2DUQA

Crystal structure of vip36 exoplasmic/lumenal domain, ca2+/man-bound form
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
249
structure length
244
Chain Sequence
HLKREHSLIKPYQGVGSSSMPLWDFQGSTILTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTIDWTKIEPSVNFLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Vesicular integral-membrane protein VIP36
publication title Structural basis for recognition of high mannose type glycoproteins by mammalian transport lectin VIP36
pubmed doi rcsb
source organism Canis lupus familiaris
total genus 58
structure length 244
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2duqA01
1LEDA 2W08A 1BZWA 3BIWE 1S0GA 1JXNA 4LBNA 3BODA 1JW6A 1HDKA 1IS3A 1HLCA 3WUDA 1JN2P 4W65A 4R9BA 4XJZA 2D44A 1GNHA 1WBFA 5H9QA 1DYPA 4XE9A 5H9SA 3VKLA 5GZCA 1VLNA 2BQPA 1KITA 3AZZA 2CL2A 3WG4A 4AYUA 4YW4A 5IK4A 2GNTA 1V6MA 1PZ7A 5IUQA 2V5YA 1IKQA 2ZGLA 2CWMA 3ASIA 2EXHA 4BLIA 5CA6A 1Z78A 2OW4A 3B9CA 4FPHA 4YGEA 2VW0A 2ERFA 3N7MA 1LHNA 1A78A 1SLBA 5T5PA 4LBKA 2CY6A 2CWSA 1V6JA 2GMPA 1WW6A 1O4ZA 2ZGUA 3D4KA 3VV1A 1AJOA 1MS4A 2DWRA 2UU8A 3AFKA 1KJLA 3POWA 5H9RA 3SLIA 4YW2A 1GKBA 2ZMLA 4I30A 3AZWA 5T5JA 2AUYA 4FOWA 3OBRA 4P9XA 1WW5A 5GZGA 3FUQA 3WDUA 4PQ9A 3RMXA 4XIKA 4AVSA 1QKQA 5DXDA 1VAVA 1N1SA 4LBQA 3RQ0A 4AVVA 1O4YA 1F9KA 3OY8B 5DUUA 1G9AA 2LTNA 2WSVA 3VKNA 3WVJA 1AXZA 3WDXA 1GYKA 1AF9A 3AYDA 4LBJA 3M3EA 4XXPA 5CBLA 1GNZA 4BLJA 4Q2FA 2E6VA 2RHPA 2UWCA 2ZHMA 1CJPA 1LHUA 2LALA 4Q27A 2C9AA 3RRDA 1EPWA 4XTMA 3FLPA 3ZXJA 3ZSMA 5T54A 4Q1PA 1URXA 2GN7A 5GZDA 2OUJA 1KQRA 2C5DA 3WHTA 2PHWA 1CVNA 4DPNA 1G86A 3TAYA 2SBAA 2R1DA 3SNMA 4GA9A 5KXEA 1OQ1A 4DQAA 2ZGPA 4XJUA 3WG2A 3WDTA 4GWMA 2SLIA 1LU2A 5GZEA 3T2TA 1ULFA 4AVTA 3B69A 1H9PA 1LESA 4FPGA 3USUB 1LOGA 2NM1A 1JUIA 2PHRA 2WSUA 2ZGRA 2ZHNA 4XHXA 5DG1A 1SLTA 1HKDA 1QNWA 1WW7A 5CAZA 1MZ5A 3MW4A 3QCWA 4YW5A 1MVEA 4D69A 1QMJA 1ULDA 1LEMA 4LBOA 3RS6A 3V0BA 2NZ9A 2A75A 2DUPA 1S0CA 2PELA 3OYWB 2XB6C 1VALA 3IPVB 4WZFA 1YIFA 4P9YA 3AP5A 3AK0A 3AJZA 1QGLA 1SCSA 2UURA 3AP9A 1DQ5A 5E8AA 4FPCA 2A6ZA 2EXIA 3FLRA 3SH4A 2CNAA 4UW3A 5FRAA 1WUVA 2OUHA 4XJ8A 5KXCA 2DTYA 3MW3A 5T55A 1UX6A 2JE7A 4HL0A 1UZYA 5IK7A 1A3KA 1Q8QA 5DG2A 5GLZA 1QOTA 3INAA 4YM1A 2GNBA 2VH9A 2H0BA 3O12A 4UW4A 5JOZA 5KXBA 1LOFC 4XYXA 1CESA 1W6NB 2VW1A 3LCPA 4ISRA 1SBFA 3AYEA 2GNMA 1LGNA 2ARXA 2P3KA 2Q5TA 4FPFA 4P14A 3VKOA 1Q56A 5JLVA 1N3OA 4YGBA 4ZKTB 4BPZA 1UL9A 2R16A 2A3XA 4M01A 5KXDA 2A6YA 4SLIA 1DFQA 2ZGMA 1V6KA 1GZCA 2AREA 1W6MB 2DVGA 4XJ9A 2DVAA 4FQ4A 3L2YA 3ZXKA 4LBMA 3GALA 2A5ZA 5DZGA 1I3HA 1F5FA 1AXKA 4GKXA 2ZBJA 2E7QA 3POSA 2VUAA 1A8DA 5GM0A 1WD3A 1BQPA 3D6EA 1IOAA 3N7JA 4FPEA 1W6PB 2XG3A 2P34A 4FP2A 1PZ8A 4UW5A 2Z42A 1W6QA 3AXEA 4FPOB 1SCRA 2R0FA 1KDKA 3VUOA 3V65A 3KQRA 1WLCA 2A6WA 4BMEA 2ENRA 1HQWA 1S0JA 2WT2A 4FPKA 3AJYA 1ULGA 3O5SA 4LBQD 1C57A 4Y20B 4U2AA 2GNDA 5JMCA 4YZ1A 1N1VA 1V6NA 2A3WA 2ZGKA 4JCKA 3Q9OA 1Q8VA 4XXAA 4YGCA 4K1YA 2EXJA 1KDMA 2WT1A 1S1AA 1YO8A 2OVUA 3M2MA 3OJBA 5DUWA 3VKFC 1QOSA 1WW4A 2R0HA 3POYA 1SBDA 1CR7A 3FFZA 4FOQA 3ZPYA 3WNXA 1MS0A 4NOTA 1KJRA 4XOGA 1G9FA 2KM2A 3WDWA 4FOYA 3M3CA 4FPYA 1W6OB 2P37A 2ZAAA 1DQ1A 3UL2A 2WT0A 3WLUA 5HCAA 2NP0A 4GWNA 4M3CA 1LENA 1OKQA 4YW3A 3UJOA 2JE9A 4BM8A 5IK8A 1ZM1A 3ZVXA 2ZMKA 2ZHLA 3WCSA 2E53A 3USUA 4Q8KA 3I8TA 4P9WA 3DGTA 4PCRA 5HCFA 4MYEA 1I1EA 2EF6A 4AGRA 1DQ2A 2DUQA 2P3JA 1CPNA 1ENSA 1QF3A 1LHVA 1J1TA 1RIRA 2ARBA 2UWAA 2YZ4A 1WCSA 2D3SA 2EIGA 2JD4A 4Y1VA 3WDVA 4DRVA 1HQLA 1W0PA 1WLWA 2E7TA 2FHRA 1G9CA 1LTEA 2EXKA 4XHBA 1GZWB 1QU0A 1V6OA 2UWBA 4YLZA 4Q8LA 5EYXA 2PHXA 1SLIA 1JYCA 3N7KA 1QNYA 1ENRA 4Y1YA 1IS5A 4YG3A 1ENQA 5F5QA 1LCLA 2A3YA 5DZFA 2JECA 4NO4A 1SFYA 1S0BA 2D6OX 2G4IA 1D0HA 1S0DA 4ATFA 3V0AA 1DIWA 5IT6A 3SH3A 1BYHA 4FQZA 4YM3A 5T5OA 1DHKB 1QDOA 3AYCA 2GDFA 4WV8A 5GJ6A 2YMZA 3WZ1A 1G9DA 1DLLA 2ES3A 2A6XA 2D43A 1FAYA 4Y1XA 1YRZA 4YZ4A 4C1XA 3WG1A 4LBQB 3AZVA 4XTPA 2WJSA 4XDQA 1GSLA 1BXHA 2GN3A 3TB0A 3UK9A 2ZGQA 3LSEA 4CRQA 1V6IA 2P3IA 1WLDA 4Y22A 2CTVA 2V73A 1LULA 5L73A 1OFSA 2GMMA 1SLAA 4M3CE 3M1HA 1N1YA 4Q26A 3AP4A 2ZZJA 2JKBA 3FBYA 4AGVA 5JOYA 3WG3A 4FP3A 4Q1RA 4M00A 3RMYA 1QOOA 3AX4A 4WVVA 2HYKA 5F9TA 3ZYPA 4BMBA 1GV9A 2CYFA 1FNZA 2FMDA 1CN1A 4XBNA 1GICA 2YY1A 3APBA 3T1MA 1KRIA 1DQ6A 1N1TA 1YXWA 4ATEA 1UMZA 3T1LA 5JVVA 2R1BA 1QDCA 3A0KA 3JUUA 4K1ZA 2ZGTA 1JBCA 3MEPA 3WHUA 2JDZA 3B3QE 2VW2A 1FV3A 1GBGA 2VY0A 3O0WA 5JOWA 5T50A 2DYCA 1H9WA 3W59A 2AENA 5EWSA 4H55A 3ENRA 1UAIA 1R1ZA 4Z8BA 1G8WA 4LBLA 3WDYA 1IS4A 1UPSA 4YZ5A 5JOXA 1SBEA 4JRAA 4R9AA 4YFWA 1W6OA 4FPJA 4GKYA 1PZ9A 1C1FA 1AX0A 1C1LA 1S0IA 3O0XA 4JC1A 2AYHA 3AZYA 1LECA 1AZDA 2ZGSA 3WOGA 1JHNA 1IKPA 1AJKA 3PJQA 1NLSA 2TEPA 4DFSA 4K21A 4KBBA 3N36A 3GNEA 2DU0A 3PVOA 4TZDA 1SLLA 3OY8A 1LHWA 1MS8A 4Y24A 2YROA 1MVQA 4YG6A 3NWKA 2NMOA 1Q8PA 3PVNA 4L8QA 1V00A 1ULEA 1JYIA 3I4IA 1MR5A 5IK5A 5JDBA 1YI7A 4XILA 2PHUA 3IN9A 1DBNA 4Y1UA 1LGBA 2NMNA 3ZSLA 2VXRA 2DVDA 1DZQA 3AXDA 2EAKA 1UZZA 3H0OA 5GZFA 3DUIA 3RSJA 5T52A 1FV2A 4GXLA 3NV1A 1FX5A 3HMYA 2P2KA 4ISQA 5LK5A 1MZ6A 2D3PA 4DS0A 1LJ7A 4YM2A 