2DUQA

Crystal structure of vip36 exoplasmic/lumenal domain, ca2+/man-bound form
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
249
structure length
244
Chain Sequence
HLKREHSLIKPYQGVGSSSMPLWDFQGSTILTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTIDWTKIEPSVNFLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vesicular integral-membrane protein VIP36
publication title Structural basis for recognition of high mannose type glycoproteins by mammalian transport lectin VIP36
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Protein transport
total genus 58
structure length 244
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2duqA01
1UMZA 2WT0A 4XMIA 2SLIA 3ASIA 3IPVA 1LODA 3ZXEA 1YI7A 1GNHA 3POYA 4BMBA 4FPHA 4U36A 4Q8KA 2VY0A 2JECA 1VLNA 4L8QA 5JOYA 4ASMB 1LOAA 1BYHA 3VKFC 1KDKA 2ZHLA 4XMAA 4Y22B 2YMZA 4RA0A 2VU9A 3AXEA 3WCRA 4BLJA 2A6ZA 4WVWA 5T55A 3UJOA 1WCSA 5HCAA 2PHFA 4C1XA 2GALA 1LESA 3O0VA 1WLWA 2AGSA 2AUYA 1GV9A 3WNXA 3LSEA 5E8AA 2A3XA 4YGBA 4HANA 1BKZA 3V0AB 1JYIA 1SBDA 1FX5A 3UK9A 1OFSA 4TZDA 3ZPYA 3D4KA 4XJAA 4M3CF 1LU1A 2GNMA 1IS5A 4P9WA 3UL2A 2A3WA 5JOWA 1AXZA 4LBJA 4XOGA 5GZDA 1WW4A 4XJZA 1UZYA 1DQ1A 4PBPA 1JXNA 3FLRA 3FFZA 1N1VA 1CJPA 5GZGA 4Y1UA 5DZFA 1CPMA 2EF6A 2DURA 1SCRA 2R1BA 2EAKA 2GN3A 3B00A 3M1HA 2DUOA 4R9AA 4YFWA 4Z8BA 1GYKA 2I2SA 5DG2A 4K20A 2ZGOA 3DGTA 4ATEA 1QDCA 3HN1A 5IT6A 1J1TA 1A8DA 4UW3A 2DVDA 3R4UA 4BM8A 2NYYA 2C5DA 2D3PA 1SLLA 2YZ4A 4FPYA 5JMCA 1S0JA 4XIOA 1MS5A 2ZA9A 5KXBA 3VKNA 4DRRA 1W6QB 5DG1A 1DZQA 4XXPA 4Y1XA 5IK4A 2P2KA 5AVAA 4YG0A 1ENQA 5FREA 4WZFA 1KRIA 2A3YA 2UU8A 1CVNA 1W6NA 2WJSA 1W6OB 2ZGSA 4Y20A 2CWMA 3BODA 4FPGA 5GZCA 1FNZA 5E88A 2NMNA 1S0IA 1IOAA 3WZ1A 5T52A 1W6MB 1URXA 2NMOA 1RITA 3OY8A 5GLVA 2VW2A 2A71A 3MW2A 1OQ1A 4GA9A 3SH5A 5HCBA 1DQ4A 1AXYA 1LTEA 1JN2P 2DVGA 3ZSLA 4FOWA 2R1DA 5GJ6A 4YZ2A 1DQ2A 3V0BA 4Y1ZA 2A6WA 2DU0A 5IK7A 1N3PA 2VUAA 4YZ1A 3SLIA 4YG3A 2ZGKA 3NV4A 4Q2FA 4FVVA 2GDFA 4KBBA 1N47A 4LBQA 3T1MA 1FV3A 4ISQA 5KXCA 1DGLA 1G9DA 1ULFA 1G86A 1JYCA 3WG1A 2P3IA 4XZPA 3MW3A 2A75A 2W39A 1MS9A 4XXAA 5T5OA 3I4IA 3AJZA 4Q8LA 2UWAA 2W08A 1Q8QA 2YROA 4AVVA 2ARXA 4ZXKA 1YXWA 1FATA 4DS0A 4ATFA 2GMMA 3MEPA 3WOGA 1QOSA 1HDKA 4BPZA 5BYNA 3WCSA 1GZWB 1ULGA 3N7JA 1LENA 3NWKA 1WLCA 3ENRA 2A7AA 4YLZA 1UX6A 1AX2A 1V6NA 1YO8A 1LHNA 3POWA 4YG6A 4R9BA 4FP3A 3IN9A 1MS3A 4FPKA 1W6PA 3ZSKA 4YGCA 1SCSA 4XJ9A 1A3KA 1CR7A 1ULCA 4PBOA 4YZ4A 1V6IA 5FRAA 3RRDA 1DQ6A 4XHBA 5GLWA 4MYEA 1ENRA 1WW5A 1LECA 1S0EA 3KM5A 3SNMA 5JDBA 4GWMA 3GALA 4WV8A 4Y1VA 5DZEA 1WD3A 1AXKA 4AVTA 2A6YA 3RS6A 5GLZA 2DTWA 1VALA 3DUIA 1S0CA 3LCPA 2FMDA 3AYAA 1JHNA 5DUWA 2DVAA 5GZFA 3QCWA 4FOVA 4YGEA 3AP4A 4ISRA 2D44A 1WW6A 2ZKNA 2CWSA 2ZMNA 5CAZA 3AFKA 4M3CB 1GBGA 4Q27A 4XJUA 1C1LA 2C9AA 2D6MA 1ZM1A 2GNBA 3AX4A 2DVFA 4Y26A 1CESA 1LOCA 1V6KA 1HKDA 1SLBA 1SBFA 2ZGRA 1Q56A 3VKOA 4Y22A 5GLUA 2WSUA 4Q1PA 2GNTA 1N1SA 2PHWA 2ZACA 4CZSA 3WLUA 3AZYA 3AZXA 3WUDA 3L2YA 3V0AA 4C1WA 1LJ7A 2EALA 3JU9A 4LBMA 1S0DA 4AGVA 2JKBA 4FOYA 3M3EA 1GICA 3A0KA 5IK5A 1DQ0A 4FPLA 1GLHA 4BMEA 2ZZJA 4U2AA 1QDOA 1EPWA 2NM1A 2CTVA 2ZHMA 3N7KA 4M00A 5DUUA 5T54A 3RMXA 3AP5A 3TAYA 5IK8A 3ZXJA 2OW4A 1BZWA 1PZ7A 4TYSA 2ZHKA 1CPNA 1BQPA 1LOGA 1IS4A 1QF3A 1SLAA 2E7QA 2VXRA 3GNEA 4CRQA 1G8WA 3T2TA 1KQRA 1Q8OA 2DWRA 3NV3A 4LBNA 4Q26A 3USUA 3AZWA 1C4RA 1LGNA 1LHUA 1G9BA 2E6VA 1NXD1 2FHRA 3ILRA 1APNA 1LGBA 2ZGLA 5T5JA 2R0FA 2P3KA 4XBNA 1H9WA 2WSVA 1DLLA 3FLTA 2PHUA 3AZZA 3PMEA 1KJRA 1YRZA 4F83A 1CN1A 3M3OA 4JCKA 2NZ9A 1Z78A 3ZSMA 2PELA 1RIRA 3FLPA 1B09A 1MZ6A 3FBYA 3WDUA 4NOTA 5HCFA 1LU2A 3ZVXA 4UW6A 5JLVA 3O5SA 1LHWA 1SBEA 2A6VA 4Y20B 4IQPA 2GNDA 4NO4A 4I30A 4YZ5A 3JUUA 4FQ4A 4D69A 2P37A 2OUHA 1DYPA 1AVBA 4XE9A 4FP2A 3OY8B 2AR6A 3N7MA 2PHRA 2DYCA 1I3HA 2VW0A 2CL2A 3N35A 2JE9A 2RHPA 4YW2A 5CA6A 3M2MA 1F31A 4H55A 2DUPA 1G9FA 1W0OA 2R16A 4AVSA 1R1ZA 1LEMA 5SV8A 2DV9A 1D2SA 1N3OA 5GLTA 1Q8VA 3WG2A 1AF9A 1OKQA 2WT2A 1UL9A 1MVQA 4YM2A 5L73A 2NN8A 1Q8SA 4DFSA 1S0GA 2D43A 2A6XA 2WKKA 1UKGA 4XJ8A 3SH4A 3IM0A 3OYWA 3WUCA 4Y1YA 3D6EA 1LGCA 3ZYRA 2JJ6A 1NLSA 3H0OA 5JVVA 1QOOA 3T1LA 1AX1A 2G4IA 2V5YA 3B3QE 1MZ5A 4GKXA 3WDTA 1V6MA 2ZHNA 2D7FA 2DU1A 4M3CE 3ILFA 4PCRA 3D5OA 5T50A 4W65A 5GZEA 2P3JA 4AGGA 1JBCA 1UN1A 3AP7A 4R9CA 1DBNA 3Q9OA 5T5LA 1DQ5A 1MS0A 2PHTA 4UW5A 3W59A 1H30A 2UWBA 3C2UA 3IMNA 1CONA 1MS8A 2OVUA 1GZWA 1QNYA 2R0HA 3O0XA 3SITA 4RL7A 4ZKTB 2H0BA 1BJQA 4FPJA 4PF5A 1W6PB 3WG4A 3ZSJA 2EXKA 1V6LA 4GWNA 2JE7A 4PQ9A 1G9AA 1DFQA 5EYYA 3RG0A 3W58A 5H9PA 1SLCA 2BQPA 1ULEA 1CIWA 1F9KA 1ZA4A 2D6KA 2HYKA 3N36A 4Y24A 3RSJA 1LOFC 1I1EA 2ES3A 3ZXLA 1FNYA 3VV1A 1QKQA 3NV1A 2JDZA 3APBA 4K1YA 1VIWB 4JC1A 2DUQA 4XTPA 1YIFA 3IPVB 3OBTA 5JOZA 1H9PA 2ZGTA 4YW3A 3HR9A 3N3HA 3SISA 3O12A 1UAIA 3OGGA 2D3SA 3OJBA 3PVNA 1KDMA 2UURA 4FPOB 2CY6A 1C57A 3INAA 1LEDA 1VAVA 3AYEA 2E53A 1AJKA 3AP6A 2E51A 1QGLA 3POSA 3QLQA 3SH3A 1D0HA 4YM1A 1IS6A 4M3CA 1FAYA 3PJQA 2ZMLA 1GNZA 1V00A 3AJYA 3AYCA 3WG3A 2CNAA 1TEIA 3FUOA 4YW4A 3M3CA 1N1TA 4XBQA 3TB0A 1V6OA 5H9QA 2ZABA 4YGDA 5EXOA 5CNAA 4K1ZA 1RINA 2VH9A 