2DUQA

Crystal structure of vip36 exoplasmic/lumenal domain, ca2+/man-bound form
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
249
structure length
244
Chain Sequence
b'HLKREHSLIKPYQGVGSSSMPLWDFQGSTILTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTIDWTKIEPSVNFLKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vesicular integral-membrane protein VIP36
publication title Structural basis for recognition of high mannose type glycoproteins by mammalian transport lectin VIP36
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Protein transport
total genus 58
structure length 244
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2duqA01
1QF3A 1LEDA 5CAZA 4YW4A 3WLUA 1Q8OA 3WCRA 1ULDA 4ATFA 4XMIA 1QDCA 3AZWA 1GZCA 3B00A 1VLNA 5GLZA 3UJQA 2ZMNA 2D43A 2ZGPA 4FVVA 3ZSLA 1GBGA 4NOTA 4BPZA 2A6YA 3ASIA 2YXSA 4M3CF 4HANA 1JHNA 2GNDA 5E88A 2A3WA 1H9PA 2PHTA 4Y1UA 4HL0A 1DYPA 4UW6A 3SLIA 4AVTA 3ILNA 4XBQA 4XE9A 2PHRA 5EYXA 1MS0A 2DTWA 5H9RA 2OUHA 3FLTA 1DFQA 2UWBA 1SLIA 4R9DA 5DUWA 5JDBA 4ASMB 2D7FA 1GNZA 2A3XA 4P9YA 2Z42A 3NV3A 3RSJA 1BZWA 3POWA 4Q27A 5FRAA 4GA9A 3AJYA 1S0CA 1AX0A 4FPLA 3Q9OA 3MW3A 4YGEA 1JBCA 5JOYA 1CN1A 3POYA 4ITCA 1OFSA 1MR5A 5IK8A 1DGLA 5GZDA 1C1LA 3O5SA 1SBDA 4AVVA 1G86A 1DBNA 5GLWA 1N47A 1UL9A 3O0VA 1DLLA 1WW5A 1LOGA 5E8AA 4Y22A 1FV2A 1F31A 2YZ4A 3O0XA 2GMEA 4GALA 4YG3A 1SLTA 3ZVXA 3NV2A 4YM1A 2JKBA 2ENRA 3WG1A 4GWMA 4FOVA 3N3HA 4LBQD 1AX2A 3N7LA 1KQRA 5JOXA 2PELA 2ES3A 4M01A 3M3EA 1A8DA 5GZFA 3ZSKA 2ZGUA 1GZWA 3AZVA 4DS0A 4BLIA 5DZGA 2CWSA 2AGSA 3MEPA 1MS4A 1NXD1 2D6MA 3MPPG 4YLZA 4PF5A 4YZ1A 2D6PA 1LHUA 1RITA 3R05A 1OKQA 2A7AA 1NLSA 2ZHKA 2GN7A 2YROA 1ONAA 3SH5A 4YZ5A 1RINA 1MS3A 1WD4A 1WW6A 2P2KA 3B69A 4FQZA 2ZGRA 4UW5A 1G9FA 2D6KA 1VALA 2VY0A 3W58A 4XILA 1C1FA 1WW7A 1N1VA 1MZ5A 4LBLA 1LOCA 1VAVA 4P9WA 2TEPA 3R4SA 2W08A 1F5FA 3JUUA 3AX4A 2CYFA 1N1YA 2PHXA 2DWRA 3ZXKA 4K21A 2WKKA 1S0JA 1OQ1A 1MS1A 2B7YA 2ARBA 4FPHA 4H55A 4XJUA 2NP0A 4XBNA 1ULCA 3IM0A 3ZPYA 2AR6A 1LU2A 1Z0HA 2E7TA 2A6XA 3OGGA 1UN1A 2CWMA 1B09A 2ZGTA 3B3QE 2R16A 2D6OX 2DURA 4FPOB 3NV1A 5T5OA 5EWSA 1QOTA 2V5YA 4FQ4A 4XMAA 1LENA 1IKPA 4YZ2A 1QNYA 1HLCA 5KXDA 1W0OA 4FP2A 5HCAA 2UURA 4PCRA 5F5QA 5CNAA 4XHBA 3V0BA 3AP4A 5GALA 2SLIA 5GZEA 5CB7A 3AYDA 3FFZA 4JRAA 1QKQA 2C5DA 3GALA 4YGBA 4DFSA 2EAKA 4YGDA 1KITA 1MS9A 3NV4A 1MVEA 2WNEA 3FLPA 1W6QB 2WT2A 2ZABA 1LOFA 1LHOA 4R9CA 4WVVA 1GYKA 3M3CA 3RS6A 3BIWE 4XJ8A 4BMBA 1MZ6A 5T5JA 4CZSA 1W6PB 2DVDA 3FUOA 3KQRA 3LCPA 1I3HA 3V0AA 1FNZA 4FPCA 4Y20A 3AYCA 1UMZA 4FPFA 5IK4A 4PBPA 3USUB 1D2SA 1XQNA 5DUXA 1Q8VA 3W59A 5DG1A 1SLLA 1W6OB 1YYNA 5KXBA 1UPSA 1HQWA 5JLVA 2I2SA 4FPGA 4XJZA 1AXZA 1WD3A 4XJWA 3VKNA 4UW3A 3WDVA 3OBRA 1LEMA 1G8WA 3AK0A 3AYEA 1DQ6A 2UWCA 4DQAA 2UWAA 3QCWA 2ZGSA 3ZYPA 2ZGKA 4Z8BA 3APBA 3R4UA 4TZDA 2ZGMA 1CPNA 1APNA 4AGVA 4ISRA 1ULGA 1LCLA 1J1TA 2OW4A 3QLQA 4P14A 3U4XA 4FPYA 2GMPA 1Z78A 4M00A 1BYHA 4UW4A 4LBKA 1GNHA 3WHUA 3BTAA 1DQ2A 1V6JA 4BQ1A 4FPEA 2ZZJA 2EF6A 2CNAA 1X50A 5GLVA 3WV6A 5T52A 5EYYA 2VW2A 1Q8PA 1LHVA 1W6MA 1S0EA 4RL7A 3ILRA 1SACA 1Q8QA 2CY6A 2ERFA 3VKLA 1WW4A 4L8QA 4YM0A 3HR9A 4DPNA 5CA6A 1H30A 4Y1ZA 1JYIA 1YIFA 3V65A 1DHKB 4R9AA 1QDOA 1S0IA 1YO8A 3H0OA 4AVSA 4I30A 3BOPA 2ZKNA 5IT6A 1JOJA 2NM1A 4JC1A 2A3YA 1LOBA 3OY8A 5IUQA 1DIWA 3N35A 5T5PA 4XZPA 1IS6A 1SFYA 3IMNA 3AFKA 3M3OA 1AX1A 1QNWA 3FUQA 1CR7A 1SBFA 2H0BA 3ZSMA 1DYKA 1S0BA 4BLJA 4DRVA 1WLDA 2EALA 3WZ1A 4BM8A 3O12A 2JJ6A 1VIWB 5JMCA 1UZZA 1GZWB 4XIOA 1LODA 4K1YA 2PHWA 2LTNA 4Y1YA 2R0FA 3SH4A 1LOEA 1W0PA 5DXDA 2ARXA 3SISA 3WDYA 2VXRA 2NMOA 3WOGA 1FATA 2A5ZA 1JUIA 1CVNA 2AUYA 2JD4A 2ZGLA 1WBLA 3WDTA 1S1AA 3ZXLA 4YZ3A 4OZXA 1EPWA 1BKZA 1MS8A 4XXPA 2D3SA 3M3QA 1LOFC 2A6ZA 1LGBA 4K1ZA 3O0WA 3BODA 4XOGA 2DU0A 3DGTA 1FX5A 1FV3A 1AJKA 1WLCA 2R0HA 3VUOA 1DZQA 1LU1A 4P9XA 2R1BA 3OBTA 2GNBA 4SLIA 5H9QA 2DU1A 4ZXKA 5L73A 3OPZA 3AZXA 4Y24A 1CIWA 1GV9A 2NMNA 3WCSA 4XTMA 1WBFA 1SLAA 1CESA 1JW6A 1LULA 1V6OA 1QGLA 4NO4A 2WSVA 3AXEA 4FP3A 2GN3A 4R9BA 4XTPA 1G9AA 2E7QA 5GLUA 1YI7A 3ZXFA 3PMEA 2YMZA 5CBLA 4Q1RA 3IPVB 1ENSA 2ZMLA 4DRRA 2AYHA 3AJZA 1QOOA 1Y7BA 1KRIA 1O4YA 4KBBA 2OVUA 2ZACA 2FHRA 3OJBA 4YW3A 3AP6A 1AF9A 5HCBA 5BYNA 3HN1A 1LOAA 4AGGA 5H9PA 3AP9A 4M3CB 4FOQA 1D0HA 1ULFA 4AWDA 4YM2A 4LBNA 3WDUA 3V0BB 3MW2A 1YRZA 4CTEA 3WUDA 3TAYA 2FMDA 4XBLA 2EXHA 3A0NA 3M2MA 3B01A 3FLRA 1LHNA 3VKFC 3OYWB 4XXAA 5FREA 4TYSA 4Q8KA 2E6VA 3D6EA 3RG0A 3RQ0A 2D6LX 4K20A 1V6LA 1ZM1A 1BJQA 5GM0A 1KJRA 4LBQB 2RHPA 3FBYA 5IK5A 3GNEA 1U0AA 4Q8LA 3WDWA 1A3KA 3V0AB 1W6NB 2ZGOA 4YGCA 5T55A 4C1XA 4LBMA 4Y20B 5H9SA 2DVGA 4AGRA 1V6NA 2HYKA 2ZAAA 3UJOA 3WVJA 1G9DA 4MYEA 1KDMA 2JDZA 2BQPA 1IKQA 2P37A 1V6MA 4FOWA 4Y1VA 1DQ4A 1V6KA 2WJSA 1AXKA 3C2UA 5E89A 3WG2A 1S0FA 3LSEA 4XHXA 3I4IA 1FYUA 2PHFA 5GZGA 5DZEA 2ZHNA 1O4ZA 3ATGA 2WQZC 3SH3A 3TB0A 1HQLA 1SLBA 2D44A 4XIKA 2ZGQA 4FPJA 1W6PA 1HKDA 1FNYA 2A71A 5HCFA 1LHWA 1N3OA 4XDQA 3SITA 2DVAA 3ZYRA 1GANA 4YM3A 2DUOA 1G7YA 3ILFA 5T54A 2KM2A 1I1EA 2E53A 4Q1PA 3USUA 5JOWA 1W6OA 4D69A 3N7JA 1A78A 2GNMA 1W6MB 2VW0A 4WVWA 3WG3A 2GNTA 