1WCDJ

Crystal structure of ibdv t1 virus-like particle reveals a missing link in icosahedral viruses evolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
421
structure length
421
Chain Sequence
IVPFIRSLLMPTTGPASIPDDTLEKHTLRSETSTYNLTVGDTGSGLIVFFPGFPGSIVGAHYTLQGNGNYKFDQMLLTAQNLPASYNYCRLVSRSLTVRSSTLPGGVYALNGTINAVTFQGSLSELTDVSYNGLMSATANINDKIGNVLVGEGVTVLSLPTSYDLGYVRLGDPIPAIGLDPKMVATCDSSDRPRVYTITAADDYQFSSQYQPGGVTITLFSANIDAITSLSVGGELVFRTSVHGLVLGATIYLIGFDGTTVITRAVAANNGLTTGTDNLMPFNLVIPTNEITQPITSIKLEIVTSKSGGQAGDQMSWSARGSLAVTIHGGNYPGALRPVTLVAYERVATGSVVTVAGVSNFELIPNPELAKNLVTEYGRFDPGAMNYTKLILSERDRLGIKTVWPTREYTDFREYFMEVAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords MAJOR STRUCTURAL PROTEIN VP2
publication title The Birnavirus Crystal Structure Reveals Structural Relationships Among Icosahedral Viruses.
pubmed doi rcsb
source organism Infectious bursal disease virus
total genus 95
structure length 421
sequence length 421
ec nomenclature
pdb deposition date 2004-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1wcdJ01
2.60.120.660 Mainly Beta Sandwich Jelly Rolls icosahedral virus 1wcdJ02
3VBFB 4CEYB 1QJY2 3ZFGC 4CDUA 1MQTC 5ACA3 5C8CC 1D4M1 1AR83 1AR63 5C4WA 1WCDJ 1GFF2 1EV12 1HX6A 1VAKA 1EAH1 1VBC3 2X5IC 2RM22 1OHFA 3J8F2 4CDWC 1C8NA 2MEV3 1R093 5C9AB 1F2NA 1V9U1 1RUH1 5CFDA 4CDQC 5CFDB 1QJU1 1VBE3 2XBO1 4JGZA 1PO23 4JGZB 1AYM2 2QQPA 4N43B 1QQP2 1POV3 1ND3C 2RR12 1QJY1 1BMV2 2BPA2 5JZGA 4JGYC 4QPGB 1ZBA2 3TN91 3CJIB 5L7OA 3HAGA 1NOVA 4GH4C 5LK7B 1PGW1 2R072 3JBG3 2RM21 3J8F1 1R083 1AR71 3NAPB 1K5MB 2R043 4GB33 2ZZQA 1ND2A 1A6CA 1H8TC 4N53A 4Q4X3 1RUG1 5J98B 4AEDC 1DDLA 1PO13 3JD73 5AC91 1OOPB 1FMD1 1NCRC 2BFUS 1EAH3 3ZXAC 2RMU1 5BNPA 1VB4A 2RS52 1PIV1 3VDDC 3VBOC 1BBT2 1ZBA1 1RUE2 4Q4Y2 5D8AB 4IV3A 3VBRB 5A32B 5ACA2 1NY71 1TME1 1VBA1 1NA1C 2HWF1 4Z92B 3LOBA 1FPN2 4QPIA 3TN93 4QPIB 2WS92 1NCQB 1VRH1 4RS5A 1IHMA 5CFCB 3M8LA 5K0UC 1RUI2 4RR3B 1QJX1 4IV1A 1RUJ3 1AR73 5BNNA 4Q4W1 5GKAC 5BNNB 3VBHA 5FMOS 4Q4V1 1PO22 5ABJB 1RUG3 1MEC3 2BBVA 2ZAHA 2WLPA 2RMU3 4CEWA 5A33B 4CEWB 1PIV3 2Y26A 2WS91 2HWD3 3VBUC 3DPRA 1X33A 1HRI2 2R042 1RVF3 4RQPC 3ZFEA 4YVWA 1VBA3 4RHV1 3ZFGB 5BNOC 1MQTB 2HWF3 4Q4X2 5C8CB 3VBFA 1PGL2 4CEYA 1HRV2 3JD72 1VRH3 3ZFFC 2RS11 1RUD3 2WZR1 1QJX3 4PDWC 5DDJ3 2X5IA 2X5IB 1B35B 1COV2 2FZ2A 4CDWB 2WFF2 1CJDA 1B35C 1NG0A 1FOD1 5C9AA 4Q4V3 2HWB1 4CDQB 1HXS1 4NWWA 1VBB3 4CDXB 1ASJ1 2HWC1 5J96B 3VBSC 1ND3A 4CDXC 1ND3B 1TMF2 4CDUC 1ZBE1 4N43A 1RUF1 1AR93 1AL0G 4JGYA 4Y4YA 4JGYB 2FZ1A 5C4WC 1R1A3 1RMU2 1Z7S2 4QPGA 4GH4B 3CJIA 1RUJ2 1EV11 1AYN2 2WFF1 2RS33 1BEV2 1AL22 3IDEA 4WM8C 4FTBA 1X36A 2HWE2 3NAPA 1K5MA 1H8TA 1H8TB 1D4M3 2WWSA 4AEDA 4AEDB 2RS13 2WZR3 5FOJB 1AYM1 1NCRB 1QQP1 4GMP1 1OOPA 2RR11 1C8M2 5JZGC 3VDDA 3VDDB 1FOD3 3VBOB 1BMV1 2HWD2 1VBD2 1V9U3 1RMU1 1RUH3 1RUC2 2R062 4YVSC 1ASJ3 2HWC3 4RFT0 1PVC2 1QJU3 2PLV2 4WM7C 2XBO3 2R071 5D8AA 4LLFA 1ZBE3 1RHI2 1BEV1 3VBRA 5A32A 1ND2C 2HWE1 4N53C 1QJY3 1NA1B 4NWVA 1AR82 1AR62 2GSYA 1RUD2 5DDJ2 1NCQA 5K0UB 2BUKA 1VBC2 5BNPC 1EV13 5CFCA 4RR3A 2MEV2 1R092 2RM23 3J8F3 4BCUA 2RS51 4EJRA 1W39A 1VBB2 1BBT1 1OPOA 1VBE2 1RUE1 4GMP0 4Q4Y1 4IV3C 5ABJA 2PLV1 1AYM3 1AR92 1RHI1 2RR13 5AC93 5ACA1 1FMD3 1R1A2 1AR61 5A33A 1HQNA 4RS5C 1FPN1 1ZBA3 3VBUA 3VBUB 3JBG2 4IV1C 2RS32 1R082 1RUI1 2R073 3FBMA 1F8VA 4RQPB 3VBHC 4GB32 1TME3 1D4M2 5BNOB 2IZWA 2VQ0A 4Y5Z0 3ZFGA 1QJZA 1MQTA 5C8CA 1PO21 1PO12 3ZFFB 1POV1 4PDWA 1EAH2 1VB2A 4PDWB 1B35A 4CDWA 4Q4W3 1BBT3 3DPRC 1QJU2 1RUE3 2XBO2 4Q4Y3 4CDQA 3VBSB 3ZFEC 4CDXA 4YVWC 1HRI1 2R041 4CDUB 4GB31 3VBFC 4CEYC 1PGL1 4Q4X1 3TN92 1CD3G 1FPN3 5C4WB 1PO11 1HRV1 2TBVA 3JD71 2WS93 1PGW2 4SBVA 1RUI3 4GH4A 1AR72 5C9AC 1COV1 4WM8A 4WM8B 1POV0 4RHV3 5CFDC 1RUG2 1AUYA 1MEC2 5AC92 4JGZC 1FMD2 4N43C 2RMU2 1TMF1 1NCRA 1PIV2 5JZGB 5FMOL 4QPGC 5L7OB 3VBOA 4YVSA 3CJIC 2HWB3 4YVSB 5L7OC 2XPJA 1HXS3 1Z7S1 4WM7A 4WM7B 1NY72 1RUJ1 1TME2 1RVF2 1HRI3 1AYN1 1VBA2 1ND2B 1K5MC 3NAPC 2HWF2 3S6PA 1RUF3 4N53B 1AL21 1MEC1 1NA1A 1HRV3 1VRH2 1QJX2 4FSJA 1OOPC 4FTEA 5BNPB 5K0UA 4Q4W2 1COV3 1C8M1 2WFF3 4Q4V2 1SMVA 2HWD1 1VBD1 4FTSA 1RUC1 2R061 4IV3B 5D8AC 1RVF1 3VBRC 1PVC1 1TMF3 2DF7A 1QQP3 4GMP3 2ZTNA 3JB8A 2GH8A 4RS5B 1AR81 4QPIC 1RUD1 1NCQC 1RMU3 1Z7S3 5CFCC 1M06G 5DDJ1 4RR3C 4IV1B 1E57A 3JB4C 1VBC1 1AYN3 4RHV2 3VBHB 2MEV1 1R091 5BNNC 1BEV3 4RQPA 1AL23 2HWE3 5ABJC 5BNOA 1VBB1 2RS12 1VBE1 2WZR2 1RB8G 3ZFFA 1AR91 1C8M3 4CEWC 1FOD2 2HWB2 1R1A1 1V9U2 1HXS2 1RUH2 1VBD3 2RS53 3DPRB 1RUC3 2R063 1ASJ2 2HWC2 3JBG1 1PVC3 2PLV3 1ZBE2 2RS31 1RUF2 4YVWB 3ZFEB 1R081 2BFUL 3VBSA 1RHI3
chains in the Genus database with same CATH superfamily
