3MZHA

Crystal structure of camp receptor protein from mycobacterium tuberculosis in complex with camp and its dna binding element
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
225
structure length
225
Chain Sequence
HMDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Camp Receptor Protein from Mycobacterium Tuberculosis in Complex with DNA and cAMP
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription/dna
molecule keywords PROBABLE TRANSCRIPTIONAL REGULATORY PROTEIN (PROBABLY CRP/FN
total genus 62
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3mzhA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3mzhA01
3FM5A 1JHHA 5CVJA 2HQRA 4MGRA 3CLOA 4KL1A 4L9VA 4A0XA 2EVXA 1KU3A 5DUKA 1ZVFA 3KLOA 4NVPA 4ZZLA 1QY4A 2ATFA 3EYIA 3L00A 5ICFA 1H1IA 1QGPA 4HX8A 5J8CA 1UPIA 4HLXA 2H0VA 4YSFA 2DT5A 1YFHA 3SXWA 2WTEA 5KHKA 4MGZE 1C0WA 3ST7A 4CO8A 5HLIA 3CJXA 1ZH5A 2Q0AA 4HV5A 4XF3A 1PP7U 1IN8A 1T2KA 3TQNA 1WLTA 2STWA 2QVSB 1IF1A 1UHWA 4XFHA 3U2RA 4E2GA 1XMKA 1P4XA 1YG2A 2CFXA 1W5TA 3R4KA 1RL3A 2XV4S 1R1VA 2FBHA 2IC1A 1F5TA 3ES4A 3V8LA 2GZWA 4MEYF 5D5XB 3DN7A 2NRAC 3E5QA 3OF1A 4AVAA 5DUIA 1MKMA 2PQQA 4LLNA 4KUMA 4JTOA 3NVCA 4UBGA 2B0LA 2IT0A 4LEJA 3F6OA 1KYWA 4GGGA 4M6YA 2C0ZA 2B5HA 3RIRA 3I4PA 1MJBA 1B9MA 5ERIA 4KWJA 2PMHA 1UD1A 2K86A 5HLGA 3I58A 2HGCA 3LA2A 3RNSA 1DZRA 3GBFA 2XGXA 1A04A 4LJZF 2EK5A 3RJPA 3QPTA 3KGLA 1LEAA 1VTNC 1R5HA 2XROA 3NW4A 1HW2A 5AIPA 1EH8A 3JW4A 2WC2A 3NJZA 2W24A 3J80Z 1LJ9A 1R58A 2M45A 1MGTA 3LSTA 2PAEA 2HWVA 3NL1A 1LVAA 2JT1A 2D1VA 2YX4A 2IXIA 1USSA 5EFUA 4O3MA 3MYXA 3GZ5A 4FBFA 2XASA 4LLOA 3BJAA 4FT8A 3ZMTA 3DXJF 1UIJA 1TW2A 1IN4A 1ZZBA 3J7AO 1O3RA 5DD4A 4LLGF 3ZP5A 2PFBA 4RGRA 2KIUA 4UVCA 1KU7A 4IJAA 3F8MA 4M9ZA 2ET1A 5FPXA 4BHPA 2GWRA 5FPZA 1ZYRF 3L7WA 4Y13A 3O14A 4UHTA 1FI2A 1I1GA 5KHJA 1Z6RA 4F7ZA 5LEJA 2XUBA 1J9IA 2RKHA 2HTSA 3ECOA 3EETA 2BNMA 2MNGA 1K6OA 5CVVA 3IKTA 3N4MA 4WBBA 3SFZA 3ECHA 2IW5A 2MLKA 3M3IA 5BPIA 2M87A 5JCTA 2Z99A 1HKQA 3H1MA 5HLHA 2HKXA 3TGNA 4I3PA 5HDNA 5HS9A 4O6JA 4OFGA 5LGNA 1OYWA 3QAHA 5H6QA 4QGNA 1R5GA 3BCWA 2H27A 3KETA 2IP2A 3CJNA 1O3SA 3FHIB 4P9FA 3HRTA 2O6GE 4UVBA 3RYPA 4LB6B 1ZG1A 1NZCA 3IBMA 3E3VA 4X6RB 3RDIA 3EJKA 2W85A 1KU9A 3MFKA 3FWEA 1YQAA 3HT2A 1DGRA 2QVOA 3U10A 3P7NA 5FCCA 4AIKA 4AQ2A 1FBQA 2F5EA 4BHBA 2UXXA 2F5FA 4ZYGA 3C3WA 5LGUA 3H7JA 1G4DA 3U0ZA 3KEQA 2KIFA 4H0EA 1YYVA 1L3LA 1CF7A 4PGGA 4JK1X 2FNAA 2CW0F 1Z05A 1ZGJA 4Z82A 2LDUA 3K69A 1UCXA 1WGPA 1LDDA 2ZMEA 2MC3A 2ZKZA 3R0JA 4EJTA 3SZTA 3CUQA 4A5NA 4MH0E 1G3TA 4MGKE 1T6SA 2XAHA 1OPCA 3GW2A 2L01A 1SFEA 3EBRA 1SD7A 1F1ZA 3Q9SA 5LRRA 1W7PD 1KGSA 3QP5A 4ESJA 1PUEE 1IXRC 1XMAA 4ENNA 4XLNF 1YUDA 1ZZ7A 1B1BA 1LB2A 4I0BA 5I8YA 3FXRA 1LDKB 3NQOA 3WTYC 1GVJA 1TLHB 4EJUA 1BI2A 1QXRA 1JE8A 3KP6A 2JPCA 4XF0A 3EO6A 1LNWA 5I8TA 2OQGA 4KN4X 5AIQA 2PQ8A 2A6HF 1YFUA 3QRFF 1I27A 2O03A 4K2EA 5E17F 3F22A 1EYBA 1SEFA 3F3XA 2D2WA 1XDUA 5J3UA 2J5OA 1TQIA 4N0BA 2ZNZA 5I0TA 4IEOA 3SXYA 1S3JA 4I02A 3HSEA 3B73A 4A5MA 5HS8A 3GX4X 3QP6A 2PHDA 4AVPA 3FFQA 4QMAA 2RV8A 1FYKA 2P8TA 2L02A 4EJOA 1GQHA 5BPXA 1BC7C 1AWCA 2AXLA 3I5UA 2Q4SA 4META 4Z07A 2VT3A 4G8XA 4EGZA 3T8TA 4HX7A 3NSTA 2ZCWA 3HTSB 4OMYA 5FD6A 4BXUA 4M9XA 5KHGA 2MLGA 2IA0A 3EQLF 2KIMA 1DDNA 1LDJA 4FX0A 3J80K 3RKYA 5LEKA 4ETSA 4RGSA 4TV7A 2PJPA 1U8RA 4IHSA 2QZ8A 1J3RA 5DEQA 1XCVA 4J1WA 2DK8A 5EEGA 1PDNC 3BB6A 1ZN2A 5KK1A 4KFCA 1CAWB 5ICEA 3FZVA 5FLJA 1FSHA 5KHIA 2OA4A 4EJVA 2XLFA 1ZGAA 3MZHA 3E6CC 2UYAA 4WXCA 2CAUA 3ZMUA 1SAXA 3GVAA 3HHHA 3W6KB 4WXHA 4D7SA 3R61A 2IXCA 4EMSA 2AS5F 5JSPA 2FBIA 2W84A 4HBLA 4KA4A 4PZJA 1R7JA 2EFPA 4KT5C 4D0PA 4KIFA 4Q48A 2A6EF 1H9TA 2LNBA 1UB9A 1PP8F 3G73A 1XN7A 2Z33A 1MZBA 4HV6A 3U1DA 2K27A 1ZLJA 5E18F 1TQMA 2HFHA 4YIIA 3LWCA 1J0RA 2FEZA 4LFUA 1ZRCA 2D45A 3BY6A 2OAZA 2HDCA 2P6TA 2DPDA 3MPBA 3CO6C 4ZH4F 4HDVA 3GWZA 1K79A 2BYVE 3I53A 4YYOA 3LZZA 1NXMA 4HSJA 3TO6A 3MEXA 5BS6A 1ONVA 5LHGA 2UZKA 3C18A 3WTVC 2PFWA 1SD5A 1Y9QA 4HX4A 3QOPA 4PIXA 1BIBA 2ET7A 5BQTA 2Z9OA 4RB0A 1RNLA 3DEUA 3I54A 4KIBA 1D8JA 2FMLA 3P9KA 4YNIA 4OINF 1BJAA 1TNSA 4JVAA 1J3PA 2VQAA 2GC3A 2P6SA 3WE3A 3C7JA 1SQ4A 1H1MA 2C6YA 4I7HA 3WTUC 2OZJA 2E9QA 2PG4A 2K4BA 2ZFWA 4OIPF 1UW8A 2ETHA 4XFGA 2MHFA 3QPHA 1QZZA 4AXOA 4HQMA 4N9IA 3H9AA 4ENKA 4UV9A 4MEXF 2QQ9A 3WU0A 1D3YA 2VONA 2BNNA 4R52A 3LWFA 5F64A 2G7UA 4IRIA 1Q3EA 2CAVA 4PCQA 1XGNA 2DU9A 2X4HA 1DUXC 2FA5A 5BXXA 2VXZA 1QZYA 5LGTA 2HS5A 4EGYA 2E7XA 1ZX5A 1FPQA 4L0ZB 1ZZ8A 6PAXA 2GC0A 1X3UA 1CAWA 2P7CB 3VODA 5CU1A 5E16A 3JTHA 3NEUA 3V8KA 5JAXA 3F23A 5J48A 5JI6A 3HYIA 3LAJA 4MX3A 3EYYA 3PFIA 3WE2A 3WG9A 3RPQA 3DF8A 2KKOA 1D8KA 1XCBA 1FP1D 3KSCA 1SD6A 1K78B 1BN5A 1Y3TA 1Q5OA 3V7RA 1V70A 2L4MA 2QQAA 3I64A 3MWMA 4R1HA 3K9TA 2GC1A 4B8XA 4GO1A 4BAYA 4MQ9F 5BPDA 2V1UA 2UWMA 2HOEA 4HOBA 3WGGA 3OTFA 1ZZCA 2F2EA 3KP7A 3OD0A 4XFFA 2GXBA 3WW4A 3KE2A 4OIQF 2PEXA 5LBQA 2ACJA 2CV6A 2GC2A 1HQCA 3FM3A 3HIFA 1FLIA 2V1DA 1TW3A 4RAYA 3V8JA 3WW1A 1QPMA 1RC6A 2OD5A 5L3CA 4CGZA 1YLFA 1BIAA 1RI7A 3D82A 3OV8A 1T38A 1X8EA 2VPVA 4EM0B 3GFIA 4KN7X 2EA7A 3IWFA 2CYYA 