2SBAA 3ATGA 2GMPA 1AJOA 2WNEA 3B69A 4DQAA 1IS3A 2ZGNA 4DRVA 1Y7BA 4LBOA 3BIWE 4YM3A 4XJWA 4BQ1A 4YW1A 4BOWA 3B01A 5E89A 3WDYA 4FQZA 5DZGA 3AP9A 3MW4A 1PZ8A 3PVEA 4AGRA 2YV8A 4LBQD 1LCLA 1QU0A 3OBRA 2TEPA 4CTEA 1JW6A 5LK5A 2EXJA 1UPSA 4XHXA 4P14A 3WHTA 2D6NA 5IUQA 1WW7A 4K21A 2D3RA 2Z42A 2R49A 3R4SA 3RQ0A 2ZGUA 3AZVA 3RMYA 1MVEA 3VKMA 1LOBA 3N7LA 4GXLA 4UW4A 1JOJA 2P34A 1HLCA 2EXHA 5DUVA 3USUB 1C1FA 2D6OX 5H9SA 2ZGMA 5JOXA 1N3QA 1CQ9A 1QOTA 4XBLA 1FYUA 3I8TA 2AENA 5F9TA 1W6QA 1GSLA 3WDXA 1MS4A 2UWCA 5KXEA 3HMYA 4YFZA 1AZDA 1GANA 1W6NB 4YW5A 1G9CA 2WT1A 1Q8PA 2W52A 3PVOA 1O4YA 4FPFA 4LBLA 2ZGQA 1W6OA 2YY1A 4OZXA 3U4XA 1WUVA 1LHVA 2V73A 1HQLA 1PZ9A 3VKLA 1F5FA 5GALA 1S1AA 1W6MA 4FOQA 2EIGA 2ENRA 2JD4A 1YYNA 3A0NA 3ZXKA 2ZBJA 5CBLA 2NP0A 1SFYA 3CNAA 3NV2A 1LULA 2AH2A 4XTMA 3AK0A 3V0BB 1S0FA 5T5PA 3BTAA 2A70A 1FV2A 1SLIA 2GN7A 2A5ZA 1S0BA 4JRAA 1G7YA 2ZAAA 4LBQB 1UZZA 5KXDA 1U0AA 3WHUA 4WVVA 4YZ3A 2XG3A 3O0WA 2D6LX 3UJQA 3OPZA 4M01A 1QMJA 1HQWA 2CYFA 1WD4A 1WBFA 3M3QA 2KM2A 3AXDA 1MR5A 4BLIA 1LHOA 1LOEA 3WV6A 1SLTA 4P9YA 3ZYPA 4FPEA 2XB6C 3A4UA 3ZXFA 3BOPA 2LALA 2W68A 1VAMA 1AX0A 3ILNA 4SLIA 4YM0A 3V65A 1W0PA 2ARBA 3OYWB 4LBKA 5EYXA 1SACA 1QNWA 2WLQA 5F5QA 1N1YA 1DYKA 1BXHA 1A78A 3B9CA 4HL0A 1KJLA 4AWDA 5DUXA 2Q5TA 3FUQA 2GMEA 1KITA 4Q1RA 2ZGPA 3KQRA 5CB7A 1DIWA 2B7YA 4ITCA 1Z0HA 2AYHA 4XIKA 2YXSA 1IKPA 1ULDA 3WVJA 4GALA 2E7TA 1MS1A 1IKQA 4GKYA 1JUIA 3MPPG 3V64A 3LSDA 1XQNA 5EWSA 3WDWA 1WLDA 2LTNA 1WBLA 1LOFA 2PHXA 2ERFA 4XILA 4FPCA 1O4ZA 3AYDA 2ZMKA 2EXIA 2VW1A 1DHKB 3R05A 4R9DA 4DPNA 1X50A 1V6JA 5DXDA 1ONAA 4P9XA 4XDQA 5GM0A 3IKWA 1GZCA 3VUOA 3WDVA 2AREA 2WQZC 2OUJA 1GKBA 1ENSA 2DTYA 2DVBA 2D6PA 5H9RA 1GZ9A 4AYUA 1MACA 4XYXA
chains in the Genus database with same CATH superfamily
2J1RA 1UMZA 2JEMA 2WT0A 2SLIA 4W6YA 3IPVA 4XMIA 5ACA2 1DYOA 1E5IA 3BKZA 2HYXA 4CEYA 2VMHA 4A2UA 1GNHA 3POYA 4QX2A 3CJIA 1CZSA 3VBOB 2WAAA 4FPHA 4NRPA 2Z5WA 2W95A 4XVHA 2ZAHA 2WFPA 4L0PA 3O1RA 4YNIA 1KDKA 1W8OA 3OSDA 4Y22B 2JWPA 5FJHA 4KWKA 1PGW2 1ALYA 1BK0A 3GDBA 3WCRA 1RUC3 1WCSA 3WNLA 2D5FA 1DGWA 1OA4A 2LW8A 3U10A 4C1XA 1GV9A 1OD3A 3LSEA 3OBZA 5A7OA 2RR13 4HANA 2D98A 2JG9C 1OFSA 1HIXA 5T3NA 5KHGA 3K48A 2VOKA 5EP9A 2PQSA 4EN7B 4P9WA 5ISLA 4UWDA 3LF7A 4WM7B 2WFF3 1FOD1 5L9VA 2ATFA 3OPWA 3JBG3 1ZBE3 3SCGA 1JXNA 4QQPA 5FK7A 5J37A 4A45A 4A7ZA 4B7KA 3MLLA 3KCXA 2B5HA 2EF6A 1ZZCA 3B00A 4IV3C 2GN3A 2UYBA 1ASJ3 2DUOA 4Q4X3 4WZCA 4Y4YA 2I2SA 3FWEA 3GZUC 2WLPA 1ENXA 4AG4A 2ZGOA 4ATEA 4JDNA 1O5LA 1J1TA 1UU6A 1RUE2 4JGZB 4DZGA 2WZ8A 1H8TC 5EZWA 4GMP0 2QQIA 1SLLA 2YZ4A 3FHQA 1UY0A 2WA4A 4QX7A 5FMOS 1S0JA 5A7WB 5FYMA 1CAXB 4RHV1 3DYPA 1OF4A 3DV8A 3NNJA 4QB6A 2TNFA 5DG1A 1DZQA 1M4WA 3UKVA 5FREA 5FZ7A 2VG9A 3WQBA 3PJYA 1W06A 2WL1A 1W6NA 4IEZA 1W6OB 3LA3A 4OUEA 1H2MA 4CDWC 2CWMA 5GZCA 1GWKA 4K9SA 3QH7A 1W99A 1ZBA2 4RFRB 4QT6A 4PJYA 3RWKX 1QJEA 5CKMA 4Q4Y2 2NMOA 1FI2A 3T09A 3OY8A 1VBC3 2BRTA 3I7DA 3OGSA 1H6XA 1OQ1A 2AEZA 4CPBA 4Q4V2 1AXYA 1X9TA 2VJXA 2DVGA 1V9U2 3CJXA 3T0DA 1W3VA 3OEBA 1XBFA 4ZS2A 3ZSLA 1UKRA 1NKGA 4GMP1 3MIDA 4BXSV 1QJX2 4KU7A 3VUOA 5FZ0A 4Y1ZA 5IK7A 2VUAA 3HOBA 4HVOA 2ZGKA 2ZOEB 3EYPA 4COVA 3IZOA 4KBBA 4CXYA 5FYZA 3VDAA 1SG3A 5A6XA 3N9PA 1G9DA 2PXJA 3NKTA 4V2VA 1G86A 1R091 1UXXX 3RNSA 5ABJB 2B39A 2P3IA 4IEYA 2R061 4N53C 2VOXA 2VBPA 2ET1A 2X29A 3I4IA 3AJZA 2WQ4A 2UWAA 2J7MA 2IUWA 3ZMOA 2YROA 1D4M2 3BOWA 3ZXDA 1FATA 3BTZA 5F6KA 1VMHA 4AOCA 5JXHA 3MEPA 5FAXA 2ORXA 5LASA 3VDDC 5IVVA 4EWEA 1SHWB 1HDKA 4YVWB 4AI1A 2Y0OA 1I6XA 4BK4A 1QHDA 2HJIA 1GZWB 1ULGA 5FYTA 2G9FA 3NWKA 1XSRA 2VVEA 4XW3A 1JZ6A 3Q8AA 3GGLA 3MGUA 4YG6A 1V6NA 1YO8A 3POWA 4OLLA 2IXIA 3ZSKA 1MQTA 3RYKA 3OPTA 3C7FA 4KG8A 2OZJA 4TWTA 4XJ9A 5FRAA 4YZ4A 1PIV1 4MYEA 1WW5A 3TWIA 1Y9MA 4EZHA 4AEDB 3T4HB 1R64A 5D8AB 4HKLA 3GALA 1BBT3 2LS6A 5FXVA 4DB5A 1YJKA 2AZ5A 1AXKA 2A6YA 4CP9B 5GLZA 3DXUA 4ZPIA 4D0QA 2XVLA 4QGMA 2VMGA 2FMDA 1JHNA 3NQHA 3RZZA 4CCLA 1AR93 4FOVA 1HV1A 4ISRA 2ZKNA 4E4DX 4MOAA 1RTVA 5BNPA 4CEYB 3AFKA 4M3CB 1GBGA 1RUD1 1C1LA 4WBBA 2D6MA 3T3YA 1AL22 2VNGA 3V56A 3VDCA 1O3RA 4GB32 2GNBA 3OGJA 1LOCA 1QY4A 4XFBA 3KV6A 1EV12 3MDPA 1XE8A 1NCRA 1HN0A 2WSUA 1PO21 4Q1PA 2WS91 1XNBA 5IHRA 4JV4A 4CU7A 2BVVA 4Y3OA 3AZYA 4LEJA 5C8WA 1VRBA 3AZXA 3V0AA 4C1WA 4IGOA 3B7MA 1OKOA 1IG0A 3ON7A 3U11A 5A6QA 2Q1ZB 5JI7A 4HK8A 1DQ0A 4BMEA 2ZZJA 2WO1A 4U2AA 1QDOA 1H8VA 4BB3A 3VDBA 2NM1A 2VVDA 3N7KA 5DUUA 3RMXA 4AEKA 2OT7A 2E32A 4BQ5A 5JR7B 3C7OA 3J8F1 1XB9A 3R6SA 2BYVE 1ND3C 2OW4A 2VOTA 1JTZX 4TYSA 4BYYA 2ZHKA 2WN2A 2JDAA 3ALQA 5JSOA 5K8SA 1OSGA 1JU4A 1QF3A 2VE1A 4QQLA 1TME1 3M70A 2FCUA 4HXCA 4I3PA 4Q26A 4LK6A 2W46A 3MBWA 4LBNA 4WM8C 1EYBA 1DGRN 1PM4A 4XFGA 4CDXA 1LGNA 1O8PA 2V09A 4V1PA 1APNA 1LGBA 2RMU2 2ZGLA 1HRI2 3KV9A 2WZR1 3R0RA 4QMAA 5F39A 4XBNA 5A32B 4B7EA 1H9WA 5C6CA 2PHLA 2BPA2 4EROA 2PHUA 3PMEA 3HT1A 1KJRA 5A33A 1C28A 4DXSA 5I0TA 5EIYB 3CZUA 4JCKA 2CDOA 1RIRA 5HCAA 1MZ6A 2OKXA 2VTFA 1J3QA 2VQ0A 3K51A 4NHLA 4UW6A 1GOFA 1UW8A 4MO3M 2QZ2A 1SBEA 3FBMA 2A6VA 1J84A 1EAH2 3O5SA 4GAZA 3THTA 1NX9A 4I30A 3JUUA 4FQ4A 4SBVA 4KBZA 4D69A 