3MZHA

Crystal structure of camp receptor protein from mycobacterium tuberculosis in complex with camp and its dna binding element
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
225
structure length
225
Chain Sequence
HMDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords PROBABLE TRANSCRIPTIONAL REGULATORY PROTEIN (PROBABLY CRP/FN
publication title Crystal Structure of Camp Receptor Protein from Mycobacterium Tuberculosis in Complex with DNA and cAMP
rcsb
source organism Mycobacterium tuberculosis
total genus 62
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3mzhA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3mzhA01
2M8EA 2PTMA 4KMFA 3S0MA 3LQQA 3Q9SA 4IEWA 3R60A 5EEGA 4UV9A 4LULA 1FPQA 2K27A 1BIAA 2NAZA 1XDUA 2ZBKA 5BPDA 3WTUC 4L5IA 2ISZA 1WKMA 4XF3A 1MDMB 1YFXA 5L3EA 4WCGA 4YIIA 4HV5A 1VP6A 4M6YA 2X4HA 1NXMA 2DO7A 4UVCA 1J58A 2HYFA 4S04A 4FBFA 2IW5A 4FX4A 2J5PA 3WGHA 3HRTA 3KETA 3RI4A 3PNAA 3SXYA 1XSVA 4YFNF 4ENKA 2XAHA 1ZZCA 4Q0VA 2X0LA 2A69F 4HDUA 4YNIA 3B02A 3JAMZ 4E2SA 1TQIA 2RC4A 4IETA 1UB9A 2NYXA 1XB4A 5EFUA 1EP0A 4I01A 3U9GA 3QU6A 2ADUA 5L3GA 3MYXA 5BOXA 2UYAA 2QBYA 3ZMUA 5D8KB 3KLOA 4YFKF 5LGUA 2XAFA 4IRHA 4AD9A 1X3UA 1GHCA 1D3YA 4Q29A 1MJAA 3F8BA 2PN6A 1BI0A 5H6QA 1IN6A 2FQPA 1T39A 5E1XA 2EFWA 1OYIA 2P5KA 3NKTA 4M73A 2ZNYA 1YQAA 1HKSA 1OYWA 2XAQA 2QUFA 3E6DA 3WTWC 4JVAA 1JGSA 4IHTA 2DPUA 1R58A 2Z99A 4MEYF 4ON0A 2GC0A 2YSRA 2K7LA 4ESFA 2XL9A 3EO6A 1OPCA 2VE8A 2PYTA 4KWKA 1LNWA 1O3RA 4AVCA 4WVZA 3FM5A 1W4MA 5AVPA 1RTVA 4AIHA 3VEPA 3FFQA 3PQKA 1B59A 4CXFA 2FU4A 1UFMA 3ECOA 1O4TA 4Y13A 3C7JA 2E7WA 2O6GE 2B9UA 4AVPA 4LD5A 3RKYA 2BEOA 1T98A 4IEVA 1R5GA 2VODA 2DAOA 3H3ZA 2OQRA 3HSEA 3DEUA 2FA5A 1ZG1A 1V3FA 3EUHA 1F9NA 3H1WA 3NVCA 2DLLA 1TLHB 3IWZA 1CAUB 2GAUA 5FCCA 3S7EA 1FC3A 1YS6A 2JPCA 4EQQA 1C0WA 3GFMA 3GX4X 2HTJA 3NJZA 1KQ8A 3F8MA 2H94A 4Z82A 3KP7A 2FBKA 2A6HF 1GVJA 2LNBA 4BHBA 2GXBA 4LK1F 2IPQX 1NYWA 1L3LA 1XMAA 3V8JA 1KYZA 2Z33A 4FAGA 4A6DA 3E5XA 4AXOA 1FSEA 3WTTC 4IERA 4H7LA 3GWZA 2MHFA 4A0YA 4LB6B 5KHJA 3REOA 4LFUA 5J6XA 3QOPA 3BJ6A 1XRUA 4KWLA 1NZCA 1IXCA 2UY9A 1IPKA 3HQXA 3DN7A 3D5LA 3KSCA 1LDKB 3QPTA 3U11A 1UW8A 3NRVA 1MD0A 2G7HA 4IEZA 1UCRA 3MWMA 3DV8A 4META 4BQAA 2VBWA 2L02A 1T6SA 1YW8A 4FAHA 2MNGA 2O3FA 4IPAA 2YR2A 3F8CA 3D0JA 4R79A 5FO5A 2BNNA 3EHKA 3L9FA 2O8QA 4BHPA 1NE4A 3TDZC 1X82A 2EA4A 3OGJA 2BE5F 1LDJA 3UKTA 4MZUA 3SZTA 2GH2A 1V4RA 3C3VA 3RIRA 2OAZA 2EJRA 2K86A 3CUOA 1T38A 1CAUA 2VOPA 2V9VA 1R1VA 3TNQA 3DFGA 3GZ6A 1OMIA 4UNOA 2F2EA 2G9WA 4BYYA 3J81K 2A68F 5D5VB 1W7PB 1YFUA 2DBBA 3FJSA 4EM0B 2EV6A 2V1DA 4N9IA 3SMHA 4U0VA 2I45A 2BV6A 2Y75A 4KU7A 1PUEE 2DQRA 1J3QA 3I7DA 2PEXA 1S7AA 2GWRA 1J9IA 2ESNA 1BC7C 1Y9QA 1EY2A 2BGCA 3USSA 1R23A 2XVCA 1SD5A 3GUDA 3NSTA 1HXDA 1BC8C 3G73A 4KMUX 1ZREA 3Q9VA 3K2ZA 4KYWA 5IT9Z 4Q0QA 1ZRFA 2D5FA 4A0ZA 1QY4A 2BNMA 1WWXA 3MCZA 4NVPA 3GO5A 3L2CA 3BWGA 2UXNA 2RNJA 2FQ3A 1EPZA 2CSOA 2W85A 2H09A 3GW2A 4QLCU 2GC1A 3RZZA 4L2NA 2QVOA 1ZG3A 1J3PA 4L5JA 2LF8A 1UIKA 4TV7A 4EM2A 5ICFA 4RB1A 1WI9A 3LAPA 3KP4A 1YTYA 4WF2A 1R00A 2A07F 3EYYA 1J59A 4UVBA 4LB5A 5E1RA 3KGLA 2K4JA 4OIRF 2EFPA 1DZTA 4R8HA 2XKOA 4E70A 2RQPA 5HDKA 1QXRA 2F5FA 2PQ8A 3FX3A 2XHKA 4YRDA 4AWXB 1DP7P 4MTDA 3MZHA 4L0ZB 1B4AA 5AONA 3GFJA 5I0UA 5DCMB 3WG9A 3MQ0A 2H6CA 5D4RA 2XLFA 3HTUA 2P5VA 1QO0D 1QNTA 2EV5A 2PI0A 5JR3A 4EGZA 3RYRA 5CVVA 1I27A 2DU9A 2QWWA 4GXOA 5K1YA 3KE2A 3S2WA 1IN4A 3FXQA 1DGRA 3CO6C 2RKHA 3E97A 3J7AO 2Q0AA 2QQBA 3LAJA 2WWYA 4OLLA 5DYMA 1B9NA 3RJPA 4B09A 1ZG5A 2FF4A 1ON1A 4HDVA 1J1LA 5BS6A 4BH9A 1ULYA 1HSTA 4HSLA 5JAXA 3KP5A 1IXSB 3F8NA 4Y15A 3ROUA 2O61A 1RNLA 5HDNA 6PAXA 3BPVA 5KBFA 5KVRA 2XIGA 1PDNC 2FE3A 2Q1ZB 1D8JA 1MGTA 5KHGA 1J5YA 1Z05A 3BALA 1JXSA 2HR3A 4XRFA 1ZZ7A 3WTZA 4L9VA 3DPLC 3K1NA 2L4MA 5FB2A 4J1XA 4XFIA 2GU9A 5KHHA 3ES1A 4Z07A 2OA2A 3HHGA 3GBFA 1VTNC 5IT3A 3ZMZA 1U3EM 1ZNPA 2LDUA 1U78A 3BJOA 3K1MA 1ON2A 1KQ9A 2P17A 5F64A 3ETQA 4IF4A 3FXUA 5FLXZ 4KUMA 4RAYA 2BNOA 2W25A 4PIYA 3IL2A 4RGRA 5JHUA 1RZ4A 4LLGF 3H9AA 3U1DA 3ACLA 5FDBA 1ZGAA 3KEQA 2GA2A 1FXZA 4PGGA 4OIPF 1YYVA 2D1VA 5FLJA 3I59B 3KP3A 3CLPA 1CAWB 3CJNA 5CLSA 2XASA 1F4KA 3HT2A 1SMTA 2C6YA 3I64A 5DDGA 1ZZ9A 4KIBA 1BI3A 4KIGA 3R4KA 4HVQA 1ZRRA 3BDDA 5A2QZ 2HKXA 4AVAA 2UZKA 4HVRA 1FYMA 5HI0A 1OKRA 4KFCA 3N4MA 4CYDA 4OOIA 3KEOA 5I91A 2NRAC 2HS5A 3EJKA 5D8LB 5J3UA 1H9TA 2GC2A 4X6QB 2MC3A 3QRFF 3LAGA 1J7KA 1HBXG 5E8GA 1IPJA 4ENMA 1D8KA 1V70A 3OTFA 1YUDA 2PAKA 1MJ9A 1FNNA 4QXKA 5BY5A 4EM1A 2MPFA 3JW4A 3F6OA 5HLIA 5D5XB 2PG4A 1P2FA 1RGSA 4GCVA 1Y3TA 4P9FA 1K78B 4MX3A 4QM9A 4Q48A 1ZZ8A 1TW3A 4MGYE 1CAWA 1ZARA 2B0LA 3B73A 3ISPA 1W7PD 2YU3A 2RN7A 1ZRDA 3TOAA 3HSFA 3H50A 4Q0SA 3WGIA 1Q3EA 5ICEA 2O8XA 1LEAA 5D5WB 1YFYA 2DFIA 2ATFA 2JRTA 2OPKA 3IKVA 1R7JA 4O9EA 5DUIA 1G4DA 3VHRA 2V1XA 3M9AA 3RPQA 5BQTA 1U5TA 3OV8A 4JTNA 4LUMA 1WRJA 4GYGA 1Q5OA 2FRHA 4E2GA 2STWA 2BBYA 2JZYA 1EYBA 3M3IA 3IDBB 5D1IA 4G6DA 5LGNA 5CYVA 1HW1A 3TO7A 1UHWA 2VBYA 3NQOA 1USTA 2ZKZA 4NB5A 3PQJA 3HIFA 5ILSA 3VOEA 1SEFA 4XF4A 2YPRA 1YFHA 1FYLA 5ERIA 2PA7A 