3MZHA

Crystal structure of camp receptor protein from mycobacterium tuberculosis in complex with camp and its dna binding element
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
225
structure length
225
Chain Sequence
b'HMDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE TRANSCRIPTIONAL REGULATORY PROTEIN (PROBABLY CRP/FN
publication title Crystal Structure of Camp Receptor Protein from Mycobacterium Tuberculosis in Complex with DNA and cAMP
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription/dna
total genus 62
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3mzhA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3mzhA01
4HA8A 2XL7A 5D5UB 1ZZ8A 3GBFA 3U1DA 4HOBA 3V8JA 5D1IA 3BP8A 1MD0A 5I0UA 2E1NA 4FHTA 1YWKA 2UXNA 2Q0AA 2FSWA 2K02A 1D8KA 2FE3A 3QP5A 1R5GA 2MC3A 2PYTA 4HX7A 1Z91A 5FLJA 4YFKF 4AIJA 4J1XA 3G73A 5EEHA 3RKWA 5K8SA 4P9FA 2Z5UA 3H9AA 2EV5A 1JXSA 1YHFA 3TGNA 4HSLA 2HYGD 3R60A 2ZKLA 2NRAC 2QBYB 4JBAA 4XF1A 3ECOA 1SMTA 4YIIA 5LHHA 4RGSA 4KIBA 2B9UA 2PA7A 1SD5A 1FOKA 3O14A 1B1BA 1FBQA 1X7NA 2FEZA 4KUMA 1G3WA 3KEOA 3SCGA 1P4AA 3WODF 4L9TA 4ZYEA 1QQIA 4UBGA 1J9IA 2K7LA 3KP3A 3GEZA 5A2QK 4LB5A 2MHFA 2XUBA 3WTUC 4NVPA 1SFXA 1RNLA 3HQXA 4WZCA 1DZRA 3VEPA 1CGPA 5BOXA 2RQPA 1VP6A 3TDUC 3L7WA 1FZPB 4MGZE 1S6LA 1ZZCA 4XSXF 3IC7A 2H6BA 2VT2A 3DV8A 4MGYE 4EROA 5FLXZ 2IXIA 3O6BB 2HOEA 2A61A 1ZN2A 1QGPA 3P9CA 1I27A 4XLNF 3E3VA 3VODA 3ZN1A 1ZG1A 2Q1ZB 5DDGA 3RPUA 5ICFA 1T0FA 3QU6A 3F8CA 1OD5A 2ZMEA 2QBYA 4R8HA 1FLIA 3SCFA 5HLGA 1R7JA 4XFGA 2KIUA 1V4RA 1U12A 3L00A 3BROA 1F9NA 2Q2EA 2XROA 1CX4A 4N9IA 4AWXB 3IKTA 4XFHA 2PI0A 4BYYA 1KQ0A 2DQRA 4L5JA 1G4DA 4LFUA 4HDUA 2ISYA 3J80K 1LEBA 5AIPA 3KCCA 4KYWA 3ZP5A 2DT5A 3BOQA 2FU4A 1QY4A 1WI9A 3VB2A 3H8UA 2PMUA 1IXCA 1KU3A 2RC4A 2D5HA 3LA7A 1LR5A 1GVJA 3K0LA 5DYMA 1P4XA 1USTA 4QX5A 4B29A 2VOOA 1O4TA 1XDSA 5IT9K 3Q9SA 2FBIA 4UV9A 1RGSA 5ED4A 3QU3A 3H7JA 1C0WA 4OIPF 2Q8KA 5A2QZ 1WKMA 1VR3A 3CO6C 1YW8A 2NAZA 4MQVA 3RTRA 3WTXC 2QZ8A 4EM2A 3WW3A 4EQQA 2VODA 3RYKA 1QXRA 1XSVA 4TV7A 2ZO4A 5AVPA 4QLCU 1QO0D 2V09A 2ISZA 1RI7A 5L3GA 4MV2A 1T38A 3E5UA 2L4MA 4XFAA 5LGNA 1ZYRF 4KU7A 5H6QA 3ACLA 4O3MA 2QQBA 1XMKA 4IPAA 2VXZA 1J7KA 3QAHA 4FAHA 2F5FA 2ETEA 1OYYA 1B59A 1ODDA 2CYYA 2FBHA 2D2WA 4ZYHA 1V3FA 4P5OA 4PCQA 1UIKA 1YS7A 4RD7A 4ESJA 4HX8A 4DQ2A 3EQLF 1CAXB 4U0VA 1LVAA 3DXJF 1FBSA 1W7PB 2O61A 3EHKA 5CYVA 5JAXA 2M5WA 4A2UA 2QQ9A 3HRSA 1ULYA 1NE6A 1IN6A 3TNPB 3V8LA 2ZNZA 3KETA 4P55A 1HSTA 1Z1DA 3J80Z 2V9VA 2XL9A 1OYWA 3IKVA 2PEXA 5L3BA 4ON0A 1GXPA 2K0GA 1P4WA 2E9QA 4M74A 3WTWC 4L18B 1Q43A 4Q0SA 1U5TB 4IJAA 3GFJA 2DLLA 4WCGA 2GAUA 2MH2A 3KP4A 4PGGA 1MZBA 4G8XA 1U6GA 1XSXA 3D0SA 2HZTA 2QVOA 3JAMZ 4RB0A 5JR3A 4IEXA 5JI6A 1OPCA 2LF8A 3BWGA 4OMZA 2DI3A 3JW4A 1KU9A 2UZKA 5BY5A 4L0ZB 2I45A 5J3UA 4N9HA 4XF9A 2EA2A 1BC7C 3KE2A 4AVBA 1CAXA 2Y0OA 5E1RA 5FLHA 3MDPA 2M87A 2IT0A 3RZZA 2DK8A 5JR7B 1SD6A 3J81K 2HJIA 2P5LC 2P17A 3FZVA 3DFGA 1MJBA 3C18A 3HOSA 3LQRA 5D6EA 1XRUA 5D6FA 4DINB 5J8FA 5J6XA 3CUQB 3E6BA 3D82A 3MAJA 1ZG3A 2R7FA 1K7AA 4XFCA 1RC6A 5BMZA 3CLPA 2EB7A 2O03A 4IETA 1U5TA 3Q5FA 5L3DA 1XGOA 2M1BA 5FQ0B 3F8NA 5FPZA 4S05A 3S7EA 4L0YB 1QNTA 4ZH4F 3FHZA 4XRFA 3ZMVA 1XCBA 1Z05A 4XF3A 4IEUA 2STWA 1J0RA 3EQEA 2GH2A 3ES4A 2PHDA 1AOYA 1K78A 1IN5A 1YLLA 4HV5A 1IPKA 4I09A 2BV6A 4LLOA 3I0TA 1YFYA 1DP7P 1HSJA 4PJYA 1BOAA 3T0YA 1T6SA 3CO7C 1YLFA 5C8WA 3HTSB 4META 4H7LA 1BIBA 3E6CC 2M45A 4IEPA 1IZ1A 4G7HF 3E6MA 4FX4A 4BHCA 1O3QA 1XCVA 2FQ3A 4E70A 1YUDA 1ZZBA 3HT1A 5FGMA 3RYRA 4UVCA 4K8FA 1E17A 4KN7X 2P6SA 4HZFA 2B5HA 1OI6A 2Y75A 2R7DA 4L9JA 4X6RB 4ZZDA 1PM7A 2XV4S 2Z2SB 2DAOA 4PDKA 5HDNA 1VTNC 1T98A 2ET1A 1J75A 3GLXA 4IERA 3K69A 3ZDSA 3C7JA 4A5MA 5JVTA 4I98B 4LGWA 4H0EA 3H7YA 3E5XA 1ON2A 4EGYA 1CAUB 3GYDA 4KL1A 4G94A 1LEAA 4RGXA 3V7RA 5FO5A 4IEQA 5HLIA 2DPUA 3IBMA 3F6OA 5DCFA 1TQPA 3T1BA 1MKMA 1BI2A 3ZMZA 1O7LA 3SZTA 2OD5A 2QUFA 4BQAA 1OFNA 1SD4A 5E20A 1S7AA 1KU7A 2P8TA 3UKTA 4F8AA 5BXXA 1BI1A 3HOTA 2QJVA 4IXAA 4BXUA 3RKYA 5BS6A 2UY9A 4QGLA 1R1TA 4UBHA 2MA3A 2HKOA 4B8XA 3ZMSA 4XF4A 5LBQA 1LDDA 2WTEA 2IP2A 3ERED 2EFNA 5HDKA 5CJ9A 5H6RA 3P9KA 4KMFA 2EFPA 2EAAA 1NXMA 3F6VA 2KJBA 3GXOA 5LEJA 1YQAA 2K27A 2BYVE 3V8KA 3PVBB 3C3VA 3FXRA 4EGZA 2FMYA 3ZPLA 2IXHA 1RUNA 1KU2A 4Z07A 4YARA 4MH0E 2NNNA 2HQRA 2GXBA 2EWNA 5HDGA 3S7IA 2PAKA 2GC1A 2PN6A 4UXAA 1USSA 3M8EA 3BPVA 3JZVA 3FMQA 5E1WA 1KYZA 1YIOA 3VOEA 1H9TA 3MYXA 1QZYA 1KYWA 2A68F 5I91A 1SMYF 1GHCA 3SFZA 2BGCA 4YSFA 2GWRA 4J1WA 5BPXA 1KQ9A 3LWCA 4RGRA 3TDZC 4JQFA 4HF0A 2GA2A 4XETA 2PJPA 2CAVA 2D5FA 3TO6A 4LMYA 2IC1A 5I8SA 2EK5A 1ZHFA 3BJAA 2P5KA 4HYEA 4U88A 3OF1A 2PTMA 2Q4SA 3KEQA 3RPQA 4D7SA 2ELHA 2HTSA 2F4PA 3ETQA 5IT3A 5LRSA 4KFCA 4FAGA 5FCCA 2YU3A 3EYIA 4HN0A 3FHIB 3LFKA 4MEYF 5H20A 3MWMA 2MLGA 5DD8A 2NNYA 5DD4A 3DKWA 3HSRA 3U2RA 2IRFG 3GZ5A 3BJ6A 2XAQA 1Y3TA 4ONUA 1O3SA 4WVZA 4ZU5A 2L02A 2BNNA 1DGRA 1KQ8A 3M70A 1ONVA 5D4RA 4RB1A 1R23A 2MH9A 2Z99A 3PQKA 4HN1A 1LQ1A 2ESHA 2XAFA 1HW2A 3R0JA 5DUIA 3JSOA 1I1GA 4WK8F 1ZX5A 4P96A 1RUOA 2GIVA 2QNKA 1Q5OA 2GQQA 4A5NA 