4YARA 4LA3A 4ASNA 2RN7A 3SCFA 3SCGA 4NB5A 1WSUA 2DCTA 4M74A 2VC1A 3T1BA 2NS0A 1BBYA 2P4WA 1I6XA 4A0ZA 4M9SA 5DCFA 1CX4A 4L18B 4KNYA 4U0WA 2H94A 1U3EM 1J59A 3ISPA 1FBSA 1REPC 1V4RA 2XIGA 3TKYA 1Z91A 5HOOA 2Z3YA 4MHGA 5JVTA 2B9UA 1EH6A 4ESFA 2OU2A 3HTUA 1KQ9A 2L4AA 3SHRA 3OOPA 3BU7A 1YW9A 1TQPA 2Q8KA 3W6JB 2FBKA 1MD0A 2P5KA 2XKPA 4OOIA 3H3UA 5D5UB 1TQ5A 4Q4ZF 4R8HA 4LMYA 3M7GA 4ENMA 1IXCA 3IIAA 1QXJA 3HT1A 3GFMA 2DTRA 1P4AA 1STZA 3H8UA 3TOBA 3CUOA 4ZU5A 1T0FA 1ZNPA 1YHFA 4UBHA 5DYMA 3UKTA 1BI0A 4Z2YA 4M72A 5D8LB 4HSLA 1B6AA 2IRFG 4DQ2A 4LD5A 2XAQA 1O7FA 5BUVA 1G3YA 4BIFA 4PGHA 3LOIA 2L3DA 5A2QK 4ORFA 5AONA 2M5WA 4LK1F 3F8NA 3HRUA 1T39A 4MZUA 1XRUA 2O8XA 4WK8F 1FY7A 5F1RA 5L3BA 1KQ8A 1SFXA 1HW1A 4IEXA 3CF6E 1XDSA 1U78A 2MH2A 2F5DA 1W4MA 3RPUA 2VBWA 3LFKA 3O6BB 5HS7A 4EM2A 4XRFA 2OQRA 4HLYA 2K4JA 2ZBKA 2EJRA 5CVIA 3MCZA 1NYWA 2XRNA 4UNOA 3PLQA 2O3FA 2CWEA 2W57A 1XGSA 1IN5A 2P5LC 2EA4A 1SMYF 2H6BA 1WI9A 3FXUA 2CO5A 4P55A 4I2OA 3CUQB 3LAPA 2M30A 1MDMB 5L3DA 2RQPA 1JUHA 4EWDA 4L9NA 1S8NA 2OBPA 2GU9A 2P5VA 2NAZA 5IT3A 4LUKA 4PIYA 2ESNA 2QBYB 2HEOA 2UXNA 1H0MA 2QBYA 3H50A 4YRDA 4JTNA 4X6QB 4LLLA 2ADUA 3KLNA 3LA7A 2FU4A 2M8EA 3CEWA 4ZYHA 1P6RA 5CJ9A 2LSOA 2VOPA 3GZ6A 5BY5A 4QM8A 3KP5A 4XSZF 2PN6A 5A2QZ 2FF4A 2FOKA 1ZG5A 4UXNA 2VE9A 3F8FA 5CVRA 2I45A 3QACA 2GA1A 4H7LA 3USSA 4AVCA 1KQ0A 1OI6A 1QQIA 2XLAA 1E2XA 1P2FA 4MTEA 3RKWA 2PI0A 3FX3A 2YR2A 5HVQC 4HLTA 4XFIA 3BP8A 1L0OC 1SFUA 2HZTA 5DCMA 3HSRA 2J5PA 3ABUA 3MAJA 2YPRA 2PBIA 3DFGA 1HKSA 4OIRF 2VBZA 2W25A 1QBJA 5E1XA 2R7FA 2Z5UA 2D93A 4CDGA 2VODA 5LHHA 3H3ZA 3R0AA 1JGSA 3SMHA 2HTJA 4IEVA 2Y0OA 1XE8A 2BBYA 5ILUA 1EH7A 2RNJA 4L9JA 1IZ1A 3U11A 2ELHA 2ZKLA 4KYWA 4P5OA 4AVBA 4EWAA 2LF7A 5FDBA 1HSTA 2DI3A 2DQLA 4LTAA 2ZMEB 5FFZA 5L3EA 4AIHA 5CYVA 2O1QA 4WCGA 3P9IA 2QM3A 3GLXA 2MA3A 4L9TA 2K02A 2JTVA 1R23A 4XETA 2Z69A 3CLPA 4XLPF 3WW2A 2K0GA 1Y0UA 3KCCA 5LLQA 4B29A 3ETQA 3TOAA 3M1EA 2EFQA 1V3FA 4RGXA 1YS7A 1IN7A 4A12A 1R36A 4KWKA 3PQJA 3D5LA 2GIVA 3DL3A 5FQ0B 1OFNA 5L3GA 1CGPA 3BZ6A 1J75A 4UUVA 2Q2EA 2EAAA 1DPUA 1XGMA 1QNTA 3I59B 3M8FA 2D40A 1O7LA 5JHUA 1BM9A 4O9EA 2CG4A 5K5OA 2ISYA 4AD9A 1RZ4A 4R79A 5K5RA 4ON0A 5CLSA 3GO5A 3H92A 3LA3A 4YFNF 5HI0A 2NNYA 1AOYA 3JAMZ 4MUVA 1RUOA 2DBBA 2WFPA 2UY9A 5D4SA 1NE6A 3UKVA 3PQKA 5T3NA 5DCMB 2G7HA 1CAXB 1O5UA 1HKTA 3M70A 3I0TA 3TDZC 3K1MA 1KU2A 2A61A 3V4GA 4L11A 1O3QA 4OIOF 4G7OF 2BNOA 2MBFA 2H09A 3S0MA 3HOTA 3L09A 3RYRA 4EQQA 4BNCA 3H7YA 4U7BA 2QNKA 1P92A 1O57A 3CO2A 2QQBA 4WF2A 1ZARA 3ELNA 1FC3A 4HMZA 1O5LA 1JHFA 5JFRA 2QJVA 4BH9A 1NHAA 2MH9A 2OA2A 2WWYA 5I0UA 4FAGA 4YFKF 2EA2A 3KGZA 4IRGA 5E8IA 3IRQA 3BPVA 1ZRRA 2JSCA 5JR7B 4A6DA 4IERA 1ZRFA 4XFBA 1VP6A 1FT9A 2LF8A 2D5FA 3CDHA 1UIKA 5JSRA 2GAUA 4N9HA 3REOA 4YG2F 5E1ZB 2KJCA 4JV4A 4UV8A 3D0SA 2K7LA 3HUGA 5E1WA 3FZ3A 3K1NA 3NRVA 4Q0UA 1OYYA 4QXKA 2HR3A 5LHIA 3DV8A 4IEZA 2OZ6A 2B8MA 3ABTA 4JBAA 3RYKA 4AQ6A 4MNUA 4U0YA 2Q1ZB 4Q0SA 5I8SA 1G3SA 2PAKA 3GF2A 1WKMA 3WTTC 1HBXG 4WXDA 4MGIE 3F72A 4NHJA 3IRRA 3U9GA 2MD5A 4IEPA 1OD5A 4I0AA 1LRHA 3ZN0A 2F4PA 4IVNA 2O0YA 1YLLA 4YFXF 2D1HA 3C3VA 3RI4A 1W7PA 1EP0A 5DDGA 3GXOA 3RKXA 4HF2A 3H1YA 2V1XA 4XEZA 1RTVA 4S04A 1UHMA 4RD7A 1D5VA 2EB7A 1I1SA 1NE4A 4IETA 4D7TA 3EDPA 5FLXK 1HSJA 1IUYA 1QO0D 2QUFA 5D4RA 5H6RA 2EV0A 1FOKA 2PTMA 1K7AA 1XSVA 2YU3A 3WGHA 1R22A 2A5YB 2FMYA 4RAZA 3WTXC 1YS6A 2DK5A 2YX7A 3R6SA 3BROA 1B59A 5I91A 5E1RA 2NNNA 1ON1A 3TO9A 2D5HA 2QCSB 3F8CA 5K8SA 4HDUA 1G3WA 5KHHA 4WX9A 3E6MA 1OYIA 4KWLA 5TRDA 3N97A 1YWKA 3GFJA 3FHZA 3HHGA 3ZMSA 4P9GA 5D5VB 2KRFA 4O5VA 4WVZA 2COMA 4EVIA 2Q0OA 3ZN1A 2XHKA 5J6XA 3B02A 5HDKA 3TNPB 4RB3C 2L54A 4GYIA 5HDGA 2XAGA 4KICA 2R7DA 2VBXA 3C1DA 5IT9Z 1ZZ9A 3MZYA 4EWEA 3KP3A 5K1YA 4A0YA 3FF5A 4KU7A 2XL7A 1EPZA 3BPZA 1Z9CA 2FSWA 5C6CA 1F9NA 1B4AA 1SFNA 3GUDA 1FYLA 3LQRA 2UYBA 3GFLA 1IXSB 2IVMA 4G6DA 5KBFA 4I01A 2IPQX 5ICCA 1R1UA 1USTA 3ULQB 1Q1HA 3CO7C 3P9CA 1FX7A 3EUHA 4Q0VA 1YFWA 1WWXA 3KP4A 2HYGD 1SD4A 1LKNA 3CUQC 3IHUA 1WRJA 2Y0MA 4EM1A 4KDPA 4Q0PA 1U2WA 2H6CA 1YTYA 4IHTA 2FNPA 2OYZA 3BJ6A 1MJ9A 4FHTA 3E5XA 1VJ2A 4U7DA 1OR7A 4EV0A 2DO7A 1BC8C 4HF1A 4LG0B 5D6FA 4O9GA 1DZTA 2Y48A 3J81K 4HQEA 2VECA 3VFZA 2YSRA 1OMIA 2KXLA 2R3SA 3TNQA 1ZLKA 3V7CA 5D1IA 1LR5A 2XKOA 3GEZA 5KVRA 3IL2A 4KMUX 3GYHX 1U5TB 4TLFA 4QM9A 4XBFA 1X7NA 4Q5SF 2V6CA 3I59A 3PVBB 2CQKA 1FYMA 4CHUA 2O8QA 1I5ZA 3E6DA 2HQNA 4HVOA 3T0YA 1HXDA 4EJWA 4L5JA 1YFXA 1JXSA 3ZQ7A 3ERED 5E20A 4E70A 1MJAA 3JSOA 1XE7A 4Y15A 4QX5A 2FXAA 2OZUA 4M71A 5H20A 4RS8A 4HF0A 4AIJA 3VOEA 4IEQA 1BI1A 4U88A 1CAUA 4OU0A 2IA1A 4LGWA 1FWZA 4XFAA 2STTA 3KZZA 5C8WA 3ES1A 2X0LA 2XVCA 5BV6A 1IW7F 1ZHFA 1ZZ6A 3VHRA 3HRMA 3IC7A 3OGJA 3TDUC 3FMQA 1ZRDA 2P17A 1CAVA 4ESBA 5LRSA 2GH2A 4XF4A 1GXQA 3EHKA 3SCHA 2LKPA 3DPTA 2DAOA 2GXGA 3S7EA 2FRHA 3JSPA 3ACLA 3E97A 4P9UA 4ZYDA 2VN2A 1TNTA 1FP2A 3M8EA 3FXQA 3HOSA 1LQ1A 4G9YA 3Q9VA 2P7VB 4LUMA 1G6NA 2A69F 2NYXA 5K5QA 1TTYA 1FSEA 1X8MA 5FD5A 3KFWX 4G7HF 3G7DA 3ZPLA 3E6BA 1Z1DA 4QWQA 1IPKA 4OLLA 5D8KB 5FLXZ 1XGOA 2VC0A 5FLIA 3DKWA 2RGVA 3MQ0A 2A07F 3ZMVA 5CADA 3J81Z 