3AYAA

Crystal structure of galectin-3 crd domian complexed with thomsen-friedenreich antigen
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
135
structure length
135
Chain Sequence
MPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for distinct binding properties of the human galectins to thomsen-friedenreich antigen
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
molecule keywords Galectin-3
total genus 31
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ayaA00
1ENSA 4LBOA 2EXKA 2RHPA 3O0XA 1FNYA 1Q8OA 2WSVA 4P9YA 1DQ1A 1AVBA 3FUQA 1F5FA 1DYKA 2VH9A 1V6IA 1GBGA 1W6MA 4Q1RA 1C4RA 3AYCA 2ES3A 2ZMLA 1S1AA 1UL9A 4CRQA 1GYKA 3WNXA 1A8DA 1BJQA 2ZGNA 1AXYA 4XYXA 3RMYA 3WDTA 4K1YA 2AREA 2D3PA 2GNBA 4PQ9A 3TAYA 2E7QA 1OKQA 4XXAA 4UW5A 4BM8A 3VUOA 3AZXA 1IKQA 4FPEA 1S0IA 1G9FA 1N3PA 1S0FA 3VKNA 3UJOA 3V64A 3BOPA 4XJ9A 2HYKA 1C1LA 4C1XA 5DUWA 3RQ0A 2EXHA 3B3QE 4JCKA 1MVQA 1SBDA 1O4YA 1G9AA 3M3QA 2JD4A 1C1FA 2R1DA 1MS9A 1W6NB 2ZKNA 5IK4A 3MW4A 1VAMA 2PHXA 2WLQA 4Y1VA 3QLQA 2FMDA 1GSLA 1W0OA 2GALA 1RIRA 2A6VA 2YV8A 1FV2A 3SH3A 2WKKA 2JECA 1QF3A 4XIOA 2PHRA 1N3QA 1W6MB 3OYWB 1SLAA 1VALA 1UZYA 3N3HA 3RSJA 4HANA 3B9CA 2ARBA 4FOWA 1G9CA 5HCBA 5GLUA 2CTVA 4XBNA 3T2TA 2D3RA 1ULGA 1DQ6A 1MR5A 1V00A 1YXWA 1S0GA 3IMNA 3SISA 1LOAA 2FHRA 1VLNA 1DZQA 2WNEA 4Y1UA 4FPOB 4YGEA 2EF6A 3OPZA 4YW3A 1AX2A 3R4UA 1JYIA 3ZPYA 1MS0A 3OGGA 3PVOA 2SLIA 3AZYA 4M3CB 1Q8PA 1UKGA 1WCSA 4FPFA 1UZZA 4BLIA 5GZFA 1LENA 3V0AA 3SH4A 4YG6A 2CNAA 3D6EA 1KQRA 1JHNA 3HN1A 5JVVA 1IS3A 4WVWA 4XHBA 1BXHA 4GWMA 2AR6A 5EWSA 1PZ7A 5IK7A 3FUOA 4P14A 5KXDA 1D0HA 2PELA 1SFYA 4ATFA 5GZCA 2E51A 2OUHA 3CNAA 4YFZA 4L8QA 3ZSLA 4FVVA 2CYFA 2A7AA 2E7TA 2EALA 3FLPA 4XJZA 3RS6A 3V0BA 1WLDA 1WW4A 1Z78A 2XB6C 2ZGKA 4Y1ZA 3T1LA 1HDKA 2WT0A 3PVNA 1AXKA 2AENA 2UWAA 2ZAAA 1W6QB 3UK9A 1PZ9A 2JE7A 3ZSJA 4AVTA 1LEMA 2DVGA 5GLVA 3W59A 3WHUA 3ZSKA 1CJPA 1D2SA 3WLUA 4MYEA 3AYEA 4ITCA 1MZ5A 5DUXA 3GALA 4XXPA 5JDBA 4TYSA 4UW3A 2H0BA 4DRVA 1FATA 3C2UA 5GLTA 5F5QA 3WDWA 5T50A 1LGCA 2A5ZA 4LBNA 2NN8A 4Q8KA 3AZWA 3M1HA 5H9SA 3VKLA 2JJ6A 2LTNA 3WDXA 1FNZA 1QOOA 1KDKA 4AGVA 1LOFA 5GZEA 2OVUA 1G9BA 3WG4A 1LU1A 1NLSA 1NXD1 1JOJA 1MZ6A 1QKQA 2I2SA 1GNZA 2V5YA 3I8TA 1V6JA 2A6ZA 2ZGPA 4K20A 4AWDA 4BQ1A 1LESA 3INAA 3PJQA 1U0AA 1YI7A 3UL2A 1W6PB 3ZXEA 3BIWE 4XMIA 4Y1XA 4DRRA 1CIWA 1HQWA 1URXA 2D3SA 4KBBA 2UWCA 4R9AA 1QU0A 1G86A 1LGBA 2A3XA 2P3JA 2ZMNA 4LBQD 4Y22B 4GKYA 1CESA 2ZHMA 1UAIA 4SLIA 4YM1A 1CONA 1KITA 3LSEA 1AXZA 2DWRA 3L2YA 2A6XA 3VKOA 4H55A 5T54A 2DVAA 2DTYA 3WZ1A 2DU0A 1MVEA 4LBJA 1XQNA 4U2AA 1WW7A 1LHUA 3ASIA 3BTAA 1PZ8A 1GANA 4FPHA 2NMNA 4M3CE 3WVJA 3AZVA 2WSUA 4FQZA 3HMYA 3IM0A 4FOQA 1APNA 3Q9OA 4RA0A 4WV8A 3VKMA 3ZVXA 5H9QA 2GMEA 5CBLA 3IPVA 3RMXA 2VUAA 1JN2P 4ASMB 3NV3A 3OYWA 1CPNA 3WDVA 1N1VA 1WUVA 3OBTA 5GZDA 1GV9A 3VKFC 3H0OA 2EXJA 2R49A 1JBCA 2A3YA 4YZ2A 5F9TA 1V6LA 1CPMA 1F31A 4M01A 5KXBA 2NM1A 3O0WA 3QCWA 4ZKTB 4YM2A 3AK0A 1R1ZA 2P37A 2SBAA 1YRZA 3NV2A 4IQPA 4YGDA 5AVAA 5EYXA 5L73A 3NV4A 3O0VA 2ZBJA 5GALA 5T5OA 3WG1A 1BKZA 4GALA 5BYNA 1LHNA 4YG0A 4AVVA 1H9PA 5JOZA 2DURA 3WOGA 1DQ2A 2ZHKA 4PBPA 4YLZA 4F83A 4YW2A 1IS4A 2GDFA 4XTMA 3N7LA 4YGBA 3WUDA 1LHOA 3AX4A 3V0BB 3B69A 1LODA 1GNHA 4XBQA 2NMOA 3ATGA 3FFZA 4XDQA 4AGRA 4ATEA 1IKPA 1W6OA 2ZMKA 4R9DA 1LJ7A 4Y20A 5GM0A 5DG1A 5SV8A 2D44A 1DBNA 1LOGA 5T5PA 1LTEA 3SH5A 3KQRA 4CZSA 3AP7A 1GLHA 3AP4A 4BOWA 1KRIA 2VU9A 1GZCA 1QDOA 2A6YA 3OJBA 1MS3A 2R0FA 4FOVA 2OW4A 4JC1A 5IUQA 2PHWA 3A4UA 2R1BA 2W52A 3VV1A 3AJZA 4GXLA 4FPLA 1N1SA 1Z0HA 1N47A 4AGGA 1DQ0A 4Y24A 1LOFC 4FPGA 1QNWA 4Q26A 1WBLA 2GN7A 4AVSA 2DUPA 3AYDA 2LALA 2ZHLA 3MEPA 1S0CA 5CNAA 3AP6A 2TEPA 4PF5A 3ZSMA 3ZXKA 4W65A 4XE9A 5DXDA 4K1ZA 5HCFA 4FP3A 2JDZA 1MS1A 2ZGSA 1W0PA 1KJRA 3OBRA 2OUJA 2ARXA 3N7MA 1LECA 1W6OB 5T52A 1H9WA 5E89A 1A78A 2C9AA 3JUUA 1BZWA 4AYUA 4DPNA 2ZA9A 2AYHA 2DUQA 1WLCA 3NV1A 4XJ8A 1AZDA 3WHTA 2CY6A 1V6MA 2D43A 1LU2A 4P9XA 1UX6A 1BYHA 1LHWA 5T55A 4DFSA 1JUIA 4YM0A 1S0DA 1Q8QA 2JKBA 3AYAA 5T5LA 2VW0A 3R4SA 1BQPA 2W08A 1SLLA 1SCRA 5DUUA 3ZXFA 2CWMA 1Q56A 1HLCA 2DVDA 1S0EA 4YFWA 1DHKB 1WW6A 2AUYA 2CWSA 3U4XA 5CAZA 4XOGA 4XZPA 2EXIA 2KM2A 3O5SA 1MS4A 5DZFA 1Q8VA 2C5DA 2ZGQA 1IS5A 1Y7BA 3I4IA 5H9PA 4BMEA 1ULEA 3FLTA 1S0JA 4YGCA 5JLVA 4LBQB 4PBOA 3WV6A 1YIFA 2GMPA 2GN3A 3ZYRA 1QDCA 2ZGMA 1HQLA 4JRAA 5FREA 3SLIA 3ZXJA 2DU1A 2P3KA 2AH2A 4BLJA 3T1MA 1DGLA 2VY0A 4DS0A 2A3WA 4FOYA 2E53A 4LBLA 3IKWA 1IS6A 1QNYA 1CVNA 3BODA 4YM3A 4XBLA 5H9RA 5EXOA 1RINA 1SCSA 4OZXA 3ILRA 4YZ4A 3RG0A 4YZ3A 2XG3A 4D69A 5KXCA 1QGLA 3POYA 1WW5A 2P2KA 5DZGA 3AP9A 2ZHNA 1RITA 3PMEA 1AJKA 4Q8LA 3ZYPA 3MW3A 4PCRA 1EPWA 2ZACA 3N35A 4YW4A 2D6NA 5JOXA 1WLWA 2A75A 3POWA 4Y22A 3DUIA 1WD4A 2DVBA 4Y20B 1S0BA 1OFSA 3SITA 4U36A 1LEDA 1N3OA 2YMZA 3AFKA 3LCPA 4GKXA 1N1YA 3LSDA 1HKDA 2ENRA 4RL7A 4XJAA 5DUVA 3POSA 4YZ5A 3UJQA 2BQPA 1LOBA 1SLTA 4UW4A 4XILA 2R0HA 4WVVA 4XJUA 2GNDA 4XTPA 3WG3A 1MACA 1YYNA 2PHFA 3ILFA 4R9BA 2V73A 1ULCA 1UMZA 2DUOA 1FYUA 2DYCA 3NWKA 3RRDA 2D7FA 3A0KA 4YW1A 2VW1A 3R05A 1Q8SA 3W58A 1GZWB 