1NE4A 1IN4A 4S04A 2PG4A 5D5XB 3DF8A 4CO8A 2STTA 3H1MA 1IXSB 2RNJA 5E18F 1NHAA 3MZHA 1KA8A 3FF5A 3TO9A 4I02A 1FYMA 2XVCA 2FXAA 5LLQA 3BPZA 3QP6A 4K2EA 3HHHA 1QWRA 3H92A 5ILUA 2RKHA 2JZYA 2XAHA 3B02A 3K1NA 5LEKA 1X82A 3E5QA 4MQ9F 4ASNA 3SXYA 4LULA 3WTVC 2B0LA 4UNOA 2P4WA 2O0YA 2CWEA 2Y48A 1U8RA 1YFWA 1MJ9A 3K2ZA 3RDIA 4M73A 1RL3A 3KSCA 1UB9A 3EUHA 2NS0A 3B73A 4OIOF 4M72A 3I59B 4XLPF 2OZJA 3PLQA 2X0LA 4Q48A 4AD9A 4HBNA 4AVAA 1SD7A 3T5XA 3P7NA 1OMIA 1BN5A 1H1MA 1JHHA 1L0OC 4IEYA 5KHJA 3GUDA 5E8GA 5DEQA 1B6AA 4MX3A 3RJPA 1EV7A 1ZRFA 2UY8A 3NJZA 3SZPA 1PMIA 2H09A 2O6GE 2PMHA 1XMAA 4YG2F 5BPDA 2WC2A 4KICA 3OTFA 2K9ZA 2Z3YA 1RZ4A 3I71A 4O9GA 5CLSA 1HXDA 1IPJA 3ROUA 5EEGA 5D4SA 3E6DA 2P7CB 3H50A 5CADA 1XD7A 3HYIA 2IXKA 5J7MA 1U2WA 2RGVA 2RN7A 1LDKB 5LGUA 5F1RA 3QPHA 5I8TA 2PHLA 4CZZA 2QYOA 4UHTA 2EV0A 1DPUA 1I1SA 1QPMA 4AVPA 5E1ZB 4BHBA 3BZ6A 5ILVA 2DCTA 4Q0UA 6PAXA 3LZZA 3PFIA 4E2QA 3I59A 5LGTA 5KBFA 3WW4A 1P92A 1WGPA 5BQTA 3ELNA 2W24A 1OR7A 2ZCWA 1REPC 5BUVA 3ML6A 4AQ2A 1HKTA 4Y17A 3REOA 2FMLA 4UV8A 1F4KA 4A12A 1S7OA 3FFQA 3GFIA 2YX7A 3S0MA 2CSOA 1ZZ6A 5C6CA 4U7DA 4EWDA 5L3FA 5LHGA 2MBFA 5CVUA 1MDMB 2BEOA 2LNBA 3KP7A 3CO2A 4CHUA 1GQHA 4A0XA 2D1HA 5EFUA 4N0BA 1ZAOA 3LAPA 2OPKA 1O3RA 1W5SA 4ENNA 2QVSB 3WGIA 1V70A 2CAUA 2ZXJA 4LG0B 4WBBA 3TOBA 2H27A 1U3EM 3ULQB 3F23A 4IVNA 3MZYA 1VJ2A 1JE8A 4WXHA 2N7GA 3KP2A 2IA1A 4OMYA 2MPFA 3WE3A 3O3KA 1KGSA 3N4MA 3RNSA 2FA5A 4P9GA 3TKYA 3ABTA 5IT9Z 3I53A 5DCMB 1XGMA 3DPLC 3CJXA 2IPQX 4EM1A 3M9AA 3CL1A 4FX0A 2KXLA 3BPXA 4WF2A 3HSFA 3ZMDA 5HLHA 5E8IA 1YO5C 4ENMA 4L2NA 1ZVFA 4L9VA 1NYWA 2NYXA 4G6QA 3M3IA 2IA0A 2HS5A 1EP0A 4YIFA 2E1CA 3M8FA 4AQ6A 4QXKA 2V1XA 2KKOA 1T39A 1DUXC 2Q0OA 1W7PA 5E17F 3JSPA 4IRHA 4KMUX 1ZZ9A 1R22A 2O1QA 4JTNA 4OU0A 1Q1HA 1O3TA 2MLKA 2PQQA 4YRDA 1MDMA 3FWEA 1YYVA 1J3PA 2QCSB 4Z2YA 1PP8F 3IWZA 2CW0F 2CG4A 1Z9CA 1FI2A 4LG0A 3USSA 3HRTA 4IRGA 3K9TA 3KP6A 5F6FA 3DQVC 4O9EA 2LDUA 5HS9A 2JSCA 4BAYA 1FP1D 1ZNPA 1YG2A 3EO6A 1JUHA 2L54A 1BI0A 4DNCA 1J5YA 3GO5A 2UXXA 4AIHA 2C6YA 4HF2A 4EJVA 4IEZA 1FC3A 1XDUA 1J2XA 2M8EA 4I3PA 3BU7A 5DUKA 3JTHA 2GC2A 1WWXA 3I64A 1R36A 3FMRA 1FT9A 2P6TA 4JK1X 4G7ZF 4LK0F 2DW4A 2F5CA 1D5VA 2EFWA 1QZZA 4WX9A 1XGSA 2ATFA 3N97A 2W84A 5LHIA 3VFZA 2E7WA 5KVRA 1Y0UA 1B9MA 3D0JA 3SQNA 1B9NA 2LSOA 2CV6A 4ZYDA 3SMHA 1FSEA 2HTJA 1OYIA 3WU1B 3DN7A 3CTAA 4HLTA 3FM5A 1J58A 1XE8A 2PAEA 2HGCA 4KNYA 3F72A 2J5OA 2VT3A 1LJ9A 2XLGA 2VOPA 2VPVA 1BIAA 1R00A 4X6QB 2A69F 3FM3A 2BBYA 4RB2C 3CUQA 4HBLA 4ZZLA 2XKPA 4O6JA 4Y15A 4LB6B 2D40A 5D5VB 2OZUA 1SFEA 4I0AA 4KU8A 1ZH5A 4PIXA 1TW3A 1L3LA 3EBRA 1Q3EA 2XIGA 4R52A 5FD5A 5LRRA 2PAMA 4QGMA 3VHRA 2KIFA 4PGHA 4HVQA 3FE5A 3EDPA 3J81Z 5FQ0A 3IDBB 2D93A 1PDNC 3ELKA 3H3ZA 4NB5A 4Q0QA 5D5WB 2UWMA 4MEXF 3WG9A 2IXJA 4PZJA 2VE9A 4ETSA 4LK1F 3WGHA 2VBXA 3K1PA 4L9NA 1O57A 3OD0A 1ZRRA 1JHFA 1MJAA 5AONA 1ZZ7A 3HRUA 4RGUA 4QGNA 4EWAA 2WV0A 3IL2A 2A5YB 2H94A 4EVIA 2OQGA 1IRFA 1PUEE 2HKXA 3LQQA 1I6XA 4KT5C 1FNNA 4PIYA 2JTVA 2XLAA 1LKNA 4LUKA 1H9GA 3FMSA 5I93A 1Y9QA 2MD5A 3FXQA 4AIKA 3HSEA 1P2FA 4OLLA 4MGKE 4NQWA 4XSZF 3L2CA 2HEOA 1J3RA 2QWWA 2LKPA 3NSTA 4LA3A 2ZKZA 4WWCA 4FBFA 3GW2A 3IRRA 4XBFA 1A04A 1SFNA 2F2EA 4M6XA 5ILSA 3CLOA 2BNOA 4GYGA 1WSUA 3WW1A 2W25A 2L3DA 4HSJA 2ET7A 2HYFA 1TQMA 5FPXA 4KIGA 3IWFA 2OA2A 5T3NA 4HDVA 1CAUA 2FNAA 4ORFA 4Q0PA 5FFXA 1D3YA 1TQIA 4EWEA 4ZYGA 1EH8A 1TLHB 4BNCA 3H1WA 5FLXK 5JSRA 4CYDA 1X3UA 2VN2A 1DZTA 2WWYA 4M9ZA 4Q29A 3R4KA 4OOIA 3SCHA 5J8CA 2OBPA 3TNQA 4EJOA 3IRQA 3SXWA 1DGWA 2MNGA 2BNMA 2V6CA 1U5TC 2IA2A 3MEXA 4Q5SF 3BB6A 3CDHA 5D8KB 4M71A 3H3UA 4D0PA 3MCZA 2HQNA 4LA2A 2ETHA 2GZWA 2XLFA 1FP2A 3ZMTA 4MUVA 4XFBA 1ZREA 1ZGJA 3KLOA 2Q30A 3HHGA 2RV8A 4LJZF 4XFIA 1YFXA 5L3CA 1UW8A 1XGNA 1D8JA 5HOOA 3F8MA 4UVBA 4IEWA 2VBYA 2OA4A 2V1DA 4O5VA 1YTYA 3UKVA 2ZMEB 2YR2A 2P7VB 2XAJA 4F7ZA 5HI0A 4MNUA 2OU2A 4EM0B 4G6DA 4L5IA 2IVMA 3M7GA 4A6EA 3K1MA 5D8LB 2JT1A 2OQRA 2KIMA 4FT8A 4RB3C 4LLGF 4OINF 1L3JA 4IESA 3ST7A 2EVXA 3MQ0A 2VBZA 2KJCA 2VBWA 1ZLJA 2K4BA 1O5UA 5K5QA 3D5LA 2A6EF 2RVCA 4I2OA 3WE2A 2W57A 2YSRA 3HRMA 1JGSA 4IEOA 5I0SA 3DL3A 4M9SA 2ESNA 3H1YA 4HW0A 1P6RA 5F64A 1FXZA 3CUQC 3ISPA 3EETA 3KLNA 1UCXA 3NEUA 2JPBA 1H0MA 3F21A 3O2PE 3ECHA 3MFKA 2D1VA 5KHHA 2VE8A 4YFNF 3V7SA 5FB2A 1RIOH 4LUMA 1Z6RA 3WGGA 2F5DA 1Z7UA 4U0YA 3JTGA 4PIZA 1UHMA 1SQ4A 4KWLA 1XE7A 2FQPA 1TW2A 2XRNA 2VC1A 3V4GA 1F1ZA 3LOIA 4MTEA 1MGTA 5CVRA 3ZMUA 2GC0A 4IF4A 5CVVA 1IXRC 1OKRA 3HUGA 1TQ5A 4ZU4A 2G7HA 5ICCA 3IIAA 2PFBA 3CF6E 2DPDA 1WLTA 3Q9VA 2G9WA 4I7HA 4BIFA 3J7AO 1STZA 2O3FA 3UKNA 2ZJ2A 3R6SA 4Z82A 1UD1A 1YFHA 3HIFA 2EA4A 3DP7A 2V1UA 2O8XA 4UVAA 2COMA 3NW4A 4MTDA 1W4MA 1IW7F 3P9IA 1TTYA 1FPQA 2AS5F 5EZWA 1SEFA 5K1YA 1BM9A 1F5TA 3TO7A 3ES1A 2DQLA 3QRFF 5TRDA 5I0TA 2EFQA 1ZG5A 3RIRA 3GYHX 1CAVB 4G9YA 2FOKA 2LF7A 3EYYA 1IAWA 3GF2A 1R1VA 1HKSA 2CQKA 2K86A 4R79A 3ZQ7A 3R0AA 3QOPA 2R3SA 5HS8A 1UFMA 3BALA 1K6OA 1BC8C 2DK5A 1XSDA 3T8RA 1DPRA 3ABUA 3TQNA 4P9UA 3JAMK 4U7BA 3WTYC 3COAC 1S3JA 1J59A 1CF7B 1LRHA 5KHIA 3NKTA 1TBXA 3AAFA 3GZ6A 1LB2A 1R1UA 3OV8A 4MGIE 3G7DA 2EV6A 