3VHOA

Y61-gg insertion mutant of tm-cellulase 12a
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
256
structure length
256
Chain Sequence
MVLMTKPGTSDFVWNGIPLSMELNLWNIKEYSGSVAMKFDGEKITFDADIQNLSPKEPERGGVLGYPEFYYGYKPWENHTAEGSKLPVPVSSMKSFSVEVSFDIHHEPSLPLNFAMETWLTREKYQTEASIGDVEIMVWFYFNNLTPGGEKIEEFTIPFVLNGESVEGTWELWLAEWGWDYLAFRLKDPVKKGRVKFDVRHFLDAAGKALSSSARVKDFEDLYFTVWEIGTEFGSPETKSAQFGWKFENFSIDLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-glucanase
publication title Enhanced activity of Thermotoga maritima cellulase 12A by mutating a unique surface loop
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 60
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vhoA00
3AKTA 1BVVA 4HK9A 2JENA 3HD8B 3VGIA 3WQ7A 1HV1A 2DFCA 3B5LB 4S2HA 1XNBA 3WP3A 3VZJA 5EJ3A 4IXLA 3ZSEA 3WXPA 3WQ1A 2BWAA 3WX5A 2D98A 1REFA 1REDA 2B42B 4S2FA 3VZKA 1KS5A 2JEMA 1H1AA 4HKWA 2VGDA 3WY6A 2QZ2A 3VZOA 1BK1A 2D97A 1PVXA 1OLRA 1XYNA 2C1FA 3AKSA 2B46X 1M4WA 1H8VA 5K7PA 2BW8A 1XNDA 2DCJA 3VHOA 3MF6A 1H4HA 1HV0A 3VHNA 2Z79A 5HXVA 2F6BA 2BWCA 2NQYA 3RI9A 2BVVA 1ENXA 4HK8A 3VZLA 1UU4A 3VHPA 1H4GA 1T6GC 3MFAA 1OA2A 2QZ3A 1QH7A 1UKRA 3LGRA 1AXKA 1YNAA 1XYPA 1QH6A 1XYOA 3VZNA 2DCYA 1TE1B 1XNKA 3AMNA 1C5IA 2VULA 2DFBA 1REEA 3WR0A 3RI8A 4XQWA 1XNCA 3WT3A 4S2DA 1C5HA 3VL8A 3VZMA 3WP6A 3VL9A 4H7MA 1HIXA 3AKPA 2DCZA 3LB9A 1OLQA 3EXUA 3VLBB 1XXNA 1BCXA 2VG9A 1UU5A 3MFCA 4HKLA 4XQ4A 3O7OA 1OA4A 4XQDA 3AMQA 3AMPA 3MF9A 4HKOA 3AKQA 3AMHA 2NLRA 2DCKA 3WP4A 2JICA 3WQ0A 1UU6A 3AMMA 4XPVA 4S2GA 2B45X 4NPRA 1OA3A 1IGOA 1F5JA 3AKRA 3M4FA 1W2UA 2VUJA 1H0BA 3WP5A 5K9YA 1NLRA 3B7MA 1KS4A
chains in the Genus database with same CATH superfamily
3C3VA 3C7OA 4NE9A 2YU1A 4FXKB 3S7EA 4HK9A 4PDWA 5C8CB 2EAAA 4LE3A 4RS5B 1RUC2 2VZOA 2XPJA 3BTZA 1D0HA 3O1MA 2BP6A 4LLFA 3L2YA 1OLMA 3NV4A 2E7AA 1W90A 2FDHA 3FHIB 3GZEA 1CZVA 1OFNA 3KZ4C 5DUVA 2G9ZA 4FSJA 2XXZA 4Q29A 3MUZ1 3IMNA 1WKYA 4N90A 3WXPA 4D6RA 4XCAA 3VB9A 3ZXEA 1SMVA 1YJKA 4PI2A 3DF0A 5I93A 4MV2A 3T0BA 5L36A 2P6CA 3WY6A 4A44A 2CDOA 2GU9A 2PHLA 3RJ2X 2E26A 2ZZQA 2WN3A 3AZYA 5LBBA 2EXHA 3THTA 5HI0A 1N3QA 4M4RA 5KHKA 2PTMA 2UURA 4FPLA 1XBFA 2AC1A 1GNZA 1UMZA 1RUH3 2W52A 2HWB3 1JTZX 4HVRA 4FOQA 5LW9A 5AC91 4UFJA 3MLKA 5FIXA 2W1WA 3MO4A 2A5ZA 1V6MA 4JAAA 1RB8G 3VHNA 1N1SA 2YYOA 4PCRA 4QDSA 5FYTA 2PA7A 2XDVA 3H7JA 5GZFA 3CF6E 4GB31 2J1TA 2HBUA 2JDHA 4WM8C 3M8LA 5CKMA 3TOJA 1H1IA 1QWRA 1H9WA 3NJVA 3K4DA 1ZZ6A 2A75A 2WFF1 4UWDA 5FZCA 1SLTA 4P9LA 1NG0A 5FFOC 3RFRA 4E27A 3GBGA 1UL9A 5FZBA 3ACLA 5E16A 3NNJA 4ISRA 3MDPA 1UWWA 4CTEA 4W50A 1ENQA 5DABA 1UKRA 4BXFA 3W20A 4Z2AA 2NM1A 3RZHA 3VD7A 2XJSA 4XF3A 1DYOA 1FYUA 2PMWB 3JB4C 4Y22A 2FZ1A 4ZXKA 3MZHA 1N1VA 1VPHA 1AXYA 2JG8C 4Q8KA 2VOXA 1KD7A 1WW6A 4CU8A 2ET7A 2P4EA 2RMU3 4AGRA 1V9U1 3WR0A 2IFWA 4LT5A 1G9FA 4XQWA 5CFCC 5T5LA 2NP0A 3RQ0A 1K5MB 3ACHA 4DUVA 2QJVA 3OUJA 2C0ZA 1CZTA 3UKNA 5BNQA 2YHJA 5T52A 4P00B 3VL9A 2VY0A 3D8CA 2WR9A 2QQNA 3E6BA 4QPGC 1AYM2 4E4DX 5DMYA 3KCYA 2YGLA 1O4TA 3NV3A 1QY4A 3I2DA 4QQOA 1WCSA 3HT1A 3WNXA 4A7KA 4CU7A 2WA4A 1E5RA 3HAGA 5A1FA 4Z82A 1XPWA 1S0IA 1PK6B 3B02A 3RSJA 3WP4A 2WO7A 1VLNA 3N7KA 2GMMA 2CYFA 2IWGB 1JHJA 3N7JA 4R8HA 4XDOA 5FZAA 2WLQA 3O1UA 2RS31 2OZ6A 4Y5TA 4N43C 3LWCA 2VW2A 3T09A 3T08A 1QJZA 3MLLA 2ARAA 2AYHA 4Q26A 3E5QA 2XJPA 3MPBA 3OD0A 3POBA 3ES4A 4WM7A 4PJYA 4AG4A 2JG9C 4D69A 4QKFA 4O65A 5L7OC 2J22A 1KXGA 1V00A 2HEWF 1NOVA 1ENRA 3OGJA 1NAEA 3NNMA 4BZ4A 2EIDA 5JOWA 4LBLA 4JGYB 3RYPA 4B29A 4AEKA 4MGKE 1LOGA 2D6PA 1AR93 4A7YA 1LOEA 1NCRC 2E7TA 3AXDA 1FNYA 4LO4B 2ZX0A 2Y64A 4XFBA 5C6CA 5AFBA 2GH8A 2JE7A 3HN3A 4Q0PA 2CAVA 1DQ2A 5LY2A 3LA3A 3LOIA 5JOYA 3E6CC 1RINA 1UF2C 3OUIA 1WLCA 5LATA 4AEDA 3GCXA 4CZSA 2BERA 2XL7A 3ZKUA 4TLFA 4KGQA 3GGLA 1VB4A 1HB2A 1F8VA 1I5PA 2C6SA 3VD3A 1J1LA 4KWLA 2XJQA 1HJFA 4V2VA 3RYRA 4L8QA 2CTVA 3IIIA 4UBHA 4IEPA 5FRAA 1IG3A 4N7UA 1AF9A 5CB7A 3WNPA 4OVEA 1X82A 4QHOA 5F3EA 4FTSA 2YG0A 5LK7B 2DCJA 4BA6A 3H1YA 3ZIXA 5A6XA 3VDBA 2IXJA 5B4XA 1NA1A 3UT0A 2Z79A 1BBT2 2ZGPA 1SBDA 1OOPC 1LOBA 2GN7A 1CR7A 1OHFA 1PO23 1YUDA 4P9GA 4YW2A 1Q8SA 2VOVA 4X8NA 4URTA 1XE8A 2VCAA 4RFRB 1DCSA 3ZXJA 3B9IA 3BUCA 4Q4Y3 4QXCA 1N3PA 2YBSA 5T5JA 1WMXA 3MGUA 1O6UA 2BOJA 2XLAA 2VQ0A 4KG0A 2VW1A 2H0VA 3X29B 1GR3A 1RUF1 2VUDA 2QCSB 2WABA 3BPZA 4JDNA 1LHOA 3A7QA 3LIGA 3ZN5A 2AENA 4XZPA 3SNMA 1HDKA 4AF9A 3ZFEB 3VZNA 1ZRIA 2X10A 1AR71 1NCQC 2VC9A 2Y6JA 4OI2A 4E2SA 3OJBA 4PDWC 3P6BA 1GYKA 2AEZA 2CNAA 3PLQA 3CJIB 2PHFA 4I0AA 3CJXA 1R1A1 2ZJCA 3TAYA 4UF0B 5FZGA 5AC92 1US2A 2X53S 2BBAA 5D8AB 2ZEWA 1AJKA 3JBG3 3JZVA 5FQ0B 3MHZA 5C5UA 5J96B 1C57A 3K2OA 1DBNA 4IESA 2C9KA 2ZS6B 1ST8A 5FZ8A 5FY9A 4YVSA 5I0UA 2WFF2 5DUUA 3ZPOA 4MADA 1DQ0A 3AMQA 1SPPA 3FUOA 4DFSA 4YWAA 5JDBA 1ZBE1 1VBD3 3H7YA 4XTMA 5A7QA 2D93A 5KHHA 3W59A 2KM2A 3KM5A 2JDUA 1O4ZA 2R30A 2XLFA 3POWA 4CEYB 5JZGA 2HWD3 2YBKA 2QQVA 3AL6A 3R4SA 5F2SA 1V9U2 3KLSA 3BOPA 3IKWA 1YFXA 5TSWA 3WF1A 3O0VA 4OMDA 1U5IA 4XFFA 3DPRA 5ERLA 4CDWA 5FZ9A 3WNOA 1PGL1 4MXVA 1YEWA 5E1RA 1OQ1A 3M3IA 4S2HA 1PZ8A 1DGWA 5F32A 4R9AA 3VBRB 3IM0A 3GM8A 1I3HA 