1WD3A 3AXEA 3JU9A 4M00A 4Y26A 1KJLA 4C1WA 1CR7A 3ENRA 3ILNA 4HL0A 3GNEA 1W6NA 2E6VA 5GLWA 1FV3A 2D6PA 2GNMA 4DQAA 2P3IA 4ISQA 1ULDA 5E8AA 3N7JA 1O4ZA 1LOCA 1YO8A 1GICA 1V6KA 5JOWA 1VAVA 3HR9A 4YZ1A 3WCSA 3ZXLA 4UW6A 4XMAA 1ONAA 2DV9A 1UN1A 5GLZA 5LK5A 3WDUA 5CA6A 2A6WA 4FQ4A 1I3HA 4BMBA 5FRAA 1MS5A 3AZZA 1QOTA 4FPYA 2DVFA 3MW2A 1JW6A 2Z42A 4FPJA 3USUB 1GKBA 3AJYA 4Q1PA 2WQZC 3OY8B 4I30A 5JMCA 2P34A 4GA9A 2ZABA 1H30A 1V6OA 3WUCA 5IK5A 2NZ9A 1I1EA 3M3CA 3IPVB 2NP0A 4FPKA 4P9WA 2WJSA 3MPPG 3B00A 3V0AB 1G8WA 1JXNA 3KM5A 1LGNA 1WBFA 2CL2A 3N36A 1AJOA 5GZGA 1DYPA 2W68A 1GZ9A 1DQ5A 2A71A 1MS8A 3A0NA 3O12A 1DLLA 1CN1A 2YROA 2WT1A 2ZGOA 4ISRA 2YXSA 2EAKA 1W6PA 3TB0A 4Y1YA 3WG2A 2UURA 3APBA 1IOAA 1SBEA 2D6LX 4LBMA 2W39A 1FAYA 2AGSA 3M3OA 1SBFA 1G9DA 2ZGUA 2B7YA 3PVEA 2UWBA 1SLIA 4XJWA 4YW5A 3WCRA 2GNTA 3OY8A 2G4IA 2UU8A 4LBQA 4YG3A 5HCAA 1DFQA 3USUA 2ZGLA 3V65A 2DTWA 2Q5TA 2ZGTA 2ERFA 1KDMA 4ZXKA 5E88A 1JYCA 1OQ1A 2ZZJA 3AP5A 1VIWB 4GWNA 5EYYA 5CB7A 2PHUA 4FP2A 1A3KA 2YY1A 4Z8BA 1GZWA 1QMJA 1SACA 2VW2A 4K21A 4BPZA 5IT6A 5KXEA 3N7KA 1LHVA 1G7YA 3B01A 2WT2A 1TEIA 1QOSA 1DIWA 2A70A 1AX1A 5GJ6A 5JOYA 1F9KA 1W6QA 1LOEA 2PHTA 1UPSA 1ENQA 4FPCA 1ULFA 5DZEA 2D6KA 1FX5A 1SLBA 1ZA4A 3M2MA 3M3EA 3AXDA 3D5OA 3FLRA 1C57A 3D4KA 1DQ4A 3WDYA 1X50A 1AX0A 1V6NA 2NYYA 2YZ4A 4LBKA 1J1TA 4NOTA 1AF9A 3SNMA 2ZGRA 2D6MA 3IN9A 2R16A 5DG2A 4XHXA 2D6OX 4Q2FA 1SLCA 4R9CA 4Q27A 1LULA 4TZDA 5T5JA 4M3CF 3DGTA 2EIGA 4NO4A 1LCLA 1ZM1A 2JE9A 4WZFA 4M3CA 1ENRA 2VXRA 4XIKA 3FBYA 1N1TA 4CTEA 1CQ9A 5IK8A 1B09A 2GMMA
chains in the Genus database with same CATH superfamily
2RHPA 1OA3A 3VD7A 5FFOC 1FNYA 4GMP1 1Q8OA 4CDQC 1R1A3 1W90A 1AR91 4MH0E 3M70A 3M3IA 1RHI1 1TNRA 1BHGA 1DQ1A 5A3LA 4GB31 2IXHA 3ACFA 3VBHA 3NAPC 3TN93 4QU2A 4UAPA 1V9U2 1BK0A 2MEV1 3H3UA 5EIYB 2ES3A 3OGVA 2ZMLA 4G9SB 1M06G 4ZU4A 4Q4X1 1UPIA 4CRQA 1V70A 3KD4A 3WNXA 2TBVA 4EV0A 1AXYA 1GWMA 1RUG2 3WDTA 3CLPA 2AREA 3R4DB 4TN7A 4Q0UA 2JG8B 4OMCA 1OKQA 4LQRA 3P3PA 4FPEA 2FCTA 2RMU2 2XJTA 5ERLA 4CCKA 4CP9B 4BE3A 2R7EB 3AMNA 1PVC3 1N3PA 2WZR1 2H0VA 5IJRA 4COWA 1RXGA 2Q8CA 3SC7X 3UJOA 3VKNA 3BOPA 4XJ9A 2HYKA 5LBEA 4ARXA 4BWOA 5DUWA 3RQ0A 4KMQA 5FOJB 4QDRA 4XFBA 1BBT1 1O4YA 5LBFA 2VXJA 5FLIA 2R1DA 1W6NB 3LE0A 4YVSB 4QQHA 2ZKNA 1OT5A 4CDXB 3DEMA 1KD7A 5ANQA 2LROA 2Y64A 1VAMA 2PHXA 2WLQA 3K77A 3WEZA 5BNPB 2WS91 3GYDA 1W2NA 4RQPB 1W0OA 4GH4C 1WZXA 4CU8A 1E5IA 1FV2A 3CIHA 4CUBA 2JECA 2PHRA 3OYWB 4XF3A 1SLAA 2C9KA 1VALA 1RUF1 1SDDB 3AL6A 2ZAHA 3N3HA 4HANA 2ARBA 3WNMA 4FOWA 1G9CA 2OT7A 5GLUA 3VBRB 1ZZ6A 2CTVA 4JGYA 4QPGB 3T2TA 2YPDA 4BA6A 2D3RA 1BBT3 3KV9A 1O3QA 4HETA 1YXWA 2RJKA 1LOAA 2FHRA 3DXUA 2G9GA 2J1TA 3ME2A 5LZ6A 4YGEA 3OPZA 3WP4A 1UYXA 1WA4A 1PIV3 4OI4A 5K0UC 4KWKA 3MUZ1 2BRTA 4M3CB 1TMF3 3VDAA 3H8UA 2B39A 5L7OA 3WT3A 4LHLA 4FPFA 1C8NA 3WF3A 1VRH2 3SH4A 5AFBA 4DUXA 3I2OA 2CNAA 3D6EA 4QX3A 5IVVA 1OXCA 1IS3A 1QJX3 4MGQA 3JB8A 5F2WA 4LA2A 3RZMA 1UY3A 2AR6A 2Y6HA 3H9AA 1R083 3RYPA 4P14A 4NPRA 2PELA 4ATFA 2RR13 2E51A 4OZOA 3CNAA 5IVBA 3GZAA 5J48A 5FIXA 1H2LA 4N53B 3POGA 3NNFA 2WABA 3J8F1 4QKDA 1WW4A 5CFCB 1ZZBA 2YC4A 2ZGKA 3I2IA 3VBRA 3NNMA 1VMFA 1YFUA 3C7GA 4PHZA 2W94A 4FTEA 5FPXA 1PZ9A 3ZSJA 2VQTA 2VGDA 4XFHA 1D2SA 2GAUA 3WLUA 3PUQA 1QQP2 3B5LB 4O65A 1IQDC 2YDEA 4AXOA 5I8TA 4CEYA 1ZNPA 5JDBA 4UW3A 3ROUA 4JDMA 4PLNA 3RZHA 1JYWA 3C2UA 3JD71 1LGCA 3VBSA 2NN8A 1WLTA 5FAXA 2XWJB 3F2ZA 4NROA 5FMDA 3TEZA 1JU4A 1NOVA 2WAOA 1QOOA 4MSVA 2QQPA 3HJRA 4AGVA 5GZEA 2DCJA 3WG4A 1HV1A 4OHWA 5FZMA 4L2NA 3MFAA 3W20A 2JIJA 2DBIA 2ZGPA 3NRUA 4K3UA 4X8PA 3U4SA 1KS5A 1XB9A 3I54A 1A6CA 1R093 2J1VA 2O8OA 1W6PB 4FO9A 3ZXEA 4GMP0 1HQWA 1URXA 5FYVA 1LGBA 5ABJB 1XYOA 2P3JA 4LBQD 1X7NA 4GKYA 3K3NA 4SLIA 4X8NA 1CAUB 3PIJA 3C7HA 5FJHA 4WM7A 1WMEA 2DWRA 1CX4A 4LOTA 4BIFA 1ULPA 3MIBA 5FZ4A 3ZYHA 2RJLA 5FY8A 4GB32 1UY1A 1RMU3 3RDIA 3K46A 1EUUA 1PGSA 2JDKA 4XQWA 2DVAA 2K0GA 2F17A 1HQNA 1JODA 4EROA 3I3EA 2WFF1 2A1XA 1PVC1 3VBOC 4LMFA 2JDHA 3KF3A 4PJYA 1MQTC 3LGRA 1PZ8A 3DF0A 3WF4A 5FXZA 4FQZA 4D0QA 3HWJA 5FZ7A 4LHNA 4AHYA 3Q9OA 4AI0A 2W95A 2Q8OA 4FFHA 1BK1A 5FUIA 3RMXA 4MHRA 4AQ2A 1JN2P 4BYYA 1ND2A 3NV3A 2WZEA 2PLV1 4LOSA 4B29A 4XC9A 1AR61 4LKEA 3U1XA 4BJ0A 1OOPC 3WW2A 2WO2A 3UETA 2VCCA 2H6BA 3NNGA 2R063 1W39A 3LA3A 5JZGB 2Q1MA 2VZSA 2A3YA 1CPMA 3EHKA 1X33A 5KXBA 3QCWA 2QQNA 1FOD3 1R1ZA 5F3EA 4IQPA 3MF6A 2LS6A 1P8JA 3I7DA 4RR3A 3USSA 4RHV3 5L73A 3IZOA 3MFCA 2ZBJA 3O0VA 4Q4Y2 1ZBA1 5BYNA 2ZX3A 1LHNA 4LE3A 2FDGA 1US3A 2VMIA 1H1MA 2DURA 1AR63 2RS53 5AVPA 3RNSA 3IAQA 4BH9A 3VZMA 2ARCA 4YGBA 1F4AA 1LHOA 1UMIA 3DV8A 5FZKA 5J98B 5L9VA 3IDCB 1JYVA 4Z82A 1LODA 1JZ8A 3VBRC 3GBWA 2JDAA 2XUEA 4AGRA 1HB4A 4ATEA 4AVBA 5JCTA 2XLGA 1RYYA 5ABJC 4Y20A 2RS11 1UXXX 2D44A 4Q4X3 4D94A 1LOGA 1ZVFA 1QY4A 5C9AC 1J84A 1KRIA 2YU2A 1RUH2 2VU9A 1GZCA 1JYXA 3O1OA 2FDFA 4K8RB 3NKTA 5C5TA 1PM4A 1N1SA 1WMDA 4HKWA 1HB3A 3ES1A 1RUG3 3I3MA 3PHMA 4QQPA 3E6CC 5ANNA 3GJBA 2GN7A 1OFNA 2DUPA 1IG3A 2LALA 3ACIA 3MEPA 1RUD3 5LY1A 1S0CA 3S57A 2J1SA 2TEPA 1XNTA 2BERA 1W8UA 3ZFFA 4DY3A 5TSWA 2B46X 