3ABZA 2X05A 4M0HA 3S7EA 3ACFA 1S2KA 2RG4A 4AAPA 2RMU1 4OI4A 2AZ5A 4JZRA 5CVRA 3OGRA 4IEYA 4CDQA 4HPKA 1WA4A 4AQ2A 1QGLA 5LA0A 1OUXA 2ZGLA 2PA7A 2YROA 5LK7B 4RA0A 1RXGA 4LITA 2W91A 2DCZA 3RZHA 1VAMA 3RGBA 1RUI3 3V64A 2GC1A 3WW1A 3ZDSA 2WNVC 3J8F1 2PAMA 4CVUA 3KV6A 4JGZA 4MVTA 5BNOB 5IFTA 2JXAA 1ENSA 1RVF2 2W08A 4IV3B 1A34A 3K77A 3T2OA 2D6LX 4LK6A 2BJSA 1S4CA 1RYYA 4NPMA 1ST8A 4QQ2A 4XDPA 2BERA 3PTRB 3GJAA 4BE3A 4ZHNA 5A1LA 4JTOA 1GNZA 2R7EB 3VKNA 1N3OA 3VHOA 4LE4A 3EHKA 3OBZA 4BPZA 1MS3A 2MPFA 1IGOA 1L7QA 1OKOA 1Z7S1 4E4HA 1ULFA 4Y20B 4MXVA 4BQ2A 4E9KA 2B7YA 3U1XA 4Z8BA 2XJTA 4CDQC 3IWZA 2RMU2 4LJHA 3EO6A 3K2OA 1UAIA 4YARA 1PIV2 1C8M2 5FAXA 2W0XA 2ENRA 4XTMA 2VD7A 2OKXA 2ERFA 4J6GA 4JRLA 2I74A 1WW5A 2ZKLA 1ULEA 5KXCA 2YZ4A 1Q8QA 2Y0IA 1WZXA 3BOPA 3KT4A 4MADA 4P9LA 4BH9A 3BGAA 1DZRA 4L99A 1RUF3 1JN2P 1JUIA 4LBNA 4R9DA 4R8HA 4YG6A 5J96B 4HKOA 3ZSKA 2HWC2 5DQ0A 3MIHA 4P9WA 1GZ9A 2WFF1 1MS9A 1F2NA 2QQVA 4IGQA 2Z79A 4RYDA 4COZA 3MIGA 1JZ7A 4KU8A 3ZKYA 1OPOA 3LIHA 3D4KA 3NV1A 1RUOA 3CLPA 1LHOA 2ZX2A 4CDWB 2DV9A 1ND2B 4NMIA 3UYJA 4CE8A 3I2DA 4QX7A 4FVVA 4LBLA 3NJXA 3DL3A 2WS91 4YG3A 3VDAA 4D6SA 3APBA 1KFUL 1LHVA 1RTVA 2R6QA 3J7MA 3WHTA 1SG3A 4I0WB 3ZXGA 4GZ9A 1ZYBA 2VZUA 4I3PA 2WO3A 4LO4B 1W6PB 2ZKNA 4UWDA 4LA2A 5A7OA 1XNKA 5GLZA 1J59A 2HEYF 2EIBA 1UIKA 5FYBA 4DB5A 3AFKA 4XF3A 3LDKA 1ZVFA 3IM0A 2H6CA 3POIA 3OTFA 1VBA1 1W05A 4AI8A 5IK7A 1SLCA 4EN7B 5FUNA 2J1TA 2VPVA 2R32A 3I7DA 1QQP3 1FNZA 5CBLA 1PGW1 2X53S 2XR4A 3GF6A 1YJLA 2VJXA 3NV2A 2VOXA 4WM7C 2QDNA 1REEA 2Q1FA 3PUAA 3ZFEA 2RS53 5FZBA 4XUNA 3S57A 3MICA 3JQWA 4HXCA 1LGNA 1UCXA 4EN9B 3ZSLA 1WCKA 4N9IA 2PLV3 3JB8A 1V6LA 5FPXA 1WW7A 1QOSA 1MS1A 1W9WA 1ZX5A 2VUJA 4PF5A 4FOYA 3WCSA 4AHXA 2JDMA 4JDNA 3U14A 4CDWC 2BZDA 4Q4Y1 4Q0UA 1COV3 1RUH1 4DS0A 4BMEA 3T0DA 1CJDA 3VD4A 4IEZA 4IQPA 