1QBJA 2HDCA 2M30A 1HW5A 1BI3A 3BJOA 1J3QA 2PQ8A 3C1DA 4LD5A 2XHKA 1G6NA 3HTUA 4KWJA 3I58A 4Y13A 1YW7A 4IRIA 4RAYA 4QM8A 5JCTA 4HVRA 1R5HA 4RAZA 2ACJA 4U0WA 3G3ZA 4LTAA 1G3TA 1FWZA 4A0YA 4GXOA 2FRHA 3F22A 2OAZA 2QLZA 4Q4ZF 1AWCA 1YS6A 3F3XA 2PFWA 3KFWX 1XN7A 1CAVA 4I01A 2V79A 4KN4X 4HLXA 2IXCA 4XEZA 4R1HA 3E97A 3SHRA 2DO7A 3I54A 5FFZA 3QACA 3LSTA 4HF1A 2D45A 3WU0A 1X8EA 4LLNA 2ZFWA 4QWQA 5HVQC 5DV5A 3F8FA 3OCPA 4GGGA 5KK1A 2TDXA 1ZGAA 2QM3A 3W6JB 2VECA 2OZ6A 4CXFA 2IXLA 1IN7A 2VQAA 1CF7A 4B09A 2EFOA 4EMSA 4HX4A 3LWFA 1LNWA 3C3WA 3V7CA 3PQJA 3PNAA 2XGXA 5E16A 4UXNA 1K79A 5CVIA 1FSHA 1EY2A 1LDJA 4D7TA 4GULA 4HVOA 2Z69A 4Q0VA 1FYKA 2QENA 3TOAA 2A07F 2YPRA 1R58A 1WQ2A 1S8NA 3KGLA 1YW9A 4HV6A 2FF4A 4MZUA 2JRTA 1K78B 1U78A 3WTSC 4YNIA 4M9XA 2C0ZA 4GO1A 4JVAA 5E1XA 1EPZA 1UPIA 2HR3A 5ICEA 2VONA 1G3SA 5CU1A 4I0BA 2DBBA 4A0ZA 2QDRA 3U0ZA 1ZRDA 2XASA 3LA3A 4ENKA 1HW1A 2EJRA 2G7UA 1O5LA 5HS7A 2E7XA 3U9GA 2KRFA 2RDPA 3CEWA 4BHPA 4EJUA 5BV6A 2GU9A 3ZN0A 1ZLKA 4CDGA 3BY6A 2WFPA 2A3SA 1FBUA 3FX3A 3LA2A 4HAMA 3I4PA 3F8BA 2UYBA 5DCMA 4TLFA 2DFIA 2QQAA 4QM9A 3BDDA 5FLIA 3L9FA 1J1LA 4HLYA 3U11A 2UYAA 4HQEA 1ZRCA 4WXDA 5ICGA 5FD6A 2DTRA 2O8QA 3KZZA 4MGRA 5JSOA 1B4AA 1O7FA 3S2WA 5I8YA 1FX7A 4OFGA 3BCWA 2JPCA 4A6DA 3RI4A 5L3EA 5KHKA 5JFRA 1QXJA 3DPTA 4IHSA 3NRVA 5CVJA 3GX4X 1BBYA 4HMZA 2OYZA 5JSPA 4ENJA 4G7OF 4RS8A 1FY7A 2XAGA 1DDNA 2FBKA 3WTTC 1IRGA 4IEVA 1GXQA 4MHGA 3RKXA 2ZNYA 2DU9A 3SHFA 4L11A 4ESBA 3NQOA 2Z33A 5FDBA 3GFMA 3DEUA 1Z6TA 1IUYA 4AVCA 3GVAA 4YFXF 3GWZA 2B8MA 3I5UA 4YYOA 4KA4A 1CAWB 2EA7A 4KWKA 3LAJA 4ZU7A 1UCRA 5J48A 5K5OA 4IHTA 1TNTA 2X4HA 4HQMA 1FYLA 4XF0A 3CUOA 3OGJA 2F5EA 4EV0A 4AXOA 1H1IA 2YX4A 5ERIA 1SFUA 2Z9OA 4CICA 4E2GA 2BE5F 1TNSA 2H0VA 3QPTA 1IN8A 2FNPA 2ADUA 2VC0A 4M6YA 4KDPA 3R61A 4LLLA 1ON1A 4XFFA 4Q47A 1S29A 4JTOA 2CO5A 3KP5A 1W5TA 1BJAA 2IW5A 3OOPA 2GA1A 4JV4A 3LAGA 2P5VA 2CFXA 4CGZA 1XB4A 3IDCB 2PBIA 4OIRF 1X8MA 2GC3A 1EH6A 5TJJA 1IF1A 4GCVA 3KGZA 3RYPA 1UIJA 4UUVA 2A6HF 2Y0MA 5AIQA 2CGPA 3T8TA 2AXLA 1SAXA 4ESFA 1HBXG 2GXGA 1ZARA 2IJLA 3CJNA 3NL1A 1HQCA 3FXUA 5JHUA 5KHGA 1HKQA 4E2SA 3FJSA 3U10A 1WA4A 1GQGA 2L01A 1UHWA 3GFLA 1CAWA 3EJKA 3NVCA 3HT2A 5K5RA 1W7PD 4BH9A 4QMAA 3I7DA 3M1EA 3FZ3A 3WTZA 3L09A 1PP7U 2L4AA 2HWVA 4LEJA 4EJTA 1RTVA 2XKOA 3IHUA 2HFHA 3L2HA 2ZBKA 4KIFA 1E2XA 3KZYA 4OIQF 4WXCA 2W85A 1EH7A 1T2KA 1YFUA 5BPIA 1I5ZA 2PLYA 1G3YA 3WW2A 3W6KB 1EYBA 1WRJA 1NZCA 5I0RA 2K4JA 4NHJA 3MPBA 4EJWA 2H6CA 3KMHA 2J5PA 4GYIA
chains in the Genus database with same CATH superfamily
4HA8A 2OUHA 2ZS6B 4F92B 2YB7A 3U1DA 3ABKH 3K3NA 3J7MA 4M0HA 4YW1A 1U8BA 1CR7A 3WUCA 2UXNA 4DRRA 2Q0AA 5E3NA 1JZ4A 3U4XA 1NY72 3QP5A 2MC3A 5IYBJ 2PYTA 1LHOA 1JI8A 4JDNA 5FLJA 2WNEA 1GP4A 5EEHA 3RKWA 5K8SA 2Z5UA 2EV5A 1HRV3 1WW7A 1V9U2 3CBNA 4FCAA 2VXJA 2XUEA 4B48A 2NRAC 2ZKLA 4JBAA 2LFBA 1JTYA 3B9CA 4RGSA 5T54A 2HBTA 1V6OA 1B1BA 5C5TA 3WQ7A 4AGGA 1O8PA 3ZPYA 5GM0A 5F6LB 1IS6A 3SCGA 1Q8VA 1V6LA 4QB2A 2DCZA 3B6AA 2OPTA 4F93B 3ABMH 2WO3A 2LLKA 1Y7BA 4LKSA 5BNPB 5A2QK 1WUVA 1ASJ2 2R32A 1OUXA 1YXWA 5FK8A 1SFXA 1GUIA 3OSFA 1RNLA 2WN2A 5ANNA 2Q8CA 4WZCA 2W9XA 4C0BA 2VU9A 3NMBA 1YCIA 2VGDA 5A32A 3AXEA 1W6NB 2V5DA 1ZZCA 3V64A 4CEWB 4ASKA 1TME3 5GLVA 2VT2A 2X5IB 3PVEA 4OI1A 1IV8A 5FZ3A 3OEBA 4EROA 2IXIA 4QDQA 2A61A 1ZN2A 2A6YA 3P9CA 1I27A 4XLNF 5L9RA 4CPBD 1QH6A 1ZG1A 5DDGA 1JYVA 3F8CA 3ZYPA 1ULCA 1X1AA 3M3QA 5HLGA 5IK7A 3I2IA 3ZXAC 1FJLA 1OQEA 4AI3A 1U12A 3CCLI 2RS52 3W3CA 2ZX0A 5C9AB 2ZX2A 1MBGA 4CDQC 3HD8B 2AH2A 3AYDA 2HWF2 1ACCA 5JI9A 1KQ0A 2DQRA 3OS2A 1HQWA 3CZ6A 5FP7A 1U9NA 1IC8A 3J80K 2I2SA 4XIOA 3T1LA 1LUJB 5BNPA 3KCCA 3ZP5A 1WZXA 3BOQA 4L9BA 1WI9A 2Y26A 4DO0A 3WU2C 2PMUA 5F08A 1KU3A 4CEYC 4TZDA 1ZBE3 2D5HA 5K4LA 2XXZA 1RUH3 1GVJA 4CEWA 2ZHKA 5HPOA 2X5IA 2W1WA 1AR71 1BMV2 3CP2A 1QHHD 5FYSA 5ED4A 3QU3A 3H7JA 3VBRB 1C0WA 4OIPF 3ABZA 1RIRA 1FIPA 1VR3A 4HOOA 1Q8SA 2J1VA 4EM2A 1KS4A 1A3KA 1H8VA 2VMGA 4TV7A 5TGTA 1UAAA 2E71A 2ISZA 3DPRB 4BCUA 4N8MA 3PJYA 4MV2A 1RR8C 3E5UA 2L4MA 1VBC3 2QBXA 4V2WA 1YJNI 1WA6X 5SV8A 5C4WC 1R4MB 2QQBA 2VZQA 4K20A 4UW5A 1BOBA 3R05A 4FPGA 5C9AA 2F5FA 2ETEA 2FBHA 1JU4A 2FDIA 4ZYHA 1V3FA 2BJSA 4HG2A 4ESJA 3VBUC 4ABZA 4DQ2A 3EQLF 4E6KG 4M0NA 1RVF1 1Z3XA 3A01B 1LECA 4XLHA 2NVTJ 1FBSA 2R062 4OUSA 3AYAA 3EHKA 5CYVA 5JAXA 2K46A 4E7IA 4A2UA 3HRSA 1ULYA 4PQQA 3VD7A 1IN6A 4NOTA 4YZ2A 4ES8A 1NAEA 5JVGF 1ZELA 2DN0A 3V8LA 2P5BA 3CHXA 1IGOA 3KETA 1DG6A 4P55A 1SC7A 1XX5A 1Z1DA 2XL9A 3U21A 3BG5A 1SCSA 5L3BA 4ON0A 2K0GA 4IHVA 5CBLA 4M74A 3WTWC 4L18B 3K6GA 5A7WB 1Y8RB 2MH2A 3OWTA 4YLZA 1BR2A 5A3UA 3DKYA 2RM21 1MZBA 1HKDA 4XNFA 2QVOA 3ALQA 3USUA 5E79C 3RG0A 3GBWA 4YFWA 2QGUA 2DMNA 2JSPA 2O14A 1OPCA 2JE7A 4YZ1A 3BWGA 2WSVA 5FZKA 2DI3A 2R4GA 1N1SA 4AVTA 4C30A 3BTCA 2YROA 4S0HB 3WUDA 4KJZA 3NAPB 2BVMA 4N9HA 4YG3A 5JOZA 4FPHA 1A34A 3WEZA 3JD72 2Y0OA 2VI6A 3L1PA 3HNYM 2WYFA 2ZMEC 2GALA 1Y0NA 3MFCA 1W05A 2IT0A 3NV3A 5JR7B 3RZJA 2ZFUA 3FXLA 2HJIA 3FZVA 4N90A 3C18A 3HOSA 1BKZA 4KI5M 3L2UA 5D6EA 5D6FA 4C1WA 4BWOA 3NRUA 4DINB 2XWBB 5J8FA 3MIGA 1NLRA 4SLIA 4A3CJ 2XBO2 