3RPQA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
201
structure length
201
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILFYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords Catabolite gene activator
total genus 60
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rpqA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rpqA01
2YR2A 3GFMA 1TBXA 4LA3A 2LF8A 3KP3A 4BIFA 4IEUA 1T39A 4WXCA 3RYKA 5TRDA 1D8JA 2DU9A 2XASA 5FLIA 4NQWA 4Y17A 4PIYA 5I8TA 1WRJA 4B09A 1PMIA 2ISYA 4Y15A 4IEPA 2UYAA 2HS5A 5FO5A 4E2QA 2CSOA 2E7WA 3I58A 1P92A 4F8AA 1TNTA 4BXUA 3CEWA 4H0EA 3SZPA 4G7OF 3ZMUA 2PBIA 4HV6A 2F5FA 4G9YA 4P9GA 4XFFA 5K5OA 3BROA 3P7NA 3RKXA 4ZYGA 1Z05A 4XBFA 3FM3A 5DCMA 5L3BA 1O3RA 1YO5C 1A04A 4XF9A 2K02A 1ZNPA 2LF7A 4WWCA 4N0BA 4XETA 1IF1A 5C8WA 3GFIA 3RNSA 3WU0A 1ZGJA 4Q0VA 2QENA 2GXBA 4J1XA 2O8QA 5TJJA 1WWXA 3LFKA 1K7AA 4M9SA 5JCTA 4PGGA 2TDXA 1ZZ6A 1SMTA 3WODF 2P5VA 5E16A 3SFZA 3MYXA 1HSTA 5CADA 4LGWA 5KHKA 1XDSA 2PA7A 2P4WA 5F6FA 4WXHA 4IERA 4MHGA 1B9NA 3KEQA 4Q4ZF 3OTFA 4XFCA 3FMQA 3FF5A 3KGLA 1SFNA 5FB2A 3ERED 3MFKA 1CAWA 2PFBA 1RUNA 1RIOH 5LRSA 2QVSB 1J3QA 4FHTA 1J3RA 3RYRA 4U88A 2Z5UA 5D8KB 1K79A 1NYWA 1O5UA 4OIRF 3C3WA 3WTZA 1FC3A 3GUDA 3BJOA 1QNTA 2QYOA 2FRHA 4ZYEA 3TKYA 1OR7A 5AONA 3KGZA 4LK1F 4QXKA 1FX7A 5CVIA 2YX7A 1OMIA 1R58A 2E1NA 3CO2A 3F8FA 2EV5A 4ZU7A 4UNOA 5AIPA 1SEFA 2OQRA 4U7DA 1ZRRA 4XFHA 1K6OA 4MQVA 5JR7B 1RL3A 2QQBA 1P4WA 4MV2A 3D0JA 3R61A 2KJCA 5KHHA 5A2QK 2L4AA 5E17F 5J48A 2K4BA 2MLKA 4ZYDA 2X4HA 2P5KA 3BJ6A 5LGNA 4TV7A 5FD6A 1ZG1A 1Q3EA 3K1NA 3IDBB 4LLLA 4EWDA 2DLLA 4KDPA 3F23A 1KU9A 1JUHA 1ZYRF 1MJBA 2H27A 1LKNA 2B9UA 4GULA 4KN7X 1BC8C 4MEXF 4KYWA 3R60A 4O9GA 1U5TB 2ETEA 1D8KA 2VPVA 2DQRA 4ZZDA 3K2ZA 1REPC 3EUHA 2P7VB 5JAXA 4HZFA 1R23A 1QZZA 2Q0OA 3TOAA 3T8RA 1O3SA 2D5HA 4WBBA 1QZYA 5EEGA 2F5EA 3BCWA 3VFZA 4XRFA 1YWKA 3O2PE 6PAXA 2B0LA 4GGGA 3ACLA 2KJBA 2O8XA 4KT5C 4ZU5A 4HVOA 3FWEA 4O6JA 4HVRA 2FU4A 5L3CA 1UW8A 4ETSA 4HA8A 5ILUA 4DINB 3CUQC 1Z7UA 1BI1A 4M74A 4EJWA 1NXMA 2IXJA 1QPMA 3L2HA 5FQ0B 1YLLA 2RV8A 1SD7A 5K8SA 2P6TA 4QLCU 1U5TA 1FPQA 2VONA 2EVXA 1DGWA 5ICCA 4UVCA 4L18B 3FX3A 1XGSA 2QUFA 3ISPA 4U0WA 1CAUB 3KMHA 2M8EA 1JGSA 3QRFF 1UHWA 3M9AA 1Z6RA 3SHFA 2PN6A 4QM8A 2IJLA 3SHRA 2IXCA 4AVBA 5DUKA 5LEJA 3HT2A 2VBXA 3K9TA 4M72A 3JAMZ 2DPUA 5FFXA 3FMRA 4HF0A 5E1RA 3Q5FA 5LHIA 4LUMA 1MJAA 1E17A 3MAJA 4K2EA 5HLHA 1T38A 3FXUA 4CHUA 1RC6A 3WTSC 5D4SA 3BPXA 4F7ZA 4ZH4F 2WFPA 1DGRA 2VQAA 4I09A 3IHUA 2PAEA 1KQ0A 3I7DA 4WVZA 3KFWX 3P9KA 1KU7A 4R1HA 2BBYA 3RDIA 5F1RA 3JAMK 2ISZA 3M1EA 5FGMA 2D45A 3F8CA 3J81K 3WW4A 1WLTA 5BUVA 4JVAA 1W5SA 3FZVA 3GVAA 2PQQA 2IA2A 3WE2A 1IRGA 1OYIA 5J8FA 1IAWA 4Z07A 2A69F 4X6QB 1F9NA 4RB2C 1TNSA 2CAVA 2OQGA 2PTMA 4MH0E 2B5HA 1KQ9A 2UY8A 2GA1A 2XIGA 2XGXA 4AIJA 3EO6A 5ICGA 4L9VA 3NVCA 2YU3A 3J81Z 1GXPA 2D5FA 4HSLA 3SCGA 4KWKA 1O3QA 5BY5A 5BPXA 4G6QA 2P6SA 4RB3C 4EMSA 3VHRA 2I45A 2HJIA 2F5DA 5LRRA 2KRFA 3WGHA 2W57A 4LLGF 3V4GA 4IHSA 4LTAA 2ET1A 5IT9Z 1Q43A 2M45A 1EH7A 4Z2YA 5FLXZ 2MH9A 5CVVA 2VOPA 4UXAA 2P7CB 4KFCA 4MNUA 3ETQA 1DZRA 5KHIA 4HV5A 2IW5A 2M5WA 4LG0B 2OU2A 4IEZA 3MZHA 2V9VA 3NL1A 4ORFA 5ERIA 1LVAA 4XSXF 4EROA 3E6BA 4QGLA 4IEYA 2V1XA 4Q29A 4ESBA 2FBIA 2IA0A 2UZKA 1FWZA 4MX3A 1T0FA 2VT2A 2PMUA 3H1MA 2EFWA 3E6DA 1MJ9A 1PP8F 4WCGA 3M3IA 3ECHA 2XV4S 5HS9A 3TDZC 1FP1D 2FOKA 2RKHA 4XF4A 1IZ1A 3S2WA 2ZFWA 4JBAA 1TW3A 4EM0B 3D82A 3ELNA 2BGCA 3SXYA 3USSA 2DBBA 3QP5A 4I01A 1UIKA 2V6CA 1IN4A 1HW1A 4HF1A 3ELKA 4S05A 2XAQA 4OIQF 2OZJA 2UXXA 2H09A 1XGMA 1QY4A 2KIMA 4EWAA 2CV6A 4CICA 1OI6A 2CG4A 4XF3A 2D1HA 3S7EA 2DTRA 1IXRC 2MPFA 2GC1A 3TNQA 1IXSB 2D2WA 3BOQA 4YRDA 4AQ2A 2YX4A 3EHKA 1DZTA 1J58A 2Z3YA 1XGNA 1HBXG 2JPBA 2DFIA 2OA4A 4G6DA 1OPCA 1WA4A 4JTOA 3NJZA 1FYMA 2C6YA 4U0YA 4CGZA 2ZBKA 5CVUA 4BNCA 2W85A 4YFKF 3GXOA 5KHGA 4EWEA 2UXNA 5J3UA 3WTTC 3C3VA 2HOEA 4L11A 4PIXA 3CUOA 1DP7P 2OYZA 2ADUA 4AWXB 3SCHA 2K4JA 3IWZA 4FT8A 5K1YA 1KU2A 4PZJA 2Q0AA 1ZH5A 1CAVB 3TGNA 4YFNF 5D5UB 2HTSA 4N9HA 2FQPA 4M9XA 1TW2A 2MBFA 3L9FA 3NEUA 3U2RA 3HRMA 3U9GA 4I2OA 5FFZA 4XF0A 3LSTA 4UVBA 5BS6A 1T6SA 3WTWC 1TTYA 3KLOA 2K0GA 3HYIA 1KU3A 2PMHA 3RKYA 3WTYC 2N7GA 4KIGA 3U11A 4O3MA 3GZ6A 4P9UA 2VBYA 1S7AA 2VOOA 1NZCA 3KP2A 1R1VA 4AVCA 3FM5A 2O1QA 4HF2A 1WQ2A 4HOBA 4LLNA 1YUDA 2PEXA 4CO8A 3KP6A 4L0YB 4WK8F 3REOA 1OYYA 5J6XA 2VE9A 2O0YA 5BMZA 5KHJA 1QGPA 1EY2A 1ZZ7A 2A07F 3ABTA 4KWLA 2DI3A 2HDCA 1YS6A 1SQ4A 3SQNA 1QO0D 3E3VA 3HOTA 1GXQA 4GXOA 2ESNA 3V8JA 4FX0A 4S04A 3WW1A 2L01A 1VTNC 2P8TA 2F4PA 5I0SA 3I59A 2P17A 3CUQA 2BE5F 1BI2A 2IC1A 2ZNZA 4PJYA 4RGRA 4IESA 3I0TA 4QWQA 4ENMA 1CX4A 3BPVA 2Z33A 5CU1A 1PP7U 3E5UA 2FF4A 3V7SA 2OZ6A 1WGPA 4E2SA 4QM9A 3P9CA 5JSPA 2CGPA 1ZGAA 3JW4A 1G3SA 1R5HA 3CO6C 3H7JA 4Z82A 1OFNA 4JV4A 3QOPA 3BY6A 5LEKA 4G7HF 1T2KA 3ZP5A 4EGZA 1OYWA 3EJKA 2FA5A 4FBFA 4WZCA 2L4MA 2EFOA 3GF2A 1ZZ9A 3OD0A 3V8KA 4I7HA 1YW8A 2VC0A 4UVAA 2QZ8A 4ONUA 1BM9A 5AIQA 1QQIA 2LDUA 1QXRA 5LLQA 4GCVA 2VC1A 2A3SA 2QJVA 2XL9A 4HLXA 2NAZA 2VE8A 3BDDA 3UKNA 4LD5A 