1WCKA 2J1SA 3BODA 3ZFFA 1HX6A 4DPNA 3PUHA 4QD2A 3VKMA 2ZGMA 4JZRA 2LRPA 4OUMA 2BWAA 1RUE1 1REDA 4K7JA 4UW4A 4EV0A 3T0DA 4AHXA 5CG9A 3TEWA 1HQWA 3ZKYA 1LU2A 1OFSA 1VAKA 4EYUA 2VGDA 2PAMA 2TUNA 1H8TB 2OIIA 3VBHA 2B5HA 2RS32 3E6DA 5FO8B 2Q8DA 3K4ZA 3KQRA 3MW2A 2VQTA 3QD6A 1VMHA 5CYYA 3D4KA 4H2AA 1GFF2 5FP8A 3V0AA 1UOBA 1W05A 2BGOA 2TEPA 2VD7A 4CDQA 1MR5A 3ALQA 4XUQA 4GMP3 1DYPA 4XXAA 3WNMA 2WN2A 3ZN6B 5ISLA 3BU0A 4JRLA 5F6LB 1ENSA 1H1MA 1W3XA 2VU9A 2W95A 5DZEA 5FZIA 4CCJA 1PHMA 1W3VA 3MF6A 4HLTA 3BKZA 4RA0A 4LPLA 1PVC3 1YFUA 4J1WA 1QXRA 4JV4A 2YB7A 4QB2A 1CGPA 4EN7B 4BMBA 4JKKA 1QGLA 2XJVA 2VW0A 4MVTA 3VBSB 4LR4A 5LZ6A 1RUC3 4K8FA 3L2HA 1UZVA 3FLRA 4GJZA 2V73A 1JHNA 4AAPA 2IXHA 2JIGA 1PNGA 1YXWA 2K9ZA 1CX4A 3U0ZA 1JU4A 5FXZA 4QU2A 1W6QA 4XFCA 1AZDA 2YPDA 3D82A 4LO8A 4AQTA 1Q3EA 2J1AA 4C0BA 3VD9A 1MS0A 4EROA 2PHUA 2ZGTA 1UY2A 3BOWA 2AREA 4L97A 3WNNA 2QQIA 4WM7C 1LB2A 3F2ZA 2ZAAA 4GMP0 2VVDA 3O14A 1CVNA 5I0TA 2VL4A 1W6OB 2QNKA 5IT6A 5IJRA 4GD4A 4EN9B 4X6RB 1SEFA 3I3DA 5EJZB 2XL9A 4OUEA 1RXFA 5JPNB 4DIQA 4RQPA 3NJXA 4W4ZA 1SLAA 2VOTA 2QQOA 3FHAA 3NW4A 4QX7A 1MZFA 1ZX5A 3ZXDA 4TZDA 2MNGA 5JWPA 1WLTA 2BQPA 3K51A 3ZXFA 5LBEA 3N3HA 1A78A 2D3PA 2WINB 3B94A 5CADA 4NIDA 5JMOA 3I2HA 3WDYA 3RZKA 3BCWA 3WW4A 4KH9A 3H8UA 1FOD1 3LDRA 4YZ1A 1WLWA 1GZTA 1X36A 4META 4QQ2A 4AEDC 5IVCA 5K4LA 2VZQA 4XPVA 3S5QA 3VDDA 2H6BA 3NAPB 5FWJA 1JYVA 1RUF2 4JCKA 4XACA 2D6OX 3I2FA 1J1TA 4XJAA 1J3RA 2DVDA 4XBQA 1GQHA 2WYFA 4ZU7A 2JDKA 2B4KA 4XJZA 1AR72 2TBVA 5LA0A 2GDFA 1V6KA 1JYWA 1W99A 1LENA 4Z1VA 4JGZC 1D4M1 5BNNB 1WMDA 5FZ1A 1QOSA 4YGDA 2EVXA 2HLEA 3BU7A 4XAEA 1NA1C 1R1A2 4FPJA 4YGBA 2A3XA 2GAUA 4MHUA 1JZ2A 4E8CA 4E9KA 1BMV1 4KWJA 4CXYA 2ZKNA 4R9CA 2JJ6A 3A0KA 4I01A 3S5AA 2P3JA 3B5LB 2J1VA 1OBNA 1WMEA 4OYUA 1XNTA 4AR2A 2ZTNA 4IV1B 2IXLA 4PT6A 3HWJA 5T3NA 2WS91 1S0FA 5FUPA 1LHNA 2J1EA 4CP9B 2R041 1SG3A 1ZBE2 1T6BX 3VD5A 1DQ5A 4QX5A 1HJGA 1W6NA 4LEJA 1AYM3 2JEMA 4JQTA 5FMOS 3TN91 3THCA 2WNVB 3OEAA 1MQTA 4Z07A 5K0UC 1IOAA 4QXHA 3U37A 2C1FA 2VAUA 2ZACA 1JU3A 2DYCA 3MV11 4Y1ZA 4FAGA 4IQPA 5T5OA 4Q4W1 4G4FA 5A3WA 1XE7A 3USSA 3IDBB 1BVP1 1QOOA 2ID4A 2Z42A 3IDEA 3ON7A 2Q4SA 4FOYA 3RNSA 1CX1A 4FPOB 4ZXEA 4DRRA 2OVUA 1R091 1PGL2 5IK8A 4GKYA 3T1MA 1TG7A 1UOJA 2W92A 4LBQB 2N7GA 3Q9OA 4YVSC 1WCQA 2CY6A 3MICA 4B1MA 2W91A 1UW8A 3NVCA 4HVQA 3N7LA 2EXKA 3LQCA 1GNHA 1YLLA 4R9DA 5ANNA 5IVEA 3VUOA 3T2OA 1AUYA 1W8HA 3VBUA 4NPLA 4GULA 1RUE2 4LKDA 1NQDA 2Y0IA 2VTXA 4AEJA 5DUXA 1CD3G 4P9WA 5D21A 5JZGC 5KXCA 4GH4A 3AP6A 3ETPA 3BN6A 4A6SA 1OQEA 1SFPA 4AFAA 3O1OA 3OGVA 2CU5A 4ZZ5A 1XNKA 1ZBA1 4FPHA 5I0SA 1ZRDA 4CDWC 3DPRC 2BRTA 3HQXA 1UD1A 4QGLA 2V5DA 2WYSA 2Y6FA 2RJLA 1VBA1 1UZYA 1ASJ2 3HVDA 1RMU1 1CJDA 3CHXA 2CWSA 1POQA 2E51A 4RSUA 4BLIA 4Z8BA 2LM3A 5JSRA 4RHV2 3ZFFC 2KR2A 2RDRA 3C8XA 3DYMA 2FQPA 2NMOA 4J25A 4TLGA 5H9QA 4LBJA 3Q8BA 4HKLA 1CWPA 4DEQA 4LHSA 4EE2A 1BBT3 2DBIA 2R32A 3OUHA 5I8TA 1CIYA 4CA9A 3H8OA 3KV4A 4GMP1 5KC5A 1Q8QA 2DCKA 3H3UA 1V6OA 3VBHC 2FDKA 2DU1A 2YC4A 2RE9A 4A45A 2OUJA 1OLME 1OA3A 4YVWB 3GJAA 4AFBA 2EALA 4EWAA 5FO7B 2D3RA 2W1UA 4CDQC 5IVBA 1PVC1 5F1RA 4F7ZA 2X5IB 2GC1A 1YJLA 1EUUA 4XJ9A 4BWOA 5L19A 2LUWA 2QQUA 1VIWB 2VOKA 2FZ2A 1W2OA 3LCPA 2LROA 3MW3A 5C71A 1AL22 2CDPA 4HETA 3HD8B 3RJRA 5FY4A 1HV1A 5DAVA 4XDQA 3BB6A 2W39A 4AL9A 5AC93 4OHZA 3H8XA 1XU2A 1AX2A 1NZIA 3I7DA 3G7DA 1LEMA 1FOD2 1GMMA 2PQSA 2PQQA 4P9XA 5FZKA 3WQ1A 4AFMA 1EPZA 2ZOEB 4OZXA 3WINE 5IK5A 2WFF3 1HRV1 1TZOA 3EQEA 5CFDA 3H1MA 4XUPA 2HKXA 1JOJA 3FBYA 1X33A 3RWNA 2P34A 1O3SA 2D97A 1H2NA 1PVXA 3I59B 1OLRA 1VJ2A 2GMEA 4DXZA 1MS5A 1LODA 2W1QA 3I54A 4C1WA 1C8NA 1DGRA 4LBMA 1D4M2 5FP4A 4LLOA 1FAYA 4JDOA 3ZXLA 2DUOA 2DVAA 3ENRA 4RQPC 5FY1A 3RGBA 4KBBA 4WVWA 1WCDJ 2AEYA 4IEUA 3SH3A 4AI1A 1BMV2 3FZ3A 5BPXA 3KT1A 5GLTA 1V9U3 2DURA 1ACCA 3R4DB 2B39A 3ZYFA 3I2IA 1RYYA 2BVVA 2WS92 2XH6A 4AK3A 4HSLA 1RVF1 4GWMA 2R042 2R1DA 5FZ4A 1G9DA 3VDDC 5EXOA 5C4WA 5CBLA 2DTWA 2YZ4A 2ZMLA 1QH7A 4B7EA 3TN92 1AJOA 3LEMA 3ZDSA 3LGRA 1WW7A 1IPJA 1LOFA 2W87A 4WVMB 2ZHKA 5C8CA 4D8MA 4RS5A 1UN1A 1IKPA 4K21A 4MXWB 1K5JA 4P9JA 4Q4W2 2XVLA 1HN0A 2BJSA 5GZEA 5C3QA 1I5ZA 2RS33 1AYN1 3QBQA 5IHRA 4QDQA 5FAXA 4BK4A 5BV6A 1BQPA 1R092 5A7NA 4N8MA 3KVAA 1YQCA 1BYHA 4IE4A 1C5HA 3PDQA 1XB9A 2E9QA 2XJRA 4LQRA 4BYYA 1WA4A 1EP0A 5IVVA 2BNMA 1IPSA 4QX3A 3UGHA 1XSQA 1JOPA 4N53B 3O7OA 3N36A 5JCTA 5FPVA 1C8M2 3LE0A 4MGYE 4DINB 4JVAA 2JDNA 4FPYA 3WHUA 2V4AA 1JZ8A 2ARBA 1MQTC 1RJ8A 1FI2A 2XGXA 3K4AA 4D6SA 3O1VA 1NLQA 4LOTA 3C7HA 1XSRA 5IVJA 1OF4A 3DXUA 4M3CF 5CNAA 1QDOA 5LY1A 2A73B 5DQ0A 1KDKA 3EYPA 2ZX2A 3KV6A 1W28A 5FZ3A 1NZCA 2QUOA 1ZBA2 4ZHNA 1CAWB 3O1TA 4HANA 1QNWA 5AVAA 5FXWA 3U75A 1W8TA 3KMHA 1KS4A 1VBA2 4IE7A 3NL1A 2WWUA 4PI0A 3UK9A 3VBOB 1RMU2 1RXGA 1FNZA 2CV6A 1GUIA 3AL5A 1GQPA 1Y9QA 3EHKA 4XURA 1F9KA 1DIWA 4BLJA 4IV3B 2DUPA 1GBGA 2WQ8A 3VBUC 2A71A 2E6VA 5AFEA 3JU9A 1A3KA 1RC6A 4ZPIA 2YC0A 1KJLA 3RZJA 2WZEA 2XHKA 1ULEA 3HIFA 1O59A 2ARCA 1A6CA 4S2FA 3K46A 1ULDA 4GH4C 4NMIA 4NIIA 1G9BA 1UYYA 2GMPA 2ZGQA 1YQ5A 3A21A 1OXCA 5FBZA 2BYVE 4AHYA 3V56A 1K5MA 3J9SA 3AM2A 1W06A 