1MS1A 1QJX1 1W0PA 3I97A 1EV12 4M4RA 2ARXA 1LECA 1W6OB 1OA4A 1VBE1 2ZZQA 1H2NA 4XETA 3AM2A 4ASKA 4AYUA 3ABZA 3ZR6A 4BQWA 1PK6C 2WNVC 2ZA9A 4PI2A 1HX6A 2EIDA 1WLCA 1AZDA 2YG0A 2ZJCA 2CY6A 1Q3EA 1V6MA 2D43A 4W6WA 5LB6A 4E4SA 5A6YA 1UX6A 1UYYA 2MNGA 1HN0A 1NE6A 4XF9A 5FZ0A 1JUIA 3VN4A 5CG9A 5BPXA 3R4SA 1BQPA 4NIGA 2ET1A 3ZXFA 2XQRA 1Q56A 3WXPA 4BQ5A 4ZZ5A 1AR81 1WW6A 3WF0A 2CWSA 5D1IA 2W87A 2Y8KA 2JG8A 4YVSA 3AMPA 1XSRA 2EXIA 4NHMA 1O5LA 2KM2A 3MIGA 1HRI3 1RUI3 1Y7BA 2ZGQA 5F5IA 3VBUC 2P6CA 5A3PA 2JG9A 3FLTA 3WV6A 5C3PA 1YIFA 2GMPA 4MXWA 1V9U1 3ZYRA 2BVBA 1QDCA 2RR11 1HQLA 5FREA 4ASLA 1C8M1 3ZXJA 5FO9B 5KC5A 3VBHB 2KD7A 5A7PA 3ZMOA 5LRRA 4QWNA 2BGCA 1DGLA 3CF6E 3TNQA 4AOCA 2JDMA 5C3SA 4FOYA 2E53A 4Z2WA 4YM3A 1OH4A 2P6HA 4META 1IZ3A 5H9RA 3WD5A 2HEYF 2YHJA 4YZ4A 3ILRA 4DEVA 3HIFA 3RG0A 3BU0A 1TMF1 3T0BA 4AHWA 5KXCA 1RUI2 1NG0A 2NPIA 3DXTA 2XL7A 1GP6A 3POYA 3ZYFA 5K0UA 3KCXA 4Y4YA 2IFRA 3TBDA 2CGOA 3MW3A 5FKBA 1BVVA 4PCRA 4XCAA 3WX5A 2VBPA 1JMUB 3THDA 1FXZA 2ZXQA 1EYBA 1WD4A 4PT6A 1W8FA 1S0BA 1RHI3 2BJSA 4U36A 4UYBA 5I93A 3VBFC 2WINB 4R4ZA 3U0ZA 1N3OA 5EP9A 5FQ0A 3AFKA 3LCPA 1WCKA 2E9QA 3LSDA 4RL7A 4IEZA 4LUKA 4OI0A 1CIYA 1OUSA 5A7SA 1UU5A 2WLPA 2Y26A 3OD4A 2R0HA 2D93A 4XILA 3LFMA 4GD4A 4O61A 4XJUA 4XTPA 1W9FA 1YYNA 3KT1A 4RYDA 5G05L 2DCTA 5FTTC 3ILFA 1AL22 4R9BA 2V73A 5FP3A 4AK3A 2BFUS 3K4AA 3FE5A 3B9IA 2CHHA 1ALYA 3AXEA 1UOGA 3BCWA 3JU9A 2WZR3 4Y26A 4CSWA 4CVUA 5J96B 2PAEA 2RDQA 3ENRA 3U14A 2WC2A 2E6VA 3A21A 4XUQA 1PX4A 2D6PA 1SHWB 3EXUA 4IV3A 3AVRA 2GNMA 4ISQA 5FZFA 4B8EA 5E8AA 5FWJA 2QQWA 1S2KA 1YJLA 4MXVA 5I91A 1PK6B 2WNVB 3HR9A 3AMHA 3ZDSA 4UW6A 2DV9A 5JXIA 4CEWC 5JIUA 4FQ4A 1H8TB 5DDJ3 1I3HA 3LEMA 5FO7B 1O8SA 3O7OA 4LHKA 4IE0A 4PDWA 5IFPA 5JWPA 1YWKA 5KHGA 4NIIA 2DVFA 4A41A 4FPJA 1PX3A 2Z42A 4QQ2A 1UQXA 5CFDB 1GKBA 5D8AB 4CE8A 4XDPA 1RUD2 1GU3A 1W8HA 3KVBA 3ZFGA 1HN1A 2ZABA 3WUCA 3D0SA 3GGLA 2EA7A 5CIRA 4W6XA 5JPNB 4FAGA 5F5CA 4P9WA 4Q0VA 1PIV2 1QJY3 2JKXA 3MPPG 3PJYA 4PLMA 1KS4A 1SEFA 1JXNA 1R081 1ZREA 4NIHA 4MG2A 5CEHA 3ZYGA 3BTYA 5FZ6A 4QX2A 4CDUC 1AR83 1MS8A 1DLLA 1W2OA 3WINE 3ZN6B 5LEKA 3W5NA 4N43A 4Y1YA 4YVSC 3WG2A 2PLV3 3BUCA 2WQ4A 5IVJA 2G1MA 3Q8CA 1IOAA 4BB3A 3AKPA 1ST8A 3ZR5A 3MYXA 1ZZ9A 4HXCA 4AVAA 2UWBA 3T4HB 1NAEA 1M4WA 2GNTA 4LBQA 4UFLA 2JG9B 3LD8A 1DFQA 2FBEA 4HONA 2ZGLA 1NKGA 2DTWA 2RV9A 5IYYA 5IHRA 3HNMA 3O1SA 4QX1A 2VVEA 5CB7A 3AP5A 5EYYA 1PO21 2BEOA 1SACA 1I5PA 4L92A 4E2SA 2Y6JA 4NN0A 2AACA 2VNGA 1ZZCA 1RUJ1 2WT2A 1TEIA 3LFIA 2EIEA 2A70A 1AX1A 3I2HA 5JOYA 2D40A 2PHTA 2P1BA 1LOEA 4PIYA 1UPSA 5FZGA 1QJFA 2JE8A 4FPCA 1VB4A 4CYDA 1CJDA 1VBA3 2D6KA 4OYUA 4BQ3A 3VBFB 4EQVA 5FYUA 4RSUA 3J7LA 2JX9A 4AG4A 1XU2A 1C57A 3RZGA 1EUTA 3MLLA 3VDCA 1AL0G 1HXS3 2VG9A 1X82A 1AR73 1HB2A 3UT0A 2YZ4A 4NOTA 1J1TA 4DXTA 1LAJA 2ZGRA 1OBNA 1VRH3 2D6OX 2XJPA 2AEZA 1B35B 3LEIA 1SLCA 1YHFA 2OQ7A 5FDBA 1XNDA 2CGNA 1W3VA 2F6BA 3U75A 5E1RA 4CDUA 1PNFA 2EIGA 4NO4A 1LCLA 5DAXA 4YVWC 3VD9A 1VBC2 1AR93 4XIKA 5D2AA 5FV3A 4BQXA 2QDNA 3KF5A 4GB33 1NQDA 2WO7A 1Z7S2 4IEQA 4Q4V1 1BBT2 1ENSA 1OURA 2EXKA 4FFFA 4G4FA 4LO8A 3RJ2X 2CAUA 3OEAA 4QX0A 3THTA 1CAVA 1KFUL 5LWBA 4JAAA 1QJU2 1RUC2 3KV4A 4ONUA 4XABA 5IAXA 4P9YA 4SBVA 4OQ8A 3CL1A 3T0AA 3WNNA 1AVBA 2P5BA 3BB6A 1F5FA 1DYKA 2VH9A 1V6IA 3DKWA 2VMHA 4TLFA 4PIXA 2HEVF 1W6MA 2VC9A 5FPBA 1TVGA 2BP6A 4UF0A 2VZUA 2VCAA 1S1AA 3NAPA 1JZ7A 3OBZA 1VBB3 1H1AA 2DDUA 4QB1A 1ODMA 2KXLA 1A8DA 2ZGNA 4HVOA 4KBZA 5A6ZA 5K7PA 4K1YA 2D3PA 2GNBA 1TE1B 4A3ZA 3CHXA 3POIA 4XXAA 3ZO0B 4NIDA 3VUOA 3MF9A 1IKQA 3S5AA 5KR7A 4CCDA 2R062 1OD3A 3WP6A 1IGOA 4DXSA 2V09A 3HOBA 4KG8A 1RUH1 1S0FA 2XKOA 1PM7A 4Y5SA 1I5ZA 4WBBA 3OTFA 1C1LA 2QZ3A 3U78A 4KWUA 4XACA 3B3QE 4DUVA 1XE7A 1T6GC 3MV01 1SBDA 2HBUA 1G9AA 3M3QA 2JD4A 1QXRA 2QNKA 2VMEA 1MS9A 4PI0A 2HWB1 4ZU5A 5J36A 1VBD1 2HWD3 4QHZA 5IK4A 1ASJ2 3FMGA 3LA2A 1GFF2 1K5JA 2XGXA 1OA2A 3MW4A 3QLQA 2FMDA 4Q4V3 4BXFA 5FO8B 1GSLA 5M0TA 1EAH2 1MQTB 4RN5A 4ZHNA 2VNRA 1RIRA 4XUTA 2WAAA 3NAPB 3WW1A 5FR3A 4AI2A 1QF3A 2JB4A 1C8M3 1RUE1 1SFPA 1BEV3 5HCBA 3NO8A 2CGPA 5HCHA 1RJ7A 4JGZC 1SFNA 3PUSA 5FUNA 1DQ6A 2VD7A 1V00A 4OVEA 1QIQA 4QB2A 4XUOA 3IMNA 4NRPA 2BGOA 3ITQA 4OHVA 4UOJA 4Y5TA 2WNEA 3KS7A 3LQCA 1RUE2 4FPOB 4YW3A 3ZDVA 4B7EA 5C8CA 2CU5A 1E5RA 3R4UA 1VBC1 3ZPYA 4F3JA 4AI3A 3JD73 5B4XA 3TNPB 2PLV2 4MLOA 2YBKA 5F32A 1ZZ7A 1Q8PA 2VM9A 2QQKA 5FP9A 1Y9MA 1J3PA 2I74A 2VVFA 1LENA 2YYOA 1PMHX 5IAVA 3SQOA 1JHNA 3HN1A 4I0BA 4WM7B 3J7MA 5FK8A 5I0SA 2R32A 1BXHA 5B2GB 3FUOA 1T6BX 3U37A 5BXXA 2O14A 4OUMA 1SFYA 2OKXA 2J1UA 2QUOA 4HZFA 2PXJA 4LO4B 4L8QA 1W9YA 4FVVA 5FLJA 2CYFA 2WA3A 5FYIA 3JBG2 1REFA 2A7AA 2E7TA 4Z07A 5I8SA 1J58A 4DO0A 3V0BA 2WS93 3HQUA 1WLDA 2IXCA 4YWAA 4BU2A 4Y1ZA 3PVNA 1VAKA 3VD4A 1DLCA 4FAHA 1W6QB 1RC6A 1NCQA 1NT0A 2DVGA 3DPRA 3MGUA 1GNYA 1O8PA 2BNNA 1RUOA 5DUXA 3KV6A 4AEJA 1QXPA 1WGPA 4TYSA 5JZGC 2W92A 2VL4A 4DRVA 1FATA 1AYM1 4IEPA 1XYNA 3GDBA 2VOWA 4CEYC 2HWB2 2A5ZA 4LBNA 2RR12 2E26A 1NLRA 2Q1FA 3AZWA 3M1HA 5H9SA 5LBBA 2LTNA 4QT6A 1FNZA 4KQ7A 3N9MA 1KDKA 2XWBB 1LOFA 1G9BA 1LU1A 2WWUA 4RGGA 