4Q26A 1KEXA 3ZFFB 1UNBA 1IZ3A 1CIYA 1MZEA 1SZBA 1Y4WA 2SBAA 3WF2A 5LEJA 1Q43A 1AJOA 2BRTA 5EQUA 5LWBA 3WW3A 4KI5M 1TME3 3GXUA 1FMD1 3MO4A 2DDUA 3D8CA 1S2EA 3ENRA 1RUG3 1NQDA 5FO9B 1RGSA 2WLQA 1W6MA 3N9LA 1PNFA 4UW3A 3ZXFA 4CU6A 1WLDA 1C1LA 2W39A 4M3CE 3FLPA 4CDXA 1OA3A 2UY8A 1VR3A 2CV6A 3G6JB 4I09A 4LK7A 3ZYRA 5CISA 1R081 5F2WA 2VMHA 2NM1A 1IKPA 4G9SB 4GB33 4LA3A 5E6HA 2EVXA 4PCRA 4NIIA 3JBG3 3K3OA 4ZKTB 4QDQA 1QJFA 5I8YA 1RHI3 5C9AA 4LT5A 2JG9B 2VQUA 5IW0A 1NCRB 4YWAA 3O1UA 1LB2A 2IXHA 4H2AA 4I3GA 3A22A 4FPHA 4KBBA 4HMZA 4QX5A 2Q8DA 3J8F3 1UOFA 2C4XA 3ZVXA 3BTZA 3HBKA 3LFIA 3PU8A 5DPNA 3P6BA 4LHNA 2VY0A 4IEWA 5EFUA 3SEPA 4EWDA 4XVHA 5GLVA 5B4NA 1E5HA 3KM5A 2ZOEB 1OD5A 4L0PA 1XNAA 3OGGA 4IE7A 4IEUA 1LGCA 1POQA 1OOPA 2JE9A 3I3DA 3SXWA 4COWA 2VW2A 1KGYA 2QQIA 1IQAA 5F3CA 1CAUA 4HG6B 3OBTA 5FXZA 1O4YA 4K6BA 1YLLA 1KS5A 5D8AB 4EN6B 1FOD3 4BIOA 2BBVA 1HRV2 3VZNA 2JDAA 3MIFA 1ZZBA 2PHUA 2A6VA 3O0XA 4W65A 4Y1ZA 4A6SA 4DQAA 4EV0A 5JPNB 5FP7A 3AL6A 3OG2A 5HCBA 1KD7A 4CCJA 3J7HA 3KQ4B 2LUWA 2XOMA 1R082 3P3PA 4OHWA 1VMHA 5FZ1A 1J83A 4TN7A 1MACA 4K20A 4UAPA 3THPA 2HLEA 3NKTA 3CBNA 1G8WA 4U36A 4FQZA 2TNFA 3OOXA 4I02A 1W03A 2V72A 4NIHA 1AR62 1BMV2 1QF3A 2WJSA 4YZ5A 4KWKA 3H1WA 1UW8A 2FQPA 3RSJA 2HWB3 3VDDA 3WXPA 2Y6GA 4YM2A 2DVGA 1H8TB 3B69A 2W5FA 4EWEA 3T09A 5BYNA 5CKNA 3TBDA 1BKZA 3E6DA 3JZVA 3T3YA 3ACIA 1YFXA 5F8PA 5GM0A 4WVZA 4QKFA 3SH3A 4BYYA 4WM7B 4KBZA 5FY7A 2XKPA 4OHXA 2JKBA 1AYN2 3W5MA 2XJUA 4TLGA 2QQPA 3T30A 4E4SA 1JODA 2D5HA 4XFIA 3KV5A 1JTZX 4XURA 3WT3A 1X82A 3D0SA 4R9CA 4YZ3A 5GZEA 4AI3A 2IWGB 1ULOA 3HEIA 4XFCA 3USUB 2XB6C 3B7MA 3WOGA 2VR4A 5JSOA 2UWBA 2N7GA 2HWF2 3GALA 5LRSA 5CNAA 3O1RA 3MZHA 5C4WA 3MGUA 3ME2A 1RUJ1 5E8AA 3T1LA 1COV2 4YW7A 2JDNA 2QDRA 3NO8A 1VLNA 1W99A 1PK6C 4X8PA 2MEV3 4C1WA 4ES9A 3FHQA 1K5JA 5FIXA 