3VHOA

Y61-gg insertion mutant of tm-cellulase 12a
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
256
structure length
256
Chain Sequence
MVLMTKPGTSDFVWNGIPLSMELNLWNIKEYSGSVAMKFDGEKITFDADIQNLSPKEPERGGVLGYPEFYYGYKPWENHTAEGSKLPVPVSSMKSFSVEVSFDIHHEPSLPLNFAMETWLTREKYQTEASIGDVEIMVWFYFNNLTPGGEKIEEFTIPFVLNGESVEGTWELWLAEWGWDYLAFRLKDPVKKGRVKFDVRHFLDAAGKALSSSARVKDFEDLYFTVWEIGTEFGSPETKSAQFGWKFENFSIDLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-glucanase
publication title Enhanced activity of Thermotoga maritima cellulase 12A by mutating a unique surface loop
pubmed doi rcsb
source organism Thermotoga maritima
total genus 60
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vhoA00
2VGDA 2C1FA 4HKOA 1UU5A 1XXNA 3AMPA 3WP6A 3EXUA 4S2GA 4H7MA 3LB9A 3MF9A 1BVVA 4S2DA 3VHNA 3WX5A 3WP5A 1KS5A 3VHOA 1XYPA 1HV0A 2DCKA 1C5IA 1W2UA 1OA4A 3VZJA 3ZSEA 1UKRA 3AMQA 3WP4A 3MFAA 2DCJA 1XNKA 3WQ7A 1H8VA 2DFCA 1TE1B 2B46X 3AMNA 2VUJA 1XNCA 1NLRA 3VZMA 3WXPA 1QH6A 2QZ2A 3WP3A 1F5JA 3MF6A 3VL9A 4XQ4A 3VZLA 3WY6A 1UU4A 3AMMA 2BWAA 4NPRA 3AKPA 3VHPA 2JEMA 4HK9A 5K7PA 2QZ3A 3VL8A 4S2HA 1IGOA 2BWCA 2DCYA 4IXLA 1H4HA 4XQDA 1XNDA 1REEA 1XNBA 1KS4A 2VG9A 1OA3A 2JENA 3RI9A 3VZKA 3WT3A 3VZNA 5HXVA 1ENXA 4HKLA 2B45X 3VZOA 1PVXA 3O7OA 1BCXA 3WQ0A 1XYNA 2D97A 1QH7A 5EJ3A 1OA2A 3AKSA 2NLRA 4XQWA 1OLRA 3HD8B 3WQ1A 3RI8A 1OLQA 1REDA 4XPVA 2JICA 2BW8A 3MFCA 3AMHA 1H1AA 2F6BA 4HKWA 1HIXA 3VGIA 2BVVA 1BK1A 1T6GC 2DCZA 1UU6A 1C5HA 3AKTA 3AKRA 1XYOA 2Z79A 2NQYA 2VULA 3B5LB 3LGRA 1REFA 3AKQA 1H4GA 2B42B 1H0BA 4S2FA 5K9YA 3M4FA 2D98A 1AXKA 3VLBB 4HK8A 1YNAA 3WR0A 1M4WA 2DFBA 3B7MA 1HV1A
chains in the Genus database with same CATH superfamily
3VUOA 3HVDA 3T08A 1RHI2 2XG3A 3HT2A 3IDAA 3PJQA 3GDBA 3M3QA 4J1XA 3VBHA 2P4EA 1YIFA 2J1UA 5FYHA 3ZXEA 1V9U3 2WKKA 4M0HA 3VDDC 5IFPA 3N7KA 3MPPG 4RQPA 3IBMA 1QMJA 3JCIA 1L7RA 2A70A 4Z1VA 2ZGRA 4QKDA 3ZSEA 1OFNA 1CN1A 1Y9MA 2XUMA 2Q30A 3GHNA 1Z7S3 1BEV1 4JTNA 5CFCB 5FXZA 2R6QA 4AAPA 4CP9A 4BLJA 1MS8A 2BPA2 1QDCA 3MPBA 1JU4A 1ODNA 4XXAA 5DAQA 4AWDA 1X82A 3ACIA 1COV3 1OQ1A 3H3LA 1DYPA 4XDPA 4XTMA 4AI8A 3MW4A 1W6PA 1FNYA 1O5UA 1OC1A 4I0BA 5JZGC 1DQ0A 1H1MA 2OUHA 2P6CA 4GULA 2ZGOA 1UN1A 2A1XA 2W5FA 3S6PA 4NIHA 2MPFA 1RGSA 1MEC2 2BOIA 1ENSA 1LOFC 2IFWA 4OI2A 1VRBA 1YJKA 4AEKA 2OPWA 5FZ1A 1CVNA 4A7KA 2P6HA 4MHUA 1S1AA 4BWOA 1W0PA 4ASLA 2GNMA 4AVBA 4YYOA 4CCKA 1GBGA 3KV9A 4L0PA 4ZZ8A 1NQJA 3FL7A 4OFGA 4L11A 4F7ZA 1V9U2 2JDZA 2VZOA 3MV11 3POFA 4N53A 4DUWA 1UX6A 3SKJE 4KMQA 4DFSA 2A6YA 1SLCA 1SLIA 4LJHA 4AFMA 2EIGA 5IVEA 4XAEA 4XUNA 4B4RA 2P37A 1ENXA 3ALQA 3B3QE 3QOPA 4WBBA 1Z7S2 1UD1A 4P9IA 3VB9A 3NNLA 1ASJ1 1ULCA 4O9EA 3RPQA 2WA4A 5LEKA 2VMHA 4JRLA 1QF3A 3MLLA 2R043 2XLFA 4OCTA 3AZVA 3AKSA 2VUDA 4XFCA 2EA7A 1COV2 3WQ1A 3PIJA 3VBSC 3GGLA 1HKDA 4TLFA 4Q0VA 4JKLA 4KWKA 1BBT1 3NKTA 3O5SA 5EWSA 5FWJA 4X6RB 2XR4A 1IOAA 2Y6GA 1CAVB 2V73A 1S0EA 1Q8OA 4JX0A 4CCDA 3G6JB 4FT8A 2XHNA 4CDXC 4IE5A 2CWMA 1X8MA 3KM5A 5E89A 1LHWA 1RIRA 4Q8LA 1NZIA 4Q4V3 4XAAA 1L7LA 2QJVA 3VBFB 3DF0A 1RUH3 2Z4FA 4L97A 2FDFA 3J8F1 2OZ6A 4AGRA 5F6KA 3VBRC 3KQRA 4XZUG 4FOQA 3LD8A 1U5IA 5EZWA 1AXKA 4CU6A 4QKFA 2FBEA 5FZ3A 5I0DA 2ZGQA 1ULEA 4I2OA 5BUVA 3MIEA 5F9TA 5BNOA 2JE9A 5EV7A 3WHUA 2R042 1WA4A 2VVEA 3M3IA 4HVOA 4EQVA 4K8FA 1DZTA 4OHZA 4ES9A 1UW8A 1NXMA 4Y5SA 5J7MA 1FXZA 2NMNA 1QXPA 2YFZA 5FZ4A 5A3LA 2RS31 4Y3OA 3SITA 4PQQA 1C5IA 4TTGA 4N7IA 4CDUA 3D8CA 5D2AA 5FZAA 1WW5A 2DCJA 2Q1MA 2GH2A 1JN2P 3SH3A 4CDWB 4D7TA 2VTXA 1UPIA 1MVEA 1NY72 1HDKA 1PMHX 2EALA 2QQJA 4Q4V2 4XZPA 5I8SA 4QX5A 3LAGA 2UY9A 4RQPB 4AHXA 3ROUA 1UYXA 4Q4X3 3TN93 5KHHA 4B4PA 2ZPXA 2WYFA 5LEJA 3RZZA 4N9HA 5GLWA 4QPGC 5B2GB 1ZYBA 2RS53 1XU2A 3THPA 2OS2A 1WMXA 5KR7A 1PVC1 5FY0A 4HK9A 2OA2A 2ZHLA 3QLQA 3U37A 4CP9B 1C8M1 4RFRB 4S2HA 3K51A 1XB9A 3U78A 1F5FA 5FFOC 1O5LA 1OF4A 2WT0A 1DGRA 5FYUA 1HJFA 3MW3A 1DGLA 1VP6A 2ZHMA 1STMA 1SDWA 1ZZ9A 2HWC1 1W6PB 1VBC3 1DP0A 2YV8A 1UMZA 3N9PA 4LIVA 4XFHA 1QJU3 5HXMA 5FY7A 2VVFA 2OX0A 2WJSA 4IEUA 4M4PA 4FTEA 2Y34A 1JYNA 5T3NA 1W8WA 2ARAA 2G19A 1SBDA 3AYAA 2YROA 1IG3A 3B02A 3D0SA 3B94A 3KF5A 1HB4A 1PIV3 1BCXA 3CNAA 4WVMB 5FP4A 4D8MA 1LRHA 1OURA 1DZRA 4CCNA 2NM1A 1YWKA 4BISA 1PZ9A 2IWGB 4B1LA 1ZA7A 4Q4X2 2GSYA 3LZZA 3TN92 5A1FA 1PM4A 2D93A 2Z69A 4KBBA 5IK5A 3A22A 3K4AA 2D7FA 2PHLA 4IE7A 1UZVA 5FMCA 1PK6A 2RS52 1F15A 5KBFA 1POQA 4JDOA 5DN2A 3IMMA 3PIGA 4IV1B 3TAYA 1G9AA 2ET7A 2J1TA 2Q5TA 5EJZB 3PU8A 3AYCA 5APAA 3UV9A 4E4HA 5FYSA 5HCAA 5B4NA 5L19A 4UW4A 1GMMA 2AEYA 4GKXA 3TEYA 1VBC2 5BY5A 4QKNA 3VDBA 4ZS2A 2GH8A 4LULA 4A3XA 1QQP2 1YC61 4DINB 4U2AA 4YG6A 2PA7A 1V6JA 4FXKB 1S55A 1TZOA 1W04A 3AC0A 3NRUA 4XW3A 5CFDB 1ACCA 4LKDA 3X29B 1PIV2 2BGOA 2OZJA 5FQ0A 1RUI1 3E6CC 1M4WA 3GALA 3E97A 4CCMA 3CMGA 1HXS1 2B8MA 3IPVB 3OPZA 3LDRA 5BXXA 1RTVA 1BMV1 4RHV1 5FPVA 4L92A 5LW9A 1XXNA 3BALA 1WKYA 3CKHA 3PUHA 5FYYA 1BYHA 2ZMNA 5FPZA 3VBOC 3ZFEC 3ENRA 2FDKA 2DU1A 1PO11 3KV5A 3OEBA 2AREA 3OD0A 1UKGA 2Y0OA 4E4DX 4JV4A 5KXDA 4B7EA 4C8DA 5JXIA 1XBFA 2QQKA 1O91A 4FQ4A 2JDAA 1UY0A 3OG2A 4Q4W1 3V0BA 5JPMB 3SMHA 4P14A 