3M3OA 4FVVA 3ZXLA 1V6LA 1GZWA 3PVEA 4AWDA 4XMAA 3OGGA 4XJWA 1CIWA 1WD4A 2DUOA 2E51A 1AX2A 1N3QA 1LODA 2A7AA 3A0NA 3AP6A 3BTAA 3OBTA 4M3CF 3IKWA 1VAMA 3VKMA 1APNA 4RA0A 3SISA 2D7FA 1D2SA 4ASMB 2A70A 1S0EA 2AGSA 5GLUA 3ATGA 2DVFA 3ZSKA 5E88A 3W58A 2NYYA 1W6QB 3ILFA 3NV4A 3ZYRA 1LU1A 4XIOA 3ZXEA 3OYWA 3AP7A 2EALA 1FATA 2ZGOA 3IM0A 1LOCA 2YV8A 3IPVA 2I2SA 2D6PA 3KM5A 4YZ2A 3A4UA 4YZ3A 3D5OA 3N7LA 1S0FA 2R49A 5GALA 2D6LX 2GALA 2YXSA 1UKGA 1ONAA 2GMEA 1VIWB 2DU1A 1LGCA 4YW1A 3U4XA 4RL7A 4ITCA 3OPZA 3R4SA 5HCBA 1AXYA 3HR9A 3LSDA 4BQ1A 4XZPA 1B09A 5E89A 3HN1A 5EYYA 4IQPA 1SLCA 3B01A 4XBQA 1DYKA 3N3HA 1LOBA 1W6NA 2A71A 3C2UA 5DUXA 5CNAA 2D6KA 1GLHA 2ZKNA 3PMEA 4BOWA 4M3CB 5T5LA 2W68A 2ZMNA 1LOFA 2ZACA 1ULCA 1XQNA 5DUVA 4XJAA 5SV8A 1MS5A 2ZABA 2W39A 1YYNA 2W52A 2WQZC 1W6MA 3SITA 1CQ9A 3NV3A 5GLWA 3MPPG 1MACA 1UN1A 2PHTA 1U0AA 3AZXA 4YFZA 1Q8OA 1G9BA 2A6VA 4WVWA 2AH2A 4F83A 4DRRA 1CONA 2ZGNA 3QLQA 1C4RA 1IS6A 3JU9A 1W0OA 1W6PA 4TYSA 3WUCA 4U36A 5H9PA 3RG0A 2AR6A 3AYAA 3BOPA 2DTWA 2D3RA 3B00A 3R4UA 1RINA 2ZHKA 3NV2A 1BKZA 1LOAA 1GZ9A 4YG0A 1CPMA 4YGDA 1X50A 2NN8A 2PHFA 5GLTA 3ZSJA 3SH5A 4Y1ZA 2D6MA 3ILRA 2WNEA 3M3QA 1MS3A 2DV9A 5AVAA 4ZXKA 4FOVA 5GLVA 2VU9A 2WKKA 4CTEA 3ILNA 4Y20A 1N3PA 3O0VA 1AVBA 5EXOA 4XBLA 2WLQA 4FPLA 5CB7A 3FLTA 3FUOA 3IMNA 1Q8SA 3N35A 2JJ6A 4PF5A 4YM0A 1JOJA 1NXD1 2DVBA 1N47A 4R9DA 5DZEA 3WCRA 4R9CA 1FNYA 1MS9A 1RITA 4UW6A 3V0AB 1AX1A 1MS1A 3MW2A 5FREA 1BJQA 4CZSA 3V0BB 1G7YA 3CNAA 1DQ4A 1DQ0A 4PBOA 1Y7BA 4HANA 1F31A 4XMIA 2D6NA 4GALA 1DGLA 1LOEA 2B7YA 4PBPA 2ZA9A 3UJQA 1SACA 2DURA 3WV6A 1GANA 3V64A 5BYNA 1LHOA 1H30A 1TEIA 3R05A 1WBLA 1ZA4A 4OZXA 1FYUA 4Y26A 4C1WA 4K20A 4Y22B 4AGGA 3ZXFA 1Z0HA
chains in the Genus database with same CATH superfamily
1AL22 5FTTC 3JQXA 1O3RA 1XYPA 2ZX2A 3BIWE 2BEOA 3BODA 1HLCA 1MEC1 3K3OA 2O1QA 2W3JA 4UFJA 3VZOA 1NX9A 5C5TA 2VZPA 4XJZA 4IEYA 4IESA 5D8AB 1DCSA 5GZCA 3CEWA 2ZX1A 1VLNA 2BQPA 3WG4A 3DCQA 3ZKUA 1HV0A 5J96B 2GNTA 1S55A 5IUQA 2V5YA 1POV3 2CWMA 2K9ZA 4DOUA 1OKOA 3IAQA 3MIHA 4XFBA 3ACLA 1OLRA 4LUKA 4LK7A 1LHNA 4ZS2A 3ITQA 2X09A 1NZIA 4HKLA 1RUG1 2PTMA 5T5PA 2VVDA 1PVXA 1W2AX 4IV1A 4LO8A 2CWSA 3VZNA 1O4ZA 3SCFA 4UT5A 4OULA 5FYMA 2ETEA 3VD7A 5H9RA 2DWRA 2UU8A 3SLIA 3W5MA 1KJLA 3I3DA 3MFAA 4FXGB 4K6BA 4WM8A 4R4ZA 3VBOA 3VBSB 2C6SA 2R32A 5HPOA 4F8AA 1PO21 1UY0A 2AUYA 4FOWA 4XCBA 4EN6B 1WW5A 5ANNA 3MDPA 4XFHA 4JDNA 3RMXA 2WWJA 4R8HA 1UMIA 3SXWA 1NLQA 1VAVA 4LBQA 1NY71 4AVVA 2PQSA 4K9SA 5A1AA 1US2A 2WSVA 1OOPA 1ZBA1 5F8PA 4IV3A 5L9VA 1I5ZA 1O3QA 5A3WA 3RVHA 3NL1A 3KHBA 2UY9A 5C3QA 4QXKA 4LKEA 3AVSA 3PVBB 5FZFA 2UWCA 1LHUA 2LM3A 2LALA 3LFMA 5FYVA 4CDQB 3AFGA 4Z82A 2FD8A 3K51A 4FI9A 3ZXJA 1UY3A 1VBE1 4BQ3A 3O14A 4I09A 2WA3A 4XFAA 3NKGA 2PHWA 3VD4A 3J8F3 5LBFA 1RUJ3 5C70A 2SBAA 2JDYA 2V09A 3SNMA 4E8DA 4Z2AA 4NMIA 1D4M1 1ZZCA 1OQ1A 3MYXA 3VHRA 3VDDB 4DQAA 2FDKA 5FZOB 2VMDA 3BTYA 4AAXA 2C0ZA 2VMFA 4IEPA 2ZEZA 4AVTA 5BY5A 4XFIA 5ANQA 3USUB 2IFWA 4ZZ5A 1OBNA 4FPGA 1UPIA 1LOGA 1JTZX 2DCYA 2ZZQA 5JZGB 2PHRA 5DG1A 2ZGRA 3DYPA 1CWPA 5CAZA 1MZ5A 2GSYA 1RUC1 3PUIA 5C6CA 5JCTA 3QCWA 1WA6X 4D69A 4CDUA 5FJKA 1W2NA 5CFDC 3V0BA 1YEWA 2DUPA 3NKTA 3VDAA 2PELA 3OYWB 5ACA1 5L7OB 2ET1A 3ZFFA 3KCYA 4H14A 4QPIB 2Q8CA 3WNPA 4XC9A 5FYZA 4AI9A 1TG7A 1RUI3 3JBG1 1VBB1 4M4RA 2WN2A 2EXIA 4NE9A 2CNAA 4XUOA 2R30A 1F15A 5A6ZA 1OPMA 3NJVA 2DTYA 5BNPB 2RS11 3LA2A 2JE7A 1YQ6A 5F3IA 1UZYA 3LOIA 4AZZA 3POEA 1Q8QA 2ET7A 2VBBA 4Y5SA 5DG2A 4HLTA 5GLZA 5JSPA 4KMQA 2H0BA 5KXBA 3VGIA 1CESA 2E7AA 2YUEA 2DBIA 1ZRRA 4H2AA 4IW3A 3AYEA 2VPVA 2Q1MA 2ARXA 3FX3A 1XSQA 1K5MA 1OVSA 4P14A 3ZYJB 1Q56A 3B02A 4QX3A 4V1PA 4YGBA 4Y4YA 5K0UB 4QX0A 2VCAA 2YBKA 4M01A 5I8TA 1Z7S3 4N8MA 4NHKA 4JGYC 2ZGMA 4QGMA 1V6KA 4COUA 4EWAA 2HH9A 4JAAA 2AREA 4N9IA 2DVGA 4AFMA 4N7IA 2X5IC 5LBEA 4AW7A 4XUTA 1DLCA 1U12A 3E5UA 1V9U1 4AOCA 2E33A 1AXKA 4GKXA 2ZBJA 2E7QA 5JXJA 1PVC2 1A8DA 1BBT2 5EZWA 1WD3A 5IAVA 4BU2A 1Y43B 2XHKA 2P34A 3NJXA 5KHHA 3IMMA 1EUTA 3VBHC 3JD71 4UF0A 4BA6A 2R0FA 1GP5A 2FDHA 3V65A 3MUY1 2XL9A 5KWRA 2BTVC 2BYVE 2ENRA 3FMGA 3KVAA 1PK6B 4OZOA 1HQWA 4LA2A 3WP6A 4NHXA 2BRTA 4WVZA 1X9PA 1ULGA 1RUH2 4N9HA 5FY1A 1XE7A 5HXVA 3BN6A 3IDAA 2H6CA 4U2AA 2GNDA 1QEXA 5FBZA 4YZ1A 1N1VA 3H42B 4JCKA 5FYUA 1MEC2 4K1YA 1KDMA 4QHOA 2WT1A 5CKNA 1JU4A 2OVUA 2A73B 3OJBA 4D8MA 4CU7A 2R061 3CMGA 1UXXX 4JGZA 1WW4A 1NCQB 1NUKA 2LS6A 1CR7A 4RQPC 4AXOA 1WA4A 1GUIA 5HBAA 1JZ2A 4YWAA 1OA3A 1EY2A 3WDWA 3M3CA 4FPYA 3DXTA 1CAXB 2Y38A 4Y5Z0 3UYJA 5BV6A 1B35C 5A7QA 1IZ3A 1NOVA 1DQ1A 1HRV3 1H4HA 4IGOA 2Z69A 2Y8KA 1TZOA 4M0NA 4M3CA 3WP5A 3VDDA 1RUG2 2TNFA 4Z1VA 3ZR5A 1OKQA 4YW3A 3UJOA 4CUAA 4KI5M 2QQWA 1BBT3 3ZVXA 3QOPA 3H50A 3ZMOA 4CYDA 1QJFA 4CDWA 2VE1A 2WAOA 4OLLA 4CP9B 1VBC1 3WCSA 1GOGA 3USUA 1NA1A 1WCQA 3AKPA 3DGTA 4LOSA 2IVIB 1X7NA 2QJVA 1XOYA 1PO22 2QUOA 4GMP1 5FZDA 2P3JA 1Q43A 1CPNA 2PN5A 4FT8A 4GIQA 3OD4A 3MFCA 4W50A 5C9AA 1RUH3 2UWAA 1NY72 5L7OA 2D3SA 3WDVA 1HQLA 1ZBA2 2VUCA 4WZCA 2E7TA 1MEC3 2TUNA 2VO5A 2YHJA 4IV1C 4QKNA 5C3PA 1C28A 3H8OA 1SG3A 4LK6A 3H8XA 4TWTA 1GZWB 1QU0A 1V6OA 1ULOA 