1VP6A 1Z78A 5KXEA 1B09A 4BA6A 1AYM2 3HQXA 1BQPA 1H8TC 4UFKA 5FREA 2C26A 4Q1PA 2EA7A 3K4ZA 3BUCA 4Y1VA 5BNOC 5K9YA 4UBGA 1YFYA 4IV3C 5FZ9A 3LFMA 1UOBA 4MYEA 1HRI1 3E5UA 3U78A 5L7OB 1F5JA 1IS3A 1WLWA 1LESA 1YC61 2HWD2 1FPN2 2ZGMA 2OIIA 1A8DA 2HWF3 1AF9A 2P5BA 4ARXA 2AR6A 1Y43B 2AACA 3DKQA 1SLTA 2OQ7A 3IZOA 3PHMA 5FZOA 4CEYC 1JYWA 1DQ4A 4AZZA 5L19A 2Q8CA 2RM22 1Q8SA 1LODA 5DAWA 3GCXA 3I49A 2G19A 4PI2A 4LHLA 1AR63 4JDOA 2BQPA 2AH2A 2VMFA 1ZREA 4XJZA 1K12A 5KXBA 5F7UA 4CU7A 3AM2A 1G86A 5J7MA 1F4HA 1RUE2 4JQTA 4RQPA 3V0BA 2Y6JA 1KFXL 1HW5A 2ETEA 2CDOA 3WNNA 1AHSA 2Y33A 1LHUA 5FZEA 2R061 2ARXA 5FPUA 2D6KA 2J1UA 4LORA 2F6BA 2EF6A 3I3EA 2OX0A 3R6SA 4RL7A 2VMDA 4MGIE 4WVMA 3TEXA 2QUOA 2XKOA 2IXCA 1W8TA 2R071 1EAH2 2EIDA 2WQZC 2ZGTA 3DN7A 4GALA 2HWB2 4JGZB 5E16A 3JQXA 5FZFA 3M2MA 1CAWB 1CONA 4AGVA 3ZR6A 3I4IA 4LO8A 2ZGKA 2DVFA 1QEXA 1IKQA 4FFHA 3RMYA 3AYAA 3MV11 1CQ9A 1PGL2 3WR0A 4GWIA 2ZBJA 2ORXA 5ANQA 3UT0A 5DUUA 1WMXA 5HBAA 4DUWA 1OVPA 4MXWA 1AR71 1R083 5C8WA 2BGOA 4PHZA 3Q8FA 4FFGA 2WNUB 3I2HA 5JWPA 4CUAA 2B46X 3SITA 2RM21 2QJVA 1VBD3 4URAA 1ND3B 3VUOA 1W39A 4IEOA 3USUA 2DTYA 2P34A 1YEWA 4DXRA 1S0CA 5DUWA 4MGKE 2JG8B 1OKQA 2XG3A 1RHI2 2YY1A 4QXHA 1DF0A 5D2AA 5CEHA 2VECA 2ORZA 2NYYA 3C7FA 4FSJA 2VVEA 4XF0A 4CCEA 4WVVA 3AKRA 2E51A 1BCXA 5FJHA 1UN1A 3AJZA 5FJKA 2CWMA 4DXTA 4EWAA 2A6XA 1SQ4A 1OC1A 3CZJA 5CA6A 1DIWA 3IMNA 1D4VB 5DZGA 5LY2A 3KD4A 2WAOA 4MHRA 1R093 5CKQA 2ZEWA 3CJIC 3USSA 3W9AA 1S2BA 1V9U2 2TUNA 1YHFA 4WZCA 3NSTA 2EALA 2R1BA 3N4MA 3OBAA 4NRMA 4BQ5A 4DRRA 1HV1A 1LOCA 1WCDJ 1WBFA 3UJOA 1ALYA 2CL2A 3ZSJA 3LEIA 2JIGA 4QM9A 2Y6HA 5C4WC 3WHUA 3WG4A 4RGKA 4PIZA 3T2PA 5E88A 5T5PA 1G9AA 1RUI2 2Y26A 3E5QA 2ZGPA 5ABJC 3D0JA 4XAAA 5L9RA 3VZJA 4A7ZA 4AFDA 1H0BA 2W95A 3O1VA 3AX4A 5FP8A 2BWAA 2DUQA 2FZ1A 5FZAA 1RHI1 2ATFA 2XLAA 4O9EA 