4ASMB 1OF3A 4XJWA 2A3YA 2XQRA 5IW0A 3I2HA 1UKRA 4IETA 3LKJA 4NUBA 1W8UA 2VOTA 4IESA 4JGYC 4UOJA 5F3EA 5DXDA 4LKFA 1QJX1 2E51A 2DVFA 5FREA 1W6NA 1OMIA 4EZ4A 1MS0A 2W1QA 3BKZA 3WHTA 3H8RA 4KGGA 1NLRA 2KA3A 2PLV3 5FZFA 4CDUB 2VZSA 5CADA 5KC6A 2XQXA 4CP1A 2UWAA 3WY6A 3AKPA 3HAGA 1VBD1 4HSJA 4E8CA 3L2HA 1NKGA 1UMHA 2NPIA 1HB3A 4BJ0A 1IQAA 1AL23 1JZ4A 2UU8A 5FP7A 1YUDA 1XNDA 3GCXA 4NMIA 1WMEA 4Y22A 3LFMA 3ZYGA 5FYZA 3ZXLA 2CTVA 4WVWA 2JD4A 1ZREA 1DHKB 1HRI3 3S5AA 3VZNA 2VCCA 4CDQB 1UY3A 2D6NA 2EICA 2HBUA 2H0BA 4UFIA 2C26A 2PHTA 4EROA 1UY2A 3CIHA 3SEPA 2JIJA 5CBLA 2EIDA 1YQCA 1X9TA 3MUY1 1AZDA 2WZR1 5DZFA 2EIBA 3M3OA 1ND2C 2JDHA 3B9IA 1W90A 3HQRA 3FHAA 4X8NA 1K3IA 3GM8A 4LO7A 1ZBE1 1GQGA 2QE3A 2XGXA 4WM8B 3WUDA 4Q4Y3 2PLV2 1RUC1 1WCQA 4Y1XA 2X53S 5C3SA 3V0AB 2HWD1 3SC7X 4JGZA 3ZFGA 4CU7A 1LEMA 5DABA 1CJDA 1VALA 3AZXA 5E88A 1K5JA 4M4RA 2RR13 3UGGA 4JHTA 2B5HA 3MICA 1YFXA 4HVRA 4HKWA 3ORJA 3ILRA 3OJBA 1MQTC 1TME1 2DCZA 2EAAA 1AL22 4R9DA 3KT1A 1RVF1 1UYYA 2F17A 3HN3A 4XCAA 4CUGA 3OBAA 3R4UA 5KWRA 2Z2SB 2XOMA 1UZYA 2HWB1 2RVAA 2ZGLA 1RUF3 5IVYA 4XF4A 1PK6B 1EPWA 3SKVA 4H3WA 1HRI2 2W1SA 2VUCA 4W8JA 1PNGA 2I45A 2BYVE 2VZRA 3ATGA 4FSJA 5ANQA 1DDLA 3PVBB 5EJ1B 1JOPA 5HI0A 4KI5M 4W50A 3SXWA 5L7OA 4YM3A 1X7NA 1YQ5A 4N43C 3CJIB 4PQ9A 4AQ2A 2K9ZA 4LHSA 2Q1ZB 4Q4Y2 5EHDA 5FIXA 1HLCA 2CAVA 2YDEA 3MV01 5C9AA 1G7YA 5GZFA 4Z92B 1GZ9A 2ZZJA 3DN7A 3TNQA 3FUQA 2GC2A 4WM7C 1NYWA 1JH5A 4GALA 1TMF2 2TUNA 5FQ0B 2RR12 4UYBA 5JAXA 4RA0A 4Y24A 2VMEA 3UJOA 3OOXA 3SCFA 1G6NA 1W2UA 3WG2A 1W8FA 4QPIB 3UGFA 1QU0A 2ES3A 3AZYA 3VBUA 1OOPA 2XVKA 3HQXA 3WW2A 4LBJA 4AI2A 1RUF2 4B4QA 2O1QA 3NQHA 4FFHA 1MPXA 2J1SA 5C3RA 1U5XA 4XFGA 5DUUA 5TSWA 4YFZA 2ZAAA 1F8VA 2VL4A 1XQNA 3V0BB 3Q8AA 1D7PM 3T30A 5IYYA 4GH4C 5F5IA 4OQ9A 4FPGA 1O3SA 4DXTA 4PF1A 2Y6HA 1LB2A 2AYHA 1NCQA 3I2GA 1LOBA 3KHBA 3ON7A 5FJKA 3LA3A 1UU4A 2E53A 2GN3A 4NPRA 4WVVA 3TEXA 4HG6B 2RJKA 1JOJA 3MIDA 2WNUC 4AQSA 2G4IA 3AYEA 2Y6KA 4RR3C 5FJHA 3BU0A 3WDYA 2OUJA 4TZDA 4MUVA 2YGMA 2A6XA 3T2QA 4DUXA 4AZZA 3LIGA 4NHXA 4YWAA 5LASA 1I1EA 1TQ5A 3PLQA 3O1VA 2YG0A 4PDWA 1VBE1 5FTTC 5BNNC 4IW3A 2W46A 1GP5A 3GZAA 1AXZA 5FZGA 2YPDA 1KRIA 2JDPA 4TN7A 2AH2A 1SPPB 2TBVA 2ZCWA 3VKNA 4EE2A 4XOGA 5FOBB 2VM9A 1SLAA 1DGWX 2VNGA 3NNMA 1AHSA 4Y22B 4CEYA 4AI3A 3LQCA 1Q8VA 4IEQA 4A6OA 1CX4A 3N9OA 5IHRA 1LAJA 1OKOA 2JDMA 3MIBA 4AOCA 2ARXA 3T4VA 2WS93 1DQ6A 5BV6A 1NG0A 2BFUS 3GHMA 1MEC1 1YO8A 2XL9A 2WC2A 2P3JA 1UL9A 2B4KA 3Q8BA 5JMOA 3P3NA 1H30A 1K5MA 2A71A 4K9SA 5FMDA 2BVVA 2ZMLA 1ZBA1 3HBKA 3UKNA 4DO0A 5FY9A 4LKSA 3E5UA 1V9U1 2ZAHA 3WQBA 3U0ZA 5KC5A 1WUVA 2E63A 2RS13 4QGNA 1ZRIA 5FMOS 2Z79A 4FPEA 4JGZB 3ZFGB 4XUTA 1C1LA 2BUKA 2IC1A 4IEPA 3WG1A 3QCWA 4QQLA 4ATEA 5FY4A 3K3OA 2B42B 3N9QA 3VBHC 4LE3A 4DXSA 2R061 1RINA 1UY1A 1RUD2 2CL2A 1C1FA 1O8PA 1YHFA 2QDRA 5DAXA 1Z7S1 4DY3A 2LRPA 2GNBA 5LY2A 3GXUA 2FDHA 3C7EA 2GN7A 1E5SA 1W6MA 4O7XA 2AUYA 3N9MA 4YRDA 5A33A 5FZ9A 1PNFA 2N7GA 3OF1A 1I3HA 2YC4A 3EHKA 2D3SA 3POSA 2ENRA 4LBQB 1COV1 3ZSLA 1J3QA 4W6WA 3WP6A 2QQLA 3WF4A 1W39A 2WS92 3INAA 4C0BA 2CDOA 2XH6A 3BTXA 2G1MA 4MOAA 2X8KA 1B09A 1ND3C 5LRRA 5BNPA 5L7OB 2GALA 3MI8A 5A32A 2V4AA 3PVOA 1A3KA 5D21A 5GM0A 4F3JA 1PGL2 2PXJA 1DQ1A 4JZRA 5C9AB 1IKQA 2RS12 3KGLA 1RUE1 4Z2AA 5FBZA 1H6YA 3B00A 1HN0A 3POYA 3UKTA 5HPOA 2ZX3A 5JXHA 1DBNA 1OI6A 2YPJA 3AMNA 5FZ6A 1Q43A 2LALA 5IAXA 1TVGA 2DTWA 2CSGA 2HH9A 4INDA 2XKPA 5EXOA 2XLGA 4LTAA 5JWPA 3MIFA 3RWNA 5F37A 3RJRA 1RC6A 2WLPA 3LCPA 3LE0A 2A75A 2BOJA 4N53C 2ADEA 4FPYA 4LNVA 4TYSA 5T54A 4UFJA 3W20A 5LRSA 1OOPB 1EV11 4H7LA 2IVIB 2PAEA 4OHYA 5K7PA 1K42A 3ZDSA 2R041 4UF0A 1GSLA 1OLME 2VMCA 5KHIA 1A78A 3KMHA 2D6OX 1HW5A 2XONA 3N7JA 4PBPA 3T0BA 1SCRA 1BQPA 1RYYA 5FUIA 1ZX5A 3S5QA 1LENA 3SQOA 1OA3A 4EN8B 4NPMA 2PHRA 2FQPA 1VBA1 4QHBA 1ENRA 4CVUA 1CZTA 1JOBA 5JUVA 4XC9A 1OVSA 3WDVA 1VBB3 3AXEA 3RZLA 3LFIA 4M0NA 4KU7A 1XSRA 1V6NA 1W05A 1OD5A 1AJOA 1AYN1 3IT8A 4QX3A 5C8CB 4Q4V1 3J26N 4KWLA 3GCWA 5FZLA 3N36A 5FY8A 3ZIWA 5LWBA 1UOGA 2RE9A 3ZYHA 2RMU3 3HPNA 3RVHA 2E7TA 5JR7B 2DVAA 1RUG3 3AM2A 3BIEA 4GB33 4ITCA 4JAAA 3EMRA 5IWFA 1MS9A 1GFF2 4XPVA 1AR73 1HB1A 5ABJA 3ZMNA 4LOSA 3BCWA 2RHPA 1GZWB 1H1AA 3KVBA 5KXCA 4CEYB 4URAA 3VGIA 5CG9A 2KR2A 1OQEA 1VAMA 2VE1A 3N4MA 1C5HA 1NT0A 1QIQA 1AR63 4MGTA 2C9KA 2VH9A 5C3OA 1NUKA 2VU9A 4BU2A 5C8CA 2JG8C 3WLUA 2ZS6B 1CAVA 1CQ9A 4KH9A 3ZYFA 5HV4A 4BA6A 3ELNA 4E4ZA 5JOXA 3VKMA 2JWPA 3OSDA 3BN6A 1F4HA 2DDUA 4LHNA 4A3ZA 1N1VA 1O4TA 1NCRA 5FPBA 1H8TB 5FZIA 2I2SA 2ZHKA 1NZCA 1UZ0A 3OBRA 1JXNA 4IL7A 5FK8A 4CXXA 4NOTA 5CZKA 3VBFA 4MV2A 1R083 4Q4X1 3TN91 3AX4A 2RMU2 3ZYBA 4CEWC 4XYXA 2GC3A 1KJRA 3EQEA 1RUG2 3I3QA 5FOJB 2QQOA 1SACA 2RS51 4I3PA 4GB32 1KD7A 2RDRA 2WRAA 3PUIA 1TEIA 2PHUA 3RS6A 1AR72 3U11A 3TWIA 4Q0QA 1CD3G 4BXSV 1KS5A 1QJFA 1D2SA 5IATA 2E26A 2J7MA 4HPKB 5FYMA 3C8XA 4OVEA 3ZPYA 4DRRA 3AMQA 2JX9A 2TEPA 3CJXA 4IGPA 3H0OA 3BYWA 1WMDA 1VBC1 2JE7A 3NW4A 1AR62 3WQ7A 1SFNA 4IV3A 1NA1B 4LBNA 2BQPA 4MZUA 2B46X 3CZUA 4OUSA 1QQP1 4XBLA 2VQTA 5BNPB 3B01A 1QH6A 1OFSA 2MEV3 5A32B 5T5LA 1F31A 5SV5A 3VKOA 4DXRA 4CDWA 1PIV1 