2ZHLA 1JYTA 1PMJX 4ISRA 3M3OA 1J84A 1QJY2 1DGRA 5A7QA 3ZLIA 5C8CC 3AYDA 4MUVA 1D4M1 5LA2A 1NXMA 4Q29A 1UU4A 5FZKA 4JTNA 1S0IA 3GBWA 1UN1A 5EWSA 4ZHNA 1PK6B 2A3WA 3AK0A 3POEA 1UY0A 2ZX3A 5FJHA 3RS6A 5TSWA 1VBC3 5A6XA 1TEIA 3JUUA 3UGGA 1Y7BA 2VCMA 4ARXA 4CP9B 2HEVF 2JECA 3WP5A 1MS5A 1RUH1 4CDQC 1OLME 1JUHA 2GAUA 4XVHA 4Y1XA 5A6YA 3AMNA 2VECA 5CZKA 4HKWA 3SEPA 1CIWA 3MPPG 1TNFA 4JGZA 5FY8A 2GP3A 1AYM2 4IETA 4M0NA 2WABA 1QQP2 3IB3A 1ND3C 4NIAA 5A3LA 3AZVA 5FXZA 4OHZA 2J1SA 2ZKLA 3IMMA 3WOGA 3WZ1A 4Q5OA 3VD9A 2J1TA 1JBCA 1SCSA 1VP6A 1YQ5A 1WLDA 3H9AA 5EHDA 1ULDA 1CVNA 3I59B 4LBNA 5F2WA 2YFUA 3CJIB 1W06A 5LEJA 4GH4C 2XUEA 1K12A 4XFBA 2WT1A 2XJPA 1PGW1 2R072 2UWBA 1MZ5A 3ORJA 4UI9L 4PHZA 3WG3A 2VG9A 1EY2A 2HBTA 4Q1RA 4DXRA 1LRHA 1K5MB 4NHYA 4GB33 2ZZQA 4QX2A 4FP2A 3NNMA 5LBFA 1J3PA 2AC1A 2RJLA 1E5RA 2YU2A 1OA2A 3MV01 4NAMA 1UYYA 3LPGA 3E6CC 3PVBB 4FOVA 1G8WA 4BQYA 4ISQA 1CN1A 5CIRA 1V00A 4AOCA 2RS52 1W2OA 3AB0A 3NKGA 1JUIA 3PMEA 3H42B 1ZBA1 3LCPA 1NYWA 5JI7A 4AAPA 3OJBA 5AFEA 3GCXA 3ACLA 4JAAA 4DNYA 5D8AB 1F5JA 3MF9A 1QWRA 1LOAA 2XLAA 5IYYA 3LEMA 4S2HA 4AYUA 5FY0A 1AF9A 1NY71 3GZAA 3VHNA 2ZX2A 5IFTA 3LPFA 2C4XA 2RE9A 3OEBA 5A3TA 5FYCA 1VBA1 3A0KA 5LW9A 1KQRA 5FPLA 3VL8A 3UETA 3LOBA 5IK7A 1FPN2 2ZMNA 5FMCA 1FV3A 5J36A 2WS92 4RS5A 1JHNA 5JLVA 1N3PA 3M8LA 2YPDA 1H6XA 5K0UC 3BI3A 1MS3A 1CAVA 1HB3A 1WLCA 2QDNA 4Q0QA 4F7ZA 1CJPA 4CRQA 1O4YA 4AEJA 1O3QA 3IT8A 2KD7A 3K4AA 1MS1A 4W6XA 1W6MB 1IG0A 3NNLA 2VMDA 2YYOA 3VKMA 5EYXA 2GNMA 1O59A 2VU9A 2FDIA 1GZWA 5H9RA 4ES9A 5ABJB 3ZX7A 4M3CB 3CL1A 3MGUA 5FP9A 1CAWB 3CEWA 3DKWA 2VL4A 4UAPA 1SDWA 2WLPA 3RYPA 3ILFA 3POSA 1O3RA 3MI8A 2NQYA 1H30A 5EFUA 1HQWA 4IXLA 3ZSMA 2DBIA 2GH2A 5FMBA 1H2MA 4GIQA 1O91A 5DUWA 1LOFC 1O8PA 4XILA 4QB6A 5DPNA 2HWD3 3VBUC 4O65A 3VHOA 4A6OA 2VR4A 2E9QA 3UJQA 3POFA 4MZUA 1RVF3 2VNRA 3ES4A 4RQPC 3WLUA 5DMYA 3BOWA 2YHJA 1VBA3 1LOBA 4P00B 3RJ2X 5EIYB 1L7LA 2SBAA 3ZFGB 5DAPA 2R0HA 4Q4X2 1UMHA 3TEXA 1PGL2 3G7DA 3SEEA 3WSOA 4JQTA 3HMYA 4UWDA 3WW2A 1RJ7A 1AJKA 2IWGB 2RS11 1RUD3 4QQOA 2WZR1 1N3OA 5GZCA 1Y9QA 3IAPA 2WT0A 2JICA 5FP4A 2X5IB 4QX5A 3POBA 5FDBA 3OGJA 4FPFA 2WFF2 3RPQA 5DXDA 4CDWB 1FATA 5FPUA 3LKJA 5JUVA 5GLTA 4LA3A 1FOD1 3THDA 3C2UA 1AXZA 2D93A 1R64A 3NW4A 3PJYA 1AVBA 2VXJA 4A44A 4QHBA 5CKQA 1V6KA 3LDBA 2VZTA 3IMNA 4LMFA 2VD7A 4RN5A 4MXWB 5FYVA 1NT0A 2Y6LA 5J96B 4P5YA 2AUYA 3NV1A 4URTA 1S2BA 1D2QA 1RUF1 4FVVA 4AQSA 4XTMA 3ST7A 1C4RA 1U5XA 2XKPA 3HBKA 5FV3A 2ZCWA 4MHUA 4C1XA 2P5BA 1YYNA 2TEPA 2A1XA 3KF5A 4JGYB 2XONA 1R1A3 4M00A 4Y4YA 1XE0A 4R8HA 4O9EA 2Y6JA 4LHSA 2PHTA 3VZNA 1OUSA 1OBNA 2CV6A 2PHXA 3ECQA 2B7YA 2R6QA 2ZGQA 4YW5A 1HKDA 2DCJA 2FCUA 1BEV2 2RS33 4E4DX 4DUWA 4MX3A 1LGCA 2OQ6A 3PVOA 5FYYA 5H9QA 2V73A 3NAPA 4B1LA 1KEXA 1VLNA 1CAUB 2JDKA 4AQTA 2ZGRA 2Y60A 5DN2A 4FPCA 3DGTA 1YNAA 2WWSA 1OVPA 1XYOA 2EXKA 2RS13 1OFSA 3POGA 4PLOA 2WZR3 4AEDB 3I2DA 1EYBA 4AFDA 2YY1A 3FFQA 4LHLA 4LBQA 4AVAA 1AYM1 3QOPA 1NCRB 5FOJB 1QQP1 2VC9A 1DP0A 3N9PA 2A6ZA 2HH9A 4W4ZA 3OY8B 1YJKA 4XJ9A 3VDDB 1FOD3 4GWMA 3VBOB 2BNOA 4UW3A 2YC2A 3MFAA 2ZX1A 3AKSA 3M7AA 2R062 4HVRA 5HI0A 1XNAA 2BV4A 2QTWB 3GZEA 1KS4A 5F6LB 4XZUG 3A22A 4AVVA 1ZM1A 1PVC2 2PLV2 2XBO3 3RZGA 3N9NA 2R071 5E8AA 1RHI2 2XWJB 4RD7A 2WDBA 5FY1A 5SV5A 4EZ4A 1QJY3 2A6YA 4NWVA 4XJUA 5A3UA 4DFSA 1C57A 5HBAA 1W90A 5FCCA 4X6RB 3TB0A 2AREA 2WO1A 4EE2A 5DDJ2 4YM3A 1LENA 1H9WA 2XLFA 1FNYA 2ZEWA 4HN0A 3WCSA 2F17A 4RR3A 3I54A 4A7YA 2WLQA 4B3NA 5JR2A 5C6CA 1X50A 1W2UA 2RS51 1W39A 2R49A 4HSJA 3BPSA 1GANA 3WNLA 3UL2A 1OPOA 2IVIB 4DXTA 5JPMB 1SLBA 2P3YA 5A80A 4IGOA 1XSRA 2QVSB 3RZJA 5J48A 1WD3A 2X53S 1AYM3 3D0JA 1AR92 4LHKA 5I93A 2CTVA 2ADEA 2WN3A 4CU6A 5LEKA 2OUHA 2FDJA 4D8MA 1ALYA 1H1IA 3ZN4A 5A33A 1HQNA 2QQNA 4RS5C 1W8UA 1C5IA 1FPN1 4AGRA 4Z1VA 2NPIA 4COVA 4FOQA 4D94A 3C7HA 4ZXKA 4QXCA 2ET7A 3AXDA 3LAGA 2Q8EA 4LO6B 5JMCA 3HOBA 3JBG2 3UJOA 3NJVA 1HIXA 5IHRA 4D7TA 2B9UA 3FBMA 4FPYA 2R073 4QT6A 1W0NA 5BY5A 1X9TA 1O7FA 2BWAA 2VZUA 1TME3 1S0FA 2OIIA 3MO4A 2AYHA 5BNOB 1XNBA 4FPGA 1OLQA 1QJZA 1MQTA 5FYBA 5LASA 3THPA 3QD6A 5CA6A 3S7EA 4EQVA 4NIGA 3WD5A 5LATA 3U4SA 4ZONA 1PO12 4TTGA 1HV1A 2IXIA 4YG3A 3B5LB 2VMEA 1YFYA 3WXPA 4DIQA 4BHPA 4LNVA 4D69A 4MGTA 2JG9A 5A3MA 4BZ4A 2VMIA 4CUBA 1F31A 1WUVA 5FZ3A 5KR7A 2C5DA 4Y33A 3VDCA 1QJU2 5F39A 1UD1A 1DZQA 4XJZA 4META 2FMDA 4QB2A 1JZ7A 5CU1A 3BIEA 2QE3A 1D4VB 4CDUB 4P9WA 3WG2A 2XH6A 3H8UA 4DEQA 1UPIA 4N9HA 2CGNA 4LPLA 5I0TA 4CVUA 4CCJA 1PGL1 4IEUA 4EN0A 4IGQA 4Q4X1 4U2AA 1Q8OA 3TN92 1CD3G 1FPN3 2PTMA 5LB6A 4LBQD 1OD5A 3VZLA 2DWRA 3BTZA 2WS93 3OG2A 2A6XA 4MLOA 4QM9A 1RINA 3I3BA 4XF0A 1J3RA 5AVPA 3OGRA 4LOSA 4ZU7A 4X8PA 1UZZA 1AR72 4DS0A 1W3XA 2JDHA 4AI9A 1QDCA 1MZEA 2WO3A 2V4AA 2KM2A 4WM8B 1GZTA 3SCFA 1G6NA 1X9PA 1JYXA 5CFDC 1OC1A 1OKQA 1AUYA 1RUG2 2CY6A 2VXRA 5FWJA 2BNMA 2J1RA 5E16A 5AC92 1MACA 1FMD2 5J1XA 2I07B 5FY7A 2C24A 2RMU2 1WBFA 5GLVA 1TVGA 2JE9A 4IEZA 2H6BA 1UIJA 1XOYA 3M3QA 3A4UA 4XXPA 1PIV2 3T1MA 4UW5A 2N7GA 2DU1A 1E5SA 2NZ9A 4XHXA 2JEMA 4BLIA 2AZ5A 1CGPA 1ULGA 1W8FA 2VOKA 4E4HA 4QQ2A 3HQXA 4C91A 5KC6A 2XPJA 2ES3A 3J7HA 4XF1A 4COYA 2D6PA 4DOUA 4HVQA 1JYVA 3ZXJA 2DFCA 2VNGA 1CZTA 5KXBA 3PLQA 3V0AB 3I2KA 3R4DB 1V6MA 3LQCA 1W9SA 4LORA 3NAPC 4FCAA 5L9VA 3S6PA 4D0QA 4N53B 4NJ4A 1YUDA 1W28A 1H1MA 1UY4A 1IGOA 2W68A 2WRAA 3WT3A 3AVSA 4M01A 5FBZA 1VRH2 3ZYPA 3S30A 3UGHA 4BA6A 4AEKA 3IDBB 4EN6B 3IBMA 4BQ4A 4FOWA 4ZY9A 4FTEA 3WP3A 1A34A 2UY8A 3AP5A 4V2WA 4Q4W2 1JN2P 4BMBA 3M3CA 2WFF3 2XL7A 4AAXA 1I1EA 4XCBA 1G86A 3VV1A 3HN3A 1FX5A 3RMYA 1YRZA 3IWZA 3PVEA 3USUB 2R061 3RWNA 3WUCA 3U37A 2JXAA 2QQJA 4NVPA 1PVC1 2KA3A 4ZU5A 3WEZA 