4NJ4A 4XZUG 5A80A 3UKVA 2I2SA 5A3UA 2V5YA 1GNZA 3I8TA 1V6JA 2B45X 5DAWA 4AWDA 1V9U3 3PJQA 5F2SA 3UL2A 4CCMA 3AKRA 2IXKA 3T4VA 4DRRA 1EY2A 2IXIA 2WA4A 3MIHA 3JQWA 4O9GA 4C90A 1ZRDA 2A3XA 4KL1A 4IEOA 3BYWA 1UAIA 4YM1A 4A2UA 1KITA 1JOPA 1RUC1 2ZEWA 1AXZA 5C71A 3O1PA 4H55A 3TWIA 1F4HA 2DTYA 3PMSA 5FPZA 3WZ1A 3NJZA 5FYSA 1MVEA 2Y6KA 4LBJA 3BTAA 4Y5Z0 3BTZA 1GANA 4FPHA 3PTRB 3UV9A 4K8FA 2WO3A 3D8CA 3IM0A 3K4DA 3IIAA 4WV8A 2J1RA 4AW7A 4JGYB 5A33A 5F7UA 5CBLA 4K6BA 5LBCA 2VUAA 5C4WA 1AYM3 4MGIE 1HXS1 3O1UA 1YFYA 1CPNA 2MEV3 2DCKA 1XNCA 1WUVA 3OBTA 5CYYA 1GV9A 1TME1 2WFF2 5EJ1B 1RUD1 2IUWA 1KXGA 1PNGA 3ZPOA 4DXZA 3LB9A 1J59A 5A32A 1JBCA 2HWE3 4M01A 2D97A 4FXKB 4GH4B 2BV4A 1HXS2 2P37A 4E9KA 5AVAA 4D7TA 4Y3OA 1RL3A 1S2EA 3NV4A 4UT5A 1OPOA 5GALA 2XXZA 3MIEA 1XXNA 4IDZA 4GALA 2DF7A 1REEA 1PGW1 2BBAA 1NA1B 4AL9A 1O91A 4OI2A 3ZIXA 2ZEYA 5DDJ1 3FHQA 4YLZA 4F83A 2XHNA 4LULA 4YW2A 1IS4A 3I2GA 1AYN1 4XTMA 2YGLA 3AX4A 3V0BB 3ACHA 4B3NA 3VZNA 2XJVA 5J3UA 4KWLA 2NMOA 1JZ6A 4XDQA 3RZKA 4TSVA 2XKPA 1S55A 4A3XA 2ZMKA 3SMHA 5GM0A 3PUIA 1UKRA 3OGJA 4JKKA 4WVMB 3KWVA 3FN9A 1DBNA 2YB7A 1GOHA 1LTEA 2OZJA 2Z69A 3KQRA 3SH5A 2QKDA 3AP7A 1GLHA 3AP4A 2RS51 4N90A 3Q8EA 3I3BA 2CDOA 3HBZA 4RGKA 1FMD2 4FOVA 4JC1A 4OI1A 5IUQA 4CTEA 5FYMA 3A4UA 2W52A 1WCUA 3I2DA 1Z0HA 4FPLA 3OB8A 5JI7A 4LO6B 2BW8A 2QTWB 2XBO1 4AGGA 4CCEA 4HSJA 2JG9C 1LOFC 4YRDA 1W9SA 1F2NA 4FPGA 2E7AA 2RS12 3IDBB 5KWRA 3AC0A 5CNAA 4OUEA 1IHMA 3X29B 1C5IA 4QPIB 1AUYA 1CD3G 2W46A 4GIQA 5FPUA 5HCFA 4M0HA 4J1WA 3ZFGB 1DDLA 3OG2A 1NLQA 2FCVA 4TXWA 2JD9A 3E5QA 1D4VB 5T52A 5C8CB 3URFA 1EPZA 3WP5A 2LM3A 1ASJ1 1POV1 1DG6A 2O8QA 4AHZA 3KVAA 2AYHA 2DUQA 1HJFA 3WHTA 1A8MA 2IC1A 1DGRN 1LU2A 5J7MA 4KU8A 2RDRA 4XUNA 1ZRCA 4DFSA 4EZ4A 3SKVA 4YM0A 2KR2A 2JKBA 5CKMA 2VW0A 2R042 1VBA1 1QHDA 1SG3A 4YNIA 2CWMA 4PLOA 1HLCA 4YFWA 5DPNA 3BPZA 3ORJA 2VAUA 3A22A 1W8WA 3AFGA 2FCUA 3O5SA 1MS4A 1YQCA 5DZFA 5A32B 1T2XA 1IS5A 3I4IA 2JB8A 4BMEA 4ZS3A 3LIGA 3C3VA 1S0JA 1VBA2 2J22A 4NMIA 4YGCA 3RI8A 2HWF1 3S5QA 5BNNB 2GN3A 5FZOA 4BCUA 1VE0A 4TTGA 1TQ5A 2XBO3 2DU1A 2Q4SA 4LEJA 3PDQA 2C4XA 4CDQB 3T1MA 3F95A 5FY1A 5J37A 3WW3A 4AQSA 2F4LA 4WM8C 4A6SA 3NW4A 4LBLA 2XL9A 3IKWA 1QNYA 1W2UA 3HT2A 4LXLA 3LA7A 1JYTA 4XBLA 2JDYA 4QX7A 2WYFA 1RINA 3L2HA 1L3JA 5I8YA 4Q4Y3 5FY5A 4D69A 3NJXA 2FD8A 3WY6A 5F3CA 1VBE3 4CUCA 5DZGA 1JI6A 3AP9A 5K0UB 1AJKA 3N9OA 3ELNA 4E2GA 2ADDA 4LR4A 1OD5A 4YW4A 2D6NA 4N53C 5AC91 3POWA 1VRBA 1SDWA 3N9QA 3HT1A 3SITA 4EN6B 2X8KA 5K9YA 3ZX7A 2YMZA 4AFAA 1WWYA 3I2JA 4GKXA 1HKDA 4XJAA 5DUVA 2HEWF 4LO5B 3VBFA 3UJQA 5C70A 1LOBA 5JXGA 1YLLA 2R043 1NUKA 3VBOA 2YFZA 2YGMA 1X9TA 1JZ4A 4YW1A 4GWJA 3MIFA 3R05A 4NVPA 1VBD3 3P3NA 1AYN2 5FZBA 1Q5OA 3W58A 4DNYA 4E2QA 1RUH3 2CAVA 1KJLA 1CR7A 5LA1A 3GNEA 4CUAA 1W6NA 5GLWA 1FV3A 2X53S 2MEV2 3WR0A 4E4DX 4COYA 4DQAA 2P3IA 4HLTA 1ULDA 2OX0A 1UY4A 5F5AA 4E8CA 5FZ8A 4IV3C 3NL1A 4JV4A 4UFKA 3HVDA 2VMFA 1V6KA 3HQXA 4XUPA 5JOWA 1ZBE1 1OOPA 2AZ5A 4V2VA 3WCSA 3WQ7A 4BZ4A 1ONAA 1W28A 1UN1A 2RE9A 3I3DA 3H1MA 3WDUA 5C8CC 3ZKUA 5HBAA 2PQQA 5CISA 4D8MA 3EMRA 3ALQA 3MUY1 1QOTA 4AEDC 2XH6A 2JIGA 4DMIA 3MW2A 3GJAA 1QJY1 3USUB 4FTBA 5G04L 3AJYA 4IEUA 4Q1PA 2VULA 4A4AA 2P34A 4E8DA 4GA9A 2GC2A 4NAOA 1V6OA 2FDHA 5IK5A 1I1EA 3IBMA 2XPJA 5A7WA 3M3CA 2VUCA 5E16A 1XU1A 4IEWA 1S2BA 2WZPP 1O3RA 2WQ8A 4MZUA 5FZ3A 1H6YA 3PUAA 1AL21 5IVFA 3AKQA 1G8WA 2ZCWA 1LGNA 3KM5A 2CL2A 4LIUA 4NHKA 5L9RA 1DQ5A 1QEXA 2ZGOA 3H3LA 2YC0A 5FYYA 4ISRA 2YXSA 5F39A 1RUNA 2HYXA 2BOJA 1W6PA 3MLJA 1AR71 1VMHA 3NVCA 4MGTA 5DN2A 1U5XA 1OC1A 4EWAA 2P3YA 4FCAA 4ES9A 1SBEA 3AKSA 1MZFA 1HIXA 2AGSA 4MUVA 5FUPA 4DB5A 3KT7A 1DP0A 2B7YA 4ET7A 1JUHA 1SLIA 2K9ZA 4D3WA 3ZYJB 2JDUA 3OY8A 2G4IA 4LK6A 1YNAA 4IV1A 5BNNA 3GZEA 3UNPA 1SMVA 2RM23 1H8VA 1AYM2 2B4KA 1PO13 1KDMA 3IDAA 4OFGA 5JUVA 2YU1A 1H4GA 1GQGA 4L97A 1VIWB 2PHUA 2Q30A 1A3KA 5IT6A 2VZOA 4BPZA 3N7KA 1LHVA 4IETA 4XAEA 5FJKA 3VHRA 3JQXA 1QOSA 1DIWA 5GJ6A 1UOBA 3GHMA 2Q8DA 3ZM8A 2EVXA 2GP3A 4QQOA 4CXYA 4NIAA 4IGQA 1PHMA 4IV3B 4MV2A 4HMZA 2VJXA 3M3EA 1SLBA 1ZA4A 4LHSA 4QX5A 4CU7A 4EE2A 1ZRRA 3K48A 1YC61 3FLRA 4GJYA 3AVSA 3BIEA 1UF2C 2PHDA 3L9JT 2C26A 3UESA 4XURA 4IV1B 1AX0A 1QQP1 3SNMA 3EYPA 4RS5A 2D6MA 5DG2A 2Q8EA 5D21A 4W8JA 1E5HA 4PF1A 5FZCA 3LPGA 4Q27A 5BV6A 4Q29A 5T5JA 4M3CF 2ZS6B 4D6SA 3FL7A 4MGKE 4C8DA 1UZ0A 1CAVB 2JE9A 2WUHA 3W21A 4M3CA 1ENRA 4XEZA 5L7OB 3FBYA 3ZLIA 4EWEA 3HNBM 2OXBA 2GMMA 3WW4A 4E4HA 4Q0QA 3NJYA 2NQYA 2PFWA 4S2FA 1PGW2 3J8F3 2Y0OA 1H6XA 2C1FA 4AF9A 1E5SA 1OVSA 2D98A 2ZPXA 2BFUL 3GF6A 4XF4A 3VDDA 2BZDA 5T3NA 1UD1A 2HH9A 1AR72 4UI9L 1OUXA 1H2MA 2RDNA 3ETQA 2W47A 2XVLA 5C7GA 1PO23 5AFEA 4QGMA 1LRHA 5HV4A 4N43C 2ZX2A 1RVF1 1X8MA 5A3MA 2OS2A 3TRSB 5AC93 4P9IA 1UCXA 1COV3 1Y4WA 1PVXA 3H7JA 1I9RA 4UFMA 1GYKA 2B9UA 4XYXA 2BVVA 3KB5A 4PIZA 4R4XA 1YQ8A 4FFGA 2QVSB 5LRSA 3ZN5A 5CKQA 3AZXA 1R1A2 5KHIA 4L9BA 1S0IA 3BKZA 2W3JA 2PHLA 3J8F2 1F35A 5F6KA 3FHAA 3OSDA 4R8HA 4DY5A 5F3GA 2ADEA 3S7IA 4C1XA 4JDOA 1ZRFA 3SCFA 2EXHA 2XJRA 3AMQA 3J7HA 4JCKA 4GULA 4CP9A 5JXHA 1C1FA 3ON7A 3WNKA 1XRUA 4NR1A 