5D8AA 2WDBA 4F3JA 1AJKA 4LNVA 4XUQA 5KXDA 2EXHA 3ALQA 4GB31 2RS11 4BZ4A 3H8OA 1MQTB 5CFCC 1GWKA 4BU2A 3UNPA 1U5YA 1W6QA 2BOJA 3HWJA 3GGLA 3OJBA 4QT6A 4XPVA 1PZ8A 4MGSA 5CKMA 3SHRA 4ASKA 2G9FA 3FFQA 2K9ZA 1QJX2 2WQ4A 1O6UA 2WA4A 1H9PA 1YQ8A 4ZU7A 4FAHA 5J37A 2WYSA 3WV6A 5LW9A 1YFWA 4XFBA 4YVSC 4AI1A 1FATA 1XU1A 2GNBA 3KGLA 3QBQA 5LA2A 3SLIA 1V6JA 5A3MA 3RZGA 2Y60A 2WO1A 4QGMA 3RRDA 2XBO3 4CPBA 1ZRCA 1UY2A 1VB4A 4BDVB 3I2KA 5JMCA 4RGAA 4IEPA 2UY9A 1ZRRA 3K4DA 1MZFA 1RMU3 2GH2A 3ZN5A 3BPSA 4QX8A 1WLCA 5JXHA 1OT5A 3VBFB 3KMHA 1HJFA 2CWSA 3JXSA 3WP6A 4AG4A 3AK0A 3ATGA 5D8AC 4ES8A 1QJZA 1W6MB 2GZWA 1W8UA 1QQP1 3VBRC 3SQOA 4AYUA 5AVPA 2G1MA 3HR9A 2DCTA 2J1VA 4K1ZA 3K48A 1C4RA 1E5IA 3Q8AA 4PLOA 2QTWB 5FKBA 5HPOA 4YW2A 5C7GA 2PELA 5BUVA 5KHHA 1OOPC 3AC0A 4HK9A 1UZVA 4WV8A 2P3KA 2RJ2A 3GYDA 3CDZB 4QQHA 1FMD3 4EZHA 2HWC1 1HRV3 2FMYA 4Q4X2 5CU1A 2Q30A 2FD8A 1PHMA 2V5YA 4AEDB 1BHGA 2TBVA 3R4SA 1JHJA 5FZLA 4AQSA 1CPMA 5A32B 1GWLA 4Q5OA 3UGFA 4HSLA 1VIWB 4AVBA 5FBZA 4FOQA 1JYNA 2XBO1 3I2OA 2VBBA 1H9WA 1YRZA 2G9ZA 2ZZJA 4FCAA 4JHZA 2VZPA 4NHXA 1JYTA 4PI0A 1OBNA 1DGRN 3SC7X 4X6QB 5T52A 3DGTA 1O91A 2FZ2A 1LKNA 1QXRA 3AL5A 1J3QA 1UKRA 3MW3A 3WLUA 5BNPA 4KNCA 3PNAA 3WQ7A 2Q5TA 5FQ0B 1VBB3 1V6KA 4N7UA 1VAKA 1UY0A 3CIHA 1H2KA 1U0AA 4LBQD 1RUF1 1RL3A 2CAUA 5GJ6A 1NE4A 1H1MA 4QHZA 2EAAA 2YBKA 2QCSB 1YJKA 2VOVA 3KF3A 1DCSA 2D44A 2VOKA 3WUDA 1RC6A 3AMQA 4DRVA 1IOAA 3AZVA 2ZEZA 5FXXA 4XFGA
chains in the Genus database with same CATH topology
1RUE3 2Q1MA 3AZZA 4N43B 4QXKA 1KITA 2PQQA 4B8EA 3WDVA 5J09A 2W68A 4INDA 5GKAC 1L3JA 4FPEA 3SH5A 1AVBA 3AMMA 4N53C 5T54A 5KBFA 2CAVA 1UU6A 1JH5A 1WCSA 3KCYA 3M1HA 2WL1A 3NAPA 3W59A 2BVBA 1RUC3 4BLJA 4K40A 1X8EA 5JSRA 1ZRFA 3AP9A 2VULA 2PLV1 3QOPA 3ROUA 2PTMA 4MGZE 3H1MA 4XF9A 1J1LA 4KL1A 3AYDA 1NCRA 1PK6A 