3H8RA

Structure determination of dna methylation lesions n1-mea and n3-mec in duplex dna using a cross-linked host-guest system
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
204
structure length
204
Chain Sequence
HSWRHIRAEGLDSSYTVLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVLINRYKDGSDHIGEHRDDCRELAPGSPIASVSFGASRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/dna
molecule keywords Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2
publication title Structure determination of DNA methylation lesions N1-meA and N3-meC in duplex DNA using a cross-linked protein-DNA system.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 204
sequence length 204
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3h8rA00
3RZGA 4O61A 4IE5A 3BUCA 3RZHA 4QKNA 4NRMA 2FDGA 4CXWA 3O1MA 3H8RA 3I49A 2IUWA 3S5AA 4CXXA 4NIHA 3O1TA 5DABA 3BKZA 4IE6A 3T4VA 4NPMA 3O1SA 3O1VA 3BTZA 4NIDA 4NRPA 3O1PA 3H8XA 4IE7A 4NROA 3BU0A 4OCTA 4IE4A 4IDZA 3KHCA 4JHTA 4NPLA 4QKFA 2FDJA 4ZHNA 4ZS3A 3T4HB 3T3YA 2FDHA 2FDKA 3BTYA 3KHBA 3I3QA 4CXYA 3S57A 4RFRB 3I3MA 3O1RA 3O1UA 2FDIA 3I2OA 3RZLA 4QKDA 3BIEA 5F8PA 3BI3A 4IE0A 4QHOA 4NIGA 4NRQA 4O7XA 3LFMA 3RZMA 4MG2A 4QKBA 2FD8A 4NIIA 4ZS2A 3RZJA 3RZKA 4MGTA 4NJ4A 3O1OA 3H8OA 2FDFA 3BTXA
chains in the Genus database with same CATH superfamily
1RTVA 1HDKA 1OXCA 3VKOA 2ZHMA 5K0UB 4AEDC 5T5OA 3WV6A 4N90A 5FZ6A 1DGLA 4YNIA 4I09A 2NZ9A 5DZEA 4GB31 4JQRA 3LOBA 4Q1PA 1FPN1 5A7SA 1ZBA1 4OMCA 4Q26A 4XZUG 3K51A 4MXVA 1L7QA 4ZXEA 3H8RA 1Y3TA 3JD72 3PJYA 3MUZ1 3POGA 2X09A 3OGSA 4GWIA 1WA4A 3BPSA 3HBKA 1JHNA 1D0HA 4XCAA 1A8DA 4COWA 4CDQB 3WW1A 4ZXKA 5K8SA 4OQ8A 3T4VA 4QX7A 1PIV1 2ZA9A 2QFEA 2Z5WA 3LEKA 3OGGA 1GQPA 3CF6E 1AYN3 4QX5A 3VZKA 4OLLA 3ZR6A 5FYMA 2EXIA 2ES3A 2CU5A 4LKEA 4JGZA 1O4YA 4PIZA 3VKFC 4CCCA 5JSPA 1C57A 1C8M3 1VBD3 4XYXA 2HWC3 3ZN5A 3EMRA 4GALA 1D2QA 4Q4X1 5BUVA 4NWWA 1ZZ9A 2W91A 2HYXA 1LCLA 4Z1VA 1W6MB 3FHAA 3AZVA 3ZDSA 5BNNB 2IXKA 1RUH3 1RUF3 2XWJB 5KC6A 1ZREA 3VBUC 3C3VA 4K7JA 1F5JA 2V09A 3NL1A 1KFXL 1TME3 3MFAA 2VUCA 3RMYA 3WG3A 2VXJA 5ABJA 4KBBA 2HJIA 3TN92 3WDVA 1NA1B 1B35A 2BJSA 2BWAA 3EHKA 1FOD2 3OGJA 4QXBA 1U12A 2WO7A 5IJRA 2XJPA 4GH4C 4GWNA 1VMFA 5HCHA 5IVVA 4TYSA 1RUJ3 2AC1A 2ZTNA 1RUG2 5I8TA 3I3MA 4CDWA 1UMHA 4TZDA 5J1XA 3U4XA 2ARBA 3JZVA 5DPNA 1G9BA 1OT5A 4XUNA 4AHZA 3AMMA 2ERFA 1ULPA 1UIJA 3HVDA 1CESA 3NVCA 4RQPB 1W3VA 4ATEA 4BA6A 4CUCA 4OUMA 1ST8A 2A3WA 5DAQA 4YWAA 4AYUA 3POSA 2FCTA 4P5HA 2BZDA 1R1A2 2RS11 3POFA 2D43A 5F3EA 4FFGA 2R32A 4AHWA 1CQ9A 5CNAA 3NJYA 2DVFA 1OSGA 1YUDA 4BE3A 3HN3A 5A1AA 2R061 1ULGA 2Y6HA 3WQ0A 4WBBA 4N43C 3THCA 2R6QA 5CKMA 3IMNA 4QQHA 5FBJA 3KT4A 1Y9GA 5CEHA 3RNSA 3VD4A 2YU2A 4B3NA 1RUOA 3CDZB 1W8UA 2AH2A 3NRUA 1DZRA 4UFMA 4OI1A 3J4UH 4URAA 4QQ2A 4JAAA 5EP9A 2HWE3 4I02A 1FI2A 1ZZ7A 3MIHA 1SBEA 1DGRN 1CVNA 2HWD2 3LA3A 1H1IA 2Y0OA 1RJ8A 5KHHA 1SG3A 3E6DA 4CDUA 4O61A 4LBJA 1YFXA 2CYFA 2Y0IA 3J8F3 2NMNA 5A7PA 4YVWC 5FY9A 4G9SB 4QKNA 3WCSA 2XBO2 4PBOA 4Y5SA 2XG3A 3TEXA 3UGFA 3UT0A 4XF9A 3WHUA 2PHRA 4E9KA 2J1TA 4G3YC 2WN3A 5IK5A 5FZDA 3PJQA 4LMFA 4XFIA 1QOTA 1J3QA 2MEV1 1CPNA 4LO6B 4GMP0 3S7EA 4Q4Y3 3GF6A 2XXZA 1G9DA 1PZ7A 4Q1RA 5LY1A 4NHMA 4OYUA 3WDTA 3WQBA 4CP1A 2QCSB 1UU6A 3AYEA 2DF7A 4MXWB 4I0BA 4PF5A 3K46A 4AFAA 1OA2A 2F6BA 1QGLA 3ZDVA 1JOBA 3KSCA 4NRPA 1V70A 4AQ2A 3ZFFA 1FPN3 4Q0VA 3TNPB 1HQNA 1ZBA3 4K8RB 3V0AB 4D8MA 3ZFEB 1YEWA 4LLOA 1QJY1 3KV9A 1RJ7A 3MIEA 5JXJA 1UOJA 2BERA 2EF6A 4DS0A 4AEJA 3B94A 3VB9A 4P5YA 5IVYA 1GOFA 3UNPA 4OHWA 4NPLA 4PDWA 2J1RA 2WUHA 3OOXA 1EV11 5IVFA 5FPUA 1PIV3 4ZS3A 1OKQA 5C8CB 3W5MA 4IXLA 5FMDA 2VL4A 1WUVA 2XQRA 3RJ2X 1DQ0A 5ANNA 2KD7A 2AR6A 4JGZC 1GWMA 3ROUA 1IS4A 1T6GC 4ES9A 1SFPA 1UZVA 4FT8A 2ZX1A 1I9RA 1WCQA 2ZCWA 3A4UA 3OPTA 3SH4A 1DYPA 4Q4X3 3K4ZA 4XUPA 1KRIA 2VMDA 1GZ9A 3LWCA 4DMIA 4V2WA 1PMJX 3UETA 5FZIA 5JI7A 4M3CF 4PI0A 4CU7A 5HCFA 3L9JT 3S0MA 1NZCA 5ABJC 3MO4A 3IAQA 1B35C 1ZZBA 3JXSA 2ORXA 4LXLA 2FCUA 1FT9A 3U37A 2X29A 2Y64A 2ZZQA 3DKQA 4QWNA 4EWEA 1IZ3A 2W92A 1YLLA 3GM8A 5F2WA 3VZMA 1HB4A 1VAKA 3JD71 3A22A 3H7JA 2GN3A 4D7SA 2XGXA 1TVGA 3ZYFA 1LKNA 2GU9A 1SHWB 1WD3A 3RZMA 3HNYM 1RL3A 3LFIA 2Y6LA 3MBWA 1FYUA 3ORJA 4EYUA 4BXSV 3LQCA 4XW3A 2SBAA 3HNMA 5ISLA 4OI4A 1Y7BA 1ACCA 1F2NA 1OLMA 2WNVA 1RUI3 1AR63 4QPIA 1IOAA 3RZJA 1W8HA 4XACA 3E5XA 3RG0A 5FMCA 4N9IA 1UKRA 3IDBB 2VZ1A 3AK0A 3SQOA 5KBFA 1QNWA 2Q30A 1RUE2 5HCAA 4L11A 3U14A 1S0DA 4AEDB 4CCDA 4ZY9A 1LRHA 2K0GA 2XWBB 2RG4A 4XZPA 1LAJA 5CFDA 2HEVF 1PNFA 4INDA 3G6JB 3MPBA 2WINB 1CIWA 2WJSA 3HQXA 3U0ZA 1RXFA 1AL22 1R092 1DYKA 1QMJA 4QMAA 3TN91 3ZXKA 2VCBA 4YZ2A 4FFHA 3RWNA 4A6SA 2JXAA 5K0UA 1S0CA 3ZSMA 3GZUC 1GKBA 2PFWA 3VHPA 1RUG1 1GSLA 2DDUA 3ES4A 4UXAA 1N1VA 4NIHA 4DOUA 3WX5A 4QHZA 3DYOA 1WLTA 2R0HA 4CDUC 3CEWA 3EO6A 1JZ7A 2W3JA 3KMHA 2JDYA 2JECA 1O4ZA 2FZ1A 4UBHA 4BXFA 3BN6A 4FO9A 2WO3A 2QJVA 3FL7A 1A78A 3RJRA 2DV9A 4NROA 4GWMA 3OSDA 3B9IA 2ZGQA 4RYDA 2VOKA 3VHNA 1OH4A 2MEV3 2CGOA 1X8MA 3PUSA 1W2UA 2ET1A 4XUTA 4YZ4A 1VLNA 3ZYIB 1GU3A 3QBQA 2D40A 3VDAA 2ILMA 2NN8A 3HR9A 1A3KA 2C5DA 2DVGA 2AEYA 1PGL2 2Q8EA 4K9SA 4M01A 4M00A 1XPWA 2VVEA 3K2OA 1ZRFA 3BTYA 5DN2A 2XJQA 2OZ6A 1W6MA 1QH7A 2WA3A 3ZFFC 2VMHA 4KBZA 5C3RA 2R1DA 4JTOA 2VVDA 2HWD1 4DPNA 1QJY3 1RINA 3N7MA 1AXYA 1U5YA 4DIQA 1BJQA 4JQTA 5FYSA 1ZZ6A 2V4AA 1NA1A 4A45A 1K5JA 4GIQA 2FDIA 1S0IA 1W8NA 2CTVA 2EVXA 3RRDA 2YFZA 4GQ7A 3ZXJA 4YM2A 1ALYA 4I0WB 2EXKA 3WQ7A 4BIOA 4ISQA 1JMUB 1EV13 2VE1A 3AKSA 5LRRA 4QKDA 1SDWA 2LROA 4W65A 5A3LA 1GP4A 1AF9A 2WLQA 3M1HA 1PX4A 1V6LA 1AHSA 1WLCA 2ARAA 2XBO1 3NAPA 1NE6A 3NJXA 4B8EA 1JUHA 3T09A 5A7WB 3AVRA 2UU8A 4V2VA 2WABA 5FYZA 2LS6A 4RQPA 4QHOA 1W3XA 4IEPA 4N43B 3D82A 1CJDA 5L9RA 1E5HA 4WZFA 4XAEA 4LR4A 4DRVA 4EJRA 3JU9A 2AEZA 5FPZA 4A44A 2PHFA 2ZGLA 1HRI2 3HT1A 4XMIA 4I2OA 2Y38A 4KH9A 1ENRA 2I2SA 2D7FA 2OVUA 2YMZA 4YW4A 2ZMKA 3TYJA 3ZYRA 5LCWL 3K77A 2DBIA 3ZSJA 5JVVA 4N7IA 1MEC2 2GMEA 1S55A 4MX3A 3WNLA 4AI2A 4FOYA 2BEOA 3HD8B 2EIEA 2C9KA 5L19A 5F3GA 3ZN4A 3OG2A 3ZMNA 1WMXA 1NLRA 2BVBA 2JE7A 4AF9A 1WW4A 5J37A 1MQTB 1UYPA 3JD73 4LE3A 4NWVA 4XF0A 2VM9A 3WG4A 2F4PA 2QDNA 4P9YA 4YVWB 1GZTA 2LW8A 4YW5A 5G04L 3THDA 4BISA 5JPMB 1NKGA 2O0OA 4HSJA 1ASJ2 4YM1A 5GZDA 5GZFA 4CSWA 2ZBJA 2RM21 3LSEA 4XBQA 4YGEA 2C9AA 5FPAA 2EALA 2ARCA 3ZYJB 3AZXA 1H1AA 3WDXA 2WNVC 4QPIC 1JODA 4KU8A 3N9OA 4AFBA 3AJZA 3SCHA 3TEYA 2A5ZA 5FZAA 3PHMA 1UY0A 5IFTA 2WFF3 1XNKA 5LBFA 2NPIA 4TLGA 1ULCA 4B1LA 2B45X 3R4SA 1NQDA 4L9BA 4MGYE 4E4SA 1UY2A 2CL2A 1DGRA 1MVEA 1IS3A 1LHVA 1URXA 3ZKYA 2JDZA 4EN6B 2EAKA 5K7PA 2E7TA 2JX9A 4XETA 2DUPA 5JIAA 1YFYA 2YC0A 1UPIA 5FBZA 3BYWA 4QU2A 1ODNA 3I7DA 3TN93 4IE7A 4Q4W2 3ZSEA 3R4DB 2QBXA 3SC7X 5IK4A 5FZLA 1NX9A 3WP6A 3FMGA 1FOD3 3PIJA 2WO1A 4XCBA 1LOBA 5K0UC 1KJLA 2C26A 2Y6JA 4MXWA 1ZVFA 3VD9A 1RUG3 3DF0A 1YYNA 3CZUA 3MV11 1Z7S2 4KG8A 2N7GA 3ZFEA 5JR2A 2ZGOA 4H55A 2YYOA 2DFBA 3ACLA 1LHNA 3WP5A 1A8MA 4Y33A 5FXWA 1AX1A 4JGZB 4Z07A 1FV3A 1OUXA 2JENA 1PM4A 2ET7A 5CB7A 2CWMA 1AR92 2VJXA 1R1A3 3AP6A 1JHJA 4PBPA 3I3QA 4QX8A 5ERLA 5FY1A 3BOWA 2W47A 2B7YA 4YW1A 4LLFA 3I2KA 4OFGA 4E4DX 3ZIXA 1C5HA 3RS6A 1RUNA 1SDDB 3WDWA 1CONA 5JXIA 1RUE1 5J48A 1POV1 2BGCA 3LPGA 2B46X 4DFSA 3F95A 5DXDA 4JZRA 5KXDA 4JDNA 1Q5OA 1NG0A 3LDRA 3MF9A 1W03A 2BWCA 1B35B 4FPYA 3VDCA 5FZKA 5T3NA 2Y60A 5M0TA 3K4AA 3KLSA 4RL7A 1AL21 1R091 4K1ZA 2PQSA 2RMU2 3VZNA 2K9ZA 5LA1A 3I2JA 3V56A 4CUBA 2HWD3 4W6WA 1LHUA 1W0OA 1H2MA 1MS8A 4UF0A 1OQEA 4NUBA 1NA1C 4YM3A 4KGGA 4AL9A 4A42A 4BQYA 1H4GA 1KS5A 5DG2A 3LFMA 2IXCA 3UK9A 2RDNA 3N9NA 5JCTA 1GBGA 5CAZA 1W9WA 5C33A 4AVTA 3NAPC 4KQ7A 4ZU7A 2XBO3 1YQCA 5FO9B 4KU7A 4RHV2 4CEYB 4BJ0A 3W59A 3POIA 4RQPC 4I0AA 4CCKA 2GMPA 3ES1A 1VE0A 3AL6A 4YPJA 3O7OA 4M0HA 3ZSLA 2V72A 1FMD2 1LOEA 1DFQA 3GZTB 2AENA 4IE5A 3RYKA 4ARYA 3R0RA 5FYCA 3D0SA 3C7OA 1DLLA 2XUEA 2ZMNA 3GJBA 2VY0A 2R7EB 4J25A 4KL1A 3VBUA 5DAXA 1PZ9A 1W05A 3KF5A 3QH7A 2DU0A 2AZ5A 1CZTA 1WBFA 4JVAA 1BEV2 2QQWA 4WVWA 3VBOA 2VGDA 5CG8A 2CDPA 4CDUB 2O14A 2HWF2 4NVPA 5BNOB 2JIJA 3T1MA 3FX3A 2ZX2A 1CAWA 2Q8DA 4EQVA 1EUUA 3S5QA 4AK3A 1S2BA 5FP4A 4UFHA 3FFZA 2XPJA 3T2PA 5B2GB 5JUVA 3B01A 4QPGA 2ADDA 3WG2A 4A7YA 5I0RA 2EIDA 2XR4A 4LITA 1H1MA 2KR2A 3AP5A 4DB5A 2BPA2 1UF2C 1NY72 1W9FA 1CX1A 4JKLA 5I0SA 3KVBA 4Y5TA 5C5UA 2GC1A 4EN7B 2DCYA 5BNQA 3WHTA 2R062 4AFDA 1IKQA 1HRI1 2W46A 2PLV2 4E2GA 5IAXA 3ZFFB 1PM7A 2FDKA 2WNEA 2A75A 3O0XA 1W6QB 3TOJA 4AGGA 3AP7A 4C91A 4FQZA 4LBMA 1OURA 5FK7A 1MEC1 1SCRA 1LENA 1R082 4LPLA 4NIAA 4Y5Z0 5FRAA 4AQSA 4KWLA 4CPBA 1DG6A 3B7MA 2IVJA 3O1UA 1BBT2 1UY1A 2RS32 2BBAA 1BMV2 1PO12 2Y6KA 4YW7A 4COUA 3UGGA 2PN5A 1ULEA 3D8CA 3OB8A 