3E6DA 1NG0A 1ZRCA 3GCWA 5DDJ3 2QQWA 4XE9A 2ZJCA 1H2KA 3OY8B 4CCNA 2WNUA 2R073 2XWJB 3MYXA 4YW2A 5KR7A 2JE9A 3M2MA 1F31A 4XZUG 1QQP2 3POGA 4LIVA 3QD6A 4RGKA 1RGSA 2R16A 3ZFFC 4C8DA 5J48A 2DV9A 4P5YA 1Q8VA 2VAUA 4RQPC 2RS33 2WUHA 4AHWA 2WT2A 4D6QA 5F1RA 3KVBA 3GBGA 3G6JB 4FXGB 5FY1A 5J3UA 2QQPA 4YM2A 4YYOA 5JSRA 4IV1A 3SEPA 2YFZA 4DFSA 4IEPA 1HW5A 2VO5A 2A6XA 2WKKA 5GZGA 3SH4A 3MIFA 4LUMA 1QJY1 1UOGA 1LKNA 1WKYA 4LA3A 1ACCA 1QOOA 2FDJA 1BLZA 2HWB2 4GKXA 1V6MA 3KT7A 5FO7B 2DU1A 2W1QA 3Q8EA 4GMP3 5J09A 3D5OA 1AHSA 2BEOA 1T2XA 2W5FA 3KCYA 1OPMA 2P3JA 1POQA 4W50A 1UN1A 1YWKA 1UU5A 3MV11 4QXHA 4UW5A 4R4ZA 4A7YA 4QQHA 1S2BA 4FXKB 1K5MA 2VXJA 4XFCA 4COUA 5D2AA 4RL7A 4JDMA 2H0BA 4Q0PA 1VRH2 4FPJA 5JMOA 3NL1A 3WG4A 1FMD3 2YDEA 1OA3A 3MIEA 4GWNA 4AI2A 5F37A 1QJZA 3X29B 2IXHA 1SLCA 1ULEA 1COV1 1X33A 2D6KA 4Y24A 4BQWA 3I2FA 1VPHA 4LO4B 3WX5A 3DPRC 4HLTA 1HQNA 3APBA 4S2DA 2O1QA 5AVPA 1SDDB 2I07B 1ZRDA 5FQ0B 5ERLA 3OUJA 4MV2A 3RDIA 3UYJA 5A70A 3OBTA 4UFHA 2ZGTA 4NJ4A 3N3HA 3SISA 2YBSA 3O12A 5C3PA 3ACIA 5EFUA 3SQOA 2UURA 4FPOB 1PX3A 2CY6A 3MI8A 1C57A 1PIV3 1VAVA 5KHKA 1RMU1 3AYEA 1V70A 2E53A 3AP6A 1VR3A 3K77A 1HB1A 3POSA 3SH3A 4CCOA 4BA6A 4AI9A 5JZGC 2ZZQA 1RJ7A 2WNVA 4J1XA 1LB2A 2CV6A 2FZ1A 1GNZA 2WNOA 1XRUA 1R1A2 4BISA 3FUOA 4YW4A 5LBBA 4COYA 2OS2A 2MEV3 3M3CA 2YBPA 1V6OA 2ZABA 1TNFA 1GOGA 2VH9A 3VBUB 2GH2A 4CPBD 3ATGA 4CSWA 2J1TA 3VBFC 2WNEA 3B69A 4HFSA 4C0BA 2ZGNA 4DRVA 5HV4A 1C8M3 2Y0IA 4DXZA 5DMYA 1AR63 4XJWA 2W94A 3ZFEA 4I09A 2CHHA 1UF2C 1W2OA 3WDYA 4BOWA 4FQZA 3J7MA 5FYVA 2HWF3 3C7GA 5F3GA 2TEPA 1RJ8A 5EJ1B 5FYCA 3IAPA 1CAUA 1UPSA 1XXNA 4XHXA 4P14A 1ZA7A 3RJRA 3THPA 2R49A 5IVBA 5CYYA 3B93A 2WS93 3VKMA 2EIDA 5FOJB 3RYRA 1LOBA 3N7LA 4GXLA 5E8AA 4UW4A 3LZZA 2EXHA 2BW8A 2HWC3 4JGYA 1AYN1 1DLCA 3O7OA 5FY5A 4Q4W1 2D6OX 4QHOA 3ZIWA 4AFCA 1N3QA 1CQ9A 5APAA 4IERA 4CDXB 1HXS1 3I8TA 4EQVA 5EHDA 2LUWA 5F9TA 1O3TA 5L9BA 4IEUA 2R6QA 4QPGA 1ZREA 3GZAA 2W2IA 3EJKA 5FUIA 1GANA 3FN9A 5J98B 3W5NA 2WT1A 4FPFA 3RZMA 5A33B 2ZGQA 1RUJ2 2JIJA 2YY1A 4CP0A 2HH9A 2J1SA 3EXUA 4B29A 1LHVA 2RDNA 4FO9A 3FHAA 2V73A 3SEEA 4N9HA 3S5AA 2BV4A 5GALA 3F2ZA 1W6MA 4AW7A 2RS52 2VZ1A 1AL0G 2BZDA 1E5RA 3RFRA 5K7PA 3A0NA 2WZR3 2VUJA 1YIPA 1ND2A 5CBLA 1YFXA 3NV2A 4HT1T 5EJ3A 3JB8A 2WNUB 2A70A 5FZBA 5LRRA 2FQPA 4PLOA 5DAPA 1OH4A 2BVBA 3CDZB 2YU1A 4Q4V3 4LBQB 4LJHA 5KXDA 4YZ3A 3O0WA 1W2TA 5I0SA 3UJQA 1WD4A 2XGXA 5FKBA 3GF6A 4RFT0 3WV6A 3EO6A 3ZKUA 1ZRRA 3RZKA 2FDKA 2BBVA 4IV1B 5FMCA 2VECA 4Q0VA 1AX0A 2ARBA 3ZDVA 1R081 3CKHA 5EYXA 3VB9A 1SACA 1QNWA 5FKCA 5JUVA 2WLQA 5F5QA 1DYKA 1A78A 3B9CA 5LW9A 5DUXA 4HBNA 4Q0QA 3UGHA 2RM21 1HB4A 2ZGPA 2B7YA 5A3TA 1EPZA 1Z0HA 2VZ3A 4ITCA 2AYHA 3WW3A 1NA1C 4BCUA 4YW6A 3WVJA 1RUOA 1XYPA 1NYWA 3AVSA 1MS1A 3ACLA 2UY9A 4EN8B 3O1SA 2ZEXA 3WDWA 3KF3A 1K5MB 3LAGA 4A7KA 1WLDA 1XNAA 2LTNA 2YC0A 3HD8B 3P1IA 4COWA 3FMGA 2JKXA 2UY8A 2WQ8A 3DYOA 2Y6LA 4R8HA 2JD9A 4XACA 5L9RA 1X8MA 4BZ4A 5CEHA 3TEZA 3I3BA 3R05A 1RUC1 2C26A 3H1YA 2W9XA 1US2A 2RR11 3VD7A 4OHWA 3WDVA 4CXWA 1GFF2 1QJU3 4EWDA 5L7OC 4ZU7A 3BPSA 1GKBA 5IWFA 3OG2A 4EN0A 4ZHNA 1YQCA 3VBHC 2D6PA 4N43C 5H9RA 1X8EA 4O7XA 4FAGA 2FDFA 1REFA 5F3EA 5BNNC 4FFIA 5LA9A 2JIGA 2WFF1 3U14A 3FFQA 3JBG1 1ZBE1 3VBSC 3KGZA 4BMBA 4L8QA 4C90A 5JOYA 4ASMB 4KNCA 3I3EA 5FP3A 1ASJ1 1BYHA 2G1MA 4Q4X1 2ZHLA 2WNVB 4QDRA 3ZOIA 1T6BX 2JG8A 2WYFA 1AL23 4NROA 2QZ3A 3AXEA 1YNAA 1U5XA 4BLJA 5FJKA 3P3NA 3EBRA 4GB33 1DZRA 1XJAA 3OF1A 4UYBA 4HN0A 2GALA 3MLKA 1WLWA 2W3JA 3CF6E 2A3XA 1RXFA 1GZTA 2JG9A 1BKZA 1X9PA 1RVF2 4YGBA 3K4DA 1JYIA 1PGSA 1SBDA 4TZDA 3SC7X 5LK7B 4LO8A 2XONA 1JZ2A 4UFJA 3VD4A 4M3CF 3TN92 1LU1A 4XEZA 2XUMA 1IS5A 3UL2A 2A3WA 1AXZA 3H1WA 2Q8CA 1F8VA 4QPIC 1UZYA 1DQ1A 4PBPA 2HWD2 1TMF3 1VMFA 2XR4A 3NNMA 4H14A 3SMHA 5DZFA 2F17A 1CPMA 2GP3A 4IV3A 1IPJA 1CAUB 4QXBA 1A34A 1XYOA 1SCRA 2R1BA 2EAKA 3LFMA 3HQXA 4R9AA 4YFWA 5IJRA 4I0AA 3RGBA 3WF0A 5DG2A 4XAAA 4CDQB 2RE9A 4DIQA 3OUIA 3JQXA 3H8RA 2QDNA 1H8TA 4A42A 3BUCA 4JGYB 3E97A 5F32A 4CYDA 1U5IA 4BM8A 4E4HA 1B35C 5JMCA 1WCKA 3CMGA 2XWBB 3EQEA 3I2KA 4JAAA 1DZTA 1MS5A 4M4PA 3VKNA 4DRRA 5FZIA 1CWPA 4XXPA 4Z82A 2P2KA 2PLV3 3PUHA 4QPGB 2HEWF 4AEJA 4NIGA 4AAPA 2UU8A 4MGTA 3ELNA 3LDRA 3NVCA 2VULA 1VMJA 2WJSA 4RD7A 5FZ1A 1UQXA 2DFCA 4RR3C 2RDSA 5LZ6A 3BODA 4MX3A 3S7IA 2ZPXA 2P3YA 4RS5C 1AYN3 3H1MA 2YC4A 5T52A 4QPWA 1W6MB 4MLOA 4Q4W3 3RZLA 5EV7A 1MEC2 1XE0A 1XOYA 1GQGA 4RN5A 4B3NA 3POBA 2CGOA 2VQAA 1CAVB 1DQ4A 5F2SA 1O8SA 1ND2B 5FY4A 5FY9A 5FZMA 3WW4A 5LATA 2R1DA 3IMMA 5M0TA 3V0BA 1WGPA 2A6WA 2DU0A 2GP5A 3A7QA 4RHV2 4X6RB 4ZY9A 3ITQA 1W9SA 3OD0A 4RSUA 3NV4A 3PTRB 4FVVA 2Q8DA 1JUHA 3T1MA 3ZN6A 1FV3A 2B9VA 1DGLA 4CU8A 1YI9A 5FPUA 1XNDA 4N53A 2ZEZA 4MGYE 4XZPA 3MW3A 1RB8G 1BBT1 2W39A 4G4FA 1O3SA 2P1BA 4XXAA 2D93A 1NY71 1V0AA 3HBZA 4Q8LA 4PLMA 4P9LA 1YXWA 2WO3A 3KCCA 5B4XA 4XF1A 3RYPA 2GMMA 1YLLA 2P6HA 2JE8A 4BPZA 3K3OA 1AR91 4KWLA 3T2QA 3WCSA 4AHYA 4CVUA 5A3MA 4CU6A 5C9AC 2Q30A 4IW3A 3WW2A 4XCAA 1FPN1 1UX6A 5A6YA 2K9ZA 1MS3A 1W8FA 4YGCA 3BN6A 2YPJA 4PLNA 5FBJA 3K3NA 3RRDA 1OC1A 1OI6A 1DQ6A 3NNGA 3ZFGA 3J7NA 1PO13 1ENRA 