1XYNA 1ZZBA 3T2QA 3H50A 3AJYA 4R4ZA 2UYAA 1HKDA 2ILMA 1SLBA 3FC0A 2JD9A 4XJUA 5F3GA 1HXS1 4TN7A 1XU1A 1RUF3 3P3PA 3IPVB 5FK7A 5J1XA 5FTTC 1CN1A 1JYNA 3LD8A 4N9HA 5FPLA 1BBT1 5FZHA 1GQGA 4AZZA 2G4IA 4MGQA 4XW3A 3IN9A 1AR73 2I74A 2E7QA 2JE9A 1HV0A 4RR3B 1DFQA 4XHBA 4FO9A 1NYWA 5DUWA 1UOFA 1PK6A 1O4YA 1N47A 1R1A3 1J3PA 3J7NA 3OBTA 1ENXA 1KRIA 4HK8A 4CYDA 4XHXA 2DU0A 1GP4A 4P5YA 3RVHA 1NX9A 2P5BA 3WW1A 4EZ4A 3VKNA 3ZM8A 2GC2A 5BY5A 4NIHA 4HFSA 1E5HA 4TWTA 2ES3A 4LIVA 4BQ1A 5HV0A 4X6QB 3MFAA 1VRH1 1YFWA 5J36A 1NE6A 4Y1VA 2P17A 2AGSA 3ZX7A 1HRV2 4W6YA 4AI2A 3KHCA 4NUBA 2XJUA 2ZHNA 5C3OA 3POEA 3G6JB 5L7OB 1ZBE3 1CPNA 2YPJA 1XYPA 2WZPP 3M1HA 4MOAA 1O8PA 2VUCA 3LEIA 4JGYA 2DF7A 3FN9A 2CL2A 3ME2A 5CU1A 5H9RA 5KHIA 2WNUA 5IYYA 2O14A 3ZSJA 1APNA 5F39A 2VO5A 4WVVA 3POIA 1WGPA 3ATGA 2D43A 1OI6A 3ASIA 4HN1A 4CU6A 2NPIA 2BNOA 3UGGA 4CSWA 2Y33A 1OVSA 3I49A 5CEHA 1OLQA 2YGMA 3LAGA 4ZY9A 1BCXA 5SV5A 4AQSA 3IAPA 3CNAA 1RVF2 2ERFA 2WA3A 2ZHMA 4KNCA 1FV2A 2B9UA 5A7PA 2ZGLA 2GSYA 4D7SA 4NROA 3USUB 1LU1A 5CFDC 3ZYJB 2AZ5A 1JI6A 5T5PA 3NNGA 5A3UA 2P3YA 2OZJA 1W8OA 4BHPA 4A4AA 4AVVA 5EPAA 4EJRA 1B35B 3RZGA 1RUE3 2WWSA 2JX9A 1C1LA 2XWJB 4OUSA 3SHRA 3CQOA 3M4FA 3ZPYA 1FPN1 1ZNPA 5IFPA 5DZGA 3WF2A 4J6GA 4A7ZA 3A22A 4UW3A 1B09A 2WIIB 4DY3A 1AYN2 1N1TA 2CWMA 4IETA 3ES1A 4IGQA 4LJHA 5EJ1B 3WG2A 4CEWB 5C3RA 1W6PB 1IZ3A 2VBBA 4ZKTB 5DZFA 3AKTA 1BVVA 4CUBA 2JENA 2VOWA 1EY2A 4LA3A 3P5BA 3WW2A 2VQAA 2V72A 2L9LA 1HB4A 2GP3A 4QHZA 1TVGA 3ROUA 5L9VA 5FMCA 1ASJ3 3VZJA 1PO11 2E32A 2RG4A 2QQMA 5JOXA 2ZX1A 5C4WC 4ZU5A 5HV4A 5CAZA 4RHV3 1OH4A 5FXXA 3H42B 1Q8VA 2DDUA 1J84A 3ZFEA 2B42B 1YYNA 4P08A 4CDXB 1KS5A 1LOFC 3NO8A 4JKMA 4AVAA 2WFPA 5C8CC 3ILNA 4QU1A 4F3JA 1F5FA 4XVHA 5FYBA 1ULFA 4AEMA 4L9BA 4UF0A 3ZO0B 1GKBA 3POGA 1QJY1 5D8AA 5FQ0A 4ASMB 4LNVA 4BK5A 3LIHA 1LHUA 5LRRA 1RL3A 4C8DA 2O1QA 2OYZA 1RHI2 4DRVA 3K75B 4BCUA 4AXOA 3LA2A 4HSJA 5F5QA 1XNDA 2YXSA 1AHSA 1K3IA 3ABZA 3HN1A 2R0FA 5EV7A 1LHVA 1WD4A 3VHOA 3AP4A 4WZFA 2ZXQA 4CP0A 1O5UA 4AVCA 1GNYA 3RRDA 1ODMA 5IATA 3RMXA 4UT5A 5K8SA 3RI9A 1AL23 2BPA2 2HWE1 1J83A 3KF3A 2DV9A 2Z4FA 3PNAA 2BBVA 3ACFA 2D6KA 3AYEA 4LTAA 3VZLA 3CKHA 3T30A 4NWWA 2QVSB 4LBNA 1S0JA 4IEYA 4KU7A 4LO7A 5LA9A 3WCRA 4BQ5A 4ZZ8A 4CEYA 2QQPA 3VKLA 5FMOL 4BQ3A 4AYUA 1PIV1 2WNOA 5FUIA 2OT7A 3MIDA 4PBPA 1AXKA 2XWBB 1FOD3 2X05A 3VHRA 1O5LA 1QJX1 3C2UA 2W2IA 3PURA 2OX0A 1Y43B 4IGPA 1TME2 1HXS2 2DCYA 5FOBB 2XQXA 3TEZA 5A80A 4ES9A 4XFAA 3THPA 3UNPA 1UYZA 2E33A 2ZKLA 3WNKA 3VBRA 4HPKB 3VBFB 2RDSA 3LSDA 4A2UA 5JXJA 3PJQA 1CAUB 1OF3A 1XOYA 3GZAA 3AP7A 1D4M3 4QT6A 4LUMA 3WLUA 3WP6A 4UI9L 4HONA 5GALA 3WV6A 4UW5A 1GLHA 4RGGA 1H8TA 4JKLA 2W68A 1H6XA 4CUGA 3BTXA 2WAOA 3KT7A 5F5IA 4DXRA 4P14A 1YQ8A 4WV8A 3FJSA 4MX3A 3CZJA 3AKQA 1VRH2 2GALA 4FT8A 3V0BB 3BIEA 5FZLA 3AJZA 3W9AA 1O3TA 1DZQA 1JYIA 3HNMA 1ONAA 2WS93 1BHGA 2ATFA 3BGAA 1K5MC 1F4HA 3L9JT 3WQBA 3ZN6A 2R043 4XFGA 2XUEA 2FD8A 5AVPA 3V65A 1ULOA 2HWF1 4LBOA 3U14A 3PUQA 2VNRA 3U1XA 5KHJA 2NMNA 4NHKA 5CG8A 4GIQA 4CCCA 3TN93 3OPTA 1QKQA 5ACA1 1IS5A 2RS51 3CDZB 4AI8A 4COZA 3VBSA 3LPFA 4BJ0A 4C0HA 2G1MA 4B1LA 2HWC1 4Q4W3 1PK6C 2X8KA 2I2SA 2XONA 4I0WB 4NVPA 1TNRA 5EIYB 2PHWA 1R081 3UL2A 2MPFA 2XQRA 1R093 2HH9A 4AAXA 1XNBA 1DF0A 2XG3A 2QQWA 3GDBA 5FR3A 5C5TA 1PZ9A 3WG3A 3T0AA 2ZAHA 3WNLA 3OG2A 3N9PA 3PJYA 3AZWA 4AVTA 4CPBA 1WWYA 2OW4A 1N1YA 1VBE1 5A3PA 2D44A 4G3YC 1W6MB 2BZDA 5HBAA 1QJEA 1W6OA 4AQ2A 1C8M3 4AHWA 1AVBA 3AYCA 3N7MA 4IE6A 3AFKA 4JGYC 1FPN2 1QMJA 1LOAA 1AXZA 1VBB2 1YIPA 2WNUC 2Y60A 5E89A 3Q8FA 5A7WB 5A7OA 4ZU4A 5LEKA 4LKSA 4E2QA 4GAZA 2XB6C 2QE3A 1UMIA 5A33B 2C26A 4NWVA 2CHHA 4H55A 2IZWA 1ZBA3 2YU2A 2HEVF 3WG1A 5KXEA 3MI8A 5I0DA 3S30A 1I1EA 2R16A 5FOJB 1VBA3 4XABA 1ND3B 5F3IA 1ZVFA 4DB5A 1PO12 1RJ7A 1Q43A 1RMU3 3NAPA 3GF6A 1EV11 2WQ4A 3T2PA 5DAWA 1Z7S2 1K45A 3ZMOA 3GJBA 1OA2A 3HNBM 1X7NA 2QFEA 1YHFA 2RJKA 1UYPA 2ZHLA 1POV0 4Y1XA 4LMFA 5BNNA 4BPZA 3AP9A 4IE0A 2WSVA 1LTEA 4L92A 3V64A 1QJY2 2QDNA 3OYWB 1STMA 3KV5A 5C9AA 5HCFA 2RS12 1F2NA 4BISA 2PAKA 1G86A 3AP5A 2LW8A 1ASJ1 2UYBA 4XJ8A 1H2LA 3ZYRA 4IV1A 4KMQA 5BNPB 1UPIA 4JTOA 3FMGA 4RHV1 2R071 5DG1A 3FFQA 1U5ZA 1HW5A 5BUVA 2GC0A 3LF7A 4CP9A 4QGMA 2YBPA 1QU0A 2JECA 3QLQA 3WF0A 2A6VA 2HWE2 3LB9A 3H1WA 3VLBB 2FBEA 1QIQA 1P8JA 4O9GA 2WNVA 2ZGUA 4Q27A 5JR7B 4XQ4A 3N35A 3ZFEC 1OH3A 1RUD1 3AMPA 3I97A 4WVZA 4EN6B 3ZYHA 5K0UB 1BXHA 5B4NA 2PELA 2EIEA 3LEKA 4Y4YA 5CISA 1PIV2 4NHXA 4AFDA 4ARYA 4CDUA 5FZ6A 3F95A 1JZ4A 5KR7A 2VQUA 5D8AC 1IGOA 1W2NA 1IS4A 1F5JA 1QJX2 5IVFA 1Y7BA 2HYKA 4DOUA 4CXWA 4QB1A 1KFXL 4QKDA 2VUJA 3POSA 5A1AA 1MEC2 4AI0A 1ZRCA 1AL21 1AR61 1HRV3 4LBQA 4Q5OA 5LA2A 4AFCA 1CAXB 1G7YA 2Y6LA 3DEMA 3LDKA 5L9BA 1SCSA 3NV2A 3OTFA 4XYXA 3SCHA 1YRZA 5EZWA 2A3YA 1GZWB 5FZMA 4SBVA 4E4ZA 4IE5A 1UCXA 1ND2B 2DCTA 2D6NA 2QQKA 4YW1A 2Y38A 4R4XA 3FHQA 4Q0QA 4CEYC 5JI9A 5HXMA 1CAVB 1UZ0A 3ZIWA 2WBKA 3ZSEA 2XR4A 3MIEA 3ECQA 3LKJA 3M70A 5FZ0A 3NSTA 1G9CA 3WX5A 3SCGA 1WD3A 4ASLA 1OVPA 3M3CA 3O12A 1C28A 1R1ZA 4I3PA 1RVF3 3FUQA 4HKWA 5FYVA 3ZMNA 5F7UA 2DUQA 2HWF2 1BK1A 5JXIA 2ZGOA 4B4QA 3I2GA 1PMHX 