1RC6A 3VDXA 3DBHB 3CLPA 2O03A 3Q5FA 5LA9A 3S30A 4LMFA 1LE8B 5F2SA 4Y5TA 4FTEA 4GZ9A 5GADJ 5GZDA 5F04A 3H35A 4XRFA 3ZMVA 2NVQJ 2EXIA 1BJQA 5M3FJ 4IEUA 1OPOA 3N7MA 5IWFA 2STWA 1UYPA 3EQEA 2GH2A 2QE3A 2WIIB 1NZIA 4Q26A 3IIIA 2AACA 4Y5SA 1K78A 4HV5A 2LR8A 1IPKA 2BV6A 4LLOA 1BVP1 1HSJA 3Q0WA 1JYCA 3NO8A 4Y1UA 1T6SA 2WQ8A 1QOOA 1RXFA 3N9QA 1R64A 4BJTA 4META 2E33A 4JYKA 1PHMA 2WUHA 1BIBA 4JQRA 2M45A 2JX9A 5FYHA 3B93A 3DPUA 4PFPA 4IHXA 1LFUP 4COWA 2Y6JA 4QU2A 1DGRM 1ST8A 3HT1A 5FGMA 2MG4A 4AYUA 3VD3A 1E17A 5IY5H 5AC91 2Y75A 4B8EA 4FISA 1GUUA 2XV4S 2Z2SB 4JC1A 5IAXA 2DTYA 5HDNA 1VTNC 3GLXA 4PUSA 3C7JA 2X09A 4A5MA 3Q8BA 5JVTA 4I98B 4LGWA 1SACA 1URXA 2BY2A 1K61A 4Z92B 2HYJA 3E5XA 3H0OA 1FEXA 5FLMJ 4LG3A 4KL1A 3N35A 1R6RA 3LSPA 2DPUA 3IBMA 4DY3A 3F6OA 2WO2A 3T1BA 1MBHA 1MKMA 4AEDB 1O7LA 2XSDC 2IWGB 4ZC3A 3SZTA 2QUFA 4BQAA 2V9PA 1SD4A 3IAPA 1KU7A 2QZ3A 2P8TA 1W39A 1T95A 1BI1A 2F4LA 3HOTA 4CPBA 2VPLA 4EJRA 1UL9A 5BS6A 4QGLA 1R1TA 1MQTC 2MA3A 2HKOA 3ZMSA 2W52A 4MADA 2JE9A 1WLCA 2VNRA 2IP2A 1TWGJ 4TTGA 2WR9A 4RR3A 3NKGA 5CJ9A 2RMU1 5H6RA 4KMFA 4R9CA 1IO2A 5EYRA 4OHVA 1VQMI 1YQAA 4N43B 1TG7A 1YITI 3C3VA 2M0CA 2FMYA 2EIMH 4GB31 4D69A 1AR63 1KU2A 3RQIA 2KDZA 2QUOA 1GR3A 4Z07A 3VPRA 2FBEA 1K4TA 5HDGA 1B09A 4XAEA 4NPMA 4C8DA 3DUIA 4UXAA 3FKJA 3M8EA 4WVWA 3BPVA 3AMNA 1YIOA 5F6KA 4QPYA 1QZYA 5BNOB 2AEZA 1D0GA 3DYPA 5BPXA 3LWCA 4N4OB 3P5JA 5FRNA 3VBFB 4JQFA 4QXCA 2CAVA 1W28A 2D5FA 3TO6A 3JBG1 2VQTA 2JJ7A 2IC1A 5I8SA 1ZHFA 1SBEA 3OYGA 3ZFFA 2VCCA 2DJNA 3T0AA 3WR0A 4CUAA 4URTA 3D1NI 3RPQA 4D7SA 2ELHA 3PMSA 1QNYA 2HTSA 4EN0A 3ZYHA 1ETOA 5FZ8A 3BR1A 5LRSA 4KFCA 3K77A 4A3XA 1AVBA 4N43A 4MEYF 1AYN1 5HNHA 4CDWB 4AOCA 3UK9A 5DD4A 3I3DA 3AP9A 3HSRA 3CDZB 3ASOH 1L7RA 3ZYFA 1JYTA 3GZ5A 2M7AA 3TBDA 4ONUA 2VZTA 3CCMI 4Y52J 5FOBB 2V73A 3VYUB 1ITYA 2DUPA 4ZU5A 1FOD3 1G59A 3M70A 3WDYA 5CEHA 3NWKA 2BXYA 5BNOA 1LQ1A 1YIPA 2ESHA 1FPN1 5F27A 4AVVA 3AC0A 1I1GA 2AREA 4NMIA 1ZX5A 3VBFA 2GIVA 2GQQA 4A5NA 3WG1A 4CCNA 4CDUB 3H5RA 4CO8A 3HNBM 2R0HA 5JXGA 4BJ5C 2ICWG 3P1IA 1S0EA 2FXAA 2QQVA 5KR7A 3QP6A 4YIRX 5HV0A 1C8NA 3PUIA 3H8RA 2XAHA 2JG8B 2GNDA 3SXYA 4DUVA 4DEQA 1XNAA 2QSFX 4LIVA 4G3YC 2OCEA 2R071 1P9QC 2X85A 3PIJA 1YFWA 1YEWA 4OI4A 4RN5A 1R1A1 4M73A 2BQPA 2FDGA 4WZFA 5EXOA 3HOYJ 2K3PA 2NXNB 2NS0A 4M72A 1RUI1 2AYHA 4XLPF 2GLOA 4AD9A 1UQXA 4HBNA 5L73A 1XXNA 2VOXA 2AUYA 1OMIA 1JHHA 4L0PA 4IEYA 5FZOA 2ZJPF 3GUDA 5DEQA 3O12A 2VZRA 2A75A 2X10A 5F32A 1EV7A 2UY8A 4ZYAA 2XQRA 1PMIA 5FZGA 1TNFA 5F5AA 3ZFEA 2VCAA 1GOFA 5AFEA 5FOJB 1B35B 3I71A 5K7ZA 3LSEA 2E35A 4N53B 3SISA 5D4SA 1W8UA 3MKZA 5JDBA 3H50A 2GNTA 2X48A 4BMEA 4XW3A 3ATGA 5J7MA 3PUFA 1REEA 1LDKB 2IFWA 2JG8A 3AKZA 5DG2A 5FZ1A 1JW6A 2VUMJ 1XTAA 1DP0A 2V72A 3SLIA 3OPZA 4PBOA 2DU1A 1QPMA 5E1ZB 3BQZA 3BZ6A 3DXTA 4JKKA 4E2QA 5H9SA 4JOMA 4KG8A 1MACA 4HANA 2I5UA 4P9XA 5BQTA 1PVXA 1HN1A 4MSVA 2ZCWA 3ML6A 5KNLA 3A02A 1HKTA 4INDA 5FRAA 4W97A 1OXCA 2FMLA 4UV8A 4CZSA 1S7OA 2ADEA 4WM7A 1KRIA 1SBFA 4K21A 2XC7A 2CV2A 2A3XA 1DGLA 3V56A 4JP0A 4R9AA 1MDMB 2BEOA 2LNBA 4QT6A 1QJU2 3TP3A 2QKLB 3K4MA 3B69A 1DQ1A 1B35A 4CXYA 2W68A 3ABLH 2JKBA 4TSVA 3I3LA 3CC4I 2OW4A 2L7MP 4IVNA 3MZYA 4KQ7A 4N53A 1JKQC 4WXHA 3M1HA 3I2DA 5EDNA 4JGYA 2IA1A 4OMYA 4YW5A 4RBOA 1SG3A 3ZLIA 3OSGA 2H8WA 1IPSA 1PO12 3I53A 5DZGA 3TN92 5BNNB 2IPQX 3A2KA 4QKNA 4HPKB 1I3AA 1NQJA 5EP9A 3U1XA 1XSQA 2BW3A 2NYYA 2WAFA 4XJWA 3W2VA 1WVRA 2NYXA 2YS9A 2R042 3INAA 4E8DA 2IA0A 4A3MJ 1W8WA 2E1CA 3M8FA 4QXKA 4YVWC 1S0CA 1VZ0A 5E17F 3NNLA 4NJ4A 1ZZ9A 2ZMKA 3FK7A 1W03A 1SANA 2MLKA 1MDMA 3K7AJ 1OOPC 4E7JA 4NHXA 4NAOA 5IK8A 1J3PA 2QCSB 4Z2YA 1PP8F 1OH3A 4BZ4A 3IWZA 3VHOA 3VDDB 1FI2A 1BBT1 2CU5A 5FY4A 1RUE3 3VZNA 2LDUA 2JSCA 3M4OJ 1UZWA 1FP1D 4PI2A 4XK4A 1E5HA 3VHPA 2EIGA 5FKLA 1XBFA 3H9QA 4DNCA 3V0AA 5FZDA 2WNUA 1N1TA 3OYIA 4IEZA 5IPAA 1J2XA 3J9SA 5DUKA 2XPJA 2IBDA 4HPKA 1KONA 3VL9A 3G71I 4JK1X 3BIEA 1K5JA 4PJ0C 4PI0A 2LYCA 1S7EA 1KGYA 4PDWA 4EN7B 3L2VA 3VSLA 4OMCA 1Z77A 2CV0A 3VFZA 2NVUB 3DKXA 4LK6A 1B9NA 2KZVA 4Z8BA 2LSOA 5F5QA 3WU1B 1DQ0A 4C91A 2X1EA 3ZM8A 1YIFA 1J58A 1XE8A 2PAEA 4M3BA 2Z42A 3F72A 2VT3A 2Y38A 3TMOA 3O1SA 3SEQA 4JGZA 2XLGA 4FE7A 2QEXI 2A69F 2M4KA 3AP6A 3AKSA 2DYRH 4I30A 1W06A 1DGWY 1VB4A 2D40A 1BYHA 2XVLA 1OCCH 1SFEA 4I0AA 2VBPA 5DXDA 3VDDA 1LAJA 4KU8A 2ZB9A 1GMMA 1Q3EA 2Y69H 2RQQA 4QGMA 5A6YA 4J19A 3HN3A 4A69C 4XBNA 3J81Z 4DOZA 5FQ0A 3OOXA 4YW3A 4AIDA 2CUZA 5EJZB 3H3ZA 5D5WB 3CDIA 1MMSA 4B4RA 3BI3A 4DEVA 1Y43B 1Z78A 1VAKA 5JMOA 2DDUA 4QX0A 4LK1F 4EN9B 1GZ9A 4RGKA 5CFCB 2VBXA 3K1PA 1MEC3 2ERFA 4E9KA 3VBOB 1O57A 1MJAA 1ZZ7A 3CIHA 2JDAA 4QGNA 2E2HJ 2AQFA 2VAUA 1YNAA 3PSIA 3J4UH 4RHV1 2HOAA 4QX7A 1PUEE 4CU9A 2HKXA 1SAUA 2L0KA 1LU1A 2LRDA 2X6XA 3SDGA 1FNNA 4PIYA 3H8XA 2JTVA 4OUMA 2XLAA 1IG3A 4GWNA 1QJEA 1V5FA 2BOLA 3ZPOA 2PQSA 5I93A 1G9FA 2OJED 3K4JA 2WN3A 2DYCA 3ZSLA 1MS5A 4NQWA 3L2CA 4OQ8A 3NSTA 1DU6A 4JDOA 5IK5A 1KJRA 2F2EA 4M6XA 5FUIA 4D6RA 3CLOA 2BNOA 1VBA2 5DTDA 1WSUA 4IE0A 4FETA 2FMDA 5FP9A 2HYFA 5C8CC 4NAMA 2C5DA 1AJKA 3ZVXA 4CP1A 2B46X 1GWMA 3P6BA 5FYCA 4Q0PA 5FFXA 2ZXQA 3KLSA 