3HN3A 1S0EA 5FPXA 1R092 1FXZA 1CIYA 3U07A 2OZ6A 4WV8A 2IVIB 2R062 3RJ2X 3DKWA 1JOPA 1ZZ8A 5BNPB 2YHJA 4HMZA 1XU2A 1OLME 2DVAA 3KS7A 1RHI2 3QCWA 3NAPA 2VQUA 5SV5A 1TNRA 3AMHA 2JDUA 2CWSA 3VN4A 3NKGA 2DBNA 5K0UA 5LY2A 4P9JA 4YVSB 1XU1A 3ES1A 2XVKA 4P00B 4FFGA 2HEVF 1W9YA 5FWJA 1EUTA 2JB4A 4K8RB 3VBOC 1SBFA 2ZGRA 1Q5OA 2JG8B 1AR73 1UD1A 5A7NA 1HRV3 2P5BA 3KZ4C 4PIZA 5EQUA 5F5AA 2JG9B 4CZSA 3WLUA 2ID4A 5FYBA 2YBKA 3RZHA 3WUDA 3L2YA 1VBA1 4X8PA 4XUOA 4CEWA 3KT4A 2EALA 2IFRA 3H7JA 3HT2A 4LBMA 5FMBA 4FOYA 3M3EA 3M4FA 3MF6A 3WF4A 2ADEA 4OUSA 2QBXA 2TBVA 3I49A 2CTVA 5LA2A 4M00A 4PDWA 3MHZA 2K0GA 3HQUA 5JWPA 1RUD2 1LR5A 1ZVFA 1W28A 3AP5A 3TAYA 3H50A 4WM7C 2QQKA 3ZXJA 1PZ7A 1CPNA 4IV3B 1IPKA 3FHIB 4LOTA 2Z69A 4GWIA 3ZPOA 3PL0A 4JVAA 4Z92B 5C8CB 1SFPA 3DECA 3GNEA 3AC0A 2VXRA 5DDJ1 4CRQA 1GQHA 5FZDA 3I54A 4KGGA 1PVC3 1Q8OA 2DWRA 3NV3A 4LKEA 4AI8A 1CZVA 4CUBA 2R071 4ET7A 3HPNA 1H4GA 1PO22 1NXD1 5T5JA 3LFIA 2AC1A 1IPSA 5FK8A 3JXSA 1NZIA 3O14A 3RVHA 4AE2A 4JGZC 3AZZA 4ES9A 3OGVA 1BHGA 1NOVA 1Y43B 2RS31 4AI3A 4F83A 3M3OA 1OD5A 5FYUA 3EMRA 2WDBA 4NOTA 1LU2A 3GHNA 4NR1A 1QXPA 1VJ2A 3PVBB 5FYSA 3J8F2 3BVCA 2GNDA 3LKJA 4Z2WA 1XNCA 2OUHA 4GH4A 2XOMA 3PHMA 2IWGB 1AVBA 4MHUA 3D3AA 2E9QA 2RS53 2XQXA 1NQDA 4L99A 2AR6A 2HBTA 2DYCA 2VW0A 2XJTA 4H55A 1QXRA 2DUPA 1OBNA 3ZFFA 2H0VA 4B4PA 3THCA 1W0OA 1OFNA 5LRSA 4OHYA 1W2AX 4O9GA 5AC92 2XHNA 5BUVA 4RQPA 2VBDA 1N3OA 3VGIA 2O8QA 1OLQA 5JXIA 2GSYA 4AF9A 4D8MA 1EY2A 1FMD1 1UX7A 2Q0AA 3ZN6B 1ZYBA 2Q4SA 4LUKA 2NN8A 4AXOA 3AMMA 4DEVA 4N7UA 1EP0A 2VUCA 3WUCA 3D6EA 1LGCA 2Y6KA 1IQAA 3ZYRA 3ZSEA 1S2KA 3H0OA 5F7UA 5JVVA 5JXJA 1JYWA 2DCZA 3B3QE 5CU1A 5ABJC 2F6BA 2D7FA 4FFFA 4M3CE 2XJVA 3PUAA 5A80A 4W8JA 2ZX2A 4CCMA 1UIKA 1ULPA 3MIBA 3E5XA 2JENA 4I3GA 5CKQA 3Q9OA 1DQ5A 4NHXA 5F5IA 3UT0A 1A8MA 1YFWA 2MHFA 2YG0A 2ZTNA 3W59A 4XPVA 3IMNA 4DXTA 2OVUA 1MS8A 3VZMA 4YVWC 5C71A 1QNYA 2BFUL 2R0HA 5LBEA 4OI1A 4ZKTB 4DMIA 1W2UA 4DEQA 1DDLA 2Y38A 4PQ9A 2J42A 3HAGA 3RG0A 1QJFA 1CJDA 3M3IA 3ZFGB 4KGQA 2BQPA 2MEV1 3UKNA 5CIRA 5D21A 3N36A 1ZZ6A 2HYKA 4BQXA 1I1EA 3DPRA 5KHIA 1QJY2 2E33A 2ES3A 2IXCA 3VV1A 1CGPA 2BWCA 4AEDC 2J1AA 4ORFA 1ZRIA 1VIWB 4JC1A 3BB6A 3ZR5A 2XKOA 4XTPA 1C8M1 3IPVB 5CISA 3PU8A 2VCAA 1AR61 1FPN3 2GH8A 2XBO2 3LEGA 5FPLA 1H9PA 3HR9A 2B46X 4OQ9A 3QBQA 4CUCA 3CJIB 2AEYA 4UFMA 2HWF1 3NAPB 1RXGA 3AL6A 3TEWA 1JYVA 3AMQA 4UFIA 3AB0A 4AVBA 5K0UB 2WINB 1AYM3 3H8XA 1IS6A 3AMPA 5FZ4A 3WP6A 4EN9B 3WF3A 1BEV3 4JHTA 4CEYC 1V00A 3AYCA 2CNAA 4KQ7A 5FPVA 1H2LA 2Y6GA 2HWC1 4E2QA 4Q5OA 5H9QA 4YGDA 2SBAA 3VBFA 2JB8A 4DQAA 3GJAA 4YM3A 3UV9A 1RVF3 2BTVC 3K2OA 3N9OA 5IAVA 3SXWA 1VAKA 1Z7S3 4UAPA 2VZQA 2WO7A 2RDQA 3E6BA 5E89A 4CEWB 5DAXA 2EIEA 4MSVA 4JKKA 4AGRA 2YV8A 3S5QA 4OMDA 4CTEA 5FZEA 5LA1A 5G05L 4PDWB 5BNOC 3WHTA 4IGPA 2FDGA 2RS12 2ZXQA 4K21A 3JQWA 3R4SA 4Y5SA 5FXWA 3WF2A 2BBAA 5B4NA 2HWD3 2ZGUA 3RMYA 1MVEA 2XJUA 4XETA 5C8CA 1X7NA 1K3IA 4KU8A 1H1MA 5G04L 1J1LA 3IT8A 1QH6A 1VBA3 3CL1A 2C0ZA 1VBD2 3ZYGA 2ZGMA 5JOXA 3J26N 1O4TA 2I74A 3D0JA 4IE5A 1UMIA 2VMFA 5FTTC 3VZKA 2AENA 1US3A 1GR3A 1W6QA 1XPWA 4Q4V1 5EJZB 2XMLA 2ETEA 5K4LA 2UWCA 4IL7A 2VQTA 4YFZA 1W6NB 4CP2A 1J58A 4LR4A 1Q8PA 2W52A 2WO2A 3I3MA 3KLSA 3DL3A 4LBLA 5C3QA 5FFOC 3JD73 3T2OA 4A6SA 1WUVA 4HSLA 2V4AA 3ACFA 3ZYJB 3VKLA 4OI4A 1F5FA 2GU9A 3POEA 4P08A 4LLOA 4FOQA 4QXKA 2EIGA 5D1IA 4M4RA 5I93A 5J36A 4GH4B 1U5YA 5LEKA 1HJFA 5AFEA 1SFYA 3GJBA 3NJYA 1MEC3 1S0FA 4QD2A 5T5PA 3VZJA 3BTAA 4ZXEA 4C0HA 3LGRA 1HXS2 4YWAA 3ZFFB 4FTEA 4JTOA 3IB3A 4NE9A 3DF0A 3B5LB 1UZZA 3SCHA 4RQPB 5GKAC 5DAVA 3O1PA 1KFXL 4M01A 5IATA 4EWAA 1HQWA 3T08A 1WBFA 3ZDSA 1LHOA 1LOEA 1WZXA 2YFUA 1PK6A 2XB6C 3A4UA 2LALA 3KV4A 3ILNA 4DXRA 3KHBA 1W0PA 4OMCA 2NPIA 4NHMA 2G19A 1RUH3 1AR82 1N1YA 1QJU1 1SZBA 2Y34A 4HETA 4HL0A 3DXTA 4QKFA 1YFYA 1RUF2 4WVMA 4NHYA 3FUQA 2JDYA 3O1TA 2XQRA 2ZEWA 3WP3A 1IKPA 3ACHA 2ADDA 4GALA 1MQTB 2O14A 4WVZA 4CXXA 2VMEA 1IKQA 4GKYA 4UBHA 4KWJA 1JUIA 3MPPG 5HBAA 5EWSA 3WW1A 3PNAA 4OYUA 1LOFA 1P8JA 3BYWA 3C7EA 1W9TA 2OYZA 2ERFA 2VNVA 4UFLA 2PAKA 2R043 2X05A 2KA3A 1F4HA 4HZFA 1O4ZA 2WRAA 3AYDA 4NIHA 2ZMKA 1AL21 3KWVA 2BUKA 2IVJA 1DHKB 2VW1A 3IDAA 3IAQA 3NNFA 1IHMA 5C7GA 2Y26A 4GB31 4OCTA 1DGRA 3VBRA 4P9XA 3AKRA 5GM0A 4AHXA 1GZCA 5L7OA 1UO9A 1R082 2Y33A 1CD3G 4IE7A 2AREA 5FUNA 5A32A 2OUJA 4UXAA 4MXVA 3VBHA 1VB2A 2DTYA 4HSJA 5C33A 1RUI2 2RM22 5IVYA 2WABA 3SCFA 4XYXA 3NSTA 4GD4A 5ACA3 3ASIA 1LODA 1RUG2 4L11A 3ZXEA 1YI7A 1RHI3 1TMF1 2E7AA 3WNKA 4U36A 1K5JA 1HB2A 1VLNA 2JECA 2QKDA 3AVRA 3ETPA 3UGFA 4BQ3A 3LB9A 1ZNPA 4R4XA 1NCRB 2WYSA 4XMAA 4Q0UA 2YMZA 5BNPC 4RA0A 4IE0A 4BIOA 5LCWL 2A6ZA 4E4SA 2PHFA 1RUC2 5FZGA 5DAWA 2AGSA 2HLEA 4XFAA 5C4WA 2KD7A 3WNXA 3WEZA 3AKSA 5IW0A 2RR12 3V0AB 3VBFB 1FX5A 1I9RA 3H7YA 3ZPYA 4F7ZA 5L36A 4MUVA 4XJAA 3AKTA 5FP4A 3VBUC 2PLV1 2ZX3A 5FUPA 3T30A 4COZA 2J1EA 4LBJA 4XOGA 5KHHA 5A1LA 1C8NA 5GZDA 1UY3A 2OA2A 3FLRA 1H6YA 1ZBE2 3FFZA 3JBG2 1N1VA 4N9IA 4RGAA 1CJPA 5FZCA 3ZO0B 1L7RA 1O3QA 5JPMB 3FE5A 1SPPA 4IXLA 1W2NA 3M1HA 2DCKA 1STMA 3MFCA 1ASJ2 3H8OA 4Q4X2 1ZRFA 4EN6B 4LT5A 3DGTA 1HN1A 1QDCA 1WMDA 