4PBOA

Crystal structure of zebrafish short-chain pentraxin protein without calcium ions
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
207
structure length
207
Chain Sequence
FKNLSGKVLQFKTATDNSYVKLYPEKPLSLSAFTLCMRVATELPLDREVILFAYYTPDVDELNVWRERDGRVSLYIQSSKDAAFFRLPPLSTLQTHLCVAWESATGLTAFWMDGRRSLHQVYRKGYSIRSGGTVVLGQDPDSYVGSFDVDQSFVGEIANLQMWDYVLSSAQIKAVYYNQDNRVKGNVFDWDTIEYDVTGNVLVVPDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords C-reactive protein
publication title Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
pubmed doi rcsb
source organism Danio rerio
total genus 50
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2014-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00354 Pentaxin Pentaxin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4pboA00
3RS6A 2Z42A 1NXD1 3NV3A 1JYCA 2R1DA 1HQLA 2ZGMA 2ZACA 4NO4A 2NP0A 1MZ6A 4WVWA 1QNWA 5GM0A 1JUIA 1GSLA 1F5FA 1KITA 1LOCA 3WDWA 2H0BA 3FLTA 1WCSA 1MS8A 4Y26A 4YM0A 4YW3A 1VAVA 3ILRA 3KQRA 1LEMA 5DUXA 4XJ8A 2UWBA 4FP2A 4FQ4A 1EPWA 1CN1A 2NZ9A 4P9WA 4TYSA 4XMAA 1IOAA 4FOVA 3WLUA 5JOXA 4FPCA 4FPKA 4GALA 5GLUA 2GMPA 2A6ZA 1W6OB 1UL9A 1UN1A 1BKZA 3AXDA 3HN1A 3BIWE 1AF9A 3WG2A 1HDKA 2SBAA 1LEDA 1N3QA 1QOOA 2A6XA 2E53A 1IS6A 4ISQA 4XILA 2CYFA 1V6KA 2ZGRA 4RL7A 1ZA4A 1Q8QA 4PF5A 3MPPG 1UKGA 5E88A 2WT1A 3AP4A 3PVOA 4XYXA 2GNMA 4LBLA 1OQ1A 3MEPA 1G9BA 5E8AA 5EYXA 3OJBA 1G9AA 1OKQA 2EXHA 3L2YA 4FPLA 3B01A 4R9AA 3AYDA 5GALA 3WHUA 2ZGSA 1Y7BA 5IUQA 2DU1A 3PMEA 1H9PA 3ENRA 2DWRA 3R4SA 4ATFA 3WG3A 5IK7A 3UL2A 3RMYA 1F9KA 2ZHMA 1YO8A 1S0GA 1DLLA 3TAYA 5DUWA 2ZGTA 3RG0A 1CONA 1CQ9A 1LODA 2CL2A 2VW0A 3QCWA 4YW2A 1FV3A 1V6OA 3RMXA 1G7YA 4YZ3A 1V6JA 1BXHA 4LBJA 1QMJA 4BMEA 4XJWA 3NV1A 1ULFA 3A4UA 1LOFA 1Q8PA 1AX0A 1IS3A 1N1TA 2ZABA 3DGTA 3LSDA 3NV4A 4FP3A 4UW6A 1QNYA 1KDMA 2AR6A 2WNEA 4XHBA 1AXYA 1W6QB 3UJQA 3A0NA 3OGGA 2ZZJA 5DZGA 2GNDA 4DPNA 2GNBA 5SV8A 2D6NA 3IKWA 1LHOA 1MS9A 3HR9A 1W6OA 1YI7A 3AX4A 5T5OA 3TB0A 3V64A 3W58A 2Q5TA 4YGEA 3MW4A 4FPJA 4F83A 2EXKA 3H0OA 3T2TA 1W6MA 3SLIA 2P34A 4YZ1A 4AGRA 5CA6A 5T5LA 2LTNA 1SBDA 1SBFA 1BYHA 4FQZA 5DUVA 1GNZA 2CWMA 1WBFA 4Y1ZA 1FNZA 1Q8SA 3MW3A 3O12A 2D6LX 1LGNA 2DV9A 5H9RA 1UZYA 1QDCA 3SISA 1DYPA 3FUOA 1PZ8A 1V00A 4Y1YA 2YXSA 1D0HA 3WCRA 3ZVXA 1IKPA 1QF3A 4LBOA 5HCFA 5IK5A 2P3KA 3Q9OA 3SITA 5L73A 2PHXA 1SCSA 1G9DA 3M2MA 2DVDA 2R49A 1QDOA 1KQRA 4R9DA 2UU8A 1DQ5A 1KJLA 4LBQA 4XJ9A 5GZDA 5LK5A 4LBMA 4WVVA 5GLZA 1AJOA 2OUHA 1CIWA 2EIGA 4Q1PA 1RIRA 1UMZA 3B3QE 3AFKA 2EXJA 1N1SA 3POYA 4CZSA 2D44A 2OUJA 1FX5A 1SCRA 5BYNA 5H9PA 4YFWA 2ZMNA 4XXPA 1W6QA 1DQ1A 1GANA 1WBLA 3POSA 4Q1RA 1SFYA 2WKKA 2DVFA 3ILFA 4AVSA 1GYKA 1LENA 4Y1UA 2NMOA 1MS5A 4PCRA 1ZM1A 5IK4A 1IS4A 3AZXA 1AX2A 2YV8A 5GZFA 4BOWA 4GKYA 2A6VA 3V0AA 1SLTA 4YZ4A 5T50A 4Y20A 3WDVA 2D6OX 4ZXKA 2UWAA 1MVEA 3KM5A 5JOZA 3AJZA 5KXEA 2D3SA 2AUYA 1U0AA 4XIOA 2A3XA 1S0FA 5T5JA 5GZGA 2A3YA 4YM2A 4YM1A 2P2KA 2E6VA 1S0BA 3AJYA 2D43A 2PHUA 1MS0A 1N3OA 3CNAA 1WUVA 1ULGA 2ZBJA 2CTVA 4YG3A 2BQPA 4MYEA 4DRRA 5KXDA 3B00A 2V73A 3VKOA 2A7AA 1N1VA 1LCLA 2UWCA 2ENRA 1KJRA 5T5PA 4DRVA 4Y24A 1AXKA 1H30A 2AH2A 4PQ9A 2R0HA 3B9CA 2ZKNA 3AP6A 4XDQA 1JHNA 2ZMKA 4DQAA 5DG1A 1S0EA 2V5YA 1GZWB 3M1HA 3LCPA 3R05A 4BLJA 1W6MB 2GN7A 3ASIA 3O0XA 3V0BA 2P37A 1A3KA 2FMDA 4RA0A 4YW5A 1LOGA 1KDKA 3APBA 4CRQA 1VALA 3VKFC 2AGSA 2PHWA 4M3CE 4YM3A 1HKDA 4DS0A 3N35A 1YYNA 1N1YA 1QOTA 2JDZA 3W59A 2NMNA 1WLDA 4NOTA 4XJAA 1VIWB 1AXZA 4UW5A 1LU2A 1MS4A 5GLWA 4YW4A 4M3CB 3AXEA 3OPZA 1ENRA 4LBQB 3IN9A 1DIWA 1LOFC 4YZ2A 2EXIA 1YXWA 1I3HA 2A75A 5DG2A 4PBOA 3T1LA 3WVJA 2ZGLA 2PELA 2TEPA 2PHTA 3HMYA 4XTPA 2DUPA 1CVNA 4AYUA 4JCKA 2A70A 3D5OA 3AYEA 1O4ZA 3RQ0A 4W65A 4PBPA 1C1LA 3RRDA 3RSJA 2GDFA 1S0JA 4YGCA 1V6LA 5IK8A 1Q8OA 5AVAA 1SLCA 3AZYA 1NLSA 1G9FA 1APNA 1GV9A 4DFSA 3FLPA 1A8DA 3ZXKA 3V0AB 2A6WA 1BQPA 4FOYA 1GZWA 4JC1A 1LHUA 3WHTA 4AGGA 1G8WA 5F9TA 2E7QA 4Y20B 4R9CA 1W6NB 3ATGA 3VKMA 4AVVA 3IM0A 1DQ6A 2WSUA 4XIKA 5DXDA 1V6NA 4Q26A 2A5ZA 1WLWA 1LECA 2DUOA 4XMIA 2G4IA 3N7MA 5KXBA 1DQ0A 4OZXA 4Y1VA 3OBTA 5JDBA 5EXOA 2ARBA 4YGDA 3SH4A 1PZ9A 1WW7A 4JRAA 5DZFA 1S0IA 2LALA 1QOSA 1AVBA 4KBBA 2D6PA 3GALA 2ZHNA 1G9CA 1MS1A 1ULEA 2P3JA 2WT0A 3WUDA 1GZCA 2SLIA 2CY6A 3AYCA 1LU1A 3ZXJA 1PZ7A 4FPOB 4M3CA 2VUAA 1GKBA 2W52A 4L8QA 2YROA 4HANA 3ZYPA 1SBEA 2OVUA 3MW2A 3NWKA 1IKQA 1B09A 1DYKA 3V0BB 3BODA 1LHWA 3IPVA 1LGBA 2DYCA 4Y22B 3VV1A 1LULA 2JE9A 3M3EA 5T54A 5JOWA 2DTWA 4U36A 3AZVA 2WJSA 1FYUA 2WT2A 2E7TA 1LJ7A 2VW2A 3PJQA 4K21A 1AX1A 1SLAA 1LOBA 1URXA 2ZGNA 4WV8A 5JVVA 3OYWA 4UW4A 2UURA 5IT6A 3ZXLA 4ASMB 1Q56A 2D3RA 1JN2P 5T55A 1ULDA 1WLCA 1JXNA 3T1MA 1W6NA 4LBQD 1V6MA 4FPFA 4K20A 2WSVA 4XBLA 1C57A 2XG3A 3M3QA 1A78A 5GJ6A 4BMBA 3AK0A 5E89A 3FLRA 3WNXA 4XBNA 4XJUA 4XOGA 5HCAA 1VAMA 4GA9A 2AENA 1H9WA 5GZCA 1SLBA 4R9BA 4Z8BA 3VKNA 1GNHA 1LHVA 1DHKB 2D6KA 4M01A 1GZ9A 3AYAA 3C2UA 2ZA9A 2ZGUA 3ILNA 2OW4A 1DQ2A 3ZSMA 2EF6A 2GMMA 4SLIA 2DU0A 3I4IA 3WDYA 1AZDA 2A6YA 2ZMLA 3ZSJA 4TZDA 2VXRA 1LGCA 4Q2FA 1SACA 1JOJA 1MR5A 2YMZA 3AZWA 4FPHA 1JBCA 2W68A 5GLTA 5HCBA 4AVTA 1ENSA 4M00A 4GWNA 1DGLA 