2DUQA

Crystal structure of vip36 exoplasmic/lumenal domain, ca2+/man-bound form
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
249
structure length
244
Chain Sequence
HLKREHSLIKPYQGVGSSSMPLWDFQGSTILTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTIDWTKIEPSVNFLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vesicular integral-membrane protein VIP36
publication title Structural basis for recognition of high mannose type glycoproteins by mammalian transport lectin VIP36
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Protein transport
total genus 58
structure length 244
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2duqA01
3ZXEA 1CESA 1J1TA 3IM0A 2ZGKA 3RSJA 2DU0A 3JU9A 1XQNA 4YGEA 1CONA 1LHWA 2B7YA 1MS3A 2CYFA 3BODA 4WV8A 2C9AA 4JC1A 3POYA 1N3OA 1QOTA 2ZGNA 3POWA 2PHUA 3AZWA 4LBQD 2DUOA 1Z0HA 1DYKA 1Y7BA 2CL2A 4MYEA 1WD4A 1LOFC 1GBGA 2A6ZA 2BQPA 2Z42A 3IKWA 3W59A 2GMPA 3WDTA 2NMOA 2PELA 3M3OA 1MR5A 2PHXA 2YV8A 4XBNA 1FAYA 1BKZA 4YM3A 3WUDA 3UK9A 1OKQA 5T5OA 3RRDA 3BOPA 1FATA 3ILNA 1JHNA 1IOAA 4DFSA 2WQZC 1NLSA 2DUPA 4XILA 4XTMA 1G86A 1LHOA 3PJQA 3AYCA 1N1TA 3ZXKA 3WLUA 1YXWA 5DXDA 4Y1VA 2A6VA 1LU1A 1ZM1A 5E89A 3OJBA 1V6OA 3ZXLA 4Y1UA 1LGCA 1OQ1A 3AX4A 2ZMKA 4SLIA 5EYYA 2C5DA 4YZ3A 5CA6A 3DGTA 1LOBA 1V6JA 1S0DA 3B00A 4U2AA 4FQ4A 3WDVA 4CRQA 4AGVA 2D7FA 5HCFA 2ZGPA 5JOWA 3OY8A 1GZCA 4XJAA 3WCRA 1QGLA 1DIWA 2JE9A 3R4SA 1VAMA 4CTEA 4YG0A 4FOWA 3R05A 1DGLA 2GNTA 5T52A 1R1ZA 2D6NA 2DYCA 1H9PA 1HQWA 1UKGA 1G9FA 1UL9A 4Y26A 1DQ0A 1KJRA 2ZAAA 5DG2A 2JDZA 3AJZA 5DUUA 1IS5A 3AYDA 2P34A 4FPLA 1GYKA 5IK8A 1LESA 1F5FA 1V6KA 2CTVA 2EXKA 3IPVB 3VKLA 2ZGOA 5GLVA 1FNYA 1LJ7A 4YW5A 3HN1A 4YM2A 3C2UA 1ZA4A 1QDOA 1JUIA 2H0BA 3ZXJA 1RITA 2SBAA 3FBYA 1WW5A 1CIWA 1PZ7A 2ES3A 4K1YA 3AJYA 1VALA 4WVVA 2TEPA 1G9AA 1ULEA 4YZ5A 2EAKA 1KDMA 2PHWA 1LOGA 3PVOA 3ZSKA 1WUVA 2DVDA 3SH4A 5T5PA 4FPOB 2WT1A 1GNHA 4Q2FA 1GANA 3AZXA 1CPNA 3MW2A 2GNBA 2P3KA 2D6OX 2D3PA 2EIGA 4HANA 2ZABA 3V0AA 3VKNA 3V0BA 3FLPA 2ZMLA 2ZBJA 3APBA 3DUIA 1LULA 1AX2A 1YIFA 1LECA 3OGGA 2A3XA 4FQZA 4YW1A 3WG2A 5EXOA 5GZGA 5GZEA 2ZHLA 2WSUA 1WCSA 2ZGRA 1KDKA 2VW2A 3OPZA 4BQ1A 4DS0A 2AUYA 4FPEA 1WW6A 3OYWA 5GZFA 3AZYA 1LGNA 1W6QA 3AP9A 4XHBA 1I3HA 2GMMA 4GKXA 3CNAA 5JVVA 1AJKA 3AFKA 1AXYA 1IS3A 3O0WA 4Y20A 2ERFA 2GNMA 2V5YA 1SLLA 4Z8BA 2XB6C 3HR9A 2ZMNA 1MACA 2HYKA 5H9QA 5KXBA 1DYPA 1MVQA 1Q8PA 1QF3A 2ZGMA 3M3CA 2DTYA 1C1LA 4Y22A 5L73A 1KJLA 2A3YA 4K21A 2GN7A 4K1ZA 3ATGA 2DVAA 4UW3A 1N3QA 1QOOA 3VKMA 5GLUA 3M2MA 2WNEA 3OYWB 4P9WA 1SFYA 1G9CA 3WG1A 3V65A 1WW4A 1QNYA 4GALA 5CBLA 1QMJA 3B01A 5GJ6A 3M1HA 2CWMA 3ILRA 4Y20B 2RHPA 2VW1A 4PQ9A 5FREA 1NXD1 1APNA 4Q8LA 4Y22B 2FHRA 3NV4A 1S0CA 1S0GA 2W52A 1F9KA 4FP3A 4HL0A 1FYUA 4XOGA 2VY0A 1MZ6A 2WKKA 3MW3A 5SV8A 4C1XA 3L2YA 5JMCA 5T5LA 4XMIA 2E6VA 1SCRA 4XJZA 3WHUA 4LBKA 1CVNA 1CQ9A 1BQPA 1LTEA 1UAIA 4XZPA 2ZGUA 1VAVA 3OBRA 4YGCA 1ULGA 1IKQA 2P3IA 2ZACA 1W6PB 4XJUA 5EWSA 4YLZA 3RG0A 3SH3A 2A5ZA 4IQPA 3POSA 1MS0A 1N1YA 1U0AA 4LBMA 1FV3A 4BM8A 3AK0A 2NM1A 1WLDA 1JXNA 3WCSA 1RINA 2ZHKA 4FPYA 2LALA 1AX0A 4AYUA 3D5OA 5IK4A 4M00A 2YZ4A 2KM2A 5H9PA 4WZFA 4ITCA 4FPCA 4XXPA 1G9DA 1YRZA 4YG3A 1H9WA 1W0OA 2P3JA 2NZ9A 3B3QE 4ZXKA 3AYEA 3SH5A 3WNXA 2NMNA 3AXDA 4M01A 3JUUA 2V73A 1SBEA 4XE9A 3IPVA 2A6WA 3O0XA 4M3CA 4YGDA 5DUXA 2NP0A 4Y1YA 1ULDA 2WLQA 3BTAA 3WDYA 3O5SA 2R0HA 4W65A 3TB0A 2A75A 2JD4A 5KXCA 2UWAA 1LEMA 4YGBA 4XTPA 2R49A 1EPWA 1MS9A 3SISA 2VUAA 4U36A 3KQRA 3FFZA 3LSDA 3QCWA 4YG6A 1UZZA 3A4UA 2DTWA 4P14A 1WW7A 4ISRA 4ISQA 3WG4A 5T5JA 1IKPA 2E53A 4M3CB 5F5QA 5T55A 2DWRA 2PHFA 4Q1RA 2WJSA 4XBQA 3SLIA 3WG3A 4DPNA 3ZYRA 5HCAA 1LOFA 5DZFA 3N7KA 4Y1ZA 4YM0A 4WVWA 1UZYA 3MPPG 3ZPYA 2UWBA 2AYHA 4LBQA 3A0KA 4R9DA 5FRAA 1GZWB 3N36A 1ONAA 5GM0A 1MVEA 2GMEA 1QU0A 2FMDA 2R16A 1ULCA 2CNAA 5GZDA 4BOWA 1AXKA 5JOZA 2W08A 1LOAA 1V00A 3HMYA 3D6EA 1Q56A 4R9CA 4GKYA 1MZ5A 2OUHA 1AX1A 5IUQA 1WLWA 1DQ5A 1GSLA 3QLQA 2W39A 4FP2A 4AVVA 3LSEA 1G8WA 4PCRA 4OZXA 1QNWA 3N7JA 1S0BA 4LBQB 4ATEA 1S0EA 3UJOA 5KXEA 4AVSA 2ARBA 3WOGA 1VLNA 3WV6A 3ZSMA 1WBFA 1LENA 1IS4A 4XJWA 4UW4A 1V6IA 4NOTA 3ILFA 2A70A 1GICA 1HLCA 3PMEA 1SLTA 3IN9A 1A78A 1PZ8A 1FNZA 3ZYPA 4YFZA 4XIOA 1N1VA 1DBNA 1AZDA 2ZGTA 4XDQA 1W6OA 5IK5A 4P9XA 2YROA 5T50A 4LBLA 3WUCA 2Q5TA 1BZWA 4TYSA 1SLBA 3AP7A 4YW4A 2JECA 1BYHA 2AH2A 1JBCA 4DQAA 4K20A 4AGGA 1KRIA 1LEDA 4FPJA 2D3SA 2DU1A 4FPKA 1BXHA 1LODA 4R9AA 5DUVA 3UL2A 3IMNA 4PBOA 2D6LX 5DG1A 4M3CE 2CY6A 4UW6A 1OFSA 1ULFA 1D0HA 2A3WA 4GA9A 1W6PA 2WT0A 4YM1A 5F9TA 1YO8A 4XJ8A 1Q8OA 4BMEA 1W6OB 5GLWA 1KITA 2DURA 3O0VA 2PHTA 1S0FA 4Q1PA 2UU8A 1Q8VA 1UPSA 2AREA 2DUQA 2GNDA 4AGRA 1V6NA 4XXAA 1SBFA 3ZSLA 2LTNA 2OVUA 1QKQA 1SLCA 1X50A 3FLTA 1SACA 3WZ1A 3N35A 1QOSA 1CR7A 3T1MA 3VV1A 3V64A 4FPHA 4Q27A 1ENRA 4YZ2A 1N3PA 4GWMA 5CB7A 4C1WA 1KQRA 1RIRA 1GLHA 2ARXA 4YW3A 3RS6A 1CPMA 4D69A 1G7YA 2UURA 3H0OA 4JRAA 2DVGA 1GNZA 3N7LA 2R0FA 2D3RA 2ZKNA 2ZGQA 1QDCA 3U4XA 4YW2A 1C57A 1UN1A 3USUA 4LBNA 3OBTA 2YMZA 3AP5A 1A3KA 1LOEA 5AVAA 4LBOA 5H9RA 3ZSJA 3ENRA 4DRVA 1AVBA 2VH9A 1O4YA 1CJPA 