3CLPA 1Z91A 1J3PA 3GYHX 1Q1HA 2VBZA 3MEXA 1FSEA 3RYPA 2PHDA 4IF4A 2GH2A 4A5MA 1P4AA 4L2NA 1T98A 2PJPA 3H7YA 4KICA 3ZMDA 4GYIA 5CVRA 4OOIA 3G3ZA 4FAHA 3KSCA 2EAAA 4HQMA 1YFXA 4ENNA 3DXJF 3KP5A 5HS7A 2DO7A 1LJ9A 1I1GA 1ODDA 1O4TA 3TNPB 4KU8A 3ROUA 5D6EA 4R79A 1CAUA 1UPIA 2FE3A 2XVCA 4YARA 1B1BA 3ABUA 3WW2A 4RGUA 5CJ9A 3IRQA 1U12A 2JZYA 3JZVA 3SXWA 2IXLA 3SCFA 2M30A 4CXFA 5CVJA 3LA2A 4HSJA 5BV6A 2GC2A 3F21A 5EFUA 5EEHA 1X3UA 3ZQ7A 5JI6A 4OINF 2LSOA 4A6EA 3H1YA 3E97A 1MKMA 2QDRA 3ZN1A 1USTA 4M9ZA 2Q8KA 2A5YB 4M73A 3MCZA 2JT1A 2P5LC 5E18F 4KIBA 2E1CA 2BV6A 3WTUC 2XL7A 4Q5SF 4KWJA 3ZMTA 2MHFA 3BPZA 1STZA 3TO6A 5KBFA 5JVTA 1MD0A 3HSFA 1FP2A 4G7ZF 1W5TA 4HX8A 1GVJA 5D5VB 4EJVA 3DV8A 1B59A 1IXCA 1P6RA 4YSFA 4QGNA 4EQQA 1R1UA 1L3JA 3ZPLA 3IKTA 4KA4A 3HRTA 3Q9VA 2K7LA 1XMAA 2HGCA 1FBSA 2QVOA 3EYYA 2IT0A 5A2QZ 3DPLC 2FSWA 2Y48A 3NKTA 4J1WA 1FT9A 2ZKZA 5JSRA 1MZBA 1UIJA 3HRUA 3TDUC 1RUOA 1UB9A 2Q2EA 4XFAA 4EM2A 2ZKLA 1TQMA 1LDDA 2QQAA 1S29A 1U78A 2YPRA 3I54A 2MC3A 1C0WA 2MH2A 2HR3A 2FNAA 4ENKA 3J7AO 5ILVA 4JK1X 4ZYHA 1JHFA 4OU0A 4BHCA 5FPXA 2BNMA 3R0AA 1FNNA 3SZTA 3LQQA 4IEOA 3KETA 1SFXA 3D5LA 2IPQX 3G73A 1R7JA 1H1IA 5L3EA 1YG2A 5IT9K 1IPJA 3QAHA 4BYYA 2VODA 3GW2A 5I91A 1IN6A 3ZN0A 3HTUA 5LHHA 1AWCA 3UKTA 3GLXA 2EWNA 1F1ZA 1E2XA 4RD7A 3O6BB 5FPZA 4AXOA 4LA2A 2KIUA 1YIOA 4MTEA 3KCCA 1CF7B 4KMUX 3RIRA 3PLQA 4HN1A 4DQ2A 2FBHA 3WGIA 2HTJA 1Y3TA 3PVBB 4Q48A 2H6CA 4M6XA 3CF6E 4IXAA 5DEQA 1GQGA 4I02A 4Q0PA 4HLYA 2FBKA 4PGHA 2DPDA 2JPCA 1FZPB 3I64A 2GC3A 4YYOA 3F6VA 1CAWB 1VJ2A 1RNLA 3IIAA 5E8IA 1YW7A 2UY9A 1FYKA 2KXLA 2HEOA 4BAYA 4PCQA 3LZZA 3WGGA 4M6YA 2XUBA 5E20A 4ASNA 2A6HF 3CDHA 1YQAA 4X6RB 3DKWA 4HN0A 3HTSB 1YTYA 4U7BA 3UKVA 1LEBA 3LA7A 2WV0A 4RGXA 4IEXA 4G94A 4R52A 1J75A 5HDGA 1SD4A 5ICFA 1HW2A 1I5ZA 2IXIA 1XCVA 5JR3A 1LDKB 1SMYF 2BYVE 2OAZA 3R0JA 1ZREA 1FSHA 2PAKA 2CW0F 4IJAA 4IHTA 1R5GA 2RC4A 4XLPF 3WTVC 3CO7C 1EV7A 2QM3A 4MUVA 3L7WA 2ELHA 2BNNA 1EH8A 2ZJ2A 2RDPA 2HKOA 2BEOA 2Y0MA 1J0RA 2L3DA 2XKOA 3DF8A 4Y13A 5HS8A 2IP2A 1ZRFA 5LGUA 3K1MA 1BIBA 3BP8A 2OBPA 4A5NA 3L2CA 4P55A 2C0ZA 2A6EF 3VB2A 3TO7A 1I1SA 1F4KA 3BALA 2ET7A 1MGTA 2GU9A 4OMZA 3RPQA 3KP7A 5I93A 4PDKA 4MGKE 3E6CC 3LA3A 4OIOF 1ZRCA 4O5VA 5FLJA 5H6QA 4LB6B 5E1ZB 2VT3A 3EQEA 3ES1A 1U2WA 5D6FA 1KQ8A 1NE4A 5KVRA 2HKXA 2V09A 2JSCA 2HQRA 2Z99A 3FMSA 5DCMB 1B9MA 4A0ZA 4D0PA 5DUIA 3EQLF 1V4RA 5HLIA 3KP4A 3DFGA 1G4DA 2XAGA 1LEAA 1S6LA 3DEUA 2MD5A 5FD5A 4KL1A 4KNYA 2QNKA 1S7OA 3CJNA 4AQ6A 3C7JA 4UBGA 2W24A 1O5LA 2FNPA 4HAMA 1XD7A 2QWWA 2WC2A 2B8MA 4ESFA 1BI0A 2QBYB 4RB1A 2EK5A 2Q4SA 3O14A 3GFJA 2ZMEB 2K9ZA 4QMAA 3D0SA 3NSTA 5CYVA 4EGYA 1ULYA 1IN5A 3W6KB 1XCBA 1ZARA 1U6GA 5DV5A 4ZZLA 5HDNA 3Q9SA 4XFGA 4AVAA 3ZMVA 2AXLA 4I98B 2EV0A 4EM1A 4D7SA 5I0TA 2ZCWA 1KA8A 3FHZA 4A0XA 4OMYA 5HOOA 2E7XA 4AD9A 1YFWA 2YSRA 3F8MA 4L9TA 5E1XA 1HKQA 3JTGA 3IBMA 4HYEA 4MGZE 4IRHA 5BOXA 2ZXJA 4JQFA 1ZZBA 3HRSA 4HMZA 1Z9CA 3RI4A 1W4MA 5LHGA 3G7DA 3RZZA 1W7PB 1I27A 3OGJA 4I0BA 4E2GA 2IVMA 3WE3A 3BU7A 3RPUA 3L09A 3N97A 4XF1A 5D4RA 1YFHA 4HLTA 3LWCA 5HI0A 4IRGA 2GA2A 1YS7A 1IPKA 4FX4A 2HQNA 1RGSA 3SMHA 4UXNA 2H6BA 4OFGA 4NB5A 5HLGA 3PQJA 1ZLKA 2QBYA 1FXZA 1FOKA 2PFWA 1EH6A 5D5WB 3DL3A 3C18A 2CQKA 2CYYA 4I0AA 5LBQA 3HHGA 4LMYA 4B29A 3T5XA 3HSEA 3L00A 2BNOA 4KU7A 4WF2A 4XFBA 4EJTA 2V1UA 2G7HA 1CF7A 3QU6A 3OCPA 4L0ZB 2DK5A 4RAYA 1PDNC 1K78B 4K8FA 2FEZA 1G3TA 1BI3A 2NYXA 1QWRA 1FY7A 5FQ0A 1HKTA 1SD6A 3FZ3A 4RAZA 2CO5A 2WTEA 3K69A 4META 1X82A 3GWZA 2IXHA 2JTVA 5ICEA 2Y0OA 2VBWA 1SD5A 4IEWA 2GXGA 3HUGA 3I4PA 5DYMA 2GWRA 1LB2A 3QPTA 3IL2A 1FBQA 2DT5A 3DP7A 4HW0A 1TQPA 2LNBA 4AVPA 4BHBA 4L9JA 1HW5A 3VODA 3VEPA 4O9EA 2XLAA 3GEZA 1K78A 1Y0UA 1EYBA 3H3UA 3ML6A 3MPBA 2XHKA 4IETA 2HWVA 3FXQA 1YW9A 1XE8A 2XAJA 2OZUA 2ZO4A 2F2EA 4Q0UA 3CLOA 1XDUA 1U5TC 4EJOA 1BBYA 2NRAC 1ZG3A 5L3DA 3EYIA 4XFIA 2VXZA 4A6DA 3IC7A 2STTA 1JXSA 5AVPA 2EFPA 1YFYA 2DQLA 3I53A 4B8XA 2Q1ZB 4LULA 2KIFA 3CJXA 1TLHB 2OPKA 4M71A 3M7GA 1J5YA 5L3GA 1XRUA 1U8RA 3ZMSA 1HXDA 4RB0A 2GQQA 3LAPA 1KYZA 2QQ9A 1ZRDA 4LLOA 2VECA 1L0OC 2Q30A 2IXKA 1HKSA 5J8CA 2HZTA 4CYDA 2MA3A 2A68F 1ZG5A 4CZZA 1ON1A 2J5PA 3AAFA 5L3FA 1H9GA 4P5OA 1LRHA 5T3NA 3M70A 2NS0A 1VP6A 2GC0A 4BH9A 5ED4A 1DDNA 3WW3A 1CAVA 2H0VA 1ON2A 3KEOA 4I3PA 5CLSA 3H3ZA 3GYDA 3LAGA 3LAJA 3LOIA 2EFQA 4KMFA 4P96A 1XMKA 5D1IA 5DDGA 4UBHA 2D1VA 5K5RA 1PM7A 4LB5A 5J7MA 1EPZA 4MZUA 1W7PD 5I8YA 4R8HA 1I6XA 1CAXB 3WG9A 2UYBA 4YIIA 2DAOA 2W84A 3QACA 5HVQC 4IVNA 3C1DA 3GX4X 2UWMA 3EDPA 1YHFA 4HDUA 4RS8A 1QXJA 2IRFG 4HBLA 2PG4A 4AIHA 4Q0QA 4LG0A 3K0LA 1O3TA 2HYGD 3EBRA 1UCXA 3JTHA 1ZZ8A 4E70A 3P9IA 2Z2SB 3QP6A 4ZU4A 1X8EA 3FXRA 3HOSA 5FLXK 2M87A 5FDBA 2D40A 5BPDA 1L3LA 2MLGA 3HQXA 2DW4A 2XLGA 2OA2A 1U3EM 2RNJA 4ON0A 2W25A 3MWMA 1YYVA 2KKOA 3W6JB 4CDGA 3DPTA 1XB4A 3BZ6A 4A0YA 2FMYA 4LJZF 4NVPA 3RTRA 2EA4A 1F5TA 5D8LB 1ZVFA 1ZZCA 1ZLJA 1V70A 3WU1B 2PLYA 2Y75A 3B73A 1P4XA 5KK1A 4D7TA 3O3KA 2EA7A 5JSOA 5I0RA 3OF1A 1WSUA 2A61A 3IDCB 3LWFA 1X8MA 4QGMA 2F5CA 5E1WA 4P9FA 1XE7A 3KE2A 5FCCA 2O61A 1S3JA 2L54A 