1DP7P 1J5YA 4FAHA 4HN1A 1FXZA 1CAXA 3BJOA 1RUNA 2JRTA 3O2PE 5FB2A 4BQAA 4KU8A 1W7PB 2E7WA 3KP2A 3BPXA 3DPLC 4HN0A 3SHFA 2IXJA 2BE5F 1DGWA 4A2UA 1W5SA 4CICA 3FMSA 4A6EA 4DNCA 1RIOH 4IESA 4ENJA 3K1PA 1IRFA 3F21A 4L0YB 2O61A 3DQVC 3COAC 4ZZDA 4QLCU 4MQVA 3KMHA 1XD7A 1K78A 3HRSA 1FNNA 3SQNA 2E1NA 3VEPA 4MGYE 1S7AA 1UFMA 2GA2A 1PM7A 4Y17A 2HJIA 5ILVA 5JSOA 1KYZA 2RDPA 3UKNA 4IEYA 1FZPB 4HYEA 5CVUA 3ELKA 5JR3A 4ZYEA 1F4KA 5I0RA 3OCPA 1J7KA 1CAUB 2A68F 3JAMK 3WTSC 4HVRA 4JQFA 5DD8A 2VT2A 2QWWA 3L2CA 2QLZA 3LQQA 3I71A 4I09A 3JZVA 2PLYA 4LK0F 2V79A 4MTDA 1SMTA 4OMZA 4Q29A 1U12A 2N7GA 2VBYA 4IEWA 1YO5C 1QWRA 4UXAA 1S29A 4IF4A 2JZYA 2PYTA 3R60A 3QU3A 2V09A 2IA2A 2EFNA 4G7ZF 1MDMA 4HZFA 3T8RA 4FX4A 5IT9K 4CZZA 1E17A 4EROA 3HQXA 4B09A 5I0SA 4HA8A 1KA8A 3KEOA 5ILSA 5FGMA 1X82A 4NQWA 4UVAA 4XF9A 3L2HA 4RGUA 3BWGA 3CL1A 5DV5A 4GULA 4HW0A 2DLLA 4QGMA 1BI3A 5BMZA 3ML6A 3I7DA 1XB4A 4KIGA 3AAFA 2IJLA 2M1BA 3WODF 2XAFA 1B9NA 5D5WB 4IXAA 3IDBB 3RZZA 4LA2A 4G94A 4PJYA 2GQQA 2EV5A 1GQGA 3EQEA 4LG0A 4LB5A 1ODDA 2HYFA 3BDDA 4RB1A 2EWNA 3ZDSA 5TJJA 5FQ0A 2ZO4A 2A3SA 3G3ZA 3IKVA 4YIFA 1WQ2A 5J7MA 3WU1B 1Z7UA 3L9FA 2IXHA 4L2NA 4PIZA 4F8AA 3SZPA 5I93A 4ONUA 5FLHA 1O3TA 4HVQA 1IAWA 2VOOA 2ZXJA 3M9AA 1Q43A 2DW4A 3WGIA 3JTGA 2UY8A 2IXLA 2QENA 3PNAA 4ZU7A 5ICGA 4M73A 4RB2C 2BGCA 3BALA 1CF7B 4M6XA 3WW3A 2EFWA 2PAMA 2Y75A 2DFIA 1R00A 5BOXA 4ZU4A 4E2SA 2K9ZA 2XLGA 4GCVA 4HAMA 4WZCA 5J8FA 1YIOA 5L3FA 1DPRA 4CYDA 1OKRA 4Q0QA 4MV2A 4S05A 3QU6A 2PHLA 1UCRA 3FMRA 3RTRA 2ISZA 2Z2SB 3FJSA 4LULA 1ZG3A 3ROUA 1LEBA 1IPJA 1J1LA 1ZAOA 2FQ3A 1EY2A 4XSXF 1PMIA 4CXFA 4K8FA 2V9VA 1O4TA 1R1TA 1P4WA 1YW7A 1CAVB 3IDCB 1J58A 2DQRA 2HKOA 2ESHA 2F5CA 3F8BA 3ZMDA 2ETEA 3FE5A 3K2ZA 2QYOA 1YFYA 2Q30A 4I98B 4QGLA 3HSFA 2BV6A 2G9WA 2IXKA 4PDKA 4IRHA 2XL9A 5ED4A 3GYDA 1EV7A 1GHCA 3VB2A 4BHCA 3H1WA 4U0VA 1ON2A 4P96A 3TO7A 4GYGA 2ZNYA 1T98A 2PMUA 4G6QA 1L3JA 3S7IA 1S7OA 2RVCA 4AWXB 2RC4A 2KJBA 4L5IA 2EV6A 4KMFA 1U5TA 3D0JA 1TBXA 1VR3A 1ULYA 2ZJ2A 4BYYA 1H9GA 2OPKA 2CSOA 4DINB 1J3QA 1ZREA 3IWZA 2QDRA 2EFOA 5E8GA 3S2WA 3V7SA 1U6GA 3ZMZA 2BEOA 1WA4A 2TDXA 2CGPA 3T5XA 3NKTA 1GXPA 5F6FA 2FE3A 1S6LA 2XAJA 3Q5FA 3F6VA 1IRGA 1J2XA 2DPUA 5AVPA 1U5TC 2WV0A 3WTZA 2E1CA 2MPFA 2VE8A 3MDPA 1FBUA 4XF1A 5EZWA 3BOQA 5D6EA 3CTAA 1HW5A 1XSXA 3KZYA 2FQPA 3WTWC 4IEUA 4IPAA 2JPBA 3O3KA 3E5UA 5FFXA 1RGSA 4E2QA 3K0LA 1YW8A 3DP7A 5EEHA 1Z6TA 3LAGA 4GXOA 1IN6A 4XFCA 4J1XA 4WWCA 5FO5A 1BOAA 1XSDA 4HBNA 2PA7A 4Q47A
chains in the Genus database with same CATH superfamily
3SKJE 2A70A 5CVJA 3UNGC 2QQWA 2E1OA 1WWYA 2HQRA 2WYSA 1KU3A 5DUKA 4ZZLA 2DBIA 1W6OA 3IH3A 3EYIA 1YJNI 5GLZA 1R093 3L00A 1GR3A 4WM7C 3ZMNA 1ZBE3 5J8CA 1US2A 3ZLIA 2JWTA 5FY9A 2DT5A 2WZR1 3MW2A 2NS7A 1OURA 1VALA 4E8CA 4Z6YA 5HLIA 1IQDC 3EUAA 1I3HA 4FFHA 2ZGPA 4XF3A 1ULPA 2ZGRA 1TMF3 2QVSB 4LHLA 1ZBA1 1P4XA 1YG2A 1OF3A 2RS31 2XV4S 2GMMA 2K5CA 3ZQIA 2FBHA 1F5JA 4K8RB 2GZWA 3LEGA 5D5XB 3ZFEC 3K4MA 4R9CA 2XSDC 5FP4A 4AVAA 1RKWA 2BY1A 5KAIC 1RUD3 1YX5A 4ET7A 3C7GA 3OPTA 3ILNA 3HB9A 5F0CA 4M6YA 4D5FA 4K9SA 3VBOB 3T4HB 1UNBA 3JU9A 3LFIA 2W92A 4KWJA 2IFWA 1DLLA 1W8ZA 2K86A 5HLGA 3I58A 3JRDA 1IGOA 4A69C 2HGCA 3RGBA 1DZRA 2QQJA 3JCIA 2OUMA 2JDHA 1VI0A 3QPTA 4G4FA 5C3PA 1VTNC 4QQHA 4IV3C 1HW2A 5AIPA 2W24A 1LJ9A 3GJBA 3GMEA 2HWVA 3I9V2 2IXIA 4N53A 3MZ8A 5EFUA 3KYLA 1S72I 4RGGA 2DCEA 4GH4B 4CXXA 4YRVA 2RR12 4LLOA 4FT8A 3KWVA 3ZMTA 1IN4A 1MIJA 2JG8A 4NPLA 4BY7J 3W5NA 2EIEA 2WNUC 4C91A 4QX2A 4LLGF 4YG6A 5HPOA 2RJLA 2ZFUA 4RGRA 4COWA 2KIUA 3N7KA 1H8TA 1GZWB 4YZ3A 1XYOA 3GTJJ 1ENRA 4BHPA 4TSVA 5DZFA 1NUKA 3HUGB 5FZOB 4Y13A 3O14A 1KONA 1QQP3 3KT4A 4F7ZA 5LEJA 3OEAA 1HLCA 1IDYA 4YW3A 2ERFA 3A4CA 3ACHA 2RKHA 2VVFA 4LIVA 3GZNB 3T1LA 5CVVA 2YGLA 1C5HA 2ZXWH 1LU2A 2IVIB 2XAUA 2IW5A 2RR11 1EAH3 2YS9A 3J8F1 1QOOA 1FJLA 5HLHA 2EZLA 3TW7A 3TGNA 4I3PA 2RS11 5H9QA 3PO2J 2PMWB 5HDNA 1AYN1 5HS9A 1W6MA 3T08A 1OYWA 4AEDA 5H6QA 4QGNA 3BCWA 4R4XA 2H27A 3VBFA 3CCUI 3FHIB 4P9FA 4KBBA 5JDBA 3VZKA 4UVBA 2XSJC 5DAVA 5FY5A 3IBMA 3Q0UA 2IAIA 4XQ4A 1VQ7I 3MFKA 2ZA9A 1SVLA 1OQEA 4PBPA 1DGRA 1J83A 3U10A 3W58A 3P7NA 4CUGA 4AQ2A 4JHZA 1OCRH 3BPSA 4ZYGA 2WQ8A 3O1TA 5LGUA 1S55A 4PDWC 2DU0A 2EZKA 2DA5A 1M1EB 3U0ZA 3BG7A 3KEQA 1APLC 4H0EA 5A80A 4IL7A 1YYVA 2VZPA 2P3YA 3AP9A 1DG6A 1W6QA 1Z05A 5IT6A 2LDUA 3K69A 1UCXA 1AX2A 1WGPA 4XQDA 1JZ8A 4EJTA 4YM3A 3SZTA 3CCEI 1CD3G 1T6SA 4XLCA 2CFOA 2UWCA 3J7HA 1SD7A 2WA0A 5LRRA 4ESJA 4LO4B 2JVHA 4ENNA 1W2UA 3B93A 1MS0A 3JD73 4P9WA 3ZGKA 4AFCA 4W1UA 2OCCH 4S2GA 1TLHB 2NN8A 4EJUA 1ASJ2 3K70C 1JE8A 2JIGA 3KP6A 2CV1A 5JXIA 3PSIA 5GZEA 2XGCA 3DU5A 2ELKA 5AIQA 1YFUA 2VW1A 2WA3A 3VD4A 2O03A 1KGYA 2ZX3A 3AP6A 3WHBA 2E36A 5JHFA 2B39A 3Q8CA 2J5OA 5J4VA 1YIPA 1TQIA 2CGOA 1HRV3 3K4AA 2ZNZA 5I0TA 2CTVA 4FPLA 4A5MA 2PHDA 1QJX2 2RV8A 5BNGA 1V6JA 3T0AA 3VPRA 3AMMA 5DG1A 3VN4A 2L02A 3RZOJ 1CQ9A 4EN6B 1BC7C 1X2NA 4META 2XUEA 1GWMA 4Z07A 1QHGA 3WF4A 3GZUC 2COBA 2L9VA 2ZCWA 3VZNA 2K46A 3HTSB 4GB32 4PQ9A 5JZGC 5KHGA 1IV6A 2CQNA 2XJSA 3EQLF 1DDNA 5EV7A 3RKYA 2WO7A 2XQRA 4TV7A 5F39A 3M3CA 4JGZA 1D1AA 