3ZFEC 3VZLA 3HIFA 1O59A 5HBAA 4QXKA 1QJU3 1ZRIA 2OT7A 1UD1A 1ASJ1 3NKGA 3WD5A 3VHOA 4CUAA 4F83A 1OA3A 3A7QA 1VAVA 3R05A 4KI5M 2GNMA 3POJA 2KA3A 5JSOA 5LWBA 2Q8OA 1HJFA 1DQ4A 4M4RA 4HZFA 1HV1A 2YBSA 1SEFA 4ISRA 4LTAA 1RUE3 2RR12 1POV3 5CIRA 5A7WA 3WXPA 5J7MA 5FMBA 3HOBA 2XB6C 1OF3A 2XVGA 4JX0A 4UW6A 2VOXA 4IEZA 3AKRA 2HLEA 4BQ1A 3PUAA 2JG8B 3SISA 1D4M2 4A6OA 3EB7A 1GNYA 3ILFA 4FI9A 4COZA 5A3UA 3LIGA 1E5RA 4JRLA 1AL23 1R093 3OY8B 1LTEA 3IKWA 4Q4W1 4DY3A 3GNEA 3MZHA 3SCFA 3ST7A 4YGCA 3SNMA 3SXWA 3WF3A 1W8OA 3I3EA 3KS7A 1BHGA 1OA4A 4QX0A 5T50A 4QHBA 4Q2FA 3U11A 2Z69A 4Q27A 1AR62 5I8YA 1Z7S1 4ET7A 4S2FA 5FK8A 5JLVA 3SKVA 5BV6A 3VD5A 1NXMA 1XE0A 2JDHA 2UWAA 1MZFA 2Y26A 1MQTA 4FPLA 4P00B 4R9AA 4XILA 5IW0A 1RB8G 2C0ZA 4QPIB 2IXJA 4NPRA 4HN1A 4YVWA 5LEJA 1VBB2 1XE7A 1AR91 4CRQA 5JOYA 1ZRDA 5FY0A 1DIWA 3WR0A 4GXLA 4MHRA 3I49A 1G6NA 1V6KA 4C0BA 3DL3A 3PUIA 5J3UA 3O5SA 4MVTA 1SLIA 4AQ6A 4UWDA 1YQ5A 4XC9A 2QQVA 2W0XA 4A41A 1AZDA 5FMOS 4FP3A 4A3XA 1DZQA 3OD4A 3I3BA 1CR7A 4MGSA 4C90A 2WN2A 3H1WA 4NAMA 2PMWB 4PT6A 4NIDA 3C2UA 4XAAA 1NXD1 4K8FA 1BYHA 1N1YA 1PVC2 3DYPA 3I2GA 4PIXA 1TEIA 3C7FA 4QXCA 4XFGA 3BU0A 2RMU1 2VNRA 4W50A 3THTA 1FX5A 1EYBA 2I74A 5FPLA 1V6NA 3VZJA 2P6HA 3J7HA 1TZOA 3WUDA 3VBOC 2WFPA 5FZOA 2P3JA 1NCQA 1JZ8A 5D8AA 4IEUA 4Y1YA 3LSDA 3B02A 5LEKA 5I0UA 3KV5A 2VMEA 2A3XA 2D6LX 4CP2A 3OGRA 1IS6A 1W06A 1W2TA 4JV4A 4LBKA 4TLFA 4YFWA 2ZGUA 1MZ6A 3T4HB 5JAXA 1RVF2 3D3AA 3JBG2 2Y34A 4FXKB 4E27A 3VBSA 4LKFA 1DQ6A 4DRRA 5DUXA 1I3HA 4RHV1 4QPGC 5F3CA 3R6SA 1X8EA 1J1TA 3CO2A 4DO0A 2H6CA 2JB4A 4Y1XA 5IAVA 1DLCA 1H2KA 3O14A 5IVEA 1MR5A 4HL0A 3SEEA 1FMD1 4QB1A 3RYPA 4OULA 5FZ1A 1QXRA 3KQRA 3MPPG 1HRI3 4MGIE 3LEMA 5F5AA 2VOVA 1HRV2 2JE8A 2LM3A 3GBFA 1C3HA 4CU9A 4I3GA 3NNJA 4FPJA 1MEC3 4AZZA 4D6SA 2D6OX 2J1EA 1QWRA 1YJKA 1XNAA 1QXPA 1BEV1 2J1SA 2WWJA 1IS5A 3UL2A 1ND2A 3BIWE 1UL9A 4XF1A 2XDVA 4BQ3A 4S2DA 3KGLA 2AGSA 2HWF1 2G4IA 3AZWA 1Z78A 4QDRA 4O7XA 1TMF2 1BXHA 1W6PB 2X8KA 4LKSA 4I30A 4TN7A 3NAPB 3WP3A 5EFUA 1JZ5A 3ETPA 4XPVA 4COVA 4QKBA 4F3JA 1ASJ3 2WAAA 1XB9A 3IPVB 4A3ZA 4HANA 4XUOA 4DXTA 2VNGA 5J36A 4ZU4A 4FTSA 1RMU3 3IDCB 2VBDA 4KMQA 3U07A 3VKNA 1L7LA 1LGBA 2FZ2A 1O5UA 3BALA 5ACA2 1NY71 2PHXA 4GKXA 2ZGMA 1XBFA 2A6YA 4UOJA 3RI8A 4CEYA 4CE8A 4FSJA 1K42A 2KM2A 2LALA 1DP0A 1MACA 3FFQA 2ZAHA 2PHTA 2PLV1 3U10A 3HQUA 1A34A 2X05A 3KQ4B 2HEWF 2DCKA 4E8DA 3ZFGA 1SACA 1VAMA 4Q4W3 1VIWB 2BU9A 3T2TA 1NAEA 2WQ4A 3MGUA 4UAPA 1R081 3CNAA 4IL7A 3UGHA 5C7GA 2KXLA 1EAH2 1BBT1 1XYNA 2B9VA 1C28A 4N8MA 2RS31 1CAUB 3QH6A 1BMV1 4PLOA 1PO11 4D0QA 3WSOA 5AC92 2HKXA 1VRH2 3POYA 1QXJA 2IC1A 5CBLA 4XIOA 3FHQA 5EJZB 5JR7B 4R4XA 2JDKA 1WGPA 1H2LA 1MQTC 1MZ5A 1QDOA 5LATA 5KHGA 3O1PA 3GZEA 3H8XA 5JSRA 3T1LA 4CPBD 1BQPA 4OCTA 1O3QA 1AR93 3GALA 1APNA 2PXJA 1LOGA 3A21A 2EA7A 2XONA 3Q8EA 4H2AA 4XQDA 2VW1A 1UKGA 3N36A 4IDZA 4UW5A 4EE2A 1UY3A 1S0BA 1QDCA 1HXS2 4JDOA 2D3RA 4BU2A 5FYBA 4UBGA 2WZPP 5HXMA 2RR11 3T0DA 3WUCA 4R9DA 3HBZA 5AFBA 3UYJA 1LOAA 2LTNA 4L8QA 4OHZA 1REDA 1YQ8A 1D4M1 2PAKA 3FE5A 2OIIA 4XBNA 4XDPA 3DGTA 2QQIA 3H7YA 2DWRA 2JDUA 2BTVC 2Q1ZB 2RMU3 3T30A 4CCLA 4GB33 1PMHX 2WT2A 3JQWA 3O1RA 1MS3A 1W6QA 1NCQC 5D8AC 3AXDA 2AYHA 4R8HA 1CAVB 5KWRA 3A23A 5JPNB 1AX0A 2VZTA 3RZLA 4AEMA 1J84A 2DUOA 2B42B 4FP2A 5C6CA 5C3OA 3F2ZA 2DCZA 3VBSC 5FLJA 3H42B 4FVVA 3AL5A 2BV4A 4IGPA 4RHV3 1VBB1 4YVSA 5FZ8A 3U1XA 2R072 2RM22 5LW9A 5FTTC 1XC6A 3MLJA 5FZ4A 2ZGRA 1JYNA 4M3CB 2ZGKA 2QVSB 5IVBA 1HW5A 4LO4B 4AI8A 1QEXA 4BK4A 4AI9A 3E6CC 4NIGA 1ODMA 2VW2A 4QM8A 3BKZA 1J3PA 1XSQA 2D3PA 3VL9A 4LHSA 2IFWA 3T0AA 4YG0A 2VZRA 4Q0QA 3VV1A 1ZRRA 4K20A 4YSFA 1LB2A 2PHWA 2VMIA 1W2AX 2D97A 2VZPA 4GD4A 4LUKA 3IDAA 3ATGA 1PZ8A 5FJKA 5LA2A 4D7YA 4BM8A 1GZCA 3P3NA 1PVC1 5DZGA 4MGKE 4CUGA 4YRDA 3WINE 2BNMA 3I54A 4RFT0 1GLHA 2PHUA 4P9GA 2UYAA 3LIHA 4UF0B 2JG8A 4LORA 4AFMA 1BEV3 1LOCA 3ACGA 4RR3A 1SLAA 1ND2C 2RDQA 1JU4A 2PAMA 2JJ6A 2LUWA 2P2KA 2W08A 5L73A 3OY8A 2HWF3 3FLPA 2WO2A 4FCAA 3VL8A 4C0HA 5G05L 5FP3A 1RVF1 2C1FA 3JBG1 4GULA 1QKQA 4RD7A 4BQXA 5IK7A 4L99A 1I6XA 3ZXGA 2VZ3A 3SLIA 3LAGA 3N7KA 2Y6GA 2DURA 4AVSA 2FDGA 3NJZA 1PO22 4CP9B 5CG9A 1CIYA 4XJWA 3B9CA 4WVZA 2RS13 1E5IA 2P17A 2WZR2 4KGQA 4LA3A 4Y22B 1BCXA 2RE9A 3NV3A 4AHYA 3FZ3A 4GMP1 3MFCA 3WLUA 2DFCA 1VJ2A 5EXOA 2GALA 4CEYC 5FZ9A 3FBMA 1O6UA 4KG0A 4R52A 2XKPA 1TNRA 3UJQA 2R063 3GHMA 3BTZA 2PLV3 3PVNA 3S6PA 3HAGA 1V0AA 4NR1A 3N3HA 1HRV1 2E7QA 3SH3A 4ARXA 5A3TA 2W9XA 3CLPA 4HFSA 3ZFGC 2L9LA 3AMNA 3L2YA 5FPBA 3VBOB 4B7KA 3KCCA 4IE4A 2W1QA 2P4EA 1R083 1XNDA 2WYFA 1EPWA 1CD3G 1J59A 1WCDJ 4KWJA 4Y1UA 1E5SA 5DAPA 2VQAA 1BBT3 4RN5A 1CAWB 2JDPA 2RS33 2JE9A 5A3WA 1PO13 1TMF1 3ZR5A 3MI8A 5FY5A 1R64A 3FBYA 3GGLA 3H0OA 1KFUL 3GCWA 1MS1A 2Y8KA 2VR4A 4QPGB 1PX3A 3GYDA 3M70A 1SLTA 3NJVA 2GNBA 1NYWA 4BLJA 4XVHA 1UQXA 5EHDA 2PELA 1Q8SA 5T5PA 2E9QA 5FZGA 1H8TB 4O9GA 4B4RA 2BNNA 1AJOA 2UWCA 5ACA1 2YFUA 5I0DA 1CX4A 3NNGA 1AL0G 2VUDA 1CAXB 4LK6A 4QPWA 4AGVA 5C9AA 2FMDA 1PGW2 2RVAA 2VMGA 2VTXJ 5EYXA 3D0JA 5EJ1B 1UCXA 2J42A 2QQJA 3ECQA 4D69A 5F37A 5L7OC 4NHYA 3N7JA 1D4M3 2WC2A 4P9WA 1KQRA 4CYDA 1VR3A 5JOZA 3ZKUA 4Z92B 1Q8PA 4HKLA 5FREA 2R042 3M2MA 5AVAA 3AKPA 3M7AA 1O7FA 1EAH1 5FY7A 1UY4A 2CHHA 2DCJA 5HCBA 4CEWB 4ASLA 1Y4WA 2X53S 4Q0PA 4AAPA 1VMJA 1J58A 5AC91 1VRH1 4PCRA 5DDJ2 5FKCA 5LB6A 4ITCA 3N4MA 2VTFA 2F17A 1LNSA 3AP9A 3GBGA 4U36A 5EWSA 3T08A 2ZKLA 1Q3EA 5APAA 4Y1ZA 4C8DA 4QQPA 1W6PA 5FQ0B 5LBEA 1O3RA 2G1MA 3RZKA 4YVSC 1VBB3 4AHXA 1UO9A 2NYYA 1L3JA 1MS5A 4Q0SA 4P9XA 5L36A 2QE3A 1HXS1 3IPVA 5GZGA 2GC0A 3SEPA 5FXXA 5TSWA 1JUIA 2BBVA 4Q29A 4P02B 5FLIA 5DAWA 5SV8A 1NCRA 1YC61 3OJBA 3PU3A 4GKYA 3ZXDA 1LECA 1UZWA 4UFLA 2DTWA 2PAEA 3I4IA 5DUWA 2QZ2A 5EQUA 5CFCB 5JZGB 1UMZA 2PHDA 3G7DA 4CP0A 1HN0A 3H50A 4TWTA 4CVUA 1PVC3 1K3IA 4NRMA 2E31A 3W9AA 2W5FA 2XJVA 4LIVA 3FUQA 1W0PA 4NO4A 4IEQA 4D94A 3ZSKA 2BGOA 2JG8C 4OI0A 1F4HA 1AVBA 1GWKA 3J7NA 4RR3C 3TBDA 3WNKA 3DXTA 3WNMA 1EUTA 2WAOA 2BRTA 4NHLA 4OUSA 4XFHA 5FV3A 2XOMA 1HLCA 1YQ6A 2BUKA 3UJOA 2H6BA 2QTWB 2W2IA 5C3PA 1DHKB 5DZFA 1RVF3 3JBG3 5FZBA 4B4PA 5FOBB 4SBVA 2VU9A 1CAUA 2RDRA 3DECA 5GZCA 2EICA 3VKMA 2XLGA 2TBVA 1AR72 2R071 4GAZA 4W6XA 2YBPA 1UOGA 2R1BA 3QCWA 1TG7A 4L97A 4NMIA 3NQHA 1V9U2 4R9CA 3OPZA 4ZZ5A 3AFGA 3LA2A 5A80A 1W28A 1ZBE2 3OPWA 2XHKA 3POBA 4FTBA 4GMP3 5JXGA 2ZMLA 1VB4A 3PVBB 1NZIA 1YFUA 2BQPA 4OI2A 4QQLA 1SCSA 3TNQA 4AAXA 3NW4A 2P34A 2WA4A 3INAA 4AOCA 2NM1A 1HRV3 1BZWA 2HBUA 2PYTA 4PLMA 1TE1B 1M4WA 4AR2A 5JMOA 3TEZA 5FZOB 3RFRA 4ES8A 1NCQB 4K1YA 5D8AB 1J83A 4JGYB 1X50A 2JDAA 3O0VA 4XIKA 1XE8A 3NNFA 4JHZA 5IATA 1XNTA 3CJXA 1CJPA 2IXIA 1WZXA 2BVVA 3AFKA 3ZXEA 5LA0A 5A7QA 1WW6A 3I2OA 5CZKA 2J22A 5IK8A 3BODA 5D2AA 1TMF3 3MF6A 3VBSB 3LZZA 2YB7A 5FXVA 2Y33A 2JEMA 4X6QB 3FLTA 1L7RA 1MVQA 1CAVA 1WWYA 1XYOA 1X7NA 4UT5A 4Y20A 4W8JA 4AW7A 1LEMA 1PO21 1REEA 2GZWA 2IZWA 2NLRA 3GBWA 4IESA 4L2NA 4P9JA 4RGKA 1GICA 1JZ4A 4QX2A 2WT0A 2D6KA 2XJSA 1E57A 2WZR1 4DEVA 1OFSA 2VXRA 5ACA3 4LA2A 3I3DA 5T55A 3H3UA 1DQ2A 1OPOA 5C9AC 1Q8VA 4P9LA 3IBMA 4M3CA 1AXKA 3W5NA 3UESA 3Q8BA 3H8UA 3JB8A 4FFIA 1H30A 1CZSA 4HSLA 3HJRA 4MG2A 3E6BA 1KGYA 3I2IA 3IZOA 3URFA 5FLHA 3J7LA 4ZS2A 3GXUA 3VDDB 1GZWA 1VBA2 4DXSA 3SCGA 4HG6B 4XMAA 1ND2B 3FLRA 1W90A 2VC9A 4MV2A 4QX3A 3MLLA 4LNVA 4XUQA 3LKJA 3PTRB 4FOQA 3JUUA 4GZ9A 3RQ0A 3TWIA 1ZRCA 1EAH3 3ENRA 3IN9A 3KM5A 2ZOEB 3PIGA 3WEZA 2HEYF 1CN1A 1F9KA 5CADA 1ULFA 4H7LA 3MW3A 1VP6A 4CDXB 1PGSA 4YZ1A 5AC93 3BUCA 1VRH3 5JZGA 3WW4A 1JYWA 4G4FA 3BOPA 4H7MA 1UX7A 4HT1T 4IETA 1JW6A 5DUUA 1SBFA 2VW0A 4D3WA 3WQ1A 3AX4A 5F3IA 4XFFA 3C7HA 3A0KA 2B9UA 1YI7A 3M3EA 3RI9A 3KV6A 1S2EA 2JDMA 1YJLA 4OQ9A 1GQGA 4JTNA 3U78A 1HXS3 1IPJA 2YU1A 1NCRC 3T0BA 4CP9A 4AVVA 3O1VA 1PGW1 2V5YA 5JIUA 5A70A 1OOPB 3ZFGB 3BGAA 1PK6B 4Y22A 4YYOA 3WF4A 4NOTA 5D21A 4CCNA 5HV0A 5JOXA 2ZHLA 2WYSA 2UY9A 3D4KA 3OTFA 1CPMA 1O4TA 1OVPA 4LO7A 5A3PA 1DU3D 4Y26A 5FXZA 3VBRB 2R041 2B39A 2JDNA 4FAGA 5A6QA 3DN7A 2VQTA 2ZKNA 1FV2A 3DXUA 3K4DA 4LHNA 2D3SA 2R30A 2ENRA 3OBZA 3QACA 2HBTA 3KD4A 1A6CA 1GFF2 1GP5A 1SZBA 2GP5A 4BPZA 4LIUA 2OYZA 5DDJ1 1K12A 4ZONA 1JOPA 3N7LA 2JG9B 2E26A 5LA9A 3SH5A 4BQ4A 4C1XA 1DQ5A 1W39A 3KHBA 5JI9A 1S0EA 1K45A 2YUEA 3MUY1 2TEPA 4B1MA 3P6BA 2W52A 3Q8CA 5IHRA 1HJGA 1XU1A 1ZZ8A 2R073 2RM23 2ZEXA 4L92A 3ZXFA 2ZX0A 3IIAA 1FNZA 2QQUA 4XJUA 4XDQA 5C71A 4UYBA 5J09A 2C24A 4ORFA 5F32A 5L7OB 3IT8A 1HQWA 2DTYA 4EZ4A 1H8TA 1ENSA 4BWOA 3MEPA 1XQNA 3BVCA 3ON7A 1CAXA 2G9GA 3UV9A 1OQDA 2A7AA 2YPDA 3K3NA 4JKKA 1HN1A 5GZEA 5T5LA 1YCIA 1ZYBA 2GH8A 1W9YA 2J1AA 1AR82 5A33A 4EN8B 2YG0A 4HKOA 2IXLA 4NHKA 2GNTA 2I45A 4WVMB 4YW2A 1XYPA 1Y43B 4ZZ8A 4HPKB 2AACA 4JCKA 4F7ZA 