1WCDJ

Crystal structure of ibdv t1 virus-like particle reveals a missing link in icosahedral viruses evolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
421
structure length
421
Chain Sequence
IVPFIRSLLMPTTGPASIPDDTLEKHTLRSETSTYNLTVGDTGSGLIVFFPGFPGSIVGAHYTLQGNGNYKFDQMLLTAQNLPASYNYCRLVSRSLTVRSSTLPGGVYALNGTINAVTFQGSLSELTDVSYNGLMSATANINDKIGNVLVGEGVTVLSLPTSYDLGYVRLGDPIPAIGLDPKMVATCDSSDRPRVYTITAADDYQFSSQYQPGGVTITLFSANIDAITSLSVGGELVFRTSVHGLVLGATIYLIGFDGTTVITRAVAANNGLTTGTDNLMPFNLVIPTNEITQPITSIKLEIVTSKSGGQAGDQMSWSARGSLAVTIHGGNYPGALRPVTLVAYERVATGSVVTVAGVSNFELIPNPELAKNLVTEYGRFDPGAMNYTKLILSERDRLGIKTVWPTREYTDFREYFMEVAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR STRUCTURAL PROTEIN VP2
publication title The Birnavirus Crystal Structure Reveals Structural Relationships Among Icosahedral Viruses.
pubmed doi rcsb
source organism Infectious bursal disease virus
molecule tags Virus
total genus 95
structure length 421
sequence length 421
ec nomenclature
pdb deposition date 2004-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1wcdJ01
2.60.120.660 Mainly Beta Sandwich Jelly Rolls icosahedral virus 1wcdJ02
2RMU3 5AC91 1VBC1 1AUYA 3NAPC 2ZTNA 1VRH1 1B35B 5J96B 1ND3A 1X33A 2HWE1 3VBHC 2RM21 1RUD1 2HWB3 1CD3G 4IV1C 4CEYB 4Q4X1 3VDDC 3CJIA 2BPA2 1RVF2 5C9AC 3IDEA 2X5IB 2VQ0A 1PO11 1RUH2 4LLFA 1HQNA 1C8NA 1V9U1 1X36A 3VBFA 4NWVA 1AR72 1NA1A 1TME1 3ZFEB 4JGZC 1PIV1 3VBOB 2HWC1 1RHI2 5J98B 5K0UB 4CDWA 4NWWA 1POV3 1BEV1 5AC93 1VBB2 1ASJ2 4YVWA 1H8TC 1VBC3 1PO21 2R043 3VDDB 2RS32 1VB4A 4RHV2 1R091 1RUE2 1AYN1 1ZBE3 4RQPB 2XBO2 1C8M2 2R061 1ND2A 5CFDA 5ACA1 1RUI2 1A6CA 1R082 1NCQA 4IV3C 4JGYB 4GB32 5BNPC 2PLV1 2WFF2 1VBB3 1AR91 2ZZQA 5C4WC 5BNOC 2XPJA 2RMU1 4QPIC 1HRV3 4CEWB 1RUJ3 5L7OB 1RMU2 1FMD2 1COV3 3VBSC 1FPN1 1NCRB 1CJDA 3VBUB 5BNNC 1QJY2 3JBG2 1D4M3 2HWC3 4FTBA 1C8M3 5FOJB 5CFCC 1OOPA 5ABJA 2HWB1 4N53A 5C8CA 2MEV2 2WS92 2RS12 4CDUC 5DDJ2 4AEDB 3VBRB 2WWSA 1QJU3 1TMF3 4GH4C 1MEC2 1VBA3 2WLPA 4RS5A 3ZFFC 3DPRC 1RMU3 4CDXB 1AYN3 1R1A2 4QPGC 1QJX2 2R063 1QJY3 4QPIB 2Y26A 1PGL2 1QQP2 5ACA3 1BBT3 4N43C 1K5MC 2HWD3 5DDJ3 1B35A 4YVSC 3JB4C 2BFUS 4PDWC 5D8AB 1RVF1 4Q4Y3 4CEYA 1AR62 1W39A 2R041 1FPN3 3J8F3 3ZFGC 2R072 1PGW2 2X5IA 4Q4W2 1ZBE1 4GH4B 1MQTB 3CJIC 2WZR3 3JD73 1RUC2 2RR12 2HWF2 4QPGB 3ZFEA 1RUG2 1RHI1 4RR3B 5FMOS 1PVC3 1HXS2 1VBB1 4N43B 3VBOA 1SMVA 1ZBA2 1K5MB 3VBFC 4RFT0 2GSYA 4Y5Z0 1HRV1 1NA1C 5K0UA 1RUJ1 1COV1 2R073 4YVSB 1WCDJ 4PDWB 4RHV1 1OPOA 1RUE1 1D4M1 1GFF2 1RUF2 1C8M1 3ZFGB 3NAPB 2DF7A 1OHFA 5A33B 4YVWC 1HX6A 1RVF3 1HRI2 4GB31 4RQPA 3VBHB 4IV1B 1FOD2 1IHMA 5JZGC 1RUH3 1QJU1 2HWE2 4CDQC 2RM22 1RUD2 1EAH2 1TMF1 1VBE2 4JGYA 4Q4X2 1VBA1 1AR73 5C9AB 1RMU1 1FMD1 2BUKA 1F8VA 1NOVA 1ND2C 1QJY1 3JBG1 4CEWA 1BBT1 5L7OA 1NCQC 1RUF3 1PO12 1RHI3 1V9U2 1NCRA 2MEV1 4JGZB 3VBUA 2RS11 1ASJ3 2HWD1 5DDJ1 4Z92B 3ZXAC 1FOD3 2RS33 4Q4Y1 1EAH3 4AEDA 1VBE3 3J8F1 3VBRA 1H8TB 4RHV3 1RUE3 5JZGB 1BEV2 1OOPC 2XBO3 3LOBA 5ABJC 4CDQB 4N53C 5C8CC 1RUI3 4WM8C 1R083 4CDXA 1AL22 2RS52 1BMV1 2WZR1 4WM7C 3JD71 4GB33 2WFF3 4QPIA 4Q4V2 1PVC1 4RS5C 4IV3B 5BNPB 1FMD3 4FTSA 2TBVA 5C4WB 3JBG3 5GKAC 5BNOB 2R071 5D8AA 2PLV2 4BCUA 1AR92 4Q4W1 2RMU2 3VBSB 2MEV3 2WS93 2RS13 1B35C 4FSJA 5BNNB 1AL23 2HWF1 1VAKA 5CFCB 5FMOL 4GH4A 1MQTA 1NY72 4WM8B 1RUH1 1AYM2 1AR82 1MEC3 1Z7S2 4CDUB 4WM7B 4QPGA 2HWB2 1ND3C 1VBD2 2X5IC 1R1A3 4RR3A 3FBMA 1AR71 1QJX3 4N43A 5A32B 1QQP3 1K5MA 3ZFFB 3DPRB 3ZFEC 1RUF1 2GH8A 4YVSA 4Y4YA 4PDWA 3VBOC 1ASJ1 1HRI1 5K0UC 3ZFGA 1AR63 1FOD1 3NAPA 1AYM3 1AR83 1Z7S3 2IZWA 2RS31 5A33A 1VB2A 1EAH1 1VBD3 1EV12 1VBE1 3TN92 3VBHA 4IV1A 4Q4W3 3VDDA 5AC92 2XBO1 1NG0A 4CDWC 3S6PA 1RUC3 1ND3B 1VBC2 2HWF3 1RUI1 2RR13 5C9AA 1RUG3 2R042 1R081 4RQPC 1DDLA 1HXS3 2WFF1 1QJZA 1VRH2 3CJIB 1ZBA3 4GMP3 1M06G 4GMP0 4JGYC 4SBVA 1ZBE2 4JGZA 3TN93 1EV13 5CFDC 4CEWC 3VBFB 5L7OC 1NA1B 1POV0 2ZAHA 1NCRC 3HAGA 3VBUC 2WS91 1AL0G 1H8TA 1HRV2 2FZ1A 1AL21 2RS51 5JZGA 1RUJ2 1TME2 1HRI3 1COV2 4CDQA 1VRH3 4CDWB 4Q4V1 2HWE3 1PIV2 4AEDC 1D4M2 2RM23 1RUD3 4YVWB 2HWC2 3VBRC 1MEC1 4Q4X3 1R1A1 1QJX1 3JB8A 1PGL1 1QQP1 4CDXC 4IV3A 5BNPA 1PO13 1PO22 1QJU2 1V9U3 5C4WA 1TMF2 1ND2B 3M8LA 5BNOA 5CFDB 1RB8G 1VBA2 1TME3 1R092 1AYN2 1NCQB 2BFUL 2R062 4EJRA 3VBSA 1PIV3 1AR61 1NY71 5BNNA 5ACA2 1BBT2 1AYM1 1AR81 1Z7S1 5D8AC 1PGW1 5CFCA 1VBD1 4FTEA 1BEV3 2HWD2 4WM8A 4CDUA 1F2NA 4WM7A 1PO23 1E57A 2RS53 4Q4Y2 1RUC1 2RR11 1RUG1 1OOPB 5ABJB 1MQTC 4CEYC 1FPN2 4N53B 3J8F2 4Q4V3 5A32A 5C8CB 5LK7B 1HXS1 1R093 3ZFFA 3DPRA 1ZBA1 4GMP1 4RR3C 2QQPA 2FZ2A 2BBVA 1BMV2 2WZR2 3JD72 4RS5B 3TN91 1EV11 2PLV3 1AR93 1PVC2 1POV1
chains in the Genus database with same CATH superfamily