1QOSA 2WT1A 3ENRA 1UAIA 2P3IA 3PJQA 4YW1A 2VU9A 1URXA 1N3QA 3INAA 2JE9A 1V00A 2D3RA 2Q5TA 2DV9A 2JE7A 2CTVA 3A0KA 3PVOA 1GSLA 4M3CE 4BOWA 3AP7A 1WCSA 3PVNA 4LBJA 3UL2A 1LESA 1LGNA 1V6IA 2C9AA 2NZ9A 4RA0A 1BXHA 1LECA 4Y22B 1WUVA 2UU8A 3OY8B 1QMJA 2EXKA 1CJPA 2OUJA 2YY1A 1DQ0A 4Q26A 5JOZA 3D4KA 2DUQA 1Q8SA 4FOYA 1QU0A 3ZXEA 2P3JA 3RMXA 3AZYA 5IK7A 1ULEA 2ZHLA 3RRDA 2XB6C 1LTEA 4YG6A 1DQ1A 1MACA 1MVQA 1F9KA 2W39A 4WV8A 3WDXA 2A6WA 5DUUA 1PZ9A 1UKGA 2VH9A 1AXYA 3KM5A 1SCRA 2AREA 2A75A 2D3PA 5F9TA 1G9CA 2W68A 1LGCA 1N3PA 4BMEA 5T5LA 2DUPA 3M1HA 2ZA9A 4ISQA 5GZCA 1IS5A 1GICA 4F83A 3VKOA 4GKYA 3POSA 3CNAA 2R49A 5T50A 2G4IA 3DUIA 4WZFA 2LALA 1C4RA 4YW2A 1PZ7A 3LSDA 4YZ4A 4AYUA 4PQ9A 2DTYA 4ZKTB 2JECA 2ZMKA 1AZDA 2WLQA 1GLHA 1UX6A 2CL2A 4XJ9A 1JN2P 3A4UA 4GKXA 3T1LA 3AYAA 3V64A 2XG3A 4Q2FA 4YG0A 4ATEA 5KXEA 1IOAA 2GDFA 2A70A 1G9BA 5SV8A 3I8TA 1FAYA 2DVBA 3SNMA 1Q56A 2PHUA 2VW1A 1IS3A 3VV1A 4U36A 3WHTA 1R1ZA 3PVEA 4LBOA 4U2AA 1BQPA 1CQ9A 1SBEA 4JCKA 4YFWA 2VUAA 3IN9A 1GKBA 2WT0A 4Y26A 5JVVA 3ZXJA 3VKMA 1DQ5A 1KJLA 2AH2A 1H9WA 5KXCA 3IPVA 1CPMA 3N7MA 1UZYA 2DVFA 1S0GA 3NWKA 1S0DA 3RMYA 2V73A 4Y1XA 2NN8A 1ZA4A 1LJ7A 3MW4A 4FPKA 1ENRA 2ZHMA 3HMYA 3N36A 2EXIA 3T2TA 1KDKA 1CONA 2EXJA 1SLCA 2AENA 2P34A 4GWNA 4M3CA 5GLTA 5DG2A 4YFZA 4GXLA 1GZ9A 2E51A 3D5OA 2SBAA 3AZZA 4IQPA 4XYXA 5DUVA 4C1WA 1PZ8A 1N1SA 2P3KA 1C57A 1YXWA 2R1DA 2W52A 4YW5A 1AVBA 3WG4A 3WUCA 3AP5A 1RIRA 2D6NA 3B9CA 3JU9A 2GMMA 3AXDA 3ZSJA 2DYCA 2WSUA 1VAMA 3OYWA 2YV8A 3L2YA 5DZFA 3T1MA 2EIGA 2ZGNA 1MS5A 1W6QA 3N7KA 4PBOA 2GALA 4LBQA 4XJAA 5AVAA 1HDKA 1AJOA 1N1TA 3UK9A 1JYCA 2ZBJA 2A6VA 4CRQA 4W65A 5GJ6A 5LK5A 1WLWA 1W6NA 1TEIA 1IS4A 1SCSA 1ENQA 1JXNA 5EXOA 2NYYA 3WNXA 3IKWA
chains in the Genus database with same CATH superfamily
4FXGB 3HWJA 3HN3A 4YW4A 5FMCA 1POV3 1Q8OA 2JIGA 4QGMA 3WCRA 4ATFA 4D6RA 4EYUA 1BMV2 4WM8C 2DCJA 1AHSA 2XWBB 3HVDA 4AFMA 3Q8FA 1UMHA 5GLZA 5A33A 2H6CA 5JZGC 2RV9A 2RDSA 1VBD3 4FVVA 1RUE1 2VQTA 3N4MA 4HANA 3WW3A 1JUHA 3WXPA 5E88A 5HV4A 2PHTA 3KF5A 4Y1UA 2VBDA 3MIBA 2BWCA 4LKEA 5F1RA 3FLTA 1SLIA 4GZ9A 2IXJA 1L3JA 1XNDA 4ASMB 5DAWA 2A3XA 3RSJA 1X33A 1ZA7A 2Z42A 1BZWA 3A22A 3LIGA 3POWA 4Q27A 4ASKA 5FRAA 1AR62 4YW7A 1DP0A 4HETA 5C9AB 2LM3A 4DEQA 2IZWA 4A41A 4HN0A 1H8TA 2WWUA 3JD72 1JBCA 4YGEA 1PNGA 5A3MA 2Z79A 1OFSA 4PDWA 4L99A 2WQ8A 1JYWA 2RMU1 4AHWA 3O5SA 1RYYA 4M0NA 3EB7A 1VRH3 2Y6JA 1HXS3 3AVRA 1GP6A 2OX0A 4KG0A 1V9U3 2ZKLA 1N47A 4QWNA 4W6YA 1DLLA 1WW5A 1LOGA 4WM8B 5DPNA 4Y22A 1FV2A 2GC2A 3ES4A 2QDRA 2XONA 5FKCA 2RS33 4CXYA 1CAWA 4QU2A 4FFIA 4PIYA 3A21A 3KCYA 4QQLA 4MGIE 4M01A 1A8DA 5GZFA 3ZSKA 3ZXAC 2WO1A 4JQRA 1QJU2 1PK6A 2CGOA 4GMP0 1W8OA 5FZKA 5FP8A 4CUGA 5DZGA 3MEPA 2AGSA 5J1XA 1MS4A 2JE8A 2Q8OA 2Q1ZB 1NXD1 3E5UA 4LOSA 1PX4A 4AI2A 4OFGA 1VE0A 4OI4A 1COV1 1KD7A 1XPWA 3SH5A 3LEMA 4IEVA 1UPIA 1WW6A 2YU2A 2EA7A 4A7ZA 4IEXA 1WW7A 1N1VA 4LBLA 3KVAA 4NVPA 3VZNA 2VUJA 1LR5A 1VMHA 2TEPA 3AX4A 4NPLA 3GHMA 2PHXA 2DWRA 1TNRA 1CAVA 4K21A 2WKKA 4URAA 1S0JA 2R32A 1OQ1A 3G7DA 3G6JB 1E5RA 3KT4A 4XJUA 5FV3A 5I8SA 5LK7B 1ZRCA 1ZBE3 3IDEA 3MBWA 1NY72 2YGLA 3K48A 1Z0HA 3IIAA 5LEJA 3RFRA 1ZZ7A 3NQHA 2VCBA 3P3PA 1J83A 3BGAA 3ROUA 1B09A 2Z5WA 2R16A 1A34A 4B1LA 4QQPA 4A45A 2DURA 4ES9A 5C3PA 5FPXA 2QQJA 3GBGA 1U5IA 1WMXA 3DL3A 5L19A 3EYPA 3OB8A 2R042 1IKPA 5F5IA 1HLCA 1PGSA 4Q0QA 1PHMA 2LROA 4RYDA 4LIUA 4P9JA 2I74A 4QDSA 4FP2A 2UURA 2WDBA 5JMOA 4GJZA 4XHBA 5JPMB 1WGPA 1OMIA 3JBG2 5CB7A 4CCMA 3FFZA 4QX1A 5FMOS 1RVF2 4M4RA 1QKQA 2QVSB 5DDJ3 5FLIA 4Q0PA 2EAKA 2WNEA 1W6QB 3S0MA 4WVVA 3M3CA 1H8TC 3BIWE 1HB3A 4FSJA 1CX1A 1NXMA 1MZ6A 3IIIA 4IETA 4BMBA 1W6PB 2ZTNA 4PDWC 4OHZA 1QJX1 3PHMA 4GD4A 2W94A 4EJRA 1W0NA 2ET1A 4UXAA 1FNZA 1M06G 2R071 4FFGA 1R093 2V5DA 5FZ7A 1VRBA 4FPFA 4Y4YA 4AI0A 1D2SA 1XQNA 5DUXA 3MIDA 2XQRA 3O1UA 5FKBA 2JWPA 1AXZA 1OLQA 2B4KA 2OT7A 3AVSA 4HONA 4XJZA 5E16A 3LD8A 5A80A 4LO7A 3AK0A 5K4LA 5CFDA 3WDVA 3I2HA 4IV3A 4LHKA 2UWCA 3K51A 5FR3A 2ZGSA 3GM8A 3ZYPA 5IVBA 1WWYA 2Y6FA 1PK6C 1PO22 4ISRA 4XQ4A 2JG9C 2GMPA 2QCSB 3WHUA 4ZPIA 2ZZJA 2CNAA 4JGZB 2XJVA 3JXSA 3MYXA 4HKOA 2QQIA 4TSVA 4CYDA 2HBUA 5JI7A 4AQTA 2HYXA 1OLME 2VW2A 2XL7A 3BPZA 1LHVA 4LORA 2CY6A 3T2QA 4BQ3A 2VJXA 5JXHA 1WW4A 4L8QA 2CDOA 5BNNB 2XJSA 5AVPA 4AHZA 4DPNA 1REFA 5C7GA 5CA6A 3HQXA 1H30A 3GZAA 1D4VB 2XVGA 4E2GA 4F8AA 3V65A 4R9AA 3L2HA 4B4PA 5IT6A 2F6BA 4F3JA 3POFA 4CEYB 5F39A 3LPGA 3ZYHA 4E27A 3KS7A 2GSYA 3J8F3 4BIFA 2J42A 3N35A 4NHKA 1CAWB 1DLCA 1CWPA 5T5PA 2BFUS 4AEDB 3IMNA 3AFKA 2LW8A 3PTRB 4COZA 5FOBB 4QAWA 5J37A 5FO9B 1EAH2 1QH6A 3WEZA 1REDA 1UF2C 1WLDA 2XKOA 3EJKA 3DYOA 3W5NA 4L0PA 5JMCA 3MV01 2ZX4A 1NCRA 4XIOA 1PK6B 4Y1YA 4IERA 1LOEA 1W0PA 4WVMA 5DXDA 5FJKA 3PURA 3K2OA 1JU4A 4AW7A 2XUEA 4XFFA 4CDQA 2VG9A 3LDKA 1UU6A 1LAJA 1IG0A 1JUIA 1CVNA 3KHCA 2WQ4A 5FXWA 1WBLA 1O59A 2XLGA 4QM8A 2C4XA 2J1UA 2QQPA 4YZ3A 4OZXA 1EPWA 4DB5A 5EJZB 1DZTA 5KBFA 4IE0A 3M3QA 1POV1 5LY2A 3VZJA 5F3GA 1LGBA 3OGJA 3KV9A 4XOGA 2MHFA 4V1PA 1E5HA 1AJKA 3LZZA 3VUOA 1DZQA 1L7QA 5FMBA 2GP3A 1VBD1 4ZXKA 3SXWA 1FPN3 3ZN4A 3AZXA 1GV9A 1CAVB 2FDFA 4HK9A 