4J01A 1TLHB 4BNCA 4AI0A 3MKYB 1C5HA 1ZBE1 1OCRH 3R4DB 5JSRA 2BHZA 2Y2ZA 3VBOA 1WMEA 3J26N 2YXSA 1RUH1 1DU0A 2CDPA 3B9IA 1H6YA 4ASMB 3V0BB 2W87A 3GMEA 4HRIA 4DPNA 2EALA 2V6CA 2WA0A 3CDHA 4XJZA 2W5FA 1ND3C 4XBQA 1XE0A 3I3EA 1VFCA 2BRTA 1MIJA 5GAGJ 4CDXC 1F2NA 1WJBA 3OS1A 2D6MA 1VRH1 1FP2A 4MUVA 1PK6C 4XFBA 1ZGJA 1NKGA 4IQ4A 4A7ZA 4AQSA 4LJZF 1Y56A 2EPFA 2E31A 2DVGA 4UFJA 1VBC1 2EZIA 2BDRA 3HUGB 5JZGC 5L3CA 4IOCF 4AHXA 1UW8A 3TW7A 3BZCA 2WS93 1UZVA 2V1DA 3W5MA 1YTYA 5DG1A 4M4RA 1W0TA 4Q4Y3 4L5IA 3M7GA 4A6EA 3D5SC 1WW6A 2W08A 3HR9A 3VZOA 3D5OA 4FT8A 1AR83 3TEZA 2MC4A 3K46A 2VUDA 4PJMA 2Q1MA 3D5LA 4I2OA 2YSRA 2IXSA 2MGQA 3HRMA 4IEOA 1D2SA 1P6RA 2RS33 3ISPA 3CNAA 1V00A 2DOFA 1OF3A 3LPFA 2JA8J 3O2PE 3ZR6A 5E88A 2WINB 3V0BA 5FB2A 2M3AA 1RIOH 2A3YA 3WGGA 2HWE2 2KISA 4U0YA 4IV1C 3WG4A 3AP5A 1XE7A 3ZCOA 1F1ZA 3LOIA 5EJCA 2GC0A 3FK6A 1QOSA 1QQP2 5CVVA 1IXRC 1E0EA 3LE0A 5EHDA 3HUGA 2R0QC 2HXIA 4XVHA 4BQ1A 2JA5J 1Y1WJ 2RDSA 2CJJA 4LBNA 3IMMA 4OVEA 1OQYA 5FY9A 4A42A 2WYSA 3W2WA 1STZA 3UKNA 1S55A 3GNEA 4NHLA 2G9FA 5FYUA 5GPAA 2HLEA 1QHDA 4UVAA 3OGRA 4ZDLA 3FHAA 1W4MA 2K9LA 1VQPI 2WNOA 1CIWA 1GZWA 1AR93 4YG6A 1SEFA 2VOVA 5K1YA 4ISRA 2GH8A 2HWD3 3TO7A 1FIAA 2EFQA 3DTIA 2ZJQF 1ODNA 5LATA 3ZYIB 2YC0A 4AHWA 4FP2A 4L97A 1HKSA 2K86A 3UR3C 2ENRA 2E19A 3ZQ7A 1W8NA 4KH9A 5C70A 3R0AA 3POIA 3QOPA 2O0OA 1XSDA 3T8RA 3ABUA 1TT5B 3COAC 1CF7B 3ZYJB 4I0WB 1LB2A 1SLCA 2BGPA 5IP7J 3H9JA 5IVBA 3DYOA 4YPJA 1HC8A 1RUD3 2FCTA 4QPGC 1K42A 3KS7A 5JLVA 4LD5A 1Z7S2 4M3DA 3ZXKA 4K7JA 3BR6A 1TMF3 1ONAA 1YW7A 4MXVA 4RAYA 2PLV2 1APLC 2VL8A 1ULOA 1XMXA 4U0WA 4LTAA 1G3TA 2QQWA 4A0YA 4GXOA 2FRHA 3ME2A 4HL0A 2RR11 3HBLA 3F3XA 3HOXJ 4I01A 2V79A 4HEA2 4KN4X 2ZGLA 4HLXA 2XVKA 4XEZA 1XB9A 5KC5A 3E97A 2YC4A 4XLEA 4OYUA 3LSTA 3OG2A 1BR1A 2ZFWA 4KT6A 3IDEA 5HVQC 1DBNA 3GF6A 5DV5A 2M2EA 2E2JJ 3KT1A 5KK1A 2Y6HA 4E7HA 2ZGSA 3W6JB 2VECA 4BLJA 2GN7A 2E32A 4CXFA 3WF1A 1AXKA 1H9PA 1CF7A 1C8M2 3GCWA 4Y7NJ 2LTNA 1A8MA 2RDQA 2JECA 4UW3A 3LWFA 3FXMA 4UWDA 3CJIC 5LW9A 3C3WA 2DXIA 4P5YA 1AX0A 1LEDA 2RS51 2VE1A 1M06G 1G7YA 1FSHA 4CCEA 4AU7A 4ZTJA 2QF7A 3VDCA 5FZ7A 2HWF1 3N9PA 2QENA 3TOAA 2A07F 1R58A 1MSFC 1WQ2A 1S8NA 2HWC3 3KGLA 3HGYA 3DEEA 4MZUA 1N78A 4YVSA 1D0HA 1RHI2 4M6VA 3WTSC 4M9XA 1S5LC 3PO3J 4JVAA 1Y9GA 3O8HA 2HR3A 5FKOA 2HQAA 1VQ9I 3PDQA 1S2BA 5LD2C 1W1WE 3QH7A 2XQXA 1SLBA 3FFZA 3X29B 3QLQA 3AG2H 4BDZA 2R7OA 2Y9ZA 2EJRA 4YM1A 3KF3A 3GTGJ 5F9TA 4EJUA 1V9U3 3EB7A 2HYXA 5EG0B 3PUHA 1JZ7A 3BY6A 3HOBA 2O8KA 1BJZA 1FBUA 2EILH 2HPMA 2X05A 4QM9A 4HLYA 4HQEA 3O1RA 4CA9A 1REFA 1D5YA 1XC5A 3CMMA 2UWCA 3ZYRA 3S14J 4E7LA 1OA3A 5LBFA 5JSOA 4OFGA 3RI4A 5L3EA 1CESA 3HL2A 3KPHA 2OX0A 4W8JA 3DPTA 4XLAA 3OBRA 4Q4X2 1JI6A 3GX4X 2BWAA 1K45A 1XNDA 4Q4W3 2OYZA 3BUCA 1CZTA 1FY7A 1NCQC 4FPCA 1I3HA 4MHGA 3RKXA 3AMPA 1W6OA 4D6SA 1ND2B 4CU8A 2DOAA 3GZUC 3LEIA 3NJVA 5FPVA 1WH5A 5A7NA 4FPJA 4O61A 4ESBA 3NQOA 1D0ZA 3VD9A 3AMQA 4IW3A 3MLJA 2ZGRA 2J1RA 2NMNA 4QQ2A 3DEUA 3GVAA 4YFXF 2B8MA 4QAWA 3KEYA 2SBAA 1SPPB 3AKPA 3AFHA 1CAWB 3LAJA 4ZU7A 1W2OA 3ESWB 4P1WA 5B1BH 5CPRB 4YELA 4OI0A 2F5EA 2YX4A 1NLSA 2V4JC 5ERIA 2Q8EA 3B00A 4E2GA 2AXTC 2XUMA 2H0VA 3QPTA 2ADUA 1OLMA 1FOD1 3C7EA 5FY7A 4KDPA 1CQ9A 4GKYA 4LLLA 1G86A 3KV9A 4Q47A 3KP5A 1W5TA 2IW5A 3VBHB 2GXAA 2J1AA 5GZFA 5CG9A 2X1CA 2PMZA 3NJYA 3I9V2 1JKRC 4JQTA 4ES9A 4GAZA 2QQJA 2CV1A 2MFZA 2J1UA 1IF1A 4GCVA 3RYPA 3FXKA 4CDQA 1UIJA 5AIQA 3T8TA 4HPQA 2E1MB 5KXEA 5FREA 5D21A 2IJLA 1JKOC 1HQCA 5JHUA 3AK0A 2GSYA 3CQOA 4E2SA 1N3QA 4LORA 2X6WA 3GCMA 4CEYA 3GFLA 1CAWA 1O4ZA 3NVCA 5K5RA 3FZ3A 3WTZA 4ZS3A 1KD7A 2WZR3 2L4AA 2A05A 5E89A 4Y4YA 4FTHA 4DZJA 2XKOA 3S3MA 4FP3A 4XKCA 4NRMA 4IXLA 1S9HA 2XGCA 3CCSI 5IVCA 1WFXA 1UG0A 1T2KA 5ERLA 4QHZA 1EUTA 4Q5OA 5I0RA 2BVBA 2ZAAA 3VBHA 4XDOA 4EJWA 3OY8B 5DDJ3 2H6CA 4FPEA 4TWTA 2JA2A 4Q8KA 4H14A 3KQRA 2IFRA 2VKDA 2JXAA 5H9QA 1FMWA 3M8LA 1UJ8A 1MD0A 5JHFA 4FHTA 5F39A 3BN6A 3BKZA 2R063 2FSWA 4FO9A 2K02A 1OLRA 4HX7A 5JXHA 4YFKF 1AR72 4FPLA 1J84A 2QSHX 3VBUA 4M3CA 5DAQA 2H8RA 3BG3A 3W6VA 3NARA 3H9AA 1YHFA 1WCKA 2QBYB 2DURA 1X9TA 4XF1A 3HB9A 1GZCA 2IGNA 4A44A 5GTHC 1KJLA 1BHGA 4V2VA 3ECOA 4YIIA 5LHHA 3OS0A 2B9UA 4GKXA 2V26A 3O14A 1VF9A 1JJ8C 2ID4A 1G3WA 1WLWA 3WODF 4AL9A 3OIOA 1UKGA 3GTLJ 4UBGA 5DUWA 1XYOA 1J9IA 2JG9B 2K7LA 2ZHMA 2ZGPA 1HXS1 3UNPA 3HQXA 4AK3A 4XN3A 2VZPA 3K3OA 3MO4A 1RVF2 1DZRA 3S8PA 5BOXA 1WH7A 1OURA 1VP6A 4QD2A 3L7WA 3MD2A 1FZPB 2WA4A 2R7TA 3JD73 5DM6F 4BS9A 4ATFA 3IC7A 1Z67A 5EZHA 2MEV3 2A6TA 3T09A 5FLXZ 3DBRB 2W0XA 4UW6A 3CLQA 4CH7A 3OYCA 1F8VA 4BE3A 3PJQA 3VODA 5ICFA 3U14A 2OVUA 1JU3A 2ZMEA 2QBYA 4R8HA 2PMZN 3QPSA 1G8WA 2K40A 1NQDA 2XRLA 2KIUA 4RS5C 1PX4A 1V4RA 4E4HA 1JXNA 2A6VA 1F9NA 1CX4A 2XROA 2D3SA 4AM3A 2D6OX 4HNTA 5JLWA 1T8IA 3GJAA 1OF4A 2PI0A 1TEIA 2JUGA 4HFSA 5KWRA 4HDUA 2ISYA 1E5IA 2XG3A 4GH4C 4QTRA 2Q8DA 3VB2A 4BQ2A 2WFF3 4GMP1 2XGDA 2VBDA 2ME0A 1TZLA 1LR5A 3VD4A 4BDVB 2XR4A 1SLTA 2PJRA 3AP4A 5IT9K 2L7ZA 2AGSA 4XABA 1RGSA 1YW8A 5F3IA 4G6TB 2NAZA 3OBZA 3ZDVA 1YX5A 1RUF1 2BERA 3NQHA 4EQQA 2VODA 3RYKA 4LOCA 2YC2A 3PUBA 1GWKA 1KITA 2V09A 