1WCDJ

Crystal structure of ibdv t1 virus-like particle reveals a missing link in icosahedral viruses evolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
421
structure length
421
Chain Sequence
IVPFIRSLLMPTTGPASIPDDTLEKHTLRSETSTYNLTVGDTGSGLIVFFPGFPGSIVGAHYTLQGNGNYKFDQMLLTAQNLPASYNYCRLVSRSLTVRSSTLPGGVYALNGTINAVTFQGSLSELTDVSYNGLMSATANINDKIGNVLVGEGVTVLSLPTSYDLGYVRLGDPIPAIGLDPKMVATCDSSDRPRVYTITAADDYQFSSQYQPGGVTITLFSANIDAITSLSVGGELVFRTSVHGLVLGATIYLIGFDGTTVITRAVAANNGLTTGTDNLMPFNLVIPTNEITQPITSIKLEIVTSKSGGQAGDQMSWSARGSLAVTIHGGNYPGALRPVTLVAYERVATGSVVTVAGVSNFELIPNPELAKNLVTEYGRFDPGAMNYTKLILSERDRLGIKTVWPTREYTDFREYFMEVAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Birnavirus Crystal Structure Reveals Structural Relationships Among Icosahedral Viruses.
pubmed doi rcsb
source organism Infectious bursal disease virus
molecule tags Virus
molecule keywords MAJOR STRUCTURAL PROTEIN VP2
total genus 95
structure length 421
sequence length 421
ec nomenclature
pdb deposition date 2004-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1wcdJ01
2.60.120.660 Mainly Beta Sandwich Jelly Rolls icosahedral virus 1wcdJ02
1PIV3 1VRH3 2HWF3 2RS51 5C9AC 1AUYA 1NY72 1ND2C 2DF7A 1Z7S1 2X5IC 5ACA1 4N43A 3VBHC 1K5MC 3NAPB 1QJY2 1EAH3 3VBUC 1HRI2 1QJY3 1QJU2 1R1A3 4IV1B 1RUJ2 3JBG1 1PVC3 5BNOA 1R091 2WFF2 2RM23 4QPIC 5CFCB 5J96B 1VAKA 1AYN3 1PO13 2RS31 3ZFFA 1QQP3 4JGZC 2TBVA 1ZBA3 3VBOB 2HWE2 4GH4A 1PO23 1RMU3 4GB33 4Z92B 5C8CC 1BEV3 4N53C 4RS5C 2GH8A 5CFCA 4Q4W1 2R041 3VDDA 1HRV1 1RVF3 4RR3C 1COV3 5FMOS 1ASJ3 2XBO3 4RHV3 1BMV1 4Q4V2 4GH4B 1MEC3 1BBT1 4RQPC 4CDXC 1RUI3 3VBFA 1PGL1 4FTSA 1PGW2 1AL21 2BFUL 1NCRB 2WS92 1PO12 1RHI1 3DPRA 1FMD2 2HWC1 4YVWA 1RUF3 5DDJ3 5C4WB 4CDWA 4Q4V3 1NCQB 5D8AA 4IV1C 1POV1 1H8TA 3M8LA 1RUH1 1B35A 2PLV3 5C9AB 1TMF1 3ZFGA 3DPRB 1M06G 1RUD2 1NCRA 4Y5Z0 4CEWA 1ND3C 2WZR3 5D8AC 5JZGA 3JB4C 3ZFGB 1FPN2 3VBSA 1AL22 5AC91 5JZGB 4CEWB 5BNNC 1C8M2 2HWB2 1RUF2 5DDJ2 1RUG2 3ZFEB 1PIV2 2R062 2RS13 1FOD3 3J8F2 4Q4W2 3VBFB 4CEYA 1RUI2 1OOPB 2RM22 1NCRC 1RUC2 4PDWA 4QPIB 3S6PA 2HWE1 2WZR1 5K0UA 1DDLA 1EV13 1ZBA2 1EV11 1AL0G 1AR91 1B35B 2WS91 1VB2A 2PLV2 1H8TB 4RR3B 4CDWC 1RUD1 3CJIB 5BNPA 3DPRC 1HXS3 2HWD3 4Q4V1 1COV2 5ABJB 2QQPA 2HWF2 1HX6A 4RQPA 2MEV2 2R042 2RR13 4FTBA 1RHI2 2MEV3 4IV3A 4WM8C 4RR3A 1VB4A 4WM7C 1OPOA 1GFF2 4RQPB 4JGZB 5A33B 1MEC1 4N43C 2X5IA 2XBO1 1ND2A 1RUE2 1HRV3 2R043 1VBD2 2RMU1 1VRH2 2RR12 2RS32 3ZFEA 3HAGA 2WFF3 1K5MB 1ND3A 4QPGA 3JBG2 5FMOL 1POV3 4RS5B 3FBMA 1D4M2 5FOJB 3VBUA 1R093 1PVC1 1Z7S2 1X36A 3JBG3 1R092 2WFF1 1AR93 4QPGB 1K5MA 1NY71 1R1A1 2RMU3 1TME2 1EAH1 5BNNA 2BFUS 4EJRA 1F2NA 1PO22 1RMU2 4GB32 5C9AA 3TN92 5ACA3 4WM8B 1Z7S3 1ND2B 4WM7B 1FOD1 1VBB2 2RS11 1PO21 1QJZA 1RMU1 4GB31 3VBFC 2BPA2 2MEV1 2HWF1 1VRH1 3VDDC 4CDWB 2RR11 1TME1 1QJX1 3CJIC 3VBSC 4WM7A 4WM8A 4IV3C 5BNPB 1QQP1 5JZGC 2XBO2 2HWD1 3JB8A 4CEWC 1HXS1 1WCDJ 1AYN1 5GKAC 1AR72 4N53A 2IZWA 1RUD3 4GMP1 5A32B 3ZFGC 2WS93 5J98B 2WLPA 1HQNA 4PDWB 1F8VA 4Q4X2 4IV1A 5BNOC 1RUC1 4JGZA 2HWE3 4GMP0 5A33A 3VBHB 4CEYB 1RUH3 4CDXA 1CD3G 3ZFEC 4N53B 1VBD1 2RMU2 4Q4Y1 1R082 4JGYC 4YVSC 1RUF1 5DDJ1 2HWC3 2RS53 4CEYC 2WZR2 1IHMA 4LLFA 1VBC1 5C8CA 1ZBE3 2FZ1A 4GH4C 1RUI1 1FPN1 5AC93 4JGYB 3J8F1 1COV1 1RVF1 4BCUA 1RUE3 2HWB1 4Q4X3 4IV3B 5BNPC 3LOBA 4QPIA 1CJDA 1BEV1 1NCQC 1OOPC 1A6CA 1V9U3 5CFDA 4CDUC 1TMF3 2R072 5AC92 2PLV1 1AR61 1AYM3 4AEDB 1V9U2 1AR92 1AR73 1ZBA1 5A32A 5K0UC 4PDWC 1B35C 5ABJA 1C8NA 1PO11 1H8TC 1VBA2 3VBHA 2RM21 1RHI3 1VBE3 1PGL2 1TMF2 1AL23 2R073 2ZAHA 5K0UB 4YVWC 1BBT3 1EV12 5ABJC 1ASJ1 4RHV1 2WWSA 5LK7B 3VBOC 3NAPC 3VBSB 4SBVA 3JD72 4Q4W3 3JD71 1MQTC 1VBC2 3VBRC 1BEV2 2R061 1RUG3 1W39A 1PIV1 5C4WA 1ASJ2 4RHV2 1BMV2 3ZFFB 4RS5A 1RUG1 1R081 1C8M1 1NG0A 3VBOA 3VBUB 3JD73 4FTEA 2RS33 2XPJA 4YVSB 4AEDA 5CFDB 3VDDB 1VBA1 2BUKA 3ZFFC 4FSJA 1NA1C 1QJU1 5C8CB 1FMD3 1RUJ3 1QJY1 2X5IB 1FMD1 2HWC2 1D4M3 4NWWA 3ZXAC 1QJU3 1AR62 4Q4Y2 2R071 1AYN2 4CDQC 1VBA3 1RUH2 1SMVA 1E57A 4YVWB 4CDXB 4N43B 2RS52 1RB8G 1X33A 1ND3B 1R083 1NCQA 5D8AB 1HRI1 1AYM1 1AR63 5CFCC 4Y4YA 4CDQB 2R063 5L7OC 1VBB1 1V9U1 1FOD2 1MQTB 1PGW1 5L7OA 2HWD2 1AR83 2HWB3 5BNOB 1BBT2 2Y26A 1RVF2 1MQTA 5L7OB 1R1A2 1QJX2 3CJIA 3J8F3 2GSYA 1HRV2 5C4WC 1FPN3 4CDQA 1PVC2 4YVSA 1ZBE1 4JGYA 1VBB3 1AR82 3TN91 1VBE1 1POV0 4NWVA 1HRI3 3IDEA 3NAPA 4Q4Y3 1VBD3 4RFT0 1NOVA 3VBRB 2VQ0A 1VBE2 2BBVA 1AR71 4AEDC 3TN93 1ZBE2 5ACA2 1NA1A 1RUC3 1D4M1 1RUJ1 4Q4X1 1OHFA 5CFDC 5BNNB 1RUE1 4CDUB 4GMP3 2ZTNA 3VBRA 1MEC2 2RS12 1NA1B 1AR81 4QPGC 4CDUA 1HXS2 1C8M3 1OOPA 2FZ2A 1AYM2 1VBC3 2ZZQA 1QQP2 1EAH2 1QJX3 1TME3
chains in the Genus database with same CATH superfamily