5FZOB 5JSPA 5FK8A 5GLZA 4JRAA 5GLVA 1NUKA 4GALA 3VBRC 2V09A 3ZFFB 3ZR6A 5ACA2 2A1XA 2RS52 4D3WA 2MEV1 3ZVXA 3BVCA 3ZDVA 4Q4X1 2HWC2 4PLOA 1RUG1 2R7EB 3I2KA 4XFHA 4PLNA 2ARXA 1GANA 3MV01 1R082 2XKPA 1AYN3 3ZFGB 2EXJA 1MZEA 1H8TC 2F6BA 3BIWE 4YFWA 3A0NA 4FXGB 2OS2A 2W9XA 4YVWA 2WO3A 5DN2A 4M01A 4O61A 4AOCA 5FZEA 3VHPA 1JODA 4ET7A 3UESA 2D5FA 2WZ8A 2Y0OA 1T6GC 5C7GA 1WLDA 3AVRA 2X5IA 1JMUB 1VBE2 2R061 4Y20B 1JZ7A 2QZ3A 4Q4V2 5ABJA 1QQP2 1OPOA 4M3CE 1C4RA 1LAJA 4GQ7A 3WD5A 1VBC1 4Y1UA 5A6ZA 3LOBA 4KQ7A 1YNAA 3KVBA 4DY5A 3B3QE 4B7KA 2HBTA 1JS9A 4UW6A 1S0EA 3M3QA 3VBSC 1IS3A 4LKEA 5FYZA 2RDQA 3KGLA 1VRBA 1OKOA 4AHZA 2PAEA 3M3EA 3O0XA 1LESA 3QH6A 4XZUG 1O91A 1RHI3 1PGW1 4H7MA 4K1YA 3IDCB 3ZYPA 1POV1 3NKGA 5EQUA 1BKZA 1VP6A 2EIGA 3UV9A 1Q5OA 2A7AA 1C8M1 4E2GA 3WEZA 4P9IA 2WLPA 1EV12 5IVYA 4IEZA 2YC2A 2D7FA 3FL7A 4B4RA 1WMFA 3I59A 1DLLA 4IEVA 1CIWA 1HRI1 5DDJ1 3PTRB 2WRAA 1GZCA 3MLJA 4OZOA 2B45X 4FPKA 3SISA 4P02B 3WVJA 1LEDA 2AR6A 4YW6A 5I8YA 3DN7A 1QEXA 3J8F1 4QQLA 3R0RA 5BYNA 2J42A 3LPGA 3UJOA 4EWDA 5JMCA 2JE8A 1UMHA 2WO2A 2BVBA 2BDRA 2VPVA 4NO4A 3E1F1 1IPKA 3HT2A 2R072 2K46A 3D0SA 4Q0VA 3PUIA 2UWAA 2GNMA 1TME3 1HXS3 1UNBA 3MIBA 4DNYA 4XFIA 3VDDB 3IMMA 3NAPC 2X09A 1Q8PA 4DMIA 2FMDA 5A3OA 4OULA 3KHBA 5C8WA 5FMBA 2AH2A 4LUKA 5IW0A 3NV1A 4K8RB 3OF1A 3FLPA 1RUD2 2G9GA 4WVMA 5KXBA 5LBCA 4PQ9A 5BNNC 2ZPXA 4H7LA 4MXWA 1SFYA 5APAA 2BU9A 2D98A 4LE4A 2P2KA 4Y24A 3HOBA 4QM8A 5DAXA 4IEOA 2OQ6A 3VKOA 1J59A 1IG0A 2F17A 5C9AC 1MPXA 1KGYA 2R1BA 4H14A 5JPMB 1ZRFA 4O7XA 4LULA 1JN2P 1VRH3 1SDDB 3PVNA 1SACA 1V6NA 4M0NA 3GHMA 5EHDA 4COVA 1DQ4A 2VMIA 1AR62 3HQUA 4RGKA 4IV1C 3OY8B 2XBO1 4KBZA 5K7PA 5DAQA 4BQXA 5C3SA 4Z2WA 2W1SA 4I30A 3DYOA 4YSFA 3KT4A 1UIJA 2IXKA 4N53A 5SV8A 3O1PA 3DYPA 2IVIB 2BFUS 1YI7A 3R05A 4D7TA 2IFRA 3DL3A 1WA6X 1XQNA 5FO9B 1V6JA 5HXVA 5FMDA 2WNVC 5BNOB 3AVSA 2WT2A 1HLCA 2BWCA 3AFGA 2XVGA 2O8QA 2ZX3A 3PU3A 2PLV2 4A3ZA 1YQ2A 4YZ4A 1GOGA 5T54A 3MPPG 1FATA 1H4GA 2UWCA 4CDUC 3KD4A 1UY3A 1JZ5A 5JIUA 3MIFA 3AX4A 3PL0A 4LITA 1CAWA 2VM9A 3T4HB 1A8MA 4OI1A 2CSGA 2WL1A 4J1XA 2JKXA 5JIAA 3NKTA 4LBKA 4EQVA 1L7QA 3VBOA 1OSGA 5JR2A 4HOOA 4PLMA 5A70A 2K2SA 1UQXA 4NIAA 1S0BA 3ZR5A 3FFZA 1TE1B 2V5YA 2VUAA 1NXD1 4IV3A 1C5IA 2MEV2 2NYYA 4IDZA 1BZWA 1KFUL 4QPIB 5CVRA 3SQOA 4INDA 4Q4X2 2Q0AA 3IWZA 3RI8A 1FPN3 1RUG2 5HCAA 1TMF1 1VBB3 5IAVA 3SMHA 5A3TA 2KA3A 2GZWA 3WDWA 4FTEA 2RR11 3MIHA 4P5HA 4PF1A 1D2QA 5E6HA 1H30A 1XXNA 5FJKA 1GOFA 1LR5A 2E31A 3MFCA 1OKQA 4XQDA 4EWEA 4AW7A 3IIAA 4JGZB 1W8FA 5FUNA 4DUXA 1WZXA 2R062 1UX7A 2WZR2 1PO13 2SLIA 1F31A 2ZEXA 4XXPA 3WQ0A 3IPVA 2EIBA 1VBC2 3MIGA 1ZZ8A 3J7LA 4OFGA 4BMEA 4Y5Z0 1Z7S3 1JYCA 4XJWA 1X50A 2GH2A 3PTYA 4MGTA 4LK6A 2C5DA 4W65A 5DG2A 4QXBA 4RR3A 5A3LA 5A6QA 3TYJA 2A3WA 1O8SA 4QMAA 1TEIA 2ZGNA 2BGCA 2R49A 1QJY3 4FP3A 1ULGA 2V4VA 4NAMA 4L0PA 2RS13 4KI5M 5CKQA 1QF3A 1W0PA 3WQ7A 3UKTA 2UU8A 2W46A 3AYDA 1W0NA 3WUDA 4CCMA 1WW4A 1PGW2 4GXLA 3C7GA 3SEPA 5FYHA 1US3A 4I09A 2Z2SB 4YVWC 5DAPA 5J48A 3POFA 3GZUC 5IK4A 3BTYA 2C9AA 1RUNA 2X5IC 4IERA 4TXWA 4Y4RA 5ABJC 4FCAA 1HRI2 2KXLA 2W3JA 5DDJ2 1NQJA 2HWE3 3HR9A 3JD71 4RL7A 3H0OA 1Y9GA 1SBEA 4BXSV 3VZKA 1DQ1A 2QQJA 2WNEA 2RHPA 3DUIA 4IL7A 3A4UA 1SLCA 2ZCWA 3FE5A 4XEZA 1W8WA 3I3EA 3K77A 3WDUA 4C1XA 1W04A 4MLOA 4WM8B 3J8F2 1MS9A 1RHI1 3J7MA 1PIV3 3WF4A 5FPXA 4NRQA 4QAWA 5BXXA 2YY1A 1W9WA 3IBMA 5EYYA 4BQ4A 2BW8A 3E97A 1QJX3 4PF5A 4DUWA 4NHLA 5D1IA 5KWRA 3ST7A 1LECA 3U07A 4UFHA 1D7PM 1MEC3 1YO8A 4C90A 1MS4A 1DGRN 4LO6B 5FYIA 1UY0A 3USUA 1OMIA 4XIKA 4CP1A 2VVEA 2JG8B 3HNYM 1MACA 1B35A 3AZZA 1GP5A 1URXA 4Q0UA 4DQAA 1GWMA 5CFCB 1QXJA 4IUGA 4XIOA 5HCBA 1RUI1 2I45A 2HEYF 3JCIA 4XE9A 2YFZA 4CEWA 1X9PA 2XLGA 5FV3A 3WHTA 3DXTA 3VKFC 1DQ6A 1TME1 1PNFA 1W6PA 1H2KA 4LHKA 5LRSA 3T2TA 1QXPA 4Q0SA 1UXXX 3ZYIB 3OB8A 3SXWA 4QPGB 2G9FA 3PMEA 5I91A 2XJTA 4GKXA 5KC6A 2IXIA 2XBO2 4QQHA 4JTNA 1VE0A 4K20A 5FYMA 2Q1ZB 1I6XA 3AMNA 4MGZE 3WOGA 4CCNA 2HWF3 5T50A 3ZOIA 4ASKA 1IS6A 3MBWA 4XUOA 1MS8A 4A42A 1WCUA 2HYXA 4PIXA 5ACA3 2RS53 5I8SA 3VZMA 5JXGA 5M0TA 1PM7A 4AGVA 3AZVA 4N43B 1VALA 1RUJ1 3EXUA 3ACGA 3ZSLA 1CZSA 2HWC3 2TNFA 4CDXA 4EN0A 3TNQA 1LCLA 2Y6GA 3OBRA 1OD3A 3PUAA 1UOGA 4Y3OA 4TTGA 1R083 4MGSA 3GNEA 3S57A 2VJXA 3WF3A 4XETA 5FZ7A 2EAKA 2H6CA 2JG9B 3P3NA 4QX0A 3AB0A 3WW3A 2Q8EA 2Z5WA 1UU6A 1SQ4A 1SBFA 4UFIA 2NZ9A 1TNFA 2VZVA 3SLIA 1W0OA 3WSOA 2WSUA 1DGWX 1ZREA 4IEQA 4M3CB 4PIZA 5FLHA 2XOMA 2E63A 2ORZA 2GC3A 1VB2A 4OHWA 1JYTA 1VBE3 1OPMA 3MEPA 2WKKA 3N9OA 4Q4V3 1QQP3 1NCRB 1RITA 3DCQA 1NLRA 3VV1A 4BM8A 4F8AA 4QX8A 1U0AA 3TBDA 4HT1T 2OPKA 2E53A 4N53C 4A3XA 1HB3A 1TMF2 4XCBA 2P6HA 2OXBA 4IEWA 4RN5A 5KHGA 1QJFA 4K40A 4YM3A 1CESA 3NNFA 2RR12 4UBGA 4NHMA 4GWJA 4HG6B 1UY1A 4DXTA 4CCKA 4URAA 4I2OA 1ZZ7A 5A32B 3T1LA 1FMD1 1G6NA 1UO9A 4YGCA 1BEV1 2YROA 3GALA 3LDBA 4YARA 1ULCA 1DP0A 1LRHA 2Z69A 3HBZA 5C3PA 1W2TA 2VZSA 4PHZA 4DEVA 3OPWA 1EV13 2VNGA 2I07B 2OQ7A 1H1AA 4A41A 3VBOC 3VDCA 1VBB1 1OOPB 4HPKA 4H3WA 3VBFA 3T3YA 1H2MA 1CAUA 3LFIA 4Y5SA 3UETA 4IV3C 1JXNA 4NJ4A 2JDMA 2DTYA 1BK0A 3GZTB 1Q56A 3GBFA 5FP3A 2RM22 1H8VA 4PBOA 4NN0A 