4IQPA 4XTMA 4BQ1A 2D6MA 2P3IA 1OFSA 3SH5A 1MZ5A 1ENQA 2NM1A 1QKQA 1WW5A 4XBQA 3N7JA 1W0OA 2B7YA 4Y22A 1JW6A 1LTEA 2A3WA 1N47A 1W6PA 2ZGKA 5EWSA 4AWDA 2VY0A 3N36A 1IS5A 3UK9A 3JU9A 5GLVA 2NYYA 4ATEA 4D69A 2ARXA 5JOYA 1DZQA 4YLZA 1QU0A 4YG0A 4FVVA 1MS3A 4K1YA 3V65A 1GICA 2PHFA 1WW6A 1S0CA 1O4YA 2I2SA 3D6EA 1CR7A 1ONAA 1RINA 3OY8B 3ZSKA 3AP5A 4YG6A 1C4RA 1HQWA 5KXCA 1GLHA 4U2AA 4XZPA 1S1AA 3BOPA 1J1TA 2D3PA 3WV6A 1WW4A 3FUQA 3M3CA 2FHRA 5T52A 3O5SA 3WDXA 1GBGA 4UW3A 4XXAA 2DTYA 3ZXFA 1BZWA 2GN3A 1CPMA 1FV2A 2PHRA 2C5DA 3ZSLA 1ULCA 1Z78A 2AYHA 5JLVA 3IPVB 3R4UA 4XE9A 3WUCA 2R1BA 1XQNA 3NV2A 2DVGA 2DVAA 2ERFA 2ES3A 3QLQA 4C1XA 4GXLA 2R0FA 3INAA 4P9XA 5CNAA 3ZPYA 2YY1A 4YGBA 1VLNA 1UAIA 1V6IA 1AJKA 1Z0HA 3OYWB 4Q8KA 1W0PA 4YFZA 4ISRA 3WG1A 2DVBA 4C1WA 4LBNA 4Y1XA 3B69A 3FBYA 3O0WA 3USUB 2ZGOA 1YIFA 1KRIA 2EAKA 3N3HA 4FPEA 1UX6A 3SH3A 1DBNA 2ZGPA 2AREA 1MACA 3I8TA 3BTAA 2EALA 3WDTA 1CJPA 1LOEA 2ZHKA 1FATA 4H55A 1RITA 2E51A 4GWMA 1C1FA 1DQ4A 5EYYA 2C9AA 3M3OA 1Q8VA 3DUIA 3WZ1A 2YZ4A 2VH9A 1LHNA 3ZXEA 2CNAA 2NN8A 2ZGQA 3OY8A 2JJ6A 1D2SA 2W08A 2JE7A 3PVNA 1BJQA 4AGVA 1X50A 4BM8A 4M3CF 4XJZA 3OBRA 2HYKA 1TEIA 1LOAA 2WLQA 4YW1A 2VU9A 5DUUA 3O0VA 4K1ZA 2DUQA 4FPGA 5CB7A 2CWSA 4Q27A 3GNEA 3WDUA 5CAZA 1MVQA 3ZYRA 3AP9A 1W6PB 2GALA 4ITCA 3LSEA 1FNYA 1HLCA 4FOWA 1UPSA 1WD4A 4FPYA 1CPNA 4P9YA 3VUOA 3D4KA 1I1EA 1SLIA 3WOGA 3U4XA 1CESA 1SLLA 3A0KA 1QGLA 2GNTA 3N7KA 1S0DA 1R1ZA 1YRZA 4BPZA 2VW1A 5F5QA 2D7FA 4CTEA 2JD4A 1F31A 2R16A 3FFZA 3USUA 4BLIA 1UZZA 5CBLA 1FAYA 2KM2A 4FOQA 3WCSA 2ZAAA 3N7LA 4ZKTB 5JMCA 4WZFA 2A71A 2W39A 5H9QA 3AP7A 4Q8LA 3SNMA 1G86A 5FREA 4GKXA 2RHPA 1JYIA 3VKLA 1WD3A 4HL0A 1DFQA 5GZEA 1N3PA 2JECA 3PVEA 4LBKA 5DZEA 2DURA 5FRAA 4YZ5A 3JUUA 2JKBA 3POWA 4XHXA 2ZHLA 2WQZC 1LESA 2XB6C 4I30A 3WG4A 4P14A 3AZZA 3IMNA 5H9SA 3UJOA 2GMEA
chains in the Genus database with same CATH superfamily
2RS33 5FZIA 3ZXDA 2HJIA 5BNOA 2HWD1 5C6CA 4LKEA 1H2LA 2E63A 2KD7A 2VMIA 2W1WA 2PLV1 2H0BA 3FLTA 1HV1A 1MS8A 1H4HA 2E26A 2WLPA 4YM0A 5FYYA 1VAVA 2VGDA 5KC5A 1ZVFA 3HN3A 5L36A 4E4DX 2RR11 5A6QA 1ZBE3 2ZX4A 4FP2A 1MEC3 3K51A 3DXUA 1CN1A 1STMA 1ND3B 1W9YA 4XMAA 3M3IA 1OD3A 1IOAA 1IG0A 4FOVA 5AC91 4FPCA 4GALA 5FY4A 5IVCA 1ODMA 2GMPA 2J42A 2A6ZA 5DABA 3DKWA 1UL9A 2GC2A 3HN1A 4IE0A 2YPDA 3A23A 1TNFA 1VBB2 5F1RA 2J1VA 2SBAA 2A6XA 2ZZQA 5I93A 4D6RA 3TNQA 1JODA 1PX3A 1VBC2 2X8KA 1ZA4A 4FXKB 2IUWA 4PF5A 5FUPA 4AQ2A 4YVSC 1O3SA 1UU5A 1VMJA 2XVKA 3W20A 4LBLA 4HSLA 1CAUA 1OQ1A 2Y0IA 3RDIA 1G9BA 4BQXA 4D0QA 1RUE2 3KV6A 1OOPB 3OJBA 4M4RA 3I2JA 4FPLA 3L2YA 2ZGSA 1NY72 4JVAA 3V56A 1AR72 2VO5A 5IK7A 2BYVE 1F9KA 2OZ6A 2V72A 1X9PA 1YO8A 3BTYA 1RMU2 3RG0A 2CL2A 5FWJA 2VW0A 2VTXA 4IE6A 1U5YA 2VECA 3D0JA 3OGSA 2XXZA 1QQP1 3MIDA 4B7EA 5EPAA 1QMJA 2QFEA 2PAEA 4LKFA 1RJ7A 4XJWA 4BMEA 5IFTA 1V9U2 3A4UA 5CYYA 3RI9A 3T1MA 3LSDA 2RJKA 3NV4A 1KDMA 1QJEA 3UJQA 4DPNA 2GNBA 2D6NA 3IKWA 3PVBB 1LHOA 4Q4Y2 4RQPC 5C4WC 2XJRA 3OTFA 1W8NA 2QQMA 3AX4A 3V64A 3VZLA 4IEYA 4B1LA 2Q5TA 2IVIB 4YGEA 5A3MA 2JG8B 1WCKA 4FPJA 2YU1A 3EBRA 3L2HA 4QX0A 4AEDB 4F83A 1A34A 1PGL1 4E2SA 3LDKA 1ND2A 1SDDB 2W3JA 3LDRA 3SKVA 3SLIA 2ID4A 4HK9A 4JGZA 1A8MA 1SBDA 2Z69A 4HPKA 4FQZA 3VGIA 1WBFA 4IEPA 1O3RA 2DV9A 2XR4A 1DYPA 4Y1YA 4FFIA 2YFZA 2HEYF 1LKNA 3ZVXA 1IKPA 3K3NA 4LBOA 4JX0A 5A3UA 1AYM3 1AR81 2B8MA 1HRI3 2WO1A 2Q30A 1RUG1 4XFGA 1K5MB 1SCSA 3VBRB 1XYPA 1FT9A 4K7JA 1AR62 4DY3A 3LA2A 4PDWB 3RVHA 5JPMB 5LK5A 3ES4A 1E57A 1ZA7A 1US2A 3AFGA 1CIWA 1DU3D 1RIRA 3AVRA 4CEYC 3MLLA 4AQSA 2QBXA 4JDOA 4OMDA 4CP0A 5FBJA 5H9PA 4N53A 5LCWL 3NJZA 5LATA 1Y9QA 1GANA 4AVSA 1ZRIA 5FOJB 5CVRA 3BCWA 2XJSA 4Y1UA 4BK5A 4MZUA 2WIIB 1AX2A 4BOWA 5AFBA 2A6VA 5FOBB 4Q0SA 4Z2WA 3C7OA 5HPOA 5CG8A 3WDVA 3B02A 1J3PA 5C8CB 1TG7A 1TME2 3KM5A 5A3OA 1X7NA 3LEKA 2X5IA 4NRMA 4XIOA 5F6KA 4PF1A 4UYBA 5BNPA 5T5JA 1B35C 1J83A 1KXGA 4YM1A 2QTWB 3K48A 2E6VA 1PVC2 2LRPA 1F2NA 2K9ZA 5G05L 3THCA 1MS0A 2JG9B 3FFQA 1N3OA 3CNAA 2JEMA 4MX3A 3IAPA 1D4M2 4XDOA 3N9MA 3VBUB 4IV3C 4YG3A 3WW1A 2FMYA 3NNGA 2R042 1Q43A 2A7AA 2RM21 2UWCA 5T5PA 2E33A 3BPZA 3GYDA 4WBBA 1FMD2 3CJIB 4V2VA 5FYSA 2BNNA 1W8FA 5B2GB 2R0HA 4IDZA 2BVBA 5J48A 4DQAA 3X29B 4CDWB 1RUI2 1GZWB 2F6BA 5LK7B 3V0BA 3O0XA 2MEV1 2A1XA 4PLNA 4WM7C 2FMDA 2WZR2 4YW5A 1LOGA 4MV2A 4CRQA 3APBA 1YHFA 4BXFA 4LEJA 5I91A 1KD7A 2Q8EA 2VNRA 2PHWA 1NG0A 4Q0UA 3WT3A 4CDXA 3AKTA 5C8CC 5C9AC 2QKDA 1UY1A 4UF0B 5IVBA 4CUBA 2FZ1A 4LE3A 1BLZA 2BV4A 1IZ3A 4Q0VA 5IW0A 3R4DB 3U0ZA 3FX3A 3RZHA 3JBG1 4NOTA 3FJSA 3SKJE 3O1MA 4XETA 1MS4A 1R1A1 2R073 2E7AA 4KL1A 1ASJ1 1W39A 4R52A 4M3CB 5GLWA 5C7GA 4XUQA 3AXEA 4HKWA 2B42B 4KG8A 5F3IA 4LBQB 3RI8A 1PO13 4LLOA 3VBUC 4Y3OA 5DAPA 2XVGA 1EAH1 3GBFA 1I3HA 1YUDA 4NAMA 3WVJA 4AHXA 4C90A 1C8NA 1RUF1 5G04L 2TEPA 1UXZA 3HMYA 5C8WA 3GM8A 1VE0A 4QQ2A 4QXCA 4AYUA 2FDHA 4PHZA 3ME2A 4W65A 4A6OA 4FI9A 4CDWC 1C1LA 1W8OA 3OGVA 1RUD1 4W50A 4B29A 5BNNC 5JXGA 1CX4A 3C7GA 1UYPA 2HWD2 3FLPA 1A8DA 3K77A 1DLCA 1BQPA 1ZX5A 4FOYA 4AGGA 1BEV1 1LHUA 2JDNA 3VBHC 3WHTA 4LITA 4R9CA 2J1UA 4YNIA 3BU7A 4GJZA 5DXDA 4Q26A 2A5ZA 5F39A 1R093 2C0ZA 2DUOA 1NA1A 4MSVA 