4YYOA 3P6BA 1OKOA 2W91A 4RS5C 5JSRA 1XC6A 4BK4A 4M4PA 4EN0A 2GALA 1W03A 3A7QA 2YV8A 3ZXDA 5A70A 3J7NA 4I3PA 2R061 2WKKA 2WRAA 1N3QA 5EHDA 5FPAA 3AMMA 3RSJA 3B9CA 3CDZB 3MLKA 2VOTA 1ZRIA 1ULGA 5FZIA 3JZVA 1S0GA 3SISA 1NZIA 4JGZA 5FY4A 1VBD2 4O9EA 4QKNA 2W2IA 2RM22 1C28A 3EO6A 1DGWA 1GOFA 1JYIA 2VQAA 2IWGB 1MS0A 3VBUB 5KC6A 2SLIA 3AZYA 3CO2A 1UKGA 3TEXA 1WCQA 4BLIA 3A23A 3NMBA 4Y33A 3V0AA 3LEKA 4YG6A 1KQRA 1PO12 3Q8FA 3GZUC 2VNOA 4WVWA 2PA7A 4XHBA 1PZ7A 2Z5WA 2P4EA 1D2QA 5KXDA 3BPSA 1UMHA 1BEV2 4LKSA 4Y4RA 5D8AA 5GZCA 4Q4V2 2OUHA 2G9ZA 3TN92 3ZSLA 1CGPA 2KA3A 3RS6A 5FBJA 3FLPA 3PLQA 4GMP3 3T09A 4YSFA 2VBDA 4IEYA 1Z78A 2A73B 2XB6C 4RHV1 4M0NA 1HDKA 4OULA 4A7KA 1B35A 2AENA 2UWAA 4HSLA 2C24A 2AC1A 2ZAAA 4HFSA 3SCHA 2BWCA 3UK9A 2JE7A 3RPQA 2AEYA 3LDRA 3W59A 3ZSKA 4QKBA 1GOGA 4S2GA 4MYEA 4ITCA 1BLZA 5FXVA 1MZ5A 4ZU7A 4RR3B 5BNQA 1OH3A 1OPMA 1UY0A 3ACLA 3UGFA 4CDXA 4D7SA 2VCMA 3DCQA 2XR4A 2EICA 2JEMA 5GLTA 5F5QA 3JBG1 3WDWA 4GQ7A 1UW8A 2ZX4A 3V56A 4AAPA 1IG0A 1W9TA 1O3SA 1O3TA 3DPRB 1GQPA 3E5XA 1NCQB 1MZEA 2OVUA 2QBXA 3NJVA 3ZFEA 1NLSA 2IFWA 1VBC3 1NXD1 1JOJA 1MZ6A 1QKQA 3S0MA 4Z2AA 3HQRA 2A6ZA 3GBGA 4CXWA 1COV1 1YI7A 1EP0A 1W9WA 4NHXA 3BIWE 4Y1XA 1RMU1 1CIWA 2EAAA 2X5IA 1ND2C 1TME2 2BUKA 1G86A 5KXEA 4DXRA 3ES4A 4BHPA 1ODNA 1QH6A 3LSEA 2QQVA 2VUJA 3J4UH 4IEVA 1COV2 5K4LA 5KHJA 2A6XA 4KH9A 3VKOA 2WO1A 4QXKA 1UIKA 3UKTA 1VR3A 5T54A 1RUI1 5AC92 1UY2A 1OQDA 4LTAA 5FXXA 1CAUA 2QQOA 3GCWA 4IE7A 3RWKX 1U5YA 2V4AA 5DABA 1XQNA 1NYWA 3ASIA 2JXAA 3H8XA 4KU7A 2X5IB 1EAH3 3POEA 4M3CE 3AZVA 1D7PM 2XJQA 1PIV1 2Y6LA 1APNA 4AVCA 1DCSA 1R082 4DEQA 4DOUA 2VO5A 1E57A 2XMLA 5H9QA 4QAWA 1LKNA 1L7RA 4ASMB 3ZFEB 2ETEA 1OOPB 4DIQA 1LR5A 2W1WA 4X6QB 3WDVA 5ABJA 5A1AA 2YBPA 4HN0A 5GZDA 4CDWA 4BISA 3VKFC 1VBB1 5IFTA 1D4M2 4PDWB 4A7ZA 2RMU1 1V6LA 2DCZA 1F31A 4ZS2A 4YZ2A 5F9TA 2NM1A 3O0WA 1HRI1 2HJIA 1UZWA 2VTFA 4RFT0 5EPAA 3VGIA 4AEDB 3T0DA 1MEC3 2BOIA 3NV2A 2ORXA 5FZDA 4LUMA 5DAQA 1F5JA 1XNKA 1BKZA 4URTA 5I0UA 2NLRA 5A3OA 3VZOA 3VBOB 5K8SA 1H9PA 3IWZA 3B02A 4EZHA 5CADA 5JR2A 1KGYA 3CJXA 3WOGA 5JOZA 1DQ2A 1LNSA 4PBPA 1FPN2 1SPPB 3KMHA 5LA0A 1JZ2A 2GDFA 4GH4A 2WZ8A 2W1UA 3B69A 3QD6A 1GNHA 1VRH1 1OMIA 1RUJ2 1ZBE3 3ATGA 3B7MA 3FFZA 4XBQA 4Q0SA 2RS31 3ACGA 3ZSEA 1W6OA 4UFJA 4IL7A 3CBNA 4R9DA 1LJ7A 4KNCA 3QH7A 4QMAA 4ZY9A 5SV8A 1WA6X 4N7IA 4YVWB 2FDJA 2WWSA 4YPJA 3U07A 4TLGA 3ZFFB 4YW6A 5APAA 4JDNA 5LCWL 4OHXA 4AEMA 1WMFA 1HV0A 5FOBB 4S2HA 1H8TC 4P02B 4CZSA 4NPMA 4CDXC 1PVC2 3NSTA 4HN1A 3RGBA 1QJZA 2XJUA 2HWF3 1UOFA 1AYN3 2FZ1A 2GC1A 2R0FA 1I6XA 2OW4A 3I59A 3OJBA 3ZYBA 5LA9A 5FMBA 1N47A 5A7NA 2LW8A 1DQ0A 4P9LA 2X29A 4JGZB 5IVYA 4A45A 1QNWA 4Q26A 2Y38A 4IW3A 4Q4X2 3LDBA 5HI0A 2ZHLA 3I49A 3AP6A 2HWC2 3KLSA 4PF5A 3WNPA 4Q4W2 4QHOA 2XLFA 4FP3A 2JDZA 2X10A 5FZOB 2J1AA 2VECA 2OUJA 4XQDA 3VB9A 4RQPA 4CEWB 2JDNA 4JVAA 1H9WA 3M8LA 5JMOA 1A78A 3CMGA 3UKNA 2UY9A 2C9AA 5A3WA 1BZWA 2QQIA 1FMD3 3WQBA 2RS33 4Q4Y1 3CJIB 2RS13 3GBFA 3NV1A 1SPPA 1YI9A 4CU6A 3UGHA 1BYHA 3ZMNA 4B4RA 4COUA 5CKNA 5T55A 1YQ6A 3T2OA 1JH5A 3O1MA 1UIJA 4C0HA 1POV0 5T5LA 1S4CA 1REDA 1SLLA 4CCNA 1SCRA 4Q4W3 2DVDA 3IAPA 4FSJA 3I3QA 2X09A 2AUYA 5GKAC 3VL8A 5CAZA 2R072 3J9SA 4AHXA 5L19A 1DU3D 3EQEA 4AFDA 4J1XA 4KI5M 5E6HA 1Q8VA 2GC0A 2Y0IA 4MGSA 2IZWA 4XFAA 1ULEA 4KGGA 3PNAA 5JLVA 4OHYA 4LBQB 4PBOA 2HWC3 2BNMA 5CVRA 2ZGMA 4FI9A 4JZRA 4XFIA 1NZCA 1PO11 4P9JA 1RHI2 3PURA 4BLJA 3CJIA 1K5MB 1IPSA 2IVIB 1OSGA 1HB1A 4EWDA 3BODA 2HWE2 3BN6A 1H2KA 1XBFA 1SCSA 1K45A 3NQHA 2P17A 1QGLA 2VTXJ 4NRQA 4AZZA 2DCYA 2BNOA 3FWEA 2P2KA 4NWWA 1POV3 4W6YA 1RITA 1NY72 1J3QA 1RVF2 1CAXA 3PMEA 3S6PA 4QPIC 2RS52 3RJRA 3C7OA 1F15A 2ZACA 3LPFA 2TUNA 2B42B 5JOXA 2A75A 1ZBE2 4ZZ8A 1Q43A 2R041 4CCCA 4LITA 2VZQA 1LEDA 5FYTA 2LRPA 5FYCA 3H42B 2WYSA 1W2AX 4QDQA 1N1YA 2ENRA 4I01A 5BNOB 2WDBA 2VVDA 4HBNA 5D8AC 1SLTA 4UW4A 3SEPA 5CFDC 4UBGA 4CDQA 1HRV1 4P5HA 4QKFA 4ZPIA 4J6GA 3WQ1A 2VBBA 2PHFA 2R30A 1UMZA 3B93A 2DUOA 1FYUA 3HAGA 2DYCA 4HOOA 4I09A 4K40A 4KGQA 1SQ4A 1H1IA 4NAMA 3RRDA 2VW1A 5FZ9A 2J1EA 4QGNA 1GZWB 1WD3A 1YUDA 3DKQA 4M00A 4ZXEA 4C1WA 1W8TA 5BY5A 4KWJA 5I0TA 3KCCA 2VPVA 1GZTA 1OF4A 5LW9A 1K3IA 2GC3A 1O4ZA 5HXVA 3SXWA 3Q8BA 1C3HA 3KQ4B 4NE9A 1DGWX 2ZOEB 1NE4A 3C7FA 3KCYA 3LAGA 2PMWB 4BDVB 4D6RA 1EAH1 2ORZA 4H2AA 4XDOA 3ZXLA 5L7OC 1NCRA 4WVZA 4XMAA 4A6OA 3TEWA 1O7FA 2E33A 2V72A 1BEV1 1FT9A 5GLZA 1RVF3 2Y6FA 5JR7B 2VQUA 5LK5A 4I2OA 4XVHA 2E31A 5CA6A 3H7YA 3G7DA 5JIAA 4JTNA 2QQMA 2VOKA 3MV11 2BYVE 1WCDJ 2BU9A 4FPYA 4LIVA 3T3YA 4UWDA 3U10A 1JW6A 4I0WB 4AEKA 5JZGA 2WQZC 4UFIA 3OY8B 3W5MA 4HG6B 4IERA 1H30A 2HWF2 4E27A 1UWWA 3O14A 5JSOA 4WM8A 2HWB3 5LASA 4AI8A 4ES8A 1RUJ3 3WNOA 4QPIA 4CXXA 3JB4C 4FPKA 2QE3A 3E97A 3T30A 3OD0A 2DFCA 3V0AB 2ZTNA 3H1WA 1MEC1 5A7WB 3ST7A 2FZ2A 2WNOA 5GZGA 2GH2A 1DYPA 2W68A 3BU7A 1R092 2K2SA 1GZ9A 4B7KA 3ECQA 3O12A 1CN1A 4INDA 4IUGA 1HRI2 3GHNA 5FZAA 4RHV2 4HK8A 5CG8A 3ZFFC 3AB0A 1MEC2 3S30A 5A6XA 1O5UA 2ZKLA 5I0DA 4PDWC 2UURA 3M4FA 2D6LX 2VNVA 2W39A 4NHLA 1FMD1 3PVEA 1VBE2 4YW5A 4XJWA 3WCRA 5IK8A 4LO7A 3OOXA 4YG3A 4P9GA 