2BW8A 4YARA 1QQP2 1VBD1 2VMFA 1SFNA 1WW5A 2WQ8A 3C8XA 5A6ZA 4E2SA 3IDEA 3ASIA 3CJIB 3LDBA 4YVSB 5FZEA 4CEWA 3AYDA 2QQKA 2V73A 4LO5B 1UWWA 3ETQA 4BMBA 4BYYA 1YXWA 1PO23 1AR71 1RIRA 1JZ6A 2QUOA 3HQRA 3OUIA 2LRPA 1UU5A 1V9U1 2GAUA 1KD7A 2P3IA 2VOWA 2JB8A 1SLBA 2WZR3 2ZGNA 3EXUA 2DVBA 5A1FA 5FQ0A 1ZBE1 4XJ9A 1SBDA 3K3OA 4RA0A 1RUC2 2A6XA 2DYCA 2WT1A 4NAOA 2V4VA 1HIXA 3GDBA 5IVCA 3IB3A 1FXZA 1S2KA 2YC4A 1W99A 1QHDA 3SITA 1ENXA 2MNGA 1OI6A 4RR3B 3O1MA 3M3CA 4X8NA 5J96B 1X9PA 4BB3A 2D93A 1LHOA 2XHNA 5CFCA 3CMGA 4D6RA 1UZ0A 1QJFA 4FPOB 1LESA 1H4HA 2WR9A 3H1YA 2RV9A 4RSUA 1GOGA 2QQMA 2XVLA 3ZXLA 1OD3A 5E1RA 3LDKA 4XF3A 4ASKA 1WCUA 3AMHA 2I07B 1U5IA 5JZGC 2AUYA 2YXSA 2E33A 1AYM2 1JS9A 4GWJA 2D5FA 4Q8KA 1KS4A 3WVJA 3Q8FA 3QOPA 4RGAA 1JU3A 3ILNA 3AZZA 4FOVA 3SKJE 1JYXA 2ZX3A 1W2OA 3ABZA 1W8FA 4XXAA 2W1SA 3KHCA 3DEMA 1JYTA 5FUNA 3ALQA 4Q4V2 1UXXX 1STMA 2ARXA 4YLZA 5FP9A 1VMHA 1NLSA 2JKBA 2OS2A 1XU2A 1DF0A 1UOBA 1LHWA 2GC2A 3AXEA 3FWEA 4FBFA 4XXPA 3LEIA 2FDJA 5EYYA 4ZHNA 1GYKA 3USUB 3T3YA 4H14A 3RYRA 4WZCA 2W94A 1UW8A 3TEWA 2UYBA 5I8SA 5DUVA 4Q8LA 2FCVA 2XKOA 5AVPA 5FZFA 3BPZA 2ZGPA 4P14A 4IW3A 1VBA1 4QGMA 3ELNA 3U75A 1JOJA 1DYOA 3S57A 4XBLA 4IV1B 2WLPA 4XTPA 1V00A 1F35A 3LF7A 5E88A 5CVRA 1IQAA 1C1LA 1NUKA 1C8NA 1V6IA 2R043 3LGRA 4PJYA 1PMIA 3MHZA 4MHUA 3KCYA 2XQXA 4P08A 4URTA 4K21A 1OMIA 4JGYA 4M4PA 2WSUA 5DDJ3 5KHKA 1XRUA 5F5QA 1O3SA 5IYYA 2GNDA 1VBC2 5EZWA 1RITA 3VBHA 5KC5A 3NV4A 4CU8A 2J1UA 4BCUA 1SLLA 1RGSA 4HVRA 3RGBA 1JYIA 5FR3A 2W1WA 4JRAA 1WMEA 3JQXA 3WP4A 2ZEZA 5C9AB 4ZU5A 5A3MA 2EIBA 2A1XA 4CCOA 5A3OA 3H3LA 2VAUA 3KZ4C 1Z0HA 2YGMA 2Q1MA 3OD0A 1JXNA 2TUNA 3CHXA 3GHNA 2X5IA 2YHJA 1H8TC 1H6YA 2O1QA 4QU1A 5FZCA 4NIIA 4LBOA 5FUPA 4M3CE 1YWKA 2RS52 3N9QA 3P3PA 3OBAA 5FZHA 4E4HA 1HB2A 2YROA 4QDQA 3OEBA 5A6YA 4EWDA 1TQ5A 1MPXA 2QDRA 1WCKA 1H9PA 1H8VA 2VD7A 5FPVA 4DEQA 3WOGA 3VDDA 3J7MA 1V6JA 4J6GA 2Q0AA 3AYCA 5F39A 3OBRA 4XFCA 4EV0A 1NT0A 3IIIA 4FTEA 2P37A 2E53A 2YGLA 2Y6FA 2YC2A 1RHI2 3I59B 4LEJA 2CV6A 2WFF2 1IKPA 3VD3A 1KITA 2BOIA 2UY8A 3IM0A 4CEWC 4CDXA 4AVAA 3RMXA 5FZ0A 5BNPB 3MW4A 2VQ0A 3ACFA 3KF3A 5IUQA 1AR73 3ZLIA 4RGGA 1MS4A 2HWB2 4WM7B 4FQ4A 1V6OA 1V9U3 1NCRB 5FWJA 3O1TA 5DABA 1WKYA 4LT5A 4DNYA 5FYHA 1ZBE3 3BTAA 3T2OA 1N3PA 1B09A 3R4UA 2IFRA 5FDBA 4MLOA 3VGIA 1H0BA 3LCPA 4BOWA 4C1WA 4EZHA 1GOHA 4EN0A 5JMCA 3KVAA 3RWKX 4BZ4A 4Y4YA 1XNCA 3CKHA 3TRSB 1LULA 2WBKA 3BB6A 1VBE2 1N1SA 5CU1A 2RJ2A 3J26N 2QZ3A 4O65A 2QKDA 4RS5B 3B5LB 4SLIA 4XHBA 1AJKA 1SLCA 2YV8A 2EXJA 1OOPA 2P3KA 1PK6A 1YHFA 5CFCC 1AR81 1N3QA 5FCCA 5E8AA 1YFWA 1RXGA 1YI9A 2P1BA 4J1WA 2XUMA 5GKAC 1QJZA 2FHRA 4GJZA 4AWDA 4NE9A 3KWVA 4IEWA 2R0FA 3POWA 2ZEWA 4K40A 4Q5OA 5BXXA 1U0AA 4AVCA 4COYA 1RUI1 1AR61 4CZSA 2J7MA 1QQP1 3VLBB 5JWPA 3VBRA 4HVOA 3T2QA 4FPFA 4LBQB 2BDRA 1Z7S3 2D6PA 5AFEA 4OHYA 1ULOA 1BVP1 5FZ7A 1HKDA 1QOSA 3EJKA 4E8CA 4Y3OA 3OUHA 2JKXA 4YW6A 3VBFB 2OPWA 1QF3A 2OZJA 4A7ZA 1ZM1A 1UNBA 2BFUL 4Q0UA 3TB0A 3M4FA 2JG9A 2ORZA 3PMEA 1BLZA 3DV8A 4YGDA 4CCMA 2OXBA 3MYXA 4IEVA 1OC1A 4UFIA 3AYAA 1WMDA 2CSGA 1XJAA 1XNBA 1RUC1 2XLFA 4QB2A 5LK5A 2OQ6A 3VD7A 4H3WA 1K5MB 2VPVA 4OMDA 1ZNPA 3PMSA 4PF1A 4X8PA 5CYYA 2OKXA 5L7OA 3ZYGA 1VBA3 3OUJA 4ONUA 4BQ5A 4EN9B 4QGLA 1W6NA 2B8MA 4V1PA 4HVQA 4S2GA 2MPFA 2E32A 2GP3A 2DU1A 3AM2A 5F7UA 2JICA 2HYKA 5J98B 2XL7A 3DKWA 3WNPA 3C7EA 2XL9A 3B69A 4XF4A 3ZOIA 2XJRA 4JGYC 1QIQA 2J1VA 3M3IA 1W8TA 1ND3B 2FD8A 2NQYA 4FPGA 1AYM1 4WVMA 4Y20B 3WNOA 4DINB 2V5DA 4HPKA 3VBHC 2OUJA 2CNAA 1RYYA 5KHIA 4LOSA 5KXEA 3WF0A 4QGNA 4LUMA 2EXHA 2WNUB 4HETA 4BH9A 1W2NA 5FOJB 1O8SA 1GR3A 4Q4V1 3CJIA 4LQRA 3P5BA 5DQ0A 1US2A 2VVFA 3AMQA 2A71A 2D6NA 4F8AA 4LE4A 1MZEA 4B7EA 1O3TA 2ADEA 1F4AA 2X5IC 3Q9OA 4N53A 1VB2A 4W4ZA 1FMD3 1OLQA 3C7GA 1F5FA 1GZWB 4XABA 3VUOA 5LZ6A 1BK1A 3IAPA 2WS92 3U4SA 2FDFA 1HQLA 3MV01 1IHMA 5LK7B 3NNMA 1V6MA 1QJEA 4UW3A 1VPHA 1IPKA 5JOWA 4HMZA 1P8JA 2GDFA 2BP6A 3H3ZA 2VNOA 2VUAA 3VDDC 5C4WB 1LJ7A 4K3UA 1UOFA 3NKTA 5C3QA 3KV4A 3CBNA 4IV3B 5FYIA 1GP6A 1D0GA 4QM9A 4L0PA 2BOJA 2D44A 4ASMB 1WLDA 3PLQA 2JD4A 2C6SA 2YBKA 3M3OA 3NSTA 1LOFA 5HV4A 1ZZCA 1VBC1 1SPPA 2XH6A 2A3YA 1X82A 4CDXC 1YNAA 3OF1A 5GALA 5ANQA 5GLUA 3DPRB 5L9VA 3FJSA 4YFZA 2CAVA 4P9IA 2WQZC 4XOGA 3IMMA 1SFYA 2VCAA 4QPYA 3WF1A 3ZYHA 3KT7A 1KXGA 4Z2WA 1JH5A 3OYWA 1O5LA 4PIYA 4R9BA 1CGPA 1Q56A 4MYEA 4KWUA 4FXGB 1W8WA 4CDWC 2RS51 5FZ3A 1RUD2 4OZOA 3W21A 4XE9A 2SLIA 3NV1A 5BYNA 3USUA 1S4CA 5IWFA 4BDVB 4YW3A 1UXZA 2ETEA 1OOPC 4D7TA 4EWAA 1QJU2 1N1TA 1PK6C 5EJ3A 3RPQA 3VKLA 4OUEA 1AR83 1OKOA 1D4VB 2BYVE 1QOOA 2MHFA 3B3QE 4WM8A 2UURA 1U5XA 5FP8A 4HBNA 3A0NA 4HOOA 2A6ZA 1NE4A 2VMCA 1QQP3 2ZHKA 4IV1A 3N9PA 3VBRC 5BNOA 1UN1A 4Y1VA 1DCSA 1RHI1 1T6BX 3BIEA 4UI9L 3OBTA 2WFF1 1AX2A 2W68A 3V0BA 5IT6A 3WT3A 1QJX2 1W6OA 2DUQA 2VG9A 4U2AA 1FAYA 4MUVA 3THPA 4X6RB 1IGOA 3X29B 1DGWA 2CGNA 4DY5A 4CU6A 3DYMA 1KJRA 2JG9C 2HWB1 1REFA 4LHLA 3NO8A 4NRQA 4OZXA 5HXVA 3S7IA 2VOTA 4CTEA 5GJ6A 3ZYBA 1FOD1 3E5UA 3PVEA 3WG1A 5KXCA 1RUC3 1OBNA 1JZ3A 3FHIB 2RR13 3W58A 1ENQA 3KGZA 5GLTA 2G9ZA 3AB0A 5A7OA 3HN1A 4IGQA 3VHRA 2BNOA 4XURA 2ZJCA 3USSA 5A33B 1OLRA 1VBE1 4IEYA 2H0BA 3KB5A 1N3OA 2VCMA 2F4LA 2E6VA 4HONA 4NJ4A 1WCSA 4ZKTB 1DZTA 3NNLA 1BVVA 3PL0A 5I91A 4DXZA 1COV2 5F5CA 4DZGA 4BQ2A 1VALA 4Z8BA 2VQUA 2PQQA 1OD5A 4CDQA 2P5BA 1TNFA 1R1A1 1PVXA 3I97A 4LBNA 1UYYA 2VCCA 1XOYA 4HK9A 1KEXA 3LA7A 2DCTA 2PA7A 1EPZA 1OPMA 5FUIA 1C5IA 3AVSA 2DVAA 2ZZJA 1NOVA 1AYM3 5EPAA 1OQ1A 4Y4RA 3VBUB 3EBRA 2ZXQA 3MICA 4JKMA 4IGOA 5LASA 1NLQA 2O8QA 4PQ9A 4HXCA 3JB4C 4MADA 3I59A 3WNXA 4CCJA 4XJZA 5DG1A 2Z4FA 2D5HA 3AKQA 3CJIC 4HN0A 4Q4V3 3ZYPA 1F8VA 1S0GA 1IPSA 2NP0A 5K4LA 2WZEA 4GH4B 5BNNA 2Z42A 2ZS6B 2G9FA 3MLKA 5H9QA 4AI3A 4BLIA 3OCPA 1DQ1A 5BNPA 5IFPA 2WNOA 3W20A 2UWBA 3PVOA 4N53C 5F6KA 4WM7A 4EROA 1LU1A 1G8WA 1S1AA 1W04A 2B4KA 3K75B 4N9HA 1LU2A 3H1MA 2X10A 4XEZA 1LGNA 4NHXA 3OGVA 3CL1A 3ZN6B 1ONAA 4XDOA 4XTMA 3PU8A 4PDWC 2YY1A 4YGBA 1GWLA 2K2SA 5T5JA 2XJUA 3H9AA 2VUJA 1O91A 3AMPA 5KXBA 4QKFA 3SMHA 4RS5A 4QD2A 2VZQA 1I1EA 4IEXA 1OVSA 1AYN2 3MIDA 2OUHA 2W87A 5FMOL 2CY6A 4AQTA 2QQNA 1C8M2 1VBD2 1LOFC 2PTMA 2Z79A 1LEDA 2HWC2 1VBC3 3I8TA 1QY4A 5F6LB 1UYZA 3GCXA 5KHJA 3WDYA 4HK8A 1POV0 2ZAAA 3E97A 1UAIA 3IWZA 4E4ZA 5IVJA 4LBQA 1RUH2 4FFFA 4QDSA 3B93A 1RUF2 1T2XA 2VTXA 3BU7A 5LY2A 1TME2 1ZA7A 3O0WA 5CKQA 3VBFA 2IVIB 3AC0A 4IQPA 4WV8A 2ZEYA 1KDMA 5B4NA 1O8PA 1PNGA 3LEGA 4YZ5A 2WDBA 3PURA 1U5ZA 5D1IA 3ACHA 3E1F1 4BMEA 4E2QA 4J1XA 1C1FA 2QQOA 2RS53 2WS91 1DDLA 3WW2A 1RUJ2 1OUSA 3KT1A 3MIBA 5B4XA 1MS9A 1W9TA 1ZA4A 5FY4A 1GNHA 2ZPXA 1K5MA 2FBEA 4GA9A 2YDEA 4WM8C 3WW3A 3UKNA 1J1LA 1ULDA 2VZSA 4W6YA 1JBCA 1RMU2 3PDQA 1QNYA 2B5HA 3NWKA 4IV1C 5BNOC 3VBHB 1UMIA 3LOIA 1WMFA 4BK5A 5A32B 1RHI3 3O12A 4XJ8A 5E6HA 5H9RA 2VZOA 1LGCA 2IXHA 5T54A 1GQHA 4MGTA 4PLNA 4PHZA 4AE2A 4CA9A 5FY8A 3SHRA 2CGPA 3DUIA 1ND3A 1HX6A 3FUOA 3ILRA 1G9FA 3L2HA 1W0NA 1UX6A 2HH9A 4O9EA 5CFDC 5EIYB 1D7PM 3RZGA 2HWB3 2C4XA 3EYPA 1IG0A 2X5IB 2WZ8A 3I2HA 2W39A 2BFUS 4S2HA 1IQDC 4N7UA 4DUWA 4DUVA 5A1LA 4FPKA 5I0TA 5T52A 5C3SA 3RZHA 4UW4A 2WL1A 2WNUA 3VDBA 3ZPOA 3D6EA 4LK7A 2HWE2 4IEOA 1H6XA 1RUD1 4M0NA 1J3RA 4LHKA 4Z82A 1VBE3 4NN0A 4HKWA 3V0AA 2CWSA 3S5AA 1AUYA 2A6WA 4CXXA 2WIIB 4DUXA 1W9SA 2VBBA 1UU4A 1QJU1 1UIKA 1Y9QA 4ZPIA 3J8F2 4NPMA 4LJHA 3O1SA 3GJAA 4CDQC 1Q43A 3MIGA 2ID4A 1UZYA 3RZZA 5C5TA 1N47A 3LB9A 5C8CA 2DVDA 3I2FA 2CDOA 2ZGTA 5FIXA 5DAVA 2VH9A 5C4WA 4TXWA 2A73B 3ZX7A 4YG3A 2VZUA 1KDKA 2GSYA 2YPJA 3CIHA 5JXHA 1D2SA 1QJX1 5FO7B 2ZGSA 4IV3A 5H9SA 5ABJB 4Q4Y2 2D6MA 2Q5TA 5FAXA 5A7NA 3HPNA 3JCIA 4OHVA 2WKKA 2P6CA 1I5ZA 1IG3A 2YZ4A 3MDPA 5BNNC 5GLWA 5BNPC 3WCRA 3PUHA 2A6VA 2H0VA 4GB32 5K9YA 4CDWB 1FPN2 1SQ4A 2O8OA 3DPRA 3I2DA 3Q8AA 1ZBA2 2RJKA 2OA2A 4WM7C 3VN4A 1G9AA 5FP7A 3LPFA 3RSJA 1OHFA 1WBLA 1WLWA 1I5PA 4Z2AA 3WDUA 3ZM8A 3PUQA 2WRAA 4GJYA 3S30A 4LULA 3CU7A 3APBA 1M06G 2OW4A 5F2SA 1UPSA 4B4QA 4UFJA 1COV1 3ZPYA 2WWSA 2XMLA 1LR5A 4BQWA 4LO8A 1PIV2 3HMYA 5F5IA 1HV0A 4RS5C 1GNZA 2RDSA 4YZ3A 4QAWA 1G86A 1YRZA 2E51A 5CKNA 3D5OA 5GLZA 2K46A 5FPXA 2ATFA 1X33A 1OLME 5FJHA 4XQ4A 3M3QA 3ZXAC 1YO8A 4PI2A 3BI3A 4IUGA 3ME2A 4A7KA 4IE0A 2FMYA 2VO5A 4Q4X2 5FZMA 2GH2A 4K6BA 1PHMA 1PGL1 2Q8CA 3N9MA 4FPCA 2WWUA 3LE0A 3VBFC 1W8ZA 3ZO0B 4OVEA 4AEDA 4MO3M 1S0FA 3CZJA 4MH0E 4R4ZA 2E63A 4MGQA 4TSVA 1JTZX 2JWPA 4XJAA 2QQPA 2W95A 2WS93 1W6NB 2Z2SB 3DCQA 1CWPA 5KR7A 3O1OA 5FYUA 4OHXA 2JD9A 4XFAA 3H8OA 1C4RA 1WD4A 5FKBA 4FOWA 4FAHA 5DMYA 3K48A 1K5MC 4PQQA 4XHXA 5HI0A 1JZ2A 2Q1FA 5LRSA 3PNAA 5E89A 4AVBA 5CA6A 5FFOC 4TTGA 5HPOA 1ZX5A 1AYN1 1X36A 1UYXA 5GM0A 1GANA 1OF4A 1WW7A 1AXZA 2RS12 2VULA 3GZAA 1POQA 4A2UA 1RUI2 