2ZMNA 3IDCB 4D94A 4MX3A 1S0EA 2ZA9A 1J1TA 3MFAA 3TOJA 5JIAA 4D3WA 1HQLA 1Z0HA 2V73A 4JTNA 1DQ0A 2I07B 3HD8B 1FYUA 3M3CA 3FLTA 1O5LA 5KC5A 4FTBA 1Y9QA 4SBVA 2BNOA 2D3PA 1B35C 1S0IA 4F83A 5BNOA 5GLWA 2IC1A 2WIIB 4AQ6A 4B3NA 3ZFFA 2XL7A 1VBE2 2R30A 3ES4A 1DLLA 1HX6A 1MS0A 1VBC3 1X50A 1XNCA 2IZWA 4JGYB 1RUD1 1WGPA 4N9HA 3ZO0B 1PO13 5C6CA 4NPRA 2PLV2 1FX5A 1W6QB 1YNAA 1YIPA 2DCYA 1LGBA 4H7MA 4L97A 2WFF3 1IPKA 3VL8A 1HXS2 4L11A 5C33A 1DZTA 1CAVA 3JD71 4E4ZA 1ZBE3 4CZSA 3S30A 2PYTA 1WMEA 3CJIA 5H9SA 2RS31 4RHV3 5IK4A 3GNEA 2P2KA 4L8QA 4RS5C 3ILRA 4YYOA 1O3RA 4Q4W1 4JC1A 1ZZ7A 2A71A 1HIXA 1LRHA 2PHTA 1YIFA 1AR61 4MV2A 2GNDA 3AXDA 4Q4V1 4YGCA 1SLBA 1TNFA 2A6WA 2IXKA 4RR3A 2IXIA 4OI1A 4DFSA 1CVNA 1XU2A 4Y24A 4AF9A 4PBOA 1O7FA 4AFCA 2XVGA 5AC91 2B9UA 4FTEA 1ND2A 3GBFA 2GH8A 4N7IA 1DDLA 2D5FA 1PO23 3NAPC 4OHVA 3SNMA 3ZYPA 4N43C 2ZS6B 5DZFA 1A3KA 1XYNA 2PFWA 1OQEA 4FT8A 3E6CC 2R073 5DG2A 4LLFA 4WM7A 2P17A 2WT0A 4E4DX 4IEVA 4QD2A 3KLSA 1O4ZA 1AXKA 4LUKA 1DG6A 4NHLA 1QNWA 4FPKA 4PDWA 5I0UA 1U12A 2P37A 2RS32 4XZPA 4EJRA 1ONAA 2WSVA 3JBG2 3KS7A 3TN91 4XW3A 2DU1A 4AVVA 3UV9A 1SACA 1ASJ1 5C8CB 4WZFA 4Q4W2 4R52A 5C8CC 4GH4C 4R9AA 5JIUA 4JGZC 4KGGA 3H3ZA 4QU2A 2CYFA 1JW6A 1BBT1 4XJ9A 1RJ8A 4LO6B 3AP4A 4LULA 1PIV1 1LOAA 5AC92 1FAYA 2NN8A 4NN0A 1POV3 2DWRA 2G4IA 2XWBB 2NLRA 3BTAA 3OY8A 2CNAA 4RSUA 3O14A 1O3TA 1MVEA 1D0GA 5CFDA 2ZGQA 3V0BB 1AR91 3QACA 2D3SA 4PDWC 2YDEA 1UZYA 2P3JA 3I8TA 1UF2C 2ZMLA 2GNTA 4XILA 4B4RA 4D7YA 1VBE3 2R062 1H2NA 4RS5A 3VKFC 3BCWA 1BBT3 2B45X 3VBHA 3AP5A 4LBMA 4Q2FA 3WW4A 1H8VA 3H7JA 3ZYJB 4LLOA 3UL2A 5C9AB 4HETA 1DGWX 1SEFA 3EBRA 2EXJA 3BB6A 4E2QA 3SMHA 4HVQA 5BNQA 2EXIA 2D98A 1UZZA 1MQTA 3VZOA 3LB9A 1JUHA 1D4M1 4LBJA 5GZGA 4MH0E 1OLRA 2OA2A 4B4PA 3WP3A 4N43A 2DCKA 3FZ3A 1FI2A 1NA1B 1SDWA 2Q4SA 1G6NA 2VH9A 3R05A 5T5LA 