1JYCA 2A7AA 3NWKA 4LBJA 4FPGA 1W6NA 3M3EA 5BYNA 4R9BA 1MS1A 5KXDA 5GLTA 3WVJA 3TAYA 3VKFC 4AVTA 4FOYA 3WDWA 3T1LA 3D4KA 1I1EA 5IK7A 3RMXA 2D43A 2GDFA 1FV2A 1SLIA 2XG3A 1JW6A 3USUB 4P9YA 3I8TA 1GZWA 1WD3A 2EXIA 3VUOA 1MS4A 3AXEA 2A71A 4L8QA 4Q26A 4FOVA 3SNMA 5HCBA 1H30A 1DFQA 4XIKA 4FPFA 1W6MA 2ZHNA 1DQ2A 1W6NB 3RMYA 2JE7A 4RA0A 3W58A 1JOJA 4M3CF 1DZQA 3KM5A 2D6KA 3LCPA 1TEIA 4CZSA 3N3HA 2D6PA 3I4IA 3FLRA 1LHVA 4PF5A 5IT6A 1C4RA 4RL7A 5GZCA 3Q9OA 2UWCA 1LU2A 1WLCA 1BJQA 4PBPA 4AWDA 4DRRA 5LK5A 2PHRA 1DQ1A 1HKDA 2EXHA 4XBLA 4ATFA 1UX6A 2E7QA 3FUQA 2P37A 4BLJA 4JCKA 3B9CA 4NO4A 4XYXA 1SBDA 1Z78A 4XMAA 4ZKTB 3A0NA 1LHUA 1W6MB 2A6YA 2JJ6A 4YZ4A 5JDBA 5DZGA 1PZ9A 1WBLA 3NV2A 2OW4A 2E51A 4Y1XA 5CAZA 2P2KA 3AP4A 4ASMB 1AF9A 1MS8A 1HDKA 1DLLA 3OY8B 1GV9A 3R4UA 5JOXA 3PVNA 4FVVA 1W0PA 2AGSA 1HQLA 2E7TA 2W68A 1CN1A 2WSVA 1V6MA 2OUJA 5CNAA 2ZA9A 3WHTA 3VKOA 1MS5A 1LHNA 5T54A 2ENRA 3PVEA 1G9BA 3M3QA 1VIWB 2ZGSA 2R1DA 2DVFA 3FUOA 1DQ4A 1LGBA 5DUWA 4I30A 1DQ6A 2VU9A 1Q8QA 3ASIA 4GWNA 3BIWE 1C1FA 1V6LA 1SCSA 2CWSA 2EALA 2GALA 2I2SA 5GLZA 5JOYA 2A6XA 2WT2A 5E88A 1GKBA 1ENSA 1S0JA 1UMZA 4BLIA 3WDUA 4BPZA 1GZ9A 4YZ1A 3AYAA 4YFWA 3AZVA 4KBBA 3UJQA 4Q8KA 3NV3A 2EF6A 3ZXFA 1YI7A 1S1AA 2NN8A 4H55A 3N7MA 1Q8SA 3ZVXA 3MEPA 1D2SA 1AXZA 1S0IA 3MW4A 4GXLA 4F83A 4FOQA 2ZHMA 3INAA 2DV9A 1ENQA 2YXSA 3GNEA 2VXRA 1O4ZA 1LCLA 1F31A 2R1BA 5GALA 2ZGLA 5E8AA 1DHKB 3RQ0A 1SLAA 2AR6A 2ZZJA 1FX5A 2G4IA 1AJOA 2GN3A 3NV1A 4XJ9A 1N1SA 4XHXA 4BMBA 4Y24A 3V0BB 3V0AB 2D44A 2JKBA 3B69A 4TZDA 1JN2P 2YY1A 2SLIA 3AP6A 1LOCA 1URXA 3SITA 2EXJA 3GALA 1IS6A 2AENA 3T2TA 1JYIA 1YYNA 1B09A 2NYYA 5EYXA 1A8DA 5DZEA 2VW0A 3O12A 3AZZA 5H9SA 3WDXA 5JLVA 4UW5A 2DVBA 2D6MA 1W6QB 1N47A
chains in the Genus database with same CATH superfamily
4BQ2A 2O8OA 2OQ7A 5FXXA 3ZXDA 1J1TA 1R083 3KHCA 3KCYA 5DDJ2 3S7IA 2XPJA 3QH6A 2RM21 4K3UA 3WP4A 5C3SA 4NHMA 4YGEA 3UGGA 3VBUB 2B7YA 3FWEA 2PAMA 2CYFA 3LDRA 4WV8A 3VBSB 5BNPA 2WS93 3O1PA 1E5RA 1REFA 4DXTA 4BDVB 1JYTA 5FK7A 1JOBA 4N43A 1PO23 4RFRB 3ZFGB 3OD0A 5EPAA 1VPHA 2CL2A 4PI2A 1V9U2 4IEVA 4W6XA 1LOFC 4AE2A 5FZ3A 3W59A 4AEJA 5A1FA 2PELA 1OQDA 2WNVC 5ABJA 3WUDA 2P1BA 1ULPA 2KR2A 1QQP2 5FP8A 2B5HA 4DZGA 2E9QA 1OUXA 1RUF1 4LTAA 4L92A 3ILNA 1JHNA 5JSOA 3RZJA 1QJFA 2B42B 2LROA 4XTMA 2P6HA 1LHOA 1NA1B 4UBHA 1I6XA 3AL5A 4HOOA 2V09A 4CP0A 1YXWA 3A7QA 4LIUA 1ZM1A 2JG8C 1HQNA 4Q4V3 4AHXA 1LGCA 4SLIA 5F39A 5K0UA 2C5DA 4YZ3A 5ACA3 5CFDB 3KWVA 5J3UA 1B35B 1S0DA 1WMDA 2XJRA 4FQ4A 1QJY3 4WVZA 3UV9A 3WEZA 5CADA 2LW8A 5JSPA 4HN1A 3LFMA 4C0HA 4AFCA 3E1F1 4JKMA 1O3QA 1GP5A 1QGLA 1RUI1 2LRPA 3R4SA 1VAMA 4MXVA 2H0VA 1UYYA 4YG0A 4DB5A 4JQTA 2GP5A 1O7FA 4FOWA 4P9JA 4EN7B 2XJSA 1R1ZA 2DYCA 5FPAA 1UKGA 3I2GA 1ULOA 3AJZA 2RS13 4MG2A 4IEZA 3LZZA 2E33A 2WFF2 1EP0A 3JD73 4MXWB 1GYKA 5K8SA 1LESA 2HBTA 4NROA 1TG7A 5DAXA 4JHTA 1CGPA 4NIHA 5GLVA 1FNYA 1R092 2OKXA 5AFBA 2QQVA 4QPGC 4LKSA 5FZMA 1OUSA 2VNOA 2OPKA 2OX0A 4CP9A 4GD4A 3FBYA 1UWWA 5FK8A 1S2EA 1WW5A 2XXZA 5J48A 1CIWA 5AC91 2OZJA 1C5HA 1ZZ8A 2GH2A 3GBWA 5FUNA 2A1XA 2TEPA 1CX4A 3ACHA 1AYN2 1ULEA 4XUPA 3HT2A 1OBNA 3TN92 3I59A 1UYPA 3IT8A 3SH4A 2WT1A 2Q1MA 4OQ8A 1FOD2 1GNHA 4NR1A 4I09A 4FI9A 3VD5A 4CA9A 4A44A 3MW2A 1D4M1 4KG0A 5CVRA 4J1WA 2Z69A 4XFCA 1J58A 3GXUA 3VKNA 3IWZA 1R081 4V2VA 1PVC3 3PLQA 2RG4A 3C3VA 1W9YA 4MHUA 3OGGA 3SMHA 1F5JA 5DABA 1Q43A 4YW1A 2WS91 4E8CA 4JGZC 2ZHLA 4GH4A 3S30A 1KDKA 2VW2A 3K4ZA 5M0TA 4DS0A 2UY9A 1CAVB 4XCAA 1PO21 3ALQA 2W87A 1OC1A 5HBAA 5GZFA 1QXRA 2B4KA 4XHBA 4FO9A 2BRTA 1H8TB 2GMMA 5JVVA 1RJ7A 5CYYA 2QFEA 3AFKA 4CCOA 3EHKA 4NIDA 3DPRA 3MUY1 4AEDC 2HEYF 4NHKA 3HR9A 1RUH2 2WFPA 5KXBA 3H1MA 2EIDA 2ZGMA 3M3CA 5I0SA 3CLPA 2A3YA 2AEZA 4RGAA 2BERA 4K1ZA 2JX9A 2D5HA 4LLFA 3ATGA 3S57A 1JI6A 1QOOA 4DOUA 3AMPA 1XB9A 4Q4V1 2GP3A 4BQYA 4LE3A 3V65A 4ZONA 4PIXA 5ACA1 1CJDA 4GALA 1QJY1 5GJ6A 3M1HA 4JGYC 2CWMA 4NPRA 4Y20B 5FREA 4HBNA 1APNA 3WP3A 3WW1A 3NV4A 1S0GA 1LB2A 4HL0A 2E31A 1FYUA 4C1XA 3MW3A 5SV8A 1MEC2 1PMJX 5JMCA 3IDCB 4Q5OA 4XJZA 2FDIA 4D3WA 2RS11 4C91A 5BV6A 1LTEA 4XZPA 2GC2A 4YGCA 2ZGUA 4YW6A 1VBC2 4ES8A 1ULGA 2ZACA 3JD71 4M0HA 3D0JA 5CFDA 2QZ2A 5JR2A 4Q4X3 4CUCA 1RL3A 4S2FA 3FHIB 4MHRA 5G04L 4L9BA 1D7PM 1MS0A 1U0AA 3RDIA 4LBMA 5I93A 1CWPA 2D93A 1XNTA 2DF7A 1U5IA 3O1RA 5KC5A 3B7MA 1ZVFA 4AYUA 5C7GA 5C3QA 1GFF2 3BYWA 4E4HA 5KBFA 4PQQA 3CBNA 5FMCA 4XXPA 3GGLA 4O9EA 3POIA 3T2PA 1YRZA 1PHMA 4D6QA 1HN0A 1UOJA 4RHV3 2V4AA 2VE1A 2VVEA 2WZEA 1UF2C 4LQRA 1W2TA 4MXWA 3B9IA 4QPIA 1U5YA 3JUUA 3KGZA 3N9PA 4TLGA 3O0XA 4M3CA 1W28A 1SDWA 1W90A 4Y1YA 4XDOA 1XYOA 1ULDA 4JX0A 4P00B 3WDYA 1O3TA 1OA4A 2R7EB 4NPMA 2VMFA 4FXKB 1RUG3 3WF4A 3PNAA 4AHYA 1PVC1 2WNUB 4ZZ5A 3VBRC 5F3GA 3N9LA 5FOJB 1EAH2 1EPWA 1MS9A 3WQ0A 2VUAA 3TBDA 2NLRA 3VBHC 3VLBB 2C26A 3IDEA 2WYSA 4AFBA 2FZ1A 2AC1A 3VHRA 2VULA 3MIEA 3ZOIA 5CFCB 3ZMOA 3ACGA 1VMFA 4CU8A 3KV9A 4XBQA 2WA4A 2F4PA 3SLIA 1SQ4A 3W21A 5HCAA 3N7KA 4Y1ZA 4YM0A 4WVWA 2N7GA 4GWIA 3AC0A 4Z82A 3RYPA 3ZN4A 5C9AA 3ZPYA 2VZTA 2H6CA 1J83A 2RR13 3KF5A 4B7EA 3I2KA 3PTYA 3A0KA 5LATA 4BYYA 1GZWB 3N36A 5JSRA 1ONAA 5GM0A 