1W0NA 4LUKA 4JTOA 1NE4A 3VL9A 3OGJA 2HWF3 2XL7A 1U0AA 2E31A 3U14A 4K40A 4P02B 1R082 3C7FA 1AR83 4ZXKA 4LBLA 1XJAA 1Q5OA 3E6BA 1GNZA 4AQTA 2JB4A 2OIIA 4XF1A 3VKFC 3FZ3A 1QHDA 1XNTA 2VBPA 3C7OA 1DFQA 4QU1A 1C28A 4XE9A 4LITA 5FYIA 4AAXA 5KXEA 3WT3A 2VTFA 5ACA3 2PHXA 3POIA 1K12A 4QDQA 4Y5TA 3JQWA 4UF0B 4G9SB 4M3CF 4YLZA 5E1RA 2ZGPA 1MS3A 2B45X 4BB3A 5LY1A 5CNAA 1DLLA 4XXPA 4R4ZA 5EJ3A 3ZOIA 4I3GA 1V70A 3ZFFA 4CUCA 5F5AA 3M8LA 4FQZA 2B9UA 4DRVA 1VMHA 1ULFA 1WBFA 3ME2A 3NJXA 1AL0G 3RSJA 4EWDA 3H8UA 2ID4A 5FZBA 2MEV2 4GMP3 2W08A 1SCSA 4LR4A 1OLQA 4K8RB 4MXVA 4COYA 2E33A 2CGPA 1MS5A 4WVMA 4UBGA 3VD9A 3JB4C 5CKNA 2HWF2 4V2WA 3VDCA 4IDZA 4V1PA 1G86A 2X05A 1AR82 4YZ1A 3JZVA 4FPFA 4GZ9A 5I93A 2X29A 2V72A 2PYTA 2C5DA 4ARXA 3RRDA 2QTWB 1NQDA 1O3QA 2DVDA 4IV1A 1BK0A 4K1ZA 4YW3A 3DPRB 2DUPA 4H55A 1GP6A 1OQDA 4FXGB 4ISQA 1H4GA 4A41A 5ABJB 3IWZA 2P2KA 1R1A1 5ACA2 4DXZA 5T52A 4FTSA 2IXKA 1V6IA 5K9YA 1IS3A 3P1IA 5DZEA 2WIIB 2R1BA 4W6YA 1RL3A 3AZZA 1FYUA 5FO8B 4QU2A 2R071 5FO7B 3AXDA 4H2AA 1ZVFA 5FKCA 4NJ4A 4MGKE 1KGYA 4XFBA 1RUJ3 3KCCA 5L73A 2WFF1 4EWEA 3ZYJB 3I3EA 1W8HA 1YFUA 3RZKA 1Y7BA 4YW7A 5CFDA 4PIXA 5JI7A 5FBJA 4JKMA 1FI2A 1NCRB 4E27A 2O8QA 1BVVA 2VNRA 3D4KA 1B35C 3IPVA 2G9GA 1UYZA 2BEOA 1G9DA 1XYPA 4QWNA 1GICA 2DCKA 4OMDA 2H6CA 2L9LA 2W1WA 4AI9A 1UO9A 2B7YA 2VQUA 1WLWA 4MGSA 4LT5A 1G9FA 4NHYA 2R0HA 5D8AB 3I2KA 3I4IA 1XNKA 4ZU7A 2CV6A 4EN6B 2WQ4A 3OYWA 3FLTA 4A7YA 1GNYA 2NN8A 2X10A 2XBO3 1SFYA 1HRI1 3GBWA 3WF2A 2BBAA 2VOWA 2ZOEB 2XJRA 3KV6A 1POV3 2E7AA 4AF9A 3T2OA 4RD7A 4XIOA 4FFIA 2DBNA 4IUGA 4YW5A 4BIFA 3OGGA 3T2TA 1YRZA 3AJZA 3N9NA 1US3A 5A6XA 3I7DA 4GQ7A 4IV3B 2VMGA 4K20A 3VL8A 4BZ4A 1RUJ2 2IXJA 4PJYA 3BTYA 2YYOA 4Q4Y1 5A7WB 5GALA 3WZ1A 5FPUA 1OPOA 1DQ5A 2YBPA 3KSCA 3APBA 2A6VA 1F2NA 1PGW1 1YXWA 1IS6A 1F4AA 1UAIA 3AL6A 3ITQA 2J42A 4HBNA 1REEA 4R4XA 3NKGA 1IPJA 1TMF1 5FMBA 2WR9A 4RSUA 2Y64A 5CYYA 4XHXA 4A2UA 4NN0A 5L9VA 2XKOA 1RUH2 3VHRA 3FE5A 3KF3A 4SBVA 5FYTA 5IK8A 5HCHA 2Q8DA 1OLMA 1GKBA 3PTYA 4XUOA 1N1SA 5T50A 1UWWA 4D6RA 3UNPA 2EAKA 5C4WA 2WUHA 4P00B 5FWEA 1AJKA 4YARA 3AP9A 2XBO2 2YC2A 3H9AA 3NL1A 4CDQA 1AX2A 4AR2A 2YUEA 3J7HA 4V2VA 2VBDA 1ZNPA 4TWTA 1O8SA 2VMIA 2VZTA 4XHBA 4AEDB 2RDNA 3RI8A 3NAPB 1OSGA 1CAWB 2WO7A 3QH7A 4NROA 5C6CA 3QACA 1J58A 2R16A 2JICA 2Q4SA 4Q1RA 2Y6FA 5LZ6A 3LA2A 2BW8A 3I3MA 1MS4A 3ZFFB 5JMCA 1CX1A 4K3UA 4WM8A 1GQHA 2W52A 4Q0SA 1UOBA 4OI0A 4FBFA 3M70A 4YVWC 3V0AA 1PZ7A 2ZX0A 3IB3A 1YFWA 5J96B 3GF6A 2QQVA 4KWJA 4RL7A 2V5YA 3AKRA 1GOFA 5T5JA 3U75A 1W2NA 2NQYA 4QMAA 5J36A 2GMMA 3ES1A 2Y6LA 3NNJA 1PO23 2D6LX 2W94A 3HIFA 2HWE3 3MLJA 3P6BA 4GJYA 4IGOA 4Q5OA 4Q26A 4DZGA 5BNQA 2BNNA 3GBGA 1UCXA 4X6QB 3WW1A 2WSVA 1FPN3 1PMIA 4ZXEA 2BTVC 4CSWA 3VD3A 3WCSA 3RG0A 5LBBA 3FLRA 5EQUA 1OVPA 3VDDA 2NP0A 1LTEA 2CAUA 5KXBA 1CONA 1RJ7A 3B7MA 2BBVA 2E32A 1VRH3 2XB6C 5LCWL 5GJ6A 4AHZA 4K7JA 3EYPA 5FV3A 4BMEA 3VBUC 2JKBA 4C1WA 1SBFA 2PQSA 1J1LA 1JI6A 2JG9C 3IN9A 4QAWA 2PHWA 4LPLA 1X8EA 4XJZA 4J6GA 3SLIA 4DNYA 5J37A 3WP5A 2HLEA 3VHOA 3OCPA 2VCMA 1QJU2 2A5ZA 4ARYA 2CY6A 3CJIA 2X5IB 3JB8A 3OPTA 3OTFA 4HXCA 5A1AA 4NRQA 5F3CA 1SDDB 1LHOA 5K0UC 1NCQC 3FWEA 4NAOA 5T55A 3A4UA 4B1MA 2WN2A 3NWKA 2J1VA 2WNEA 3ACGA 2BERA 1QOTA 4CP0A 4L99A 1HN1A 5AVPA 4D6SA 3NNFA 5JZGA 5LBCA 1PO22 3MIHA 1IQDC 5F8PA 2HWE2 2HJIA 3ZR6A 1RUD1 4QPIA 3W59A 3SISA 4IGQA 1FPN2 1JHJA 2P3YA 2WO2A 1S0DA 4QX7A 3WINE 4D3WA 4PDWC 2ZGSA 1XU1A 4AVSA 5EYYA 1LU2A 1EUTA 3I54A 4PI0A 1WW7A 1J3RA 2K2SA 1IKPA 3AMMA 1CESA 3OYWB 2CNAA 2KM2A 2PAMA 5SV8A 2VUAA 1VRH2 4YPJA 3LOIA 2BDRA 3PVEA 3W5MA 1EPZA 4Y1VA 2C24A 3WD5A 3AK0A 4AI1A 4JQTA 2WS91 1Y3TA 3KS7A 3VN4A 5A3UA 2ZEYA 2K46A 5FYVA 3SH5A 2WQ8A 1I9RA 4GD4A 4Y20B 2ARBA 1WLCA 5DG2A 5F3IA 3ZPOA 1N1TA 5HXVA 4BM8A 4PIZA 2AENA 1PGL1 2WO3A 4RYDA 1YQ8A 1W99A 4ZKTB 4YVSC 5C5UA 1QKQA 4KL1A 3DEMA 5C8WA 1ASJ3 4JDNA 2RS11 2XJSA 2OW4A 3C2UA 3ILFA 3KGZA 3WQ0A 4BQWA 2E6VA 3DL3A 4FFGA 2B9VA 1PMJX 1K5MC 2QQWA 3TB0A 2RM21 3MLKA 3RGBA 4RS5C 5JR2A 2DF7A 1HX6A 3W58A 4EJRA 1SPPA 3HNBM 3UT0A 3ZXAC 4CDXA 4WZFA 4Y4RA 4HSLA 4UW3A 3O0VA 3R05A 2A73B 5C4WB 1D4M1 3M1HA 5DDJ3 1GWKA 4QXCA 5KHJA 1GR3A 2HYKA 1DYOA 5I8YA 2YMZA 1EYBA 3VBRA 3OB8A 3E5QA 1AR93 1W28A 2W91A 3LDBA 2TNFA 1GOGA 3AVSA 3NJZA 3WSOA 5FP3A 4Y26A 1REFA 1GQPA 3U07A 4D94A 2WNVB 3AKQA 2QKDA 1CJPA 4Q8KA 3MEPA 4URTA 2J1EA 2VBBA 4QX1A 1EUUA 3JUUA 5LA1A 1LHUA 3ACHA 4QX0A 3O0WA 4LO4B 4Q0PA 4ZU5A 4ATFA 2UYAA 5EIYB 1ASJ2 1EAH3 4NHLA 5IT6A 2CDPA 3BU7A 4LBKA 3H1MA 3HWJA 1V6OA 4P08A 3WR0A 5FDBA 1HV1A 1X9PA 3AP7A 4HANA 4LMFA 4AK3A 1MZEA 2C9AA 4UXAA 3A0NA 3AMPA 1GZTA 3FHQA 2D3PA 3KLSA 4IE6A 4P9WA 1D0HA 5CAZA 5CB7A 3VDAA 2P34A 1JUIA 2PTMA 1UX7A 2BU9A 3OGSA 4HLTA 5IJRA 3VDDB 3WVJA 4AEJA 4D7SA 4EYUA 5FZ7A 1ONAA 2JD9A 2WINB 1GU3A 5DDJ2 5FZKA 1EY2A 1LULA 4LBQA 4OHWA 4YSFA 4UAPA 3TBDA 4GJZA 5CFCC 4ET7A 1CR7A 5ANNA 2Y33A 1PX3A 3MFAA 3H42B 4BIOA 3T0AA 1AR92 4QPGA 1SHWB 1WCSA 1OUXA 4XF9A 3U4SA 3NO8A 4YNIA 5JOWA 1SZBA 1YIPA 3NV2A 1AUYA 4M00A 1JYXA 3C7GA 4X8PA 4XMAA 2EXKA 1O4ZA 4CZSA 3WV6A 4COWA 3IIIA 4QHOA 4KG0A 4AE2A 1EAH2 2PN5A 1FMD3 5GLZA 4XQ4A 3VZLA 