2VG9A 4YLZA 5BUVA 2PHXA 4Q0VA 4ZU7A 1RUNA 1JYCA 4WM8C 3N7KA 4Y1YA 4YG3A 3RZKA 4DUVA 3NJZA 5BNPA 2J42A 5HV0A 1W9FA 1VBE2 2JECA 3LPFA 2Y6JA 4NO4A 1R64A 2G4IA 4NRQA 4CSWA 4JZRA 3KT1A 1DIWA 1H2LA 5IT6A 2Q4SA 4I2OA 1RUG3 2OQ6A 2IXIA 1D4M2 3E5XA 5T5OA 1QDOA 3RWNA 3AYCA 3ZXGA 4ET7A 1OOPC 2KA3A 1DLLA 4IV3C 1J83A 2C26A 2ES3A 2PLV1 4LOTA 5F3CA 3I3EA 5K0UA 5L9RA 1YRZA 4P5YA 3WG1A 3U75A 1JYVA 4XTPA 4HFSA 2WJSA 4LTAA 5JIUA 4XDQA 1RVF1 3WNLA 3EQEA 1L3JA 1JOPA 4CU9A 2YBSA 2VQ0A 1GSLA 1PO23 4Q0UA 3T08A 4PHZA 1UU6A 4FSJA 1RUC2 3FBMA 4UFLA 4F3JA 2CTVA 3BPSA 2FDFA 1U5XA 1OFSA 3ZDSA 5ERLA 4XAAA 5A3UA 1DGWA 2QVSB 3VBRB 5ABJB 1UY4A 3FBYA 2JKBA 1ZBA3 3THCA 5ACA2 5F5AA 3BOWA 3HJRA 3WG3A 4M00A 5FXVA 4WVVA 4X6RB 4CEYA 3KV9A 2VR4A 3ZYPA 2BBVA 2QE3A 2QQLA 4RGKA 1JHJA 4UFIA 4QKBA 5C5UA 4XBNA 4OI0A 4UXAA 3GBFA 1AHSA 3JBG2 1GICA 1VBB2 3LEGA 3T1MA 3O1TA 1DQ6A 1RHI1 1YXWA 2P5BA 1VBE3 2R1BA 5F32A 3E97A 1F35A 1ZNPA 2JB8A 2RS12 3A0KA 3JUUA 1W2OA 4K1ZA 3UKVA 1RMU3 1A8MA 2W46A 3ELNA 3IIIA 4S2HA 3WHUA 2VW2A 2JE8A 1GBGA 3O0WA 2WZPP 4CDUC 3ES4A 2DYCA 1W3VA 1T6GC 1FPN1 3GBWA 1D4M3 1H4GA 1YJLA 5EWSA 4QKFA 4H55A 2HWD1 2IFRA 4XF4A 4DINB 2W91A 2F4LA 5A3LA 3ZFFC 4LMFA 4CCNA 3HNYM 1REEA 2YGLA 2WNVA 2VTXA 4DNYA 5C8WA 5FZLA 1JYNA 1NQDA 5C3RA 1C1FA 4CDXC 1AX0A 3ZM8A 1GMMA 1LECA 2D40A 1OSGA 2XQXA 1TMF1 1C8NA 2XWBB 1NLSA 2DCKA 1TNRA 2TEPA 3PJQA 4IE0A 4IUGA 4OHWA 4DFSA 4TZDA 1O5LA 1RUC3 1UWWA 1H6YA 1R083 1OPOA 1V9U2 4YG6A 4AR2A 3NWKA 3RNSA 4L8QA 4LKDA 4QQPA 1CAVB 5ACA3 2QQOA 3NAPB 5A6XA 4CEWA 3I2GA 2YFUA 2V5DA 4KL1A 3IN9A 3ACHA 1DBNA 3LDBA 1K5MC 4I0AA 3JD72 2NMNA 4Y1UA 2VXRA 4FO9A 1NAEA 3LEMA 4K8FA 4PF1A 2FDJA 3H0OA 3HQUA 5GZFA 1YUDA 5FZ0A 1QQP1 4AK3A 3CJIA 5KHKA 1FV2A 3SQOA 4HMZA 2RS13 4QQ2A 5EJZB 5LK5A 1MZ6A 3P3NA 3OEBA 5C33A 4BZ4A 2VAUA 4HBNA 3PURA 3M3OA 3HWJA 2WQ4A 4OUSA 1YI9A 3ZXLA 3DKQA 1GZWA 3CBNA 4AWDA 2QFEA 4JKMA 4B1LA 4CPBA 2R062 1WD4A 3OBTA 2JIJA 2TBVA 2RS51 3VBSC 1QJX3 4M3CF 4OI2A 1X33A 4B7EA 4BK4A 1APNA 4BISA 1LAJA 2VQTA 2D7FA 1H1MA 4JQRA 5FO7B 4XF3A 3MF9A 1ZZ9A 1XNDA 3TN91 3H1WA 3ZSKA 4COVA 4KWLA 1NG0A 3ZN6B 4BE3A 2QCSB 4IGQA 5IHRA 5KHJA 4QU1A 1DP0A 4D7TA 5EIYB 4QDSA 3PLQA 1V9U3 3MF6A 5J98B 1D7PM 1GWMA 3IM0A 4LIUA 1OD3A 1W8ZA 2BDRA 3IPVA 2I2SA 2JG8A 1VBC2 3N7LA 4BQ2A 4JGZC 1OUXA 4RN5A 3JD73 4BJ0A 3N9PA 3EXUA 1AR93 1KFXL 1ONAA 3OGSA 2DU1A 1LGCA 5HXMA 5EP9A 1O59A 4RL7A 4ITCA 3POBA 3WNKA 2ZEYA 3R4SA 3WEZA 2BERA 1AXYA 1ST8A 3M70A 5FY4A 3VBRA 4BQ1A 5ABJA 5E89A 3HN1A 3WQBA 4META 4JKLA 4MVTA 3VDDC 4BIFA 3N3HA 1OMIA 5DUXA 2FBEA 3HQRA 2D6KA 1NCRB 1RJ7A 2R063 3PMEA 1VBD2 3AB0A 5J36A 3BUCA 3E5QA 2OT7A 1UIKA 1IG3A 1IPKA 2L9LA 4MX3A 1NA1C 3UT0A 2YPJA 2G9FA 2W52A 4IEUA 4LITA 1W6MA 1OLQA 2AC1A 4HK9A 4EROA 1AYM3 4LO7A 3ZR6A 5LB6A 4GH4A 4MGYE 3UGGA 5C9AC 5I0SA 2BGPA 5JXGA 3VDBA 5L7OC 1XNCA 3QLQA 1IS6A 4O9EA 4TYSA 1POV1 2W1UA 5A7PA 3WUCA 4CP0A 4EWDA 2PLV2 5H9PA 3AYAA 3BOPA 4WVMB 2D3RA 4RR3B 1O4TA 4ZONA 1ND3B 3NV2A 4YYOA 1UU4A 3AKSA 4E4ZA 1RVF2 4I0WB 5CKMA 2P4EA 1X50A 1YFWA 2VZ3A 5A6YA 3RYPA 1RUOA 2OXBA 4GMP3 4PDWB 4CXYA 2D6MA 5BNPC 3M3QA 4COZA 4Y20A 5BNNB 5DAVA 1N3PA 5FPUA 2O14A 1RXFA 4XBLA 5FMDA 2ORXA 3N35A 1VB4A 1GFF2 2EA7A 3AKQA 4JDOA 1C3HA 1MPXA 3USSA 5LEJA 5C7GA 1L7RA 1NXD1 1DF0A 2PA7A 4R9DA 4D0QA 4OHYA 1FNYA 1RITA 4MXWA 2BU9A 3ZYBA 4DY3A 5K0UC 3V0AB 1AX1A 1DGRA 2XWJB 1VB2A 4CZSA 3VB9A 2IXLA 2KR2A 5DABA 1K3IA 1RHI2 2LUWA 2ZJCA 4HANA 1F31A 4XMIA 2OPWA 1VP6A 3HD8B 4DIQA 1LOEA 2F6BA 2MNGA 2Y6HA 2JDPA 1YFYA 3LB9A 4RFT0 3UJQA 2BP6A 2XBO1 3DKWA 4HSLA 2P17A 4BDVB 1GANA 3CKHA 5LWBA 5BYNA 2WQ8A 3S6PA 1TEIA 4XCAA 1FPN2 4DXSA 5F39A 3K2OA 2RR13 5A32B 2XPJA 2HWD2 5FZEA 3C7OA 5IYYA 3H3ZA 4XFCA 1Z0HA 4CEYC 1LEDA 3J8F1 2QTWB 1RUJ1 1XYOA 1XJAA 2NLRA 2VOWA 1OT5A 5FZ1A 1JXNA 4WM7B 2Y0OA 4MHUA 1IS3A 3SKJE 1DGRN 1RVF3 1JU3A 1AL0G 3KT4A 3P6BA 2VZQA 3ZN6A 1TMF2 1GNHA 2HBUA 2HWC1 5H9QA 1GQPA 3PIJA 5D2AA 2RVAA 4QT6A 4V2WA 2J1EA 3OSDA 5LA9A 2YB7A 1LNSA 4XQ4A 1UOFA 3M4FA 1RUD1 4QQLA 2Y34A 2HWF1 2EXHA 3T3YA 1UQXA 1IPSA 2CDOA 1Z78A 4FPHA 3S7IA 4QX2A 3N7MA 2VM9A 3C3VA 3AMNA 3TNPB 4CA9A 3S5AA 1SLBA 4E27A 4IXLA 2BFUS 2VOKA 2WNVC 2CY6A 3OGJA 1V6JA 1F8VA 2PXJA 2GMPA 3HOBA 2PMWB 1QQP2 2W92A 3VV1A 5I0RA 2BPA2 3POWA 3VZMA 4AQ6A 2FZ1A 4YW2A 1RUI1 1GKBA 2OZJA 4Y33A 4I30A 5FZAA 1W9WA 3GGLA 5T5JA 1OD5A 4P9XA 1FPN3 1NCRA 3FUQA 4PQ9A 3I49A 4AVSA 2HWD3 5C8CB 5DXDA 5FZ4A 1N1SA 3LKJA 4CEWC 4NIIA 2RS52 2VZOA 1G9AA 1XE8A 5HCHA 4AFBA 4B4RA 1D4VB 1KXGA 1AF9A 4LBJA 2AZ5A 1JYXA 3WF0A 3TN92 5CBLA 5CG9A 2EICA 1TMF3 4BLJA 2F17A 2QKDA 2E6VA 3BKZA 1VBA1 3CJIC 1YIPA 1CJPA 2V4VA 3I2JA 5JPNB 4MGIE 3RRDA 1HX6A 1EPWA 4Q5OA 4XTMA 3T09A 1Z7S1 3FLPA 4M4PA 4P00B 5FP9A 3K4ZA 4Q1PA 2RV9A 3ROUA 2WINB 4W6XA 5GZDA 3QD6A 4EYUA 2C5DA 2HWB3 1ND3A 4DPNA 1OF3A 3A22A 3TAYA 3LQCA 3I2IA 2WABA 1XE0A 3AVRA 3NNMA 4L99A 4AI2A 2WYSA 3I2OA 2VCCA 3BVCA 1RC6A 4NAOA 4XJUA 3HAGA 4GWMA 2VXJA 2QZ2A 3T2TA 1A34A 1PMIA 2X05A 4UAPA 4LE4A 5FQ0B 3SKVA 2W1SA 2BOIA 2ZHNA 2XOMA 4OFGA 1PMHX 1QNWA 2BW8A 2XDVA 4KWKA 2OZ6A 2WNUB 4YW5A 5IVCA 5DQ0A 5I8SA 2JG8C 3RS6A 2HEVF 3OF1A 2NZ9A 2A75A 2VVFA 2VZ1A 