3MZHA

Crystal structure of camp receptor protein from mycobacterium tuberculosis in complex with camp and its dna binding element
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
225
structure length
225
Chain Sequence
HMDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Camp Receptor Protein from Mycobacterium Tuberculosis in Complex with DNA and cAMP
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription/dna
molecule keywords PROBABLE TRANSCRIPTIONAL REGULATORY PROTEIN (PROBABLY CRP/FN
total genus 62
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3mzhA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3mzhA01
5C8WA 1Q43A 4FAHA 2P4WA 1Q5OA 3O14A 4LG0B 1E17A 4ASNA 3MZYA 4GYIA 4Y15A 2G9WA 4EJVA 3K2ZA 3KEQA 2D93A 1T6SA 1S29A 1T2KA 2RKHA 1H9TA 3ZMVA 5HI0A 3SZPA 4JTNA 2O6GE 1LDJA 4M6YA 4ETSA 2XL9A 1P4WA 1YYVA 2A3SA 3DEUA 3KGLA 4UUVA 2GC2A 1DP7P 4MGZE 3DL3A 1LDDA 2M30A 5ED4A 3J80K 3JW4A 3CLPA 3MQ0A 2ZO4A 3SCHA 4IRGA 1H1IA 4QGMA 2Z33A 1MJ9A 5J8CA 4KUMA 3KP4A 5DD4A 4LTAA 4EROA 5JSPA 3F8FA 4A5NA 3ZP5A 4KT5C 4ZYDA 1H0MA 2DK5A 2RQPA 2GWRA 3ETQA 4MGYE 1O3QA 1EP0A 3RKXA 3SCFA 3CEWA 2D5HA 2XKPA 2RC4A 1VP6A 4Q0UA 1LNWA 5K8SA 5I91A 4EQQA 4IJAA 2PBIA 3DPLC 5CVRA 5E20A 4BHPA 3H7YA 4LK1F 4OOIA 3D82A 2CAUA 2FQPA 4X6QB 1OYIA 2UYBA 4HX8A 1D3YA 1BM9A 2V79A 5FLHA 3IRQA 2OQRA 4QXKA 1BIBA 1QY4A 4XFGA 2X0LA 2FSWA 5KHKA 5H6RA 2NYXA 1P4XA 2FOKA 3SHFA 1ZX5A 4HAMA 4HN0A 4EJTA 2BV6A 3SQNA 1L0OC 3NQOA 5E18F 2O8QA 4Q0QA 4E2QA 1G3SA 4D7SA 5DV5A 4KIGA 5E8GA 1FP1D 4KFCA 2KJCA 2BNMA 2EV5A 5FDBA 3EQEA 5L3GA 3E6DA 2ESHA 2OA4A 3JAMZ 4LULA 2G7HA 1LJ9A 4LLOA 2GXGA 1IN4A 3EJKA 3HTUA 3R0JA 2STTA 3T1BA 1KQ9A 2QLZA 4IF4A 3WW2A 1O3RA 4N9HA 2FF4A 2IVMA 3QACA 3U9GA 4GULA 4LUMA 1UFMA 4I01A 3IC7A 3FMRA 3TO6A 2ZKLA 3NW4A 2HOEA 3HSRA 1S8NA 2PFWA 1XMKA 3T5XA 3C7JA 3IWFA 5JFRA 2DBBA 3BALA 2ATFA 3SMHA 1STZA 1XDSA 4KU7A 3I0TA 1WLTA 5D6FA 1RUOA 1SEFA 1NE4A 4XFHA 3L00A 3E6CC 1IRFA 5D4SA 2D5FA 2XAGA 1HXDA 4KMUX 4YFXF 1ZLJA 1CAWB 3ZDSA 3D0SA 3WTWC 3JTGA 3WTTC 3TO7A 4UXAA 5H20A 4IETA 4GXOA 3EQLF 1JHHA 5KK1A 1Z1DA 3G73A 3G3ZA 5FFZA 4Z07A 4UVBA 2X4HA 4RGSA 2E7WA 4IEXA 1QGPA 5K1YA 5BV6A 2V1XA 4RB1A 1JXSA 4XFIA 2QQ9A 3CTAA 4I7HA 2XKOA 1ODDA 3GVAA 2DK8A 3H7JA 2MLGA 4BHBA 1K78B 1PM7A 1D8KA 3LQQA 3UKNA 4QM8A 4JK1X 5FQ0B 4E2SA 4XFAA 2FBKA 4IEUA 4PGGA 2CW0F 3F8NA 5LHHA 1QXRA 3QPTA 2IXHA 4EMSA 4XEZA 3I53A 4PIXA 1PUEE 4LA3A 3NKTA 4A6EA 4XETA 3CUQB 1CGPA 4L0ZB 2KIUA 3U2RA 5FD6A 1KGSA 4MUVA 3HRSA 3CO7C 1DUXC 4AVBA 4PIZA 3GZ6A 4WBBA 5KHJA 1JGSA 4MHGA 1VJ2A 2FA5A 2C0ZA 4XSZF 5ERIA 2DCTA 1AWCA 1F1ZA 4O3MA 2F5EA 5F64A 2IC1A 3LWCA 2GU9A 4A6DA 4EGYA 5FLJA 1BI0A 4I2OA 2NNYA 2M8EA 1WKMA 2W85A 4IXAA 3LAJA 3RYRA 4XBFA 4I0AA 4ESBA 1RTVA 5CVJA 4G8XA 5E1XA 4QGNA 2VC0A 3ULQB 3WTVC 2Q4SA 1FSEA 5DCMB 1USSA 3MCZA 1DPRA 1XN7A 1FYMA 1QQIA 3NEUA 2PFBA 3O6BB 1CAWA 2UY9A 2VQAA 3VFZA 5L3FA 5A2QZ 4ZU5A 5IT3A 1CAVA 3QOPA 4P55A 2M5WA 1J59A 1T0FA 2VE9A 2ET1A 4KIBA 1YS7A 4WXHA 3HSEA 3R60A 1K7AA 2K27A 3H9AA 4XF1A 1IN5A 5I0UA 3ZMDA 3BROA 1HSJA 3RYKA 3O3KA 4EWAA 1W5TA 3KEOA 4HBLA 2ZBKA 2XV4S 1OYWA 4M73A 2ZCWA 2QNKA 2EJRA 4HYEA 4TLFA 5KHHA 2VONA 4HVOA 3L2HA 1XGSA 3FF5A 4IEZA 2EVXA 4YNIA 3BU7A 2IXLA 4IEYA 3GYDA 4L5JA 3K1PA 4ENNA 5DUIA 2IT0A 5CADA 1CAUA 3MYXA 1Z6RA 5E1RA 2QQAA 3H1YA 2Q0OA 2CWEA 3TGNA 4IEOA 1BN5A 4UBGA 2HYFA 1FC3A 4RB2C 3W6JB 2FNPA 3WODF 3ECHA 1B6AA 1HQCA 1X82A 3NSTA 1W7PB 4Q0VA 1LDKB 2FBIA 2CAVA 3TOBA 3GFJA 1Q1HA 2FXAA 1GQHA 1NE6A 3WE3A 1ZGJA 1L3LA 1QNTA 1XB4A 4HQEA 3E97A 2Q8KA 3ES4A 3OGJA 1O4TA 4I09A 6PAXA 4DQ2A 2B0LA 3S2WA 2QJVA 4D7TA 3I64A 4KIFA 1U6GA 5AVPA 3PQKA 4U7BA 4AQ6A 5ICGA 2YX7A 3VB2A 4XF0A 3WTUC 2VXZA 4HLXA 3EUHA 2IXIA 3SXWA 3CUQA 3NJZA 5BY5A 4KWLA 1REPC 1HW5A 4QGLA 1AOYA 1YW8A 2H0VA 1F4KA 1ON1A 4HX4A 2EFPA 3WGHA 1ONVA 4FBFA 2F5CA 2ET7A 4XFBA 4ZH4F 4R1HA 5HDNA 2QDRA 2AS5F 4A5MA 2P5LC 3FHIB 3MAJA 4ESJA 1R00A 3IWZA 3VHRA 3FM3A 3QU3A 4ONUA 3KFWX 3E6MA 4HLTA 2KRFA 1WQ2A 4RGXA 1XDUA 2AXLA 4HBNA 4P9GA 3JZVA 4MZUA 3RTRA 3WTYC 3FX3A 4A12A 1KU7A 4OIRF 4P9UA 4ZYGA 3GW2A 1TTYA 2FU4A 4FT8A 1HKSA 2Y48A 2PJPA 2V1DA 4WK8F 1IAWA 1YFYA 2ACJA 2VBYA 2K4BA 2XLAA 3COAC 2VT3A 2UY8A 1X8EA 4KWKA 1ZG5A 2ELHA 3ML6A 2HQNA 3D0JA 4EVIA 4RAYA 1ZG1A 2QBYA 4WZCA 2OBPA 1XGMA 3M70A 1BC8C 1RZ4A 3HOTA 2EA4A 1ON2A 2DW4A 5HDGA 1H1MA 2ZMEB 5K5QA 1ZH5A 1XGOA 4NHJA 1GHCA 2BE5F 4I0BA 4U0VA 2VECA 1IPJA 5I8YA 3LAGA 4P9FA 4M71A 2XRNA 5I0SA 1Y3TA 1Z9CA 2VODA 2LKPA 4U7DA 5F6FA 5LGTA 1XSXA 2EWNA 2JTVA 3F8CA 1VTNC 2EK5A 1YTYA 2FE3A 3K0LA 5BS6A 2I45A 4MGIE 5DUKA 1P2FA 3BB6A 1OFNA 5DYMA 3WW1A 3E5UA 1DPUA 2FRHA 2DU9A 4R52A 4HSLA 3HRUA 3FZVA 1CAUB 5E1ZB 3RJPA 4G9YA 5BPIA 3TDZC 4F7ZA 1ZRCA 3H8UA 4WXDA 3I5UA 4HV6A 1J58A 3FMQA 4RB3C 1K79A 2QUFA 2CO5A 2PQQA 1W7PA 4YYOA 3ECOA 4IRHA 4LG0A 4TV7A 2MLKA 1TW2A 2YPRA 3Q9VA 4MGKE 1SD6A 2QVOA 3GF2A 1MGTA 4JTOA 4WCGA 1ULYA 1J1LA 3E5XA 2IXCA 4Y13A 1DDNA 3F8BA 3QP6A 1ZZ7A 3EETA 4HZFA 4OIOF 1OKRA 1IXSB 2L3DA 4B09A 4EWDA 3T8TA 5CVIA 2P5KA 3CO6C 1HKTA 1EH6A 5LEKA 3VOEA 4IPAA 1BI2A 4XLNF 1Z6TA 4PIYA 1J3QA 1SMTA 4HVQA 