3FX3A 4AW7A 1AR92 1X33A 4JRAA 2QFEA 4QPIA 5E1RA 4AHZA 3ELNA 3HN1A 1SCRA 3UJQA 3Q9OA 3L9JT 5T50A 4QHBA 1Q5OA 2P3IA 1K5MA 2UURA 3DPRA 3VBOB 5AC93 1Y3TA 1ND2C 4XE9A 2Z42A 2A6YA 3NWKA 1XE8A 2OVUA 4LE3A 2PHFA 4CEWC 3FUOA 2XUMA 3KT7A 1S0FA 2YUEA 1Q8PA 4RFT0 1A6CA 2B5HA 1GSLA 2GALA 5EWSA 2R041 4P9XA 1Y7BA 4FOWA 5F9TA 1LENA 1CR7A 3H7YA 1NCQC 2XGXA 3IT8A 4NVPA 3B02A 2Q0AA 4YW5A 2ZGOA 4ZXKA 3B94A 2DCJA 3VBUC 3DPRB 1PVC1 3I54A 4XYXA 3VBSA 2OYZA 3PMSA 4Q8KA 1DYPA 5LK5A 2UYBA 4HANA 5IK5A 3N7LA 4HSJA 4MXWB 1PO11 4GA9A 4LEJA 1I3HA 3VBOC 1NOVA 3I59B 3FWEA 5J3UA 2HWD3 4Q8LA 1VBA3 4EN8B 2WSUA 4AEKA 1LHNA 1QJU2 1N1TA 2DFBA 2NMOA 4LR4A 4NR1A 5B2GB 1X8MA 1G9FA 5K0UA 2MHFA 1DGWA 1CAXA 3AZXA 5HXVA 2R0HA 1REFA 1ZA4A 2WNVB 2KA3A 1XNBA 4Y22B 1NCQB 1VRH1 4GQ7A 4M3CB 4YW1A 5A33A 2WZR2 4HN1A 4Q4Y3 3VBUB 4OHYA 4XF4A 4BHPA 2V09A 3BOWA 4YG0A 2WKKA 5CADA 1H30A 1HKDA 4K21A 3MF9A 1VJ2A 1UPSA 2CGNA 5GLUA 2E7TA 1AYM3 2GN3A 3CEWA 3L2YA 1LR5A 1PO12 4Y22A 2WNVA 4LBKA 1SBDA 5FLIA 3C3VA 1SFYA 1CAXB 4H14A 1TMF3 1KDKA 3ECQA 1NY71 4Y5Z0 4R4ZA 5ABJA 3U07A 2D3RA 3M3QA 1CGPA 3H50A 4BCUA 1GYKA 1DQ5A 2HEVF 2DYCA 3LWCA 5E89A 2O8OA 1RINA 3VBRB 2RHPA 2D6OX 2I2SA 1CJPA 2WS93 4W6WA 4HPKB 1AYN3 3WG1A 3PTYA 3RI9A 3N35A 3J26N 4I2OA 3ZXJA 1LOBA 1YI9A 2MNGA 2QKDA 1NXD1 4CEWA 4Y1UA 4O9GA 3AMHA 1ZZ9A 1C57A 3HIFA 5IT6A 3ZPYA 3GZAA 1HRI2 3AXEA 1ULGA 5LRRA 1R1ZA 2WNEA 2HWD1 3RPQA 2A73B 2DU0A 1LHWA 2XJVA 4XHXA 3SCFA 1ZBA1 1QH7A 4GKXA 3CO2A 3O0WA 1BJQA 3J8F2 4XIOA 2XVLA 1RVF1 3ZN6A 5FQ0A 3H0OA 3SCHA 4J1WA 3A0KA 4Q29A 1PVC3 1PM7A 2VNRA 3HT1A 1YO8A 1OA2A 4XJ8A 4P9YA 4URTA 2FHRA 4GKYA 1IPJA 1BZWA 3TWIA 2GC3A 5JOWA 2JEMA 5T5OA 1EAH1 3B9IA 5ACA1 3ZXKA 4HBNA 1URXA 3WG3A 1O5UA 1Z7S2 3N7MA 4AK3A 5A32A 5DDJ2 4Y20A 1C8M1 2OUHA 2WZPP 4HL0A 2Z69A 1TMF2 1JXNA 4AXOA 3KCXA 4Q0SA 4YM0A 3FLRA 1J3RA 3LKJA 