1DBNA 1O3TA 2OS2A 3OBRA 5FPVA 4URAA 3QLQA 1AX0A 4XUNA 2GALA 2JDAA 3TWIA 3TEYA 3KGZA 1OVPA 1VBC1 4QM8A 5EJ3A 3WQBA 4C1WA 5FPBA 5M0TA 1G9CA 4UXAA 5CADA 3J4UH 3WV6A 2C24A 2N7GA 2ZTNA 1CAWA 3KVAA 4QHBA 5AVPA 5A80A 1LGCA 5FPUA 2YY1A 1B35B 4CUAA 3A0KA 1CZTA 2OPKA 1X33A 4LHSA 5E89A 4ARXA 5GZGA 4DO0A 2CNAA 4QPWA 3O0WA 2HWB3 4IV1C 4CEYB 3M70A 4NO4A 4HXCA 4CCLA 1BQPA 3VDDC 3N4MA 4N90A 3C7FA 3MW4A 1CAXB 2BPA2 1RVF2 3IDEA 1DF0A 1NLSA 2WN2A 3AYDA 2NN8A 2Z79A 3SCGA 3IBMA 3AFGA 2XL7A 4LBLA 4LLFA 2YC4A 1X36A 3VBFA 1GQPA 3HT1A 4NWVA 4GA9A 3URFA 3PUIA 1EYBA 1LOEA 2WT2A 1RL3A 2X29A 4I02A 3N7KA 4QGMA 2J1VA 1V6LA 4BK4A 3EHKA 1JW6A 3I54A 3WW4A 3MUZ1 4UFHA 4GKYA 3BGAA 2HWC1 3ZIWA 3LPFA 4DMIA 4DUWA 5DABA 4XF9A 5C3OA 4YARA 1JYIA 4NWWA 1POV3 1RJ8A 3KV6A 5FTTC 4AW7A 3H3LA 4MH0E 5EYXA 2D5HA 1SACA 1YWKA 3T30A 5T5PA 3MV01 3T3YA 3BU0A 2Y6JA 2E6VA 1LHUA 5DZGA 1CJPA 4XIKA 3IMMA 4Y1ZA 5DAQA 3ZXJA 4B8EA 3VDCA 1YQ5A 4HKOA 4JZRA 1W6MB 1GR3A 1Q8QA 4OCTA 4CYDA 4Z2AA 1CQ9A 4BQWA 1L7LA 1K42A 4QKFA 1AYN1 3ZXKA 5K7PA 1G9AA 3BTXA 3J7LA 4RQPB 3LFMA 3T2QA 2ARBA 2R061 3QH6A 4Y4RA 1DCSA 3ETPA 5LBBA 4KG8A 1ND2A 5CFDA 3WP6A 2JDNA 1N1VA 4EQVA 5FYIA 4LORA 4HL0A 1A6CA 1ZZ7A 3HQXA 1F5JA 4HETA 5EQUA 5BPXA 3WG4A 3ZSMA 1D0GA 1NCQA 4M00A 4YW2A 2ETEA 1LHVA 4XCAA 5BNPC 1CX1A 4IE5A 2R7EB 1UZVA 2WFF2 2ZGRA 4LO6B 5C4WC 2JE9A 2Y38A 3USUA 1OXCA 2DFBA 2D7FA 5LB6A 2RMU1 2VTXJ 1JYNA 4IEPA 5FZOA 4KL1A 5L7OB 2Z69A 2W5FA 4AVCA 2GAUA 5LK5A 1SLCA 4UFMA 3RSJA 2VXRA 4X6RB 1GICA 1NCRB 1O4ZA 2YV8A 3JBG2 2W68A 5TSWA 4XBQA 5FUNA 4A6OA 4ATFA 2Q30A 1GQGA 4XDQA 3LEMA 5LY2A 1XSRA 4X8NA 4L11A 4N53A 3MI8A 2WS92 3FHQA 1CPMA 4XJAA 3RYPA 5B2GB 3CDZB 1WCKA 2KM2A 2YPJA 4AEDB 2DTYA 3EJKA 3ZKUA 4LO4B 1JYWA 4BXFA 2E7TA 2TEPA 4BH9A 2E63A 1PNGA 4XJZA 5E16A 4MX3A 5FPXA 4Q1PA 2CTVA 1BZWA 1TMF3 4GH4C 1MEC2 1W6QB 5JCTA 2WLPA 3ZFFC 4ET7A 1CPNA 2LROA 5LA9A 3LF7A 1MS5A 4P5YA 2GC0A 2ZABA 4PF1A 4QPGC 2HYXA 3THCA 1QJX2 3FBYA 4P02B 4K20A 4V2VA 1CN1A 4QPIB 1YFUA 1CAVB 1BBT3 2DURA 2VMIA 4QX8A 5LW9A 1GP5A 1UQXA 3KCXA 4UW4A 3E6DA 4LBQB 4ZXEA 2ARXA 2JG8C 2BEOA 3H8UA 1XNAA 3I2DA 4FOYA 3VL9A 4U36A 4QWNA 3AKRA 1G9FA 1LECA 2GMMA 4J6GA 2UWCA 3KGLA 4LEJA 4J1WA 1ZRRA 5BNQA 2JB8A 1GOFA 4X6QB 4PDWC 2X09A 4FFGA 2AYHA 4A41A 5KC6A 1QOSA 3POWA 4FBFA 4OULA 4UFKA 2A70A 4KBZA 5D21A 1IZ3A 2ZX1A 3UL2A 1QF3A 4PIXA 1IKPA 3B9CA 2X5IA 3AP7A 1A78A 3BOWA 4KWJA 3DKQA 1DQ0A 1GSLA 1SCSA 3AP6A 4K6BA 5HCBA 3W58A 3WDVA 1BHGA 2W39A 4B29A 2VAUA 2NPIA 1HKDA 3A4UA 1W2TA 2HWF2 2RR12 5FY0A 1RUG2 1O6UA 4LBNA 5JLVA 5FBJA 4RR3B 5JXHA 4BMBA 4AHWA 1E5SA 1PVC3 2PFWA 2F17A 5FY4A 4PIYA 2YU1A 3NMBA 4QHOA 2MHFA 2FCTA 1K5MB 2QBXA 2PHDA 2A3WA 1MS4A 1ZZ9A 4MZUA 2Q4SA 3VBFC 1HRV1 1W0OA 2FD8A 1RUJ1 1COV1 2PHTA 4EN7B 3WD5A 2ZOEB 1WCDJ 2HJIA 1DGWA 1X50A 3M2MA 1GOGA 3CL1A 1D4M1 2A6XA 4Y33A 1UY1A 5F6LB 1L7QA 5F7UA 1JZ6A 1C8M1 3INAA 3H8OA 4WVWA 2BQPA 1AZDA 3IKWA 2PHUA 1E5IA 4YW1A 4YW4A 1OURA 2GMPA 2LW8A 1OUXA 2ZCWA 1HRI2 4GB31 3WEZA 5FP3A 3ALQA 4IV1B 1FYUA 1OSGA 5CNAA 3K4DA 5KC5A 2QZ3A 4CDQC 5T52A 1CAUB 3H7YA 1OA3A 3ACFA 2RM22 1UMZA 3RZMA 2V09A 1UIJA 3TNPB 1RMU1 3WF2A 4CU7A 4DXZA 2X05A 2H6BA 2WFPA 1LAJA 1ND2C 4ASMB 3OEBA 1LTEA 2W2IA 5ANQA 4AI8A 4HPKA 1BK0A 4V1PA 4ZZ5A 4JDNA 1NCQC 1YQ6A 2AC1A 4XUQA 2XLGA 1PZ9A 3FFZA 4LITA 3VHOA 2GZWA 2MEV1 1WW6A 1OD5A 4K9SA 2HWD1 5DDJ1 2PN5A 4Z92B 2W94A 3OOXA 2NZ9A 3AP5A 2DU0A 1JOPA 2KR2A 3H42B 2Y6HA 3KZ4C 1C28A 3ZN5A 2OVUA 5IVYA 5GLVA 3NV4A 5JZGB 3SEEA 2PTMA 1BEV2 4NE9A 3OYWB 1JZ8A 4BQ2A 5C5TA 3LOBA 2P3IA 4N53C 4UOJA 1VMHA 3UKNA 4WM8C 2RS52 2OW4A 4QU2A 3JD71 4XFHA 1D0HA 1LOBA 4D7TA 4LK7A 1LOGA 3E1F1 3UGGA 2G1MA 2PAKA 2FHRA 4CP1A 2ZGOA 1JS9A 1QKQA 4Q4V2 2ZX2A 4LO5B 3ZN6A 2CY6A 4XZUG 3ZIXA 3MW3A 4LULA 4AYUA 1W28A 3WQ7A 3M7AA 1GNZA 3LEKA 4A7ZA 4OQ8A 4YFWA 5FZIA 4FPYA 2FCVA 4LHKA 1FMD3 5BNPB 2VW2A 5FUIA 1JZ5A 5C4WB 1JU3A 3I97A 3PIGA 4HMZA 4IE0A 4KG0A 4TN7A 4CP9A 1LGNA 5D8AA 4YGEA 4BCUA 4N7IA 4BDVB 1WBLA 2O8OA 4O65A 3ZYRA 3RI9A 5FO8B 1Q5OA 1GU3A 1HQLA 4B1LA 1BLZA 3WDUA 2XR4A 3FX3A 4ISRA 3TRSB 5JDBA 2Z2SB 2D3SA 3KT7A 3B5LB 4AI2A 1VAKA 1AX1A 4YM1A 3VDAA 2R32A 2RG4A 3AZZA 2ZEXA 1JZ2A 3AJZA 4MADA 2AUYA 1NY72 4WVMB 3I2GA 3VZKA 2VD7A 4FPEA 2BVVA 3PVEA 3K3NA 2X5IC 2Z5WA 1VBD2 1R1A3 5DUVA 1J84A 5C3PA 3U4XA 4XVHA 2OX0A 2A1XA 2YC0A 3N9OA 4N43A 5G05L 3FL7A 5IW0A 5FQ0A 5A3PA 3OG2A 1N3PA 1QQP3 3AC0A 3Q9OA 2XL9A 1V0AA 1W06A 2PHWA 2VM9A 3ZFFB 1OA4A 5HXMA 1ZRCA 2K46A 3RDIA 2GH8A 3J7MA 3HN3A 2XGXA 4Y4YA 1FNYA 3O1UA 2LUWA 2JKBA 4XFAA 3CKHA 1KXGA 3LSEA 4LXLA 5FZHA 4NPRA 4DFSA 3VD7A 4IE4A 3ZSEA 2XUEA 4W65A 3AKTA 1W8TA 3AFKA 1W2UA 2ZHMA 3VN4A 3ZFGA 4HK8A 3VKFC 4UYBA 2IZWA 1UY2A 4D6QA 3W59A 1VB2A 1NQJA 1VBD3 2MPFA 3Q8CA 1FXZA 1EPWA 3VBHA 1L7RA 5DQ0A 3GALA 3T4VA 3JUUA 4CUBA 3UGHA 4Q4W3 1Y3TA 5FLJA 4XQDA 1XNKA 2YU2A 1CAWB 1X9PA 2JJ6A 3I8TA 5I8SA 4KQ7A 5A6YA 4WVZA 5IVBA 1VBC2 3TNQA 5FZ8A 3NV3A 2ORXA 5FYHA 4AG4A 2WFF1 1QJZA 3MZHA 1XBFA 2KA3A 2WSUA 4Z82A 3WDTA 1QGLA 1Q56A 1OMIA 3BN6A 1GZCA 5FZLA 4JTOA 1M06G 4YZ1A 3S57A 1WMFA 1DQ1A 4FPOB 1UZZA 4JGZA 3FWEA 4WVVA 3BUCA 1RJ7A 1DU3D 3G6JB 3HWJA 1A34A 3O0VA 3VBFB 5A3WA 4D94A 3WG1A 2EAAA 3VB9A 2B42B 1Q8SA 2Y6GA 1G7YA 3BOPA 4N9HA 2WS91 1OI6A 1H8TA 3SH5A 3WF3A 3NV2A 4D3WA 4XOGA 3GYDA 3UV9A 1OC1A 4Q1RA 2DU1A 1WCUA 2CAVA 3DEMA 2WYFA 4QX3A 4RN5A 4UFIA 5CG8A 2PAMA 1S4CA 2UWBA 1WBFA 2WC2A 2JX9A 2W95A 4XJUA 1XOYA 1LODA 2HWC2 1MEC1 2Y0OA 4OHZA 3SQOA 5FWJA 4ONUA 1H2MA 1FATA 2DVBA 1I5ZA 3B69A 1QY4A 3VGIA 4A7YA 4XQWA 2OZ6A 5CBLA 1QJX1 3BALA 1QDCA 4OMCA 3ELNA 2VMHA 4ASLA 1XNDA 4UBGA 3JB8A 3VZJA 4I2OA 1UYPA 1J1TA 1GZTA 4S2FA 1QJU2 4SLIA 4UW5A 1I9RA 3WHUA 4OI0A 