1PVC3 2H6BA 5A7PA 1Z0HA 5A3MA 5C33A 1DQ2A 4ES8A 5JZGB 1WMFA 2RMU1 4LHKA 3ZX7A 1MZFA 3HR9A 4IXLA 1RUG1 1X50A 2VZUA 3ZR5A 3QD6A 1GUIA 5EP9A 1DQ4A 2HWC3 5F3GA 2F4LA 2SLIA 1KFXL 2Y6JA 3ZXFA 2J1RA 3T0DA 1ALYA 4YM0A 4K21A 3LDKA 3ZN6B 3ASIA 3K4DA 4FOYA 2AR6A 3OY8A 4FP2A 1N47A 3VZOA 4BQYA 1C57A 1PVXA 2NMOA 1AR61 2LW8A 1A8MA 3S0MA 1UZWA 1KFUL 1TNRA 4BK4A 3I49A 2VR4A 5FCCA 1RHI1 2NLRA 5FLJA 2VZQA 3POJA 1OLRA 3ZKYA 1ZM1A 4HONA 2ETEA 2XJUA 1KDKA 1W2TA 1FMD2 3T1LA 3T3YA 4AFBA 4CE8A 1BVP1 2R1DA 1PVC2 4W65A 2VC9A 3N3HA 3VBSB 1R081 2WYSA 3MFCA 4A42A 4FOWA 1BJQA 4KQ7A 2VOVA 5LATA 4EZHA 2XJQA 4Q29A 5FAXA 3VBFC 2HWC2 3FUOA 3LA7A 5DUXA 3PNAA 4B7KA 3POWA 2DCTA 1ZA4A 2VOKA 4LBQD 4CDXB 5A70A 1GZWA 4RGGA 5CVRA 2D6KA 2WZEA 2ZABA 1H0BA 3DYMA 4LE4A 2IZWA 1MZ6A 3AJYA 3MW2A 2D3RA 4BCUA 4IEXA 2FD8A 2Q0AA 1D2QA 4FAHA 5FY1A 2RDSA 1RUI3 2EF6A 2OT7A 3VBRB 4CU9A 3IAPA 2BP6A 2ZJCA 5GZEA 1HXS3 1MVQA 2YC0A 1VJ2A 4ASKA 1VMFA 2D43A 4RHV3 4YZ2A 1UU5A 1ZZ6A 4YM1A 4YGDA 2I74A 3ETPA 4MLOA 4CP2A 2XLAA 1H8TA 2JDUA 1K45A 4S2GA 2XVLA 3UL2A 4P9YA 1CIYA 3DUIA 3M7AA 1AXYA 4QXBA 4S2DA 2EXHA 3TEWA 4OUMA 1G9CA 3OBZA 4NHKA 3BVCA 4Q4W3 4UFKA 3E5XA 2WNOA 3I59A 4EN9B 2VNOA 1N3OA 4CDWC 3UYJA 2ZGNA 2ZA9A 5GZCA 4IEOA 5IVCA 2ILMA 4QGMA 1UMIA 4DB5A 4RQPC 4DPNA 1IS5A 1BZWA 3NV1A 1W9WA 2DFCA 3N9LA 4I0AA 4ZPIA 3ZXKA 3RZHA 4HPKA 5ACA1 1QDOA 2ZGMA 4GWJA 5JXGA 5FZCA 1U5ZA 1Y4WA 3LPGA 4FCAA 4CXYA 1JZ6A 2WABA 4MVTA 1SEFA 2YBKA 3MO4A 2OYZA 4BMBA 3H8OA 1RUI2 4XETA 4R8HA 1NA1A 4GAZA 1HXS2 4QPGB 5FXWA 4AYUA 3IAQA 4PCRA 5LA2A 2BRTA 4BPZA 4RHV2 3AZWA 1R1ZA 1LGNA 3I2DA 1IGOA 4P9GA 3EB7A 4CUBA 3LOBA 3CU7A 4I0WB 1FV3A 5A6ZA 4M3CE 2PHFA 3WCRA 3USUB 3DCQA 4Z8BA 2WQZC 1R64A 5LBEA 5FXXA 3VD7A 4D0QA 3O1SA 4N7UA 4ZU4A 4LXLA 2XUEA 1JUHA 5FXVA 3WUCA 3VZKA 2HYXA 4Q4W2 3GYDA 4E2QA 3KQ4B 4BK5A 1Q8QA 2VQAA 3CZJA 3ABZA 1LOEA 4OZXA 2CGOA 4QX2A 2AACA 2FMDA 2PHDA 2O14A 2QQMA 4XDOA 4FVVA 2OQ6A 2LS6A 5IVJA 2D6MA 5AFBA 1AX1A 4EV0A 3JXSA 5J1XA 2VXRA 4FAGA 3HD8B 3OY8B 2HWD3 4KNCA 1MQTA 1VE0A 3J7MA 1UOFA 2K0GA 2ZX4A 4IV1C 4KBZA 4QDSA 2QNKA 2VW1A 3MIGA 4UW5A 4QXKA 4UFHA 1XC6A 1W3VA 1RUJ1 3LEKA 3RQ0A 3MBWA 1HQNA 1W8TA 2WSUA 3RYRA 3FHIB 1MACA 1BK1A 1TME3 1X36A 4IERA 5I0TA 3WDUA 4AVCA 1RVF3 4CXWA 2I07B 3JBG3 5LK5A 2Q8CA 3PU3A 1JZ5A 3R4DB 2HWB3 4YG0A 3PL0A 2VO5A 1NY71 5GZGA 1VR3A 3LGRA 1JYVA 3D6EA 3VD5A 2QFEA 1RUH1 2F4PA 4QQOA 5CFDC 1W9SA 1UXXX 1UIJA 3TOJA 4A7ZA 1X33A 2RJLA 2D98A 4HZFA 4DEQA 1DF0A 1S0GA 3NMBA 2A7AA 3W21A 2LUWA 1CWPA 4QPWA 1J1TA 3IKWA 4IEZA 1VB2A 2Z42A 2DFBA 3ACLA 4DIQA 3DPRA 3IDEA 2XBO1 3FBMA 3GZEA 3PJYA 2VY0A 4WM7A 4LORA 1W8NA 4DOUA 2W0XA 1G9BA 2XWJB 2NYYA 1W8OA 4DY5A 2GP3A 4M01A 2CU5A 5FUPA 3F2ZA 2NZ9A 2W87A 4D7YA 5A6QA 1WGPA 4O65A 3U4XA 3FX3A 2GAUA 1S0JA 5K4LA 2HWD2 2RG4A 3N35A 5FPXA 1S0BA 2OQ7A 2SBAA 3D0JA 3PUQA 3SEEA 3WNOA 3WDWA 3MF9A 5A7SA 3VBOB 3ZFEB 2IVJA 3WDTA 5BNOC 1W3XA 3ZYPA 3ES4A 2VOXA 4E4SA 1TNFA 3O12A 5FUNA 5HV0A 4E2SA 3S7IA 1TME2 3DV8A 1RVF2 4E8DA 2ZKLA 3JBG2 4GH4A 1VBB2 2WN3A 3BGAA 1YYNA 3WNLA 2HWB2 2D6PA 3HQUA 2XMLA 4LQRA 2BFUL 4JGYB 3PDQA 5E8AA 5F5CA 3H50A 2GC1A 5EPAA 2X09A 5E6HA 4AG4A 4CDUC 1RJ8A 1BLZA 1C4RA 1XNCA 3I59B 4QB2A 2WO1A 2WNUA 2YGLA 4BQ5A 5D8AA 1YEWA 1GLHA 4FPJA 3FN9A 2UY8A 2DTYA 3GJAA 4GWMA 4Y1ZA 2ZEWA 5FMOL 2IXLA 3RYPA 2DUQA 3V64A 5A6YA 1LECA 3QBQA 5AVAA 5LB6A 4C91A 1AYM3 1WD4A 3Q9OA 4XF0A 3OUJA 1FX5A 3S30A 4XABA 4OI1A 4DUVA 3O14A 1JODA 2DVBA 2D5HA 2ERFA 4LBOA 1KS4A 2CGNA 4XFFA 4CDQC 1VBE3 2WFPA 1QJU1 5FLIA 4A45A 1IS4A 3DXTA 1VMJA 5A7WA 1XRUA 5IK4A 4XJUA 5J09A 1UF2C 4ONUA 4PIYA 4WZCA 2PFWA 3ZKUA 3JQXA 1FNZA 1R093 3JU9A 4CCOA 4XFIA 1LEDA 1U5YA 4WM8C 5ERLA 1PO21 1GANA 1UOJA 3H3UA 2HWE1 5LBFA 1W6QB 2C0ZA 1WBLA 3NV4A 3BODA 5F5QA 1V0AA 2H0VA 4BOWA 1JYIA 3LSEA 4XDQA 1CGPA 2R7EB 3ZN4A 1HRV3 1VLNA 3EJKA 1ND2B 1Q8SA 2QBXA 3WNMA 4AQ6A 3BI3A 1QGLA 1EP0A 1QJZA 2VZPA 2GU9A 1YQ2A 3TNPB 1UIKA 1ULGA 1MEC3 2VZ3A 2DVGA 2EXJA 1VRH1 3GJBA 5GKAC 3ZXDA 5KHGA 1KQRA 1ENQA 1LESA 1J83A 3KVAA 4OZOA 1LJ7A 1AYM2 1GZCA 1UYPA 1ZBA3 3ZM8A 4AEDA 1PK6C 3KWVA 1UU6A 3AP4A 3NAPA 1CAWA 1DU3D 3SH4A 2QDNA 5GLUA 5D1IA 1VB4A 1MQTB 1XYOA 5DAPA 1VBE2 3I2FA 3HEIA 2OVUA 3SCHA 1S0CA 2WAOA 3BTAA 1JYTA 2VPVA 2YU2A 3RDIA 2R063 1RB8G 4LLOA 5I0UA 3ZSKA 5A3WA 2GZWA 4HN0A 5G04L 2KXLA 5FZDA 4XIKA 3JD73 4CU8A 1YNAA 1R092 4KGQA 2P5BA 2PMWB 5HCBA 1NAEA 5J3UA 2P3KA 3CJIC 4QT6A 1RUNA 4WVZA 1CAXA 1RXGA 4YG3A 2VGDA 4HFSA 1LKNA 3URFA 4LIUA 5A80A 1ND3A 3HNMA 4QB6A 1HRV2 3POEA 4LO6B 1OKQA 1L3JA 4N43B 1BHGA 3RMXA 1MZ5A 1JMUB 5H9PA 5I8TA 3LB9A 4TSVA 4LOTA 4KU8A 3SHRA 2GC0A 4QPIC 2P17A 4TLGA 4W6XA 1HQLA 2QUOA 4B3NA 4LUMA 4WM7B 4XF3A 4CYDA 5I0SA 1WLTA 1KDMA 1QWRA 1ZBA2 2VW0A 5FYCA 2FZ2A 2VCBA 2VTXJ 5L9RA 2A6WA 4P5HA 1IZ3A 3FC0A 2Y26A 3K2OA 5DQ0A 5T5PA 1YJLA 1RUE3 2IFRA 2VMFA 3NJYA 3OEAA 2J22A 3ZDVA 2X5IA 1YQ6A 3R4SA 2BJSA 5EFUA 1IG0A 2QQIA 2C4XA 2IUWA 2R062 3PHMA 2G9FA 4C90A 2ATFA 2HKXA 1ZZBA 2PLV1 2QZ2A 1QJEA 2DURA 4BLIA 3JD72 4W4ZA 2C6SA 2A6ZA 3M2MA 3R6SA 4JDMA 4RGKA 4GH4B 1EV13 2BZDA 4PLMA 3O0XA 5C71A 1ZRDA 1RXFA 3V65A 2ZX2A 4PT6A 2FZ1A 2UURA 4UI9L 5JIAA 4P9LA 5DUWA 4QPYA 