3WTZA 2Q2EA 3LQRA 4L9TA 4IRIA 1UHMA 3IHUA 3E5QA 3QRFF 4L9JA 2RNJA 1O3SA 2DAOA 2PMHA 3L7WA 1FPQA 4YFNF 3IKVA 2EFNA 2O3FA 4R79A 3FXRA 4FHTA 4Q0PA 3E3VA 4MGRA 2GC1A 4HMZA 3GO5A 4PCQA 3ELNA 3MPBA 2P8TA 2CQKA 5ICEA 1EYBA 1FWZA 1P6RA 4AVCA 3S7IA 5FPZA 3U0ZA 2Y0OA 4EGZA 4LLLA 4O9GA 3DQVC 3I59B 2Z9OA 2QENA 1O3TA 1IF1A 5D5UB 2PN6A 4GCVA 4MTDA 1Q3EA 4HA8A 1ZZCA 2IW5A 4D0PA 2WWYA 3VEPA 4KN7X 3DXJF 1KQ0A 4H0EA 3RKYA 4U0YA 3HHHA 1EH8A 4B8XA 1R7JA 2A07F 1YWKA 3GZ5A 4OLLA 3H1WA 3DV8A 2P17A 1IW7F 2BNOA 2IA2A 1ZRRA 3EHKA 1HKQA 4MNUA 3CL1A 1UCXA 2PMUA 4ENJA 3BJOA 2A69F 2MC3A 2H27A 2VC1A 5J3UA 4META 3V8JA 3RZZA 2DT5A 4KU8A 2HKOA 5HOOA 5JHUA 1RGSA 4RB0A 4NVPA 2ZNYA 4M9XA 4RS8A 5FGMA 1YW9A 2R7DA 4G6DA 3WE2A 1S6LA 1JUHA 2DTRA 2L02A 5BPDA 4KNYA 3VODA 4Q29A 2YR2A 4I98B 1NHAA 1JE8A 1BC7C 1L3JA 1QXJA 2GQQA 2EFQA 3USSA 5HDKA 4EM1A 3V7CA 4BAYA 2RGVA 5ILVA 5TRDA 2F4PA 1R1UA 3KSCA 3HTSB 1KYWA 4AVAA 3HIFA 4KWJA 2ETHA 4ZYHA 4Z82A 3K69A 1R5HA 3ROUA 3HQXA 2K02A 2GAUA 3WG9A 3EYYA 4AIHA 2IXKA 1U5TB 5D6EA 3GLXA 3FHZA 3BDDA 5C6CA 3PQJA 3GUDA 1T38A 1J0RA 5FQ0A 4MEXF 1I27A 3UKVA 3GEZA 3HT1A 3FWEA 4QWQA 2QYOA 3DPTA 2PTMA 4EJOA 4HDUA 4CDGA 2BGCA 1OPCA 3GFIA 1WWXA 1XE8A 1G6NA 4A0ZA 2STWA 1XRUA 4FX0A 3BOQA 5EEGA 3BCWA 2MBFA 2XHKA 3DKWA 2J5OA 3KE2A 4CGZA 1XGNA 2MHFA 5HLHA 2WC2A 3BPXA 1G3YA 1FSHA 2ISZA 4LK0F 4CHUA 4CZZA 1QZYA 1X8MA 1B9NA 4CXFA 3ZMUA 2EFOA 4B29A 5JSOA 4IVNA 5JAXA 3HHGA 5I0TA 1SD7A 2M1BA 3GYHX 1IRGA 1XE7A 4YRDA 3ZMTA 2W84A 1U2WA 3SZTA 3SFZA 4YFKF 3WW3A 3L9FA 2HDCA 4OMZA 1YFXA 1XCBA 2NNNA 1P4AA 1YQAA 3I54A 1O57A 1IN8A 3TQNA 1ZGAA 4Q5SF 1LEAA 4XSXF 1S7OA 2PLYA 3C3WA 3DP7A 3H3UA 4LGWA 1O7FA 1FX7A 1RIOH 5LHGA 4LFUA 4BNCA 1FT9A 3HUGA 2O8XA 4G7OF 4BHCA 3H50A 5FLIA 2DPUA 4IEPA 3Q5FA 4JBAA 2MD5A 3C1DA 4E70A 1LB2A 4OU0A 4J1WA 3TOAA 3TNPB 1X7NA 2MH2A 2VBZA 5K5OA 3GWZA 1BJAA 3ACLA 5LRSA 1G3WA 3BWGA 3MZHA 1FLIA 4IEQA 2VOPA 3MDPA 2HZTA 4OIPF 3IKTA 2MNGA 4WVZA 3WU1B 2COMA 3ERED 3KP7A 2KIFA 3KLNA 1FBSA 4WXCA 3F72A 1V3FA 2OZ6A 2A5YB 1ZZ9A 4BIFA 1YLLA 1ZARA 2E9QA 5LGUA 1FXZA 2JPBA 4ON0A 3ZMZA 2A6HF 4ORFA 4AD9A 1TNSA 1TQMA 3FJSA 3F23A 1DZTA 5EEHA 2CSOA 1P92A 2QQBA 2L01A 2E1CA 2C6YA 2Z2SB 1CAVB 2HR3A 1B4AA 2GH2A 1T98A 4I3PA 4YIIA 4LLGF 3F6OA 5JVTA 3NL1A 5J7MA 3OD0A 1FY7A 4S04A 3KP2A 4AWXB 2QCSB 4G7ZF 3TO9A 1YFUA 3M9AA 5CJ9A 2FNAA 4KL1A 2XUBA 1J9IA 3KGZA 1O7LA 3V8KA 2MH9A 2XAFA 2HTSA 1D5VA 4E2GA 1U78A 1J75A 3WTSC 3KMHA 3BJAA 2XL7A 3HRMA 1W4MA 4BQAA 5T3NA 2ADUA 3R61A 3QAHA 5IT9K 1U8RA 2B8MA 2ETEA 5J8FA 3QP5A 1OD5A 3EO6A 1PDNC 2P6TA 2PQ8A 1TBXA 3KLOA 5ILSA 1U12A 3LFKA 4XF3A 2KXLA 2XAHA 3KZZA 4NQWA 1DGWA 2CYYA 4JV4A 5FFXA 5I8TA 2ZNZA 3FE5A 3RI4A 1C0WA 3M1EA 2VT2A 5J48A 4QMAA 3S0MA 3ES1A 4BH9A 4YARA 1YUDA 1SFEA 2K0GA 3RPUA 2L4AA 3JSOA 1KU3A 5JCTA 4M9SA 2GA2A 4Q4ZF 3ZPLA 2R7FA 5KVRA 1QPMA 5F1RA 1V70A 2IA1A 5BMZA 4LUKA 4AXOA 4KMFA 5CLSA 2HGCA 1QO0D 1XMAA 2FBHA 1TQIA 4IEVA 3HOSA 5I8SA 2XVCA 3ABTA 2O0YA 2OZJA 3P7NA 1R1VA 4EJWA 3CLOA 4L9NA 3IIAA 5FD5A 2VPVA 4XFCA 1ZZ6A 4EWEA 4L11A 2YU3A 1JHFA 3AAFA 4J1XA 2UXXA 3REOA 2RVCA 1BI1A 2A61A 5DD8A 2NRAC 3HSFA 4HV5A 4XF9A 2B5HA 4Q0SA 4RD7A 3Q9SA 3U11A 2XLGA 4PDKA 5FLXZ 2XASA 5JR3A 1F5TA 4ZZDA 2DI3A 2W57A 1YFHA 5IT9Z 1IN7A 2HWVA 3R0AA 5ICCA 1IPKA 3LA7A 5BUVA 3J81Z 3HT2A 2A6EF 2MPFA 3P9IA 5HS9A 1SD4A 4Q47A 5FLXK 2BBYA 1ZAOA 4EV0A 1O5UA 1R36A 3DN7A 2O1QA 4N0BA 1W7PD 1R23A 5LBQA 5FCCA 2V1UA 4G7HF 1PP8F 4UVCA 1UIKA 1V4RA 2E1NA 3CF6E 2RV8A 3EYIA 5D5XB 1KU2A 3NVCA 1SFUA 4XLPF 1SD5A 4ZU7A 4MX3A 3MWMA 1IXCA 2OPKA 4OINF 3BJ6A 2IJLA 5J6XA 3BY6A 2D1VA 4HN1A 1UPIA 2VE8A 1FYKA 2D2WA 3G7DA 1SFXA 2H6BA 1GXPA 1IUYA 1NYWA 4FAGA 5L3CA 2BEOA 5D5WB 1TLHB 5JR7B 2DLLA 4WX9A 1USTA 3WGGA 4KA4A 3GFLA 4RGRA 4A0XA 2HYGD 2BYVE 3OCPA 3PLQA 2OU2A 1TW3A 1LQ1A 3FXUA 1WGPA 2XLFA 3U10A 3ZMSA 1RI7A 3PVBB 4M74A 1Z7UA 2F5FA 5FB2A 2GZWA 1QBJA 2H94A 5H6QA 2E7XA 2VBXA 1XD7A 4LEJA 1U3EM 4IEWA 2DQRA 2O03A 2Z99A 3GXOA 4AQ2A 4I02A 5LGNA 3TNQA 1MJBA 4UBHA 1FOKA 3F22A 4EJUA 2V6CA 5JSRA 2IPQX 1YS6A 3ABUA 3S7EA 1R5GA 1YHFA 4AVPA 4JVAA 5L3BA 3LWFA 1KU9A 3L09A 4K2EA 1J2XA 5DCMA 4KICA 2JRTA 4RGUA 4ZYEA 4OFGA 4HW0A 2PHDA 1HW2A 1HSTA 4GYGA 4PJYA 3FXQA 1ZZBA 4N9IA 1D8JA 4X6RB 3WW4A 3CJNA 1OR7A 2Z69A 4QX5A 3W6KB 1GQGA 2RDPA 4CYDA 1G3TA 2D45A 1BOAA 2EA2A 2ZKZA 4QM9A 1TQ5A 5KHIA 3N97A 3KP3A 3V4GA 1R58A 2P7VB 4LD5A 4U88A 3U1DA 3UKTA 3B73A 2VOOA 1S3JA 1OYYA 2HFHA 2JZYA 1BIAA 3K1MA 2ESNA 2UWMA 2GXBA 4HF0A 4EM0B 3LA2A 5AONA 2OZUA 3GX4X 4H7LA 1F9NA 1YIOA 1ZREA 4CICA 2YX4A 2EV6A 2IRFG 2PAEA 5CU1A 2PG4A 4ENMA 2P5VA 3FM5A 4UXNA 1I1GA 1J5YA 2M45A 1WRJA 2J5PA 4S05A 3WTXC 3IRRA 3M8EA 4PGHA 4HDVA 2Y75A 2QBYB 1CF7A 2EAAA 2PAKA 4UV8A 2UXNA 4ESFA 4HQMA 4LB5A 2H09A 3HRTA 1YO5C 1MJAA 2ZFWA 1SAXA 1ZLKA 3JTHA 5FPXA 4UNOA 2LNBA 4WWCA 4A2UA 2GIVA 2XGXA 3RKWA 3R4KA 1EPZA 3H3ZA 5HVQC 5A2QK 5AIPA 1HBXG 3ZQ7A 3M7GA 2CFXA 2Z3YA 1FBQA 1YW7A 5HLGA 4ZZLA 2UYAA 1DGRA 2K4JA 3SXYA 3IDBB 3KP5A 2DQLA 1K78A 1ZN2A 1KA8A 2G7UA 5JI6A 3QU6A 1E2XA 4KYWA 3SCGA 4ZU4A 4KN4X 4ENKA 1XSDA 2QZ8A 4HLYA 3N4MA 4BXUA 1A04A 1IXRC 3RPQA 5CYVA 2UZKA 1XSVA 5EZWA 