1XC6A 1H1MA 1JW6A 1XU2A 5LA1A 3IAQA 2WSVA 2B9VA 3AXEA 2VNVA 4XTPA 4P00B 2E7QA 1DYOA 1D4M2 2YMZA 5CBLA 1QEXA 2WZR3 3IPVB 4LIVA 2ZMLA 4Q0SA 4QPYA 2AYHA 3S5AA 3B7MA 4HPKB 4KBBA 2EIDA 5F37A 4NR1A 2FHRA 4HT1T 3OJBA 5CFDC 4IV3C 3AP6A 4YW3A 1Z7S2 3KT7A 4XAEA 3UGGA 3SEEA 3HN1A 1LOAA 5FYSA 5KC6A 3H1WA 5H9PA 3TWIA 5C8CA 4FOQA 1D0HA 3W5MA 2X5IA 1VBE3 5FOJB 1HRV2 2FMDA 4UT5A 3NJZA 2EXHA 5BNPA 1RJ7A 2HWF2 3B01A 3FLRA 3HBZA 2FZ2A 4UBGA 4OHWA 3VKFC 1VRH1 1C8NA 5TSWA 1O5UA 2BNOA 1HXS1 4TYSA 5LA0A 1BVP1 1C8M2 1V9U1 2D6LX 1ZM1A 2QNKA 1OA3A 5A7NA 4BQWA 1VBB2 2RHPA 2WZPP 3GNEA 4GB32 4IGQA 4Q8LA 2RS31 2WO3A 1OH4A 2XBO3 3WDWA 3PMSA 1A3KA 1W6NB 4YGCA 1TNFA 5C5UA 2VZPA 3T4HB 1ZBA2 3H50A 4Q29A 1JTZX 3WP3A 1V6NA 4FXKB 2ZAAA 1VBC3 3BVCA 3HD8B 3WVJA 5LY1A 1I5PA 3WW2A 2BQPA 2P37A 1W28A 1GP4A 4Y1VA 3BALA 1ND3B 2WJSA 5FXVA 1AXKA 2FDHA 4LOTA 4K40A 2WC2A 1BBT2 4BWOA 3A7QA 5I0RA 3MIFA 5I91A 5GZGA 4Y5Z0 3CIHA 4ZZ5A 1O4ZA 3RYRA 3SH3A 3ETPA 2GU9A 2Y34A 2MPFA 4Q4W3 2LRPA 3GHNA 2WFF2 4FPJA 4CP0A 1NCRC 1FNYA 5HCFA 3UETA 5I0DA 1N3OA 3MICA 1QXRA 1NA1A 3GYDA 3SITA 1W8HA 2ZPXA 4YM3A 3CZJA 4CU9A 1I1EA 1UCXA 1OURA 2HWB2 2E63A 1O91A 3USUA 1AR93 1F8VA 2E31A 1BK1A 3NNJA 3A23A 5I0UA 4A3XA 4GWJA 2G19A 3DPRB 2RR13 3UYJA 4BQXA 2GNTA 1ZBE1 2CU5A 4LKSA 2QE3A 2W1SA 3C3VA 4W6WA 4CDWA 2XXZA 2DV9A 4X6RB 3C7OA 3QOPA 2CGNA 3UL2A 1LESA 1LGNA 1Q3EA 1RMU3 2C9AA 2NLRA 2QFEA 1DGRN 3DCQA 3I2GA 4XF1A 3THDA 5IVVA 2PLV3 1CJPA 5A1LA 2BRTA 5C71A 1NG0A 2YY1A 1DCSA 5APAA 2WRAA 4KWUA 3VBUB 4BJ0A 1H2LA 2P6CA 2XHKA 2DUQA 5DDJ1 4RSUA 4CXWA 1HW5A 4D6QA 5KWRA 2LS6A 2X10A 5C8CC 4Q4Y3 3RRDA 1US2A 3AMNA 3K46A 1DQ1A 4AHYA 1F9KA 2X5IC 3VDDB 4W4ZA 2PHDA 3WDXA 3AL5A 3K77A 4YVWA 4CDQB 1I5ZA 4C91A 3H8RA 1WLTA 3MF9A 5KC5A 1UKGA 1ZRRA 4A4AA 3LWCA 4PQQA 4AHXA 2BTVC 5BNPC 1SCRA 5F9TA 1G9CA 2C9KA 2XUMA 1R091 5T5LA 4AQ6A 4XPVA 1BHGA 2H0VA 1UIJA 4MHUA 2BVBA 1GICA 3VKOA 3I54A 1HX6A 3POSA 5LZ6A 3BTYA 1RL3A 4QPGA 1OUSA 2BBAA 5B4XA 3KWVA 4NWWA 4PI0A 4WZFA 3AB0A 4GJYA 4MGYE 4SBVA 3LSDA 4O9GA 4LITA 1AZDA 2XGXA 5FYTA 1AYN2 3RZJA 1P8JA 1US3A 3F2ZA 1NYWA 2Y8KA 1JN2P 5D8AA 5FPUA 1OH3A 1W39A 1PIV3 3A4UA 1X7NA 1AR82 3T1LA 2XG3A 4Q2FA 5FZOB 5FZ3A 4ATEA 3N9QA 3R4DB 5SV8A 2D93A 3I8TA 2DVBA 2OQ6A 2VMHA 3KGLA 4HVQA 1Q56A 2QJVA 4OUSA 2VW1A 4PJYA 3CLPA 2X5IB 2WIIB 5LBBA 2WNVA 1DG6A 5HXVA 1NA1C 3PVEA 1WMEA 2XLFA 5BNPB 2ORZA 1BQPA 3OBZA 4F7ZA 1SBEA 2OKXA 5G04L 1DZRA 1G6NA 1ZRIA 4BCUA 3CJXA 3VGIA 3LKJA 2QQKA 3ZXJA 2WFPA 1PO13 5CZKA 4KGQA 1H9WA 5KXCA 1CPMA 5CVRA 1OQEA 3NAPA 3O14A 2V73A 4IW3A 3J8F1 3KD4A 4ZU5A 3RZGA 3KSCA 3MW4A 4FPKA 2GH2A 3N36A 2OPKA 1KDKA 3LGRA 4CDWC 1YFUA 1ST8A 1D2QA 5FY4A 1W03A 2AENA 2R062 2D98A 4GWNA 1QJY2 4M3CA 5GLTA 1R082 2JDKA 3NO8A 3CHXA 1XJAA 3U10A 3VKNA 4C1WA 4Z2WA 1B35A 1YCIA 1W8UA 3BTZA 4EZ4A 1ZZ8A 4MVTA 2KR2A 1RIRA 3MO4A 1YJLA 3AXDA 1RUC3 4NIDA 3WT3A 1W9SA 2HH9A 1LRHA 4P5YA 1F4AA 2VL4A 4K8RB 2ZGNA 5FZ4A 3WQ1A 3N7KA 4WM7A 4FBFA 4MOAA 2E32A 4LJHA 2GALA 2J7MA 5CIRA 3ZO0B 3LEGA 3ACFA 3OF1A 4W65A 1NA1B 5FZDA 5LK5A 5A6ZA 1IS4A 3IAPA 2IFRA 4YVWC 5IHRA 3KZ4C 4SLIA 2VZ3A 4RHV3 1FPN1 1LEDA 4YVSB 2RDRA 2EIBA 1F2NA 5FBJA 1RUF1 2ZEWA 3Q8BA 4DUXA 1RUE2 2PFWA 1TE1B 3E5XA 1ULOA 3GZTB 1PMHX 4N53A 5BY5A 3B94A 2K9ZA 5EJ1B 1K5JA 1GWLA 1NCQB 1Y4WA 2WZR1 2ZGPA 1XNAA 4NWVA 5JCTA 1CIYA 2DCZA 3ASIA 1JHNA 2ARAA 3D0SA 4QPGC 1H9PA 4RGKA 3SLIA 4HL0A 1DYPA 5H9RA 4XE9A 4O61A 4AEKA 2JG8C 2DTWA 1DFQA 2KXLA 2UWBA 4AZZA 5JDBA 3IMMA 2FMYA 4LA3A 5A1FA 1MEC3 4KU7A 1XRUA 4QPIA 1VBE1 4CP1A 1QQP2 2BZDA 1WCKA 4O9EA 5D8AC 4GA9A 1W2OA 1S0CA 1YIPA 5FQ0A 5IWFA 3VZOA 4P02B 2PAMA 4Q4X3 5C3SA 2RMU2 2WINB 3Q9OA 3MIHA 5JOYA 1CN1A 3P6BA 4JKMA 3CZUA 3BOWA 3IDCB 2VQUA 1AYM3 1RGSA 2JD9A 2WNVC 5KHHA 3VBHC 3I97A 4YVWB 1VB2A 2XBO1 3D8CA 3FHQA 1H2MA 2DCTA 1SBDA 1TVGA 4AVVA 3ZSEA 1G86A 1DBNA 3C7FA 4ASLA 3POBA 2YFZA 3NSTA 1UL9A 4OI0A 1V0AA 4AFDA 1JH5A 1OKOA 1F31A 2VQ0A 2YZ4A 1YFWA 3O0XA 4JX0A 3ETQA 2WS93 3HIFA 5GKAC 5IFPA 1SLTA 4NPRA 4YM1A 5JZGA 3PTYA 3OPTA 4FOVA 2WA4A 3VD5A 3N7LA 4IEYA 4AAXA 1ZNPA 2PELA 5EV7A 3RDIA 1R64A 4IEUA 4COWA 4XURA 3WF4A 2FCTA 4LA2A 3OOXA 4FTEA 4Q4W1 3AZVA 4DS0A 4BLIA 2W47A 1COV2 1YWKA 4YZ1A 1GP5A 4BQ2A 3PIGA 4HLTA 4XF9A 5FZAA 3RJRA 1U5XA 4PLOA 5D8AB 2A7AA 4D6SA 1NLSA 2ZHKA 4CDUB 2YROA 1CAUA 2O1QA 1MS3A 2XVKA 1AR91 4WM7C 3VD3A 2ZGRA 3FE5A 4UW5A 1G9FA 2D6KA 4DMIA 1VALA 4HKLA 3W58A 1C3HA 3WP6A 1C1FA 2FCUA 3ZN6A 3NJYA 2RR11 5FAXA 1MZ5A 3SC7X 3IDBB 2WNVB 5KR7A 2CGPA 3I3MA 4YYOA 3TN93 2WWSA 2W08A 2Z69A 4H7LA 2CYFA 2O0OA 3NRUA 1SZBA 1HN0A 3FHAA 3MFAA 3U14A 1KFXL 1MS1A 3AKRA 4EZHA 4TTGA 3CKHA 1ZVFA 2DBIA 2JKXA 4AVBA 1H2KA 4XDPA 1RMU1 3NAPB 4DIQA 3JB4C 2J1VA 2IXIA 5JI9A 3B3QE 2PLV1 3S30A 2G1MA 3U78A 2FDIA 5LEKA 3NV1A 4QXKA 3RGBA 5T5OA 4CA9A 2N7GA 3AM2A 4FQ4A 4XMAA 4YZ2A 2RJ2A 5A6QA 1XYPA 5A3LA 4PCRA 1B35B 1ZZCA 3I3BA 1GQHA 5CNAA 4Q4Y1 3AP4A 3ZIXA 4XF3A 4BQ4A 3LB9A 4EN6B 1Y3TA 5B2GB 4JAAA 4QPIC 4JRAA 4LE4A 2Z4FA 4DEVA 1WMDA 2C5DA 4AFAA 4CUAA 2EICA 4YGDA 4D7SA 3FLPA 4E2QA 2WT2A 1QJX2 3LOBA 2R072 4W6XA 1IQAA 1IPSA 2DVDA 4BA6A 5HCHA 3R6SA 1W3XA 3UKNA 2WO7A 3CF6E 1GFF2 4FPCA 1RXGA 