3T0YA 4DNCA 1J59A 1OD5A 3H92A 3S0MA 2GIVA 4XSZF 1NHAA 3E5XA 1R36A 4EJUA 2XROA 4Q47A 3IKVA 2L02A 2RN7A 3LQRA 3R6SA 1O7FA 3F8NA 3FFQA 2CFXA 4ESJA 3KZYA 4LK0F 2V1DA 3GBFA 3FHIB 3J80Z 4U0VA 4BQAA 5D5XB 2HFHA 2OD5A 1YFUA 1VR3A 1ZN2A 1GQHA 3ZMZA 2LKPA 2O6GE 3ZDSA 2M1BA 1R1TA 2Z9OA 4GYGA 1XSXA 4L9NA 1R00A 3R4KA 5JFRA 1OKRA 2E9QA 2D93A 2J5OA 2RGVA 2R7FA 2HYFA 2O03A 4QX5A 2PAMA 1SFUA 1GHCA 1BC7C 1ZX5A 1O7LA 4HQEA 1LDJA 3PFIA 1QBJA 4YFXF 2PYTA 4L5IA 1CGPA 2ZMEA 4G8XA 4LUKA 3TQNA 1WKMA 2EJRA 3HSRA 1X7NA 1LNWA 3MZYA 2GAUA 1LQ1A 2PHLA 3CL1A 1B4AA 1B6AA 5F64A 1Q5OA 2K27A 3E5QA 3QPHA 4UUVA 3B02A 1D3YA 1IN8A 3I59B 5H6RA 1NE6A 2CWEA 3QU3A 1UD1A 2R3SA 1J1LA 1WI9A 3T1BA 2CAUA 2G7UA 3N4MA 4MGIE 4PIZA 1BN5A 3PQKA 4KN4X 3KZZA 1J9IA 3HHHA 5BPIA 3NQOA 1P2FA 3K1PA 4BHPA 5JHUA 2MNGA 3IRRA 4JTNA 3GO5A 4EVIA 1S8NA 3F6OA 4LEJA 4MQ9F 1R22A 3F3XA 1Z6TA 1RZ4A 1IUYA 4HBNA 1BIAA 3M8EA 3OOPA 3FJSA 2XAFA 3HIFA 4OIPF 4UV9A 1USSA 1W7PA 4LFUA 3NRVA 1KYWA 1J7KA 2JRTA 4IPAA 2VN2A 1TQ5A 2XLFA 5ILSA 3GZ5A 1RI7A 4XEZA 5EZWA 1AOYA 4YNIA 1H1MA 1MDMA 2V79A 4MGYE 3MDPA 1DUXC 4NHJA 1UHMA 3U1DA 5IT3A 3V8LA 1D5VA 2FMLA 4FAGA 4L5JA 1HQCA 1SFEA 4TLFA 5LGTA 3F72A 4OLLA 2AS5F 2EV6A 2G9WA 4KUMA 3H8UA 2R7DA 3V7RA 3M8FA 4HX7A 3H9AA 5K5QA 1CAXA 1G3YA 2NNYA 1IRFA 2K86A 5BXXA 3I71A 5BQTA 1JE8A 3HT1A 1J2XA 1H9TA 2IA1A 2NNNA 4H7LA 1O57A 4A2UA 1ONVA 3U10A 5C6CA 3JSOA 3RJPA 3BWGA 4GO1A 1HSJA 1H0MA 1ZAOA 3BB6A 2XRNA 5DCFA 4AIKA 1SAXA 3RKWA 3DN7A 5H20A 1FI2A 5I8SA 2ESHA 3S7IA 1FLIA 3COAC 1Y9QA 1FBUA 2FXAA 2PI0A 2RVCA 4UHTA 3ECOA 1XGOA 4IRIA 1TQIA 3J80K 4Q0SA 1MDMB 1IN7A 4KIFA 2EA2A 2STWA 2EB7A 3MQ0A 2H94A 3V7CA 1FYLA 4A12A 4N9IA 3TOBA 4UV8A 2FQ3A 2GZWA 4EV0A 3T8TA 4HVQA 1RTVA 3DQVC 5FLHA 3TO9A 5E8GA 3I5UA 2DK8A 2ATFA 2XKPA 1JHHA 3KLNA 3FE5A 4HDVA 4IEQA 4HX4A 4ENJA 4IEVA 4MGRA 2Z69A 5DD8A 1G3WA 2ETHA 2DCTA 3PNAA 3F22A 1PUEE 2X0LA 4YG2F 1KGSA 1UFMA 5HDKA 3WTXC 1LR5A 3U0ZA 2PQ8A 3ULQB 2COMA 1IW7F 4MEYF 2QCSB 1XSDA 3ST7A 1Z1DA 2RQPA 2WWYA 3E6MA 5DD4A 3NW4A 4YIFA 5I0UA 4RGSA 2XAHA 3H1WA 1DPUA 1BOAA 3F8BA 2O3FA 3ES4A 2QLZA 4MTDA 1G6NA 3JSPA 1BJAA 1XSVA 2EFNA 2ZNYA 1V3FA 4XLNF 3VOEA 4WX9A 1XN7A 3EETA 1EP0A 3BJAA 1YLFA 1ZHFA 1DPRA 4WXDA 3CUQB 3GFLA 2ACJA 1UCRA 3H50A 3OV8A 3CTAA 3IWFA
chains in the Genus database with same CATH superfamily
4YWAA 3UV9A 4ZS3A 5JZGC 1VBB3 2LF8A 4A3ZA 3I9V2 3ITQA 4A42A 3PSIA 3D5SC 3KP3A 2NZ9A 1ULOA 1QXPA 3N05A 2K85A 4DYQA 3PNYA 3OS1A 1B72B 3HL2A 5FZFA 2GP3A 3OYBA 3RYKA 2OTJI 2DU9A 2E51A 3GCWA 1R092 4CYCA 2FOWA 4DOUA 5ACA3 1PMIA 4IEPA 2UYAA 2HS5A 2CSOA 2E7WA 1B8IA 3I58A 3AKRA 5FZOB 3MV01 2HOAA 4NHXA 3CEWA 1GP6A 4NNJA 3N9NA 2HI3A 3ZMUA 1UY1A 2PBIA 4HV6A 2F5FA 3SDGA 2G9GA 1W5CC 1LHVA 1YO8A 3P7NA 3RKXA 3N9QA 2XWJB 4HETA 3FM3A 2B4KA 2M0CA 3KVBA 4Y1YA 3OOUA 5KHDA 3AZXA 1UZVA 5DCMA 5L3BA 2Q1FA 4E7HA 5C4JJ 1D2QA 4H2AA 4N0BA 1IF1A 1MZ6A 1ZGJA 4Q0VA 4NQWB 2GXBA 4ABZA 3DGTA 2O8QA 5TJJA 4M9SA 5CYYA 4LBNA 2E1MC 4NPLA 3VBRA 2BHZA 2CUFA 4MXVA 3RMXA 3M1CA 2PX9A 4ZTFA 3OSDA 4S0HB 5KHKA 1XDSA 2VOVA 2ID3A 4LK6A 3TP0A 2E60A 4B1LA 5FB2A 3ERED 3ZQIA 3VBUB 3JRAA 1RUNA 2IS1A 2CY6A 3LSJA 1LE8A 1HOMA 1J3RA 3CBNA 1H8TB 4P1WA 3IIIA 1K79A 1AR83 1TME1 1WZXA 1APNA 2EZKA 3IKWA 4BQXA 1AR72 1OR7A 2DVFA 1COV2 1Y9GA 4EN9B 4QXKA 3LOCA 1NY72 1OMIA 1BA5A 2KFDA 4IE0A 3VBRB 3MIHA 4ZU7A 4UNOA 5FYUA 3CC2I 4XLCA 2COBA 4U7DA 4XFHA 1TZLA 5DUXA 5B5EC 4LHSA 4O7XA 1RL3A 2KJCA 2OS2A 5FY7A 5FKOA 2K4BA 2MLKA 2P5KA 4PI2A 3KHCA 4UW4A 4LLLA 3BR1A 4C30A 1APLC 1JUHA 1ZYRF 1H0BA 2H27A 3VYSB 3USUA 2VW0A 5LBBA 2K40A 2P3IA 2OUHA 4FTBA 5LA9A 2WYSA 4KN7X 1BC8C 1HB3A 4GMP1 4KYWA 1OQEA 2LUWA 5LD2C 1U5TB 3MN2A 2CNAA 2ETEA 1D8KA 2DQRA 4ZZDA 1NCRC 2DA2A 1BCXA 1REPC 2CW7A 1SBDA 1JUMA 4HZFA 1R23A 3LCPA 1QZZA 3HGYA 3T8RA 2A6XA 2D5HA 3RZGA 2WQZC 1IC8A 2HXOA 1WW4A 5FYZA 1OH4A 2HWF3 2B0LA 4GGGA 1Z0XA 2ZSIB 3PFYA 2KJBA 2JDKA 2IFWA 2ME6A 4RHV3 4IHVA 4HVRA 5F0HA 1DHKB 5A32A 1UW8A 4ETSA 4Q4W2 4DINB 3MV11 3CUQC 5IVEA 1Z7UA 4M74A 3A02A 2GMMA 1WW7A 3L2HA 5FQ0B 1YLLA 2RV8A 1DYOA 4CUGA 3WF2A 1DQ6A 1KS4A 2P6TA 4QLCU 3QYFA 1ODMA 1QJZA 3OL3A 5ICCA 1MH4A 4L18B 4FQGA 5FJ8J 2DXIA 3CMAI 3AYAA 1Y8QB 4U0WA 1VBA3 1UHWA 1JODA 3SHFA 2HBTA 1W36D 1ZBA3 5IFTA 5B3SH 1B35A 3K4JA 1PGSA 2W48A 1XPWA 2WNEA 3J8F1 3JAMZ 1PVXA 3FMRA 2XJTA 2IGOA 5LHIA 3LDKA 2R7OA 5HLHA 2AACA 4CVUA 5D4SA 3DKYA 1RUJ1 2VQAA 2L7MP 3I7DA 2ZGUA 4WVZA 4BMBA 4DXTA 1QDCA 2BBYA 1K4TA 3F8CA 3J81K 3HOZJ 1WLTA 1LODA 5BUVA 1W5SA 3GVAA 1IRGA 4RA2A 1IAWA 1F9NA 1V6OA 3KT1A 4YZ2A 4MH0E 2B5HA 1KQ9A 1JOJA 4AI2A 3EO6A 1SLTA 5A33A 3NVCA 4Y1UA 3D5OA 5M0TA 2DF7A 3J81Z 4CP1A 3LF7A 1ONAA 1GXPA 1JTYA 2V5YA 4KWKA 3JRCA 3MF9A 1FX5A 5FZIA 4Q4Y2 4G6QA 3A01B 1J1TA 4AM3A 2J1AA 3GBGA 4E4SA 4AYBN 2BW8A 5IW0A 2I45A 5TSWA 3A2KA 2F5DA 5LRRA 3JRGA 4XQDA 1PYVA 2YXSA 2W57A 1AYM1 1ACIA 5IT9Z 3WT3A 3LFIA 2WAQA 4BS9A 4OZOA 4RM2A 2YB7A 3VD3A 1DZRA 4A45A 2IW5A 2M7BA 2OU2A 4C1WA 3POGA 4F3QA 1UMZA 4IEZA 4Q1PA 3HPHA 2V9VA 4AI9A 5ERIA 1LVAA 2XR4A 4FCAA 2JWPA 4XQFA 5FRAA 4LMFA 4XR6A 3BPSA 4P9YA 3GDBA 1QNWA 3J7ZI 1HC8A 