3J26N 2W39A 3CIHA 4OUSA 2EXJA 1DQ5A 2ZTNA 3MW3A 5I0SA 4MV2A 1ZZCA 3JB8A 3QLQA 2GNTA 1X7NA 5KXDA 2GH8A 1CAXB 2JD9A 4QPIC 5C8WA 1W6PA 3TEZA 1J1LA 2G9ZA 4ZPIA 1M06G 5DDJ1 4RR3C 1W6OB 4IV1B 4LO5B 3H7YA 2JIJA 2WQ4A 2JDNA 3QH6A 1JZ6A 5BNNC 1BEV3 3LIHA 1DZRA 2BEOA 1QEXA 3QACA 5A3WA 1YC61 2PHFA 5C3PA 5IVBA 2VJXA 3ZM8A 1KJRA 2VULA 2D3RA 4OLLA 1DQ0A 3WNPA 4CCLA 1J83A 2CWMA 3VKNA 1IQAA 3ZFFA 1ZRCA 3H3LA 4CA9A 2CU5A 4HG6B 1WA6X 1AR91 1VR3A 5CB7A 2VH9A 4IE7A 2XJVA 4K7JA 4CEWC 2VW2A 1LGBA 1ZNPA 2LW8A 4XBNA 5I0RA 3S5AA 2BTVC 2HWB2 2W5FA 2QQMA 3T2OA 4CZSA 1B09A 4XXAA 1RUH2 1JZ8A 2WAOA 4XMAA 5FO7B 2R063 4HSLA 1ASJ2 2HWC2 3C7GA 3N36A 1Y3TA 3MLLA 3JBG1 1KS5A 1OT5A 1PVC3 2GU9A 1ZBE2 2PLV3 3IPVA 3KCXA 3ZFEB 1UMZA 1HB4A 3H3ZA 4L9BA 1RHI3 5IT6A 1GP6A 3D6EA 1MQTC 3ZYFA 2BOIA 2E51A 3PUQA 3W9AA 1BK1A 3W59A 1LULA 5C5UA 4O9GA 5JIAA 2PFWA 2ZGUA 3DXUA 2A75A 5C4WA 4FO9A 2ARXA 1D0HA 4HK9A 4BIOA 2B39A 2YDEA 3LA2A 1EV12 1HX6A 4HOOA 4K9SA 4F3JA 1CZVA 3LB9A 2JG9C 5F37A 1LR5A 1CWPA 1C8NA 4OVEA 5C9AB 1V9U1 3K48A 2JE8A 2X05A 3WHUA 1UU5A 3ITQA 3O1MA 2ZGLA 2FDFA 3PUAA 3J9SA 3I3QA 4YYOA 3OUHA 1QJU1 2LRPA 3I2FA 2E53A 1PO23 1NE4A 3LSEA 5FZ8A 3WF3A 3MZHA 4N43B 4DUVA 1Q56A 5ISLA 1MZ6A 1POV3 3JXSA 4FFGA 4Y1YA 2B46X 4LK7A 4Q1PA 3AJYA 3E5XA 2R1BA 2W3JA 4HKLA 1DQ4A 4QMAA 2E7AA 5FYIA 2V4VA 4QPGB 4JZRA 4JRAA 5FRAA 1ZBA2 4KMQA 2GNBA 1YIFA 1VRBA 3TN91 2WNVA 3O1UA 4MGZE 4XAAA 3N7MA 5KHGA 2WN2A 3JBG3 4ZS3A 4P9YA 5G05L 3HNMA 3T1LA 3WV6A 1H1AA 2HBUA 1AR71 2VNOA 2RDQA 4GA9A 5F1RA 3AZWA 4E4SA 1ND2A 2E33A 2DTWA 4N8MA 1REEA 1H8TC 2Q1FA 3OPTA 5HXMA 4AK3A 2Y64A 3CF6E 1RUG1 3FZ3A 5J98B 5BV6A 3PURA 1PO13 2P34A 2ZS6B 5FZDA 2FMYA 5AC91 1OOPB 4COZA 1FMD1 2BFUS 2V5YA 2OX0A 4GALA 1UAIA 2D6LX 2RMU1 2VCBA 3ZSEA 3PTRB 4I30A 3IIAA 4KG8A 3V0BA 1VB4A 1C5HA 3FUOA 1DQ6A 1PIV1 4NHXA 2OA2A 5EV7A 1GKBA 3F2ZA 3KSCA 5GLUA 1BBT2 2DYCA 4I02A 2BGCA 5A7PA 1KDMA 4RFRB 1XE7A 1ST8A 2WINB 1EUTA 1O3SA 4IV3A 4UFLA 3VBRB 5ACA2 1W03A 4R9CA 1ZZ7A 1GBGA 3THTA 5T5PA 1BYHA 2CWSA 5LBBA 1NKGA 4N90A 1W8NA 3TN93 1RYYA 3FUQA 5I8TA 1NCQB 1VRH1 1IHMA 3DYPA 2QBXA 1LHUA 1RUI2 5CBLA 4MSVA 1W0OA 3BALA 4HANA 5FZOB 2FBEA 1BK0A 3B69A 1AR73 4BDVB 4INDA 4Q4W1 1LOCA 3VBHA 1REDA 2PN5A 2YC4A 5FMOS 3VD4A 5FQ0B 4LXLA 5DABA 1ULFA 1IQDC 1NLRA 1RUG3 4PF1A 4IE4A 4RGGA 1W8HA 4MXVA 3MIDA 3EXUA 2DCKA 2BBVA 1DQ2A 2ZAHA 2YXSA 3WP6A 3T0BA 2RMU3 2OPWA 4QB1A 2Q8OA 3S57A 2KR2A 5L36A 5AFBA 4K8RB 4L92A 4QKFA 1PIV3 3IAQA 5LA9A 2VTFA 1UO9A 5C70A 2VBBA 2W1UA 3LA3A 3NV4A 2PHLA 4OQ9A 1UY2A 1HB2A 2ZEYA 3DPRA 4DRRA 4B7EA 4FXKB 1X33A 2YBKA 3NNFA 3PU8A 4LUMA 3ZYGA 5HCHA 1ULPA 5D1IA 4AVTA 2R042 2OS2A 4RA0A 3AVRA 1O8SA 2JB4A 2VOXA 3OD0A 4YVWA 5A6QA 3OF1A 2I45A 4CU8A 5C8CB 3VBFA 4AFAA 4CEYA 3IN9A 3JD72 3AYCA 3ZR6A 3OCPA 4LT5A 2Y34A 1VRH3 3T4HB 3BTAA 3ZFFC 4UF0B 3P1IA 4FPEA 2GMEA 4QKDA 3SH3A 3AC0A 4L0PA 4PDWC 1XNKA 4B4PA 3B9IA 2JD4A 2X5IA 2C6SA 4AF9A 4KU8A 2XXZA 4SLIA 2LROA 3S5QA 5FREA 3SC7X 4GULA 1CIYA 2HWB1 4Z2WA 1ZREA 4CDQB 2K0GA 2ZHMA 3QCWA 3BIWE 1XYPA 1GU3A 4AG4A 3Q8CA 2XJRA 1VBB3 4HK8A 2XWBB 3KWVA 1ASJ1 1A8DA 2HWC1 3ACHA 2YMZA 3OEAA 4FPKA 4R9DA 4Q8LA 4Y22A 3SH4A 4KGGA 1ND3B 2R30A 2V5DA 3AL6A 4PIXA 1ZBE1 2YUEA 2ZGOA 1H2LA 5FZ4A 4DXZA 4NROA 4YM1A 5BYNA 4OCTA 4LJHA 4JGYA 2GMPA 1OFNA 4Q26A 3OBTA 1QMJA 5CEHA 1GNZA 5C4WC 5JXHA 2JKXA 1JOPA 4IEVA 1Z7S2 1F35A 3T30A 2FD8A 2D40A 4GH4B 1RUJ2 2XG3A 1KITA 3AYAA 3KZ4C 3R05A 4XFAA 3RZZA 1REFA 4HFSA 1FXZA 3OBZA 1EV11 1AYN2 2X8KA 3KF3A 4Y4RA 5IVJA 1OSGA 3DF0A 4JCKA 1XU2A 1UL9A 2W9XA 2GC2A 1TE1B 3N7LA 4H55A 5H9SA 2H6CA 2DU0A 1C1LA 2WKKA 4P9LA 4UFJA 1D4M3 2WAAA 4IW3A 5DAQA 4AEDA 4Y24A 1UY1A 4QWNA 3KT1A 1ENSA 1F5FA 5FZGA 1QOOA 3SKVA 1WLTA 3P3NA 2B5HA 4EWDA 3ZKYA 2FDKA 4QDQA 1WW4A 2BDRA 5FYZA 1R1ZA 3VDDA 4A3ZA 5K9YA 1WLWA 2ZGKA 5FPXA 4GWJA 3TEYA 2JX9A 2WNVC 1RUNA 5JOXA 3IM0A 4ATFA 3ZN6B 4FAGA 1RUH3 3CNAA 4YVSC 2B4KA 2YB7A 2WNUA 2DTYA 2RDNA 4D6RA 4E9KA 2B42B 2Z5WA 4IEPA 1ASJ3 4UFMA 2HWC3 4RFT0 2NP0A 3TEWA 4WM7C 2IUWA 5GZFA 1ZRIA 5CAZA 1MVQA 1ZBE3 5A32A 3E6BA 5C3SA 4HONA 1ND2C 3N35A 4A7KA 5B4NA 2HWE1 4K40A 4NMIA 1F4AA 4W6WA 4FAHA 1W6QB 2A70A 2RJKA 2JG8A 1BJQA 4XEZA 2ARCA 4FOYA 2A5ZA 3TNQA 3T08A 3ZYBA 4D7SA 1PMIA 4OFGA 4QM8A 3AMHA 5K0UB 4BB3A 5CFCA 1EV13 1PZ9A 4JDMA 2MEV2 1R092 3NKTA 2WQZC 3ZDSA 2OZ6A 4HZFA 5GLZA 1CQ9A 1YQ2A 4ET7A 4BPZA 2VZ3A 3EBRA 4EJRA 1QHDA 2D6OX 5FZAA 2FDHA 1BBT1 4FPHA 2OW4A 3AKRA 1IS5A 5KHKA 1K42A 4YW1A 1VBE2 4GMP0 1QDOA 4OZOA 4IV3C 4Q27A 5FR3A 4QQLA 2W52A 5J09A 2EF6A 1FV2A 5FZBA 2VW0A 3O12A 1SLCA 1SLLA 4LK6A 4PQQA 1L3JA 1NX9A 4PIYA 5ACA1 4L11A 4EN8B 5B2GB 4XBQA 5DG2A 1IZ3A 3B93A 5FXWA 1RGSA 3T0DA 4MGQA 1AR61 4LKDA 1RUOA 4B4QA 1H4GA 4QAWA 2AEZA 2NM1A 3BN6A 4ASLA 1ZBA3 3AZYA 2WNEA 3RMXA 3VBUB 5I0DA 2VVEA 3W58A 3ZYRA 5FP8A 4B29A 1WCQA 1R082 1RUI1 3OUJA 1JOBA 4W8JA 5IUQA 1MS4A 4RQPB 3VBHC 1JU4A 2Y33A 1U5YA 1QXRA 2G9GA 2VQTA 2ZPXA 2IZWA 1UKGA 4UW6A 3AP7A 2D43A 1N1YA 2P17A 4LBMA 2GN7A 4LHNA 3MFCA 5FLHA 4AFBA 4I2OA 1URXA 1UZ0A 1VE0A 2CAVA 2XLGA 3ILNA 2E63A 1RL3A 4HXCA 3T4VA 2D44A 2QZ2A 1XC6A 3UESA 5K4LA 3IKWA 4OULA 4AI1A 3W5NA 3VD3A 1LTEA 2BOJA 5JI9A 3ASIA 1U5ZA 1B35A 2Q8CA 4YGEA 2BQPA 5L19A 1QJFA 5K7PA 