3IDAA 1K5MA 1W9TA 2O8OA 5L7OB 3ZFGB 1REEA 2XPJA 2PAKA 1UZ0A 2BOIA 1Q8VA 4N53B 4IEQA 5DG1A 4CEWB 4CPBD 1W6OB 1YYNA 1XBFA 4A7KA 2I2SA 4FPGA 5CKNA 4COUA 1X82A 3FHIB 1XE8A 3H3ZA 4K8FA 4M4PA 3VBSB 4UW3A 4AFCA 1G8WA 4AEMA 2A1XA 1F15A 1DQ6A 1PIV1 1GOHA 2JDMA 2UWAA 4CP9A 2ZGKA 1YFXA 2CAVA 2W46A 1FOD3 2Y6LA 3VD7A 4EN9B 4AE2A 2VMFA 2ZGMA 2ZX2A 3HT2A 3WQ7A 5IVCA 4BQ5A 4MV2A 2OW4A 4YPJA 4KU8A 5LATA 2PYTA 3THCA 4M00A 1Z78A 4UW4A 4LBKA 3DF0A 1DQ2A 2XJRA 2HBTA 1E5SA 2BBVA 4FTBA 2QQLA 2ZEYA 3KB5A 5LA9A 2MNGA 1Q8PA 1Y43B 4BE3A 1S2EA 1PO11 4J1XA 1W6MA 4CCLA 5A32A 1MZFA 1XSRA 3PU8A 1TME3 1Q8QA 4MX3A 3ZKUA 1PVC3 3B02A 2IXKA 1W9WA 4N43C 3PL0A 1OSGA 3BIEA 4BDVB 4IE7A 2C6SA 5FBZA 1EPZA 1TG7A 1UYPA 2VCMA 2VO5A 3BOPA 4KWLA 1OVPA 1UOGA 2BWAA 1W99A 1O3TA 2VC9A 4LLOA 2HWD2 1AL23 2BERA 1ND2A 3KHBA 4I0WB 3OPWA 4QX2A 2KD7A 3EO6A 5JZGB 1SFYA 4XCBA 1CGPA 4CCEA 1AX1A 1YQ2A 1SBFA 3F95A 1RUC1 1S0BA 4DRVA 2E9QA 4OUMA 5J3UA 3S57A 2W2IA 4IXLA 3VBOA 4BM8A 5JXJA 2X8KA 4QU1A 4OULA 1W04A 1LODA 2FDJA 4HMZA 2LTNA 4GH4A 2JX9A 3HBKA 4XFAA 2JG9A 4A44A 1XXNA 3LFIA 4JDOA 2JD4A 1J3QA 1KEXA 1I6XA 1MPXA 1W9YA 4R52A 4MO3M 2XKPA 4RHV1 1CAUB 1BKZA 1H6XA 1UY2A 2VPVA 2YHJA 2D3SA 3AC0A 2F4PA 1SPPA 1NZCA 1QJFA 1VBD2 1NZIA 3H7JA 3ZN6B 1FX5A 4M0HA 2V4AA 2B5HA 4C0BA 2R0HA 3GXUA 1LU1A 3ZFFC 4P9XA 1O3RA 3OBTA 2GNBA 5H9QA 2YG0A 4JQTA 4BK5A 5FJHA 5FYZA 3VDCA 5L73A 3GCWA 4EN7B 4HSJA 5LCWL 3WCSA 4HVOA 3ZR6A 3BPSA 4D8MA 1SLAA 3AMHA 4XFCA 1K5MC 1ZZ6A 3B9IA 1GOFA 2VR4A 4NO4A 5DAQA 4MXWA 1YI7A 2K2SA 4Q1RA 1IG3A 1RUJ3 2W91A 1MEC1 1KRIA 5A7PA 4E4ZA 2GC0A 3X29B 1UKRA 4Y4RA 3TOJA 2WBKA 5HCBA 3K75B 3K3NA 1QJZA 5BYNA 1EYBA 4AGGA 3AP9A 3MHZA 2ILMA 4AWDA 4Q4X1 1HJGA 3SQOA 4P9IA 2CSGA 2VZ1A 4LBNA 4YM2A 1WCDJ 1YRZA 4RFT0 4CTEA 3WUDA 1VRH2 4TN7A 5J7MA 3ALQA 5EPAA 1HXS2 1SQ4A 1AYM1 2VOTA 1V9U2 1HN1A 4B29A 5DMYA 2B39A 1LHNA 4EN8B 5C33A 1CAXB 2W1QA 2XWJB 5FREA 4Q8KA 3NNMA 2RS32 3J7LA 4K20A 1JHJA 1V6LA 4XEZA 1OLMA 1J58A 1UY0A 4LBQB 2WZ8A 1PVXA 2IXCA 3K3OA 5FDBA 5IK5A 1ZRDA 5D1IA 2GAUA 2WS91 4N9HA 1DU3D 2E7AA 1RUI3 3I2FA 2HWC3 3TEYA 4Z92B 5T55A 2YC4A 4C1XA 4LBMA 1ZRFA 3VLBB 4KBZA 3UJOA 2IVJA 1ZYBA 1G9DA 4QXBA 1IKQA 1V6MA 4FOWA 2XVLA 5A7SA 1OA2A 1DQ4A 1V6KA 3C2UA 3J7NA 3ZYBA 1RTVA 3WG2A 4JV4A 1ND2C 5FPZA 5A33B 5FO8B 4OI2A 3GF6A 4MUVA 2ZHNA 2FCVA 3DYMA 4BU2A 1DGRA 1HQLA 2W92A 4NMIA 3ST7A 4D94A 2VVDA 1FT9A 2VCCA 3EQEA 4XIKA 3VBOC 2XHNA 4I3PA 2Y38A 2UY8A 3IBMA 1YLLA 2A71A 3M4FA 4TLFA 4GH4C 5F2SA 3KV6A 4IESA 2VOXA 2DVAA 4XDQA 5FO7B 3T3YA 3ZYRA 3H8XA 1F5JA 4R8HA 1OQDA 5T54A 1R1A2 2IUWA 3TN91 5JXGA 3ECQA 3ACHA 4Q1PA 4TLGA 1ZBE2 4S2DA 5CFCC 3JB8A 2GNMA 3GJBA 5A32B 1W6MB 1H8TB 5A3UA 5JSOA 1U5YA 4D0QA 1UAIA 4O65A 4PDWB 2YU1A 2RDNA 1NT0A 3INAA 3BCWA 3H1MA 3WQBA 2D3RA 1EY2A 5FP4A 2Q5TA 3A0KA 4ARYA 1M4WA 4CU6A 2QQWA 2W9XA 1HB2A 4Q4V3 3OBAA 3E97A 3KMHA 1V6IA 1BXHA 1SFPA 4QX0A 2FDGA 4Y22B 1WUVA 4LHSA 1UD1A 5DDJ2 4A2UA 5IYYA 1POV0 1DQ0A 2WWJA 4Q26A 2RS52 4PIXA 3DECA 3AKTA 3ZYJB 1Q8SA 4FOYA 3ZXEA 2P3JA 3RMXA 4LO6B 4I09A 3T2PA 3VBOB 1KS4A 1H4HA 3W9AA 1JS9A 4HSLA 2R6QA 4C8DA 3ZX7A 4UYBA 1MACA 1OOPA 1HB1A 1NE4A 3JD71 3TEXA 1R092 2A6WA 2BYVE 2JG9B 4Y5TA 1H6YA 1ASJ3 3KM5A 2HWF3 2A75A 1HIXA 5EJ3A 4G4FA 4BMEA 5FY0A 4C0HA 3ES1A 4S2FA 4ISQA 5FYVA 5A7WA 1C8M3 3VL9A 3B93A 3EMRA 1JZ7A 2VAUA 3RZHA 3KF3A 2D97A 1JYNA 3KLSA 2ET7A 4DUWA 5B4NA 3PUQA 4CCDA 4JRLA 3IZOA 3POGA 4ZY9A 2Y60A 5C70A 3DKWA 3ME2A 1RUF3 4LK7A 1FI2A 1C4RA 3HT1A 4ZKTB 1FOD1 4HBNA 3M7AA 4MXWB 1W8WA 2JECA 3K4DA 3FC0A 2B8MA 3GZUC 1F4HA 2CL2A 3DXTA 4XF4A 4XJ9A 4OMDA 2D5HA 2VTFA 5K7PA 3S6PA 3DKQA 1PMJX 4AI1A 2R7EB 1EUTA 3AYAA 3FN9A 1JU3A 5FZMA 1UOFA 5KXEA 1IOAA 4H2AA 4YWAA 5JWPA 5A3PA 3ZDSA 1WZXA 1FAYA 5IVEA 4I0AA 4NAOA 1ENXA 2WFF3 5AC92 1IS3A 1GQGA 1TME1 5FYCA 4U36A 3VV1A 4E8CA 4FAGA 1PVC1 1AR72 5F6LB 1CQ9A 3JQXA 4YFWA 4NN0A 2P1BA 1XOYA 3VKMA 3J8F2 4CE8A 5LRSA 3OD0A 2C24A 3GDBA 5FMDA 4RR3A 2DVFA 1S0GA 3TRSB 5LW9A 1AUYA 2XOMA 2VNGA 4UFMA 4AG4A 2L9LA 3I3DA 2NN8A 1AL21 1NY71 4Y1XA 1LJ7A 4MGKE 1H8VA 3HMYA 3AMQA 2EXIA 5I8YA 1RUH3 1GOGA 2QZ3A 4COVA 2EXJA 4MADA 5FZ0A 4LO8A 5DG2A 4YFZA 5JPNB 4ZS2A 3MLKA 4IQPA 4DXZA 2SBAA 1J84A 1N1SA 4QKDA 3WUCA 2ZXQA 3B9CA 4IV1A 2GMMA 4B1MA 4GULA 3OYWA 2JDPA 3PIJA 3WW4A 1PM7A 4A6SA 3T1MA 5CFDB 3OSDA 1XSQA 3AKQA 4IV3B 3HNMA 2VULA 1BCXA 4UFIA 1H0BA 2B45X 1N1TA 3SCGA 3UK9A 1JYCA 2A6VA 4OUEA 1FPN2 1OOPC 1TEIA 3LAGA 1SCSA 5L9VA 5L9BA 4QKNA 5SV5A 1RUD3 3WNXA 3HOBA 3UKTA 3H3UA 3H3LA 5CAZA 2QQOA 3WLUA 4UFHA 2VTXJ 2WZR2 2PA7A 1UXZA 1QDCA 3AZWA 4QHZA 5JSPA 1UO9A 3E6CC 5F5AA 5EHDA 1YQCA 4JTNA 3UJQA 2ZMNA 1RUJ1 2YC2A 1GBGA 3I7DA 4NOTA 4RGAA 3TYJA 2YXSA 3ZSLA 4NIHA 4IL7A 2GNDA 5LBCA 4V2WA 4D7YA 4B8EA 4RQPC 2XL9A 5FYUA 4XBQA 5EYXA 4DXRA 1W05A 1SG3A 1VBE2 5DUWA 5FYYA 1YQ6A 4NHYA 1OXCA 3U1XA 2K46A 3ZMNA 1J3PA 4X6QB 4MGSA 1LB2A 2YBKA 3J7HA 2D7FA 1W2AX 1ODMA 2BP6A 3ACLA 3C7EA 3RYKA 1VBA3 3U0ZA 3MZHA 5D2AA 3AJYA 5I93A 1AX0A 3SEPA 5D21A 4ZS3A 4NE9A 5FP3A 1W8FA 2Y26A 4PLMA 5JIUA 3MW3A 1XYOA 2XBO2 2G9ZA 3POYA 1NCRB 1NUKA 3BU7A 5F6KA 3IB3A 3H7YA 2RS13 4EWEA 2XQXA 4WVMB 1DGLA 5FIXA 1C1LA 5LRRA 3OEAA 