2DMNA 5AC92 2UZKA 1FWZA 2DYSH 4BA6A 1BMV2 4ZTJA 3RQ0A 3MIFA 3DEWA 3MKWB 2EFWA 3E6DA 2G19A 3L2RA 4EE2A 4AQSA 2HZDA 1VZ0A 1PP8F 3ECHA 1FP1D 2FOKA 1LULA 1IZ1A 3NWTA 4JBAA 4E7JA 2QQUA 4OVEA 3USSA 1MW7A 4RGGA 2R32A 1T6BX 4P02B 4HF1A 3ELKA 2OZJA 1BXHA 5E3NA 5IVJA 1V6IA 1W6QA 3BUCA 2LY1A 1SCSA 3RZOJ 3GTOJ 3BOQA 1UZ0A 2BERA 1SVLA 1QVTA 1DZTA 2GALA 1UYPA 2NP0A 3I4NJ 1J58A 5BNOC 4M3CB 2X53S 2JPBA 2DFIA 4G6DA 1R64A 1DZQA 4CDXB 4AC0A 2C6YA 2JDMA 2ZBKA 2NVTJ 3BG5A 1F8VA 3LDBA 4JCKA 4M3CF 4RDUA 5E89A 4IV1B 2CV1A 5J3UA 3C3VA 4K3UA 4IW3A 2W2IA 3LSIA 4JGZA 4AWXB 2TBVA 2K4JA 1W9WA 5IFPA 5ABJC 1KU2A 1W6QB 5JDBA 1K4SA 3U21A 2HTSA 4M9XA 1H4GA 1S0GA 2DVBA 2JG8A 3U2RA 5FZ0A 2VGDA 4COYA 3CJIC 1IS5A 3LSTA 3DCQA 2M4GA 3KLOA 2RDNA 3L2VA 1NKGA 2DURA 2RS33 3U11A 3AP7A 4XM3A 4NBQA 2VQTA 3AJYA 1H89C 3LGRA 4M6VA 4P9UA 3KP2A 1WQ2A 3LL7A 2D6NA 2PEXA 4KMQA 1AL23 1TNRA 1JS9A 4NWWA 3REOA 1OYYA 4LPLA 4NRQA 4PDWB 2VE9A 2O0YA 5C44J 1WHUA 4URTA 4W6YA 3K4KA 1ZZ7A 2J1VA 1FMD1 4KWLA 1YS6A 1LUJB 4LIUA 2O14A 5ABJA 1AR92 3LQCA 1GXQA 4CRQA 4DXSA 1Z21A 4S04A 2F4PA 3I59A 1GNYA 2IC1A 1Q8SA 2ZNZA 2Z16A 2J22A 4RGRA 3I0TA 5CZKA 3VB9A 2O9LA 4YIRX 1VBC1 2OZ6A 2CQXA 2JEMA 3KF3A 3P9CA 2JMWA 3JW4A 3CO6C 3J7LA 1T56A 3EJKA 2NOGA 4A3IJ 1M1EB 4XN3A 4GXLA 2LP0A 3GF2A 1ZZ9A 1YW8A 3LMMA 1RUI3 2P3YA 2QZ8A 3HBKA 4QDRA 5B1BH 1BM9A 1FATA 2L9NA 2OQ6A 3ON7A 3A0BC 4UT5A 3ZXDA 2A3SA 1YHQI 2JDYA 2VKDA 1WPKA 1F31A 2AEZA 4DRVA 2NAZA 2X1DA 4DY3A 3NJVA 3MKYB 1K5MA 4A44A 3Q8CA 1TMF3 1BW6A 3GYHX 3G2BA 5L19A 2PHDA 4JDNA 5GZEA 1VQ6I 3JRHA 1HDKA 4FXGB 4W6XA 4UOJA 2GDFA 2BU9A 5D8AB 3FLRA 4AEDB 4L2NA 2PJPA 3H7YA 1PO13 4CCOA 4MGSA 4P9LA 5CVRA 3BZKA 2Y64A 3DPRC 3KSCA 1V6LA 3TEZA 3RGBA 2YBSA 1GICA 5EGOA 1G9DA 4RL7A 5LZ6A 4NIIA 2XVKA 2BVMA 2CSGA 1MVQA 4U36A 4FI9A 2VKEA 4Q8LA 4QT6A 2VBBA 4XJ8A 4Z2WA 3PVNA 1CAUA 4ARXA 2FE3A 5HCFA 2D7FA 3T4HB 4RGUA 2WZR1 5SV5A 1IS6A 1U12A 2ZXHA 2XDVA 2ZJPF 3SCFA 3FXJA 4CXFA 5CVJA 4BEHB 3BQYA 1S2KA 3F21A 5D8AA 4MFEA 4JKMA 1ZYBA 2R5ZB 3ZYHA 4OINF 3RMYA 2LSOA 2KRCA 1USTA 2JT1A 2VZ1A 2P5LC 2YUSA 4XUTA 4XRSA 2KR2A 3PU8A 2WNUB 1NG6A 1D4M3 1GLNA 4KWJA 1Y7BA 4PCRA 2DMUA 4N43A 5A3MA 3T2OA 1STZA 3A01A 3DEMA 4M3DA 3HSFA 2XGEA 2WV1A 4G7ZF 1OPOA 1BEV3 4GH4B 2ZGPA 3POYA 4Q4Y1 3VPRA 2C9KA 3MIGA 4PT6A 1XX5A 3GLLA 5C3RA 5GZFA 1OCTC 2GMEA 4KA4A 5A1AA 1BVP1 5FUIA 1NXD1 3VL8A 5A2QZ 2IT0A 1DP3A 3TBDA 2Y48A 4K1ZA 1D1CA 5E8AA 4CCJA 1UAIA 5JSRA 2CDPA 4G9SB 1B35C 1FOD3 1WW6A 1QHHD 1QJEA 5F5QA 1S7EA 5FO8B 3B00A 1TQMA 1YQ2A 4PFPA 1X9PA 1BW5A 5HXVA 2EINH 1ODNA 4Y1XA 4P9XA 2FNAA 4ENKA 2CH0A 1WMEA 4BLJA 2MGQA 2E26A 2VZQA 2X09A 1LGCA 5H9QA 1R5ID 3D5LA 2WFF2 2YUEA 5M5YJ 2M0MA 3BIWE 1IPJA 1TWCJ 3ABZA 2VODA 3FKJA 3HTUA 5LHHA 3GLXA 2XHNA 5IWFA 1AX2A 2EWNA 1BOBA 3O6BB 1IGNA 2DFBA 5HBAA 3KCCA 2ZHKA 2NM1A 3OR2C 5C4WB 5H9SA 3WGIA 3NQHA 3S16J 3DXUA 1Y3TA 1HX6A 1GQGA 2VUDA 3I8TA 1OVSA 2DPDA 4YW7A 2JPCA 1ETOA 1FZPB 5L7OA 1NOVA 4IQPA 1OHFA 3IIAA 2FDFA 1SVOA 1YW7A 3NWSA 2KXLA 4RSUA 5D2AA 3RI8A 4CDXA 3UNPA 2XUBA 5E20A 4WM8A 4NO4A 2BQPA 3PVOA 1GZCA 1RJ7A 3GCMA 4IEXA 1J75A 5HDGA 5ICFA 2GBYA 1I5ZA 2IXIA 4UUSB 5FOBB 2BYVE 2OAZA 4CXXA 5IYYA 1ZREA 1FSHA 2ZGKA 4IE6A 4IHTA 4R4ZA 4LJHA 5HNFA 3K3OA 4XLPF 3CO7C 1WJDA 2QM3A 1VQ9I 3L7WA 2FHRA 5FPBA 3FBNB 1XNKA 3UR3C 4RFRB 1DF0A 1AKHB 2BEOA 2Y0MA 5JXIA 3H5AA 1VQ8I 5CEHA 1H6YA 5GPCA 2O8KA 3U75A 5KC6A 3L2CA 2YU2A 2EPFA 1UXXX 2W46A 1KFUL 1F4KA 5C3SA 2VQ0A 4CP9A 3IV5A 1YQ8A 1VMFA 4LBMA 3RPQA 3HJEA 4WVWA 2WQ8A 5I93A 4PDKA 2Y6KA 1GUUA 1VMJA 4OIOF 3NARA 1L7QA 5FLJA 1KITA 5JOZA 1COV1 4LKEA 2EXJA 4D6SA 3KPHA 3SEZA 1OOPB 5FK7A 1LHWA 2R063 1WJCA 4D0PA 3TAYA 3KP4A 2EILH 1BK0A 2HWB2 4CUAA 3O5SA 3T0AA 3I2OA 1FPN1 1S6LA 1VF9A 2MD5A 5L7OC 3MMYB 1VQ7I 3UETA 5IAXA 3VWBA 2VOXA 4FFIA 1JZ8A 4FPEA 4HSRA 3D5RC 5FMOS 2CV2A 1AKHA 4AQ6A 3C7JA 5C9AA 5EV7A 2FNPA 2HPIA 2R7RA 1GNHA 2B8MA 2WC2A 2QQWA 2VE1A 1BI0A 4IGOA 4KG0A 3S1RJ 2EK5A 3O14A 3HEIA 3VN4A 3MW3A 2ADDA 2YBKA 3SEQA 4PJ0C 2WDBA 3L2UA 4Y22A 3DF0A 3DBRB 2GIZA 3WNPA 3Q9SA 5FZHA 4AVAA 3P1IA 1JKRC 5IP7J 2AXLA 3RZDJ 1OOPA 1T6GC 2GNBA 4AD9A 5JMCA 1YFWA 5KAIC 3JTGA 4EZHA 4HYEA 4MGZE 3RWKX 3D6EA 2F48A 3HRSA 2R073 5FY0A 3ZXKA 5IAVA 1W7PB 3V0AA 1UOJA 2JSPA 4Q4X1 2OX0A 4PHZA 3L09A 3N97A 4GDFA 1SPPB 3CCEI 3KVAA 2BGPA 1GOGA 1OKQA 1ASJ2 1DLLA 2HQNA 1UY0A 1RGSA 3LIHA 3AKZA 4UXNA 1QU0A 1WD4A 5HLGA 3T2TA 1FOKA 3VBHA 3ORJA 1EH6A 3KV9A 4UYBA 2ARBA 3L00A 2BNOA 4KU7A 1P7JA 4X1EA 1WA6X 1YX5A 2G7HA 1CF7A 2HXIA 3I4MJ 4RAGA 2X1CA 3POSA 4FPYA 3B6AA 2DFFA 2MFZA 3W2WA 1HLCA 4XAAA 3AMQA 2DK5A 5FBZA 1K78B 5JVVA 5FYHA 1CIYA 4K8FA 4P14A 1QWRA 1XPXA 4GB32 4OUMA 2ZTNA 1RB8G 2A05A 3K69A 3PDQA 3VSLA 1X82A 3GWZA 4UF0B 3VBRC 1AXKA 4LG3A 4MO3M 2JTVA 3MW2A 1ND3A 3CJRB 1SD5A 3HUGA 3K6GA 1AXZA 5DABA 3SYTA 5M3MJ 2WNUC 1LB2A 1WZ2A 3QPTA 2ZJCA 2GNMA 2ZS6B 3VDAA 1IO2A 3OY8A 4BHBA 5LA1A 4L92A 1MNDA 1HW5A 5FKMA 5DZEA 4I99C 2Y9ZA 3ZFGC 1DGWY 3GEZA 4D7YA 5IVCA 2XMLA 4IETA 4E27A 2VMCA 2HWVA 5GLTA 2XAJA 2F2EA 1YRNB 3C7EA 4P5YA 4GWMA 1FYUA 3CLOA 1XDUA 2XPJA 5GTIC 2NRAC 1C5HA 5L3DA 4DIQA 2VXZA 