4BXSV 1FPN3 3USUA 3V65A 4XF0A 3C7EA 2Q5TA 4QHBA 3MZHA 2ERFA 4NHYA 4OCTA 4W50A 5A7OA 1JYCA 1C8M2 2GU9A 3E5UA 5FP8A 1R64A 1OQ1A 5F8PA 2VZ3A 1O59A 4V1PA 5FCCA 4GAZA 5LY2A 3R0RA 5BUVA 4FP2A 3TEYA 4Z8BA 2JICA 1XNBA 4K21A 1G7YA 1TG7A 3B01A 2HWD2 1U5ZA 3JCIA 5F37A 4F7ZA 1F9KA 1W6QA 1OF3A 2Y6GA 5FPVA 2W9XA 5C9AA 1XE0A 3MDPA 3VBSB 5FP7A 3DL3A 4XFFA 1ULFA 5DZEA 2WBKA 3KSCA 4BK5A 3AXDA 3D5OA 1BCXA 3LF7A 4IXLA 1OLRA 4CEYB 2QQUA 2YPJA 1WMXA 3D4KA 1W8ZA 2Y60A 1RGSA 1QH7A 2NYYA 5FMCA 1AF9A 4B1MA 1UU6A 3IN9A 4H14A 4XHXA 1GP5A 1ASJ3 2R6QA 3BALA 5LATA 4R9CA 1VBB2 4TZDA 3ZN4A 5JI9A 3TN91 1VMJA 5A3TA 3KV5A 4LNVA 1UX7A 5ACA2 2OYZA 2VXRA 4XFGA 2W5FA 3MHZA 5FZ1A 1ZBA3 1IPKA 3ETPA 3MO4A 2WS92 4HK9A 2VZVA 4IE5A 3ZN6A 2DBNA 1W0NA 3ZXAC 4LBOA 4AFBA 1PGL2 3O0XA 1J83A 3THPA 5LA2A 3ZOIA 2WSVA 4A7YA 2WWJA 3WP3A 3Q8AA 4WM7C 2XDVA 3WQ0A 1YFWA 3FUQA 4RR3C 3H1YA 4QXBA 1GBGA 2J7MA 3VDDC 3OCPA 4Q1RA 4YVWA 1C4RA 2W0XA 3AYCA 4RS5B 5KHHA 1VPHA 4NWVA 4I3GA 4AI9A 1UL9A 2L9LA 2O0OA 2Z4FA 5C3QA 5FP4A 1BJQA 5JAXA 5FYHA 3RMYA 2XLAA 1W06A 3O1VA 5FWEA 5FBZA 1ZYBA 2QQLA 4PQ9A 5CFCC 2B5HA 4TWTA 3TAYA 2E7QA 2I07B 4UW5A 5IW0A 4BM8A 1QJU3 2YBSA 4FTSA 1QQP3 3FJSA 3FBMA 4QGLA 1W99A 1G9FA 2K46A 3DYPA 4GJZA 5J09A 1RUF2 1UO9A 2CSGA 4B4QA 1ND3B 4HPKB 3V64A 2DFBA 2H6CA 2B9VA 2MHFA 3VBSC 5ACA3 4O7XA 1MVQA 5A1LA 3DECA 2WNUA 5BNPA 4Z92B 4LORA 4AEDA 3E6BA 4K7JA 1NXMA 3GXUA 2WR9A 4Y1VA 2X5IC 5I0RA 4QXHA 5LK7B 5A1FA 2A6VA 2ARAA 4IGPA 2VMDA 3SH3A 2VE1A 2GH8A 3FC0A 4XIOA 1W6MB 3BOWA 4QD2A 1UZYA 3CZJA 3ZKYA 1UU4A 4B4PA 3QACA 4XBNA 4YW7A 5C3RA 1JOBA 4CA9A 1MR5A 2WL1A 3UGGA 1JYNA 1CZSA 1CAWA 3OUIA 2VOXA 1VLNA 1DZQA 3PL0A 1W8OA 4I0AA 1GMMA 2EF6A 2D5HA 4IE4A 1AX2A 4Y1UA 3W9AA 1V0AA 3LDKA 3THCA 3JBG3 3OGGA 3PVOA 1BVP1 3IB3A 1WCSA 1YIPA 2Z2SB 4OQ9A 5HPOA 1UZZA 1VJ2A 5FMOL 5GZFA 3VDDB 1DGRA 1GP4A 5F3IA 2RDSA 1FI2A 1K12A 4L99A 1OI6A 1NCQC 4IGOA 4IV1C 5JVVA 4MADA 1PMJX 3RYRA 5BNOC 4GWMA 5FKCA 5EWSA 5IK7A 1D0HA 1RUC3 4QQLA 1QJY2 3OUHA 4QPGC 3VHOA 1HRV3 4XQ4A 4YFZA 2PAKA 5C6CA 2IXLA 4LT5A 5C8WA 4CP1A 1YQ2A 3JD72 4XJZA 2EALA 2XOMA 3TOJA 4CPBD 1Y3TA 3EBRA 4JGYC 3HN3A 2GP5A 5EJZB 3T1LA 3WF1A 1FPN1 2WT0A 1AXKA 3BI3A 1OLME 1OVPA 4JTOA 1ZZ8A 2HWD1 3OF1A 4HT1T 2WFPA 4CUGA 4RD7A 4AVTA 1LEMA 3OGSA 5GLVA 3WHUA 1CJPA 4D6QA 3AYEA 1LB2A 3QH6A 1AR92 1PO22 3B94A 3GALA 4B1LA 4XXPA 2W1QA 4IESA 2H0BA 2ZX0A 3C8XA 1UNBA 3RVHA 1VB2A 5DMYA 5T50A 2G19A 2IXJA 3RWNA 3K75B 4Q8KA 5SV5A 2QCSB 2JJ6A 4I02A 4MOAA 3VKLA 3WDXA 5JXJA 3J26N 2W1SA 1IQAA 4Q0PA 2BTVC 3I2FA 4JKMA 4EYUA 1GWLA 1XE8A 3D3AA 4BQ1A 1ZX5A 4K20A 5CFCA 3KT4A 1LESA 4N9HA 4LE4A 3D0JA 1NX9A 3INAA 4V2WA 4LPLA 3VZKA 4A42A 1U0AA 2JWPA 2YUEA 4XMIA 3IT8A 4KBBA 2D3SA 4R9AA 2UWCA 1ENXA 1QU0A 2UYAA 2ZMNA 4Y22B 2I45A 1CESA 1D4M1 2Y34A 2ZHMA 3CKHA 1CONA 3E1F1 3H8OA 4EN9B 1NY71 3VZLA 4E4ZA 2VMCA 2RJ2A 1YCIA 3L2YA 1GR3A 4ARYA 1YQ5A 1W04A 3POFA 1Y9GA 3ZYIB 1STMA 1Z7S1 1NA1C 2VZ1A 5FY7A 2DU0A 4JRLA 3T2QA 4U2AA 1EV11 2PYTA 1X36A 1WW7A 1LHUA 4RQPC 5BNPC 4P00B 1GWKA 2NMNA 3WVJA 5EJ3A 2OIIA 5EZWA 2WSUA 3I59B 2Y33A 5FYBA 1IPJA 3HMYA 4FOQA 5CFDA 4URAA 1JZ5A 5FZLA 4L0PA 5ISLA 4HKOA 1XNAA 1MPXA 3K2OA 4RA0A 4XPVA 2XUMA 4CDUB 3GZTB 3VKMA 3ZVXA 1ZBA2 3K51A 2GMEA 3RI9A 2QZ2A 3IPVA 5A7QA 4MO3M 3I2KA 2OA2A 3OYWA 1PK6A 2WNVA 1N1VA 1YEWA 5FPLA 2D5FA 3H0OA 2EXJA 2R49A 3CZUA 3RZLA 4LK7A 5JPMB 3QBQA 3PVBB 1RUE3 3BTXA 4FBFA 4N8MA 1JS9A 2MPFA 2PAMA 3HEIA 4ZKTB 4YM2A 3AK0A 3SHRA 2SBAA 1YRZA 4YGDA 5EYXA 2BDRA 4CU9A 4JQRA 4QM8A 3WG1A 5T5OA 1VP6A 2UY8A 1J3RA 3IIIA 2HWE1 4YG0A 4AVVA 2QQJA 1L7QA 5JSPA 1OLQA 1UYZA 5DQ0A 1UZVA 2ZHKA 5A3NA 3RZZA 1CX1A 5ACA1 4OUSA 3VD3A 3WUDA 1DZTA 3N7LA 1KFXL 2VCBA 3MICA 5C4WC 4LJHA 2JDPA 3WNLA 1YJKA 4UBHA 3ZFEC 1UYPA 1IKPA 4H7MA 4CDWB 5DG1A 2PQSA 3NNJA 1X9PA 2FDIA 2XONA 3LOIA 5IVCA 5T5PA 1PMIA 2VTXA 4X6RB 1RUF3 1W8NA 3BVCA 4YARA 1AL23 3VZJA 4BOWA 3T08A 2WZR2 1QDOA 2A6YA 1MS3A 2PHWA 2R1BA 3VV1A 2RG4A 3AJZA 4GXLA 1AHSA 2ET7A 5KBFA 3N9LA 3N9NA 1XSQA 3P5BA 3SKJE 4Y24A 1H0BA 4EN8B 1ACCA 1FOD1 1CAWB 2R071 3PUHA 4JQTA 1WBLA 4MGYE 3TYJA 4AVSA 3HPNA 3AYDA 4LKFA 2BWAA 2VZTA 3MBWA 5IATA 3FZ3A 4QM9A 3ZSMA 3ZXKA 4W65A 4XE9A 5DXDA 3PTYA 3HBKA 4K1ZA 1WKYA 3OPWA 5IWFA 1JU3A 2ZGSA 1KJRA 3OBRA 3VLBB 3LKJA 3O1RA 3N7MA 2RM21 3PU3A 1MQTA 2EIBA 3DYMA 2ZEXA 5E89A 4HVQA 2CV6A 3JUUA 4A44A 4DPNA 3NNLA 1W3XA 2GZWA 2PTMA 2BGPA 3DPRC 4XJ8A 3LWCA 3AKTA 1K5MC 2V5DA 3G6JB 2OPKA 2G9FA 4P9XA 1NA1A 2WIIB 3MPBA 1LHWA 3S7EA 3VL9A 5DDJ2 3VD5A 1S0DA 1Q8QA 3AYAA 3IMMA 1DF0A 2W08A 2JG8C 3KHBA 5EV7A 4AFMA 5DUUA 1A34A 1R1A1 1S0EA 2WFF3 1DHKB 2XHKA 3U4XA 4XOGA 3BGAA 4XZPA 1RUG1 4H7LA 5F6LB 4F8AA 1B35C 2C5DA 2YC2A 3PU8A 4CEWA 4AFCA 3WSOA 5H9PA 1H4HA 4QU1A 4DZGA 5KHKA 2R073 4QPYA 1G6NA 2Q1ZB 4W4ZA 2YFUA 1R091 4JRAA 3SLIA 1BMV2 2FQPA 3EB7A 3MI8A 2VOVA 2P3KA 5IVEA 2AH2A 1SZBA 5A33B 2WN2A 4AQ6A 4Q4W1 2VY0A 3SEEA 4CCLA 2C0ZA 4N53A 4DS0A 2A3WA 1O4TA 5FQ0B 3CJIC 5HXMA 1IS6A 3N9PA 1CVNA 5FY0A 1PGL1 4QX8A 2E32A 2QJVA 1XOYA 4N9IA 1XYPA 2RS32 5LEJA 4FXGB 2B8MA 2UYBA 4R52A 5EXOA 4AQTA 4OZXA 2BBVA 4UF0B 3VHPA 1CZTA 1YFXA 5FXWA 4GWIA 4YZ3A 