3N35A 3NMBA 1GV9A 1GUIA 2ZACA 1MS0A 3E5QA 4QT6A 1C8M1 4BIFA 2PHLA 2ZABA 1WA6X 4AFCA 4CXWA 2R16A 3TAYA 5F1RA 2HWC1 2ZX4A 4BHPA 4QQOA 1BK0A 2IUWA 1ND3C 3M8LA 1X9TA 3CQOA 1XXNA 3UKVA 3MIFA 1R1ZA 1RUH1 4Y24A 1RUF1 3WNNA 4IE6A 3N9LA 1F31A 2OPKA 2GMMA 2A70A 2WSVA 2RJLA 1FATA 3HWJA 4N53B 5E16A 1TME1 5FYVA 5LBBA 3V64A 5A3NA 4FPHA 2OX0A 4D6QA 4I3PA 2WNUC 2G19A 1FNYA 1VRBA 4YG6A 1SMVA 1EP0A 5C8WA 2FQPA 3RVHA 1EY2A 4PDWB 4LBQD 4MOAA 4GH4A 4QX1A 4UFKA 2VBPA 1RUD3 4AI0A 1RUJ1 5F9TA 1JI6A 2GC3A 1JN2P 4JHTA 2VECA 4FPEA 2XLAA 3FC0A 5SV5A 1RC6A 2NMOA 2EAAA 4AXOA 4QB6A 3ZN6A 4DXRA 1YIPA 1Q8QA 4AI1A 5FWEA 3LD8A 2QQLA 1UZZA 1RMU1 2BGPA 4HLTA 5H9PA 1OFNA 4I01A 2XVKA 5I93A 2FDHA 3QD6A 5C8CC 1H9WA 5FYTA 1H2NA 3UKTA 1SPPB 5JDBA 4A4AA 5C4WC 1G7YA 1YQ2A 4JC1A 3V65A 2QNKA 3NV2A 4DQAA 1F15A 4CXYA 1BKZA 3VZOA 5FO8B 2MEV2 1NQJA 4QXHA 4RFRB 1QJX3 1XSRA 4IV3C 3OEAA 3RDIA 2AREA 4N43A 1DBNA 1DGWX 2GN7A 2JIGA 4XQWA 2E7AA 4CCEA 3ITQA 4WVVA 1Y9MA 1CZVA 4META 1G9CA 3AP4A 4KWKA 2TNFA 3OYWB 5EV7A 3BCWA 2EIGA 3HNBM 1YIFA 3WY6A 3ZVXA 1HB3A 2Q4SA 2ZHNA 3P1IA 4KNCA 3HEIA 3DPRC 3WZ1A 2W1UA 5C70A 2HWE1 5F8PA 4IERA 1JYVA 4AEKA 4AGRA 1JYCA 5BY5A 1QJY2 2DBNA 4JDMA 4YM0A 5CISA 3QLQA 4MGZE 1OH3A 3WF2A 3ACIA 4WM8B 2D98A 5L9BA 3POEA 4AG4A 3HT2A 2P3YA 2VNVA 3ZMOA 1Q8OA 2VZVA 3ZIWA 5BPXA 1COV3 3AJYA 3AZYA 1EV12 1GMMA 1LODA 2CAUA 2IWGB 2WNVB 3J8F1 1QU0A 3EQEA 3PTYA 4ATFA 4LKDA 4MSVA 3V0BB 5GLVA 3J9SA 1S0JA 2OQ7A 3AKTA 5FYYA 1W6OB 3B00A 2R49A 5LBCA 4LBLA 4B29A 3MW2A 4MZUA 1US3A 5CFDB 2RHPA 4XFBA 3KCXA 2XJTA 1HB1A 4LOTA 5A6XA 1QH6A 4Q4Y1 3BTXA 5A32A 3FN9A
chains in the Genus database with same CATH topology
3RZGA 4O61A 4IE5A 3BUCA 3RZHA 4QKNA 4NRMA 2FDGA 4CXWA 3O1MA 3H8RA 3I49A 2IUWA 3S5AA 4CXXA 4NIHA 3O1TA 5DABA 3BKZA 4IE6A 3T4VA 4NPMA 3O1SA 3O1VA 3BTZA 4NIDA 4NRPA 3O1PA 3H8XA 4IE7A 4NROA 3BU0A 4OCTA 4IE4A 4IDZA 3KHCA 4JHTA 4NPLA 4QKFA 2FDJA 4ZHNA 4ZS3A 3T4HB 3T3YA 2FDHA 2FDKA 3BTYA 3KHBA 3I3QA 4CXYA 3S57A 4RFRB 3I3MA 3O1RA 3O1UA 2FDIA 3I2OA 3RZLA 4QKDA 3BIEA 5F8PA 3BI3A 4IE0A 4QHOA 4NIGA 4NRQA 4O7XA 3LFMA 3RZMA 4MG2A 4QKBA 2FD8A 4NIIA 4ZS2A 3RZJA 3RZKA 4MGTA 4NJ4A 3O1OA 3H8OA 2FDFA 3BTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZG A;  4O61 A;  4IE5 A;  3BUC A;  3RZH A;  4QKN A;  4NRM A;  2FDG A;  4CXW A;  3O1M A;  3H8R A;  3I49 A;  2IUW A;  3S5A A;  4CXX A;  4NIH A;  3O1T A;  5DAB A;  3BKZ A;  4IE6 A;  3T4V A;  4NPM A;  3O1S A;  3O1V A;  3BTZ A;  4NID A;  4NRP A;  3O1P A;  3H8X A;  4IE7 A;  4NRO A;  3BU0 A;  4OCT A;  4IE4 A;  4IDZ A;  3KHC A;  4JHT A;  4NPL A;  4QKF A;  2FDJ A;  4ZHN A;  4ZS3 A;  3T4H B;  3T3Y A;  2FDH A;  2FDK A;  3BTY A;  3KHB A;  3I3Q A;  4CXY A;  3S57 A;  4RFR B;  3I3M A;  3O1R A;  3O1U A;  2FDI A;  3I2O A;  3RZL A;  4QKD A;  3BIE A;  5F8P A;  3BI3 A;  4IE0 A;  4QHO A;  4NIG A;  4NRQ A;  4O7X A;  3LFM A;  3RZM A;  4MG2 A;  4QKB A;  2FD8 A;  4NII A;  4ZS2 A;  3RZJ A;  3RZK A;  4MGT A;  4NJ4 A;  3O1O A;  3H8O A;  2FDF A;  3BTX A; 
#chains in the Genus database with same CATH topology
 1RTV A;  1HDK A;  1OXC A;  3VKO A;  2ZHM A;  5K0U B;  4AED C;  5T5O A;  3WV6 A;  4N90 A;  5FZ6 A;  1DGL A;  4YNI A;  4I09 A;  2NZ9 A;  5DZE A;  4GB3 1;  4JQR A;  3LOB A;  4Q1P A;  1FPN 1;  5A7S A;  1ZBA 1;  4OMC A;  4Q26 A;  4XZU G;  3K51 A;  4MXV A;  1L7Q A;  4ZXE A;  3H8R A;  1Y3T A;  3JD7 2;  3PJY A;  3MUZ 1;  3POG A;  2X09 A;  3OGS A;  4GWI A;  1WA4 A;  3BPS A;  3HBK A;  1JHN A;  1D0H A;  4XCA A;  1A8D A;  4COW A;  4CDQ B;  3WW1 A;  4ZXK A;  5K8S A;  4OQ8 A;  3T4V A;  4QX7 A;  1PIV 1;  2ZA9 A;  2QFE A;  2Z5W A;  3LEK A;  3OGG A;  1GQP A;  3CF6 E;  1AYN 3;  4QX5 A;  3VZK A;  4OLL A;  3ZR6 A;  5FYM A;  2EXI A;  2ES3 A;  2CU5 A;  4LKE A;  4JGZ A;  1O4Y A;  4PIZ A;  3VKF C;  4CCC A;  5JSP A;  1C57 A;  1C8M 3;  1VBD 3;  4XYX A;  2HWC 3;  3ZN5 A;  3EMR A;  4GAL A;  1D2Q A;  4Q4X 1;  5BUV A;  4NWW A;  1ZZ9 A;  2W91 A;  2HYX A;  1LCL A;  4Z1V A;  1W6M B;  3FHA A;  3AZV A;  3ZDS A;  5BNN B;  2IXK A;  1RUH 3;  1RUF 3;  2XWJ B;  5KC6 A;  1ZRE A;  3VBU C;  3C3V A;  4K7J A;  1F5J A;  2V09 A;  3NL1 A;  1KFX L;  1TME 3;  3MFA A;  2VUC A;  3RMY A;  3WG3 A;  2VXJ A;  5ABJ A;  4KBB A;  2HJI A;  3TN9 2;  3WDV A;  1NA1 B;  1B35 A;  2BJS A;  2BWA A;  3EHK A;  1FOD 2;  3OGJ A;  4QXB A;  1U12 A;  2WO7 A;  5IJR A;  2XJP A;  4GH4 C;  4GWN A;  1VMF A;  5HCH A;  5IVV A;  4TYS A;  1RUJ 3;  2AC1 A;  2ZTN A;  1RUG 2;  5I8T A;  3I3M A;  4CDW A;  1UMH A;  4TZD A;  5J1X A;  3U4X A;  2ARB A;  3JZV A;  5DPN A;  1G9B A;  1OT5 A;  4XUN A;  4AHZ A;  3AMM A;  2ERF A;  1ULP A;  1UIJ A;  3HVD A;  1CES A;  3NVC A;  4RQP B;  1W3V A;  4ATE A;  4BA6 A;  4CUC A;  4OUM A;  1ST8 A;  2A3W A;  5DAQ A;  4YWA A;  4AYU A;  3POS A;  2FCT A;  4P5H A;  2BZD A;  1R1A 2;  2RS1 1;  3POF A;  2D43 A;  5F3E A;  4FFG A;  2R32 A;  4AHW A;  1CQ9 A;  5CNA A;  3NJY A;  2DVF A;  1OSG A;  1YUD A;  4BE3 A;  3HN3 A;  5A1A A;  2R06 1;  1ULG A;  2Y6H A;  3WQ0 A;  4WBB A;  4N43 C;  3THC A;  2R6Q A;  5CKM A;  3IMN A;  4QQH A;  5FBJ A;  3KT4 A;  1Y9G A;  5CEH A;  3RNS A;  3VD4 A;  2YU2 A;  4B3N A;  1RUO A;  3CDZ B;  1W8U A;  2AH2 A;  3NRU A;  1DZR A;  4UFM A;  4OI1 A;  3J4U H;  4URA A;  4QQ2 A;  4JAA A;  5EP9 A;  2HWE 3;  4I02 A;  1FI2 A;  1ZZ7 A;  3MIH A;  1SBE A;  1DGR N;  1CVN A;  2HWD 2;  3LA3 A;  1H1I A;  2Y0O A;  1RJ8 A;  5KHH A;  1SG3 A;  3E6D A;  4CDU A;  4O61 A;  4LBJ A;  1YFX A;  2CYF A;  2Y0I A;  3J8F 3;  2NMN A;  5A7P A;  4YVW C;  5FY9 A;  4G9S B;  4QKN A;  3WCS A;  2XBO 2;  4PBO A;  4Y5S A;  2XG3 A;  3TEX A;  3UGF A;  3UT0 A;  4XF9 A;  3WHU A;  2PHR A;  4E9K A;  2J1T A;  4G3Y C;  2WN3 A;  5IK5 A;  5FZD A;  3PJQ A;  4LMF A;  4XFI A;  1QOT A;  1J3Q A;  2MEV 1;  1CPN A;  4LO6 B;  4GMP 0;  3S7E A;  4Q4Y 3;  3GF6 A;  2XXZ A;  1G9D A;  1PZ7 A;  4Q1R A;  5LY1 A;  4NHM A;  4OYU A;  3WDT A;  3WQB A;  4CP1 A;  2QCS B;  1UU6 A;  3AYE A;  2DF7 A;  4MXW B;  4I0B A;  4PF5 A;  3K46 A;  4AFA A;  1OA2 A;  2F6B A;  1QGL A;  3ZDV A;  1JOB A;  3KSC A;  4NRP A;  1V70 A;  4AQ2 A;  3ZFF A;  1FPN 3;  4Q0V A;  3TNP B;  1HQN A;  1ZBA 3;  4K8R B;  3V0A B;  4D8M A;  3ZFE B;  1YEW A;  4LLO A;  1QJY 1;  3KV9 A;  1RJ7 A;  3MIE A;  5JXJ A;  1UOJ A;  2BER A;  2EF6 A;  4DS0 A;  4AEJ A;  3B94 A;  3VB9 A;  4P5Y A;  5IVY A;  1GOF A;  3UNP A;  4OHW A;  4NPL A;  4PDW A;  2J1R A;  2WUH A;  3OOX A;  1EV1 1;  5IVF A;  5FPU A;  1PIV 3;  4ZS3 A;  1OKQ A;  5C8C B;  3W5M A;  4IXL A;  5FMD A;  2VL4 A;  1WUV A;  2XQR A;  3RJ2 X;  1DQ0 A;  5ANN A;  2KD7 A;  2AR6 A;  4JGZ C;  1GWM A;  3ROU A;  1IS4 A;  1T6G C;  4ES9 A;  1SFP A;  1UZV A;  4FT8 A;  2ZX1 A;  1I9R A;  1WCQ A;  2ZCW A;  3A4U A;  3OPT A;  3SH4 A;  1DYP A;  4Q4X 3;  3K4Z A;  4XUP A;  1KRI A;  2VMD A;  1GZ9 A;  3LWC A;  4DMI A;  4V2W A;  1PMJ X;  3UET A;  5FZI A;  5JI7 A;  4M3C F;  4PI0 A;  4CU7 A;  5HCF A;  3L9J T;  3S0M A;  1NZC A;  5ABJ C;  3MO4 A;  3IAQ A;  1B35 C;  1ZZB A;  3JXS A;  2ORX A;  4LXL A;  2FCU A;  1FT9 A;  3U37 A;  2X29 A;  2Y64 A;  2ZZQ A;  3DKQ A;  4QWN A;  4EWE A;  1IZ3 A;  2W92 A;  1YLL A;  3GM8 A;  5F2W A;  3VZM A;  1HB4 A;  1VAK A;  3JD7 1;  3A22 A;  3H7J A;  2GN3 A;  4D7S A;  2XGX A;  1TVG A;  3ZYF A;  1LKN A;  2GU9 A;  1SHW B;  1WD3 A;  3RZM A;  3HNY M;  1RL3 A;  3LFI A;  2Y6L A;  3MBW A;  1FYU A;  3ORJ A;  4EYU A;  4BXS V;  3LQC A;  4XW3 A;  2SBA A;  3HNM A;  5ISL A;  4OI4 A;  1Y7B A;  1ACC A;  1F2N A;  1OLM A;  2WNV A;  1RUI 3;  1AR6 3;  4QPI A;  1IOA A;  3RZJ A;  1W8H A;  4XAC A;  3E5X A;  3RG0 A;  5FMC A;  4N9I A;  1UKR A;  3IDB B;  2VZ1 A;  3AK0 A;  3SQO A;  5KBF A;  1QNW A;  2Q30 A;  1RUE 2;  5HCA A;  4L11 A;  3U14 A;  1S0D A;  4AED B;  4CCD A;  4ZY9 A;  1LRH A;  2K0G A;  2XWB B;  2RG4 A;  4XZP A;  1LAJ A;  5CFD A;  2HEV F;  1PNF A;  4IND A;  3G6J B;  3MPB A;  2WIN B;  1CIW A;  2WJS A;  3HQX A;  3U0Z A;  1RXF A;  1AL2 2;  1R09 2;  1DYK A;  1QMJ A;  4QMA A;  3TN9 1;  3ZXK A;  2VCB A;  4YZ2 A;  4FFH A;  3RWN A;  4A6S A;  2JXA A;  5K0U A;  1S0C A;  3ZSM A;  3GZU C;  1GKB A;  2PFW A;  3VHP A;  1RUG 1;  1GSL A;  2DDU A;  3ES4 A;  4UXA A;  1N1V A;  4NIH A;  4DOU A;  3WX5 A;  4QHZ A;  3DYO A;  1WLT A;  2R0H A;  4CDU C;  3CEW A;  3EO6 A;  1JZ7 A;  2W3J A;  3KMH A;  2JDY A;  2JEC A;  1O4Z A;  2FZ1 A;  4UBH A;  4BXF A;  3BN6 A;  4FO9 A;  2WO3 A;  2QJV A;  3FL7 A;  1A78 A;  3RJR A;  2DV9 A;  4NRO A;  4GWM A;  3OSD A;  3B9I A;  2ZGQ A;  4RYD A;  2VOK A;  3VHN A;  1OH4 A;  2MEV 3;  2CGO A;  1X8M A;  3PUS A;  1W2U A;  2ET1 A;  4XUT A;  4YZ4 A;  1VLN A;  3ZYI B;  1GU3 A;  3QBQ A;  2D40 A;  3VDA A;  2ILM A;  2NN8 A;  3HR9 