3HN1A 4FT8A 5IT6A 1RUE3 2EIBA 1A8DA 2EA7A 2DVDA 1CAWA 1H0BA 4ZU4A 2D3PA 3D0SA 4Q0SA 3GXUA 5FP8A 1C5HA 2ZA9A 3VHRA 1W6QB 4H7MA 3ROUA 5F8PA 5IK4A 1PGL2 2VCMA 5AVAA 4YG0A 1ENQA 4CDXC 4AK3A 4WZFA 1WCDJ 2A3YA 3BCWA 4Y5Z0 5C3SA 1KRIA 2BP6A 1FT9A 3ETQA 3J4UH 2W0XA 4MXWA 4RR3A 4LITA 2E26A 4BXFA 5BNQA 2VCCA 2WZPP 1T6GC 4PT6A 1ZBA3 2HWE2 4META 4I01A 4PF1A 1FNZA 4RS5A 4E9KA 4IEWA 1S0IA 3LE0A 4TTGA 1IOAA 3WZ1A 4IESA 4Q4Y3 1URXA 3OUHA 4D94A 1RITA 3T4VA 4QDSA 2VW2A 5K9YA 3MFAA 1VBC2 2A71A 3MW2A 4GA9A 3SH5A 1V9U3 4OI2A 2ZKLA 3F95A 4E2SA 1J3PA 3GZEA 2YGLA 1QJX3 1NCQA 4O61A 5GJ6A 4D6SA 4JHZA 1W05A 3ZR6A 4Y33A 4YZ2A 1N3PA 4X6QB 3SLIA 4LLFA 2W47A 3HEIA 4CE8A 4F3JA 3S0MA 5IFTA 4Q2FA 4BWOA 4I2OA 1ST8A 2VOWA 1N47A 5AC93 5CFCC 4DINB 1VBB2 3OTFA 3RWNA 5KXCA 1OVSA 1UYXA 1PO11 1JYCA 2VMIA 1PNFA 3MICA 1PK6B 2VR4A 5FZKA 1UWWA 2FMYA 2BOJA 1MS9A 1O6UA 3KD4A 4YRDA 1OOPA 4DUVA 1MPXA 2QQOA 2W08A 1D4M3 2XH6A 4AVVA 2ARXA 1UOJA 2BGOA 2VZUA 4QAWA 4ZXKA 2CSGA 4W4ZA 2ILMA 4UI9L 3SITA 1QH7A 2NQYA 3ZX7A 1HX6A 2IC1A 1WLCA 5C70A 4MGIE 3ENRA 2LM3A 4YLZA 5L19A 4R9BA 4FP3A 1IGOA 2XHKA 4XDPA 3HNBM 4NPMA 4QHBA 3TNPB 1KGYA 5FZ6A 1SCSA 1A3KA 1CR7A 1ULCA 4Z2AA 3H42B 1V6IA 3HVDA 4I0BA 4I0WB 2FDHA 2FZ2A 2W1SA 1LECA 1DCSA 2D40A 2XDVA 5TSWA 4OHXA 4QGNA 4FCAA 4GWMA 5JDBA 3ZXGA 4ZU5A 3RZGA 4X8NA 1BBT2 4JTNA 5ANQA 2JICA 3DCQA 3VBRB 1AR71 1WD3A 4AVTA 5FY0A 1HRV1 2R7EB 3SHRA 3RS6A 3DN7A 3LDBA 1VALA 5L7OB 3JZVA 4YW7A 3DUIA 5FPBA 3PMSA 1S0CA 3C7HA 3LCPA 3VBHB 2ZS6B 1NZCA 3GCXA 4P9GA 5DUWA 4AAXA 2QE3A 3WQ1A 3LOIA 1AR92 3GYDA 2D44A 1UOBA 2XBO3 3MF9A 2QTWB 4Q27A 4QHZA 4XJUA 1VBE2 2X09A 4NVPA 3EB7A 1RYYA 4TXWA 1SFNA 3LA2A 2VZOA 3AX4A 3MUY1 1SQ4A 5C3RA 4AFDA 4Y26A 5AFBA 3H3ZA 5FXZA 1HKDA 1EV13 1SLBA 3WY6A 1PVC1 1W9WA 4Y22A 5GLUA 5A3WA 3WNMA 2WNVC 1GQPA 2QQMA 3B02A 2PHWA 1N1SA 2QFEA 2ZACA 4NN0A 5C4WB 4HK9A 1OHFA 5IFPA 1ZZ9A 3ZFEB 2N7GA 2XJQA 2B8MA 3S7EA 4OHZA 5JCTA 3I2OA 1X36A 1WA4A 1LJ7A 2OXBA 3LEMA 2JDKA 1S0DA 1F2NA 4QXCA 4AGVA 5IVJA 2HBUA 3WP4A 1GICA 3A0KA 3ZMNA 4QM9A 2R32A 2V4VA 1EPWA 5CZKA 2VD7A 5T54A 3MUZ1 4XF0A 2Q8OA 1BZWA 1HV0A 3BTYA 4LK7A 1IS4A 1OLMA 1UCXA 1BVVA 5A3OA 3WNNA 3NW4A 5FWEA 2RS13 3USUA 2RS51 5I0RA 2WWJA 4AFMA 5IYYA 2WWSA 3C8XA 2H6CA 4CDQC 4LHNA 3J9SA 1G9BA 2RMU3 1SMVA 1HRI3 3ILRA 1CAWB 2VL4A 4QQOA 4AEMA 1JZ8A 4LNVA 2R0FA 4ASLA 2P3KA 4AVAA 1UYPA 1VBD3 4JGYC 2VZVA 4CDWA 1BMV1 1FOD2 2OX0A 1UY1A 5A7WA 1GP5A 1YRZA 4D3WA 1CN1A 2DDUA 3CQOA 4DNYA 2ORZA 2XJRA 2NZ9A 3ZSMA 5IVEA 3BU7A 1B09A 3PTYA 5HCFA 4AL9A 2QQNA 4MXWB 3OOXA 3HNMA 4MADA 4RR3B 1PHMA 1EAH3 1OUXA 1K42A 4INDA 1F15A 4LTAA 4IQPA 4RS5B 4YZ5A 2VTXA 1JOBA 2O0OA 2P37A 3LQCA 4XC9A 1DYPA 2BGCA 4QX8A 3IIIA 3WQ7A 5DDJ2 2RJLA 1MZFA 1ULOA 4I02A 4JRLA 1W90A 2OQ6A 3N7MA 5BPXA 4QWNA 1I3HA 3N35A 2WZEA 2Z79A 2Y60A 2R072 2RHPA 3JCIA 4JKMA 2CGPA 1QQP3 1O5UA 1G9FA 4KH9A 5A6ZA 4PIXA 1LEMA 1NCQB 1D2SA 5GLTA 3DKQA 3H8UA 1ND2C 4GWJA 5CFDC 3WG2A 4FBFA 4ZS3A 2RS32 3A22A 3U78A 2XJPA 1S4CA 3A23A 4IGQA 2RJ2A 4M0HA 5LB6A 3BPZA 4J6GA 2C4XA 1Q8SA 1S0GA 4L97A 1C5IA 2D43A 3QH6A 4XJ8A 4Y5TA 3ZN4A 3IM0A 4PQQA 2JDNA 4NMIA 3VDDA 5F3IA 4HVQA 2JJ6A 2HWB3 1AX1A 2V5YA 5FY8A 3MLJA 1MZ5A 1OOPB 5FZAA 3KHCA 5ANNA 5CVRA 1TZOA 3MO4A 2I45A 3PURA 4MVTA 1AR83 4CDUC 1OLRA 4Z1VA 4BE3A 5LWBA 4CCJA 1H30A 3U4SA 1CONA 1XC6A 2Q1FA 2X10A 4N90A 1GZWA 3AKPA 1GU3A 2K46A 3O0XA 3FJSA 3P5BA 2BERA 1VRH3 1KD7A 2YC2A 3M7AA 4W6XA 1BJQA 5A7SA 5A3NA 1AYM1 1PMJX 2QQLA 2BNNA 1JH5A 2EXKA 3ZSJA 1G9AA 1FMD2 1BEV1 3W58A 2C9KA 1OUSA 2PQQA 1YC61 2XL7A 5CADA 2FBEA 1O59A 3VZOA 1CIWA 3KSCA 5C5UA 3ZXLA 1D4VB 4LIUA 3ZM8A 1W3XA 4LQRA 2GAUA 1QKQA 3J7HA 3NV1A 1WLTA 1YUDA 2YU2A 1KXGA 1K45A 1OMIA 2PMWB 3I97A 3W9AA 4XURA 4CP9A 1OURA 4DOUA 1RVF1 2IXKA 5JOZA 2X5IC 2QQJA 1Z7S1 4YW3A 2O8OA 3OGGA 3PVNA 5BV6A 4LO7A 5FDBA 1G6NA 1RUI3 1LRHA 5FR3A 1U5ZA 4HKWA 1YHFA 1LEDA 1WWYA 1PIV2 4H3WA 4YSFA 1W8UA 3O1MA 2E51A 1QGLA 1RUG3 1TQ5A 1JMUB 4IEVA 4LHLA 4YM1A 4M3CA 1FAYA 2VMCA 4XFIA 4ARXA 2HWD1 1R1A3 4AQTA 3IDCB 1WCUA 4YVSC 1JYNA 4QQ2A 2F4PA 1N1TA 2MEV2 3TB0A 5JSPA 2OPKA 1RINA 4K1ZA 1YQ5A 2BDRA 3O1UA 1LAJA 1GP6A 3M8LA 2JG8C 2Y8KA 1IS3A 1QEXA 1Y7BA 2YUEA 3BIWE 4LBOA 4S2HA 4QKNA 2QVSB 1C8M2 3H3LA 2CGNA 3KQ4B 4BQ1A 4YW1A 4URAA 1AR62 3LEIA 1ND3A 4IE4A 4PI2A 2WA3A 2OIIA 5CKNA 3UNPA 5DZGA 4JQTA 3WSOA 3E6CC 2DCYA 1PZ8A 3LWCA 3PVEA 3JD71 2HWF2 3QOPA 4GJZA 4XABA 4P9IA 5FZ8A 1QU0A 1ZX5A 3OBRA 3LPGA 4QX0A 1JW6A 4NAOA 4CU9A 5BNOA 3G7DA 4WM8A 5KHJA 2Z2SB 2LROA 3D8CA 3ZKYA 4BU2A 2D6NA 3ACGA 1WW7A 2JDMA 5IUQA 3VD5A 1J59A 3RQ0A 4DY3A 2W1WA 3FX3A 4JKLA 1H8TB 2WS92 4QKBA 3LPFA 1JOJA 5FZOA 2P34A 1HLCA 2V72A 5C3OA 5DUVA 5BY5A 2GC3A 2HWC2 3KGLA 3USUB 5H9SA 1MEC1 1UZWA 3LEKA 1WMXA 4IE6A 5C8CC 2E31A 4NIDA 1QOTA 2J1VA 4FFHA 4XBLA 3ECQA 1FYUA 5IAXA 3KVAA 2PN5A 1NT0A 2W1UA 3LA7A 1JYTA 3I2HA 3IDEA 3WDXA 1MS4A 3HMYA 4CDWB 4GIQA 4CCEA 4YW5A 3JB4C 1RUJ3 2A73B 2GC0A 5I0UA 5A1AA 1POV3 2BFUS 3U4XA 1CX1A 2RJKA 4J25A 4ARYA 4B1MA 1PZ9A 1E57A 5KBFA 1OXCA 4LULA 3BGAA 1TME2 1PMIA 1S1AA 3CEWA 2QDRA 3B9IA 4K8FA 3ABZA 5EPAA 4BK5A 2HWE3 1RUH1 2JD4A 3S30A 1YYNA 3URFA 3ZXKA 5J96B 2ZBJA 