5D2AA 5A6YA 3OBTA 1VRH2 1WCDJ 1FXZA 1MZEA 2JDUA 5EXOA 2CGPA 1OXCA 3LOIA 5DZFA 4A7ZA 3ZKYA 3ZN4A 4RR3A 3IDCB 1OPMA 3P3PA 4LORA 1RUH1 1HJGA 1G9CA 4BDVB 3VHOA 4AI9A 4DOUA 4XUOA 3AYCA 5CFCC 2UY9A 4FPOB 4YVWA 2VZVA 3H8RA 5C4WA 3MO4A 4JKKA 1GKBA 2D5HA 4UWDA 3AC0A 5J98B 1UKRA 4EN6B 4NHXA 1EY2A 2OS2A 3S5QA 3T30A 2XONA 1SBEA 2OVUA 3MW2A 3P3NA 5FJHA 3DYMA 2Y6KA 1LHWA 2C4XA 4Y22B 4E4HA 4QX8A 2BZDA 1JZ4A 4OUEA 5T54A 1UZ0A 5FPZA 1YQ5A 3J7HA 3AZVA 3JD71 2WT2A 4QQHA 4HT1T 4P02B 4PIXA 4CPBA 1M4WA 3N9NA 4K21A 5CIRA 1AX1A 3S6PA 3VHRA 4EROA 4L0PA 2B45X 1OUXA 3F95A 5DDJ1 3ZXLA 1L7RA 3WP5A 1DDLA 1Q56A 3CMGA 1FPN3 1W6NA 2XHNA 4K20A 4XBLA 4QXKA 4XFBA 4C8DA 2XG3A 4N9IA 5LEJA 3KSCA 4OUMA 2BBAA 1GNYA 3FLRA 4XF9A 3ZIXA 4BMBA 3J8F1 4XCBA 5E1RA 1VAMA 4XF1A 1HB3A 2TUNA 1H2KA 3ACFA 1NOVA 3VKNA 1RUC3 5F7UA 4XZUG 1H8TA 1DHKB 3CL1A 1GZ9A 1DZTA 5F2SA 3M7AA 5A32B 3C2UA 4EN7B 2MNGA 1BVP1 3ILNA 4MGKE 3ZYFA 2WFPA 5FKCA 1SFPA 2LS6A 4AHYA 4CPBD 3ZSMA 1E5RA 3H50A 5ABJA 3EHKA 5FMOS 2JE8A 3ZSJA 4TZDA 1VBA3 1CAXA 5FYTA 3A7QA 1PK6B 1SACA 4XVHA 4K6BA 3WQ0A 4GWJA 2IFWA 4CSWA 1JBCA 4AVTA 2BOIA 4M00A 4Q4X3 3ZFGB 5FZ3A 2VUJA 3SCGA 2P3IA 1OFSA 2VMHA 4Y5SA 1MZ5A 4H2AA 5EV7A 1AR82 2HLEA 3N9OA 1WW5A 2WABA 1VBE1 5FY7A 5L7OB 1QIQA 1VBD1 1RUG2 3AM2A 5EWSA 4CXXA 4QX3A 4LE4A 2LROA 2VY0A 3N36A 4A4AA 3UK9A 1GQPA 2PYTA 3JU9A 4URAA 1CJDA 3VZKA 5JOYA 2HWB1 2JDMA 1ZRRA 3WINE 4BQWA 1MS3A 1UY0A 1O59A 1S4CA 2OPWA 3OEBA 4AI2A 5FO8B 3V65A 4KNCA 4J1XA 1GICA 3KCYA 1RVF1 3LAGA 2PHFA 4P9GA 2VVDA 2XUMA 2I2SA 3O1RA 2WAAA 1ONAA 1RINA 2VJXA 2ZS6B 1ZBA1 4UFKA 3W5NA 1VBB3 4MXVA 4IETA 4YYOA 1AYN2 5C9AA 1GLHA 4XZPA 1DP0A 1XSRA 2WAOA 1CAVB 3BOPA 3I59A 3QBQA 4BQ2A 1HRV1 3FUQA 3BALA 3H3ZA 1VBC3 1GBGA 4ASLA 3BUCA 3CZUA 1Y43B 2EAAA 2GN3A 5FK7A 2Z79A 4CEWA 4FFHA 2PHRA 3ZSLA 5LZ6A 3THDA 1PGSA 3VDBA 1GQHA 1Z78A 1UMIA 3IPVB 2YDEA 4OVEA 3R4UA 4XE9A 3WUCA 3ZFGC 2D40A 5LA9A 2XVLA 4JKLA 3VBOB 2PFWA 5DQ0A 1AR73 4RFRB 4IW3A 2Q1MA 4KU8A 4QDQA 3D0SA 1V6IA 1AJKA 1YWKA 3OYWB 4XABA 2ZPXA 4LBNA 3B69A 3FBYA 5L9BA 2ZGOA 1YIFA 3R0RA 4D7YA 4KWLA 3N3HA 4FPEA 5FPAA 1RUJ1 4XUPA 1DBNA 1W05A 5EJ1B 3SH3A 3UGFA 2XHKA 1MACA 3GHMA 3ZR5A 2ZX2A 3BIEA 1H6YA 1OFNA 1X8MA 2XLAA 2ZHKA 1FATA 3LOBA 4H55A 2RS13 3WNOA 1W9TA 1U5ZA 2QQKA 1C1FA 3UV9A 2C9AA 3DEMA 4KBZA 2YZ4A 5FPBA 1LHNA 4CA9A 2CNAA 4Q4W3 2MEV2 5KWRA 2ZGQA 4XQDA 1OVSA 2VOVA 1RL3A 3AKPA 1O4TA 2Y34A 1COV3 2YBSA 1X50A 4IUGA 4ZONA 3BN6A 4ZU4A 1SPPA 2R7EB 4E4SA 3VBHA 4LR4A 2ZX3A 1J59A 3VB9A 5F8PA 5CISA 4MGTA 4BQ3A 5GKAC 2WN3A 3JBG2 4D6QA 3CO2A 2Y0OA 4CDQC 2RMU1 1W6PB 3OPTA 1JZ3A 4PIZA 1FNYA 4FOWA 1WD4A 1CPNA 2BU9A 3NAPA 3D4KA 2RS51 3UKVA 5KHJA 2Y26A 3VD5A 1AR63 5DAQA 1R1ZA 1SDWA 2I07B 1RUF2 1PHMA 1YRZA 3H1YA 2QQPA 5F3CA 4ZS3A 4CTEA 1HXS3 1GQGA 5FWEA 5FLHA 4QHZA 3NMBA 4PIYA 1W06A 3WCSA 3HQXA 2ZAAA 4LLFA 1RUD2 1JYTA 4O7XA 2EVXA 4WZFA 2MPFA 1W03A 3AMQA 1CAUB 2VMFA 4MH0E 4V2WA 5FREA 5FR3A 1ZRCA 4OZOA 3H1MA 4NIAA 3HAGA 3VKLA 5M0TA 1DGWX 3HWJA 4HL0A 3VDDB 2VNOA 2JECA 4FAHA 3MIHA 2VTXJ 5FXZA 1YFUA 2PQSA 4AL9A 2EIEA 5C3OA 1QJX2 2D5FA 2ZHLA 3EO6A 4X6QB 4I30A 4XHXA 4OI1A 2Q8DA 3AZZA 3IMNA 5CB7A 2WS91 3GCWA 3C7EA 1WWYA 4JZRA 5EP9A 3RS6A 5FPUA 1EUTA 2VXJA 2Z42A 3NV3A 2R1DA 4XF4A 1HQLA 2VAUA 2XWBB 1GP6A 3A22A 4XFHA 4WVWA 3M4FA 1W3VA 2VQTA 1LOCA 5GM0A 3POFA 3KZ4C 1YFYA 1WCSA 3G6JB 4Y26A 4JAAA 3KQRA 3OUIA 2VZQA 5FCCA 4XJ8A 4XAAA 1D4M3 2UWBA 2BDRA 1HB1A 4FQ4A 2P6HA 1H2MA 4JQRA 1BMV1 4TYSA 5FXXA 3IBMA 1NXMA 4L97A 5DAVA 1Y9MA 1AR91 1FMD3 2WC2A 4FPKA 3H1WA 4IGQA 4PI0A 4I0AA 5FZLA 4NWVA 4XUTA 4N7IA 3AXDA 5FK8A 4BZ4A 1DGRN 3KVAA 3WG2A 1DZRA 3ECQA 1LEDA 3RNSA 5JXHA 4WZCA 4Q4V3 4XILA 2C9KA 4QMAA 2VBDA 4RL7A 4JGZB 4E2GA 1JYNA 4HPKB 5A7WA 3S7EA 2QZ2A 4NIDA 2WZR3 3WF0A 4GB31 3PVOA 2GNMA 3HNYM 4DINB 4GMP3 4WM8A 3MEPA 2WL1A 5DDJ2 1G9AA 5CG9A 3NNLA 5C70A 3BVCA 5CFDB 4G3YC 3WHUA 2P3YA 5T3NA 4PI2A 4NMIA 2WO7A 2DU1A 3PMEA 5JZGA 1H9PA 1WGPA 5FZKA 2YGMA 2DWRA 3ZLIA 4XF3A 5K4LA 2J7MA 4BWOA 2HWF2 4P00B 3CEWA 4O65A 2ZGTA 1CQ9A 4EN0A 1FV3A 1V6OA 4JRLA 4RHV2 3AMMA 3OF1A 1NZCA 4MGYE 4YZ3A 5JUVA 4HKLA 1XNCA 4LBJA 4RN5A 3N9QA 4HKOA 3SEPA 2GH2A 1LOFA 1EYBA 1AX0A 1N1TA 1YCIA 4FP3A 1QNYA 1WMDA 1AXYA 1O3TA 3Q8CA 3A0NA 1RGSA 2GNDA 2WNUC 5SV8A 2K46A 4CCEA 3WF4A 2WWJA 4AFCA 1CAWA 1W6OA 1WLTA 1FOD1 2V4AA 3HQRA 4GH4A 3TB0A 5I0SA 3W58A 2K0GA 1U12A 3OD0A 5A6XA 3MV01 3MW4A 1VBE2 1K42A 1KS4A 1VBD2 2WFF1 4XAEA 1NCRA 4CUGA 3PNAA 1W6MA 4UFMA 2P34A 4YZ1A 1W8UA 2XJQA 3LFMA 5DMYA 4IV1C 3GZEA 4DNYA 1TQ5A 2Y38A 5CFDC 1SBFA 3HPNA 5L9VA 1RHI3 1GNZA 2CWMA 2X5IB 4Y1ZA 1FNZA 4IGPA 3GZUC 1C3HA 3MW3A 1VRH3 2D6LX 1LGNA 5H9RA 2WUHA 2ZEYA 4XFIA 1V00A 3WCRA 2WWSA 4E9KA 4IEUA 1EV12 1O91A 3MZHA 3Q9OA 1W9SA 3ZYIB 2PHXA 1VMHA 2VZ3A 1OKOA 3GJAA 1BVVA 1RXFA 4HN0A 4TWTA 2XKPA 3M2MA 4NIIA 3S30A 5C33A 1QDOA 2KR2A 3Q8AA 1KQRA 4LKSA 4R9DA 5FZ4A 1DQ5A 1KJLA 3MUZ1 4XJ9A 1JYWA 3ZFFA 3FC0A 3TWIA 2PTMA 2B5HA 5IAVA 3ST7A 2W46A 2OUHA 4NWWA 4B4QA 3N9PA 2EIGA 1NT0A 2CV6A 1DGWA 1UMZA 3NO8A 4IEQA 3B3QE 3VZNA 3VD9A 2R063 3AFKA 1OH4A 3GF6A 1W9WA 1MQTA 2D44A 1SCRA 4NRPA 2ZMNA 2IXLA 1XYNA 3Q8BA 1R083 1W6QA 2YC0A 3POSA 4Q1RA 2VQUA 