3WDYA 2WC2A 1BBT3 3VZJA 3ZPOA 3DPRC 2GC3A 1XBFA 2QDRA 3ZXDA 4NOTA 2W87A 4NAOA 4XHBA 1U5IA 5T5JA 1JYIA 1DGLA 1M4WA 2D97A 1JZ4A 4H7LA 1OQ1A 3K3OA 4OQ8A 4CDXA 1AXYA 1DLCA 1RXGA 4I09A 3LEKA 4JKKA 4QPWA 2R041 3MYXA 4YVWC 3VN4A 3VBFC 4CEYC 5G04L 4XJWA 4NPMA 1UIKA 2BBAA 4KH9A 4FBFA 2DCYA 1G9AA 3NQHA 3O0VA 5C7GA 3NV3A 4IGPA 1C3HA 2TBVA 1OF4A 3JD71 4KWKA 2O0OA 1WCKA 2MPFA 4BK5A 4ASKA 4BQWA 2BVVA 1YO8A 1RUI3 2IFRA 3ZIXA 1SCRA 2FCTA 1GNHA 2H0BA 5DAXA 4IEOA 3SLIA 3ZYHA 2PHUA 2J22A 4M0HA 2J42A 3M4FA 5A3PA 4QQHA 1DIWA 2DV9A 2P4EA 1SLTA 3Q8AA 3VDBA 3FJSA 4WM8A 5EPAA 3SQOA 4YGBA 4X6QB 2PHRA 4LO7A 2GNDA 3LOIA 3GDBA 4EYUA 3ACFA 5FYUA 1LESA 1OA3A 5CKMA 4CCNA 5CKNA 2J1EA 5FMDA 4JGZC 4P14A 4RL7A 3KV4A 4D7YA 5A7WA 3WINE 4YZ1A 3LEIA 1Z0HA 2VM9A 1SPPB 2FHRA 3UKTA 2XJSA 4XQWA 4CP1A 2WUHA 1ULCA 2WSVA 5FZ6A 5J3UA 5FMOL 1SFNA 4QHOA 4CCKA 2UU8A 2W0XA 2VNVA 1YQ8A 3VUOA 2Z69A 4TWTA 1ULEA 3KT7A 3OGVA 2BERA 3HIFA 1Z7S1 2D7FA 4AXOA 3BU0A 4XAEA 2IXLA 1RUJ1 2W46A 3KB5A 3BPZA 1SACA 4M3CF 4K3UA 1AYN1 3BB6A 5DAVA 2BGOA 3I2IA 1UOFA 2NMOA 3VZOA 1W2TA 2JIGA 1RUF3 1Q8VA 1JZ5A 1D0GA 1W04A 3GM8A 3K3NA 1S0BA 5L73A 1PZ7A 1MEC1 3T0AA 4K8FA 2CDPA 2Y0OA 1AZDA 1NA1A 4QGMA 5A7OA 5C33A 2QQVA 4GKYA 4NUBA 2RDRA 4XDOA 1H8VA 1MVEA 5JXJA 3WW3A 2AR6A 4K6BA 5I8YA 2R0FA 5FYMA 3C7EA 5T50A 4AHWA 2HEWF 1IS3A 4S2FA 5JWPA 4Q4V2 2A7AA 3DUIA 4AFMA 3RZLA 2WNUC 2VE1A 4FTSA 3PDQA 1CZSA 1XJAA 1DGWX 4LIVA 1DHKB 5FJKA 5FXVA 1STMA 4XBLA 5A1AA 2W91A 4UW4A 1F15A 2WO2A 4YZ3A 1SBEA 2VPVA 3AMPA 1W9FA 1UXZA 2DF7A 4QX0A 4YFZA 1QQP3 3D3AA 3H3UA 3ZYJB 2EALA 2F6BA 2JG8C 1OLRA 4NRPA 3RRDA 3T2QA 3DV8A 4XABA 2AEYA 4GAZA 3TWIA 1HDKA 2VZRA 5IAVA 2X10A 4RS5B 4CU7A 1JXNA 3FLTA 4JVAA 5F8PA 1XNDA 1Z7S3 1CAVB 5CFCC 1W6OA 3MPBA 3T3YA 5FUPA 1TNRA 3ZDVA 4LE3A 2QQKA 5JOYA 3FN9A 1H2NA 5T52A 1AYN3 4RHV2 2IFWA 2ZKNA 2J1AA 1NXD1 2E32A 1R091 2MEV1 1WGPA 3EQEA 4HLTA 5HCFA 1GZWB 3OBAA 1UU6A 2D6NA 3OPZA 2BW8A 4GXLA 4M4RA 5DZFA 5IK8A 1ZRDA 3DXTA 5BXXA 3UT0A 4GJYA 4HL0A 2WZ8A 3ON7A 1QF3A 1VBE1 1DYOA 2WFPA 2XGXA 1RB8G 2CGPA 4XF3A 3WY6A 4KWLA 3I3DA 4J25A 4GZ9A 1LJ7A 3A23A 5J7MA 2NMNA 1ODMA 5KXCA 3WNKA 4LLOA 3U78A 2QQWA 1L7QA 2GP5A 3ATGA 3IIIA 2MHFA 2R1DA 1NAEA 1V9U2 3T09A 1ZRFA 1HXS2 2FDGA 3URFA 2RS53 1F9KA 3KV6A 4UFHA 4CE8A 3RZMA 4CTEA 1XXNA 1G9BA 3UKVA 4N7IA 4DUXA 4TZDA 5FZ0A 2WR9A 4LBOA 2CSGA 1AX0A 4ZXEA 2NLRA 1R081 2D3SA 3AKQA 2LUWA 3JU9A 3NV2A 4LBKA 4NIIA 1O5UA 3VBSA 5L9BA 1WCUA 1LOEA 2PQSA 3O1SA 3H8XA 1W3VA 1NZCA 3WQ7A 3WF4A 2VZQA 3I2JA 4L99A 2DVBA 4Y20A 1YFUA 2A6VA 2JWPA 5LBEA 4J1XA 4BQ5A 5KHJA 3I3EA 4Q0SA 2DBNA 1VAKA 5E89A 4YGCA 4MVTA 5EQUA 5EJ1B 5LRRA 5LZ6A 2MEV3 2Z42A 1R093 3B3QE 2Q5TA 3MW2A 1VMJA 2XJQA 3NJZA 1GZCA 1QOSA 4Y1VA 4YARA 4UFKA 3ETPA 2PQQA 3I8TA 4PI2A 5CFDB 1K3IA 4MGKE 1VBE3 4DQAA 2SLIA 3HT2A 3HWJA 4WZCA 4C8DA 1W8TA 1V6JA 2VCAA 4ZS2A 2ARBA 3A7QA 4AI8A 3NSTA 1WW7A 3SKJE 3ELNA 1GR3A 1GQGA 3BGAA 3D8CA 3AKTA 2GN3A 5JSOA 2XVGA 5JCTA 1BMV2 1W6NA 1UMIA 2ADDA 4S2DA 5JZGA 1DFQA 3J7NA 1W0PA 5FPVA 3UNPA 1C28A 4ARYA 5L7OA 3HAGA 1AX1A 2ZMLA 4LITA 4WVMA 5F7UA 5LK7B 1RC6A 1G9DA 2RM21 1MR5A 3J8F1 4I0AA 1R083 1FT9A 2HKXA 1WW5A 2ZX0A 1O4ZA 5FZ7A 1N1TA 3NAPB 2DFBA 3ZN5A 2W92A 3HD8B 4WZFA 5FAXA 2VBDA 3D4KA 5FLJA 1A6CA 4FI9A 3B01A 1VAVA 4Q4X3 2BWCA 4LBQB 4HT1T 4E8DA 2GZWA 2L9LA 3H1WA 1LNSA 2CNAA 2J7MA 1KD7A 5BNPA 4P9IA 5EYYA 3WNNA 2B45X 3PUIA 4Q4Y2 4XYXA 3WDTA 5JOZA 3RYKA 2GDFA 1UZVA 3ETQA 4IEWA 4R52A 4YW6A 5FPBA 3VKOA 3RVHA 1N1SA 1V6LA 4MYEA 3JZVA 4TXWA 4HPKA 3AMMA 2VY0A 3DN7A 2IXKA 2JENA 2ZEZA 1NA1C 3MHZA 2QUOA 2RG4A 5GLWA 2HJIA 3SITA 4R4ZA 1AJOA 4XF4A 4QPIB 4KWJA 5FZ1A 4OI2A 4DY3A 1OMIA 4Z07A 4IQPA 3MLJA 1IKQA 1UY3A 4RR3B 3EB7A 1V6OA 4L8QA 4XPVA 1XRUA 4I3PA 5FZEA 1UWWA 4E2SA 3ZXEA 1W8WA 5GKAC 5BNNB 2BP6A 3J7LA 3NJYA 5APAA 4Y3OA 4DO0A 4Q4V1 5JVVA 3U11A 3H8RA 2G19A 4AQ6A 1PX4A 3PU3A 4AW7A 2QQLA 1PGSA 3V56A 4COUA 3GGLA 1UOGA 1V70A 4UBGA 2Q0AA 4HBNA 4ZKTB 5A33B 4CEWB 5KC5A 3S0MA 2YGLA 3WW4A 3W20A 2Y26A 1J1TA 3BODA 3OYWB 2VZSA 4OUMA 5LA0A 3MLKA 4QPYA 1GWKA 1JS9A 2ET1A 2G9FA 1IPKA 1LODA 2B9VA 1DGWA 1OI6A 1ZRRA 4DY5A 2P3IA 1YFWA 4QKNA 3HNBM 4PLNA 1CESA 4YPJA 3TRSB 1HRI2 4E2QA 5DUUA 2X29A 3KHBA 2OUJA 3KQ4B 5FUIA 4C1WA 4RHV1 5DAWA 3FMGA 4AZZA 1MQTB 2J1UA 5KHIA 3KCYA 1Q8SA 1FYUA 2Q30A 4HMZA 4I0BA 5C3QA 4NIDA 4YM2A 2ZA9A 4MO3M 4YLZA 2XQXA 1PK6A 4UYBA 1T2XA 5DDJ3 2JG9B 3VZKA 4RGAA 5IVFA 3P5BA 2GMMA 3H1MA 2E26A 4BU2A 1CJDA 2O8OA 5JIUA 5AVAA 1N1VA 1NG0A 3KS7A 1GOGA 3GHMA 2F4PA 4Q4V3 4CP9A 1MZFA 2D6MA 4E27A 2OXBA 1HXS1 3WQBA 4NWWA 3WQ0A 3ME2A 4KWUA 4FFFA 2PELA 3FLRA 2O14A 5JXGA 4MADA 2WNOA 2XB6C 4IDZA 1PHMA 4YW7A 3VBSC 5CG8A 1ND3A 1U12A 2R16A 1TMF2 2WIIB 4NO4A 5JR7B 1QIQA 3VKLA 1J58A 5FP7A 3OBRA 2CHHA 1AR93 2RDSA 3KMHA 3N4MA 2JDMA 3CMGA 4OYUA 1BVP1 4PIZA 3R6SA 1US2A 2VOWA 4WVVA 1AL0G 2WBKA 4BQ1A 3OSDA 4ZZ8A 2FZ1A 3JQWA 3O0XA 4QKBA 1WD4A 3K51A 4RGKA 1O5LA 3I59A 3CJIA 3EHKA 4XQ4A 5F5AA 2YBPA 4DMIA 1YEWA 4NN0A 2ZHNA 4YRDA 2QCSB 3GCWA 2DVFA 1SZBA 1PX3A 2ARAA 3DYOA 3ZXFA 3IDEA 1SLIA 1BKZA 1X36A 4QHZA 2HWE2 3ZMOA 1K5MA 5I0UA 3SCHA 1H8TB 2WZPP 4D6QA 2YFZA 4EWAA 3N7KA 3KGZA 4IL7A 5E88A 4D6SA 5J37A 4D3WA 1YCIA 3QH7A 4LUKA 4XUOA 5BPXA 