4INDA 3O1MA 5HPOA 3H1YA 5JZGB 2EVXA 2CNAA 5GZDA 1AXKA 1CAVA 4B1MA 3UGFA 3ZMNA 3VBUC 2FMYA 3VBSC 2RMU3 1NCRA 2PLV3 4FTSA 5FZEA 3NJYA 4XFFA 2YG0A 1DQ5A 2YDEA 1Y9QA 2IC1A 4FP2A 4AVVA 4P9LA 3FHQA 3LSEA 5KR7A 1G8WA 5KHKA 5FYSA 1QNWA 4F7ZA 4IV1A 1OA3A 4QX8A 1S0EA 3ZFGC 4COWA 2CGPA 2MEV2 5A3PA 2GC3A 1RMU2 1VBD2 1WBFA 1LENA 1WCKA 4UW4A 2QDRA 4QD2A 4XAEA 4UFLA 5ERLA 4NOTA 5A6XA 3ILFA 1UZVA 4XC9A 1HLCA 1OURA 4OMCA 4OI4A 4XVHA 1Y4WA 4NRQA 1A78A 3P1IA 3ZN6B 1HRV2 5AFEA 4YFZA 5BNOB 5IATA 3DCQA 5KHJA 3R4DB 1N1VA 2CGOA 3BI3A 4ARXA 5EIYB 4Q4X1 1ODMA 4G4FA 3WUCA 1NA1C 3OPWA 2Q5TA 5A7SA 5JR7B 2OT7A 1CAXB 1UU5A 1JBCA 2PXJA 4DQAA 2X09A 4AGGA 5A6ZA 1KRIA 1AL0G 2JENA 4BHPA 1XNCA 2DCJA 3CKHA 1B35C 2C1FA 1VRH3 3EXUA 3LF7A 3U10A 4AI3A 3J7HA 2FDGA 1TME3 2XHKA 5DG1A 4IE6A 4LUKA 3X29B 1HXS2 2A3WA 4URAA 3LDBA 4RHV1 5FXVA 5F8PA 3NJVA 3Q8AA 5BNNC 5F9TA 4IEWA 4XJ8A 4BMEA 1W6OB 4LO5B 1AR93 1POV3 2DURA 3AMMA 4A7YA 1W8NA 3BTXA 2UU8A 4MGQA 1UPSA 2AREA 2ZX4A 1W3VA 5SV5A 3H3UA 4B3NA 4E4DX 2G9ZA 4AGRA 1W99A 3VZJA 2Y34A 4XXAA 3T30A 2LTNA 1RUG1 4P9GA 1HW5A 1SLCA 3JQXA 3GHMA 1X50A 4CDXB 3WF0A 4AL9A 1A34A 4HK8A 3WZ1A 2G19A 3N35A 1QOSA 4XUQA 5AVPA 4Q4Y3 1AL22 3ZXGA 3T1MA 4BQWA 4COVA 2BYVE 3VV1A 4COZA 1UIKA 5JUVA 4CU6A 1REDA 1N3PA 1UXXX 5CB7A 3CF6E 2BJSA 3SCFA 1RIRA 1GLHA 5BY5A 1CPMA 4E9KA 1G7YA 1IZ3A 3H0OA 4RR3C 1ACCA 2ZKNA 3ZFEB 3ZYJB 2RS33 3T0DA 3P3PA 4GZ9A 2VXJA 5EQUA 1OF4A 1BBT3 2WNUA 4QKFA 3UNPA 4D6RA 2RR11 1DYOA 3C7GA 2YMZA 5FPBA 3WINE 5AVAA 4IE4A 2JG9A 1H2MA 5FY8A 3ZSJA 4RS5C 4CP1A 1CJPA 2A7AA 2W1SA 1D2QA 1ND3A 1QY4A 5FZOA 4N53B 5CFCA 1VAKA 5E6HA 3WXPA 5GLTA 1RHI3 2XMLA 3VDBA 3VKFC 3THPA 4ZU5A 2Q8DA 3I2JA 1L7LA 4D8MA 3D4KA 2RMU1 2PLV1 2FD8A 4YRDA 3NNLA 5BXXA 1SDDB 2PFWA 2VMDA 3W20A 1RUD3 3CZUA 3MFCA 4P9YA 2JB4A 3I8TA 3PDQA 1GZWA 2EXIA 3RGBA 4DUVA 1MS4A 2JDMA 3B5LB 1H8TC 5JZGA 2OPWA 2ZHNA 4LO4B 4P5HA 1BK0A 3W58A 1DZQA 1QJU2 4LKEA 4AW7A 2BZDA 2O0OA 4Y33A 4ZPIA 5IVJA 1TEIA 5F5CA 4CZSA 4NUBA 4OVEA 3LDKA 5IT6A 4K6BA 2UWCA 4C8DA 4B4RA 4COYA 4AWDA 3S0MA 1DQ1A 2DFCA 1C28A 1HKDA 2EXHA 1VBB3 3JBG2 1TMF2 2W95A 3AFGA 2OYZA 3ZYHA 1X36A 3TRSB 2JIGA 4BLJA 4JCKA 3B9CA 4NO4A 4XFAA 5L9RA 4OHVA 1T6GC 1Z78A 2XDVA 3HNBM 3A0NA 4Y4RA 2W2IA 2A6YA 4KWKA 2ORZA 2J1AA 1VRH1 1OT5A 2Q1FA 1WBLA 3P6BA 1OLME 4GJYA 2VNVA 4LORA 1TME1 2OW4A 3PL0A 1XXNA 1F4AA 5BNOA 2P2KA 1X7NA 4EN0A 1TQ5A 1YLLA 3BPZA 4ASMB 1JZ3A 3D8CA 4WM7B 5FMBA 1HDKA 2Q30A 3GBGA 4WM8B 2ZX3A 2W68A 1LAJA 1AR91 1POV1 1YEWA 5C4WB 1AR62 2OUJA 3TEXA 2ZA9A 1YFUA 1CZVA 3OTFA 2ZGSA 3FUOA 3HIFA 4UFKA 4UFMA 2WZR2 5FKCA 4X8NA 3QOPA 4LE4A 5LBEA 4Q4Y1 4QQLA 5J36A 2C0ZA 3ASIA 2HWD2 3PIGA 3MHZA 4PLOA 1C1FA 2GALA 5FWJA 4I0BA 5LA0A 4K8FA 4CCJA 3DXUA 4XURA 5FP7A 4BLIA 4CDWA 1C8NA 2VECA 1GZ9A 4IL7A 4YZ1A 3KT4A 2VZ3A 3AYAA 4AI9A 1W8OA 4E8DA 4YFWA 1JZ7A 3AZVA 4B4PA 4Q8KA 2EF6A 1S1AA 2RS31 1J84A 1W9TA 2WAOA 4AVBA 3U4SA 3CJXA 1NZCA 1OQEA 1BBT1 4F83A 2K2SA 2BU9A 2DV9A 3RI8A 3T2QA 5KHHA 1LCLA 1F31A 2YBPA 2WBKA 1HB2A 4CCNA 2VD7A 2G4IA 1AJOA 2GN3A 4BMBA 1GMMA 2WIIB 4IETA 4QQHA 2QQLA 4E2GA 1O5UA 1RHI1 3HNYM 3V0BB 1NYWA 3B69A 3WW3A 1RC6A 1S2KA 4D7TA 4YVSC 4RGKA 1IPKA 5FLHA 4BWOA 1RUD1 5FZCA 2R073 5FZ0A 3DKWA 2HWC2 3O12A 1JZ4A 4CXYA 4AFAA 3AZZA 5H9SA 1MZFA 2E26A 2DVBA 3JU9A 5FP4A 2D6MA 4CUBA 4N53A 5FYUA 3ZXEA 3ZYGA 2BV4A 1CESA 3IM0A 4YPJA 2ZGKA 3RSJA 2HWF2 4E4SA 4HVQA 2DU0A 4UOJA 3LB9A 2OQ6A 4W4ZA 1MS3A 4PDWB 4JC1A 2WINB 3POYA 4V1PA 1JYNA 3POWA 4I3GA 1VBB1 4WBBA 1PIV2 2WUHA 3BB6A 3VBFA 1DYKA 5LB6A 3N9OA 1QEXA 2EIEA 5A3WA 3MLKA 4MYEA 3AMQA 1WD4A 1GBGA 2A6ZA 2BQPA 1NOVA 1CD3G 1NY72 3M3OA 2KXLA 1MR5A 2PHXA 2YV8A 2BVVA 1FAYA 4NRMA 4EV0A 3O1SA 1OKQA 1JH5A 3NAPA 2QVSB 4IDZA 3MIDA 1H6XA 3AKSA 5C5TA 3WNNA 5LY1A 2BUKA 5LA1A 1NLSA 3E5UA 1U12A 4XILA 3TNQA 2XKOA 1KFUL 1Y43B 1ZBE2 2C4XA 3ZXKA 4ET7A 3WNKA 1PNGA 2IXJA 5DXDA 3ZXLA 5E89A 2ZMKA 3E6BA 4UT5A 4QXCA 3S7EA 1V6JA 3LOIA 5ABJB 4CRQA 3O1UA 3ZLIA 2VZ1A 2DCZA 2QCSB 4KNCA 1RUE3 5JOWA 1W3XA 1GZCA 4UF0A 4WM8A 3HJRA 3WCRA 3O14A 3RJ2X 4CTEA 5FUPA 4JQRA 5JCTA 1H1MA 1PGL2 1DGLA 2GNTA 5FUIA 3CIHA 5FMOL 1JZ8A 1G9FA 4Y26A 4AHWA 4X6QB 4DUXA 3OGJA 1PX4A 1NUKA 3ACFA 3D0SA 4FPLA 5K0UB 1GU3A 3KSCA 1F5FA 2CTVA 4I3PA 5I0DA 3ZYFA 2EXKA 1RVF2 4NPLA 3PTRB 4UFJA 4KWJA 4YM2A 3C2UA 2CAVA 5D8AB 2RJKA 3H42B 3PUHA 2H0BA 5FZAA 3I3EA 3ZXJA 4FSJA 1RITA 3OUHA 4CDXC 2K46A 2JKXA 3AJYA 4XQ4A 3RNSA 4PIZA 2BBVA 1RUC2 1UY1A 4FBFA 4JDMA 3I7DA 1KDMA 2I74A 3G7DA 3OUIA 3ZSKA 2R071 4AAPA 3OBZA 4H7MA 3ZFEC 3AKPA 3ECQA 1V70A 4PI0A 4DIQA 2J42A 2VOVA 3KV5A 4A2UA 3DKQA 1FPN3 2D6OX 2VZVA 1EUTA 2EIGA 3EYPA 2VG9A 2C24A 3L2HA 4HANA 5FY5A 2Q8EA 4CP9B 3V0BA 2ZBJA 4OUMA 2VTFA 3DUIA 4LA3A 4NAMA 5FPVA 1YIFA 1TZOA 3VL8A 1LECA 2A3XA 2YFZA 3NNMA 4FQZA 3THTA 3RZLA 2JEMA 2YUEA 5GZEA 2RDRA 2ZGRA 3PUQA 3I59B 5IWFA 3U14A 3H9AA 3MPBA 1S2BA 3U75A 1WW6A 2P3YA 4V2WA 5A6YA 1J1LA 3EO6A 3K51A 4GKXA 3CNAA 5FY0A 3E97A 2WWUA 4LR4A 1AJKA 1AXYA 4K8RB 4LMFA 2IXIA 3MI8A 3MV11 2MHFA 3O0WA 4P02B 5J98B 1COV3 2V5YA 5LASA 1PGW1 2HYKA 1E57A 1M4WA 3NNGA 1MVQA 5B2GB 2DTYA 4QX2A 4D0QA 1VB4A 4LITA 5L73A 4QKNA 2B9VA 4K21A 1W2AX 2GN7A 