3NJYA 3W21A 4AEMA 4FAHA 5BNOA 1WCKA 2R6QA 1CZTA 5FP8A 3WW4A 1VALA 5I8YA 2J1AA 4IE5A 1NT0A 1YIFA 1QJZA 2WO3A 2UURA 1S2EA 3AP9A 2IXJA 3KCXA 4FPCA 5FLIA 3B93A 5FXXA 3VBRC 5A1LA 1YLLA 3OTFA 1SPPB 4QQHA 4ZS3A 5ABJC 4TLGA 1L7QA 1WMXA 3Q8EA 1Y9MA 5LATA 5EV7A 5T55A 4M0HA 1J84A 2W95A 1HRV1 1JH5A 2VJXA 5JI7A 4WM7A 2BVVA 3L9JT 3NRUA 3KVBA 3D8CA 2GNBA 1WMFA 5AC91 5KHGA 4XYXA 3LCPA 3TEYA 2P3KA 2Q5TA 5JLVA 5FBJA 1QJU3 4RQPA 1R1A3 1QH7A 3KWVA 2BFUL 1TVGA 1W06A 5F5CA 4C0BA 3HNBM 5LY2A 2A6YA 4SLIA 1DFQA 4GH4C 4QX7A 1GZCA 4P9GA 5A3NA 4HKOA 4Q0QA 3NNJA 2XQRA 3OGRA 1RTVA 1Y9QA 2XMLA 3L2YA 5I91A 3WW2A 3GALA 3HN3A 4MADA 4XFFA 5I0DA 1CAUA 3A21A 3DPRB 2VUAA 1HRI1 4DY5A 1IOAA 4FPEA 1W6PB 2XG3A 4G3YC 4LR4A 4LORA 3B9IA 3OPWA 2HEYF 3U10A 2Z42A 1W6QA 2CAVA 2DBNA 3VD3A 2WFF3 1XRUA 4FPOB 1SCRA 2C4XA 5JUVA 2XBO2 3KQRA 4BMEA 2QQVA 1ZZ7A 1W8HA 4OI1A 4Q29A 4QB1A 4EZHA 4LBQD 3S5QA 2RM21 1D0GA 1EAH1 3J8F2 5FKBA 1RUJ2 3BALA 4FFGA 3WW1A 1NYWA 1V6NA 4QGNA 3DYMA 4RHV1 2BNMA 4A6SA 2V72A 1HN1A 1YO8A 2Z2SB 2V4AA 5DUWA 3GF6A 4MGQA 5M0TA 2HWC2 4FOQA 3POYA 1SBDA 3FFZA 3MLKA 3ZPYA 4CP2A 5DN2A 1W8OA 4Q0SA 3LIGA 1KJRA 2PAEA 4LJHA 4Q0PA 2KM2A 4NAMA 3VN4A 4QD2A 1RUD2 1ND2B 2HWF2 4HPKA 3IIAA 3UL2A 3WLUA 1NQJA 1T2XA 4DXRA 3T4VA 1LENA 1YNAA 5IWFA 3S30A 3UGHA 2ZX4A 1OI6A 3V56A 3ZFEB 1ZM1A 4JDMA 3WNNA 2XLFA 1SDDB 4MGTA 4EZ4A 4AVBA 4LXLA 4P9WA 1CAWB 4E4SA 1UW8A 4DB5A 1RUI2 1REDA 4FTBA 1I1EA 4AGRA 2VL4A 4H7MA 2VCMA 2XBO3 4QGLA 3EYPA 5FMBA 5FWJA 1JZ3A 1LB2A 3ACIA 3T30A 2H6BA 2JG9A 1WKYA 3C7FA 4AVCA 4L97A 1UYPA 1GOFA 3T2OA 1GR3A 1NZCA 5F1RA 1WCSA 1RMU1 1AYN3 2YYOA 2JD4A 3EB7A 2PAKA 3G7DA 1WLWA 4D6QA 1WMDA 2GC0A 3PDQA 1G9CA 2EXKA 4N43A 2XJPA 4I3GA 2HWC3 4FAGA 1H8TA 4Q8LA 1VBA2 2J1VA 1SLIA 2XVLA 2DF7A 3D82A 1QNYA 5J3UA 3ON7A 4Q4Y1 1K5JA 4AEKA 1SFNA 1Z7S2 2A3YA 5F5QA 1VRH1 1RUD3 2HWF3 4KWUA 4PLMA 1S4CA 1PHMA 5DZFA 4ZZ8A 1S0BA 2D97A 3VBFB 3RGBA 1D0HA 1NCRC 3ETQA 2ZX3A 5FYTA 3VD5A 3ZMNA 1UZ0A 2WZ8A 4W6YA 5FZHA 4CCDA 1QHDA 1R081 1BYHA 3HNMA 4P9JA 4YM3A 3TYJA 4YVSA 5GJ6A 1G9DA 2YMZA 2A6XA 2D43A 4Y1XA 3N9MA 3EBRA 3SMHA 5K8SA 1ODNA 1QXRA 4QPGB 2VC9A 3WQ0A 1T6BX 3F2ZA 4CDXA 2GC2A 4AQ2A 1W2TA 5KC6A 5L36A 5C3OA 1H2MA 4QXBA 4RFRB 2FMYA 1OURA 1V6IA 4E2SA 1HW5A 1WLDA 4Y22A 3OUIA 2W1WA 5FYHA 2GMMA 2QQPA 1ND3C 3M1HA 2X8KA 2FDIA 1N1YA 1PIV1 4YW7A 3OEAA 2ZZJA 5A33B 4QXHA 4W6WA 4RD7A 1X36A 5F9TA 2H0VA 4TXWA 1J3PA 1CJDA 5D8AA 4JHZA 3Q8CA 5FZ7A 5IVBA 1DZTA 1W8TA 4XZUG 4XF9A 1QJX1 1VBA3 3ES1A 2YY1A 3SEPA 4XFGA 1KRIA 4X8PA 2XR4A 1N1TA 4K20A 2X29A 2QDNA 5F6KA 3T1LA 4ATEA 4ARYA 1ZRCA 2J1TA 4NIGA 1QDCA 1JUHA 4PQQA 1HRV2 1JBCA 1H0BA 1W3XA 4YPJA 3ZFGB 5EHDA 3O1MA 1FV3A 1A6CA 2VY0A 3P1IA 3PTRB 5JOWA 1H9WA 3W59A 5AC92 3HBZA 4JX0A 3H1MA 4COWA 5BNOC 4Y3OA 2GH2A 3DEMA 1ODMA 1G8WA 4B4PA 4YZ5A 1IS4A 5JOXA 5FKCA 1COV1 3VBSA 4YFWA 4GKYA 1PZ9A 4BQYA 1C1LA 1S0IA 1W8UA 2IXHA 1ZRIA 4ZY9A 4DMIA 1AR91 4DUXA 1K42A 3K4AA 3N36A 3GNEA 4MG2A 3MICA 3X29B 2JDMA 5FPZA 1MS8A 3GJAA 1MVQA 2QDRA 4WM7C 4GWIA 1SMVA 1Q8PA 4A41A 1HRI2 1RYYA 1LR5A 3VL9A 1JYIA 3VBUB 5F3GA 2B9VA 4DEVA 1PGSA 4KGQA 3FC0A 1LGBA 2CU5A 2DCZA 4WBBA 3EMRA 4C0HA 5FZBA 4HG6B 3VDCA 4CDQA 1UZZA 4L0PA 5C71A 2WBKA 4OUMA 2BNNA 1F5JA 1OLME 4QHBA 5D1IA 3SEEA 4GXLA 4XETA 3AMMA 5JPMB 2IXKA 2P2KA 1AYM1 2PFWA 2RM22 4DS0A 1EAH2 3E6DA 5IVVA 1LJ7A 1W9SA 4YM2A 3WP4A 4RHV2 4L11A 1PO11 4HK8A 5AC93 1V6LA 3MV11 5FZOA 1C8M3 4YVWB 3OGGA 2DUOA 1QJY3 1N3QA 2A7AA 1LODA 3AP6A 4AFAA 4TSVA 4NWVA 3SCGA 5J37A 5AFEA 2RMU3 4Q4X1 1CZVA 1D2SA 5JZGA 2VTFA 2A70A 2WO2A 4P9LA 3VBFA 1S2BA 2KXLA 1IG0A 5E88A 2EIDA 1V0AA 1K45A 1UD1A 1IQDC 2C9KA 2NYYA 3O1VA 1BMV1 4GB33 4XF0A 4MUVA 3ZYRA 1RUF1 3ZXEA 2LRPA 2CAUA 3OYWA 4LLFA 1BK1A 1W8FA 2ZGOA 1HRI3 2JENA 4QPIA 1E5IA 3RI8A 1SDWA 2KD7A 5F6LB 2WWUA 3D5OA 2MEV3 1S0FA 3U37A 2WS93 5GALA 1UYYA 3ZYFA 2YXSA 3ZIXA 2GMEA 2RS33 1TNFA 1HQNA 1UO9A 1VIWB 1XSRA 4YW1A 3PHMA 1FT9A 4KGGA 3OPTA 4PIXA 4A45A 3THPA 4H7LA 4D6SA 3IDBB 4BCUA 2Z79A 3HR9A 4CCJA 2RM23 4X8NA 1RMU2 1EAH3 1WCDJ 4QB6A 1DYKA 4RHV3 4YSFA 3SHRA 3WF4A 4UI9L 1NE4A 4K8RB 2O8OA 2RR11 4CCKA 3WQ7A 5L19A 3FWEA 5FMOS 3WY6A 5T5LA 4CXXA 2ZMNA 1LOFA 1OXCA 1XQNA 2CGOA 4XJAA 1K12A 1MS5A 1O6UA 5DAXA 4LQRA 4Q4Y2 2XJUA 2CHHA 3SITA 1PX3A 1GP6A 1VRH2 5FYCA 3GCXA 3KS7A 3MV01 1O8PA 4UOJA 2JG9C 4BQ4A 3OUHA 2PHTA 1U0AA 4Y4RA 3U11A 2Y26A 1Q8OA 3H7JA 4NPMA 1G9BA 4WVWA 1R082 5JMOA 1KS5A 4RGAA 4DRRA 1CONA 5LY1A 1HB1A 3JU9A 2WDBA 3BTZA 3RG0A 2AR6A 1PM4A 1ZREA 2VNGA 3PMSA 4N43C 1UU5A 1RINA 4AL9A 1J1LA 4IE4A 2JD9A 1H8TC 2VUJA 2Q1ZB 1CIYA 4PI2A 5SV5A 2NN8A 2PHFA 1RUE1 1PK6A 2XVGA 4MGSA 1MS3A 2E26A 3QH6A 4MH0E 1VPHA 4XABA 4FFHA 4HKWA 3WW3A 4K40A 2ZEXA 3ZXAC 5A7WB 2WLQA 1PIV2 3FUOA 5FK7A 1Q8SA 2J1UA 2YC2A 2IXCA 2OIIA 2VCBA 3LA3A 2ZEWA 4YM0A 4YVSC 3Q8AA 1NCQA 3WCRA 1JZ8A 2YC0A 5FLJA 4UW6A 4B1MA 4IE7A 1MS1A 3MW2A 5FREA 1QJX2 5A6QA 2YFZA 1AUYA 1G7YA 4LHSA 1CAXA 1CD3G 1DQ0A 4Q4Y3 2YDEA 4E8CA 4CVUA 3CQOA 3ZXDA 3TEZA 1VRH3 2DDUA 5F3EA 1REFA 4DXTA 3AL6A 2B7YA 2GC3A 4K7JA 1S2KA 1SACA 2DURA 1H30A 3R05A 1QXJA 5APAA 4OZXA 1NKGA 4CPBD 1FYUA 4JRLA 4P08A 3FL7A 5JAXA 1CZSA 1RGSA 3ZXFA 