A;  1A3K A;  2C5D A;  2DVG A;  2AEY A;  1PGL 2;  2Q8E A;  4K9S A;  4M01 A;  4M00 A;  1XPW A;  2VVE A;  3K2O A;  1ZRF A;  3BTY A;  5DN2 A;  2XJQ A;  2OZ6 A;  1W6M A;  1QH7 A;  2WA3 A;  3ZFF C;  2VMH A;  4KBZ A;  5C3R A;  2R1D A;  4JTO A;  2VVD A;  2HWD 1;  4DPN A;  1QJY 3;  1RIN A;  3N7M A;  1AXY A;  1U5Y A;  4DIQ A;  1BJQ A;  4JQT A;  5FYS A;  1ZZ6 A;  2V4A A;  1NA1 A;  4A45 A;  1K5J A;  4GIQ A;  2FDI A;  1S0I A;  1W8N A;  2CTV A;  2EVX A;  3RRD A;  2YFZ A;  4GQ7 A;  3ZXJ A;  4YM2 A;  1ALY A;  4I0W B;  2EXK A;  3WQ7 A;  4BIO A;  4ISQ A;  1JMU B;  1EV1 3;  2VE1 A;  3AKS A;  5LRR A;  4QKD A;  1SDW A;  2LRO A;  4W65 A;  5A3L A;  1GP4 A;  1AF9 A;  2WLQ A;  3M1H A;  1PX4 A;  1V6L A;  1AHS A;  1WLC A;  2ARA A;  2XBO 1;  3NAP A;  1NE6 A;  3NJX A;  4B8E A;  1JUH A;  3T09 A;  5A7W B;  3AVR A;  2UU8 A;  4V2V A;  2WAB A;  5FYZ A;  2LS6 A;  4RQP A;  4QHO A;  1W3X A;  4IEP A;  4N43 B;  3D82 A;  1CJD A;  5L9R A;  1E5H A;  4WZF A;  4XAE A;  4LR4 A;  4DRV A;  4EJR A;  3JU9 A;  2AEZ A;  5FPZ A;  4A44 A;  2PHF A;  2ZGL A;  1HRI 2;  3HT1 A;  4XMI A;  4I2O A;  2Y38 A;  4KH9 A;  1ENR A;  2I2S A;  2D7F A;  2OVU A;  2YMZ A;  4YW4 A;  2ZMK A;  3TYJ A;  3ZYR A;  5LCW L;  3K77 A;  2DBI A;  3ZSJ A;  5JVV A;  4N7I A;  1MEC 2;  2GME A;  1S55 A;  4MX3 A;  3WNL A;  4AI2 A;  4FOY A;  2BEO A;  3HD8 B;  2EIE A;  2C9K A;  5L19 A;  5F3G A;  3ZN4 A;  3OG2 A;  3ZMN A;  1WMX A;  1NLR A;  2BVB A;  2JE7 A;  4AF9 A;  1WW4 A;  5J37 A;  1MQT B;  1UYP A;  3JD7 3;  4LE3 A;  4NWV A;  4XF0 A;  2VM9 A;  3WG4 A;  2F4P A;  2QDN A;  4P9Y A;  4YVW B;  1GZT A;  2LW8 A;  4YW5 A;  5G04 L;  3THD A;  4BIS A;  5JPM B;  1NKG A;  2O0O A;  4HSJ A;  1ASJ 2;  4YM1 A;  5GZD A;  5GZF A;  4CSW A;  2ZBJ A;  2RM2 1;  3LSE A;  4XBQ A;  4YGE A;  2C9A A;  5FPA A;  2EAL A;  2ARC A;  3ZYJ B;  3AZX A;  1H1A A;  3WDX A;  2WNV C;  4QPI C;  1JOD A;  4KU8 A;  3N9O A;  4AFB A;  3AJZ A;  3SCH A;  3TEY A;  2A5Z A;  5FZA A;  3PHM A;  1UY0 A;  5IFT A;  2WFF 3;  1XNK A;  5LBF A;  2NPI A;  4TLG A;  1ULC A;  4B1L A;  2B45 X;  3R4S A;  1NQD A;  4L9B A;  4MGY E;  4E4S A;  1UY2 A;  2CL2 A;  1DGR A;  1MVE A;  1IS3 A;  1LHV A;  1URX A;  3ZKY A;  2JDZ A;  4EN6 B;  2EAK A;  5K7P A;  2E7T A;  2JX9 A;  4XET A;  2DUP A;  5JIA A;  1YFY A;  2YC0 A;  1UPI A;  5FBZ A;  3BYW A;  4QU2 A;  1ODN A;  3I7D A;  3TN9 3;  4IE7 A;  4Q4W 2;  3ZSE A;  3R4D B;  2QBX A;  3SC7 X;  5IK4 A;  5FZL A;  1NX9 A;  3WP6 A;  3FMG A;  1FOD 3;  3PIJ A;  2WO1 A;  4XCB A;  1LOB A;  5K0U C;  1KJL A;  2C26 A;  2Y6J A;  4MXW A;  1ZVF A;  3VD9 A;  1RUG 3;  3DF0 A;  1YYN A;  3CZU A;  3MV1 1;  1Z7S 2;  4KG8 A;  2N7G A;  3ZFE A;  5JR2 A;  2ZGO A;  4H55 A;  2YYO A;  2DFB A;  3ACL A;  1LHN A;  3WP5 A;  1A8M A;  4Y33 A;  5FXW A;  1AX1 A;  4JGZ B;  4Z07 A;  1FV3 A;  1OUX A;  2JEN A;  1PM4 A;  2ET7 A;  5CB7 A;  2CWM A;  1AR9 2;  2VJX A;  1R1A 3;  3AP6 A;  1JHJ A;  4PBP A;  3I3Q A;  4QX8 A;  5ERL A;  5FY1 A;  3BOW A;  2W47 A;  2B7Y A;  4YW1 A;  4LLF A;  3I2K A;  4OFG A;  4E4D X;  3ZIX A;  1C5H A;  3RS6 A;  1RUN A;  1SDD B;  3WDW A;  1CON A;  5JXI A;  1RUE 1;  5J48 A;  1POV 1;  2BGC A;  3LPG A;  2B46 X;  4DFS A;  3F95 A;  5DXD A;  4JZR A;  5KXD A;  4JDN A;  1Q5O A;  1NG0 A;  3LDR A;  3MF9 A;  1W03 A;  2BWC A;  1B35 B;  4FPY A;  3VDC A;  5FZK A;  5T3N A;  2Y60 A;  5M0T A;  3K4A A;  3KLS A;  4RL7 A;  1AL2 1;  1R09 1;  4K1Z A;  2PQS A;  2RMU 2;  3VZN A;  2K9Z A;  5LA1 A;  3I2J A;  3V56 A;  4CUB A;  2HWD 3;  4W6W A;  1LHU A;  1W0O A;  1H2M A;  1MS8 A;  4UF0 A;  1OQE A;  4NUB A;  1NA1 C;  4YM3 A;  4KGG A;  4AL9 A;  4A42 A;  4BQY A;  1H4G A;  1KS5 A;  5DG2 A;  3LFM A;  2IXC A;  3UK9 A;  2RDN A;  3N9N A;  5JCT A;  1GBG A;  5CAZ A;  1W9W A;  5C33 A;  4AVT A;  3NAP C;  4KQ7 A;  4ZU7 A;  2XBO 3;  1YQC A;  5FO9 B;  4KU7 A;  4RHV 2;  4CEY B;  4BJ0 A;  3W59 A;  3POI A;  4RQP C;  4I0A A;  4CCK A;  2GMP A;  3ES1 A;  1VE0 A;  3AL6 A;  4YPJ A;  3O7O A;  4M0H A;  3ZSL A;  2V72 A;  1FMD 2;  1LOE A;  1DFQ A;  3GZT B;  2AEN A;  4IE5 A;  3RYK A;  4ARY A;  3R0R A;  5FYC A;  3D0S A;  3C7O A;  1DLL A;  2XUE A;  2ZMN A;  3GJB A;  2VY0 A;  2R7E B;  4J25 A;  4KL1 A;  3VBU A;  5DAX A;  1PZ9 A;  1W05 A;  3KF5 A;  3QH7 A;  2DU0 A;  2AZ5 A;  1CZT A;  1WBF A;  4JVA A;  1BEV 2;  2QQW A;  4WVW A;  3VBO A;  2VGD A;  5CG8 A;  2CDP A;  4CDU B;  2O14 A;  2HWF 2;  4NVP A;  5BNO B;  2JIJ A;  3T1M A;  3FX3 A;  2ZX2 A;  1CAW A;  2Q8D A;  4EQV A;  1EUU A;  3S5Q A;  4AK3 A;  1S2B A;  5FP4 A;  4UFH A;  3FFZ A;  2XPJ A;  3T2P A;  5B2G B;  5JUV A;  3B01 A;  4QPG A;  2ADD A;  3WG2 A;  4A7Y A;  5I0R A;  2EID A;  2XR4 A;  4LIT A;  1H1M A;  2KR2 A;  3AP5 A;  4DB5 A;  2BPA 2;  1UF2 C;  1NY7 2;  1W9F A;  1CX1 A;  4JKL A;  5I0S A;  3KVB A;  4Y5T A;  5C5U A;  2GC1 A;  4EN7 B;  2DCY A;  5BNQ A;  3WHT A;  2R06 2;  4AFD A;  1IKQ A;  1HRI 1;  2W46 A;  2PLV 2;  4E2G A;  5IAX A;  3ZFF B;  1PM7 A;  2FDK A;  2WNE A;  2A75 A;  3O0X A;  1W6Q B;  3TOJ A;  4AGG A;  3AP7 A;  4C91 A;  4FQZ A;  4LBM A;  1OUR A;  5FK7 A;  1MEC 1;  1SCR A;  1LEN A;  1R08 2;  4LPL A;  4NIA A;  4Y5Z 0;  5FRA A;  4AQS A;  4KWL A;  4CPB A;  1DG6 A;  3B7M A;  2IVJ A;  3O1U A;  1BBT 2;  1UY1 A;  2RS3 2;  2BBA A;  1BMV 2;  1PO1 2;  2Y6K A;  4YW7 A;  4COU A;  3UGG A;  2PN5 A;  1ULE A;  3D8C A;  3OB8 A;  3ZFE C;  3VZL A;  3HIF A;  1O59 A;  5HBA A;  4QXK A;  1QJU 3;  1ZRI A;  2OT7 A;  1UD1 A;  1ASJ 1;  3NKG A;  3WD5 A;  3VHO A;  4CUA A;  4F83 A;  1OA3 A;  3A7Q A;  1VAV A;  3R05 A;  4KI5 M;  2GNM A;  3POJ A;  2KA3 A;  5JSO A;  5LWB A;  2Q8O A;  1HJF A;  1DQ4 A;  4M4R A;  4HZF A;  1HV1 A;  2YBS A;  1SEF A;  4ISR A;  4LTA A;  1RUE 3;  2RR1 2;  1POV 3;  5CIR A;  5A7W A;  3WXP A;  5J7M A;  5FMB A;  3HOB A;  2XB6 C;  1OF3 A;  2XVG A;  4JX0 A;  4UW6 A;  2VOX A;  4IEZ A;  3AKR A;  2HLE A;  4BQ1 A;  3PUA A;  2JG8 B;  3SIS A;  1D4M 2;  4A6O A;  3EB7 A;  1GNY A;  3ILF A;  4FI9 A;  4COZ A;  5A3U A;  3LIG A;  1E5R A;  4JRL A;  1AL2 3;  1R09 3;  3OY8 B;  1LTE A;  3IKW A;  4Q4W 1;  4DY3 A;  3GNE A;  3MZH A;  3SCF A;  3ST7 A;  4YGC A;  3SNM A;  3SXW A;  3WF3 A;  1W8O A;  3I3E A;  3KS7 A;  1BHG A;  1OA4 A;  4QX0 A;  5T50 A;  4QHB A;  4Q2F A;  3U11 A;  2Z69 A;  4Q27 A;  1AR6 2;  5I8Y A;  1Z7S 1;  4ET7 A;  4S2F A;  5FK8 A;  5JLV A;  3SKV A;  5BV6 A;  3VD5 A;  1NXM A;  1XE0 A;  2JDH A;  2UWA A;  1MZF A;  2Y26 A;  1MQT A;  4FPL A;  4P00 B;  4R9A A;  4XIL A;  5IW0 A;  1RB8 G;  2C0Z A;  4QPI B;  2IXJ A;  4NPR A;  4HN1 A;  4YVW A;  5LEJ A;  1VBB 2;  1XE7 A;  1AR9 1;  4CRQ A;  5JOY A;  1ZRD A;  5FY0 A;  1DIW A;  3WR0 A;  4GXL A;  4MHR A;  3I49 A;  1G6N A;  1V6K A;  4C0B A;  3DL3 A;  3PUI A;  5J3U A;  3O5S A;  4MVT A;  1SLI A;  4AQ6 A;  4UWD A;  1YQ5 A;  4XC9 A;  2QQV A;  2W0X A;  4A41 A;  1AZD A;  5FMO S;  4FP3 A;  4A3X A;  1DZQ A;  3OD4 A;  3I3B A;  1CR7 A;  4MGS A;  4C90 A;  2WN2 A;  3H1W A;  4NAM A;  2PMW B;  4PT6 A;  4NID A;  3C2U A;  4XAA A;  1NXD 1;  4K8F A;  1BYH A;  1N1Y A;  1PVC 2;  3DYP A;  3I2G A;  4PIX A;  1TEI A;  3C7F A;  4QXC A;  4XFG A;  3BU0 A;  2RMU 1;  2VNR A;  4W50 A;  3THT A;  1FX5 A;  1EYB A;  2I74 A;  5FPL A;  1V6N A;  3VZJ A;  2P6H A;  3J7H A;  1TZO A;  3WUD A;  3VBO C;  2WFP A;  5FZO A;  2P3J A;  1NCQ A;  1JZ8 A;  5D8A A;  4IEU A;  4Y1Y A;  3LSD A;  3B02 A;  5LEK A;  5I0U A;  3KV5 A;  2VME A;  2A3X A;  2D6L X;  4CP2 A;  3OGR A;  1IS6 A;  1W06 A;  1W2T A;  4JV4 A;  4LBK A;  4TLF A;  4YFW A;  2ZGU A;  1MZ6 A;  3T4H B;  5JAX A;  1RVF 2;  3D3A A;  3JBG 2;  2Y34 A;  4FXK B;  4E27 A;  3VBS A;  4LKF A;  1DQ6 A;  4DRR A;  5DUX A;  1I3H A;  4RHV 1;  4QPG C;  5F3C A;  3R6S A;  1X8E A;  1J1T A;  3CO2 A;  4DO0 A;  2H6C A;  2JB4 A;  4Y1X A;  5IAV A;  1DLC A;  1H2K A;  3O14 A;  5IVE A;  1MR5 A;  4HL0 A;  3SEE A;  1FMD 1;  4QB1 A;  3RYP A;  4OUL A;  5FZ1 A;  1QXR A;  3KQR A;  3MPP G;  1HRI 3;  4MGI E;  3LEM A;  5F5A A;  2VOV A;  1HRV 2;  2JE8 A;  2LM3 A;  3GBF A;  1C3H A;  4CU9 A;  4I3G A;  3NNJ A;  4FPJ A;  1MEC 3;  4AZZ A;  4D6S A;  2D6O X;  2J1E A;  1QWR A;  1YJK A;  1XNA A;  1QXP A;  1BEV 1;  2J1S A;  2WWJ A;  1IS5 A;  3UL2 A;  1ND2 A;  3BIW E;  1UL9 A;  4XF1 A;  2XDV A;  4BQ3 A;  4S2D A;  3KGL A;  2AGS A;  2HWF 1;  2G4I A;  3AZW A;  1Z78 A;  4QDR A;  4O7X A;  1TMF 2;  1BXH A;  1W6P B;  2X8K A;  4LKS A;  4I30 A;  4TN7 A;  3NAP B;  3WP3 A;  5EFU A;  1JZ5 A;  3ETP A;  4XPV A;  4COV A;  4QKB A;  4F3J A;  1ASJ 3;  2WAA A;  1XB9 A;  3IPV B;  4A3Z A;  4HAN A;  4XUO A;  4DXT A;  2VNG A;  5J36 A;  4ZU4 A;  4FTS A;  1RMU 3;  3IDC B;  2VBD A;  4KMQ A;  3U07 A;  3VKN A;  1L7L A;  1LGB A;  2FZ2 