3LKJA 5IVBA 2P5BA 4UW3A 2UYAA 3H8RA 2KA3A 1IQDC 4I01A 1MPXA 3KT7A 3M2MA 3ST7A 1D4M3 2W1QA 4WVMA 5FY7A 1F8VA 4A4AA 1G9CA 3FX3A 5HCHA 1WW4A 5FZGA 4FFHA 5C33A 2RM22 5CBLA 3B01A 1WZXA 2P17A 3P5BA 5EJ1B 2QQKA 2WQ4A 5FZBA 5FDBA 3DPRB 3ILRA 1NXD1 3OG2A 1RUE1 4Q8LA 2FHRA 2TNFA 4XUNA 4M4RA 2F4LA 2XL7A 5FY1A 1H1AA 3CDZB 4XOGA 1MZ6A 2WKKA 4AQ2A 1H8VA 2YGMA 1PMHX 3T0BA 4XMIA 2L9LA 1UKRA 4LBKA 3RYRA 4WM7C 5K4LA 1BQPA 5C3OA 2VZUA 1GQPA 1VAVA 4QM9A 1OMIA 4MZUA 2P3IA 1W6PB 3J4UH 2A5ZA 5C4WC 3QBQA 5FO9B 3H8UA 3POSA 4FFFA 1K5MA 1RUF2 4BM8A 2E32A 1W39A 3AK0A 3IMMA 3ON7A 4LHLA 3WCSA 1RINA 3K2OA 2LALA 3SEEA 4CXWA 5FZ4A 4G3YC 3THCA 2GZWA 4ITCA 4NJ4A 1HIXA 1G9DA 2W46A 3K46A 1JYXA 1LR5A 2NZ9A 3B3QE 3HAGA 3AYEA 4HMZA 2NMNA 4CEWA 4CSWA 2LS6A 3OB8A 1H1IA 2V5DA 3ZXAC 2JDKA 1SBEA 4DXZA 2WABA 1XNBA 1GWLA 5DUXA 4TSVA 1RUI2 2IXKA 5D8AA 2R0HA 1L7RA 1FPN1 4W65A 1H2LA 1VBA3 4CDQA 5L36A 2JD4A 1XRUA 5KXCA 1LEMA 1PM4A 4YGBA 4B7KA 4HKOA 2BNMA 4YYOA 2KD7A 3FFZA 4NMIA 4K7JA 2BFUL 2JXAA 2YB7A 4EN8B 3A4UA 2D40A 5LA9A 3NNFA 3O1TA 4QPIB 4XZUG 5L9BA 2NPIA 3MF9A 5F5QA 2E53A 4M3CB 5T55A 3WNLA 4DPNA 5BPXA 5JWPA 2FDJA 2WJSA 4PLMA 1NAEA 4CU9A 2Q0AA 1W8UA 1IG3A 1X82A 4OHYA 1POV0 4RQPA 3LEKA 4TN7A 5AC92 4CUAA 4IERA 1COV1 3HBKA 3K3NA 1UCXA 4QX0A 4R9DA 3WW4A 5FYMA 2V72A 5FYZA 1WA4A 2FMDA 4KQ7A 1NCQC 4BOWA 1V00A 4K9SA 3HMYA 4LO7A 2XUMA 4CCKA 3OSDA 4QAWA 5DAPA 1VE0A 4GKYA 3A22A 2OUHA 2CHHA 2ZZQA 3JXSA 4PDWC 5FYYA 5IUQA 2VCMA 1R082 2VCCA 5FOBB 5J7MA 3NQHA 4FTEA 1UXZA 1MQTB 2J1UA 1GSLA 5J37A 2W39A 4PCRA 5C9AB 5BNQA 1JYWA 4ORFA 3DYMA 2BWCA 2R30A 2WS92 3UJOA 5IVCA 2FDHA 1VLNA 3VD7A 3LAGA 4UWDA 2IFWA 2RV9A 3I3MA 3I2FA 1POQA 4JRLA 4R8HA 1PO22 5FZFA 3H7JA 1XU2A 4H2AA 1QXPA 3VBOB 5F1RA 3TEZA 3ZYPA 1RUNA 4AK3A 3LEMA 2GAUA 3IBMA 1NCRB 2ZGTA 5BNPC 2VAUA 3MGUA 5FYCA 5IK5A 4P9XA 1OOPB 5JMOA 4HK9A 1BZWA 2NQYA 4YSFA 5A3MA 1SLBA 3DL3A 1NKGA 2BNOA 4N43C 4QXBA 5FLJA 1BYHA 2AH2A 4IV1B 3U07A 2BP6A 1ZRDA 1HRI3 1EYBA 2XHNA 4HG6B 1GNYA 1LEDA 2XONA 2D3SA 4FPJA 2R6QA 2QNKA 1BXHA 3D3AA 5A1LA 5DUVA 5ABJC 3UL2A 4HT1T 2RS53 3IMNA 4PBOA 1UOFA 4Q4V2 1JZ2A 4UW6A 3HD8B 1ULFA 1KS5A 2XWBB 5ACA2 1W6PA 2ZEYA 4LK6A 2HH9A 1EUUA 4HSJA 1Q8OA 1QJY2 4CDUB 1KITA 2QQUA 3BPSA 3O0VA 4JTNA 4NHXA 4DEQA 4EQVA 1OA2A 1QH7A 2VCBA 5FQ0B 1XYNA 4JV4A 2ZPXA 1VBA1 4YWAA 5IVYA 1UY4A 2JDNA 4N7IA 4BXFA 5K0UC 4ZS2A 1YQ5A 2VTXJ 1NX9A 4BE3A 4A3XA 1SACA 1K42A 4NE9A 2RS12 4K40A 3VGIA 3V64A 2BBAA 3AVSA 3JD72 4GWMA 2B8MA 1BK1A 4LOSA 1XNKA 4YW3A 3ZX7A 4EN9B 1GP6A 2UURA 4JRAA 3RWNA 1AR83 1GNZA 3N7LA 4YARA 2D3RA 5FP3A 3K48A 3BIEA 1CAUB 1O8SA 2ZGQA 1QJEA 2RJ2A 1YQ6A 2X5IA 3OOXA 4XABA 2R043 3OPTA 3BUCA 3USUA 2IUWA 1HB3A 3M70A 5FPXA 2W3JA 3OBTA 4BQ4A 1A3KA 1RJ8A 4QHOA 3ZIXA 3ENRA 2WC2A 4DRVA 2JDHA 4CEYA 3MLJA 1LKNA 1WWYA 3WR0A 5C71A 3BOWA 3J8F3 4KL1A 1JTZX 1MS1A 2XOMA 1YCIA 1O8PA 2Y60A 3ES1A 5KXDA 2W9XA 5F5IA 3ZKYA 4D7YA 4CP2A 3BALA 2IZWA 2XBO3 3PURA 3T1LA 3GZUC 3WDWA 1PVC2 4OI2A 2D43A 3RMXA 1W06A 4OI0A 1FV2A 1SLIA 3C7FA 4IEOA 1NXMA 3TNPB 2BVBA 2YBSA 1J3QA 3VUOA 2AACA 3AXEA 2JG9B 4PF1A 2XJPA 5KHGA 4FOVA 5EJZB 5HCBA 4IEQA 4YVWA 2QKDA 1ND3B 4FPFA 4QX5A 3RMYA 5FO8B 5FZOB 3KM5A 4BQXA 3LCPA 2PQSA 2ZXQA 4QGNA 1LHVA 2ATFA 1C4RA 1YQ8A 4RL7A 2HKXA 3KD4A 1MQTA 4C90A 5GZCA 3WNOA 2QQMA 4PBPA 5F3IA 1CX1A 4Z2WA 4GH4C 2VBDA 2PHRA 1GOHA 4XBLA 4NIAA 4BH9A 2YC4A 1H2NA 2Q8OA 1DCSA 1HRI1 1SBDA 4XYXA 4URTA 3KT1A 4L97A 2JDPA 2JJ6A 4YZ4A 3NO8A 5DZGA 3CJIB 2ZX0A 1T6BX 3DPRC 2RS51 4IEPA 1NG0A 3VBOA 4B29A 2YBKA 1K12A 1UOGA 2G9GA 2GSYA 5LA2A 3ZM8A 5LZ6A 5FYHA 3OGVA 1AF9A 3R4UA 3OY8B 1GV9A 4OZOA 1OOPA 2P6CA 2EAAA 5JOXA 4HVRA 1UZ0A 5CNAA 5J09A 1LHNA 2BOJA 1ZRIA 1BMV1 3ABZA 4IESA 1O6UA 3POFA 5DUWA 4MVTA 3LGRA 5HV0A 4I30A 1DQ6A 2YU2A 4I0WB 4MLOA 1WLTA 5A7WB 4GWNA 3BIWE 2HWB3 3LWCA 1Q3EA 1SCSA 2EALA 2B39A 5GLZA 2I2SA 4Q4X2 4TLFA 4CXXA 4E2SA 2A6XA 4XAAA 4CDUA 3EBRA 1WCDJ 2CSGA 2OIIA 4PIYA 4QGLA 3WDUA 4A3ZA 1AR81 3M8LA 3MZHA 1R1A3 4JDOA 1OPOA 3NV3A 5FQ0A 3ZXFA 4ARYA 2NN8A 3ZVXA 4MH0E 1QHDA 3GZEA 3MEPA 3U1XA 2R041 2Z79A 3IDBB 3MW4A 4QPWA 5F6LB 1VMJA 5CFDC 4FOQA 2ZHMA 3KCXA 3BU0A 4QU2A 1OFNA 2YXSA 2VXRA 1BEV3 1O4ZA 5DAVA 4RHV2 5FXZA 1X9PA 2R1BA 2XQRA 3MF6A 3UESA 4HSLA 1Z7S3 1WA6X 5F37A 2A73B 3M4FA 3RFRA 3WW2A 4EROA 5L7OB 2PHDA 1OLRA 2YPDA 3J8F1 2CGNA 4IV3B 5IYYA 1GQHA 1N1SA 4JHZA 4LHSA 4NHLA 4XHXA 4CDWB 2JKBA 1F35A 1CAUA 4FXGB 4A42A 4CCDA 5IVFA 2XBO1 2YY1A 1RUG2 3AP6A 4MADA 4CVUA 3POEA 4B8EA 1LOCA 2ZX1A 4FFIA 4J1XA 3GALA 4HVOA 3HEIA 1F2NA 1ZZ9A 4QPIC 3T2TA 1YFWA 5HV4A 1B09A 1W05A 4BXSV 3QH7A 3ZDSA 4S2GA 1FT9A 3POBA 5A3OA 4UI9L 1WMFA 2Y64A 1W6QB 1N47A 4IGPA 4C0BA 1VB2A 2HJIA 3D82A 1NE6A 4UXAA 4AZZA 1E5IA 2W1WA 2ZTNA 4UBGA 1JOPA 3LEIA 3VHOA 4XF1A 1XQNA 1H0BA 5EV7A 1CONA 1HJFA 4EJRA 3BODA 5JXJA 1KFXL 2C9AA 2RR12 2WA3A 1N3OA 5A32B 4KG8A 2ZGNA 3NVCA 2ET7A 2QQPA 3AZWA 2ZKLA 4WZCA 1C5IA 2DFBA 3ZN5A 5F2SA 5FJKA 4NWWA 4P08A 3KHBA 4XFGA 3O1OA 1DU3D 3GJBA 2GMPA 5FY9A 2FCTA 2NMOA 5C9AC 4YM3A 5DAWA 1BKZA 1EPZA 4CDQB 2RMU2 2PLV2 5HXVA 2PN5A 3RRDA 3BOPA 3N9QA 3BTZA 1FATA 3SHRA 1FMD3 5I8YA 2J1RA 4DFSA 2DUPA 3WD5A 3LFIA 1SZBA 