1H4HA 2QZ8A 5IOZA 1YJKA 2DK8A 1UKRA 1PDNC 2OQ7A 5KK1A 3K3OA 2JMWA 3LMMA 2ZJRF 2VXRA 1JZ5A 5KHIA 2DCKA 3TBDA 4QD2A 5IOYA 1UL9A 2WAOA 2OA4A 3E6CC 2UYAA 4UWDA 4WXCA 3S17J 3GVAA 2ZAHA 2VE1A 4D7SA 3PUAA 4AFMA 3KS7A 5EGOB 5FYSA 5JSPA 2LRDA 2W84A 2DFHA 5B4NA 4KA4A 1AA7A 4ISQA 1D5YA 4C0BA 1XX5A 1KDMA 4D0PA 1SLIA 2A6EF 1CZTA 1QJY2 1UB9A 2MW8A 1PP8F 2TNFA 2B9SA 1XN7A 2Z33A 1O4XA 3U1DA 2K27A 2CWSA 2L5QA 2M7AA 4RLQA 2HFHA 4YIIA 2FEZA 1TC3C 3BZCA 3OS2A 4LFUA 4DUWA 3BY6A 4RLFA 3I4IA 3MFCA 4Q4X2 2VUAA 3MPBA 4ZH4F 4HDVA 4CEYB 4CEYA 5F5QA 3OIPA 3I53A 2KQRA 3LZZA 2LYCA 1BVVA 2DUPA 3V42A 3MEXA 4XHXA 2JE9A 1FMVA 3J8F2 2JDZA 5JXGA 4B3NA 3C18A 2PFWA 4E7JA 4ATEA 4HX4A 2AREA 4D94A 3G1OA 4CTEA 2EIJH 5BQTA 2G9FA 1NQDA 3I54A 3S1NJ 2M4GA 1D8JA 1DP3A 5HXVA 3P9KA 1BJAA 1U0AA 4PJMA 1J3PA 3WE3A 4U36A 1GMMA 2R16A 4MHRA 3ZRGA 1YQCA 3WQ7A 2ZFWA 4PLMA 4RA0A 2V73A 3E0JB 2XGEA 4CP9A 2VONA 3K4BA 4AC0A 3LPGA 3A0KA 4R52A 3LWFA 1UYXA 4CP1A 1C5IA 4DBRA 1V9U1 2CAVA 4IW3A 3F0CA 4AF9A 2HNHA 2VXZA 3NAUA 1Y9MA 2HS5A 4EGYA 2E7XA 3T2PA 1FPQA 4AAPA 4ZXEA 6PAXA 5K7FA 2P7CB 1Y6IA 2DUQA 3K70D 3K2OA 3BTCA 1QDCA 3FBNB 5C8CA 3CP2A 1A78A 4UB8C 3ZSJA 4CU8A 1PNFA 3HYIA 2AR6A 4OI1A 1S1AA 3N05A 2WBMA 1CJPA 3PFIA 2WNUB 1Q56A 1BR2A 2EINH 2BJSA 4FETA 1Y3TA 2R0HA 3DBHB 1X1BA 1FYUA 3I64A 4CU6A 3RCOA 4RFRB 3MWMA 5M5WJ 2FD8A 3JR9A 3FN9A 5BNNA 5BPDA 4J6GA 4NIAA 2FDIA 1LGBA 2UUZA 5FZHA 1P9QC 2HOEA 3WGGA 4O65A 2F2EA 4MYEA 3OUIA 2HWF2 2ZZQA 1QF3A 3J8F3 4C0HA 3PMSA 1C3HA 2GC2A 3HIFA 2WKKA 2DODA 2V1DA 4RAYA 1VBB2 3V8JA 3WW1A 5L3CA 2IS2A 4CGZA 5ABJB 5IFPA 3H0OA 1BIAA 3VYUB 1M4WA 3D82A 1VE0A 3LSPA 2K9LA 1PGL2 2QF7A 4LA3A 4ASNA 1W6NA 2DCTA 5LBFA 2XR4A 4Y24A 4A0ZA 2M2EA 1JODA 1VAMA 2NVXJ 4B7EA 1R9TJ 1LGCA 3SITA 4LHSA 4U0WA 4QB6A 1J59A 1UOFA 1FBSA 2A3YA 2XIGA 4XR6A 3CDZB 5C7GA 5T50A 2Z3YA 1MBKA 2R1DA 4MHGA 5JVTA 2B9UA 2DDAA 1K42A 4YZ2A 1HC8A 2OU2A 3HTUA 1KQ9A 2CU7A 3SHRA 1ULDA 4KMQA 2Q8KA 2FJ1A 2P5KA 2XKPA 2Y0SN 4M3CF 2DYRH 4Q4ZF 4LMYA 1VIWB 4CA0A 3IIAA 1R71A 1STZA 3H8UA 2YPDA 1JXNA 1JUMA 3CUOA 5FYTA 1JKPC 5LA9A 3SH5A 1ZNPA 1CWPA 5FYUA 3VBUC 1V6LA 3QYBA 4D7MA 3B9CA 1XNAA 4DQ2A 2IS4A 3AKRA 5A2QK 4ORFA 4NC8A 5A32B 5LK7B 1A6IA 4LK1F 3F8NA 4YVSC 3L2YA 3HRUA 1QQP2 2DFEA 1YO8A 4MZUA 1DFQA 5FUIA 1FY7A 2BVMA 2DDUA 2CGNA 1KQ8A 3Q8FA 3CF6E 1T8IA 2C4XA 1ODNA 2MH2A 3RPUA 3GHMA 3O6BB 1JU4A 1FMD2 2LY2A 3OIOA 3OYKA 3A2KA 3K75B 3VZMA 4LBMA 2XRNA 2DN0A 5IJRA 2KL4A 3VB9A 2W1UA 3HNBM 5FZIA 4M0NA 1LULA 2W57A 2EA4A 2H6BA 3M4FA 2K85A 1ITYA 3FXUA 2VJIA 2QE3A 2M30A 4CUBA 1U0JA 4DXTA 4D69A 5EQUA 1JUHA 2HVQA 2VKEA 2OBPA 2GU9A 5DUXA 2NAZA 4LUKA 3BR2A 5A1FA 2B46X 3ZFFA 1MPXA 4QKBA 1LKXA 4YRDA 2WO1A 4X6QB 4LLLA 1F8VA 4GWJA 3ZFGB 3PFYA 3RZLA 3LA7A 3CEWA 3ZSEA 1OCPA 3M8LA 1XMXA 2VOPA 1SCRA 4GH4C 3K6GA 5F1JA 3MHZA 1OLME 5FY7A 1W9YA 3KIOA 4B1LA 3FXKA 3KV9A 3NNMA 3BGAA 2HWB3 3AJYA 3VBUB 2X9DA 2A6WA 1ZG5A 1UX6A 5CVRA 1ZA4A 1APNA 4I0WB 5A3MA 1KQ0A 1OI6A 3PIOF 1KJLA 2KDOA 1S7EA 1P2FA 2BXYA 2YBKA 1VQLI 4TXWA 4PSXA 5AVAA 3RKWA 1HXS3 4HLTA 4P1WA 4XFIA 4PQQA 3BP8A 1L0OC 1SFUA 1HQWA 1D4M2 3TWIA 1RRJA 1NA1C 3ABUA 1MQTA 3I4MJ 2ZEWA 1HKSA 5IP9J 1QNYA 4UW5A 1F2NA 1RR8C 2Z5UA 4CDGA 3K4NA 1SC7A 3H3ZA 2EIMH 1JGSA 3SMHA 2HTJA 4IEVA 2VB6A 4KI5M 1ZR4A 3K7AJ 2HDWA 1XE8A 2QSFX 5GZGA 3OGGA 3DEMA 5E88A 3HXLA 1MQTB 4E7HA 3S3MA 4P5OA 2RAEA 1WCMJ 1YRNB 4EWAA 5H9PA 2NOJB 1VQOI 1N77A 2DI3A 3B01A 1JZ2A 5CYVA 1XOYA 4IV1B 2BHZA 4UW6A 5SV8A 2AUYA 2JTVA 4XETA 1OSGA 1FATA 4PJJA 1X33A 5KC5A 4CDQA 2Q1FA 4QHZA 4HL0A 5ACA2 2DFFA 4H14A 4V2WA 3OMYA 1NZIA 3CHXA 4MO3M 2W00A 4OCTA 1AUYA 4RGXA 1IN7A 4HETA 4Q27A 5LATA 2LR8A 2JE7A 2JA7J 1REDA 4UUVA 3H1CA 4CH7A 1DPUA 5FYMA 2NVTJ 1QNTA 3T09A 2D40A 2EZHA 1O8SA 3LFMA 1MMGA 2WT0A 2XHNA 1RZ4A 4B4QA 2R062 4YFNF 2NNYA 1AOYA 3LNQA 4NHMA 3S3NA 3CU7A 5F0FA 2W82A 2ORXA 3UKVA 2TEPA 4B4RA 4V19K 5F3CA 4Q4Y2 1O5UA 1YE9A 1VBD2 5EP9A 2XPJA 3K1MA 2DCZA 2GNTA 2RMU3 3BKZA 4G7OF 2ZJQF 3RFRA 2RHPA 3ZPYA 2R7OA 3LE0A 4PI0A 3NNJA 2W95A 4ZS3A 2DVBA 3GJAA 2DFBA 4WF2A 1ZARA 3NV2A 1FC3A 4QXBA 4HMZA 2YC0A 5JFRA 4BH9A 4C2MJ 1OBNA 4YZ1A 2WZR2 2OA2A 4XOGA 4FAGA 1Q8SA 4YFKF 4EN9B 2EA2A 2GP3A 3CKHA 5F27A 3IRQA 1UYYA 3VUOA 3DPRB 3I3LA 2GP5A 4Q4V1 4A6DA 1YJLA 1C8M1 3DPUA 3NWKA 5CKNA 4IV1A 2SLIA 3FHNA 1QH7A 5KXDA 2BUKA 2W1QA 4ARYA 4PT6A 2KJCA 2WS93 1A3KA 3ACFA 1N75A 2K7LA 3HUGA 3AP5A 5FZOA 4EZ4A 4X6AJ 2PMZA 2UURA 4QXKA 2HR3A 5LHIA 4QAWA 3DV8A 4IEZA 2E60A 2OZ6A 5A1AA 4JBAA 4XJAA 3BTYA 4AQ6A 4U0YA 2Q1ZB 4HRIA 3GF2A 1WKMA 3WTTC 3L2UA 5F5IA 1W6PA 4FSJA 3AKZA 4BB3A 3AKSA 4PJNA 3F72A 4NHJA 2V6EA 5F04A 2H8WA 1OUXA 2MD5A 2XF6A 2HLEA 1FIPA 4I0AA 3R05A 1LRHA 2DOEA 2E34A 1PO21 1Q1VA 2E7TA 4IVNA 2O0YA 3BQYA 4C8DA 4XKVA 4CUAA 4DXRA 2NP0A 3GXOA 3RKXA 3OUHA 4L99A 5FO8B 2HYJA 2V1XA 3MUZ1 4XEZA 4FPFA 1GZ9A 5B3SH 2GH8A 2VCBA 3ERMA 1NE4A 4IETA 4M3EA 5HNFA 2WO3A 3BC8A 1IHMA 1VB4A 5FLXK 4YVWC 4AQSA 1VRH1 5CFDB 3S8PA 2CS3A 1WPKA 1XSVA 4IGPA 1QJU3 2A5WA 2BY2A 2FMYA 4RAZA 1YS6A 4YGBA 3O5SA 2E2JJ 3BU0A 5FZ6A 2L7KA 5C3QA 1U9NA 5ISLA 4XLEA 1G3WA 5KHHA 4AEDC 5CISA 4MXVA 2HZDA 3N97A 1YWKA 3KM5A 1G9AA 4XDQA 2IGMA 