3IM0A 4COVA 1H4HA 5HCFA 1AL21 3ZLIA 4XQDA 4YW1A 3UESA 2WNUB 1CZSA 3ZXGA 5LK7B 4RR3B 4AVVA 2O0OA 3H8XA 3U10A 1VBA3 1RMU3 5DDJ1 1O3TA 1NXD1 1GOHA 5AFEA 2MNGA 2JXAA 3A7QA 4DMIA 5BNNB 3UK9A 3PTRB 1G8WA 2G9ZA 5FP9A 1AR91 2W39A 4CCJA 1AYN3 3AYDA 4PHZA 4M3CA 1RUE2 3MYXA 3FFQA 4AVTA 2CWSA 3B93A 4Y20A 5ISLA 2VQ0A 2ORXA 3ZO0B 1QJY3 1AVBA 1H1IA 4MXWA 1KITA 4XQWA 5JVVA 1SBEA 3PUAA 3AVRA 4MGQA 1EAH1 2V09A 3POBA 1O7FA 3BIWE 3BOPA 1EV12 1UQXA 2CHHA 2DU0A 3DYOA 3CBNA 5FZMA 5A3NA 2RR11 2VXJA 3A23A 1Z78A 4Y1YA 2BNOA 2XPJA 3RZMA 4Z2WA 2Y60A 5AC93 1O4YA 3RFRA 5JSOA 2JG8A 2AC1A 1T6GC 4JGZC 3RJ2X 1TG7A 1W6OA 4QD2A 3ZFGC 2RV9A 3OPWA 2YZ4A 3PMEA 5FZOB 1SLBA 4BQ2A 3AKTA 1RUOA 4OMCA 3WW3A 1RUF1 2WDBA 3CLPA 3GBFA 2ZKNA 4OHXA 4QQHA 1VBA2 1RMU2 4NWWA 3O1TA 3IZOA 1LR5A 4S2FA 4F83A 2ZEZA 2W47A 5I91A 1OT5A 4XACA 1XE7A 5I0RA 1SFPA 1UNBA 3VBHB 4CEWA 5FO9B 4OLLA 1N3PA 1AYN2 5FR3A 4AI0A 2WNVA 4XCBA 3WNKA 3ZXJA 2AZ5A 2GP5A 4UBHA 4OYUA 4BQ3A 4LHLA 5DMYA 2ET1A 5JPNB 3I3BA 2Y0IA 3ZYRA 1QJY2 3G7DA 5FY5A 2LTNA 5A3OA 4L2NA 3D3AA 1JW6A 4KWUA 1E5RA 5IVVA 4H7MA 1FMD1 1HB2A 2EXIA 3CQOA 3KD4A 4BQ1A 5L7OC 4OI4A 1S2KA 1FV2A 1FOD3 2R32A 1CAXB 5AC92 3ILNA 4P5YA 4LEJA 3AP6A 2VW2A 1NE6A 3BB6A 4PF5A 3VZJA 5C9AC 1O6UA 2Q8OA 1ND3B 2JDKA 4E2GA 3BPZA 3O1RA 5DUVA 4CCCA 3HMYA 2W92A 1SLTA 2ZACA 1UPSA 5FPAA 1H8VA 2BVBA 2R49A 4HMZA 5JIUA 1QQP3 5B4XA 5A1LA 3M3CA 2OXBA 1JZ8A 2W9XA 1F9KA 1OOPC 3OUHA 3WP3A 1SLLA 1WA6X 1J3PA 2BNMA 1AX0A 1OPMA 4HETA 3UJQA 1N1YA 1US2A 4BDVB 1F5JA 1NLQA 1S2BA 4LBMA 3ZSMA 1DYKA 2BV4A 4XVHA 2XWBB 3DGTA 3VHPA 1JTZX 1O59A 4N53B 1J84A 1W9TA 2QZ3A 5C3QA 1LGCA 1XOYA 1JBCA 2DCYA 3WOGA 4E9KA 1WLDA 1VAVA 2V4VA 2Z5WA 4H14A 4Y33A 5GZDA 4CTEA 5C70A 5JOYA 2P3IA 2WLQA 1BEV3 1XNBA 2QQNA 2XJPA 1XSQA 1FOD2 2ZHNA 5K8SA 1KXGA 3AB0A 1DGWA 1QNYA 1Y43B 3D5OA 3F95A 1Y9QA 1LOFA 3A0KA 4YGCA 1WW4A 4R9AA 5DAWA 2OKXA 5C8CC 3BOWA 3I8TA 5FK7A 5L9BA 4I09A 5JOZA 4MGZE 5A3PA 1IPSA 3CEWA 3LPFA 3ZSJA 4UT5A 3ZN6A 1M06G 4MSVA 4COUA 2IXHA 1OA2A 3PMSA 4MHRA 4UW6A 5FZEA 4JC1A 5F2SA 1XE0A 1ST8A 1CAUA 1S0IA 2FDJA 1E5HA 3MHZA 4NRPA 4AFCA 5E16A 2VD7A 5DPNA 5F7UA 2FDGA 3H7YA 4CEYC 4DQAA 5BYNA 5F2WA 3OBTA 3USSA 1DG6A 4M3CB 4JKKA 3V56A 3DECA 4DS0A 4BHPA 3K4ZA 4YM2A 3HNYM 3AFKA 1C8NA 2WWSA 1WWYA 5DG1A 1ZRCA 3DKQA 4BE3A 4EN0A 1YFYA 4PLNA 4MXWB 4NO4A 2CYFA 3BUCA 3HN1A 3FJSA 4Q27A 4B8EA 1BEV2 1QXRA 1JYWA 3H1YA 3VBSA 2XJTA 3VKLA 3B5LB 4EN7B 3A21A 4IQPA 4UWDA 3POGA 1R1A3 1H8TC 5BNOB 4CCEA 2WWUA 4R9BA 1ZZ7A 5L36A 2JG8B 3THCA 2JB8A 4LO5B 4NAMA 2R073 3Q8EA 1W6OB 4AHWA 2Y8KA 5FLHA 2VVDA 1BBT3 4DEVA 1Y9GA 4AW7A 1B35A 2J1AA 1LHVA 5EYXA 3PVNA 2DV9A 2WFF3 3UKVA 4NRMA 2ZGUA 3ETQA 1WCKA 2E9QA 5FZ8A 4QKBA 1KJLA 1XPWA 2YFUA 2OPKA 3HJRA 1PM7A 3J9SA 4JCKA 5H9RA 3DXUA 5FKBA 1A6CA 3S7EA 4CEWB 2ORZA 2WZPP 1I5ZA 3J4UH 5F1RA 5KHKA 1VPHA 3KCYA 1I6XA 2JJ6A 2W95A 1FAYA 3EO6A 3KCXA 3R0RA 3O1UA 2ZZQA 1PZ8A 3H3ZA 3THDA 3WDXA 2YBSA 3O1PA 1NLSA 3J8F3 2QQUA 3DYPA 5IVBA 1NA1C 1CPNA 4N9IA 4K1YA 1GNHA 1J59A 2ZBJA 3MDPA 4TXWA 5A7OA 5CIRA 2JDNA 3FBYA 4MGYE 4YGEA 2E7QA 4OUEA 5BNPC 1TE1B 3E1F1 2IXCA 3FLPA 5BPXA 1R1A2 1N3QA 3WW4A 2VUJA 2Q8EA 2PAKA 3HOBA 4NPLA 5F32A 3T4HB 4OULA 3WNNA 3T1MA 1ULOA 1WW6A 5CA6A 2W1UA 3I2IA 2R072 1C3HA 2JDYA 3O1OA 4YW4A 2UYBA 4CA9A 4YW2A 1ODMA 5IUQA 1CZVA 2BWAA 1BBT2 4OQ8A 1W06A 4Q1PA 1W2OA 1GWLA 1LOAA 2RS33 3WF1A 2WFF2 2XJVA 1WCDJ 3S57A 4C0HA 1LHNA 4NR1A 2BGPA 4QHZA 4Y4YA 3O1MA 1XE8A 2EIEA 1HJGA 2XXZA 1TMF3 1OD3A 3OUIA 4A6SA 1LGBA 4MYEA 3RI9A 4L8QA 1H9WA 4D6QA 5GLVA 2R0FA 1A8DA 1W8ZA 3J8F2 4GKYA 4HKLA 3JBG1 1VBB1 3USUA 4NIAA 3LEMA 5CKQA 3O7OA 4AGVA 4BQ4A 1MR5A 2D97A 1QH7A 3NV3A 4CPBA 1V6LA 2D40A 3NVCA 3C7HA 4FP3A 4QGLA 1ZZ8A 3AFGA 2WT1A 3EBRA 4NVPA 4AXOA 1C8M3 1DIWA 4MO3M 2QQPA 2W3JA 2WWJA 4NIIA 2Q1FA 5JSRA 1H9PA 3VD4A 1NOVA 1H2KA 4YVWA 3TYJA 3VV1A 4GB31 3NNGA 4GWIA 1D4VB 3WF3A 2WAAA 4Y1UA 3D82A 1AR71 1GWMA 1LU1A 4LO8A 3C3VA 4A4AA 3CO2A 5HBAA 2RS32 4FO9A 5JSPA 4FTBA 2RDQA 1WZXA 5GLTA 1PGW2 1CAUB 3DPRC 1WD3A 4QM9A 3MGUA 5ABJC 4Z07A 1W03A 4QB1A 3K46A 5IAVA 2VULA 4O9GA 2O8OA 4YZ5A 5CG8A 1OH3A 2VZ1A 3PUSA 4U36A 4XTPA 3NJVA 4AFDA 1LNSA 2AEZA 3VLBB 5F6LB 3LF7A 4FPOB 2JG9A 4MADA 4ZZ5A 1DLCA 2BGCA 3SCGA 1PHMA 3IDCB 4AFAA 4ZY9A 1YCIA 1ZRFA 3OGVA 1U12A 2QVSB 1C8M2 1YI7A 2GNDA 2HEVF 1NCRC 1DGRN 4ZHNA 1WCUA 1AF9A 1OXCA 4D69A 4FFFA 4LA2A 1NX9A 2JKXA 2XVGA 5K0UA 3EXUA 1LCLA 2VCAA 4F8AA 4G4FA 1E57A 1L7QA 3DKWA 3VHNA 1BXHA 1S4CA 2WL1A 3AP5A 5FZHA 1QOOA 3WX5A 1W6NB 4QQ2A 4CCLA 1OUSA 2FDIA 1HV0A 5FZ0A 1S2EA 1HQWA 3CF6E 1B35B 1AYM1 1UXZA 5D8AC 4MH0E 4LKEA 1GYKA 3KHCA 4GMP0 4ISRA 1H2LA 2JE8A 4JVAA 2D5FA 3WP4A 1Q56A 3VBOA 3B9CA 1PX4A 3ZFEA 3ZMOA 5CEHA 3Q8CA 1CIWA 5CKMA 4Q2FA 3TRSB 4N8MA 1RUD3 3WNPA 2VMDA 4JRAA 2DBIA 1APNA 2YY1A 3VZMA 4AHYA 4NIDA 4CPBD 2MEV1 3L9JT 3ZYIB 1QY4A 4JHZA 4PI2A 1R091 2JIGA 3QH6A 4RN5A 3GZUC 3T09A 4IV3C 3K3NA 1PO13 3W5NA 4JGYA 1P8JA 2HWF1 3ACFA 4LA3A 3FFZA 4J25A 5F39A 2VJXA 1Q3EA 2RJ2A 2ZGKA 3J7LA 3CDZB 5FP8A 4LK7A 1AR81 1HRV1 4XURA 4XFAA 2XDVA 3HBZA 2A3XA 1I5PA 4XMIA 1MS1A 4XJAA 1QJX3 4YVSA 2WT2A 5A3TA 3WF0A 1KEXA 2ZX1A 4HN1A 4XILA 4HL0A 4META 