5A1FA 1ZZ6A 4GMP1 1S4CA 4UXAA 3WCRA 3PTYA 5JZGC 2JDPA 4JDOA 1UPSA 1BMV1 2HWD2 5FO9B 1V9U3 4BXSV 1OLMA 1RMU1 4H7MA 3O1PA 4A4AA 3ACIA 3BCWA 4JDNA 1NZIA 1HJFA 5DZEA 3SH5A 4YZ4A 5F3CA 4PQ9A 4CXWA 3PL0A 1QJU3 4BQ2A 1LU2A 4CPBD 3BKZA 3VDAA 1CPMA 5D8AA 1ZX5A 4LLFA 3VHRA 1ZA4A 1W8ZA 1TQ5A 2OYZA 1RIRA 1VJ2A 2VMGA 4MHRA 3IDCB 2JE7A 1JHJA 1YLLA 5DQ0A 1UYPA 5LK5A 1AR82 1AR62 1RUD2 2VAUA 3POJA 5F32A 4XFIA 2A6WA 2WL1A 2XMLA 4KBBA 5FZFA 5HCAA 4P9XA 2QQIA 2D3PA 3MICA 4PT6A 4QXKA 5I91A 2HLEA 2Y6HA 4X8NA 4BQ3A 5BNPC 1UZWA 5JDBA 2W1QA 3WQ1A 1DQ1A 1N47A 3U07A 4NHMA 4QDSA 1LU1A 1VIWB 1OF3A 3VZMA 5L9RA 3CBNA 2JKBA 2DUQA 4Z8BA 1GYKA 1W6MA 4LEJA 1JTZX 5FY4A 2ZOEB 4Q4Y1 5ABJA 4LE4A 3APBA 1ACCA 2WYSA 4M3CA 4UBHA 4FT8A 1CAWA 2W2IA 1I5ZA 2VUDA 5AC93 1WA4A 3B9CA 1FMD3 1JMUB 1S1AA 1GOHA 4LBJA 4M4PA 3O7OA 3ILRA 2VOVA 1R1A2 4TN7A 3USSA 3MBWA 4P02B 2PMWB 3AP6A 1GSLA 1W6PB 2VUAA 4JC1A 3E97A 5IFPA 1KFUL 2AGSA 2FCVA 4YWAA 3SHRA 3VBUA 4JX0A 2A3XA 3F95A 3HNYM 2OPKA 2ETEA 1QXJA 1K45A 2RS32 1GQHA 1POQA 2JDAA 1ZYBA 2XVKA 5F2SA 1UQXA 4HN1A 2JB8A 4EN9B 4OHVA 3ZXKA 3POWA 2VQ0A 4Y5Z0 4ITCA 5JPNB 4PI0A 4NRQA 3ZFGA 1OH4A 2YZ4A 2DCTA 1MPXA 2IC1A 1JOJA 4A6SA 4E2GA 5LCWL 4Y5SA 3ZFFB 3RGBA 2F4LA 4CSWA 3Q8EA 3HR9A 3KVBA 1YQCA 3ENRA 4AR2A 1EAH2 4PDWB 4OI4A 4OI1A 4A41A 4XACA 1JYNA 1SFPA 2VZVA 2HYKA 4CDWA 1D2SA 2C26A 3IZOA 3WW1A 3MUY1 4Q4W3 4LKEA 2NN8A 4JQRA 2XBO2 4Q4Y3 4DXSA 4CU9A 3FHQA 4XTPA 2MNGA 4MXWA 4Q0UA 1G7YA 5FYHA 3KVAA 3CHXA 1HRI1 2E7QA 4FP3A 3ZOIA 1ZVFA 4GB31 3OB8A 3KQRA 4L2NA 2EIEA 3OUIA 3ZR5A 1Q43A 2RJ2A 5GALA 2K9ZA 2ORZA 3BVCA 3GBGA 2VO5A 1XYNA 4EV0A 3CKHA 2VQUA 2DVAA 5C4WB 3HT1A 4DZGA 3TYJA 1SFYA 1J3QA 2QQOA 1PK6C 3L2YA 5JSPA 4LKFA 4SBVA 1XQNA 2PAKA 2BGPA 1A3KA 2R7EB 2H0VA 2ZX4A 2P1BA 5LY2A 3SMHA 1YFXA 1OXCA 2ID4A 4XE9A 1BQPA 3R4SA 3L2HA 4H14A 4H2AA 5FIXA 5HXVA 5IATA 4MGYE 3W21A 4G3YC 3CU7A 5FY5A 1POV0 4IE0A 1WWYA 2EVXA 1PM4A 2JDUA 4Q2FA 3O1OA 1MEC2 2J1VA 4BOWA 2RHPA 1CAUA 4I3GA 3TAYA 3HBZA 2VMCA 3O0WA 3FHIB 5ERLA 1Q3EA 2R32A 5IW0A 4A2UA 4BXFA 4DRVA 4P5HA 4MGIE 4O61A 4QXBA 1SPPA 2RVAA 1TMF1 2W1WA 5FFOC 1NCRA 1ZZBA 2C9AA 4K1ZA 4UOJA 4Y26A 5F3GA 2Q8DA 3FC0A 3M1HA 3OY8A 2UURA 5IK5A 2EAAA 1QH6A 1WW6A 2WNVB 3VBOA 1S2EA 3CJIC 2HWB3 1RXFA 1VMHA 1VAMA 3GXUA 4YVSB 5FK8A 3EYPA 3AFKA 2OT7A 3D5OA 3MIGA 3ZSJA 4YZ5A 4TLFA 2Z2SB 1UOJA 3FE5A 1QU0A 4QDRA 2ZJCA 4WM7B 2IXCA 1TME2 4U36A 3CO2A 3T2PA 1HRI3 5FZIA 1ZA7A 1XPWA 4JHTA 3RQ0A 1ND2B 1K5MC 1XB9A 2HWF2 2LS6A 3QBQA 2UYBA 2W1SA 5T5LA 3H0OA 2ORXA 2EIBA 4FQZA 4M3CE 4A3XA 1BCXA 5EJZB 1X82A 3ZSKA 1APNA 3E1F1 3G6JB 2VVDA 3N9QA 3WNMA 1LB2A 1QJX2 1KXGA 4FSJA 3BOPA 3WDUA 5CISA 4AHYA 1S0JA 3V0BB 2Y8KA 3MDPA 2AACA 3SISA 1PVXA 1QNYA 1UF2C 4LQRA 1O6UA 5FUNA 3UV9A 4ES8A 3KV5A 4AQ2A 3NWKA 4QU1A 3RDIA 5A7NA 3SXWA 2HWD1 5IVEA 4Q0PA 1DF0A 1SLAA 1XNCA 1S55A 3CQOA 1JZ2A 4IV3B 1IPSA 3LIGA 4GKXA 2LTNA 5D8AC 5LRSA 2VZ1A 1RVF1 3ZSLA 3DKQA 3GJBA 4EN7B 5F5IA 5T54A 1TMF3 3LZZA 2D5HA 1UX6A 3K46A 4IEQA 3NJXA 1W8OA 5DUXA 1DLLA 4CUGA 4GWIA 1AR81 3HEIA 1KGYA 1RUD1 4LO8A 4GWNA 1VALA 1OQDA 4HVOA 2EICA 4W50A 4WV8A 4CXYA 3B00A 3LSDA 4AI3A 2AH2A 3K4DA 2C1FA 2ZACA 4XFHA 3VBHB 1L7RA 1S0CA 2A3YA 2ZXQA 1WZXA 3CZUA 3GNEA 3U14A 2UWAA 4G4FA 4BE3A 5GM0A 1NUKA 1G9FA 4YM0A 2WWUA 3J7MA 2HWE3 3WG4A 5ABJC 5BNOA 5HV0A 5FKBA 2VTXJ 4GQ7A 4K1YA 2ZGSA 4FFIA 1BVVA 4Q8KA 2GC0A 3O5SA 2ZAAA 3AP4A 5D21A 5GZEA 2PHDA 5FYSA 3V64A 4LO4B 2D5FA 1XNTA 3BTXA 1OVSA 4Y1ZA 1YJLA 3WUDA 1R1A1 1IS6A 5CVRA 3ZKUA 3WR0A 3DPRB 4J6GA 3ROUA 2OVUA 3E6DA 3MEPA 3LF7A 1GWLA 1Z78A 4A7ZA 3AXEA 1HN1A 1YI7A 3NVCA 5JAXA 3AJZA 4EWEA 1SBFA 2RS31 3KGLA 1O4TA 4XOGA 4YVWB 4F8AA 5BUVA 2BFUL 3H7JA 3NL1A 4OUEA 3FLPA 5T3NA 1YXWA 3VBFB 1LGNA 4CEYB 4XC9A 1V6NA 3ZFGC 1S0EA 1UNBA 4BM8A 4CDUA 2VW1A 4CYDA 5ACA3 2PAMA 2ZGPA 4JRLA 3B02A 1YWKA 3AZXA 2DUPA 1AR83 1AR63 2Y6KA 4IEXA 1V0AA 2A73B 3POIA 1BHGA 1WCDJ 3WDVA 4BYYA 4XQDA 1GFF2 3KLSA 4KBZA 5A3NA 5C3RA 1JU3A 1EAH1 2X5IC 2HYXA 2RM22 1EPWA 1KJLA 1OHFA 2VGDA 2TUNA 3J8F2 4NHKA 1F4HA 4CDWC 1QXPA 1F2NA 5IVYA 3I49A 1BXHA 3GF6A 3INAA 1W2AX 1LAJA 5CFDA 4BLJA 4DB5A 1UYZA 5A7SA 3SNMA 3CDZB 4Y22B 4Z2AA 1SG3A 2EIGA 2XBO1 2VUJA 4KQ7A 2ENRA 2CAUA 2XHKA 2Y38A 2UY9A 1X8MA 2XJUA 4JGZB 4ONUA 4AHZA 2QQPA 4QX7A 4AFCA 1RTVA 1XE8A 2RR12 1Y9GA 4LULA 3WF1A 2XVLA 1GLHA 5KHHA 4H3WA 2EIDA 3UK9A 2CDOA 1QJY1 3A21A 5E6HA 2ZGMA 2WT2A 2G1MA 1W2NA 3WNXA 4AGGA 1LHWA 3D82A 4AVBA 2BPA2 3HJRA 2V72A 4KGQA 4JGYC 1LEMA 2XOMA 2ZEXA 1UYXA 1NOVA 3LD8A 3OGSA 4HETA 3X29B 4XUPA 2DUOA 4Q0VA 1NLSA 5IK4A 4XCAA 3VD5A 1UOBA 1GICA 1LKNA 1PM7A 4BK4A 4B8EA 1LHOA 2O1QA 1JI6A 2R043 3V0AA 1XSQA 3RSJA 4JKLA 4LKSA 4LA2A 4N53A 4R4XA 4YW2A 2Q4SA 1SBDA 2RV9A 3WF0A 3ZXLA 4AEDC 1DDLA 3L9JT 3JD73 5IVCA 1UKRA 1SEFA 2BU9A 1NCRC 5FZHA 1EAH3 3MV11 4XJ8A 4YW3A 3ZXAC 2LM3A 3U10A 1HW5A 2D98A 3IDAA 2XQRA 3K2OA 2QZ3A 3VDDC 3VBOC 1WBLA 3AX4A 5FPAA 2OZJA 4IERA 3VHPA 2WNUB 3DEMA 1RUE2 4BJ0A 2BVBA 1QNWA 2XJTA 2X09A 5LA1A 3FWEA 1IPJA 1QKQA 2XL9A 4YG6A 5LBCA 3USUA 3PIJA 3NO8A 5A32B 2GC1A 2PA7A 3FX3A 3POYA 4KNCA 1A78A 3VKFC 1TME1 2WA4A 3CLPA 3HN1A 5JSRA 3J4UH 2OKXA 4AI2A 2ATFA 4HKOA 3UKNA 2JG8B 2HWF1 3GZUC 4MOAA 4Z92B 4QPIA 3HPNA 2P6HA 3LFIA 