2BPA2 1SFYA 1J3QA 2HWC2 3ILFA 4OQ8A 4CDXB 1GYKA 1ACCA 4LUKA 4BISA 4DXTA 1ZRDA 1RUOA 1XYOA 2BFUS 1KFXL 1MS5A 4PCRA 1ZZBA 3E6BA 4XFAA 4JTNA 3AZXA 4I0BA 4QPIC 4GKYA 3P6BA 3V0AA 1SLTA 3THPA 4Y20A 3R6SA 1RUJ2 2G9GA 4TN7A 3VBFC 3T2QA 3IIIA 5KXEA 1GWKA 2AUYA 1VRBA 2A3XA 2FBEA 4KU7A 4W4ZA 2A3YA 4YM2A 2YGLA 1CWPA 2JWPA 4L11A 4N9HA 3RZKA 1OQEA 2O1QA 4N43A 1U5XA 5FZ0A 3PTRB 1WKYA 1WUVA 1ULGA 2BEOA 3I3DA 1VR3A 2Y8KA 3H8OA 4MYEA 1W28A 4PJYA 1UYZA 2VZSA 1N1VA 2OYZA 1LCLA 1W2TA 4Y24A 1P8JA 2OQ6A 5IVVA 2JIJA 1UU4A 3IIAA 3NJXA 2YBKA 3I3QA 3G7DA 3AP6A 3PUAA 3M1HA 3VBSA 3R05A 4BLJA 4OHYA 2RMU2 2ZX0A 4CUCA 3HT2A 5FV3A 1A3KA 1QH7A 3D8CA 2QQNA 3LF7A 3WF1A 2RS52 1NA1B 3T0AA 1VALA 1LRHA 2AGSA 4QPGC 3BKZA 1H6XA 2EICA 4NIGA 3GBGA 3C7FA 3RZJA 1HN0A 3N35A 3ZOIA 4DS0A 4RR3B 2HBTA 2RDRA 1NYWA 1QJU3 1CIYA 4XCAA 2NPIA 1KS5A 2NMNA 4XJAA 4DUXA 1VIWB 2Q1FA 1NCQB 3OSDA 4LHKA 3Q8FA 4UW5A 5I8TA 4B4PA 1UNBA 4BQ5A 4LPLA 1DYOA 4YW4A 3GBWA 1AYN3 1ENRA 2Q0AA 3E1F1 3OPZA 3IN9A 2ZTNA 4M0HA 4FTBA 3BYWA 3BB6A 3ZFEA 2EXIA 1VB2A 1W2NA 1YXWA 2VZTA 3E5QA 3MV11 4PBOA 3S57A 2ZGLA 1UX7A 1XXNA 5FZCA 2X10A 2PHTA 1ND3C 2BRTA 4XTPA 2OXBA 3ZN6B 4JTOA 3ZN5A 1WA4A 4LXLA 2YBPA 4UAPA 3AYEA 4CDUB 1Z7S3 4PBPA 5FQ0B 1POV3 3ZYHA 2VCCA 3RRDA 2GP5A 3KT1A 4NPRA 2B9UA 4YW7A 4IE7A 2IWGB 2HWE1 5IK8A 1BK0A 3QH6A 2ATFA 1UYYA 1XE0A 1GV9A 2ZCWA 4E8DA 4DFSA 5JCTA 3ZXKA 4J6GA 4LO4B 1RUNA 5ACA2 5IVFA 4F3JA 4OHVA 3SXWA 5AFEA 1OSGA 3FL7A 1W6NB 2HEVF 4RS5A 5FKBA 3VKMA 4AVVA 1IQAA 4B7KA 2XBO2 1OOPC 1V6NA 3IDBB 4P08A 2G4IA 4F8AA 1DQ0A 2R6QA 1UOGA 2RS31 2ARBA 1XRUA 3SH4A 4CCCA 1AR92 1NCQC 5A70A 3K46A 1H8TB 3DV8A 3GXUA 1UOJA 3M70A 4XEZA 4EN8B 2F4LA 2D6PA 3GALA 3I2KA 2ZHNA 1HJFA 5ABJB 3TEYA 1MS1A 4CYDA 1BBT3 2P3JA 2SLIA 2Y64A 1LU1A 1ZBE1 1MEC1 4AR2A 3O1OA 1E5SA 1PZ7A 3TBDA 4COYA 3POGA 4GB32 4GMP0 4A41A 1GWMA 2Y6GA 3PU8A 4CDUC 3MDPA 1F8VA 4OHXA 1XNAA 5E16A 2QVSB 4HK8A 2QDRA 4EN9B 4JGYA 2OZJA 2YROA 2UYAA 4FTSA 3ZYPA 4IV1A 1IKQA 1B09A 1DYKA 4DEVA 2V09A 2NLRA 2DYCA 2BBVA 3VV1A 2JE9A 3DPRA 2KA3A 1EP0A 1I5ZA 2ARCA 2DTWA 2JG8C 4U36A 4AEDC 5KHGA 2WJSA 1FYUA 4PLMA 2E7TA 3HJRA 1RJ8A 1URXA 1LOBA 2ZGNA 2WA3A 2OPKA 2WNVA 4ZXEA 2UURA 3ABZA 2Q8OA 4OI4A 1YI9A 1WCUA 4AEJA 3LGRA 1C8M2 1JXNA 3I2IA 1POQA 1V6MA 4LHSA 1C57A 3M3QA 4H7LA 4M4PA 3AK0A 3PIJA 4QGMA 4XBNA 4XOGA 3I59B 3KCCA 1NQDA 2AENA 1H9WA 3ACGA 4AQ6A 4JQTA 5KHIA 2VTFA 4Z8BA 1K5MC 2P4EA 3VBRC 1LHVA 4M01A 3PLQA 5JIAA 2DCZA 1HB4A 4PDWC 3RYPA 2XDVA 2ZA9A 2ZGUA 2FDJA 4M0NA 4MO3M 3AL5A 1S2KA 4P5YA 2EF6A 2BP6A 3JQXA 1UY2A 3KGZA 3WDYA 1WMEA 3HT1A 2EIDA 2WZEA 1QJX3 2FZ2A 2K2SA 1MR5A 2YMZA 4QPIA 5FMDA 2E31A 2W68A 5FYHA 1ENSA 1DGLA 4BB3A 4MADA 4SBVA 2BWAA 3K75B 1WZXA 3WNNA 4QU1A 1GU3A 5FYVA 3VBFA 1QKQA 1H2NA 4AG4A 4XBQA 2E9QA 4FXGB 1JW6A 1N47A 3AMHA 4AWDA 4TXWA 1IS5A 3TRSB 4ATEA 1QJY3 2ZEZA 3QOPA 2J1SA 4IXLA 3VHNA 4YG0A 5BNQA 1PIV3 3VD4A 1F5JA 4K1YA 4URTA 3VN4A 3ZX7A 1UIJA 4QGNA 5CKQA 1ZREA 3E5XA 1WW6A 1AYM1 1O4YA 4MHRA 3D6EA 1CR7A 1HRI1 1CZTA 2CAVA 4ES8A 2ET7A 4A45A 1R64A 3AP5A 4XC9A 5DAXA 3FE5A 5KXCA 2GC0A 2JG9C 2B39A 2C6SA 3LFIA 3FWEA 3IWZA 2GSYA 4NAOA 3O14A 3O5SA 5T52A 1DG6A 1OH3A 4XXAA 3U4SA 3WR0A 1QH6A 4QXHA 5ISLA 1CPMA 2HH9A 1UF2C 3CJIC 1FV2A 3LE0A 2C5DA 2IFRA 2XUEA 1ULCA 2RG4A 5FY1A 4KH9A 3M8LA 4YVSA 1TMF3 1OF3A 2P5BA 3OCPA 1YEWA 3NV2A 1UY3A 2DVGA 3NAPB 2Y6LA 1L7QA 3RJ2X 2R0FA 3INAA 2YY1A 5FYZA 1Z0HA 2DDUA 4YFZA 2HWF3 2CGNA 5FZBA 4EZHA 3D3AA 3MIEA 2PLV2 3WG1A 2DVBA 4L99A 1PGW1 4A42A 4DUVA 4RHV3 1O3QA 4QX1A 3ACIA 5D8AB 3O0WA 2AC1A 4NE9A 2RR12 2VUDA 2DCYA 3CJXA 3GGLA 1UX6A 3SCFA 1JI6A 4YWAA 2ZGPA 1AL23 1UO9A 1TNRA 1ULOA 2WDBA 4NHYA 4R8HA 5AC92 3CU7A 2I74A 2GU9A 4MGQA 3WDTA 4YARA 2IZWA 3JB8A 2PHDA 4N90A 5FP9A 1CGPA 4H7MA 3HNMA 5TSWA 4EV0A 4GWIA 4GWMA 5EYYA 3RZZA 3U75A 3VKOA 3OBZA 1YJLA 2VMEA 1ODNA 2W87A 1C5IA 3CZJA 4QB1A 3WZ1A 3I2OA 2QDNA 3C8XA 4KMQA 2NN8A 2JJ6A 3B5LB 1U5IA 2W08A 3ACLA 3ETPA 4Y4YA 1K3IA 1H1IA 2J1EA 4BM8A 2JXAA 4RQPA 4XJZA 4AZZA 2HYKA 4LO6B 4D6SA 3T2PA 2WLQA 4YW1A 3NJYA 4RGGA 5F5IA 2VU9A 5LWBA 1EPZA 3O0VA 4I01A 4IEWA 1W90A 4LHLA 4HSJA 4LO5B 1MZFA 5JI7A 4COWA 4IERA 1J1LA 4LMFA 1EV13 2GALA 4ITCA 3LSEA 1HLCA 1WMXA 3RYKA 4DEQA 4FPYA 2C26A 4P9JA 3JCIA 1SLIA 2G1MA 4BA6A 3TNPB 1FI2A 1PO23 1UOBA 3N7KA 1QGLA 4MOAA 2Q1ZB 2WQ4A 5DAWA 3ZDSA 1QQP2 2OX0A 3WEZA 4BPZA 4IEVA 4X8NA 5CU1A 5F5QA 5FYCA 2JD4A 2W95A 2G9FA 2R16A 5FZEA 1REEA 3GCXA 4HMZA 3USUA 3EYPA 1UZZA 1POV0 2CDOA 1FAYA 3CKHA 3PMSA 2R071 2GH8A 4ZS2A 3LPGA 1NAEA 4UOJA 1AHSA 5A7WB 1V70A 1W8TA 4N8MA 5JSOA 4S2HA 1PO11 2A71A 3DYOA 3THTA 3TN93 4EYUA 3RZMA 3AP7A 4Q8LA 2PMWB 3SNMA 2HWC3 4GKXA 4IEOA 4CEYA 2IXKA 3LD8A 3OUJA 3BOWA 4P5HA 1D2QA 4AAPA 1JYIA 3KD4A 5C3RA 2VOXA 5J7MA 1DFQA 5GZEA 1N3PA 2W9XA 4CCDA 2ZEXA 3LB9A 3PVEA 4LBKA 3OGRA 5DZEA 4BQYA 4ET7A 3J26N 5JZGB 3POWA 3U37A 2WQZC 2B46X 2XB6C 1XOYA 3UJOA 1SG3A 1MPXA 2RS32 2GMEA 5FAXA 5CADA 1NXD1 5D21A 1JYCA 2ZGMA 3URFA 1GUIA 2ZACA 4NO4A 2NP0A 4J1WA 2BGOA 1MZ6A 1QNWA 4JHTA 5HI0A 3LEMA 1F5FA 1KITA 4ONUA 4P9IA 2OA2A 4RD7A 4EJRA 3WSOA 2RJ2A 1I5PA 2D97A 4CCJA 3ILRA 5D1IA 1ZBE2 1B35A 1R091 1MEC2 1XJAA 3H7JA 3H8UA 4JKMA 4COUA 