2XG3A 2ID4A 4XF1A 3KZ4C 1EV13 1CAXB 5DAVA 1WW5A 3U11A 3AL5A 1JHJA 2ZHNA 3EJKA 4MX3A 4Q8LA 3ZYPA 1U5IA 2HKXA 4CPBA 1EPWA 2RVAA 3N35A 4J25A 4AI1A 3POJA 4AR2A 4CDWC 3DYOA 3VBUA 1WLWA 2ZEZA 4Y22A 2LUWA 3DUIA 3UYJA 4JHTA 1ND3C 4IEXA 2DVBA 1RMU2 4Y20B 1OFSA 3KHCA 3N4MA 4UXAA 3O1TA 2FDKA 3FFQA 2QFEA 3FX3A 4H3WA 4IE6A 4LLFA 4AAXA 4XW3A 4Z1VA 3H8RA 5CU1A 1K5MA 3GCXA 3POSA 1GQHA 4LKDA 2BQPA 4BQYA 3GM8A 4QPGA 4YZ5A 3KGLA 4XAAA 4WVVA 2GNDA 2PN5A 1W2TA 4G3YC 3WG3A 1MACA 2HWC1 3WF2A 4MGZE 2OZ6A 3CEWA 4WZCA 5C9AB 1ULCA 1D0GA 4WVMA 5CZKA 4MXWB 3LOBA 3LIHA 2VR4A 3NWKA 4C0BA 2D7FA 3A0KA 3P1IA 1RB8G 2VMGA 5C3OA 1TME3 4D7YA 4DINB 1Q8SA 4COVA 5B4NA 4XFCA 1ZA7A 4FFIA 3KGZA 4HL0A 3ILNA 1QWRA 5FY9A 4AE2A 2QDRA 1C5HA 4NUBA 1XPWA 4CP0A 4MHUA 2HBTA 3NKGA 1HJGA 2N7GA 4MVTA 1Y9QA 3N7JA 3K4ZA 2XQXA 3VBHC 1LOCA 1YO8A 5A6QA 1GICA 1VAVA 4YZ1A 1ND2B 2E63A 3FHIB 4RFRB 4ZONA 4NRMA 2V4VA 2X05A 2BPA2 2A6WA 3H50A 4JHZA 5FK7A 1RJ8A 2Z79A 4BMBA 2VZRA 5FRAA 1MS5A 3AZZA 4N43B 2XJSA 1HW5A 5EFUA 4LA3A 5C5UA 1Y43B 1AR62 5J1XA 1ULOA 1D4M3 2WN3A 4I30A 4BQ2A 5JMCA 4DUWA 2NZ9A 4JX0A 4HKLA 5C4WB 1F8VA 3IPVB 4RGAA 3RYKA 5HV0A 2NP0A 2RMU3 4EJRA 1DYOA 2WJSA 1O6UA 3B00A 1RTVA 3SCGA 1X8EA 3CU7A 2XBO2 3N36A 1WBFA 2OPWA 2OQ6A 1AJOA 4NPLA 1GUIA 3VDBA 5BNNC 2XVKA 2A71A 3A0NA 3VHNA 1L7LA 2YROA 1RXFA 2WT1A 5C33A 2J42A 4BQ4A 3OPTA 3LEGA 2EAKA 2VQ0A 3TB0A 4QDSA 3POBA 4FT8A 3JXSA 3RFRA 2Q0AA 1POQA 4PQQA 4HVRA 5FZEA 1H8TA 4KG0A 2IVJA 5L9BA 2ILMA 1OLMA 3APBA 4Q5OA 4LBMA 1FAYA 3M3OA 1NCRB 1SBFA 4OMDA 4WM8B 2ZGUA 1G9DA 1TMF2 3IDEA 5HCAA 1TNFA 2VZPA 2UU8A 3ZXGA 5L36A 4QB6A 4XCBA 3MIDA 1JZ3A 3LZZA 1QJX2 2ZGTA 3DN7A 4P08A 5DAPA 4BIOA 1DZRA 4ZXKA 5E88A 2C6SA 4C91A 3R6SA 1US2A 2ZZJA 4GWNA 3K3OA 4UFHA 2ATFA 2YY1A 1U12A 1GZWA 1QMJA 2TNFA 2VW2A 2WNUB 3M7AA 4GZ9A 4K9SA 5FLHA 3D82A 5EQUA 1HRV2 4JKLA 3ZIWA 2ZX1A 3ZFGC 4COZA 5F1RA 2VUDA 1BMV1 2CDPA 1TZOA 4CCJA 1ND3A 4HPKA 4OLLA 4LLOA 4ORFA 2F4PA 1ENQA 4QXCA 2O1QA 1OHFA 1J1LA 1FX5A 3OGRA 3M2MA 3H3ZA 4S2DA 1CWPA 3OEBA 4EN7B 1QXJA 1AR82 4CCOA 3HNYM 1DQ4A 1KEXA 1NCRC 3HD8B 1FOD2 4P5YA 3WDYA 1X50A 1V6NA 4LBKA 5FMOS 1QJU1 1UOJA 3E6DA 3QOPA 1W05A 2R16A 1OQEA 2JENA 5FYZA 3RZJA 1JTZX 2FMYA 3PIGA 3OBAA 3CQOA 4Q2FA 4OHZA 1XJAA 1LULA 3T2PA 4CP2A 2WNUC 1Z7S3 5BNOA 2HLEA 3DGTA 1QJEA 1K42A 2GSYA 1UXZA 1CZVA 1ZM1A 3OUJA 4N7UA 4QPWA 4WZFA 5FZHA 4L11A 1N1TA 2XVGA 1CQ9A 1NQJA 1B09A
chains in the Genus database with same CATH topology
2RHPA 1OA3A 5FFOC 1FNYA 4GMP1 1Q8OA 4CDQC 1R1A3 1AR91 4MH0E 3M70A 3M3IA 1RHI1 1TNRA 1DQ1A 5A3LA 4GB31 2IXHA 3VBHA 3NAPC 3TN93 4QU2A 1V9U2 2MEV1 3H3UA 2ES3A 2ZMLA 4G9SB 1M06G 4ZU4A 4Q4X1 1UPIA 4CRQA 1V70A 3KD4A 3WNXA 2TBVA 4EV0A 1AXYA 3WDTA 1RUG2 3CLPA 2AREA 3R4DB 4Q0UA 2JG8B 1OKQA 3P3PA 4FPEA 2RMU2 2XJTA 4BE3A 3AMNA 1PVC3 1N3PA 2WZR1 2H0VA 4COWA 3VKNA 3UJOA 3BOPA 4XJ9A 2HYKA 4BWOA 5DUWA 3RQ0A 5FOJB 4XFBA 1BBT1 1O4YA 5FLIA 2R1DA 1W6NB 4YVSB 4QQHA 2ZKNA 4CDXB 1KD7A 1VAMA 2PHXA 2WLQA 5BNPB 2WS91 3GYDA 4RQPB 1W0OA 4GH4C 1FV2A 2JECA 2PHRA 3OYWB 4XF3A 1SLAA 1VALA 1RUF1 3N3HA 2ZAHA 4HANA 2ARBA 4FOWA 1G9CA 2QQPA 5GLUA 3VBRB 1ZZ6A 2CTVA 4JGYA 4QPGB 3T2TA 4BA6A 2D3RA 1BBT3 1O3QA 4HETA 1YXWA 2RJKA 1LOAA 2FHRA 2G9GA 3ME2A 4YGEA 3OPZA 3WP4A 1WA4A 5K0UC 1PIV3 4OI4A 4KWKA 4M3CB 5L7OA 1TMF3 3H8UA 2B39A 3WT3A 4LHLA 4FPFA 1C8NA 1VRH2 3SH4A 5AFBA 2CNAA 3D6EA 1IS3A 1QJX3 3JB8A 4LA2A 2AR6A 3H9AA 1R083 3RYPA 4P14A 4NPRA 2PELA 4ATFA 2RR13 2E51A 3CNAA 3GZAA 5J48A 1H2LA 4N53B 3J8F1 1WW4A 5CFCB 1ZZBA 2ZGKA 3VBRA 1YFUA 4FTEA 5FPXA 1PZ9A 3ZSJA 4XFHA 2VGDA 1D2SA 2GAUA 3WLUA 1QQP2 3B5LB 4AXOA 2YDEA 5I8TA 4CEYA 1ZNPA 5JDBA 4UW3A 3ROUA 4JDMA 4PLNA 3C2UA 3JD71 1LGCA 3VBSA 2NN8A 1WLTA 5FAXA 2XWJB 1NOVA 1QOOA 4MSVA 4AGVA 5GZEA 2DCJA 3WG4A 1HV1A 4OHWA 4L2NA 3MFAA 2ZGPA 4K3UA 4X8PA 1KS5A 3I54A 1A6CA 1R093 2O8OA 1W6PB 4FO9A 3ZXEA 4GMP0 1HQWA 1URXA 1LGBA 5ABJB 1XYOA 2P3JA 4LBQD 1X7NA 4GKYA 4SLIA 4X8NA 1CAUB 4WM7A 1WMEA 2DWRA 1CX4A 4BIFA 3MIBA 2RJLA 4GB32 1RMU3 3RDIA 4XQWA 1PGSA 2DVAA 2K0GA 1HQNA 4EROA 2WFF1 1PVC1 3VBOC 4PJYA 1MQTC 3LGRA 1PZ8A 3DF0A 4FQZA 3HWJA 4AHYA 4LHNA 3Q9OA 4AI0A 2Q8OA 1BK1A 3RMXA 4AQ2A 1JN2P 4BYYA 1ND2A 3NV3A 2PLV1 4B29A 1AR61 1OOPC 3WW2A 2H6BA 5JZGB 2R063 1W39A 3LA3A 2Q1MA 2A3YA 1CPMA 3EHKA 1X33A 5KXBA 3QCWA 1FOD3 1R1ZA 4IQPA 3MF6A 3I7DA 4RR3A 3USSA 4RHV3 5L73A 3O0VA 3MFCA 2ZBJA 4Q4Y2 1ZBA1 5BYNA 2ZX3A 1LHNA 4LE3A 2VMIA 1H1MA 2DURA 1AR63 2RS53 5AVPA 3RNSA 4BH9A 3VZMA 4YGBA 1LHOA 3DV8A 5J98B 3IDCB 4Z82A 1LODA 3VBRC 3GBWA 4AGRA 4ATEA 4AVBA 5JCTA 2XLGA 5ABJC 4Y20A 2RS11 2D44A 4Q4X3 4D94A 1LOGA 1ZVFA 1QY4A 5C9AC 1KRIA 1RUH2 2VU9A 1GZCA 3NKTA 1N1SA 1WMDA 4HKWA 3ES1A 1RUG3 3PHMA 4QQPA 3E6CC 2GN7A 1OFNA 2DUPA 2LALA 3MEPA 1RUD3 1S0CA 2TEPA 3ZFFA 4DY3A 5TSWA 2B46X 1MS1A 1QJX1 1W0PA 1EV12 2ARXA 1LECA 1W6OB 1OA4A 1VBE1 2ZZQA 1H2NA 4XETA 3AM2A 4AYUA 1PK6C 2WNVC 2ZA9A 1HX6A 1WLCA 2ZJCA 1AZDA 4W6WA 4E4SA 2CY6A 1Q3EA 1V6MA 2D43A 1UX6A 2MNGA 1NE6A 4XF9A 1JUIA 3VN4A 5CG9A 5BPXA 3R4SA 1BQPA 2ET1A 3ZXFA 1Q56A 3WXPA 1AR81 1WW6A 2CWSA 5D1IA 2JG8A 4YVSA 3AMPA 2EXIA 4NHMA 1O5LA 2KM2A 