3FUQA 2BZDA 1ND2B 5BNOA 4O61A 5CFDB 2XMLA 3CQOA 2VJXA 4AVVA 1AYN2 3BCWA 3KCYA 3GGLA 1NCQB 4LE3A 3G7DA 3VD4A 4AQ2A 5L73A 1JH5A 2R062 2RDQA 4LKEA 3U14A 2YC2A 4EJRA 4GJYA 3USUB 2NMNA 4HVQA 3T1LA 4OYUA 4FXGB 5D8AC 5FZOB 1CR7A 2RDRA 3ZSJA 4AVSA 3WY6A 4C1XA 2JE8A 2B5HA 3JU9A 4P9YA 1ULEA 2JG9A 4A3ZA 4CDUA 3RNSA 1F2NA 4NIGA 1LR5A 4WM7A 3LEIA 1DLCA 4BQ5A 3RZHA 2XKPA 4AQ6A 3UNPA 3AZVA 3DYOA 3V64A 4M3CE 1DZTA 1E57A 2YROA 2VL4A 4IEVA 2P17A 2VCBA 1MS8A 2RR11 1RUG1 4IERA 2JENA 4CEYC 4N53B 3J8F2 1JBCA 1RUOA 5FY5A 2JXAA 1GBGA 2QQIA 2A5ZA 5J3UA 1HV0A 4MGSA 1VALA 3T1MA 4GMP1 3CU7A 5FPAA 3D0JA 5KHJA 2FZ2A 3H8XA 2V4VA 3NV1A 5GLUA 4XIOA 5B4NA 1QXPA 2IFWA 1BMV2 4LOTA 5FOBB 3UETA 4E9KA 1W03A 3MIGA 2JKXA 1S0IA 1EV11 3OUIA 1C57A 3D8CA 4XC9A 3TN91 4CE8A 5HV0A 3UYJA 3B01A 4QT6A 3AMHA 1QNYA 1REFA 3LWCA 2VCMA 2RMU3 5AC91 4CDXA 1VR3A 3CF6E 4IGQA 2G9FA 1W9WA 4B4PA 1NYWA 2L9LA 3WHTA 2ZGUA 3BI3A 3MW2A 1LJ7A 4P9GA 3GJAA 2F4LA 1IG0A 3O5SA 4BHPA 4EN9B 1VMFA 3MHZA 2IXCA 4Y22A 5IFPA 3VBHC 3P3PA 2RM21 1WW7A 4LKDA 2DDUA 1NUKA 1FT9A 1Q8OA 3R4UA 4RGKA 2XB6C 4LA2A 1HV1A 5FXVA 3N35A 3DKWA 4DIQA 2PMWB 2X5IB 4K1YA 2ES3A 4I0AA 1RUH2 4AHZA 4QB2A 3H50A 2WA3A 4IDZA 1SLAA 5A6ZA 1MZ6A 1WA4A 4GALA 4NVPA 2EIEA 3I49A 1JMUB 1YQCA 3OGJA 1OVSA 2V4AA 2VOVA 5FK8A 2IC1A 2F6BA 2ZGMA 4JGZC 1SFPA 3LEGA 2WNUA 3VD9A 1YNAA 4MYEA 4QGLA 4LKFA 1OA2A 1V6IA 1YIPA 4NJ4A 1YXWA 4TLFA 2WUHA 4FPCA 4OMDA 2DCKA 5A7OA 5A3LA 1S0GA 5J09A 1BEV1 2Q1FA 2B45X 2VOXA 4NOTA 5HXVA 2VZ3A 1H8TC 3WVJA 5E8AA 1BCXA 1EUUA 5DUXA 5CG9A 1VP6A 4D6SA 4COYA 4E4SA 2D3RA 4CXXA 2RS32 3OB8A 4MOAA 5T50A 5CKNA 2A3YA 2BU9A 1QOTA 1UIKA 1J83A 2R6QA 4JDOA 4YGBA 4INDA 3WDWA 5IFTA 1V00A 4DXTA 4HG6B 1VB4A 5B4XA 2VUDA 3IDAA 1H4HA 4PI2A 5CYYA 4ZONA 4DY5A 2LRPA 3QACA 3PJYA 1C8M2 2D43A 1RINA 3MDPA 2NLRA 1KGYA 5IK7A 1RUI2 1R082 2VNOA 3GCXA 4TXWA 3RQ0A 5GJ6A 4YYOA 1VAVA 4GB32 5FCCA 2B9VA 1IS6A 3IDCB 1X7NA 5F1RA 4BOWA 5BNOC 1YC61 4QPIC 2VW1A 4NROA 1HRV3 4HPKB 2B39A 1UWWA 2PHXA 1LRHA 1RUJ3 1S55A 2NMOA 3NKTA 1RMU2 3NWKA 4HVOA 4IE6A 1COV3 5FZ7A 4BMEA 3BTYA 4IEUA 1FPN1 4R4XA 5A1FA 5C5UA 1D2QA 1W9SA 3KF3A 5D2AA 1X9TA 4OUEA 5F3IA 1SLTA 1D4M3 3DXTA 3B02A 5IAVA 3GBGA 4FTBA 1C8M3 1ZM1A 4Q0SA 1W2OA 3OBZA 5F5IA 5KHKA 4OFGA 1VIWB 4A2UA 4KI5M 2HKXA 2MEV2 2W87A 5GZEA 2JG9C 4BPZA 4CDUC 2OUHA 5DDJ2 2VXJA 4ES8A 4AI9A 3ZXGA 2VQUA 1O3QA 3PVNA 4BE3A 1RUNA 1Q8PA 5JXJA 1C1LA 5T55A 5GM0A 2VC9A 4NRMA 1RMU3 2IXLA 2XVKA 4LBMA 5FZ1A 4ZXKA 4OI1A 4YPJA 5F9TA 4GKXA 2WDBA 4RGAA 1UOBA 3FHIB 5ACA3 3ZN6B 1Z78A 4YWAA 5HCHA 5FZ0A 1NE6A 3KQRA 1K5MC 3KCCA 3B7MA 4TLGA 1XSQA 5A3NA 5DUUA 4DXRA 4XMIA 4DQAA 2HWD3 3M3QA 5DDJ3 2A6ZA 2YXSA 4CCMA 1X8EA 3OEAA 4Z8BA 4DUVA 3JB4C 4CP9B 2BFUS 2O0OA 3OBAA 1DYPA 5D8AB 3ZDVA 3AYEA 4XAAA 1PX3A 2WO1A 1AR62 1W39A 4GZ9A 5CA6A 3JXSA 2GMEA 5GLWA 3CBNA 4MLOA 1MPXA 4AFBA 5GALA 3MFCA 3C7GA 2X8KA 3C7HA 2JDMA 1S2KA 4QM9A 1S2BA 5FP7A 1BVP1 1JOBA 2H0VA 4AI0A 1Y4WA 5EPAA 5FZKA 1KITA 2VZRA 3OPZA 3GZAA 3JD73 5F2SA 1RUC2 2DCJA 4LTAA 3ZFEA 3HMYA 3NJZA 3RZLA 1OT5A 1RHI1 1OFSA 5FMOS 5EYYA 5L9RA 4EYUA 5IVJA 2D6PA 3ZKYA 4N43B 5FQ0B 5EZWA 5F6KA 1SMVA 1ZBA2 1DQ5A 1OLRA 4Y3OA 5ANNA 4RFT0 3RZGA 4XPVA 5K0UA 5IYYA 4PQQA 3RJ2X 5K4LA 3AMQA 2W0XA 2WNUC 4JDMA 4KNCA 2ILMA 2QQOA 1O4TA 5FP4A 1KEXA 1HB3A 1XE0A 1WW4A 4S2GA 2IXIA 4C0HA 5CISA 4RHV1 4WZCA 5J48A 1RUE1 5AVAA 1Y9MA 2VCAA 1HB4A 2V72A 2VMFA 4L99A 4XUPA 3ZFGB 5BY5A 4NIIA 2XJVA 2DF7A 5C33A 1QU0A 2YPDA 4FPHA 4K21A 5FRAA 2VUJA 2VUAA 4YFZA 1HX6A 2VNVA 4E4DX 2CGPA 5EJZB 4Q8KA 1RVF3 3VBHB 5FZAA 4HSLA 3T0DA 4AFDA 5JZGC 2ARCA 3VKMA 3PUQA 4TTGA 1QJU1 2HWE2 3EO6A 3J9SA 4KU7A 4QAWA 5A7QA 4BLJA 1PMJX 2E53A 4BQXA 4JGYA 1LNSA 5IK4A 5IK8A 5DZFA 4EWEA 4RSUA 2G9GA 2BUKA 3RG0A 4NRPA 5KR7A 2X53S 4MXWA 1BXHA 4MGZE 1NOVA 3I2OA 4GWJA 4ZHNA 1T6GC 5EIYB 5JPNB 3OCPA 4XF3A 4CEWA 4I30A 5KXBA 2VMEA 1N1TA 1NE4A 1PO12 1UKGA 4K8FA 2V5YA 2AACA 3X29B 1VJ2A 4JGZB 1U5XA 5DAWA 2QE3A 1PNFA 2RS11 1W6OA 3VBUA 3LB9A 4FFIA 4H3WA 3VHPA 4AR2A 3ILRA 3WDYA 1AJOA 2EICA 1WKYA 1EPZA 2YUEA 4M0NA 1W6PA 3I2FA 4Y5SA 3C8XA 3HBZA 4OHVA 2A3XA 3J8F1 3VBRA 1H8TB 2DUOA 2R1DA 3DYMA 4M3CF 3WZ1A 1SDWA 5JXGA 1WD4A 3WSOA 4YZ4A 1W3VA 2XJQA 3IAQA 1YLLA 2D93A 5T5OA 4JQRA 4LHLA 1UU5A 3PU3A 1ZRDA 4UI9L 1ULDA 4KWUA 2IFRA 3CZUA 1BMV1 1MS0A 3OGSA 4AK3A 3H1YA 1ZYBA 2WFF3 2BRTA 2Z4FA 3KD4A 4MHUA 3L2YA 1XNTA 2XWJB 2H6CA 2ZHNA 5FZ4A 5LBCA 1CONA 4NHXA 3S5AA 4P9IA 4A3XA 3FLPA 5FKCA 2HEVF 4FQZA 3K4AA 2XJTA 2ZGKA 4HKWA 1XE8A 5ERLA 1H4GA 2R0HA 3JBG3 5L9BA 5BNOB 4DY3A 3T4HB 3WOGA 2GH2A 3AZYA 5CKMA 3ACIA 3E97A 1AR92 1QMJA 1E5HA 4Q8LA 1QXJA 2VNRA 4NHYA 3D5OA 1RXGA 5FYBA 1NZCA 1XNBA 2D6KA 2VZTA 2WS93 1JYVA 5JIAA 4FSJA 1Q3EA 3TYJA 4E4HA 3ZLIA 3T0BA 1GUIA 4D69A 5I8TA 2FDGA 4XAEA 4PLNA 5FMOL 3K46A 2Z42A 3THPA 3MGUA 3SXWA 1P8JA 1UF2C 2JG9B 2WZ8A 1RUH1 3K51A 4CDUB 1MEC3 2IUWA 3EYPA 4WM7B 1KFUL 3VD3A 3WUDA 2PHRA 2A73B 4QDSA 3K48A 1QJX3 1T2XA 3U37A 3VHNA 3B00A 3IB3A 3K2OA 2Y60A 2UURA 3M4FA 3ZFEC 1G9BA 4TWTA 4XJ8A 1YFWA 4JRLA 2P6CA 1R64A 1KQRA 4QX5A 3N36A 4JV4A 4YVSA 2AEYA 3LD8A 4HZFA 4XFFA 4Y20A 3HVDA 1GYKA 3NNMA 2XJRA 4Q29A 3KV9A 5K0UC 1O8PA 2PYTA 3FLRA 1ZA4A 1FV3A 2RJKA 2G4IA 1ODNA 4GD4A 4OHWA 2RS31 