4RS5A 4HG2A 1IGOA 5AVPA 1YFYA 1OVPA 3I53A 4XYXA 5CFDA 2Q1ZB 4AK3A 2OPKA 4QU1A 5LWBA 4XLFA 2G9FA 1F35A 3ZKYA 4E4ZA 4E8DA 2HDDA 1S0CA 2VECA 2XG3A 2EIMH 3PNVA 3ZLIA 2CGNA 2FCVA 2MA3A 1OA2A 5KCMA 4C0HA 4SLIA 2MC4A 4CZZA 5L3FA 4E7SA 2FMDA 1WGXA 1QPIA 4JDMA 3FIWA 2GC0A 4B4CA 3L2WA 1AR63 1GSLA 4BH9A 4QHOA 1WCDJ 3M3OA 5ED4A 3L9JT 4BY7J 1QJX2 1U5YA 3KEOA 3MW4A 3RG0A 4Z2AA 3LAJA 1US2A 4DFSA 1IG0A 1W6OB 1RUE3 3N7LA 3AC0A 3PIGA 1AUYA 1VBE3 3H8OA 3Q0UA 3H36A 1I6XA 1CAXB 4LHLA 1CQTA 4BL0B 1KDMA 5JR2A 4YIIA 5EPAA 3QACA 5HVQC 3MO4A 1TG7A 4HG6B 4JRLA 1OSGA 4ASKA 1P7IA 3K0LA 2HYGD 3EBRA 3EUAA 3ZKUA 1NQDA 3VGIA 3KZIC 1NG7A 4KWUA 1D1AA 3HOSA 4BJ0A 2M87A 2D40A 1L3LA 3E1F1 3HQXA 4YW3A 2VJXA 2DCKA 1YIPA 3LNQA 4YG3A 3SH5A 4ON0A 2RVAA 1GR3A 3MWMA 1TWHJ 1C8M1 3OOXA 1VBB2 2H1KA 1WD3A 3DPTA 4Y20A 3WINE 2B46X 1A31A 5CB7A 4A0YA 5GLVA 4LJZF 3K2OA 3ZFEA 1ZR4A 1ZVFA 4A69C 1V70A 1RUC1 4XILA 4AEDC 3HMYA 2XGCA 1TNFA 3WNNA 5J09A 1VB2A 3I3QA 1AYM3 1WW5A 4Y5TA 1GZTA 3KV5A 2Y33A 4CXYA 4M0HA 3B9IA 4QB2A 4NN0A 2RN7A 4MXWA 1FPN3 1O7FA 2CFXA 2V1DA 1T8IA 3IB3A 2HFHA 3IH3A 2QEXI 3LSDA 3W9AA 2KL4A 1AR62 1FIAA 1AJKA 2O6GE 3KWVA 2M1BA 4NROA 2Z9OA 3NV4A 2V73A 3WV6A 1Y6IA 1MZ5A 4LO5B 2VMIA 2E9QA 2D93A 2R7FA 2PAMA 2VMDA 4LXLA 4C0BA 1LDJA 1AA7A 1ETQA 3HBLA 1QBJA 4N53A 4YFXF 3DTEA 1RYYA 3IH4A 1CGPA 1XE0A 2ZMEA 4P08A 1TZOA 2OXBA 1UMHA 2VQGA 2PMZA 3HSRA 1CR7A 1JUPA 2RM23 1G7YA 1UQXA 5FYCA 4CZSA 3CL1A 2NS8A 2A6ZA 1PZ9A 1B6AA 3POEA 5K0UA 1VB4A 1BR4A 1Q5OA 1V9U1 1QA6A 4E4DX 1GZWA 3QPHA 1WH7A 5FP3A 4AI0A 4BQ5A 1IN8A 1NE6A 2VMGA 2YPJA 1WI9A 4BBSJ 5T54A 5FZKA 4PIZA 1BN5A 1H2NA 3BU0A 1J9IA 2Y34A 5A3OA 3NQOA 1GV5A 2HVSA 3K1PA 4IHWA 5HCBA 4C90A 4PFOA 1HDPA 1HB1A 4LEJA 3F6OA 4K6BA 3HQRA 4GJZA 1JOBA 4E7KA 1ZBE3 2ZGTA 2XB5A 5C33A 1Z6TA 3N7MA 1WVRA 2Y0SA 5K4LA 3W6VA 2FBEA 2WA0A 4INDA 3P3PA 3OYWA 3HIFA 2EXKA 3ZQGA 1IS3A 2A7AA 1SDWA 4QTRA 1TQ5A 4ISRA 1P9QC 3SKJE 5ILSA 1RI7A 4XEZA 1H1MA 4XOTA 1YE9A 2DA4A 1FMD2 2QQLA 1MIJA 3ZIXA 2V79A 3KLSA 4MGYE 1F4HA 3MDPA 1EV13 3BG3A 3OBAA 5J1XA 4HONA 2EXHA 3BCAA 2P34A 1HQCA 1SFEA 4UF0A 1K83J 3F72A 4OLLA 2R7VA 2KQRA 2E36A 4DS0A 2A70A 4KUMA 3OYWB 2AHQA 4QPWA 1IDZA 3CQZJ 4KBZA 4U87A 4GA9A 2NNYA 2J1TA 2XVLA 3KCXA 1IRFA 4DPNA 2ME0A 2VZ3A 5GLZA 5LBFA 1O57A 2BY2A 3LSGA 3U10A 5FO7B 1OQYA 3ATGA 5C6CA 3JSOA 3S2HJ 3RJPA 1OUXA 1IV8A 1HSJA 4NPMA 4CDUA 2XUMA 2XRNA 2CS3A 1JZ5A 1BEV1 4LT5A 3RKWA 3VV1A 4A3FJ 3COAC 4PJLA 3K46A 2K3PA 3V0BB 3ECOA 3J80K 3TN92 1MDMB 1HRV3 4KIFA 1LOCA 4II2A 3GALA 4MADA 3TOBA 2FQ3A 2W0XA 2VJ4A 4D7MA 3PUHA 5FZ4A 1CPMA 5E8GA 2ZMLA 4LO8A 2XKPA 1D5YA 4QB6A 5T5PA 1E0EA 4HX4A 2R043 2W95A 1PUEE 1JYIA 1RIRA 3AXDA 1UFMA 1SC7A 4CDXC 1O91A 4MEYF 2WY8Q 2QCSB 4CCLA 4H14A 4PLMA 3J8F2 2LKXA 5FXZA 2AR6A 3HD8B 1EF4A 1PGW1 3OGGA 1S72I 4Q4V2 3NW4A 5I0UA 4RGSA 2XJSA 2XAHA 3PIJA 1DYPA 3ES4A 2QLZA 1G6NA 4BE0A 3DYMA 2LY2A 1XSVA 3CF2A 2EFNA 4FO9A 3SLIA 2WWUA 3VOEA 4JHTA 3CMMA 2WJSA 2LTPA 1QKQA 2VPRA 1V55H 3CUQB 3GFLA 2ARAA 3OV8A 3IWFA 4RBOA 3BTJA 1A6CA 2YR2A 1TBXA 1DLCA 3S14J 4QHZA 2VL8A 1T0FC 4L5EA 5GAHJ 3BGAA 1D8JA 2DOEA 4Y17A 4FPCA 4PIYA 2VU9A 4B09A 4XABA 4Y15A 1TMF2 2R16A 2DDUA 1P92A 3FHNA 4BXUA 3DLLF 4H0EA 4RHV1 4G7OF 1SHWB 5LY2A 3AP6A 1QEXA 5K5OA 1DQUA 2DCYA 2CJJA 3BROA 1YJKA 1NX9A 5CKQA 4ZYGA 1Z05A 5M3FJ 4XBFA 4Z6YA 1JUIA 4IV3C 1YJLA 2BFUS 1R4NB 3CP2A 4N43C 3OIPA 2VQCA 3O1PA 1NCQB 4XETA 4DQAA 5C8WA 1MMGA 1ZKGA 2DT6A 1HIXA 2QENA 4GH4C 3T4VA 4J1XA 3S5QA 2VMHA 4PGGA 3WODF 2P5VA 5E16A 3VD5A 3MYXA 4ITVA 2DA5A 5FY8A 1AL0G 4EEFG 3OJBA 1I50J 4QKBA 2P4WA 4KNCA 5FFOC 4MHGA 3V42A 2JKBA 1D0GA 3ZOIA 3TYJA 4XFCA 4RLFA 3KGLA 1SFNA 1ND2C 5DTDA 1C1LA 4M0NA 5JIAA 3GJBA 1RIOH 1U5IA 1LOBA 5C8CB 4FHTA 3PTRB 2Z5UA 5D8KB 4ZKTB 1DQ1A 5FZOA 1TP4A 4OIRF 4Y4YA 2VNGA 1FC3A 4DXRA 5CKNA 3PVEA 5BNQA 2OTLI 3ZXSA 2J1UA 1C1FA 5AONA 3RRDA 3KGZA 4LK1F 1FX7A 5D8AC 3RJRA 1MR5A 1UPSA 4TN7A 2EV5A 4B3XA 4IDZA 2JJ7A 4H4KC 5AIPA 1SLCA 1XNTA 2Y31A 3VSKA 2DA1A 3MZ8A 5T52A 3JD72 2W1SA 2LC2A 5JR7B 3QBQA 3DYOA 2EALA 3UESA 5T5OA 4NIAA 3UT0A 2CGOA 3OB8A 3KEYA 5A2QK 5E17F 5GZGA 3BTIA 4NAOA 1ZG1A 3K1NA 3U4XA 4IO9F 3IDBB 1I9RA 1MZEA 5IJRA 1QU3A 1URXA 2LH9A 3F23A 4TTGA 1DQ2A 1MJBA 2EQRA 2LRPA 1BMV1 4OI1A 1DU6A 3DTKA 3ZN4A 1TWAJ 2HWD3 1Y4WA 3DUIA 1OLME 3WVJA 1N3PA 1TC3C 3ZQHA 1HRV2 4PQQA 1N1TA 3R60A 3VDBA 4C3IJ 2OV7A 2VPVA 4AFMA 3EUHA 2G1MA 1AHSA 3U4SA 2R7EB 2DT7B 3TOAA 5JHFA 3FXLA 1G9AA 4WBBA 4BKXA 2WSVA 1XBFA 5CKMA 3ZOBA 1RUC2 4KT5C 4AWDA 2ICWG 3I3MA 2FCUA 3AZYA 2HBUA 2KA3A 5CAZA 5ILUA 5FK8A 2TUNA 1BI1A 1LOFA 2IXJA 3VDDA 3OY8B 2WS93 1SD7A 2R072 2ZX4A 1AJOA 4WVMA 1JKPC 2VONA 4BCUA 3ILFA 1DGWA 1RVF2 4UVCA 4JOMA 3FX3A 5K7FA 1UHSA 3ACGA 2QUFA 4NUBA 2P2KA 4Y52J 3ISPA 3SJMA 2K46A 1CAUB 1UZCA 3W3CA 3KMHA 4XIOA 4V1PA 2CYFA 1SACA 1JGSA 3QRFF 1Z6RA 4JP0A 3KHBA 3J7YJ 3OGVA 2IJLA 3ZSMA 5JPNB 3HC7A 4AVBA 3OYGA 3HT2A 2DPUA 3K9TA 5EGOB 2DFCA 5FFXA 3AXEA 3VZOA 4AYUA 3MAJA 4K2EA 4O61A 2DUPA 2HWD1 4A4AA 1IRXA 5FMCA 3R4SA 3WTSC 4F7ZA 2WFPA 5ANQA 4I09A 4LORA 2NXNB 4YM1A 2VOTA 2WFF3 1KU7A 2XGDA 4R1HA 3JAMK 2ISZA 4CUCA 