5J4YA 4LIUA 1MQTB 1RI7A 2FQ4A 4XFAA 3IH2A 1ZYRF 2AC1A 1LJ7A 5H6QA 2EZLA 1GLHA 4RA0A 3C7OA 3AYEA 5IVJA 5JR2A 1XMKA 2X53S 4IPAA 2VXZA 4IO9F 2PX9A 4JRLA 5DMYA 1B59A 1ODDA 2CYYA 3CD6I 2D2WA 1UY1A 3UJOA 4IE6A 9ANTA 2NPIA 4XOGA 3KCYA 3WT3A 3CMEI 4HX8A 3VN4A 4CCMA 1UOJA 1V6MA 5IK4A 4H2AA 1PVC1 1S0FA 4ET7A 1PZ7A 2WL1A 1LENA 4EQVA 1PGW1 1NE6A 1W0PA 1RMU3 2ZNZA 5HNFA 2ZHNA 3CP8A 1HSTA 4Y20B 3WCSA 2V9VA 3VSKA 2CRGA 3IKVA 2PEXA 4UUSB 1H2KA 3I2GA 1LFPA 3CZJA 1P4WA 2VJ4A 2E9QA 5AC92 1JJ6C 1Q43A 1U5TB 2ARAA 3LSHA 1MQTA 2A70A 1YO8A 3AZYA 2EICA 3MIHA 3VBSB 3JB8A 3CJRB 3MV01 1MNEA 5JI6A 2ARBA 1SLAA 2F5VA 1AJOA 3WINE 4CU7A 3JW4A 2QFEA 5CFDB 1JT6A 3G4SI 4L0ZB 2TUNA 3OYHA 1YHQI 4OCTA 1BR4A 4XF9A 3A0HC 3Q9OA 3FDYA 2RNGA 4AAXA 5E1RA 1DF0A 2XDVA 3MDPA 3MN2A 1W99A 1SD6A 2P5LC 2P17A 3A4CA 3FISA 4QKDA 3LQRA 4HNVA 3E1F1 4XJ8A 4Y22B 2UV1A 3LSGA 3SQOA 3S5QA 5A33A 3M4FA 3CUQB 3E6BA 3O0VA 3PNYA 4Y3OA 3MAJA 1W36D 2D3PA 5T50A 2YZ4A 2GMEA 4NC6A 2VH9A 1XSRA 4XOTA 1RJ7A 4X8NA 4IETA 1U5TA 5L3DA 1POQA 3FBMA 3VV1A 3IDAA 4PLNA 4GB32 5E6HA 2JDHA 3VBSA 3S7EA 1MS8A 5M3MJ 4L0YB 4QPWA 4ZH4F 3FHZA 2W2IA 2GBYA 3IAS2 2QQLA 1FOXA 2QA4I 3HGGA 2ZGKA 4EN6B 4BY7J 2QDNA 3ES4A 4CUBA 3CC7I 1DFQA 1NH3A 5FY1A 2BU9A 1YLLA 2ID3A 3DTKA 4I09A 1YFYA 1DP7P 2ZGMA 2XMLA 1BOAA 1N77A 3N36A 3I3BA 4ZXEA 3CO7C 5J09A 2D6PA 4FXGB 5C8WA 4C3IJ 3JREA 4LE4A 5FKMA 4AFBA 3BT9A 1GNYA 1IZ1A 3MF6A 4G7HF 4BHCA 4XXPA 3LGRA 1O3QA 4Y22A 2BFUS 2DOEA 1YUDA 4QKBA 2OXBA 4J25A 2DA7A 3TB0A 3RYRA 3ON7A 5FMOL 4UVCA 4Q4Y1 2B5HA 2R7DA 4A3EJ 2VQUA 1R093 4ZZDA 4FCYA 2DAOA 2DCEA 1AYN2 1SFYA 2B7YA 1X4PA 2ET1A 3BVCA 3TEWA 3ZDSA 4AR2A 1PO11 1WJFA 4H0EA 3H7YA 1YC61 1ZK8A 4EGYA 3GYDA 3OSDA 1X1BA 3V7RA 1HRI3 4IEQA 2W00A 5DCFA 1TQPA 4XQ4A 3AMMA 1D2QA 2CWMA 3HNMA 3IAQA 2OD5A 4P9LA 1UU6A 1OFNA 3OL4A 1EF4A 3UKTA 1A6CA 4GWIA 4BY1J 3I49A 3AL6A 4XCBA 4BXUA 4JDMA 2Y9YA 1UHSA 4QXHA 1LDDA 2WTEA 3AZWA 1W8OA 3ERED 3LEGA 2DFFA 2EFPA 1A6IA 1NXMA 5DS9A 3KF5A 1YIJI 3GXOA 2CWSA 4XAAA 5LEJA 1TWFJ 2BYVE 3U78A 3V8KA 5L19A 3WY6A 5J36A 1AL23 3PVBB 4JX5A 1IDZA 2BTVC 3FXRA 2VOWA 3ZPLA 2R072 5FZHA 5GP9A 2R0FA 5HCAA 2GXBA 4MFEA 2EWNA 3S7IA 4PJNA 2PAKA 4FFHA 3S3OA 2W4SA 1USSA 5CNAA 4QQPA 3JZVA 2DCJA 5E1WA 3BTIA 2M4GA 1X9PA 2BP6A 3MYXA 2NS7A 1KYWA 2A68F 1SMYF 5HBAA 4XHXA 4BE0A 2VVDA 3AG4H 4CP9A 4G12A 1PNGA 1KQ9A 2HH9A 4DXZA 1DIWA 4HF0A 1W9WA 2GA2A 1LOGA 1HQNA 2OPWA 1NG6A 3RZGA 3TEXA 4M3FA 1OJLA 1G9BA 4HYEA 1QJY3 2Z16A 2JMWA 1IRZA 1MVEA 1UOBA 3NAUA 1ZYBA 2OCCH 1SBDA 2F4PA 3ETQA 5IYDJ 2A5ZA 1Y39A 5DQ0A 4DYQA 3EYIA 1XYNA 4HN0A 3RZMA 3HG9A 5FXZA 2D97A 3QYEA 1M4WA 5DD8A 5EIYB 1SVMA 3I3MA 1HLCA 3KVAA 2NN8A 3DKWA 3TN93 3CF2A 1I1EA 3JXSA 2COBA 2IRFG 2XAQA 1DGWX 2W3JA 1GQPA 2BNNA 1KQ8A 4FTBA 1OKQA 4OHYA 5D4RA 4B3AA 4RB1A 1YQ5A 5B5EC 2R043 2XAFA 5A1FA 4XJ9A 3KV6A 1WJEA 5DUIA 5B66C 3FUQA 3X2QH 2VD7A 2BZTA 1GYKA 3AFKA 4NE9A 2FJ1A 1ZR4A 4BMBA 5IYCJ 2LK2A 2PG4A 3WHUA 1NA1B 4Y4RA 1BW5A 1VBB2 5CISA 2EF6A 1IXSB 3OYNA 5E18F 1NHAA 4P9WA 3TO9A 4YVWA 2RS12 1DYPA 2CL2A 4C0HA 4QKFA 3HHHA 1QWRA 4NO4A 5ILUA 2RKHA 3B02A 3POSA 1UPSA 5LEKA 1X82A 4ASNA 1QXPA 2B0LA 4UNOA 5K7PA 2G19A 1OOPA 3ZQQA 2JIGA 2LBFA 1JGGA 1VQLI 1QJZA 1UB9A 3WP3A 3PNTA 5FZ6A 3AM2A 5DUUA 2L2OA 5ACA3 4AVAA 1VQ7I 5A3LA 1SD7A 3T5XA 4A3FJ 2GOMA 1UU5A 3WX5A 1EV13 4AE2A 1J09A 4XM3A 1L0OC 1NXD1 4PBPA 3RI8A 5KHJA 2Y64A 2BWCA 5F8PA 2DA3A 1VNDA 4MX3A 2VMHA 3RJPA 1ZRFA 3NJZA 1FX5A 1G9DA 1K5MC 3GGLA 1UAIA 4IV3B 4HKWA 2L7KA 3OTFA 4GRIA 1RZ4A 2V4VA 5CLSA 1NA1A 1L7QA 3NWSA 2P81A 3PSFA 3ROUA 1BBT2 4IHWA 2P7CB 2VJXA 5FZMA 1XD7A 3HYIA 3O0WA 5LGUA 3DEMA 1H8TC 5F1RA 5JLXA 1XNBA 2ID6A 2PHLA 1W2UA 4LBJA 1I1SA 5JI7A 3PIPF 2EINH 3VZKA 4KG0A 2DCTA 4DUWA 1H2LA 1AYM3 3LZZA 3PFIA 4Q4W1 2XAUA 5KBFA 5J1UA 1RUG3 3WW4A 1CN1A 3SEEA 4IX7A 2L7FP 1Q8OA 3AZXA 1IG7A 4Y17A 5FO9B 3CESA 1A35A 5A3OA 2R7UA 3FFQA 3GFIA 2ZX4A 2YX7A 3R4SA 2CSOA 4U7DA 4EWDA 3BOWA 1LGCA 1SLIA 1W8TA 3CCYA 3KP7A 4CHUA 4FQ4A 4N0BA 3LAPA 1O3RA 2HWE1 2C4XA 2QVSB 4ENNA 3WGIA 3JRDA 1V70A 2CAUA 2ZXJA 4LG0B 5FJ8J 4IUGA 1SFPA 3I2OA 5FO7B 1U3EM 3ULQB 4EEFG 2VG9A 5L7OB 1QA6A 2XB5A 2MPFA 1F31A 3WE3A 1RR7A 3HJEA 3O3KA 1R71A 1FOYA 1I39A 2FA5A 4P9GA 1VBA3 4BQ5A 2HOSA 4AFCA 3DPLC 4EM1A 2VASA 3WNLA 2QQ8A 4IKFA 2DUQA 3HMYA 5J96B 3FBYA 3BPXA 3J7HA 1OFSA 4ZY9A 4AEKA 3IH4A 4BE2A 3HSFA 3ZMDA 3UGGA 4A7YA 3FLRA 3DXUA 2NS8A 5E8IA 4D7YA 2WABA 4II2A 4ENMA 4LOTA 3OYLA 4L9VA 1D1AA 2E51A 2W7NA 3LKJA 3M3IA 2HS5A 3CJTB 5C8CA 4AQ6A 2VCMA 2UURA 1COV3 1TME2 4RHV2 1T39A 5FBJA 1W7PA 3JSPA 1VB2A 1DYOA 5GKAC 3OYJA 4BXSV 1R22A 2O1QA 4BQWA 4E4SA 4JTNA 1A5JA 4OU0A 4W6WA 2PQQA 2BY1A 2VW0A 1YYVA 4A6OA 4U36A 4YG0A 2CW0F 3BG6A 3OGGA 3EUHC 4LG0A 3USSA 3HRTA 2O9LA 1KDKA 4O9EA 1F5JA 4BQ3A 3VYSB 3BR3A 4BAYA 1ND3A 1ZKGA 2L54A 4U2AA 4CDXA 3BTYA 1ULEA 3S1QJ 4DS0A 2C6YA 1JOPA 3DGTA 4EJVA 2PHRA 1NCRC 5M5WJ 1XDUA 2M8EA 3S3NA 5DDJ1 1OHFA 3TW6A 4CSWA 4CEWC 3RFRA 5JZGA 2X5IC 2DVDA 2W39A 5LA1A 2P6TA 4I76A 1ETVA 2HWB3 1ZBE2 2F5CA 3H9GA 1ZM1A 1D5VA 2NOJB 1XGSA 4Q4V3 3MBWA 3N97A 4XUNA 5LHIA 1RUH2 5KVRA 5ABJB 1Y0UA 2CV6A 4ZYDA 3ZIXA 2Q5TA 2VMCA 2HTJA 2VCBA 