2VZ1A 5JWPA 4MG2A 3GBWA 5EXOA 5A33A 2P5BA 4COVA 1W0PA 4TSVA 1EAH1 3TN92 1EV12 4QX7A 3H3ZA 2YBPA 1TEIA 5A6QA 3I3QA 3POGA 3FZ3A 2GNDA 4X8PA 4ZS3A 5AC92 3SNMA 4ATEA 2QQWA 4D0QA 2DV9A 3AZWA 5FBZA 4JAAA 3ZYBA 3ZYGA 4XJ9A 5EP9A 4Y22B 5FZEA 2HWF3 1RUI1 2RR13 2WWUA 1RUG3 1PMIA 3OSDA 2R042 1R081 5C9AA 5LEKA 1BVVA 4S2DA 3FHAA 1GMMA 1K5JA 3E5XA 5FYSA 3UK9A 4AVAA 2J42A 1IGOA 2QNKA 4ITCA 3WF4A 1F31A 1ULOA 1PHMA 3NO8A 4GMP3 4LBOA 2ZHKA 4FPJA 4GMP0 1WCSA 2XQRA 4JGYC 5E6HA 3KV5A 5BYNA 1ZBE2 3CO2A 4Z2WA 3T2TA 1ALYA 3ZPOA 2ZMLA 2WNVA 2W91A 3F2ZA 5JVVA 2ZJCA 5F3EA 3SCHA 1O3RA 4XMAA 3RJRA 1EV13 3TN93 5IVCA 1UW8A 1N1YA 2VBDA 5FY7A 4BJ0A 5CFDC 3WG2A 5GZFA 4CCCA 1STMA 1W8HA 2JDKA 4CEWC 1TQ5A 1H9PA 1XJAA 2PA7A 3PLQA 3WQ1A 1TG7A 5JI9A 3HAGA 4F8AA 3VBUC 1GNYA 2VH9A 2VZUA 2WNUB 4QKBA 1BYHA 3T2PA 3ME2A 5FZDA 3WF1A 2WO7A 2GDFA 4PIZA 5HPOA 1KD7A 1N3QA 1AL21 5IVEA 1GQHA 1HRI3 4NRQA 1Q8VA 5D1IA 1EUTA 2ID4A 1OH4A 4C8DA 4UF0A 4Y1VA 5FP9A 5FMDA 2QCSB 4NHKA 1VPHA 2RM23 3FLTA 3VBRC 1X82A 1FX5A 2W47A 5T5LA 3FMGA 1Q43A 2Q1MA 2E7AA 1URXA 3T2OA 3WX5A 5I0RA 1WLWA 1XYPA 2OA2A 1JYTA 4Y1UA 1PZ8A 4QXBA 4M0HA 3AP9A 3KB5A 3O1SA 2ZMNA 3HNMA 5FYCA 1F4AA 3I2HA 1MS9A 2XLFA 1OLME 1QNWA 3PUSA 2PHFA 1O91A 4AEMA 2VTXA 4Y5TA 1RITA 1RYYA 2VBBA 4PBOA 5FZ9A 5JOYA 3M8LA 1RB8G 1VBA2 1UYZA 4XCBA 3N9QA 2CHHA 5IK5A 1QJEA 3QOPA 2JICA 3VKNA 1MVEA 3TB0A 1OFNA 2DVAA 2EIGA 3NW4A 5LRSA 2BNMA 1M4WA 2GNBA 1AR61 2W46A 3ILNA 4K7JA 1W9TA 1ODMA 2XG3A 1AYM1 1AR81 2GC2A 2P37A 2VQAA 4NHLA 4AHYA 3S7EA 1UPSA 4N8MA 3WNLA 3AL6A 4M4PA 4XBNA 4FTEA 1BEV3 2PXJA 1MS1A 2XWBB 4M3CB 1WA6X 2XJPA 1PM4A 3BIWE 4B3NA 1A8MA 1RIRA 5FYMA 3E6CC 4XACA 5FPZA 3P3NA 5G04L 1AXZA 3ZSLA 3O1PA 2RS53 3SH3A 4Q4Y2 1RUC1 2AEZA 2QQUA 1UY0A 4GWMA 2A71A 2YB7A 3KHCA 1FPN2 4Q4V3 2VO5A 2VECA 5A32A 5KHIA 2UY8A 3POEA 1IKQA 2ATFA 1UOFA 1K45A 2P34A 4PCRA 1QH7A 1ZBA1 4FOQA 2QQPA 2Q8EA 3BB6A 1C5IA 1DQ6A 4C90A 3B9IA 2A6YA 5J1XA 2HH9A 3IIIA 3SEPA 2E33A 2KD7A 2WZR2 3E5UA 2B8MA 3UESA 4OLLA 4AI1A 4CUCA 1A3KA 1AXKA 2VUCA 3K77A 4A6SA 3WCRA 1US3A 3HPNA 3RS6A 3H9AA 1POV1 1DGRN 2BOIA 2WO2A 2J7MA 4HONA 1SLBA 1W2AX 5DN2A 2OPWA 2K9ZA 4N9IA 1AUYA 2WZPP 4CU9A 1K3IA 2WO3A 1IQDC 3M3EA 3MBWA 2RJLA 2YFUA 2W1SA 3I59A 4HN0A 1W2NA 1GNHA 3WNPA 4R9DA 5J96B 5LATA 4B4RA 3WW2A 3S5QA 4FT8A 1ND3A 1H2LA 2HWE1 2BNNA 3R05A 4JQTA 4XQ4A 3NNGA 1CD3G 3AYAA 1IPJA 4Q0UA 3I2IA 3FN9A 2P2KA 3GJBA 4OUMA 4YM0A 3CJIA 2Y34A 5H9RA 4AVTA 1WCQA 2AREA 4CVUA 3VL8A 5C9AC 2V5DA 4E2GA 2RHPA 5F3CA 1FAYA 1DYKA 2WYSA 1PO11 2QZ2A 1UZWA 2VQ0A 1YFXA 1HQNA 1XQNA 4P9LA 5IUQA 3B3QE 3AB0A 3N7LA 1W0NA 1WUVA 4CCNA 4FP3A 1PX4A 1BJQA 1GOHA 4I0BA 1AR72 1TME1 1DFQA 1YYNA 1WWYA 2NQYA 3HBKA 3ZFEB 2O1QA 4D7YA 4DXSA 2NP0A 3GM8A 3CHXA 3RYKA 2WNVC 3ES4A 1PIV1 2I74A 5CVRA 1LHWA 3B93A 5AFBA 5KXDA 1ZRIA 3K3OA 1ZX5A 3SC7X 1UYXA 3KQ4B 1F15A 2BGOA 1RHI2 3POSA 5J98B 2WKKA 1MACA 4XF1A 4CDWA 5K0UB 1O7FA 3LDRA 4LLOA 4YG0A 2BJSA 4QX1A 4ZY9A 4DRVA 1ASJ2 4DEQA 3C7EA 3WUCA 4QKDA 3AMNA 2UU8A 5C70A 4U2AA 2PAEA 5IATA 4ZU4A 1VBC3 1WW5A 1CIYA 4FAGA 4BA6A 4H7LA 5LY1A 3TOJA 4BIOA 3BYWA 2P6HA 1YHFA 1XU2A 1U12A 4QGNA 1YUDA 1O59A 4ARYA 3RZKA 1WZXA 3IZOA 4RYDA 4RHV2 1R091 4YW5A 1POQA 1RUE2 3H0OA 2IWGB 2QVSB 4XF0A 1F35A 3KT4A 3TEWA 2XBO2 1W8NA 1YJKA 2UWAA 5FZCA 2A7AA 4C91A 3HQRA 4NIAA 4NHMA 4IL7A 2J1EA 3ZM8A 2AZ5A 4G4FA 4JGYB 2FMDA 1PK6B 2Y33A 1ZZCA 3D6EA 1AR91 2ZZQA 5FLIA 2CU5A 2VG9A 4MXWB 1CZSA 1NT0A 4FVVA 2QQLA 3MPBA 2A6WA 3IT8A 4CEWB 2Q1ZB 3EB7A 3I2JA 1QOOA 5F32A 1EP0A 3HD8B 1CJDA 4HANA 1JI6A 3VBUB 1W6OB 2XHNA 1W90A 3HOBA 4AF9A 4ISQA 2HWC3 3RWNA 2E31A 3JZVA 4URTA 5FOJB 1OOPA 1S0CA 5LA2A 5E88A 2B9UA 4XDPA 2JEMA 3EQEA 1W6PB 2RS12 4CPBA 2JDHA 2WAAA 3UGFA 4QX0A 3VBRB 3V0AA 2SLIA 2BBAA 2OXBA 2G19A 4A42A 1QJU3 1F4HA 1KDMA 2ZHLA 4QXKA 2XDVA 3R0RA 3AKQA 4YLZA 4OHYA 5C7GA 2HYKA 2D5FA 1HJFA 5JSOA 5KXEA 2YBSA 4RS5A 4IEQA 4M01A 1XNCA 3VZNA 1AYN3 5SV8A 3ILFA 5JI7A 1OQDA 3WXPA 5EFUA 2R063 2E51A 2QDNA 4XUTA 1GV9A 3OGRA 4H14A 2VMDA 4JKMA 4N43C 1OUSA 3KT1A 2CL2A 3KVBA 1G8WA 3QH7A 1IG3A 2ZX3A 5IJRA 4LA3A 4GAZA 4FXKB 2YDEA 4P9JA 1SPPA 2GU9A 3BPSA 2VQTA 2XHKA 5FYUA 4ORFA 3O1RA 1MZEA 2A75A 3FJSA 4XFBA 5FZ3A 1ULCA 4FOWA 1LHNA 2A6VA 3MIBA 4P9WA 2QTWB 2VE1A 4JVAA 5LBEA 3VKOA 2R041 3VUOA 2W08A 1UY4A 5H9SA 3J8F3 4GQ7A 1H2NA 2O14A 3ZFGC 4FAHA 2CDPA 2D6NA 4NUBA 1PGW2 1UMHA 3ZR5A 1CWPA 4MGQA 3N9PA 4PF5A 1X8MA 3APBA 2ORZA 1AXYA 3U4SA 3WNXA 3D3AA 4JTNA 1ZBE1 4LKSA 1LOFA 1JU4A 3CJIC 3MIDA 3BU7A 2IVIB 3HIFA 2XJUA 3PTYA 5H9PA 1V70A 2WAOA 1HXS2 1SBEA 5FWEA 3UKVA 3TEZA 2GC1A 4L8QA 1B09A 1VBB1 2XUMA 3K4ZA 3DYPA 4QD2A 3VBOA 2XKOA 4WBBA 3N7MA 3GZUC 1YI7A 2GSYA 2WIIB 4Y5Z0 5DG1A 3RPQA 2JDZA 1C1FA 1UZ0A 2Y6KA 2Y6FA 1V6OA 2DYCA 2XQXA 4CCKA 4YVSB 1N1SA 1YQ8A 1HB2A 1IS5A 4JKLA 4XURA 4Y20B 2P3YA 3DL3A 3U1XA 5LA0A 5DZEA 3Q8EA 4CP2A 1KRIA 4R4ZA 1PGSA 1IPSA 4G9SB 4GWIA 4Y1XA 5A33B 2RJ2A 3CIHA 5FAXA 3N3HA 2FDFA 2VW0A 1R1ZA 1JXNA 1IHMA 1AJKA 2JD9A 4META 1RUH3 3QCWA 1F9KA 4DEVA 5FUPA 3AXDA 2BWAA 2VU9A 1RUD2 3CNAA 1EAH2 1YO8A 3ZSKA 4Q4X2 1VBA1 2AGSA 5C9AB 1WMDA 4QQPA 4CCEA 1FMD1 1UNBA 1JOJA 5DAPA 2YG0A 1C3HA 2IXHA 2ZGSA 3LPGA 1QJY1 1NZIA 1VRBA 3MV11 2XXZA 2AR6A 3NSTA 1O4YA 