1D0GA 1W9YA 4O61A 4RS5A 4SLIA 1OH4A 2WA3A 4WV8A 2HBTA 3Q8FA 4RGAA 5M0TA 2GMEA 3N7LA 4CRQA 5J48A 4MX3A 2R30A 3KV4A 2LM3A 4AEDC 1VBD3 2RM23 5H9QA 3NAPC 1BMV2 4B29A 2ZGTA 1OHFA 1E5IA 2A3WA 2UWCA 4GMP1 4XUQA 3JD71 4FI9A 2YB7A 2UWBA 3WNXA 5C3PA 2DWRA 1W2AX 2GMPA 1IPKA 3M3EA 4JQRA 4YZ3A 1BKZA 3RMYA 1QEXA 3ZFFC 1PO12 1REDA 1LOGA 3KT7A 5JCTA 4MG2A 1D4M3 1W6QA 3H1WA 4FPLA 4OHVA 1V6KA 3WG4A 1HIXA 2ARCA 1POV0 1JU3A 1ND2A 4IE0A 4QM8A 4YZ4A 3SNMA 4G3YC 1VIWB 2D44A 3LEIA 5FYBA 3OD4A 5FPLA 1QJX2 4YVWB 1LOCA 3J7NA 1H6XA 2VZVA 4QXHA 2ZXQA 2WZR3 4XJ8A 3P3PA 5A7NA 5G05L 1CPMA 4NHMA 1ZBE3 1IHMA 3M4FA 2FHRA 4C1XA 3B69A 1RUC3 2ZEXA 3MZHA 4NIGA 2IXIA 4FOVA 4I02A 2KD7A 1T2XA 3CHXA 3N7MA 4AL9A 4UFLA 4P9XA 5JDBA 1YI9A 1VBD2 2RM22 5DAVA 2C1FA 2WZ8A 1QXJA 4HKOA 1A34A 1QNWA 4XBQA 2EVXA 3UGHA 5CFCA 4AGGA 3L2YA 4IEYA 3IDBB 3VBUB 1O3RA 2X5IC 4BYYA 5FRAA 3PURA 5LA9A 1ULDA 4ZS3A 2JG9B 1D4M2 3I97A 1JHNA 1YLLA 2HEWF 4GWNA 4QDRA 1OA4A 4GXLA 3GNEA 2WBKA 3K48A 2W2IA 2JECA 4N90A 1F35A 1LODA 2VECA 2FCVA 4N43A 1S0FA 4MGIE 4Y5Z0 4AVAA 1PGSA 5K0UB 1NCQB 3RWKX 1SG3A 1V6MA 3ECQA 4P9JA 3K77A 4XUPA 1RMU1 2WZR2 3OGRA 4EWAA 5JXJA 4HT1T 1JZ3A 3RNSA 3W9AA 1ZBE2 1POV1 5T5OA 3WXPA 4BQXA 2P1BA 2W68A 5CISA 1RUC2 3TEZA 4I01A 5IK7A 3HT1A 2AGSA 3MF6A 3LSDA 2FCUA 4XJ9A 4PBOA 1QOSA 2ZMKA 4NWVA 5DZGA 1FATA 4PDWB 2JEMA 2ADDA 4BH9A 3I3DA 3NSTA 3E6DA 4R52A 4R9CA 1QJY1 4GIQA 3H7JA 4ORFA 2PELA 5C5TA 2BWCA 2VNVA 2VAUA 1H2NA 3THTA 3UETA 3ZN5A 4GA9A 1UZZA 1FT9A 2ZTNA 3LIHA 5CU1A 3RZJA 4ZONA 2VG9A 1ZRRA 2JENA 4BXFA 1GP4A 1W9FA 3BPSA 3FMGA 3KT4A 5C7GA 5AC91 5JI9A 4LLFA 1GV9A 3K75B 4XEZA 1SQ4A 3GZTB 2YU1A 4XBNA 4YGBA 4CUAA 1RITA 3U1XA 2QCSB 4RR3A 1XYNA 1URXA 4FPCA 1DCSA 1OBNA 3I2JA 1ZZCA 4YVSB 4A44A 4K6BA 3KB5A 4QQPA 2FCTA 2DYCA 1RHI3 4YW6A 5BNNA 4I30A 4YFWA 1K5MB 1JZ2A 2FMYA 4Q0UA 5A7QA 1Q8PA 1W0OA 2GNTA 3IIAA 4RS5B 4Z82A 5C4WC 1VAKA 2GDFA 1T6BX 3I2OA 1SMVA 4IE4A 4IEVA 4LK6A 1JS9A 1H2MA 2Y38A 3ST7A 3AMHA 2F6BA 4UFMA 3T2PA 5IFTA 5JLVA 1ULPA 4RFT0 2YHJA 4FPKA 2XHKA 5IVFA 2MHFA 2PQQA 3CL1A 1DZQA 4NE9A 1UY4A 2LROA 4AEMA 2WNVC 3KZ4C 2DUOA 1XNAA 3ZVXA 3RZGA 1FOD1 1W6MB 5LA0A 3P5BA 4QX8A 2YXSA 4HVQA 3IMNA 5A33B 1V00A 3BTZA 4PLOA 3MUZ1 4J1WA 1FPN1 3AL5A 3RYKA 3ZIXA 4FPHA 2B39A 4IEWA 5FZOA 4HK8A 4KG8A 3WEZA 4COZA 1JZ7A 2V5DA 3LEGA 3LWCA 3WG3A 4L9BA 2HEYF 1JYCA 5J98B 5H9SA 4HOOA
chains in the Genus database with same CATH topology
3VUOA 1RHI2 2XG3A 3HT2A 3PJQA 3M3QA 4J1XA 3VBHA 1YIFA 3ZXEA 1V9U3 2WKKA 4M0HA 3VDDC 3N7KA 3MPPG 4RQPA 3IBMA 1QMJA 3JCIA 2A70A 4Z1VA 2ZGRA 3ZSEA 1OFNA 1CN1A 2XUMA 2Q30A 3GHNA 1Z7S3 1BEV1 4JTNA 5CFCB 2R6QA 4BLJA 1MS8A 2BPA2 1QDCA 3MPBA 4XXAA 4AWDA 1X82A 1COV3 1OQ1A 4AI8A 1DYPA 4XTMA 3MW4A 1W6PA 1FNYA 1O5UA 4I0BA 5JZGC 1DQ0A 1H1MA 2OUHA 4GULA 2ZGOA 1UN1A 3S6PA 2MPFA 1RGSA 1MEC2 2IFWA 1ENSA 1LOFC 4OI2A 4AEKA 4A7KA 1YJKA 1CVNA 4BWOA 1S1AA 1W0PA 4ASLA 2GNMA 4AVBA 1GBGA 1NQJA 4OFGA 4L11A 4F7ZA 1V9U2 2JDZA 4N53A 1UX6A 4DFSA 2A6YA 1SLCA 1SLIA 4AFMA 2EIGA 4B4RA 2P37A 1ENXA 3ALQA 3B3QE 3QOPA 4WBBA 1Z7S2 1UD1A 4P9IA 4O9EA 1ASJ1 1ULCA 3RPQA 2WA4A 5LEKA 2VMHA 4JRLA 1QF3A 3MLLA 2R043 2XLFA 3AZVA 3AKSA 4XFCA 2EA7A 1COV2 3WQ1A 3VBSC 1HKDA 4TLFA 4Q0VA 4KWKA 1BBT1 3NKTA 3O5SA 5EWSA 4X6RB 1IOAA 1CAVB 2V73A 1S0EA 1Q8OA 3G6JB 4FT8A 4CDXC 2CWMA 1X8MA 3KM5A 5E89A 1LHWA 1RIRA 4Q8LA 4Q4V3 2QJVA 3VBFB 3DF0A 1RUH3 4L97A 3J8F1 2OZ6A 4AGRA 5F6KA 3VBRC 3KQRA 4FOQA 1U5IA 5EZWA 1AXKA 2FBEA 2ZGQA 1ULEA 4I2OA 5BUVA 3MIEA 5F9TA 5BNOA 2JE9A 5EV7A 3WHUA 2R042 1WA4A 2VVEA 3M3IA 4HVOA 4K8FA 1DZTA 4OHZA 4ES9A 1UW8A 1NXMA 5J7MA 1FXZA 2NMNA 1QXPA 5A3LA 2RS31 3SITA 1C5IA 4N7IA 4CDUA 3D8CA 1WW5A 2DCJA 2Q1MA 2GH2A 1JN2P 3SH3A 4CDWB 4D7TA 1UPIA 1MVEA 1NY72 1HDKA 2EALA 4XZPA 4Q4V2 5I8SA 4QX5A 3LAGA 2UY9A 4RQPB 4AHXA 3ROUA 4Q4X3 3TN93 5KHHA 4B4PA 2ZPXA 5LEJA 3RZZA 4N9HA 5GLWA 4QPGC 5B2GB 1ZYBA 2RS53 1XU2A 3THPA 1PVC1 4HK9A 2OA2A 2ZHLA 3QLQA 1C8M1 4S2HA 3K51A 1F5FA 5FFOC 1O5LA 2WT0A 1DGRA 3MW3A 1DGLA 1VP6A 2ZHMA 1ZZ9A 1SDWA 3HN1A 2HWC1 1W6PB 1VBC3 2YV8A 1UMZA 4XFHA 1QJU3 2VVFA 2WJSA 4IEUA 5T3NA 3AYAA 1SBDA 2YROA 3B02A 3D0SA 3B94A 1PIV3 1BCXA 3CNAA 4WVMB 1LRHA 1DZRA 2NM1A 1YWKA 1PZ9A 2IWGB 4Q4X2 2GSYA 3LZZA 3TN92 2Z69A 2D93A 4KBBA 5IK5A 2D7FA 2PHLA 1PK6A 2RS52 5KBFA 4JDOA 4IV1B 3TAYA 1G9AA 2ET7A 2Q5TA 3AYCA 3UV9A 5HCAA 5L19A 4UW4A 4GKXA 1VBC2 5BY5A 2GH8A 4LULA 4A3XA 1QQP2 4DINB 4U2AA 4YG6A 2PA7A 1V6JA 4FXKB 1S55A 4XW3A 5CFDB 3X29B 1PIV2 2OZJA 5FQ0A 1RUI1 3E6CC 1M4WA 3GALA 3E97A 1HXS1 2B8MA 3IPVB 3OPZA 5BXXA 1RTVA 1BMV1 4RHV1 4L92A 1XXNA 3BALA 3VBOC 1BYHA 2ZMNA 5FPZA 3ZFEC 3ENRA 2DU1A 1PO11 2AREA 3OD0A 1UKGA 2Y0OA 4E4DX 4JV4A 5KXDA 4B7EA 1O91A 4FQ4A 4Q4W1 3V0BA 5JPMB 3SMHA 4P14A 4ASMB 4XJWA 2A3YA 4IETA 1UKRA 3LKJA 4JGYC 4IESA 5DXDA 1QJX1 2E51A 2DVFA 5FREA 1W6NA 1OMIA 1MS0A 3WHTA 4KGGA 1NLRA 2KA3A 2PLV3 4CDUB 5CADA 5KC6A 4CP1A 2UWAA 3WY6A 3AKPA 3HAGA 1VBD1 4HSJA 3L2HA 2NPIA 1IQAA 1AL23 2UU8A 1YUDA 1XNDA 1WMEA 4Y22A 3ZYGA 3ZXLA 2CTVA 4WVWA 2JD4A 1ZREA 1DHKB 1HRI3 3VZNA 4CDQB 2D6NA 2H0BA 2PHTA 4EROA 5CBLA 1AZDA 2WZR1 5DZFA 3M3OA 1ND2C 3B9IA 4X8NA 4LO7A 1ZBE1 