1VBC2 3WNKA 1RUI1 2HWC1 4S2HA 4MH0E 3O0VA 5FZEA 2JEMA 3KV5A 1XNKA 4RR3C 4ARXA 1HRI3 1RC6A 2G9GA 3IT8A 1YUDA 3HAGA 1NOVA 4COYA 5I0SA 2JKBA 2V72A 3FMGA 4GWMA 4KQ7A 3RPQA 1TMF3 2DF7A 2WN2A 4QB1A 4Q4W2 4N8MA 4PF1A 2ES3A 1EV13 5FZFA 2MEV3 3VBFA 4IDZA 2K0GA 3WSOA 1WA6X 1RUG3 2JG8A 4QX7A 2QQVA 4QDRA 1I9RA 4CDXA 4KWKA 3D0JA 2D6MA 4RS5C 1QJEA 5FY9A 3M3IA 1CZVA 2D6PA 2ORXA 5KHIA 4CPBA 1AR92 2PMWB 3R05A 2YDEA 4XQWA 5FXXA 4IV1C 4RN5A 3LDBA 5FZ6A 1ZZ9A 4YZ5A 5F7UA 1RINA 2P2KA 2BUKA 3B69A 4FQZA 4L97A 5DABA 2RJKA 4OHXA 4XILA 5C8CB 3ABZA 1VMJA 5LB6A 1LOCA 1VAVA 4OVEA 5FZ1A 5C4WC 3VBHA 2Q8EA 1N1YA 3OTFA 2J1AA 3ZXKA 4META 4EN0A 2W1UA 3VD4A 1NKGA 1OBNA 1RMU2 2VOVA 4FPHA 2CAUA 4H55A 4AF9A 3LA7A 3LOIA 4XBNA 3IM0A 2PLV2 4J6GA 2AR6A 4Q4V1 3KVBA 2J22A 5T3NA 4C90A 5BNOA 2E7TA 3OGRA 3AKSA 2RM23 3WD5A 2ZZQA 2Q8DA 1RHI2 2CWMA 2ZGTA 5FZ9A 4FCAA 2D6OX 4FPOB 3KQ4B 5EWSA 2AACA 4G3YC 5A3TA 2FD8A 2J1RA 4W8JA 1PGL2 1FMD3 5A3NA 4P9LA 3O1SA 5KXDA 2WYSA 1W0OA 4E9KA 3CBNA 3O1TA 5FZBA 3V0BA 3VD9A 2SLIA 3O1OA 2D5FA 5GZEA 2G9FA 1BLZA 4FFFA 4BXFA 3WNNA 2HKXA 4YGBA 4DFSA 1QQP3 3K4AA 4LHLA 1ASJ1 3NL1A 1MVEA 2HWF1 1CX4A 1LHOA 3ACIA 4R9CA 3B5LB 5FK7A 4I0BA 4OMCA 4XACA 1C8M1 5T5JA 2DFCA 2GP5A 4CZSA 1H1IA 3H9AA 4AVCA 1RB8G 3LCPA 2PAEA 1I3HA 2VCAA 5CKMA 2BGPA 3GBWA 3ZFEA 5ABJA 4Y20A 1GQPA 3FBMA 3MLJA 5IVJA 3AYCA 1UMZA 4QT6A 1XYNA 1ZBA1 4PBPA 3USUB 4OZOA 3ZIWA 1ACCA 1IPJA 2Q30A 3I3QA 1UPSA 2XLAA 5JLVA 1PIV2 5FUIA 4HXCA 3CU7A 5J96B 1WD3A 3I2IA 3CEWA 2JXAA 1NLQA 1LEMA 3ITQA 2PHLA 4CDWB 3WR0A 5JSRA 4I02A 3ACGA 1OF3A 2BGCA 3VBFC 4Z8BA 1O8PA 3R4UA 5FWEA 1CPNA 1APNA 1UNBA 1MQTC 5FPVA 4AOCA 1J1TA 5K9YA 3U4XA 2WFF1 4FPYA 4LLFA 4CDXC 1YFYA 1BYHA 2W1WA 3VDAA 3BTAA 3R0RA 1V6JA 1UYZA 2GZWA 1PO12 2DDUA 2EF6A 4FPEA 4PI2A 3O7OA 1JZ3A 4LE3A 3T0AA 1J1LA 5GLVA 5EYYA 1BEV3 4LUKA 3WF0A 1S0EA 4UFLA 3Q8EA 2ZX3A 3PVBB 3U4SA 2JB4A 5J36A 1EP0A 3ON7A 3HR9A 4HKWA 4GMP3 5HI0A 2IWGB 3RZLA 4Y1ZA 1AL0G 3RWKX 1YIFA 1RUH1 1JYVA 1QDOA 1S0IA 3H0OA 1W9FA 4AVSA 2ADEA 2ZKNA 1DGWX 4NRMA 1OPMA 2VXJA 1JOJA 2NM1A 4JC1A 1PMIA 5BNOC 1JYXA 1RUC2 5IATA 5IUQA 3AL6A 1OUXA 4DUVA 2BEOA 4HG6B 4XZPA 1W2UA 2IC1A 4ZONA 4RGGA 5C9AA 3URFA 3FUQA 5FY7A 1CR7A 4DXSA 2H0BA 1DYKA 4YSFA 4QPGB 4G9SB 1PM4A 5FUNA 2HWE3 5M0TA 3GGLA 3VBFB 3O12A 2JJ6A 4XCAA 3WNOA 3LEKA 4OQ9A 2JG8B 4K1YA 3RJ2X 2YFUA 3U07A 3HEIA 3VZKA 3FJSA 4AXOA 2ARXA 5DQ0A 2Y33A 1OPOA 2BGOA 3SISA 4H3WA 3N9NA 4RHV2 5FZHA 3RNSA 4AI9A 4BHPA 3Q8CA 2ZGLA 4QDQA 2C26A 3BI3A 1RUD1 2H6BA 2QTWB 3NKTA 1MS8A 5JIAA 5A1AA 5HPOA 3E5QA 3H42B 3T2OA 4ZU7A 1GR3A 3BODA 2DU0A 3ORJA 4KGGA 2ADDA 4N43A 5DAXA 3N9LA 5EP9A 3WQ0A 4OYUA 2R1BA 1NX9A 3VBHB 4JZRA 4Z2AA 5HBAA 1UY3A 1QHDA 5JUVA 1JYTA 4Y24A 5IJRA 3ZFEC 5ABJC 4ONUA 3AKPA 2RG4A 2EAAA 2O14A 3TEWA 1W2NA 4IEPA 1MEC2 4HK8A 1G9AA 2VBBA 1O6UA 5BNOB 5GLUA 4B7EA 3HNYM 4QGNA 1QY4A 2C0ZA 2Y6HA 4NRPA 1ENSA 3THPA 4KL1A 2IVIB 4DRRA 1K12A 1K42A 1QOOA 1EUUA 1Y7BA 1O4YA 2IXHA 4EV0A 2ZACA 4TXWA 3QH7A 4Q4X2 4MSVA 3S7IA 1VBA1 1AF9A 2VMIA 3UGFA 3D82A 4R4ZA 3E6BA 3PUSA 3LPFA 5A6XA 2ZEZA 3MV11 4M3CB 1AYM2 4IEWA 5IVFA 1ODNA 2VVFA 3V0BB 3MW2A 3BTXA 2QQNA 3MFCA 5A3WA 3TAYA 4XBLA 2RS11 3A0NA 2WNOA 4JVAA 3SCFA 5J98B 3DEMA 5CISA 3OCPA 1GWMA 2F4LA 1AR63 1X8MA 3D6EA 3FWEA 2WS92 3LIHA 4WM7B 3WF2A 3T09A 1CZSA 2P3YA 3C7HA 1KJRA 5LASA 3FBYA 1RXFA 4V2VA 1HRI1 3JD73 2XJQA 5FYIA 4CVUA 2KA3A 3ZFFA 2ZGOA 2BDRA 4BB3A 1TMF1 2VNOA 5ABJB 2IFWA 4Y20B 5H9SA 4UFKA 3VZMA 4AI8A 4QMAA 3FX3A 1KXGA 4KI5M 2HYKA 3C7GA 4Y5SA 1EV11 5F3EA 2MEV1 2BNNA 2JDZA 3LFMA 4XFHA 4XUOA 1RUG1 1W3VA 3S5QA 2TNFA 2HWD3 3T4VA 2PQQA 4HOOA 3LSEA 3BKZA 3I4IA 1FYUA 1K3IA 2TUNA 3K4ZA 5C9AC 3AFGA 3NNFA 5I8TA 4LXLA 5ANNA 5J09A 2VZOA 2WQZC 5CG8A 2JICA 2VTXA 2D44A 2ZX1A 4AR2A 3CL1A 1KFUL 1W6PA 4KWJA 3TN92 1LHWA 1QJU3 1GANA 4DINB 3ZKYA 1MZEA 1G7YA 2DUOA 3ILFA 2KM2A 3WX5A 4NRQA 2XJUA 4QPIB 2E53A 4AVAA 4DOUA 5C5TA 1D7PM 1T2XA 5JOWA 5FQ0B 4D69A 1YQ5A 4IE5A 4A3ZA 4LHNA 1KS5A 2VW0A 3WG3A 2WT1A 1WCQA 3KCCA 3ENRA 2B9UA 3U37A 4LMFA 2P3IA 2DCKA 3PJQA 2RM21 2YYOA 4XDOA 5FPAA 2VU9A 1URXA 1N3QA 2JE9A 3T0DA 1HJFA 3T0BA 3H1YA 2CTVA 1STMA 2YPDA 1GSLA 3CDZB 4GAZA 4CP2A 2XMLA 5FWJA 3AP7A 3I2DA 1WCSA 3KT1A 4LBJA 1FMD1 4RA0A 2NZ9A 3J4UH 4PHZA 2JB8A 1LECA 1S2BA 2UU8A 4MG2A 1TQ5A 2UYBA 1QMJA 5AFEA 3PJYA 2BFUL 4JGZA 4FTSA 1RJ8A 2W95A 4UBHA 1SDDB 1O7FA 2VMGA 3BYWA 3D4KA 5IFTA 4YRDA 1QQP1 3QACA 3VHNA 2IXLA 2Q4SA 3AZYA 4XUTA 2NPIA 3WW1A 2A73B 1JZ6A 2R043 3JQWA 1LTEA 3OUIA 4YG6A 4AI3A 5BNNA 1U5ZA 5DUUA 5FLHA 1GUIA 1PZ9A 1UY1A 2Y0OA 3I3EA 5FCCA 4BIOA 4FAHA 2VH9A 1AXYA 3JBG3 1O5LA 2D3PA 3CQOA 1XNCA 1LGCA 1N3PA 1RVF3 4CEYA 5CKQA 2FZ1A 3ZN5A 2DUPA 5CFCA 4XFGA 2ZA9A 2X29A 4LULA 2J1SA 5GZCA 1C5IA 2PXJA 4Y33A 4F83A 4AEDA 3OUJA 4GKYA 1H2NA 3WP4A 4N43B 4BYYA 2BJSA 3BU0A 3IWZA 4ZZ8A 3NJVA 4L11A 2VOKA 1FOD2 3CNAA 3I59A 4QX3A 5T50A 2G4IA 3Q8AA 3DUIA 4A6OA 3OD4A 2LALA 3PU3A 5HV0A 1PGW1 1PZ7A 3OGVA 1C28A 1WCUA 2DTYA 4PQ9A 1VMFA 2P6HA 1XB9A 2WLQA 3WY6A 4S2GA 2XJPA 2WO2A 2JENA 4AK3A 3NW4A 4J25A 2FDKA 2WLPA 2ZS6B 4GKXA 4ES8A 3V64A 2VZVA 4YG0A 1TME2 2RJLA 1PVC2 3HNBM 4XUQA 1G9BA 1BEV1 1J3RA 3SNMA 