A;  1O5U A;  3BAL A;  5ACA 2;  1NY7 1;  2PHX A;  4GKX A;  2ZGM A;  1XBF A;  2A6Y A;  4UOJ A;  3RI8 A;  4CEY A;  4CE8 A;  4FSJ A;  1K42 A;  2KM2 A;  2LAL A;  1DP0 A;  1MAC A;  3FFQ A;  2ZAH A;  2PHT A;  2PLV 1;  3U10 A;  3HQU A;  1A34 A;  2X05 A;  3KQ4 B;  2HEW F;  2DCK A;  4E8D A;  3ZFG A;  1SAC A;  1VAM A;  4Q4W 3;  1VIW B;  2BU9 A;  3T2T A;  1NAE A;  2WQ4 A;  3MGU A;  4UAP A;  1R08 1;  3CNA A;  4IL7 A;  3UGH A;  5C7G A;  2KXL A;  1EAH 2;  1BBT 1;  1XYN A;  2B9V A;  1C28 A;  4N8M A;  2RS3 1;  1CAU B;  3QH6 A;  1BMV 1;  4PLO A;  1PO1 1;  4D0Q A;  3WSO A;  5AC9 2;  2HKX A;  1VRH 2;  3POY A;  1QXJ A;  2IC1 A;  5CBL A;  4XIO A;  3FHQ A;  5EJZ B;  5JR7 B;  4R4X A;  2JDK A;  1WGP A;  1H2L A;  1MQT C;  1MZ5 A;  1QDO A;  5LAT A;  5KHG A;  3O1P A;  3GZE A;  3H8X A;  5JSR A;  3T1L A;  4CPB D;  1BQP A;  4OCT A;  1O3Q A;  1AR9 3;  3GAL A;  1APN A;  2PXJ A;  1LOG A;  3A21 A;  2EA7 A;  2XON A;  3Q8E A;  4H2A A;  4XQD A;  2VW1 A;  1UKG A;  3N36 A;  4IDZ A;  4UW5 A;  4EE2 A;  1UY3 A;  1S0B A;  1QDC A;  1HXS 2;  4JDO A;  2D3R A;  4BU2 A;  5FYB A;  4UBG A;  2WZP P;  5HXM A;  2RR1 1;  3T0D A;  3WUC A;  4R9D A;  3HBZ A;  5AFB A;  3UYJ A;  1LOA A;  2LTN A;  4L8Q A;  4OHZ A;  1RED A;  1YQ8 A;  1D4M 1;  2PAK A;  3FE5 A;  2OII A;  4XBN A;  4XDP A;  3DGT A;  2QQI A;  3H7Y A;  2DWR A;  2JDU A;  2BTV C;  2Q1Z B;  2RMU 3;  3T30 A;  4CCL A;  4GB3 3;  1PMH X;  2WT2 A;  3JQW A;  3O1R A;  1MS3 A;  1W6Q A;  1NCQ C;  5D8A C;  3AXD A;  2AYH A;  4R8H A;  1CAV B;  5KWR A;  3A23 A;  5JPN B;  1AX0 A;  2VZT A;  3RZL A;  4AEM A;  1J84 A;  2DUO A;  2B42 B;  4FP2 A;  5C6C A;  5C3O A;  3F2Z A;  2DCZ A;  3VBS C;  5FLJ A;  3H42 B;  4FVV A;  3AL5 A;  2BV4 A;  4IGP A;  4RHV 3;  1VBB 1;  4YVS A;  5FZ8 A;  3U1X A;  2R07 2;  2RM2 2;  5LW9 A;  5FTT C;  1XC6 A;  3MLJ A;  5FZ4 A;  2ZGR A;  1JYN A;  4M3C B;  2ZGK A;  2QVS B;  5IVB A;  1HW5 A;  4LO4 B;  4AI8 A;  1QEX A;  4BK4 A;  4AI9 A;  3E6C C;  4NIG A;  1ODM A;  2VW2 A;  4QM8 A;  3BKZ A;  1J3P A;  1XSQ A;  2D3P A;  3VL9 A;  4LHS A;  2IFW A;  3T0A A;  4YG0 A;  2VZR A;  4Q0Q A;  3VV1 A;  1ZRR A;  4K20 A;  4YSF A;  1LB2 A;  2PHW A;  2VMI A;  1W2A X;  2D97 A;  2VZP A;  4GD4 A;  4LUK A;  3IDA A;  3ATG A;  1PZ8 A;  5FJK A;  5LA2 A;  4D7Y A;  4BM8 A;  1GZC A;  3P3N A;  1PVC 1;  5DZG A;  4MGK E;  4CUG A;  4YRD A;  3WIN E;  2BNM A;  3I54 A;  4RFT 0;  1GLH A;  2PHU A;  4P9G A;  2UYA A;  3LIH A;  4UF0 B;  2JG8 A;  4LOR A;  4AFM A;  1BEV 3;  1LOC A;  3ACG A;  4RR3 A;  1SLA A;  1ND2 C;  2RDQ A;  1JU4 A;  2PAM A;  2JJ6 A;  2LUW A;  2P2K A;  2W08 A;  5L73 A;  3OY8 A;  2HWF 3;  3FLP A;  2WO2 A;  4FCA A;  3VL8 A;  4C0H A;  5G05 L;  5FP3 A;  1RVF 1;  2C1F A;  3JBG 1;  4GUL A;  1QKQ A;  4RD7 A;  4BQX A;  5IK7 A;  4L99 A;  1I6X A;  3ZXG A;  2VZ3 A;  3SLI A;  3LAG A;  3N7K A;  2Y6G A;  2DUR A;  4AVS A;  2FDG A;  3NJZ A;  1PO2 2;  4CP9 B;  5CG9 A;  1CIY A;  4XJW A;  3B9C A;  4WVZ A;  2RS1 3;  1E5I A;  2P17 A;  2WZR 2;  4KGQ A;  4LA3 A;  4Y22 B;  1BCX A;  2RE9 A;  3NV3 A;  4AHY A;  3FZ3 A;  4GMP 1;  3MFC A;  3WLU A;  2DFC A;  1VJ2 A;  5EXO A;  2GAL A;  4CEY C;  5FZ9 A;  3FBM A;  1O6U A;  4KG0 A;  4R52 A;  2XKP A;  1TNR A;  3UJQ A;  2R06 3;  3GHM A;  3BTZ A;  2PLV 3;  3PVN A;  3S6P A;  3HAG A;  1V0A A;  4NR1 A;  3N3H A;  1HRV 1;  2E7Q A;  3SH3 A;  4ARX A;  5A3T A;  2W9X A;  3CLP A;  4HFS A;  3ZFG C;  2L9L A;  3AMN A;  3L2Y A;  5FPB A;  3VBO B;  4B7K A;  3KCC A;  4IE4 A;  2W1Q A;  2P4E A;  1R08 3;  1XND A;  2WYF A;  1EPW A;  1CD3 G;  1J59 A;  1WCD J;  4KWJ A;  4Y1U A;  1E5S A;  5DAP A;  2VQA A;  1BBT 3;  4RN5 A;  1CAW B;  2JDP A;  2RS3 3;  2JE9 A;  5A3W A;  1PO1 3;  1TMF 1;  3ZR5 A;  3MI8 A;  5FY5 A;  1R64 A;  3FBY A;  3GGL A;  3H0O A;  1KFU L;  3GCW A;  1MS1 A;  2Y8K A;  2VR4 A;  4QPG B;  1PX3 A;  3GYD A;  3M70 A;  1SLT A;  3NJV A;  2GNB A;  1NYW A;  4BLJ A;  4XVH A;  1UQX A;  5EHD A;  2PEL A;  1Q8S A;  5T5P A;  2E9Q A;  5FZG A;  1H8T B;  4O9G A;  4B4R A;  2BNN A;  1AJO A;  2UWC A;  5ACA 1;  2YFU A;  5I0D A;  1CX4 A;  3NNG A;  1AL0 G;  2VUD A;  1CAX B;  4LK6 A;  4QPW A;  4AGV A;  5C9A A;  2FMD A;  1PGW 2;  2RVA A;  2VMG A;  2VTX J;  5EYX A;  3D0J A;  5EJ1 B;  1UCX A;  2J42 A;  2QQJ A;  3ECQ A;  4D69 A;  5F37 A;  5L7O C;  4NHY A;  3N7J A;  1D4M 3;  2WC2 A;  4P9W A;  1KQR A;  4CYD A;  1VR3 A;  5JOZ A;  3ZKU A;  4Z92 B;  1Q8P A;  4HKL A;  5FRE A;  2R04 2;  3M2M A;  5AVA A;  3AKP A;  3M7A A;  1O7F A;  1EAH 1;  5FY7 A;  1UY4 A;  2CHH A;  2DCJ A;  5HCB A;  4CEW B;  4ASL A;  1Y4W A;  2X53 S;  4Q0P A;  4AAP A;  1VMJ A;  1J58 A;  5AC9 1;  1VRH 1;  4PCR A;  5DDJ 2;  5FKC A;  5LB6 A;  4ITC A;  3N4M A;  2VTF A;  2F17 A;  1LNS A;  3AP9 A;  3GBG A;  4U36 A;  5EWS A;  3T08 A;  2ZKL A;  1Q3E A;  5APA A;  4Y1Z A;  4C8D A;  4QQP A;  1W6P A;  5FQ0 B;  5LBE A;  1O3R A;  2G1M A;  3RZK A;  4YVS C;  1VBB 3;  4AHX A;  1UO9 A;  2NYY A;  1L3J A;  1MS5 A;  4Q0S A;  4P9X A;  5L36 A;  2QE3 A;  1HXS 1;  3IPV A;  5GZG A;  2GC0 A;  3SEP A;  5FXX A;  5TSW A;  1JUI A;  2BBV A;  4Q29 A;  4P02 B;  5FLI A;  5DAW A;  5SV8 A;  1NCR A;  1YC6 1;  3OJB A;  3PU3 A;  4GKY A;  3ZXD A;  1LEC A;  1UZW A;  4UFL A;  2DTW A;  2PAE A;  3I4I A;  5DUW A;  2QZ2 A;  5EQU A;  5CFC B;  5JZG B;  1UMZ A;  2PHD A;  3G7D A;  4CP0 A;  1HN0 A;  3H50 A;  4TWT A;  4CVU A;  1PVC 3;  1K3I A;  4NRM A;  2E31 A;  3W9A A;  2W5F A;  2XJV A;  4LIV A;  3FUQ A;  1W0P A;  4NO4 A;  4IEQ A;  4D94 A;  3ZSK A;  2BGO A;  2JG8 C;  4OI0 A;  1F4H A;  1AVB A;  1GWK A;  3J7N A;  4RR3 C;  3TBD A;  3WNK A;  3DXT A;  3WNM A;  1EUT A;  2WAO A;  2BRT A;  4NHL A;  4OUS A;  4XFH A;  5FV3 A;  2XOM A;  1HLC A;  1YQ6 A;  2BUK A;  3UJO A;  2H6B A;  2QTW B;  2W2I A;  5C3P A;  1DHK B;  5DZF A;  1RVF 3;  3JBG 3;  5FZB A;  4B4P A;  5FOB B;  4SBV A;  2VU9 A;  1CAU A;  2RDR A;  3DEC A;  5GZC A;  2EIC A;  3VKM A;  2XLG A;  2TBV A;  1AR7 2;  2R07 1;  4GAZ A;  4W6X A;  2YBP A;  1UOG A;  2R1B A;  3QCW A;  1TG7 A;  4L97 A;  4NMI A;  3NQH A;  1V9U 2;  4R9C A;  3OPZ A;  4ZZ5 A;  3AFG A;  3LA2 A;  5A80 A;  1W28 A;  1ZBE 2;  3OPW A;  2XHK A;  3POB A;  4FTB A;  4GMP 3;  5JXG A;  2ZML A;  1VB4 A;  3PVB B;  1NZI A;  1YFU A;  2BQP A;  4OI2 A;  4QQL A;  1SCS A;  3TNQ A;  4AAX A;  3NW4 A;  2P34 A;  2WA4 A;  3INA A;  4AOC A;  2NM1 A;  1HRV 3;  1BZW A;  2HBU A;  2PYT A;  4PLM A;  1TE1 B;  1M4W A;  4AR2 A;  5JMO A;  3TEZ A;  5FZO B;  3RFR A;  4ES8 A;  1NCQ B;  4K1Y A;  5D8A B;  1J83 A;  4JGY B;  1X50 A;  2JDA A;  3O0V A;  4XIK A;  1XE8 A;  3NNF A;  4JHZ A;  5IAT A;  1XNT A;  3CJX A;  1CJP A;  2IXI A;  1WZX A;  2BVV A;  3AFK A;  3ZXE A;  5LA0 A;  5A7Q A;  1WW6 A;  3I2O A;  5CZK A;  2J22 A;  5IK8 A;  3BOD A;  5D2A A;  1TMF 3;  3MF6 A;  3VBS B;  3LZZ A;  2YB7 A;  5FXV A;  2Y33 A;  2JEM A;  4X6Q B;  3FLT A;  1L7R A;  1MVQ A;  1CAV A;  1WWY A;  1XYO A;  1X7N A;  4UT5 A;  4Y20 A;  4W8J A;  4AW7 A;  1LEM A;  1PO2 1;  1REE A;  2GZW A;  2IZW A;  2NLR A;  3GBW A;  4IES A;  4L2N A;  4P9J A;  4RGK A;  1GIC A;  1JZ4 A;  4QX2 A;  2WT0 A;  2D6K A;  2XJS A;  1E57 A;  2WZR 1;  4DEV A;  1OFS A;  2VXR A;  5ACA 3;  4LA2 A;  3I3D A;  5T55 A;  3H3U A;  1DQ2 A;  1OPO A;  5C9A C;  1Q8V A;  4P9L A;  3IBM A;  4M3C A;  1AXK A;  3W5N A;  3UES A;  3Q8B A;  3H8U A;  3JB8 A;  4FFI A;  1H30 A;  1CZS A;  4HSL A;  3HJR A;  4MG2 A;  3E6B A;  1KGY A;  3I2I A;  3IZO A;  3URF A;  5FLH A;  3J7L A;  4ZS2 A;  3GXU A;  3VDD B;  1GZW A;  1VBA 2;  4DXS A;  3SCG A;  4HG6 B;  4XMA A;  1ND2 B;  3FLR A;  1W90 A;  2VC9 A;  4MV2 A;  4QX3 A;  3MLL A;  4LNV A;  4XUQ A;  3LKJ A;  3PTR B;  4FOQ A;  3JUU A;  4GZ9 A;  3RQ0 A;  3TWI A;  1ZRC A;  1EAH 3;  3ENR A;  3IN9 A;  3KM5 A;  2ZOE B;  3PIG A;  3WEZ A;  2HEY F;  1CN1 A;  1F9K A;  5CAD A;  1ULF A;  4H7L A;  3MW3 A;  1VP6 A;  4CDX B;  1PGS A;  4YZ1 A;  5AC9 3;  3BUC A;  1VRH 3;  5JZG A;  3WW4 A;  1JYW A;  4G4F A;  3BOP A;  4H7M A;  1UX7 A;  4HT1 T;  4IET A;  1JW6 A;  5DUU A;  1SBF A;  2VW0 A;  4D3W A;  3WQ1 A;  3AX4 A;  5F3I A;  4XFF A;  3C7H A;  3A0K A;  2B9U A;  1YI7 A;  3M3E A;  3RI9 A;  3KV6 A;  1S2E A;  2JDM A;  1YJL A;  4OQ9 A;  1GQG A;  4JTN A;  3U78 A;  1HXS 3;  1IPJ A;  2YU1 A;  1NCR C;  3T0B A;  4CP9 A;  4AVV A;  3O1V A;  1PGW 1;  2V5Y A;  5JIU A;  5A70 A;  1OOP B;  3ZFG B;  3BGA A;  1PK6 B;  4Y22 A;  4YYO A;  3WF4 A;  4NOT A;  5D21 A;  4CCN A;  5HV0 A;  5JOX A;  2ZHL A;  2WYS A;  2UY9 A;  3D4K A;  3OTF A;  1CPM A;  1O4T A;  1OVP A;  4LO7 A;  5A3P A;  1DU3 D;  4Y26 A;  5FXZ A;  3VBR B;  2R04 1;  2B39 A;  2JDN A;  4FAG A;  5A6Q A;  3DN7 A;  2VQT A;  2ZKN A;  1FV2 A;  3DXU A;  