5C71A 1CAXA 3PHMA 4P9GA 5CFCB 3AKPA 1QJX1 2K46A 5JOWA 2OQ7A 3RFRA 2I74A 2YG0A 1QJEA 4IV1A 2CYFA 4XFGA 1RUJ3 3N3HA 4JKMA 1NQJA 4CCEA 5BNNA 3JCIA 1WMDA 4RSUA 1HN0A 1GOFA 3MIBA 5EJ3A 3KV9A 1PO22 1OUXA 4K20A 4OHXA 1MEC3 3KHCA 1DYKA 5CNAA 2B8MA 2I2SA 1H0BA 2K2SA 3I2HA 1BZWA 1DBNA 3KD4A 3RNSA 1T6BX 3HVDA 5DG1A 5M0TA 4N9IA 3RG0A 4CEWA 3MUZ1 2W95A 2XKOA 3OYWA 2ZGNA 1NE6A 3AM2A 2XUMA 3AP9A 2WS91 1YIPA 1ULOA 1IOAA 4XW3A 4E4ZA 4FPJA 4URAA 5BNQA 4B1MA 3BYWA 4S2GA 1AHSA 5ANQA 3B7MA 3WNOA 1QY4A 3C8XA 4LR4A 5HCBA 3Q9OA 3ZFEA 1V6IA 1H6YA 2JDYA 5BNOC 2HWF3 3LA7A 3RZKA 3UGFA 1ZZ9A 2BRTA 4XUNA 1HRV2 3NNJA 2VZPA 3K75B 2DDUA 3N9LA 2A71A 3TNPB 1JYWA 2DVGA 2LALA 3KCCA 5IVVA 2FQPA 4YZ2A 1VPHA 1QJX3 1GQPA 3OD4A 3PIGA 1ZZ8A 2C9KA 2QNKA 3RZHA 3H1YA 1B35B 1COV2 2YU1A 4QQPA 2FZ2A 1N3QA 2E31A 1B35C 2EA7A 3D0SA 1CR7A 2VUCA 5C9AA 4FPLA 4BH9A 4A42A 4CUAA 5EP9A 1HB1A 4KG0A 3M70A 4PBPA 2Z79A 4CP2A 5GZDA 4CDXB 5FO8B 1LCLA 1E5HA 4P9JA 4AI0A 4AEMA 1RITA 4CDXC 1ENXA 5KBFA 4AGVA 4CDUC 3VGIA 4N43A 3MF6A 5H9PA 2P3KA 1SHWB 3M2MA 2DURA 3M3EA 4BMEA 2E7TA 2VCCA 4Y1UA 1SDDB 5IJRA 4Z82A 4ASMB 1GV9A 4FFHA 4YGDA 4DINB 1RMU2 4QPGA 4C0BA 2JDZA 3FHAA 5IAXA 2WWJA 3Q8BA 4WVZA 1GZ9A 2ERFA 5FZCA 2QJVA 2WFF1 4C90A 2Y6GA 4IE6A 3MIEA 1AL22 1GUIA 1RJ8A 1HV0A 1HJGA 1H9PA 1WKYA 3P6BA 4L97A 2P2KA 4WM8C 5F3EA 4G9SB 4FTBA 1W05A 1H8TA 2ZMKA 3PJQA 4YNIA 2EXIA 1CPNA 4XMIA 3MIHA 5A7WB 1TG7A 5FP3A 3LFMA 2EAKA 1JW6A 2W08A 5FPZA 2DCZA 4XDPA 1OOPA 2D6KA 2RR11 1C8M2 3AL5A 5F6KA 4AWDA 1W9WA 4TLGA 1CONA 1I5PA 1A8MA 3WDXA 1DGRN 1AXKA 4R9BA 3RI9A 1VBD2 1NQDA 2VTXA 4RYDA 2AENA 3GBFA 1RUC2 4CP0A 4NHLA 3A0NA 3WF2A 4QGNA 4PF5A 1J59A 3HQRA 4ZZ5A 1UXXX 1JH5A 1BEV1 2WSUA 3VBRA 4BWOA 3SCGA 4JV4A 3DECA 3KT4A 2CL2A 1GMMA 1WMEA 3AFGA 3ABZA 4N53C 1PNFA 4XIKA 1NA1B 3CJXA 4CCCA 2GSYA 1X8EA 2V09A 1ENRA 2WO7A 4PBOA 3LDKA 2QQUA 2KXLA 3BTYA 1NCQA 4OHYA 4B7KA 2C0ZA 2BUKA 3E5QA 4CXXA 1VBC2 4UT5A 4IE5A 1I3HA 2VVFA 1PNGA 4QD2A 2RM23 5FZOA 3J8F3 3PUHA 1OA4A 4P08A 4B4RA 4BCUA 5EZWA 3BU7A 1Q8PA 1I6XA 3HQUA 4J1WA 4GJZA 3WX5A 4CPBA 1VBB2 1Y43B 4BIFA 5HPOA 1RUE1 4E8CA 5FQ0A 4JHZA 3VD7A 1UX7A 2PLV1 4R9AA 1DZTA 1OPMA 3N7JA 1H2KA 1RHI1 5FBJA 3GALA 3P3PA 4XJAA 5DZGA 2RR13 3UYJA 3PMSA 4FPOB 1GNYA 5DUVA 1WMXA 2DVDA 3C7OA 2YBSA 4YG0A 1W9TA 3H50A 4W65A 4JTOA 2BYVE 2Q1ZB 2IVJA 2WA3A 3DCQA 3VLBB 5GZGA 3O1VA 4OHWA 3PNAA 3H8OA 2PAEA 5IWFA 5C3OA 1G9CA 4IV1C 3EO6A 4F83A 5FXXA 1F8VA 5FZLA 1MS8A 3O1RA 5B4XA 1KFXL 4GB32 5A6ZA 1MS9A 4KI5M 1D4M2 2Q1MA 2BZDA 3OPWA 4OZXA 5A70A 5C8CA 1PO21 4MH0E 3TOJA 1PMHX 4BQXA 4KU7A 4KL1A 5C5TA 1MS0A 2P37A 2ZGTA 1POV1 4N7UA 1UW8A 1OD3A 2QFEA 1DYPA 1UCXA 3GHNA 3O14A 1VB2A 4PDWA 4UF0A 4ZU4A 2NYYA 3I2OA 3GZTB 2Y0IA 5SV8A 1PZ8A 4LOTA 4V1PA 5A1LA 3EMRA 2YROA 4YFWA 1Y4WA 4C0HA 1Q8QA 3DL3A 2UWCA 4I01A 3ZMNA 2YGMA 1RUE3 4XZPA 1S0DA 2G4IA 1Y9MA 3VB9A 4CDQA 3U0ZA 4PJYA 3I2GA 1T6GC 4OMDA 4I0WB 4O7XA 3AYEA 1GWMA 3Q8FA 3MW4A 3VBSB 3ZFEC 1YHFA 3NMBA 3NRUA 1ONAA 4CCMA 4QU2A 3T2TA 2P3JA 5LWBA 1VMFA 4QXHA 3OOXA 3PUSA 4Y20B 2ILMA 4QX8A 2Y6FA 3AMQA 4XDQA 1PO11 1HRV1 2WQ8A 2BJSA 4QGLA 5F5CA 3C7FA 5FY9A 5D2AA 3WHTA 3U75A 1JZ3A 3WDWA 1PGW2 3VL9A 3MIFA 4DEVA 1OQEA 1TZOA 2ZZJA 4GH4A 3N9OA 2CGOA 5C9AC 3S7IA 5JMOA 3GJAA 1COV1 3ZO0B 2EXHA 3I3MA 3ZVXA 2VMHA 1O3TA 5JXIA 3LE0A 4RHV3 2VOTA 1EP0A 1IS4A 1I9RA 3N9MA 4OMCA 4ORFA 3CZJA 3THCA 5KWRA 2TNFA 2ZHKA 5FKCA 2IXJA 2PHWA 3LDRA 1IKPA 4N43C 1Q5OA 4UFIA 5F5QA 1OURA 3DYMA 5FZMA 1ENQA 3RYRA 1ODNA 1C1FA 1W6NB 4A45A 2VMFA 5HV4A 1CX4A 5JZGB 5GJ6A 1EPZA 3WVJA 4AL9A 1AX2A 4QPGC 5L7OB 3V65A 3LGRA 4K21A 5FWEA 4WVMB 4YVSA 4FQ4A 5L7OC 3ZN6A 4AHXA 1HXS3 2W94A 2W47A 4LBLA 5FZ9A 2XHNA 3W5MA 3NNGA 3R0RA 4W6YA 4WM7A 1NY72 4CCOA 4BISA 1RVF2 4CUCA 5E1RA 1FAYA 4QX3A 3ZXGA 1GP5A 3OTFA 1VBA2 4MG2A 2WZEA 4AE2A 1AL21 4NR1A 3I7DA 3TBDA 4AVCA 1W99A 3BUCA 1HRV3 4IUGA 5F9TA 1QH7A 1W6QA 4LTAA 4DPNA 4XETA 3FBYA 1OOPC 1LHNA 4EZHA 2VBPA 4XFFA 2XR4A 4WBBA 1NLQA 1XU1A 5K0UA 5BNPB 1D7PM 4TSVA 4NPLA 3B94A 1COV3 1C8M1 5F3IA 3ES1A 3I97A 2WYFA 4XUQA 2P6CA 5I8SA 1SMVA 3FFZA 1KDKA 4PLMA 3O1TA 1VBD1 2UYAA 4NRMA 4WVWA 2YV8A 1RUC1 3PVNA 5FK7A 1FI2A 4FXGB 4HPKB 3VBRC 2VQAA 5A3OA 4CCDA 4COWA 5CG9A 1DG6A 1HQLA 3KM5A 5FLIA 1P8JA 4GMP3 4ATEA 5FTTC 1K5JA 1EUUA 1HLCA 3K4ZA 3ACGA 1DU3D 4IESA 2HEYF 3FL7A 2E6VA 4NIHA 1S0GA 1NCQC 2IXHA 5LY1A 1OH3A 1RMU3 1LOFA 5EXOA 2JJ6A 1US3A 5CYYA 5T5OA 3ZIWA 5K8SA 3LWCA 3R4UA 1E57A 3WG1A 3RJRA 3WP4A 1CX1A 3JB4C 5FOBB 4XF9A 4XIOA 1VBC1 4QX1A 3ALQA 4OI0A 1OKOA 1FNZA 5KXEA 1S2KA 2WJSA 2YPJA 1E5IA 1AL23 1IG3A 2PYTA 4MGSA 3E5UA 4RQPA 1LHVA 4YW4A 3ZPYA 4IEYA 1LEDA 3M3IA 3RWKX 5CADA 1VBB1 1H4HA 1KRIA 4Y5TA 4XURA 2QKDA 2GALA 2RS12 1BLZA 1QGLA 1W9YA 1WCSA 2WZR2 3AZZA 2YC0A 3I4IA 1JODA 3K77A 5ANNA 3GYDA 3JQXA 1JYCA 2O8QA 2ZABA 1YQ6A 1WMFA 3LEGA 4V2VA 1C8M3 3ZYIB 2PXJA 4EROA 1FOD2 4AVSA 1LECA 1YI9A 4TYSA 2VZOA 4NE9A 1SQ4A 3U4XA 1VBD3 5T55A 1U0AA 1GP4A 1UZYA 1RUC3 3U1XA 4PCRA 3C3VA 4GD4A 2BNNA 4LIUA 1DCSA 4XFCA 1QOTA 2Z4FA 2ZBJA 4NPRA 3EJKA 3OGGA 4XUTA 1RUF2 3IPVB 5FYTA 3RI8A 1LOGA 2XDVA 4YSFA
chains in the Genus database with same CATH topology