3WQ1A 4FXKB 3AP6A 3D6EA 3H1YA 4GMP1 4OLLA 5AVAA 2GN7A 4OZXA 4Q27A 3AMPA 4S2HA 3WP5A 2WFF2 1ULDA 3G7DA 3EJKA 4MLOA 1IOAA 4QQOA 4X6RB 5C9AC 4XETA 1PZ7A 4KU7A 4TSVA 5LEKA 5CFDC 2CGPA 1QJX3 5JR7B 1UPIA 3TB0A 2OW4A 4XMAA 1C3HA 2A3WA 3KB5A 4ITCA 1OQ1A 3MLLA 2XH6A 4P9JA 2ZGRA 4JQRA 5GLTA 2ZHNA 2WZR3 2R043 3VHRA 3WINE 5I8TA 2DUPA 3MIBA 1HXS3 3GZUC 2VU9A 5KWRA 1WD4A 1WMFA 1NQJA 1PK6B 2YHJA 5JI7A 5T3NA 2E6VA 2OZJA 3AZYA 1ENQA 1VALA 1UU4A 2ZJCA 1X7NA 5DDJ1 2ZX3A 1S1AA 4WM8C 1SLLA 3LSDA 1GQHA 4TLFA 1WLTA 5F5QA 5H9PA 3EQEA 2E7AA 2JICA 1EV13 1BEV3 3R4DB 1I5ZA 2O8QA 1IS6A 2PHXA 3QLQA 2X29A 3NW4A 4JAAA 2WLPA 3GZTB 1TQ5A 5DDJ3 4PLMA 4QPGA 3N36A 3ZFEB 1ULCA 2NPIA 1O3SA 1MEC3 2I45A 3GHNA 5FMOS 4Q4V2 2VW1A 4PIXA 2MEV1 2W52A 4Q4W3 4DZGA 4FXGB 4DPNA 3FBMA 3WY6A 2RS12 1WW6A 4ISRA 3B3QE 4F7ZA 4XHBA 1AL21 4LO7A 1PIV3 2RS33 1QNYA 3ZN6B 2IXLA 1TE1B 3LAGA 1VBD1 1OLQA 2YPJA 5F6LB 1YCIA 2D6NA 4CDUA 5BNPB 1BVVA 1SMVA 4JV4A 4GMP3 3B01A 5FFOC 2IFRA 2IFWA 4IEQA 2VVDA 4BMBA 3IDEA 1GV9A 4RGGA 2EAKA 3PLQA 4AGRA 1CAUB 1U5IA 4HKLA 3S0MA 4QPGC 3WP4A 3RYKA 4XIKA 4ATEA 3M8LA 4CEWB 4UW6A 5F1RA 2BW8A 3RWNA 3POYA 1PO22 1QJY1 1GZWA 2AUYA 2D40A 4YFZA 3M4FA 2BEOA 4Z2WA 4META 2X5IA 4TZDA 4BOWA 1D2SA 1CN1A 1ZRDA 4B7KA 3NVCA 4Q4X3 1WMDA 4TWTA 1MEC1 1VBD2 3LA7A 5FMOL 4XBQA 4XQWA 3RI8A 1WBLA 1J3PA 4NO4A 5FLHA 4CEYA 1TME2 4UXAA 4YVSB 1EV11 2H0BA 1BYHA 3WDUA 1OFSA 1RB8G 1IHMA 3ZX7A 1POV0 2DF7A 1UL9A 1RUH2 3UKNA 4WVMB 3ILNA 4H3WA 2Y0OA 4IV3A 4OVEA 1H2MA 1W6NB 5JSPA 1DQ1A 5JOXA 3MFCA 1DZQA 3WQ0A 2HKXA 2VOWA 5IUQA 4GULA 1FMD2 4AI0A 2BVVA 1V00A 5FRAA 1XQNA 2C1FA 2DTWA 2XJSA 1OPMA 2RS52 3LZZA 4HKWA 4IV1A 4QT6A 4TYSA 3V0AA 5ACA3 3AYEA 1UIJA 2JDZA 4HLTA 1QJY2 4CP1A 5I0RA 4P9IA 2ZTNA 2ZHMA 5C8CA 2YGLA 4Z07A 3H3UA 4CDXC 5FOBB 1VBC1 4S2FA 1MQTC 3UKTA 5CFCB 5K8SA 3ZMNA 2B42B 4DY5A 