4IESA 2DO7A 2OAZA 3FZ3A 4LA2A 1LR5A 2FEZA 2PHLA 3LOIA 1Z91A 3CJXA 3WU0A 2CGPA 3FFQA 3CDHA 2D1HA 3J80Z 2Q1ZB 2K86A 4O5VA 1Z05A 2JT1A 1X3UA 1MDMB 4HSJA 3MEXA 1U5TC 2OYZA 3L2CA 1GXQA 2IP2A 3DFGA 4RAZA 2EB7A 1CX4A 2NAZA 4M6XA 1OMIA 3C3VA 5E1WA 3RYPA 2OA2A 4HOBA 4BYYA 1T39A 4YG2F 1TNTA 2V09A 3ZN0A 1OI6A 1QWRA 1SMYF 2MA3A 1G4DA 5EFUA 4LJZF 3LAPA 1RNLA 4YIFA 2PYTA 2EV0A 3ISPA 5CVUA 2D40A 4MTEA 5ILUA 5CVVA 1S7AA 1MZBA 4MQ9F 1I1SA 3IL2A 3PNAA 2DPDA 5K5RA 3DF8A 5BPXA 3WGIA 3OV8A 5L3EA 3IDCB 3LA3A 4A0YA 3P9KA 1PMIA 1U5TA 2KIMA 2CV6A 3T8RA 3R6SA 3I4PA 4IHTA 4G94A 4XF4A 1FP2A 3J81K 5L3DA 5DDGA 4M72A 3LZZA 3ST7A 3I58A 2OQGA 1XCVA 2N7GA 4IHSA 2BNNA 5LRRA 2PEXA 2QWWA 2Q0AA 3LSTA 3EDPA 1YLFA 1CAXB 3BPVA 1LEBA 1LVAA 2KKOA 1ZVFA 3H92A 3I71A 1ZZ8A 1UCRA 2LSOA 4UHTA 2QVSB 2EFWA 2IA0A 4O6JA 1FZPB 3I59A 2HEOA 4LLNA 3F6VA 2V9VA 5HS7A 4JQFA 2XAJA 4WF2A 5D5VB 5D1IA 4MEYF 4R8HA 2RN7A 3K9TA 4O9EA 5LHIA 3IBMA 1FYLA 1LRHA 2HTJA 1B1BA 4M9ZA 3RNSA 3V8LA 2NS0A 3HYIA 1B9MA 2JSCA 1UD1A 2FMYA 4QLCU 3P9CA 2WTEA 1I5ZA 2DFIA 4FX4A 1ZRFA 1KYZA 2GA1A 3J7AO 2LF7A 2P7CB 1DZRA 4DNCA 4MH0E 2XAQA 3CUOA 5DCFA 1WA4A 2XROA 3BPZA 5D4RA 1PP7U 5I93A 2OD5A 3KETA 4L5IA 5HS8A 2PA7A 2A68F 3ZN1A 1J3RA 2EA7A 2H6CA 3NRVA 2ZXJA 3V7RA 3RDIA 5AIQA 2FMLA 4MQVA 3KCCA 4EM2A 3F3XA 2FQ3A 4U0WA 4IERA 2HS5A 2XIGA 3M8FA 2ISYA 3I7DA 4XRFA 5BQTA 4KDPA 1MKMA 4LB6B 2HKXA 3QPHA 1WSUA 1H9GA 3B02A 1EY2A 2GC0A 2F2EA 3F21A 1Y9QA 5BXXA 5E16A 1CF7B 1YG2A 2JPCA 2VBWA 1KQ8A 1ZHFA 2LDUA 1K6OA 2PI0A 3JAMK 2ZJ2A 2K9ZA 4GGGA 3T0YA 2Q30A 1FBUA 4OIQF 3RIRA 3OOPA 3KP6A 2TDXA 3MFKA 1B59A 1UB9A 2L54A 4MV2A 3CUQC 1ZRDA 3TDUC 1ZNPA 2W24A 2WV0A 2LF8A 1BBYA 4DINB 2PAMA 3CO2A 1VR3A 1I6XA 3JSPA 4AIJA 2B9UA 2IXJA 3F8MA 4K8FA 4OMYA 1HW1A 1W5SA 4Z2YA 3KZYA 4PZJA 1MD0A 3O2PE 3OF1A 5LEJA 5KHGA 1R22A 3SHRA 2F5DA 5D8LB 4YSFA 5E17F 4L0YB 2CG4A 2WFPA 5KBFA 4F8AA 3EBRA 4L9VA 4NB5A 4CO8A 4HF1A 3GBFA 1RL3A 2Z5UA 4HF2A 4LMYA 3C18A 1ZG3A 1RC6A 1J3PA 1Y0UA 4P96A 3E6BA 1UW8A 1SFNA 2K7LA 4G6QA 2GC3A 2YSRA 1SQ4A 1LKNA 1IN6A 2VN2A 4Y17A 4L18B 1MDMA 1FI2A 2R3SA 1WI9A 1EV7A 5TJJA 3ELKA 1QZZA 3OTFA 1BI3A 3BP8A 2P6SA 2M87A 4HX7A 2HJIA 5ICFA 2HQRA 1J7KA 2Y0MA 1TQPA 3GFMA 1NXMA 5FO5A 5DEQA 5LLQA 5BOXA 2O61A 4Q48A 1UHWA 2ZMEA 1YFWA 3V7SA 1EH7A 4UVAA 4AIKA 3H1MA 2QM3A 1O5LA 1GVJA 5D8KB 4HVRA 3BZ6A 3M3IA 2W25A 1UIJA 5I0RA 4P5OA 2KJBA 1R1TA 1NZCA 4UV9A 3K1NA 5HLIA 3FMSA 1RUNA 5E8IA 4GO1A 4L2NA 2L4MA 1FNNA 3D5LA 1IZ1A 3PFIA 3TKYA 1ZYRF 1CAXA 4XFFA
chains in the Genus database with same CATH superfamily
5C8WA 5C3EJ 1GSLA 3R0RA 5FYVA 2DVGA 4OI1A 4FAHA 1MBFA 1W8FA 5FMOS 3SYTA 5FUPA 4GYIA 4CDUB 5CQEA 1V9U3 1W2TA 2AZ5A 1VQOI 1ASJ3 2RKHA 1H9TA 3KT7A 4S2FA 2ZACA 1LECA 1UAAA 3RWNA 1P4WA 1YYVA 3KGLA 1DP7P 2ZX0A 3ZN4A 1LDDA 2VMEA 2LREA 5B2GB 3MQ0A 3SCHA 2AYHA 3B69A 1H1IA 2Z33A 1RUI1 3KT1A 4LTAA 1P7JA 3VYRB 1AYN3 4EROA 5JSPA 1E5HA 1D4M2 3ZP5A 4KT5C 5F32A 5FROA 4ZYDA 2ZJCA 3GTKJ 1DQ2A 2DK5A 2RQPA 3WNMA 4DXSA 1DP0A 3VBRC 1VP6A 4AEMA 4Q0UA 5FBZA 2V4JC 2WQZC 4BHPA 3H7YA 5LZ6A 3LSKA 2RDQA 3D82A 1XNTA 2CAUA 4X6QB 1GZWB 2BW8A 3MF9A 1S9HA 4FASD 3DWLE 1ONAA 2QCOA 4TYSA 3U14A 1ZQ3P 2NYXA 2VTXA 1R64A 5L7OA 3SHFA 4HAMA 3O0XA 2WA3A 4CZSA 2Y6KA 3NRUA 3NQOA 5IATA 3C7GA 4LQRA 1MEC1 1D1AA 2HU9A 3LFUA 4KIGA 1WW7A 4TSVA 2KA3A 1JUSA 5FDBA 2E60A 3E6DA 4COWA 3JAMZ 2YBPA 2WWSA 1A8MA 2RS33 2TEPA 5IP7J 4LLOA 5FKLA 5FYCA 4UFLA 1DBNA 3HTUA 3OYKA 2XONA 1JI6A 1LHNA 2QLZA 4IXLA 2VW2A 3PNVA 1QJY2 1UY0A 3DEWA 1DYOA 5JUVA 3QACA 5F39A 3HUGB 1ZR4A 3MIDA 4GULA 4I01A 3IC7A 3BOWA 4YZ1A 4S0HB 3ZYBA 3TO6A 2ZKLA 2KM2A 3HWJA 1VQ4I 4HL0A 3T5XA 3C7JA 2IGNA 3IWFA 3GZUC 4NAMA 3BZKA 3W2VA 1W0OA 1WLTA 1SEFA 2JDNA 1NE4A 4XFHA 5F08A 3L00A 1TEIA 2LRPA 4IKFA 1W8ZA 3R4SA 1QHDA 1WWYA 2DCEA 1HXDA 3ZDSA 3D0SA 3PUFA 5M5XJ 2R6QA 2L7ZA 3JTGA 4YW1A 5H20A 4HSTA 4IETA 1JHHA 2XF5A 3GJAA 2OXBA 2QKDA 4Z07A 3KEYA 2X4HA 3TN92 2E7WA 3UNPA 2PHTA 5K1YA 3WNKA 5BV6A 2CGOA 2BUKA 3JRBA 4AFDA 2E2HJ 1UZCA 2KRCA 4JC1A 4XFIA 4MO7A 3CTAA 3EXUA 3GVAA 2DK8A 3WHCA 3H7JA 3LSPA 2ORXA 2E34A 3NJYA 1LCLA 4JP0A 3POGA 4AWDA 2IGMA 3MN2A 4JK1X 2QZ2A 1V6MA 5EG0A 2G0EA 3W2AA 3IH3A 1QXRA 2NPIA 3S32A 3GALA 4XEZA 4E8DA 3I53A 1CQTA 4LA3A 3BTYA 3NKTA 3ZX7A 4A6EA 1AR82 4Y7NJ 2QQLA 4XETA 1N77A 4PI2A 1RR8C 5GKAC 3HRSA 1VMJA 3TMOA 1WW4A 3GZ6A 4GIQA 1YE9A 4AHYA 1DFQA 3PUHA 4GA9A 4MHGA 2OQ6A 5GAEJ 2FA5A 5JOWA 2JECA 2CUEA 5ERIA 1QGLA 1AL23 4B3NA 3OUIA 4O3MA 4C3HJ 1GMMA 3LWCA 4A6DA 4KG0A 1YQ5A 4EGYA 5FLJA 1YI2I 1VQ6I 2NNYA 2M8EA 2BZTA 2ZKNA 4IHXA 3WSOA 2VZQA 3I3MA 2BXZA 4JHZA 1CPNA 2VTFA 2XH6A 3DYOA 3WTVC 2Q4SA 2J7MA 4CA9A 2Q2EB 1JUMA 1XN7A 3BG5A 3MICA 2PFBA 2Y9ZA 2UY9A 5L3FA 3NV4A 4ZU5A 3ZFFC 1CAVA 4LOCA 4GB32 3M3YJ 1Z78A 1LKXA 1J59A 1XBFA 4WXHA 1FMD1 1K7AA 1OQEA 2K27A 2CJJA 5I0UA 3ZMDA 3V65A 5C3OA 4AM3A 1SVLA 4EWAA 1W5TA 3KEOA 4HBLA 4E7HA 1CESA 5J37A 4M73A 5L36A 4HYEA 1T8IA 2VONA 1F15A 4UFHA 3FF5A 2G9GA 1BK0A 2ME6A 5J1RA 4XVHA 2WT2A 4L5JA 4XE9A 3K1PA 4ENNA 5DUIA 1W2UA 3KYDB 4XORA 1CAUA 3MYXA 4DIQA 1Z6RA 1W6OA 2Q0OA 3ZKUA 4IEOA 4LBOA 4XLEA 3I9V2 4RB2C 3ACIA 2VO5A 2JG9A 1HQCA 