2B9VA 2ADDA 1RUOA 3I2OA 4MGIE 1LULA 1W9SA 2DBNA 3ILRA 4BOWA 3KGZA 4Z92B 4QHBA 2VCCA 2GNDA 3RYKA 3B93A 5A6YA 1A8DA 1DZTA 3D6EA 3O1RA 1COV1 3V0BA 3GHNA 2D6MA 5GKAC 4I02A 1D0GA 4CXXA 1Z7S1 2A6YA 2NQYA 1U5YA 2R073 4QGNA 4XUNA 3BI3A 1BLZA 1NCQB 4NR1A 5L73A 4FOWA 2RV9A 2VXJA 5F5AA 4PDWB 2J1RA 5FYUA 2JKBA 4RS5C 4FPFA 3CJIA 1UYXA 3JD72 1NT0A 3IB3A 1R64A 5F5CA 4YW5A 5JOZA 4IGOA 1QHDA 3OSDA 2O8OA 2YMZA 4K1ZA 1RUD3 2EA7A 1W9FA 2RS11 2VVFA 4E4SA 2O0OA 4FI9A 4RR3C 4K9SA 1CONA 1QH6A 2JIJA 4SLIA 1UAIA 4M4PA 5G04L 4DZGA 2H0BA 1ODNA 4NOTA 2ETEA 2WAAA 5J37A 2BGPA 3Q8AA 3ZYBA 1AR63 1S2KA 3B9CA 4XUTA 3FX3A 5L9RA 3PUSA 2DVFA 3FLTA 3U10A 5FREA 1QJU1 1X8EA 1X9TA 2D5HA 3I4IA 4BDVB 4CPBD 2VMHA 1E57A 5C33A 1WBFA 2PHTA 2DCZA 3D5OA 2A70A 3UKVA 3OCPA 4M0HA 3CEWA 1W6MA 4KGGA 4UFMA 5KXDA 5HCHA 2P3KA 3S7IA 1WW5A 2VBDA 3MF9A 1AR82 4HKOA 4QDRA 2WNUB 2Y26A 2EF6A 5A7WA 1RUI2 5GZDA 4YM0A 2D3SA 2K0GA 5IAXA 2MHFA 1DDLA 4YYOA 3DGTA 2PLV3 4YW4A 3SCFA 3E5XA 1MEC1 1OUSA 4FQZA 1GP6A 2XUMA 3RDIA 5A33A 3QACA 1IKQA 1DZRA 5FYSA 1W2UA 1DG6A 4K6BA 3SC7X 2DVBA 1HN1A 4YLZA 3B7MA 4OHVA 4V1PA 1O7FA 5FXVA 5C70A 1ND3A 4QX2A 4OCTA 1NLSA 5FPUA 4XBNA 4COUA 4QPYA 1S0DA 1LGNA 3VGIA 4Y22B 4V2WA 2P37A 2RVAA 2MEV3 2VNOA 3SH4A 4LK7A 5LCWL 1RUJ2 3KCCA 4Q4X3 1B35C 4M00A 1RUG3 4XILA 4CCEA 2W5FA 3GCWA 2P3IA 4XC9A 4YPJA 3WDVA 4OQ8A 4EN8B 4GWNA 3RG0A 1GU3A 3PVEA 2C4XA 4FFIA 4QB6A 3SKJE 2GNTA 4W6XA 3OYWA 1KITA 4CEWC 2FDGA 1YI9A 2LS6A 2EICA 1GV9A 3WDTA 1QDCA 3IZOA 4AVBA 4CCLA 1W03A 3AK0A 2D40A 1ZA4A 1S55A 4D94A 5BNPA 2QZ2A 3Q8EA 1J3QA 1PMIA 3VZOA 4CP2A 5CIRA 2R063 2BV4A 1EAH1 2WZR3 4PQQA 3J4UH 3AKSA 4JC1A 4LKFA 3OOXA 1VBC3 3TB0A 3HBKA 1GSLA 3URFA 1KJRA 1EYBA 1GOHA 3KSCA 2GP5A 3B01A 5K0UA 4BIOA 2FDJA 4R52A 4CUAA 1H4HA 4MSVA 4CDXC 5LEJA 3SKVA 4BH9A 4OLLA 4OHYA 1H9PA 3ZN4A 4LOSA 2C24A 3QOPA 3OGGA 2F4LA 1M06G 1FMD2 4WM7B 1IQDC 1BEV2 3WZ1A 1I9RA 2QTWB 4Q4V1 5FBJA 1QQP1 2VMDA 2JDZA 4GB32 5G05L 1POV3 3ETQA 2ADEA 1MZ5A 4FPCA 4C91A 4FTBA 1PGSA 4JX0A 4LBQD 1W9TA 4UXAA 5J09A 3KF5A 1CAXA 4UOJA 3GXUA 1QNYA 3B69A 2VMFA 4MUVA 1HRI3 3PIJA 5DDJ3 2VMEA 1YWKA 4I3GA 5LASA 2ZEYA 3D3AA 1RUH1 1C1FA 1GZWA 2HWB1 4LO5B 1PX3A 3H9AA 3M2MA 1XYOA 3O5SA 1JW6A 1ND2A 5FDBA 5J7MA 1SZBA 4Q1RA 5F9TA 1AX1A 3APBA 3J8F3 4AEDB 2BFUL 2XHNA 3W58A 4AWDA 2CGPA 3EMRA 3UGFA 3Q8CA 1CAVA 5FPZA 3DKWA 2IUWA 3VL8A 1COV2 2BEOA 4XF0A 5LB6A 4AGGA 3T4VA 4QM9A 1KEXA 3ITQA 3FWEA 1XRUA 5JAXA 2PFWA 4MZUA 4P9YA 2FCVA 5JVVA 2VG9A 4BQYA 3LSEA 2UY8A 3ELNA 4QPWA 5CZKA 1NA1B 5J98B 2ZA9A 5FZOA 4AI9A 5F3CA 1VMFA 4UFLA 3AMHA 2NLRA 3KV9A 3KWVA 4W8JA 3VBFC 3AMMA 2W08A 5EP9A 5FY7A 4S2GA 5KBFA 3RZMA 1KQRA 2LTNA 1YQ6A 5GM0A 1ZZCA 4U2AA 3EBRA 1OUXA 2JWPA 2RMU1 2VBPA 2WT1A 1K12A 3WP5A 1UPSA 5T55A 3ZFGA 1S2BA 4MG2A 1A34A 3U11A 3R4UA 2BUKA 4YG6A 3WUCA 4D0QA 2XBO3 3N9MA 1QJU2 4Q8LA 4KL1A 1RTVA 1JUIA 4Y20A 5FLIA 1U12A 5FPAA 3ZLIA 3W5NA 2VCMA 1VMJA 3IAQA 4OMCA 2OPWA 3CJIC 5CA6A 1N3OA 2QKDA 4NHYA 1CPMA 2IC1A 4IXLA 5JLVA 3U78A 5FYYA 1RIRA 2CGNA 2BOIA 4HL0A 2R0HA 5FP9A 1REFA 4KU8A 2PHXA 4QQPA 5GLUA 3RMYA 4BQWA 1F35A 2AACA 4LIUA 4FOVA 1JYXA 1D2SA 4XTPA 4YVSB 4HBNA 1SPPB 1PMJX 1SCRA 1S0GA 2VZ3A 2CAUA 2ZMNA 3PVBB 3K3NA 1OQDA 1UX6A 5JSOA 4FPGA 5FLJA 3OGRA 3ORJA 5JXHA 2PYTA 5D2AA 1YIFA 2YUEA 5JUVA 3OPZA 4E8DA 2AUYA 2JDAA 3FBMA 3HMYA 2OA2A 2YDEA 3R6SA 2FMYA 3NJYA 4XAAA 1AR91 5JZGB 1UIKA 4FPEA 1O3QA 1LJ7A 4Y33A 1MVEA 2G19A 2B8MA 2PLV1 2GN3A 3ACIA 4Q1PA 4QKNA 4DXSA 2ZBJA 4HXCA 4JHTA 1TMF3 2ZZJA 1MZ6A 3C7FA 4UYBA 4DS0A 3HPNA 4CDWB 3DPRB 5A1LA 4ZS3A 2RR13 5GZGA 2VZUA 2A6WA 5FCCA 4YGEA 1OURA 4W6WA 3HJRA 4K3UA 2ZGKA 3ILFA 3ZSMA 3CU7A 3MYXA 3CLPA 2Y6HA 4N9IA 4L11A 4YM2A 1EAH2 4RYDA 3M3OA 4O9EA 3PHMA 3U4SA 1ND3C 5FKBA 4B3NA 1W39A 2YV8A 2A6ZA 1L3JA 1S1AA 3AZXA 2DFBA 2OUHA 5EYXA 5FPBA 3PMSA 4OI0A 5B2GB 1D4VB 3VBHB 3N4MA 4KG8A 4ATFA 4BE3A 4X8PA 1UKGA 4YFZA 1PO21 1PX4A 3EB7A 4LXLA 1H6YA 1NY71 4XMAA 3NMBA 2RM23 3QH7A 3V0AB 3JQXA 4GWIA 3MUY1 4CDQB 3TNPB 4Q4Y1 4FFHA 2Q8CA 2VZRA 5C9AB 2R6QA 1UU5A 3W21A 2WZR1 2QQLA 1TQ5A 1G9AA 3DKQA 4LHLA 1XE0A 1E5SA 2W47A 1NE4A 5DXDA 3WCSA 4ZONA 2BTVC 2WJSA 5BNPC 1NXMA 3OY8A 3SEEA 1LNSA 2J1UA 3GBWA 2VMCA 4TSVA 5LWBA 5F2WA 5IFTA 1FXZA 3PU8A 4UAPA 1E5IA 1WUVA 3JD73 1RUH2 2HWB2 3JUUA 2DWRA 4JDMA 2PHDA 3IT8A 3LA7A 3I3BA 1C3HA 1V70A 3POYA 1L7LA 1W6QB 5GJ6A 3VDAA 5BNOA 1DHKB 1U5XA 1V6IA 2WO1A 3JBG1 4GA9A 1LKNA 4NIGA 1HB1A 1HQLA 2WC2A 3DV8A 4JHZA 4PIYA 2YFUA 1LGBA 2D6LX 4B4PA 2VR4A 3MW4A 1AX0A 4CDUB 1ZYBA 2DFCA 2JDPA 4KWUA 3PVOA 3WP3A 4LHNA 1ZZ9A 4CUCA 2XKOA 2WDBA 5LA1A 2VECA 4HZFA 1VBD1 2CGOA 4NPMA 4RQPB 4GJYA 3I8TA 4GZ9A 2JDYA 5FZDA 4YM1A 5F37A 3HEIA 1T2XA 4QPIA 1SLIA 2ZX4A 2JD4A 2HWD1 4YNIA 3SH5A 5GZCA 1AR83 1GWLA 1W8NA 2VTFA 4ISQA 4WZCA 1ND2C 2W0XA 4MO3M 2RMU2 1OD5A 3NQHA 3UYJA 1RUI3 3NWKA 4LA2A 4ZS2A 5F8PA 3LFMA 2WT0A 3ZYGA 2Y8KA 3J7HA 1ZA7A 4CRQA 2FHRA 4FFFA 4OQ9A 4WBBA 4CE8A 3O1SA 4BB3A 1CQ9A 1M4WA 1PM4A 5A3MA 2ENRA 4XF4A 1FT9A 4XDPA 3INAA 1BJQA 2PN5A 2WQZC 4B8EA 3S0MA 1ULPA 1JH5A 1X8MA 4JGZA 3ZSKA 4RD7A 1W2AX 4ES8A 1JZ3A 3NRUA 3TEYA 3RPQA 1YCIA 2VMGA 2Y34A 4NRMA 3N9QA 1UZZA 2QDRA 3DECA 3N9NA 