2ZHLA 4ISRA 3M3OA 1QJY2 1DGRA 5C8CC 3AYDA 4MUVA 1D4M1 1NXMA 4Q29A 1UU4A 4JTNA 1S0IA 3GBWA 1UN1A 5EWSA 1PK6B 2A3WA 3AK0A 2ZX3A 3RS6A 5TSWA 1VBC3 1TEIA 3JUUA 1Y7BA 2HEVF 2JECA 3WP5A 1MS5A 1RUH1 4CDQC 1JUHA 2GAUA 4Y1XA 3AMNA 2VECA 4HKWA 1CIWA 3MPPG 1TNFA 4JGZA 1AYM2 4IETA 4M0NA 1QQP2 1ND3C 5A3LA 3AZVA 4OHZA 2ZKLA 3WOGA 3WZ1A 1JBCA 1SCSA 1VP6A 1WLDA 3H9AA 1ULDA 1CVNA 3I59B 4LBNA 3CJIB 5LEJA 4GH4C 4XFBA 2WT1A 2XJPA 1PGW1 2R072 2UWBA 1MZ5A 3WG3A 2VG9A 1EY2A 4Q1RA 1LRHA 1K5MB 4GB33 2ZZQA 4FP2A 1J3PA 2RJLA 1OA2A 3E6CC 3PVBB 4FOVA 1G8WA 4ISQA 1CN1A 5CIRA 1V00A 2RS52 3AB0A 3NKGA 1JUIA 3PMEA 1ZBA1 3LCPA 1NYWA 5JI7A 3OJBA 5AFEA 3ACLA 4JAAA 4DNYA 5D8AB 1F5JA 3MF9A 1QWRA 1LOAA 2XLAA 4S2HA 4AYUA 1AF9A 1NY71 3GZAA 3VHNA 2ZX2A 2RE9A 1VBA1 3A0KA 1KQRA 3VL8A 3LOBA 5IK7A 1FPN2 2ZMNA 5J36A 1FV3A 2WS92 4RS5A 1JHNA 5JLVA 1N3PA 3M8LA 5K0UC 1MS3A 1CAVA 1WLCA 4Q0QA 2QDNA 4F7ZA 1CJPA 4CRQA 1O4YA 4AEJA 1O3QA 3IT8A 1MS1A 4W6XA 1W6MB 3VKMA 2YYOA 5EYXA 2GNMA 2VU9A 1GZWA 5H9RA 4ES9A 5ABJB 3ZX7A 4M3CB 3CL1A 3MGUA 1CAWB 3CEWA 3DKWA 1SDWA 2WLPA 3RYPA 3ILFA 3POSA 1O3RA 3MI8A 2NQYA 1H30A 5EFUA 1HQWA 4IXLA 3ZSMA 2GH2A 1H2MA 4GIQA 1O91A 5DUWA 1LOFC 4XILA 2HWD3 3VBUC 3VHOA 2E9QA 3UJQA 4MZUA 1RVF3 2VNRA 3ES4A 4RQPC 3WLUA 3BOWA 2YHJA 1VBA3 1LOBA 3RJ2X 2SBAA 3ZFGB 1PGL2 2R0HA 4Q4X2 3G7DA 3HMYA 3WW2A 1RJ7A 1AJKA 2IWGB 2RS11 1RUD3 4QQOA 2WZR1 1N3OA 5GZCA 1Y9QA 2WT0A 2JICA 2X5IB 4QX5A 5FDBA 3OGJA 4FPFA 2WFF2 3RPQA 5DXDA 4CDWB 1FATA 3LKJA 5GLTA 4LA3A 1FOD1 3C2UA 1AXZA 2D93A 3NW4A 3PJYA 1AVBA 4QHBA 1V6KA 3IMNA 4MXWB 5J96B 2AUYA 3NV1A 4URTA 1S2BA 1D2QA 1RUF1 4FVVA 4AQSA 4XTMA 3ST7A 1C4RA 1U5XA 2XKPA 2ZCWA 4C1XA 1YYNA 2TEPA 4JGYB 4M00A 4Y4YA 1R1A3 4R8HA 4O9EA 2PHTA 3VZNA 2CV6A 2PHXA 3ECQA 2B7YA 2R6QA 2ZGQA 4YW5A 1HKDA 2DCJA 2RS33 1BEV2 4E4DX 4MX3A 1LGCA 3PVOA 5H9QA 2V73A 3NAPA 1VLNA 1CAUB 4AQTA 2ZGRA 4FPCA 3DGTA 1YNAA 2WWSA 1XYOA 2EXKA 4AEDB 2RS13 1OFSA 4PLOA 4AFDA 2WZR3 3I2DA 1EYBA 2YY1A 3FFQA 4LHLA 4LBQA 4AVAA 1AYM1 3QOPA 1NCRB 5FOJB 1QQP1 2A6ZA 3OY8B 1YJKA 4XJ9A 3VDDB 1FOD3 4GWMA 3VBOB 2BNOA 4UW3A 3MFAA 2ZX1A 3AKSA 3M7AA 2R062 4HVRA 5HI0A 5F6LB 1KS4A 4AVVA 1ZM1A 1PVC2 2PLV2 2XBO3 2R071 5E8AA 1RHI2 2XWJB 4RD7A 5SV5A 1QJY3 2A6YA 4NWVA 4XJUA 4DFSA 1C57A 5FCCA 4X6RB 3TB0A 2AREA 5DDJ2 4YM3A 1LENA 1H9WA 2XLFA 1FNYA 4HN0A 3WCSA 4RR3A 3I54A 4A7YA 2WLQA 4B3NA 5C6CA 1X50A 2RS51 1W2UA 1W39A 2R49A 4HSJA 1GANA 3UL2A 1OPOA 5JPMB 1SLBA 2QVSB 5J48A 1WD3A 2X53S 1AYM3 3D0JA 1AR92 4LHKA 5I93A 2CTVA 5LEKA 2OUHA 1ALYA 1H1IA 3ZN4A 5A33A 1HQNA 4RS5C 1C5IA 1FPN1 4AGRA 4Z1VA 2NPIA 4COVA 4FOQA 4D94A 4ZXKA 2ET7A 3AXDA 3LAGA 4LO6B 5JMCA 3JBG2 3UJOA 1HIXA 4D7TA 2B9UA 3FBMA 4FPYA 2R073 4QT6A 5BY5A 1O7FA 2BWAA 2OIIA 1TME3 1S0FA 2AYHA 5BNOB 1XNBA 4FPGA 1OLQA 1QJZA 1MQTA 5CA6A 3THPA 3QD6A 3S7EA 3WD5A 1PO12 1HV1A 2IXIA 4YG3A 3B5LB 1YFYA 3WXPA 4BHPA 4LNVA 4D69A 2JG9A 5A3MA 4BZ4A 2VMIA 1F31A 1WUVA 2C5DA 1QJU2 1UD1A 1DZQA 4XJZA 4META 2FMDA 5CU1A 2QE3A 1D4VB 4CDUB 4P9WA 3WG2A 2XH6A 3H8UA 1UPIA 4N9HA 2CGNA 5I0TA 1PGL1 4IEUA 4EN0A 4U2AA 4Q4X1 1Q8OA 3TN92 1CD3G 1FPN3 2PTMA 4LBQD 1OD5A 3VZLA 2DWRA 2WS93 2A6XA 4MLOA 4QM9A 1RINA 4XF0A 5AVPA 1J3RA 4ZU7A 4X8PA 1UZZA 1AR72 4DS0A 1QDCA 1MZEA 4WM8B 2KM2A 3SCFA 1G6NA 5CFDC 1OKQA 1RUG2 1AUYA 2CY6A 2VXRA 2BNMA 5E16A 5AC92 1MACA 1FMD2 2I07B 2RMU2 1WBFA 5GLVA 2JE9A 4IEZA 2H6BA 1UIJA 3M3QA 3A4UA 4XXPA 1PIV2 3T1MA 4UW5A 2N7GA 2DU1A 4XHXA 2NZ9A 2JEMA 4BLIA 2AZ5A 1CGPA 1ULGA 2VOKA 4QQ2A 3HQXA 4C91A 5KC6A 2XPJA 2ES3A 4XF1A 4COYA 2D6PA 4DOUA 4HVQA 3ZXJA 2DFCA 2VNGA 5KXBA 3PLQA 3V0AB 3R4DB 1V6MA 3NAPC 4FCAA 3S6PA 4N53B 1YUDA 1H1MA 2W68A 1IGOA 3WT3A 4M01A 5FBZA 1VRH2 3ZYPA 3S30A 4BA6A 4AEKA 3IDBB 4EN6B 3IBMA 4FOWA 4FTEA 3WP3A 2UY8A 3AP5A 4Q4W2 1JN2P 4BMBA 3M3CA 2WFF3 2XL7A 1I1EA 1G86A 1FX5A 3RMYA 1YRZA 3IWZA 3PVEA 3USUB 2R061 3RWNA 3WUCA 2JXAA 4NVPA 1PVC1 2KA3A 4ZU5A 3J26N 2W39A 4OUSA 2EXJA 1DQ5A 2ZTNA 3MW3A 5I0SA 4MV2A 1ZZCA 3JB8A 3QLQA 2GNTA 1X7NA 5KXDA 2GH8A 1CAXB 4QPIC 5C8WA 1W6PA 1J1LA 1M06G 5DDJ1 4RR3C 1W6OB 4IV1B 4LO5B 3H7YA 2WQ4A 3QH6A 5BNNC 1BEV3 1DZRA 2BEOA 3QACA 2PHFA 1KJRA 2VULA 2D3RA 4OLLA 1DQ0A 2CWMA 3VKNA 3ZFFA 1IQAA 1ZRCA 1AR91 1VR3A 5CB7A 2VH9A 2XJVA 4K7JA 4CEWC 2VW2A 1LGBA 1ZNPA 4XBNA 5I0RA 2BTVC 2HWB2 4CZSA 1B09A 4XXAA 1RUH2 4XMAA 5FO7B 2R063 4HSLA 1ASJ2 2HWC2 3N36A 1Y3TA 3MLLA 3JBG1 1KS5A 1PVC3 2GU9A 2PLV3 1ZBE2 3IPVA 3KCXA 3ZFEB 1UMZA 3H3ZA 4L9BA 1RHI3 5IT6A 3D6EA 1MQTC 2E51A 3W9AA 1BK1A 3W59A 1LULA 4O9GA 5JIAA 2PFWA 2ZGUA 2A75A 5C4WA 4FO9A 2ARXA 1D0HA 4HK9A 4BIOA 2B39A 2YDEA 3LA2A 1EV12 1HX6A 4K9SA 4F3JA 4OI0A 3LB9A 2JG9C 1LR5A 1C8NA 4OVEA 5C9AB 1V9U1 3K48A 3WHUA 1UU5A 2ZGLA 3J9SA 4YYOA 1QJU1 2E53A 1PO23 1NE4A 3LSEA 3MZHA 4N43B 1Q56A 1MZ6A 1POV3 4Y1YA 2B46X 4Q1PA 3AJYA 3E5XA 2R1BA 4QMAA 4HKLA 1DQ4A 2E7AA 4QPGB 4JRAA 5FRAA 1ZBA2 2GNBA 1YIFA 3TN91 2WNVA 4MGZE 3N7MA 5KHGA 3JBG3 4P9YA 3WV6A 3T1LA 1H1AA 1AR71 2VNOA 4GA9A 5F1RA 3AZWA 4E4SA 1ND2A 2DTWA 1REEA 1H8TC 4AK3A 3CF6E 1RUG1 3FZ3A 5J98B 5BV6A 1PO13 2P34A 2ZS6B 2FMYA 5AC91 1OOPB 4COZA 1FMD1 2BFUS 2V5YA 4GALA 1UAIA 2D6LX 2RMU1 3V0BA 3ZSEA 4I30A 3IIAA 4KG8A 1VB4A 1C5HA 3FUOA 1DQ6A 1PIV1 5EV7A 2OA2A 5GLUA 1GKBA 3KSCA 1BBT2 2DYCA 4I02A 2BGCA 1KDMA 1XE7A 2WINB 