1GQGA 2QE3A 2XGXA 4WM8B 3WUDA 4Q4Y3 2PLV2 1RUC1 3V0AB 4Y1XA 2X53S 2HWD1 4JGZA 3ZFGA 1LEMA 1CJDA 1VALA 3AZXA 5E88A 2RR13 2B5HA 3MICA 1YFXA 4HVRA 4HKWA 3ILRA 3OJBA 1MQTC 1TME1 2DCZA 2EAAA 1AL22 4R9DA 3KT1A 1RVF1 5KWRA 3R4UA 2Z2SB 1UZYA 2HWB1 2ZGLA 1RUF3 4XF4A 1PK6B 1EPWA 4H3WA 1HRI2 1PNGA 2I45A 2BYVE 3ATGA 4FSJA 1DDLA 3PVBB 5HI0A 3SXWA 5L7OA 4YM3A 1X7NA 4N43C 3CJIB 4PQ9A 4AQ2A 2K9ZA 2Q1ZB 4Q4Y2 1HLCA 2CAVA 2YDEA 5C9AA 1G7YA 5GZFA 1GZ9A 2ZZJA 3DN7A 3TNQA 3FUQA 2GC2A 4WM7C 1NYWA 1JH5A 4GALA 1TMF2 2TUNA 5FQ0B 2RR12 5JAXA 4RA0A 4Y24A 3UJOA 3SCFA 1G6NA 1W2UA 3WG2A 4QPIB 1QU0A 2ES3A 3AZYA 3VBUA 1OOPA 2XVKA 3HQXA 3WW2A 4LBJA 4AI2A 1RUF2 4B4QA 2O1QA 1U5XA 4XFGA 5DUUA 5TSWA 4YFZA 2ZAAA 1F8VA 1XQNA 3V0BB 4GH4C 1O3SA 4FPGA 1LB2A 2AYHA 1NCQA 1LOBA 3LA3A 1UU4A 2E53A 2GN3A 4NPRA 4WVVA 2RJKA 1JOJA 3MIDA 2WNUC 4AQSA 2G4IA 3AYEA 4RR3C 3WDYA 2OUJA 4MUVA 2YGMA 2A6XA 1I1EA 1TQ5A 3PLQA 4PDWA 1VBE1 5FTTC 5BNNC 3GZAA 1AXZA 1KRIA 2AH2A 2TBVA 2ZCWA 3VKNA 4XOGA 5FOBB 1SLAA 1DGWX 2VNGA 1AHSA 4Y22B 4CEYA 4AI3A 1Q8VA 4IEQA 1CX4A 3MIBA 2ARXA 2WS93 1DQ6A 5BV6A 1NG0A 2BFUS 3GHMA 1MEC1 1YO8A 2XL9A 2WC2A 2P3JA 1UL9A 3P3NA 1H30A 1K5MA 2A71A 4K9SA 2BVVA 2ZMLA 1ZBA1 3UKNA 3E5UA 1V9U1 2ZAHA 3U0ZA 5KC5A 1WUVA 2E63A 2RS13 4QGNA 5FMOS 2Z79A 4FPEA 4JGZB 3ZFGB 1C1LA 2BUKA 2IC1A 4IEPA 3WG1A 3QCWA 4QQLA 4ATEA 2B42B 3VBHC 4LE3A 2R061 1RINA 1RUD2 2CL2A 1C1FA 1YHFA 2QDRA 4DY3A 1Z7S1 2GNBA 2GN7A 1W6MA 2AUYA 4YRDA 5A33A 1PNFA 2N7GA 3OF1A 1I3HA 3EHKA 2D3SA 3POSA 2ENRA 4LBQB 1COV1 3ZSLA 1J3QA 4W6WA 3WP6A 1W39A 2WS92 3INAA 4C0BA 2XH6A 2X8KA 1B09A 1ND3C 5LRRA 5BNPA 5L7OB 2GALA 3MI8A 5A32A 3PVOA 1A3KA 5GM0A 4F3JA 1PGL2 1DQ1A 5C9AB 1IKQA 2RS12 3KGLA 1RUE1 5FBZA 3UKTA 3B00A 3POYA 2ZX3A 1DBNA 1OI6A 2YPJA 3AMNA 1Q43A 2LALA 2DTWA 4INDA 2XKPA 5EXOA 2XLGA 4LTAA 5JWPA 3MIFA 3RWNA 3RJRA 1RC6A 2WLPA 3LCPA 4LNVA 2A75A 4TYSA 4N53C 4FPYA 5T54A 5LRSA 1OOPB 1EV11 4H7LA 2PAEA 4OHYA 5K7PA 3ZDSA 2R041 1GSLA 5KHIA 1A78A 3KMHA 2D6OX 1HW5A 3N7JA 4PBPA 1SCRA 1BQPA 1ZX5A 1LENA 1OA3A 4EN8B 2PHRA 2FQPA 1VBA1 4QHBA 1ENRA 3WDVA 1VBB3 3AXEA 4M0NA 4KU7A 1V6NA 1OD5A 1AJOA 1AYN1 3IT8A 5C8CB 4Q4V1 3J26N 4KWLA 3N36A 3ZIWA 2RE9A 2RMU3 2E7TA 5JR7B 2DVAA 1RUG3 3AM2A 4GB33 4ITCA 4JAAA 1MS9A 1GFF2 4XPVA 1AR73 5ABJA 3ZMNA 3BCWA 2RHPA 1GZWB 1H1AA 5KXCA 4CEYB 3VGIA 5CG9A 1OQEA 1VAMA 3N4MA 1C5HA 1AR63 2VH9A 2VU9A 2JG8C 3WLUA 2ZS6B 1CAVA 1CQ9A 4KH9A 4BA6A 3ELNA 4E4ZA 5JOXA 3VKMA 4LHNA 1N1VA 1O4TA 1NCRA 1H8TB 2I2SA 2ZHKA 1NZCA 3OBRA 1JXNA 4IL7A 4NOTA 3VBFA 4MV2A 1R083 4Q4X1 3TN91 3AX4A 2RMU2 4CEWC 4XYXA 2GC3A 1KJRA 3EQEA 1RUG2 5FOJB 1SACA 2RS51 4I3PA 4GB32 1KD7A 3RS6A 1TEIA 2PHUA 1AR72 3U11A 3TWIA 4Q0QA 1CD3G 1KS5A 1D2SA 4HPKB 4OVEA 3ZPYA 4DRRA 3AMQA 2JX9A 2TEPA 3CJXA 3H0OA 1WMDA 1VBC1 2JE7A 3NW4A 1AR62 3WQ7A 1SFNA 4IV3A 1NA1B 4LBNA 2BQPA 4MZUA 2B46X 4OUSA 4XBLA 1QQP1 5BNPB 3B01A 1QH6A 1OFSA 2MEV3 5A32B 5T5LA 1F31A 5SV5A 3VKOA 4CDWA 1PIV1 4LUKA 4JTOA 1NE4A 3VL9A 3OGJA 2HWF3 2XL7A 1U0AA 4K40A 1R082 1AR83 4ZXKA 4LBLA 1Q5OA 3E6BA 1GNZA 4AQTA 2OIIA 4XF1A 3VKFC 3FZ3A 1QHDA 4XE9A 1DFQA 1C28A 5KXEA 3WT3A 5ACA3 2PHXA 5E1RA 4YLZA 3JQWA 4G9SB 4M3CF 2ZGPA 1MS3A 2B45X 5CNAA 1DLLA 4R4ZA 5EJ3A 4I3GA 1V70A 3ZFFA 3M8LA 4FQZA 2B9UA 4DRVA 1ULFA 1WBFA 3ME2A 3RSJA 1AL0G 4EWDA 3H8UA 2MEV2 4GMP3 2W08A 1SCSA 4LR4A 1OLQA 4MXVA 4COYA 2CGPA 1MS5A 4WVMA 4UBGA 3JB4C 2HWF2 4V1PA 1G86A 1AR82 4YZ1A 3JZVA 4FPFA 5I93A 2X29A 2PYTA 2C5DA 3RRDA 1O3QA 1NQDA 2DVDA 4IV1A 4K1ZA 4YW3A 3DPRB 2DUPA 4H55A 1OQDA 4FXGB 4ISQA 1H4GA 5ABJB 3IWZA 2P2KA 1R1A1 5ACA2 4DXZA 5T52A 4FTSA 2IXKA 1V6IA 5K9YA 1IS3A 5DZEA 2WIIB 2R1BA 4W6YA 1RL3A 3AZZA 1FYUA 5FO8B 4QU2A 2R071 5FO7B 3AXDA 1ZVFA 4MGKE 4XFBA 1RUJ3 3KCCA 5L73A 2WFF1 4EWEA 3ZYJB 1YFUA 1Y7BA 5CFDA 4PIXA 5JI7A 1FI2A 1NCRB 4E27A 2O8QA 1BVVA 2VNRA 3D4KA 1B35C 3IPVA 2G9GA 2BEOA 1G9DA 1XYPA 1GICA 2DCKA 2H6CA 2B7YA 1WLWA 4LT5A 1G9FA 2R0HA 5D8AB 3I4IA 1XNKA 4ZU7A 2CV6A 4EN6B 2WQ4A 3OYWA 3FLTA 4A7YA 2NN8A 2XBO3 1SFYA 1HRI1 3GBWA 2VOWA 2ZOEB 2XJRA 1POV3 2E7AA 4AF9A 4RD7A 4XIOA 4BIFA 4YW5A 3OGGA 3T2TA 1YRZA 3AJZA 3I7DA 4GQ7A 4IV3B 2VMGA 4K20A 3VL8A 4BZ4A 1RUJ2 2IXJA 4PJYA 2YYOA 4Q4Y1 5GALA 3WZ1A 1OPOA 1DQ5A 3KSCA 3APBA 2A6VA 1F2NA 1PGW1 1YXWA 1IS6A 1UAIA 4HBNA 4R4XA 1REEA 3NKGA 1IPJA 1TMF1 4RSUA 4XHXA 4A2UA 4NN0A 2XKOA 1RUH2 3VHRA 3FE5A 4SBVA 5IK8A 3PTYA 1GKBA 1N1SA 5T50A 2EAKA 5C4WA 1AJKA 4YARA 3AP9A 2XBO2 3H9AA 3NL1A 4CDQA 1AX2A 2YUEA 1ZNPA 4TWTA 2VMIA 4AEDB 4XHBA 3RI8A 3NAPB 1OSGA 1CAWB 3QH7A 5C6CA 3QACA 1J58A 2R16A 2JICA 2Q4SA 4Q1RA 3LA2A 2BW8A 1MS4A 3ZFFB 5JMCA 4K3UA 4WM8A 1GQHA 2W52A 4Q0SA 4OI0A 4FBFA 3M70A 4YVWC 3V0AA 1PZ7A 2ZX0A 1YFWA 5J96B 3GF6A 4KWJA 4RL7A 2V5YA 3AKRA 5T5JA 4QMAA 2NQYA 5J36A 2GMMA 3ES1A 4XXPA 1PO23 2D6LX 3HIFA 4Q26A 2HWE3 3MLJA 4DZGA 5BNQA 5J37A 2BNNA 3GBGA 1UCXA 4X6QB 3WW1A 2WSVA 1FPN3 1PMIA 2BTVC 3WCSA 3RG0A 3FLRA 2NP0A 3VDDA 1LTEA 2CAUA 5KXBA 1CONA 1RJ7A 3B7MA 2BBVA 1VRH3 2XB6C 5GJ6A 4AHZA 4K7JA 4BMEA 3VBUC 2JKBA 4C1WA 1SBFA 1J1LA 2JG9C 3IN9A 2PHWA 4XJZA 1X8EA 3SLIA 4J6GA 4DNYA 3WP5A 3VHOA 3OCPA 1QJU2 2A5ZA 2CY6A 3CJIA 2X5IB 3JB8A 