4WZCA 4XFBA 2PHUA 5JAXA 3POJA 4XETA 3KV4A 3HQUA 3LA2A 3WF3A 1PO23 1R1ZA 1QXPA 4U2AA 1KGYA 4GMP1 4I3GA 1R1A3 2HEWF 2OIIA 1LNSA 4Y26A 5JVVA 3PLQA 1KJLA 2AH2A 1AL22 2ZJCA 3POIA 3IPVA 3N7MA 4MZUA 2VD7A 3NWKA 1S0DA 5FZLA 3RMYA 3RVHA 3ZPOA 4HPKA 4JDMA 1ZA4A 5BXXA 5K8SA 1ENRA 2VZUA 3E1F1 4WVZA 3ZFFB 1CONA 1QXJA 3SCHA 1T6BX 1YQ8A 3QD6A 5BNQA 2P34A 3GJAA 5LBFA 4BQYA 4I2OA 2HWE1 1K5MB 4ZU4A 4NIGA 4GXLA 1QH7A 4NPMA 1IHMA 3AZZA 3DYPA 4FT8A 4XYXA 3HQRA 3MF6A 3VZLA 1PZ8A 4YW5A 2W52A 5ACA1 3JU9A 4QHOA 3ZSJA 3MIGA 1ZZBA 4JGZC 3L2YA 4QXHA 2RS53 5DZFA 2EIGA 1MS5A 2VVEA 5FYBA 5BPXA 4DXTA 1EAH3 5CG9A 1L7RA 4Z82A 4XJAA 4CP9B 5AVAA 3ZLIA 1HDKA 3P1IA 3JZVA 4CCJA 5ERLA 4JHTA 4JGYA 5GJ6A 5BNNC 1UXXX 1WLWA 1W6NA 3PNAA 5ISLA 2VGDA 2UY9A 4J1WA 1JXNA 3POEA 4LT5A 5EXOA 2NYYA 5L9RA 3IKWA 1NQJA 1OD3A 3N9PA 4QM9A 4X8PA 3VL8A 1QF3A 3WZ1A 4NHMA 3I2JA 4LKFA 2WN3A 1XE7A 1ULDA 3UV9A 4CEYC 1ND3A 4XMIA 1RUJ2 4Z07A 2JDHA 4IE6A 1GZCA 3B00A 1VLNA 4NAMA 2ZOEB 2VOWA 1YHFA 2D43A 3UT0A 4AEDC 1BMV1 2EVXA 1PNFA 2AEYA 1SFNA 4QKFA 4BPZA 2A6YA 4M3CF 1ULPA 2YBPA 1JODA 1SEFA 2WNUA 2A3WA 4IGPA 3VHOA 1S4CA 2BV4A 1H4GA 3HJRA 4UW6A 2CV6A 4AVTA 3EHKA 3ILNA 4IGOA 2PHRA 1MS0A 2YGMA 2OUHA 1QIQA 4R9DA 2YPJA 3OGSA 4ZXEA 4QQOA 3RWNA 4MHRA 5CEHA 3WNPA 4P5HA 1GNZA 4P9YA 3NV3A 1ND2B 1D4M3 4LEJA 3M70A 4K3UA 4ZHNA 4W50A 3ZM8A 2CDPA 1BVVA 3OEBA 4FPLA 1UU4A 3DPRA 2OXBA 1AR61 3DN7A 1Z7S3 2OYZA 4ITCA 4QPWA 1RUI2 1F35A 2HWC2 2JDYA 1MR5A 4GH4B 5AC93 5IK8A 5F3IA 2VBPA 3ELNA 5GZDA 3LF7A 1OC1A 1AR73 2VUCA 4LKDA 3GCXA 1U12A 1HRV3 3BUCA 5GLWA 2JDNA 5E8AA 3LEIA 5CFCB 2ID4A 4UAPA 1SPPB 2GMEA 2W5FA 3L9JT 4GALA 4YG3A 5FPBA 1V70A 3NV2A 4P08A 3U11A 3ZVXA 2ENRA 1XNBA 2PTMA 2HWD1 3VBUA 3N3HA 1VBB3 3WG1A 4CXXA 4LBQD 5DN2A 4GB33 1AX2A 3WINE 1KQRA 5JOXA 5J48A 2QBXA 3I59B 3M3EA 4RQPA 4MGZE 4B4QA 2ZGUA 4E4SA 3NJXA 1GZWA 1ZBA3 2X09A 5FK8A 3AMMA 2BW8A 3VDDA 2CWSA 3P5BA 3PUIA 2BPA2 4N7IA 3MPPG 4YLZA 4PF5A 4BISA 1LHUA 1QJU1 1S55A 2QUOA 1RITA 1OKQA 4NIIA 5FZ8A 4QX5A 2Q8CA 1BBT3 2DFBA 1QWRA 2ZEXA 1XNTA 1CD3G 2GN7A 1ONAA 5HXMA 4QXCA 1JI6A 1T6GC 1WD4A 2HEVF 2XDVA 3FFQA 2ATFA 2VY0A 3TBDA 3ZYIB 4GIQA 1CZTA 3LDRA 4OCTA 1OI6A 3DXUA 4DZGA 4P9WA 4JGYC 3O1RA 3R4SA 4XQDA 2OQ7A 1F5FA 3JUUA 4HVRA 1UY4A 3SMHA 2HLEA 1UOBA 4Q4V2 3SKVA 1YI9A 2B7YA 2NP0A 2ARBA 4K6BA 2HWB3 1HB4A 4Z1VA 1ULCA 1L7LA 1OT5A 2ZX0A 4IUGA 3ZPYA 1LU2A 1ND3C 3CJIA 3MGUA 2A6XA 3DV8A 3OGGA 1UN1A 5A3OA 2WA3A 1JOPA 4X8NA 5FZOA 5FLJA 3SKJE 1QOTA 2V5YA 2WNUC 1LENA 1QNYA 2BOJA 4NHXA 4QQ2A 5BV6A 5C8WA 2R30A 3NNLA 5HCAA 2YBSA 1FXZA 2R041 2O8QA 3BN6A 4MLOA 5F5QA 5GALA 1ASJ2 3OG2A 4RS5A 3AYDA 2FQPA 5E1RA 4P9GA 5EQUA 5F2WA 3GALA 3PDQA 2CHHA 1KITA 1MS9A 3NV4A 3JBG1 4RD7A 2Y64A 4MGTA 2ZABA 1LOFA 1RVF1 3ZOIA 3RS6A 1GYKA 3I2KA 3DPRC 4B4RA 4XJ8A 2WR9A 5C3RA 1GWKA 5JR2A 4CUBA 2XR4A 5FFOC 2AZ5A 4JGYB 3FUOA 3KQRA 2HJIA 4NHLA 5C4WA 4JDNA 2BVVA 3V0AA 3NKGA 3ZXGA 5A6YA 4TWTA 1RUF2 2YUEA 4UF0A 3MLLA 2JDUA 5IK4A 3H8UA 5LBEA 2BU9A 3W59A 1SLLA 4YW6A 5KXBA 4DO0A 5JXIA 1HQWA 1HV0A 3WP5A 2VMEA 1WMFA 4XJWA 4CUCA 2P4EA 2TBVA 4URTA 3VBUC 3OBRA 2WAOA 1XE0A 3I49A 3AYEA 2NQYA 2WNUB 4DQAA 2OS2A 3MI8A 3QCWA 1CJDA 4EQVA 1E57A 4E4HA 5IAXA 2JDAA 3APBA 4TZDA 4AGVA 4QHBA 2D40A 4RFRB 1ULGA 1LCLA 1SMVA 1W90A 3LQCA 3QLQA 4P14A 4PLNA 3VDDC 5C3OA 4CDQC 3FL7A 3WNLA 4EWAA 1GNHA 3TNQA 1PO21 4BQ1A 1AYN3 2VM9A 4YVSA 4YNIA 1X50A 2VZTA 3J26N 4ORFA 5EFUA 5EZWA 1O3SA 1UQXA 3WV6A 1R1A1 5T52A 3WNMA 4PIZA 4XABA 4QB6A 1AR83 4A7YA 4RL7A 3ILRA 1SACA 2ERFA 1NCQA 4N9IA 3VKLA 1ALYA 1RUH2 1WA4A 2OA2A 2W0XA 3EXUA 2RE9A 4YM0A 1OOPB 4D7TA 5ACA3 1JYIA 4LPLA 1DHKB 1YO8A 5FY8A 4AL9A 4I30A 4LQRA 4E2SA 4E8DA 3T08A 3ZDVA 1JOBA 3W21A 4IE4A 2A3YA 2JIJA 1LOBA 1OVSA 4KMQA 3USSA 3OY8A 3CJIC 1DIWA 5A7WB 3J9SA 4Q0VA 1VR3A 4XW3A 1IS6A 3M3OA 1HQNA 1ZX5A 1RHI3 4QKBA 1QNWA 3O1PA 3ZSMA 4INDA 1XU1A 5FXZA 4BLJA 1VP6A 1UW8A 2E33A 2EALA 2Q1FA 2RS51 4RQPB 1ZREA 1Y9QA 1VIWB 3D3AA 1UZZA 1GZWB 4UFJA 3O1MA 3C8XA 2PHWA 2R063 2I07B 4R4XA 1EAH1 2R0FA 1HV1A 1QJY3 3SH4A 1R083 4N90A 1MQTA 3VN4A 4CCKA 3WDYA 1RUD2 1OF4A 1Q5OA 2NMOA 2QZ2A 2VXRA 5K0UA 1FATA 5A7OA 3WOGA 1NQDA 1IQDC 2A5ZA 2GC1A 2Q1MA 2AUYA 3M8LA 1D0GA 3PUHA 4LNVA 4DNYA 5LWBA 3WDTA 2VMDA 1S1AA 4DY5A 1LKNA 3ZXLA 1SDWA 4XXPA 4AAPA 5F3CA 2RR12 1LOFC 1POQA 2A6ZA 4K1ZA 3UGHA 4XAAA 3O0WA 1OD5A 3DGTA 2Y0IA 1FV3A 4B7KA 1WLCA 4K7JA 3NMBA 1VAKA 5KHKA 1YC61 2DU1A 2OZ6A 3LA3A 3OPZA 1CIWA 2NMNA 4XTMA 1JZ2A 1WBFA 3MIEA 3V56A 1CESA 1QGLA 1LULA 1V6OA 5FZCA 5A70A 5JR7B 4FP3A 1TZOA 2GN3A 4R9BA 3I2OA 4NROA 3CJIB 3ZXFA 3PMEA 3RYPA 4RR3B 1RUE3 1VBA2 3AJZA 4E4DX 2YB7A 2OVUA 3O1VA 2DCYA 4OLLA 5BUVA 4CDUA 1D4M1 5KHJA 1UX7A 3ZXDA 3KGZA 3UNPA 3THTA 4HN1A 4EWDA 3VB9A 4Q4Y2 2RS12 4OHVA 1ULFA 1K45A 4HZFA 5EIYB 4XC9A 1Z7S1 1VPHA 3WDUA 2GH8A 3UESA 4RS5B 4LR4A 2X53S 4JTOA 2P5BA 5AC91 1UZVA 3VHPA 1UU5A 3M2MA 5IAVA 1C5HA 1AR71 4IV1B 5IVYA 4AQ2A 5CU1A 4YVSC 2WAAA 3OYWB 1Y9GA 4HFSA 1HRV1 4XXAA 4CCNA 4CCCA 1O3QA 2E6VA 2B46X 1HRI2 4KNCA 4QQHA 3RG0A 3RQ0A 1BJQA 5GM0A 4CU8A 1TMF2 5FYMA 4CCOA 1NCQC 2RMU3 1U0AA 2WL1A 3PUAA 1JZ5A 3P3NA 1EV12 4L2NA 2MEV2 2W87A 4LK6A 4XFIA 