1MS0A 3SH4A 5FKNA 3B94A 1OCTC 2J5OA 1IS3A 1LJ9A 2CQ7A 2ZEZA 2VPVA 1R00A 4X6QB 1AHDP 3CCUI 1ULDA 1VRH2 4ZZLA 1T6GC 4O6JA 4Y15A 1DDLA 1TW3A 1XNCA 1VBC2 3HVDA 5LZ6A 5FD5A 3P3PA 4PGHA 5IUQA 1GWLA 1C8M1 1OR7C 3FE5A 2ZHLA 1ZBA1 3IDBB 2JENA 2ZEYA 2D93A 4Q27A 1PDNC 5G04L 3ELKA 5A7OA 4NB5A 2B42B 2ZX3A 4B3XA 4N4NB 2EIBA 3ACHA 1MR5A 4Y1VA 2BVVA 2UWMA 4MEXF 3DU5A 1ETXA 5FMOS 4ETSA 2DMPA 2Y31A 3WGHA 2YFUA 5F3CA 4RQPC 2LY2A 1W0UA 1PX3A 3VBRC 1JHFA 3HRUA 4XLFA 3LD8A 5KC6A 2NZ9A 4MG2A 2WV0A 3WG3A 1SVLA 3NJXA 2OQGA 4CCKA 1XPXA 4HT1T 3DPRC 3HOWJ 2YBKA 3QYFA 4KT5C 3BC8A 1O4XA 4MIMA 3FMSA 5FFOC 2MD5A 4V2FA 1VBE3 3C2HA 4AVSA 2QWWA 2ZKZA 5DAVA 4B44A 5FJKA 2F4MB 3OYBA 1EAH3 4NROA 1SFNA 1A04A 3OPTA 5ILSA 2DUOA 2L3DA 3AVSA 3H0DA 3AL0B 1D4M1 4E27A 3Q8AA 4F91B 4UF0A 1TQMA 1NG0A 1ZRIA 2R7XA 5JWPA 3IWFA 2WB1A 5ANQA 4HDVA 1CAUA 2FNAA 2E7TA 4ORFA 1D3YA 1BK1A 5DZEA 4QXBA 3CU7A 4ZYGA 1EH8A 1W6QB 1W2AX 4CYDA 2IGKA 1X3UA 4QQLA 5TSWA 3BZKA 4OOIA 5C4XJ 2OBPA 1LOCA 1DGWA 2LKXA 2ZJCA 5A32B 3MEXA 1X2MA 3BB6A 2ZXHA 1G2HA 2ELKA 4QPQA 2LY1A 4B4CA 4D0PA 1TVGA 3FN9A 5FO8B 2QQPA 2PHXA 3J7ZI 1SFKA 4HKLA 3ZMNA 2FDHA 3LB9A 3FBNB 4YM0A 1YFXA 3J7NA 3LQCA 1XGNA 1D8JA 4FQGA 1OFCX 4IEWA 2OA4A 1Q56A 1GV2A 2W95A 2YR2A 5JOYA 2XAJA 5FZLA 3NAPC 3VZMA 4F7ZA 2X9DA 1DQ4A 3F2ZA 3HM5A 2OU2A 4G6DA 1XYPA 1UO9A 4JCKA 3S1NJ 5D8LB 2JT1A 1KEXA 3QH6A 4HSRA 1IQAA 4S2HA 4RB3C 3ST7A 3MF9A 3MQ0A 5EEAA 2KJCA 1ZLJA 2K4BA 2MSYA 1TNRA 4HSTA 5K5QA 1B8IB 1C1LA 3WE2A 3ZRGA 2Q1FA 3O7OA 1W6QA 2G0EA 3DL3A 4M9SA 2ESNA 1O4YA 5FYZA 4HW0A 1FXZA 3ZSEA 2JK3A 3H36A 1FTTA 2RR12 5JUVA 1RHI3 2B7EA 2ZX1A 3MFKA 5KHHA 4Y24A 2UWBA 3V7SA 4LUMA 4TXWA 2F5DA 4P08A 2WQ4A 2CMPA 3G1LA 4PIZA 1SQ4A 3R4UA 5F5CA 2OF7A 1TW2A 2XRNA 3V4GA 3JCIA 3VKNA 3B5LB 1MGTA 3ZMUA 2BW8A 1OLME 3WNMA 1TQ5A 4ZS2A 2K3FA 3CF6E 5FYIA 1SMVA 4PK4A 1UYZA 3GTKJ 3ACGA 2DPDA 2D43A 1WLTA 4BIFA 3J7AO 1WCSA 2O3FA 4D7NA 4Z82A 5K7HA 3HIFA 4JX4A 1V55H 2COMA 4XONA 1LOBA 5DABA 2HQ5A 3P9IA 2XPVA 1REDA 3VZJA 2AS5F 1B8IA 2AENA 1BM9A 4Q4X3 4MFDA 1F5TA 3ES1A 3QRFF 1O59A 5M5YJ 3VDAA 4XRMA 2FOKA 1IAWA 3EYYA 1WJCA 3MFAA 3FC0A 1R1VA 2CQKA 1FNYA 4R79A 2BY0A 2X1DA 3CQZJ 2GP3A 2R3SA 3MGUA 4D3WA 5HS8A 1UFMA 1Y4WA 1K6OA 1DPRA 5HLTA 3TQNA 2XJSA 2WB1N 3JAMK 1YQ6A 2CYFA 4U7BA 1NCQA 3KWVA 4CP0A 3C7FA 5KHIA 3CC2I 1AR62 4AEDC 1TBXA 5FPAA 2YU2A 1R1UA 2EV6A 4BJ6C 3T30A 2PQ8A 3N9NA 2XHKA 1LULA 4KWJA 3USUB 4NC7A 3GZEA 1JUIA 3POJA 1LOFC 2ACJA 1KZHA 2VMDA 3WV6A 5LK5A 4XHBA 3HBZA 4JX6A 3ZN6B 2PFWA 4M3CE 2VKEA 2AR6A 2Y33A 4GIQA 3N7KA 4N43C 5CKMA 4BK5A 2HDWA 4DYCA 1Z0XA 4DUXA 2J1EA 4NC8A 3SHRA 1H2NA 2YBPA 5FFZA 2N8GA 3WU0A 2VNVA 3IMNA 4LLNA 1UELB 4XE9A 2ELJA 4GGGA 2TDXA 1R091 5F5IA 2OZ6A 4D7MA 2JN6A 1JUSA 3WQBA 1X50A 2EFOA 5BNOC 1V0AA 4M01A 5D2AA 3RZHA 3WNNA 3Q8FA 1RINA 1LNWA 1GU3A 4UFMA 1HRI1 4NIHA 3VBFC 1FOD2 3URFA 4E7SA 3B6CA 4UXNA 1K79A 4A45A 1LDJA 4D7TA 4HVOA 2ECCA 4Q0VA 2QQOA 1VQ5I 2DFEA 2WAQN 2FF4A 1K78B 4PF5A 1U78A 4YNIA 3DTEA 4PJLA 2B9SA 4B1MA 2OIIA 3ZN6A 1UPIA 5H2FC 4LBMA 5J1YA 4FVVA 2VONA 3IUOA 4OAYA 3A22A 5CU1A 2KZGA 4CDWC 2E6VA 2QDRA 4A0ZA 2R16A 2D98A 4CCOA 3HC7A 2XASA 2IS6A 2Y6LA 3EXUA 3KM5A 3LA3A 4XJUA 1HW1A 5E8AA 3WNXA 4LPLA 2G7UA 3WDVA 3U9GA 3H3VK 5BV6A 1AA7A 4HG6B 2ZTNA 2ZZJA 3FX3A 1PO23 2CFOA 2IZWA 3F8BA 4KBBA 3M2MA 5DCMA 1UOFA 1BXHA 4FASD 4TLFA 3FMGA 4R4ZA 3ERMA 3RZDJ 4ZTFA 2UYAA 3BCBA 1S0DA 5ICGA 2AEYA 3DECA 2O8QA 2ORZA 4MGRA 3S2WA 5I8YA 1FX7A 3BCWA 2C6SA 2JPCA 4A6DA 5KHKA 4CDUC 3D5RC 2ES3A 2E34A 2XB6C 1BBYA 3L9JT 4HMZA 4HETA 1XPWA 4RS8A 2XAGA 3POYA 2KM2A 5GZCA 3A1YA 4XBLA 1L7LA 2QQKA 3OUHA 3V65A 2HZDA 2DU9A 5A80A 4RM3A 1CVNA 2EBIA 3HQUA 3CDLA 3AVRA 2L9SA 1PGL1 4DFSA 3BPSA 3I5UA 3HOUJ 5FV3A 4B7EA 2JEMA 2VVFA 4QX3A 4RR3B 5K5OA 3BGAA 1JYNA 1RJ8A 1VLNA 3DU6A 1RPWA 3WLUA 2EXJA 3CUOA 2W1UA 4EV0A 4AXOA 1H1IA 4M3GA 1U9OA 1ZA4A 2R1BA 4XXAA 3S5AA 3LDRA 4CYCA 1AXYA 2RM23 4M6YA 4XFFA 2VQGA 4JTOA 2E1OA 2CQQA 3OOPA 1BJAA 2A6ZA 2GA1A 4JV4A 1B35C 2P5VA 1JMUB 2CFXA 2HDDA 2ME6A 1XB4A 3IDCB 1HXS2 4N53C 1HDPA 4RS5A 1X8MA 2NOGA 4A3BJ 4H55A 4H3WA 2GC3A 3K4AA 5TJJA 4AI8A 4UUVA 3WVJA 5L9VA 2HOTA 2AXLA 3VDBA 3OJBA 4IGPA 1SAXA 4ESFA 1GANA 3ZFGC 2BVLA 2VOKA 2GXGA 1LHVA 3WP4A 3GTPJ 1S0GA 3BTAA 4GH4A 3FXUA 3ZFFB 5KHGA 4XKVA 1AXZA 3FJSA 3U10A 1WA4A 4FOVA 5C44J 1GQGA 3MIBA 1JZ5A 5A6XA 1WKYA 4BH9A 2XB0X 3K4DA 3I7DA 2E2IJ 4JKLA 3L09A 1PP7U 1JUMA 3O1UA 2GN3A 3RQ0A 2E5ZA 1JH5A 2HVRA 1W8HA 3LIHA 5ACA1 2HFHA 2HI3A 2Y6FA 2ZBKA 1MNDA 4KIFA 4CCLA 2W85A 1EH7A 4D6QA 3LDKA 3CF5F 3A7QA 1EV11 4R9BA 4A3LJ 1NZCA 3MPBA 4WVMA 4AGRA 5B1AH 2OQ7A 2RJ2A 2MYSA 4QX1A 4XIKA 2XL7A 1ZZ8A 5EPAA 3ZGKA 1YJLA 4G4FA 4LKFA 2ZBJA 2ZZQA 5I0UA 1YWKA 1D8KA 2FE3A 1GICA 1R5GA 3AP7A 3GM8A 3SJMA 1D1CA 5BNNC 4AIJA 4J1XA 3G73A 1MMDA 3WHBA 3PFYA 1YOVB 1JXSA 3TGNA 4HSLA 5KHDA 1RUF2 3OR2C 1KFUL 3BR5A 5FYBA 1SMTA 2R5YB 4ZONA 4KIBA 1SFOJ 1IG0A 2PA7A 3O5SA 3FIWA 1FOKA 1AYM1 5FP4A 4B3NA 1FBQA 1X7NA 1QJX3 2XHNA 3KEOA 3S17J 4LO7A 3DBLB 1ULFA 1P4AA 3DLLF 4L9TA 4ZYEA 1QQIA 1QJFA 2OS2A 4YW6A 1RUC3 3RSNA 2PHUA 3GEZA 1ZA7A 2Y34A 4LB5A 4LK7A 2XUBA 4NVPA 1VIWB 1HIXA 2IVJA 1KDMA 