1G86A 4CYDA 2VZPA 3AYCA 3PU8A 4OHWA 2AEYA 2MNGA 4Y5SA 3VDDB 5C8CB 4L99A 3VBFB 4D94A 4Y1VA 1S55A 2A6VA 1NCRC 3OJBA 4XETA 4Y1UA 1OQ1A 3ACIA 3HWJA 3CJIA 5F2WA 4QHZA 1C8M3 4U2AA 3WDVA 1ZNPA 3B00A 4IV1C 3ZKUA 4AGVA 2D7FA 2JE8A 2WN2A 1US3A 5HCFA 2HWB1 4CCLA 3NAPB 1L3JA 1NQDA 2ZGPA 3OY8A 1VMHA 4XJAA 2JE9A 2J1EA 3VN4A 3ZFFA 5FPLA 4IE5A 1ND2A 5K7PA 5T52A 4YNIA 3E6CC 3SKJE 4KU7A 1HQWA 1R1A1 2XJTA 5DUUA 1KJRA 1KEXA 3U0ZA 4EYUA 1VRH2 4I02A 1X8EA 2Z4FA 4LIVA 5LY2A 1TME2 1YC61 5LEJA 2BGCA 2F6BA 4M0NA 5A7WA 1BEV1 3VKLA 2ZGOA 4B4QA 1Z7S1 3HN1A 3EJKA 3CZJA 1AR92 1JUIA 3LD8A 4UF0B 4QPYA 3LPGA 1NLRA 4RD7A 2Y0OA 4Z92B 4K1YA 5HXMA 2XH6A 3HN3A 4Q4W3 3I49A 4WVVA 1OPMA 4FCAA 2G9FA 4HXCA 1K5JA 1MZEA 5FZ1A 2F17A 2D97A 2PHWA 1LOGA 4Q4Y2 3TWIA 1WUVA 2DVDA 2Z5WA 5T5PA 2HYXA 2VQAA 4DY5A 5KWRA 1CPNA 5L7OA 1PMIA 2P3KA 2WQ8A 3PVBB 4HKLA 4IV3A 4S2HA 2D3PA 5IVVA 3ME2A 2ZABA 3Q8BA 1ZRFA 2BDRA 3MV01 3FLPA 4Q0PA 4GB33 3APBA 2RS32 4QB1A 1LULA 2Y6LA 2RDNA 4X8PA 4HN0A 5CG8A 1BBT2 3WG2A 5EXOA 5GZGA 5A70A 5I91A 4HKWA 1VBE3 1WCSA 1XYPA 3OPZA 4QM8A 3KZ4C 4BQ1A 1YNAA 5FBJA 3LPFA 2R32A 5D2AA 5LRRA 4DO0A 3RJRA 1JZ5A 4ZS3A 1OF3A 3NKTA 4JTOA 3USSA 3OYWA 2Y6FA 3EMRA 3PU3A 2HWE3 1LGNA 1OD5A 1W6QA 2CDOA 3AP9A 3AZYA 3KMHA 4QX7A 4XQWA 1RHI2 3ZYIB 5CKNA 2WNUC 2ARAA 3SXWA 2GNMA 2JG9C 4QKBA 4Z8BA 2XB6C 1UMIA 5H9QA 1Q8PA 1ND3C 1QF3A 1PK6A 4Y22A 1FMD1 1C1LA 1RUD2 5A32A 2ARCA 1GR3A 5CFCC 2MPFA 3E5QA 2IFRA 2J1TA 3AMHA 1QJX3 4META 2DVAA 4LA2A 2VUDA 1W9FA 1N3QA 3VKMA 3WT3A 4TTGA 2WNEA 4LULA 4KWLA 1SFYA 4W50A 3WG1A 3J26N 1HV0A 2QTWB 2I07B 1X9TA 1LNSA 2B46X 2BGPA 1A8MA 1C8M1 1PGSA 1QMJA 2K0GA 2Y6KA 3GCWA 3GJAA 4LJHA 1DGRN 5JPMB 5FZKA 2RHPA 2VW1A 1RUJ3 1XC6A 1EV13 1REEA 5JZGC 5IFTA 1A6CA 1VBB2 1S0CA 2QQJA 4OUEA 4QPGB 1AR73 1U5XA 1ZX5A 2J22A 3ROUA 5C70A 1NZIA 5FYTA 1HB4A 5C3PA 2VY0A 3MICA 3VDDA 2UY8A 4QXHA 1XOYA 5C8CA 5T5LA 5JIUA 2E6VA 2VUJA 1SCRA 2IXCA 5FWEA 3WHUA 1X8MA 1CVNA 1ASJ3 3VZKA 4EZ4A 4WVMB 3OBRA 4N9HA 3RG0A 4AI8A 3SH3A 5EWSA 3RYKA 1N1YA 1FV3A 1XE8A 3JCIA 5DN2A 2NM1A 3PUIA 1OVPA 1UYZA 4AHZA 4A7KA 4ZU4A 1JXNA 5IK4A 4FPYA 4O7XA 2YZ4A 4Z1VA 4IEUA 1UW8A 2KM2A 5H9PA 3LIGA 2DDUA 1ZBA3 2IXLA 1H4HA 4Q4W1 1GOFA 5JXIA 5BNOC 1YUDA 1Q5OA 4YG3A 4ZXKA 5JLVA 3WNXA 2RDQA 4LXLA 2QQIA 4KBZA 3JB8A 3GZTB 4JGZB 3AKQA 1YWKA 1YFYA 1SFPA 2Y8KA 3IB3A 3R0RA 4YGDA 1K5MB 2Y0IA 1AYM3 3POGA 2XVGA 3WQBA 3BTAA 3NSTA 4Y5TA 4MGZE 1GUIA 5FZDA 3TB0A 2A75A 1PO13 5ISLA 1JMUB 4GB31 4MV2A 1H2KA 3I97A 4GMP0 3SISA 5FYBA 2LM3A 4AEDB 3KQRA 3LSDA 4AEKA 3QCWA 4LT5A 4YG6A 2VGDA 4NRPA 3DF0A 1YFXA 4I2OA 4CEWB 3NKGA 1VBE1 4CDWC 1Y9GA 4ISRA 1ZRRA 1XPWA 4IW3A 2YHJA 3LOBA 5T5JA 3THDA 4HONA 2R061 3I3DA 2HWE1 1D0GA 5DDJ3 3I3BA 5T3NA 3VD4A 1LOFA 5DZFA 3LA3A 1YIPA 4IUGA 3H3ZA 1UZYA 2EICA 3MPPG 2TBVA 4BB3A 1RTVA 2WNVA 3EQEA 4LBQA 5FZ8A 4AI2A 1DGWA 2ZX2A 3DECA 4PHZA 4XEZA 2GMEA 2R16A 2R072 1JS9A 3LEGA 3DN7A 4Q0UA 1V9U3 1WMEA 4N7UA 1QJX1 3D6EA 2HBUA 2VOWA 4R9CA 1MZ5A 1AX1A 1QXJA 4R52A 3MUZ1 2JG8A 1QQP3 1P8JA 2B45X 4RQPB 2X10A 4AR2A 3MO4A 4PJYA 3MDPA 2OS2A 4OZXA 3N7JA 5TSWA 1IG0A 4ATEA 2ZJCA 1RUJ1 4MGYE 1EV11 5KXEA 2ARBA 3ZSMA 1HJGA 2ADEA 3WV6A 4N53C 3FL7A 4CPBD 5FMDA 5LCWL 1IS4A 1AR71 1RUC1 1O91A 4KU8A 1FXZA 5JXGA 1GICA 2XLFA 5FP9A 3PMEA 4MOAA 3ZR5A 3IN9A 1WCUA 1PZ8A 1FNZA 2QE3A 1ASJ1 2AZ5A 3KV6A 3FBMA 4LO8A 4XDQA 3SCGA 3W9AA 4A45A 3ZR6A 2YROA 4JDNA 1RUOA 2JICA 1PGW2 4TYSA 4EWAA 1V0AA 4YW4A 2JECA 3VBFC 5F3EA 4IGQA 4QPGA 2VNRA 1K3IA 2VUCA 1D4VB 2DU1A 4FPKA 2QZ3A 5IFPA 4R9AA 3GZAA 1ZBA1 1JU4A 3MIGA 2WFF3 3FFQA 3GDBA 3VBRB 4D6SA 2E7AA 4H14A 3NAPC 3I2DA 4GA9A 3VBHB 3IAPA 2WT0A 4YM1A 1YO8A 3MIBA 1R093 3FMGA 4XF3A 4XDPA 4BK4A 5GLWA 2JDUA 1YI9A 3VD3A 1RUE2 1S0FA 5FIXA 1O3RA 1Q8VA 3NW4A 4GQ7A 4TXWA 1AYM1 2DUQA 4QB6A 2GNDA 2DCKA 4BQ5A 1JU3A 5FKBA 5LBCA 1SBFA 3ZSLA 2FQPA 1PO11 3FLTA 1AYN3 1SHWB 1JYVA 3TN93 5F7UA 4NIGA 4FPHA 1NE4A 4Q27A 5A80A 1FOD3 2WWSA 4AQTA 1W9SA 4YZ2A 5F3CA 4WM8C 2B9UA 3LA7A 1KQRA 4C1WA 4JGZA 3PJYA 2FZ2A 2ZEXA 3F95A 3RS6A 2ZCWA 3VDAA 3QACA 4XF4A 2VZQA 4D69A 1HV1A 4MO3M 4N8MA 4IGOA 4LO6B 3OUJA 4ZHNA 2V4VA 1QDCA 5DDJ1 4BK5A 1C57A 2Z2SB 1E5SA 1L7QA 3RVHA 4JAAA 4AEDA 4LBOA 1BHGA 4XFBA 5IJRA 1O59A 1AVBA 1O4YA 2WDBA 3NWKA 2ZOEB 1ALYA 1DZRA 1W6NA 3B02A 3M3EA 4OLLA 5BYNA 4R9BA 1W8FA 4XPVA 1V9U1 1XSRA 5A3TA 4MGIE 3WVJA 3TAYA 3AL6A 4AVTA 4S2DA 4FOYA 3VHNA 1JZ6A 2FCUA 1ZZBA 2Y33A 1PX3A 2Y6GA 4QWNA 1FPN2 5IK7A 4BJ0A 4QDSA 1QQP1 3SKVA 3HBZA 3SEPA 2X5IB 2BFUS 4MGKE 1RUH3 2GDFA 3FZ3A 2XG3A 3CQOA 3USUB 2W1UA 4JGYA 3HVDA 4W8JA 4Q26A 2VMEA 3SNMA 3BVCA 3ZO0B 1WCQA 2VVDA 1H30A 3C7EA 2ZAHA 5CIRA 2WO3A 4XIKA 1W6MA 5F5AA 4CEYB 4F3JA 1ODNA 2JE7A 2W5FA 4RA0A 1JOJA 4JVAA 4M3CF 2Q8CA 5LEKA 1UOBA 2D6KA 1BVVA 3VZMA 3AM2A 5CU1A 3FLRA 4PF5A 1XNDA 3Q9OA 4KWUA 2PAEA 1BJQA 1Y9MA 2PHLA 4HETA 4OHXA 3UKVA 3GM8A 5BNNB 2O1QA 5LK5A 1COV2 2XJVA 3EB7A 3MYXA 5J1XA 1OI6A 3KF3A 4QT6A 3FUQA 4NVPA 3IIAA 1MEC3 4ES9A 2BGOA 2QQWA 4OULA 4XMAA 4ZKTB 2VPVA 4YVWB 2IWGB 1LHUA 2QQOA 2WR9A 1LRHA 1QWRA 3E6DA 1PZ9A 1VBC3 4GJZA 2WFF1 1D4M2 5DPNA 3MIHA 4A41A 2E51A 5JI9A 2W91A 5CAZA 3GBFA 2QUOA 5C5UA 3Q8EA 1R091 