4KA4A 4QGLA 2IT0A 2Z3YA 1IUYA 3ZMSA 3EETA 1EH6A 5I0SA 3IBMA 3DPTA 4D0PA 2ELHA 3TDUC 4EROA 4P9GA 2XKPA 3FXRA 3I5UA 3SCFA 4UVAA 2YX4A 3KFWX 2F5EA 1ZZ6A 2FNPA 1MKMA 1FOKA 1ZGJA 1FI2A 1SFXA 1YS7A 1KA8A 1R1UA 2WV0A 4L9TA 1G3TA 2OD5A 1MDMA 3EBRA 1ZH5A 3HSRA 3PFIA 2EWNA 1S8NA 3ZMTA 2HYGD 2KJBA 4PGHA 1QGPA 3BOQA 3COAC 1OI6A 3H3UA 2QVSB 1LJ9A 2PMUA 1O3TA 3QP6A 2L4AA 1UIJA 2HQRA 5FFZA 1XD7A 4KT5C 5HLGA 2EV0A 2Z5UA 4IESA 4OINF 1IRFA 2PFBA 4HAMA 3G7DA 4MUVA 1R5HA 2PAMA 1HSJA 2ZKLA 4RD7A 1BM9A 5KHIA 3CL1A 1RI7A 4YFXF 4Z2YA 1G3SA 5FD5A 3N97A 1P4AA 4U88A 2K9ZA 1FSHA 4EWAA 2VBZA 2GA1A 2UY8A 4R1HA 1GQGA 2XGXA 4P5OA 1LVAA 3KMHA 4AQ2A 5FGMA 1QWRA 2ZMEB 4QM8A 1FBUA 2VONA 4ENJA 3P9CA 1FP1D 3EDPA 4O3MA 3FWEA 5LGTA 2CGPA 4ASNA 1G3WA 5D5UB 1TQMA 2HJIA 2OZ6A 3GLXA 5ED4A 1F1ZA 2W84A 1ZX5A 4IXAA 3NW4A 3KCCA 3IRRA 1SD6A 4EMSA 3F22A 1XGMA 3FMSA 2A6EF 1BI2A 3JSPA 4JQFA 3HYIA 3WE2A 1RC6A 2H0VA 3IIAA 4MV2A 2EVXA 3FMRA 5CVUA 4XFCA 5C6CA 1G3YA 1W5TA 3EQLF 4HW0A 1ZZBA 5FFXA 2MLGA 4XFGA 3BJAA 1Z6TA 1K79A 1QZYA 2F5DA 1JHFA 1H9GA 2KIFA 2ZFWA 4IVNA 4XEZA 3JSOA 2QDRA 3R6SA 1SAXA 5E16A 2IXKA 3LWCA 2EK5A 2FXAA 2DCTA 2ZJ2A 1IXRC 1IN5A 3SCGA 4LLOA 4AQ6A 3RTRA 2O03A 5FQ0B 2C0ZA 4WXCA 3NL1A 2VPVA 2OZUA 4KN4X 5I0TA 2PBIA 1QPMA 2Z9OA 1SD7A 2E7XA 3K0LA 4LA2A 2IA0A 3HTSB 1EH8A 3BY6A 4IEUA 2DQLA 3BP8A 5ILUA 1LDDA 2Y0MA 5K8SA 4ZYHA 2F4PA 4HYEA 5E1WA 4MNUA 2ET7A 1YW7A 5LBQA 3LWFA 3DQVC 3ZPLA 3O3KA 1DPRA 3MEXA 5AIQA 3P7NA 4L18B 2EB7A 4PZJA 4IRGA 4LJZF 4ESBA 1ZLKA 1RL3A 2XV4S 3QACA 2M30A 3M7GA 3TOBA 2M5WA 1JE8A 4RS8A 5FLHA 5I8TA 4HBNA 1YIOA 4OIQF 1ZRCA 4AIKA 3ABTA 2IXLA 3BZ6A 5LLQA 4M71A 4WWCA 3CJXA 4OMZA 4IHSA 2QQAA 4FX0A 4HX8A 3P9IA 1CAXB 3U10A 3ZDSA 5K5OA 4KL1A 2LKPA 2IC1A 1S3JA 4EJVA 4G7HF 3KP6A 4MHGA 1P6RA 3R0AA 3T1BA 1NHAA 3M8EA 4G6QA 2CAVA 3DXJF 1J75A 4HA8A 4IEYA 2E9QA 4YIFA 4BAYA 2O0YA 3TGNA 2VN2A 1J2XA 4N0BA 2V1UA 3CTAA 3FZVA 2K4BA 3IWFA 5A2QK 4L11A 2HFHA 2NS0A 2RDPA 3VFZA 2NNYA 2RGVA 1H1MA 1L3JA 3SFZA 3HT1A 5F6FA 1I5ZA 3H7JA 4PCQA 1W7PA 4U0YA 1IN8A 3J80K 4MGZE 3U0ZA 3OOPA 2VT3A 3VB2A 5JFRA 3WU0A 2PJPA 5CVJA 2DI3A 3CDHA 4HLTA 3GZ5A 4PIXA 1R1TA 1O3QA 3D0SA 4WBBA 1XSXA 1TQPA 2PQQA 1SFNA 4RB0A 4XETA 2HWVA 4M74A 4M9XA 3LA7A 2MBFA 2P7VB 1XGSA 3DP7A 2EFOA 3IKTA 3L00A 4YYOA 2TDXA 5HVQC 2IA1A 1ODDA 4ZZDA 5I93A 1ONVA 1X7NA 4HF1A 1P4XA 4XFAA 3BB6A 4LMYA 2AXLA 2D40A 2FSWA 1LRHA 1H0MA 1SFUA 2UYBA 4UUVA 4I98B 4UHTA 4DQ2A 2VQAA 2D2WA 1OD5A 1XE8A 1H1IA 3OF1A 2P8TA 4KIFA 1CGPA 4B29A 3HRMA 4ZH4F 4WZCA 2IP2A 4MQVA 2W57A 4MQ9F 3BPZA 4WXDA 4L0YB 1RUNA 3WODF 4O6JA 3CUQC 4FT8A 4EJOA 1Y0UA 1LEBA 4LG0B 2OU2A 4TLFA 4CDGA 1QQIA 3J81Z 2JSCA 2WFPA 3S7IA 1SFEA 4I0AA 4IEPA 2V6CA 4GYIA 4XF0A 4XSZF 4JV4A 5JVTA 3SQNA 5JR7B 2FEZA 2IA2A 1Q1HA 1R36A 4GULA 1NE6A 3ZQ7A 1D5VA 5DCMA 2D45A 4M9SA 4WXHA 5BMZA 3JAMK 3CLOA 4M9ZA 2GC3A 2CV6A 3M1EA 1TQ5A 4A0XA 2ETHA 4HMZA 3GFLA 5LEJA 3EYIA 1HW5A 5CVRA 5E17F 1YLLA 2BYVE 5J7MA 3F72A 3Q5FA 4KN7X 2MH9A 4HF2A 2JT1A 1JUHA 3CO2A 4BHCA 4HSJA 2M87A 3G3ZA 4ETSA 3LZZA 1WQ2A 4LLNA 4UXNA 3OD0A 4A2UA 4XSXF 1U5TC 4G8XA 2DTRA 4ZYDA 1USSA 1CF7B 4EVIA 3FM3A 3WW2A 4D7SA 4RGUA 3E6MA 3PLQA 1ZAOA 3LFKA 3RYKA 3QP5A 5DD8A 4XFHA 3PVBB 3SHFA 5HS8A 1ZYRF 2V09A 2GXGA 1XN7A 2ETEA 2DK5A 4HX7A 3BU7A 3QU3A 2KIUA 1QZZA 5J8FA 1YG2A 1SQ4A 2PHLA 3W6JB 3F6VA 4PIZA 3I71A 2PHDA 3MZYA 2STTA 2RVCA 3JZVA 4UXAA 3CO7C 3VODA 4GGGA 1YLFA 2IVMA 4P96A 4OMYA 2FNAA 4XFFA 2VECA 4K2EA 4HLXA 2F5CA 5BV6A 2HEOA 4NHJA 2FMLA 2EFNA 3FF5A 2QBYB 1YFWA 3I4PA 2P7CB 4E2QA 5AIPA 1YW9A 5JI6A 3L7WA 2WTEA 4HQEA 1DPUA 4HN1A 3ES4A 5E20A 4KU8A 3I59A 4LTAA 1S7OA 4JTOA 2PAEA 1O5LA 1ZN2A 1ZHFA 1FT9A 3GVAA 5L3BA 1SD4A 2A5YB 3ZMVA 4Q0PA 4XBFA 1XCBA 1B6AA 3SXWA 4F7ZA 4I2OA 4A5NA 2OZJA 2OA4A 3ABUA 1CF7A 2FMYA 3LA2A 1R22A 4XFBA 1U8RA 4WX9A 3BCWA 3MAJA 5J8CA 3GXOA 4B8XA 4M6XA 1LKNA 4U7BA 3QAHA 3C1DA 5TRDA 2QNKA 1E17A 2GZWA 1REPC 1AWCA 4D7TA 2QQ9A 4BNCA 2QYOA 5CU1A 2VBXA 1HKTA 5E1ZB 5J48A 1Z6RA 1RIOH 4LLLA 5BPXA 2CQKA 3W6KB 3TO6A 2P6SA 3H7YA 4DINB 1WGPA 5DUKA 1XGOA 2Q2EA 2KRFA 4X6RB 2ESHA 1LQ1A 1VJ2A 3LQRA 1O7LA 4HLYA 3GFIA 3KZYA 2VT2A 4ZU4A 5ILVA 4MEXF 1PMIA 3E6BA 1IZ1A 2OQGA 3K69A 1KQ0A 4LA3A 2QLZA 5DD4A 5TJJA 3ECHA 2XROA 2KIMA 3F21A 1E2XA 1STZA 1GXQA 2CFXA 2HTSA 1MZBA 1U12A 1K78A 3WW3A 4LGWA 4Q0UA 2IJLA 4OIOF 1W5SA 4KNYA 2Z69A 1XMKA 3GEZA 3V7CA 4KDPA 2OYZA 4ZU7A 2M45A 2M1BA 4GO1A 3WW4A 5JSPA 2IXJA 1XE7A 2D5HA 5I0RA 2KXLA 3RYPA 5I8SA 4MGIE 5DV5A 1BI1A 1JHHA 5FD6A 2IXCA 2XAGA 4G94A 4IEOA 3SHRA 2KKOA 5C8WA 3AAFA 3T8RA 4KICA 1I1GA 3KP2A 2H27A 1EH7A 1GQHA 3L2HA 3U2RA 2O1QA 4EJWA 1KU9A 1FY7A 4HVOA 3LSTA 5BPIA 2V79A 1K6OA 5IT9K 4N9HA 3ZN1A 1IW7F 3O2PE 5KHKA 3C3WA 2VE9A 1CAVB 2LF7A 2VOOA 2QM3A 1Z1DA 1XDSA 4LEJA 2ZXJA 3ERED 4Q5SF 2VC0A 3TQNA 5JCTA 4UBHA 1O7FA 4PDKA 2MA3A 3K9TA 1Z9CA 3D82A 3DF8A 3F23A 1J3RA 2CWEA 3F3XA 4YG2F 2GIVA 2OBPA 4Y17A 2GQQA 2P4WA 1DDNA 3LOIA 3SCHA 2L01A 2JPBA 2XLAA 4ZZLA 1BOAA 5FLIA 3BPXA 2CYYA 5DEQA 3CF6E 3H1YA 5HLHA 5DCFA 5JSRA 2E1NA 1XGNA 1IF1A 5ICGA 3FMQA 1RUOA 1CX4A 3V7SA 5E18F 2HZTA 1TTYA 3TO9A 1KYWA 4JK1X 1U6GA 3BROA 2EAAA 4EJTA 2IXIA 