5FZ3A 2LUWA 2Y34A 3AJZA 3OCPA 3O1UA 1XNAA 2A6ZA 3K2OA 1AUYA 2QCSB 5A3OA 1WCQA 4CCOA 5HCHA 2Y33A 4XFCA 4BWOA 4BXFA 3KV9A 1MACA 3WNPA 2BZDA 2B42B 2HLEA 3WG1A 5LA2A 1QU0A 1UMZA 4I3PA 2ZGLA 1KITA 4MYEA 4PCRA 1V70A 3MIEA 3NAPB 1JZ5A 3ZIWA 3SQOA 4BQ2A 1EAH3 3LA3A 1LAJA 5E89A 1W3VA 2DVDA 3VBUC 1HRI2 1REFA 4LBMA 4B4RA 4KWLA 2FCUA 1RUJ2 3EMRA 5T5PA 4QQLA 3JBG1 5T5LA 5C3PA 1IKPA 1RINA 2JD9A 5BNOA 2PTMA 1R091 2WFF2 4FQ4A 4QQ2A 3WOGA 2XVKA 2CV6A 5CNAA 3FN9A 2ZEYA 3ACLA 1PO13 5E6HA 3WY6A 3ZMOA 4JV4A 2IUWA 5F9TA 1W90A 2YPJA 2MHFA 4FPLA 4AI1A 1QQP3 3VD4A 4LITA 1WLTA 3MIDA 2CGOA 4M01A 1ZBA3 1V6KA 1YNAA 4LBJA 5F6LB 4HPKB 3OBAA 5EYXA 4OZXA 1D7PM 4CP9B 4AVCA 4GH4A 1PO23 1MS9A 2BWCA 4F83A 4Y1VA 2QBXA 3OB8A 2GC0A 2ZACA 1HRV1 3NNFA 5CAZA 4N7UA 1RVF3 1TQ5A 3IB3A 4BK4A 3GBWA 1ASJ3 1KS4A 1PMJX 1QXJA 2J7MA 4EYUA 4GH4B 4XAEA 4L0PA 1KDKA 1JW6A 4XXAA 4CDXC 2PA7A 3ZR5A 1QXPA 2ZGTA 2BYVE 4DNYA 2KD7A 3I2FA 1JOJA 1JUIA 2EAAA 3HT1A 5IAVA 2ARCA 1PHMA 3FJSA 5EPAA 4A6SA 1KS5A 4PBOA 1XXNA 4JKMA 1UYZA 1OUXA 4NAOA 4M4PA 4J25A 2RDNA 5C8WA 1POV1 2PHRA 1HN0A 1RUH1 1PM7A 1B35A 2WT0A 3ASIA 2RDRA 2G9GA 2AUYA 4D6SA 1KDMA 1QJFA 1QWRA 1YHFA 2E63A 2WWJA 1DLLA 4GA9A 4GWNA 4O61A 4Y33A 2IFRA 5T54A 2GDFA 4XFIA 2R1DA 5JUVA 1WLWA 2F4LA 2G4IA 2YXSA 4IERA 4AEKA 5FYVA 3T2OA 3NW4A 5JZGA 2VY0A 1JN2P 3BTXA 3DGTA 4DXRA 1OA4A 1GOGA 3SNMA 4TSVA 3VHNA 1SCSA 1GUIA 4ITCA 4XW3A 4AGGA 4MXVA 3ZSLA 4O65A 3HOBA 1V0AA 4FQZA 2E32A 2N7GA 5KXDA 5ISLA 5LA9A 3TYJA 1W8WA 1OLMA 5DDJ2 4UBHA 2R7EB 2EIDA 3E6BA 3RZLA 3T0DA 1KQRA 3I3DA 2FDGA 3ZFEB 5JOXA 1P8JA 2R062 2B46X 2VNRA 1FOD3 4MH0E 5J09A 3ZXFA 5FZHA 2K46A 4META 3VBFB 4HSLA 4OLLA 1RUI2 1WA4A 5J48A 1NCRC 4W8JA 1W0NA 4PDWA 3AKQA 2V73A 4QPIB 4XACA 5LB6A 4COZA 1W04A 1ZA7A 4FOVA 4OUSA 2WZR1 5FZIA 4MG2A 5HI0A 1EV13 1FATA 1LOBA 3DKWA 4FFGA 4V1PA 1B35B 2P2KA 2PLV2 4I2OA 2P3JA 2ENRA 4ES9A 3TAYA 4I0WB 1V6LA 4LK7A 2QQKA 4A44A 3CJIB 4CUBA 5GZEA 2Y0OA 3USUB 3PUAA 1UOGA 3CQOA 5A1AA 3WG4A 3KGZA 4LHLA 4AFCA 4OQ9A 2ZOEB 5A3MA 4XCBA 3VHOA 2WR9A 1GNHA 4OI0A 4JDNA 2HWF2 4RQPA 4Y5SA 5JOZA 2W39A 4NIDA 2R1BA 2R042 1OQ1A 1GR3A 4R9AA 4FTBA 1XQNA 2MEV3 2XWJB 3KVAA 3ETPA 4RR3A 5DPNA 5BV6A 3KT4A 4Z8BA 1LGBA 2NLRA 3H1MA 3U07A 1MEC1 3LIHA 5AVPA 4BPZA 5I0RA 2XBO1 3VL9A 1RUE2 4KWKA 1W6PA 4YWAA 3BALA 3Q8CA 3U75A 2UYBA 4A7KA 5I8SA 2R043 1VBD2 1VRH2 1OVPA 3RZJA 3ITQA 3OGGA 1QH7A 1NE6A 1H9WA 1W6QB 2A6VA 4MGSA 1WBLA 2VTXJ 5CKMA 3JUUA 3S7IA 4LUKA 1ND3A 5FZAA 3BTYA 1BXHA 3RVHA 1PVXA 4MHUA 2DVBA 1ZYBA 4ZONA 4AXOA 5EJ3A 5F3CA 5LCWL 2WBKA 3WDTA 3E97A 2ADDA 2P4EA 2WINB 2JIJA 2JDPA 2VVDA 2ZJCA 3SKVA 4ASKA 2X8KA 4HZFA 1UKGA 2VUAA 3VBUA 1W9SA 1W6MA 2Q1ZB 5F5CA 2E7AA 2VQTA 3JQXA 5A1LA 3LIGA 1NQJA 2VECA 2XOMA 3CDZB 5FPLA 1R1A1 2W5FA 3RZZA 4NIGA 1ZVFA 3ZIXA 4P5YA 2EIGA 1LHUA 1TME2 3CZJA 4B1MA 4HSJA 5A3TA 5BNNA 2BVVA 1IQDC 2Y38A 5C3RA 5C5TA 4H14A 1NZIA 3C3VA 3H0OA 1RUOA 4Y20B 5C9AA 4QQHA 3R05A 3EYPA 2GP5A 4WM7B 5C70A 1RMU1 1QJZA 4GB31 4CCLA 1J83A 4DUXA 1WD4A 2JE7A 1MZFA 2VMHA 2CL2A 4LA3A 1TME1 1PZ9A 3RJ2X 3P5BA 2K9ZA 4XBNA 3KB5A 1LESA 4XTMA 5C3OA 2RJKA 5FZ4A 3LB9A 5I8TA 3O1SA 4IEOA 2F6BA 4AI9A 3SLIA 2B45X 2JG9B 3IDCB 1DYPA 1ZZ6A 3V56A 3WVJA 4FPJA 3MEPA 2W87A 2CSGA 4P9GA 4RD7A 4QX8A 5GKAC 4Z2AA 3BIWE 2ZA9A 5H9RA 1N1YA 2XVLA 4GMP1 5KXBA 4P9LA 5A32B 2WS93 1CJPA 1HQNA 4WVVA 1EPZA 1AX0A 2IFWA 4PDWB 1PMHX 4UFJA 4DFSA 5IVVA 4XQWA 1OMIA 5FCCA 4LORA 5BNOC 2E31A 2HWE3 3ZO0B 4R8HA 3UGFA 5DZEA 1E5RA 2C9AA 4FOWA 4FXKB 3VBHB 4CEYB 5F3GA 3GJBA 3J7HA 3VB9A 1QNYA 1HV0A 1K3IA 1OF3A 5FZ0A 2BGOA 3WDVA 4H2AA 1K12A 3OBZA 4OVEA 1IGOA 1K45A 1ACCA 2RMU2 3POFA 4Q4Y1 4CCNA 3H8UA 5IVFA 3Q9OA 1J1LA 4LBQD 4NN0A 3C7OA 2OYZA 2HWC3 4UAPA 4D7SA 4CEYC 1DU3D 4LBOA 1IHMA 2DUOA 2W52A 4IETA 1QIQA 2VW2A 4XMAA 4E4SA 3GZEA 3ZXJA 4AHYA 2RJ2A 1ULFA 3HN1A 1ZRFA 3M3OA 1H1IA 4QB6A 3WD5A 3MLJA 1XPWA 3RYPA 4B29A 1HIXA 5JXJA 3I59A 1YLLA 5FUPA 1LRHA 3AFKA 3NMBA 2BRTA 4L97A 4BOWA 1QHDA 4ZU7A 1W28A 4BCUA 2ZX4A 1UY3A 1W2NA 2ATFA 1OLQA 1I3HA 4LOSA 3WF2A 4AWDA 5FZCA 1A8DA 2P3IA 3NKGA 3VKFC 3ZXDA 1V9U3 1FT9A 3WR0A 2WZPP 1Q5OA 1SBFA 2CDPA 2DTYA 1AYM3 2DBNA 5JLVA 4EROA 1YFUA 3SH5A 3NV4A 4AHWA 2XDVA 4BM8A 2XL9A 4IEYA 1SBDA 4FPFA 4MXWA 2JE9A 3RWNA 5F2SA 1MS8A 3OYWB 2JE8A 5LASA 4BLIA 3NJYA 4AFAA 1H8TC 1VBA2 2A3WA 4DINB 2E51A 4YARA 3P6BA 3UETA 1OA2A 1A8MA 2QQJA 3GZUC 2V5YA 4FAGA 2ZAHA 4PT6A 2VD7A 2BNOA 4PIXA 2WQ4A 1KJRA 4XILA 3B7MA 3OPZA 4UW4A 1BKZA 3E5XA 5ABJC 4DUWA 2C0ZA 4YRDA 2WWSA 3UV9A 1R1ZA 2XLGA 2YC2A 3MDPA 3ZR6A 4D6RA 5KHJA 2X29A 1ZX5A 4SBVA 3JD72 4QXBA 4QX5A 5L73A 4Q4W3 1U5XA 2XH6A 4W65A 4PF1A 1ENQA 3VBRC 1G9CA 4HONA 1SEFA 4L9BA 1GNZA 1OH3A 2WWUA 1LHNA 3QOPA 1RUG3 1W39A 5KXEA 5F5QA 1HLCA 3VUOA 1UY4A 3A22A 3CBNA 1SLAA 2VNGA 3BVCA 2ZGPA 5A7PA 1O5LA 4FTEA 2VULA 4YVSB 3FBYA 3LAGA 1RITA 4H7LA 4X8PA 1LNSA 5DAPA 2J1TA 1GU3A 3MPBA 2Q8OA 2PXJA 1JH5A 1NKGA 5CKNA 2G19A 3D0SA 1CAUA 1QJU1 3KS7A 5C8CB 3LZZA 4XCAA 3HN3A 4QX2A 1CIWA 2X5IB 2J22A 2UURA 2I07B 2YY1A 2BGCA 2ZEXA 4CPBA 1C1LA 2R071 4AG4A 3POGA 1UAIA 3RDIA 4G4FA 2YHJA 4ISQA 4XC9A 4KWJA 5E16A 4QPWA 1RUH2 4IEPA 4YVWB 4QQOA 3WF0A 5I91A 1LGCA 1VR3A 4YW3A 4N43B 1NUKA 1O8SA 2RS52 1H6YA 5ANNA 1RB8G 4NROA 1R083 3D4KA 4ARXA 1U5YA 3AZVA 5J7MA 2OZJA 3AP4A 4S2DA 4Y4YA 5L7OC 4C1WA 2GMPA 3FE5A 1ENSA 2Q4SA 3AKSA 1CWPA 4IE6A 4MLOA 3Q8BA 2OUJA 4AQ2A 1MQTB 1V6MA 1W9TA 3PMSA 4LLOA 2HWB3 2QE3A 2ZX3A 3UNPA 1BBT2 1EP0A 2YFZA 3MIBA 3AP9A 4W6XA 3RYKA 1UZYA 1CX4A 3LEIA 4HVQA 2Y26A 3UKVA 1DQ6A 1XNDA 5AFBA 1R1A2 5L7OB 3AP6A 3MLKA 4NHXA 5C4WC 5BUVA 1FPN3 1WZXA 1LU2A 3IPVA 2JICA 3VZKA 4MSVA 1ZBE1 3WDXA 2VUJA 1VBB3 3C7EA 3OOXA 5JAXA 4ZS2A 1VBE1 