5C4WB 3V0AB 1A6CA 1VBB1 2XJTA 3U75A 1RUG2 4GB31 3VHRA 2DVGA 4KH9A 4KG8A 1JZ8A 4AGRA 4UF0B 3MDPA 1KDMA 4MYEA 3SHRA 1OLRA 4I01A 2QDNA 3ZR5A 5E89A 4BZ4A 1S0FA 4QB2A 3HPNA 2Z2SB 3FZ3A 4XHXA 4JKLA 2PHFA 5DZEA 1VB4A 3ATGA 1BBT1 1X8EA 1UOJA 3TB0A 1GNYA 1SLBA 2B42B 2GC3A 3QBQA 3VBRA 3TEZA 2ZGQA 1O8SA 4XF0A 3OUHA 1HKDA 4UOJA 3VDBA 1JMUB 2HEYF 5K0UC 1COV3 5IW0A 2I45A 4WBBA 5FZIA 4XVHA 4CSWA 2VE1A 5FP7A 5L7OA 3RI9A 3ZFGA 2J1EA 1YNAA 1SHWB 4FI9A 4UI9L 4IEOA 4OI1A 4CEWA 1GZTA 1W6OA 2PN5A 3N7JA 1A78A 2RM22 1VJ2A 2HWB1 2VNRA 2WYFA 4PT6A 4WVWA 4NIAA 1QOSA 4XZUG 3VBSA 3GZEA 5FZGA 4YW1A 5KHGA 3QH6A 1O4TA 2LUWA 1FMD2 1NLRA 1V00A 1DGWA 1X9TA 2RDQA 5G05L 5I0TA 4M3CE 2JE7A 2ZAHA 3PVOA 5FPLA 2VZRA 2OPWA 4BOWA 5FYHA 4QD2A 3PVNA 2F17A 2ARCA 1E5IA 5FP9A 3RZZA 3N9MA 3OY8B 2V09A 2DBNA 1RUOA 2EXKA 2OUJA 3H8OA 4GWIA 2VZQA 3BB6A 5JOZA 4CDUC 1QU0A 3EBRA 1Y9MA 3LE0A 5IK7A 1UYXA 1YJKA 1ULEA 2E26A 4OHYA 3WF1A 2ZHLA 4Q0UA 2WZEA 2XB6C 4BXSV 1UMIA 1MQTB 1DF0A 1MVQA 2W39A 3KCXA 1GMMA 4WV8A 5K0UB 4CDXB 4YARA 1RUNA 3T30A 1Q43A 4L9BA 4QX8A 2AREA 3NNGA 5F8PA 2W68A 1VBC1 4WM8A 4ET7A 3M1HA 2FBEA 1W06A 1IS5A 3NAPC 5A7QA 1QJX3 3MPBA 4A42A 4BK4A 4N7UA 5L36A 4B3NA 2R073 4JKKA 1PGW2 3UKVA 4DY3A 2C1FA 1H1AA 4FO9A 2R49A 4MXVA 4Q5OA 5ANQA 1A8MA 1IGOA 1OA4A 1UWWA 4YW2A 4LO4B 1B35C 4YZ4A 4AYUA 4UWDA 2ZCWA 2ZMKA 1NAEA 2VZSA 1GLHA 2VMCA 1UX6A 1X9PA 5CADA 1JZ4A 1OFNA 3W20A 4Y3OA 2VQAA 4EROA 1BEV2 1UYYA 1W8TA 5FY1A 1AYN1 2VECA 2GDFA 1YEWA 3RZMA 2A70A 3N9OA 3S7EA 3VBRC 1S2KA 1AR81 2RVAA 4IEZA 4MGQA 2Y6KA 4CU7A 2YC0A 3JCIA 4JHZA 5LA2A 3MUY1 5DAVA 2QKDA 4XUNA 3WHTA 5F32A 4FFHA 2ETEA 1PX3A 4LBOA 3TNPB 2WUHA 4OQ8A 5FMOL 1UIKA 2Q0AA 4GQ7A 4O7XA 4JCKA 4BH9A 5AFBA 5FTTC 2VUAA 3IN9A 1GKBA 2EIEA 2WT0A 3ZFGC 5L7OC 1DQ5A 3ZYGA 4N53C 3RI8A 1W8NA 4CEWC 4QGLA 1UZYA 1NE6A 4LTAA 4H14A 2PQSA 1J59A 4XUPA 2QQMA 4LO5B 4NUBA 5C6CA 2OZJA 3CMGA 5FUPA 5FY5A 2ZHMA 3T2TA 3VBSC 2HWE2 2UYAA 3RZKA 4L92A 1RHI1 4AFBA 3CO2A 1SLCA 3ZFEB 4D3WA 4AEJA 3NVCA 5ACA2 4NJ4A 4EE2A 1BK0A 2W3JA 1GZ9A 2E51A 3D5OA 5DUVA 1PGL1 3ZMOA 1WKYA 2R061 2P3KA 1C57A 1QJY1 1YXWA 1GU3A 1R081 1AVBA 2R1DA 3WG4A 2VUDA 3AP5A 2X05A 2D6NA 5DAPA 2DYCA 2Y6GA 2AC1A 1VAMA 2WSUA 1CAXA 2YV8A 2XH6A 1W2TA 3E6DA 1W8ZA 1UZWA 2V4VA 1W6QA 5CYYA 4PBOA 4LBQA 3AMPA 4LUMA 5E6HA 3VBRB 5C3QA 2QQUA 3ZYFA 3MUZ1 1AJOA 3GBFA 2BNMA 2ZBJA 3J7MA 4H7MA 4K9SA 5F5CA 4AQSA 4CRQA 1DDLA 2WABA 1OHFA 2AEZA 1X36A 1ENQA 2P17A 2J1TA 1IPKA 1IZ3A
chains in the Genus database with same CATH topology
4FXGB 3HWJA 4YW4A 1POV3 1Q8OA 4QGMA 3WCRA 1BMV2 4ATFA 4WM8C 2DCJA 1AHSA 2XWBB 4AFMA 5GLZA 5A33A 2H6CA 5JZGC 1VBD3 4FVVA 1RUE1 3N4MA 4HANA 3WW3A 1JUHA 3WXPA 5E88A 2PHTA 4Y1UA 3MIBA 2BWCA 5F1RA 3FLTA 1SLIA 2IXJA 1L3JA 1XNDA 4ASMB 2A3XA 3RSJA 1X33A 2Z42A 1BZWA 3POWA 4Q27A 5FRAA 1AR62 5C9AB 4HETA 2LM3A 2IZWA 4HN0A 1H8TA 3JD72 1JBCA 4YGEA 1PNGA 5A3MA 2Z79A 1OFSA 4PDWA 4L99A 2RMU1 4AHWA 3O5SA 4M0NA 1VRH3 1HXS3 4KG0A 4W6YA 1V9U3 2ZKLA 1N47A 1DLLA 1WW5A 1LOGA 4WM8B 4Y22A 1FV2A 2GC2A 3ES4A 2QDRA 2RS33 1CAWA 4QU2A 4PIYA 3KCYA 4QQLA 4MGIE 4M01A 1A8DA 5GZFA 3ZSKA 3ZXAC 4JQRA 1QJU2 1PK6A 2CGOA 4GMP0 5DZGA 3MEPA 2AGSA 1MS4A 2Q8OA 2Q1ZB 1NXD1 3E5UA 4AI2A 4OFGA 4OI4A 1COV1 1KD7A 3SH5A 4IEVA 1UPIA 1WW6A 2EA7A 4A7ZA 4IEXA 1WW7A 1N1VA 4LBLA 4NVPA 3VZNA 2VUJA 1LR5A 2TEPA 3AX4A 3GHMA 2PHXA 2DWRA 1TNRA 1CAVA 4K21A 2WKKA 1S0JA 2R32A 1OQ1A 3G7DA 3G6JB 3KT4A 4XJUA 5LK7B 5I8SA 1ZRCA 1ZBE3 3IDEA 1NY72 2YGLA 3K48A 1Z0HA 3IIAA 5LEJA 1ZZ7A 3P3PA 3ROUA 1B09A 2Z5WA 2R16A 4QQPA 2DURA 4ES9A 5FPXA 3GBGA 1U5IA 3DL3A 5L19A 2R042 1IKPA 1HLCA 1PGSA 4Q0QA 1PHMA 4P9JA 2I74A 4FP2A 2UURA 4XHBA 5JPMB 1WGPA 1OMIA 3JBG2 5CB7A 3FFZA 5FMOS 1RVF2 1QKQA 2QVSB 5DDJ3 5FLIA 4Q0PA 2EAKA 2WNEA 1W6QB 3S0MA 4WVVA 3M3CA 1H8TC 3BIWE 4FSJA 1NXMA 1MZ6A 4IETA 4BMBA 1W6PB 2ZTNA 4PDWC 4OHZA 1QJX1 3PHMA 4EJRA 2ET1A 4UXAA 1FNZA 2R071 1R093 4FPFA 4Y4YA 4AI0A 1D2SA 1XQNA 5DUXA 3MIDA 4XJZA 1AXZA 1OLQA 5E16A 3VKNA 3WDVA 5CFDA 4LO7A 3AK0A 4IV3A 4LHKA 2UWCA 3K51A 2ZGSA 3ZYPA 1PK6C 1PO22 4ISRA 4XQ4A 2JG9C 2GMPA 2QCSB 3WHUA 2ZZJA 2CNAA 4JGZB 2XJVA 3MYXA 4HKOA 4TSVA 4CYDA 5JI7A 4AQTA 2VW2A 2XL7A 3BPZA 1LHVA 2CY6A 1WW4A 4L8QA 5BNNB 2XJSA 5AVPA 4AHZA 4DPNA 1REFA 5CA6A 3HQXA 1H30A 3GZAA 1D4VB 2XVGA 4E2GA 4F8AA 3V65A 4R9AA 3L2HA 4B4PA 5IT6A 2F6BA 4F3JA 4CEYB 4E27A 3KS7A 2GSYA 3J8F3 4BIFA 3N35A 4NHKA 1CAWB 5T5PA 2BFUS 4AEDB 3IMNA 3AFKA 4COZA 5FOBB 5J37A 5FO9B 1EAH2 1QH6A 1REDA 1UF2C 1WLDA 2XKOA 3EJKA 5JMCA 2ZX4A 1NCRA 4XIOA 1PK6B 4Y1YA 4IERA 1LOEA 1W0PA 4WVMA 5DXDA 4AW7A 4XFFA 4CDQA 2VG9A 1UU6A 1JUIA 1CVNA 2WQ4A 1WBLA 4QM8A 2XLGA 2QQPA 4YZ3A 4OZXA 1EPWA 4DB5A 1DZTA 5KBFA 3M3QA 1POV1 3VZJA 1LGBA 3OGJA 4XOGA 2MHFA 4V1PA 1AJKA 3LZZA 3VUOA 1DZQA 1VBD1 4ZXKA 3SXWA 1FPN3 3ZN4A 3AZXA 1GV9A 1CAVB 4HK9A 1H1MA 1JW6A 1XU2A 2WSVA 3AXEA 4XTPA 2E7QA 1D4M2 2YMZA 5CBLA 2WZR3 3IPVB 4QPYA 2ZMLA 4Q0SA 2AYHA 3B7MA 4HPKB 4KBBA 4NR1A 2FHRA 4HT1T 3OJBA 5CFDC 4IV3C 3AP6A 4YW3A 1Z7S2 3KT7A 3HN1A 1LOAA 5KC6A 3H1WA 5H9PA 3TWIA 5C8CA 4FOQA 1D0HA 2X5IA 1VBE3 5FOJB 1HRV2 2FMDA 3NJZA 2EXHA 5BNPA 1RJ7A 2HWF2 3B01A 3FLRA 3HBZA 