4MHRA 2WZR2 2NP0A 4XTMA 1GP4A 3CNAA 1LULA 5FPZA 3V0BB 3PIGA 5DABA 2XXZA 2ZX0A 5C5TA 1WA6X 1SLIA 1S0BA 4K6BA 2F4LA 2XG3A 2VZPA 3OEAA 5KWRA 2D6LX 3W5MA 4DO0A 3OPZA 3HNYM 4N53B 5FZHA 3M3QA 2KM2A 2R041 3AXDA 3L9JT 4NRMA 4XUQA 5LA0A 3ZYPA 1SLTA 4P9YA 3VZLA 2EVXA 3OGRA 3ZXFA 2RG4A 2IXJA 5FOBB 1VBB3 2W68A 1VAMA 2EAAA 4XQ4A 4BQ4A 2JDHA 4LBKA 4NIIA 5JIUA 4K40A 3VDDB 4XUPA 3HWJA 1VE0A 3CU7A 4KL1A 1BXHA 2G9ZA 4AWDA 1KJLA 2RV9A 4J1WA 3RI8A 1W8TA 2IXLA 5FMOL 2PAMA 2GMEA 1KITA 4Q1RA 4XF3A 1DIWA 4XUNA 4XIKA 5ACA1 2FDIA 2YXSA 3NO8A 1ULDA 5FO9B 1TE1B 1F4AA 2E7TA 2VZRA 4XQDA 1RHI1 4NIAA 2P4EA 1XQNA 2J22A 3PDQA 1WBLA 3IIAA 1JU3A 2PHXA 1Q3EA 2WN3A 4XILA 2A1XA 1EUUA 2YYOA 3HJRA 5FV3A 2CDPA 1PGW1 2DCTA 2Q1MA 5D8AC 4LO6B 1V6JA 5DXDA 1XSQA 3CBNA 3VZNA 1ONAA 4C91A 5I8YA 1XNKA 4XDQA 1J3RA 5DAQA 3CZJA 3POIA 5HCHA 2WQZC 3ZFGC 2DF7A 1L7QA 1QJU2 1U12A 3I2JA 3BIEA 1UPIA 2GC2A 1UY4A 3KT1A 4LMFA 2WBKA 1MACA 4HPKA 2YB7A 5A1FA 5JZGA 5FQ0A 4XF9A 4OZOA 4XDOA 3PU3A 1XYNA 4GZ9A 4QX1A 4QU1A 1YCIA 1NQJA 4Q8KA 2VY0A 3HIFA 4AFBA 3CJIC 2WAOA 1BK1A 3AM2A 3NAPC 3Q8FA 5FCCA 1K12A 3ZYBA 1COV2 2D97A 4IETA 1LOAA 3VKFC 4QKDA 1VBE3 4HKOA 1WMFA 4E27A 2VU9A 2X8KA 4D7YA 1NE6A 5K0UC 3D82A 1PVXA 4WVWA 5T55A 3UJOA 1RUE1 3ME2A 2ARAA 1LESA 1UNBA 3O0VA 4UT5A 2AUYA 4CCKA 1NE4A 2CAVA 3VHPA 3RPQA 1DP0A 5I0DA 5DN2A 4CP1A 1UIJA 3UK9A 4BIFA 2BNOA 5FZ9A 3D4KA 3UKTA 1JZ4A 3VBUA 3TN93 1BVP1 2GNMA 5JOWA 1Y9GA 4MGKE 1RMU2 4EZ4A 3GBWA 1ND3B 4UFKA 1L7LA 1WW4A 4XJZA 4XFHA 1JODA 3USSA 4OUMA 2B4KA 2BOIA 3EHKA 4CEWC 1ZBA1 3ZIXA 3C3VA 2WR9A 4N8MA 1TMF2 1MZEA 1NUKA 4Y1UA 5BNOB 3ORJA 4WM8B 3AKQA 4R52A 4D6RA 2DURA 3PUQA 1DU3D 4Q4Y1 4Z8BA 1GYKA 2XVGA 1CZTA 5KC5A 4K20A 4PDWC 2BJSA 4S2FA 5FZOB 2CU5A 1V9U1 4UW3A 3E5QA 3R4UA 3T2PA 2TUNA 2C5DA 2GC1A 2NYYA 1L3JA 4FPYA 4JDOA 1QJX1 3J7LA 4XIOA 5FIXA 4UF0A 4KWUA 1I5ZA 4AR2A 3S6PA 5KXBA 1UOFA 4Y1XA 4QX5A 1RL3A 2PFWA 4NPLA 1KEXA 2PLV2 5FLJA 5AC91 4E8DA 1CVNA 1FOD3 1OQEA 4MGSA 3H9AA 2GZWA 5CG9A 2ZGSA 4Y20A 4FPGA 3VD3A 5E88A 1X82A 2NMNA 3SKVA 3KV5A 4HN1A 1TG7A 1AYN2 4GULA 3U1XA 4LORA 1O7FA 3IBMA 1D4M1 4Q4W2 4PI0A 5GLVA 1GOHA 4CCDA 3POFA 1JZ5A 5FZ3A 5HCBA 2E63A 2Y64A 5HPOA 1H2NA 4Y4RA 1LTEA 1H4HA 1JN2P 1VP6A 4FOWA 1PNGA 1QWRA 4IDZA 4GH4C 1DQ2A 4RHV3 4GJYA 5FYIA 4YZ1A 4LKDA 4HONA 4ZONA 3N9LA 4YG3A 1W8WA 4HOOA 5CFCA 2GDFA 3LOBA 1GMMA 4LBQA 3HBKA 2XLFA 3PUIA 4ISQA 3VL8A 4A3ZA 3LDKA 1ULFA 2R30A 3MZHA 4RGGA 3N9NA 3Q8CA 3VHOA 4KG0A 3WG1A 1RC6A 3N4MA 2A75A 5F5CA 2BGPA 2VPVA 5T5OA 1NA1A 1Q8QA 3H3UA 3DEMA 3U0ZA 4DS0A 4ATFA 4FSJA 3WOGA 1QOSA 4S2GA 1W8ZA 3N9QA 5I91A 5BYNA 1F35A 3E5UA 3N7JA 4LHKA 2NLRA 3K4AA 1LENA 4QDQA 5FZFA 3WINE 4IUGA 5FO8B 4XFFA 3MIHA 2XBO1 4E8CA 2A7AA 1AX2A 2G9GA 4CUAA 1LHNA 3IN9A 4FPKA 1W6PA 2Q8EA 5HI0A 4BHPA 1MQTC 3T0BA 4PBOA 4XAEA 1UMHA 3GM8A 4Q29A 3TEXA 4XHBA 4GQ7A 3DPRB 2VUDA 5GLWA 1R093 3MV01 1IG3A 4XF4A 3KM5A 1EV11 1PO12 1QXJA 1WCQA 3SNMA 5LEJA 2R063 3KF5A 1SEFA 4Y1VA 5DZEA 4P5HA 4A44A 3CLPA 1A6CA 4N43A 4L9BA 1KS5A 3FL7A 3LD8A 4O9EA 4D7TA 3K75B 5BNNA 2DTWA 4AQ6A 2BNMA 3VBSA 5IVCA 5FLIA 4A4AA 2VZTA 3AYAA 5DQ0A 3O1VA 2ZEYA 2KR2A 5GZFA 1HJGA 1IZ3A 2VBBA 5F2WA 2C1FA 2ET7A 3AP4A 4HPKB 4YGEA 5FXXA 3UETA 4D7SA 1WW6A 5JZGB 1OQDA 2VM9A 2PHDA 2ZMNA 5CAZA 4HG6B 2C9AA 2HEYF 4OVEA 4B4QA 1XE7A 1ZM1A 1JZ7A 1QIQA 3RZJA 2DVFA 4ASKA 4YARA 1CESA 1V6KA 3WQ0A 1H1IA 4UBGA 1Q56A 3DYMA 3VKOA 2RS11 4AHZA 3ZLIA 3WP5A 1J83A 4AFAA 1NCRC 3TNQA 1PMHX 1AR72 2GNTA 1HRI1 2RMU1 1W0NA 1HRV2 3I59A 4LA2A 4QPIA 2VGDA 3R4DB 4BH9A 1VBD1 2WFF2 2FCTA 2IFWA 2RDRA 1OH3A 3JU9A 3PLQA 2JKBA 2QNKA 4UOJA 5A3LA 5IK5A 3FZ3A 2XL9A 3L2HA 4FPLA 1GLHA 1I5PA 1W03A 5I8SA 2C24A 4NWVA 1TVGA 1YQ8A 2ZHMA 3WT3A 1RUD3 4FTBA 1EAH1 4LHSA 2XLAA 5IK8A 3BALA 4DUWA 4MGQA 2ZCWA 1BQPA 1LOGA 1B35A 5A7QA 5J1XA 3VD9A 1SLAA 2E7QA 4A6OA 3T0AA 1G8WA 3T2TA 1KQRA 3ZXAC 5JR2A 2DCJA 1PVC2 2ZX1A 3A21A 4CDQA 1UY2A 2BWAA 1PO23 1JYXA 2K2SA 3K46A 3AZWA 1C4RA 2J1UA 1LHUA 4XUTA 1QQP1 2E6VA 2VC9A 2FHRA 4ZZ5A 3KB5A 5A3PA 3OBAA 4DUXA 2KXLA 1E5HA 1Q43A 2WSVA 1DLLA 3FLTA 3PUSA 4LXLA 4UF0B 5DPNA 4ZZ8A 3W21A 3NJZA 1PX4A 1Z78A 4NHKA 2PELA 3FLPA 3FBYA 3IDBB 3WDUA 5JIAA 3ZVXA 1CX4A 4M0NA 4EV0A 5JLVA 4NUBA 4EE2A 3J8F3 1LHWA 4Y20B 3OB8A 4XQWA 4E4ZA 4FTSA 1YQ6A 4NO4A 1O91A 2HWB1 2VNOA 3CO2A 3WR0A 1TME3 5FMDA 4FP2A 4F8AA 4AI0A 3I3QA 2PHRA 2Z4FA 5FYHA 2DFBA 1W9FA 2CL2A 5CA6A 3BTXA 1AR81 2WNUC 2WWUA 3SKJE 3POJA 1GNYA 5FYYA 1ODNA 1CAVA 1RUF1 4LE4A 4QPYA 2VVFA 1OA2A 5HXVA 4YPJA 3NRUA 5BXXA 1R1ZA 4AVSA 5SV8A 1IQDC 5CFDA 2CAUA 1BMV2 4TLGA 3WNOA 5E16A 2AACA 1AF9A 1VRH1 3U75A 1OKQA 1UL9A 4NWWA 3LIGA 5CFCB 1ODMA 1MVQA 4KI5M 2B45X 2UYAA 3W20A 1YQ2A 2X53S 5L73A 1F5JA 5B2GB 2QQUA 4IV1C 4L92A 4AVCA 1UKGA 4QB2A 3OYWA 2VZSA 5FPAA 4Y1YA 2DBIA 4WVMB 1NLSA 3NNLA 3T1LA 1GWMA 2G4IA 3WDTA 4BQYA 2ZHNA 3AMNA 1PK6C 2W92A 5C9AA 1NA1B 4K7JA 3ILFA 4PCRA 4HVRA 5T50A 4CDUA 4W65A 5LBCA 5GZEA 4ONUA 1W39A 4AGGA 3I2DA 1JBCA 3AP7A 4R9CA 4B8EA 4OHVA 1DBNA 5JPNB 4BDVB 1VB4A 5T5LA 1MS0A 2PHTA 3PIJA 1RUI1 2UWBA 3C2UA 4NAMA 1K5MC 2OQ7A 1RUG1 4QX3A 1NAEA 4A41A 1NLRA 5KC6A 4OQ8A 4G3YC 4PF5A 1W6PB 5I8TA 4JQRA 1REDA 1V6LA 