5EV7A 3PTRB 4NWVA 2L9LA 1OBNA 3LQCA 3OGRA 4YM3A 1ZZ9A 4Y5TA 1OPMA 2RHPA 4DZGA 2VZRA 4Z07A 3VZLA 3NKTA 3B02A 1Y43B 3GM8A 4QX7A 2BBVA 1UO9A 1AR71 4OYUA 4TLFA 5EQUA 1PM4A 3ACFA 3DXTA 3LFIA 3OGSA 3PVBB 1T6BX 2XONA 5FP7A 2OX0A 5DAQA 1IPJA 3DUIA 4AQTA 1S0GA 3NVCA 5JXIA 1JHNA 1OHFA 1OKQA 1ZZBA 3H8XA 5CEHA 3KT7A 2DUQA 1L3JA 1RUE1 1W2OA 1W8UA 3PURA 4CDUB 5BNNB 3IAPA 2ZHKA 2ZTNA 5DUVA 1UU6A 2JB8A 2KR2A 4OI4A 2FDFA 3NO8A 2W1SA 3DYPA 4WBBA 3ZSJA 3MHZA 1XE8A 4GULA 1LU1A 1AXZA 3AMHA 1OOPA 4XBQA 5F3EA 3ZSMA 1C1FA 1AYM2 4Q29A 1VBC3 4XMIA 5EP9A 3LDRA 5DQ0A 4E27A 1QJX3 2X53S 4XIKA 3W58A 1DGRN 1PIV3 1VRH3 2HWF3 4MZUA 2YG0A 4RGAA 3WHTA 5DAVA 5J37A 1NY72 1FNZA 3U14A 5IFTA 4K21A 1WLCA 3SCHA 3BI3A 3H1YA 1ND2C 4YM1A 3KLSA 5FQ0B 4QHBA 2DF7A 1Z7S1 3UGHA 3WHUA 5FZKA 4ZKTB 5ACA1 2ZGNA 3I2DA 5T50A 4OMDA 2EIBA 4NMIA 3PNAA 3M3EA 5T5OA 3IIAA 1DHKB 2OQ6A 2VC9A 1ZZ7A 3N9QA 1W8NA 2D5HA 2ZHNA 4TTGA 1G8WA 3CO2A 5F37A 2C1FA 5FP8A 1UYPA 2PQSA 4JCKA 5FTTC 1Q8OA 1NZCA 4QXCA 3VZJA 4ZZ8A 1PVC3 5A1FA 1W9WA 1EUUA 4XEZA 2ARBA 2RM23 5CFCB 5J96B 4MGZE 3LEMA 1AYN3 1X9TA 1PZ7A 4CZSA 5FJKA 3URFA 3ZFFA 3W9AA 5GZGA 4JGZC 2DCZA 3CHXA 1FV3A 5JMOA 1W03A 5H9PA 1RUNA 3VBOB 5FXZA 1YQ8A 4COUA 2GNBA 3TEWA 4PHZA 2DYCA 1J84A 1XNBA 4E9KA 4E2GA 1BEV3 3OSDA 1SBEA 1W8HA 4XPVA 4Q4W1 1BYHA 3N9LA 3OD4A 3D0JA 1HB1A 4KL1A 1COV3 4RR3C 5FYHA 4D7TA 2FDKA 4BH9A 2IXIA 3I54A 1X8EA 4P9YA 4QAWA 4LBQA 4Q4V2 2XLAA 1VALA 4QM8A 1RUI3 5BPXA 4BLJA 4EWAA 4CSWA 3VBFA 1QMJA 2ZS6B 4FTSA 3HPNA 3VDCA 3PJQA 5LW9A 2W47A 5FZFA 1CR7A 4BQYA 1NCRB 5FMBA 2WNEA 2WS92 1PO12 3BKZA 1WCKA 4LNVA 1FMD2 1UNBA 1UQXA 4UF0B 3OBTA 3LPGA 1RUF3 4IGOA 1YQ2A 3KQ4B 1U5IA 2ZMLA 3EO6A 5C4WB 4D3WA 1PK6B 4Q4V3 5A7WA 4YW2A 3USSA 1XE7A 1NCQB 3A0NA 4Y24A 3WP6A 4IV1C 3K51A 4FOQA 1W99A 3MI8A 1S2KA 2JG9A 5HV0A 2ZABA 2Q30A 2UU8A 3LA2A 4LJHA 3ZFGA 2UWBA 1M06G 4NE9A 2O8OA 2W94A 2HBUA 1LCLA 5D1IA 4E2QA 4QT6A 1PK6C 1PZ8A 4QGMA 2WA4A 4E4ZA 3WDUA 4CEWA 1ND3C 3WF3A 2Y60A 1IG0A 2ORZA 3PUSA 1LENA 1JYWA 5I0DA 5CA6A 3M4FA 1W9FA 4HBNA 4IW3A 2HBTA 3WT3A 3JB4C 1YEWA 3ZFGB 1FPN2 3VBSA 1JOBA 4M3CA 2XR4A 3V0AB 2WNOA 2JDNA 3DXUA 5JZGB 3GGLA 3N36A 5APAA 4CEWB 2PHLA 2B5HA 3IMMA 1FV2A 4LULA 4QMAA 5DZGA 2C24A 5BNNC 1W8TA 3LA7A 2VMGA 2OZ6A 1OF4A 3MICA 3WSOA 1XYNA 1RUG2 5FUNA 4NR1A 3FFQA 5GZDA 1ZRIA 3C7FA 3ZPYA 1W6OA 2DVFA 4BISA 2WKKA 4UFHA 1O3TA 2XQXA 3UT0A 4UW6A 3WCSA 2PHUA 1JYTA 4XFGA 1GANA 4OHXA 2J42A 2HWE1 1CAUB 3B3QE 5K0UA 2O14A 3BTAA 3MV11 3TRSB 1IQAA 2YDEA 4I09A 4TZDA 3FC0A 1ZBA2 1YI9A 4LO6B 1AR91 2VOTA 4QQPA 2ZGOA 1OA3A 3PVNA 3T30A 1LOAA 2WS91 5FR3A 5GZFA 1H8TB 5IYYA 3ZSEA 3CIHA 3MF9A 2QQIA 4FCAA 1UXZA 3OUHA 4YW4A 4B1LA 4CDWC 3O1TA 2YB7A 4MXWB 5BNPA 3DPRC 4AF9A 4I3GA 3WNOA 1C28A 1MZ5A 1GP5A 4B4PA 1G9BA 2E6VA 3O7OA 3JXSA 3CEWA 3ZYFA 4Y1XA 5ABJB 1EY2A 2QQPA 1HX6A 1LGNA 3DCQA 4LR4A 5FY0A 4EN8B 4ZZ5A 2MEV2 3USUA 1CPMA 1UOBA 2VZ3A 3R6SA 3T4HB 2VW0A 3ZDVA 4F7ZA 1I5PA 4IV3A 5FWEA 4PI2A 1UU4A 1VB4A 2G9ZA 4WM7C 4XVHA 3UGGA 1GFF2 4RQPB 4JGZB 4DMIA 1C4RA 1Q8VA 1UZVA 3E5QA 5FDBA 4LE4A 4BIFA 5L9RA 4K1ZA 3KV6A 3U4SA 3VKNA 3NNLA 4XABA 2DFBA 1NX9A 1URXA 2XJPA 3BODA 3ES1A 2TEPA 1DZTA 3EXUA 1RTVA 1UY0A 3Q8AA 2RS32 3HMYA 1WKYA 5F2WA 4CP9A 4A7ZA 2VPVA 2VR4A 3HAGA 1IG3A 3UK9A 4IESA 5KHGA 5F6KA 1S1AA 5JOWA 1NXMA 1CVNA 1K5MB 4Y4RA 2XJVA 2YBPA 5FK7A 2VBPA 5FKBA 4Y22A 5LY1A 3PIJA 4C0BA 1IOAA 2P3KA 3PJYA 2A3YA 4Q2FA 1G86A 4PIYA 2IC1A 5HCFA 2CWSA 2QDRA 3VZNA 3A21A 1GOFA 3OPTA 1PK6A 1D4M2 4A7YA 1EPWA 1NQDA 5F8PA 3M70A 4KU7A 4LKFA 1J3RA 1DLCA 3VHPA 3AYEA 3ES4A 4OUEA 3ELNA 4XIOA 4XE9A 1AR93 3EBRA 4QPGB 3UYJA 2VAUA 1NY71 1YFYA 3L2YA 3L9JT 1CAXB 2JKBA 3MIGA 3N7JA 3OGJA 3T08A 3ACHA 2JDUA 4JDMA 5JI7A 3WDYA 3N9MA 4BU2A 5FJHA 1F2NA 1PO22 2P34A 2WO2A 3POBA 3QCWA 5ERLA 3QLQA 4KNCA 3TN92 2Y6FA 2HEVF 2IVIB 1RXGA 5JSRA 4AFMA 4Z1VA 4R9BA 4MGIE 2FCTA 3KCYA 5JXGA 1Q8QA 2BPA2 1F35A 5FY7A 1Q8SA 1F15A 2MEV1 2QQWA 4JX0A 1WGPA 1GLHA 5I0UA 1N3PA 1N3OA 3CJIC 2H0VA 4WM7A 3ETQA 3FHAA 2RG4A 2BTVC 4YG0A 4EZ4A 2PQQA 2TUNA 2WIIB 2YROA 5HXMA 1KRIA 5JZGC 2GN7A 1SLBA 3FUQA 3JB8A 4PLMA 4S2GA 2TNFA 4XF0A 5FKCA 2VVEA 4CEWC 1AYN1 1ZRDA 4FP3A 4PIZA 2VCBA 3W5MA 1QGLA 2J1RA 1W9YA 5J98B 2JB4A 2WLPA 1OQDA 1Y4WA 3EB7A 1YWKA 3S7EA 3N9OA 4Q4X2 4IV1A 2Y8KA 5A33A 2XL7A 1QNWA 4MX3A 4XJAA 1JYIA 1Y9GA 2IXJA 1ULGA 4GALA 5H9QA 3WZ1A 3ZXKA 4E4HA 1CD3G 3HJRA 4DUVA 5KWRA 3T2PA 3ZFEC 2WNVB 3PU3A 1NT0A 1R64A 3N7KA 1ZZ8A 4N53B 1BK0A 4ES8A 2BBAA 3OEBA 1SQ4A 2H6BA 4A41A 4ASLA 1F4HA 1RUF1 3VHRA 3NJXA 2B4KA 1GZ9A 2WZR2 2YMZA 3KCCA 3N9PA 3U11A 4BHPA 4NOTA 1VBC1 2VBBA 5KHHA 2AEYA 4P5HA 1RUI1 5FK8A 2XXZA 2BW8A 2VUDA 3R4UA 1O3RA 5A7SA 1RXFA 4K20A 1DCSA 4XDPA 1COV1 4LK6A 1US2A 2NMOA 1RUE3 4LBQB 5L9VA 2DCTA 5F3IA 3VD5A 2YV8A 4XDOA 2R49A 4IEVA 4IE5A 3FWEA 1XNTA 3LOBA 4X6QB 1BEV1 3ILRA 1C57A 1UPIA 2ZKNA 4IDZA 1MS3A 3PHMA 1OOPC 3I3BA 1A6CA 1OURA 3AYCA 3QBQA 1AR61 2GC2A 5JSPA 2D6MA 3POYA 5C33A 1AR73 5FWJA 3D5OA 5EFUA 5K0UC 2LW8A 3MYXA 2D44A 2JG8C 3SHRA 4JRAA 3ZXLA 1WWYA 2CYFA 3SC7X 5B4NA 1WD3A 4ZPIA 1UPSA 4DB5A 5FYUA 3ECQA 1C8NA 2ZMKA 4IL7A 2BU9A 3WP5A 3T09A 3LEGA 4MGQA 2G9FA 4ONUA 4NUBA 2RM21 4XXPA 3I3MA 1VBE3 3T2QA 1PGL2 3RZGA 5FYYA 2F17A 1IS6A 