3PIPF 3NSTA 2CAVA 3GFJA 1Q1HA 2FXAA 4BQNA 1NE6A 3NWKA 1QNTA 4JGZA 2DJIA 4BL0B 4HQEA 3KF3A 1O4TA 2CWMA 2WZ8A 4A6SA 2B0LA 3S2WA 3DTIA 2QJVA 4D94A 5DAVA 5AVPA 2YC4A 2RS11 4AQ6A 3N35A 2X5IA 2VKVA 1YI9A 3WTUC 3EUHA 3SXWA 3CUQA 5BY5A 1YW8A 1U8BA 4BZ4A 1F4KA 1CIWA 4FBFA 3ZSLA 1R9TJ 2D5VA 5F5QA 4UWDA 3G71I 2OPWA 5FJHA 2WO3A 3FHNA 4GMP1 3GJBA 4XLCA 1W6MB 2AS5F 4WV8A 3FHIB 5FO9B 2NQYA 2KDOA 1R00A 4CCLA 3FDYA 5IYDJ 2YDEA 3VV1A 3FM3A 2BTVC 2CV0A 2OCCH 1JODA 4IV3C 1XDUA 2AXLA 3O7OA 5IVFA 2W52A 4P9GA 3ZN6B 2OX0A 4ZKTB 1LVKA 3M3OA 1TTYA 1T08B 2WNVA 1JYXA 3K4CA 5FKOA 4DZJA 4HPKB 1LFPA 3KWVA 1IAWA 1JZ8A 1YFYA 3GNEA 1X36A 2VT3A 3TAYA 4KWKA 2Y6FA 2HQNA 4QPQA 4EN6B 2QBYA 3ZR6A 5B1AH 2KFDA 1BC8C 1B72B 2LW8A 2D44A 2F4MB 1Q8VA 2DW4A 1H1MA 4E9KA 1ND2B 3WQBA 1VBC1 4CCNA 4Q4X2 5EPAA 2RS52 4E7IA 4FPGA 3OS2A 1XGOA 5CQGA 1GANA 1G2HA 1FNYA 2V9KA 3CJIC 3SEPA 3O5SA 3ZFGA 1QHGA 3DEMA 1T33A 5K7HA 3DEEA 2VNGA 2XRNA 2V7FA 1Z9CA 2JD9A 4U7DA 5F27A 3GCXA 5BNPA 1FV2A 1YOVB 1A34A 3H8OA 5DUKA 3BB6A 3ZN5A 4E4SA 2LY2A 4UUSB 1TWGJ 3E5UA 2GNMA 2DU9A 4RM3A 4KT6A 4HSLA 3FZVA 3DYMA 3K48A 3RJPA 4QTRA 4FQ4A 3HM5A 1W6QB 4NPMA 2BWAA 4G9YA 3APBA 3NO8A 1Y9MA 3LQCA 4PFPA 4RHV2 3ZRGA 1ZRCA 3H8UA 5LD2C 3I5UA 1J58A 3JR9A 2W1UA 2QUFA 1O4XA 1VQ7I 1W7PA 1EAH2 4IRHA 1T56A 3C7EA 2WZR1 2YPRA 3Q9VA 1ND2A 2QVOA 3GF2A 4JTOA 3INAA 1ULYA 3OSDA 2BU9A 5C4JJ 2A05A 1DDNA 4H14A 1OKRA 3N7LA 4EWDA 2LVSA 4YM1A 3L2YA 2P3YA 1BJZA 3T8TA 1SLCA 2VVFA 4P9YA 1AR62 2Q1FA 1M4WA 4ZY9A 1QKQA 1J3QA 5DAQA 2Y69H 4CXXA 1QQP2 3WLUA 3WTZA 3S15J 4ZJZA 1Z7LA 3AYDA 4L9JA 3ONQA 2PMHA 2DJNA 2O3FA 3A0HC 3ZFFB 3VZLA 4Q0PA 1AR71 3GO5A 4PCQA 3ECQA 3K3NA 5ICEA 1DU6A 3OB8A 3WDUA 3U78A 4QX1A 2A6YA 1TME2 1FWZA 4DY5A 1XS9A 1EJ9A 3VZJA 1ZBA2 4DBQA 1MEC3 5JMOA 4D1QA 1NCQB 3AVRA 3TEDA 1RUD2 2HXOA 3BIWE 5K0UB 3QLQA 1RHI1 1OD3A 4K6BA 1AX0A 3B5LB 2W2IA 4KN7X 3P1IA 4LPLA 4P9JA 1BA5A 3FXLA 1K6YA 2D98A 1RRJA 4LORA 1PO13 2KPMA 4YVSB 2A07F 4QPIC 3AL0C 3K4AA 1ETVA 1IW7F 1AYN2 1AXKA 2BPA2 5DZEA 3R4DB 1OSGA 2BY0A 1HKQA 2MSYA 1NXD1 2HVQA 2Y9YA 1UCXA 5DAXA 2DFHA 2DYRH 2A69F 1OLTA 2W87A 5J3UA 1IC8A 1AJKA 3V8JA 4UB8C 4BBRJ 1LGBA 4A3DJ 4K21A 4XNFA 1YRNA 1X1DA 1RGSA 1G9CA 2ELKA 4NO4A 2VUMJ 1X1PA 3BR1A 5BPDA 4KNYA 2YR2A 2WAFA 2PHWA 3WF0A 1JE8A 1L3JA 4ES8A 1AF9A 3HOZJ 1QF3A 2R043 3VB9A 2WQ4A 2LY1A 2M4KA 4LOTA 1AR81 3OR1C 3AMPA 2WFF2 3A23A 4Q4V2 4KI5M 1D1CA 3BODA 2F4PA 4B4CA 3UYJA 1KYWA 2QKMB 2QSGX 1AHSA 2VLAA 1LULA 3RWKX 4ZYHA 2EINH 5CZKA 3ASNH 2HEWF 1R5HA 2ZJQF 4P00B 2JE8A 4K1ZA 3WG9A 5A3PA 4AIHA 1YJ9I 3F9KA 2DFBA 2IXKA 1U5TB 2HWB1 3GLXA 1PUFA 5CKQA 3MPPG 4RA2A 1V55H 1T38A 3ZCOA 1J0RA 4JYKA 3LB9A 4IE4A 4MEXF 1HDKA 3HT1A 2PTMA 1RMU2 4HDUA 4CDGA 4CTEA 2DURA 5FYSA 1XE8A 2STWA 5B66C 3BCWA 2O8KA 4C1WA 2QKLB 2MBFA 4G9SB 3HVDA 2XHKA 4XIKA 1VMFA 4KISA 3AZVA 5HLHA 1G3YA 2QSHX 1XG1A 4CZZA 5M5YJ 2JWPA 3J8F1 1OH4A 4CCKA 3ZMUA 2EFOA 4QU1A 5JAXA 2B39A 2JIGA 5DG1A 1IRGA 1XE7A 1U2WA 1QMJA 2P81A 1PGL1 3BTCA 3WW3A 3ZXSA 2Y38A 5LB6A 5FZ7A 1F43A 1XCBA 4QX0A 3TYJA 1CR7A 4TXWA 2NNNA 1P4AA 1Z7S2 1O57A 1IN8A 3TQNA 2R7RA 3BG9A 2PLYA 3BR6A 5IVBA 3C3WA 4XJWA 1RUI2 5C9AC 1FX7A 3OIPA 3JQXA 4M0NA 2P6CA 4AGGA 3VUOA 2HI3A 3KQRA 1NQDA 5CIRA 5FLIA 2CY6A 4IEPA 4W50A 5F3EA 4QPGC 4JBAA 1VQ9I 3C1DA 1N47A 1LB2A 5FZEA 4J1WA 5F8PA 2HPIA 1GUUA 2VBZA 2LBFB 5JI9A 1DDLA 1WMDA 3ACLA 3MIFA 4PQQA 5A33A 3A0BC 3OSGA 1POQA 3BWGA 1T6BX 1N1YA 1JN2P 3MBWA 2MNGA 3IPVB 4WVZA 3ZQHA 2COMA 1IV6A 3WUCA 2JDAA 4FPKA 1VQNI 1ZGWA 3W21A 3LEIA 1I5PA 5EYRA 1X9TA 4B1MA 1ZARA 2JPBA 2VNVA 5D8AB 2PHFA 4G6TB 2D6OX 1G9AA 5DUUA 1G9FA 1DZTA 4UOJA 5FR3A 3HGYA 2CSOA 1P92A 2XVKA 2C6YA 5HNHA 1CAVB 1B4AA 1W8TA 5IVCA 1LOEA 3A03A 4V2VA 4M3CF 4A3IJ 3MIBA 5J7MA 1PGW2 4OUSA 2RJLA 1YJLA 3CMGA 1YYNA 1K5MA 2VZSA 2Y30A 1YFUA 1E3HA 2X1EA 1E5IA 4ET7A 1UELB 2R0HA 3CKHA 3BKZA 4K1YA 1B09A 3PL8A 3DGTA 1ST8A 3JRFA 3N7JA 4BQAA 3H3LA 3LEGA 1O91A 3EO6A 2IXSA 5DZFA 5AFBA 2W9XA 4JDNA 2D6NA 1GNZA 3JBG1 4XF3A 3OPTA 3KZZA 4XLFA 4JZRA 1AYM2 1DGWA 2VE1A 5FFXA 1RVF3 2ZNZA 1W2NA 3RI4A 2KR2A 4XR6A 2GXAA 3S0MA 1RXFA 5D8AC 1SFEA 4N4NB 2HYKA 1ERDA 4CP0A 3HOXJ 4M9SA 4Q4ZF 2DT7B 3MVPA 4NC7A 5IVYA 1JXNA 5K0UC 3KZIC 4RLFA 1QPMA 2IA1A 2PX9A 1DGRN 4DRVA 3TP0A 2HGCA 3ZSJA 2ZAHA 2FBHA 4IEVA 5G05L 4GFBA 3O0WA 2XVCA 1VBA2 4Q2FA 2F5VA 3CCJI 3P3NA 5A3LA 4K3UA 3CLOA 3M07A 3F0CA 4EWEA 2LP0A 3MLKA 2W91A 3PURA 3LSRA 2NRAC 2JEMA 2QUOA 3ORJA 1OC1A 4PSXA 3IZOA 3U11A 5J1XA 2H1LA 1UZYA 2QQIA 2XLGA 5FO8B 1MS3A 2DI3A 2W57A 1WMXA 2QZ3A 1YFHA 1NA1A 2HWVA 2EBIA 3LA7A 5DUXA 3P9IA 2D3RA 1IS4A 4U2AA 2O1QA 5M0TA 5LBQA 2V1UA 1W5CC 2KL4A 1PP8F 2DMQA 3AZWA 1UIKA 1V4RA 2E1NA 2XPJA 4YZ4A 1OT5A 4AGRA 3CCVI 4MSVA 3NVCA 2EILH 1QJZA 3AP7A 1F2NA 4OINF 3H42B 3WDXA 2FOWA 2D2WA 5GTIC 3G7DA 4XDOA 1NYWA 4RS5B 3HMYA 4FAGA 5L3CA 5SV8A 2I74A 3LGRA 4UT5A 4BE0A 4FPHA 3VKMA 5HCBA 2WNUC 3ABKH 1GBGA 3BZCA 4A0XA 2HYGD 1ALYA 3ENRA 1IOAA 5BNPB 3T0BA 4IUGA 1C1FA 2OU2A 4O7XA 3VD3A 2XLFA 3PVBB 5E3NA 4M3GA 1QBJA 2H94A 2VBXA 3QYEA 2DYSH 2R072 1XD7A 2DDBA 4IEWA 1STMA 3OG2A 3HPHA 3GXOA 4JGYC 1LPQA 3IAPA 5KHDA 2OT7A 3F22A 2JKXA 3HR9A 2V6CA 