1Z0HA 1MS3A 2BNNA 2FCUA 3K3OA 1UU4A 4N7IA 4AE2A 2JXAA 4FQ4A 3O0WA 4QX1A 4QXKA 3S6PA 4IEXA 1RUJ3 3E5UA 3JXSA 2WUHA 1W9YA 4L2NA 4NRPA 2DVGA 1EPWA 1Y9MA 5HPOA 5IUQA 2Q1MA 5FWEA 5FY5A 2EXIA 2RJ2A 3N9LA 3WDXA 3ZFGC 1QOTA 1XJAA 2VCBA 2PXJA 3KB5A 4ITCA 5DPNA 1W6NB 4TYSA 2VULA 4XMIA 4AQ6A 1G8WA 1DU3D 1MQTB 4YG3A 3C7EA 2Q30A 4BQ2A 1XNCA 3WT3A 1ALYA 4ONUA 1DLCA 1AR92 2JB4A 1JUHA 2GNBA 2ORXA 2QBXA 3UJQA 1GZ9A 2Y6KA 4D6QA 5E88A 5ABJB 2B7YA 1RUC1 1NKGA 4BU2A 1SHWB 5ANQA 2ZABA 5FZFA 4I0BA 4MHRA 3U4XA 4L99A 3I3MA 1PZ7A 2XVKA 4WM8A 4D7YA 4RFT0 5A3NA 2VH9A 3AC0A 3LZZA 4AVSA 1FMD3 1BEV3 4RGAA 4FBFA 5A7SA 2W94A 4GB33 3THDA 1WBLA 3PIGA 1ZRRA 3BPSA 1AL0G 3JB8A 3RZLA 1UXZA 3BTAA 3VBUB 2FDFA 1MS1A 5K9YA 4QWNA 1SDWA 1Z78A 1XNAA 3BALA 2JB8A 4DO0A 4LORA 1IHMA 1S4CA 2JG8A 2ZMKA 5FY8A 4FAHA 3JQWA 1OC1A 4GH4B 1PO22 2F4PA 1JBCA 3RS6A 1NY72 3A23A 5FP7A 1YC61 1JOBA 5FKCA 2A6XA 5CFCA 1V6LA 4YZ2A 4Q4Y2 1FV3A 3I3QA 1SLLA 3ZXKA 2PHRA 4YW3A 4YZ5A 4EZHA 3W5MA 5EJ3A 1COV3 2UWBA 2VNVA 5LBFA 4MH0E 3EO6A 4QPGA 3ZXGA 4R9BA 1LHWA 3HQRA 3OGSA 4A6OA 1ZM1A 1F15A 1XC6A 3OBZA 4HN0A 4IW3A 1LGCA 3VD4A 5IK7A 2ET1A 2RM21 1L7RA 2WWJA 5LK5A 2B46X 1HQNA 3IDAA 3WG4A 1RGSA 1CJPA 2HJIA 5I0RA 3JBG2 2Q5TA 4N43A 1VAVA 2ZEZA 3I2JA 5H9PA 4AI3A 1FX5A 4COWA 1J58A 3B00A 4KWKA 3CMGA 3CO2A 1Q8OA 1LOCA 2UY9A 3NNLA 4XF1A 5IWFA 5H9SA 3TWIA 3M7AA 2VZTA 2JG9A 5GLWA 2ZGSA 2Q8OA 5L7OA 3CBNA 3POJA 3CIHA 3CZUA 4XBLA 3KS7A 4G9SB 3TEXA 4U36A 1K42A 3GYDA 4E4HA 1Y3TA 3NJZA 1AYM1 1QJU3 2J7MA 1VBD2 4M3CA 3RZZA 4CVUA 4YRDA 4XOGA 1NCRA 3D0JA 5CKNA 1JZ6A 3RWKX 1DGLA 2HWD2 1F4AA 3CL1A 4MYEA 1UY4A 3QCWA 4OI4A 4YZ3A 3SITA 3OEBA 4CCDA 2RDNA 2NN8A 1S0CA 5BNOC 5EFUA 3TRSB 3KQ4B 1YFYA 2VZ1A 5FJHA 2FDIA 5J3UA 2VTXJ 3H8RA 4YW7A 2OKXA 4Q2FA 4YG0A 2KD7A 1EUTA 1MVQA 4HMZA 5CFDB 1REEA 3OD4A 5JI7A 2ZGRA 5A32A 1KDMA 1S2EA 1SFNA 1VAMA 3KCXA 3P1IA 4S2DA 4QKBA 3VN4A 4FVVA 1HIXA 4ORFA 1DYKA 2IXCA 3AKPA 1AR81 3H3LA 4UFKA 4CU9A 2FCTA 2X29A 3AYAA 4OHXA 1GWKA 3EJKA 3H3ZA 1V0AA 1OOPA 1Y4WA 2P1BA 1OA4A 3K48A 3OBAA 1VR3A 3BYWA 5E8AA 4F83A 4QPIC 1W8UA 2VZPA 4ATEA 1UZWA 2JICA 4CCOA 4FFGA 4ARXA 3J26N 4JQRA 4FP2A 4NPRA 5FYCA 4Y26A 1GICA 3AXEA 2Q1FA 2IVJA 1OT5A 4COYA 2XMLA 3AKRA 1IQAA 4HVOA 4Y1YA 5F6KA 1H0BA 2SBAA 4NAOA 5C4WB 2VE1A 2LALA 3LEGA 1O3RA 2VXRA 4XF9A 5FY0A 3ZXAC 1W8ZA 5EWSA 1PVC2 4BIFA 1NCQA 1EAH3
chains in the Genus database with same CATH topology
3C3VA 4FXKB 3S7EA 4HK9A 4PDWA 5C8CB 2EAAA 4LE3A 4RS5B 1RUC2 2XPJA 1D0HA 4LLFA 3L2YA 3NV4A 2E7AA 3FHIB 1OFNA 3KZ4C 5DUVA 4FSJA 4Q29A 3IMNA 4N90A 3WXPA 3ZXEA 1SMVA 1YJKA 3DF0A 5I93A 4MV2A 5L36A 3WY6A 2GU9A 2PHLA 3RJ2X 2ZZQA 3AZYA 2EXHA 3THTA 5HI0A 1N3QA 5KHKA 2PTMA 2UURA 4FPLA 1GNZA 1UMZA 1RUH3 2W52A 2HWB3 1JTZX 4HVRA 4FOQA 5AC91 3MLKA 2A5ZA 1V6MA 4JAAA 1RB8G 3VHNA 1N1SA 2YYOA 4PCRA 2PA7A 3H7JA 5GZFA 3CF6E 4GB31 4WM8C 3M8LA 3TOJA 1H1IA 1QWRA 1H9WA 1ZZ6A 2A75A 2WFF1 1SLTA 4P9LA 1NG0A 5FFOC 4E27A 3GBGA 1UL9A 3ACLA 5E16A 4ISRA 3MDPA 4CTEA 1ENQA 1UKRA 2NM1A 2XJSA 4XF3A 3MZHA 1FYUA 3JB4C 4ZXKA 4Y22A 2FZ1A 1N1VA 2JG8C 1AXYA 4Q8KA 2VOXA 1KD7A 1WW6A 2ET7A 2RMU3 4AGRA 1V9U1 3WR0A 2IFWA 4LT5A 1G9FA 4XQWA 5CFCC 5T5LA 2NP0A 3RQ0A 1K5MB 2QJVA 3UKNA 2C0ZA 5BNQA 2YHJA 5T52A 3VL9A 2VY0A 3D8CA 3E6BA 4QPGC 1AYM2 4E4DX 3KCYA 2YGLA 1O4TA 3NV3A 1QY4A 3I2DA 4QQOA 1WCSA 3HT1A 3WNXA 4A7KA 2WA4A 3HAGA 4Z82A 1S0IA 1PK6B 3B02A 3RSJA 3WP4A 1VLNA 3N7KA 2GMMA 2CYFA 2IWGB 3N7JA 4R8HA 2WLQA 2RS31 2OZ6A 4N43C 3LWCA 2VW2A 1QJZA 3MLLA 2AYHA 4Q26A 3E5QA 2XJPA 3MPBA 3OD0A 3ES4A 4WM7A 4PJYA 4AG4A 2JG9C 4D69A 5L7OC 1KXGA 1V00A 2HEWF 1NOVA 1ENRA 3OGJA 4BZ4A 5JOWA 4LBLA 4JGYB 3RYPA 4B29A 4AEKA 4MGKE 1LOGA 2D6PA 1AR93 4A7YA 1LOEA 1NCRC 2E7TA 3AXDA 1FNYA 4LO4B 2ZX0A 4XFBA 5C6CA 5AFBA 2GH8A 2JE7A 4Q0PA 2CAVA 1DQ2A 3LA3A 3LOIA 5JOYA 3E6CC 1RINA 1UF2C 1WLCA 4AEDA 4CZSA 2XL7A 4TLFA 4KGQA 1VB4A 1F8VA 1J1LA 4KWLA 2XJQA 3RYRA 4L8QA 2CTVA 4UBHA 5FRAA 4IEPA 4N7UA 1AF9A 5CB7A 4OVEA 1X82A 4FTSA 5LK7B 2DCJA 4BA6A 3H1YA 3ZIXA 2IXJA 1NA1A 2Z79A 1BBT2 2ZGPA 1SBDA 1OOPC 1LOBA 2GN7A 1CR7A 1OHFA 1PO23 1YUDA 4P9GA 4YW2A 1Q8SA 2VOVA 4X8NA 4URTA 1XE8A 3ZXJA 3B9IA 4Q4Y3 1N3PA 5T5JA 3MGUA 2XLAA 2VQ0A 4KG0A 2VW1A 2H0VA 3X29B 1GR3A 1RUF1 3BPZA 2QCSB 4JDNA 3ZN5A 1LHOA 2AENA 4XZPA 3SNMA 1HDKA 4AF9A 3ZFEB 3VZNA 1AR71 1NCQC 4OI2A 4E2SA 3OJBA 4PDWC 1GYKA 2CNAA 4I0AA 3PLQA 3CJIB 2PHFA 3CJXA 1R1A1 2ZJCA 3TAYA 5AC92 2X53S 5D8AB 1AJKA 3JBG3 3JZVA 5FQ0B 5J96B 1C57A 1DBNA 4IESA 2ZS6B 4YVSA 5I0UA 2WFF2 5DUUA 1DQ0A 3AMQA 3FUOA 4DFSA 5JDBA 1ZBE1 1VBD3 3H7YA 4XTMA 2D93A 5KHHA 3W59A 2KM2A 3KM5A 1O4ZA 2R30A 2XLFA 3POWA 4CEYB 5JZGA 2HWD3 3R4SA 1V9U2 3KLSA 3BOPA 3IKWA 1YFXA 5TSWA 3O0VA 1U5IA 4XFFA 3DPRA 4CDWA 1PGL1 4MXVA 5E1RA 1OQ1A 3M3IA 4S2HA 1PZ8A 1DGWA 4R9AA 3VBRB 3IM0A 1I3HA 1WCKA 3BODA 3ZFFA 1HX6A 4DPNA 4QD2A 3VKMA 2ZGMA 4OUMA 2BWAA 1RUE1 1REDA 4K7JA 4UW4A 4EV0A 5CG9A 4AHXA 1HQWA 1LU2A 1OFSA 1VAKA 2VGDA 2PAMA 2TUNA 1H8TB 2OIIA 3VBHA 2B5HA 2RS32 3E6DA 5FO8B 3KQRA 3MW2A 3QD6A 3D4KA 1GFF2 3V0AA 2TEPA 4CDQA 1MR5A 3ALQA 4GMP3 1DYPA 4XXAA 3ZN6B 4JRLA 5F6LB 1ENSA 1H1MA 2VU9A 5DZEA 1PHMA 3MF6A 