2FZ2A 4UBGA 4OHWA 3VKFC 1VRH1 1C8NA 5TSWA 1O5UA 2BNOA 1HXS1 4TYSA 1BVP1 1C8M2 1V9U1 2D6LX 1ZM1A 2QNKA 1OA3A 1VBB2 2RHPA 2WZPP 3GNEA 4GB32 4Q8LA 2RS31 2XBO3 3WDWA 3PMSA 1A3KA 1W6NB 4YGCA 1TNFA 1ZBA2 3H50A 4Q29A 1JTZX 3WP3A 1V6NA 4FXKB 2ZAAA 1VBC3 3HD8B 3WVJA 3WW2A 2BQPA 2P37A 4Y1VA 3BALA 1ND3B 2WJSA 1AXKA 4K40A 2WC2A 1BBT2 4BWOA 5I0RA 3MIFA 5I91A 5GZGA 4Y5Z0 1O4ZA 3RYRA 3SH3A 2GU9A 2MPFA 4Q4W3 3GHNA 2WFF2 4FPJA 4CP0A 1NCRC 1FNYA 5HCFA 1N3OA 3MICA 1QXRA 1NA1A 3GYDA 3SITA 2ZPXA 4YM3A 1I1EA 1UCXA 2HWB2 2E63A 1O91A 3USUA 1AR93 1F8VA 1BK1A 5I0UA 4A3XA 3DPRB 2RR13 2GNTA 1ZBE1 2QE3A 3C3VA 4W6WA 4CDWA 2DV9A 4X6RB 3QOPA 2CGNA 3UL2A 1LESA 1LGNA 1Q3EA 1RMU3 2C9AA 2NLRA 2QFEA 1DGRN 4XF1A 2PLV3 1CJPA 1NG0A 2YY1A 3VBUB 1H2LA 2XHKA 2DUQA 5DDJ1 4RSUA 1HW5A 5KWRA 5C8CC 4Q4Y3 3RRDA 3AMNA 1DQ1A 4AHYA 1F9KA 2X5IC 3VDDB 1LB2A 2PHDA 3WDXA 4YVWA 4CDQB 1I5ZA 4C91A 1WLTA 3MF9A 5KC5A 1UKGA 1ZRRA 3LWCA 4AHXA 5BNPC 2BTVC 1SCRA 5F9TA 1G9CA 2XUMA 1R091 5T5LA 4AQ6A 4XPVA 2H0VA 1UIJA 2BVBA 1GICA 3VKOA 3I54A 1HX6A 3POSA 1RL3A 4QPGA 4NWWA 4WZFA 3AB0A 4MGYE 4SBVA 3LSDA 4O9GA 1AZDA 2XGXA 1AYN2 1NYWA 5D8AA 1JN2P 1W39A 1PIV3 3A4UA 1X7NA 1AR82 3T1LA 2XG3A 4Q2FA 4ATEA 3R4DB 5SV8A 2D93A 3I8TA 2DVBA 2VMHA 3KGLA 4HVQA 1Q56A 2QJVA 4OUSA 2VW1A 4PJYA 3CLPA 2X5IB 2WIIB 2WNVA 1DG6A 5HXVA 1NA1C 3PVEA 1WMEA 2XLFA 5BNPB 1BQPA 4F7ZA 1SBEA 4BCUA 1DZRA 1G6NA 3CJXA 3VGIA 3LKJA 3ZXJA 2WFPA 1PO13 4KGQA 1H9WA 5KXCA 1CPMA 5CVRA 1OQEA 3NAPA 3O14A 2V73A 3J8F1 3KD4A 4ZU5A 3KSCA 3MW4A 4FPKA 2GH2A 3N36A 2OPKA 1KDKA 3LGRA 4CDWC 1YFUA 1D2QA 2AENA 2R062 2D98A 4GWNA 1QJY2 4M3CA 5GLTA 1R082 3NO8A 3U10A 4C1WA 4Z2WA 1B35A 1YCIA 1ZZ8A 4MVTA 1RIRA 1YJLA 3AXDA 1RUC3 3WT3A 1LRHA 3WQ1A 2ZGNA 4FBFA 3N7KA 4WM7A 2GALA 5CIRA 3ZO0B 3OF1A 4W65A 1NA1B 5LK5A 1IS4A 2IFRA 4YVWC 3KZ4C 4SLIA 4RHV3 1FPN1 1LEDA 4YVSB 1F2NA 1RUF1 1RUE2 2PFWA 1TE1B 3E5XA 3GZTB 4N53A 5BY5A 3B94A 2K9ZA 2ZGPA 1NCQB 2WZR1 4NWVA 5JCTA 2DCZA 3ASIA 1JHNA 3D0SA 4QPGC 1H9PA 3SLIA 4HL0A 1DYPA 5H9RA 4XE9A 4AEKA 2JG8C 2DTWA 1DFQA 2KXLA 2UWBA 5JDBA 2FMYA 4LA3A 1MEC3 4KU7A 1XRUA 4QPIA 1VBE1 4CP1A 1QQP2 4O9EA 1WCKA 5D8AC 4GA9A 1S0CA 1YIPA 5FQ0A 3VZOA 2PAMA 4Q4X3 2RMU2 2WINB 3Q9OA 3MIHA 5JOYA 1CN1A 3BOWA 3IDCB 1AYM3 1RGSA 5KHHA 2WNVC 3VBHC 4YVWB 1VB2A 2XBO1 3D8CA 1H2MA 2DCTA 1SBDA 4AVVA 3ZSEA 1G86A 1DBNA 4ASLA 3NSTA 1UL9A 4OI0A 4AFDA 1JH5A 1F31A 2VQ0A 2YZ4A 1YFWA 3O0XA 3ETQA 2WS93 3HIFA 5GKAC 1SLTA 4NPRA 4YM1A 5JZGA 3PTYA 4FOVA 2WA4A 3N7LA 4IEYA 1ZNPA 2PELA 5EV7A 3RDIA 4IEUA 4COWA 4LA2A 4FTEA 4Q4W1 3AZVA 4DS0A 4BLIA 1COV2 1YWKA 4YZ1A 4HLTA 4XF9A 3RJRA 1U5XA 4PLOA 5D8AB 2A7AA 1NLSA 2ZHKA 4CDUB 2YROA 1CAUA 2O1QA 1MS3A 2XVKA 1AR91 4WM7C 2ZGRA 3FE5A 4UW5A 1G9FA 2D6KA 4DMIA 1VALA 4HKLA 3W58A 1C3HA 3WP6A 1C1FA 3ZN6A 2RR11 5FAXA 1MZ5A 3IDBB 2WNVB 2CGPA 4YYOA 3TN93 2WWSA 2W08A 2Z69A 4H7LA 2CYFA 2O0OA 3MFAA 1KFXL 1MS1A 3AKRA 1ZVFA 4AVBA 1H2KA 1RMU1 3NAPB 3JB4C 2IXIA 5JI9A 3B3QE 2PLV1 3S30A 5LEKA 3NV1A 4QXKA 5T5OA 2N7GA 3AM2A 4FQ4A 4XMAA 4YZ2A 1XYPA 5A3LA 4PCRA 1B35B 1ZZCA 5CNAA 1GQHA 4Q4Y1 3AP4A 3ZIXA 4XF3A 3LB9A 4EN6B 1Y3TA 5B2GB 4JAAA 4QPIC 4JRAA 4LE4A 1WMDA 2C5DA 4AFAA 4YGDA 4D7SA 3FLPA 4E2QA 2WT2A 1QJX2 3LOBA 2R072 4W6XA 1IQAA 4BA6A 2DVDA 3R6SA 3UKNA 3CF6E 1GFF2 4FPCA 1K5MA 5L7OB 2O8OA 2XPJA 3ZFGB 1REEA 2PAKA 1Q8VA 4N53B 4IEQA 5DG1A 4CEWB 1W6OB 1YYNA 4A7KA 2I2SA 4FPGA 4COUA 1X82A 3FHIB 1XE8A 3H3ZA 4K8FA 4AFCA 3VBSB 4UW3A 1G8WA 4AEMA 1DQ6A 1PIV1 2UWAA 2ZGKA 1YFXA 2CAVA 1FOD3 4EN9B 4AE2A 2ZGMA 2ZX2A 3HT2A 3WQ7A 4MV2A 2OW4A 4KU8A 2PYTA 4M00A 1Z78A 4UW4A 4LBKA 3DF0A 1DQ2A 2XJRA 4FTBA 3KB5A 2MNGA 1Q8PA 1Y43B 4BE3A 4J1XA 1PO11 5A32A 1W6MA 1MZFA 1TME3 1Q8QA 4MX3A 1PVC3 3B02A 2IXKA 4N43C 1OSGA 5FBZA 1EPZA 3BOPA 4KWLA 2BWAA 1O3TA 4LLOA 2HWD2 1AL23 4I0WB 1ND2A 3EO6A 5JZGB 1SFYA 1CGPA 1AX1A 1SBFA 1RUC1 1S0BA 4DRVA 2E9QA 4OUMA 5J3UA 4IXLA 3VBOA 4BM8A 2X8KA 4OULA 1LODA 4HMZA 2LTNA 4GH4A 2JX9A 4XFAA 2JG9A 1XXNA 4JDOA 2JD4A 1J3QA 1I6XA 4R52A 2XKPA 4RHV1 1CAUB 1BKZA 2YHJA 2VPVA 2D3SA 2F4PA 1NZCA 1VBD2 3H7JA 3ZN6B 1FX5A 4M0HA 2B5HA 4C0BA 2R0HA 1LU1A 3ZFFC 4P9XA 3OBTA 2GNBA 5H9QA 4EN7B 5L73A 4HSJA 3WCSA 4HVOA 1SLAA 3AMHA 4XFCA 1K5MC 1ZZ6A 3B9IA 4NO4A 4MXWA 1YI7A 2K2SA 4Q1RA 1RUJ3 1MEC1 1KRIA 4E4ZA 2GC0A 3X29B 1UKRA 3TOJA 5HCBA 1QJZA 5BYNA 1EYBA 4AGGA 3AP9A 2ILMA 4AWDA 4Q4X1 4P9IA 4YM2A 4LBNA 1WCDJ 1YRZA 4RFT0 4CTEA 3WUDA 1VRH2 5J7MA 3ALQA 1HXS2 1SQ4A 1AYM1 4B29A 1V9U2 2B39A 1LHNA 4EN8B 5C33A 1CAXB 2XWJB 5FREA 4Q8KA 2RS32 4K20A 1V6LA 4XEZA 1J58A 4LBQB 1PVXA 2IXCA 5FDBA 5IK5A 1ZRDA 5D1IA 2GAUA 2WS91 4N9HA 1DU3D 2E7AA 1RUI3 2HWC3 4Z92B 5T55A 4C1XA 4LBMA 1ZRFA 3VLBB 3UJOA 1ZYBA 1G9DA 1IKQA 1V6MA 4FOWA 2XVLA 1OA2A 1DQ4A 1V6KA 3C2UA 1RTVA 3WG2A 4JV4A 1ND2C 5FPZA 5A33B 5FO8B 4OI2A 3GF6A 4MUVA 2ZHNA 1DGRA 1HQLA 3ST7A 4D94A 2VVDA 1FT9A 3EQEA 4XIKA 3VBOC 4I3PA 2Y38A 2UY8A 3IBMA 1YLLA 2A71A 3M4FA 4TLFA 4GH4C 5FO7B 4XDQA 4IESA 2VOXA 2DVAA 3ZYRA 1F5JA 4R8HA 1OQDA 5T54A 1R1A2 3TN91 3ECQA 4Q1PA 1ZBE2 4S2DA 5CFCC 3JB8A 2GNMA 5A32B 1W6MB 1H8TB 5JSOA 1U5YA 1UAIA 4PDWB 3INAA 3BCWA 3H1MA 2D3RA 1EY2A 2Q5TA 3A0KA