1E57A 3RQ0A 4QPWA 3FC0A 3CC4I 1AYN1 1UMHA 4W6YA 4XRSG 2V73A 2F48A 4N53B 4ANJA 4M3CE 1KU9A 4C0HA 1J2XA 4RGUA 3CJRB 2EAKA 3VBUB 2O0OA 1HJFA 1EUUA 1QJX1 2FQ4A 2CQNA 1H88C 2FBEA 2PN5A 1TZOA 4CDQA 1IGNA 1VBA3 2GNBA 4MFEA 2HQ5A 3FXQA 5IK5A 2XSJC 4Y5Z0 4CDWB 4B4PA 4UUTA 1YQ2A 2WAEA 2WINB 1GQGA 3ZFEB 1DYKA 2D45A 3O12A 2VXDA 1PHMA 1TQ5A 3KP3A 1R58A 2P7VB 4LD5A 1LJ7A 5CKMA 4INDA 1NY72 2XWJB 3UKTA 2Z1DA 2XBO2 2JZYA 1BIAA 2ZMEC 2ESNA 1QJY3 4EZHA 5FPAA 3MLLA 1F5FA 3F95A 4HF0A 2IBDA 3POSA 3KIOA 4HOOA 3B01A 3GX4X 4H7LA 4XOGA 5HODA 1JOBA 5EJCA 2XGCA 4CICA 1ZREA 3H9JA 4CUGA 1A3KA 2P37A 3I2GA 1PNFA 2W1QA 1OURA 4FTSA 5CNAA 1AKHB 4BWOA 3FM5A 4A7KA 1I1GA 1WRJA 1FYUA 3DCFA 3AJYA 4N53C 3FBMA 3UGHA 2M4GA 5FYBA 5L9BA 1MEC2 5BNGA 2EAAA 2ES3A 1CD3G 3WQ0A 2FCVA 2UXNA 4ESFA 4HQMA 1YX5A 4D5FA 4GKXA 2H09A 3VL8A 2HVSA 1I1EA 3CQOA 3LDBA 1SAXA 5FPXA 1R1A1 4WWCA 4LO8A 2RM21 3AKZA 1YIPA 1YW7A 1OUSA 3T0AA 3H5AA 4ZZLA 3WP4A 3K3OA 3KP5A 1K78A 3G2BA 4A69C 4CDXC 4XCBA 2G7UA 5JI6A 3QU6A 1E2XA 4KYWA 2XJUA 1HQLA 4HLYA 4BXUA 3J7AY 2W7NA 3P6BA 1OPOA 3VBUA 1OHFA 1QJX3 3RPQA 1VRH1 5J09A 2EIBA 5C8CA 3FZ3A 1UG0A 1G8WA 1VBD1 1GLNA 3FL7A 3E1F1 5EGOA 1UWWA 4OI0A 3AMHA 4O5VA 3I97A 4FFFA 3QD6A 1B8IB 2OYZA 3J8F3 3OYBA 5DPNA 4RAZA 1DGLA 2EB7A 1UJ8A 1OMIA 1RR7A 5E1WA 2YXSA 2OA2A 5CFCB 1SLBA 3RJRA 1QXPA 2WNVB 4PLNA 1JTXA 1QNYA 3ZN0A 3DYPA 3M8LA 1LOAA 1LESA 2HWC1 3LSEA 3A02A 2D40A 1W99A 2RDRA 2VKHA 1MZBA 2ADDA 1I1SA 1X58A 3PNAA 5K5RA 3DF8A 5BPXA 2F17A 5A7PA 5GLZA 2OUHA 3LA3A 1QHHD 1SAUA 1PMHX 1SC7A 3KS7A 4AI2A 1FJLA 2ZMLA 5K7ZA 1U5TA 2P3KA 1APLC 3T8RA 2RS12 3R6SA 4IHTA 3LSDA 2Y34A 1UNBA 4M72A 3ILNA 1U9NA 5C44J 1AL21 2K3PA 2Y0SN 1ASJ1 4HK8A 5FZHA 1VQPI 1TNRA 2OCEA 5LRRA 2QWWA 3LSTA 4DBRA 4CXWA 1LEBA 2KKOA 1ZVFA 4H2AA 1ZZ8A 4UHTA 2QSFX 1SFOJ 2VJ5A 5LASA 2BOJA 1HXS2 3QYBA 5HS7A 5D5VB 5D1IA 1SMVA 2QA4I 2D3PA 3NJXA 4LO5B 1BMV2 2DCJA 4NIIA 4BISA 3K9TA 4O9EA 3IBMA 1ODMA 2HTJA 1VBB2 4M4PA 4W97A 4M9ZA 4ZDLA 5LCWL 3RNSA 3V8LA 2NS0A 3HYIA 3H0DA 5FZ4A 2FDJA 1U5YA 3G6JB 3P9CA 4F93B 2DFIA 1ZRFA 4QSHA 4DRRA 2LF7A 4DNCA 5J1UA 1ZRIA 4MH0E 1UQXA 1VBD3 1UMIA 1PP7U 1RJ8A 3ERMA 1A35A 2E63A 1TC3C 1NCRC 2VVEA 5FRAA 5HS8A 5CA6A 3HQUA 2JQ7A 3N7MA 3ZN1A 4E7LA 4JHTA 4OHZA 3DKYA 4Q4W3 1VFCA 3MIHA 2H6CA 4GH4B 2ZXJA 3FBNB 3RDIA 2F4IA 2FMLA 4AI3A 3KCCA 2VXRA 3HL2A 5GPCA 5CFCC 4Q26A 1MQTB 3M8FA 2ISYA 4DUXA 2WAQA 2F4OB 4RR3B 3BR2A 1WSUA 1OKOA 1O4ZA 4C2MJ 2OTLI 1UG2A 1GOGA 1UXZA 4AI9A 3O1SA 3VDXA 1Y9QA 4OMCA 4AI8A 1CF7B 4AEJA 3MUY1 4AAPA 1K6OA 2FDGA 2E71A 3A4UA 4CPBA 2ZJ2A 4GGGA 3T0YA 5J98B 1FBUA 3RIRA 4OIQF 3A01A 3X29B 2EICA 1TNFA 1W1WE 5FKNA 1UB9A 3CZJA 4YFZA 3CUQC 4OQ9A 2Y6HA 4FO9A 2X6XA 4CU8A 2Y0SA 2RV9A 4IE0A 1MS0A 2LF8A 2XHNA 4IV3B 1GZCA 2VQGA 2PAMA 3CO2A 4K8FA 1TE1B 2DA1A 4Z2YA 4XJ9A 2DU1A 2FD8A 5LEJA 4YVSA 4ZC3A 5KHGA 3N9MA 4YM3A 4E4ZA 2IFWA 1MH4A 2HWB3 4YSFA 5FY8A 3I49A 3ZXDA 1KDKA 3EBRA 4L9VA 4NB5A 4CO8A 4Q4X1 3GBFA 1RL3A 4C2TA 1F5JA 4LMYA 2VJIA 4GH4C 1V6NA 1U9OA 1T95A 2AO9A 1UW8A 4Y1YA 3FBYA 3F2ZA 5KXBA 4ITVA 5EF6A 2E2IJ 2R3SA 4PSWA 4EYUA 2AHQA 5TJJA 3ELKA 5GP9A 2P6SA 2M87A 2HJIA 5ICFA 4QXHA 1OLQA 1J7KA 1OCZH 1TQPA 3GFMA 2WZR3 4YW5A 2GN3A 4AFMA 4UW6A 1NXMA 1RUH1 1ACCA 4Q48A 3MGUA 3ATGA 1JYTA 2XMLA 1EH7A 4UVAA 4MADA 3T30A 1VRBA 4A3GJ 3H1MA 2QM3A 4JOMA 2DVDA 5D8KB 4HVRA 3M3IA 2J1EA 4P5OA 4MGTA 2LM3A 3TWIA 5IK7A 1UHSA 3I3DA 1YQCA 4HNTA 3K1NA 2ZZJA 2DMNA 3BR5A 3I4NJ 4LITA 4GO1A 3L2UA 3QBQA 1W6QA 1IZ1A 4B43A 1QDCA 3EB7A 3OSFA 3D1NI 2VUJA 3POBA 5K4LA 5EG0B 1ZYRF 2WFF3 2DTZA 1LUJB 5IVEA 2ZGNA 1HRV1 2MABA 4LG0B 4WM8A 3MZYA 4BQXA 1G59A 3J8F2 4XDQA 3ZQQA 2LS6A 4ZTFA 3PIJA 3K2ZA 4QU2A 5CFDA 2D93A 1T6SA 3CMYA 1PZ7A 3M1HA 4IV3A 1T2KA 1PVEA 3WDYA 3W9AA 4QX3A 1W3VA 1X4OA 2C26A 2O6GE 1LDJA 4M6YA 4ETSA 2IAIA 3C2BA 4ES9A 2L7MP 2A3SA 3PO2J 2MC4A 4UUVA 1RJ7A 2GC2A 4MGZE 4RGKA 4CUBA 4JX6A 4I6ZA 3CLPA 5LW9A 4CVUA 3DCQA 1C4RA 4BIOA 3PMSA 4QGMA 2WA0A 3GHMA 1GZ9A 1V6IA 5DD4A 1CJPA 1A78A 2AENA 4PDWB 4ZPIA 1X33A 1O8SA 4LHSA 4XABA 1T0FC 1S0EA 3BGAA 3WNNA 1PIV3 2GWRA 2G19A 3SCFA 3CEWA 2C5DA 2OKXA 2D5HA 2DCZA 2E26A 2X53S 5I0DA 3ILRA 2WB1N 4EQQA 2VMHA 3A22A 1DIWA 1RUH3 1ULFA 4IHVA 5HPOA 4Q4Y1 2V79A 5JDBA 1JI8A 1JZ4A 4QXKA 3ZXKA 2W94A 1WCDJ 3ZQCA 1ORKA 1XQNA 1QU0A 3NNJA 3U4XA 4KWUA 5DS9A 3AZXA 3SQNA 3RZOJ 5E18F 4Q0QA 4E2QA 2FD5A 2E1OA 2XPVA 5DM7F 4GALA 1YI7A 3O8GA 1NQJA 1QIQA 4KFCA 2BNMA 2X05A 4P9LA 4LULA 4MYEA 2G7HA 4F92B 2ID4A 3VDDC 1WD4A 5BNQA 3EJKA 3O0VA 3R0JA 5IJRA 1NK3P 4IF4A 3WW2A 1O3RA 4YG3A 1V6KA 4E27A 3TEYA 3K46A 2DU0A 4QB6A 2JE9A 4XK4A 2FCTA 1UFMA 4YVWC 1OF4A 1Z7S3 3POWA 4D9JA 4D6SA 2H8RA 3GCMA 1AA7A 1S8NA 2VNRA 5FY7A 1W6NB 3OYEA 2R30A 5GPAA 2KQRA 4G12A 4RL7A 1ODNA 1STZA 4NPLA 4V2FA 3S8PA 4DO0A 3I0TA 4IE5A 1N3QA 1RUE1 4AUXA 2LFBA 2XAGA 4KMUX 2QQVA 1N25A 3CP2A 2WLPA 4M6VA 4UXAA 3TO7A 2W4SA 1ETYA 1CX1A 5FZBA 5LA2A 1LOBA 1Z1DA 3G73A 3RJ2X 3HXLA 1UKGA 2E2JJ 5EHDA 5E3LA 5JZGC 1W9FA 1X3ZB 2QQ9A 4I7HA 2K85A 1SBEA 2YMZA 4UY8I 2MLGA 4BHBA 1K78B 1ENSA 3UKNA 1N75A 4E2SA 4AU7A 4XFAA 4AQTA 4PGGA 4MGQA 1GKBA 5LHHA 4F3JA 4NHLA 3DKQA 4EMSA 4PIXA 4EATA 