2HWB1 4CP9A 5D8AC 4DO0A 1COV2 1LKNA 2ZTNA 2DCTA 4KU7A 5T52A 4URTA 4XW3A 4D7YA 5JXIA 1JW6A 1HDKA 4COYA 5KR7A 4NIDA 4QX8A 4W65A 1AR92 1X8EA 3PNAA 3WX5A 1L7LA 3JXSA 4XE9A 4GWJA 3VKLA 1OUSA 3MIGA 3AZZA 4RS5B 4XURA 4E4DX 1HB2A 1SEFA 3R4DB 4JTNA 5LK7B 1PZ7A 4BLIA 1IKQA 1PIV3 5FOJB 2OW4A 2Z5WA 2VW0A 2ERFA 2CDPA 4L2NA 3HIFA 1E5SA 4IERA 3IZOA 4BXSV 4A4AA 2VOVA 3FE5A 4D3WA 2BV4A 1AJOA 1MS4A 1YQ2A 5FMOL 4C90A 2WZR1 3K77A 2ZMLA 1AYM2 1OQEA 1ZYBA 3AZWA 2W87A 3H7YA 1H6XA 2WR9A 3OBAA 1PO12 4G4FA 5LASA 5GZGA 1JZ4A 5LW9A 1GWKA 1EP0A 5KHIA 1QKQA 2YC4A 3RQ0A 2VQAA 1F9KA 3OY8B 5DUUA 5CADA 2Q8DA 1COV3 2IUWA 2MHFA 3WVJA 1AXZA 3WDXA 1AR63 4Q4X2 5BPXA 4AI8A 2UY8A 3DV8A 1F4HA 3I2DA 1YJKA 3M3EA 4P5HA 4XXPA 4CDQC 4ASKA 4Q2FA 5FY8A 3RYKA 3AMHA 2RHPA 3NNFA 5FFOC 2AEZA 1QJU1 1W39A 1BMV2 2WWSA 4MZUA 1QXPA 1R1A1 2WUHA 1M4WA 1D2QA 1RUF2 5DMYA 3ZSMA 4NROA 5T54A 5C4WB 2QQMA 1YWKA 2GN7A 1KQRA 3WHTA 2FDGA 3GBGA 3VHNA 4XDOA 2R1DA 5I0UA 1XB9A 2B46X 4GA9A 5KXEA 4FFFA 1UZWA 3T0AA 2ZGPA 2OYZA 4GJYA 5FOBB 5JZGC 3VBFC 2SLIA 1LU2A 4EV0A 5GZEA 1AR73 3I2HA 2WFF1 3B69A 1H9PA 1LESA 3CDZB 4LHNA 4B3NA 2NM1A 4EJRA 1JUIA 2WSUA 4XHXA 3RWKX 2C1FA 1PO13 1HKDA 1PNGA 1SLTA 2WIIB 1HN0A 3CHXA 4NRPA 3MW4A 2VZSA 1MVEA 3KV5A 2RR12 3AMPA 4QPIC 5CFCB 2BBAA 2HJIA 3JB4C 3VD9A 1QWRA 1S0CA 3KD4A 4UWDA 4Q4X3 1EPZA 3RJRA 4LKSA 5CFDB 4P9YA 2QQIA 3AK0A 4AEDB 3AJZA 1QGLA 1SCSA 2D93A 3J7MA 1DQ5A 3VZLA 5E8AA 5DPNA 2BUKA 5IAXA 1RB8G 3ACGA 2A6ZA 3FLRA 3TRSB 4IETA 3SH4A 3I59B 1ACCA 1RUF3 1BEV1 4HOOA 1WUVA 2BNOA 1CAVA 3NAPA 4XACA 2OA2A 4ASLA 1UX6A 2GAUA 4J6GA 4XPVA 1W8WA 4NHMA 3FFQA 2D5FA 1PX4A 4QM9A 3INAA 2VH9A 2Q30A 4HVOA 1LOFC 3MIBA 3ZLIA 1W6NB 1QY4A 2VW1A 4UBHA 5FPXA 5LRSA 1W8NA 2ZPXA 1RUE2 3VKOA 4BWOA 3A7QA 1N3OA 2OPKA 4OVEA 5FY5A 1UL9A 2R16A 2WO1A 5KXDA 3BTXA 3C7EA 3KLSA 2K0GA 2XGXA 2DVAA 4BK5A 1E57A 4QM8A 4BQ5A 3MLLA 5FYSA 2VUDA 2Y0IA 1EUUA 1DYOA 2A1XA 4JGYB 2ZOEB 1I3HA 5DZGA 4CUCA 3T2PA 3F95A 1AYN1 2X5IB 2R043 3LIHA 3ME2A 3D6EA 3N7JA 5BNQA 5A3MA 3QACA 3MLJA 4B7KA 4FP2A 5J09A 1PK6C 4UW5A 3MIFA 1UXZA 1KDKA 3VUOA 4QDQA 1BVVA 2ATFA 3TEWA 1UCXA 3VBHB 1KGYA 1J59A 1S0JA 4CXWA 2WT2A 3PJYA 3AJYA 3J9SA 4Z07A 5FUNA 3U0ZA 3FZ3A 2HWB2 5CYYA 2B39A 2UYAA 1NCQC 3HQXA 2A3WA 1Q8VA 4XXAA 2EXJA 1IPJA 2CV6A 3M2MA 2EIEA 2NPIA 3E6CC 2XUMA 1GP4A 1QOSA 1RUE3 2JXAA 4QX5A 1ZRFA 3WNXA 4LHKA 5B4NA 2IC1A 3GDBA 1UF2C 4NJ4A 5JSOA 4XOGA 1G9FA 1MZFA 5C4WA 2W1QA 4FOYA 4OMDA 1W6OB 2P37A 1HB3A 4AHWA 1ZZ8A 4YVWC 5IVFA 3NQHA 3WF2A 4S2FA 5FPVA 5A70A 4XUPA 2VZVA 1F2NA 2R073 3QBQA 1B35B 2JIGA 2O8QA 2ARAA 2Y60A 5FO9B 1YQ5A 2FCUA 3DL3A 3RYRA 2ZHLA 2E31A 2UYBA 5A1FA 1ZA7A 4Q8KA 1CX1A 2WRAA 3I8TA 2WZR2 2E9QA 4MYEA 3VZJA 4GD4A 1DQ2A 1DG6A 2DUQA 1KFUL 3U07A 4XEZA 5FV3A 1QF3A 1LHVA 1RJ8A 1J1TA 5CFCA 2WFPA 1RIRA 4WVMA 2ARBA 2C24A 2YZ4A 4RR3A 2EIGA 3M7AA 4DRVA 4I0BA 3O1OA 2JDAA 5F2SA 5IW0A 2FHRA 1J3RA 4AEDA 1LTEA 2RJKA 4HSJA 4XHBA 2VBDA 3THTA 4PDWA 3CJXA 3OCPA 3ST7A 3WNMA 5FYBA 2Q0AA 4QB2A 4Z92B 5EYXA 1QJU2 3I59A 5BNNA 1H1AA 4S2GA 1R1A2 4IV1B 3IBMA 3N4MA 1XNAA 2QQUA 3J26N 3H3UA 3RI9A 3OOXA 1SFYA 3VBOB 4WM8B 5LBBA 2VULA 1S0DA 3J7HA 3V0AA 1GOHA 2P1BA 3O1RA 2XLGA 1DHKB 4QKDA 1M06G 2GDFA 4WV8A 3WZ1A 1ZZBA 4W8JA 2VNVA 1FAYA 4LE3A 3U14A 4LBQB 3AZVA 3OD0A 4LIVA 4CCLA 2WZR3 2G19A 2WFF2 5FP3A 4IV3B 2GH8A 2QQKA 3WSOA 3PIGA 5FZ9A 2GN3A 4O7XA 4HVRA 3TB0A 3UK9A 5IATA 2ZGQA 3LSEA 5A32A 4AHZA 2P3IA 3WQ1A 2V73A 5KBFA 1LULA 5L73A 2N7GA 1SLAA 2VECA 4M3CE 5FAXA 4BXFA 5A3PA 1VMHA 4X6QB 4Q26A 3LZZA 1UOGA 4UFKA 3MO4A 4AGVA 5FR3A 2RDRA 2XJSA 4Q1RA 1U5ZA 5IFTA 2HYKA 4CE8A 1C8M1 5F7UA 2D5HA 4EN9B 1FNZA 1X82A 1QJY1 5FZGA 1U5YA 3T2QA 3BGAA 3W20A 3S57A 4Q4W3 3APBA 1ASJ3 2BGCA 3GM8A 3R6SA 3VHOA 2RMU1 4IDZA 3DYOA 1BEV2 2VMIA 1UMZA 3I7DA 1UY1A 4NIAA 4NWWA 5JVVA 1SFPA 3PL0A 2XJQA 2ZGTA 2LROA 4FXKB 4YARA 1Q3EA 3B3QE 4O65A 5DAPA 4GB31 1XBFA 3GHNA 4JKKA 5T50A 5DDJ1 3MPBA 5FPBA 4Q4V3 3I3BA 3U4SA 2AENA 3D0JA 4UFMA 3ZDVA 1O3TA 2VBPA 3ZOIA 4J1XA 1ZX5A 4CDUB 1TME1 2Y6FA 4ARXA 1SBEA 4LA3A 1PM7A 2MEV1 1C5HA 1W6OA 4FPJA 1QJEA 4LEJA 3RZJA 3UKNA 2WS91 1XC6A 3O0XA 2RDNA 4JC1A 4W4ZA 4KH9A 2AYHA 3AZYA 3KSCA 4NHYA 1GNYA 2RS31 3ZFFB 5CEHA 1IKPA 1AJKA 2GU9A 4A6OA 2FCVA 3JCIA 4KBBA 1O3SA 3PVOA 5C8CA 3CO2A 3NAPC 1JS9A 4I02A 4A44A 1BK0A 1H2KA 1P8JA 3B94A 1O5UA 2YROA 4Y24A 2OS2A 3LDKA 2XUEA 3PVNA 5EJ3A 1GWLA 1AYN2 1SZBA 1ULEA 1V00A 3I4IA 4AAPA 3T0BA 4LPLA 1MR5A 5BXXA 5F5IA 4OHXA 1NLRA 4RS5C 1AR81 1W04A 3TNQA 2WO7A 5K9YA 3AXDA 1HV1A 2EAKA 5FYYA 2XXZA 3W9AA 3DUIA 3BI3A 1BEV3 3RSJA 1K5MB 2YGMA 4ZU4A 4CUBA 2BWAA 1DGWX 4XF1A 3HMYA 4ISQA 4PLOA 4TLFA 5FXWA 2GP5A 4HT1T 3KHCA 3ZYHA 5IVYA 3T4HB 3RZHA 4K3UA 1Y4WA 3LD8A 4AFDA 1CIWA 2ZX0A 2E51A 5JI9A 4NVPA 3IKWA 1VAMA 4LNVA 3VKMA 4Y5TA 4NIHA 4IL7A 5T3NA 5L9BA 4GULA 4RA0A 4YRDA 4AI0A 5FQ0A 1MQTB 1FI2A 4GZ9A 4ASMB 4UBGA 5FCCA 2AGSA 4UFHA 5GLUA 2HWE3 2DVFA 5LZ6A 2WNUA 3W58A 4FFIA 1W0NA 3ILFA 5A3OA 3RZLA 4UF0B 1US3A 2ZXQA 3I2KA 3EHKA 4XIOA 4MV2A 3AP7A 3CF6E 2EALA 1FATA 1LOCA 2YV8A 3RZGA 2Y6KA 2D6PA 1AL23 3A4UA 4YZ2A 4YZ3A 3POIA 1GQHA 5LCWL 5JR7B 1XPWA 1JYWA 1VMJA 3J7LA 2D6LX 2XJRA 2GALA 