4M4RA 2R072 5KWRA 3HZJA 3KQ4B 4CDUC 1X19A 4ABZA 3AP7A 4AHXA 2L54A 1LNSA 4GYIA 2CRGA 2R7DA 5FREA 1YI7A 1AYN2 5IT9Z 3MZYA 1BJZA 1FOWA 2OW4A 2DA6A 2NVQJ 2FDJA 5K1YA 4A0YA 1JTZX 3FF5A 3MIHA 3AM2A 2CYFA 2WZPP 3VKFC 1F36A 3GUDA 1QHHD 5E3MA 3P1IA 4QDQA 4JKLA 2LKXA 2UYBA 1IXSB 4G6DA 4I01A 1USTA 1FX7A 4Q0VA 1YFWA 5CFCA 1SD4A 4RHV1 2MYSA 4EM1A 4Q0PA 3OOUA 3FHQA 2Q8OA 1LVKA 1YTYA 2CQ7A 4IHTA 3IN9A 1MJ9A 4QKFA 4DMIA 4U7DA 3OR2C 1XC5A 3NQHA 1U9OA 1HIXA 2XVGA 3VFZA 4QU2A 2RG4A 2XKOA 5KVRA 1W9WA 3IL2A 3GYHX 1LHOA 4FISA 4RS5A 4TLFA 5L7OC 4NC7A 2ARXA 1W1WE 4XQFA 3I59A 3PVBB 2FHRA 3U75A 4FI9A 4MO7A 3FUOA 4HVOA 1YFXA 5DDJ3 4BJ5C 2DTYA 2O5RA 4E70A 5JMCA 1G7YA 1W3VA 1XE7A 4Y15A 3J9SA 4COUA 4OVEA 3MFAA 5EWSA 4AIJA 4XXPA 2LLKA 2VCMA 1WD4A 1BI1A 3GTPJ 1FIAA 4XFAA 4BJ0A 4DQAA 1MSFC 5FZKA 2Q5TA 1W0UA 2E31A 3OBAA 5GAEJ 3H8XA 2VQLA 1ZHFA 5GPCA 4Y5SA 1YYNA 3HOXJ 3A23A 5IP6A 1CAVA 3ITQA 2EIBA 1GDTA 1JOBA 3V0BA 2WQ4A 4NIHA 1U5ZA 2DAOA 2B42B 2W4SA 1MS5A 1UO9A 3Q9VA 2NYXA 5DDJ2 3MKLA 3ZPLA 1UZCA 3E6BA 1ULEA 2PJRA 1Z1DA 2Z16A 1D7PM 1DYKA 5FLIA 3RZKA 1YI2I 2DA3A 3I2JA 3FIWA 2RGVA 1LOBA 5C33A 3LOBA 5CADA 4KWUA 2FDGA 3WP5A 2LY9A 3WR0A 3SDBA 2ZJCA 1TME1 2W0XA 1MH3A 4HN1A 4Y22A 1POQA 1WJFA 3O2PE 4KU8A 4BQAA 2NPIA 2E7WA 4XOPA 3SHFA 4XK4A 1DGWA 4CICA 3AYEA 4FPJA 4NHKA 1R49A 4A6EA 2PLV3 3VHOA 3OS1A 1IRFA 1OUSA 1L7LA 2QSGX 1GOGA 1AR73 4MQVA 1V00A 1D2QA 4E6KG 1ULOA 3GCMA 1FNNA 2X5IB 1IV8A 4NUBA 2HYKA 4AAXA 3WUCA 1NX9A 1SBDA 4NC6A 1H4GA 2GA2A 2HOTA 3Q9OA 3AYAA 3OYIA 5D21A 2RDPA 4BKXA 4DXZA 4IEYA 4UI9L 5FYVA 1JBCA 4JAAA 2OUHA 5I0RA 4LBQD 5BNQA 1CAUB 2LM3A 5FPBA 2QEXI 3WTSC 1HRI1 5K0UB 2H0BA 2VT2A 1ETYA 2QLZA 1X4PA 3LQQA 2JENA 2V79A 4CDWB 5DM6F 5IVJA 3A4UA 1U12A 1YO5C 4UXAA 3U14A 2DVAA 4JDMA 3C7OA 4AOCA 2V09A 4HZFA 1LHWA 1E17A 3ZSMA 4NNJA 5F9TA 3QOEA 2W9XA 5FWJA 4HA8A 5GADJ 1KA8A 3KEOA 5ILSA 4AYUA 5IVVA 1OLMA 1A34A 2WS91 4Y4RA 2ZHNA 3BWGA 3CL1A 3ZFGA 4DUXA 5FRNA 3I2HA 4PLNA 3CJIA 1XB4A 3WODF 1R083 2VZTA 4GIQA 2X6OA 1QVUA 1AR72 5GALA 1LOGA 3IDBB 3HBLA 4LA2A 1WMXA 5ABJC 2EV5A 4BISA 1CZSA 3N7MA 1NAEA 4YEJA 3GALA 1POGA 4L97A 4URAA 4OMCA 2A3SA 3N35A 4XABA 4AI2A 5CNAA 2EILH 5F5CA 2JA8J 2BU9A 2JA5J 1WQ2A 2XWBB 3VBHA 1V55H 4LK7A 2GDFA 1Z7UA 4DYCA 2VZSA 2EBIA 5DTDA 2R042 5IK5A 4QB2A 2MABA 5BNPB 3RJ2X 1WCUA 3QODA 3H3LA 3VBFB 4P08A 1ALYA 4AFAA 1AR71 4A3FJ 1S0GA 4INDA 4AEDB 1AR83 3HOZJ 2K40A 1OHFA 4FOVA 2ZXJA 2WSUA 1Q43A 2DW4A 3I2IA 4Q4Y1 4ZU7A 4IE0A 2W47A 4A3DJ 2BGCA 3BALA 5L7OB 1CF7B 3A21A 2RS53 3WW3A 1HRV2 5JMOA 2FDFA 1WMEA 4QQPA 2XLGA 4GCVA 4HAMA 3O12A 4KISA 4XIOA 4AVVA 4TWTA 1DPRA 3KX2A 4CYDA 4NAOA 4IE5A 2QZ3A 2PHLA 4E27A 3RZMA 3AG1H 2XF5A 1U8BA 1Z7S3 4GH4A 1O4TA 1P4WA 1O8PA 3OYWB 2DQRA 1WW5A 3TW6A 2R7XA 4FTSA 2CNAA 2PHTA 1BYHA 2BQPA 3OS0A 1AVBA 3J4UH 3KT7A 2YU9J 2PHRA 4PF5A 4ZYAA 1VRBA 5FZ3A 4PDKA 2XL9A 4CEYC 1OA3A 5F0HA 4DW6A 1AR92 4BJ6C 4BEHB 2ZNYA 2JG9C 3OEBA 2WNVC 2W08A 3VBOA 2WN2A 4EYUA 1S7OA 2IBDA 3BG5A 4D1QA 2RC4A 2Q8DA 3OG2A 2EV6A 1W6PB 2WL1A 4KMFA 1TBXA 4RGAA 1H0BA 4ZPIA 2Z5WA 3O0XA 3FDYA 1A35A 2W46A 3MV01 2OPKA 5F3EA 3JD72 4DINB 5T52A 1ZREA 5L9BA 4XE9A 3MIBA 5F6KA 2WFF3 4UFIA 2JDAA 1V6MA 2TDXA 4LOTA 1H6XA 2CGPA 2YDEA 1GLHA 1ZTRA 1OCCH 2ZHLA 4LT5A 1IRGA 3GGLA 3I3EA 3WTZA 2E1CA 4FE4A 2MPFA 1VQ6I 2VE8A 2I5UA 1HW5A 2XB5A 4XL9A 5F2SA 1XSXA 4IPAA 1W2OA 4S2HA 2Y26A 4ARXA 3U07A 5JLWA 4BDVB 2VBDA 1QIQA 1WW6A 2ZHMA 3LAGA 4Q8KA 4XORA 1JHNA 2KFDA 2V9KA 5K0UC 4BQ1A 2PA7A 3LFUA 3PVOA 4Y33A 2HOAA 4QPIA 3FM5A 1TE1B 2VNGA 5A3WA 4KL1A 4A0XA 4Y20B 1COV3 1ENSA 3KLOA 3RMYA 3MIFA 3CZUA 3IAM2 2WB1A 4JQRA 3QYFA 1HQNA 1US3A 5HV0A 2ZXQA 3SH3A 1H1IA 2OXBA 3AG4H 1OKQA 1UPIA 2H0VA 3ILFA 1GV9A 1O4ZA 1D0YA 3TB0A 5M5XJ 1PVEA 1POV0 4CO8A 1A31A 1XG1A 3CJXA 1CIYA 3PURA 1N1VA 4HV5A 2R073 1IN8A 2ORZA 4IE7A 2STWA 3U2RA 1P8JA 1WCSA 1XMKA 5DAWA 2CFXA 3R4KA 1W99A 2PHXA 3MW4A 2OJED 3SKVA 2RDRA 3DN7A 1SACA 2NRAC 2E2IJ 2OPTA 5KNLA 1SLCA 1XU1A 4LBJA 3A0NA 3GXUA 5DAPA 4LLNA 2VJ5A 3NVCA 2IT0A 3W2VA 2A71A 2JJ7A 3Q0VA 1KYWA 4GGGA 4HT1T 5FY4A 1LODA 1BW5A 1H8AC 1IG7A 3ZXFA 1Q8QA 3I4PA 1MJBA 2JECA 1AL23 2B4KA 2RMU1 3LSJA 5FZ7A 2BXZA 4CCEA 2V7FA 5FMOS 2VM9A 2RDSA 2W87A 2XGXA 5BYNA 1H2KA 3GZEA 1TMF2 3NW4A 2YZ4A 2WC2A 3NJZA 3J80Z 1R58A 5JLXA 2M45A 3NL1A 1LVAA 2JT1A 2D1VA 1BEV1 3MYXA 4A7YA 4D7YA 1PIV3 1F31A 4EQVA 1W0PA 1UIJA 1UG0A 1ZZBA 1HB1A 2IZWA 1FOYA 4QT6A 5EGOA 1OJLA 4NPRA 3ZR8X 1BCXA 3OSDA 3PSFA 2DWRA 3VZJA 3OYEA 3JRBA 2GWRA 3TL4X 5FPZA 1W2NA 1ZYRF 3L7WA 2HWC1 4BXFA 4GAZA 1FI2A 3Q0WA 4B3AA 3WNKA 1ZM1A 3AC0A 5KHJA 3KEYA 2DJIA 1SDWA 1J9IA 2HTSA 3ECOA 3NRUA 2BNMA 3WP3A 4EN7B 1U5XA 2VZQA 1BEV2 3VDDC 2WNUA 1YJWI 2F6CA 4Y52J 4WBBA 3SFZA 1R081 1ENQA 3ECHA 5BPIA 2ENRA 2Z99A 3GF6A 1HKQA 4UT5A 3HG9A 2HKXA 1TME3 4LKDA 2CDPA 4O6JA 4IZZA 4OFGA 1HV0A 4IHVA 5LB6A 1R5GA 2L9NA 5BNOB 3AFKA 3AZWA 4NE9A 3CJNA 1O3SA 1WA6X 1E5IA 1RINA 5T5OA 2O6GE 5TISC 4IOAF 3RYPA 4HSRA 4OI0A 3VDDA 4MFEA 5LY1A 3RDIA 1VQPI 3EJKA 2W85A 4A3KJ 3FWEA 4V2FA 4M3GA 4ZDLA 5FCCA 1MZ5A 3FXOA 3Q8EA 3VL8A 1LAJA 3IT8A 3DLLF 2UXXA 1DBNA 2F5FA 3FC0A 1J1TA 3H7JA 1Q8PA 3SEZA 1EUTA 