2ZGNA 3LE0A 3LIGA 4K1ZA 5FJHA 2B4KA 1NXMA 3BTAA 1V9U2 4FCAA 1L3JA 2WL1A 2WNVB 1W8UA 1W8ZA 2OKXA 1J3RA 3RVHA 3SHRA 3LA7A 2B46X 2JD4A 2FBEA 3U0ZA 3KHBA 2RS33 1OPMA 4Q4Y1 3RFRA 2ZX4A 3KLSA 4M3CA 1LU1A 1MVQA 1ST8A 1YEWA 4EN6B 5LASA 1EAH3 3GHNA 2BGPA 2ZEZA 4IEWA 5CIRA 4BIFA 2YGLA 4P08A 2AENA 3MLLA 3P1IA 3HNYM 4YNIA 1JUIA 3C7OA 3W20A 2FCUA 1UKRA 3ZN4A 1OOPC 1TNFA 1UL9A 5JR2A 3AL5A 1E5RA 1QWRA 1SFYA 2KXLA 3E5QA 4UF0B 5FR3A 5FMBA 5IT6A 1H6XA 1RUI3 2ZXQA 4PHZA 1OD3A 1GP6A 1R083 1AL22 1GZ9A 2C0ZA 2LTNA 2WZR1 2YFZA 2ZX0A 4LPLA 4WM7C 4GB33 3SKVA 4XE9A 4FI9A 1S1AA 4Q27A 4MXVA 3LZZA 1GWMA 1O5LA 4WZFA 4AGGA 5EJ1B 5I93A 4P9XA 4CCDA 4RS5C 3B94A 4D6RA 1WGPA 3PL0A 4EWAA 3SKJE 4YG6A 3LFIA 1MZ5A 3MLKA 3LOIA 1V6KA 1S0JA 4FTSA 2TBVA 3D82A 3LDBA 4IUGA 4E27A 4LMFA 2R071 4YGDA 3WNKA 3MYXA 2PLV2 3PVBB 2DCYA 2WQ4A 5A6XA 2VZQA 2RV9A 4Q4W1 2WNOA 4PLOA 3I2KA 2MEV3 3GXUA 2EVXA 4QPYA 3WQ0A 4OZOA 3ZMOA 3W5NA 4DB5A 1AL23 2DUQA 3F95A 4ZZ8A 3JQWA 1CGPA 3P6BA 4JC1A 2WN3A 4EZ4A 2WABA 4GH4A 1MQTA 4W8JA 2W1UA 4YZ5A 3D0SA 1SEFA 4AL9A 5LWBA 1AYM2 1AR82 1XE7A 3RI8A 4AAPA 2GN7A 4OZXA 4QPGA 3SCFA 5JMCA 4BB3A 1OQ1A 1H1MA 2HWB2 3OD4A 2FQPA 4MGIE 5FYVA 1J3QA 2ZACA 3MF6A 2IXKA 3FBMA 1AR71 3NNFA 4N7UA 5IAXA 5IVVA 2AH2A 1ENQA 2GP3A 1C4RA 1LOFC 2RDSA 3MEPA 4XHXA 4BZ4A 5A32B 2JG8A 1H1IA 1W3XA 2VBPA 1KS5A 3S0MA 2UY9A 1RUF1 4LNVA 4K8RB 1U0AA 4TZDA 5FPLA 1NKGA 4PDWA 4H55A 5J36A 2BOJA 3VBOC 3BTZA 1ASJ1 1OQEA 1T6BX 1LEDA 1AR63 1ENRA 1FOD1 1H9WA 3HR9A 3NAPA 4UFLA 5F8PA 3T0AA 1AYM3 1AR83 4LO7A 5I91A 4XFCA 5KWRA 1TVGA 2ZGTA 5FMCA 2ERFA 4OQ9A 1VBE1 4CCOA 1KJRA 2JB4A 4MV2A 4FQ4A 2D44A 5C3SA 2VY0A 1IS4A 2X10A 5HV4A 4BQYA 2XBO1 3I59B 2D6OX 5HBAA 2ZZJA 1I3HA 2WBKA 1RUC3 4A7KA 1ND3B 3JCIA 4LK6A 4AFCA 4R9CA 4ZPIA 4FO9A 2Y0IA 4QHZA 1CVNA 5FIXA 2DFCA 3MUY1 5HCFA 3DV8A 2EIDA 1SLLA 2WSVA 2FDKA 1OF3A 2PQQA 1QXRA 3V65A 3CJIB 3IN9A 1ZBA3 2J1UA 3DN7A 3QD6A 3HQUA 4SBVA 4V2WA 3ZXFA 1S0EA 5ISLA 1VAMA 2QQKA 2C1FA 1PK6A 1JZ7A 3L2HA 4K3UA 4CU6A 4NAMA 1MR5A 4FP2A 3DXUA 4DNYA 5C8CA 1ENSA 5JOXA 4GIQA 1QHDA 1ZA7A 4IW3A 4KU8A 4R9AA 4OI2A 4JX0A 2UYBA 2LALA 3PIJA 1POV0 1DQ4A 4OHXA 1SFNA 4I09A 4XXPA 4XEZA 1DGWX 4W6YA 3LCPA 4QMAA 1ZZ8A 2Y8KA 4E8CA 5JSRA 2QQJA 1AL0G 3ZPYA 2FZ1A 3WINE 2EALA 2YYOA 1TME2 1QDOA 2VOKA 3TEXA 4B1MA 4CDQA 5FDBA 2D97A 4L97A 4CDWB 3IWZA 1LU2A 2HWE3 1PIV2 4E4ZA 3RWKX 4DRRA 3GDBA 4XTPA 2HLEA 4MO3M 4Y26A 4D7SA 1W6NA 4XDOA 3SMHA 4QKNA 2VCCA 4YGCA 1DGRA 1AHSA 3ST7A 4XUOA 1WLCA 3O12A 3U07A 4CDXC 4IV3A 4B7KA 1PO13 3HEIA 3WW3A 4MGTA 3GCWA 5T3NA 2EXIA 4AI3A 1TMF2 1K12A 2VZSA 3VKLA 1DG6A 1TME3 1G9DA 1SG3A 2GC3A 1R092 4QU1A 1W9YA 3IPVA 4P00B 3WP5A 4BYYA 2BFUL 3NL1A 3VBSA 2OYZA 1LCLA 1PIV3 2BNOA 3C2UA 3ZYPA 4AEJA 5BNNA 5A7WA 4GJZA 3ZR6A 1BBT2 3ASIA 1Z7S1 2CGNA 2JE7A 4WV8A 2EA7A 3Q8BA 3SISA 1PGW1 3THTA 3ZYJB 5CFCA 4HOOA 2BVBA 2ET7A 4YG3A 4XXAA 5A7NA 2JDYA 4WM8A 2C9AA 2RE9A 4QB1A 4F3JA 5JXIA 3IIAA 4HT1T 4XW3A 1HDKA 3BODA 4RL7A 3GZTB 3ON7A 1GLHA 2P4EA 4A44A 5JOZA 3DECA 2QQVA 2D6MA 3EXUA 1OOPB 1RXFA 2BWCA 1IPKA 1MQTC 4LBJA 4XBLA 5GLZA 4XZPA 3MO4A 3MIFA 3CZJA 1HXS1 4I01A 3WCSA 3NNLA 1R093 1YRZA 3OGGA 3MIHA 4CU8A 5HCAA 3PDQA 3DPRA 4J25A 2D40A 2OIIA 3V0AB 2W3JA 3V0BA 3AVSA 1ZZBA 4JHZA 1BK1A 2CGOA 3W21A 5C8WA 2ZGPA 2R16A 2IVJA 3KSCA 5F39A 2BBVA 1WLTA 2WLQA 1NAEA 3LAGA 4BQ1A 1H1AA 2CAUA 2WZEA 5FYZA 1DYOA 2VVEA 2VTFA 4PI0A 2ARAA 4RS5B 4OUSA 2I2SA 2J1TA 3WDXA 4EN0A 1AR93 1CX4A 1OF4A 2E7QA 1PVC2 2EF6A 1DLLA 4AVBA 4NIDA 1V6JA 1UX6A 3MLJA 1UN1A 3JQXA 4KH9A 4YW7A 3OF1A 1CZVA 1LKNA 3I4IA 5LZ6A 2WT0A 3ZO0B 1RGSA 4IXLA 5C3RA 5IVFA 2E9QA 2C4XA 4NAOA 4AFMA 3CMGA 2RDNA 3NAPC 3PTRB 5EWSA 3OPTA 4DZGA 4R9BA 2I07B 4RFRB 1VRH1 5IHRA 2VGDA 3FUOA 1SPPB 1SBFA 2WNEA 2DVFA 1AVBA 1UOJA 1LESA 1RUD1 3AJYA 5LBFA 4Q4X1 1UCXA 3WG3A 3WR0A 1HN1A 4CTEA 3WNOA 1XXNA 4PJYA 3K75B 1JHNA 3LKJA 2ZBJA 3POBA 1SBDA 4OI4A 3WT3A 1W05A 4CZSA 5T54A 4JRAA 1W04A 4KGGA 2BERA 2XJSA 5A7PA 3U10A 1C8NA 1V9U1 4A4AA 3ACGA 4UFJA 4R8HA 4L2NA 4J1XA 4R52A 1NA1A 1QIQA 2H0BA 2YGMA 3CEWA 5FXWA 4CXWA 1PK6C 2DBNA 4M4RA 1KDKA 1OKOA 5A70A 4LR4A 1FNZA 3T08A 4QDRA 1JODA 4QQHA 3VBOB 1ONAA 3P5BA 3VD5A 1UX7A 3BIEA 4XFIA 2B7YA 3ZOIA 4CA9A 3ORJA 5AC93 1VBB2 3CJXA 2PHLA 4XABA 2WQ8A 2C9KA 1MS3A 4YVWA 4UWDA 3O1TA 1FV2A 3ACLA 5JIUA 1JYXA 5DXDA 1RTVA 3EMRA 1PO21 2R043 3VDDB 1GZWA 4MGKE 4IEOA 4LO8A 4YW3A 5A3UA 4AXOA 1Z0HA 2J1SA 3ZXEA 4H2AA 5A3MA 4HK9A 5HI0A 2QUOA 1UMIA 2DVGA 3GNEA 3OGVA 1LEMA 2OT7A 1UAIA 1ZBE3 1H30A 2XVLA 1H2KA 2PQSA 3MICA 5CU1A 1GP4A 1H8VA 1O8SA 2D98A 5ACA1 5KBFA 2BDRA 4I3PA 4HLTA 4QQOA 5L9VA 4IV3C 4O9EA 2HEYF 3IMNA 1FI2A 2ENRA 1DIWA 1KS4A 2PLV1 1VBB3 2XH6A 2FDJA 3KF5A 4IGOA 3WNNA 4EN8B 1OKQA 5LCWL 4HSJA 1O3SA 4IEXA 4XILA 4B7EA 2XPJA 4YM3A 1LOAA 3OY8A 2J1RA 3WF0A 5IWFA 1Y9GA 4D8MA 4LQRA 4Z07A 3RZZA 1TE1B 2CDOA 1FMD2 1DHKB 3ITQA 2YHJA 4EROA 3VBSC 5APAA 3RMYA 4LUKA 2CYFA 2E26A 5BNNC 3ECQA 1QJY2 3WLUA 2BGCA 5CKQA 2OQ6A 4JCKA 3ZYHA 5FV3A 1NQDA 4FPKA 3AXEA 1UOGA 4QDQA 2UYAA 4G3YC 5CFCC 3PVOA 3KV4A 4Q0PA 3OBTA 5FY9A 1JN2P 5FY1A 5ABJA 2HWB1 2YBKA 2HBUA 2ET1A 3OUJA 4IEYA 4P5HA 1VE0A 2XOMA 2P3JA 1QH6A 2EXJA 3AMMA 2K2SA 3PNAA 3PHMA 1REEA 2RVAA 2W1WA 3TAYA 1UXXX 