3K4D A;  4LHN A;  2D3S A;  2R30 A;  2ENR A;  3OBZ A;  3QAC A;  2HBT A;  3KD4 A;  1A6C A;  1GFF 2;  1GP5 A;  1SZB A;  2GP5 A;  4BPZ A;  4LIU A;  2OYZ A;  5DDJ 1;  1K12 A;  4ZON A;  1JOP A;  3N7L A;  2JG9 B;  2E26 A;  5LA9 A;  3SH5 A;  4BQ4 A;  4C1X A;  1DQ5 A;  1W39 A;  3KHB A;  5JI9 A;  1S0E A;  1K45 A;  2YUE A;  3MUY 1;  2TEP A;  4B1M A;  3P6B A;  2W52 A;  3Q8C A;  5IHR A;  1HJG A;  1XU1 A;  1ZZ8 A;  2R07 3;  2RM2 3;  2ZEX A;  4L92 A;  3ZXF A;  2ZX0 A;  3IIA A;  1FNZ A;  2QQU A;  4XJU A;  4XDQ A;  5C71 A;  4UYB A;  5J09 A;  2C24 A;  4ORF A;  5F32 A;  5L7O B;  3IT8 A;  1HQW A;  2DTY A;  4EZ4 A;  1H8T A;  1ENS A;  4BWO A;  3MEP A;  1XQN A;  3BVC A;  3ON7 A;  1CAX A;  2G9G A;  3UV9 A;  1OQD A;  2A7A A;  2YPD A;  3K3N A;  4JKK A;  1HN1 A;  5GZE A;  5T5L A;  1YCI A;  1ZYB A;  2GH8 A;  1W9Y A;  2J1A A;  1AR8 2;  5A33 A;  4EN8 B;  2YG0 A;  4HKO A;  2IXL A;  4NHK A;  2GNT A;  2I45 A;  4WVM B;  4YW2 A;  1XYP A;  1Y43 B;  4ZZ8 A;  4HPK B;  2AAC A;  4JCK A;  4F7Z A;  2BW8 A;  4YAR A;  1QQP 2;  1VBD 1;  2VMF A;  1SFN A;  1WW5 A;  2WQ8 A;  3C8X A;  5A6Z A;  4E2S A;  3IDE A;  3ASI A;  3CJI B;  3LDB A;  4YVS B;  5FZE A;  4CEW A;  3AYD A;  2QQK A;  2V73 A;  4LO5 B;  1UWW A;  3ETQ A;  4BMB A;  4BYY A;  1YXW A;  1PO2 3;  1AR7 1;  1RIR A;  1JZ6 A;  2QUO A;  3HQR A;  3OUI A;  2LRP A;  1UU5 A;  1V9U 1;  2GAU A;  1KD7 A;  2P3I A;  2VOW A;  2JB8 A;  1SLB A;  2WZR 3;  2ZGN A;  3EXU A;  2DVB A;  5A1F A;  5FQ0 A;  1ZBE 1;  4XJ9 A;  1SBD A;  3K3O A;  4RA0 A;  1RUC 2;  2A6X A;  2DYC A;  2WT1 A;  4NAO A;  2V4V A;  1HIX A;  3GDB A;  5IVC A;  3IB3 A;  1FXZ A;  1S2K A;  2YC4 A;  1W99 A;  1QHD A;  3SIT A;  1ENX A;  2MNG A;  1OI6 A;  4RR3 B;  3O1M A;  3M3C A;  4X8N A;  5J96 B;  1X9P A;  4BB3 A;  2D93 A;  1LHO A;  2XHN A;  5CFC A;  3CMG A;  4D6R A;  1UZ0 A;  1QJF A;  4FPO B;  1LES A;  1H4H A;  2WR9 A;  3H1Y A;  2RV9 A;  4RSU A;  1GOG A;  2QQM A;  2XVL A;  3ZXL A;  1OD3 A;  5E1R A;  3LDK A;  4XF3 A;  4ASK A;  1WCU A;  3AMH A;  2I07 B;  1U5I A;  5JZG C;  2AUY A;  2YXS A;  2E33 A;  1AYM 2;  1JS9 A;  4GWJ A;  2D5F A;  4Q8K A;  1KS4 A;  3WVJ A;  3Q8F A;  3QOP A;  4RGA A;  1JU3 A;  3ILN A;  3AZZ A;  4FOV A;  3SKJ E;  1JYX A;  2ZX3 A;  1W2O A;  3ABZ A;  1W8F A;  4XXA A;  2W1S A;  3KHC A;  3DEM A;  1JYT A;  5FUN A;  3ALQ A;  4Q4V 2;  1UXX X;  1STM A;  2ARX A;  4YLZ A;  5FP9 A;  1VMH A;  1NLS A;  2JKB A;  2OS2 A;  1XU2 A;  1DF0 A;  1UOB A;  1LHW A;  2GC2 A;  3AXE A;  3FWE A;  4FBF A;  4XXP A;  3LEI A;  2FDJ A;  5EYY A;  4ZHN A;  1GYK A;  3USU B;  3T3Y A;  4H14 A;  3RYR A;  4WZC A;  2W94 A;  1UW8 A;  3TEW A;  2UYB A;  5I8S A;  5DUV A;  4Q8L A;  2FCV A;  2XKO A;  5AVP A;  5FZF A;  3BPZ A;  2ZGP A;  4P14 A;  4IW3 A;  1VBA 1;  4QGM A;  3ELN A;  3U75 A;  1JOJ A;  1DYO A;  3S57 A;  4XBL A;  4IV1 B;  2WLP A;  4XTP A;  1V00 A;  1F35 A;  3LF7 A;  5E88 A;  5CVR A;  1IQA A;  1C1L A;  1NUK A;  1C8N A;  1V6I A;  2R04 3;  3LGR A;  4PJY A;  1PMI A;  3MHZ A;  4MHU A;  3KCY A;  2XQX A;  4P08 A;  4URT A;  4K21 A;  1OMI A;  4JGY A;  4M4P A;  2WSU A;  5DDJ 3;  5KHK A;  1XRU A;  5F5Q A;  1O3S A;  5IYY A;  2GND A;  1VBC 2;  5EZW A;  1RIT A;  3VBH A;  5KC5 A;  3NV4 A;  4CU8 A;  2J1U A;  4BCU A;  1SLL A;  1RGS A;  4HVR A;  3RGB A;  1JYI A;  5FR3 A;  2W1W A;  4JRA A;  1WME A;  3JQX A;  3WP4 A;  2ZEZ A;  5C9A B;  4ZU5 A;  5A3M A;  2EIB A;  2A1X A;  4CCO A;  5A3O A;  3H3L A;  2VAU A;  3KZ4 C;  1Z0H A;  2YGM A;  2Q1M A;  3OD0 A;  1JXN A;  2TUN A;  3CHX A;  3GHN A;  2X5I A;  2YHJ A;  1H8T C;  1H6Y A;  2O1Q A;  4QU1 A;  5FZC A;  4NII A;  4LBO A;  5FUP A;  4M3C E;  1YWK A;  2RS5 2;  3N9Q A;  3P3P A;  3OBA A;  5FZH A;  4E4H A;  1HB2 A;  2YRO A;  4QDQ A;  3OEB A;  5A6Y A;  4EWD A;  1TQ5 A;  1MPX A;  2QDR A;  1WCK A;  1H9P A;  1H8V A;  2VD7 A;  5FPV A;  4DEQ A;  3WOG A;  3VDD A;  3J7M A;  1V6J A;  4J6G A;  2Q0A A;  3AYC A;  5F39 A;  3OBR A;  4XFC A;  4EV0 A;  1NT0 A;  3III A;  4FTE A;  2P37 A;  2E53 A;  2YGL A;  2Y6F A;  2YC2 A;  1RHI 2;  3I59 B;  4LEJ A;  2CV6 A;  2WFF 2;  1IKP A;  3VD3 A;  1KIT A;  2BOI A;  2UY8 A;  3IM0 A;  4CEW C;  4CDX A;  4AVA A;  3RMX A;  5FZ0 A;  5BNP B;  3MW4 A;  2VQ0 A;  3ACF A;  3KF3 A;  5IUQ A;  1AR7 3;  3ZLI A;  4RGG A;  1MS4 A;  2HWB 2;  4WM7 B;  4FQ4 A;  1V6O A;  1V9U 3;  1NCR B;  5FWJ A;  3O1T A;  5DAB A;  1WKY A;  4LT5 A;  4DNY A;  5FYH A;  1ZBE 3;  3BTA A;  3T2O A;  1N3P A;  1B09 A;  3R4U A;  2IFR A;  5FDB A;  4MLO A;  3VGI A;  1H0B A;  3LCP A;  4BOW A;  4C1W A;  4EZH A;  1GOH A;  4EN0 A;  5JMC A;  3KVA A;  3RWK X;  4BZ4 A;  4Y4Y A;  1XNC A;  3CKH A;  3TRS B;  1LUL A;  2WBK A;  3BB6 A;  1VBE 2;  1N1S A;  5CU1 A;  2RJ2 A;  3J26 N;  2QZ3 A;  4O65 A;  2QKD A;  4RS5 B;  3B5L B;  4SLI A;  4XHB A;  1AJK A;  1SLC A;  2YV8 A;  2EXJ A;  1OOP A;  2P3K A;  1PK6 A;  1YHF A;  5CFC C;  1AR8 1;  1N3Q A;  5FCC A;  5E8A A;  1YFW A;  1RXG A;  1YI9 A;  2P1B A;  4J1W A;  2XUM A;  5GKA C;  1QJZ A;  2FHR A;  4GJZ A;  4AWD A;  4NE9 A;  3KWV A;  4IEW A;  2R0F A;  3POW A;  2ZEW A;  4K40 A;  4Q5O A;  5BXX A;  1U0A A;  4AVC A;  4COY A;  1RUI 1;  1AR6 1;  4CZS A;  2J7M A;  1QQP 1;  3VLB B;  5JWP A;  3VBR A;  4HVO A;  3T2Q A;  4FPF A;  4LBQ B;  2BDR A;  1Z7S 3;  2D6P A;  5AFE A;  4OHY A;  1ULO A;  1BVP 1;  5FZ7 A;  1HKD A;  1QOS A;  3EJK A;  4E8C A;  4Y3O A;  3OUH A;  2JKX A;  4YW6 A;  3VBF B;  2OPW A;  1QF3 A;  2OZJ A;  4A7Z A;  1ZM1 A;  1UNB A;  2BFU L;  4Q0U A;  3TB0 A;  3M4F A;  2JG9 A;  2ORZ A;  3PME A;  1BLZ A;  3DV8 A;  4YGD A;  4CCM A;  2OXB A;  3MYX A;  4IEV A;  1OC1 A;  4UFI A;  3AYA A;  1WMD A;  2CSG A;  1XJA A;  1XNB A;  1RUC 1;  2XLF A;  4QB2 A;  5LK5 A;  2OQ6 A;  3VD7 A;  4H3W A;  1K5M B;  2VPV A;  4OMD A;  1ZNP A;  3PMS A;  4PF1 A;  4X8P A;  5CYY A;  2OKX A;  5L7O A;  3ZYG A;  1VBA 3;  3OUJ A;  4ONU A;  4BQ5 A;  4EN9 B;  4QGL A;  1W6N A;  2B8M A;  4V1P A;  4HVQ A;  4S2G A;  2MPF A;  2E32 A;  2GP3 A;  2DU1 A;  3AM2 A;  5F7U A;  2JIC A;  2HYK A;  5J98 B;  2XL7 A;  3DKW A;  3WNP A;  3C7E A;  2XL9 A;  3B69 A;  4XF4 A;  3ZOI A;  2XJR A;  4JGY C;  1QIQ A;  2J1V A;  3M3I A;  1W8T A;  1ND3 B;  2FD8 A;  2NQY A;  4FPG A;  1AYM 1;  4WVM A;  4Y20 B;  3WNO A;  4DIN B;  2V5D A;  4HPK A;  3VBH C;  2OUJ A;  2CNA A;  1RYY A;  5KHI A;  4LOS A;  5KXE A;  3WF0 A;  4QGN A;  4LUM A;  2EXH A;  2WNU B;  4HET A;  4BH9 A;  1W2N A;  5FOJ B;  1O8S A;  1GR3 A;  4Q4V 1;  3CJI A;  4LQR A;  3P5B A;  5DQ0 A;  1US2 A;  2VVF A;  3AMQ A;  2A71 A;  2D6N A;  4F8A A;  4LE4 A;  1MZE A;  4B7E A;  1O3T A;  2ADE A;  1F4A A;  2X5I C;  3Q9O A;  4N53 A;  1VB2 A;  4W4Z A;  1FMD 3;  1OLQ A;  3C7G A;  1F5F A;  1GZW B;  4XAB A;  3VUO A;  5LZ6 A;  1BK1 A;  3IAP A;  2WS9 2;  3U4S A;  2FDF A;  1HQL A;  3MV0 1;  1IHM A;  5LK7 B;  3NNM A;  1V6M A;  1QJE A;  4UW3 A;  1VPH A;  1IPK A;  5JOW A;  4HMZ A;  1P8J A;  2GDF A;  2BP6 A;  3H3Z A;  2VNO A;  2VUA A;  3VDD C;  5C4W B;  1LJ7 A;  4K3U A;  1UOF A;  3NKT A;  5C3Q A;  3KV4 A;  3CBN A;  4IV3 B;  5FYI A;  1GP6 A;  1D0G A;  4QM9 A;  4L0P A;  2BOJ A;  2D44 A;  4ASM B;  1WLD A;  3PLQ A;  2JD4 A;  2C6S A;  2YBK A;  3M3O A;  3NST A;  1LOF A;  5HV4 A;  1ZZC A;  1VBC 1;  1SPP A;  2XH6 A;  2A3Y A;  1X82 A;  4CDX C;  1YNA A;  3OF1 A;  5GAL A;  5ANQ A;  5GLU A;  3DPR B;  5L9V A;  3FJS A;  4YFZ A;  2CAV A;  4P9I A;  2WQZ C;  4XOG A;  3IMM A;  1SFY A;  2VCA A;  4QPY A;  3WF1 A;  3ZYH A;  3KT7 A;  1KXG A;  4Z2W A;  1JH5 A;  3OYW A;  1O5L A;  4PIY A;  4R9B A;  1CGP A;  1Q56 A;  4MYE A;  4KWU A;  4FXG B;  1W8W A;  4CDW C;  2RS5 1;  5FZ3 A;  1RUD 2;  4OZO A;  3W21 A;  4XE9 A;  2SLI A;  3NV1 A;  5BYN A;  3USU A;  1S4C A;  5IWF A;  4BDV B;  4YW3 A;  1UXZ A;  2ETE A;  1OOP C;  4D7T A;  4EWA A;  1QJU 2;  1N1T A;  1PK6 C;  5EJ3 A;  3RPQ A;  3VKL A;  4OUE A;  1AR8 3;  1OKO A;  1D4V B;  2BYV E;  1QOO A;  2MHF A;  3B3Q E;  4WM8 A;  2UUR A;  1U5X A;  5FP8 A;  4HBN A;  3A0N A;  4HOO A;  2A6Z A;  1NE4 A;  2VMC A;  1QQP 3;  2ZHK A;  4IV1 A;  3N9P A;  3VBR C;  5BNO A;  1UN1 A;  4Y1V A;  1DCS A;  1RHI 1;  1T6B X;  3BIE A;  4UI9 L;  3OBT A;  2WFF 1;  1AX2 A;  2W68 A;  3V0B A;  5IT6 A;  3WT3 A;  1QJX 2;  1W6O A;  2DUQ A;  2VG9 A;  4U2A A;  1FAY A;  4MUV A;  3THP A;  4X6R B;  1IGO A;  3X29 B;  1DGW A;  2CGN A;  4DY5 A;  4CU6 A;  3DYM A;  1KJR A;  2JG9 C;  2HWB 1;  1REF A;  4LHL A;  3NO8 A;  4NRQ A;  4OZX A;  5HXV A;  3S7I A;  2VOT A;  4CTE A;  5GJ6 A;  3ZYB A;  1FOD 1;  3E5U A;  3PVE A;  3WG1 A;  5KXC A;  1RUC 3;  1OBN A;  1JZ3 A;  3FHI B;  2RR1 3;  3W58 A;  1ENQ A;  3KGZ A;  5GLT A;  2G9Z A;  3AB0 A;  5A7O A;  3HN1 A;  4IGQ A;  3VHR