3I0TA 5EEHA 5KK1A 4RB3C 2CAUA 5CADA 1ZLJA 1TW2A 4O9GA 4CICA 1Z7UA 1K7AA 4ESJA 4P55A 3GYHX 3O14A 4CHUA 1L0OC 3I53A 2XLGA 1YHFA 3FE5A 4IEQA 4AVBA 3WTXC 2R3SA 2PFWA 2FBIA 4IEXA 2MH2A 2H6BA 1HQCA 1FP2A 3C18A 2HDCA 1BJAA 2MD5A 2K02A 3RKWA 1Q43A 5K5RA 1PP7U 1B9MA 4HZFA 3T5XA 3V4GA 2KJCA 4MGRA 1S29A 3GYDA 1HW2A 1SMYF 1IAWA 4UV8A 1CAVA 2IRFG 3IDCB 3H1MA 5L3DA 2HGCA 4HQMA 4M72A 4U7DA 3SZPA 2ZMEA 5BXXA 4QGMA 4PJYA 1IN7A 2ET1A 5LEKA 2CG4A 3FZ3A 3WU1B 2UWMA 2Q8KA 4XLPF 3M70A 3I54A 3RDIA 4RAZA 1FYKA 1FBSA 4I0BA 4EJUA 4WK8F 1UHMA 5I8YA 2HKOA 1OYYA 1BN5A 2EA2A 2PLYA 2B5HA 1PP8F 3MPBA 5ICCA 3IC7A 1ZVFA 3WTYC 5H6RA 1TNSA 3KZZA 4DNCA 3GF2A 3R61A 4JBAA 3CEWA 4HX4A 1FWZA 2L3DA 5D6FA 2Y48A 1WA4A 3MDPA 5FLXK 4ENNA 4I7HA 4ZU5A 4HOBA 1F5TA 4P9UA 4XF1A 3ULQB 5D4SA 2XL7A 2DK8A 5EZWA 1KGSA 2XUBA 4J1WA 3NEUA 3ZP5A 1KU2A 3V8KA 4A12A 4O5VA 4A6EA 2N7GA 2J5OA 2CW0F 2Q30A 1Z91A 4U0WA 2Y0OA 3WTVC 3MFKA 5FQ0A 4RGSA 4MH0E 1TNTA 5L3FA 2IXHA 3IRQA 5T3NA 5LHHA 2YX7A 4I09A 2HQNA 1QBJA 1DZRA 4HBLA 5LRSA 1B1BA 2D1HA 3WGGA 4G9YA 1GXPA 3E5UA 2UXXA 4XLNF 2Q4SA 1UPIA 3QPHA 2P6TA 5HDGA 4QWQA 3KLNA 1FBQA 2PMHA 2CO5A 2R7FA 2DT5A 3I58A 5L3CA 2EA7A 2ZNZA 3HRUA 1BBYA 3EQEA 3WW1A 4L9NA 1XCVA 2B8MA 4A5MA 3WTSC 4ZYGA 4AIJA 1UD1A 4S05A 4H0EA 3H8UA 5FPZA 1KU7A 4R52A 3TNPB 2R7DA 4F8AA 1X8EA 2QJVA 3UKVA 1DGWA 4NQWA 1WLTA 5BUVA 3H92A 4CO8A 4IRIA 2XRNA 3DKWA 5F1RA 3K1PA 4G7OF 5LRRA 1VR3A 2WC2A 3JTGA 1CAXA 3IHUA 1QXJA 4IJAA 3E3VA 4XF9A 4ONUA 4BXUA 1XSDA 3ZMDA 2VC1A 1O57A 2Z2SB 2HOEA 4I3PA 2FBHA 3JTHA 3RKXA 3DL3A 1T0FA 2RV8A 1I6XA 1G6NA 3F8FA 3WE3A 1U2WA 2LSOA 3E6CC 4K8FA 5H20A 4ORFA 1KU3A 3CUQB 4MTEA 1PM7A 4YSFA 3ELKA 1OFNA 2QENA 3P9KA 2L54A 4ZYEA 4QMAA 3T0YA 2ZO4A 4I02A 3HUGA 3R0JA 4KWJA 1IRGA 2FOKA 5LHIA 4YARA 2COMA 2DW4A 4QGNA 5JSOA 2E1CA 3V8LA 5K5QA 1DUXC 1O3SA 4RB2C 3RPUA 1MJBA 5E8IA 2QCSB 4HV6A 3ELNA 2AS5F 3O6BB 2QZ8A 2P5LC 5HS7A 1I1SA 1P4WA 3V7RA 4MGKE 1UCXA 4OU0A 5HS9A 3M8FA 3T8TA 5LHGA 2D93A 2JTVA 2G7UA 4EWEA 1FZPB 3HHHA 4UBGA 1HKQA 3L09A 4EWDA 3HOTA 2ISYA 4CGZA 1T2KA 1FX7A 2EFQA 5FPXA 3LA3A 1YWKA 2K0GA 4HF0A 4EV0A 3UKNA 1AOYA 1EV7A 3OCPA 4QX5A 4Q47A 4FHTA 4Q4ZF 1BIBA 1A04A 4CZZA 2Q0OA 3ML6A 1U5TB 4RGXA 4LG0A 2DPDA 1FLIA 1X8MA 3HRSA 3HOSA 4LUKA 2MLKA 4BIFA 1LB2A 2A3SA 5HOOA 2A61A 2ACJA 2VXZA 5CVIA 1YO5C 3FHIB 3J80Z 4EGYA 4HN0A 4OFGA 1OR7A 4G7ZF 3ST7A 1TBXA 5D6EA 1LR5A 2W24A 3FHZA 2XAJA 3CUQA 1J0RA 5CJ9A 1O5UA 4L9JA 3TKYA 1WSUA 3E5QA 2ZCWA 3ZN0A 4LK0F 1S6LA 2NNNA 1P92A 3KGZA 3RNSA
chains in the Genus database with same CATH superfamily
3S5QA 4E7IA 3S0MA 3LQQA 3Q9SA 1Y9GA 5EEGA 4UV9A 4LULA 4K9SA 5CKNA 5E8AA 4LBNA 2K27A 2NAZA 1I50J 2A7AA 2ZBKA 4LG3A 5A3PA 4L5IA 2PMZA 3ZPYA 4H4KC 1EV13 1BMV1 1NG0A 3KB5A 4WCGA 2NVTJ 2WAOA 4YZ4A 4YIIA 4HV5A 3E1F1 3HEFA 3PIPF 3OYCA 2X4HA 4HPKA 1NXMA 4N53A 1HDPA 5CIRA 5FO8B 3OYFA 3MD2A 3IPVA 3VDXA 1J58A 1OC1A 1UN1A 1GR3A 1NK2P 4JKLA 4OYUA 3APBA 5L19A 3LQCA 4ZZ5A 5DG1A 3KETA 3BPSA 3PNAA 3OYJA 1YI9A 2W48A 4QHOA 4ENKA 3ZRGA 2XAHA 2W46A 1MQTC 2EILH 2A69F 3MW3A 4YNIA 3JAMZ 1MPXA 4P9WA 2BZDA 4D94A 4IETA 3WG7H 1XB4A 3I3BA 1Y9MA 3CCJI 4XORA 3VYTB 3GCXA 1GZWB 3MYXA 4PI2A 2QBYA 4YRVA 3ZYJB 2EZLA 4YFKF 2XAFA 1GHCA 2RDRA 3O0VA 1KDMA 1D3YA 4Q29A 1BJZA 1MJAA 3A03A 1JTXA 3I4IA 1MNMC 1BBT3 5H6QA 2ZXIA 4NOTA 5E1XA 2BXZA 1W8FA 1HC8A 2X1EA 4RM3A 1DZQA 1JGSA 1HRI2 4IHTA 3EMRA 3OS2A 4MEYF 4ON0A 2OCCH 3VN4A 2K7LA 5A1LA 1JYXA 2PYTA 1SBFA 3HMYA 3AKQA 4NC6A 4IHYA 1O3RA 1RTVA 3VEPA 3LEKA 1KONA 2KZGA 4WVWA 4LQRA 3HPGA 5JZGA 1W9TA 2PHTA 4QHZA 2E7WA 1E3OC 1Y0NA 2O6GE 4YVSC 2ENRA 4JOMA 4AVPA 3RKYA 2BEOA 4IEVA 4EZHA 2DAOA 1QMJA 1EV11 5A6XA 1PVXA 3JCIA 2HOTA 4YW1A 3CCRI 5JVGF 3OPZA 3POFA 1TLHB 3IWZA 1CAUB 5F0FA 3M8LA 3S7EA 1YS6A 1HN0A 4EQQA 1IS3A 3N9OA 3GX4X 2XF7A 4JP0A 4Z8BA 1UKGA 1V5GA 1L3LA 3V8JA 1WLCA 1KYZA 2Z33A 2R073 2C9AA 3GWZA 2RJLA 4XZUG 5D2AA 4PQ9A 2VXJA 1F5FA 1E5HA 5GLUA 1AYM3 3QOPA 1XRUA 4A6OA 5FZIA 3RG0A 1NZCA 4Z2AA 1GV2A 2HVRA 1IPKA 1QJY1 3D5LA 3KSCA 3OS0A 3TEDA 1JOJA 2QKDA 2G7HA 1JKQC 1O4ZA 2Q5TA 1R49A 3MWMA 5BNPB 4Q1PA 2Z4FA 3KT1A 1BBT1 1YW8A 3AYCA 3KQRA 1Z0XA 1WCDJ 1DGWY 1H8TA 1DGRN 4P02B 4IPAA 3I2GA 2G9FA 3D0JA 5FO5A 5LZ6A 1AUYA 2BNNA 3L9FA 4XIDA 4QX7A 5FLVA 1NE4A 4A7ZA 1RMU2 1X82A 3NAPC 4IQJA 4H7MA 2E34A 1UOJA 2JJ7A 4HK9A 1A6IA 4XRMA 3C3VA 2VOPA 4V2GA 1D2QA 2QSHX 3DFGA 1ENHA 1OMIA 4B3NA 3J81K 1BEV3 2CQQA 2V6EA 1YFUA 3ZFEC 1JZ8A 3IAS2 3I3QA 3ZX7A 3SMHA 2I45A 4GB32 2Y75A 2JVHA 5ANQA 2NPIA 1PUEE 1J3QA 2PEXA 2R7XA 1IZ3A 4ZTJA 4XILA 3RZDJ 3GUDA 5HCAA 1HXDA 1BC8C 5CFDC 4KMUX 1ZREA 4KYWA 4AI9A 5GADJ 3KCYA 1WWXA 4NHXA 1X3ZB 3GO5A 3LF7A 3B01A 3L2CA 1HKDA 3BYWA 1LOBA 3S3MA 3DF0A 2JG9B 4CDQA 2RNJA 4A3FJ 3TW6A 3VBRB 1FOD1 2R071 1ZBA2 4QLCU 3SNMA 2GC1A 1AYN1 1FIPA 1ZG3A 4QXHA 1J3PA 4L5JA 3ZQLA 2AEZA 4EZ4A 2D98A 3IP4B 1AX1A 5IP6A 5FMDA 3BR5A 1MEC2 1YQCA 5B4XA 3IT8A 3QD6A 5EYRA 4QDSA 4FQGA 2ZMLA 1ENXA 2BHYA 3LOBA 3OYWB 1DZTA 1UY3A 3POGA 4OHYA 5HDKA 2PQ8A 3FX3A 2VJ5A 2LY1A 2XHKA 4AWXB 1CZVA 4BISA 5DN2A 1LKXA 5I0UA 2Z5WA 3WG9A 1JZ3A 4AFDA 5J4VA 4UUSB 2WAAA 3HTUA 2P5VA 2WINB 1QNTA 3OIQA 5L7OC 