4HLTA 4RA0A 1PVC3 1YFUA 4J1WA 1QXRA 4JV4A 1CGPA 4EN7B 4BMBA 1QGLA 2XJVA 2VW0A 4MVTA 3VBSB 4LR4A 1RUC3 4K8FA 3L2HA 3FLRA 2V73A 1JHNA 2IXHA 1PNGA 1YXWA 2K9ZA 1CX4A 3U0ZA 4QU2A 1W6QA 4XFCA 1AZDA 3D82A 4LO8A 4AQTA 1Q3EA 4C0BA 1MS0A 4EROA 2PHUA 2ZGTA 3BOWA 2AREA 4L97A 4WM7C 1LB2A 2ZAAA 4GMP0 2VVDA 3O14A 1CVNA 5I0TA 1W6OB 2QNKA 5IT6A 4EN9B 4X6RB 1SEFA 5JPNB 2XL9A 4RQPA 1SLAA 4TZDA 3NW4A 1MZFA 1ZX5A 3ZXDA 2MNGA 5JWPA 1WLTA 2BQPA 3K51A 3ZXFA 3N3HA 1A78A 2D3PA 2WINB 3B94A 5CADA 3WDYA 3BCWA 3WW4A 4KH9A 3H8UA 1FOD1 4YZ1A 1WLWA 4META 1X36A 4AEDC 4QQ2A 4XPVA 3VDDA 2H6BA 3NAPB 1RUF2 4JCKA 2D6OX 1J1TA 4XJAA 1J3RA 2DVDA 4XBQA 1GQHA 4ZU7A 4XJZA 1AR72 2TBVA 2GDFA 1V6KA 1LENA 4Z1VA 4JGZC 1D4M1 5BNNB 1WMDA 1QOSA 4YGDA 2EVXA 3BU7A 4YGBA 1NA1C 1R1A2 4FPJA 2A3XA 2GAUA 4E9KA 1BMV1 4KWJA 2ZKNA 4R9CA 2JJ6A 3A0KA 4I01A 2P3JA 3B5LB 1WMEA 2ZTNA 4IV1B 2IXLA 3HWJA 5T3NA 2WS91 1S0FA 1LHNA 2R041 1ZBE2 1DQ5A 4QX5A 1W6NA 4LEJA 1AYM3 2JEMA 5FMOS 3TN91 2WNVB 1MQTA 4Z07A 5K0UC 1IOAA 2C1FA 2ZACA 2DYCA 4Y1ZA 4FAGA 4IQPA 5T5OA 4Q4W1 4G4FA 3USSA 1XE7A 3IDBB 1BVP1 1QOOA 3IDEA 2Z42A 3RNSA 2Q4SA 4FOYA 4FPOB 2OVUA 1R091 1PGL2 5IK8A 4GKYA 3T1MA 4LBQB 2N7GA 3Q9OA 4YVSC 2CY6A 3MICA 1UW8A 3NVCA 4HVQA 3N7LA 2EXKA 1GNHA 1YLLA 4R9DA 3VUOA 1AUYA 3VBUA 4GULA 1RUE2 1NQDA 2Y0IA 4AEJA 5DUXA 1CD3G 4P9WA 5JZGC 5KXCA 4GH4A 3AP6A 1OQEA 4AFAA 1XNKA 1ZBA1 4FPHA 5I0SA 1ZRDA 4CDWC 3DPRC 3HQXA 1UD1A 4QGLA 2RJLA 1VBA1 1UZYA 1ASJ2 1RMU1 1CJDA 4RSUA 2CWSA 2E51A 4Z8BA 4BLIA 5JSRA 2LM3A 4RHV2 3ZFFC 2FQPA 2NMOA 5H9QA 4LBJA 4HKLA 1BBT3 2R32A 5I8TA 4GMP1 5KC5A 1Q8QA 2DCKA 3H3UA 1V6OA 3VBHC 2DU1A 2RE9A 2OUJA 1OA3A 4YVWB 4AFBA 2EALA 4EWAA 5FO7B 2D3RA 4CDQC 1PVC1 5F1RA 4F7ZA 2X5IB 2GC1A 1YJLA 4BWOA 4XJ9A 5L19A 2LUWA 1VIWB 2VOKA 2FZ2A 3LCPA 3MW3A 1AL22 4HETA 3HD8B 3RJRA 1HV1A 4XDQA 3BB6A 2W39A 5AC93 4OHZA 1XU2A 1AX2A 3I7DA 3G7DA 1LEMA 1FOD2 2PQQA 4P9XA 3WQ1A 4AFMA 1EPZA 2ZOEB 4OZXA 3WINE 5IK5A 2WFF3 1HRV1 3EQEA 5CFDA 3H1MA 2HKXA 1JOJA 3FBYA 1X33A 3RWNA 2P34A 1O3SA 2D97A 1H2NA 1PVXA 3I59B 1OLRA 1VJ2A 2GMEA 4DXZA 1MS5A 1LODA 3I54A 4C1WA 1C8NA 1DGRA 4LBMA 1D4M2 4LLOA 1FAYA 4JDOA 3ZXLA 2DUOA 2DVAA 3ENRA 4RQPC 4KBBA 4WVWA 1WCDJ 4IEUA 3SH3A 4AI1A 1BMV2 3FZ3A 5BPXA 3KT1A 5GLTA 1V9U3 2DURA 3R4DB 2B39A 2BVVA 2WS92 2XH6A 4AK3A 4HSLA 1RVF1 4GWMA 2R042 2R1DA 1G9DA 3VDDC 5EXOA 5C4WA 5CBLA 2DTWA 2YZ4A 2ZMLA 1QH7A 4B7EA 3TN92 1AJOA 3ZDSA 3LGRA 1WW7A 1IPJA 1LOFA 4WVMB 2ZHKA 5C8CA 4RS5A 1UN1A 1IKPA 4K21A 4MXWB 4P9JA 4Q4W2 2XVLA 5GZEA 1I5ZA 2RS33 1AYN1 3QBQA 5FAXA 5BV6A 1BQPA 1R092 1BYHA 1C5HA 2XJRA 2E9QA 4BYYA 1WA4A 1EP0A 2BNMA 4N53B 3O7OA 3N36A 5JCTA 1C8M2 4MGYE 4DINB 4JVAA 4FPYA 3WHUA 2ARBA 1MQTC 1RJ8A 1FI2A 2XGXA 4M3CF 5CNAA 1QDOA 2A73B 1KDKA 2ZX2A 1NZCA 2QUOA 1ZBA2 1CAWB 4HANA 1QNWA 5AVAA 3KMHA 1KS4A 1VBA2 3NL1A 3UK9A 3VBOB 1RMU2 1FNZA 2CV6A 1Y9QA 3EHKA 1F9KA 1DIWA 4BLJA 4IV3B 2DUPA 1GBGA 3VBUC 2A71A 2E6VA 5AFEA 3JU9A 1A3KA 1RC6A 2YC0A 1KJLA 2XHKA 1ULEA 3HIFA 1A6CA 4S2FA 1ULDA 4GH4C 1G9BA 2GMPA 2ZGQA 4AHYA 5FBZA 2BYVE 3V56A 1K5MA 3J9SA 3AM2A 1XYNA 1ZZBA 3H50A 3AJYA 4R4ZA 2UYAA 1HKDA 2ILMA 1SLBA 3FC0A 4XJUA 1HXS1 1XU1A 1RUF3 3P3PA 3IPVB 5FTTC 1CN1A 4N9HA 1BBT1 1GQGA 2G4IA 4XW3A 3IN9A 1AR73 2I74A 2E7QA 2JE9A 1HV0A 4RR3B 1DFQA 4XHBA 4FO9A 1NYWA 5DUWA 1PK6A 1O4YA 1N47A 1R1A3 1J3PA 3OBTA 1ENXA 1KRIA 4HK8A 4CYDA 4XHXA 2DU0A 5BY5A 3WW1A 3VKNA 2GC2A 4HFSA 4TWTA 2ES3A 4BQ1A 4X6QB 3MFAA 1VRH1 1YFWA 5J36A 1NE6A 4Y1VA 2P17A 2AGSA 3ZX7A 1HRV2 4W6YA 4AI2A 2XJUA 2ZHNA 3G6JB 5L7OB 1ZBE3 1CPNA 2YPJA 1XYPA 2WZPP 3M1HA 4JGYA 2DF7A 5CU1A 2CL2A 3ME2A 5H9RA 5KHIA 2WNUA 3ZSJA 1APNA 4WVVA 1WGPA 3ATGA 2D43A 1OI6A 3ASIA 4HN1A 2NPIA 2BNOA 1OLQA 2YGMA 3LAGA 5SV5A 1BCXA 4AQSA 3CNAA 1RVF2 2ERFA 2WA3A 2ZHMA 4KNCA 1FV2A 2B9UA 2ZGLA 2GSYA 4D7SA 3USUB 1LU1A 5CFDC 3ZYJB 2AZ5A 5T5PA 2OZJA 4BHPA 4EJRA 4AVVA 1B35B 1RUE3 2WWSA 2JX9A 1C1LA 2XWJB 4OUSA 3SHRA 3M4FA 3ZPYA 1FPN1 1ZNPA 5DZGA 4J6GA 4A7ZA 4UW3A 1B09A 2WIIB 4DY3A 1AYN2 1N1TA 2CWMA 4IETA 3ES1A 3WG2A 4CEWB 5J09A 1W6PB 1IZ3A 4ZKTB 5DZFA 3AKTA 1BVVA 2JENA 2VOWA 1EY2A 4LA3A 3WW2A 2VQAA 3ROUA 1ASJ3 3VZJA 1PO11 5JOXA 2ZX1A 5C4WC 4ZU5A 5CAZA 4RHV3 1Q8VA 3ZFEA 2B42B 1YYNA 4CDXB 1KS5A 1LOFC 3NO8A 4AVAA 2WFPA 5C8CC 3ILNA 4F3JA 1F5FA 1ULFA 4AEMA 4L9BA 3ZO0B 1GKBA 1QJY1 5D8AA 5FQ0A 4ASMB 4LNVA 1LHUA 5LRRA 1RL3A 2O1QA 2OYZA 1RHI2 4DRVA 4BCUA 4AXOA 3LA2A 4HSJA 5F5QA 1XNDA 2YXSA 1AHSA 3HN1A 3VHOA 2R0FA 5EV7A 1LHVA 1WD4A 3AP4A 4WZFA 4CP0A 1O5UA 4AVCA 3RRDA 3RMXA 5K8SA 3RI9A 1AL23 2HWE1 2DV9A 3PNAA 2BBVA 3AYEA 2D6KA 4LTAA 3VZLA 4NWWA 2QVSB 4LBNA 1S0JA 4IEYA 4KU7A 4LO7A 3WCRA 4CEYA 2QQPA 3VKLA 5FMOL 4AYUA 1PIV1 3MIDA 4PBPA 1AXKA 2XWBB 1FOD3 3VHRA 1O5LA 1QJX1 3C2UA 1Y43B 5FOBB 1TME2 1HXS2 2DCYA 4ES9A 4XFAA 3THPA 2ZKLA 3VBRA 4HPKB 3VBFB 3LSDA 4A2UA 3PJQA 1CAUB 3GZAA 3AP7A 1D4M3 4QT6A 4LUMA 3WLUA 3WP6A 5GALA 3WV6A 4UW5A 1GLHA 4RGGA 1H8TA 2W68A 3KT7A 4P14A 4WV8A 3FJSA 4MX3A 3AKQA 1VRH2 2GALA 4FT8A 3V0BB 1O3TA 3AJZA 3W9AA 1JYIA 1DZQA 1ONAA 2WS93 2ATFA 1K5MC 3L9JT 3ZN6A 2R043 4XFGA 5AVPA 3V65A 4LBOA 2HWF1 5KHJA 2VNRA 2NMNA 4NHKA 5CG8A 4GIQA 3TN93 