3KT7A 1SPPA 1W9YA 3ETPA 3POJA 3U4XA 5C4WC 2VOXA 2NQYA 3ABZA 3OPZA 4JGZB 5CISA 1XNBA 2J1RA 2PYTA 4NUBA 4N90A 3LSDA 2HYXA 4XZPA 3J7NA 5I0TA 3O7OA 1SLCA 1VMFA 4B4QA 1LOBA 2XJVA 4YNIA 3C2UA 4PIZA 1GLHA 3G6JB 2X10A 1WZXA 2I74A 2J7MA 2XL7A 2XONA 2Y64A 4N53B 2HLEA 4NPLA 4BOWA 2BWCA 4M3CB 4O61A 3FHAA 1JZ7A 1ULCA 5DUVA 5SV8A 5FUPA 1WLTA 2ZABA 3LF7A 1VR3A 1F4AA 1YYNA 2WQZC 2W5FA 3GYDA 3KB5A 1CQ9A 3NV3A 4LHLA 3MPPG 5GLWA 4CDWB 1MACA 4FBFA 4XVHA 5CFCC 1NA1B 4URAA 1BVP1 3D3AA 4LO6B 4YFZA 5FO8B 5I93A 2AH2A 4F83A 3DPRA 4RR3C 2ZGNA 1HJFA 2RJLA 1YFUA 3R0RA 2Y6LA 1W6PA 3IDCB 4AEDC 3HVDA 5C9AB 1E5HA 3B00A 1OH4A 3PTYA 3R4UA 4PDWC 2ZHKA 3J4UH 3UESA 1CPMA 4YGDA 5BNNC 2VMGA 3E1F1 3GCWA 1J3QA 4NR1A 3ILRA 2DV9A 2VTXJ 3JZVA 4ZXKA 5AVPA 2VU9A 4CTEA 3VHPA 5GKAC 4PT6A 3UKTA 3O0VA 4OUEA 3RPQA 3KQ4B 4PI0A 2WL1A 3OGVA 5CB7A 3O1SA 1ULPA 1UX7A 2GP3A 2JJ6A 1UYXA 1ZZ6A 4C91A 1JOJA 5DAWA 3TBDA 3CU7A 1C8M2 3RFRA 5AFBA 1UIJA 4R9CA 2AEYA 2BZDA 1QJY2 2QBXA 5LA2A 1FXZA 3D0SA 3WXPA 2WYFA 3RDIA 1DQ4A 3IB3A 3O1UA 1AR61 1BHGA 1ND2A 2RMU2 4PBOA 4A3ZA 1IGOA 1Y7BA 3U1XA 3EO6A 1HJGA 3FHIB 3I97A 2WAAA 2VNOA 4GALA 1TE1B 4B8EA 4PBPA 2ZA9A 1QH6A 2EVXA 3WV6A 4GB32 3V64A 5FXZA 5DDJ2 3ZX7A 1WBLA 4BB3A 3ZFEA 2ARCA 4HVQA 2DFBA 2YU2A 4Y26A 2VOTA 4C1WA 4QX1A 4AGGA 5JR2A 1TME2 4NHLA 4AFCA 1MQTA 1CAWA 2P6CA 2VMEA 3K46A 2W08A 1BZWA 2MEV2 1S0GA 4LBNA 4XQWA 2WS92 3WUDA 3GXUA 1JN2P 3UV9A 3U78A 4J25A 4R9BA 2RS32 4CEYB 2D44A 1WBFA 1DYPA 5H9SA 4E2QA 4EWEA 1UY2A 4CCOA 1KITA 2CL2A 4LO5B 4AYUA 1C5IA 4YW4A 4SBVA 5IK4A 1AR71 1V6MA 1TQ5A 1DU3D 4N7UA 2VD7A 2ZGLA 2G9GA 4AQTA 3ASIA 5CA6A 1YFXA 1J58A 5CZKA 1JODA 3B9CA 4YGEA 4S2DA 1RXGA 3KGZA 1A78A 3LEIA 1FOD1 3CIHA 4EE2A 1AR82 4GMP0 4CUGA 4LBKA 5A7SA 3AMQA 2B4KA 1WW6A 3IWZA 4ZPIA 2ZGUA 3D4KA 3KV4A 3CZJA 2DCJA 4XDPA 1STMA 3AFKA 3LGRA 3GZAA 1ZRDA 2XJTA 4FCAA 1X8MA 2WNVB 3LE0A 4MXVA 3DN7A 1OHFA 2QQNA 4RYDA 5C8CC 2Z4FA 3OBRA 5DDJ3 1OH3A 5JWPA 4AVAA 4AQSA 2XLAA 4N53A 3WDUA 4G9SB 4XIKA 4LLOA 2B45X 4CU6A 1O4YA 4UYBA 1R091 1TME3 1OQDA 2LTNA 1PVC3 2Y33A 4QPGA 2Q8OA 3VKNA 2PHLA 5FMCA 1GYKA 3AYDA 4D6RA 4CEWB 4JV4A 1GNZA 1YCIA 5G04L 3SCHA 5FLHA 2ZHMA 3NNLA 4Q27A 3N9LA 2C9AA 5CVRA 4AEJA 3HBKA 5A33A 3POFA 1W05A 1URXA 2OUJA 3JQWA 3CJIB 3Q8BA 1OVPA 1CVNA 1H1IA 1H8VA 5EFUA 5CU1A 1G86A 2R7EB 3BCWA 3HT1A 1HXS1 1VE0A 1AR83 4LUMA 5FP7A 3ZPOA 3UNPA 4KG0A 4A2UA 4H3WA 2XH6A 4A7YA 4P9IA 2R041 1VBD1 3WINE 2JKXA 3LOBA 1LRHA 3N9OA 3WG2A 3BU7A 5FJHA 4MOAA 4KNCA 3WDTA 3VBOC 3RZMA 1ULFA 3GZUC 3VZKA 2WNUC 5CG8A 3ZFGA 1BLZA 3PUAA 3WP3A 3KZ4C 5IJRA 1WCUA 1XXNA 3N9NA 3PU3A 4JQTA 1WW7A 4CU8A 4O9GA 5K4LA 1ALYA 1QMJA 2VVEA 1ULDA 1LEMA 3H8UA 4LBOA 4NN0A 4QPWA 2XB6C 3IPVB 1I9RA 4WZFA 2JG8B 2FQPA 1Y3TA 3AP5A 4NRMA 4CCEA 2RJ2A 3E6BA 5FIXA 4DZGA 3LWCA 2WC2A 2FZ2A 3H9AA 1E5RA 3NSTA 4UW3A 5FRAA 5IFPA 5FZIA 2OUHA 3L2HA 4XJ8A 5FZMA 3VBUA 5KXCA 3MW3A 2G1MA 5FDBA 4HL0A 4A7ZA 4JHTA 2JDNA 5IK7A 3ZYGA 2WNOA 3KGLA 1A3KA 3LEKA 1QOTA 2D98A 4YM1A 1JI6A 2R071 2PAMA 3O12A 4UW4A 2WZEA 3POGA 4E4HA 5JOZA 4ISRA 5LA0A 4EN8B 2QQJA 1SBFA 3I3QA 2CGNA 2GNMA 1LGNA 4BIOA 1SQ4A 4FPFA 5FYIA 3ZKYA 2W9XA 2MPFA 4IEQA 4R52A 3WT3A 4Z2WA 4HN1A 4BPZA 4ZKTB 2A3XA 5CKQA 1XU2A 2Q8EA 5C3SA 4EQVA 4A3XA 3UGFA 4HETA 2K2SA 2B42B 5JXHA 1W6MB 4XJ9A 3DPRC 4FQ4A 5FZ8A 4YVWA 3ZXKA 3N9QA 4LBMA 2A5ZA 3KMHA 4GH4B 2JDUA 4GJZA 1F5FA 3S7EA 3POSA 3ZIWA 5GM0A 1BQPA 1ZBE1 1AR62 3HPNA 4AHXA 2W2IA 1PZ8A 3ECQA 3C8XA 3K4DA 3AXEA 3MUZ1 5FUIA 3WD5A 3ZN4A 3O1PA 3B7MA 3T0DA 5FP4A 5F37A 3GZTB 2JDKA 5FY9A 1WLCA 2A6WA 1DZRA 1HB4A 3IDEA 1GZTA 1JMUB 3BB6A 4KBZA 4FPKA 4KG8A 3O5SA 3H1YA 1C57A 3TWIA 4L9BA 5FY0A 4Y20B 3BPZA 2JWPA 5JMCA 4ZXEA 1I6XA 5EQUA 3AC0A 2ZGKA 2PHDA 3Q9OA 4YGCA 1EYBA 4PIYA 1S1AA 2ZAHA 4MLOA 3ALQA 3JB8A 3ORJA 4MGZE 3RZZA 2R0HA 1ND2C 3VKFC 1JYTA 3JBG3 4MXWB 1VBB3 4OQ9A 1MS0A 1PMJX 2VMCA 4NOTA 1YHFA 4LT5A 5FZKA 2JDHA 1AR72 4QPYA 3DECA 1OA2A 2ZAAA 3ZFEC 4AHYA 2WT0A 4YW6A 3NVCA 3HT2A 2B9UA 5HCAA 2NP0A 3PU8A 1ENXA 4GWNA 1FOD2 1FMD1 2K46A 1JZ6A 2RG4A 4KWJA 4BM8A 1MQTC 2BGOA 2JE9A 4XAEA 3GJBA 4DXZA 4QAWA 5IK8A 2RE9A 4OMCA 2ZMKA 2ZS6B 5B2GB 1SHWB 2OKXA 3AKTA 2E53A 3MI8A 1EV11 3LDRA 4PCRA 2VZRA 5HCFA 5FZ3A 2EF6A 4C8DA 1UZVA 2J22A 4ZHNA 4Q4W1 1ASJ1 1ENSA 5FWEA 3RJ2X 2OX0A 4CCMA 1G6NA 3SC7X 5LA1A 4AI1A 1KS4A 3PUSA 1R092 3ZSEA 4Y1VA 2I45A 1NE6A 4CP1A 1W0PA 1YC61 3ZO0B 4Q4V1 4FTEA 5HV4A 3I2FA 5KC5A 4NPRA 4OYUA 2GZWA 2YPDA 4CCCA 5LRRA 4AE2A 2DFCA 2UWBA 3MIDA 5B4XA 1UNBA 1WGPA 1Y9GA 3FHQA 3I54A 1ENRA 1IS5A 1UMHA 1POV0 1ENQA 2BVBA 3EJKA 5A7WA 4E2GA 1LCLA 3CL1A 2D6OX 4QDRA 4N53C 1W9TA 4ATFA 4PJYA 1FOD3 1V70A 1HXS2 4FQZA 3SH3A 4F7ZA 4XQDA 4BQWA 4QPGC 5LEKA 2VNRA 1IHMA 2R042 4CDWC 5J1XA 4C1XA 4OCTA 4YZ4A 4QQOA 3ACFA 1XYNA 2HKXA 3H8RA 5FPLA 4KQ7A 1YQCA 1OA4A 1BXHA 2JB4A 3P5BA 1OLMA 1XNKA 4CRQA 2QNKA 4RSUA 2XVKA 3BU0A 1R093 2JICA 2VZUA 3AP4A 4PLNA 3URFA 5JOYA 3C7HA 4FP3A 3RMYA 1QOOA 3AX4A 5E16A 1VBC3 4BMBA 1GV9A 2CYFA 4QHZA 2FMDA 3MGUA 1PGL1 1CN1A 4RS5A 5E1RA 4HN0A 4AG4A 3IAPA 3NMBA 2F4PA 3A23A 3ZFGC 3AM2A 5CIRA 4LULA 5FPAA 3K75B 2HWE1 1UKRA 2RDQA 3C7GA 2ADDA 3TEXA 1O8SA 4OI4A 3MEPA 2JDZA 