2R6QA 4FFFA 1BVP1 2Y0IA 5K0UB 4YVWC 3AZXA 1D2SA 1FNYA 3IZOA 5FRAA 1EV12 1MZEA 2OQ7A 2WSVA 4L8QA 5JOYA 1ASJ1 2ZGSA 3C7GA 4QM9A 1WBFA 4KGQA 2XJSA 3H50A 4XDQA 3VBOC 1G6NA 1ONAA 3C2UA 4ZS3A 3HD8B 3ZN6A 2VXRA 3BCWA 4QB2A 3VBSB 5EYYA 4I01A 1GICA 2DU1A 3JD71 1MQTC 1UOFA 2AH2A 4YW1A 5CIRA 4HXCA 4IUGA 1JBCA 1LR5A 5A80A 2VMCA 2YFUA 4IEQA 4AK3A 4UT5A 3LSEA 1PIV1 4XAAA 4XF3A 1ASJ2 1LJ7A 2QQVA 3ZFFB 4KH9A 3RNSA 1REEA 2OPWA 4YGEA 4A42A 1R081 4AW7A 3IIIA 2VZQA 3NV2A 3NRUA 5I8YA 3VBOA 3KWVA 3WF4A 3J7NA 1UL9A 1LOCA 2A70A 3JD73 1S0JA 2XPJA 1Q43A 3NWKA 5BYNA 1CZTA 2DBIA 2QZ2A 3J26N 5FZ7A 5CFDB 1NYWA 1XJAA 4DIQA 1A34A 2BNMA 2D3RA 5HXVA 2BUKA 3AP5A 5FBZA 4CVUA 3ZFFC 4EWDA 3J4UH 1NA1C 3MW3A 4NRMA 4XF4A 2OA2A 2JD4A 2ARAA 2FDIA 2Q5TA 1LOFA 2VO5A 4NWWA 3ZXAC 1NAEA 1QJU3 3IMNA 5FMCA 4NVPA 4ASMB 3NSTA 4OHWA 1AR62 1DQ5A 2VUCA 1DP0A 1I9RA 4CDQC 5L19A 1FYUA 2QTWB 3ME2A 4GKXA 3G6JB 4K9SA 4M3CE 1F5FA 4YFWA 1KJLA 1X33A 1ND3B 4JHTA 2ZHMA 2GZWA 4U36A 2Z4FA 4N90A 1AR63 3GCXA 5EIYB 4CDQB 1UOJA 1CONA 1VBB1 5GM0A 1SFYA 4XFBA 1FOD2 3W21A 2XMLA 1TZOA 2Y6HA 3JZVA 1W05A 5FY5A 4OHVA 5LBFA 2YBSA 3THCA 5KHKA 1SFNA 2E53A 3KZ4C 1PGW1 1UW8A 3LGRA 3ZKUA 3TEYA 5FYBA 4DXTA 4IGQA 1AR83 2E26A 2JX9A 5DZFA 2W1UA 4Z82A 5BNOB 1N47A 2CY6A 4HN1A 2FMDA 4FPYA 3GYDA 2QJVA 4LQRA 4Q0SA 4XQDA 3DYMA 1MQTA 3T1LA 4JKLA 2GSYA 3FLPA 2DWRA 1LOGA 4W50A 2QNKA 3CKHA 1OLRA 2XUMA 4PF5A 3ZX7A 3SISA 3MW2A 1SDWA 4BMEA 2CAUA 5FZOA 2BOIA 2XHKA 1AR82 3PVOA 3QD6A 2GH2A 1S4CA 2VU9A 3N35A 1X50A 2DV9A 2QQMA 1H30A 3TB0A 3MIHA 1CAWA 3SEEA 1UX7A 3N9NA 3VBRB 3KHBA 1UU5A 2VQ0A 1ENXA 2JDYA 4GWMA 3HNMA 1S55A 3UJQA 4RL7A 1IS4A 3U4XA 4DO0A 2NZ9A 1ZBE2 4IE7A 5A7OA 3TN93 1H4GA 2OUHA 3AXEA 2O0OA 3NNGA 2WO1A 3IM0A 2JEMA 5C6CA 1OC1A 2JG8B 1MS5A 1V6OA 2BOJA 3PVEA 2B9VA 5FV3A 3I2GA 1ZM1A 3ALQA 1OD3A 3D3AA 2Q8DA 2OVUA 1GZWA 1F31A 1Q8PA 2BWAA 4JHZA 4FT8A 3LWCA 3RG0A 3KCXA 2GALA 5FYMA 1RL3A 3ZN6B 4EN7B 4RYDA 1BHGA 4CDUA 2E7QA 2W92A 3WNXA 4EN0A 1NXD1 3B94A 1GZWB 1AX1A 2YC0A 3WW2A 5A3PA 3O1OA 4WVWA 1WCUA 5JI9A 3THPA 2P37A 1KD7A 1S0FA 1AXYA 1OLME 1SZBA 5C9AC 4K40A 4XURA 1JXNA 2O1QA 4RFRB 4UFIA 2QQUA 4CUAA 5FZOB 3D8CA 3FFZA 5JPMB 2AC1A 3N3HA 4C91A 5FO8B 4GJZA 4KI5M 5FAXA 2Y6GA 4J1WA 4COYA 3A23A 1JYNA 1K5MC 1ST8A 3LSDA 2OT7A 4WZCA 1S0CA 2XVGA 4UF0A 3RWKX 5IATA 3LEKA 1WW6A 5LRSA 2LALA 1QJY3 3NQHA 1VMHA 1S0DA 4HPKA 4MUVA 4IV1B 1Y3TA 4TYSA 4JKKA 1W8FA 1JI6A 3DN7A 2K0GA 1IKQA 2XJQA 2AYHA 2VGDA 4XUPA 4QPIC 2WN2A 5DAXA 4ZHNA 1H2MA 4MHRA 4C8DA 2RS31 4FFIA 3TEZA 3KQRA 3ZYPA 1OI6A 5LBBA 1W6NA 4MGKE 4YSFA 3IAQA 2ID4A 4Z2WA 3GHMA 5FPZA 3EQEA 3AB0A 2Q8EA 4TWTA 3ZSKA 2ET7A 4FXGB 4URAA 2ZCWA 1O7FA 3ZM8A 2WABA 1X7NA 1RMU3 1VMFA 2VQAA 4GB33 4O9EA 4YGBA 5C8CC 1OT5A 4DXSA 2JWPA 4RS5C 2GH8A 5KXCA 4OHZA 1JU4A 4WV8A 3OY8A 1PGSA 2WA3A 3MF6A 4MVTA 2NQYA 4Q0VA 4XUOA 3VDDA 4M3CF 4X8NA 1DQ1A 3M2MA 1X82A 2DVGA 3EHKA 3FUOA 1U5ZA 4CTEA 4CP2A 2X10A 3ORJA 4AQ6A 4D0QA 3ILNA 3RI8A 4DY3A 1YRZA 4RHV3 4KBZA 4LBKA 2WN3A 4OMCA 4YG6A 3CF6E 5J36A 2GNMA 5HCBA 2AENA 3K4ZA 2SLIA 2XJUA 5I93A 1PGL1 1W0PA 1S2BA 2GMEA 5GALA 1A78A 2YC4A 1US3A 1AL21 2LRPA 5G05L 3Q8FA 4DY5A 4F8AA 3BUCA 4B3NA 5CADA 3DPRA 2HWC1 1HQLA 1HB2A 3MO4A 1O3QA 1J58A 1SFPA 3JCIA 5D8AA 3DKQA 3BIEA 1NLRA 4TLGA 1H8TA 1CAWB 3M8LA 2HEWF 4BDVB 1WW5A 1ZNPA 2PLV3 4BB3A 1CN1A 3DPRB 4HT1T 5DABA 5IK4A 3N4MA 1RUD2 5LBCA 1JZ7A 4XOGA 2VNVA 4Y5Z0 4EWEA 1T2XA 2ZGKA 4FPOB 3VZOA 3V0BA 4NO4A 4NPMA 5IVBA 4LBLA 3S30A 5C3SA 4GXLA 3U10A 3NV3A 5A70A 4C1XA 3OG2A 2HYXA 1STMA 2QUOA 2ZAAA 2VMDA 4NHMA 5GZCA 3SKJE 3GBFA 4AFBA 1YCIA 3T1MA 4DS0A 5G04L 3KD4A 1G9FA 1MVQA 1ULCA 4DQAA 5FZEA 1SG3A 2CDOA 4IEXA 1B09A 5FOBB 2C26A 2AR6A 4AFDA 3OTFA 4BXSV 1DYKA 1C8M2 4DEVA 1RUF2 5EJ1B 3KF3A 4Q8LA 3OYWA 5LATA 3AZYA 3F2ZA 1JTZX 2VBDA 1JZ2A 2NN8A 1H1MA 4BA6A 4O9GA 3ROUA 2UWCA 2RDQA 2WT1A 4XTPA 3HIFA 2FMYA 4N7IA 5F39A 1OH4A 5DUUA 1OOPB 1C5HA 1AZDA 2RM22 2VOKA 4XFHA 5JVVA 3WXPA 1XB9A 3M7AA 1GMMA 1OKOA 4IE4A 5DMYA 1HV1A 1AXKA 2WQ8A 4WZFA 3S6PA 2EF6A 1PX4A 3SH3A 1XE0A 4OI2A 2JG9C 3J7MA 4L2NA 2E7TA 1EV11 4CRQA 4YPJA 3DECA 3H8OA 5FBJA 1FXZA 5LBEA 1VB2A 4LUMA 3AC0A 1VAVA 1KFXL 4RR3B 1BJQA 3W59A 5CG8A 3KF5A 5GLUA 3UKNA 5KHIA 2QDNA 4COWA 5T5JA 4WVMA 1CPNA 4R4XA 2JJ6A 4Q4V1 1W6PB 1GSLA 1Q3EA 1S0BA 3H3LA 1D0HA 4CE8A 2PHFA 1WMDA 1MS1A 1COV2 2QZ3A 1DZQA 3AZWA 3WCRA 3ZYBA 2QQOA 2OIIA 1ULPA 1ZREA 3W20A 3C7HA 4LO7A 3I4IA 5F1RA 4N8MA 1RHI2 1XNCA 4S2FA 1CAVA 4QWNA 1GWKA 2OKXA 2GAUA 4NAMA 1OPOA 1Y7BA 5FPBA 2VTFA 4N43C 3POIA 4Q26A 2W46A 4FPHA 2FDHA 1D4VB 4HVRA 4YW6A 4UI9L 4HOOA 4FBFA 1UF2C 1Y9MA 2AGSA 1GZCA 3AMMA 2VQUA 4NJ4A 4KGGA 2IWGB 3AXDA 4UFKA 5DUXA 3N7MA 3WDWA 5FO9B 2BGPA 3WLUA 2D6PA 5IVJA 2XJRA 1YQ6A 3BN6A 3WG3A 1POQA 2XJTA 2XUEA 4Y1UA 5FMOL 4YLZA 1JHJA 4Q5OA 1POV3 3E6DA 2WNUB 4NIIA 1LEMA 2UWAA 4AHZA 5JPNB 1W3XA 3FLTA 4UOJA 2D93A 2HH9A 3H9AA 3I2JA 4WVZA 2FD8A 2I74A 1GKBA 4QU1A 1PVC1 3A4UA 1Z7S2 3ZN5A 3B93A 3AJYA 3FHQA 1R092 2WFF1 4HKWA 5FFOC 3ZMNA 5FPXA 1BVVA 1K5MA 2JDHA 5DUWA 1LODA 4P00B 2JENA 3I7DA 4COVA 4PLNA 3AP7A 2RMU3 4LKSA 4L11A 2A73B 1XYOA 2W91A 3ACIA 4EJRA 3GALA 2B7YA 1CQ9A 1HN1A 3O1VA 5EHDA 5F5IA 1CAXA 3RYRA 1JS9A 4G9SB 5ACA3 3O0XA 3ZYRA 