1X82A 5FO7B 2I45A 1EPWA 2JB4A 4P9WA 2OIIA 4TSVA 4XF0A 4XFCA 4ES9A 5FPXA 3RZGA 5GLUA 3T4HB 5FP3A 4IV3A 3ETQA 1CAWB 1W6OB 1X9TA 3OUHA 2W0XA 1OLRA 2O14A 5SV5A 4CP9A 3T4VA 4EWAA 1VP6A 1HDKA 1NCRB 1N3QA 2E53A 3PTYA 4OMCA 3N9LA 3I7DA 3WD5A 3WW3A 2CYFA 1NE4A 2ZAHA 1PMHX 1Q8QA 1AUYA 3MPPG 5IATA 2WT1A 4LJHA 4AFBA 2ORZA 1RXGA 2WA4A 2JD9A 3WQBA 1OA3A 1RTVA 2QUOA 5E8AA 4D8MA 1PK6C 4V1PA 5EYXA 4K40A 5A6ZA 1JYXA 4WM7A 1X36A 1OKQA 2EXHA 1RUE3 5GALA 3B01A 4A44A 3AYDA 3ON7A 2YU2A 2J1AA 2BTVC 3ENRA 2D93A 3R4SA 4META 1OURA 2VUCA 5C8CA 3DKQA 1KFUL 4QT6A 4O61A 4QXBA 1UY4A 4UXAA 3RMYA 3UL2A 4N7UA 4BU2A 5F32A 1S0GA 1REDA 1LODA 4YW2A 4UBGA 1RMU3 5LASA 3RMXA 3ZFFB 1G7YA 5APAA 1WCQA 4RSUA 4XURA 3O1VA 3ZXAC 1SQ4A 1V6JA 1FPN1 3B93A 3E97A 4DY5A 5FP4A 1HV0A 3NV1A 3ZM8A 1ULFA 3VBUA 1Q8PA 2RM22 3DGTA 1MQTB 4CVUA 1V9U3 2P1BA 4UW6A 5GZGA 1HN1A 1H4GA 2AR6A 1W6QB 3OGGA 5DZGA 1XPWA 3O1PA 2VCBA 1RUC1 4JDMA 4A2UA 1MS9A 3HR9A 4Q4Y3 4QX5A 5T5OA 5A7PA 3PUSA 2RDSA 4NHMA 4CDWA 4HVRA 5K7PA 2WINB 1GR3A 5K0UB 1VB4A 2PXJA 4KI5M 3ZIWA 5ACA3 4UT5A 5BNNA 2GC3A 2BOJA 1DF0A 3USSA 5CA6A 4JDNA 2XKOA 1VBA1 2LTNA 2YB7A 5T5LA 1JZ5A 2XBO3 1BYHA 1OQDA 3RWNA 1Q8SA 3TEZA 4Z07A 5CKNA 1PGL2 5BNOB 4AE2A 4Q4X1 2JICA 2Z2SB 2Q8CA 3VBOC 3SISA 1IPKA 2XJVA 4N43B 3KLSA 5FZGA 2OT7A 1AYM2 5IK5A 3RZLA 2P3KA 3B94A 4GZ9A 1R1A2 1SZBA 1ULPA 3AB0A 1ASJ2 1GMMA 1BK1A 2ZX1A 1G9DA 1DGRA 4QM8A 3NNJA 3ORJA 4MLOA 5KR7A 4AI8A 2HBUA 2EA7A 1EAH2 4CU8A 1OI6A 2UU8A 2ET1A 4LBQA 5A80A 1F15A 5HXVA 4WVVA 4K8RB 5GLZA 2QE3A 4LULA 4D94A 4AFMA 5CFCA 3VBSB 2WRAA 3N4MA 4BK4A 2VD7A 2VQ0A 1ZZ9A 1VBB1 2EXJA 3POYA 1FX5A 2QQJA 1J3RA 3MI8A 1XC6A 3FHQA 4YFWA 4YSFA 2GZWA 2Y6FA 3ITQA 1DQ1A 1WBLA 4LA3A 3DF0A 2VMDA 2PHLA 2WKKA 2Y6JA 2DFBA 4XXPA 1VBC1 1LENA 3TN92 5K0UC 3VZOA 3KF5A 2OQ7A 3WF3A 4G9SB 3Q8EA 1PGW2 1BEV2 1ZM1A 3ALQA 5IK4A 4RFT0 1IS4A 4OYUA 4INDA 2VZPA 2YV8A 5GZFA 3MFAA 4MXWA 3J4UH 4UFIA 5BNOC 4NROA 1C8M3 1D0GA 4ZXKA 1MVEA 1NY71 4AHZA 4LTAA 1TME3 1AR71 2D3SA 4LUMA 4NJ4A 5A7SA 4OI0A 1S0FA 3MUY1 4NUBA 5DN2A 3ZFEB 2P2KA 1IPJA 2D43A 2JDPA 1RUH2 1PVC3 3JB4C 2J1TA 2PHUA 2P17A 2XMLA 1M06G 3H7YA 2ZBJA 2QQUA 3JXSA 5FZMA 5HBAA 4K8FA 3WNKA 2BQPA 4OHWA 4DRRA 3T2OA 5KXDA 3UNPA 4B4RA 3TEXA 4BCUA 2R043 2ENRA 1KJRA 1YQ2A 3HBZA 2WZPP 1UW8A 2WQ8A 2ZKNA 4XDQA 2GAUA 2RS11 1JHNA 4CP2A 2ZMKA 2VMGA 1S0EA 2V5YA 2VZUA 1RUI3 4Q5OA 4Q4W1 1GOGA 4RS5B 1ND2B 2GN7A 3W9AA 2P37A 4L92A 3JD72 4RA0A 1COV1 1YIPA 2KXLA 5C3SA 3VDDC 5FZOA 2XJPA 4ZU7A 2R30A 2VQAA 4NR1A 5IWFA 3SC7X 4CXWA 1HKDA 1YYNA 3WW2A 1JU4A 1XE8A 2BJSA 1N1YA 2VOWA 1QOTA 1LB2A 1NLQA 3KV9A 3W59A 4PLOA 4Z2AA 3KCXA 5IAXA 3J8F2 2R072 1LU2A 3EMRA 3FN9A 3CQOA 4KWUA 4I0WB 1PO12 2YPJA 2ZXQA 4LKDA 1AR61 2CGOA 3KHBA 3T1LA 2A75A 5DG2A 1UU6A 4QQOA 1F35A 4CCNA 4DIQA 2PELA 1T2XA 3DECA 4JGYB 1HXS1 5BY5A 1SEFA 1VMFA 4L9BA 3F2ZA 5CKMA 2A70A 3T08A 4W6XA 5A7NA 5JXIA 4N53B 3DPRB 1QHDA 1GP5A 5FY5A 1EUUA 5FUIA 2GDFA 3FMGA 4YGCA 3CHXA 2DF7A 1V6LA 4DO0A 3DCQA 5AVAA 5FZ9A 1SLCA 2WNVB 3AZYA 2OKXA 4JGZC 4QB2A 3S5AA 2HWD3 4QM9A 3ZFGA 4R4XA 5JI9A 5A1FA 5BPXA 5F9TA 3LIGA 1G8WA 2PLV3 4UFJA 3ZYBA 5F37A 1O5UA 2L9LA 3IM0A 2WSUA 4FAGA 5FZ1A 1R092 2RR13 4XMIA 2HWB2 3N7MA 3OG2A 5A33A 4Y1VA 5LBCA 2QQWA 1SHWB 5BNPB 3H8XA 3VL8A 5AC93 1PZ9A 4BXSV 4JRAA 1RVF2 3K4AA 3VD3A 1W8ZA 5HV0A 2J1RA 4FFFA 4KBBA 4E8CA 1ZBA2 4W6YA 5FDBA 2UYBA 4AI0A 4LO7A 3WUDA 1D4M1 4DXZA 4GD4A 5LY1A 1QXRA 2Z4FA 1CZSA 1HRV2 2AACA 3OGJA 4PT6A 3ZXJA 5LEKA 5FP7A 1Q3EA 2YHJA 3LA7A 3LQCA 4EZ4A 4D3WA 2DCJA 4OFGA 4I02A 1W2UA 1FMD1 2VC9A 4AFAA 4NPMA 3AL6A 2BWCA 4MGIE 2AEZA 3CLPA 4HANA 3I49A 1JUHA 3NWKA 1KGYA 3V0BB 4YPJA 3BODA 3U07A 3IPVA 1LGBA 4Q4V1 4K9SA 3C3VA 1LULA 4QHBA 1L7LA 4QKDA 4YRDA 5IYYA 3NKGA 5JOWA 5KHHA 1QY4A 2XH6A 4QWNA 2WZR1 2AZ5A 2QQVA 1LJ7A 5A7OA 5A3NA 3ZYJB 4GMP1 4WVZA 5JVVA 2VZRA 4XPVA 3OYWA 4UW4A 5FYUA 3P5BA 2CHHA 3E6DA 4CDQA 4ZZ8A 1AL0G 2X5IC 4JHZA 4RGKA 5IT6A 5HCHA 4AHWA 4ASMB 4IGOA 1FPN2 1QQP3 5BNPC 1ULDA 2FCVA 4FPFA 5GJ6A 3WP3A 1A78A 3WNXA 1O6UA 1XNBA 3I54A 4XJUA 5HCAA 5L7OC 4GA9A 1YQ8A 1IGOA 4ZY9A 1RUC2 2ZKLA 1JZ7A 2A73B 4Y33A 1WMFA 3AYAA 5FMCA 3U14A 2XWJB 4RYDA 4E27A 2ZEWA 2TBVA 2GMMA 4SLIA 5JAXA 5JIUA 1VBA2 3I4IA 2A6YA 3P1IA 2VXRA 1LGCA 2PN5A 5L19A 1JOJA 2FCTA 2P6CA 4FPHA 4Q4X2 5GLTA 3EQEA 4S2GA 4GWNA 4IQPA 2D6MA 4CDXC 3SH5A 1ENQA 2NM1A 1ENXA 2CAUA 1AR83 1UZWA 1W0OA 1TVGA 2B7YA 3WQ7A 4B3NA 5KBFA 1LTEA 1RUG3 2WBKA 1W6PA 2ZGKA 1D7PM 5GLVA 1RHI1 2MHFA 1ZNPA 1DZQA 4YLZA 2BW8A 1VRH1 3MFCA 4FVVA 5IFPA 3LPFA 5JWPA 2XQXA 1JZ2A 1ST8A 2XPJA 1JS9A 3HOBA 1NX9A 1BHGA 1SMVA 1S0CA 2WYFA 4ZHNA 2VR4A 4YG6A 1C4RA 2QNKA 3KV5A 4YVWB 2ADEA 1S2BA 2D3PA 4RQPB 3WV6A 1OHFA 1UMHA 5C4WB 3M3CA 1XNTA 4F7ZA 2FDIA 1UD1A 1YNAA 2G9ZA 3ACHA 3WDXA 1OPOA 1BZWA 2WNOA 3HEIA 3I2HA 3POIA 1BCXA 3O1SA 5AVPA 5A3TA 4HFSA 2W2IA 3EJKA 4C91A 2DCKA 2AYHA 5I0DA 3PDQA 2R061 1IHMA 3VDDA 2R1BA 1XQNA 4J25A 2WS92 3JQWA 4CP1A 1R081 4TTGA 3NNFA 1OC1A 4B8EA 4L2NA 4S2DA 4C1XA 3NJVA 5J96B 4GXLA 4QQLA 1VJ2A 3ZPYA 5JSPA 3HIFA 3OD4A 1NLRA 2CSGA 3HVDA 3SCHA 1W0PA 2H6CA 2VZ1A 1NA1C 2X29A 1YLLA 3GDBA 4ISRA 4KGQA 1JZ6A 4Z92B 1XNKA 4C1WA 3USUB 5FPLA 3I3EA 