4AF9A 2PI0A 4IV1C 4EGZA 2DU9A 1OOPB 4FOQA 4NAOA 1DGRA 5LFAA 5FZAA 2NVYJ 1QJU2 4QU2A 3H36A 3E97A 2W87A 1V9U2 1B9NA 1ZG5A 4HDVA 1J1LA 5BS6A 4XAEA 4Q4V2 2IEKA 4DY5A 5JAXA 2W0XA 1IXSB 2HQ5A 3KZIC 3F8NA 1UY1A 4LBQA 6PAXA 4GRIA 3BPVA 1BEV1 2WQZC 5KVRA 3GZEA 2LW8A 1L7RA 3CESA 1PDNC 4M0HA 2FE3A 4B1RA 2DOFA 2VZQA 4M3FA 4XRFA 3ABZA 1Q8PA 2VOXA 2W08A 5JOZA 1V6LA 5F2SA 2QFEA 1Y6IA 5J40A 5KHHA 4D5FA 2XSJC 2DFFA 1MH4A 3HHGA 1DQ6A 3GBFA 4CPBA 5IT3A 1YJWI 2QQOA 1D0ZA 4Z1VA 3Q8BA 3BJOA 1ST8A 1F36A 1T6BX 4IV3C 3BQYA 2FJ1A 1IKQA 5EG0B 1H9WA 1YE9A 4PIYA 2ZHMA 2WABA 1RZ4A 3HQUA 2HPIA 3QPLA 1X1AA 3U1DA 5FDBA 2WA3A 1YYVA 2HNHA 1EAH3 1PO12 2MSYA 5FYIA 5CLSA 4Y7NJ 4URAA 4XAAA 1B35B 5A3WA 2EICA 2D44A 4FETA 1VAKA 2HXIA 5DDGA 3HDDA 3I2DA 1BI3A 2VJXA 2Z42A 4HRIA 2DCEA 3R4KA 5CAZA 2X5IB 1ZRRA 3FBNB 3GTLJ 3CZ6A 2GIZA 4NPMA 1WI3A 4HVRA 1FYMA 3H1CA 1RINA 5T52A 1PIV2 2XPVA 5DTDA 5HODA 3DEWA 4EEFG 1W2AX 3RZMA 3B3QE 5I91A 2NRAC 4XQDA 1MSFC 3EJKA 1SLIA 2GP5A 1FX5A 1MMDA 2JDZA 4ES9A 1SPPA 5FV3A 3S30A 2B7YA 4XOGA 3KM5A 2XJQA 3M3EA 5AFEA 4M3BA 3OTFA 1VNDA 2QZ2A 3N35A 1WH5A 5FZ1A 1MJ9A 1VMHA 3L2WA 3CBNA 3JW4A 1UOBA 1W0OA 3A01B 2DCZA 2PG4A 4UAPA 4EYUA 4RFRB 1RGSA 2Q1MA 4M3GA 2Q8DA 3GTQJ 1Y3TA 1V5FA 2ZFUA 4QM9A 4E4ZA 2YROA 3HGYA 4ZS3A 3ISPA 1RHI3 1PO23 1LOFC 5J1XA 2LFBA 3H50A 1S2BA 3L9JT 2LS6A 2JECA 5ICEA 3B69A 5D5WB 2DTWA 5TISC 2RM23 4LOSA 2O8OA 1IKPA 3N9MA 1SCSA 2VQGA 1RIRA 3VHRA 5BQTA 3A1YA 4IL6C 4P5YA 1IGNA 3OV8A 1WRJA 1Q5OA 3TYJA 3FBMA 3VDAA 2JZYA 5T5JA 4D9JA 1YNAA 1EAH1 3IDBB 4LBQD 3I49A 3Q0VA 1HW1A 1F35A 3VBHC 3WUDA 3NQOA 1US2A 1W2OA 5FY9A 1TNFA 3GDBA 1BCXA 5C44J 4FPOB 3SDBA 4XF4A 2YPRA 4RHV3 1UELB 4KITB 5FROA 4KA4A 4QGLA 1WJ5A 5I0SA 1EH6A 4TTGA 2KDOA 1PGW1 4K40A 4A3BJ 2ELHA 4HEA2 1XS9A 1A34A 2DVAA 3AL0B 5C3RA 3SCFA 2P81A 4CPBD 2H1KA 3OD4A 2GNMA 1AXKA 2RG4A 4PHZA 1YS7A 4L9TA 4XN0A 4YM1A 1V6OA 1VAMA 3KX2A 1JBCA 2HYGD 3FLTA 1ND3C 3P3PA 1JH5A 5HCHA 5B1AH 3BR6A 5K0UC 1OI6A 3R05A 2BP6A 5EYYA 4F83A 1C8NA 4TSVA 3S17J 3WVJA 2R49A 2EV0A 4AQTA 4OINF 3WQ0A 3ZN6B 4ZJZA 2I5UA 2VPRA 1R5HA 1OVSA 2L9RA 2ZKLA 5LBBA 2QQMA 4F52A 4HFSA 3B5LB 4UOJA 4Z2YA 1AR92 1G3SA 4FFGA 1LFUP 2GM4A 1P4AA 1RHI1 1PO21 3F0CA 4ZC3A 2JE8A 4EWAA 1ND2B 4W50A 2XGXA 4HOOA 3H5NA 4BACA 1Q8OA 1GZWA 1POQA 2L9NA 2WO1A 1YIFA 4ENJA 2RM21 3AZYA 4H2AA 3NJVA 1RUC3 3ZQIA 3HOYJ 1HXS3 1GV9A 1G3WA 1N25A 4HETA 2BXYA 3ESWB 4IL7A 5FLMJ 1HB2A 2LR8A 5J09A 3KCCA 3FBIB 1SD6A 1RUJ2 4CYCB 3N9NA 4EMSA 3F22A 1XGMA 1HCRA 3O1OA 3JSPA 4JQFA 1RC6A 3OS1A 1DG6A 4E4DX 2EVXA 5CVUA 1NXD1 4I99C 4RHV1 5ISLA 2ZZQA 5FFXA 1JYTA 2Y6KA 5FYTA 1BBT2 3UT0A 1BR1A 2CWMA 3BJAA 4X6AJ 2ZKNA 1LUJB 3PSFA 1QZYA 1JHFA 2KIFA 4XEZA 3JSOA 1SAXA 2JENA 4COYA 3ZYGA 2NVQJ 5H9RA 2IXKA 2CNAA 2A05A 2P5BA 2QQ8A 3OBAA 4TLGA 1IXRC 3SCGA 5B2GB 1WJAA 2O03A 1QJEA 4QTRA 2KRCA 5FQ0B 2C0ZA 5FOBB 3VDDB 1MS3A 1SEUA 2PBIA 1SLLA 3QPSA 3OYNA 1MMNA 1UYPA 2I10A 2J1SA 2ZS6B 4IEUA 3BP8A 2EZIA 2Y0MA 2XWJB 3B6CA 3LSKA 4HYEA 2XQRA 4MNUA 2VL8A 5LBQA 3DQVC 3IV5A 2XBO1 2JRMA 1F5JA 4L18B 5CEHA 1S5LC 4LJZF 1T56A 4ESBA 1ZLKA 2HWF1 2YU2A 1PK6C 2VULA 1X50A 3QACA 4CU6A 2VKVA 3KT7A 4UWDA 3JD73 1UYZA 4D1QA 2R072 4OIQF 3ZXDA 1RUC1 3ABTA 1HXS1 1YYNA 3DEMA 1G9AA 5LLQA 2R063 2ZJRF 4LE4A 2BV4A 2QDNA 4OMZA 4IUGA 2HEYF 1AYM2 3KPHA 2VXRA 4CDWC 3ZR6A 4E4HA 3V0BB 2L2OA 5F5AA 5CNAA 5JXGA 5H2FC 2DA5A 4EJVA 1S3JA 4G7HF 1OVPA 1XX5A 3T1BA 1QDOA 4BJTA 3DU6A 3HOZJ 1TWHJ 1ZQ3P 4BLJA 3TGNA 3SZGA 2EQRA 4XUTA 1MBHA 1GUUA 3EPZA 3FHNA 1ZK8A 4UF0B 3OUJA 4L11A 3CJQB 1UXXX 2GMPA 2HFHA 2NS0A 1NQDA 2M2EA 5F6FA 3ABKH 3OMYA 5K7ZA 1YIPA 4CCKA 2ZXWH 2VJJA 2VT3A 4B3AA 1X58A 5JFRA 3I2JA 4DZGA 2DI3A 3KLSA 3HGGA 1D7PM 1D1AA 2GNTA 3GZ5A 1O3QA 3D0SA 1DIWA 4KBZA 4WBBA 4RB0A 4NWVA 3J7AY 2HWVA 1I6HJ 4GXLA 3OB8A 4GWNA 5FMCA 3OL3A 1Z3YA 3DP7A 4ITVA 1BEV2 3L00A 5F3EA 4NIDA 2W9XA 2JDYA 2IA1A 2CYFA 2XWBB 4CXWA 3UR3C 1OISA 2AXLA 3IAM2 2FSWA 2JG9A 2XB6C 1LRHA 1H0MA 1SFUA 3VBRA 5A7SA 2W7NA 3HOVJ 3JREA 1OD5A 3OPWA 3RJRA 4A3DJ 4HG2A 5ACA3 3JBG3 2W57A 3ABLH 4A3ZA 2F48A 1X1BA 2AHQA 1UZVA 1RUNA 2VUAA 3CUQC 4EJOA 3INAA 1U0AA 4E27A 4QD2A 3D1NI 2G4IA 4UW6A 1OXCA 4Y1VA 3W9AA 5C3SA 4BMEA 1D0YA 5T5PA 3W21A 3K4BA 3CZUA 2V6CA 3OIOA 3BG6A 3U37A 1M06G 2R061 2IA2A 4CEYB 1Q1HA 4GULA 3WU2C 4Y4YA 2HWD2 1D5VA 3K10A 2D45A 4CDUC 3K70C 4WXHA 1DLLA 5EIYB 1GYKA 2HWE3 2JA8J 3ZSKA 4D7NA 1TQ5A 2BGPA 4A0XA 2ETHA 1WWYA 3A4UA 4XE9A 1PUFB 1QH7A 4QQ2A 3GFLA 3Q3SA 5E17F 2HWC3 4N53C 3VKOA 3W20A 1V6NA 4KN7X 3RZGA 2FZ2A 3BOWA 1AHSA 3PIGA 3K4KA 4EJRA 2FDKA 2NM1A 2YMZA 2HWB3 1GUIA 1CF7B 3TN93 4HONA 3WW2A 2ZGSA 1WUVA 2FQ4A 3PLQA 3KVBA 1ETYA 4XFHA 3K7AJ 4KGQA 3PVBB 2K9SA 1YI7A 3MVPA 2ETEA 1MIJA 4HX7A 3S16J 4JHZA 1QZZA 3AYDA 1YG2A 2JG8A 4BDZA 3O1SA 4PIZA 4K20A 2C9KA 2ORXA 1K12A 2WJSA 1TNRA 3T4VA 5A32B 3ORJA 2Q8EA 3V0AB 4GGGA 4OMYA 3BTXA 4P96A 4LBMA 1TME2 1JHJA 2IGOA 2VKDA 4H55A 1AJOA 2WT0A 2HEOA 4NHJA 5EG0A 5ACA1 5IOZA 4XONA 1O4XA 5G05L 3JBG1 3PO3J 2FD8A 3NWSA 3GTPJ 3DCQA 1YFWA 2WSUA 5AVAA 3P5BA 1P7JA 3CP2A 1MSEC 1YO8A 4Z2WA 4GIQA 4LTAA 1S7OA 3DU5A 2DFCA 2EIGA 3QODA 1XYNA 1VMFA 2PMWB 3GVAA 5FMOL 2A5YB 