2JE7A 1OPOA 1R1A1 1DGWX 2WC2A 1NY72 1Y9QA 1DFQA 2YGMA 5EYYA 5H9PA 1UZVA 2L9LA 1Y4WA 1YEWA 4P02B 2VNRA 3IWZA 1ZA4A 1F9KA 2PYTA 1QJY3 3HQRA 3I2IA 3P6BA 1LOFC 4H2AA 3RSJA 1JHJA 1FNYA 4N43B 2FD8A 1BCXA 2JDZA 4MZUA 4K1YA 1KFUL 4QGLA 2DUQA 5BNNB 1YIFA 4TSVA 3U37A 5LY1A 2X5IA 3VBSB 1S2EA 3VBRC 4LE3A 1HB3A 1FPN2 4FAHA 1POV0 1YJLA 4OULA 3THDA 1GWLA 1UAIA 1UU4A 2D3SA 3OJBA 2XKPA 1KDMA 2B42B 3VBOA 3INAA 2VOVA 4CA9A 4PIYA 3QLQA 1AJKA 3ZYFA 2FCVA 5JI9A 3ST7A 1D0HA 1ZZBA 4LKFA 5LBFA 3PJQA 1AYM2 3P3PA 2RVAA 4AZZA 2ZMLA 4YVSA 1W8HA 3AJYA 3TBDA 1BEV2 3WG3A 1LNSA 1TEIA 5JXGA 3UESA 1WMEA 4QM8A 4LPLA 4Z07A 4MG2A 1COV3 4XBQA 3WF1A 5CG8A 5EXOA 2XUEA 5CNAA 3TYJA 5IVFA 1AUYA 2GMPA 1AJOA 5F3CA 4ES8A 1XNTA 3I59B 2EICA 4QPIB 5FP9A 2Y6FA 5J7MA 1S55A 5C4WC 4WM7A 3B01A 4V2WA 1Z7S2 1RUJ1 3ZFEC 1D0GA 1OF3A 3AP9A 1POV1 3MW4A 3N9MA 1D7PM 5F6LB 1JZ3A 4OI0A 1PGL1 4LBQD 1LCLA 1SPPB 5E6HA 4DY5A 5LK5A 1RMU3 2EXJA 4IEOA 2PTMA 2WIIB 2C6SA 4K3UA 4EYUA 5HXMA 2QCSB 2XJSA 2HKXA 2D3RA 2LRPA 2Z42A 5JAXA 3TOJA 3AZVA 2HWE1 5FY7A 1B35B 4IEXA 3VLBB 3ES4A 1M06G 1E5SA 4JGZA 3OD4A 3VHNA 4JZRA 2JDPA 1C1FA 2ARCA 3TEYA 1VBA2 3LIHA 1CAXA 4BJ0A 2QQVA 1YFUA 5A3UA 1VBC1 2Y6JA 1REEA 2B9UA 3NJXA 4LO5B 1GSLA 1UZ0A 3QACA 5KXEA 2PAEA 4QB1A 4QPGC 3TRSB 1AZDA 1G9CA 2XPJA 3PVOA 1O4YA 2PA7A 4QU2A 4URTA 1W6OA 4OZXA 2ZX4A 3JD72 1GUIA 1HQLA 2MNGA 2P6CA 1VBB1 2QUOA 4O65A 3CHXA 4TN7A 2ENRA 1ZZ7A 4TLFA 1W8NA 3NMBA 2QJVA 4KMQA 1Y3TA 5FLHA 1OT5A 4LKSA 4AQSA 1UYZA 2AH2A 3I2GA 3K4ZA 1JI6A 2IZWA 2Y6HA 3AK0A 2V5DA 5FZLA 1FV2A 2GN7A 4MGZE 4NRQA 1HXS3 2A5ZA 2W91A 3E1F1 4JRAA 3ZYHA 4CUGA 1G7YA 1RUNA 4A3XA 4OFGA 2ZAAA 2VTXJ 2VMDA 1NXMA 1U0AA 3WHUA 4WVVA 5CFDB 2MPFA 4FI9A 4B4RA 4PHZA 1OVPA 1DF0A 2YPDA 5FBZA 1QMJA 1UXZA 1UYYA 1NCQC 2CYFA 1C3HA 1MR5A 4BLIA 5ABJA 3B94A 4FPEA 3GBFA 3GZTB 3FC0A 3BOPA 4YM0A 3UGGA 3V65A 3WXPA 4SLIA 3OYWB 3MIGA 2JX9A 3MPBA 1W04A 3I3DA 3AFGA 4L2NA 3ZYIB 1RUH2 1RUF3 5FP7A 5HV0A 4CCCA 2Q5TA 5C9AB 4YVWA 2JXAA 3KMHA 1D2QA 4NPRA 3O1OA 5CB7A 3KQRA 3NJVA 4N7IA 1H1AA 2D5HA 2OPWA 3WNPA 3CIHA 4CDUB 1OOPC 2W87A 4G9SB 3WD5A 4MH0E 3VL9A 1KS4A 4B1LA 3S57A 4LOSA 3V64A 3LSDA 3GHMA 2XLGA 1PM7A 4FPCA 1DG6A 3RI9A 4AEDA 2R042 1VBE1 2BU9A 3OCPA 4H7LA 5D8AA 4E2GA 2EXIA 5A7PA 1SDWA 4IEQA 4R9DA 4W6WA 4DPNA 1X50A 4XCBA 5E1RA 3ZN5A 3AL5A 1R083 2P17A 2H6BA 3IKWA 4BQ2A 2VCBA 1ENSA 4JX0A 3BU0A 3Q8BA 4RYDA 4AQ2A 2RM23 3TN91 1NLQA 4EJRA 3BI3A 2DVBA 1GZ9A 4AYUA 2X5IB 1JS9A
chains in the Genus database with same CATH topology
1UMZA 2JEMA 2WT0A 2SLIA 4W6YA 3IPVA 4XMIA 5ACA2 4CEYA 2VMHA 4A2UA 1GNHA 3POYA 3CJIA 3VBOB 4FPHA 2Z5WA 2ZAHA 2WFPA 4YNIA 1KDKA 4Y22B 4KWKA 1PGW2 1ALYA 3WCRA 1RUC3 1WCSA 2D5FA 1DGWA 1OA4A 3U10A 4C1XA 1GV9A 3LSEA 2RR13 4HANA 2D98A 2JG9C 1OFSA 1HIXA 5T3NA 5KHGA 3K48A 2VOKA 4EN7B 4P9WA 4WM7B 2WFF3 1FOD1 2ATFA 3SCGA 3JBG3 1ZBE3 1JXNA 4QQPA 5J37A 4A7ZA 4B7KA 3MLLA 3KCXA 2B5HA 2EF6A 1ZZCA 3B00A 4IV3C 2GN3A 2UYBA 1ASJ3 2DUOA 4Q4X3 4WZCA 4Y4YA 2I2SA 3FWEA 3GZUC 2WLPA 1ENXA 4AG4A 2ZGOA 4ATEA 4JDNA 1O5LA 1J1TA 1UU6A 1RUE2 4JGZB 4DZGA 1H8TC 5EZWA 4GMP0 2YZ4A 1SLLA 5A32A 2WA4A 5FMOS 1S0JA 1CAXB 4RHV1 3DV8A 2TNFA 5DG1A 1DZQA 1M4WA 3UKVA 5FREA 2VG9A 3PJYA 2WL1A 1W6NA 4IEZA 1W6OB 3LA3A 1H2MA 4CDWC 2CWMA 5GZCA 4K9SA 3QH7A 1ZBA2 4QT6A 4PJYA 4Q4Y2 2NMOA 1FI2A 3OY8A 1VBC3 3I7DA 1OQ1A 4Q4V2 1AXYA 3CJXA 2DVGA 1V9U2 3ZSLA 1UKRA 4GMP1 3MIDA 1QJX2 4KU7A 4Y1ZA 5IK7A 2VUAA 4HVOA 2ZGKA 2ZOEB 4COVA 4KBBA 1G9DA 3NKTA 1G86A 1R091 3RNSA 5ABJB 2B39A 2P3IA 4IEYA 2R061 4N53C 2VOXA 2ET1A 2X29A 3I4IA 3AJZA 2WQ4A 2UWAA 3ZMOA 2YROA 1D4M2 3BOWA 3ZXDA 1FATA 5F6KA 3MEPA 5FAXA 3VDDC 4EWEA 4YVWB 1HDKA 4AI1A 2Y0OA 1I6XA 1QHDA 2HJIA 1GZWB 1ULGA 2G9FA 3NWKA 4XW3A 2VVEA 3MGUA 4YG6A 1V6NA 1YO8A 3POWA 4OLLA 2IXIA 3ZSKA 1MQTA 3RYKA 4KG8A 2OZJA 4TWTA 4XJ9A 5FRAA 4YZ4A 1PIV1 4MYEA 1WW5A 3TWIA 4AEDB 5D8AB 4HKLA 3GALA 1BBT3 4DB5A 1YJKA 2AZ5A 1AXKA 2A6YA 5GLZA 2XVLA 4QGMA 2VMGA 2FMDA 1JHNA 3RZZA 1AR93 4FOVA 1HV1A 4ISRA 2ZKNA 4E4DX 1RTVA 5BNPA 4CEYB 3AFKA 4M3CB 1GBGA 1RUD1 1C1LA 4WBBA 2D6MA 1AL22 2VNGA 3V56A 1O3RA 4GB32 2GNBA 3OGJA 1LOCA 1QY4A 4XFBA 1EV12 3MDPA 1XE8A 1NCRA 2WSUA 1PO21 4Q1PA 2WS91 1XNBA 4JV4A 2BVVA 3AZYA 4LEJA 5C8WA 3AZXA 3V0AA 4C1WA 3B7MA 3U11A 2Q1ZB 5JI7A 4HK8A 1DQ0A 4BMEA 2ZZJA 4U2AA 1QDOA 1H8VA 2NM1A 2VVDA 3N7KA 5DUUA 3RMXA 4AEKA 5JR7B 3J8F1 3R6SA 2BYVE 1ND3C 2OW4A 4BYYA 1JTZX 4TYSA 2ZHKA 3ALQA 5JSOA 5K8SA 1OSGA 1QF3A 4QQLA 1TME1 3M70A 4I3PA 4Q26A 4WM8C 4LBNA 1EYBA 1DGRN 4XFGA 4CDXA 1LGNA 2V09A 4V1PA 1APNA 1LGBA 2RMU2 2ZGLA 1HRI2 3R0RA 2WZR1 4QMAA 4ZU5A 5A32B 4XBNA 4B7EA 5C6CA 1H9WA 2PHLA 2BPA2 4EROA 2PHUA 3PMEA 3HT1A 1KJRA 5A33A 1C28A 5I0TA 4JCKA 5HCAA 1RIRA 1MZ6A 1J3QA 2VQ0A 3K51A 4NHLA 4UW6A 1UW8A 2QZ2A 1SBEA 3FBMA 2A6VA 1EAH2 3O5SA 3THTA 4I30A 3JUUA 4FQ4A 4SBVA 1ZRCA 4D69A 3E6DA 1NG0A 5DDJ3 4XE9A 2ZJCA 1H2KA 3OY8B 2WNUA 2XWJB 2R073 3MYXA 4YW2A 2JE9A 3M2MA 1F31A 1QQP2 3QD6A 1RGSA 2R16A 3ZFFC 5J48A 2DV9A 1Q8VA 4RQPC 2RS33 4AHWA 2WT2A 5F1RA 3GBGA 3G6JB 4FXGB 5J3UA 2QQPA 4YM2A 4YYOA 5JSRA 4IV1A 4DFSA 4IEPA 1HW5A 2A6XA 2WKKA 5GZGA 3SH4A 3MIFA 4LUMA 1QJY1 