3PVNA 1VR3A 4FVVA 4IEXA 5IVEA 2AGSA 1HQLA 1V6MA 4RGGA 2CAUA 2GH8A 2C9KA 2VZOA 3KB5A 3M3IA 4QMAA 4RR3B 5A7OA 3FE5A 5T54A 1W8WA 5IHRA 3A23A 1G9BA 3LQCA 3M3QA 3VZLA 2Q1ZB 4BCUA 4OMDA 3GYDA 4AG4A 3AB0A 3SQOA 1W04A 1UNBA 1AYN1 1KXGA 3J7MA 3VBRA 2X05A 3TN91 2VU9A 1Q8QA 4IE7A 4RSUA 3VBHA 3OGSA 1V6LA 3MIFA 1FOD1 2CWSA 5JOYA 4RS5B 5LK7B 2WT2A 5E88A 3CL1A 2J1VA 3UKTA 1ENSA 1UMZA 2OZ6A 4AOCA 4BPZA 3H50A 3ACLA 4A7ZA 2XGXA 1HN1A 1CAWB 3WSOA 4SBVA 4YW7A 1YI7A 2WRAA 4GMP3 3GHNA 1Q8SA 1EAH3 3N7MA 5A7QA 3SCHA 1AXZA 2WLPA 4DUWA 4GXLA 1VRBA 3I2HA 1DZTA 3T4HB 4MGSA 5FZIA 2VZRA 1ENQA 1UPIA 1K5MC 4HPKB 1X33A 3VHPA 4KH9A 4AFDA 2ZGLA 4Q0SA 3RQ0A 1SLAA 2XL9A 4AF9A 1FX5A 1W8HA 3NV1A 1OLMA 5FZ6A 3WY6A 2VQ0A 3V0AB 1GWMA 4TZDA 1BCXA 1W2UA 1JN2P 3VBUA 1VBA2 3VBSA 2Y6HA 2XLAA 3LE0A 2QJVA 4CEWC 1RUH1 3SITA 1O3SA 2AENA 2BEOA 1O5LA 4L0PA 1YYNA 1JYIA 1SEFA 2H6BA 2Y6JA 2NYYA 5EYXA 1A8DA 5DZEA 1QJZA 3HOBA 3JZVA 3ZFGA 2JD9A 5D8AC 2XVLA 1BLZA 5C8WA 3U37A 1TNRA 3AZXA 3T2OA 1W03A 2PMWB 4BIOA 5FZLA 1OSGA 1KGYA 2W0XA 4E2QA 3NRUA 1LHWA 4KI5M 5B4NA 4BIFA 4NHYA 4CCEA 1SPPB 2MEV3 1DGWX 1QOTA 3QD6A 1RMU3 1VBD3 1NA1A 2PHUA 4H3WA 3TEWA 4LBQD 1UIJA 2DUOA 1Z0HA 4J25A 1Y7BA 5A33B 1MEC1 2HEWF 3TYJA 2GC0A 3VZOA 4FAHA 4BU2A 4Y4YA 3IKWA 4J6GA 2Z42A 4M4PA 5A6QA 1HRV3 4RQPC 5FJHA 2X8KA 5FLIA 4XBNA 3WDTA 4EN6B 5JXHA 1B35A 1VBC1 4UYBA 4MSVA 3R6SA 3UK9A 4QXKA 4COUA 2XVKA 5T5OA 5CKQA 3J7LA 4XACA 5BNNA 1IOAA 2WQZC 4XCBA 3HPNA 3ETPA 3PUSA 4Z2AA 3I3QA 3PJQA 3WP6A 3DYPA 1N1TA 1UX7A 4OHZA 3WLUA 5C3RA 3NNJA 2PQQA 1LU1A 2BTVC 2P4EA 4Z07A 1V6OA 2XKPA 3AX4A 5FPUA 5FYIA 1OD3A 1HXS3 3NJZA 5EYYA 4FT8A 5CA6A 1H6YA 3SC7X 3DGTA 1LOBA 1ZRCA 2VMIA 3KVBA 4GULA 3ZYBA 3T09A 2JWPA 5DMYA 1DIWA 2YC2A 3AMNA 1G6NA 1CIYA 3R05A 5APAA 3UKNA 3V56A 4RR3A 2D6NA 1H9PA 1HRI2 3H8XA 1UL9A 5DG2A 1DQ0A 2ZAAA 4GMP1 2JDZA 1EAH1 3O7OA 1AL23 1IS5A 4UFIA 2RVAA 4KGGA 4ONUA 1UY3A 1FI2A 3AVRA 2P34A 2RS52 2WN3A 3AYDA 3A21A 4YVSB 3L9JT 5A7PA 5IK8A 2YFUA 3BKZA 4XUOA 3T3YA 1YJKA 4AQSA 1V6KA 3ES4A 3IPVB 5D21A 2PA7A 1LJ7A 4RS5A 4YW5A 1SG3A 1ZA4A 1QDOA 4AI0A 4E27A 2SBAA 3ZFFB 4QDRA 1ND2B 1CAWA 4TWTA 3UT0A 4AI1A 1PZ7A 2ES3A 1ZZCA 3CU7A 4JKLA 4CU7A 3BTYA 1VALA 4P5YA 1BMV2 5JAXA 4A6OA 3KS7A 1G9AA 1OVSA 1Y3TA 2EAKA 2VMGA 4YZ5A 3IDAA 3PVOA 4HPKA 2O8QA 4N90A 5CG9A 4FPOB 1JODA 4PLNA 2ILMA 4Q2FA 4B1LA 3E5XA 1GANA 1H8TA 2GNBA 2WL1A 2YC0A 2VMCA 1AR82 1KS4A 3V0AA 2ZMLA 1PVXA 1AX2A 5DAQA 2R042 4XQDA 2JDAA 1T2XA 3TEYA 2MEV1 4XF9A 1NT0A 2LUWA 2WSUA 3HNMA 5CISA 1RMU1 1VBD1 4Y3OA 5FO7B 2AUYA 1UD1A 2XJUA 1IPSA 5FFOC 2YYOA 4FPEA 3KCCA 1QJU3 4X6RB 3J8F2 4HZFA 1QIQA 2X5IC 4MUVA 1I3HA 5D1IA 4DEVA 1UO9A 3JQWA 1HRV1 4QU1A 4A6SA 5IW0A 3WNPA 1IS3A 2ZEWA 5CKMA 2XBO2 5LBFA 2XWJB 4Y20A 2ERFA 3ZDVA 1SLLA 3JBG3 4CE8A 2EA7A 1TMF3 1MACA 2FBEA 2ZMNA 4R4ZA 4CEYC 1DYPA 4DXRA 1SPPA 1W8TA 1KJLA 1XSQA 2RJLA 2TUNA 1JUHA 2YGLA 5A33A 3OD4A 4LHNA 5FCCA 5GLUA 5A7NA 5JIAA 3OYWB 4P9WA 1HXS1 1YQ2A 4GIQA 4QQPA 5KHIA 2VJXA 1QNYA 4DNYA 3CMGA 5LRSA 1AR63 4PQ9A 5FR3A 3C7OA 3VB9A 3PUAA 5F32A 4CPBA 4YVWC 4Y22B 5FTTC 1PK6B 3U78A 4OCTA 2W52A 1F9KA 4FP3A 1KD7A 2VOTA 1AUYA 2PTMA 3L2YA 1OHFA 2WZR3 2VOKA 1DLCA 3RI9A 1CQ9A 1AL21 1UAIA 1MQTC 2HWD3 1IKQA 4XJUA 2X53S 4YLZA 1VP6A 4IQPA 5LW9A 2VR4A 1DF0A 2XQXA 1U5ZA 2QQNA 3VD9A 2BW8A 4FAGA 1WLDA 2HLEA 4MGTA 3RZKA 2FCVA 4L2NA 2ZHKA 2IVIB 3I54A 1AX0A 1AHSA 3D5OA 4CCMA 3OBAA 2WAAA 4M00A 5A1AA 4CUGA 1WGPA 4WZFA 4LKDA 1ENXA 4FPCA 5FAXA 2HEVF 3OCPA 3VBOC 4RN5A 2VC9A 2ZEZA 3MFAA 1H9WA 1W0OA 2P3JA 1OH4A 3SH5A 2CV6A 2G1MA 4DY3A 4EE2A 4YVSA 1OKOA 1UY2A 3AXDA 1OOPC 1GZTA 3BGAA 4M01A 1W0NA 2RE9A 2V73A 2HWB2 3B93A 4XE9A 3IPVA 2A6WA 2FDKA 2XUEA 3CHXA 2NP0A 3CO2A 3LIHA 3C7HA 3S5QA 2WLQA 4H7LA 3K75B 3O5SA 3FHAA 1TE1B 3URFA 1R1A2 3MBWA 3K77A 2UWAA 2YPJA 4KGQA 4XTPA 2R49A 3N9MA 1UYXA 1ZZ7A 3NJXA 4U36A 2IXHA 3AKRA 1YJLA 1XE0A 1UZZA 2HWC3 2UYBA 2W92A 2DTWA 5K9YA 4CDUC 1BEV2 4P14A 2BWAA 1WW7A 1I5ZA 4ISQA 1Z7S2 3WG4A 2VCAA 1GWKA 3DEMA 1IKPA 1YQCA 1QJU1 4LUMA 3VZNA 2DWRA 2PHFA 2HWF3 4G9SB 4Q1RA 3WG3A 3B94A 4UFHA 3RZHA 3ZYRA 3KVAA 5JPNB 1UU4A 2ET1A 4RYDA 2ADDA 1F15A 2UWBA 2AYHA 4L11A 5FPZA 2VQUA 3JBG1 2DCTA 5ANQA 1TMF1 4JZRA 5FRAA 5FXWA 4AVCA 3HQXA 4QKDA 5DQ0A 1PIV3 1MVEA 2ID4A 1QU0A 4LKFA 1W2NA 3NL1A 5JI7A 3WF2A 1ULCA 1NQJA 2VL4A 3OF1A 4D7SA 5E1RA 5JOZA 2W08A 1LOAA 4CCCA 4LEJA 3O1VA 4NAOA 4LK7A 1Q56A 3ZN6A 3ELNA 1O4TA 3M7AA 4N9IA 1WLWA 5A3LA 1WKYA 2PAKA 5LWBA 1W9WA 1UZWA 3P3NA 5E16A 3TOJA 3QLQA 4E4ZA 2CDPA 4JKKA 1ZZ6A 3KLSA 2WZPP 1CAXA 2J1SA 2WNVB 3JB4C 1S0BA 4LBQB 1AR61 4AVSA 4XFHA 3WOGA 2VZSA 1ZBE3 1J3RA 4XJWA 3OEBA 4OYUA 2VQTA 3W5NA 4NN0A 2D5FA 1V6IA 2A70A 4O65A 4ZXEA 3PHMA 4AFMA 1SLTA 2WZR1 4LPLA 5HI0A 1W8ZA 3K4DA 2R063 3ZPOA 5FV3A 4ASLA 4XIOA 2HWD1 1DBNA 1AZDA 2JG8B 5FZ7A 1K45A 2XLGA 4Q0VA 1W6OA 5IAVA 5T50A 2JDYA 4LBLA 2WO7A 1H4GA 4DMIA 1XJAA 3AP7A 1FMD2 1DDLA 4ASKA 3ETQA 5EP9A 2WWJA 3UYJA 4K20A 4XUTA 3ITQA 2VTXA 3T0AA 4CDXA 4LHKA 1LODA 4KMQA 3VL9A 5ANNA 4QX1A 1RYYA 3S6PA 2D6LX 3RZMA 4M3CE 2CY6A 4HFSA 1OFSA 1D0HA 1VJ2A 2X29A 3I2OA 3WF3A 5C6CA 1RVF3 1C8M2 4QDQA 2VNGA 4NWVA 1ZREA 2DBNA 1J59A 4QQ2A 