3VDDC 4NWWA 1AX1A 1OISA 2DMTA 2MD0A 4LLFA 1HF0A 1QGLA 1R081 3VEPA 5FZOB 2RQPA 2DTWA 1PVC2 4O7XA 4QSHA 2EZHA 3HBKA 3T0BA 1X19A 2DFCA 1YI7A 1VE0A 2HVQA 2H6BA 3O0XA 1PGW2 3ZFEB 4FFGA 2WAOA 4DQAA 4C9YA 3O6BB 2JDKA 2HOEA 4RSUA 2JD9A 5J47A 5JPNB 2A73B 3HPNA 3W9AA 3MLLA 3RPUA 2RMU3 1VMFA 2WV1A 1OSGA 1F9KA 3WXPA 3SCFA 1AL0G 2R5YA 5F1JA 4XFGA 1U5YA 1S2KA 2H0BA 4QQOA 4MXWA 2Q2EA 4N9IA 2I07B 2R6QA 3IKTA 4KWUA 5A7SA 2B39A 2VULA 1BEV3 4ZHNA 1LEBA 1GFF2 4IE4A 2NMOA 1B72A 2DDAA 2FU4A 1FAYA 4YGCA 4XORA 4D5CA 3H8UA 1IXCA 3POBA 2YUEA 5DAWA 3OGSA 2RG4A 4WM7B 3EUAA 2WT0A 2W91A 1P4XA 3AFGA 4B29A 1BL0A 3JBG3 1XDSA 3Q9SA 2FBIA 4UV9A 1WKMA 2BXZA 3CO6C 1POV0 3ZQCA 3I2HA 1JZ8A 4MQVA 3WTXC 4MO3M 3WW3A 1O8SA 1QXRA 3I2KA 4COUA 2ZO4A 5CFCC 4QLCU 1QO0D 3VBOC 1BCXA 4JGYB 4LHKA 5L3GA 1V6IA 3M3CA 4RGGA 1T38A 2WY8Q 4PSWA 1EPWA 4KU7A 2DMUA 3GCXA 3WHCA 4O3MA 2W46A 3FLTA 2HWB1 2F6BA 1LESA 1J7KA 3QAHA 3DWLE 1GNHA 1R1ZA 4NHMA 1PGSA 1HJFA 4P5OA 4PCQA 4I3GA 2DT6A 3OL3A 2BW3B 1UIKA 2JIJA 1YS7A 2LVSA 1STMA 2Y8KA 2WWSA 4JAAA 4OZOA 4RD7A 1A6QA 4BOWA 4KITB 4S2DA 2DA5A 2NQYA 1CAXB 4XPVA 3OEAA 1LVAA 3GTQJ 2XONA 3W21A 2GM4A 3VLBB 3T4VA 5GLUA 1FPN3 5EYYA 3UESA 1S72I 2M5WA 4DGWB 2DA1A 1RRJA 1GVDA 1WI3A 4XMIA 5B4NA 2P3IA 4BQNA 3TNPB 2RAEA 4OWRB 1HDKA 3E0JB 3HOZJ 4QHBA 1VBB1 5AFBA 1OYWA 5ISLA 4UT5A 1VMJA 2YU1A 4QHOA 1BW6A 2RS11 1IHMA 1GXPA 3S15J 4QQHA 2L5QA 4Q4Y2 3BYWA 1FMVA 2DLLA 2KQRA 2EIDA 3GTMJ 1W04A 1XNKA 5AVAA 1WCQA 4PGGA 3V0AB 1WMXA 3I4IA 1U6GA 1XSXA 1SZBA 2HZTA 3GALA 2WNUB 4YWAA 4CZCA 1R1A3 4WM8B 5C7GA 3THPA 2LF8A 1RUI3 4YW4A 1CZSA 3THTA 5FZ0A 2TCTA 3P3NA 5BY5A 3ZX7A 5HCFA 2I45A 4PDWB 1MW7A 2CS3A 1CAXA 4AW7A 1IS5A 1T0FC 3PIOF 5FLHA 1QIQA 3AKQA 5IP6A 3KIOA 4JGZB 4FI9A 5FYYA 5FZBA 5J6XA 3ILFA 4AYBA 4L99A 5D8AC 2RV9A 4BB3A 3ZIWA 1F43A 3D82A 3OYDA 2VZSA 1HA8A 4IQJA 2R7FA 1GNZA 4DRVA 1JHJA 5BMZA 2EB7A 3WP6A 4OHZA 1PMJX 2W82A 2M1BA 1UZZA 5FQ0B 3F8NA 1DQ2A 2M8GX 5FPZA 1SDWA 4S05A 3JRGA 1QNTA 1AR92 1Z05A 4WM8A 4CU6A 3WNPA 2HWD2 4LBOA 4BISA 1JOJA 2PHDA 1AOYA 4AFDA 3WZ1A 3SEZA 5FKKA 1FTZA 1WJ5A 1ENQA 3FL7A 2EH3A 2ZSHB 4YZ3A 1JHNA 4BEHA 4BUPA 4AVZA 5C3PA 4U87A 1W5CC 4DJAA 4IEPA 3G1OA 1X4OA 3E6MA 1HRV1 1R5ID 3I56I 1XCVA 5T55A 3K4LA 2QSGX 1MBJA 2EZKA 5FRMA 1C4RA 4NQWB 3PUSA 4K8FA 1Q8QA 2LREA 4HZFA 1OI6A 1QU0A 1X3WB 4L9JA 4X6RB 2VIXA 1PM7A 3HXLA 2JDNA 5K0UB 1NOVA 4IEJA 1T98A 4IERA 3K69A 4ITVA 2WBMA 4UFKA 3GTJJ 4KMQA 2VOTA 1ON2A 3MPPG 4G94A 3EMRA 2DA2A 5FO5A 5G05L 3OYWA 3TRSB 1PM4A 1E3OC 4RM2A 4XQDA 5DN2A 3KB5A 1Y6IA 1JS9A 4LBKA 4GA9A 3THDA 5E20A 1W9SA 2ZPXA 4F8AA 3DLAA 3K51A 1TME1 4IXAA 2R5ZA 3ZOBA 4XL9A 1Z0HA 1H8AC 2A6XA 3RKYA 1SEUA 2UY9A 4B8XA 3NNMA 3RMYA 4XF4A 2IVIB 2C24A 2VMEA 3WCRA 2FHRA 2EFNA 5HDKA 2HXOA 3P9KA 3MUZ1 2EAAA 1BBT3 3AMHA 3D3AA 1FNZA 2DF7A 1K5MA 2VQLA 5FY5A 3O1VA 1FMD3 1E5RA 5LB6A 5K0UA 2IXHA 3LPGA 5LY2A 1GP5A 1RUNA 1OCPA 2ZJRF 1XJAA 1RKWA 2NNNA 2HQRA 2Y60A 3OOUA 4DW6A 1UKRA 2HWC2 4BBRJ 2YFZA 4RAFA 4NIDA 1H8TA 3FHQA 3L2YA 3FMQA 1X2NA 1KYZA 1H9TA 3VOEA 3QBQA 1RITA 3CMAI 3G6JB 2GWRA 3RS6A 3ZQIA 3RZLA 1MBEA 4AYBN 2I74A 1OBNA 4JZRA 3TDZC 2R7EB 2HNHA 1VBD3 2UU8A 3OYEA 3A0KA 1RETA 4A3IJ 4C3JJ 3HDDA 4A93J 3DCQA 3WHTA 3LSRA 1TWHJ 4GD4A 3BJAA 2HBUA 3APBA 3UKGA 3F95A 2P5KA 2PTMA 2XJQA 4XZUG 4TYSA 2IEKA 1G9CA 1S4CA 4COYA 4M3CF 3PUAA 3K4ZA 2R7ZJ 4FAGA 5FCCA 1KFXL 4AHZA 2R7RA 1RUJ3 2Z79A 3LFKA 4HONA 5H20A 1R9TJ 4DXTA 1YRNA 4EYUA 4PT6A 4ARYA 1N3PA 5BYNA 1JTZX 3BR2A 4CXWA 1SDDB 3BJ6A 1WMFA 1Y3TA 3GJBA 4Q4W2 1O3SA 4WVZA 2YU9J 2L02A 2JDMA 1DGRA 2ZOEB 1GZWB 2MH9A 5EJ1B 1NCRB 1VMHA 1HW2A 3R0JA 3JSOA 1TWCJ 3POGA 1IS4A 1LVKA 4RHV3 4XCAA 4P96A 2A6WA 1RUOA 2F4OB 4Q2FA 2XSJC 1Q5OA 1IN4A 4S04A 4I6ZA 4N7IA 4UI9L 3T4HB 3ZN5A 5D5XB 2W47A 2P1BA 2RNJA 3A03A 2DCYA 3FF5A 3CKHA 1FYMA 3WNKA 1UX6A 1G9AA 3GXUA 2XJVA 5LLQA 3BPZA 4K2EA 1EA3A 4R4XA 3H92A 3K1NA 4BJ0A 3PL8A 1PIV3 4A3DJ 3E5QA 4MQ9F 4XYXA 4LULA 3WTVC 2KIQA 1WJAA 3FXOA 2O0YA 1UYYA 1U8RA 4A3GJ 1MJ9A 1UXXX 4AFMA 1H4GA 2Y6KA 1RL3A 3A4UA 2H1KA 3EUHA 3B73A 4OIOF 1UX7A 1ND2C 1F15A 2O8OA 3N7JA 1W9TA 1MS9A 2OZJA 1UNBA 4Q48A 5JIAA 2ZABA 4ASLA 3MKLA 4OHXA 1PUFB 4V19K 3JR9A 2CUJA 1GLNA 1BN5A 1H1MA 3RZOJ 2DBNA 5DUVA 5E8GA 1NCRA 3WNOA 1W6NA 4BLIA 3SZPA 5FTTC 4RQPB 2O6GE 2PMHA 1XMAA 5BPDA 1IOAA 1WZ2A 1YJKA 2LP0A 2V4AA 2Z3YA 2AO9A 2MABA 1PVEA 4O9GA 1VALA 5FYTA 1HXDA 1VRH3 2WZR2 5J3LA 1PO21 3N9OA 3VBHC 5CADA 2RN7A 3J8F3 5HCHA 1OQ1A 3GZTB 3QPHA 5FY0A 5I8TA 4CZZA 4LKEA 4UHTA 2EV0A 1DPUA 1HB4A 4GWJA 4Q0UA 4QDSA 3TEYA 5DDJ2 2AQEA 2E1MC 4ITCA 4IZZA 1PUFA 2KPMA 2W24A 1OR7A 4XRSG 3ZQFA 4XTPA 1REPC 4NBQA 4F83A 5BUVA 2B45X 1DZQA 4XTMA 4A4AA 4URAA 3SZGA 3REOA 3Q8EA 1OVPA 4YVSB 5J1XA 2V6EA 3LSMA 2J7MA 3S2HJ 3S0MA 5HXVA 3C7HA 3ILNA 5CVUA 1BVVA 1W9FA 3CO2A 3PTYA 4RQPA 1GQHA 2D1HA 2WA3A 2OPKA 1D7PM 2VMIA 3SFIA 3VBRA 4GFBA 3ZSJA 3TOBA 3ZQHA 1X1PA 2DFHA 3OMYA 1VJ2A 4XQFA 3BODA 2BOJA 3DPRA 1Z21A 3KP2A 4B1LA 2QTWB 2ZMLA 1ALYA 1DGRN 3UJQA 4MGSA 3RNSA 3TP0A 1WCUA 1ZBA2 3C8XA 3ABTA 3HWJA 5IT9Z 3T3YA 1C3HA 4YM3A 3CL1A 4FX0A 3A23A 2KXLA 3POFA 2QQIA 2FD5A 1VQOI 1ULGA 2CDOA 2HEYF 4IE7A 5J37A 5SV5A