4AEMA 1KRIA 4RR3C 1W8WA 3AKRA 4QAWA 3DL3A 1BMV2 3I8TA 2JENA 2RM23 2WWUA 3ZKUA 1CD3G 3ZXGA 3BTAA 1Y9GA 1JH5A 2RS12 4EQVA 2Z5WA 4CEYB 1RITA 4YVWC 1DQ4A 3EXUA 4IE4A 3M3OA 4R4ZA 2XOMA 5FXVA 3DUIA 3BTZA 4AEKA 3ES1A 4Q4W2 3ZXEA 4CCLA 3OY8A 2RE9A 3SMHA 1D2SA 2MEV3 2WNUA 1COV2 1L3JA 4QB6A 3UKNA 5FLIA 1CAXB 4M3CF 3T3YA 1TEIA 1LOAA 5FMOL 5FZFA 4KWJA 5A7QA 4AFDA 4NVPA 4CCKA 5DUUA 1YC61 4K1ZA 4A3XA 2DUQA 1K5JA 2CWSA 2LW8A 2WZ8A 3OB8A 3KGLA 4Q27A 2FD8A 4DXSA 2RJLA 1K12A 3WDUA 5CAZA 3KVBA 5CFDA 1MVQA 1JOBA 3QD6A 1HQNA 3JBG3 4GULA 5JMOA 2Q4SA 1B35B 3VDCA 4CU7A 1UPSA 4P9YA 1R1A3 3VUOA 1I1EA 1ASJ3 3WOGA 3U4XA 3W5MA 3BPSA 5DPNA 4AW7A 1QJFA 3A0KA 3O1TA 4A7KA 2GP3A 4H14A 1EAH3 1QXPA 2XQRA 3KHCA 4IV3B 4A7YA 4COVA 1GOFA 1RUF3 4WVMA 1HXS2 2VW1A 2D7FA 1QJU1 1H0BA 5ANQA 3ZO0B 4CP9B 1REFA 1IPSA 2WN2A 1JOPA 4DXRA 3FFZA 1H8TC 5IVJA 2PA7A 4ARXA 5CBLA 1OT5A 2KM2A 4FOQA 4UFLA 1QJZA 1AYN1 3POJA 5ABJC 1RUD3 5JMCA 2W39A 3B7MA 2BVVA 2RDQA 2WO2A 1FOD2 4QX2A 1G86A 4CEWB 1Y4WA 4EE2A 1HX6A 2JDYA 3KQ4B 1XSQA 2WR9A 4NN0A 4AXOA 3ZMOA 4WM7B 2WFF2 4GJYA 1WD3A 2N7GA 1BEV3 1UWWA 4GIQA 1PM4A 2X53S 4ASKA 5FRAA 3TEWA 1Z7S1 3JUUA 2JKBA 3ZMNA 1POV1 4COZA 5C9AB 2VZOA 2W91A 5H9SA 2ADDA 3I2GA 4I3PA 1O5LA 3K4DA 4ARYA 1I6XA 3POBA 5EZWA 5KC6A 3KS7A 1JUIA 1GSLA 3WDWA 3DYPA 4RGAA 1RUH3 2PQQA 4YW3A 5C3PA 3OBAA 3GZAA 1LEMA 1W2OA 2BNMA 3AMPA 1RC6A 3PUQA 5DUXA 4CU6A 5EIYB 5E6HA 3FZ3A 4UFHA 1ZYBA 3WQ1A 4CU9A 2NZ9A 2VVEA 3T0BA 3WLUA 1XB9A 5JOXA 4HBNA 3S7IA 3MICA 4QKNA 4AAXA 1QWRA 4CUAA 3WF2A 1UN1A 1BKZA 2VOTA 3WP6A 3BIWE 1AF9A 2BERA 2W1SA 4Q4V2 5BNNB 1BBT1 1OA4A 1QOOA 4ISQA 4D7SA 1IS6A 4CEWC 2LM3A 4GAZA 1V6KA 4LOSA 2ZGRA 4MG2A 2RV9A 3JD73 5LW9A 1UKGA 1SPPB 2VPVA 2DCTA 4XYXA 3AP4A 5E88A 3I3MA 3VBHB 5FZHA 1WA6X 5DDJ3 2DBNA 4NHKA 4R9AA 1H1AA 5F3EA 1QXJA 1UPIA 1Y7BA 5IUQA 5A3LA 4IE5A 1JHJA 5J37A 4QPGA 3QACA 4FO9A 5JR7B 3WG3A 1KEXA 2VBBA 4ATFA 3IZOA 3J8F3 2ZHMA 3MBWA 3NVCA 5F5CA 3TAYA 1DLLA 5LRSA 5DUWA 1CONA 2PAMA 2RVAA 3QCWA 1VAKA 4OCTA 3O7OA 2VOKA 4BYYA 3AMNA 3IDAA 4TLFA 1VPHA 3RFRA 3VHPA 1BXHA 1GWLA 5CFCB 5J3UA 3AKQA 4QPWA 5KHKA 3LIHA 3LZZA 2ZABA 1IS3A 3WP4A 2FCUA 4D7TA 4H3WA 1E5HA 2WNEA 4XHBA 5A1AA 3E6CC 1GFF2 4B1MA 3IAQA 2ZZJA 1ND3A 2RDNA 2XGXA 3SHRA 2F4PA 5FYIA 5K9YA 5ERLA 2QQLA 4E4ZA 1YI7A 1H8VA 3OPWA 3LEIA 2BGCA 4QHOA 3VZMA 3NNMA 4MXWB 4AI1A 2QZ3A 5FO9B 2JDKA 1VBE3 2B9VA 2EXKA 1VBD3 3H0OA 5FZAA 3T2TA 4C0BA 4IEXA 3VL9A 5LBBA 4AGRA 5I8YA 5C5UA 1RHI2 2VL4A 4HN1A 1QJX1 3H3UA 5DUVA 2IXIA 2ARAA 1RYYA 2HWB3 3O12A 1UZYA 3NAPC 2JDAA 1QDCA 3LDBA 3FUOA 1PZ8A 3DN7A 1OOPA 2YXSA 2PAKA 4QGLA 1D0HA 4CE8A 1QF3A 1RVF3 5HCFA 5FBZA 2ORXA 4AVAA 5FPVA 4LIVA 3SITA 5L73A 5I0RA 3KF3A 1ZBA3 5IHRA 5LA2A 5JR2A 1NCQA 5FYBA 3KWVA 5D8AC 5IVYA 2DVDA 2R49A 4S2FA 1QJY1 4KGGA 2B4KA 1HRV3 3BU0A 4A6SA 1PIV1 5GZDA 1PM7A 4LBMA 5FP8A 1C28A 5IVEA 5F6LB 1AJOA 1W0NA 2BGPA 3CIHA 4LQRA 3CF6E 4Q1PA 3ZN6A 2R062 1JYVA 2DBIA 1F4AA 1N1SA 5FTTC 4CZSA 3MIGA 2OUJA 5FIXA 4CDUA 5BYNA 1R082 1O7FA 3MGUA 4UBHA 4AVCA 5FQ0A 1C5HA 5FZOB 5B4NA 2HWE2 2DVFA 4WM8B 2YC2A 5JPNB 1DCSA 2NMOA 1OLME 1OVPA 1UOFA 1ZZ6A 2C1FA 2VULA 2CDPA 5F3GA 2JG8A 4AEDA 2VNGA 1W8HA 4YZ4A 4IEZA 3PUHA 1TMF1 3NL1A 5T50A 2D6OX 4DB5A 3B9IA 2UWAA 1RUJ3 5BXXA 5JOZA 3AJZA 1JTZX 1O8SA 3KB5A 3WXPA 5FFOC 1U0AA 4AOCA 4XDPA 4YW6A 2HWF1 3FHIB 3AKSA 3UGGA 2YG0A 2F17A 3WNMA 1S0BA 5FY8A 3AJYA 4RHV1 4Z1VA 5BUVA 3I2DA 3ZSEA 4O9GA 2XL7A 5HV4A 1YQ6A 4MGSA 2CTVA 3MIBA 1K5MA 1AL21 1IQDC 2EIBA 2V73A 2WO3A 3B00A 3I2FA 3I97A 3OEAA 5FXWA 3U11A 2QCSB 2VM9A 4BJ0A 4DRVA 3T09A 3IDEA 1AXKA 1H30A 4PDWA 4QD2A 4XACA 1XBFA 2AH2A 4PQ9A 4TLGA 5A3PA 1PNGA 4MVTA 3B9CA 1S55A 1JU3A 4OLLA 4BE3A 4GH4B 1ZZ8A 4QQPA 2HEWF 3HD8B 5FMBA 1ZZCA 5DG1A 2NQYA 3KT4A 5K8SA 4QX7A 2JKXA 3LCPA 3D82A 4WM8C 1W6MB 3W21A 3ASIA 3KMHA 2RMU3 3LEGA 2XJUA 1KDKA 4OUSA 4HETA 4FT8A 4W6WA 4XQ4A 5IJRA 2E32A 2RS53 3U1XA 5A33B 3CBNA 3VKFC 5JZGC 2W5FA 4LA2A 2WYSA 4M3CE 4YM3A 2IXJA 4I09A 2YYOA 5JSRA 1QJU2 5A1LA 1CX1A 3LA3A 2JDZA 4KQ7A 3SQOA 4AF9A 2C24A 1WLDA 2W92A 4W8JA 1EV11 1AXZA 1NQJA 4QDRA 4AK3A 1JMUB 1UYXA 2FDFA 2YFUA 3NKTA 5LBFA 5LBEA 1PO21 1DIWA 1LOFC 1OLMA 2VVFA 4HVOA 4YZ2A 2AEYA 2Y33A 2QQOA 3MPBA 2VNVA 1G6NA 4X6RB 2JG9A 1UZVA 2DUPA 3ZPOA 1ALYA 1CVNA 1UCXA 1JZ8A 1HIXA 4OQ9A 1Z7S2 4JCKA 3ZDVA 3D5OA 1PVXA 1O4ZA 4FFGA 3RQ0A 4LOTA 4GH4C 3TOJA 3KV4A 3U10A 3NQHA 3RSJA 1S0JA 2WS93 3CJIA 1NCRC 3TN91 1W04A 3J7LA 1Q8OA 3O1UA 2HWC1 1NLSA 3IT8A 1G9FA 1APNA 4CDQB 3KT7A 3RPQA 3V0AB 2A6WA 2W94A 4JC1A 4CCOA 1GZWA 1NZIA 2BFUL 3C7HA 4UI9L 1J84A 4XFFA 2E7QA 4Y20B 1OUSA 3ATGA 3ROUA 3VDAA 3TYJA 2IC1A 1DQ6A 2FDKA 4XIKA 1H1MA 3MLKA 4XW3A 4JV4A 2BNOA 1WLWA 3PURA 1LECA 1K45A 4X8PA 1YQCA 3PUIA 3JZVA 5KXBA 1Y3TA 4OZXA 5JDBA 3SEEA 3QH7A 5CEHA 2JB8A 5J1XA 4YGDA 1WW7A 1XNDA 1US3A 1S0IA 2LALA 1AR93 4UF0A 5LA1A 1QOSA 3RWKX 3H3LA 4ZZ5A 3A21A 1AVBA 1GOHA 1HRI2 5LY2A 5B4XA 2VCMA 2TNFA 4MHUA 1BBT2 3ZFFC 3PU3A 1ULEA 2WT0A 1GZCA 1I9RA 2CY6A 3RGBA 4M3CA 3POEA 1W3XA 1NKGA 2W1UA 2IVJA 2FQPA 4XUNA 5LB6A 4Y4RA 2VUAA 3DXTA 1MQTC 1SFNA 4GB33 3WY6A 2W52A 4L8QA 2ZOEB 3K3OA 4DZGA 1UIKA 1W9FA 4LHNA 1YFXA 3M3EA 4Y5TA 1W2AX 3MHZA 3NSTA 