1DGLA 4WM8B 1Z7S3 4QXHA 3AZZA 4UXAA 5HPOA 1TNFA 1FOD1 4RGGA 4HMZA 2ZEZA 1VBB2 4HANA 4QKFA 4ZU4A 1PO21 4KU8A 3WNMA 5LZ6A 3VBFC 3VD7A 5HV4A 2HWF1 1VRH1 3B69A 3PMEA 2RR11 4CDWB 1QJX1 4QU2A 3SMHA 5H9SA 2A1XA 2OPKA 5C71A 3DYOA 1YFWA 3DF0A 3O0VA 4WM8A 1QQP1 4MOAA 2FHRA 3IDAA 2XBO2 3E1F1 3WP3A 5IK8A 1DYOA 2HWD1 3HR9A 1HXS1 2PHWA 2J1EA 1UZWA 3LDKA 5A3WA 3V64A 4ATFA 4KWUA 1AR72 3WW3A 2NMNA 3FLRA 4NHYA 2IZWA 4A3XA 1GQGA 1RUD3 1XBFA 5M0TA 2VZ1A 1L7RA 1QOOA 3ZFGC 2ZKLA 3OBRA 2EXHA 4PQQA 3AM2A 3IKWA 2QQLA 4Q0UA 4QDRA 3RZKA 1CIYA 1F8VA 5FIXA 3BOPA 3MUY1 4AGVA 1LHOA 4EQVA 3B5LB 5IUQA 5J3UA 1BQPA 1MVEA 4YNIA 3GHNA 1QF3A 1RUH3 2WJSA 3T0AA 4CDXA 2W0XA 1OFSA 5JR7B 4IEWA 3AKTA 4I0AA 5D2AA 1UN1A 2A3XA 1R082 5DN2A 2V5DA 5LK5A 1I6XA 4JGYC 4ZXEA 1QKQA 1GQHA 4XJZA 5FYIA 2Z42A 5T55A 3O14A 2E9QA 4V2VA 5B4XA 2WNVA 2V4VA 4AZZA 4LLFA 3FZ3A 5C8CA 5FYZA 1ZBE3 4GH4C 3ZVXA 3P3PA 3ZYIB 3POEA 2WFPA 2J1SA 1GWLA 1FPN1 2Y6LA 1XC6A 5E1RA 5AC93 2WO7A 4JGYB 1PMIA 3VGIA 4LKEA 2WT2A 4LBNA 5C3QA 4HKLA 5FYTA 5C5UA 1DQ2A 3M3IA 2PHTA 1APNA 1RVF1 3NNJA 1SPPB 2DTWA 1G7YA 2HWB1 4ARYA 4QKDA 4Q4X3 4IV3B 5FY9A 3RI9A 5BNPC 2VNOA 1CJDA 2QVSB 2AACA 3BPSA 3MGUA 2W08A 2O8QA 1S2EA 4D7YA 2Q0AA 5EXOA 5CFDA 3U78A 1TMF3 2R072 5K8SA 1TEIA 2IXKA 2C5DA 4BQ3A 2D5FA 3HEIA 3I8TA 1ZBA1 5LEJA 4NRPA 1K5JA 4Y20A 4HETA 1BLZA 2AREA 2P3YA 1U12A 1VRBA 3AKRA 1PO11 2Z5WA 3AFGA 1LOFC 2A6XA 2GC1A 5CYYA 1RHI3 5FXXA 3WQ0A 4CXYA 1LHWA 1TMF2 2R073 1V6JA 2WZEA 4NIHA 2ILMA 5A6ZA 2GP3A 3FMGA 5F5AA 2GNTA 2WRAA 1BBT3 4GZ9A 1O4YA 5CB7A 1TNRA 2EALA 3LD8A 4NRQA 3U37A 5L36A 3ZYGA 5L9BA 3WF1A 2VOWA 3AVSA 4XBLA 1Z0HA 5KC6A 2EXIA 3NAPC 1QJEA 4BQWA 4QKBA 5IW0A 1Z78A 3WW4A 1O59A 5CKQA 1SDDB 2FQPA 3H3ZA 4UYBA 2Q8CA 2FDJA 3FHIB 5SV5A 4LIUA 1YJKA 3KT1A 1JZ6A 1N1VA 4CCMA 5BNQA 2HKXA 1W2UA 4P08A 2VZTA 1EUTA 1DGWA 1YXWA 2Q1FA 5C4WA 3ZKYA 3ZYHA 1BMV2 4RS5A 5CVRA 1RUG1 3PTYA 3I49A 2NP0A 2QQNA 1H8VA 1WW7A 1OUSA 1C8M1 3GZAA 4Q8KA 2P5BA 2R16A 4BYYA 3KM5A 4OHYA 1UIJA 4M4RA 3EJKA 4QPYA 4YM0A 2BP6A 1VP6A 2LTNA 1VBA1 2EXJA 3AMNA 4AEMA 2VJXA 4UFLA 4EZHA 4FSJA 5JDBA 2JDMA 5D21A 3LFMA 4CXWA 1FMD3 1RUJ3 4EV0A 2HWC2 4AOCA 1D4M3 4NHKA 1IPKA 2XGXA 4AE2A 2ZGMA 3MPPG 4AI2A 2VOXA 4AVSA 4DXZA 1AYN2 2YBKA 3WW1A 4LO4B 1OXCA 1C3HA 4Q0PA 1UY1A 5GLWA 3OD0A 4CDXB 2UY9A 1DZRA 1AJKA 4KQ7A 3JU9A 4QHOA 2D6LX 1NCQA 4FO9A 1HRI1 2E33A 3HNYM 1N3QA 1AYM1 4K8FA 5GLZA 4NPLA 5A6YA 5CFCC 2BERA 2R063 5K7PA 1V9U1 4S2HA 3O5SA 1LHVA 2P6CA 2IVJA 3H1WA 1SLIA 4JZRA 3WQBA 1AX2A 1O4TA 3I2OA 2ZXQA 3AYAA 3DV8A 3VDAA 2VW1A 2OS2A 2HWD2 3U0ZA 1Y9QA 3M1HA 4CUGA 4CXXA 1UKRA 4SLIA 4AAXA 4HL0A 4CU8A 4JDOA 4KG0A 4KG8A 4E8DA 1RYYA 4IE0A 1QJX2 4INDA 1NLSA 3CJIA 5FP9A 3SEPA 4F3JA 4TXWA 1JYVA 1E5HA 4AI0A 2JECA 2ORXA 5J1XA 4CYDA 4CDQA 3OEAA 1PVC2 4QGLA 1UIKA 1MR5A 1QDOA 4JTNA 4XJWA 1GV9A 1ODNA 5JIAA 1DGWX 2XB6C 1POV0 3UL2A 2J1AA 4AYUA 3IT8A 2Y6KA 5JCTA 4QX3A 1W8ZA 5CZKA 4AI3A 4FPGA 3OJBA 2LROA 4XFAA 5DAWA 1WUVA 1GP6A 4Q4Y3 1NOVA 1C5IA 4AR2A 3A7QA 1VBE2 3TNPB 5AFEA 5JXHA 1W6OB 2EVXA 3GZTB 2VMEA 2A7AA 3AMPA 4QHZA 2VTXA 3KGLA 1ULEA 5ACA2 4BMBA 3BYWA 3OUJA 1NA1A 4KMQA 4YW5A 2CNAA 3KSCA 3BTZA 5FYSA 5IVCA 2H0BA 2PHXA 3ENRA 1U0AA 2D40A 3R0RA 3O1RA 2JDAA 4D8MA 1SLTA 3RRDA 1ULDA 2D3SA 2WYFA 5CFDC 4W4ZA 3GXUA 4GMP3 2JDKA 3WV6A 5LEKA 1NE4A 2JG8A 3AVRA 1QXRA 2D43A 4Y1ZA 4CPBD 4GQ7A 1A3KA 2RS12 4DRRA 1NA1B 2DU0A 4R52A 4GD4A 1UX6A 3TWIA 4CCJA 1CESA 2CAVA 4QPGC 4ET7A 4Y1YA 1HXS2 1PX3A 4P9JA 4Y22B 2BNNA 2FZ2A 3OY8B 3I2KA 3O1MA 4LXLA 2W1QA 4D6QA 5ANQA 1H2LA 2ZZQA 1RIRA 2ZEWA 2ZX1A 4X6RB 3ST7A 4K6BA 1EAH2 3GDBA 1W2TA 1TME3 2VZPA 2RS51 3H42B 2D6OX 3OF1A 4E4DX 1CZSA 1UZ0A 2VZOA 3R4DB 4UW3A 1W6MB 4CP1A 5FP4A 4BE3A 4XZUG 3HBZA 3H8RA 1GYKA 5FZ9A 2X5IC 3GCWA 2DFCA 2W68A 1JZ3A 3GJAA 2EXKA 1HQWA 2WO3A 4IEUA 4N43A 3VBHC 1D0GA 3C8XA 1XSRA 5CBLA 2UYAA 3OPWA 1WMEA 3VV1A 4PJYA 1QJY2 1SPPA 3MV01 4H7MA 4FPCA 2K2SA 2YYOA 1JOPA 1QJU2 4QD2A 1R1A3 4B4QA 2B39A 2Q1MA 4AEJA 3BGAA 3F95A 4HN0A 1UD1A 4UFMA 4YG3A 1YIFA 5CU1A 1F9KA 3INAA 2MPFA 1VAKA 3K3OA 4JC1A 3FX3A 1YYNA 1UMIA 3CL1A 3NJVA 1GZTA 2XG3A 2VZUA 2F4PA 3B01A 2TBVA 2D6NA 3GBGA 4K1YA 3RSJA 4LKDA 2BJSA 2VZVA 2ZZJA 2HWE2 4MGYE 3LF7A 1O6UA 5A7NA 1OSGA 1JU3A 4CCEA 4Z92B 3HWJA 4KBBA 4CU6A 4N53C 2EICA 1DF0A 5CFCA 2YUEA 3QACA 2R041 1MS4A 4YGCA 5FZMA 5FZBA 3HNBM 3NNMA 5A6XA 4C90A 4BQ1A 5FMOS 3FL7A 1BMV1 2XBO3 2YU1A 2YU2A 5FY8A 3THTA 1MEC3 3W5NA 1BBT1 4QX1A 2YGMA 4RQPC 1ZRCA 3LKJA 4XF9A 1O3SA 3WQ1A 2RVAA 2Z69A 1PGW2 3AK0A 3GNEA 2J1UA 2BFUL 5I0SA 2CWMA 4P02B 1RHI1 2KM2A 3VKOA 4M00A 4UW5A 4M0NA 1FX5A 4YVWA 5DDJ3 4AL9A 1DQ0A 4CDWA 3MUZ1 4RN5A 1H2KA 4HK8A 1NLQA 1IZ3A 1VAMA 4Y26A 5FYCA 3WP4A 3ZLIA 4YM2A 2RJLA 2PAKA 1OD5A 2VG9A 2NYYA 1J59A 1LULA 2ZGQA 3A0KA 3IWZA 4B8EA 3WQ7A 4M3CB 4CA9A 2H6CA 3B00A 5TSWA 3RFRA 5LY2A 5C9AB 3TOJA 1ZRRA 1OVSA 1TMF1 2XLFA 4JQTA 4WVMB 4Q1RA 5T52A 5FPUA 3O1PA 3I2IA 3BU0A 3ACGA 1WLDA 4AQSA 2A5ZA 1NCRA 3PU8A 1JZ4A 4QKNA 4CCDA 2CTVA 2WLQA 2WZR3 3AL5A 5D8AC 1DGRA 2A71A 2NM1A 4QB1A 4RSUA 3V65A 4XFFA 4XUTA 1CX1A 5A7WB 1YQ5A 2IXLA 3AKPA 5SV8A 1TG7A 3LCPA 4E8CA 1CAVB 1S0EA 1JMUB 1AL22 1DQ4A 2ZPXA 5AC91 2XKPA 2PMWB 1XNKA 2Y6JA 1KEXA 3CLPA 1L7LA 2XWBB 