2ILMA 4HONA 1HXS3 2R072 4TTGA 2Q1FA 1WWYA 4ORFA 3ENRA 5JSRA 1UAIA 1R1ZA 3ZYIB 1PGW1 1VBD3 1YQ8A 3Q8FA 4Z8BA 4LBLA 3WDYA 1W99A 1AL21 1UPSA 4XUNA 5FY7A 3S0MA 4FTSA 4JRAA 4R9AA 3HEIA 3OBZA 5LBCA 2XKOA 3WF1A 2G9ZA 5BNOB 2AACA 1NXMA 3WOGA 1AZDA 2ZGSA 1JHNA 2JEMA 5E6HA 3IT8A 4K21A 3VL8A 2DU0A 3VBUC 3BYWA 1SLLA 4EN0A 2B5HA 1LHWA 3OY8A 3WNOA 2GC1A 2W94A 2NMOA 1XU1A 4QMAA 1VAKA 2PLV3 2X53S 1ZBE2 4MSVA 4D7SA 5JDBA 5IK5A 1YI7A 2OQ7A 4XILA 2PHUA 1CGPA 2XHNA 1UOJA 2BOJA 1VRBA 1UOBA 1W90A 2HBTA 2IVJA 2PQQA 2EIBA 3H3LA 2DVDA 3MIEA 3PUHA 3ZSLA 5IVEA 1DZQA 3W5NA 1JOBA 4IEXA 2J1SA 1W28A 3PUQA 2WA4A 4HXCA 3KF5A 4RQPB 3NV1A 1FX5A 1WMEA 4V2VA 5DAQA 4INDA 2D3PA 3NNGA 4TN7A 4GQ7A 5FZ6A 4FVVA 2HEWF 2VQUA 4A7KA 2XKPA 3OG2A 3PVEA 4XMAA 3DF0A 4XJWA 3A0NA 3BTAA 1AX2A 1MZEA 3ZN5A 1CAUB 1VJ2A 5A80A 3SISA 1RHI3 3THDA 3UETA 3CLPA 2RDSA 1GQGA 1S0EA 4JTOA 3ATGA 4QWNA 2I07B 3BIEA 4L92A 1W6QB 4BYYA 2O0OA 1KD7A 3K3NA 3NV4A 1FMD2 2YBPA 2ZCWA 3AL5A 1LU1A 4EN7B 2QZ3A 1OFNA 1HIXA 1Q5OA 4RGGA 5J48A 3KM5A 1ZBE3 5CFDA 2FCTA 5ISLA 1U5IA 2ORZA 4IGPA 2R49A 1EV12 5HI0A 4BQXA 3B5LB 1UKGA 3KCCA 2EAAA 2YG0A 4Q4W2 1ASJ2 4DUWA 3GZEA 5F2WA 2E63A 1OF4A 3LPGA 1W03A 5HCBA 2CSGA 4A42A 1B09A 3LA7A 5EYYA 1IQAA 3AKRA 4IQPA 3B01A 4ONUA 4XBQA 4XUQA 2CGPA 5K7PA 1W6NA 2A71A 4IEZA 2E32A 4Q4V2 5CNAA 1H2NA 4HPKB 3WR0A 2ZKNA 4R4XA 4KU8A 4AI3A 5A3TA 3LFIA 4OHZA 1ZVFA 4IEVA 1KEXA 2VGDA 4B29A 2W68A 2P3YA 3M8LA 2ZACA 1DDLA 3MHZA 4DEQA 2W39A 1QQP3 1OOPB 3VLBB 4LO4B 3I3MA 1POQA 2IWGB 1UN1A 1QIQA 4IEOA 5A7NA 4HZFA 4OHVA 5J7MA 3AZXA 4JGYA 4AF9A 3P3PA 2A6VA 2IZWA 1FMD3 2X5IA 5FZCA 1GU3A 4BHPA 1C4RA 1W0OA 2JG9B 4U36A 4QU2A 2RS53 2DTWA 5G05L 1O91A 3M3IA 3QH7A 3TOJA 2ID4A 3NW4A 1BKZA 1EV13 1GZ9A 1LOAA 2JX9A 4YG0A 4BH9A 3MZHA 2WLPA 4LKFA 3MBWA 3TN93 3LAGA 3GHMA 5GLTA 3ZSJA 3VBHA 4ZU5A 4N43B 3SH5A 4Y1ZA 3OUJA 2P6HA 2WNEA 1O7FA 1PNFA 3DXUA 5AVAA 2WN3A 2W0XA 4FOVA 4I01A 2WKKA 4IE6A 1H8TB 2B8MA 4J1WA 3ILNA 5D21A 5GLVA 5JIAA 2ZKLA 3K48A 2VZTA 4IEWA 1AVBA 5EXOA 5A7OA 4FPLA 4JVAA 3FLTA 3IMNA 4MGKE 3FJSA 4PF5A 4OQ8A 1XNTA 4E9KA 4D94A 3KV6A 5DZEA 2DVBA 1N47A 1JZ5A 5IVJA 1MS9A 3CZUA 3OB8A 4MHRA 4P02B 4ES9A 1CX4A 1PGL2 1RL3A 1BJQA 4QXCA 1PVC1 1BBT1 5TSWA 3V0BB 2VMHA 2Y6GA 3CNAA 4YVSB 4I3PA 4GAZA 1UYZA 5FK8A 2ADEA 2D6NA 1BCXA 2HWE2 1DGLA 5EJ1B 1X9TA 2W47A 4CDXB 1B35A 3WF3A 2LW8A 5EPAA 1LHOA 3FN9A 3NO8A 1ZA4A 1OC1A 2BJSA 1W2UA 4MO3M 1RUH1 2YU1A 1PGW2 4Y22B 4ES8A 1I5PA 3KF3A
chains in the Genus database with same CATH topology
1AL22 5FTTC 3JQXA 1O3RA 1XYPA 2ZX2A 3BIWE 2BEOA 3BODA 1HLCA 1MEC1 2O1QA 3VZOA 4XJZA 4IEYA 4IESA 5D8AB 5GZCA 3CEWA 2ZX1A 1VLNA 2BQPA 3WG4A 1HV0A 5J96B 2GNTA 1S55A 5IUQA 2V5YA 1POV3 2CWMA 2K9ZA 4DOUA 4XFBA 3MIHA 3ACLA 1OLRA 4LUKA 1LHNA 5T5PA 4HKLA 1RUG1 2PTMA 2VVDA 1PVXA 4IV1A 4LO8A 2CWSA 3VZNA 1O4ZA 3SCFA 4OULA 2ETEA 5H9RA 2DWRA 2UU8A 3SLIA 1KJLA 3MFAA 4FXGB 4K6BA 4WM8A 3VBOA 4R4ZA 3VBSB 2R32A 4F8AA 1PO21 2AUYA 4FOWA 4EN6B 1WW5A 3MDPA 4XFHA 4JDNA 3RMXA 4R8HA 3SXWA 1VAVA 4AVVA 4LBQA 1NY71 4K9SA 2WSVA 1OOPA 1ZBA1 4IV3A 1I5ZA 1O3QA 3NL1A 2UY9A 4QXKA 3PVBB 2UWCA 1LHUA 2LM3A 2LALA 4CDQB 3AFGA 4Z82A 3K51A 3ZXJA 1VBE1 3O14A 4I09A 2WA3A 4XFAA 3NKGA 2PHWA 3J8F3 1RUJ3 2SBAA 2V09A 3SNMA 1D4M1 1ZZCA 1OQ1A 3MYXA 3VHRA 3VDDB 4DQAA 2C0ZA 4IEPA 4AVTA 5BY5A 4XFIA 3USUB 2IFWA 4FPGA 1UPIA 1LOGA 1JTZX 2DCYA 2ZZQA 5JZGB 2PHRA 5DG1A 2ZGRA 5CAZA 1MZ5A 2GSYA 1RUC1 5C6CA 5JCTA 3QCWA 4D69A 4CDUA 5CFDC 3V0BA 2DUPA 3NKTA 2PELA 3OYWB 5ACA1 5L7OB 2ET1A 3ZFFA 3KCYA 4H14A 4QPIB 1RUI3 3JBG1 1VBB1 2EXIA 2CNAA 2R30A 1OPMA 2DTYA 5BNPB 2RS11 3LA2A 2JE7A 1UZYA 3LOIA 5DG2A 1Q8QA 2ET7A 5GLZA 5JSPA 4HLTA 2H0BA 5KXBA 3VGIA 1CESA 2E7AA 2YUEA 1ZRRA 3AYEA 2VPVA 2Q1MA 2ARXA 3FX3A 4P14A 1K5MA 3ZYJB 1Q56A 3B02A 4YGBA 4V1PA 4Y4YA 5K0UB 4M01A 5I8TA 1Z7S3 4NHKA 4JGYC 2ZGMA 4QGMA 1V6KA 4COUA 4EWAA 4JAAA 2AREA 4N9IA 2DVGA 4AFMA 4N7IA 2X5IC 4AW7A 1U12A 3E5UA 1V9U1 1AXKA 4GKXA 2ZBJA 2E7QA 1PVC2 1A8DA 1BBT2 5EZWA 1WD3A 1Y43B 2XHKA 2P34A 5KHHA 3VBHC 3JD71 4BA6A 2R0FA 3V65A 5KWRA 2XL9A 2BTVC 2BYVE 2ENRA 3FMGA 1PK6B 1HQWA 4LA2A 3WP6A 4WVZA 1ULGA 1RUH2 4N9HA 1XE7A 5HXVA 2H6CA 4U2AA 2GNDA 5FBZA 4YZ1A 1N1VA 4JCKA 1MEC2 4K1YA 1KDMA 2WT1A 2OVUA 2A73B 3OJBA 2R061 4JGZA 1WW4A 1NCQB 5HBAA 1CR7A 4RQPC 4AXOA 1WA4A 1OA3A 1EY2A 3WDWA 3M3CA 4FPYA 1CAXB 2Y38A 4Y5Z0 5BV6A 1B35C 1IZ3A 1NOVA 1DQ1A 1HRV3 1H4HA 2Z69A 4M0NA 4M3CA 3WP5A 3VDDA 1RUG2 2TNFA 4Z1VA 1OKQA 4YW3A 3UJOA 1BBT3 3ZVXA 3QOPA 3H50A 3ZMOA 4CYDA 4CDWA 4OLLA 1VBC1 3WCSA 3USUA 1NA1A 3AKPA 3DGTA 1X7NA 2QJVA 1PO22 2QUOA 4GMP1 2P3JA 1Q43A 1CPNA 2PN5A 4FT8A 4GIQA 3OD4A 3MFCA 5C9AA 1RUH3 2UWAA 1NY72 5L7OA 2D3SA 3WDVA 1HQLA 1ZBA2 4WZCA 2E7TA 1MEC3 2TUNA 4IV1C 2YHJA 1C28A 4TWTA 1GZWB 1QU0A 1V6OA 2VG9A 4YLZA 5BUVA 2PHXA 4Q0VA 4ZU7A 1RUNA 1JYCA 4WM8C 3N7KA 4Y1YA 4YG3A 3NJZA 5BNPA 1VBE2 2JECA 4NO4A 2G4IA 3KT1A 1DIWA 1H2LA 5IT6A 2Q4SA 4I2OA 1RUG3 3RWNA 2IXIA 1D4M2 3E5XA 5T5OA 1QDOA 3AYCA 3ZXGA 1OOPC 2KA3A 1DLLA 4IV3C 2ES3A 2PLV1 5K0UA 1YRZA 3WG1A 4XTPA 4HFSA 2WJSA 4LTAA 5JIUA 4XDQA 1RVF1 3EQEA 1L3JA 2VQ0A 1GSLA 1PO23 4Q0UA 1UU6A 4FSJA 1RUC2 