3OTFA 1LHOA 5K0UC 1NCQC 3FWEA 5T55A 3A4UA 3NWKA 2WNEA 1QOTA 4CP0A 4L99A 5AVPA 5JZGA 1PO22 3MIHA 2HWE2 2HJIA 1RUD1 4QPIA 3W59A 3SISA 1FPN2 1S0DA 3WINE 4D3WA 4PDWC 2ZGSA 1XU1A 4AVSA 5EYYA 1LU2A 3I54A 1WW7A 1J3RA 2K2SA 1IKPA 3AMMA 1CESA 3OYWB 2CNAA 2KM2A 2PAMA 5SV8A 2VUAA 1VRH2 3LOIA 3PVEA 1EPZA 4Y1VA 3WD5A 3AK0A 4AI1A 2WS91 1Y3TA 3KS7A 3VN4A 3SH5A 1I9RA 4Y20B 2ARBA 1WLCA 5DG2A 1N1TA 5HXVA 4BM8A 4PIZA 2AENA 1PGL1 4ZKTB 4Z92B 4YVSC 1QKQA 4KL1A 5C8WA 1ASJ3 4JDNA 2RS11 2XJSA 2OW4A 3C2UA 3ILFA 3KGZA 3WQ0A 2E6VA 3DL3A 1K5MC 3TB0A 2RM21 3MLKA 4RS5C 2DF7A 1HX6A 3W58A 4EJRA 3ZXAC 4CDXA 4WZFA 4HSLA 4UW3A 3O0VA 3R05A 2A73B 5C4WB 1D4M1 3M1HA 5DDJ3 5KHJA 1GR3A 2HYKA 5I8YA 2YMZA 1EYBA 3VBRA 3E5QA 1AR93 2TNFA 3NJZA 4Y26A 1REFA 3U07A 4D94A 2WNVB 3AKQA 2QKDA 1CJPA 4Q8KA 3MEPA 4URTA 3JUUA 1LHUA 3O0WA 4LO4B 4Q0PA 4ZU5A 4ATFA 2UYAA 5IT6A 1ASJ2 1EAH3 4NHLA 4FTEA 3BU7A 4LBKA 3H1MA 3HWJA 1V6OA 3WR0A 5FDBA 1HV1A 3AP7A 4HANA 4AK3A 1MZEA 2C9AA 4UXAA 3A0NA 3AMPA 2D3PA 3KLSA 4P9WA 1D0HA 5CAZA 5CB7A 2P34A 1JUIA 2PTMA 4HLTA 4D7SA 3VDDB 3WVJA 4AEJA 1ONAA 2WINB 5DDJ2 4YSFA 1EY2A 1LULA 4LBQA 4OHWA 3TBDA 5CFCC 1CR7A 3MFAA 4BIOA 1AR92 4QPGA 1WCSA 4XF9A 3NO8A 4YNIA 5JOWA 1YIPA 3NV2A 1AUYA 4M00A 4X8PA 4XMAA 4CZSA 2EXKA 1O4ZA 3WV6A 4COWA 4AE2A 4KG0A 1EAH2 2PN5A 1FMD3 5GLZA 4XQ4A 3VZLA 1PVC3 2H6BA 5A3MA 1Z0HA 5C33A 1DQ2A 4ES8A 5JZGB 1WMFA 2RMU1 4LHKA 3ZX7A 1MZFA 3HR9A 4IXLA 1RUG1 1X50A 3QD6A 1DQ4A 2HWC3 2SLIA 1KFXL 3ZXFA 1ALYA 4YM0A 4K21A 3ZN6B 3ASIA 4FOYA 2AR6A 3OY8A 4FP2A 1N47A 3VZOA 1C57A 1PVXA 2NMOA 1AR61 1A8MA 3S0MA 1KFUL 1TNRA 5FCCA 1RHI1 2NLRA 5FLJA 1OLRA 1ZM1A 2ETEA 2XJUA 1KDKA 3T1LA 1FMD2 5C8CA 4AFBA 1BVP1 2R1DA 1PVC2 4W65A 3N3HA 3VBSB 1R081 3MFCA 4FOWA 1BJQA 4KQ7A 2VOVA 2XJQA 4Q29A 5FAXA 3VBFC 2HWC2 3FUOA 3LA7A 5DUXA 3PNAA 4B7KA 3POWA 2DCTA 1ZA4A 2VOKA 4LBQD 4CDXB 1GZWA 4RGGA 5CVRA 2D6KA 2ZABA 1H0BA 4LE4A 2IZWA 1MZ6A 3AJYA 3MW2A 2D3RA 4BCUA 4IEXA 2Q0AA 1D2QA 4FAHA 1RUI3 2EF6A 3VBRB 2ZJCA 5GZEA 1HXS3 1MVQA 2YC0A 1VJ2A 2D43A 4RHV3 4YZ2A 1UU5A 1ZZ6A 4YM1A 4YGDA 2I74A 4CP2A 4MLOA 2XLAA 1H8TA 4S2GA 2XVLA 3UL2A 4P9YA 3DUIA 3M7AA 1AXYA 4S2DA 2EXHA 4OUMA 1G9CA 4NHKA 4Q4W3 3E5XA 3I59A 4EN9B 2VNOA 1N3OA 4CDWC 2ZGNA 2ZA9A 5GZCA 4IEOA 2ILMA 4QGMA 4DB5A 4RQPC 4DPNA 1IS5A 1BZWA 3NV1A 2DFCA 4I0AA 3ZXKA 4HPKA 5ACA1 1QDOA 2ZGMA 1U5ZA 4FCAA 4MVTA 1SEFA 2OYZA 4BMBA 1RUI2 4XETA 4R8HA 1NA1A 1HXS2 4QPGB 4AYUA 4PCRA 4BPZA 4RHV2 3AZWA 1R1ZA 1LGNA 3I2DA 1IGOA 4P9GA 3LOBA 3CU7A 4I0WB 1FV3A 4M3CE 2PHFA 3WCRA 3USUB 4Z8BA 2WQZC 4N7UA 4ZU4A 1JUHA 3WUCA 3VZKA 4Q4W2 3GYDA 4E2QA 1Q8QA 2VQAA 1LOEA 4OZXA 2CGOA 2FMDA 2PHDA 4FVVA 2D6MA 5AFBA 1AX1A 4EV0A 2VXRA 4FAGA 3HD8B 3OY8B 2HWD3 4KNCA 1MQTA 4IV1C 2K0GA 2ZX4A 2QNKA 2VW1A 3MIGA 4UW5A 4QXKA 3RQ0A 1RUJ1 1HQNA 2WSUA 3RYRA 3FHIB 1MACA 1BK1A 1TME3 1X36A 4IERA 5I0TA 3WDUA 4AVCA 1RVF3 2I07B 3JBG3 5LK5A 3R4DB 2HWB3 4YG0A 1NY71 5GZGA 1VR3A 3LGRA 3D6EA 2QFEA 1RUH1 2F4PA 4QQOA 5CFDC 3TOJA 1UIJA 4A7ZA 1X33A 2RJLA 2D98A 4HZFA 1DF0A 1S0GA 2A7AA 2LUWA 1J1TA 3IKWA 4IEZA 1VB2A 2Z42A 2DFBA 3ACLA 3DPRA 3IDEA 2XBO1 3FBMA 3PJYA 2VY0A 4WM7A 4DOUA 1G9BA 2W0XA 2XWJB 2NYYA 4DY5A 4M01A 4D7YA 2NZ9A 1WGPA 3U4XA 3FX3A 2GAUA 1S0JA 2HWD2 3N35A 5FPXA 1S0BA 2SBAA 3D0JA 3WDWA 3MF9A 3VBOB 3ZFEB 3WDTA 5BNOC 3ZYPA 3ES4A 2VOXA 4E4SA 1TNFA 3O12A 4E2SA 3S7IA 1TME2 3DV8A 1RVF2 2ZKLA 3JBG2 4GH4A 1VBB2 1YYNA 2HWB2 2D6PA 2BFUL 4JGYB 5E8AA 3H50A 2GC1A 4AG4A 4CDUC 1RJ8A 1C4RA 1XNCA 3I59B 2WNUA 2YGLA 5D8AA 1GLHA 4FPJA 2UY8A 2DTYA 5FMOL 4GWMA 4Y1ZA 3RYPA 2IXLA 3V64A 2DUQA 1LECA 3QBQA 5AVAA 4C91A 1AYM3 1WD4A 3Q9OA 4XF0A 1FX5A 3S30A 4OI1A 3O14A 2DVBA 2D5HA 2ERFA 4LBOA 1KS4A 2CGNA 4XFFA 4CDQC 1VBE3 2WFPA 1QJU1 5FLIA 1IS4A 1XRUA 5IK4A 4XJUA 5J09A 1UF2C 4ONUA 4PIYA 4WZCA 2PFWA 3JQXA 1FNZA 1R093 3JU9A 4XFIA 1LEDA 1U5YA 4WM8C 1PO21 1GANA 4YYOA 3H3UA 2HWE1 1W6QB 2C0ZA 1WBLA 3NV4A 3BODA 5F5QA 1JYIA 2H0VA 4BOWA 3LSEA 4XDQA 1CGPA 3ZN4A 1HRV3 1VLNA 3EJKA 1ND2B 1Q8SA 4AQ6A 1QGLA 1EP0A 1QJZA 2GU9A 3TNPB 1UIKA 1ULGA 1MEC3 2DVGA 2EXJA 1VRH1 3ZXDA 5GKAC 5KHGA 1KQRA 1LESA 1ENQA 1LJ7A 1AYM2 1GZCA 1ZBA3 4AEDA 1PK6C 1UU6A 3AP4A 3NAPA 1CAWA 1DU3D 3SH4A 2QDNA 5GLUA 5D1IA 1VB4A 1MQTB 1XYOA 1VBE2 2OVUA 3SCHA 1S0CA 3BTAA 2VPVA 3RDIA 1RB8G 2R063 4LLOA 5I0UA 3ZSKA 2GZWA 4HN0A 2KXLA 4XIKA 3JD73 1YNAA 1R092 4KGQA 5HCBA 5J3UA 1RUNA 2P3KA 3CJIC 4QT6A 4WVZA 1CAXA 4YG3A 2VGDA 4HFSA 1LKNA 3URFA 1ND3A 1HRV2 4LO6B 1OKQA 1L3JA 4N43B 3RMXA 1MZ5A 5H9PA 5I8TA 3LB9A 4TSVA 4KU8A 3SHRA 2GC0A 4QPIC 2P17A 4W6XA 1HQLA 2QUOA 4B3NA 4LUMA 4WM7B 4XF3A 4CYDA 5I0SA 1WLTA 1KDMA 1QWRA 1ZBA2 2VW0A 2FZ2A 2A6WA 4P5HA 1IZ3A 3FC0A 2Y26A 5T5PA 1YJLA 1RUE3 2IFRA 2X5IA 3R4SA 5EFUA 2R062 3PHMA 2G9FA 4C90A 2ATFA 2HKXA 1ZZBA 2PLV1 2QZ2A 2DURA 4BLIA 3JD72 5JPNB 2A6ZA 3M2MA 3R6SA 4JDMA 4GH4B 1EV13 4PLMA 3O0XA 1ZRDA 3V65A 2ZX2A 2FZ1A 2UURA 5JIAA 4P9LA 5DUWA 4QPYA 3IM0A 4COVA 1H4HA 5HCFA 1AL21 4XQDA 4YW1A 2WNUB 3ZXGA 5LK7B 4RR3B 4AVVA 2O0OA 3U10A 1VBA3 1RMU3 5DDJ1 1O3TA 1NXD1 5AFEA 2MNGA 2JXAA 4DMIA 5BNNB 3UK9A 1G8WA 1AR91 2W39A 1AYN3 3AYDA 4M3CA 1RUE2 3MYXA 3FFQA 4AVTA 2CWSA 3B93A