3VBFC 4AI3A 5F3GA 4QQ2A 2KIFA 2RS32 5E3OA 4RHV2 2W39A 1UX7A 1LEMA 2CW0F 5E3LA 2R4GA 2BPA2 2QKLB 4Q5OA 1LDDA 2ZMEA 2MC3A 5FJ8J 3R0JA 3NNFA 1NLQA 4ITVA 1NK3P 1D1BA 1GWKA 3WDXA 5M3FJ 1OPCA 3HPGA 2L01A 2R5YB 4LPLA 3HPHA 2TRTA 3Q9SA 3QP5A 2NXNB 4CE8A 5FZAA 1XMAA 4IV1C 3DCFA 4DRVA 2DXIA 4AVZA 3OY9A 1LB2A 5I8YA 4I0BA 4XM3A 2MEV2 5GZCA 3CC2I 1FEXA 4Y3OA 3A22A 1QXRA 2H8RA 4IGQA 5KXCA 4BQWA 1GNZA 2JPCA 2AXTC 1LECA 3MUY1 4XF0A 4RS5C 1LNWA 5I8TA 2HQAA 4CCCA 2A6HF 1HJGA 3QRFF 4EJRA 1I27A 4I99C 2LMDA 2GBYA 1QJX1 4XOTA 1AYM1 3O1OA 3S15J 1EYBA 2OIIA 4XKWA 3ZYBA 3RJRA 4IHXA 5FMCA 1ZBA3 1VZ0A 5J3UA 4RBOA 3GBGA 2QBXA 2HEVF 2VOKA 1JN2P 4K7JA 4IEOA 1QH6A 3SXYA 3AMNA 3HSEA 1TL8A 4A3MJ 1X1PA 3AMHA 4AVPA 4FPKA 4QMAA 5LA2A 3MLLA 4MG2A 3ZQLA 3BR5A 1OH4A 3POJA 4BGDA 5F5AA 1GQHA 3HNYM 3RZGA 2AXLA 2Q4SA 4V2VA 4COYA 5CG9A 4G8XA 3GHNA 1GP4A 3NSTA 2G9ZA 3U4SA 4OMYA 3O1VA 5FKNA 1WJEA 4BXUA 3FMGA 3LDBA 1JZ4A 3P5JA 4H3WA 3FLRA 2IA0A 4FX0A 3J80K 4FCYA 5LEKA 2JEMA 4ETSA 1ZBA2 2HEYF 5F08A 4IHSA 3UNPA 4ZDPA 4GJYA 4J1WA 5EEGA 4FPEA 1ZN2A 1CAWB 2ZGOA 1CJDA 3FZVA 4AK3A 1N25A 3VL9A 2L7MP 4XUOA 1YRNA 3MZHA 2RS12 2EPFA 1UPSA 3ZMUA 3HHHA 4U87A 3MGUA 3W6KB 3R61A 4YG3A 1UWWA 4QDSA 2FBIA 3OYGA 1SVOA 2WJSA 2BBAA 1UU6A 5FUPA 3P5BA 2A6TA 3K46A 5DQ0A 5J36A 1KRIA 4Q48A 2FX0A 4DOUA 1PO12 1VQNI 4Q1PA 5FZ4A 2WSVA 4RHV3 5CAZA 2V5DA 5E18F 4LHNA 1ZELA 4BACA 3K48A 2BV4A 4S0HB 2VMGA 1ZRCA 3T3YA 5DG2A 2D45A 5IYCJ 4OYUA 1PK6C 4KG0A 4XJUA 1D0HA 1Y8QB 3GWZA 5CPRB 2OT7A 5JPNB 2K9NA 3JRCA 3FKJA 5C3RA 5FZMA 3FKIJ 4HSJA 5JOWA 5ACA3 1QMJA 2Y69H 3AKPA 5LHGA 2DOAA 1SD5A 3ZYRA 4PIXA 5HCFA 5L7OA 4XQWA 4F83A 3JB8A 3WHTA 1RR7A 2X6XA 5DMYA 4YNIA 2WIIB 1CIWA 1K4TA 3ABLH 5A7WA 5FXVA 1H1MA 2C6YA 3LKJA 2B63J 2JKBA 3FBIB 2AC1A 1PMHX 2VKDA 1DF0A 2E9QA 2K4BA 2ETHA 4XFGA 1PJRA 2MHFA 5C4WA 3QPHA 4AXOA 3B69A 3KCYA 4ENKA 3JQWA 3ZDVA 1Q3EA 3I2FA 3OYMA 2EXHA 4K3UA 4K1ZA 2DU9A 1AR82 1DUXC 2FA5A 4KQ7A 3WD5A 1QKQA 1ZX5A 3L2WA 1ZZ8A 3LQCA 1Z7S2 2KRCA 1X3UA 2G0EA 2C24A 3VODA 4HANA 2R1BA 3A7QA 5E16A 4BQYA 2YC2A 5JI6A 1NLSA 3LAJA 3IH2A 3TBIA 3P3NA 4FASD 1RVF1 2G9GA 4JDNA 4M3CA 3WE2A 2G19A 3RPQA 2KKOA 4D7NA 1SD6A 1K78B 2X10A 3MIDA 2R0FA 3N7JA 3ZVXA 4R1HA 2GC1A 5M0TA 4B8XA 4GO1A 4W4ZA 2V1UA 2R7UA 3DYOA 1RITA 1DU0A 3WU2C 1ZZCA 2YFUA 4SLIA 4XFFA 5EJCA 1W9FA 4CDWA 2PEXA 4N7UA 5IW0A 3FM3A 1PO22 1QPMA 1HRI3 2OD5A 1YLFA 1W8FA 4D0QA 3DXUA 1YIJI 3FFZA 3WNMA 4RFT0 2WQZC 5F37A 3OV8A 1RUC3 1X8EA 4KN7X 2AACA 1QA6A 4NIGA 2VNOA 2JJ6A 4PDWB 3SCFA 4BA6A 1S0IA 3SCGA 5DUUA 2YBPA 2E26A 3OGRA 1UOJA 1WI3A 4FPYA 3AZYA 2P4WA 3C2HA 1I6XA 4NQWB 4RR3A 4M9SA 5FYCA 4ZC3A 3AZZA 5FZBA 2H94A 3SFIA 1SLLA 3ISPA 1RUE2 1SEUA 4DS0A 2WAQA 3TKYA 4FPGA 2OPWA 4BPZA 5F8PA 5GZFA 1JKQC 4ESFA 2OUJA 3AVRA 2D7FA 2JDKA 1TZOA 4R4ZA 3OOPA 2VZUA 1YW9A 3ZYPA 2WADA 5DZEA 3OPZA 2J7MA 2GOMA 1REEA 1RUG3 4OOIA 1TQ5A 3M7GA 4UFJA 3FL7A 2QKMB 4ENMA 1GQPA 2F17A 1QXJA 2P6HA 3HT1A 2KLOA 2DTRA 3U78A 4AEJA 3UKTA 2EXKA 1BI0A 4JRLA 1YQ2A 1MS8A 2WZEA 5D8LB 1KFXL 1B6AA 5BUVA 1G3YA 1F5FA 4PGHA 1RUH1 4NDLA 4M3CE 2V4VA 1IS5A 2DCYA 5CEHA 2XRLA 1T39A 1QEXA 5J1XA 3NWTA 1VRH2 4QPGA 2GIZA 1SFXA 3M7AA 4XKBA 1HW1A 4QTRA 2DV9A 3RSNA 1IUFA 3UGHA 2F5DA 3PL0A 4X0GA 2VBWA 3T1MA 1RUF3 5H9SA 1TZLA 3P3PA 1BL0A 4MADA 1JJ6C 4XRFA 4XN3A 2K4JA 2PLV2 3VV1A 3KCXA 3OYAA 1YHQI 1GUIA 1NYWA 2LS6A 1IS4A 3W2AA 1W06A 2GN7A 3F2ZA 4P02B 2K3PA 3SEPA 2P5LC 2KA3A 5F6LB 1AR61 5FYZA 5FZGA 1SMYF 1W0OA 2CO5A 1GNHA 2CUEA 3CUQB 3MPPG 1NH3A 1V5EA 1XJAA 3PUBA 2RQPA 4FE7A 1S8NA 1LHVA 1EKEA 4PIYA 3OYCA 2QBYB 3MN2A 3THDA 2Y60A 1H0MA 2QBYA 3T30A 4Q4W2 3BN6A 3NV3A 3IAS2 4WM8C 4EEFG 2R7RA 2P1BA 2ADUA 1MMNA 1VMHA 4M4PA 2FQ4A 2VTXA 5EYYA 3HNMA 4XC9A 2CDOA 2HWC2 4XSZF 1BR4A 2PN6A 2R7TA 2YV8A 2PN5A 4Y1UA 2FOKA 4QPQA 3N9LA 1JOPA 4UXNA 3R0RA 2JSPA 2KMUA 3QACA 5B1AH 3UYJA 1AR81 3OPWA 3BQZA 3IPVB 2VO5A 1QQIA 1KITA 2XLAA 2DF7A 1E2XA 2KZVA 1RUJ2 2PI0A 1JYXA 2YR2A 4XZUG 2VBPA 3DTKA 5GJ6A 2G1MA 3NAPB 4N43B 3RG0A 1X3WB 1W36D 1E5HA 4MXWA 1XB9A 2HZTA 3KYDB 3HSRA 3INAA 3THPA 2X6YA 2J5PA 1JT0A 5GTHC 4EATA 1FPN3 3DU6A 3DFGA 5EYXA 2R32A 1QBJA 1L7RA 3BUCA 5F7UA 4F91B 3R0AA 2Y0OA 1CZVA 5FFOC 3K2AA 2RNJA 1MBGA 3WHCA 3VD3A 2ZKLA 1XSQA 5JVVA 2C9AA 1TWHJ 1OVSA 4AVBA 2W48A 2LF7A 5JVGF 1R1A2 3DYPA 4G9SB 5FDBA 2DQLA 4LTAA 1PGW2 5L3EA 2OKXA 4CDXA 4WCGA 2DMNA 3P9IA 5HLTA 1W90A 4COZA 2QM3A 1AYM2 5A7PA 3LCPA 4PHZA 1VBB1 2FUG2 1NG7A 2JDYA 5B2GB 3AJZA 5E3NA 2K0GA 1Y0UA 3KCCA 4A42A 2QQOA 3TOAA 3B00A 3ZSLA 4DUVA 1R36A 1JJ8C 1TME2 1H89C 3BG3A 2NZ9A 4YW2A 2QQPA 4OHYA 2JK3A 2E71A 3H5RA 1J75A 2E1MB 4YM1A 3I59B 3M8FA 1WH5A 4GD4A 2NMOA 3GCWA 4IV3B 5CLSA 3HVDA 4UB6C 1WW4A 3H92A 3LA3A 5HI0A 5EZGA 3KV5A 1GV2A 1HDKA 2VVEA 3K4ZA 2QQUA 2WFPA 3MI8A 4NRPA 5IK8A 3MF6A 5IAVA 1W8WA 3OBZA 4JKKA 2BP6A 4LO6B 2G7HA 2LW8A 3M70A 1VQMI 1DLCA 3IDAA 3V4GA 4L11A 1LE8A 3AZXA 3ZXKA 5JZGB 2RS13 5BNPA 2MBFA 2H09A 3USUA 4A44A 2HVRA 3OBRA 5TSWA 3RYRA 4U7BA 1P92A 2LFBA 3AMQA 3CO2A 3ECQA 4P9IA 3PNVA 2DVGA 1LOFA 3ZN5A 1O5LA 2QJVA 1NHAA 2L7FP 3VD9A 3HN3A 5EXOA 1WCKA 3WNOA 3RZJA 5HXMA 1ZRRA 3FXMA 4GKYA 2JSCA 1RMU3 2I2SA 4IERA 