2FDHA 4LUMA 4EZHA 1W9FA 2WWSA 5CZKA 3OUHA 3H3UA 2BW8A 4MHRA 4W50A 5F37A 1ZNPA 2XVGA 1XC6A 3MFAA 1J58A 3RZJA 1ZREA 4NN0A 1VBA3 2QJVA 1ZRFA 2SBAA 2P1BA 1S2EA 3DPRC 1SDDB 3ZX7A 4W4ZA 1OBNA 4E2QA 4CDXB 5C71A 1WMXA 1R1A2 5FYYA 1QJY3 2EXKA 5FREA 2Y26A 3QBQA 1PGL2 1QQP2 1D7PM 3W9AA 3ZXLA 4DOUA 4HVRA 3PU8A 3W5MA 2ZGLA 4L92A 3VLBB 3OPWA 1Y9QA 3POFA 4BXSV 3H8RA 3LGRA 1B35A 2C5DA 3POJA 4YVSC 4KBBA 4LBKA 2FMYA 3PMSA 1APNA 1RVF1 2I45A 4Q4Y3 5FLHA 3UJOA 4CEYA 4LHNA 1DZRA 1YFYA 1AF9A 4HBNA 2VZVA 3VZLA 2ZKNA 3MF9A 4H7MA 4OVEA 5JUVA 5LEJA 1FPN3 5A7SA 1CAXA 3DF0A 4ZS2A 1YCIA 4KGQA 3RMXA 1W99A 2R072 2R0FA 2QKDA 4RA0A 4PLMA 2G9ZA 4ES9A 2E32A 4K40A 3V56A 3Q8AA 1AX2A 2W52A 3A23A 2JIGA 2GNTA 4Q4W2 5A3TA 3R4DB 4GH4B 1MQTB 5K8SA 5LRRA 3O7OA 2DCTA 3OD0A 3ETQA 5SV5A 2WZR3 1S0FA 4CCJA 2FDIA 1DZQA 5GZCA 1I1EA 4QPGB 5FP8A 2XLAA 3U75A 4E8DA 1JZ3A 5GZDA 2DTWA 4FPLA 3O14A 4UW6A 4XF4A 3GZEA 1O5UA 1UD1A 1PM7A 3AZXA 4LIUA 5F5CA 2WA4A 3ZYIB 2QDRA 3N7JA 3R4SA 5KHHA 1VMJA 2LM3A 1SZBA 1TNRA 2JG8B 3A7QA 3ABZA 3LIHA 1NA1C 2WWJA 3KMHA 4B4QA 4ZKTB 3AX4A 2GP5A 2W92A 1CIWA 4GXLA 2Q8CA 4AWDA 5GLTA 4CUGA 4F7ZA 2R073 4FOVA 4PDWB 1W8OA 4FFHA 1JTZX 1OLQA 3UT0A 1JUHA 1OPOA 3HNBM 4L0PA 4LIVA 1GFF2 3ES1A 4QX2A 1RUF2 1W6MA 1Y7BA 1XYOA 3DCQA 3VZOA 3NAPB 4AQTA 1GKBA 1ZVFA 4DINB 1OHFA 5DPNA 4HFSA 4YVWC 2VZOA 4FFFA 3MPPG 1UXZA 1NLQA 4RQPA 4PT6A 3RGBA 1FOD2 2CWMA 5FJKA 3VDBA 2O8QA 5JMOA 2GN3A 3TBDA 3SH4A 1J3PA 1NXD1 2CSGA 4FPGA 5J37A 1OLMA 2V73A 4COZA 1QEXA 5K9YA 1BKZA 2VMGA 3SITA 1TMF1 3FC0A 1VBE2 4YM2A 5FO9B 5CB7A 4DUXA 1AR73 1LB2A 2NM1A 5AFEA 4AQSA 4XETA 3I3BA 1F5FA 1F8VA 2HBTA 4BISA 2ZAAA 3JBG1 2QFEA 1WLDA 1C5HA 1BBT1 5L7OA 1RUF3 2D6LX 2ADDA 1RHI3 4DS0A 5BV6A 2DUPA 4Q0QA 3POIA 4ZU7A 1NCRA 2W9XA 5I0TA 5CEHA 5I0DA 1ASJ3 3OTFA 4HKLA 2OUJA 4PQ9A 1H0BA 5CAZA 3WP3A 1UU4A 3I7DA 3ZXAC 5JOWA 2ZS6B 4XJWA 1FOD3 1CESA 4XTMA 1N3OA 4LT5A 2ZA9A 1WMEA 5FXZA 1A8DA 3FE5A 4EE2A 4AEDA 2Q8OA 1VBE3 2OQ7A 3M3OA 2J1AA 3J26N 4RHV3 5I0SA 1RUE3 5LA1A 3NQHA 3OJBA 4O9GA 3T09A 1U5YA 2XBO3 5ABJC 3HJRA 1REDA 4CDQB 1U5ZA 4YW6A 5C8CC 4CP0A 1W6QA 1LULA 4AHXA 4NIHA 3A0NA 4BLIA 5FFOC 2WJSA 1XRUA 2VVFA 1PMHX 1SCRA 1LENA 3C3VA 3NJYA 4IESA 1W6NB 4BWOA 3M3IA 4CRQA 2BTVC 3PUHA 1SHWB 3VHRA 3USSA 4BU2A 4QPIA 2JIJA 4BQ3A 3LSDA 2R30A 1PVC1 1CAVA 4QB6A 4IE7A 5F5QA 4QXCA 3UJQA 4NPLA 4AFAA 3ZDSA 4LBQA 5DG2A 2Y6LA 3ENRA 4IV3B 3O0XA 5JPMB 4AAXA 4W6WA 4UBHA 1Y43B 2WR9A 4CPBD 5EHDA 3NJVA 1XPWA 3AVRA 3E6BA 5GKAC 1LHOA 2DVDA 4I0WB 1GWKA 4BM8A 3H1MA 4UW3A 2ZMKA 1S0DA 5L19A 1QJFA 2TNFA 1EY2A 4YRDA 3IPVB 1UO9A 4EWDA 4YZ3A 4QQLA 4LBQD 2RMU2 3VBSB 1ENXA 2RS13 1B35C 5BNNB 1UPIA 5A7WB 4ASKA 5KHGA 1ULFA 5EV7A 2HWF1 5BXXA 2QQNA 1NLRA 1H6YA 2VOTA 4C0BA 5CFCB 1TZOA 2Y64A 2IXJA 2D3PA 4WM8B 5JSPA 2C6SA 5FK7A 1Z7S2 5F2WA 1N47A 3GBFA 2EAKA 1YQ2A 2DWRA 4LOSA 3I3EA 4RR3A 1KJLA 1ND3C 5FZBA 2R49A 1UZYA 5FZGA 3J7HA 3GHMA 2WT1A 1US2A 4GWNA 3N9LA 1K5MA 5T5JA 4RGGA 3AMPA 3D4KA 3DPRB 5DAXA 1OH3A 4AGVA 4QXHA 4COUA 4ZU5A 5FZ6A 3V0BB 1W8WA 2OZJA 3IDBB 1UYYA 4KMQA 4Q2FA 1RC6A 4Z1VA 5FYTA 5FXXA 3A21A 1J1LA 1MZFA 4MVTA 3UKTA 4S2HA 3PURA 2P3KA 1HRI1 2VZPA 2WINB 2W1QA 2ZEYA 1JZ4A 3DGTA 4AEKA 2JDUA 1WD3A 1Z7S3 2YZ4A 3J7NA 1DP0A 1ULGA 1G6NA 4KWKA 3BPZA 5C6CA 2Q0AA 3CLPA 4LE4A 4P14A 4CXYA 4QQ2A 2VULA 1JHJA 3KS7A 4IV1A 3NNJA 4JHTA 3U11A 5BUVA 4UAPA 3VDDA 3KWVA 3AKSA 1NX9A 1NG0A 1ZZ6A 1CAUA 3M3CA 5FO7B 3NVCA 4CDWC 3S6PA 3ZVXA 1HJGA 2J22A 3IM0A 1IQAA 5C3QA 4UT5A 4NMIA 5JAXA 4AGRA 4COWA 3ZMNA 3SLIA 4RQPC 3KM5A 2JECA 4O7XA 5F3GA 1HXS3 3AP4A 1DDLA 2ZPXA 4XFGA 1UU6A 1VRH2 3VV1A 3O1MA 2DCZA 2VVDA 1HIXA 3GF6A 1YI9A 2VPVA 2BP6A 1G86A 4W6XA 2YMZA 1UY3A 3BKZA 3N9MA 3H7JA 1GWLA 2CWSA 4AZZA 3WNMA 1DQ2A 4BK5A 3FFQA 5L7OC 5A3OA 1ACCA 1NA1B 2ZAHA 1XB9A 4MUVA 2NYYA 4MSVA 1PZ7A 1NCRC 1HW5A 2ZGQA 3EBRA 3LQCA 4JKKA 5FKBA 3AK0A 2F4PA 2TUNA 4TYSA 1HRV2 2Q5TA 3WW1A 1LOCA 1YJLA 2GNMA 2RS51 5JZGA 1RUJ2 2HEWF 1V6NA 3OYWA 5JR7B 4IGPA 4IETA 4Q5OA 3S7IA 1COV2 1IOAA 3THDA 1VRH3 2PELA 4Q4V1 1J59A 1I6XA 5KXCA 4AEDC 1D4M2 4YVWB 1RUD3 4Q26A 1HB1A 2EIBA 5L36A 4Q4X3 3BVCA 3Q8FA 1HN0A 1GZWB 1R1A1 3S30A 2XONA 3IAPA 4GULA 5F5AA 4EV0A 5DAVA 4IQPA 5FY8A 1XU1A 1PGL1 1QQP1 2MNGA 1VLNA 5BNPA 2CV6A 1PO22 1JYCA 5A1AA 3NKGA 5I0UA 2JDPA 1V9U3 5C4WA 3WP4A 5DUWA 2EXHA 5E1RA 2WQZC 2R1BA 3DUIA 3HT2A 4IEZA 2QQMA 4CSWA 2Q8DA 3U78A 3ATGA 3HN1A 4AE2A 2WRAA 4XHBA 1NY71 4DPNA 4A45A 2LS6A 5ACA2 4Y1YA 1IS3A 3LA2A 4YZ2A 5DMYA 5FZMA 1DGLA 2K0GA 3OY8B 3LA3A 4Q0VA 1LGBA 1U5IA 1VBD1 3AKPA 3NJXA 4NPMA 4L9BA 4WVMA 2DBIA 2HWD2 3M1HA 3ZYFA 3ZXDA 1KFXL 1SQ4A 3O1VA 1ULPA 1D4VB 2C26A 3NRUA 1PO23 4LJHA 3RYRA 3LDKA 4KWLA 4F83A 2VNGA 5A1LA 3ROUA 4E2SA 3R6SA 5I8YA 3N9NA 3AM2A 4FPFA 1GANA 2BYVE 2VMCA 4YSFA 5ABJB 2BV4A 2VOWA 5C8CB 3PMEA 3ACHA 5LK7B 3ZFFA 4Y24A 2ZEWA 1YIFA 3L9JT 4RD7A 5H9QA 4BQ4A 4PBPA 4RR3C 3I3DA 4NR1A 3POYA 1XYNA 4AOCA 1S0BA 3PJQA 3RRDA 3H1WA 5FZFA 4XYXA 5J7MA 1SLIA 1HLCA 2VR4A 3JD72 4HN1A 4I3GA 3O1OA 3AYCA 3I3MA 1V6MA 3PUAA 2PLV3 3VZMA 1I5PA 2JWPA 2ZKLA 1W8FA 1HQWA 1PVXA 4MGYE 3MIEA 3A22A 2ADEA 1D2SA
chains in the Genus database with same CATH topology