4ORFA 2BYVE 4Q0QA 4Z82A 1QU0A 3QD6A 4K8FA 1V70A 5FCCA 4P14A 4L2NA 1TME1 2JECA 1F31A 2RR11 4ONUA 3M7AA 3HMYA 1EV12 4Q1RA 3BALA 1W0OA 2XVKA 3BODA 1EPZA 1W6PA 1H4GA 5DG1A 1OA4A 1COV1 4NHKA 3MDPA 2YMZA 1PZ9A 1QXPA 1DU3D 3VZLA 1YWKA 5GALA 5I0TA 2JE7A 2HEWF 1AR82 1A78A 1AYM1 1M4WA 4YM1A 1HRV1 4ASLA 5EV7A 2R16A 2R042 3WDXA 3E6BA 2JD4A 4V1PA 4ZU4A 3T1MA 4SLIA 4LBQA 4I0AA 4LO5B 3KT1A 5KHGA 4XF1A 1FPN1 4MSVA 1NZCA 3PVEA 1PVC2 2WT1A 3AKSA 3MYXA 1C1FA 1C5HA 2H0VA 3FC0A 4COUA 1YFUA 4IETA 2WT2A 2TEPA 3RQ0A 2D6PA 5D1IA 1KJLA 5SV8A 1H1IA 2GDFA 1ND3A 4AEDC 2JG8C 2WWSA 3EXUA 2WFPA 4G3YC 4Z1VA 1YYNA 3BPZA 3RJRA 4FPLA 1RUE1 3U4XA 3VHPA 3VKOA 2VMGA 4XXAA 3D82A 1X36A 4CP0A 2GMMA 3V0AB 3MW2A 1VBB2 4XBLA 3GBGA 2WA3A 1QY4A 2C0ZA 1N3PA 2R072 2PHRA 2VXRA 1ZBE2 4K1YA 3MLJA 1AR81 1IS4A 4MUVA 1CIWA 3UKVA 4E27A 4KG0A 4AGGA 4XFAA 3IDBB 4LUMA 5KHKA 3V65A 1NLSA 4AFBA 1BXHA 3CL1A 3UK9A 5K0UB 1AXZA 5EXOA 4YRDA 2HWE1 1LJ7A 2A5ZA 5HCFA 4Y1YA 1RUJ2 2A75A 1UU5A 2ZHKA 4XJUA 1GFF2 1W6OB 1M06G 1V6NA 4AFAA 2RJLA 2PHDA 3VBHC 3T2TA 1RUG2 2Q1ZB 5H9QA 2A3XA 4XQDA 3QH7A 2IXJA 3VBUA 4A7YA 2YGMA 1QHDA 2UU8A 4AQTA 2B39A 4K9SA 2BUKA 1C28A 1GZWB 1FPN3 4B7EA 5EJ3A 3AYCA 4Q0PA 5L7OA 2JG9A 4H7LA 4YNIA 1JYCA 1AXYA 2LTNA 5L73A 1FXZA 3AJYA 1PVXA 2VUAA 4XDQA 3J4UH 3LCPA 1LECA 1KRIA 1RMU2 3FMGA 3LA3A 1GZCA 3B5LB 2QE3A 3MIEA 3P3NA 3I59A 3MW4A 4PJYA 1RJ7A 1G9BA 2K0GA 3ZFFC 5J98B 4KH9A 4AVCA 1PNGA 4I0BA 1UD1A 4B29A 1CD3G 2XLGA 1QJY3 4YGBA 1FT9A 1SBEA 2A6ZA 4COYA 1FNYA 2BPA2 4YW3A 4C90A 2ZGSA 2H6BA 4JVAA 3VKMA 1CESA 4L9BA 2HWE3 1ZZ8A 4WM8B 2OUJA 3AZWA 3MIDA 3GHMA 1NXMA 1AX2A 1IS5A 2DURA 3WZ1A 2C5DA 4UBHA 4DOUA 1W0PA 4AE2A 5AFBA 4FTSA 1UKGA 4XFHA 2CTVA 2B8MA 2BFUL 3WDYA 2JENA 4DMIA 3KGZA 2YYOA 2JG8A 1DHKB 5JPMB 1MZ6A 1FV3A 1GNHA 4HFSA 4L92A 2NQYA 4QPIB 4G4FA 2VGDA 3NV3A 1S55A 4RS5B 4DNY<