2JE9A 3RFRA 4QKFA 3WW4A 1ORKA 3VBHB 3FZVA 3I3DA 4XBLA 1OF3A 2R0HA 1VQNI 3WE2A 4NWVA 3OR1C 3EPZA 2D3SA 1ZA7A 3T08A 2A69F 1JUSA 4RB2C 2CAVA 4XUPA 4XC9A 5B66C 2JE7A 5DUUA 2XIGA 1X2MA 1RUE2 4L9VA 4EATA 5C5TA 2YU3A 5LBEA 4CA0A 4QB1A 2JVGA 1TT0A 3AYDA 5GTHC 5BY5A 4CP0A 1XS9A 5BPXA 3ONQA 1KFXL 5LB6A 4EMSA 2VL4A 1GDTA 4RA0A 4HEA2 4BQNA 1VQKI 2HJIA 2RQQA 2KRFA 3WGHA 1WMFA 2ZZJA 4LLGF 2QGUA 2K5CA 3L1PA 4BK5A 1XYNA 4N7UA 4Z2YA 4FQZA 5DM6F 2VVDA 2BXYA 5FYTA 2JUGA 1S2EA 5CVVA 2VOPA 5JMOA 2P7CB 2XXZA 2WAEA 3WR0A 2M5WA 1RUG2 1N25A 2DTZA 1V0AA 4QPGB 3BCBA 3ZGKA 1AL21 3MZHA 1U9NA 3PO3J 1FTTA 1REFA 2VO5A 4ORFA 2V9PA 4CDQC 2W1QA 2E5ZA 3E6BA 1PUFB 4V2FA 5FUPA 2ZFUA 4BE1A 4J01A 2W1OA 4ESBA 2FBIA 1NA1A 3WEZA 4ANJA 3DYPA 3HOVJ 4FPKA 1T0FA 3ABMH 4DUWA 2PMUA 2CTVA 4PBPA 3HR9A 5FZ3A 2HWE3 2HOTA 5KXBA 2XV4S 1M06G 3TDZC 4ASLA 1JZ2A 1FV3A 4XF4A 5A70A 2RMU2 2ZFWA 4EM0B 4FPLA 4R9AA 3D82A 3QYBA 3DU5A 1VQPI 2P6CA 4I01A 3PURA 2V6CA 1IN4A 4ZONA 4OIQF 1QY4A 2E7TA 2KIMA 4CICA 4LBOA 2HYKA 2L9RA 4Q4W3 5FV3A 1BQPA 4QKDA 3TNQA 3I2GA 2D2WA 5IYBJ 1ETXA 2GMPA 4PDWC 1KDKA 4AHWA 2W3JA 3NJZA 5C9AC 2VQUA 3ACIA 2A6VA 1F5JA 4U0YA 5CVUA 1B8IB 1RUF1 2W85A 4YFKF 2XJVA 1WMDA 5GLWA 5KHGA 4C8DA 3POBA 4EWEA 1W6OA 1IKQA 4AW7A 4L11A 3H1CA 4QX7A 4PJJA 3CUOA 2ADUA 2I07B 5K1YA 2Q0AA 2DBNA 4YFNF 1IHMA 1MMSA 3NEUA 3ZXGA 2X5IB 4I2OA 5FFZA 4G12A 1X9TA 2GSYA 3BG7A 4CP9B 1TTYA 4CEWB 2WN2A 3WTYC 3MEPA 2H0BA 2ZABA 5FXVA 4KIGA 2HWE2 4O3MA 4BU2A 3FM5A 2R7UA 3H9GA 3EMRA 4FOYA 4LLNA 1JHNA 4CO8A 3O0WA 4DY5A 4WK8F 2VD7A 3E0JB 5KHJA 1QGPA 1XU1A 4YVWB 2A07F 1YITI 5F7UA 2V4AA 1S9HA 1R081 5GADJ 1SQ4A 1QO0D 1U0JA 5F6LB 4F3JA 1AXYA 4FX0A 4A93J 5GZCA 2L01A 2NS7A 1SFYA 2P17A 1Y39A 1OC1A 4LBKA 3TEWA 3ETPA 4XMIA 3O8HA 4QWQA 4ENMA 4WZFA 3H42B 4JAAA 2ARXA 3CCJI 3PL0A 5EYRA 1PVC2 1BLZA 3O8GA 4NHYA 4FISA 3ZFGB 1G3SA 4OYUA 4UFIA 1R5HA 5DDJ2 4Z82A 1OFNA 3BY6A 4EGZA 2FA5A 2QZ2A 1JZ3A 3RZLA 4Q4X3 1U9OA 2L4MA 3H3VK 2OQ7A 2P4EA 3OD0A 3V8KA 4I7HA 3ZXLA 1L7LA 1OQ1A 2R7ZJ 1Q1VA 2EIGA 4PSWA 2WO3A 2RE9A 4W6WA 1XSRA 4BQ4A 3ABKH 3QLQA 1V9U3 5A3UA 4D9JA 4HLXA 2VE8A 4XOGA 4ES9A 3BDDA 3F95A 4DZPA 3UKNA 1CWPA 3CLPA 4CCKA 1NA1C 2VBZA 2E7QA 1FSEA 3RYPA 3PTYA 2GH2A 1P4AA 2VB6A 2VMFA 4A6SA 1AR71 1I39A 5IK5A 1SAUA 4Q4V1 4LO7A 4GYIA 2ZAHA 3G3ZA 4AAXA 3DXJF 4IX7A 3T2PA 5K0UB 1BL0A 1LJ9A 2MYSA 2PJRA 4CPBA 4OQ8A 3TNPB 3HG9A 4WM7B 1RUD3 4AG4A 1UPIA 2XVCA 1B1BA 5EXOA 2IZWA 2K9NA 1ETVA 2MEV1 1SCRA 2J1SA 2JZYA 3WNMA 1SEUA 2X05A 3POWA 3IT8A 2M30A 3ZM8A 3WP4A 2BY1A 1LCLA 2GC2A 4YG0A 4BJ6C 1X3UA 5JI6A 1NK2P 4M9ZA 4QAWA 4XJUA 4M73A 3MCZA 5BNPB 1CONA 1T33A 5E18F 1MQTC 1RUG1 2BV6A 5HV0A 3WTUC 2Q8EA 2XVGA 3ZMTA 4RHV2 3MLKA 3AX4A 1QJFA 3USUB 5JVTA 4URAA 3U1KA 4FP3A 1WJFA 1W5TA 4LK7A 1GVJA 5D5VB 4EJVA 5CBLA 3DV8A 1SLBA 3VL9A 1B59A 4BOWA 1H2LA 4EQQA 1R1UA 3QPLA 1JKOC 3ZPLA 3IKTA 3AMMA 1EJ9A 2JDUA 1DQ5A 2FDKA 1XMAA 1W36C 2QVOA 1ZBA1 4FP2A 4Q4Y3 3NKTA 1VBC3 2PLV1 2EBIA 2ZKZA 2RR13 3I2JA 1MZBA 3HRUA 4K21A 5DQ0A 3TDUC 4COZA 1FOYA 2WADA 2Q2EA 1H4HA 2AQEA 1VRH2 3LPGA 3WG3A 4EM2A 3WXPA 1HQLA 4CH7A 2G4IA 2WS91 4N8MA 1S29A 2YPRA 2MC3A 1PGW2 1C0WA 1ENQA 2DVDA 1NG0A 2HR3A 2E31A 4QPGC 3OMYA 4JQRA 2XJUA 2BVLA 3NNLA 4NIHA 4AR2A 2BNMA 3MLLA 3WCRA 3R0AA 2KT0A 3SZTA 1QVUA 4UWDA 3MKLA 2YFZA 1N1YA 2IPQX 1GWKA 4AFAA 2UWAA 2GM4A 5FYIA 3FBYA 1MH3A 3GW2A 3ZN0A 5L36A 1AWCA 3BTXA 5FKNA 2WZR3 1DGRN 1F1ZA 1IPSA 5F3GA 5FPZA 4N4OB 4LA2A 4IE4A 2KIUA 3HEFA 1WJ5A 4ATEA 4OMDA 1YIOA 2OPTA 5FYBA 2WRAA 3RIRA 3PLQA 4HN1A 2PELA 4QQLA 2UV1A 1WLWA 1VRH1 2A3XA 2QBXA 2JA5J 4Q48A 3WY6A 4YVSC 2Y6FA 1F9KA 1MNMC 3CF6E 3K4ZA 3VD9A 4I02A 4HLYA 2CWSA 2FBKA 1KEXA 4D69A 4PGHA 1D4M1 3WP3A 3G1MA 5L73A 1ST8A 1W2AX 2VZTA 1ZGWA 4BQWA 5KAFC 3I3BA 3I64A 2GC3A 1CAWB 3K4BA 1VJ2A 2VULA 3VD7A 2UY9A 5E8IA 1FYKA 4HKOA 1GZ9A 2HEOA 2ZX1A 4BAYA 2WIIB 5FPLA 3WGGA 2ZGLA 4RAFA 1FTZA 3WDXA 1W06A 4XCAA 2A6HF 3CDHA 2ZKNA 3UKVA 4U7BA 1VE0A 2WA3A 5HLTA 3DBHB 1O6UA 5EJCA 3SQOA 4RGXA 1GMMA 2QQIA 3WF3A 3BKZA 4C2MJ 1IUFA 1LDKB 1S1AA 5DG1A 1OLQA 2O7OA 5IK7A 1C28A 2UURA 2PAKA 1B72A 1R5GA 2RC4A 2E2HJ 4FE4A 1EV7A 2QE3A 3AMPA 3PUQA 2X29A 4PSXA 3HB9A 2YY1A 2X6OA 3B01A 3IN9A 5GLUA 2XKOA 2P0WA 3FXOA 1PHMA 4FPGA 4XICA 5GAEJ 2ZC2A 4BK4A 3BP8A 3NRUA 3P5BA 4P55A 1FEXA 2R071 5F5CA 4CPBD 2HWF2 5GM0A 1I1SA 2JG9C 3BALA 3WHUA 2YU9J 3M7AA 4MGKE 1CESA 3DTIA 3E6CC 3VZJA 4XCBA 4O5VA 4WM8B 5H6QA 3N3HA 3VBOC 5E1ZB 3ACFA 1KQ8A 2DCJA 1NE4A 1PX3A 3MUZ1 1WCMJ 2HQRA 1V54H 2BPA2 1WKYA 5APAA 3ZYPA 4A0ZA 5FYYA 2PLV3 1COV3 3VDDC 3ASOH 2WQ4A 5JOWA 3K70C 3ZSEA 3JCUC 5J3LA 4RM3A 2RJ2A 5FD5A 4A3BJ 3VBOB 4BMEA 3N35A 4IV3A 4K9SA 2P3JA 3PUFA 2GNTA 2W24A 4Y24A 1TT5B 1XD7A 2QWWA 4FSJA 2A75A 4HT1T 2QBYB 4RB1A 1HXS1 3GFJA 2ZMEB 2K9ZA 5FLMJ 1MMNA 3GZNB 1DGRM 1R1A2 3BN6A 3BTLA 3CCYA 1NTCA 3W6KB 1XCBA 2JUCA 4QDQA 5HDNA 1H1AA 3HXLA 3GTJJ 1W9FA 4XFGA 2JA8J 3ZMVA 4I98B 1VQMI 4EM1A 1KA8A 3VBUC 1KS5A 1Z7S1 1N1SA 2DVAA 4OMYA 3QH7A 3H5RA 5J1UA 4L9TA 2ZEXA 1NAEA 5E1XA 1HKQA 3M8JA 1QQP3 4IRHA 5BOXA 2ZXJA 5KWRA 3G7DA 3RZZA 1L7RA 4I0BA 2IVMA 2DJIA 3WE3A 1EUUA 