1DBNA 1O3TA 3OBRA 3QLQA 1AX0A 3TWIA 2GALA 3KGZA 1VBC1 4QM8A 5EJ3A 4C1WA 1G9CA 4UXAA 5CADA 3J4UH 3WV6A 2N7GA 4QHBA 2ZTNA 1CAWA 5AVPA 1LGCA 2YY1A 1B35B 3A0KA 2OPKA 1X33A 5E89A 5GZGA 2CNAA 3O0WA 2HWB3 4IV1C 4CEYB 3M70A 4NO4A 1BQPA 3VDDC 3N4MA 4N90A 3MW4A 1CAXB 2BPA2 1RVF2 3IDEA 1DF0A 1NLSA 3AYDA 2NN8A 2Z79A 3SCGA 3IBMA 3AFGA 2XL7A 4LBLA 4LLFA 1X36A 3VBFA 3HT1A 4NWVA 4GA9A 1EYBA 1LOEA 2WT2A 1RL3A 2X29A 4I02A 3N7KA 4QGMA 1V6LA 3EHKA 1JW6A 3I54A 3WW4A 4GKYA 2HWC1 3ZIWA 4DMIA 4XF9A 4YARA 1JYIA 4NWWA 1POV3 1RJ8A 5FTTC 4AW7A 4MH0E 5EYXA 2D5HA 1SACA 1YWKA 5T5PA 5DZGA 2E6VA 1LHUA 1CJPA 4XIKA 4Y1ZA 3ZXJA 4B8EA 4HKOA 1W6MB 1GR3A 1Q8QA 4CYDA 1CQ9A 1G9AA 1AYN1 3ZXKA 5K7PA 4RQPB 2ARBA 2R061 3QH6A 4KG8A 1ND2A 5CFDA 3WP6A 1N1VA 4HL0A 1A6CA 1ZZ7A 3HQXA 1F5JA 4HETA 5BPXA 3WG4A 3ZSMA 1D0GA 1NCQA 4M00A 4YW2A 2ETEA 1LHVA 5BNPC 2WFF2 2ZGRA 4LO6B 5C4WC 2JE9A 2Y38A 3USUA 2DFBA 2D7FA 2RMU1 4IEPA 4KL1A 5L7OB 2Z69A 4AVCA 2GAUA 5LK5A 1SLCA 3RSJA 2VXRA 4X6RB 1GICA 1NCRB 1O4ZA 2YV8A 3JBG2 2W68A 5TSWA 4XBQA 4ATFA 2Q30A 1GQGA 4XDQA 4X8NA 4L11A 4N53A 3MI8A 2WS92 1CPMA 4XJAA 3RYPA 5B2GB 1WCKA 2KM2A 2YPJA 4AEDB 2DTYA 3EJKA 4LO4B 2E7TA 2TEPA 4BH9A 2E63A 1PNGA 4XJZA 5E16A 4MX3A 5FPXA 4Q1PA 2CTVA 1BZWA 1TMF3 4GH4C 1MEC2 1W6QB 2WLPA 3ZFFC 1CPNA 1MS5A 2GC0A 2ZABA 4QPGC 1QJX2 3FBYA 4K20A 1CN1A 4QPIB 1YFUA 1CAVB 1BBT3 2DURA 2VMIA 3KCXA 4UW4A 3E6DA 4LBQB 2ARXA 2JG8C 2BEOA 3H8UA 3I2DA 4FOYA 3VL9A 4U36A 3AKRA 1G9FA 1LECA 2GMMA 4J6GA 2UWCA 3KGLA 4LEJA 1ZRRA 5BNQA 4X6QB 4PDWC 2AYHA 5KC6A 1QOSA 3POWA 4FBFA 4OULA 2A70A 1IZ3A 2ZX1A 3UL2A 1QF3A 4PIXA 1IKPA 3B9CA 2X5IA 3AP7A 1A78A 3BOWA 4KWJA 1DQ0A 1GSLA 1SCSA 3AP6A 4K6BA 5HCBA 3W58A 3WDVA 2W39A 4B29A 2NPIA 1HKDA 3A4UA 2HWF2 2RR12 1RUG2 4LBNA 5JLVA 4RR3B 4BMBA 4AHWA 1PVC3 2PFWA 4PIYA 2MHFA 1K5MB 3VBFC 2PHDA 2A3WA 1MS4A 1ZZ9A 4MZUA 2Q4SA 1HRV1 1W0OA 1RUJ1 1COV1 2PHTA 4EN7B 3WD5A 2ZOEB 1WCDJ 2HJIA 1DGWA 1X50A 3M2MA 3CL1A 1D4M1 2A6XA 5F6LB 1C8M1 3INAA 4WVWA 2BQPA 1AZDA 3IKWA 2PHUA 4YW1A 4YW4A 2GMPA 2ZCWA 1HRI2 4GB31 3ALQA 4IV1B 1FYUA 1OSGA 5CNAA 5KC5A 2QZ3A 4CDQC 5T52A 1CAUB 3H7YA 1OA3A 2RM22 1UMZA 2V09A 1UIJA 3TNPB 1RMU1 4DXZA 2H6BA 2WFPA 1ND2C 4ASMB 1LTEA 4AI8A 4HPKA 4V1PA 4JDNA 1NCQC 2XLGA 1PZ9A 3FFZA 3VHOA 2GZWA 2MEV1 1WW6A 1OD5A 4K9SA 2HWD1 5DDJ1 2PN5A 4Z92B 2NZ9A 3AP5A 2DU0A 3KZ4C 1C28A 3ZN5A 2OVUA 5GLVA 3NV4A 5JZGB 2PTMA 1BEV2 3OYWB 3LOBA 2P3IA 4N53C 3UKNA 4WM8C 2RS52 2OW4A 4QU2A 3JD71 4XFHA 1D0HA 1LOBA 4D7TA 1LOGA 2PAKA 2FHRA 4CP1A 2ZGOA 1QKQA 4Q4V2 2ZX2A 4LO5B 3ZN6A 2CY6A 4AYUA 3ZIXA 3MW3A 4LULA 3WQ7A 3M7AA 1GNZA 4A7ZA 4YFWA 5BNPB 4FPYA 4LHKA 1FMD3 2VW2A 5C4WB 4KG0A 4HMZA 1LGNA 5D8AA 4YGEA 4BCUA 4N7IA 1WBLA 2O8OA 3ZYRA 3RI9A 5FO8B 1Q5OA 1HQLA 5JCTA 3WDUA 3FX3A 4ISRA 5JDBA 3TRSB 2Z2SB 2D3SA 3KT7A 3B5LB 4AI2A 1VAKA 1AX1A 4YM1A 2R32A 3AZZA 3AJZA 2AUYA 1NY72 4WVMB 3VZKA 4FPEA 2BVVA 3PVEA 2X5IC 2Z5WA 1VBD2 1R1A3 5DUVA 3U4XA 2YC0A 4N43A 5FQ0A 1N3PA 1QQP3 3Q9OA 2XL9A 2PHWA 3ZFFB 1OA4A 1ZRCA 3RDIA 2GH8A 2XGXA 4Y4YA 1FNYA 2LUWA 2JKBA 4XFAA 1KXGA 3LSEA 4NPRA 4DFSA 3ZSEA 4W65A 3AKTA 3AFKA 1W2UA 2ZHMA 3VN4A 3ZFGA 4HK8A 3VKFC 2IZWA 3W59A 1VB2A 1NQJA 1VBD3 2MPFA 3VBHA 1FXZA 1EPWA 3GALA 3JUUA 4Q4W3 1Y3TA 5FLJA 4XQDA 1XNKA 3I8TA 1CAWB 2JJ6A 5I8SA 4KQ7A 4WVZA 1VBC2 3TNQA 3NV3A 4AG4A 2WFF1 1QJZA 3MZHA 2KA3A 2WSUA 4Z82A 3WDTA 1QGLA 1Q56A 1OMIA 1M06G 1GZCA 4JTOA 4YZ1A 1WMFA 1DQ1A 4FPOB 1UZZA 4JGZA 3FWEA 4WVVA 1RJ7A 1DU3D 3G6JB 3HWJA 3O0VA 3VBFB 4D94A 3WG1A 2EAAA 2B42B 1Q8SA 1G7YA 3BOPA 4N9HA 2WS91 1OI6A 1H8TA 3SH5A 3NV2A 4D3WA 4XOGA 3GYDA 3UV9A 4Q1RA 2DU1A 2CAVA 5CG8A 2PAMA 2UWBA 1WBFA 2WC2A 2JX9A 4XJUA 2HWC2 1LODA 4OHZA 1MEC1 2Y0OA 4ONUA 1H2MA 1FATA 2DVBA 1I5ZA 3B69A 1QY4A 3VGIA 4A7YA 4XQWA 2OZ6A 5CBLA 1QJX1 3BALA 1QDCA 3ELNA 2VMHA 4ASLA 1XNDA 4UBGA 3JB8A 3VZJA 4I2OA 1J1TA 4S2FA 1QJU2 4SLIA 4UW5A 1I9RA 3WHUA 4OI0A 3FUQA 1ND2B 5BNOA 5CFDB 4AVVA 1AYN2 3BCWA 3KCYA 4LE3A 1NCQB 3G7DA 4AQ2A 5L73A 1JH5A 2R062 4EJRA 3USUB 2NMNA 4HVQA 3T1LA 4FXGB 5D8AC 1CR7A 3ZSJA 4AVSA 3WY6A 4C1XA 3JU9A 2B5HA 4P9YA 1ULEA 2JG9A 4CDUA 1F2NA 1LR5A 4WM7A 2XKPA 4AQ6A 3AZVA 3V64A 4M3CE 1DZTA 1E57A 2YROA 4IEVA 2P17A 1MS8A 2RR11 1RUG1 4IERA 2JENA 4CEYC 4N53B 3J8F2 1JBCA 2JXAA 1GBGA 2A5ZA 5J3UA 1HV0A 3T1MA 1VALA 4GMP1 3CU7A 5KHJA 3D0JA 2FZ2A 3NV1A 5GLUA 4XIOA 1QXPA 2IFWA 1BMV2 5FOBB 4E9KA 3MIGA 3TN91 1S0IA 1EV11 1C57A 3D8CA 3B01A 4QT6A 3AMHA 1QNYA 1REFA 3LWCA 2RMU3 5AC91 1VR3A 3CF6E 2G9FA 4B4PA 1NYWA 3WHTA 2ZGUA 3MW2A 1LJ7A 4P9GA 3O5SA 4BHPA 4EN9B 2IXCA 4Y22A 3VBHC 3P3PA 2RM21 1WW7A 1FT9A 1Q8OA 3R4UA 2XB6C 4LA2A 1HV1A 3N35A 3DKWA 2X5IB 4K1YA 2ES3A 4I0AA 1RUH2 4AHZA 3H50A 2WA3A 1SLAA 1MZ6A 1WA4A 4GALA 4NVPA 3OGJA 2VOVA 2IC1A 2F6BA 2ZGMA 4JGZC 2WNUA 1YNAA 4MYEA 4QGLA 1OA2A 1V6IA 1YIPA 4TLFA 1YXWA 4FPCA 2DCKA 5A3LA 1S0GA 5J09A 1BEV1 2B45X 2VOXA 4NOTA 5HXVA 1H8TC 3WVJA 5E8AA 1BCXA 5DUXA 5CG9A 1VP6A 4COYA 4E4SA 2D3RA 2RS32 5T50A 2A3YA 1QOTA 1UIKA 2R6QA 4JDOA 4YGBA 3WDWA 4INDA 1V00A 1VB4A 4DY5A 1H4HA 3QACA 3PJYA 1C8M2 2D43A 1RINA 3MDPA 2NLRA 5IK7A 1RUI2 1R082 2VNOA 3RQ0A 5GJ6A 4YYOA 1VAVA 4GB32 5FCCA 1IS6A 3IDCB 1X7NA 5F1RA 4BOWA 5BNOC 4QPIC 2VW1A 1HRV3 4HPKB 2B39A 2PHXA 1LRHA 1RUJ3 1S55A 2NMOA 3NKTA 1RMU2 3NWKA 4HVOA 