2ET1A 4MADA 1REDA 5FUIA 4JTOA 4FP2A 4LHSA 1VE0A 5FY1A 2ZBJA 2HWB2 5IHRA 3SCGA 4YYOA 4W6WA 3ZPOA 5JMCA 3D6EA 3E6CC 3I3QA 2HEYF 1PIV2 2RS13 2QKDA 5FY4A 5FZGA 5IAXA 3S5QA 3J8F2 5JIUA 3APBA 4Q4W2 1GWMA 3T4VA 4CEYA 2DDUA 1HB3A 4R4ZA 2WL1A 5DG1A 1XU2A 2MNGA 1RUC2 3MZHA 1AF9A 1XSQA 3AX4A 5EJZB 3VL8A 4AVVA 3ZDSA 2DVAA 4P9WA 1DDLA 4BZ4A 3KHCA 2P6HA 5FXVA 2LS6A 1GOHA 2W95A 4YZ4A 3THDA 1AL0G 2XKOA 3AL6A 3X29B 2BV4A 4HK9A 3I3EA 4JAAA 5IJRA 4GKYA 2VXJA 1RUD1 3WX5A 2JIGA 2OW4A 1GNYA 2ADEA 2HYKA 2KA3A 3LDBA 5FMDA 5C7GA 1HXS3 2CHHA 1QH6A 5FLIA 3SITA 2HWD3 1GBGA 4GAZA 4YZ1A 4UBGA 4Q0QA 3HT2A 4R9DA 3I59B 4HVOA 4L92A 1YJLA 4OCTA 3WG2A 4AVTA 2Z79A 4D94A 3K77A 5FZ6A 2JXAA 3K48A 1CZVA 4GWIA 2RR13 4RGKA 3GF6A 2A6YA 2A6WA 3RS6A 2Z2SB 3K75B 4WM8C 3CNAA 2JDZA 3H7YA 2D3PA 4LOTA 1HW5A 2W9XA 4YZ5A 1KXGA 4L99A 1W2AX 5A33B 4J6GA 2X5IA 3ON7A 4IXLA 1W6NB 1PNFA 4XQ4A 1ND2A 1WW4A 4XUNA 1F4AA 1QEXA 1W6QA 5KC5A 2DUPA 1ALYA 5LRRA 4EN9B 2ZGRA 2VMFA 1HRV3 2C9KA 1JODA 2P1BA 3LOIA 3KVBA 2RR12 2RMU1 3ZFEA 2RDSA 4RA0A 4Q1PA 1H2NA 3ZXEA 4DEQA 1S0IA 1H9PA 1V6NA 1LB2A 1AVBA 2VCCA 5FPAA 2WFF3 2X05A 4LA2A 4QPGA 3JBG2 3WINE 3S5AA 3BPZA 3RQ0A 2D6KA 3VN4A 3ZXGA 1K42A 2I45A 2VOVA 3IN9A 5FP3A 2BEOA 5T3NA 3VKMA 3J7LA 3ZOIA 1XU1A 1YC61 4RS5B 3FBMA 4K8RB 4R9CA 3PIGA 4AVAA 3VLBB 5A3UA 1HJFA 3AMQA 3K4DA 5FOJB 1R093 2WNUA 5KBFA 1XOYA 4BIOA 1X36A 3JBG3 4AGRA 2C4XA 1LEDA 4IQPA 1N1SA 2A75A 3H3UA 3NV1A 1L7QA 1W06A 4EN6B 5K9YA 4OQ8A 3TEXA 4QDSA 1V00A 5GJ6A 3RJRA 4XJUA 2XHNA 1QOTA 1EAH1 3ABZA 1LOEA 1XRUA 3PUIA 3S0MA 5IK7A 3PUQA 1WCSA 2BFUS 3R4SA 2WQZC 3AYDA 4XZPA 1RMU2 4GB32 4BQ4A 5BXXA 3B9CA 3Q8EA 4H55A 1H0BA 4QDQA 1ND2B 2ZMNA 2GC3A 1O5UA 2D97A 1QY4A 2RS11 1IPSA 2R30A 3HQXA 3N7LA 1UYXA 2WC2A 1GP4A 3H7JA 1KGYA 4GIQA 3J9SA 5IT6A 2X09A 3VDDC 3I97A 4BQXA 1BCXA 1CGPA 3VBSC 2P17A 3WNLA 1OQEA 4LTAA 4IV3C 1AHSA 5BNPB 3K4AA 5JWPA 4MO3M 2WAOA 3HQUA 2QFEA 4MV2A 1DG6A 1DBNA 4LO8A 1FI2A 1WCDJ 2PELA 1RC6A 4LE3A 4B7EA 3HBKA 2YPDA 4N53A 1LKNA 3O12A 5HBAA 3B9IA 1YO8A 3KMHA 4CCCA 4LO5B 3G7DA 5FZ1A 1JUHA 1T6GC 4CP0A 1ENRA 5CG9A 4BQ5A 4YZ3A 4P9XA 2FBEA 4JQRA 2WUHA 1RUC1 1UYYA 4JGZA 4GMP0 3RZMA 3MW4A 4FVVA 3SXWA 4NHLA 2BDRA 1ZA4A 5A6QA 2VMIA 4I30A 4M0HA 1EYBA 5LA1A 3ZN4A 1V6IA 1VBD1 3RPQA 1ULOA 5IFPA 2B8MA 1YUDA 4LIVA 2PHDA 4XUQA 2YZ4A 4YVSC 1VIWB 5DDJ1 2KXLA 5FZLA 3SCFA 3T2TA 5FQ0A 2J1VA 2RS53 5F7UA 1TVGA 4YFZA 1BZWA 3QH6A 1LECA 1W8OA 2R0FA 5A3LA 4J1XA 3M3QA 4PQ9A 2FZ1A 1WA6X 2GN3A 4CU9A 5IK5A 1UMHA 4DOUA 5AVAA 4QGNA 3LE0A 3MBWA 3J8F1 3WUCA 1I5ZA 1UZZA 3VD9A 4YGDA 5F32A 4ZY9A 1O4ZA 5A7QA 5K4LA 3VD3A 4H3WA 4XYXA 4XHXA 4NIAA 4AVBA 1IS5A 3OUIA 2I2SA 2BQPA 3L2HA 2DCYA 2ZGUA 5GLVA 3KV4A 1D2QA 4I0BA 3LPFA 4LMFA 4QPIA 1NCQC 1I1EA 1LTEA 3K3NA 1H6XA 3CMGA 4K3UA 4ZU5A 1E5SA 3D82A 1VPHA 4CDUC 5AC92 4OUMA 2PLV1 3RMYA 2IXHA 1UWWA 5DXDA 1V9U2 2ES3A 4AEDB 4BK5A 1AR92 4CU7A 1UY2A 5A32A 2ETEA 4FFHA 4XJ9A 4A45A 4PDWC 5FLHA 5FZ8A 3POWA 2UY8A 1SLCA 1B35C 2C6SA 5ABJA 4ORFA 2CGPA 1WMXA 3VBHA 3P3NA 1TE1B 2WDBA 3RZHA 1AL23 2PYTA 4HG6B 1ODMA 2VCAA 3MFAA 3JQWA 4D69A 2HJIA 3MIFA 4LHKA 5EWSA 4GWJA 1HJGA 2FCVA 3OGVA 1HB4A 4JRLA 4XF1A 5FPVA 3TNQA 1M4WA 2VCMA 4RHV1 4XETA 1ZZCA 4HLTA 3PL0A 4FI9A 5LK7B 3QH7A 4TN7A 4QX0A 4XHBA 1G9AA 3DEMA 2Y64A 5A3NA 2WSUA 1YFXA 3WNKA 3TBDA 2YGLA 4Q27A 1KFUL 2VE1A 4MGTA 1N1TA 1SHWB 4P14A 1O8PA 3SH4A 1MZ6A 1VBC2 4GJYA 1VLNA 4DRVA 1VJ2A 4E2SA 1BEV2 3DL3A 4OZOA 3UJOA 4C0HA 3MFCA 4AI8A 5IVYA 1DFQA 2R061 2CU5A 1IS3A 1X9PA 4RHV2 2RE9A 1MPXA 1AJOA 1RJ8A 2V09A 2WYSA 4XJ8A 5FXWA 4ZXKA 5LWBA 1NG0A 2ARXA 3VBUB 3T3YA 3WUDA 2EA7A 2EIEA 2RS33 4AEDA 2W2IA 2ZHLA 2DCJA 2SBAA 5FREA 3CU7A 2V72A 1JYCA 3VDDB 1SACA 4U2AA 3V0BB 2GNDA 4I02A 4YZ2A 1UXXX 1G9DA 5IVEA 2WNVC 2AZ5A 4A2UA 5E8AA 1QJY1 1FMD1 5B2GB 5GLTA 1J1TA 4IGPA 1MS0A 1H4HA 1YIPA 3O0WA 4K7JA 4N9HA 4NPRA 1X8MA 4Q4Y2 4QXKA 4LHNA 5DG2A 3VZMA 5KR7A 5HCAA 4A4AA 1VBA3 4DPNA 2XQRA 4OFGA 3P1IA 1SMVA 1E57A 4OI1A 5BY5A 1FAYA 1SCRA 4LEJA 1BK1A 2JKXA 2PAEA 5FO7B 2VM9A 2EAKA 1XYPA 5D8AB 1J3QA 1OFNA 3E5UA 1J3PA 1RJ7A 2ERFA 4ISRA 2GU9A 2V4AA 4P9IA 3IPVB 4FPKA 4A6OA 1QOSA 2PN5A 3KV5A 4HKOA 5I0TA 4AAPA 2VVFA 1E5IA 3K46A 3S57A 1VMJA 4BJ0A 1DIWA 5L7OA 1UCXA 2D7FA 5JSOA 2PAMA 4URTA 4HFSA 4V2WA 3BOWA 2ZX0A 3T0BA 3ZYJB 3WEZA 3HQRA 4FAHA 3CZUA 2RV9A 1F5JA 3ATGA 3CJXA 3NJZA 1QDCA 1RVF2 4JVAA 4CCKA 5FZDA 2LM3A 3WNNA 2VZSA 4FPEA 1WMFA 4PI0A 3J8F3 2ZX2A 5E88A 1SLLA 5LA0A 1HRV2 1W0OA 5EZWA 2CGNA 1YQCA 3BB6A 2W1WA 4YVSA 4LT5A 4FOYA 1O91A 4JGYA 4AHXA 3RMXA 2IXCA 3ILFA 3TN91 4A3ZA 1HRI3 2D98A 3UESA 3UKTA 3M3CA 3PLQA 2W3JA 5JR2A 3IDEA 4PLOA 3NAPA 4EE2A 1GQPA 1VBD3 4RFT0 3MLLA 2DCKA 4IEZA 3PUHA 2BVBA 2R32A 3POSA 2NPIA 4LPLA 5CISA 3RGBA 3IBMA 2DURA 2WAAA 4AEDC 1RGSA 3POJA 2PFWA 1RUC3 3V0AA 4OULA 1D4M1 2WNUC 3I2HA 4YW7A 4UWDA 1RUJ1 2R0HA 3IDBB 3BU7A 4Q4X1 4Y3OA 2WZ8A 3VDBA 1PNGA 3NL1A 4PBPA 3VBRA 3PDQA 5IWFA 1MEC2 2OXBA 2GMMA 3HVDA 4G3YC 4W6YA 4B7KA 1JYXA 1HKDA 3VKLA 1AR81 1HDKA 2B9UA 1Q56A 1H1AA 1YI7A 4N9IA 4O7XA 5FLJA 4CUCA 1C8M3 2VL4A 2G1MA 1JZ8A 4ATEA 1QQP2 3U1XA 2AEZA 2VH9A
chains in the Genus database with same CATH topology