A;  2BNO A;  4XUR A;  2ZJC A;  3USS A;  5A33 B;  1OLR A;  1VBE 1;  4IEY A;  2H0B A;  3KB5 A;  1N3O A;  2VCM A;  2F4L A;  2E6V A;  4HON A;  4NJ4 A;  1WCS A;  4ZKT B;  1DZT A;  3NNL A;  1BVV A;  3PL0 A;  5I91 A;  4DXZ A;  1COV 2;  5F5C A;  4DZG A;  4BQ2 A;  1VAL A;  4Z8B A;  2VQU A;  2PQQ A;  1OD5 A;  4CDQ A;  2P5B A;  1TNF A;  1R1A 1;  1PVX A;  3I97 A;  4LBN A;  1UYY A;  2VCC A;  1XOY A;  4HK9 A;  1KEX A;  3LA7 A;  2DCT A;  2PA7 A;  1EPZ A;  1OPM A;  5FUI A;  1C5I A;  3AVS A;  2DVA A;  2ZZJ A;  1NOV A;  1AYM 3;  5EPA A;  1OQ1 A;  4Y4R A;  3VBU B;  3EBR A;  2ZXQ A;  3MIC A;  4JKM A;  4IGO A;  5LAS A;  1NLQ A;  2O8Q A;  4PQ9 A;  4HXC A;  3JB4 C;  4MAD A;  3I59 A;  3WNX A;  4CCJ A;  4XJZ A;  5DG1 A;  2Z4F A;  2D5H A;  3AKQ A;  3CJI C;  4HN0 A;  4Q4V 3;  3ZYP A;  1F8V A;  1S0G A;  1IPS A;  2NP0 A;  5K4L A;  2WZE A;  4GH4 B;  5BNN A;  2Z42 A;  2ZS6 B;  2G9F A;  3MLK A;  5H9Q A;  4AI3 A;  4BLI A;  3OCP A;  1DQ1 A;  5BNP A;  5IFP A;  2WNO A;  3W20 A;  2UWB A;  3PVO A;  4N53 C;  5F6K A;  4WM7 A;  4ERO A;  1LU1 A;  1G8W A;  1S1A A;  1W04 A;  2B4K A;  3K75 B;  4N9H A;  1LU2 A;  3H1M A;  2X10 A;  4XEZ A;  1LGN A;  4NHX A;  3OGV A;  3CL1 A;  3ZN6 B;  1ONA A;  4XDO A;  4XTM A;  3PU8 A;  4PDW C;  2YY1 A;  4YGB A;  1GWL A;  2K2S A;  5T5J A;  2XJU A;  3H9A A;  2VUJ A;  1O91 A;  3AMP A;  5KXB A;  4QKF A;  3SMH A;  4RS5 A;  4QD2 A;  2VZQ A;  1I1E A;  4IEX A;  1OVS A;  1AYN 2;  3MID A;  2OUH A;  2W87 A;  5FMO L;  2CY6 A;  4AQT A;  2QQN A;  1C8M 2;  1VBD 2;  1LOF C;  2PTM A;  2Z79 A;  1LED A;  2HWC 2;  1VBC 3;  3I8T A;  1QY4 A;  5F6L B;  1UYZ A;  3GCX A;  5KHJ A;  3WDY A;  4HK8 A;  1POV 0;  2ZAA A;  3E97 A;  1UAI A;  3IWZ A;  4E4Z A;  5IVJ A;  4LBQ A;  1RUH 2;  4FFF A;  4QDS A;  3B93 A;  1RUF 2;  1T2X A;  2VTX A;  3BU7 A;  5LY2 A;  1TME 2;  1ZA7 A;  3O0W A;  5CKQ A;  3VBF A;  2IVI B;  3AC0 A;  4IQP A;  4WV8 A;  2ZEY A;  1KDM A;  5B4N A;  1O8P A;  1PNG A;  3LEG A;  4YZ5 A;  2WDB A;  3PUR A;  1U5Z A;  5D1I A;  3ACH A;  3E1F 1;  4BME A;  4E2Q A;  4J1X A;  1C1F A;  2QQO A;  2RS5 3;  2WS9 1;  1DDL A;  3WW2 A;  1RUJ 2;  1OUS A;  3KT1 A;  3MIB A;  5B4X A;  1MS9 A;  1W9T A;  1ZA4 A;  5FY4 A;  1GNH A;  2ZPX A;  1K5M A;  2FBE A;  4GA9 A;  2YDE A;  4WM8 C;  3WW3 A;  3UKN A;  1J1L A;  1ULD A;  2VZS A;  4W6Y A;  1JBC A;  1RMU 2;  3PDQ A;  1QNY A;  2B5H A;  3NWK A;  4IV1 C;  5BNO C;  3VBH B;  1UMI A;  3LOI A;  1WMF A;  4BK5 A;  5A32 B;  1RHI 3;  3O12 A;  4XJ8 A;  5E6H A;  5H9R A;  2VZO A;  1LGC A;  2IXH A;  5T54 A;  1GQH A;  4MGT A;  4PLN A;  4PHZ A;  4AE2 A;  4CA9 A;  5FY8 A;  3SHR A;  2CGP A;  3DUI A;  1ND3 A;  1HX6 A;  3FUO A;  3ILR A;  1G9F A;  3L2H A;  1W0N A;  1UX6 A;  2HH9 A;  4O9E A;  5CFD C;  5EIY B;  1D7P M;  3RZG A;  2HWB 3;  2C4X A;  3EYP A;  1IG0 A;  2X5I B;  2WZ8 A;  3I2H A;  2W39 A;  2BFU S;  4S2H A;  1IQD C;  4N7U A;  4DUW A;  4DUV A;  5A1L A;  4FPK A;  5I0T A;  5T52 A;  5C3S A;  3RZH A;  4UW4 A;  2WL1 A;  2WNU A;  3VDB A;  3ZPO A;  3D6E A;  4LK7 A;  2HWE 2;  4IEO A;  1H6X A;  1RUD 1;  4M0N A;  1J3R A;  4LHK A;  4Z82 A;  1VBE 3;  4NN0 A;  4HKW A;  3V0A A;  2CWS A;  3S5A A;  1AUY A;  2A6W A;  4CXX A;  2WII B;  4DUX A;  1W9S A;  2VBB A;  1UU4 A;  1QJU 1;  1UIK A;  1Y9Q A;  4ZPI A;  3J8F 2;  4NPM A;  4LJH A;  3O1S A;  3GJA A;  4CDQ C;  1Q43 A;  3MIG A;  2ID4 A;  1UZY A;  3RZZ A;  5C5T A;  1N47 A;  3LB9 A;  5C8C A;  2DVD A;  3I2F A;  2CDO A;  2ZGT A;  5FIX A;  5DAV A;  2VH9 A;  5C4W A;  4TXW A;  2A73 B;  3ZX7 A;  4YG3 A;  2VZU A;  1KDK A;  2GSY A;  2YPJ A;  3CIH A;  5JXH A;  1D2S A;  1QJX 1;  5FO7 B;  2ZGS A;  4IV3 A;  5H9S A;  5ABJ B;  4Q4Y 2;  2D6M A;  2Q5T A;  5FAX A;  5A7N A;  3HPN A;  3JCI A;  4OHV A;  2WKK A;  2P6C A;  1I5Z A;  1IG3 A;  2YZ4 A;  3MDP A;  5BNN C;  5GLW A;  5BNP C;  3WCR A;  3PUH A;  2A6V A;  2H0V A;  4GB3 2;  5K9Y A;  4CDW B;  1FPN 2;  1SQ4 A;  2O8O A;  3DPR A;  3I2D A;  3Q8A A;  1ZBA 2;  2RJK A;  2OA2 A;  4WM7 C;  3VN4 A;  1G9A A;  5FP7 A;  3LPF A;  3RSJ A;  1OHF A;  1WBL A;  1WLW A;  1I5P A;  4Z2A A;  3WDU A;  3ZM8 A;  3PUQ A;  2WRA A;  4GJY A;  3S30 A;  4LUL A;  3CU7 A;  3APB A;  1M06 G;  2OW4 A;  5F2S A;  1UPS A;  4B4Q A;  4UFJ A;  1COV 1;  3ZPY A;  2WWS A;  2XML A;  1LR5 A;  4BQW A;  4LO8 A;  1PIV 2;  3HMY A;  5F5I A;  1HV0 A;  4RS5 C;  1GNZ A;  2RDS A;  4YZ3 A;  4QAW A;  1G86 A;  1YRZ A;  2E51 A;  5CKN A;  3D5O A;  5GLZ A;  2K46 A;  5FPX A;  2ATF A;  1X33 A;  1OLM E;  5FJH A;  4XQ4 A;  3M3Q A;  3ZXA C;  1YO8 A;  4PI2 A;  3BI3 A;  4IUG A;  3ME2 A;  4A7K A;  4IE0 A;  2FMY A;  2VO5 A;  4Q4X 2;  5FZM A;  2GH2 A;  4K6B A;  1PHM A;  1PGL 1;  2Q8C A;  3N9M A;  4FPC A;  2WWU A;  3LE0 A;  3VBF C;  1W8Z A;  3ZO0 B;  4OVE A;  4AED A;  4MO3 M;  1S0F A;  3CZJ A;  4MH0 E;  4R4Z A;  2E63 A;  4MGQ A;  4TSV A;  1JTZ X;  2JWP A;  4XJA A;  2QQP A;  2W95 A;  2WS9 3;  1W6N B;  2Z2S B;  3DCQ A;  1CWP A;  5KR7 A;  3O1O A;  5FYU A;  4OHX A;  2JD9 A;  4XFA A;  3H8O A;  1C4R A;  1WD4 A;  5FKB A;  4FOW A;  4FAH A;  5DMY A;  3K48 A;  1K5M C;  4PQQ A;  4XHX A;  5HI0 A;  1JZ2 A;  2Q1F A;  5LRS A;  3PNA A;  5E89 A;  4AVB A;  5CA6 A;  5FFO C;  4TTG A;  5HPO A;  1ZX5 A;  1AYN 1;  1X36 A;  1UYX A;  5GM0 A;  1GAN A;  1OF4 A;  1WW7 A;  1AXZ A;  2RS1 2;  2VUL A;  3GZA A;  1POQ A;  4A2U A;  1RUI 2;  3N35 A;  3NMB A;  1GV9 A;  1GUI A;  2ZAC A;  1MS0 A;  3E5Q A;  4QT6 A;  1C8M 1;  4BIF A;  2PHL A;  2ZAB A;  1WA6 X;  4AFC A;  4CXW A;  2R16 A;  3TAY A;  5F1R A;  2HWC 1;  2ZX4 A;  4BHP A;  4QQO A;  1BK0 A;  2IUW A;  1ND3 C;  3M8L A;  1X9T A;  3CQO A;  1XXN A;  3UKV A;  3MIF A;  1R1Z A;  1RUH 1;  4Y24 A;  1RUF 1;  3WNN A;  4IE6 A;  3N9L A;  1F31 A;  2OPK A;  2GMM A;  2A70 A;  2WSV A;  2RJL A;  1FAT A;  3HWJ A;  4N53 B;  5E16 A;  1TME 1;  5FYV A;  5LBB A;  3V64 A;  5A3N A;  4FPH A;  2OX0 A;  4D6Q A;  4I3P A;  2WNU C;  2G19 A;  1FNY A;  1VRB A;  4YG6 A;  1SMV A;  1EP0 A;  5C8W A;  2FQP A;  3RVH A;  1EY2 A;  4PDW B;  4LBQ D;  4MOA A;  4GH4 A;  4QX1 A;  4UFK A;  2VBP A;  1RUD 3;  4AI0 A;  1RUJ 1;  5F9T A;  1JI6 A;  2GC3 A;  1JN2 P;  4JHT A;  2VEC A;  4FPE A;  2XLA A;  3FC0 A;  5SV5 A;  1RC6 A;  2NMO A;  2EAA A;  4AXO A;  4QB6 A;  3ZN6 A;  4DXR A;  1YIP A;  1Q8Q A;  4AI1 A;  5FWE A;  3LD8 A;  2QQL A;  1UZZ A;  1RMU 1;  2BGP A;  4HLT A;  5H9P A;  1OFN A;  4I01 A;  2XVK A;  5I93 A;  2FDH A;  3QD6 A;  5C8C C;  1H9W A;  5FYT A;  1H2N A;  3UKT A;  1SPP B;  5JDB A;  4A4A A;  5C4W C;  1G7Y A;  1YQ2 A;  4JC1 A;  3V65 A;  2QNK A;  3NV2 A;  4DQA A;  1F15 A;  4CXY A;  1BKZ A;  3VZO A;  5FO8 B;  2MEV 2;  1NQJ A;  4QXH A;  4RFR B;  1QJX 3;  1XSR A;  4IV3 C;  3OEA A;  3RDI A;  2ARE A;  4N43 A;  1DBN A;  1DGW X;  2GN7 A;  2JIG A;  4XQW A;  2E7A A;  4CCE A;  3ITQ A;  4WVV A;  1Y9M A;  1CZV A;  4MET A;  1G9C A;  3AP4 A;  4KWK A;  2TNF A;  3OYW B;  5EV7 A;  3BCW A;  2EIG A;  3HNB M;  1YIF A;  3WY6 A;  3ZVX A;  1HB3 A;  2Q4S A;  2ZHN A;  3P1I A;  4KNC A;  3HEI A;  3DPR C;  3WZ1 A;  2W1U A;  5C70 A;  2HWE 1;  5F8P A;  4IER A;  1JYV A;  4AEK A;  4AGR A;  1JYC A;  5BY5 A;  1QJY 2;  2DBN A;  4JDM A;  4YM0 A;  5CIS A;  3QLQ A;  4MGZ E;  1OH3 A;  3WF2 A;  3ACI A;  4WM8 B;  2D98 A;  5L9B A;  3POE A;  4AG4 A;  3HT2 A;  2P3Y A;  2VNV A;  3ZMO A;  1Q8O A;  2VZV A;  3ZIW A;  5BPX A;  1COV 3;  3AJY A;  3AZY A;  1EV1 2;  1GMM A;  1LOD A;  2CAU A;  2IWG B;  2WNV B;  3J8F 1;  1QU0 A;  3EQE A;  3PTY A;  4ATF A;  4LKD A;  4MSV A;  3V0B B;  5GLV A;  3J9S A;  1S0J A;  2OQ7 A;  3AKT A;  5FYY A;  1W6O B;  3B00 A;  2R49 A;  5LBC A;  4LBL A;  4B29 A;  3MW2 A;  4MZU A;  1US3 A;  5CFD B;  2RHP A;  4XFB A;  3KCX A;  2XJT A;  1HB1 A;  4LOT A;  5A6X A;  1QH6 A;  4Q4Y 1;  3BTX A;  5A32 A;  3FN9 A; 
#chains in the Genus database with same CATH homology
 3RZG A;  4O61 A;  4IE5 A;  3BUC A;  3RZH A;  4QKN A;  4NRM A;  2FDG A;  4CXW A;  3O1M A;  3H8R A;  3I49 A;  2IUW A;  3S5A A;  4CXX A;  4NIH A;  3O1T A;  5DAB A;  3BKZ A;  4IE6 A;  3T4V A;  4NPM A;  3O1S A;  3O1V A;  3BTZ A;  4NID A;  4NRP A;  3O1P A;  3H8X A;  4IE7 A;  4NRO A;  3BU0 A;  4OCT A;  4IE4 A;  4IDZ A;  3KHC A;  4JHT A;  4NPL A;  4QKF A;  2FDJ A;  4ZHN A;  4ZS3 A;  3T4H B;  3T3Y A;  2FDH A;  2FDK A;  3BTY A;  3KHB A;  3I3Q A;  4CXY A;  3S57 A;  4RFR B;  3I3M A;  3O1R A;  3O1U A;  2FDI A;  3I2O A;  3RZL A;  4QKD A;  3BIE A;  5F8P A;  3BI3 A;  4IE0 A;  4QHO A;  4NIG A;  4NRQ A;  4O7X A;  3LFM A;  3RZM A;  4MG2 A;  4QKB A;  2FD8 A;  4NII A;  4ZS2 A;  3RZJ A;  3RZK A;  4MGT A;  4NJ4 A;  3O1O A;  3H8O A;  2FDF A;  3BTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...