1LKNA 4LA3A 1QOOA 2HWB2 4GKXA 1V6MA 3KT7A 5FO7B 2DU1A 4GMP3 5J09A 3D5OA 1AHSA 2BEOA 3KCYA 1OPMA 2P3JA 1UN1A 1YWKA 1UU5A 4UW5A 4R4ZA 4A7YA 4QQHA 1S2BA 4FXKB 1K5MA 4XFCA 4COUA 4RL7A 4JDMA 2H0BA 4Q0PA 1VRH2 4FPJA 3NL1A 3WG4A 1FMD3 2YDEA 1OA3A 3MIEA 4GWNA 4AI2A 1QJZA 3X29B 2IXHA 1SLCA 1ULEA 1COV1 1X33A 2D6KA 4Y24A 4LO4B 3WX5A 3DPRC 4HLTA 1HQNA 3APBA 4S2DA 2O1QA 5AVPA 1ZRDA 2I07B 5FQ0B 4MV2A 3RDIA 3OBTA 2ZGTA 3N3HA 3SISA 3O12A 5EFUA 2UURA 4FPOB 2CY6A 3MI8A 1C57A 1PIV3 1VAVA 5KHKA 1RMU1 3AYEA 1V70A 2E53A 3AP6A 1VR3A 3POSA 3SH3A 5BNPB 4BA6A 5JZGC 2ZZQA 1RJ7A 2WNVA 4J1XA 1LB2A 2CV6A 2FZ1A 1GNZA 1XRUA 1R1A2 3FUOA 4YW4A 4COYA 2MEV3 3M3CA 1V6OA 2ZABA 1TNFA 2VH9A 3VBUB 2GH2A 3ATGA 3VBFC 2WNEA 3B69A 4HFSA 4C0BA 2ZGNA 4DRVA 1C8M3 2Y0IA 4DXZA 1AR63 4XJWA 3ZFEA 4I09A 1UF2C 3WDYA 4BOWA 4FQZA 2HWF3 2TEPA 1RJ8A 1CAUA 1UPSA 1XXNA 4XHXA 4P14A 3RJRA 3THPA 2R49A 3B93A 2WS93 3VKMA 5FOJB 3RYRA 1LOBA 3N7LA 4GXLA 4UW4A 3LZZA 2EXHA 2BW8A 2HWC3 4JGYA 1AYN1 3O7OA 4Q4W1 2D6OX 3ZIWA 4AFCA 1N3QA 1CQ9A 4CDXB 4IERA 1HXS1 3I8TA 5F9TA 1O3TA 2LUWA 4IEUA 2R6QA 4QPGA 1ZREA 3GZAA 3EJKA 1GANA 5J98B 2WT1A 4FPFA 5A33B 2ZGQA 1RUJ2 4CP0A 2YY1A 3EXUA 4B29A 1LHVA 4FO9A 2V73A 4N9HA 5GALA 1W6MA 4AW7A 2RS52 1AL0G 5K7PA 3A0NA 2WZR3 2VUJA 1YIPA 1ND2A 5CBLA 1YFXA 3NV2A 4HT1T 5EJ3A 3JB8A 2WNUB 2A70A 5LRRA 2FQPA 4PLOA 2BVBA 4Q4V3 4LBQB 5KXDA 4YZ3A 3O0WA 5I0SA 3UJQA 1WD4A 2XGXA 3GF6A 4RFT0 3WV6A 3EO6A 1ZRRA 2BBVA 4IV1B 2VECA 4Q0VA 1AX0A 2ARBA 1R081 5EYXA 1SACA 1QNWA 2WLQA 5F5QA 1DYKA 1A78A 3B9CA 5DUXA 4HBNA 4Q0QA 2RM21 2ZGPA 2B7YA 1EPZA 1Z0HA 4ITCA 2AYHA 3WW3A 1NA1C 4BCUA 3WVJA 1RUOA 1XYPA 1NYWA 1MS1A 3ACLA 2UY9A 4EN8B 3WDWA 1K5MB 3LAGA 4A7KA 1WLDA 2LTNA 2YC0A 3HD8B 4COWA 3FMGA 2UY8A 4R8HA 1X8MA 4BZ4A 3R05A 1RUC1 3H1YA 2RR11 4OHWA 3WDVA 4EWDA 1GFF2 1QJU3 5L7OC 4ZU7A 1GKBA 4EN0A 3VBHC 2D6PA 4N43C 5H9RA 1X8EA 4FAGA 1REFA 5BNNC 2WFF1 3VBSC 3FFQA 3JBG1 1ZBE1 3KGZA 4BMBA 4L8QA 4C90A 5JOYA 4ASMB 4KNCA 1ASJ1 1BYHA 4Q4X1 2ZHLA 2WNVB 2JG8A 1AL23 2QZ3A 3AXEA 1YNAA 1U5XA 4BLJA 3P3NA 3EBRA 4GB33 1DZRA 3OF1A 4HN0A 2GALA 3MLKA 1WLWA 5E8AA 3CF6E 2A3XA 2JG9A 4YGBA 1BKZA 1RVF2 1JYIA 1PGSA 1SBDA 4TZDA 5LK7B 4LO8A 4M3CF 3TN92 1LU1A 4XEZA 2XUMA 1IS5A 3UL2A 2A3WA 1AXZA 3H1WA 1F8VA 4QPIC 1UZYA 1DQ1A 4PBPA 2HWD2 1TMF3 3SMHA 4H14A 5DZFA 1CPMA 4IV3A 1IPJA 1CAUB 1XYOA 1SCRA 2R1BA 2EAKA 4R9AA 3HQXA 4YFWA 5C8CA 5FOBB 4I0AA 5DG2A 4CDQB 2RE9A 3JQXA 2QDNA 1H8TA 4JGYB 3E97A 4CYDA 1U5IA 4BM8A 1B35C 5JMCA 1WCKA 4JAAA 2XWBB 3EQEA 1DZTA 1MS5A 3VKNA 4DRRA 4XXPA 4Z82A 2P2KA 2PLV3 4QPGB 4AEJA 2HEWF 2UU8A 3ELNA 3NVCA 2VULA 2WJSA 4RD7A 2DFCA 4RR3C 3BODA 4MX3A 3S7IA 2ZPXA 4RS5C 1AYN3 3H1MA 5T52A 1W6MB 4MLOA 4Q4W3 5EV7A 1MEC2 1GQGA 4B3NA 2CGOA 2VQAA 1CAVB 1DQ4A 1ND2B 3WW4A 2R1DA 3V0BA 1WGPA 2A6WA 2DU0A 4RHV2 4X6RB 4RSUA 3OD0A 3NV4A 4FVVA 1JUHA 3T1MA 3ZN6A 1FV3A 1DGLA 1YI9A 1XNDA 4N53A 4MGYE 4XZPA 3MW3A 1RB8G 1BBT1 2W39A 4G4FA 1O3SA 4XXAA 2D93A 1NY71 3HBZA 4Q8LA 4PLMA 4P9LA 1YXWA 3KCCA 4XF1A 3RYPA 2GMMA 1YLLA 4BPZA 1AR91 4KWLA 3WCSA 4AHYA 5A3MA 5C9AC 2Q30A 3WW2A 1FPN1 1UX6A 2K9ZA 1MS3A 4YGCA 2YPJA 4PLNA 3RRDA 1OI6A 1DQ6A 3ZFGA 1PO13 1ENRA 1S0EA 5FPXA 1R092 1FXZA 3U07A 2OZ6A 4WV8A 2R062 3RJ2X 3DKWA 1ZZ8A 2YHJA 4HMZA 1XU2A 2DVAA 3KS7A 1RHI2 3QCWA 3NAPA 5SV5A 1TNRA 3AMHA 2CWSA 3VN4A 3NKGA 5K0UA 4P9JA 4YVSB 1XU1A 3ES1A 2XVKA 2HEVF 3VBOC 1SBFA 2ZGRA 1Q5OA 2JG8B 1AR73 1UD1A 1HRV3 3KZ4C 4PIZA 2JG9B 4CZSA 3WLUA 3WUDA 3L2YA 1VBA1 4X8PA 4CEWA 3KT4A 2EALA 2IFRA 3H7JA 3HT2A 4LBMA 4FOYA 3M3EA 3M4FA 3MF6A 4OUSA 2TBVA 2CTVA 4M00A 4PDWA 2K0GA 5JWPA 1RUD2 1LR5A 1ZVFA 3AP5A 3TAYA 3H50A 4WM7C 3ZXJA 1PZ7A 1CPNA 4IV3B 1IPKA 3FHIB 4Z92B 2Z69A 4JVAA 5C8CB 3GNEA 2VXRA 5DDJ1 4CRQA 1GQHA 3I54A 4KGGA 1PVC3 1Q8OA 2DWRA 3NV3A 4AI8A 2R071 1H4GA 1PO22 1NXD1 5T5JA 3O14A 4AE2A 4JGZC 3AZZA 4ES9A 1NOVA 1Y43B 4F83A 2RS31 4AI3A 3M3OA 1OD5A 4NOTA 1LU2A 3GHNA 4NR1A 1QXPA 1VJ2A 3PVBB 3J8F2 2GNDA 3LKJA 4Z2WA 1XNCA 2OUHA 4GH4A 3PHMA 2IWGB 1AVBA 2E9QA 2RS53 1NQDA 4L99A 2AR6A 2DYCA 2VW0A 2XJTA 4H55A 1QXRA 2DUPA 3ZFFA 2H0VA 4B4PA 5LRSA 1W0OA 1OFNA 4OHYA 4O9GA 5AC92 5BUVA 4RQPA 1N3OA 3VGIA 2O8QA 1OLQA 2GSYA 4AF9A 1EY2A 1FMD1 2Q0AA 3ZN6B 1ZYBA 2Q4SA 4LUKA 2NN8A 4AXOA 3AMMA 4N7UA 1EP0A 3WUCA 3D6EA 1LGCA 3ZYRA 1IQAA 3ZSEA 1S2KA 3H0OA 5JVVA 2DCZA 3B3QE 5CU1A 5ABJC 2F6BA 2D7FA 4M3CE 2XJVA 2ZX2A 1UIKA 3MIBA 3E5XA 2JENA 4I3GA 3Q9OA 1DQ5A 1A8MA 1YFWA 2MHFA 2ZTNA 3W59A 4XPVA 3IMNA 3LOBA 2OVUA 1MS8A 3VZMA 4YVWC 1QNYA 2BFUL 2R0HA 4OI1A 4ZKTB 4DMIA 1W2UA 1DDLA 2Y38A 4PQ9A 3HAGA 3RG0A 1CJDA 3M3IA 3ZFGB 4KGQA 2BQPA 2MEV1 3UKNA 5CIRA 1I1EA 3N36A 1ZZ6A 2HYKA 3DPRA 5KHIA 1QJY2 2ES3A 2IXCA 3VV1A 1CGPA 2BWCA 4AEDC 4ORFA 1VIWB 4JC1A 3BB6A 2XKOA 4XTPA 1C8M1 3IPVB 1AR61 1FPN3 2GH8A 2XBO2 1H9PA 3HR9A 2B46X 3QBQA 3CJIB 2HWF1 3NAPB 3AMQA 3AB0A 4AVBA 5K0UB 2WINB 1AYM3 1IS6A 3AMPA 3WP6A 4EN9B 1BEV3 4CEYC 1V00A 3AYCA 2CNAA 4KQ7A 1H2LA 2HWC1 4E2QA 5H9QA 4YGDA 2SBAA 3VBFA 4DQAA 4YM3A 3UV9A 1RVF3 2BTVC 3SXWA 1VAKA 1Z7S3 4CEWB 3E6BA 5E89A 4MSVA 4AGRA 2YV8A 4CTEA 4PDWB 5BNOC 3WHTA 2RS12 4K21A 3JQWA 3R4SA 2HWD3 2ZGUA 3RMYA 1MVE