2LUWA 3AJZA 3OCPA 2A6ZA 1AUYA 2QCSB 4BWOA 4XFCA 1MACA 2B42B 3WG1A 1QU0A 1UMZA 4I3PA 2ZGLA 1KITA 4MYEA 4PCRA 1V70A 3MIEA 3NAPB 3ZIWA 1EAH3 3LA3A 5E89A 2DVDA 3VBUC 1HRI2 1REFA 4LBMA 4B4RA 4KWLA 1RUJ2 5T5PA 4QQLA 3JBG1 5T5LA 1IKPA 1RINA 5BNOA 2PTMA 1R091 2WFF2 4FQ4A 4QQ2A 3WOGA 2XVKA 2CV6A 5CNAA 3ACLA 3WY6A 1PO13 3ZMOA 4JV4A 5F9TA 2YPJA 2MHFA 4FPLA 4AI1A 1QQP3 1WLTA 3MIDA 2CGOA 4M01A 1ZBA3 1V6KA 1YNAA 4LBJA 5F6LB 4HPKB 5EYXA 4OZXA 4AVCA 4GH4A 1PO23 1MS9A 2BWCA 4F83A 4Y1VA 2GC0A 2ZACA 1HRV1 5CAZA 4N7UA 1RVF3 1TQ5A 3GBWA 1ASJ3 1KS4A 1QXJA 4GH4B 1KDKA 1JW6A 4XXAA 4CDXC 2PA7A 1QXPA 2ZGTA 2BYVE 4DNYA 1JOJA 1JUIA 2EAAA 3HT1A 1PHMA 3FJSA 1KS5A 4PBOA 1XXNA 5C8WA 1POV1 2PHRA 1RUH1 1PM7A 1B35A 2WT0A 3ASIA 2G9GA 2AUYA 1KDMA 2E63A 1QWRA 1YHFA 4GWNA 5T54A 1DLLA 4GA9A 2IFRA 2GDFA 4XFIA 2R1DA 1WLWA 2G4IA 2YXSA 4IERA 4AEKA 3NW4A 5JZGA 2VY0A 1JN2P 3DGTA 1OA4A 3SNMA 4TSVA 3VHNA 1SCSA 4ITCA 4XW3A 4AGGA 4MXVA 3ZSLA 4FQZA 2N7GA 5KXDA 3TYJA 5DDJ2 4UBHA 3E6BA 1KQRA 3ZFEB 5JOXA 2R062 2B46X 2VNRA 1FOD3 4MH0E 5J09A 3ZXFA 4META 3VBFB 4HSLA 4OLLA 1RUI2 1WA4A 5J48A 1NCRC 4PDWA 3AKQA 2V73A 4QPIB 4COZA 4OUSA 4FOVA 2WZR1 5HI0A 1EV13 1FATA 1LOBA 3DKWA 4V1PA 1B35B 2P2KA 2PLV2 4I2OA 2P3JA 2ENRA 4ES9A 3TAYA 4I0WB 1V6LA 3CJIB 5GZEA 2Y0OA 3USUB 3WG4A 3KGZA 4LHLA 4AFCA 2ZOEB 5A3MA 3VHOA 1GNHA 4OI0A 4JDNA 2HWF2 4RQPA 5JOZA 2W39A 2R1BA 2R042 1OQ1A 1GR3A 4R9AA 4FTBA 1XQNA 2MEV3 2XWJB 4RR3A 5BV6A 3KT4A 4Z8BA 1LGBA 2NLRA 3H1MA 3U07A 1MEC1 5AVPA 5I0RA 4BPZA 2XBO1 3VL9A 1RUE2 4KWKA 1W6PA 3BALA 2UYBA 4A7KA 5I8SA 2R043 1VBD2 1VRH2 3OGGA 1QH7A 1NE6A 1H9WA 1W6QB 2A6VA 1WBLA 3JUUA 3S7IA 4LUKA 1ND3A 1BXHA 1PVXA 2DVBA 1ZYBA 4AXOA 5EJ3A 3WDTA 3E97A 2WINB 2VVDA 2ZJCA 2X8KA 4HZFA 1UKGA 2VUAA 3VBUA 1W6MA 2Q1ZB 2E7AA 3JQXA 1NQJA 2VECA 3RZZA 1R1A1 1ZVFA 3ZIXA 2EIGA 1LHUA 1TME2 4HSJA 5BNNA 2BVVA 2Y38A 4H14A 3C3VA 3H0OA 1RUOA 4Y20B 5C9AA 4QQHA 3R05A 4WM7B 1RMU1 1QJZA 4GB31 1WD4A 2JE7A 1MZFA 2VMHA 2CL2A 4LA3A 1TME1 1PZ9A 3RJ2X 2K9ZA 4XBNA 3KB5A 1LESA 4XTMA 2RJKA 5I8TA 3LB9A 4IEOA 2F6BA 3SLIA 2B45X 2JG9B 3IDCB 1DYPA 1ZZ6A 3V56A 3WVJA 4FPJA 3MEPA 4P9GA 4RD7A 5GKAC 3BIWE 2ZA9A 5H9RA 1N1YA 2XVLA 4GMP1 5KXBA 4P9LA 5A32B 2WS93 1CJPA 1HQNA 4WVVA 1EPZA 1AX0A 2IFWA 4PDWB 4DFSA 4XQWA 1OMIA 5FCCA 5BNOC 2HWE3 3ZO0B 4R8HA 3VBHB 5DZEA 4CEYB 2C9AA 4FOWA 4FXKB 1QNYA 1HV0A 3WDVA 4OVEA 1IGOA 2RMU2 4Q4Y1 3H8UA 3Q9OA 1J1LA 4LBQD 4NN0A 2OYZA 2HWC3 4D7SA 4CEYC 1DU3D 4LBOA 1IHMA 2DUOA 2W52A 4IETA 2VW2A 4XMAA 4E4SA 3ZXJA 4AHYA 3HN1A 1ULFA 1ZRFA 3M3OA 1H1IA 3WD5A 3MLJA 3RYPA 4B29A 1HIXA 3I59A 1YLLA 1LRHA 3AFKA 4L97A 4BOWA 4ZU7A 1QHDA 4BCUA 2ZX4A 2ATFA 1OLQA 1I3HA 4AWDA 1A8DA 2P3IA 3NKGA 3VKFC 3ZXDA 1V9U3 1FT9A 3WR0A 2WZPP 1Q5OA 1SBFA 2DTYA 1AYM3 5JLVA 4EROA 1YFUA 3SH5A 3NV4A 4AHWA 4BM8A 2XL9A 4IEYA 1SBDA 4FPFA 4MXWA 2JE9A 3RWNA 1MS8A 3OYWB 4BLIA 4AFAA 1H8TC 1VBA2 2A3WA 4DINB 2E51A 4YARA 1OA2A 1A8MA 3GZUC 2V5YA 4FAGA 2ZAHA 2BNOA 4PIXA 2WQ4A 1KJRA 4XILA 3B7MA 3OPZA 4UW4A 1BKZA 3E5XA 5ABJC 2C0ZA 4YRDA 2WWSA 3UV9A 1R1ZA 2XLGA 3MDPA 5KHJA 2X29A 1ZX5A 4SBVA 3JD72 4QX5A 5L73A 4Q4W3 1U5XA 2XH6A 4W65A 1ENQA 3VBRC 1G9CA 1SEFA 4L9BA 1GNZA 1LHNA 3QOPA 1RUG3 1W39A 5KXEA 5F5QA 1HLCA 3VUOA 1SLAA 2VNGA 2ZGPA 1O5LA 4FTEA 2VULA 4YVSB 3FBYA 3LAGA 1RITA 4H7LA 4X8PA 3MPBA 2Q8OA 1JH5A 3D0SA 1CAUA 1QJU1 3KS7A 5C8CB 3LZZA 1CIWA 2X5IB 2UURA 2I07B 2YY1A 2BGCA 1C1LA 2R071 4AG4A 1UAIA 3RDIA 4G4FA 2YHJA 4ISQA 4KWJA 5E16A 1RUH2 4IEPA 4YVWB 4QQOA 5I91A 1LGCA 1VR3A 4YW3A 4N43B 2RS52 1RB8G 1R083 3D4KA 1U5YA 3AZVA 5J7MA 2OZJA 3AP4A 4S2DA 4Y4YA 5L7OC 4C1WA 2GMPA 3FE5A 1ENSA 2Q4SA 3AKSA 4MLOA 2OUJA 4AQ2A 1MQTB 1V6MA 4LLOA 3PMSA 2HWB3 2QE3A 2ZX3A 1BBT2 1EP0A 3MIBA 4W6XA 3AP9A 3RYKA 1UZYA 1CX4A 4HVQA 2Y26A 3UKVA 1DQ6A 1XNDA 5AFBA 1R1A2 5L7OB 3AP6A 3MLKA 5C4WC 5BUVA 1FPN3 1LU2A 3IPVA 2JICA 3VZKA 4MSVA 1ZBE1 3WDXA 2VUJA 1VBB3 5JAXA 1VBE1 5EV7A 4NWVA 4YM3A 1ZZ9A 1OPMA 2RHPA 4DZGA 4Z07A 3VZLA 3NKTA 3B02A 1Y43B 2BBVA 1AR71 4TLFA 3PVBB 1IPJA 3DUIA 4AQTA 1S0GA 3NVCA 1JHNA 1OHFA 1OKQA 1ZZBA 3KT7A 2DUQA 1L3JA 1RUE1 4CDUB 5BNNB 2ZHKA 2ZTNA 5DUVA 1UU6A 4OI4A 3NO8A 4WBBA 3ZSJA 1XE8A 4GULA 1LU1A 1AXZA 3AMHA 1OOPA 4XBQA 3ZSMA 1C1FA 1AYM2 4Q29A 1VBC3 4XMIA 4E27A 1QJX3 2X53S 4XIKA 3W58A 1DGRN 1PIV3 1VRH3 2HWF3 4MZUA 4RGAA 3WHTA 5J37A 1NY72 1FNZA 4K21A 1WLCA 3SCHA 3H1YA 1ND2C 4YM1A 3KLSA 5FQ0B 4QHBA 2DF7A 1Z7S1 3WHUA 5ACA1 4ZKTB 2ZGNA 3I2DA 5T50A 3PNAA 3M3EA 5T5OA 3IIAA 1DHKB 1ZZ7A 2D5HA 2ZHNA 1G8WA 3CO2A 2C1FA 4JCKA 5FTTC 1Q8OA 1NZCA 3VZJA 1PVC3 4XEZA 2ARBA 2RM23 5CFCB 5J96B 4MGZE 1AYN3 1PZ7A 4CZSA 3URFA 3ZFFA 3W9AA 5GZGA 4JGZC 2DCZA 1FV3A 5H9PA 1RUNA 3VBOB 4COUA 2GNBA 2DYCA 1XNBA 4E9KA 4E2GA 1BEV3 1SBEA 4XPVA 4Q4W1 1BYHA 3OD4A 3D0JA 4RR3C 4KL1A 1COV3 4D7TA 4BH9A 2IXIA 3I54A 1X8EA 4P9YA 4LBQA 4Q4V2 2XLAA 1VALA 4QM8A 1RUI3 5BPXA 4BLJA 4EWAA 3VBFA 1QMJA 2ZS6B 4FTSA 3PJQA 1CR7A 1NCRB 2WNEA 2WS92 1PO12 1WCKA 4LNVA 1FMD2 3OBTA 1RUF3 1U5IA 2ZMLA 3EO6A 5C4WB 4D3WA 1PK6B 4Q4V3 4YW2A 3WP6A 1XE7A 1NCQB 3A0NA 4Y24A 4IV1C 3K51A 4FOQA 3MI8A 1S2KA 2JG9A 2ZABA 2Q30A 2UU8A 3LA2A 3ZFGA 2UWBA 1M06G 2O8OA 4E2QA 1LCLA 5D1IA 4QT6A 1PK6C 1PZ8A 4QGMA 2WA4A 4E4ZA 3WDUA 4CEWA 1ND3C 1LENA 5CA6A 3M4FA 4HBNA 3WT3A 3JB4C 3ZFGB 1FPN2 