3MIGA 1HRI3 1RUI3 1Y7BA 2ZGQA 3VBUC 2JG9A 3FLTA 3WV6A 1YIFA 2GMPA 4MXWA 1V9U1 3ZYRA 2BVBA 1QDCA 2RR11 1HQLA 5FREA 4ASLA 1C8M1 3ZXJA 5FO9B 5KC5A 3VBHB 3ZMOA 5LRRA 2BGCA 1DGLA 3CF6E 3TNQA 4FOYA 2E53A 4Z2WA 4YM3A 4META 1IZ3A 5H9RA 3WD5A 2HEYF 2YHJA 4YZ4A 3ILRA 3HIFA 3RG0A 1TMF1 4AHWA 5KXCA 1RUI2 1NG0A 2NPIA 2XL7A 3POYA 5K0UA 3KCXA 4Y4YA 2IFRA 3TBDA 2CGOA 3MW3A 3WX5A 1BVVA 4PCRA 1FXZA 1EYBA 1WD4A 1S0BA 1RHI3 4U36A 5I93A 3VBFC 2WINB 4R4ZA 3U0ZA 1N3OA 5FQ0A 3AFKA 3LCPA 1WCKA 2E9QA 3LSDA 4RL7A 4IEZA 4LUKA 4OI0A 1UU5A 2WLPA 2Y26A 3OD4A 2R0HA 2D93A 4XILA 4XJUA 4XTPA 1YYNA 3KT1A 2DCTA 5FTTC 3ILFA 1AL22 4R9BA 2V73A 4AK3A 2BFUS 3FE5A 3B9IA 1ALYA 3AXEA 5J96B 3BCWA 3JU9A 2WZR3 4Y26A 2PAEA 3ENRA 2WC2A 2E6VA 2D6PA 3EXUA 4IV3A 2GNMA 4ISQA 4B8EA 5E8AA 1S2KA 1YJLA 4MXVA 5I91A 1PK6B 2WNVB 3HR9A 3AMHA 3ZDSA 4UW6A 2DV9A 4CEWC 5JIUA 4FQ4A 1H8TB 5DDJ3 1I3HA 5FO7B 4LHKA 3O7OA 4PDWA 5KHGA 5JWPA 1YWKA 2DVFA 4FPJA 2Z42A 4QQ2A 5CFDB 1GKBA 5D8AB 1RUD2 3ZFGA 2ZABA 3WUCA 3D0SA 2EA7A 5CIRA 4W6XA 5JPNB 4FAGA 4P9WA 4Q0VA 1PIV2 1QJY3 3MPPG 3PJYA 4PLMA 1KS4A 1SEFA 1JXNA 1R081 1ZREA 3ZYGA 4CDUC 1AR83 1MS8A 1DLLA 3WINE 3ZN6B 5LEKA 4N43A 4Y1YA 4YVSC 3WG2A 2PLV3 2WQ4A 1IOAA 3AKPA 3MYXA 1ZZ9A 4AVAA 2UWBA 1M4WA 2GNTA 4LBQA 2JG9B 1DFQA 2FBEA 2ZGLA 2DTWA 2VVEA 5CB7A 3AP5A 5EYYA 1PO21 2BEOA 1SACA 4L92A 4E2SA 4NN0A 2VNGA 1ZZCA 1RUJ1 2WT2A 1TEIA 2A70A 1AX1A 5JOYA 2D40A 2PHTA 1LOEA 4PIYA 1UPSA 4FPCA 1VB4A 4CYDA 1CJDA 1VBA3 2D6KA 3VBFB 4RSUA 2JX9A 4AG4A 1XU2A 1C57A 3MLLA 1AL0G 1HXS3 2VG9A 1X82A 1AR73 2YZ4A 4NOTA 1J1TA 2ZGRA 1VRH3 2D6OX 2XJPA 1B35B 1SLCA 1YHFA 5FDBA 1XNDA 2CGNA 2F6BA 5E1RA 4CDUA 1PNFA 2EIGA 4NO4A 1LCLA 4YVWC 1VBC2 1AR93 4XIKA 2QDNA 4GB33 1NQDA 4Q4V1 1Z7S2 4IEQA 1BBT2 1ENSA 4G4FA 2EXKA 4LO8A 3RJ2X 2CAUA 3THTA 1CAVA 1KFUL 4JAAA 1QJU2 1RUC2 4ONUA 4P9YA 4SBVA 3CL1A 1AVBA 3BB6A 1F5FA 1DYKA 2VH9A 1V6IA 3DKWA 2VMHA 4TLFA 4PIXA 2HEVF 1W6MA 1S1AA 3NAPA 1VBB3 1H1AA 2KXLA 1A8DA 2ZGNA 4HVOA 5K7PA 4K1YA 2D3PA 2GNBA 1TE1B 4XXAA 3ZO0B 3VUOA 3MF9A 1IKQA 2R062 3WP6A 1IGOA 2V09A 4KG8A 1RUH1 1S0FA 2XKOA 1PM7A 1I5ZA 4WBBA 3OTFA 1C1LA 2QZ3A 3B3QE 1XE7A 1T6GC 1SBDA 1G9AA 3M3QA 2JD4A 1QXRA 2QNKA 4ZU5A 1MS9A 2HWB1 5J36A 1VBD1 2HWD3 5IK4A 1ASJ2 3FMGA 3LA2A 1GFF2 3MW4A 2XGXA 1OA2A 3QLQA 4M0HA 2FMDA 4Q4V3 5FO8B 1GSLA 1EAH2 1MQTB 2VNRA 1RIRA 3WW1A 3NAPB 4AI2A 1QF3A 1C8M3 1RUE1 1BEV3 5HCBA 3NO8A 2CGPA 1RJ7A 4JGZC 1SFNA 1DQ6A 1V00A 4OVEA 3IMNA 4OHVA 5C8CA 2WNEA 3KS7A 4FPOB 1RUE2 4YW3A 4B7EA 3R4UA 4F3JA 1VBC1 3ZPYA 4AI3A 3JD73 3TNPB 2PLV2 4MLOA 1ZZ7A 1Q8PA 1J3PA 2I74A 2VVFA 1LENA 2YYOA 1JHNA 3HN1A 4I0BA 4WM7B 5I0SA 2R32A 1BXHA 5B2GB 3FUOA 5BXXA 4OUMA 1SFYA 2QUOA 4HZFA 4LO4B 4L8QA 4FVVA 5FLJA 2CYFA 2WA3A 3JBG2 1REFA 2A7AA 2E7TA 4Z07A 5I8SA 1J58A 3V0BA 2WS93 1WLDA 2IXCA 4Y1ZA 3PVNA 1VAKA 4FAHA 1W6QB 1RC6A 1NCQA 2DVGA 3DPRA 3MGUA 2BNNA 1RUOA 5DUXA 4AEJA 1QXPA 1WGPA 4TYSA 5JZGC 4DRVA 1FATA 1AYM1 4IEPA 1XYNA 2VOWA 4CEYC 2HWB2 2A5ZA 4LBNA 2RR12 1NLRA 3AZWA 3M1HA 5H9SA 2LTNA 4QT6A 1FNZA 4KQ7A 1KDKA 2XWBB 1LOFA 1G9BA 1LU1A 4RGGA 3UKVA 2I2SA 2V5YA 1GNZA 3I8TA 1V6JA 2B45X 4AWDA 1V9U3 3PJQA 3UL2A 3AKRA 2IXKA 4DRRA 1EY2A 2WA4A 2IXIA 3MIHA 3JQWA 4O9GA 4C90A 2A3XA 4KL1A 4IEOA 1UAIA 4YM1A 4A2UA 1KITA 1RUC1 1AXZA 4H55A 3TWIA 2DTYA 3PMSA 5FPZA 3WZ1A 3NJZA 1MVEA 4LBJA 3BTAA 4Y5Z0 1GANA 4FPHA 3UV9A 4K8FA 3D8CA 3IM0A 3IIAA 4WV8A 4AW7A 4JGYB 5A33A 5CBLA 4K6BA 2VUAA 5C4WA 1AYM3 4MGIE 1HXS1 1YFYA 1CPNA 2MEV3 2DCKA 1XNCA 1WUVA 3OBTA 1GV9A 1TME1 2WFF2 4DXZA 1RUD1 1KXGA 1PNGA 3LB9A 1J59A 5A32A 1JBCA 2HWE3 4M01A 2D97A 4FXKB 4GH4B 1HXS2 2P37A 4E9KA 5AVAA 4D7TA 1RL3A 4DZGA 3NV4A 5GALA 1OPOA 3MIEA 1XXNA 4GALA 2DF7A 1REEA 1PGW1 1NA1B 1O91A 4OI2A 3ZIXA 5DDJ1 4YLZA 4F83A 4LULA 4YW2A 1IS4A 1AYN1 4XTMA 2YGLA 3AX4A 3V0BB 4B3NA 5J3UA 3VZNA 2XJVA 4KWLA 2NMOA 4XDQA 4TSVA 2XKPA 1S55A 4A3XA 2ZMKA 3SMHA 5GM0A 1UKRA 3OGJA 4WVMB 1DBNA 1LTEA 2OZJA 2Z69A 3KQRA 3SH5A 2QKDA 3AP7A 1GLHA 3AP4A 2RS51 4N90A 3HBZA 1FMD2 4FOVA 4JC1A 4OI1A 5IUQA 4CTEA 3A4UA 2W52A 3I2DA 1Z0HA 4FPLA 5JI7A 4LO6B 2BW8A 2XBO1 4AGGA 4HSJA 2JG9C 1LOFC 4YRDA 1F2NA 4FPGA 2E7AA 2RS12 3IDBB 5KWRA 5CNAA 1IHMA 3X29B 1C5IA 4QPIB 1AUYA 1CD3G 4GIQA 5HCFA 4J1WA 3ZFGB 1DDLA 3E5QA 1D4VB 5T52A 5C8CB 3URFA 1EPZA 2LM3A 1ASJ1 1POV1 1DG6A 2O8QA 4AHZA 2AYHA 2DUQA 3WHTA 1A8MA 2IC1A 1DGRN 1LU2A 5J7MA 4KU8A 1ZRCA 4DFSA 4YM0A 2JKBA 2VW0A 2R042 1VBA1 1QHDA 4YNIA 2CWMA 4PLOA 1HLCA 4YFWA 3BPZA 3AFGA 3O5SA 1MS4A 5DZFA 5A32B 1IS5A 3I4IA 4BMEA 3C3VA 1S0JA 1VBA2 4YGCA 5BNNB 3RI8A 2HWF1 2GN3A 4BCUA 1TQ5A 2XBO3 2DU1A 2Q4SA 4LEJA 4CDQB 3T1MA 5J37A 3WW3A 4AQSA 4WM8C 3NW4A 4LBLA 2XL9A 3IKWA 1QNYA 1W2UA 3HT2A 3LA7A 4XBLA 1RINA 3L2HA 1L3JA 5I8YA 4Q4Y3 4D69A 3WY6A 1VBE3 5DZGA 3AP9A 5K0UB 1AJKA 3ELNA 4E2GA 4LR4A 1OD5A 4YW4A 2D6NA 4N53C 5AC91 3POWA 1SDWA 3HT1A 3SITA 4EN6B 2X8KA 5K9YA 3ZX7A 2YMZA 4AFAA 4GKXA 1HKDA 4XJAA 5DUVA 2HEWF 4LO5B 3VBFA 3UJQA 1LOBA 1YLLA 2R043 3VBOA 2YGMA 4YW1A 3MIFA 3R05A 4NVPA 1VBD3 3P3NA 1AYN2 3W58A 1Q5OA 4DNYA 4E2QA 1RUH3 2CAVA 1KJLA 1CR7A 3GNEA 1W6NA 5GLWA 1FV3A 2X53S 2MEV2 3WR0<