1O3SA 4IV3A 3VBRB 5ACA2 4R9CA 1ZZ7A 1GBGA 3THTA 5T5PA 1BYHA 2CWSA 4N90A 3TN93 3FUQA 5I8TA 1NCQB 1VRH1 1IHMA 1LHUA 1RUI2 5CBLA 4MSVA 1W0OA 3BALA 4HANA 2FBEA 3B69A 1AR73 4INDA 4Q4W1 1LOCA 3VBHA 1REDA 2PN5A 5FMOS 5FQ0B 1ULFA 1NLRA 1RUG3 4RGGA 4MXVA 3MIDA 3EXUA 2DCKA 2BBVA 1DQ2A 2ZAHA 2YXSA 3WP6A 2RMU3 2Q8OA 5L36A 5AFBA 4L92A 1PIV3 3LA3A 3NV4A 2PHLA 3DPRA 4DRRA 4B7EA 4FXKB 1X33A 4LUMA 3ZYGA 5D1IA 4AVTA 2R042 4RA0A 2VOXA 3OD0A 4YVWA 3OF1A 2I45A 5C8CB 3VBFA 4AFAA 4CEYA 3IN9A 3JD72 3AYCA 3OCPA 4LT5A 1VRH3 3BTAA 3ZFFC 4FPEA 2GMEA 3SH3A 4PDWC 1XNKA 4B4PA 3B9IA 2JD4A 2X5IA 4AF9A 4KU8A 4SLIA 5FREA 4GULA 2HWB1 4Z2WA 1ZREA 4CDQB 2K0GA 2ZHMA 3QCWA 3BIWE 1XYPA 4AG4A 2XJRA 1VBB3 4HK8A 2XWBB 1ASJ1 1A8DA 2HWC1 3SH4A 2YMZA 4FPKA 4R9DA 4Y22A 4Q8LA 4KGGA 1ND3B 2R30A 4PIXA 1ZBE1 2YUEA 2ZGOA 1H2LA 4DXZA 4YM1A 5BYNA 4JGYA 2GMPA 1OFNA 4Q26A 3OBTA 1QMJA 1GNZA 5C4WC 4IEVA 1Z7S2 2D40A 4GH4B 1RUJ2 2XG3A 1KITA 3AYAA 3KZ4C 3R05A 4XFAA 3RZZA 1REFA 4HFSA 1FXZA 1EV11 1AYN2 2X8KA 1OSGA 3DF0A 4JCKA 1XU2A 1UL9A 2GC2A 1TE1B 3N7LA 4H55A 5H9SA 2H6CA 2DU0A 1C1LA 2WKKA 4P9LA 1D4M3 4AEDA 4Y24A 3KT1A 1ENSA 1F5FA 1QOOA 1WLTA 3P3NA 2B5HA 4EWDA 1WW4A 5K9YA 1R1ZA 3VDDA 1WLWA 2ZGKA 5FPXA 2JX9A 2WNVC 1RUNA 5JOXA 3IM0A 4ATFA 3ZN6B 4FAGA 1RUH3 3CNAA 4YVSC 2WNUA 2DTYA 4E9KA 2B42B 2Z5WA 4IEPA 1ASJ3 2NP0A 2HWC3 4RFT0 4WM7C 5GZFA 5CAZA 1MVQA 1ZBE3 5A32A 3E6BA 1ND2C 3N35A 4A7KA 2HWE1 4K40A 4W6WA 4FAHA 1W6QB 2A70A 2RJKA 2JG8A 1BJQA 4XEZA 3TNQA 4FOYA 2A5ZA 4D7SA 1PMIA 4OFGA 4QM8A 3AMHA 5K0UB 5CFCA 1EV13 1PZ9A 4JDMA 2MEV2 1R092 3NKTA 2WQZC 3ZDSA 2OZ6A 4HZFA 5GLZA 1CQ9A 4BPZA 4EJRA 3EBRA 1QHDA 2D6OX 1BBT1 4FPHA 2OW4A 3AKRA 1IS5A 5KHKA 4YW1A 1VBE2 4GMP0 1QDOA 4Q27A 4IV3C 4QQLA 2W52A 5J09A 2EF6A 1FV2A 2VW0A 3O12A 1SLCA 1SLLA 1L3JA 4PIYA 5ACA1 4L11A 4EN8B 5B2GB 4XBQA 5DG2A 1IZ3A 3B93A 1RGSA 1RUOA 1AR61 4B4QA 1H4GA 2NM1A 4ASLA 1ZBA3 3AZYA 2WNEA 3RMXA 3VBUB 2VVEA 3W58A 3ZYRA 4B29A 1R082 1RUI1 5IUQA 1MS4A 4RQPB 3VBHC 2ZPXA 1U5YA 1QXRA 2G9GA 2IZWA 1UKGA 4UW6A 3AP7A 2D43A 1N1YA 2P17A 4LBMA 2GN7A 4LHNA 3MFCA 5FLHA 4AFBA 4I2OA 1URXA 2CAVA 2XLGA 3ILNA 1RL3A 2E63A 2D44A 2QZ2A 3IKWA 4OULA 4AI1A 1LTEA 5JI9A 3ASIA 1U5ZA 1B35A 4YGEA 2BQPA 5L19A 5K7PA 3WDYA 2WC2A 1BBT3 3VZJA 3DPRC 2GC3A 2QDRA 3ZXDA 4NOTA 4XHBA 1U5IA 5T5JA 1JYIA 1DGLA 1M4WA 2D97A 4H7LA 1OQ1A 4CDXA 1AXYA 4YVWC 4I09A 3VV1A 2R041 3MYXA 3VN4A 3VBFC 4CEYC 4XJWA 1UIKA 4KH9A 4FBFA 2DCYA 1G9AA 3O0VA 3NV3A 1C3HA 2TBVA 3JD71 4KWKA 2O0OA 1WCKA 2MPFA 2BVVA 1YO8A 1RUI3 2IFRA 3ZIXA 1SCRA 2H0BA 1GNHA 3SLIA 4IEOA 2PHUA 4M0HA 3M4FA 4QQHA 1DIWA 2DV9A 1SLTA 3FJSA 4WM8A 4YGBA 4X6QB 2PHRA 4LO7A 2GNDA 3LOIA 1LESA 1OA3A 4JGZC 4P14A 4RL7A 4D7YA 3WINE 4YZ1A 1Z0HA 2FHRA 3UKTA 2XJSA 4XQWA 4CP1A 1ULCA 2WSVA 5J3UA 5FMOL 1SFNA 2UU8A 2W0XA 3VUOA 2Z69A 4TWTA 1ULEA 3KT7A 3HIFA 1Z7S1 2D7FA 4AXOA 2IXLA 1RUJ1 3KB5A 3BPZA 1SACA 4M3CF 4K3UA 1AYN1 3BB6A 2NMOA 3VZOA 1RUF3 1Q8VA 1D0GA 1S0BA 5L73A 1PZ7A 1MEC1 4K8FA 2Y0OA 4QGMA 1AZDA 1NA1A 5C33A 4GKYA 1H8VA 1MVEA 3WW3A 2AR6A 4K6BA 5I8YA 2R0FA 5T50A 4AHWA 2HEWF 1IS3A 4S2FA 5JWPA 4Q4V2 2A7AA 3DUIA 4AFMA 2WNUC 4FTSA 1DGWX 1DHKB 4XBLA 4UW4A 4YZ3A 4YFZA 1SBEA 2VPVA 3AMPA 2DF7A 1QQP3 3H3UA 3ZYJB 2EALA 2F6BA 2JG8C 1OLRA 3RRDA 3DV8A 3TWIA 1HDKA 4RS5B 1JXNA 3FLTA 4JVAA 1XNDA 1Z7S3 1CAVB 5CFCC 1W6OA 3MPBA 1TNRA 4LE3A 5JOYA 1H2NA 5T52A 1AYN3 4RHV2 2IFWA 2ZKNA 1NXD1 2MEV1 1R091 3EQEA 1WGPA 4HLTA 5HCFA 1GZWB 5DZFA 1UU6A 2D6NA 3OPZA 2BW8A 4GXLA 5IK8A 1ZRDA 5BXXA 4HL0A 1QF3A 1VBE1 2WFPA 2XGXA 1RB8G 2CGPA 4XF3A 3WY6A 4KWLA 1LJ7A 5J7MA 2NMNA 5KXCA 4LLOA 3ATGA 2MHFA 2R1DA 1V9U2 1ZRFA 1HXS2 3URFA 2RS53 1F9KA 4CTEA 1XXNA 1G9BA 3UKVA 4N7IA 4TZDA 4LBOA 1AX0A 2NLRA 1R081 2D3SA 3AKQA 2LUWA 3JU9A 3NV2A 4LBKA 3VBSA 1O5UA 1LOEA 1NZCA 3WQ7A 4L99A 2DVBA 4Y20A 1YFUA 2A6VA 5KHJA 4J1XA 4Q0SA 1VAKA 5E89A 4YGCA 4MVTA 5LRRA 2MEV3 2Z42A 1R093 3B3QE 2Q5TA 3MW2A 2XJQA 3NJZA 1GZCA 1QOSA 4Y1VA 4YARA 2PQQA 3I8TA 5CFDB 4MGKE 1VBE3 4DQAA 2SLIA 3HT2A 3HWJA 4WZCA 1V6JA 4AI8A 2ARBA 3NSTA 1WW7A 3ELNA 1GR3A 1GQGA 3D8CA 3AKTA 2GN3A 5JSOA 2XVGA 5JCTA 1BMV2 1W6NA 4S2DA 5JZGA 1DFQA 1W0PA 1C28A 5L7OA 3HAGA 1AX1A 2ZMLA 4WVMA 5LK7B 1RC6A 1G9DA 2RM21 1MR5A 3J8F1 4I0AA 1R083 1FT9A 2HKXA 1WW5A 2ZX0A 1O4ZA 1N1TA 3NAPB 2DFBA 3ZN5A 3HD8B 4WZFA 5FAXA 3D4KA 5FLJA 1A6CA 3B01A 1VAVA 4Q4X3 2BWCA 4LBQB 4HT1T 2GZWA 3H1WA 2CNAA 1KD7A 5BNPA 4P9IA 5EYYA 2B45X 4Q4Y2 4XYXA 3WDTA 5JOZA 3RYKA 2GDFA 3ETQA 4IEWA 3VKOA 4R52A 1N1SA 1V6LA 4MYEA 3JZVA 4HPKA 3AMMA 2VY0A 3DN7A 2IXKA 2JENA 1NA1C 2QUOA 5GLWA 2HJIA 3SITA 4R4ZA 1AJOA 4XF4A 4QPIB 4KWJA 4OI2A 4DY3A 1OMIA 4Z07A 4IQPA 3MLJA 1IKQA 4RR3B 1V6OA 4L8QA 4XPVA 1XRUA 4I3PA 4E2SA 3ZXEA 5GKAC 5BNNB 4Q4V1 5JVVA 3U11A 4AQ6A 4AW7A 1PGSA 3V56A 4COUA 1V70A 4UBGA 2Q0AA 4HBNA 4ZKTB 5A33B 4CEWB 5KC5A 3S0MA 2YGLA 3WW4A 2Y26A 1J1TA 3BODA 3OYWB 4OUMA 3MLKA 4QPYA 2ET1A 2G9FA 1IPKA 1LODA 1DGWA 1OI6A 1ZRRA 4DY5A 2P3IA 1YFWA 4PLNA 1CESA 3TRSB 1HRI2 4E2QA 5DUUA 2X29A 2OUJA 4C1WA 4RHV1 3FMGA 1MQTB 5KHIA 3KCYA 1Q8SA 1FYUA 2Q30A 4HMZA 4I0BA 4YM2A 2ZA9A 4YLZA 1PK6A 5DDJ3 2JG9B 3VZKA 4RGAA 2GMMA 3H1MA 1CJDA 2O8OA 5JIUA 5AVAA 1N1VA 1NG0A 3KS7A 3GHMA 2F4PA 4Q4V3