3ASNH 1ZRFA 4XFBA 1FT9A 1DQ4A 3CDHA 1NG0A 4NWWA 2J1UA 2VD7A 3W5MA 3M3OA 4RA2A 1VQ4I 2DCJA 3AG3H 2A6XA 4AEKA 3JBG2 3G4SI 3FZ3A 4Z2WA 4Q0UA 1OYYA 2JG9A 4C3IJ 1D4M3 4FTBA 4BQ5A 3ZSKA 4FQGA 2RMU2 2B8MA 2Y6FA 3ABTA 3RYKA 1KS5A 1FOD2 4HG6B 5FWEA 5CFCB 2WS92 3VHPA 4YZ5A 1XTAA 4WXDA 4ZTFA 2NQYA 3IRRA 2LALA 1XXNA 4XKCA 1UY0A 3CCQI 3L9JT 2F4PA 3POYA 4RQPA 1T6GC 5DS9A 3C3VA 2EXJA 3RI4A 1W7PA 2V72A 2ICWG 4C90A 4LHKA 3PUFA 5DDGA 3JCUC 1FNZA 4XJ9A 3OYLA 2ZAAA 1UHMA 4RD7A 5CIRA 4D8MA 1AF9A 1RJ7A 1Y7BA 1JYWA 2WNVB 4FPCA 1Y8RB 2QQIA 5D4RA 4HOOA 5H6RA 4E4DX 2EV0A 2FCUA 2WLPA 1R092 3HOBA 3WNXA 4RSUA 2YU3A 4LJHA 3WGHA 1R22A 4M3FA 4UUSA 3ZN6B 4EN0A 5E1RA 1NKGA 5LK5A 2ZBJA 1UF2C 3ZX7A 1ON1A 2ZGKA 5CKQA 3TO9A 2XB0X 2QFEA 4YVSA 5L73A 5K8SA 4HDUA 3H42B 4KWLA 3X29B 2DTWA 3ZO0B 3GFJA 4N53B 3FHZA 5IP7J 4P9GA 4HNUA 4M00A 4IQ4A 2COMA 3I3QA 3B02A 2R061 1HCRA 1ND3C 5CA6A 3EUHC 3TNPB 3LEIA 2XAGA 4OQ9A 5IATA 3C7EA 1KS4A 4ZKTB 3K4LA 1COV1 5FK8A 3K3NA 1EPZA 3LSDA 1VQ9I 5C6CA 3WP6A 1F9NA 3BR1A 1JTYA 1SFNA 1FYLA 1UU5A 2A5ZA 5GLWA 4XIDA 4JHTA 3GFLA 2IVMA 1CPMA 5ICCA 1Q1HA 3CO7C 3P9CA 3EUHA 1WWXA 2ZMEC 3KP4A 4BQ4A 2HYGD 5ANQA 1LKNA 3MIEA 3BYWA 3IHUA 1WRJA 3ZFEA 4BIOA 4GWNA 3W9AA 3GZAA 1PGW1 2D6KA 1AR91 2C26A 1S2EA 2JD9A 3WDYA 2FNPA 3CP8A 2BGOA 3E5XA 1VJ2A 3RI9A 1LHUA 5H9RA 5FIXA 4BJTA 3TP3A 4O9GA 3EYPA 2DA2A 2VECA 3N9OA 2J1AA 2YSRA 4BBRJ 4WVVA 4OULA 2BDRA 1MBFA 3V7CA 4FP3A 1LR5A 3GEZA 1XQNA 1U5TB 4QM9A 1DZQA 3U4XA 4XBFA 5G05L 1EF4A 5LD2C 5LASA 1UU4A 1QPIA 4P9YA 2HYXA 2Y8KA 4CHUA 3RZDJ 1WGXA 4LOSA 3VKOA 4L5JA 3BR3A 2HI3A 4YM0A 1YCIA 2LOOA 3ZQ7A 4YFWA 4Z1VA 3ERED 1MJAA 4AHWA 5E89A 4QX5A 1MBJA 2FXAA 4M71A 5H20A 1DQ2A 3RQ4A 2WNEA 1YC61 3TN91 1SLTA 4HF0A 2I07B 2DTZA 5FKOA 4Y1YA 1W6QB 4I6ZA 1RXFA 1RUI2 3KZZA 2KT0A 1OT5A 3ES1A 2X0LA 3DPRA 5BV6A 1Z67A 3DCQA 2W52A 4AM3A 1PVC1 3ZXLA 2C5DA 3W20A 3FMQA 1ZRDA 2UV1A 2P17A 4ESBA 5LRSA 4YW7A 4XF4A 3EHKA 1XSRA 3SCHA 2LKPA 3DPTA 2GXGA 2X1CA 3JSPA 1UXXX 3MIGA 4P9UA 4ZYDA 2AQFA 1TNTA 1I50J 3M8EA 1VMJA 2QQNA 1T2XA 3DEWA 4LUMA 3JB4C 2A69F 1TTYA 5C4WB 1FSEA 4MIMA 3ZR5A 3WNPA 2X1EA 3RPUD 4QWQA 3DPRC 3BOPA 2HWD3 4OUMA 1XGOA 3DEEA 2BW3A 5FZCA 5DN2A 4XUNA 3V0AA 4AGRA 4FXGB 3UV9A 4H7MA 1QVTA 2QUOA 1DP0A 3S30A 2P37A 4QXCA 5A32A 1CAXA 1R1A3 2WWJA 4HN0A 2BERA 2IGNA 2Y6GA 2VOWA 4OHZA 1W28A 2RM23 5C4JJ 3JRIA 4IESA 4DNCA 3PJRA 4ENJA 2R071 3AYDA 1HF0A 3F21A 1IZ3A 1EV12 3COAC 4ZZDA 4IOCF 5FZ1A 1ONAA 3KMHA 2MFZA 3HMYA 2F4IA 1E57A 4DEQA 3SJMA 3HRSA 1QJFA 3B7MA 4WM7B 3AKQA 2E1NA 2ZX0A 4AI9A 1IKQA 1NY71 4MGYE 1DGRM 1PM7A 2HJIA 1W2TA 4Q4Y3 4HYEA 3ELKA 4ZYEA 1KZHA 2KPMA 5J47A 2YUSA 4QPGB 4AI8A 1E3PA 2R93J 2ZMNA 1UJ8A 5FZDA 2R7EB 4BOWA 1ODMA 3ME2A 2R063 2BOIA 1F4AA 1SMTA 2E35A 4OMZA 4Q29A 3MD2A 2N7GA 4LBQB 3M3QA 1QWRA 4IF4A 1N3OA 5FMDA 2ZX4A 3QU3A 4G7ZF 1MDMA 4EROA 3HQXA 2YGMA 4B09A 5M3MJ 1UAIA 3K77A 4NMIA 4NQWA 4UVAA 3G6JB 2VUJA 4CYCA 1S9HA 4RGUA 1B35B 4B48A 2ZB9A 5FP3A 4FQZA 1R4MB 4HW0A 2DLLA 2B45X 2HWF3 2VZOA 4NHLA 1RIRA 4B3XA 2IJLA 2R5ZB 2M1BA 2XAFA 3LDKA 1RUE3 4BUPA 4CUCA 4YIRX 4QX0A 4IGOA 2BVBA 5C4XJ 5LBCA 4PJYA 1TT0A 1YQ6A 1Y56A 1GQGA 3VLBB 2RJKA 1DGLA 3VZOA 1TWGJ 3HJEA 3BDDA 2PJRB 5C9AB 1NCRC 2EWNA 4OWRB 3ZDSA 5CKMA 3BTXA 5TJJA 4F3QA 1NCQA 3CJIC 1GBGA 3G3ZA 2HEWF 2BWAA 4IKFA 3IKVA 3WUDA 5FTTC 1W5CC 1W8OA 3WU1B 1AKHB 2F48A 3L9FA 3I55I 2IXHA 1KDKA 4BXSV 2CUZA 2WAQN 4UAPA 4JC1A 5I93A 1RUF2 3T0DA 4XRMA 2JDPA 5FLHA 1O3TA 4HVQA 3GNEA 2VOOA 3S3OA 5KCMA 1QJX3 3JTGA 2UY8A 2IXLA 2QENA 1UMZA 1R4NB 2HOSA 3OGSA 5J96B 2W2IA 2Y30A 2LTNA 3CJRB 3VKLA 4DO0A 3K4DA 2XDVA 2DA1A 2ZSHB 3OY8B 1VNDA 4JX0A 1ETVA 2DFIA 1VQ5I 2W3JA 2M3AA 4YW4A 2WBKA 2LVSA 4DY3A 4CDWC 2VPRA 3USUB 1JYCA 2K9ZA 5J8FA 5L3FA 4Q0QA 4MV2A 2ZEYA 3QU6A 4A7KA 3RTRA 2ISZA 2C6SA 3FJSA 5EF6A 1MZ6A 2HWE2 1XPXA 4LK6A 5KAFC 3ROUA 2WY7Q 1ZAOA 5GLVA 3M1CA 4QKNA 4XSXF 4K8FA 2V9VA 1R1TA 3VBSB 1OH3A 1HLVA 1TWFJ 1J58A 2DU1A 1JTXA 2D3SA 2F5CA 3F8BA 5A3PA 3FE5A 1NT0A 2QYOA 1EPWA 1DIWA 2Z4FA 2K2SA 5CB7A 2TUNA 4RDUA 4JCKA 2VNVA 2Y6HA 2G9WA 4H4KC 1AKHA 5ED4A 3GYDA 3WSOA 1GHCA 4LE4A 5C3SA 1A6CA 4BHCA 4U0VA 4Q4X3 1Y0NA 2YBSA 2HH9A 3PUSA 1NCQB 4NROA 5T5PA 4GYGA 4B8EA 3KV4A 1T98A 1K12A 1OD3A 5FKKA 1L3JA 2Y38A 3S7IA 2RVCA 1HV1A 5DXDA 2UWAA 5FOBB 3NJVA 4NBQA 4W97A 1SFYA 2ECCA 4LLFA 3AXDA 1SFPA 5JZGA 3J7LA 1BLZA 2EFOA 3J7YJ 3GM8A 1TT5B 3ZMZA 2BEOA 1UY2A 2BHYA 1RMU1 1RUD1 4CEWA 1XNCA 3JREA 2WNVA 4JGYB 5F6FA 2FE3A 2XAJA 2CHHA 3CZJA 3G71I 2ID6A 1J2XA 3T2OA 2DPUA 5AVPA 3NJXA 1JS9A 5HCHA 2RREA 4ZS2A 2VUMJ 1IJWC 1FBUA 3VSLA 3CTAA 3QCWA 5D8AB 1OXCA 3BI3A 3E5UA 1WMFA 5FXXA 1DHKB 2QTWB 3ALQA 2VMEA 3DP7A 1ND2A 2ZJPF 4BBSJ 4QX3A 3ZXDA 4XFCA 3TEZA 3J7AY 4WWCA 5FO5A 1BOAA 4HBNA 5C8CC 5FZFA 2MD0A 1JHHA 3UJOA 2XXZA 4E4SA 4L9VA 1UY4A 1ZVFA 5K4LA 1I39A 4GALA 4NVPA 1S4CA 1WCQA 4PSWA 2OF7A 1LPQA 1AJKA 2O8OA 4HX8A 4HLXA 4BQXA 4YSFA 2LG4A 1YFHA 4FFFA 1HJFA 2P2KA 2WTEA 1MNDA 1KEXA 1GVDA 3PU8A 1ZH5A 2Q0AA 4JOMA 3GLLA 2PLV1 3DWLE 3MKWB 1T2KA 1MMAA 3TQNA 1E3OC 4WM8A 4QKDA 4NPMA 1OQ1A 3FISA 4N4OB 5K7ZA 5BNPC 1W5TA 1RL3A 2PHWA 3V65A 3MO4A 1R1VA 5FXWA 1F5TA 3ES4A 