2LK2A 3C2UA 5FYYA 3ZMVA 4XBFA 5FWEA 1W9YA 3SXWA 5JZGC 2E5NA 3ACHA 4AEDC 4E8CA 1F4AA 1ETKA 2OZJA 2OA4A 4PFPA 3LA2A 1NCRC 4UUTA 4WX9A 2X5IA 3BCWA 1XPXA 2HWE1 3W2AA 4M6XA 1LKNA 1EAH2 4WVMA 4J01A 1SLCA 1OCPA 1O59A 2V9KA 5A3MA 3JR9A 3K77A 2QNKA 1LHUA 3BR2A 2X6WA 4D7TA 1A3KA 1U9OA 1ETQA 1ENRA 5E1ZB 4A3GJ 3OPTA 5BPXA 3ZSLA 1HOMA 3CMGA 3OBRA 2HWB1 1TC3C 3TO6A 4AUXA 3OJBA 3TN91 3VD3A 4DXZA 4DXRA 1ZR4A 3H9JA 3S14J 4YVWC 4X6RB 4LO6B 1LQ1A 4GKYA 3LQRA 4HLYA 1G9FA 2JDPA 3DWLE 4GZ9A 3A01A 2VW2A 3F95A 4XUPA 2KIMA 3PMEA 1GXQA 2X51A 1JZ6A 5BNNB 5GAEJ 3RGBA 2IJLA 2DWRA 4KISA 3VSLA 1ZYBA 1SFPA 2B4KA 1DU0A 4JDMA 3POJA 5JSPA 3RYPA 5I8SA 3BR0A 1ENQA 2LM3A 2M4KA 2FX0A 5DQ0A 4MXVA 2VNVA 2Y64A 4IEOA 2AC1A 3T8RA 2IWGB 1EH7A 3ZXJA 3B00A 3U2RA 1VI0A 2EXHA 1RHI2 2AYHA 1FY7A 4AEJA 4XDPA 1W8HA 1OD3A 5KHKA 1UXZA 1X2NA 1ZM1A 3AP4A 4JGZC 1IPSA 1YEWA 2VOOA 3IM0A 1Z1DA 1XSRA 3ZO0B 2RS53 1AKHB 4FCAA 3WF1A 3TQNA 3O1TA 3B94A 2KT0A 2V72A 4PDKA 3P1IA 3F3XA 4YG2F 2OBPA 2XJVA 3SCHA 1YJKA 4DY3A 3AKRA 2JPBA 1S0EA 1XNCA 5GPCA 5FLIA 1CQ9A 3CF6E 5HLHA 4QPIC 1XGNA 4RGGA 2R7QA 1CX4A 1Q56A 2OJED 3LSJA 1ASJ1 3TP0A 3I2IA 3GBGA 2DDAA 2DJIA 3BROA 4K21A 2WY8Q 5EEHA 4CDQC 5M0TA 4R9BA 5CADA 1ZLJA 3OUHA 5K7PA 4IE5A 5HXMA 1Z7UA 3HAGA 4B44A 3H3VK 3C7HA 1AHDP 4CHUA 1QU3A 5FYHA 4AI3A 3I53A 2XG3A 1YHFA 3FE5A 4YW4A 4IEQA 3ZN6A 4XCBA 3I2FA 2PFWA 3CZJA 2HDCA 4UFIA 3VHPA 1Q43A 1PP7U 2C24A 2XPUA 3HKZN 3BN6A 4MGRA 3GYDA 1HW2A 9ANTA 2V4VA 3ZQFA 1FMVA 1IAWA 1QVUA 3WD5A 1CAVA 4BA6A 3H1MA 1ND2A 2E60A 3SFIA 1V5EA 4PJ0C 2F4LA 1LENA 3ITQA 3SZPA 3JRAA 5BXXA 2BVLA 5J3LA 1IN7A 3WX5A 3POWA 2TNFA 1JKOC 5LEKA 2WR9A 2CG4A 2ZSHB 3WU1B 4MHUA 4HK8A 3OOUA 2WNVB 4LHKA 2ELKA 2H8WA 1X9PA 2WLPA 2RJKA 4GMP1 3T08A 2WAFA 2R7ZJ 1OYYA 1BN5A 4DMIA 1PP8F 4RQPA 3OUIA 4ITCA 1RUC2 4DNCA 4COVA 1UWWA 2L3DA 1UX7A 2RS51 4BKXA 3VBSB 2LALA 5DAVA 2ZPXA 2A3WA 1HB4A 5E3OA 3ULQB 4MOAA 2OIIA 5D4SA 5CYYA 3MV11 4NMIA 4BS9A 4D7MA 4QX8A 3ECQA 4EE2A 1Z7S2 2XUBA 3ZP5A 2YDEA 4NIIA 4A12A 4YFZA 2JDKA 4O5VA 4UI9L 2IS6A 2J5OA 1AR63 2XXZA 4U0WA 2Y0OA 3JRCA 5FQ0A 3LEIA 5A6QA 3LSHA 3ILFA 2IXHA 2PHWA 2JICA 2FDGA 4NUBA 2VASA 1NG7A 2X9DA 2CV2A 4LO5B 4D6SA 4XUNA 1QQP1 3WV6A 4JC1A 4LO8A 3GHNA 4AEKA 5JIUA 3K75B 1DQ2A 3JQXA 1W5CC 1RC9A 3HPHA 3KLNA 4M0NA 1QIQA 2VBPA 4C3HJ 5LA9A 2OC6A 1UKRA 2PQSA 3S15J 3AVSA 5L3CA 3TB0A 2CMPA 2PJRB 3WW1A 3N9LA 2CUJA 1XCVA 1FOWA 1AX2A 1VZ0A 3WTSC 1RKWA 1UD1A 1MBEA 1HLCA 2VU9A 4S05A 4R52A 3TNPB 1DGWA 2AEYA 4NQWA 1HB3A 2J1VA 4CO8A 4Y1ZA 3LNQA 2XRNA 4Y24A 2FMDA 4N43C 4QB1A 1U5ZA 2OT7A 1VR3A 3OYKA 1LU2A 5SV5A 2M0MA 1LOEA 3V0BA 4AHWA 1I5PA 1JOPA 3JD72 2O0OA 2RS11 3DCFA 3HNBM 3JRIA 2CQXA 2RVAA 3KHCA 4I3PA 2W00A 4UY8I 2XMLA 3JTHA 4UF0A 3RKXA 1T0FA 2RV8A 3M3CA 2GOMA 3WE3A 3OSFA 3FXOA 4XJ9A 3ZIXA 2A70A 2YGLA 4ORFA 4IGQA 4ASMB 1OFNA 3TEXA 3AJZA 1HB1A 2E32A 2HYKA 5FY7A 4UFHA 2RDSA 4Y5SA 1TMF3 3HUGA 2FOKA 2B46X 5LHIA 1X36A 1ZA4A 3G1MA 1AR73 3OGRA 2DCYA 5DS9A 2B39A 3V42A 1V54H 3V8LA 3LSEA 1DUXC 3F9KA 1MJBA 3ELNA 2NN8A 2CU5A 2V4AA 2P5LC 2ZMKA 3AXDA 1P4WA 5BNQA 4MGKE 4DYRA 3M8FA 2JTVA 2G7UA 4EWEA 2ZX0A 2LLKA 2W92A 2WNEA 2ISYA 4XRSA 4CGZA 1T2KA 4CDXB 4LNVA 5FMBA 5F6KA 3WG1A 4XKBA 4LE3A 4Q47A 1A04A 1W6MB 5C4JJ 4W65A 4AQSA 2X29A 1U5TB 4RGXA 4Q5OA 3U1KA 2DPDA 1FLIA 1W04A 4Z92B 1E0EA 1QPIA 1K4SA 4LUKA 3PL8A 1LB2A 2A3SA 5HLTA 4A3IJ 3GNEA 5ANNA 3VZKA 3GALA 1YO5C 4HN0A 3TEYA 1X4PA 2QKLB 1XYPA 1OR7A 3JRFA 4CH7A 5D6EA 1LR5A 2VBDA 2C1FA 5EJ1B 5CJ9A 1J0RA 2DVDA 1Y43B 1GT0C 1XNBA 1WSUA 4GH4C 3GTMJ 3E5QA 4D69A 3ZN0A 3ZFGC 1S6LA 1PUFA 5JPNB 2ID4A 2OVUA 2DYSH 4FO9A 2L7KA 4NDLA 2GNDA 3N7KA 1NCQB 3GZAA 4AFAA 2YC2A 4B7KA 3WG3A 3OIPA 3E1SA 5EZHA 3LSRA 1RETA 4P9JA 4XF3A 3VZNA 4EN0A 2E7TA 5L3EA 2DURA 5FKLA 1N47A 3CKHA 1H1AA 2HWC2 5BNOC 2JA7J 3VBUB 2H8RA 2JDHA 3CDIA 1TMF1 2IW5A 3WGHA 4C9YA 3RI4A 3SXYA 2ZEZA 1XSVA 3VD7A 2HWB2 3AMQA 1GVDA 4PK4A 2X8KA 4LITA 3KYLA 2HOSA 3OGGA 2I07B 3V0AA 1LE8B 4CU7A 1X33A 1IQDC 1UB9A 2WAEA 2A6YA 1EP0A 4JGYC 4I01A 3S5AA 3QU6A 2W52A 2UYAA 2YV8A 1WD3A 3VHOA 4OI4A 2EIJH 2BGOA 4NBQA 2IFWA 4AD9A 1IS6A 5FYZA 4AI0A 3M8JA 1N78A 3W3CA 4M00A 3O1PA 1IN6A 4XPVA 1T39A 2ZJCA 2MFZA 3NKTA 1WPKA 2R5YB 3WTWC 5J98B 1C28A 4JVAA 1R58A 2WUHA 1MH3A 2Z99A 2GC0A 4FASD 2ZMNA 4CCNA 4ESFA 4A3CJ 5C4XJ 4HKWA 4HL0A 4NPLA 4WVZA 1W4MA 4Q4W3 3VWBA 3KCXA 2Y6LA 2F4IA 3FFQA 4U87A 4CXFA 3USUA 2YBPA 4QQOA 1O4TA 1IS4A 4Y13A 3V64A 2ZMEC 2QQNA 1JZ5A 1IV8A 5C8CC 4URTA 4WM7A 1T98A 1BXHA 3H3ZA 4LBLA 2VNOA 2ZEYA 2OQRA 3HSEA 1JJ6C 3DEUA 4YG0A 1NT0A 1OQEA 1VAVA 3E0JB 1V3FA 2Z16A 5KXDA 3D3AA 2Q8OA 1HRV3 1LODA 3MICA 2QQUA 1Y1WJ 1G9DA 2ZGQA 5JXIA 2JPCA 4E6KG 1DGWX 1WJCA 2NMNA 4Q1RA 2HTJA 2E1OA 1GBGA 1GVJA 2J7MA 5BNNA 2VUJA 1XMAA 3URFA 2VM9A 4N7UA 4AXOA 3WTTC 1MBKA 2CJJA 2MHFA 2DUQA 1UHSA 4JDOA 1GP4A 1KFUL 4CVUA 3PUHA 2XRLA 1VBE3 4XJWA 3MIDA 5J6XA 3BJ6A 3VUOA 5C4WB 2WWUA 3MIGA 1IXCA 5DM6F 1GDTA 2TRTA 2MEV3 1MZFA 1HDDC 2BU9A 3DN7A 4DYQA 3PNVA 1RUF3 3U11A 1CONA 3MKWB 1TT5B 2OXBA 3I4NJ 4W6YA 1MD0A 5D21A 4DFSA 3BR3A 4Q4Y1 4JQTA 1SG3A 1TZLA 1C8M3 5JMCA 4BQAA 4D0QA 3CLQA 4A7YA 4PDWA 2AZ5A 2O3FA 2YR2A 3QOEA 