4XXPA 4XJZA 1YFHA 4IRGA 2LW8A 2DV9A 3J8F3 1YS7A 3KV6A 2VXRA 4S2GA 4UFMA 5DZFA 1IPKA 3CZUA 4DEVA 4I3GA 1NCRB 3SMHA 2ZGRA 2H6BA 2I10A 4OFGA 3K75B 1WJBA 3PQJA 1ZLKA 1FXZA 3O1OA 4DOZA 1E57A 4OUSA 2MD0A 5LBQA 5FO9B 4HANA 2BBVA 1IV6A 1MNEA 5F6KA 4WF2A 4XFBA 2IGKA 1EAH3 5GALA 1WCKA 1ZTRA 4L0ZB 3OEAA 3TP3A 3OWTA 1R6RA 1JT0A 5K7ZA 3CCVI 3CDLA 3JRFA 5FQ0A 1HKTA 1WLDA 5ACA2 1JZ6A 1WJAA 2HEYF 1W3XA 1XU2A 1YIJI 3DEEA 1OUSA 5CQGA 5C3OA 5FUNA 3S8PA 2Y0OA 4BXSV 1X1PA 4XPVA 5B1AH 2GWRA 2QKMB 2DWRA 2R30A 2BVBA 3IL2A 1GYKA 1ETKA 1FBQA 4G6TB 1YXWA 3VHOA 5CFDB 2VMEA 5EZGA 3VDXA 3U14A 4HW0A 5EG0B 1TQPA 2LNBA 2VZPA 4AVPA 3CCLI 1ULFA 1CX1A 4A3EJ 3FL7A 3Q9OA 1K78A 2WB1N 3MD2A 3H3UA 3V56A 2QKDA 3N7KA 5EZHA 3KF5A 4Q0UA 2QCOA 1AR73 5FR3A 1H8VA 1ZG3A 4LBQA 3EYIA 3AL6A 4XFIA 2BOIA 4A6DA 2QQOA 2DQLA 4LQRA 4LULA 4F92B 3A4UA 2KIFA 1YOVB 3LDRA 1VNDA 2D5VA 2XWBB 4M71A 3QCWA 5L3GA 1EPWA 1DU3D 3GTQJ 2D3RA 4YW5A 4RB0A 2D6OX 1KYZA 2CV0A 2JRMA 3UNGC 3FBMA 3TOJA 1ZRDA 2V26A 4LLOA 4HSTA 2WNOA 1YJNI 4ITCA 2Q30A 4NDLA 1HKSA 2HZTA 3VBSC 4C1XA 2WNVC 2A68F 2W47A 4YW6A 2XC7A 2OC6A 1JW6A 3BYWA 4PLOA 5FJKA 2AEYA 2J5PA 3AAFA 1MS1A 4P5OA 4P00B 2YZ4A 2K9SA 2WABA 5EWSA 3ASIA 2VKHA 1YEWA 1VP6A 1V5FA 2WNVA 3CZJA 3PO2J 4BE2A 1Q8PA 1DDNA 1PIV3 2BVVA 2H0VA 3DBLB 3LAGA 3OBZA 1RHI3 2EFQA 5D1IA 5J1RA 3GMEA 3AP5A 4UBHA 3NO8A 3BZCA 5K5RA 2OIIA 4MOAA 4LB5A 1EPZA 2B39A 4XMAA 5FZLA 4MZUA 3ZYGA 3VDCA 2C24A 1OA4A 3WG9A 1PVEA 2MEV3 1K61A 1W0OA 5BNPA 3GBWA 3ZYBA 1IS4A 4V2GA 3GJAA 2IRFG 4AIHA 1O3TA 5TGTA 3LSPA 3POFA 3P9IA 1FMWA 1UKRA 4YM0A 5FDBA 1JTXA 3B69A 2DYRH 2DW4A 2OA2A 1YX3A 1FNYA 1YQCA 2LLKA 1D0HA 5HPOA 4QQPA 2WB1A 2ZB9A 2KKOA 3W6JB 2K3FA 2WT0A 3AYCA 4BM8A 3B94A 3WHTA 1GOHA 4XRMA 2FMYA 3KM5A 1VAVA 3RTRA 3FK6A 1ZZCA 1ZLJA 4BQQA 3LFMA 2E33A 3B73A 1P4XA 3Q3SA 3OF1A 2R49A 3IDCB 3GF6A 3AJZA 4D7NA 5E1WA 1XE7A 3WG4A 3KE2A 2QQNA 5FCCA 2JDZA 2O61A 4FPOB 1S3JA 1VBA1 1V00A 4DNCA 2CMPA 1PIV1 2GIVA 4Y26A 3VZMA 4XSZF 4FXKB 1NHAA 4XIDA 1YI2I 3T2QA 2NLRA 2ORZA 4DYCA 2ZX0A 4FETA 4D5CA 3MUY1 4AFDA 3IKVA 4JC1A 4Z92B 4X8NA 5CISA 3GBFA 4CE8A 3J80Z 4HKLA 1ZN2A 4LLFA 1D0ZA 1MEC3 1X4PA 4XW3A 1QHGA 4QSHA 3VBFB 4V2WA 2LKPA 3OYAA 1R1TA 2JVHA 1LFUP 2DDAA 3OYLA 4JX6A 4C3JJ 1XSXA 2KISA 3ZQQA 1MS0A 4BQYA 4JDOA 1GLHA 4QX5A 4N7IA 1SFUA 1GHCA 2TNFA 1H6XA 1W6PB 3HKZN 3HUGB 4L5IA 2ZOEB 4MXWB 2DN0A 4G8XA 1UZWA 3TQNA 3J26N 2VVFA 2EJRA 1LJ7A 2X1EA 2ERFA 4CYCB 2JXAA 1SG3A 1LQ1A 4UW6A 4P9WA 5E88A 3WP6A 4LNVA 3IAS2 1RVF3 5F64A 1VBB1 3MIBA 1RKWA 2WT2A 4ET7A 4HKWA 1D0XA 4UUVA 3B02A 1D3YA 4FOQA 2GH8A 3RWNA 1PMHX 1UD1A 3W20A 3T1BA 2G7UA 2W82A 4MGIE 3PQKA 5J40A 4XONA 3HHHA 5CA6A 1AZDA 4BQ2A 2HQ5A 1A3KA 4BHPA 3VBFA 2ZGNA 3AFHA 1Z7LA 5AC91 2GNDA 3RPUD 2VUCA 4JTNA 4X6AJ 1LGBA 2QQMA 4QU2A 1REEA 2XQXA 3S15J 1RZ4A 1IUYA 4HBNA 4X0GA 1QH7A 2EIBA 2Y38A 3FJSA 2XAFA 3ZCOA 3VHNA 5FRMA 4XZUG 2VCCA 4LFUA 3NRVA 2WLQA 1J7KA 2JJ6A 1PNGA 2VN2A 2XLFA 1LE8B 2YU1A 4B4RA 2WYFA 5EZWA 2W87A 3HVDA 4L97A 3D8CA 3SKVA 3Q0WA 1X1AA 1G59A 3HDDA 2KD7A 1UHMA 2GN3A 1D5VA 2JG9A 2FMLA 1K5JA 4FAGA 4QPYA 3TRSB 4TLFA 2WZ8A 2AS5F 4CEYC 1CIWA 3WQ1A 3H8UA 2VZRA 2R7DA 1UL9A 4B3NA 3M8FA 4AEDA 3S93A 3ABLH 3ZSKA 3IP4B 5K5QA 3VBOA 2YYOA 2K86A 1STMA 3WQBA 5FPUA 2DUOA 3GHMA 4OULA 5BQTA 2YMZA 4Q4V3 5FPVA 4QPQA 1J83A 5A33B 3SEPA 4A2UA 1QQP2 4FOVA 1ONVA 4OAZA 2JX9A 3ALQA 5G05L 5BNGA 3BWGA 4GO1A 1BBT1 3KQ4B 2KDOA 5FP9A 5DCFA 4XUOA 2A5ZA 3DN7A 5FMOL 5J98B 1V6JA 4DJAA 3WG2A 3K2AA 1FLIA 3AP4A 3WLUA 4C91A 4C3HJ 1VMHA 2FX0A 2PI0A 1LU2A 3O1MA 5IK8A 1G9FA 1TQIA 2LRDA 1WUVA 2KPMA 2KZGA 1IN7A 4XZPA 4AVSA 2EA2A 2XAUA 5F2SA 2EB7A 1DQ4A 3MQ0A 4XKCA 2LOOA 3S2DJ 2X51A 1WCQA 1FYLA 3WNKA 4A12A 4EV0A 4PLNA 1HDDC 4ZXKA 3IM0A 5FLHA 5A3NA 3LSMA 3T3YA 3I5UA 4P9IA 2VKVA 2GOXB 4ZS2A 1JHHA 2Y0IA 5IOYA 1QZEA 5FWEA 4HDVA 4ENJA 1MVEA 1JH5A 2WBMA 2R062 2ETHA 3QD6A 3PNAA 3F22A 1HLVA 3TN93 1A34A 5HDKA 1LR5A 3ULQB 1BBT3 4RQPB 2E35A 2VZUA 3RZHA 2YROA 2WWYA 3SH4A 4HPKB 5FZGA 1BK1A 5AFEA 4DEQA 3BG9A 4AFBA 3H1WA 3H9QA 2WAFA 4AAPA 1BOAA 5A7WA 3GZEA 2MG4A 1MS9A 1FMVA 4XBNA 4XUNA 1PK6B 2X6WA 1MSEC 1BJAA 3BTZA 1VAMA 4WX9A 2D6PA 3NAPA 1G9CA 3BR3A 3K4CA 1ZHFA 2RS51 1QH6A 4WXDA 4IE7A 2LALA 5GKAC 2OCCH 3A4CA 2P37A 4LA3A 4QPIA 3C7GA 4IEUA 4QD2A 2XASA 3OGSA 3VLBB 2DTWA 5I8TA 2JICA 4Q8KA 1WRJA 1W0UA 3AG2H 5FO5A 4E2QA 2BZTA 2Q5TA 1F15A 1TNTA 3SZPA 4GB31 3WZ1A 2WAOA 3SH3A 4G9YA 2E5NA 4P9GA 4XFFA 4GJYA 4YGBA 3ZMNA 2ILMA 2QDNA 4AHZA 2W91A 1LTEA 2LY9A 3M3CA 3ZSJA 5IYCJ 3AL0B 1FNZA 2O5RA 2NPIA 1Y1VJ 1O3RA 5FKLA 1HKDA 4D6QA 5HODA 4LOCA 2R7WA 4ZZ5A 3PM1A 2LF7A 4WWCA 2VM9A 4JGYA 2IXSA 2QUOA 3GFIA 4DYRA 2HWB3 3AL5A 3WU2C 4MO7A 2VZOA 4S2HA 1A6IA 4CEWA 2YPDA 1WWXA 1K7AA 2TDXA 3A1YA 3GTKJ 5A7QA 4IUGA 1XNAA 5CADA 4IGQA 1R093 1S2BA 2D97A 2XBO1 4LGWA 3CF5F 1KRIA 1YNAA 5F6FA 2PA7A 4F91B 1W28A 2FD8A 1B9NA 3KEQA 4CCCA 4Q4ZF 3OTFA 5K9YA 3FMQA 2QZ3A 3H9JA 1JYCA 4XJAA 3MFKA 3MHZA 1Q8VA 4MFDA 5LRSA 2EAKA 2QVSB 2KMUA 5AVAA 3LOBA 4D1QA 3RYRA 5DPNA 1J09A 2HLEA 1O5UA 1NYWA 3C3WA 3P6BA 2RS52 4OUEA 3WTZA 3GUDA 1BYHA 1YYNA 3BJOA 5A3WA 1QNTA 