4I0AA 3N9NA 2PHTA 4R4XA 4Q1PA 3ZFEA 4OQ9A 5F6KA 3J7NA 3ORJA 4LOTA 5I0RA 3I2IA 3T08A 3KGLA 1V6NA 4DXSA 1RUC3 2OVUA 3CJIC 1QKQA 4EWEA 2VM9A 4GAZA 3WQ7A 1OXCA 1CR7A 1ZA7A 5EHDA 2Q4SA 2HWC1 3HQRA 5BUVA 1ENRA 4O9GA 3ZFFC 1W2OA 2ARXA 1PM7A 3ZIWA 1ND2C 4NIIA 3OEAA 1NCQB 3H1WA 2DVGA 4O61A 3WX5A 4BQ3A 1E5HA 2R0FA 1RXFA 2K9ZA 2HWF1 1TVGA 1I9RA 3U4XA 4YW2A 2VBBA 5CZKA 1GP4A 1UN1A 4FFGA 4LBNA 4Q4W2 1F4HA 4ZZ8A 3PMSA 1S4CA 3AP5A 4IE0A 1LOEA 4DINB 1I5PA 1M06G 5H9RA 1IPJA 1HX6A 1XE7A 4OFGA 2CU5A 2VH9A 1JYCA 1CZSA 4LBJA 1PIV1 4OUSA 4P9IA 4FPGA 5IAXA 2OA2A 1SFNA 3KV4A 2GU9A 2IVJA 1JHJA 3U11A 2FDFA 3BU7A 1NY71 3J9SA 5EZWA 3K3OA 5FMOS 2J7MA 1QH6A 4BZ4A 4QQOA 5FY4A 1I1EA 5CEHA 5LBBA 1DGRA 3F2ZA 3T4VA 4GB32 2Y38A 5BNPB 5A3UA 5J96B 4MX3A 1JW6A 3Q8CA 3FN9A 3WP5A 3H7YA 1J3PA 3IIIA 4PT6A 1WD3A 4Q29A 2A71A 3VDCA 4N43B 4L8QA 5L7OC 3CEWA 1VBE2 1ZBE1 4IV3C 3UGHA 3WF1A 1DFQA 4XFIA 1DQ2A 1W6NB 4LNVA 2OXBA 1IHMA 4FTBA 2QDNA 3S5AA 1RGSA 5EFUA 2R062 2HWE2 4HLTA 2ZS6B 1TNFA 4XW3A 3N3HA 2RM23 2W47A 2D6PA 2XR4A 3I4IA 5I0TA 2QBXA 4WM7A 1LU2A 1WLCA 1XU1A 1OH3A 4DRRA 3RZZA 2ORXA 5C4WA 2D98A 3H8OA 3OGRA 4ATFA 4BA6A 3C8XA 4OI1A 1UX6A 5GKAC 2E7QA 4AXOA 2DCYA 5KC6A 1PGL1 2P37A 4JGYB 1BVP1 2E63A 2VO5A 4GWJA 4AQ6A 1C3HA 4F8AA 3UETA 1QJX2 1W6MB 1GOGA 1RB8G 4AEMA 2WO2A 5JDBA 2W94A 2JIJA 3NV2A 4Y5Z0 2O14A 4Y1XA 1US2A 1RUF3 3AP4A 5EJ3A 1PK6C 4QGMA 1RVF1 1MS8A 1DLLA 2YU1A 3PIJA 2VMHA 3RWKX 1W0PA 4LLOA 2ETEA 2E7TA 5I8TA 1CN1A 2WSVA 3RZGA 1RUJ2 2GC1A 1EV12 4W6YA 3WQ1A 1XNAA 3DYOA 1UU6A 1RXGA 3WHTA 3VKOA 5A3NA 1MS5A 4Q0QA 1AR72 2ENRA 3WNMA 5I0UA 5L9VA 3PVEA 1XBFA 3HT1A 1VIWB 2R1DA 2DVFA 3IZOA 1DQ4A 1YHFA 1LGBA 4RFT0 1CZTA 3DXTA 3W5MA 4CDQC 2BPA2 1UY0A 2VVFA 2WO1A 1ASJ2 1DG6A 1ST8A 4AAXA 3N4MA 1EY2A 2EIBA 5B4XA 3GCXA 4IXLA 3DV8A 1RUI3 2BOIA 1GKBA 1S0JA 2RDSA 3FC0A 4AVAA 3VDDC 5C8CC 5G05L 2JB8A 3H3LA 4KBBA 4XF0A 3UJQA 3RPQA 4H55A 2PYTA 1UMHA 3BCWA 1D2SA 2VOXA 1S0IA 4ZU7A 5FZ9A 1ZBA2 1IGOA 2DBIA 1R64A 5L19A 1ZYBA 1PNFA 3INAA 3GNEA 1GQGA 1STMA 1HB1A 3AKTA 3FJSA 5GALA 5E8AA 2Y26A 4IEYA 1DHKB 1IQAA 1WMXA 2AR6A 3HQUA 2WZ8A 3POJA 4EZHA 2ZZJA 5I8SA 2VBPA 3GF6A 1DP0A 2WYFA 1NCQA 4XJ9A 4Y24A 1NLQA 3BN6A 5FZHA 1AYM2 2I45A 2BNNA 2D44A 5FYVA 4QX3A 4W6WA 4QB2A 5AC93 1SMVA 2SLIA 4ZY9A 4PDWA 3G6JB 1PO12 3IAQA 1URXA 3MLLA 4EWDA 2EXJA 3LA2A 1IS6A 4GH4B 1OLQA 2VW0A 4QHBA 3WDXA 2XJQA 3K4AA 3NMBA 3ZSEA 4BISA 5FBZA 2C6SA 3Q8FA 4UW5A 3KQ4B 1UQXA 4UAPA 2WNOA
chains in the Genus database with same CATH topology
2O8OA 3ZXDA 1J1TA 1R083 3KCYA 5DDJ2 3S7IA 2XPJA 3QH6A 2RM21 4K3UA 3WP4A 4NHMA 4YGEA 3VBUB 2B7YA 3FWEA 2PAMA 2CYFA 3VBSB 4WV8A 5BNPA 2WS93 1REFA 4N43A 1PO23 3ZFGB 3OD0A 2CL2A 4W6XA 1V9U2 4IEVA 1LOFC 4AE2A 3W59A 4AEJA 2PELA 1OQDA 2WNVC 5ABJA 3WUDA 1QQP2 2B5HA 4DZGA 2E9QA 1RUF1 4LTAA 4L92A 3ILNA 1JHNA 5JSOA 2B42B 4XTMA 1LHOA 1NA1B 4UBHA 1I6XA 2V09A 4CP0A 1YXWA 1ZM1A 2JG8C 1HQNA 4Q4V3 4AHXA 1LGCA 4SLIA 5K0UA 2C5DA 4YZ3A 5ACA3 5CFDB 5J3UA 1B35B 1S0DA 1WMDA 2XJRA 4FQ4A 1QJY3 4WVZA 3UV9A 5CADA 5JSPA 4HN1A 4C0HA 4AFCA 1O3QA 1QGLA 1RUI1 3R4SA 4DB5A 4MXVA 1VAMA 2H0VA 4YG0A 4P9JA 4FOWA 1O7FA 4EN7B 2XJSA 1R1ZA 2DYCA 1UKGA 3AJZA 2RS13 4IEZA 3LZZA 3JD73 2WFF2 1EP0A 4MXWB 5K8SA 1GYKA 1LESA 1CGPA 5GLVA 1FNYA 1R092 5AFBA 4QPGC 2VNOA 2OPKA 3FBYA 1WW5A 5J48A 1CIWA 5AC91 2OZJA 1C5HA 1ZZ8A 2GH2A 3GBWA 2TEPA 1CX4A 1AYN2 1ULEA 3HT2A 3TN92 3I59A 3IT8A 3SH4A 2WT1A 2Q1MA 1FOD2 1GNHA 4NR1A 4I09A 3MW2A 1D4M1 4KG0A 5CVRA 4J1WA 2Z69A 4XFCA 1J58A 3VKNA 3IWZA 1R081 1PVC3 3PLQA 3C3VA 3OGGA 3SMHA 1F5JA 1Q43A 4YW1A 2WS91 4JGZC 2ZHLA 4GH4A 3S30A 1KDKA 2VW2A 4DS0A 2UY9A 1CAVB 1PO21 3ALQA 5HBAA 5GZFA 1QXRA 4XHBA 4FO9A 1H8TB 2GMMA 5JVVA 1RJ7A 2QFEA 3AFKA 3EHKA 3DPRA 4AEDC 2HEYF 4NHKA 3HR9A 1RUH2 2WFPA 5KXBA 3H1MA 2ZGMA 3M3CA 5I0SA 3CLPA 2A3YA 4RGAA 4K1ZA 2JX9A 2D5HA 4LLFA 3ATGA 1QOOA 4DOUA 3AMPA 4Q4V1 4LE3A 3V65A 4PIXA 5ACA1 1CJDA 4GALA 1QJY1 5GJ6A 3M1HA 4JGYC 2CWMA 4NPRA 4Y20B 5FREA 4HBNA 1APNA 3WP3A 3WW1A 3NV4A 1S0GA 1LB2A 4HL0A 1FYUA 4C1XA 3MW3A 5SV8A 1MEC2 5JMCA 3IDCB 4XJZA 4D3WA 2RS11 4C91A 5BV6A 1LTEA 4XZPA 2GC2A 4YGCA 2ZGUA 4ES8A 1VBC2 1ULGA 2ZACA 3JD71 4M0HA 3D0JA 5CFDA 2QZ2A 4Q4X3 1RL3A 4S2FA 3FHIB 4L9BA 1MS0A 1U0AA 3RDIA 4LBMA 5I93A 2D93A 2DF7A 1U5IA 5KC5A 3B7MA 1ZVFA 4AYUA 1GFF2 5KBFA 4XXPA 4O9EA 1YRZA 1PHMA 4RHV3 2VVEA 1UF2C 4MXWA 3B9IA 4QPIA 1U5YA 3JUUA 3KGZA 3O0XA 4M3CA 1SDWA 4Y1YA 1XYOA 1ULDA 1O3TA 3WDYA 1OA4A 4FXKB 1RUG3 4AHYA 3PNAA 1PVC1 2WNUB 3VBRC 5FOJB 1EAH2 1EPWA 1MS9A 3WQ0A 2VUAA 3TBDA 2NLRA 3VBHC 3VLBB 3IDEA 4AFBA 2FZ1A 3VHRA 2VULA 3MIEA 5CFCB 3ZMOA 3SLIA 4XBQA 2WA4A 2F4PA 1SQ4A 5HCAA 3N7KA 4Y1ZA 4YM0A 4WVWA 2N7GA 4Z82A 3RYPA 3ZN4A 5C9AA 3ZPYA 2H6CA 2RR13 4B7EA 3PTYA 3A0KA 4BYYA 1GZWB 3N36A 5JSRA 1ONAA 5GM0A 4INDA 3H1YA 5JZGB 2EVXA 2CNAA 5GZDA 1AXKA 1CAVA 3ZMNA 3VBUC 2FMYA 3VBSC 2RMU3 1NCRA 2PLV3 4FTSA 4XFFA 1DQ5A 2YDEA 1Y9QA 2IC1A 4FP2A 4AVVA 4P9LA 3LSEA 1G8WA 5KHKA 1QNWA 4F7ZA 4IV1A 1OA3A 3ZFGC 1S0EA 4COWA 2CGPA 2MEV2 2GC3A 1RMU2 1VBD2 1WBFA 1LENA 1WCKA 4UW4A 2QDRA 4QD2A 4NOTA 3ILFA 1HLCA 4OI4A 1A78A 3ZN6B 1HRV2 5AFEA 4YFZA 5BNOB 