1NUKA 2G19A 3PJQA 2VW2A 1SLAA 3UT0A 3MF9A 4WV8A 1NE6A 4DMIA 4OI2A 5EQUA 1OD5A 4XQWA 4ZU5A 1RUE1 2H6BA 2D3RA 5T55A 1JN2P 4LT5A 2YUEA 1WLCA 5D8AA 4QDSA 4LBQD 2WSVA 4GQ7A 1LAJA 4MUVA 4N43C 5E89A 4OULA 1V0AA 3U78A 4EWEA 5C71A 5GZCA 4FTEA 4MGZE 2VMCA 1SLBA 4R9BA 5C5TA 2DFCA 1RMU1 1GNHA 2JX9A 2D6KA 1UXXX 1QEXA 1FOD3 2VCAA 3NRUA 4LK6A 4BHPA 3UESA 2OW4A 2WFF3 1DQ2A 3WW4A 3EB7A 1V9U1 1LNSA 2DU0A 5EFUA 5EJZB 3VBSC 1AZDA 2ZMLA 5FZDA 2QJVA 3FBMA 1D4VB 3UYJA 4Q2FA 3AZWA 2FDGA 3GHNA 4AVBA 2O8OA 5A3WA 1X33A 5HCBA 3PJYA 4Q29A 4Q4Y1 4XTMA 3ZYGA 4BQ1A 3WNLA 3PHMA 3MF6A 2Y6HA 3VLBB 2R32A 5FJKA 5ACA1 3N7JA 4A3ZA 4Y22A 4QU2A 2A3WA 2UY8A 2V4VA 2XBO1 1F4HA 1QJY2 2NYYA 5FY0A 4D69A 2ARXA 1PIV2 4FCAA 1QU0A 5ANNA 1UQXA 3WX5A 1A6CA 3AVSA 3MLJA 5I8SA 3VZJA 3ZFEC 1OBNA 5HXMA 3WNPA 3OY8B 3E5UA 5L9RA 3ZSKA 4BIOA 2WNUB 4BQ4A 1HQWA 3T0DA 4U2AA 1S1AA 2V5DA 1J1TA 3J9SA 4HONA 1WW4A 5FZ8A 3HNBM 1OMIA 2FHRA 4Q0PA 2O8QA 5BV6A 3ZXFA 1J58A 4UW3A 2DTYA 3H42B 4LK7A 5JXJA 1S2EA 4HXCA 5A32A 3UKTA 4IL7A 3UGHA 1PMJX 4IV1B 5C3QA 3RYRA 5JLVA 1HW5A 1TMF2 4Q0QA 4I2OA 1TZOA 3CDZB 2VG9A 4PQQA 4HVQA 2X05A 5F5AA 5EJ3A 1OF4A 3BTXA 4LNVA 2DVAA 2LUWA 4E2QA 2ERFA 1PK6A 2ES3A 3QLQA 1ND2C 2BUKA 3NW4A 1LR5A 1XE7A 4P9XA 4RS5C 5CNAA 4YGBA 1VLNA 1UAIA 1XU2A 4Q8KA 4HOOA 3OOXA 3HQUA 1Q5OA 4OHZA 2W47A 4WVMB 2HKXA 4Y1XA 5L7OA 3ZR6A 1C8M1 1AL22 2EAKA 2GC1A 3MYXA 4Z82A 4DUWA 3UETA 4ZPIA 2VE1A 2AREA 3K4ZA 4NHLA 1TME1 4I3GA 3S0MA 3MIFA 1W99A 4QKBA 5I0UA 4BIFA 4FSJA 2EALA 1CJPA 1T6GC 3LWCA 3PL0A 1LOEA 3VD7A 3LKJA 2JIGA 2ZJCA 3GJBA 2XJTA 1X8EA 1PVC1 2E51A 3VBRA 5FUNA 2O0OA 4EWDA 2ILMA 1Q8VA 1OLQA 3J7MA 2VH9A 1ZRFA 1HB2A 3RJRA 3IB3A 1PMIA 3IMMA 2JE7A 4JGYC 5EHDA 4FBFA 3PVNA 2R041 1BJQA 2XLGA 4NIHA 4AGVA 1CAVA 1OA2A 3OBRA 4QPIB 1GZTA 4N53C 3DPRC 5FLJA 4FPGA 1T6BX 3BGAA 4NRQA 4AQTA 2IXCA 1ZZ7A 3GNEA 3PIGA 4HG6B 5FZ7A 3VBFB 3L9JT 1RUI1 2YC4A 1PNFA 2WNVC 4HZFA 5LRRA 2J22A 3ZYRA 3AP9A 1IG3A 4QPYA 3HBKA 2XL9A 1CZVA 1GP4A 3VBOA 2CU5A 1XU1A 1PO22 4Y5Z0 4HLTA 3FHAA 1CESA 1SLLA 2GNTA 1S0DA 1YJKA 4AI3A 2JDHA 2VBPA 3ELNA 3K2OA 5CZKA 5F2WA 1F31A 2ETEA 2HYXA 1E5IA 4BLIA 3GZTB 4CXYA 4BH9A 2QQIA 4CCMA 4K3UA 5FY9A 4KWKA 4LIUA 3N7LA 4C0HA 5J09A 4ZKTB 5FYMA 1TE1B 5H9QA 4ORFA 2HWE3 3H9AA 4O9EA 2IXHA 5LA0A 4G4FA 4IESA 4QKFA 4P9LA 2RHPA 2H0VA 2W1QA 5I0TA 1O8PA 4YVSB 4YZ5A 2DURA 1YFWA 2X09A 2XLFA 4QPGB 5K0UA 1RB8G 1PX4A 2Y60A 3J7NA 4NPLA 3WG4A 5J36A 1LESA 2D98A 4P14A 5FZ6A 3I3BA 3BI3A 4LO8A 4KG0A
chains in the Genus database with same CATH topology
2RS33 3ZXDA 2HJIA 5BNOA 2HWD1 5C6CA 1H2LA 2E63A 2VMIA 2PLV1 2H0BA 3FLTA 1HV1A 1MS8A 1H4HA 2WLPA 4YM0A 5KC5A 1VAVA 2VGDA 1ZVFA 5L36A 4E4DX 2RR11 1ZBE3 2ZX4A 4FP2A 1MEC3 3K51A 1CN1A 1ND3B 4XMAA 5AC91 3M3IA 1IOAA 4FOVA 4FPCA 4GALA 2GMPA 2A6ZA 3DKWA 1UL9A 2GC2A 3HN1A 1TNFA 1VBB2 5F1RA 2SBAA 2A6XA 2ZZQA 5I93A 3TNQA 1VBC2 2X8KA 1ZA4A 4FXKB 4PF5A 4AQ2A 4YVSC 1O3SA 1UU5A 2XVKA 4LBLA 4HSLA 1CAUA 1OQ1A 2Y0IA 3RDIA 1G9BA 1RUE2 3OJBA 1OOPB 4FPLA 3L2YA 2ZGSA 1NY72 4JVAA 3V56A 1AR72 5IK7A 2BYVE 1F9KA 2OZ6A 1YO8A 1RMU2 3RG0A 2CL2A 2VW0A 1U5YA 2VECA 3D0JA 1QQP1 3MIDA 4B7EA 1QMJA 2QFEA 2PAEA 4XJWA 1RJ7A 4BMEA 1V9U2 3A4UA 3RI9A 3T1MA 3LSDA 2RJKA 3NV4A 1KDMA 3UJQA 4DPNA 2GNBA 2D6NA 3IKWA 3PVBB 1LHOA 4Q4Y2 4RQPC 5C4WC 2XJRA 3OTFA 3AX4A 3V64A 3VZLA 4IEYA 2Q5TA 4YGEA 5A3MA 2JG8B 1WCKA 4FPJA 3L2HA 3EBRA 4AEDB 4F83A 1PGL1 4E2SA 1ND2A 3SLIA 4HK9A 4JGZA 1A8MA 1SBDA 2Z69A 4HPKA 4FQZA 3VGIA 1WBFA 4IEPA 1O3RA 2DV9A 1DYPA 4Y1YA 2HEYF 1LKNA 3ZVXA 1IKPA 4LBOA 1AYM3 1AR81 2B8MA 1HRI3 2Q30A 1RUG1 4XFGA 1K5MB 1SCSA 3VBRB 1XYPA 1FT9A 4K7JA 1AR62 4DY3A 3LA2A 4PDWB 5JPMB 5LK5A 3ES4A 1E57A 3AFGA 1CIWA 1DU3D 1RIRA 4CEYC 3MLLA 4AQSA 4JDOA 4CP0A 5H9PA 4N53A 3NJZA 1Y9QA 1GANA 4AVSA 5FOJB 5CVRA 3BCWA 2XJSA 4Y1UA 4MZUA 2WIIB 1AX2A 4BOWA 5AFBA 2A6VA 5FOBB 4Q0SA 4Z2WA 5CG8A 3WDVA 3B02A 1J3PA 5C8CB 1TME2 3KM5A 1X7NA 2X5IA 4XIOA 5F6KA 5BNPA 5T5JA 1B35C 1KXGA 4YM1A 3K48A 2E6VA 1PVC2 1F2NA 2K9ZA 1MS0A 2JG9B 3FFQA 1N3OA 3CNAA 2JEMA 4MX3A 1D4M2 3VBUB 4IV3C 4YG3A 3WW1A 2FMYA 2R042 1Q43A 2A7AA 2RM21 2UWCA 5T5PA 3BPZA 3GYDA 4WBBA 1FMD2 3CJIB 2BNNA 5B2GB 2R0HA 2BVBA 5J48A 4DQAA 3X29B 4CDWB 1RUI2 1GZWB 2F6BA 5LK7B 3V0BA 3O0XA 2MEV1 4PLNA 4WM7C 2FMDA 2WZR2 4YW5A 1LOGA 4MV2A 4CRQA 3APBA 1YHFA 4LEJA 5I91A 1KD7A 4CDXA 2VNRA 2PHWA 1NG0A 4Q0UA 3WT3A 3AKTA 5C8CC 5C9AC 2QKDA 2FZ1A 4LE3A 1IZ3A 4Q0VA 3R4DB 3U0ZA 3FX3A 3JBG1 4NOTA 3FJSA 4XETA 1MS4A 1R1A1 2R073 2E7AA 4KL1A 1ASJ1 1W39A 4R52A 4M3CB 5GLWA 3AXEA 4HKWA 2B42B 4KG8A 4LBQB 3RI8A 1PO13 4LLOA 3VBUC 2XVGA 1EAH1 3GBFA 1I3HA 1YUDA 3WVJA 4AHXA 4C90A 1C8NA 1RUF1 2TEPA 3HMYA 5C8WA 4QQ2A 4AYUA 3ME2A 4W65A 4CDWC 1C1LA 1RUD1 4B29A 5BNNC 1CX4A 2HWD2 3FLPA 1A8DA 1BQPA 1ZX5A 4FOYA 4AGGA 1LHUA 1BEV1 3VBHC 3WHTA 4R9CA 4YNIA 3BU7A 5DXDA 4Q26A 2A5ZA 1R093 2C0ZA 2DUOA 1NA1A 4MSVA 3OBTA 1VRH2 1WCDJ 1FXZA 1MZEA 5EXOA 2CGPA 3LOIA 5DZFA 4A7ZA 3ZN4A 4RR3A 3IDCB 1OPMA 3P3PA 1RUH1 1G9CA 3VHOA 4DOUA 3AYCA 5CFCC 2UY9A 4FPOB 4YVWA 5C4WA 1GKBA 2D5HA 5J98B 1UKRA 4EN6B 1EY2A 1SBEA 2OVUA 3MW2A 3P3NA 1LHWA 4Y22B 5T54A 5FPZA 3AZVA 3JD71 2WT2A 4QQHA 4HT1T 4PIXA 