1GWMA 4V2GA 4LBJA 4RN5A 3CUQB 3CIHA 1MBHA 1MVQA 1BEV1 4L0ZB 2KIUA 1KGSA 2RS31 4MUVA 2NOGA 5KNLA 2RJKA 3CO7C 4NUBA 1DUXC 3I3LA 1XPXA 4WBBA 2B63J 5KHJA 4BXFA 3MFAA 1BBT3 4W6XA 3WG1A 1UF2C 5KC6A 2X1DA 1KRIA 2L9SA 4OWRB 3U21A 2KD7A 1GLHA 2DCTA 1SDDB 2ZGMA 1WVRA 2F5EA 3GTPJ 4CCEA 2GU9A 2NVTJ 3WU2C 4BDYA 1RVF2 2XF6A 4LIUA 1JU4A 1I3HA 5HNFA 3IPVA 2XGDA 2NP0A 4BBSJ 2W85A 1IHMA 4XBFA 1COV1 1JJ8C 5CVJA 1VNDA 4G8XA 4K8RB 2ELJA 2Y6JA 2E53A 4QGNA 3G1LA 3L9JT 3ULQB 3VDCA 2DBIA 1JT0A 3AYEA 5DCMB 1USSA 4GZ9A 4GWMA 2JG9B 1CAWA 4KH9A 2GOXB 3ZXGA 1HQWA 4FE4A 5FYIA 3QOPA 2M5WA 4XOPA 1FTZA 1VQ8I 3URFA 3HOVJ 1YS7A 4MHUA 5DZGA 2BWCA 3H9AA 2X6WA 3BROA 3FXJA 5FPVA 2EXJA 3RYKA 1D4M3 1AR63 2GSYA 1SDWA 2X5IC 2HWF1 5FP4A 4PT6A 1ZBA3 2AC1A 3VBOA 1OYWA 4Y4YA 1ETWA 2ZCWA 2VUDA 1JMUB 2ZGTA 3MFCA 5LBEA 3NQHA 4YNIA 2E1MC 3BU7A 2GMEA 2IXLA 3GYDA 3WNOA 1BMV1 2Y0IA 3H1YA 1W90A 4LO6B 4GWNA 3ZXJA 1HLCA 2FNPA 2QGUA 4KNCA 2BOLA 1GZTA 4P5HA 1B6AA 1LE8A 2VMGA 3VBFA 1W7PB 4Q0VA 2IFRA 4FPYA 2ZSHB 3TOBA 1GQHA 2WNOA 1YNAA 1W0NA 1IDYA 4BKXA 4QHOA 2XPUA 3ES4A 2X48A 4I09A 3TL4X 1ZBE1 3BQYA 4HONA 2WNVC 1ZA4A 3CJIB 3I64A 4KIFA 3CCEI 3AG1H 1U6GA 3PQKA 4U7BA 1VMHA 2YX7A 3VB2A 2ZS6B 4XF0A 2VAUA 4HETA 1COV2 4BE3A 3FK7A 4HLXA 5FRMA 2VUAA 1VRH2 1PNGA 3NJZA 3ZQGA 1REPC 4Y33A 3HNMA 2H0VA 4HKLA 1XE0A 4IEJA 2VQHA 1UY2A 4XFBA 4QX7A 1MQTC 3VD9A 2WAQN 2CRGA 4R1HA 2QDRA 1H30A 1YJKA 3FLRA 4ESJA 3S1MJ 4DEQA 3QU3A 4ONUA 5FZOA 3H1CA 3E6MA 5IK8A 5A7SA 1OCPA 2KRFA 2W08A 5HXMA 1WQ2A 4RGXA 2XJQA 4HBNA 4XOTA 4MZUA 1S0FA 1SFPA 1N3PA 3S2DJ 3FX3A 4OIRF 2VQUA 4ZYGA 1VBB1 3GW2A 2YU2A 2NMNA 4FT8A 3D4KA 1HKSA 3JRHA 5CFDB 5FOBB 4WK8F 3N9QA 4XZUG 4QD2A 2UY8A 1EV13 3GLLA 1DCSA 1ZG5A 2HBUA 5JVVA 3JQWA 1V6LA 4EVIA 3D0JA 4B4QA 2VZUA 1XGMA 2A1XA 3M70A 2E7TA 3HPGA 5HDGA 2ZMEB 1AX1A 2XR4A 4FP3A 3UKGA 2NOJB 2BQPA 4NHJA 2JIJA 3ASOH 3B9IA 2BE5F 5A6ZA 1QVUA 1VLNA 4B8EA 3VD4A 1WKYA 4R4ZA 2ZJRF 4P9FA 2LH9A 5I0SA 1G86A 5F6FA 3ZOBA 5LGTA 1YRNB 2EWNA 3JD73 5FZ1A 4CEWA 4A41A 2EK5A 1YTYA 5IPAA 2FE3A 3K0LA 4QQLA 4MGIE 3PFYA 3WW1A 1DPUA 1R4NB 3LSGA 3AXDA 3H9QA 1QPIA 5F0HA 1HN0A 5E1ZB 4YELA 1GNHA 2NN8A 3KLSA 5BPIA 2W48A 1D5YA 5F7UA 2DA6A 2WNUB 2JRMA 4RB3C 1OLMA 2EH3A 4Y1ZA 2VL8A 2CW8A 5FMCA 3ECOA 4LG0A 4WM8B 2ZAAA 1H2NA 1X2NA 5CEHA 1TW2A 4BLIA 1RITA 3ZQIA 2D7FA 1ACIA 4RQPC 2R4GA 3ZDVA 3MV11 1PZ8A 3QP6A 2M9HA 1IQDC 2V26A 4HZFA 4OIOF 3H5NA 1FAYA 1H8TC 2P6HA 4IGPA 2EQRA 2P5KA 1HKTA 2MFZA 2X09A 1EH6A 5LEKA 3N9PA 1BI2A 2CDPA 4YW3A 5FZ8A 4ZTJA 2GP5A 3CCQI 2BERA 4LHKA 4CCDA 1SHWB 4HVQA 1TWHJ 3QQAA 4BB3A 3LQRA 3RZKA 1UHMA 4ITCA 1GV5A 3L1PA 1AZDA 3E5QA 1KJLA 2VR4A 3OYWB 4QX8A 1JKPC 1HXS1 4ARYA 4C3JJ 4AGVA 3KD4A 4MGRA 2PLV3 3ELNA 3U1XA 3MPBA 2P8TA 1RUJ3 4Y1VA 2XB5A 1EYBA 3PUQA 1P6RA 4PJJA 5FPZA 1VBC3 3HJEA 2Y0OA 4P9XA 4EGZA 1TWCJ 4LLLA 3W20A 1OISA 2R7SA 2TBVA 4BA6A 2QENA 3LMMA 1VALA 2QQ8A 4GCVA 1Q3EA 4AC0A 2WWYA 2ICWG 5JLWA 1OR7C 3DXJF 4H0EA 4JX5A 1VBA1 3ZQFA 2RR13 3HHHA 3DPRB 1KITA 1F4AA 4A42A 1MMSA 1YWKA 3GZ5A 2XG3A 3VPRA 5GZFA 3DV8A 2P17A 1U5ZA 2IA2A 5FXXA 2QQUA 3EHKA 3H9GA 3R4UA 1REFA 3CL1A 2ZGUA 1F4HA 3PTYA 3RGBA 3BJOA 2H27A 3HBKA 4J25A 3AKPA 2ZGOA 4WVMB 3USUB 4RBOA 4OVEA 4AR2A 4QQ2A 2NM1A 2DT5A 2L9NA 2B42B 4C1XA 2H0BA 3N05A 2Y31A 4XQWA 4PLOA 1YW9A 4G6DA 3WE2A 4QWNA 4B7EA 4FE7A 1SEUA 4FPOB 3VODA 2FZ1A 4YGBA 5BNNA 4CP9A 3IMNA 2IS4A 5J4YA 3I2HA 2Q8CA 2K9SA 4BJ6C 2M3AA 2ZMKA 5HV4A 2UWBA 4EM1A 4NAOA 1VBD2 3V7CA 3OL4A 2H8WA 1JTYA 4BAYA 2RGVA 5TRDA 4XDPA 4GXLA 4D6QA 1US3A 2PLV1 1GU3A 3P5BA 4BOWA 1IPSA 4LK7A 2RM23 2ETHA 3A7QA 1V6OA 3K69A 3L2WA 1S0GA 4QQPA 2K02A 1CZSA 1Y9GA 4NIGA 3PVNA 4XILA 2W0XA 4QHBA 3K4MA 3MHZA 2TRTA 5FQ0A 1FEXA 4ZS2A 1I27A 3UKVA 2O14A 1MQTA 4DGWB 1HV0A 3WNXA 1XB9A 4XACA 2QYOA 4GQ7A 4BMBA 1X4PA 1OPCA 1FMWA 5C4WC 2LG4A 3FLPA 2BY2A 3BOQA 5EEGA 4AQSA 1ND3C 2P3IA 4QDRA 3JRCA 2YPDA 4LKEA 5GLUA 2J5OA 1D4VB 4CGZA 2MHFA 3MIGA 5FYTA 2WC2A 3MUZ1 1FSHA 4P14A 1JYWA 4MO3M 1XC5A 5FWJA 2IUWA 5IAXA 2QE3A 1QZYA 1B9NA 1WZXA 3P5JA 4B29A 5JSOA 1ZM1A 3HHGA 4Y22B 5I0TA 1SD7A 3GYHX 1YXWA 1IV8A 4QB1A 2W84A 3SZTA 3SFZA 2W1WA 4DPNA 3BTAA 2SBAA 3V0BA 1H9WA 4R4XA 3CDIA 3TEWA 2FX0A 1AR91 3L9FA 3AFGA 2HDCA 4OMZA 1JYVA 1X1AA 5IOZA 1S0BA 3U75A 4QPGA 1YQAA 3BLYA 2VMFA 2JA5J 1OBNA 1LEAA 3AL6A 1W3XA 4XIOA 4C90A 2E33A 3H3UA 1O7FA 2HWE1 3KV4A 3MO4A 4QAWA 3S1RJ 1HB2A 5GALA 3QPSA 1P7IA 4BHCA 4YGCA 3W6VA 3SITA 1R081 5A32A 4W6WA 2DPUA 4I99C 1IRZA 2HDDA 2QQWA 5G04L 1W06A 2Q1MA 3GBGA 4YIRX 4E70A 3N9LA 1Y4WA 5GZDA 5C5TA 4OU0A 2HWF3 1AHDP 3K75B 3GWZA 2BVVA 5FYMA 2ZHKA 1BKZA 2ZHMA 3DTEA 3IB3A 3POYA 5A3NA 2A6XA 4OIPF 1FMVA 3IKTA 4XLHA 2LKSA 3J9SA 2QQKA 5EXOA 3KLNA 1FBSA 2WO2A 5C7GA 1V5FA 4GKYA 3WOGA 4HPQA 1ZZ9A 3QOEA 5E89A 2E9QA 1FXZA 1XYPA 1OOPA 3CCLI 2A6HF 3LEMA 5J1YA 1TNSA 3IH4A 3FJSA 3HEFA 3F23A 3HQRA 3NNFA 4XAEA 4Q4W2 1GUIA 4AHWA 2XDVA 1NG6A 1OLME 4PJLA 4Q1PA 4YWAA 1J09A 1NA1B 4QX2A 3DTKA 1CPMA 5F9TA 1OXCA 4YM0A 2RG4A 5EJ3A 1MZFA 5C3SA 3KP2A 4AWXB 2QCSB 4G7ZF 1JZ2A 1DU0A 1CVNA 1MS8A 5K0UA 2C24A 4KL1A 3GTMJ 1NUKA 3MV01 3KGZA 3B3QE 1O7LA 2HTSA 2JE7A 2QQPA 1F31A 4M3BA 2J1SA 3T09A 