5KHJA 3R4DB 1N1VA 2CGOA 4Q4X1 4G4FA 3WUCA 1NA1C 2Q5TA 5JR7B 1CAXB 1UU5A 1JBCA 4DQAA 4AGGA 1KRIA 1AL0G 2JENA 4BHPA 1XNCA 2DCJA 3EXUA 1B35C 2C1FA 1VRH3 3U10A 4AI3A 1TME3 2XHKA 5DG1A 4LUKA 3X29B 1HXS2 2A3WA 4RHV1 5BNNC 5F9TA 4IEWA 4XJ8A 4BMEA 1W6OB 4LO5B 1AR93 1POV3 2DURA 3AMMA 4A7YA 2UU8A 5SV5A 1UPSA 2AREA 2ZX4A 4E4DX 3H3UA 4B3NA 4AGRA 3VZJA 4XXAA 2LTNA 1RUG1 4P9GA 1HW5A 1SLCA 3JQXA 3GHMA 1X50A 4CDXB 4HK8A 3WZ1A 3N35A 1QOSA 5AVPA 4COVA 4Q4Y3 1AL22 3ZXGA 3T1MA 4COZA 2BYVE 3VV1A 1UIKA 1REDA 1N3PA 5CB7A 3CF6E 3SCFA 1RIRA 1GLHA 5BY5A 1CPMA 4E9KA 1G7YA 1IZ3A 3H0OA 4RR3C 2ZKNA 3ZFEB 3ZYJB 2RS33 3P3PA 1BBT3 2WNUA 2RR11 2YMZA 3WINE 5AVAA 2JG9A 1H2MA 3ZSJA 4RS5C 4CP1A 1CJPA 2A7AA 1D2QA 1ND3A 1QY4A 4N53B 5CFCA 1VAKA 3WXPA 5GLTA 1RHI3 3VKFC 3THPA 4ZU5A 3D4KA 2RMU1 2PLV1 4YRDA 5BXXA 2PFWA 1RUD3 3MFCA 4P9YA 3I8TA 1GZWA 2EXIA 1MS4A 3B5LB 1H8TC 5JZGA 2ZHNA 4LO4B 4P5HA 3W58A 1DZQA 1QJU2 4AW7A 2O0OA 1TEIA 4CZSA 4OVEA 5IT6A 4K6BA 2UWCA 4B4RA 4COYA 4AWDA 3S0MA 1DQ1A 2DFCA 1C28A 1HKDA 2EXHA 1VBB3 3JBG2 1TMF2 3AFGA 2OYZA 1X36A 3TRSB 4BLJA 4JCKA 3B9CA 4NO4A 4XFAA 4OHVA 1T6GC 1Z78A 3A0NA 2A6YA 4KWKA 1VRH1 1WBLA 1TME1 2OW4A 1XXNA 5BNOA 2P2KA 1X7NA 4EN0A 1TQ5A 1YLLA 3BPZA 4ASMB 3D8CA 4WM7B 1HDKA 2Q30A 3GBGA 4WM8B 2ZX3A 2W68A 1AR91 1POV1 1AR62 5C4WB 2OUJA 2ZA9A 1YFUA 3OTFA 2ZGSA 3FUOA 3HIFA 2WZR2 4X8NA 3QOPA 4LE4A 5J36A 4Q4Y1 4QQLA 2C0ZA 3ASIA 2HWD2 4PLOA 1C1FA 2GALA 4I0BA 4K8FA 4BLIA 4CDWA 1C8NA 2VECA 1GZ9A 4IL7A 4YZ1A 3KT4A 3AYAA 4YFWA 3AZVA 4B4PA 4Q8KA 2EF6A 1S1AA 2RS31 4AVBA 3CJXA 1NZCA 1OQEA 1BBT1 4F83A 2K2SA 2DV9A 3RI8A 5KHHA 1LCLA 1F31A 2G4IA 1AJOA 2GN3A 4BMBA 2WIIB 4IETA 4QQHA 4E2GA 3V0BB 1O5UA 1RHI1 1NYWA 3B69A 3WW3A 1RC6A 1S2KA 4D7TA 4YVSC 1IPKA 5FLHA 4BWOA 1RUD1 2R073 3DKWA 2HWC2 3O12A 4AFAA 3AZZA 5H9SA 1MZFA 2DVBA 3JU9A 2D6MA 4N53A 3ZXEA 3ZYGA 1CESA 3IM0A 3RSJA 2ZGKA 4E4SA 2HWF2 4HVQA 2DU0A 3LB9A 1MS3A 4PDWB 4JC1A 2WINB 3POYA 4V1PA 3POWA 4I3GA 1VBB1 4WBBA 1PIV2 3BB6A 3VBFA 1DYKA 3MLKA 4MYEA 3AMQA 1WD4A 1GBGA 2A6ZA 2BQPA 1NOVA 1CD3G 1NY72 3M3OA 2KXLA 1MR5A 2PHXA 2YV8A 2BVVA 1FAYA 4EV0A 1OKQA 1JH5A 3NAPA 2QVSB 3MIDA 3AKSA 2BUKA 1NLSA 3E5UA 1U12A 4XILA 3TNQA 2XKOA 1KFUL 1Y43B 1ZBE2 3ZXKA 1PNGA 2IXJA 5DXDA 3ZXLA 5E89A 2ZMKA 3E6BA 3S7EA 1V6JA 3LOIA 5ABJB 4CRQA 2DCZA 2QCSB 4KNCA 1RUE3 5JOWA 3WCRA 1GZCA 4WM8A 3O14A 3RJ2X 4CTEA 4JQRA 5JCTA 1H1MA 1PGL2 1DGLA 2GNTA 5FMOL 1G9FA 4Y26A 4AHWA 4X6QB 3OGJA 3D0SA 4FPLA 5K0UB 3KSCA 1F5FA 2CTVA 4I3PA 2EXKA 1RVF2 4KWJA 4YM2A 3C2UA 2CAVA 5D8AB 2RJKA 4FSJA 2H0BA 3ZXJA 1RITA 4CDXC 3AJYA 4XQ4A 3RNSA 4PIZA 2BBVA 1RUC2 4FBFA 4JDMA 3I7DA 1KDMA 2I74A 3G7DA 3ZSKA 2R071 4H7MA 3ZFEC 3AKPA 3ECQA 1V70A 2VOVA 4A2UA 1FPN3 2D6OX 3L2HA 3N4MA 2EIGA 4HANA 2VG9A 3V0BA 2ZBJA 4OUMA 3DUIA 4LA3A 1YIFA 3VL8A 1LECA 2A3XA 4FQZA 3THTA 2JEMA 2YUEA 5GZEA 2ZGRA 3I59B 3H9AA 3MPBA 1S2BA 1WW6A 1J1LA 3EO6A 3K51A 4GKXA 3CNAA 3E97A 4LR4A 1AJKA 1AXYA 2IXIA 3MI8A 2MHFA 3O0WA 5J98B 1COV3 2V5YA 1PGW1 2HYKA 1E57A 1M4WA 1MVQA 5B2GB 2DTYA 1VB4A 5L73A 4K21A 2GN7A 3LKJA 4UW3A 2UYAA 2KA3A 4I01A 3KT7A 3M2MA 3ST7A 1D4M3 4WVMA 1F8VA 1G9CA 3FX3A 1WW4A 5C33A 2RM22 5CBLA 3B01A 2P17A 5FDBA 2WQ4A 3DPRB 3ILRA 1NXD1 1RUE1 4Q8LA 2FHRA 2TNFA 2XL7A 1H1AA 4XOGA 1MZ6A 2WKKA 4AQ2A 1H8VA 2YGMA 4XMIA 1UKRA 4LBKA 3RYRA 4WM7C 1BQPA 4QM9A 1VAVA 1OMIA 4MZUA 2P3IA 1W6PB 3J4UH 2A5ZA 5C4WC 3QBQA 5FO9B 3H8UA 3POSA 1K5MA 1RUF2 4BM8A 1W39A 3AK0A 4LHLA 3WCSA 1RINA 2LALA 4G3YC 2GZWA 4ITCA 1HIXA 1G9DA 1LR5A 2NZ9A 3B3QE 3HAGA 3AYEA 4HMZA 2NMNA 4CEWA 1H1IA 3ZXAC 1SBEA 4DXZA 1XNBA 5DUXA 4TSVA 1RUI2 2IXKA 5D8AA 2R0HA 1FPN1 4W65A 1H2LA 1VBA3 5L36A 2JD4A 1XRUA 5KXCA 1LEMA 4YGBA 4B7KA 4HKOA 2BNMA 4YYOA 3FFZA 4K7JA 2BFUL 2JXAA 4EN8B 3A4UA 2D40A 4QPIB 2NPIA 3MF9A 5F5QA 2E53A 4M3CB 5T55A 4DPNA 5JWPA 5BPXA 2WJSA 4PLMA 2Q0AA 1X82A 4OHYA 1POV0 4RQPA 5AC92 4IERA 1COV1 4R9DA 1UCXA 3WW4A 1WA4A 2FMDA 4KQ7A 1NCQC 4BOWA 1V00A 4K9SA 3HMYA 4LO7A 2XUMA 4GKYA 2OUHA 2ZZQA 4PDWC 5IUQA 5J7MA 5FOBB 1R082 4FTEA 5J37A 1MQTB 1GSLA 2W39A 4PCRA 5C9AB 5BNQA 4ORFA 2BWCA 2R30A 2WS92 3UJOA 1VLNA 3LAGA 2IFWA 4JRLA 4R8HA 1PO22 3H7JA 1XU2A 1QXPA 3VBOB 5F1RA 3ZYPA 1RUNA 4AK3A 2GAUA 3IBMA 1NCRB 2ZGTA 5BNPC 3MGUA 5IK5A 4P9XA 1OOPB 4HK9A 1BZWA 2NQYA 4YSFA 5A3MA 1SLBA 3DL3A 2BNOA 4N43C 5FLJA 1BYHA 2AH2A 4IV1B 3U07A 1ZRDA 1HRI3 1EYBA 1LEDA 4FPJA 2D3SA 2R6QA 2QNKA 1BXHA 5DUVA 5ABJC 3UL2A 4HT1T 2RS53 3IMNA 4PBOA 4Q4V2 4UW6A 3HD8B 1ULFA 1KS5A 2XWBB 5ACA2 1W6PA 4HSJA 1Q8OA 1QJY2 4CDUB 1KITA 3O0VA 4JTNA 1OA2A 1QH7A 5FQ0B 1XYNA 4JV4A 2ZPXA 1VBA1 4N7IA 5K0UC 4BE3A 4A3XA 1SACA 2RS12 4K40A 3VGIA 3V64A 3JD72 4GWMA 2B8MA 1BK1A 4YW3A 1XNKA 3ZX7A 4EN9B 2UURA 4JRAA 3RWNA 1AR83 1GNZA 3N7LA 4YARA 2D3RA 3K48A 1CAUB 2ZGQA 2X5IA 2R043 3USUA 3M70A 5FPXA 3OBTA 1A3KA 1RJ8A 3ZIXA 3ENRA 2WC2A 4DRVA 4CEYA 3MLJA 1LKNA 3WR0A 3BOWA 3J8F3 4KL1A 1JTZX 1MS1A 1YCIA 5KXDA 3ES1A 4D7YA 4CP2A 3BALA 2IZWA 2XBO3 3T1LA 3WDWA 3GZUC 1PVC2 4OI2A 2D43A 3RMXA 4OI0A 1FV2A 1SLIA 4IEOA 1NXMA 3TNPB 2BVBA 1J3QA 3VUOA 3AXEA 2JG9B 2XJPA 5KHGA 4FOVA 5HCBA 4IEQA 4YVWA 2QKDA 1ND3B 4FPFA 4QX5A 3RMYA 5FO8B 3KM5