3VBSA 4M3CA 3V0AB 5JZGB 3N36A 4CEWB 2PHLA 2B5HA 4LULA 1FV2A 4QMAA 5DZGA 5BNNC 3LA7A 2VMGA 2OZ6A 3MICA 1XYNA 1RUG2 4NR1A 3FFQA 5GZDA 3ZPYA 1W6OA 2DVFA 2WKKA 1O3TA 4UW6A 3WCSA 2PHUA 4XFGA 1GANA 4OHXA 2HWE1 1CAUB 3B3QE 5K0UA 3BTAA 3TRSB 1IQAA 2YDEA 4I09A 4TZDA 3FC0A 1ZBA2 1YI9A 4LO6B 1AR91 4QQPA 2ZGOA 1OA3A 3PVNA 1LOAA 2WS91 5GZFA 1H8TB 3ZSEA 3MF9A 4YW4A 4FCAA 4CDWC 4MXWB 5BNPA 3DPRC 4AF9A 4I3GA 1C28A 1MZ5A 4B4PA 1G9BA 2E6VA 3O7OA 3CEWA 4Y1XA 5ABJB 1EY2A 2QQPA 1HX6A 1LGNA 4LR4A 4EN8B 2MEV2 3USUA 1CPMA 3R6SA 2VW0A 4F7ZA 4IV3A 1UU4A 1VB4A 4WM7C 1GFF2 4RQPB 4JGZB 4DMIA 1C4RA 1Q8VA 3E5QA 5FDBA 4LE4A 4BIFA 4K1ZA 3VKNA 2DFBA 2XJPA 1URXA 3EXUA 3BODA 3ES1A 2TEPA 1DZTA 1RTVA 2RS32 3HMYA 4A7ZA 2VPVA 3HAGA 3UK9A 4IESA 5KHGA 5F6KA 1S1AA 5JOWA 1NXMA 1CVNA 1K5MB 2XJVA 4Y22A 4C0BA 1IOAA 2P3KA 3PJYA 2A3YA 4Q2FA 1G86A 4PIYA 2IC1A 5HCFA 2CWSA 2QDRA 3VZNA 1PK6A 1D4M2 4A7YA 1EPWA 1NQDA 3M70A 4KU7A 1J3RA 3VHPA 3AYEA 3ES4A 3ELNA 4XIOA 4XE9A 1AR93 3EBRA 4QPGB 3L2YA 1NY71 1YFYA 3L9JT 3MIGA 1CAXB 2JKBA 3N7JA 3OGJA 4JDMA 5JI7A 3WDYA 1F2NA 1PO22 2P34A 3QCWA 3QLQA 4KNCA 3TN92 2HEVF 5JSRA 4AFMA 4Z1VA 4R9BA 4MGIE 3KCYA 1Q8QA 2BPA2 1Q8SA 2MEV1 1WGPA 1GLHA 5I0UA 1N3PA 1N3OA 3CJIC 2H0VA 4WM7A 3ETQA 2BTVC 4YG0A 2PQQA 2TUNA 2YROA 2WIIB 1KRIA 5JZGC 2GN7A 1SLBA 3FUQA 3JB8A 4PLMA 4S2GA 2TNFA 4XF0A 4CEWC 2VVEA 1AYN1 1ZRDA 4FP3A 4PIZA 1QGLA 5J98B 2WLPA 1OQDA 1YWKA 3S7EA 4Q4X2 4IV1A 5A33A 2XL7A 1QNWA 4MX3A 4XJAA 1JYIA 2IXJA 4GALA 1ULGA 5H9QA 3WZ1A 3ZXKA 1CD3G 5KWRA 3ZFEC 2WNVB 3N7KA 4N53B 1ZZ8A 4ES8A 1SQ4A 2H6BA 4ASLA 1RUF1 3VHRA 2WZR2 1GZ9A 2YMZA 3U11A 3KCCA 4BHPA 4NOTA 1VBC1 5KHHA 4P5HA 1RUI1 2BW8A 3R4UA 1O3RA 4K20A 1COV1 2NMOA 1RUE3 4LBQB 2DCTA 2YV8A 2R49A 4IEVA 3FWEA 3LOBA 4X6QB 1BEV1 3ILRA 1C57A 1UPIA 2ZKNA 1MS3A 3PHMA 1OOPC 1A6CA 3AYCA 3QBQA 1AR61 2GC2A 5JSPA 2D6MA 3POYA 5C33A 1AR73 3D5OA 5EFUA 5K0UC 3MYXA 2D44A 2JG8C 3SHRA 4JRAA 3ZXLA 2CYFA 1WD3A 1UPSA 4DB5A 3ECQA 1C8NA 2ZMKA 4IL7A 3WP5A 2G9FA 4ONUA 2RM21 4XXPA 1VBE3 1PGL2 1IS6A 2R6QA 1BVP1 2Y0IA 5K0UB 4YVWC 3AZXA 1D2SA 1FNYA 5FRAA 1EV12 1MZEA 2WSVA 4L8QA 5JOYA 1ASJ1 2ZGSA 4QM9A 1WBFA 4KGQA 2XJSA 3H50A 4XDQA 3VBOC 1G6NA 1ONAA 3C2UA 3ZN6A 3HD8B 2VXRA 3BCWA 3VBSB 5EYYA 4I01A 1GICA 2DU1A 3JD71 1MQTC 2AH2A 4YW1A 5CIRA 1JBCA 1LR5A 4AK3A 4IEQA 3LSEA 1PIV1 4XF3A 1ASJ2 1LJ7A 3ZFFB 4KH9A 3RNSA 1REEA 4YGEA 1R081 4AW7A 3NV2A 5I8YA 3VBOA 1UL9A 1LOCA 2A70A 3JD73 1S0JA 2XPJA 1Q43A 3NWKA 5BYNA 2QZ2A 3J26N 5CFDB 1NYWA 2BNMA 2D3RA 5HXVA 2BUKA 3AP5A 5FBZA 3ZFFC 4EWDA 3J4UH 1NA1C 3MW3A 4XF4A 2OA2A 2JD4A 2Q5TA 1LOFA 4NWWA 3ZXAC 1QJU3 3IMNA 4NVPA 4ASMB 3NSTA 4OHWA 1AR62 1DQ5A 1I9RA 4CDQC 5L19A 1FYUA 3ME2A 4GKXA 3G6JB 4K9SA 4M3CE 1F5FA 4YFWA 1KJLA 1X33A 1ND3B 2ZHMA 2GZWA 4U36A 4N90A 1AR63 4CDQB 1CONA 1VBB1 5GM0A 1SFYA 4XFBA 1FOD2 3JZVA 4OHVA 5KHKA 1SFNA 2E53A 3KZ4C 1PGW1 1UW8A 3LGRA 1AR83 2JX9A 5DZFA 4Z82A 5BNOB 1N47A 2CY6A 4HN1A 2FMDA 4FPYA 3GYDA 2QJVA 4Q0SA 4XQDA 1MQTA 3T1LA 2GSYA 3FLPA 2DWRA 1LOGA 2QNKA 3ZX7A 1OLRA 2XUMA 4PF5A 4BMEA 3SISA 3MW2A 1SDWA 2CAUA 2XHKA 1AR82 3PVOA 3QD6A 2GH2A 2VU9A 3N35A 1X50A 2DV9A 1H30A 3TB0A 3MIHA 1CAWA 3VBRB 1UU5A 2VQ0A 1ENXA 4GWMA 1S55A 3UJQA 4RL7A 1IS4A 3U4XA 2NZ9A 1ZBE2 3TN93 1H4GA 2OUHA 3AXEA 2O0OA 3IM0A 2JEMA 5C6CA 2JG8B 1MS5A 1V6OA 3PVEA 1ZM1A 3ALQA 2OVUA 1GZWA 1F31A 1Q8PA 2BWAA 4FT8A 3LWCA 3RG0A 3KCXA 2GALA 1RL3A 3ZN6B 4EN7B 4CDUA 2E7QA 3WNXA 4EN0A 1NXD1 3B94A 1GZWB 1AX1A 2YC0A 3WW2A 4WVWA 5JI9A 3THPA 2P37A 1KD7A 1S0FA 1AXYA 5C9AC 4K40A 1JXNA 2O1QA 3D8CA 3FFZA 5JPMB 3N3HA 4C91A 5FO8B 5FAXA 4J1WA 4COYA 1K5MC 3LSDA 4WZCA 1S0CA 2XVGA 1WW6A 5LRSA 2LALA 1QJY3 1S0DA 4HPKA 4MUVA 4IV1B 1Y3TA 4TYSA 3DN7A 2K0GA 1IKQA 2XJQA 2AYHA 2VGDA 4QPIC 1H2MA 2RS31 3KQRA 3ZYPA 1OI6A 1W6NA 4MGKE 4YSFA 4Z2WA 3GHMA 5FPZA 3EQEA 3AB0A 4TWTA 3ZSKA 2ET7A 4FXGB 2ZCWA 1O7FA 1X7NA 1RMU3 2VQAA 4GB33 4O9EA 4YGBA 5C8CC 4RS5C 2GH8A 5KXCA 4OHZA 4WV8A 3OY8A 1PGSA 2WA3A 3MF6A 4MVTA 2NQYA 4Q0VA 3VDDA 4M3CF 4X8NA 1DQ1A 3M2MA 1X82A 2DVGA 3EHKA 3FUOA 1U5ZA 4CTEA 4CP2A 4DY3A 4AQ6A 3ILNA 3RI8A 1YRZA 4RHV3 4LBKA 4YG6A 3CF6E 5J36A 2GNMA 5HCBA 2AENA 2SLIA 2XJUA 5I93A 1PGL1 1W0PA 1S2BA 2GMEA 5GALA 1A78A 1AL21 4F8AA 4DY5A 4B3NA 5CADA 3DPRA 2HWC1 1HQLA 1O3QA 1J58A 3JCIA 5D8AA 1NLRA 1H8TA 1CAWB 3M8LA 2HEWF 1WW5A 1ZNPA 2PLV3 1CN1A 3DPRB 4HT1T 5IK4A 3N4MA 1RUD2 4XOGA 4Y5Z0 4EWEA 2ZGKA 3VZOA 4FPOB 3V0BA 4NO4A 4LBLA 3S30A 4GXLA 3U10A 3NV3A 4C1XA 2QUOA 2ZAAA 5GZCA 4NHMA 3GBFA 4AFBA 1YCIA 3T1MA 4DS0A 3KD4A 1G9FA 1MVQA 1ULCA 4DQAA 4IEXA 1B09A 5FOBB 2AR6A 4AFDA 3OTFA 1DYKA 1C8M2 1RUF2 4Q8LA 3OYWA 3AZYA 1JTZX 2NN8A 1H1MA 4BA6A 4O9GA 3ROUA 2UWCA 2WT1A 4XTPA 3HIFA 2FMYA 4N7IA 5DUUA 1OOPB 1C5HA 1AZDA 2RM22 2VOKA 4XFHA 5JVVA 3WXPA 3M7AA 1HV1A 1AXKA 4WZFA 3S6PA 2EF6A 3SH3A 4OI2A 2JG9C 4L2NA 2E7TA 1EV11 4CRQA 1FXZA 1VB2A 4LUMA 3W59A 1VAVA 1KFXL 4RR3B 1BJQA 5CG8A 5KHIA 3UKNA 2QDNA 4COWA 5T5JA 4WVMA 1CPNA 4R4XA 2JJ6A 4Q4V1 1W6PB 1GSLA 1Q3EA 1S0BA 1D0HA 2PHFA 1WMDA 1MS1A 1COV2 2QZ3A 1DZQA 3AZWA 3WCRA 2OIIA 1ZREA 5F1RA 4LO7A 3I4IA 1RHI2 1XNCA 4S2FA 1CAVA 2GAUA 1OPOA 1Y7BA 4N43C 4Q26A 4FPHA 1D4VB 4HVRA 4FBFA 1UF2C 2AGSA 1GZCA 3AMMA 4KGGA 2IWGB 3AXDA