5FLMJ 1U78A 3KMHA 3WP5A 2L0KA 3R61A 5IT9K 2B8MA 1XU1A 2ETEA 5J8FA 3QP5A 1OD5A 1LFUP 3M1CA 4HG2A 2P6TA 2PQ8A 2GMPA 3ZYIB 5ILSA 1U12A 3OBTA 3Q0WA 2VZVA 3MEPA 1WLDA 3KZ4C 1E0EA 4RQPB 3JREA 4O61A 3M1EA 2MEV3 5J48A 3FXKA 1WJAA 4YRVA 2A6VA 2NZ9A 3ES1A 4BH9A 4YARA 1RUH2 2K0GA 4EN7B 3BIEA 5GM0A 4KITB 1PX3A 2L4AA 3OGGA 1KU3A 2GA2A 3LEKA 2IZWA 1D2QA 5KVRA 4CDWA 1H4GA 1GZWA 5CLSA 3BTLA 2VTXJ 1VIWB 1NCRA 3HOSA 1HA8A 3FK6A 2OS2A 3VKNA 1RINA 3PU8A 1W6NA 1N1VA 3ZO0B 5FY4A 2P3JA 1KFXL 2I5UA 4EJWA 2YG0A 3IIAA 2G9ZA 5FD5A 1JHFA 2VGDA 4OZXA 4XJUA 3K6GA 3AAFA 3REOA 4Z8BA 2GOMA 3HSFA 1UYPA 1N1SA 5JWPA 4HV5A 3OPZA 3GGLA 4Q0SA 3LPFA 1DZQA 4X6AJ 1ND3A 1HDPA 5JR3A 2E36A 4X1EA 4HXCA 5C9AB 5IT9Z 3R0AA 2VUCA 1IQAA 1IPKA 3KT4A 1VQMI 2IVIB 5BUVA 2W82A 3J81Z 2A6EF 3I3QA 3OR2C 2D6LX 1DGWX 3DPRC 1J83A 4Q47A 4EV0A 1BVP1 5H2FC 9ANTA 1MS5A 3VBSA 2BW3B 4BJ5C 2CYFA 4UVCA 2AQFA 1KU2A 1T6GC 5FZ9A 5IW0A 1UPSA 3WHBA 2NLRA 1IG7A 3MIEA 3BJ6A 1MS4A 2IJLA 5J6XA 5GLWA 2ORZA 1JZ3A 4BQ2A 2CV1A 3K77A 2W68A 4R9AA 4FISA 1IUYA 2DTYA 1MZ6A 3TP3A 4F3QA 3Q8AA 4N43B 4C30A 3WGGA 2BYVE 1URXA 3OCPA 4PDWA 1NX9A 4CYCA 2O5RA 1UX6A 1TW3A 1AU7A 4OAZA 4OAYA 1WGPA 1RI7A 4XUTA 3OBRA 1Z7UA 5LA0A 5H6QA 1QEXA 3Q8BA 4D7MA 2FZ2A 3GMEA 5CISA 3VDBA 1MH3A 1MJBA 4UBHA 1FOKA 1RUJ1 1HRI2 5FBJA 3LSJA 3UJQA 1FOD2 2WNUA 5JSRA 2DUPA 3S7EA 1R5GA 4AVPA 5L3BA 2A3WA 4GAZA 4FTEA 1MMNA 2NXNB 1AXYA 1TME3 4K2EA 1MVEA 2WSUA 4KICA 5BNPC 2JRTA 1RUC2 3K2AA 5IAVA 4OFGA 2FMDA 4HW0A 4DW6A 5FZ6A 3FHQA 1Z67A 1K5MB 2WRAA 5T5LA 3FUOA 4GYGA 2K9NA 4PJYA 1ZZBA 1D8JA 2WS92 3CJNA 1OR7A 1CQ9A 2RDPA 1G3TA 2Z42A 5H9RA 4DMIA 2EA2A 5F0FA 4QM9A 4IGOA 2NYYA 1ULOA 3V4GA 3GZTB 3KF5A 4X8PA 1GOFA 3EMRA 5T50A 4U88A 1FX5A 2WO1A 2HFHA 4UAPA 1POV0 2O9LA 2UWMA 4AL9A 3I2OA 3VDDB 2TCTA 5B3SH 1HJGA 3LA2A 5AONA 4A3BJ 5FZ0A 2OZUA 2J1AA 4WVMA 1IS6A 5F5CA 1UKRA 3AB0A 1LOGA 3MF6A 1PGL2 5AC93 2VI6A 2M45A 2J5PA 2RR12 4FOWA 1J84A 3VKOA 4PGHA 4HDVA 2JMWA 4KGQA 2LOOA 3W59A 1CF7A 4UV8A 4BY7J 1YO5C 1IGOA 2CQXA 1EAH3 4UNOA 3VYUB 4A2UA 2VCCA 2ZEWA 3RKWA 1EPZA 1HKDA 5AIPA 1WBFA 1X1BA 3ZQ7A 5DN2A 1C8M3 2CUZA 2Z4FA 3GZEA 2UYAA 5EZGA 1DGRA 3WNPA 2KMUA 3PUSA 1KA8A 1NA1C 1S5LC 1JYCA 1XSDA 3N4MA 5M3MJ 5FK7A 4EJRA 3RMXA 2VQ0A 1A04A 1IXRC 3VZOA 5CYVA 1RB8G 2P4EA 5EZWA 2OAZA 4LA2A 1RUE2 1GWLA 2FEZA 3ZXAC 4QPOA 2D6KA 1X19A 1Z91A 1LOFC 2D1HA 3J80Z 5FYHA 2JT1A 1MDMB 1LTEA 4JGYA 5FMBA 5DXDA 1GXQA 5CB7A 2NAZA 1ZA7A 4BYYA 1T39A 1V6JA 5F37A 2VBDA 2V09A 2EXHA 3VBFC 1SMYF 4BQ1A 1G4DA 4LJZF 3LAPA 2PYTA 2E19A 3S30A 2VPRA 4TN7A 1UX7A 1D1BA 1DGRM 5FPUA 3IL2A 3OV8A 5L3EA 3KX2A 4XONA 3P9KA 2GMMA 2KIMA 1W8OA 5EYXA 2CV6A 3KHBA 3Q3SA 1V9U1 4XF4A 3OL3A 5L3DA 5DDGA 3A01B 3WXPA 2VOWA 4AYBA 2PJRA 1RUD1 3PIOF 4AOCA 3OGRA 1R1A3 5FFOC 4HK9A 4XMAA 3NAUA 4UW4A 1YLFA 1CAXB 1QRYA 1HXS3 5AC92 1JU3A 4AG4A 3G1OA 1LVAA 2R073 3AKRA 3S93A 3WCRA 4XTMA 3S16J 2Z79A 3H92A 2QVSB 2LUWA 1WFXA 2DUOA 2ZEXA 3I59A 1W28A 3F6VA 1KS5A 3ZYFA 2JDPA 2DVFA 1GOHA 2LRDA 4LE3A 4WF2A 4FFIA 4R8HA 1ENQA 4XQFA 3WHUA 2YU1A 3V0BB 2NS7A 5F04A 4AFCA 1ZTRA 4DYQA 2BZDA 1B9MA 1JKRC 2WY7Q 1UD1A 2TNFA 4QPGB 1ZYBA 2FMYA 2V4AA 4HNUA 1I5ZA 4YVWA 2DA4A 4YFWA 1DZRA 3RZLA 2YZ4A 5KXDA 4GMP3 1WA4A 5A6XA 2PJRB 5KR7A 2FDHA 4DB5A 2FDIA 3JCUC 5C3PA 2Y26A 3BTXA 5IVJA 3KETA 4FP2A 1LE8B 2KT0A 1L7RA 1MBKA 2E5NA 2HWC3 4J01A 4XHXA 4ABZA 2CQQA 3NRVA 4Q1RA 1WW6A 2WWJA 4NIDA 4Z1VA 4FQGA 2VC9A 2XIGA 3UK9A 2WADA 3I7DA 3GDBA 4XRFA 1UY1A 3ZR5A 2HKXA 2JB8A 3B02A 1EY2A 2A73B 2XRLA 5BXXA 2VBWA 5DMYA 5DTDA 2VOVA 3K4LA 3JAMK 2K9ZA 2K9QA 1WJBA 3OOPA 2TDXA 3MFKA 4IHYA 1Z7S1 1WCMJ 4CP1A 3ABZA 1NCQA 1TG7A 3HJRA 5FAXA 2WV0A 4MLOA 4DZPA 4DINB 5T55A 1H2LA 2B9UA 3HEIA 1FPN1 1HW1A 4WVWA 1W5SA 4YLZA 4CCJA 3KZYA 1RETA 3ABMH 3O2PE 3OF1A 4TTGA 2M0MA 2E7QA 1XPWA 4L0YB 3NWTA 5KBFA 2C9KA 2EIMH 1VBC2 2Q8OA 4IZZA 4PBOA 3A0KA 3NWSA 4HF2A 4MIMA 1RC6A 4P96A 4HG6B 5JPNB 1XXNA 1BR4A 4NWVA 2YSRA 1IN6A 4Y17A 2LD5A 5EWSA 5JOYA 1QZZA 4RS5A 3BP8A 3OIOA 4BLJA 4HX7A 1WLWA 2KLOA 3AG3H 4IL6C 3TEXA 1TVGA 5BOXA 1UHWA 2ZMEA 1YFWA 3V7SA 2O7OA 5C33A 4OI2A 4Q27A 5AVAA 5JOXA 1GR3A 4Q4W1 2E32A 3IMMA 5BNOC 1H6YA 2W25A 2J1TA 2XJVA 4AE2A 2KJBA 3HNYM 2OW4A 1BL0A 1ZBE2 3UL2A 3GTJJ 1R1TA 2VKEA 2A3YA 1NZCA 4JKKA 5HLIA 3S6PA 5E8IA 5EGOB 3SLIA 2R7EB 4BK5A 3BN6A 3H3VK 3W2WA 2DMUA 1DYPA 1S55A 1Q43A 2GBYA 4LMFA 3D5SC 5FUIA 2P4WA 1Q5OA 1WHUA 3O14A 1E17A 2P34A 4ASNA 2HWE2 2BFUL 4Y15A 4EJVA 4UFKA 2DA5A 2JB4A 5IP9J 2X5IB 2ECCA 1Z77A 5L73A 3SZPA 3CZUA 3M3QA 3HKZA 4JTNA 1POV3 3HNBM 2L5QA 2JD4A 5BNOA 1H2KA 4E7ZA 5LY2A 3DEUA 4FFHA 2M30A 3J80K 5F3CA 2CUJA 4QHZA 2ZO4A 4CEWC 3PUIA 4BACA 1IO2A 2KISA 3GCWA 4KUMA 1OCOH 4Y26A 2ZTNA 3F8FA 4CDXB 5LK7B 1QNWA 4BGDA 5EDNA 1H0MA 4W8JA 4XUQA 2RM22 5L7OC 2KIQA 3OUJA 5L9VA 4DXZA 2RC4A 2E51A 4K40A 2ZGQA 3ZFGC 2E1MB 3ACGA 4UFIA 4IJAA 4UYBA 5CVRA 2WZPP 4COVA 4LK1F 4OOIA 1ZK8A 2FQPA 2UYBA 1D3YA 5K7PA 4UW3A 5FLHA 3IRQA 3WR0A 3IUOA 1XNAA 3SDBA 1QY4A 4XFGA 2I8DA 2X0LA 3LSHA 2VBPA 4YW6A 1QU3A 1I50J 2JK3A 4FI9A 4HN0A 3VZKA 4EJTA 1HRI1 2PMZN 3AX4A 1L0OC 2O8QA 4BPZA 3WZ1A 4D7SA 5DV5A 5E8GA 4WZFA 2KJCA 2VD7A 3EQEA 