3HN1A 1RESA 1W39A 3M3EA 5DUWA 5JLVA 3U21A 2PQQA 3CCMI 2EAKA 3W21A 4JTOA 4UBGA 2B0LA 4LEJA 3F6OA 4OHXA 2C0ZA 2V9PA 3RIRA 2F6BA 4GKXA 1SCSA 1B9MA 5ERIA 3CJQB 3D5OA 4D9JA 3LA2A 3RNSA 4II3A 1A04A 4LJZF 2EK5A 2D6OX 1LEAA 5CZKA 4K1YA 1R5HA 3WNNA 3VD7A 2RQQA 2XROA 1PVC3 1UMQA 3AZVA 1MGTA 1TEIA 2PAEA 5A6ZA 4IHWA 2YX4A 3OSGA 1USSA 4O3MA 3GZ5A 1VBC1 3VBRC 2GLOA 4AYBA 4ZONA 3WINE 2ZEZA 3DECA 3POSA 3CJIB 4F92B 1BA5A 1O3RA 3O1SA 5IVEA 1RUC1 2PFBA 3LSKA 4UVCA 1TVGA 5A33B 3F8MA 4M9ZA 1CPNA 3CBNA 3L1PA 3IM0A 2BOJA 2VMHA 1QJZA 4UHTA 5HNHA 4F52A 2XUBA 3KF5A 3WQ0A 1DYOA 4BEHA 2OX0A 3EETA 3DUIA 2NS8A 2MNGA 4YWAA 1K6OA 1LHNA 5K9YA 1X58A 3IKTA 4E7KA 2ZZJA 2GNBA 3OGVA 3T2TA 2MLKA 3M3IA 2JDNA 1GZTA 2M87A 3KQRA 5GLUA 1VLNA 3TN92 2Y0IA 5ABJA 1WLCA 3CMEI 4RYDA 3LOCA 4NOTA 1NK2P 1ACCA 3PNYA 4DNYA 1S2KA 4E7LA 3I3DA 4LMFA 3QAHA 1QRYA 3KETA 1GSLA 2IP2A 2JB4A 3TEXA 2P3IA 3N9QA 3PJYA 2HWD2 9ANTA 4LB6B 4PF1A 1XPWA 1YXWA 4X6RB 5DABA 1KU9A 5FMBA 1Y4WA 4LBKA 2R49A 4GRIA 1ETXA 1YQAA 5J3LA 5FR3A 4XURA 4GXLA 1FBQA 2F5EA 3HKZN 3UKGA 2KM2A 5J98B 1G4DA 3H3VK 1RUI1 5IVYA 2L7ZA 1L3LA 1CF7A 4JK1X 2FNAA 1MZFA 3CZ6A 2FDHA 3EXUA 3H36A 1ZGJA 4Z82A 1LOFC 4BMBA 1K6YA 1BKZA 3QD6A 4WZFA 2VOVA 4MH0E 4BDYA 2HWD1 3CC7I 4UW4A 1Z77A 2EICA 1AHSA 1SFEA 1F1ZA 5J4YA 1JZ6A 1PYVA 1AXZA 1PUEE 3AVSA 1C8NA 1IXRC 2AGSA 3IB3A 4XLNF 4M3CB 1ZZ7A 1B1BA 3PTYA 2VQGA 1LDKB 3WTYC 1GVJA 3CLQA 4W6YA 1BI2A 5E79C 4QX7A 1G59A 2VG9A 2DYCA 1O4YA 3EO6A 5FZ0A 5EIYB 4K2EA 4HPKA 5T5JA 4CDUB 5E17F 3F22A 1MQTC 1WBFA 1SEFA 2D2WA 1XDUA 3ZYHA 4N0BA 2VASA 1TMF1 4XILA 3ZKYA 5HS8A 4Q26A 2EF6A 3IPVA 4LG3A 1Z0HA 5DAQA 3FFQA 1MVQA 4M0HA 2P8TA 3ZQFA 5J09A 2VL8A 5GKAC 3JBG1 5BPXA 4DIQA 1LEDA 1AWCA 1XE0A 1ZKGA 3A01A 3JBG3 1OQDA 4NIDA 3GTQJ 3T8TA 1WJCA 4HX7A 5FD6A 3AG2H 4M9XA 5EZHA 1JHJA 1W8NA 2TCTA 2MLGA 1MBHA 2LY1A 1X2MA 5FOJB 2A05A 4KBZA 3FHAA 3DKQA 3MKYB 3ZFFC 3AB0A 4UYBA 1POV3 4OMDA 1J3RA 3NAPC 3FUQA 1XCVA 4CCMA 4BLJA 3BB6A 1QDOA 4N8MA 1B35C 4KFCA 2RDNA 3HEFA 3NV1A 4CP0A 3D5RC 4MVTA 4EJVA 2XLFA 1XYPA 2BWCA 4HK8A 2ARCA 2CAUA 1G8XA 3N9MA 1XYNA 1H8TB 4C3JJ 3KVBA 1RETA 4GMP1 4CYCB 2IXCA 3DBRB 3S1MJ 4EMSA 1BVP1 1Z3YA 2BRTA 3BVCA 1NY72 3HJRA 4PLOA 4KT5C 1M06G 2A1XA 1H9TA 2LNBA 1N1SA 4BQ2A 3G6EI 1X36A 1VBE3 4C2UA 3LWCA 4XCAA 1J0RA 3F9KA 1MH4A 4FPHA 4XUPA 2VMFA 3ETPA 3MV11 4XTMA 2HDCA 1YRZA 2R041 2DPDA 3CO6C 1D4VB 2ZMLA 3SQOA 1K79A 3LIHA 4O7XA 3T2QA 5JOZA 3BTAA 2HPIA 1NXMA 5B66C 2BTVC 3OOXA 5BS6A 1S0EA 2C1FA 2XC7A 3WTVC 2VCAA 3U37A 3WF1A 4XJZA 1RUD2 5GTIC 2ET7A 1BOBA 2Z9OA 5GLTA 2Y6KA 4RB0A 1K5MA 4KIBA 3OYBA 1POV1 4LBQA 2FMLA 2M4KA 4OINF 2HPMA 1ZRIA 1TNSA 2VH9A 3GBWA 3VHNA 4XRSG 2M8GX 2GC3A 4FFGA 1SQ4A 2YU2A 1DQ5A 4I7HA 1ULCA 1FX5A 3WTUC 2OZJA 3S2DJ 4PJ0C 3RVHA 1Q8OA 1UW8A 3ATGA 3WOGA 2CMPA 4HQMA 3WXPA 2YXSA 2BW3B 2YU1A 3VDCA 5EYRA 2X8KA 3QYEA 2BNNA 3RRDA 2Y6JA 4AVSA 2G7UA 3X2QH 4IRIA 3APBA 4I30A 1XGNA 2GSYA 4FCAA 4JRAA 4HSTA 1ETWA 5BXXA 2DMPA 1QZYA 5LCWL 5LGTA 2WA4A 1HQLA 3WG7H 4L0ZB 1DCSA 3B9IA 4AZZA 2GC0A 1NCQC 2W91A 1CAWA 2VOXA 2LUWA 3N9PA 5CU1A 5EPAA 3JTHA 1VBC3 2X05A 3NEUA 3V8KA 5JAXA 3PHMA 1PVC2 5T55A 2CWMA 1WJ5A 2D3RA 1IG3A 2VNRA 3DF8A 1D8KA 1XCBA 1FP1D 3K4CA 4R9BA 1QQP1 3ASIA 1VQKI 2DFCA 3CIHA 2M0CA 2L4MA 4C1WA 2QQAA 3CJTB 2JICA 1I3QJ 4DB5A 4RS5B 4BAYA 3A0HC 4MQ9F 2AH2A 2XQXA 4HOBA 2FDKA 3OD0A 3ZIWA 2GXBA 3WW4A 5LBQA 2ACJA 1BK1A 1WZXA 1BHGA 1TW3A 1RUJ3 4YZ4A 2D6LX 3O7OA 4FOWA 1RC6A 4B1MA 2CV2A 2ZEXA 1RI7A 3H9JA 2VPVA 1T38A 3DGTA 1O91A 3GFIA 4E8DA 1H8VA 1MNEA 3UL2A 1EJ9A 3LGRA 2EA7A 4JGZB 4YARA 4LBOA 3TYJA 4NB5A 2WR9A 3LB9A 4M74A 2RV9A 2HXOA 5DCFA 1CX4A 1UY1A 5CFDC 5CFCC 2IS6A 4KNYA 2J1EA 1U3EM 3D6EA 1V4RA 5LWBA 1DQ1A 4BE1A 1X9PA 1EV11 5HOOA 3W59A 4TTGA 2WDBA 4UF0A 5FUNA 4AI0A 1VBB3 1X50A 4XUQA 1UZZA 1TQPA 1UZYA 3W6JB 3ABMH 4JZRA 4Y5TA 1V6NA 3H3UA 4K6BA 4RR3C 5LW9A 3WX5A 1RMU2 1S0JA 1RB8G 3GFMA 4BWOA 1P4AA 4IQJA 1SG3A 3TOBA 3RQ0A 1GYKA 3H8RA 2FOWA 1YHFA 4UBHA 5DYMA 5ACA1 2VMCA 1OOPC 4HSLA 2IRFG 1O7FA 2ZS6B 3LOIA 2KR2A 3HOVJ 1VB2A 1JYVA 1DU3D 4CU9A 1XRUA 5F1RA 5L3BA 4OI4A 4JGYA 4D6SA 5A3UA 5FYHA 4IEXA 5FZLA 1XDSA 1IKPA 4CCLA 2H1KA 1W4MA 2L2OA 3CCYA 1U5YA 3LFKA 4KT6A 1T56A 3BCAA 4HONA 5FO9B 2O9LA 3ZQCA 2OQRA 4HLYA 3QPLA 4FP2A 3CCVI 5FY1A 3IH4A 2ZBKA 2X6WA 4XHBA 5CVIA 3MCZA 2J1SA 1AHDP 3PLQA 2CWEA 2Y0SA 4QPGC 4HG2A 3ZMOA 4UFHA 1XGSA 4J01A 4QQLA 2GMPA 2HWB2 2D43A 4BE0A 4P55A 4I2OA 3LAPA 2ECBA 4ES8A 3WLUA 3DTEA 4P9LA 2X53S 4EWDA 4L9NA 2OTLI 4K21A 3O1PA 4PDWA 1DDLA 2HEOA 3KYCB 3W2WA 1V6IA 3ZFFB 4XIKA 3H50A 2O8KA 1R1ZA 1WCDJ 4JTNA 1SLBA 4D3WA 5JOYA 3JRFA 2M8EA 4ZYHA 2M34A 5CJ9A 3GZ6A 4QM8A 2WFF1 2VR4A 5A2QZ 2PXJA 5A33A 2FF4A 4IO9F 1AR93 4LQRA 4YW1A 4EN8B 1PVXA 1JUSA 2DURA 5EHDA 3F8FA 5E6HA 4C3HJ 4KNCA 3USSA 4AVCA 2XJRA 4YFZA 4DOZA 1XNDA 1PGL1 5FMOL 3ZYFA 5A3TA 3TMOA 1YI9A 4B7KA 4MTEA 1N1TA 2J42A 5HVQC 1Z3XA 1RPWA 5FKMA 3AX4A 4FOQA 3SDGA 2YPJA 2G4IA 1ETOA 2DMTA 2YPRA 2PBIA 1EA3A 2E19A 4XDOA 4OIRF 1PK6A 2QCOA 2X29A 3EMRA 5E1XA 2YHJA 4XCBA 3VYRB 4JX4A 1VAVA 1XU2A 3VDBA 1GU3A 4B44A 3A0BC 1UY3A 1F15A 1I9RA 5IVBA 3JXSA 5ILUA 3ZFGC 1EH7A 4L9JA 1YITI