4CSWA 3TKYA 5FTTC 5CVIA 4RN5A 2YX7A 3O0VA 1QDOA 4RFT0 3F8FA 1NLSA 4B1MA 1MPXA 1RHI1 1SEFA 3OYMA 3ACHA 4R9DA 3WD5A 4MQVA 1H8TC 3W5MA 1VBE2 1XMXA 2QQBA 1P4WA 5IP9J 4MV2A 3D0JA 2CFOA 1ZA4A 2L4AA 1H2KA 5J48A 2L5QA 2X4HA 3GNEA 3Q8AA 3BJ6A 5GJ6A 4UY8I 1W0PA 3M1HA 4TV7A 5FD6A 1Q3EA 4EWDA 1VRH3 3JBG2 5LBCA 4E7IA 1LKNA 4GULA 1UAAA 3OBRA 2JE8A 3ZDVA 4QX8A 2HVRA 3HNYM 3CCSI 3WOGA 4MEXF 2HWD2 3IDAA 4LOTA 4O9GA 4N4NB 2E6VA 2NN8A 2XBO3 1OCZH 5J4YA 1QOSA 4Y5Z0 5JAXA 1UG0A 2Y60A 4QIWN 2IEKA 2Q0OA 1K5MB 2Y0SN 1O3SA 3NNFA 3W21A 1QZYA 1SMVA 5EEGA 3BCWA 1GQPA 3VFZA 2AXTC 1JZ7A 4XRFA 1QGLA 3O2PE 3ACLA 2Q8DA 5E3OA 3UGGA 2O8XA 1ASJ1 4ZU5A 4HVOA 3AK0A 2HYXA 2FU4A 2BY0A 1UOFA 2CWMA 1C57A 3KIOA 2RS13 4EJWA 2E71A 3RSJA 1C4RA 1UN1A 3AFGA 5FZCA 1U5TA 2EVXA 3GGLA 4GD4A 1SANA 4AHXA 5JZGB 3FBIB 2ELJA 1XGSA 3JR9A 4AVZA 2V4JC 2R7SA 4CTEA 1POGA 3JCIA 1LEDA 4OMCA 1POQA 4H55A 4ZDLA 1IDYA 3CCUI 2VTXJ 3HGGA 3AP9A 5I0DA 2ZX3A 4BEHA 5LEJA 1X1BA 1NQJA 2VBXA 4M72A 2HQAA 4HF0A 4FTHA 3ZYIB 2RV9A 1MJAA 4K8RB 3TW7A 2Z1DA 2R0QC 1G86A 4AGRA 1T38A 1RC6A 1UG2A 3DLAA 3IHUA 4M01A 2JENA 1KQ0A 2IUWA 4FTSA 3KFWX 3AG4H 5CG9A 3RKQA 3RDIA 2NQYA 3WDUA 3M1EA 5FGMA 5T5JA 1G8XA 2D45A 2ZEYA 2LVSA 2FJ1A 5J36A 5JIUA 1N47A 4Z07A 4X6QB 1TNSA 2JB8A 5D21A 2OQGA 2PTMA 5A7SA 2UY8A 2DU0A 2GA1A 1R1ZA 4OHXA 4AIJA 3I2IA 5EP9A 2A3YA 3FLPA 3IMMA 1VPHA 4JKLA 3DPRB 3SNMA 4OZXA 1GZWB 4V19K 5A1FA 2P6SA 3OYIA 3LEIA 3HM5A 1I6HJ 4BDVB 3TN91 3OSGA 4E7ZA 2VNOA 1YI9A 2Q2EB 3CC7I 3R0RA 3GTPJ 2Y6HA 2VJIA 3JD73 2XSJC 3S5AA 2ET1A 2XPWA 3ZR5A 2M45A 4YM2A 3N7JA 5FYSA 2R042 5FLXZ 4LHKA 2MH9A 4BIOA 4UXAA 1RRJA 5IK4A 4MNUA 4IKFA 4HV5A 2YHJA 4LG0B 3VZLA 3DPRA 4EN7B 1W39A 1UF2C 1UKGA 3VBUA 1JU3A 3I97A 2JK3A 2GXAA 5FP4A 2BJSA 3NL1A 2CQQA 4A3JJ 4EROA 4IEYA 2DMTA 2ZZQA 3PU3A 4JQTA 4Q29A 5F1JA 4GMP3 2IA0A 3OL4A 4XN0A 2Z4FA 4D0QA 2DJNA 4UUTA 4Y1VA 5DAWA 1YJ9I 3S1QJ 1MJ9A 4CDQA 3ZXJA 2VJ5A 4B47A 4GB33 5GAGJ 1QIQA 1VAKA 1HV0A 2RS31 3POIA 3M3IA 1WBFA 5HS9A 2RKHA 1YRNA 1E5SA 1YRZA 1RUH3 3S2WA 4CCDA 4LBQB 3SXYA 3PSFA 1EAH1 4S05A 2P5BA 2M34A 2YBPA 1XGMA 2F6CA 3WG1A 4DO0A 4EWAA 2CV6A 2XUEA 4E9KA 2D1HA 3K3NA 2DTRA 2C5DA 1LU1A 1IXRC 2WUHA 2MPFA 1IXSB 2DBIA 4YRDA 4YZ1A 4AQ2A 2FD5A 3TW6A 2YX4A 3EHKA 3WF4A 1ULCA 1D7PM 4ISQA 1HJFA 2OA4A 3DECA 2X6YA 4CDWA 4CGZA 1K3IA 1IOAA 1E3HA 1KJLA 2HOEA 3CDZB 3OYDA 4UFLA 2OYZA 4NPRA 1XC6A 3SCHA 2W4SA 3IWZA 4H3WA 4FT8A 1QMJA 4G4FA 4NC7A 4UUSA 3FKIJ 4PZJA 5LFAA 1ZH5A 2PMWB 4KH9A 3TGNA 5D5UB 3CMYA 2FQPA 3A21A 5KXCA 3G1LA 2MBFA 2OPWA 3ZFFB 2G9ZA 4YLZA 4A7YA 3HRMA 4SBVA 5FY1A 4XF0A 4UVBA 2HNHA 3ESWB 3WTWC 2K0GA 2OUMA 1W2OA 1UX6A 3JQXA 3SISA 2MABA 4NIDA 3UJQA 4AGVA 1RMU2 2VOOA 1NZCA 2RMU3 4V2VA 2R7QA 4HF2A 4HOBA 2YDEA 3AMHA 5LA2A 1HQWA 1B35B 2W92A 3OY9A 4LITA 4Q26A 2JG8C 2DI3A 5A3TA 3E3VA 1JHJA 3HOTA 1GNZA 3ZYFA 1VQ4I 5F37A 3WW1A 1VTNC 2P8TA 1W9SA 5I0SA 1RKTA 1BI2A 2DOAA 3AM2A 4B8EA 1R71A 2VTFA 3POJA 1RUG3 1OJLA 9ANTA 2Z33A 1X3ZB 1CX4A 4PF1A 5CU1A 1SLIA 2Y6JA 3WNOA 3S6PA 3PNTA 2W39A 1LFBA 3V7SA 1JTZX 5HCHA 2I74A 2DVGA 5FZAA 2CU7A 2KHMA 5JSPA 1ZGAA 4XIKA 1MBFA 2WWJA 1MZFA 4YVWA 3AMNA 3H7JA 2RDQA 5CFCC 4G7HF 3ZP5A 1OYWA 5FZ7A 2R93J 1IJWC 1WI3A 4J00A 1G9BA 1CD3G 2VC0A 4UVAA 3ZO0B 3LSRA 3HOBA 3TEXA 4B4PA 3ZQCA 4YVSA 2LDUA 1K42A 1QXRA 1HV1A 3N9OA 4JX5A 3WX5A 1ITYA 2B9VA 4RS5B 2K2SA 5FRNA 3CJQB 1MS3A 3BC8A 2R5ZA 3GXUA 3RQIA 2LG4A 2XL9A 3W58A 1KJRA 3IPVA 2XRLA 4NRPA 3NWKA 1PIV2 3KX2A 1Z91A 4JRAA 5CFDC 1W8ZA 1Q1HA 3MIEA 4A5MA 3KT7A 1YJWI 4RS5C 5ERLA 3RZKA 5AC93 2ZXIA 5F3CA 1R4MB 4HNVA 3HKZA 4O65A 2HEWF 3MKZA 2F4MB 1JYNA 2E7AA 2BRTA 2XJPA 1N78A 1HCRA 4ENNA 2LM3A 2JDHA 4TXWA 3N9MA 4BGDA 2P81A 2DO7A 1I1GA 4YGEA 1UMIA 3THCA 1O4TA 1Q8OA 3FHQA 4KU8A 2BOLA 4FTEA 3I3EA 5D6EA 2VPLA 4R79A 3BLYA 4YARA 3O12A 3WW2A 3ABUA 2C9AA 3IRQA 1ND2A 3ZYJB 1AR81 1TME3 4XHBA 2IXLA 1SFOJ 3LA2A 5FIXA 5BV6A 2A3WA 5EEHA 2R7XA 3ZQ7A 1S55A 2QDRA 3NJYA 3ZN1A 2Q8KA 4FFFA 2A5YB 4GFBA 2D3PA 1R9TJ 1W8HA 2E1CA 4MHRA 2XL7A 4Q5SF 1X50A 1VQ5I 3K51A 3CHXA 2VZSA 3BR6A 4DW6A 2R0FA 1FP2A 4AVVA 4BY1J 3IAQA 1QJX3 1Z7S2 2LMDA 1W2TA 5A1LA 4GQ7A 1XNDA 1E5HA 3APBA 2LBFB 1IXCA 1GANA 4FPHA 4QGNA 1L3JA 3HRTA 4JGZB 4F52A 2HGCA 1FBSA 5EEAA 1W2NA 3EYYA 2FSWA 5JLVA 4XKVA 1FT9A 5DN2A 1ND2B 2L2OA 1RUOA 4AFCA 2V5DA 3VKNA 3M4FA 4JKKA 4XFAA 2VIXA 3ME2A 2ZKLA 3JUUA 1UU5A 1U8BA 1LDDA 3QYEA 3I54A 5A32B 4N90A 4AUXA 3J7AO 4GKXA 4AEJA 5ILVA 4WV8A 1JJ8C 2R1BA 4JK1X 4ZYHA 1Y9MA 1JHFA 2GP5A 1LEMA 2XH6A 1MQTB 3LQQA 4LKDA 1SFXA 1AYM2 2JN6A 1R7JA 5L3EA 3S57A 2VASA 1QJX1 3B3QE 2ZA9A 4GIQA 2YC2A 5K7PA 5I91A 4KITB 1IN6A 2WWSA 2XPVA 1W6MA 4JGYB 3GTMJ 4H7MA 3NAUA 2BWAA 2CHHA 5FXWA 2DA6A 3A0NA 2A73B 4MTEA 5ABJB 4KMUX 1ACCA 1NA1B 3WDWA 4BDZA 2ZPXA 2R1DA 2FBHA 4XACA 3PVBB 4L8QA 2H6CA 3KQRA 1ULEA 4C2UA 5DEQA 1N1VA 4MVTA 1VI0A 1X3WB 1FV2A 1DDLA 3O7OA 1X58A 2Z5WA 1TE1B 1I5PA 4UW3A 4QKNA 3BIEA 2O0OA 1AR91 4DZJA 4YYOA 3L2YA 3F6VA 4EN6B 2ES3A 1ND3B 1BKZA 5L9RA 4AVTA 1X4OA 3NNGA 4PCQA 3RS6A 3PUBA 3CU7A 3OBTA 4BISA 1XOYA 3HNMA 1YQAA 3DKWA 4FPFA 3HTSB 4HN0A 1S0BA 1X33A 1LEBA 2IFRA 2WV0A