4EROA 1M4WA 4K21A 5CIRA 3S6PA 1AX1A 3VHRA 2B45X 5DDJ1 3ZXLA 3WP5A 1DDLA 1Q56A 1FPN3 1W6NA 4K20A 4XBLA 4QXKA 4XFBA 5LEJA 2XG3A 4N9IA 3KSCA 4OUMA 4XF9A 3ZIXA 3FLRA 4BMBA 3J8F1 5E1RA 1VAMA 4XF1A 2TUNA 1H2KA 1NOVA 3VKNA 1RUC3 1H8TA 1DHKB 3CL1A 1GZ9A 1DZTA 5A32B 3M7AA 3C2UA 4EN7B 2MNGA 1BVP1 3ILNA 4MGKE 2WFPA 4AHYA 5ABJA 1PGL2 3ZSMA 3H50A 3EHKA 5FMOS 3ZSJA 4TZDA 1VBA3 1CAXA 1PK6B 1SACA 4K6BA 3WQ0A 2IFWA 1JBCA 4AVTA 4M00A 4Q4X3 3ZFGB 2VUJA 3SCGA 2P3IA 1OFSA 2VMHA 1MZ5A 5EV7A 4F8AA 1AR82 5L7OB 1WW5A 1VBE1 1VBD1 3AM2A 1RUG2 5EWSA 4LE4A 2VY0A 3N36A 3UK9A 2PYTA 3JU9A 1CJDA 3VZKA 5JOYA 2HWB1 1ZRRA 3WINE 1MS3A 4AI2A 5FO8B 3V65A 4KNCA 4J1XA 1GICA 3KCYA 1RVF1 3LAGA 2PHFA 4P9GA 2VVDA 2XUMA 2I2SA 1ONAA 1RINA 2ZS6B 1ZBA1 1VBB3 4MXVA 4IETA 4YYOA 1AYN2 1GLHA 4XZPA 3BOPA 1CAVB 3I59A 3QBQA 1HRV1 3FUQA 3BALA 3H3ZA 1VBC3 1GBGA 4ASLA 1Y43B 2EAAA 2GN3A 2Z79A 4CEWA 2PHRA 3ZSLA 1PGSA 1GQHA 1Z78A 4OVEA 3IPVB 2YDEA 3R4UA 4XE9A 3WUCA 3ZFGC 2D40A 2XVLA 3VBOB 2PFWA 1AR73 2Q1MA 4KU8A 3D0SA 1V6IA 1AJKA 1YWKA 3OYWB 2ZPXA 4LBNA 3B69A 3FBYA 2ZGOA 1YIFA 3R0RA 4D7YA 4KWLA 3N3HA 4FPEA 3SH3A 1RUJ1 1DBNA 2XHKA 1MACA 3GHMA 2ZX2A 1OFNA 1X8MA 2XLAA 2ZHKA 1FATA 3LOBA 4H55A 2RS13 1U5ZA 1C1FA 3UV9A 2C9AA 2YZ4A 1LHNA 2CNAA 4Q4W3 2MEV2 5KWRA 2ZGQA 4XQDA 2VOVA 3AKPA 1RL3A 1O4TA 1COV3 1X50A 4ZU4A 4E4SA 3VBHA 4LR4A 2ZX3A 1J59A 5GKAC 3JBG2 3CO2A 2Y0OA 4CDQC 2RMU1 1W6PB 4PIZA 1FNYA 4FOWA 1WD4A 1CPNA 3NAPA 3D4KA 2RS51 3UKVA 5KHJA 2Y26A 1AR63 1R1ZA 1SDWA 2I07B 1RUF2 1PHMA 1YRZA 3H1YA 2QQPA 4CTEA 1HXS3 1GQGA 5FLHA 4PIYA 3WCSA 3HQXA 2ZAAA 4LLFA 1RUD2 2EVXA 4WZFA 2MPFA 3AMQA 1CAUB 4MH0E 5FREA 1ZRCA 3H1MA 3HAGA 3VKLA 1DGWX 3HWJA 4HL0A 3VDDB 2VNOA 2JECA 4FAHA 3MIHA 1YFUA 1QJX2 2D5FA 2ZHLA 3EO6A 4X6QB 4I30A 4XHXA 4OI1A 3AZZA 3IMNA 5CB7A 2WS91 3RS6A 2Z42A 3NV3A 2R1DA 4XF4A 1HQLA 2XWBB 4XFHA 4WVWA 3M4FA 5GM0A 1LOCA 3KZ4C 1YFYA 1WCSA 3G6JB 4Y26A 4JAAA 3KQRA 5FCCA 4XJ8A 1D4M3 2UWBA 4FQ4A 1H2MA 4JQRA 1BMV1 4TYSA 3IBMA 1NXMA 4L97A 2WC2A 1AR91 1FMD3 4FPKA 3H1WA 4I0AA 4NWVA 4N7IA 3AXDA 4BZ4A 1DGRN 3WG2A 1DZRA 3ECQA 1LEDA 3RNSA 4WZCA 4Q4V3 4XILA 4QMAA 4RL7A 4E2GA 4JGZB 4HPKB 3S7EA 2QZ2A 2WZR3 4GB31 3PVOA 2GNMA 4DINB 4GMP3 4WM8A 3MEPA 2WL1A 5DDJ2 1G9AA 5CG9A 5CFDB 4G3YC 3WHUA 5T3NA 2DU1A 3PMEA 5JZGA 1H9PA 1WGPA 2YGMA 2DWRA 4XF3A 4BWOA 2HWF2 3CEWA 2ZGTA 1CQ9A 4EN0A 1FV3A 1V6OA 4JRLA 4RHV2 3AMMA 3OF1A 1NZCA 4MGYE 4YZ3A 4HKLA 1XNCA 4LBJA 4HKOA 2GH2A 1LOFA 1EYBA 1AX0A 1N1TA 1YCIA 4FP3A 1QNYA 1WMDA 1AXYA 1O3TA 3A0NA 1RGSA 2GNDA 2WNUC 5SV8A 4AFCA 1CAWA 1W6OA 1WLTA 1FOD1 3TB0A 4GH4A 5I0SA 3W58A 2K0GA 1U12A 3OD0A 3MW4A 1VBE2 1KS4A 1VBD2 2WFF1 1NCRA 3PNAA 1W6MA 4YZ1A 2P34A 2XJQA 4IV1C 4DNYA 1TQ5A 2Y38A 5CFDC 1SBFA 1RHI3 1GNZA 2CWMA 2X5IB 4Y1ZA 1FNZA 3GZUC 1C3HA 3MW3A 1VRH3 2D6LX 1LGNA 5H9RA 4XFIA 1V00A 3WCRA 2WWSA 4E9KA 4IEUA 1EV12 1O91A 3MZHA 3Q9OA 3ZYIB 2PHXA 1BVVA 4HN0A 4TWTA 2XKPA 3M2MA 3S30A 5C33A 1QDOA 1KQRA 4R9DA 1DQ5A 1KJLA 4XJ9A 3ZFFA 3FC0A 3TWIA 2PTMA 2B5HA 3ST7A 2OUHA 4NWWA 4B4QA 2EIGA 2CV6A 1DGWA 1UMZA 3NO8A 4IEQA 3B3QE 3VZNA 2R063 3AFKA 3GF6A 1MQTA 2D44A 1SCRA 2ZMNA 2IXLA 1XYNA 4XXPA 1R083 1W6QA 2YC0A 3POSA 4Q1RA 3TN92 2BPA2 1SFYA 1J3QA 2HWC2 3ILFA 4CDXB 1GYKA 4LUKA 1ZRDA 1RUOA 1XYOA 2BFUS 1KFXL 1MS5A 4PCRA 1ZZBA 3E6BA 4XFAA 4JTNA 3AZXA 4I0BA 4QPIC 4GKYA 3V0AA 1SLTA 3THPA 4Y20A 3R6SA 1RUJ2 2G9GA 3VBFC 5KXEA 2AUYA 2A3XA 2FBEA 4KU7A 2A3YA 4YM2A 2YGLA 4L11A 4N9HA 1OQEA 2O1QA 4N43A 1U5XA 1WUVA 1ULGA 2BEOA 1VR3A 4MYEA 4PJYA 1N1VA 2OYZA 1LCLA 4Y24A 1UU4A 3IIAA 3G7DA 3AP6A 3M1HA 3VBSA 3R05A 4BLJA 4OHYA 2RMU2 2ZX0A 3HT2A 1A3KA 1QH7A 3D8CA 2RS52 1NA1B 1VALA 1LRHA 2AGSA 4QPGC 3GBGA 4DS0A 3N35A 4RR3B 1NYWA 1QJU3 2NPIA 1KS5A 2NMNA 4XJAA 1VIWB 4LHKA 1NCQB 5I8TA 4UW5A 4B4PA 4YW4A 3GBWA 1AYN3 1ENRA 2Q0AA 3OPZA 4M0HA 3IN9A 2ZTNA 4FTBA 3BB6A 3ZFEA 2EXIA 1VB2A 3E5QA 1YXWA 4PBOA 2ZGLA 1XXNA 2PHTA 1ND3C 4XTPA 3ZN6B 4JTOA 3ZN5A 1WA4A 3AYEA 4CDUB 1Z7S3 4PBPA 5FQ0B 1POV3 3RRDA 3KT1A 4NPRA 2B9UA 2IWGB 2HWE1 5IK8A 3QH6A 2ATFA 2ZCWA 1GV9A 1RUNA 4DFSA 5JCTA 3ZXKA 4J6GA 4LO4B 5ACA2 4F3JA 4OHVA 3SXWA 5AFEA 1OSGA 4RS5A 1W6NB 2HEVF 3VKMA 4AVVA 1IQAA 4B7KA 2XBO2 1OOPC 1V6NA 3IDBB 2G4IA 1DQ0A 2R6QA 2RS31 2ARBA 1XRUA 3SH4A 1AR92 1NCQC 1H8TB 3DV8A 3M70A 4XEZA 4EN8B 2D6PA 3GALA 2ZHNA 5ABJB 1MS1A 4CYDA 1BBT3 2P3JA 2SLIA 1LU1A 1ZBE1 1MEC1 1PZ7A 4COYA 3TBDA 4GB32 4GMP0 4CDUC 1F8VA 3MDPA 4OHXA 5E16A 2QVSB 4HK8A 2QDRA 4EN9B 4JGYA 2OZJA 2YROA 2UYAA 4FTSA 3ZYPA 4IV1A 1IKQA 1B09A 1DYKA 2V09A 2NLRA 2DYCA 2BBVA 3VV1A 2JE9A 3DPRA 2KA3A 1EP0A 1I5ZA 2DTWA 2JG8C 4U36A 4AEDC 5KHGA 2WJSA 1FYUA 4PLMA 2E7TA 1RJ8A 1URXA 1LOBA 2ZGNA 2WA3A 2OPKA 2WNVA 2UURA 2Q8OA 4OI4A 1YI9A 4AEJA 3LGRA 1C8M2 1JXNA 1V6MA 1C57A 3M3QA 4H7LA 3AK0A 4QGMA 4XBNA 4XOGA 3I59B 3KCCA 1NQDA 2AENA 1H9WA 4AQ6A 5KHIA 4Z8BA 1K5MC 3VBRC 1LHVA 4M01A 3PLQA 5JIAA 2DCZA 4PDWC 3RYPA 2ZA9A 2ZGUA 4M0NA 1S2KA 2EF6A 3JQXA 3KGZA 3WDYA 1WMEA 3HT1A 1QJX3 2FZ2A 2K2SA 1MR5A 2YMZA 4QPIA 2W68A 1ENSA 1DGLA 4SBVA 2BWAA 3VBFA 1QKQA 1H2NA 4AG4A 4XBQA 2E9QA 4FXGB 1JW6A 1N47A 3AMHA 4AWDA 1IS5A 3TRSB 4ATEA 1QJY3 3QOPA 4IXLA 3VHNA 4YG0A 5BNQA 1PIV3