4CDWC 5L3GA 3PU3A 3B9CA 2OA4A 2LC2A 1PO23 2LTPA 3U1KA 3AYCA 1LJ9A 3USUA 2VG9A 4IO9F 2STTA 3UETA 3WP6A 2LROA 3S1NJ 2IVMA 4XUNA 1OPMA 3U9GA 5FMOL 4LUMA 3FMRA 4J6GA 3NKGA 3NW4A 5C3QA 2HOEA 2G1MA 3WG7H 4PJ0C 5JFRA 3KCYA 2Z16A 3SMHA 3MW2A 1XDSA 4KU7A 1GQPA 1RUOA 1FNZA 4IHWA 3OY8B 5ANNA 4Y20A 2WKKA 4E7KA 4N8MA 3SKJE 5J36A 3TW7A 5D4SA 5A33B 1NG0A 2B7YA 4RM2A 2BVMA 5K9YA 5TGTA 2WY8Q 1CAWB 2V6EA 1RUC3 2J22A 2XB6C 3WTWC 3L2VA 5JMCA 4GXOA 3EQLF 5KK1A 1UOJA 3G3ZA 5FFZA 2WZR2 4RGSA 5EJ1B 3OYAA 2KHMA 1QGPA 2JG9C 4CEYA 5CBLA 5D8AA 3HG9A 1HQNA 3D3AA 3OEBA 5A3MA 2JA7J 3K51A 1ODDA 4OMDA 5JHFA 1PM7A 4NWWA 2IS1A 1D8KA 4ZHNA 1LAJA 3LQQA 3POEA 4DZGA 2LR8A 3D5RC 3CF5F 1RHI2 5FQ0B 3IAS2 3ZR8X 2LK2A 2FBKA 3C2UA 4NHKA 5C4WB 3QPTA 1RC9A 3SQOA 2QEXI 2IXHA 3BC8A 1WBLA 5FXWA 1YCIA 4IQJA 4QIWN 4Y3OA 1YRZA 4QPIB 4AVBA 4PIZA 4RDUA 4TZDA 1Q8SA 1KGYA 1VJ2A 2BVBA 2EZKA 3TBDA 3WHTA 3S5AA 1WZ2A 4B1RA 2C0ZA 3WY6A 4XSZF 2WO7A 1F1ZA 2J1VA 1V00A 2L9LA 2IC1A 1PO22 3ZFGB 3J7NA 4YW7A 3DBLB 1OCRH 3BCBA 1PJRA 1GFF2 2EALA 3AKSA 3VBOC 4YPJA 1BI0A 4I2OA 2XOMA 3I2DA 1WKMA 3VYSB 4GH4A 4H55A 1ND3B 3HZJA 3RYRA 4BE2A 2UU8A 2OTJI 4I0AA 4ESBA 1RTVA 1JKOC 5E1XA 3OJBA 3MD2A 1W8HA 3LCPA 1JHJA 2VC0A 1W0PA 4EN9B 4RR3A 1FYMA 1QQIA 3IAM2 3NEUA 5ACA2 2VQAA 2BVLA 1S2BA 3VD7A 4QQOA 3VBSB 1SFKA 2YHJA 3V56A 4P55A 1VBE1 3BR0A 4XCAA 5EV7A 2LLKA 2ET1A 4KIBA 3HSEA 3K10A 1ASJ2 3CJIA 2EZLA 2R062 5J40A 2K46A 2CHHA 2UWCA 1GYKA 4CA0A 4V19K 2ZX1A 4QDSA 2CU5A 2ZBKA 2XV4S 2C6SA 4NHYA 2QNKA 2EJRA 3JB4C 1SANA 4HVOA 3IAQA 3L2HA 4QPYA 2V1NA 1AR83 2ENRA 2WFF1 1WPKA 1FTTA 3AXEA 4YVWB 5B1BH 2BBVA 5CADA 3K4KA 1EKEA 1HRV3 1OH3A 1WA6X 3QODA 1BN5A 4YW2A 3GM8A 4COZA 2HQAA 2BW3A 3ECHA 3WODF 4FPFA 2HVRA 1A8DA 2EZIA 1LDKB 2FBIA 1PO11 3K4NA 2J1UA 5IHRA 2WZEA 2B46X 4LKDA 3J26N 3Q8EA 1XB4A 2L7FP 3E97A 3OGJA 6PAXA 1O4YA 2JWTA 2CFOA 3RS6A 2HWD2 4A3FJ 2B45X 1XNKA 2DOEA 3OYNA 5ICGA 4ZZ5A 1DU3D 4JQRA 2VXZA 2IXIA 3NV1A 2HPMA 2VCAA 2XBO1 4LBNA 5FP8A 4Q4V3 4QGLA 2DCYA 3ZPOA 3H36A 1ON1A 4HX4A 3HAGA 3VSKA 3WGHA 2DA3A 1W9SA 2F5CA 2ET7A 3A21A 3CHXA 5FWEA 4ZH4F 3WT3A 3OEAA 2Y2ZA 3CQZJ 5HDNA 2CWSA 1LGNA 3MW3A 2JG8A 3MAJA 3JRGA 1IRXA 1FIAA 4BUPA 4RGAA 4RQPA 3IWZA 1D0YA 4YG6A 4HLTA 4LT5A 1H4HA 3JZVA 3SC7X 1PUFB 4RLQA 3J7YJ 2FU4A 2Y48A 3S57A 2PJPA 2V1DA 5JLVA 1MZEA 1C8NA 1XNBA 5FKBA 2K4BA 2XLAA 3COAC 2ZPXA 3OOUA 1W9YA 1X8EA 2ELHA 3ML6A 2AGSA 1ZG1A 2JJ6A 1RZ4A 3HOTA 2BP6A 2EA4A 4J00A 1ON2A 5APAA 1W36C 5K5QA 4XHBA 1SCSA 1GHCA 1PO12 3RRDA 2UURA 3VN4A 3RVHA 1VAKA 4OZOA 3KV6A 1JOJA 5I8YA 1IPJA 2WN3A 3LAGA 4F52A 4M71A 2LKXA 5LATA 1Y3TA 1NKGA 1EA3A 1XSRA 4FOQA 2VODA 1T2XA 1RUD3 2WNEA 1XSXA 3F8CA 3IH2A 4GJYA 5BS6A 1P2FA 1RUG3 1OFNA 5J3LA 2FRHA 4NHMA 5FREA 4R52A 3HRUA 2PELA 1CAUB 1K45A 4NJ4A 3H8XA 1MIJA 4F7ZA 4KMQA 4HNVA 3OYGA 4WXDA 4HV6A 3ITQA 1B35A 3FMQA 1K79A 2JKBA 3O1MA 3ZFEC 4DNYA 5C3RA 2CO5A 2PQQA 2P5BA 4YYOA 1JS9A 5IFTA 4IOCF 1OLRA 1CZTA 3KV9A 1FPN2 3WVJA 4MGKE 2W1OA 4PF5A 2NS8A 3SEQA 3BYWA 2JDUA 4LLFA 1LGCA 4WCGA 1J1LA 3E5XA 1QH7A 2UUZA 2W00A 1HDDC 4YVSC 4Y13A 4Y24A 3OS0A 4BQYA 2JSPA 3MKLA 2IS2A 5A1AA 4RYDA 1W9WA 4B09A 3OPWA 1HLVA 4U87A 5CVIA 3CO6C 4XYXA 4YW4A 2JICA 2CU7A 4IPAA 3VBRB 4XM3A 1UOFA 2RNGA 2R5YA 1R093 1JZ7A 2R7QA 2Q2EA 3PUBA 1OA3A 1FOYA 4L9TA 4IRIA 3B00A 4XURA 3IHUA 4JX4A 2WAAA 2L2OA 1O3SA 4H4KC 3LE0A 3HOYJ 3L7WA 1OKQA 1FPQA 2YS9A 4YFNF 1KZHA 2X10A 4OYUA 2RVAA 3FXRA 3AMMA 3EUAA 5E8AA 3SNMA 2WAOA 4GRIA 1R1ZA 3UJOA 5A1LA 1TT5B 3DQVC 3I59B 2V5DA 1O3TA 5D5UB 4HT1T 3VBOB 4MTDA 3PUAA 1ZZCA 2R063 2IW5A 4D0PA 3G6EI 4L8QA 3VEPA 3BTZA 3C2GA 1KQ0A 2JVHA 1U5XA 3RKYA 2VMDA 1C57A 1BW5A 1Q8OA 3CJQB 1OF3A 2EIDA 5ABJC 3GZAA 2F4LA 4OLLA 3H1WA 5JXIA 5FY0A 4PUSA 5E79C 2X9DA 2BNOA 2WN2A 1ZRRA 2YY1A 4IW3A 3A4CA 4B7KA 3VZMA 4B4RA 5A7NA 1N78A 1BLZA 3M7AA 1ETKA 2DXIA 2PMUA 4ENJA 1FOXA 3NNLA 2VOKA 4F83A 1S0IA 4MOAA 5F2SA 4META 3RZZA 2Z5WA 2Y64A 2GH8A 4KU8A 2HKOA 5HOOA 4Q4Y3 1FMD3 3CD6I 1PK6B 2W46A 2ZNYA 4M9XA 4RS8A 5FGMA 3IKWA 2R7DA 3OYJA 1JUHA 1KEXA 2XAUA 3VWBA 1WJEA 2YBKA 1BC7C 3IDEA 3RZJA 5AC91 4AEDA 1WH5A 4C3IJ 3OYIA 3UGGA 5HDKA 5F1JA 3S17J 1EV12 3VKFC 1WCQA 5ILVA 2R49A 4YZ2A 1BW6A 1R1UA 3H8RA 3HTSB 4AFAA 4AVAA 4KWJA 2WJSA 1W04A 2PMZA 4FCAA 4Z82A 3BQZA 5HLTA 5LBFA 5FP9A 4NROA 3ROUA 2VL4A 3N36A 1GP6A 2R0QC 2JDZA 1JJ6C 1GP4A 3N7KA 4L99A 2RQQA 4XAAA 1XX5A 3FHZA 3BDDA 1FOWA 3KVBA 3PQJA 3PSIA 1Z3XA 2E7AA 1BK1A 1W03A 4II3A 4Y20B 4D8MA 3FWEA 2BGCA 3GFIA 3FHAA 4Q5OA 1LOCA 1A36A 4A0ZA 2V72A 2EPFA 1PK6C 2A6ZA 4M4RA 1R092 3DKWA 2KZGA 2ZSIB 3KE2A 3BPXA 5TSWA 4LK0F 1MBEA 4CHUA 4DUWA 2X6OA 4CXFA 3HBLA 5FKKA 4V2WA 3SH3A 4IVNA 3WNLA 1ETOA 3M4OJ 2BGOA 3ZMTA 3ALQA 5FZCA 2P1BA 3RI9A 4YEJA 1HF0A 3RQ4A 4D6RA 1ETXA 1BR2A 4QXCA 5F5AA 3B6AA 1W0TA 1VBB3 1SLTA 3I2IA 3L2QA 3BTJA 4Q5SF 4S2DA 3DP7A 5JVGF 2A75A 1MNEA 2WR9A 4BNCA 4AAXA 4B1LA 2ZX3A 1G8XA 1OVSA 2VBBA 1JUPA 2O8XA 1EV11 3OYWA 4G7OF 4FCYA 3W3CA 3ZFFA 2VXJA 3HB9A 2G4IA 3ACFA 3K4DA 1AYM3 4A3MJ 4XRMA 4KGGA 5A70A 5L7OB 3TOAA 2MH2A 2ZXQA 1SPPA 2EZHA 1MPXA 1BJAA 1V54H 5LRSA 3ZVXA 4IQPA 4MGSA 3MZHA 1FLIA 2VOPA 1RUG2 1MACA 2HZTA 3PVOA 1AL22