3FBMA 4F3JA 2CTVA 1U5XA 1OFSA 3ZDSA 1DGWA 2QVSB 3VBRB 5ABJB 3FBYA 2JKBA 1ZBA3 5ACA2 3BOWA 3WG3A 4M00A 4WVVA 4X6RB 4CEYA 3ZYPA 2BBVA 2QE3A 4XBNA 4OI0A 4UXAA 3GBFA 1AHSA 3JBG2 1GICA 1VBB2 3T1MA 1DQ6A 1RHI1 1YXWA 1VBE3 2R1BA 3E97A 1ZNPA 2RS12 3A0KA 3JUUA 4K1ZA 3UKVA 1RMU3 1A8MA 4S2HA 3ELNA 3WHUA 4CDUC 2VW2A 1GBGA 3O0WA 2WZPP 3ES4A 2DYCA 1T6GC 1FPN1 3GBWA 1D4M3 1H4GA 1YJLA 5EWSA 4H55A 2HWD1 2IFRA 4XF4A 4DINB 5A3LA 3ZFFC 1REEA 2YGLA 2WNVA 4DNYA 5C8WA 1NQDA 1C1FA 4CDXC 1AX0A 1LECA 2D40A 1OSGA 1TMF1 1C8NA 2XWBB 1NLSA 2DCKA 1TNRA 2TEPA 3PJQA 4OHWA 4DFSA 4TZDA 1O5LA 1RUC3 1R083 1OPOA 1V9U2 4YG6A 3NWKA 3RNSA 4L8QA 4QQPA 1CAVB 5ACA3 3NAPB 4CEWA 4KL1A 3IN9A 1DBNA 1K5MC 4I0AA 3JD72 2NMNA 4Y1UA 2VXRA 4FO9A 4K8FA 3H0OA 5GZFA 1YUDA 1QQP1 4AK3A 3CJIA 5KHKA 1FV2A 4HMZA 2RS13 4QQ2A 5LK5A 1MZ6A 3P3NA 5C33A 4BZ4A 4HBNA 3M3OA 3HWJA 2WQ4A 4OUSA 1YI9A 3ZXLA 1GZWA 4AWDA 2QFEA 2R062 1WD4A 3OBTA 2TBVA 2RS51 3VBSC 1QJX3 4M3CF 4OI2A 1X33A 4B7EA 1APNA 2D7FA 1H1MA 4JQRA 5FO7B 4XF3A 3MF9A 1ZZ9A 1XNDA 3TN91 3H1WA 3ZSKA 4COVA 4KWLA 1NG0A 3ZN6B 4BE3A 2QCSB 5KHJA 4D7TA 3PLQA 1V9U3 3MF6A 5J98B 3IM0A 3IPVA 2I2SA 2JG8A 1VBC2 3N7LA 4JGZC 3JD73 3EXUA 1AR93 1KFXL 1ONAA 2DU1A 1LGCA 4RL7A 4ITCA 3R4SA 1AXYA 3M70A 3VBRA 5ABJA 4BQ1A 5E89A 3HN1A 4META 4MVTA 3VDDC 4BIFA 3N3HA 1OMIA 5DUXA 2FBEA 2D6KA 1NCRB 1RJ7A 2R063 3PMEA 1VBD2 3AB0A 5J36A 3E5QA 1UIKA 1IPKA 4MX3A 1NA1C 2YPJA 2G9FA 2W52A 4IEUA 1W6MA 1OLQA 4HK9A 4EROA 1AYM3 4LO7A 4GH4A 4MGYE 5C9AC 5I0SA 5L7OC 1XNCA 3QLQA 1IS6A 4O9EA 4TYSA 1POV1 3WUCA 4CP0A 4EWDA 2PLV2 5H9PA 3AYAA 3BOPA 4WVMB 2D3RA 4RR3B 1O4TA 4YYOA 1ND3B 3NV2A 4E4ZA 1UU4A 3AKSA 1RVF2 4I0WB 1X50A 1YFWA 1RUOA 3RYPA 4GMP3 4PDWB 2D6MA 5BNPC 3M3QA 4COZA 4Y20A 5BNNB 1N3PA 4XBLA 3N35A 1VB4A 1GFF2 2EA7A 3AKQA 4JDOA 1C3HA 3USSA 5LEJA 1NXD1 1DF0A 2PA7A 4R9DA 4OHYA 1FNYA 1RITA 4MXWA 4DY3A 5K0UC 3V0AB 1AX1A 1DGRA 2XWJB 1VB2A 4CZSA 2IXLA 1RHI2 2LUWA 2ZJCA 4HANA 1F31A 4XMIA 1VP6A 3HD8B 1LOEA 2F6BA 2MNGA 4RFT0 1YFYA 3LB9A 3UJQA 2XBO1 3DKWA 4HSLA 2P17A 1GANA 5BYNA 3S6PA 1TEIA 1FPN2 2RR13 5A32B 2XPJA 2HWD2 3H3ZA 4XFCA 1Z0HA 4CEYC 1LEDA 3J8F1 1RUJ1 1XYOA 2VOWA 2NLRA 1JXNA 4WM7B 2Y0OA 1IS3A 1DGRN 1RVF3 1AL0G 3KT4A 3ZN6A 1TMF2 1GNHA 2HWC1 5H9QA 4QT6A 4XQ4A 3M4FA 1RUD1 4QQLA 2HWF1 2EXHA 1Z78A 4FPHA 3S7IA 3N7MA 3C3VA 3AMNA 3TNPB 1SLBA 4E27A 4IXLA 2BFUS 2VOKA 2WNVC 2CY6A 3OGJA 1V6JA 1F8VA 2GMPA 1QQP2 3VV1A 5I0RA 2BPA2 3POWA 3VZMA 4AQ6A 2FZ1A 4YW2A 1RUI1 1GKBA 2OZJA 4I30A 5T5JA 1OD5A 4P9XA 1FPN3 1NCRA 3FUQA 4PQ9A 4AVSA 2HWD3 5C8CB 5DXDA 1N1SA 3LKJA 4CEWC 2RS52 1G9AA 1XE8A 4AFBA 4B4RA 1D4VB 1KXGA 1AF9A 4LBJA 2AZ5A 5CG9A 3TN92 5CBLA 1TMF3 4BLJA 2QKDA 2E6VA 1VBA1 3CJIC 1YIPA 1CJPA 5JPNB 4MGIE 3RRDA 1HX6A 1EPWA 4XTMA 1Z7S1 3FLPA 4Q1PA 3ROUA 2WINB 4W6XA 5GZDA 3QD6A 2C5DA 2HWB3 1ND3A 4DPNA 3TAYA 4L99A 4AI2A 4XJUA 1RC6A 3HAGA 4GWMA 2QZ2A 3T2TA 1PMIA 4LE4A 5FQ0B 2ZHNA 4OFGA 2BW8A 1QNWA 4KWKA 2OZ6A 2WNUB 4YW5A 5I8SA 2JG8C 3RS6A 2HEVF 3OF1A 2NZ9A 2A75A 2VVFA 4AEMA 5BNOA 4FAHA 1WCKA 2R6QA 3WW4A 1VALA 5I8YA 1YIFA 1QJZA 2UURA 3AP9A 2IXJA 3KCXA 4FPCA 5FLIA 3B93A 3VBRC 5ABJC 1YLLA 3OTFA 4QQHA 5EV7A 5T55A 4M0HA 1HRV1 1JH5A 5JI7A 4WM7A 2BVVA 3L9JT 3D8CA 2GNBA 1WMFA 5AC91 5KHGA 4XYXA 3LCPA 2P3KA 2Q5TA 5JLVA 1QJU3 4RQPA 1R1A3 1QH7A 4C0BA 2BFUL 2A6YA 4SLIA 1DFQA 4GH4C 1GZCA 4P9GA 4HKOA 4Q0QA 1RTVA 1Y9QA 3L2YA 5I91A 3WW2A 3GALA 4XFFA 1CAUA 3DPRB 2VUAA 1HRI1 4DY5A 1IOAA 4FPEA 1W6PB 2XG3A 4G3YC 4LR4A 3B9IA 2HEYF 3U10A 2Z42A 1W6QA 2CAVA 2WFF3 1XRUA 4FPOB 1SCRA 2XBO2 3KQRA 4BMEA 1ZZ7A 4OI1A 4Q29A 4LBQD 2RM21 1D0GA 1EAH1 3J8F2 1RUJ2 3BALA 3WW1A 1NYWA 1V6NA 4QGNA 4RHV1 2BNMA 1YO8A 2Z2SB 5DUWA 3GF6A 2HWC2 4FOQA 3POYA 1SBDA 3FFZA 3MLKA 3ZPYA 4CP2A 4Q0SA 1KJRA 2PAEA 4Q0PA 3VN4A 2KM2A 4QD2A 1RUD2 1ND2B 2HWF2 4HPKA 3IIAA 3UL2A 3WLUA 1NQJA 1LENA 1YNAA 3S30A 2ZX4A 1OI6A 3V56A 3ZFEB 1ZM1A 4JDMA 2XLFA 4AVBA 4P9WA 1CAWB 4E4SA 1UW8A 4DB5A 1RUI2 1REDA 4FTBA 1I1EA 4AGRA 4H7MA 2XBO3 4QGLA 1LB2A 2H6BA 2JG9A 4AVCA 4L97A 1GR3A 1NZCA 5F1RA 1WCSA 1RMU1 1AYN3 2YYOA 2JD4A 2PAKA 3G7DA 1WLWA 1WMDA 2GC0A 1G9CA 2EXKA 4N43A 2XJPA 4I3GA 2HWC3 4FAGA 1H8TA 4Q8LA 1VBA2 1SLIA 2XVLA 2DF7A 3D82A 1QNYA 5J3UA 4Q4Y1 4AEKA 1SFNA 1Z7S2 2A3YA 5F5QA 1VRH1 1RUD3 2HWF3 4PLMA 5DZFA 1PHMA 1S0BA 2D97A 3VBFB 1D0HA 1NCRC 3ETQA 2ZX3A 3ZMNA 4W6YA 1QHDA 1R081 1BYHA 4YM3A 4P9JA 3TYJA 4YVSA 5GJ6A 1G9DA 2YMZA 2A6XA 2D43A 4Y1XA 3EBRA 3SMHA 5K8SA 1QXRA 4QPGB 3WQ0A 4CDXA 2GC2A 4AQ2A 5KC6A 5L36A 1H2MA 2FMYA 1V6IA 4E2SA 1HW5A 1WLDA 4Y22A 2GMMA 2QQPA 1ND3C 3M1HA 2X8KA 1N1YA 1PIV1 2ZZJA 5A33B 4W6WA 4RD7A 1X36A 5F9TA 2H0VA 1J3PA 1CJDA 5D8AA 1DZTA 4XF9A 1QJX1 1VBA3 3ES1A 2YY1A 4XFGA 1KRIA 4X8PA 1N1TA 4K20A 2X29A 2QDNA 5F6KA 3T1LA 4ATEA 1ZRCA 1QDCA 1JUHA 1HRV2 1JBCA 1H0BA 3ZFGB 1FV3A 1A6CA 2VY0A 5JOWA 1H9WA 3W59A 5AC92 3HBZA 4COWA 3H1MA 5BNOC 2GH2A 1G8WA 4B4PA 4YZ5A 1IS4A 5JOXA 1COV1 3VBSA 4YFWA 4GKYA 1PZ9A 1C1LA 1S0IA 2IXHA 4DMIA 1AR91 3N36A 3GNEA 3MICA 3X29B 5FPZA 1MS8A 1MVQA 2QDRA 4WM7C 1SMVA 1Q8PA 1HRI2 3VL9A 1LR5A 1JYIA 3VBUB 1PGSA 4KGQA 3FC0A 1LGBA 2DCZA 4WBBA 4C0HA 4CDQA 1UZZA 4OUMA