4R79A 4BIOA 1QRYA 3C2BA 2WS93 1AKHA 4BHPA 2H1LA 1OQ1A 1KGYA 2EA4A 1H2MA 2JE9A 3OGJA 4FPKA 1LDJA 3UKTA 2H0BA 5F37A 2CTVA 1GSLA 5FZ8A 4MZUA 3SZTA 2GH2A 2OAZA 2EJRA 4Q4W1 3TNQA 5FZ4A 1N3PA 2VIXA 1A31A 4BYYA 1UJ8A 4AG4A 1W7PB 5FAXA 1C1LA 2DBBA 2RS52 2WN2A 5EEAA 2LRPA 3VBOB 2V1DA 4N9IA 4OCTA 1WJBA 4U0VA 3LCPA 3FXJA 3HN3A 1Z67A 4INDA 5LCWL 2DQRA 2DA2A 4LBKA 1BA5A 4NIGA 2QQWA 1UU6A 2W39A 2W1WA 2QQIA 3CMMA 1R9TJ 1HRV1 1T08B 1XQNA 1FAYA 1W03A 3EYPA 5IT9Z 5DPNA 2Y2ZA 3T4HB 2D5FA 1D1BA 1QY4A 1RUE3 3MCZA 3LDKA 4RS5B 3MF9A 1W0TA 5IJRA 5HPOA 2FQ3A 5BNGA 2CSOA 5F1JA 2PX9A 3GW2A 3NNJA 1GNZA 1W6OB 2Y6HA 4L2NA 1W36C 4EM2A 1VBE1 2HLEA 3LAPA 2VQ0A 2HDWA 5C9AB 2A07F 4LORA 4UVBA 4QPQA 1DBNA 2MEV1 3M3OA 3KGLA 1MS0A 1RUF1 4DEVA 3RVHA 1XXNA 4E70A 2RQPA 1IG3A 2F5FA 4Y22B 2BUKA 1C8M1 4QKBA 4A93J 3T1MA 3R0RA 2H6CA 4NHMA 3UYJA 5A70A 5D4RA 2XLFA 1MBJA 3DGTA 2A75A 1QO0D 2JVGA 5JR3A 1YJNI 1RUI3 2WQ8A 1KDKA 1PZ8A 3KE2A 2NOGA 3S2WA 4JKMA 3FXQA 1A8MA 3VBSA 2RKHA 3J7AO 2X10A 3LAJA 2WWYA 5DYMA 2NZ9A 4B09A 2FF4A 1GANA 1RVF3 1H2NA 2DT7B 1HQWA 4BMBA 4IEJA 1HSTA 2JG8C 3ROUA 1TWAJ 5HDNA 1VB4A 4RR3B 4IGOA 1JU4A 2D6OX 5JUVA 2M3AA 3QBQA 1NX9A 4DB5A 1VE0A 4LIVA 4CA9A 2Q1ZB 3ZR5A 1D8JA 4ZTFA 4GA9A 1MGTA 1JXSA 4C90A 5F5QA 3WDYA 1ULCA 3K1NA 2L4MA 5GAHJ 2KA3A 4J1XA 3ZXFA 4BJ6C 2GU9A 4Z07A 2OA2A 4XCAA 5FZFA 2CY6A 2DVFA 3HBZA 1K42A 3ZMZA 1ZNPA 1CZSA 1MZ5A 1AR62 3K1MA 1RUE1 1PGL1 1SFKA 1ON2A 2UUZA 5CKMA 1S0BA 5E3NA 2R6QA 3ETQA 2XH6A 4IF4A 2BFUS 1AX0A 2PJRA 5IK8A 2BNOA 4KUMA 1OA3A 3K3NA 4L92A 2P4EA 2W25A 2VUMJ 4RGRA 3GXUA 2K40A 2YBKA 1Q1VA 3ACLA 3MV01 1ZGAA 2TCTA 4PGGA 2D1VA 3I59B 5T5LA 3CLPA 3K6GA 3GBWA 5IAVA 1ZGWA 2BERA 4OVEA 4E7ZA 3HT2A 2L0KA 3ASNH 5FXXA 1TP4A 2W4SA 5JOXA 1TVGA 2PHFA 2RREA 4QPGB 1JYIA 3ZYRA 3LB9A 3T1LA 1GOHA 3BDDA 2R7WA 3I3LA 4XKWA 2G9GA 4AVAA 1RUI1 3LFUA 5E89A 1OKRA 3N4MA 3RKQA 2A6WA 1NOVA 3ZLIA 3VKMA 3WNXA 1WH7A 4L99A 5FJHA 4OOIA 3KEOA 4P9XA 1RVF1 3HQRA 2HS5A 4F92B 5D8LB 3SKJE 5J3UA 4QX1A 1BL0A 4X6QB 4KJZA 1J09A 4RL7A 4CUBA 1HBXG 4OAYA 1JS9A 2K46A 2R042 1GKBA 2LTNA 1O8SA 4XACA 2VCAA 1HDKA 3THPA 2QBXA 3VD4A 1FNNA 1CX1A 1VQNI 3AL6A 2MPFA 5HV4A 3F6OA 4Y20B 5HLIA 4YLZA 1POGA 1UF2C 1W39A 2Y0SN 4LBOA 3CJIB 2WO7A 4P9FA 1K78B 1MS8A 4Q48A 1W8ZA 4MGYE 1CAWA 2B0LA 1TMF2 1P9QC 4XABA 3J8F3 3TOAA 3ZXSA 1AR72 3SEQA 5EDNA 4G9SB 5EV7A 3MW2A 4LKSA 3S1RJ 1Z3XA 3AZVA 3LIHA 2E36A 1YQ5A 1XNTA 1G4DA 2V1XA 2KFDA 1U5TA 2COBA 3ACIA 4JTNA 4LUMA 2JB4A 2WO3A 2HBUA 2FRHA 2ZX1A 4QX0A 4E2GA 1RXFA 3AB0A 3N05A 1SBDA 4AI2A 1GICA 1A78A 5D1IA 4FXGB 3G71I 1AJKA 2VBYA 4ARYA 1UOFA 1JKRC 4NB5A 4L9BA 2FBEA 3PQJA 5ILSA 3VOEA 1YFHA 1FYLA 1YQ8A 5ERIA 2PA7A 3N9QA 3DKQA 3PJRA 4OULA 2Z3YA 4R4XA 3EETA 3IBMA 5H9QA 3TDUC 1MQTB 2XKPA 3I5UA 1UZZA 2V73A 5FZLA 5A7QA 2QQVA 4UVAA 4K6BA 3FMGA 2FNPA 1ZGJA 3S1MJ 4F93B 5ERLA 2GALA 2V9PA 3M1CA 3ZVXA 5A33B 3WF4A 4KQ7A 2EZKA 3PFIA 4NIAA 3ZMTA 1VQMI 1NA1C 2J1AA 3BOQA 1LHVA 3VBUA 3BODA 3H3UA 1UL9A 2L4AA 3KV4A 1UIJA 2HQRA 5FFZA 1XD7A 5DAXA 4KT5C 1ZKGA 5HLGA 1CD3G 2AR6A 1K6YA 2VVFA 3T0DA 2E7QA 1GWMA 1ULOA 4C2TA 2V1NA 2VQHA 3RZLA 4YFXF 1LE8A 1S55A 2Y0SA 4XLEA 3N97A 2ZGNA 3J8F1 5DAWA 4XICA 5IAXA 4AHYA 4N90A 4DUXA 4P5OA 1LVAA 3KMHA 4BE3A 1QWRA 4QM8A 4CA0A 4RQPC 1QNYA 3H8OA 3PNYA 1FP1D 4YVSB 3EDPA 5EWSA 3FWEA 4CTEA 5D5UB 5GLTA 4KMQA 3X29B 1VQ7I 4JYKA 4M01A 4ZONA 1NAEA 3BTAA 1OFSA 4FPCA 2R5YA 1BI2A 3WE2A 2QTWB 2H0VA 1HJGA 4AYUA 1WLDA 1IGOA 4MV2A 3FMRA 5EQUA 3EQLF 3PMSA 3WCRA 2CGOA 1GOGA 1JODA 1ZZBA 4J00A 1ZBA3 5GP9A 2LBFB 2ZGOA 2ZGTA 4FPHA 4NO4A 4XFGA 4XJUA 1Z6TA 2YU1A 4J6GA 4WM8A 1H9GA 4QPOA 1LCLA 2QDRA 3TBIA 1MEC3 5E16A 3THCA 4MGSA 3LWCA 5T50A 2FXAA 1G9CA 1W0PA 2YFZA 1UOGA 4LLOA 2Y33A 3SKVA 1VBB3 1X1CA 3RTRA 5FUIA 4WXCA 4P5HA 2ZC2A 2OZUA 1JYCA 4KN4X 1UMHA 2Y31A 2CUFA 2W94A 2VNGA 3A02A 3I2OA 3VL9A 2WA0A 4BQWA 5J1YA 4CEWA 4FFIA 3K0LA 1G7YA 1H30A 1U8BA 2DQLA 3FXLA 1C3HA 4AGRA 5K8SA 2F4PA 3FUQA 1WBFA 1V9U3 1RMU1 2D6NA 3LWFA 3NAPB 3HVDA 2EZHA 4LHLA 1VQ9I 4M4RA 4Q4V3 1HRV2 4NHYA 3P7NA 4XW3A 2WZR3 2ID6A 4QB2A 5C4WA 3GCMA 4MIMA 3VZJA 5B1BH 3GTJJ 1D0HA 2C26A 2K3PA 3ZFEB 1OKQA 2WYFA 5DZFA 3OYHA 1VBD3 5K7HA 2X6XA 4G4FA 4HBNA 4A45A 1YIOA 1Y4WA 1WBLA 4IO9F 3K4DA 3JRDA 4Y1UA 5FY8A 4ANJA 3BZKA 1LOCA 3BQZA 2M9HA 1VBE2 2WRAA 2FDHA 2CUZA 2QQAA 4FX0A 3P9IA 5GZDA 1IG0A 1CAXB 2MEV2 2X53S 5K5OA 5CFDB 3HOWJ 4MHGA 2BY3A 1EPWA 3M8EA 4G6QA 5LK5A 3VDCA 2BTVC 3SH4A 4AK3A 2O0YA 3Q0WA 1OH3A 3MIEA 3CJTB 1J2XA 2B63J 2V1UA 1ZBA1 3GM8A 2K4BA 3IWFA 1D0GA 2BPA2 4DS0A 3VFZA 2RGVA 4YZ5A 5J1RA 3HT1A 1COV3 1I5ZA 3H7JA 1UYYA 4PCQA 1W7PA 4U0YA 1V00A 1IN8A 3SC7X 1KS5A 4MO7A 2NVUB 2WS92 5A1FA 1MEC1 3J80K 1WMDA 3VBOA 5LWBA 4HT1T 3WU0A 1Z78A 5CVJA 2OPTA 3DTKA 2WNUA 2R7UA 3CDHA 3RQIA 3HR9A 4HLTA 1R1TA 5IP7J 1VBB1 2OTJI 2HVQA 4M74A 3CCLI 1XGSA 5A3UA 1LPQA 2EFOA 2BY1A 1OHFA 1JZ2A 1KD7A 5HVQC 3MIFA 1ODDA 4XBQA 1Q8VA 5L7OB 4IGPA 4RS5A 1ETXA 4ZYAA 4IV1B 3BB6A 4V2VA 2I8DA 3ONQA 3AP7A 2UYBA 2L7ZA 1UMZA 3PJYA 4UHTA 1QJU1 1H1IA 1V9U1 3VBFC 4CSWA 3W6VA 1UAAA 1LHNA 1CGPA 4RA0A 4B29A 2V4JC 1OR7C 3HRMA 3ZFFA 5A7WB 4Q4V1 5CA6A 4MQ9F 2Y6GA 3DYMA 