1QKQA 5ACA1 1IS5A 2RS51 4AI8A 4COZA 3VBSA 4C0HA 2HWC1 4Q4W3 1PK6C 2X8KA 2I2SA 4I0WB 4NVPA 1TNRA 2PHWA 1R081 3UL2A 2MPFA 1R093 1XNBA 1DF0A 2XG3A 1PZ9A 3WG3A 2ZAHA 3PJYA 3AZWA 4AVTA 2OW4A 1N1YA 1VBE1 2D44A 4G3YC 1W6MB 5HBAA 1W6OA 4AQ2A 1C8M3 4AHWA 1AVBA 3AYCA 3N7MA 4JGYC 3AFKA 1FPN2 1QMJA 1LOAA 1AXZA 1VBB2 1YIPA 2WNUC 5E89A 4ZU4A 5LEKA 4E2QA 2XB6C 2QE3A 5A33B 4NWVA 4H55A 3WG1A 2IZWA 1ZBA3 2HEVF 5KXEA 3MI8A 1I1EA 3S30A 2R16A 5FOJB 1VBA3 1ND3B 1ZVFA 4DB5A 1PO12 1RJ7A 1Q43A 1RMU3 3NAPA 3GF6A 1EV11 2WQ4A 1Z7S2 3ZMOA 1OA2A 1X7NA 2QFEA 1YHFA 2RJKA 2ZHLA 4Y1XA 1POV0 5BNNA 4BPZA 3AP9A 2WSVA 1LTEA 4L92A 3V64A 1QJY2 2QDNA 3OYWB 5C9AA 5HCFA 2RS12 1F2NA 2PAKA 1G86A 3AP5A 2UYBA 1ASJ1 4XJ8A 1H2LA 3ZYRA 4IV1A 5BNPB 1UPIA 4JTOA 3FMGA 4RHV1 2R071 5DG1A 3FFQA 1U5ZA 1HW5A 5BUVA 2GC0A 4QGMA 1QU0A 2JECA 3QLQA 2A6VA 2HWE2 3LB9A 3H1WA 3VLBB 2FBEA 4O9GA 2WNVA 2ZGUA 4Q27A 5JR7B 4XQ4A 3N35A 3ZFEC 1RUD1 4WVZA 3AMPA 4EN6B 5K0UB 1BXHA 2PELA 4Y4YA 1PIV2 4AFDA 4CDUA 5D8AC 1IGOA 1IS4A 1F5JA 1QJX2 1Y7BA 2HYKA 4DOUA 1KFXL 2VUJA 3POSA 1MEC2 4AI0A 1ZRCA 1AL21 1AR61 1HRV3 4LBQA 4AFCA 1CAXB 1G7YA 1SCSA 3NV2A 3OTFA 4XYXA 3SCHA 1YRZA 5EZWA 2A3YA 1GZWB 4SBVA 4E4ZA 1UCXA 1ND2B 2DCTA 2D6NA 4YW1A 2Y38A 4R4XA 4Q0QA 4CEYC 5JI9A 1CAVB 3ZIWA 3ZSEA 3MIEA 3ECQA 3LKJA 3M70A 3NSTA 1G9CA 3WX5A 3SCGA 1WD3A 4ASLA 3M3CA 3O12A 1C28A 1R1ZA 4I3PA 1RVF3 3FUQA 4HKWA 3ZMNA 2DUQA 2HWF2 1BK1A 2ZGOA 4B4QA 5JSPA 5GLZA 4JRAA 5GLVA 4GALA 3VBRC 2V09A 3ZFFB 5ACA2 2RS52 4D3WA 2MEV1 3ZVXA 4Q4X1 2HWC2 4PLOA 1RUG1 4XFHA 4PLNA 2ARXA 1GANA 1R082 2XKPA 1AYN3 3ZFGB 2EXJA 1MZEA 1H8TC 2F6BA 3BIWE 4YFWA 3A0NA 4FXGB 4YVWA 4M01A 3VHPA 2D5FA 2Y0OA 1T6GC 1WLDA 2X5IA 2R061 1VBE2 4Y20B 2QZ3A 4Q4V2 5ABJA 1QQP2 1OPOA 4M3CE 1C4RA 4GQ7A 3WD5A 1VBC1 4Y1UA 3LOBA 4KQ7A 1YNAA 4DY5A 3B3QE 4B7KA 4UW6A 1S0EA 3M3QA 3VBSC 1IS3A 3KGLA 4AHZA 2PAEA 3M3EA 3O0XA 1LESA 3QH6A 1O91A 1RHI3 1PGW1 4H7MA 4K1YA 3IDCB 3ZYPA 1POV1 3NKGA 3UV9A 1BKZA 1VP6A 2EIGA 2BPA2 1Q5OA 2A7AA 1C8M1 4E2GA 4P9IA 2WLPA 1EV12 4IEZA 2D7FA 4B4RA 1WMFA 3I59A 1DLLA 4IEVA 1CIWA 1HRI1 5DDJ1 1GZCA 3MLJA 2B45X 4FPKA 3SISA 3WVJA 1LEDA 2AR6A 5I8YA 3DN7A 3J8F1 4QQLA 3R0RA 5BYNA 3UJOA 4EWDA 5JMCA 2BVBA 2VPVA 4NO4A 1IPKA 3HT2A 2R072 3D0SA 4Q0VA 2UWAA 2GNMA 1TME3 1HXS3 3MIBA 4DNYA 4XFIA 3VDDB 3NAPC 1Q8PA 4DMIA 2FMDA 4OULA 5C8WA 2AH2A 4LUKA 3NV1A 3OF1A 3FLPA 1RUD2 2G9GA 4WVMA 5KXBA 4PQ9A 5BNNC 2ZPXA 4H7LA 4MXWA 1SFYA 2D98A 4LE4A 2P2KA 4Y24A 4QM8A 4IEOA 1J59A 3VKOA 5C9AC 2R1BA 4H14A 5JPMB 1ZRFA 4LULA 1JN2P 1VRH3 3PVNA 4M0NA 1SACA 1V6NA 3GHMA 4COVA 1DQ4A 2VMIA 1AR62 4IV1C 3OY8B 2XBO1 5K7PA 4Z2WA 4I30A 4YSFA 3KT4A 1UIJA 2IXKA 4N53A 5SV8A 2BFUS 1YI7A 3R05A 4D7TA 2IFRA 3DL3A 1XQNA 5FO9B 1V6JA 5HXVA 2WNVC 5BNOB 2WT2A 1HLCA 2BWCA 3AFGA 2XVGA 2O8QA 2ZX3A 2PLV2 4YZ4A 5T54A 3MPPG 1FATA 1H4GA 2UWCA 4CDUC 3KD4A 5JIUA 3MIFA 3AX4A 1CAWA 1A8MA 4OI1A 2WL1A 4J1XA 5JIAA 3NKTA 4LBKA 3VBOA 1OSGA 4PLMA 2K2SA 1S0BA 3FFZA 1TE1B 2V5YA 2VUAA 1NXD1 4IV3A 1C5IA 2MEV2 2NYYA 4QPIB 1BZWA 1KFUL 5CVRA 4INDA 4Q4X2 2Q0AA 3IWZA 3RI8A 1FPN3 1RUG2 5HCAA 1TMF1 1VBB3 3SMHA 2KA3A 2GZWA 3WDWA 4FTEA 2RR11 3MIHA 4P5HA 1D2QA 1H30A 1XXNA 1LR5A 3MFCA 1OKQA 4XQDA 4EWEA 4AW7A 3IIAA 4JGZB 2R062 2WZR2 1PO13 2SLIA 1F31A 4XXPA 3WQ0A 3IPVA 1VBC2 3MIGA 1ZZ8A 4OFGA 4BMEA 4Y5Z0 1Z7S3 1JYCA 4XJWA 1X50A 2GH2A 3PTYA 2C5DA 4W65A 5DG2A 4RR3A 5A3LA 3TYJA 2A3WA 4QMAA 1TEIA 2ZGNA 2BGCA 2R49A 1QJY3 4FP3A 1ULGA 2RS13 1QF3A 1W0PA 3WQ7A 3UKTA 2UU8A 3AYDA 3WUDA 1WW4A 1PGW2 4GXLA 4I09A 5J48A 2Z2SB 4YVWC 3GZUC 5IK4A 2C9AA 1RUNA 2X5IC 4IERA 5ABJC 4FCAA 1HRI2 2KXLA 5DDJ2 1NQJA 2HWE3 3HR9A 3JD71 4RL7A 3H0OA 1SBEA 3VZKA 1DQ1A 2WNEA 2RHPA 3DUIA 4IL7A 3A4UA 1SLCA 2ZCWA 3FE5A 4XEZA 3WDUA 4C1XA 4MLOA 4WM8B 3J8F2 1MS9A 1RHI1 1PIV3 5FPXA 5BXXA 2YY1A 3IBMA 5EYYA 2BW8A 3E97A 1QJX3 4PF5A 5KWRA 4NHLA 5D1IA 3ST7A 1LECA 3U07A 1MEC3 1YO8A 4C90A 1MS4A 1DGRN 4LO6B 3USUA 1OMIA 4XIKA 4CP1A 2VVEA 2JG8B 1MACA 1B35A 3AZZA 1URXA 4Q0UA 4DQAA 5CFCB 1QXJA 4XIOA 5HCBA 1RUI1 2I45A 2HEYF 3JCIA 4XE9A 4CEWA 2XLGA 3WHTA 3VKFC 1DQ6A 1TME1 1PNFA 1W6PA 1H2KA 4LHKA 5LRSA 3T2TA 1QXPA 4Q0SA 3ZYIB 3SXWA 4QPGB 2G9FA 3PMEA 5I91A 2XJTA 4GKXA 5KC6A 2IXIA 2XBO2 4QQHA 4JTNA 4K20A 2Q1ZB 1I6XA 3AMNA 4MGZE 3WOGA 2HWF3 5T50A 1IS6A 1MS8A 4PIXA 5ACA3 2RS53 5I8SA 3VZMA 1PM7A 4AGVA 3AZVA 4N43B 1VALA 1RUJ1 3EXUA 3ZSLA 4CDXA 2TNFA 2HWC3 4EN0A 3TNQA 1LCLA 3OBRA 1R083 3GNEA 4XETA 2EAKA 2H6CA 2JG9B 3P3NA 3AB0A 3WW3A 2Z5WA 1UU6A 1SQ4A 1SBFA 2NZ9A 1TNFA 3SLIA 1W0OA 2WSUA 1DGWX 1ZREA 4IEQA 4M3CB 4PIZA 5FLHA 2E63A 2GC3A 1VB2A 4OHWA 1VBE3 1OPMA 3MEPA 2WKKA 4Q4V3 1QQP3 1NCRB 1RITA 1NLRA 3VV1A 4BM8A 4F8AA 1U0AA 3TBDA 4HT1T 2OPKA 2E53A 4N53C 4A3XA 1TMF2 4IEWA 5KHGA 4K40A 4YM3A 1CESA 2RR12 4UBGA 4NHMA 4I2OA 1ZZ7A 5A32B 3T1LA 1FMD1 1G6NA 4YGCA 1BEV1 2YROA 3GALA 4YARA 1ULCA 1LRHA 2Z69A 3HBZA 1EV13 2VNGA 2I07B 1H1AA 3VBOC 1VBB1 1OOPB 4HPKA 4H3WA 3VBFA 1H2MA 1CAUA 4IV3C 1JXNA 2DTYA 3GZTB 1Q56A 3GBFA 2RM22 1H8VA 4PBOA 4NN0A 1RUOA 4MGIE 1LULA 3ILRA 4BOWA 3KGZA 4Z92B 4QHBA 2GNDA 3RYKA 3B93A 1A8DA 1DZTA 3D6EA 1COV1 3V0BA 3GHNA 2D6MA 5GKAC 4I02A