4J1WA 1COV3 4BMEA 4IEUA 1FPN1 4R4XA 1D2QA 1SLTA 1D4M3 3B02A 3GBGA 4FTBA 1C8M3 1ZM1A 4Q0SA 5KHKA 4OFGA 1VIWB 4A2UA 2HKXA 2MEV2 5GZEA 2JG9C 4BPZA 4CDUC 2OUHA 5DDJ2 4ES8A 3ZXGA 1O3QA 3PVNA 4BE3A 1RUNA 1Q8PA 1C1LA 5T55A 5GM0A 1RMU3 2IXLA 2XVKA 4LBMA 4OI1A 4ZXKA 5F9TA 4GKXA 4RGAA 3FHIB 5ACA3 3ZN6B 1Z78A 1NE6A 3KQRA 1K5MC 3KCCA 3B7MA 5DUUA 4XMIA 4DQAA 2HWD3 3M3QA 5DDJ3 2A6ZA 2YXSA 4Z8BA 1X8EA 3JB4C 2BFUS 2O0OA 5D8AB 1DYPA 3AYEA 1AR62 1W39A 5CA6A 2GMEA 5GLWA 4MLOA 5GALA 3MFCA 2X8KA 1S2KA 4QM9A 1S2BA 1BVP1 2H0VA 4AI0A 1KITA 3OPZA 3GZAA 3JD73 1RUC2 2DCJA 4LTAA 3ZFEA 3HMYA 3NJZA 1RHI1 1OFSA 5FMOS 5EYYA 2D6PA 4N43B 5FQ0B 5EZWA 5F6KA 1SMVA 1ZBA2 1DQ5A 1OLRA 4RFT0 4XPVA 5K0UA 3RJ2X 3AMQA 2W0XA 2WNUC 4JDMA 4KNCA 2ILMA 1O4TA 4S2GA 1WW4A 2IXIA 4C0HA 4RHV1 4WZCA 5J48A 1RUE1 5AVAA 4L99A 3ZFGB 5BY5A 2XJVA 2DF7A 5C33A 1QU0A 4FPHA 4K21A 5FRAA 2VUJA 2VUAA 4YFZA 1HX6A 2CGPA 4E4DX 4Q8KA 1RVF3 3VBHB 4HSLA 4AFDA 5JZGC 3VKMA 1QJU1 2HWE2 3EO6A 3J9SA 4KU7A 4BLJA 2E53A 4JGYA 5IK8A 5IK4A 5DZFA 4EWEA 4RSUA 2G9GA 2BUKA 3RG0A 2X53S 4MXWA 1BXHA 4MGZE 1NOVA 1T6GC 5JPNB 3OCPA 4XF3A 4CEWA 4I30A 5KXBA 1N1TA 1NE4A 1PO12 1UKGA 4K8FA 2V5YA 3X29B 1VJ2A 4JGZB 1U5XA 3VBUA 2QE3A 1PNFA 2RS11 1W6OA 3LB9A 4H3WA 3VHPA 3ILRA 3WDYA 1AJOA 1EPZA 2YUEA 4M0NA 1W6PA 3HBZA 4OHVA 2A3XA 3J8F1 3VBRA 1H8TB 2DUOA 2R1DA 4M3CF 3WZ1A 1SDWA 1WD4A 4YZ4A 2XJQA 1YLLA 2D93A 5T5OA 4JQRA 4LHLA 1UU5A 1ZRDA 1ULDA 2IFRA 1BMV1 1MS0A 4AK3A 3H1YA 1ZYBA 2WFF3 3KD4A 3L2YA 2XWJB 2H6CA 2ZHNA 1CONA 4P9IA 4A3XA 3FLPA 2HEVF 4FQZA 2XJTA 2ZGKA 4HKWA 1XE8A 1H4GA 2R0HA 3JBG3 5BNOB 4DY3A 3WOGA 2GH2A 3AZYA 3E97A 1AR92 1QMJA 4Q8LA 1QXJA 2VNRA 3D5OA 1NZCA 1XNBA 2D6KA 2WS93 5JIAA 4FSJA 1Q3EA 3TYJA 4D69A 5I8TA 4PLNA 5FMOL 2Z42A 3THPA 3MGUA 3SXWA 1UF2C 2JG9B 3K51A 1RUH1 4CDUB 1MEC3 3WUDA 4WM7B 1KFUL 2PHRA 2A73B 3K48A 1QJX3 3VHNA 3B00A 2UURA 3M4FA 3ZFEC 1G9BA 4TWTA 4XJ8A 1YFWA 4JRLA 1KQRA 4QX5A 3N36A 4JV4A 4YVSA 4HZFA 4XFFA 4Y20A 1GYKA 2XJRA 4Q29A 5K0UC 2PYTA 3FLRA 1ZA4A 1FV3A 2RJKA 2G4IA 4OHWA 2RS31 5JWPA 3GBWA 5EXOA 5A33A 4COVA 1W0PA 4TSVA 1EAH1 3TN92 1EV12 3H3ZA 1TEIA 3FZ3A 2GNDA 4X8PA 5AC92 3SNMA 4ATEA 2DV9A 3AZWA 5FBZA 4JAAA 3ZYGA 4XJ9A 4Y22B 3RNSA 2HWF3 1RUI1 2RR13 5C9AA 1RUG3 1PMIA 2R042 1R081 5LEKA 1BVVA 4S2DA 3E5XA 3UK9A 4AVAA 2QNKA 1IGOA 4ITCA 1F31A 1PHMA 3NO8A 4GMP3 4LBOA 2ZHKA 4FPJA 4GMP0 1WCSA 4JGYC 5BYNA 1ZBE2 3CO2A 4Z2WA 3T2TA 1ALYA 2ZMLA 2WNVA 5JVVA 2ZJCA 3SCHA 1O3RA 4XMAA 3RJRA 1EV13 3TN93 1UW8A 1N1YA 5CFDC 4CEWC 3WG2A 5GZFA 1TQ5A 1H9PA 2PA7A 3PLQA 3WQ1A 5JI9A 3HAGA 4F8AA 3VBUC 2VH9A 2WNUB 1BYHA 3ME2A 4PIZA 2GDFA 1KD7A 1N3QA 1AL21 1GQHA 1HRI3 1Q8VA 5D1IA 4Y1VA 2QCSB 4NHKA 3FLTA 2RM23 3VBRC 1X82A 1FX5A 5T5LA 3FMGA 1Q43A 2Q1MA 2E7AA 1URXA 3WX5A 1WLWA 1XYPA 2OA2A 4Y1UA 1PZ8A 4M0HA 3AP9A 3KB5A 2ZMNA 1MS9A 2XLFA 1QNWA 2PHFA 1O91A 4AEMA 1RITA 4PBOA 5JOYA 3M8LA 1RB8G 1VBA2 5IK5A 3QOPA 2JICA 3VKNA 1MVEA 3TB0A 1OFNA 2DVAA 2EIGA 3NW4A 5LRSA 2BNMA 1M4WA 2GNBA 1AR61 3ILNA 4K7JA 2XG3A 1AYM1 1AR81 2GC2A 2P37A 2VQAA 4NHLA 4AHYA 3S7EA 1UPSA 4XBNA 4FTEA 1BEV3 2XWBB 1MS1A 4M3CB 4B3NA 3BIWE 2XJPA 1A8MA 1RIRA 3E6CC 5FPZA 3P3NA 1AXZA 3ZSLA 2RS53 3SH3A 4Q4Y2 1RUC1 4GWMA 2A71A 1FPN2 4Q4V3 5A32A 2VECA 5KHIA 2UY8A 1IKQA 2ATFA 2P34A 4PCRA 1QH7A 1ZBA1 4FOQA 2QQPA 3BB6A 1C5IA 1DQ6A 4C90A 3B9IA 2A6YA 3E5UA 2WZR2 2B8MA 4OLLA 1A3KA 1AXKA 3WCRA 3RS6A 3H9AA 1POV1 1DGRN 1SLBA 2K9ZA 4N9IA 1AUYA 2WZPP 3M3EA 2RJLA 3I59A 4HN0A 1GNHA 4R9DA 5J96B 4B4RA 3WW2A 4FT8A 1ND3A 1H2LA 2HWE1 2BNNA 3R05A 4XQ4A 1CD3G 3AYAA 1IPJA 4Q0UA 2P2KA 4OUMA 4YM0A 3CJIA 5H9RA 4AVTA 2AREA 5C9AC 3VL8A 4E2GA 2RHPA 1FAYA 1DYKA 1PO11 2QZ2A 2VQ0A 1YFXA 1HQNA 1XQNA 4P9LA 5IUQA 3B3QE 3AB0A 3N7LA 1WUVA 4FP3A 1BJQA 4I0BA 1AR72 1TME1 1DFQA 1YYNA 2NQYA 3ZFEB 4D7YA 2O1QA 2NP0A 3RYKA 2WNVC 3ES4A 1PIV1 2I74A 5CVRA 1LHWA 3B93A 5AFBA 5KXDA 1ZX5A 1RHI2 3POSA 5J98B 2WKKA 1MACA 4XF1A 4CDWA 5K0UB 1O7FA 4LLOA 4YG0A 4DRVA 1ASJ2 3WUCA 3AMNA 2UU8A 4U2AA 2PAEA 4ZU4A 1VBC3 1WW5A 4BA6A 4H7LA 3TOJA 4BIOA 1YHFA 1XU2A 1U12A 4QGNA 1YUDA 4RHV2 1R091 4YW5A 1RUE2 3H0OA 2IWGB 2QVSB 4XF0A 3KT4A 2XBO2 1YJKA 2UWAA 4C91A 2A7AA 4NHMA 4IL7A 2AZ5A 4G4FA 4JGYB 2FMDA 1PK6B 1ZZCA 3D6EA 1AR91 2ZZQA 5FLIA 2VG9A 4MXWB 4FVVA 3MPBA 2A6WA 3IT8A 4CEWB 2Q1ZB 1QOOA 1EP0A 3HD8B 1CJDA 4HANA 3VBUB 1W6OB 4AF9A 4ISQA 2HWC3 3RWNA 3JZVA 4URTA 5FOJB 1OOPA 1S0CA 5E88A 2B9UA 2JEMA 3EQEA 1W6PB 2RS12 3VBRB 3V0AA 2SLIA 1QJU3 1KDMA 2ZHLA 4QXKA 3R0RA 4YLZA 3AKQA 4OHYA 2HYKA 2D5FA 5JSOA 5KXEA 4RS5A 4IEQA 4M01A 1XNCA 3VZNA 1AYN3 5SV8A 3ILFA 5JI7A 1OQDA 3WXPA 5EFUA 2R063 2E51A 2QDNA 1GV9A 4H14A 4N43C 3KT1A 2CL2A 1G8WA 3QH7A 2ZX3A 4LA3A 4FXKB 2YDEA 4P9JA 2GU9A 2XHKA 4ORFA 1MZEA 2A75A 3FJSA 4XFBA 1ULCA 4FOWA 1LHNA 2A6VA 3MIBA 4P9WA 4AFBA 4JVAA 3VKOA 2R041 3VUOA 2W08A 5H9SA 3J8F3 4GQ7A 1H2NA 3ZFGC 4FAHA 2D6NA 1PGW2 4PF5A 1X8MA 3APBA 1AXYA 3WNXA 4JTNA 1ZBE1 1LOFA 3CJIC 3MIDA 3BU7A 3HIFA 2XJUA 3PTYA 5H9PA 1V70A 1HXS2 1SBEA 3UKVA 2GC1A 4L8QA 1B09A 1VBB1 2XUMA 4QD2A 3VBOA 2XKOA 4WBBA 3N7MA 3GZUC 2WIIB 1YI7A 2GSYA 4Y5Z0 5DG1A 3RPQA 2JDZA 1C1FA 1V6OA 2DYCA 4YVSB 1N1SA 1IS5A 4Y20B 3DL3A 5DZEA 4CP2A 1KRIA 4R4ZA 1PGSA 4G9SB 4Y1XA 5A33B