5HBAA 4WXDA 2EIEA 4YFWA 5C9AA 4L0YB 2WZR1 3BGAA 4O6JA 2LD5A 1Y0UA 4YZ3A 5FP7A 1RUE2 4CXXA 4LG0B 2IGMA 4TLFA 3AXEA 3J81Z 2WFPA 3S7IA 4GYIA 4XF0A 2RNGA 2P1BA 5JVTA 3TEZA 1CJDA 3SQNA 2EF6A 4Y22A 3C2GA 4LKDA 1NE6A 3OYIA 2XR4A 3RFRA 4M9SA 4UFJA 4A3KJ 4XQ4A 5BMZA 3T2TA 2GC3A 2R1DA 2CV6A 1U5IA 1S7EA 2CDPA 5FPAA 3H0DA 1NQJA 4HMZA 3EYIA 1HW5A 2OF7A 3PTYA 4DO0A 3WSOA 4II3A 3WHBA 2M87A 3G3ZA 3OYBA 3AG1H 2OQ6A 4IV3B 4BGDA 4B4RA 3H3LA 4QQHA 4K1YA 3OD0A 4ISQA 1OUSA 1A6CA 2DTRA 1CIYA 2QUOA 1USSA 4BE2A 1GNHA 1QH6A 1BK1A 4RGUA 1DDLA 5H9SA 4IOCF 3PURA 3A21A 2WQ4A 4CP1A 1RVF2 1ZYRF 2AH2A 4DXTA 4DUVA 2GXGA 3KWVA 2VVDA 2DK5A 1JYNA 1JYVA 1XC6A 1UU5A 2DMNA 1SQ4A 3ZSEA 5GTIC 2PHLA 1S0FA 1DU3D 4GDFA 3MZYA 2A3XA 1O91A 3NARA 3J7MA 4B1MA 3U78A 4UXAA 3KF5A 3T2QA 3CO7C 1HQNA 2IVMA 4O7XA 2VECA 4K2EA 4HLXA 3CC4I 2OX0A 3SJMA 4B1LA 1MVEA 2EFNA 5FY0A 3D5RC 2P7CB 4XJZA 3O1UA 4CUCA 3T2PA 4YGCA 4A42A 3ES4A 2FHRA 3I59A 4KU8A 4PJLA 4JTOA 2JDMA 1SZBA 1OPMA 5KAFC 1ZN2A 1S9HA 2GSYA 1ZHFA 5L3BA 5A7NA 1SD4A 2E35A 2VW1A 3TL4X 4BQOA 4XHBA 1XCBA 1B6AA 5CG9A 3OY8B 4O61A 3WY6A 5EHDA 3ABUA 5M3MJ 4QPGA 2FMYA 1R22A 1E3HA 4WM7C 5J8CA 3GXOA 2VTXJ 3PVNA 1AR93 5KHDA 1OH4A 3C1DA 2EIDA 1S0IA 5TRDA 4XMAA 2Y6FA 4P08A 1REPC 2RV9A 1AWCA 2QQ9A 2QYOA 3AK0A 5TSWA 2EINH 2JA5J 1T8IA 2VBXA 1HKTA 1RIOH 4LLLA 3TP3A 2P6SA 4XR6A 1TZOA 2WV1A 3H7YA 4DINB 1WGPA 5DUKA 1XGOA 3OGSA 2R0FA 5DAPA 1RUJ3 5T54A 3GFIA 3KZYA 1QJX3 3RSNA 2RS33 5ILVA 4FP2A 4AW7A 1PMIA 3BI3A 3OYDA 2E2HJ 3VBHB 4LT5A 1KQ0A 5DD4A 2M4GA 4J19A 2NXNB 3U21A 5TJJA 3ZCOA 3CJIA 1STZA 3OR2C 2HTSA 1JUIA 1U12A 4P00B 1K78A 1IRZA 3WW3A 4LGWA 4Q0UA 2IAIA 3RWNA 3BG9A 5AFBA 5CFCA 1Y8QB 1H89C 3GEZA 3V7CA 4XLFA 2IXJA 4O65A 1RJ7A 3PUFA 2KXLA 1PVEA 2WZ8A 4BPZA 4PDWC 2DMTA 2F6CA 3BR1A 2LREA 5FD6A 3MUZ1 2IXCA 3SHRA 5C8WA 4RGAA 3KP2A 5KC5A 2ZJPF 5EPAA 1GQHA 5LA2A 2O1QA 2IVJA 2DMPA 4EJWA 1ND3B 2YUSA 3J8F2 4HVOA 5IVFA 3I55I 1JGGA 5K0UB 3MPPG 4BQ2A 1D4VB 4N9HA 3O2PE 2NOJB 1SVOA 4ZHNA 3C3WA 2LF7A 5I0DA 4ZKTB 4LEJA 2KZVA 2D6PA 3FHAA 2YPDA 5AC93 2AGSA 2R7EB 4PBPA 1VFCA 4KI5M 4UBHA 5FOJB 1OJLA 2MA3A 1Z9CA 2EXKA 3D82A 5EF6A 1AR91 1DDNA 1XC5A 1YJLA 4YGDA 3WNPA 4ZZLA 2CYYA 4N4OB 3O1VA 4NIHA 5JSRA 1VRBA 1X4OA 1VQ6I 2E1NA 2BDRA 5A33A 5ICGA 1RUOA 3AKTA 3CCQI 3M07A 4IE6A 3WG2A 2Y26A 1SLAA 2EAAA 2IXIA 2CAUA 4XM3A 1PVC3 4AFBA 2ZSIB 3O14A 4ZDLA 5GKAC 5DDJ3 1RUJ1 4UFLA 1ZTRA 2XLGA 5D8AC 3BIEA 2RS31 2OTLI 4AVBA 5T55A 2FBIA 2JSPA 4CCLA 2H6BA 1ERDA 1FP2A 4LHNA 3POSA 3L1PA 1WMEA 5KCMA 5IYBJ 4QX3A 5K5RA 3MKZA 4F3JA 4HZFA 3T5XA 5APAA 5FKMA 4IZZA 1SMYF 3AG3H 2JDAA 1BVP1 2Y69H 2IRFG 3IDCB 5L3DA 4NE9A 4HQMA 4XDOA 3DBLB 4M72A 1MVQA 5LBCA 5FPLA 4QGMA 5FO9B 4YVSA 4FTHA 2DXIA 3LIGA 2WADA 2K3FA 3FK6A 1OCOH 1Q8SA 2Q8KA 2VUDA 4RAZA 2XJSA 1FYKA 3I56I 1FBSA 2VCMA 4EJUA 2W1SA 2KISA 4WK8F 4CCCA 2EA2A 2GDFA 5FYSA 3KV6A 5KAIC 3OYGA 4GWJA 3UV9A 3MPBA 5ICCA 1VBC3 1QOOA 3WTYC 3TMOA 5FFOC 4YW2A 4MG2A 1JUSA 4AM3A 4JBAA 4HX4A 1FWZA 2Y48A 1WCSA 4FE4A 5ABJC 5FLXK 2P2KA 3IZOA 4I7HA 4ZU5A 2LBFA 4D6RA 4Y3OA 2XL7A 3HN1A 4BY1J 2R5ZB 2FUG2 2UWBA 2R16A 1KGSA 3LEGA 5DUWA 3NEUA 1PK6B 3N36A 3KIOA 5A3TA 4AHXA 1WHUA 1IRXA 1JI6A 2CW0F 1Q8QA 1Z91A 5FZOB 4MGQA 3MFKA 3IKWA 4RGSA 4MH0E 4FXKB 5M3FJ 3CCVI 1SLBA 3FK7A 3AYEA 5T3NA 5LHHA 1PVC1 2HWD3 1C4RA 2VMHA 3TRSB 4I09A 1AYM1 1QBJA 2P34A 4HBLA 4NAMA 3O0XA 5LRSA 2D1HA 4CDWB 1OFCX 3AG2H 2DBIA 5A3LA 2JN6A 4CP0A 2BY0A 2UV1A 2UXXA 4YW7A 1UPIA 2KQRA 1VBB2 2P6TA 3SDGA 2CWSA 3A0BC 4PLMA 3NAPA 4Z6YA 1K5MC 2PMHA 2DT5A 1YQ2A 3CQZJ 3HRUA 3EQEA 4WVVA 3DECA 3CCEI 1W6PB 3N7LA 5GZEA 1C57A 1APNA 2B8MA 2VOWA 1W9SA 4MXWA 3K4JA 1UNBA 3H8UA 5FPZA 3ZFEA 5IFPA 1KU7A 1I3AA 2R7DA 3VKLA 1X8EA 5CBLA 1WLTA 3S8PA 3KF3A 2GMMA 5BUVA 2KDZA 2ZGPA 5IOYA 3OBTA 1ULEA 1T33A 2X1DA 1R083 3K1PA 2ARBA 1MMSA 5LRRA 1NY71 2WC2A 2WZR2 3VZMA 1DGRM 4IX7A 3JTGA 1U5XA 1R64A 4B4CA 3MBWA 5FBZA 1CAXA 4UFMA 1QXJA 4IJAA 1K5JA 3EXUA 3WQ1A 3E3VA 3H0GJ 1S0CA 5CFDA 4ONUA 2KHMA 3ASOH 2R30A 3BLYA 2GBYA 1VBD2 1F31A 1VBC1 4XDQA 4BXUA 1CPNA 3ATGA 1AXYA 2LRDA 2RAEA 2VC1A 1ULDA 1FMD2 4Y5Z0 1DFQA 1TME3 2A6ZA 2WFF2 2HOEA 1ORKA 1PX3A 1JYWA 4CCEA 4XUQA 1I6XA 4E7JA 2AENA 2QKMB 3WP4A 1G6NA 3K4AA 3VYSB 1U2WA 3LFIA 4IOAF 2RR13 5H20A 4G12A 5GJ6A 2YC0A 1KU3A 3CUQB 4E7SA 4GQ7A 4P9YA 1AXZA 1CIWA 2G9ZA 4FVVA 2L54A 2BOJA 3T0YA 1C5IA 2WDBA 5FZGA 5JIAA 3GGLA 2M34A 4KWJA 5GZGA 2COMA 1PJRA 3MKYB 1WMFA 4QGNA 3KD4A 1COV2 5JSOA 2HWD1 2P3KA 1SC7A 5LATA 2CW7A 1O3SA 3SH3A 4CDUB 1WZXA 5E8IA 2QCSB 4HV6A 5L7OA 2DTZA 4IV1A 2BW3B 1UCXA 4XJAA 3T8TA 2ME0A 2JMWA 4DJAA 1RPWA 1QVTA 1FZPB 4N53B 3IPVB 3HHHA 4UBGA 5EXOA 4UB8C 1WMXA 4XLCA 4ATEA 2W68A 1FX7A 2EFQA 5A7WA 1ALYA 5FPXA 3GZNB 4HF0A 3UKNA 3BTYA 1EV7A 4MFDA 2ICWG 3OCPA 4FHTA 5FYVA 4HKLA 1BIBA 4PSXA 3BUCA 4XURA 3OL4A 4LG0A 1LJ7A 1CR7A 3HOSA 1XG1A 2MLKA 2A6TA 5SV8A 5FZKA 4XK4A 2ACJA 1OPOA 3DPRC 2YGMA 4M6VA 1U0JA 2XONA 3T30A 4R9CA 3HOUJ 3A0KA 2F4MB 2QCOA 1R081 2PHXA 4XLAA 1K3IA 3ZM8A 1LGCA 3FHZA 2ILMA 2E19A 4C3IJ 4CCJA 4ZY9A 4YM2A 4BWOA 1LHOA 4L9JA 4IE4A 5F6LB 4LK0F 3KGZA 2M8EA 3CHXA 5F0HA 3A0HC 1TME1 1JZ7A 4OHWA 4YM0A 1FPQA 3FUOA 5FO7B 1XDUA 5GLZA 1N1VA 5BPDA 5FY4A 3SEEA 1RB8G 3WDUA 1UAIA 1BQPA 2P3JA 1BW6A 4GWIA 1BLZA 1VP6A 4M6YA 2DO7A 2JDUA 4UVCA 3P6BA 5L9BA 5M5YJ 3UKGA 1JHNA 3GTOJ 1JZ4A 1VQ5I 4FX4A 3B9CA 1FOYA 1MNEA 4ZXKA 5JZGB 3D8CA 1F43A 3IIIA 4AEDB 1XNAA 4BM8A 4YFNF 1HN1A 1RXGA 2LP0A 1K61A 2NLRA 3CC2I 4EN9B 1NCRB 1IQAA 3K4LA 3PUAA 2ZGRA 1ZZCA 4Q0VA 2X0LA 4AVVA 1ZBE2 5CPRB 3VYRB 4E2SA 4OHXA 1TQIA 2RC4A 2NYXA 1H4GA 3L2UA 5L3GA 2PN5A 2CV1A 5BOXA 2FDFA 3ZMUA 5D8KB 5LGUA 5CISA 4Q4X2 3WDTA 4DGWB 1NLQA 1YCIA 4AI8A 1DQ4A 2Q1FA 1POV0 2VQCA 3F8BA 5J96B 3H8XA 1BI0A 2A1XA 3NRUA 4YVWB 5FPBA 4RFT0 4F55A 2FQPA 3UGHA 1FV3A 2EFWA 1WJFA 2W5FA 4WM8C 2ZHLA 2CUEA 3OY8A 2P5KA 2LTPA 4M73A 3H42B 1OYWA 2XAQA 2QUFA 1UZWA 4M3EA 5L73A 4OAZA 2DPUA 3CF5F 2FOWA 1OQDA 2YSRA 5G04L 4KBBA 5LA1A 3TEWA 3CCSI 2DYRH 1LNWA 3FM5A 5AVPA 4AIHA 2ZX4A 3PQKA 1HA8A 5FKOA 1B59A 1LOFA 2FU4A 4CZSA 1HLVA 4LMFA 1UFMA 3ECOA 3K4NA 4CEWC 2PHUA 3C7JA 3I3DA 1DLCA 3WP5A 1ULGA 3ZGKA 1IOAA 1Y7BA 4E8DA 3PDQA 1H8AC 2R7TA 3EUHA 1F9NA 3H1WA 2GP3A 2DLLA 4XQWA 4XIKA 5FZMA 5FCCA 2VOVA 1FC3A 4AZZA 3VBHA 3GFMA 2DA4A 2W91A 3ZPOA 4OUMA 3W58A 4JGZB 3NJZA 2XSDC 4OUSA 1KQ8A 3F8MA 2X05A 5CQEA 4Z82A 2FBKA 2LNBA 4LK1F 2IPQX 3S2DJ 3AMPA 1OURA 2ZOEB 4FAGA 3LEMA 3E5XA 1FSEA 4IERA 1W9FA 4U36A 3IMMA 4A3MJ 2QZ3A 5FR3A 4A0YA 4LB6B 1LTEA 5IVJA 1QJX2 2AREA 4LFUA 3WXPA 1PZ9A 2HVSA 2RS32 1LESA 1UPSA 1GNYA 1Z7S3 5EJCA 1W8OA 4PQQA 4QPIB 2UY9A 4PLOA 2JDNA 3HQXA 4MLOA 4CCDA 3OYLA 1BK0A 1LDKB 2GLOA 1UW8A 1XB9A 4IEZA 3JCUC 3LDBA 1ND3A 3PUQA 2XVGA 4CDQB 3WNMA 2R7VA 3DV8A 2V26A 2VBWA 2L02A 1T6SA 1MS4A 2MNGA 2R32A 3F8CA 4RSUA 5LY1A 1YJ9I 3FBYA 3RCOA 4YG3A 1CWPA 3TDZC 2WNUC 4EQVA 5IVYA 1T38A 1CAUA 4XNFA 2V9VA 1R1VA 4LK7A 3GZ6A 5FYBA 4UNOA 2SLIA 4Y1XA 2VZPA 5D5VB 5GAGJ 2CFOA 1W8WA 2VZVA 2VKHA 3FJSA 3VL8A 2QGUA 5AC92 1E5RA 3CMYA 2EV6A 4BZ4A 1ZA7A 5FP3A 1NTCA 2XJUA 2BV6A 2VPLA 5LW9A 4MVTA 2FZ1A 1UX6A 1J9IA 4DPNA 2ESNA 5L9RA 1EY2A 3BOPA 5GZFA 2BGCA 5DUUA 3ZFFC 1R23A 3VLBB 3G73A 3Q9VA 1YITI 4Q0QA 4LBQB 1X1DA 4A0ZA 2BNMA 1LEDA 4AOCA 4OMDA 1K83J 2UXNA 5IUQA 1VQKI 2OKXA 1OKOA 5BNPA 1PVC2 2H09A 1I1EA 1JUMA 1WJEA 3RRDA 3FKJA 2LF8A 4TV7A 5DDJ2 2D6LX 4RB1A 1G59A 4AEMA 4Q2FA 4WF2A 2I2SA 1R00A 1OA2A 2VGDA 3QYBA 1SFOJ 2F17A 4LO4B 1Z7S1 4LB5A 3O0WA 5E1RA 3Q8EA 3RZJA 2YS9A 3WHTA 1P7IA 2K4JA 3L2RA 2R0HA 2EFPA 3UETA 3ZMOA 3HG9A 1DP7P 2ZACA 4MTDA 2ZGMA 4FTEA 1B4AA 4YGEA 5JR2A 3GFJA 2YY1A 5DCMB 4QHBA 4XKCA 2E31A 3RSJA 2ELJA 2EV5A 5JLXA 2QWWA 3BTZA 2VLAA 1IN4A 2VO5A 3CO6C 4MO3M 1NY72 5F3IA 2Q0AA 4OLLA 3RJPA 1Z0HA 1ON1A 1DP0A 3EUAA 2E6VA 1AL23 1ULYA 1WD4A 3KP5A 1WW7A 4IQ4A 4Y15A 2C5DA 3VGIA 3S6PA 3BG3A 1VBC2 3PUIA 2O61A 1PZ7A 1RNLA 2W1OA 1D2SA 5KBFA 3AZXA 4AGVA 3IN9A 1IDYA 5F0CA 5KHGA 1Z05A 3BALA 2HR3A 1ZZ7A 2WZPP 4N43B 5FB2A 3RZHA 1UMIA 5LY2A 2QEXI 3G1LA 2NVXJ 5F08A 2DCKA 4CDWA 2IZWA 4WZFA 1Y1VJ 3DLLF 1U78A 5H9PA 2PHRA 1MS1A 3JD71 3OYWA 2WLQA 4CZCA 4PBOA 5FPUA 1KQ9A 2P17A 1EUTA 5F64A 1W8NA 3S2HJ 1W6PA 4UUSA 1RUG2 4G3YC 3IL2A 3K2AA 1A36A 3FN9A 4GMP0 1OOPA 3PUBA 3OSGA 2EALA 4PLNA 3HL2A 3ZQQA 3HBKA 3H9GA 2VNRA 3CJNA 2XASA 1FTTA 4DW6A 2EXJA 1MS9A 3LKJA 2XB0X 2C6YA 3I64A 4KIBA 1CVNA 4XYXA 4AAXA 5FXWA 4DUWA 4KIGA 1KZHA 1TWCJ 1BVVA 4QKFA 4FPEA 5E88A 4UFKA 2UZKA 1R082 3ZQCA 4EN6B 4FPYA 2Z1DA 2W1UA 2ARCA 1ENSA 3WDWA 2V7FA 5GM0A 1RUD2 1AL21 2GC2A 5FKBA 2KPMA 2MC3A 3QRFF 2JWPA 1J7KA 3MGUA 1IPJA 3IMNA 5CFCC 1D8KA 3LDRA 1IG7A 2EIMH 4QT6A 3PFYA 4QXKA 5BY5A 3MLLA 4DYCA 4FQZA 4V1PA 1WW5A 2ZBJA 3ZYHA 5IK5A 2RR12 4CDUA 3T2OA 2HXOA 2VI6A 1LECA 4GCVA 3DEEA 1IS5A 4BY7J 4GH4B 1ZZ8A 2BW3A 1W2UA 4XVHA 2Y8KA 3D5SC 3B73A 5IATA 3PVOA 3ZFGB 5A3OA 1B35A 2DV9A 3I3MA 3LE0A 2KRHA 2E1MC 3HSFA 4Q0SA 3U14A 1LEAA 1DCSA 1YFYA 2DFIA 2ATFA 2XHNA 2JRTA 2OPKA 3IKVA 2WT2A 4QXBA 4O9EA 5FPVA 4OHZA 2BZTA 2L9SA 2E26A 2B7EA 5DUIA 3CP8A 3M9AA 4COZA 1WZ2A 2BJSA 3TBDA 5EZGA 4GYGA 2J42A 4V2WA 1SHWB 2P37A 2STWA 2BBYA 3VYUB 1EYBA 3M3IA 2HWC1 5BNOB 5LGNA 5CYVA 1RJ8A 3TO7A 1UHWA 4LPLA 1E5IA 1YIJI 3ZN5A 1PMJX 5F04A 1QJY3 3HIFA 3HXLA 1W1WE 1GOFA 1MNDA 3NV1A 2IT0A 1IUYA 2A6XA 3ZMSA 2CSGA 4D0PA 2Y60A 4P9GA 3FXRA 4QWNA 5GALA 2R4GA 2DDUA 1Z7LA 2F5EA 1KRIA 1ZZ6A 2ORZA 5GLWA 1FOKA 2QSFX 4XMYA 4HNVA 2E53A 4JGYB 1VQLI 1QOSA 1SFXA 1TWFJ 1PX4A 3QWLA 1KA8A 1R1UA 2WV0A 1FPN2 1G3TA 2OD5A 4CXYA 5GZCA 2P3IA 3OR1C 3HSRA 1SACA 2EWNA 2VQUA 4BB3A 4PGHA 1QGPA 2E51A 4PUSA 2LMDA 4B7EA 4GFBA 2B9VA 3COAC 4OZOA 4AIDA 1YHQI 4L5EA 2PMUA 3QP6A 1LOGA 4PFOA 2ARXA 1H8TC 2ZA9A 4IESA 1CQTA 1IRFA 4NRPA 5FJKA 4AEDA 4RA2A 2YC4A 4NNJA 4RAFA 3SYTA 2VL4A 1HSJA 1HF0A 1NCRA 4LBJA 1BM9A 2WY7Q 2QQKA 2R1BA 5KHIA 3CL1A 1RI7A 2Y0IA 1K4TA 4S2DA 2DMUA 3U4SA 1WFXA 3H5RA 2Y38A 3IH3A 4I30A 4OI0A 4FQ4A 1R1A2 5FRAA 2VBZA 4R1HA 3HM5A 2RMU2 4AQ2A 4BL0B 5FGMA 2E71A 2ZMEB 5LBFA 4S0HB 3ZDVA 4YZ1A 2VD7A 4O3MA 5C8CB 4D7YA 1SANA 5LGTA 2CGPA 3WT3A 2W3JA 1TQMA 2HJIA 2WBKA 2OZ6A 5ED4A 1F1ZA 1FOD3 3NV4A 1AYN3 4YVWA 1N3QA 4IXAA 4PT6A 3H9QA 3ZN4A 3FMSA 2A6EF 4ES8A 4P1WA 4GKXA 1REEA 4B4PA 4XFCA 5C6CA 2VQTA 3WF3A 2IUWA 4NJ4A 1JN2P 3K4ZA 3MIHA 3MUY1 3I2HA 1BR4A 1PNFA 2MLGA 3K70D 5DXDA 1K79A 2HQAA 2ZFWA