3RPQA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
201
structure length
201
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILFYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords Catabolite gene activator
total genus 60
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rpqA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rpqA01
1ZRDA 1ZHFA 1FWZA 1UFMA 3M3IA 2O0YA 3FMQA 3NW4A 1ZH5A 4O5VA 4OU0A 1ZZ6A 2Y75A 1EH6A 1BJAA 5H20A 3VODA 1YG2A 4HLTA 3WW3A 3NQOA 3HHHA 1J0RA 5EEHA 2OQRA 4OIRF 3DN7A 1YTYA 4TLFA 4DQ2A 1JXSA 1LJ9A 5ILUA 1EH7A 2LKPA 5D8KB 1IN4A 5EEGA 4AIHA 4XF9A 5J48A 2Q2EA 1IPJA 3FMSA 3JW4A 3HRMA 4IXAA 5AIQA 2EFWA 1I27A 1P2FA 3KMHA 4G7HF 3PVBB 1T6SA 1CAXB 1U12A 2ZBKA 1MD0A 1SD6A 3EHKA 4L2NA 4LUKA 1FC3A 2D93A 1ULYA 4YRDA 4EM1A 3BB6A 3RPQA 1QZYA 3ZP5A 3KE2A 3O3KA 2QBYB 3S7IA 3C3WA 2EJRA 3V7RA 2PAEA 2C0ZA 1I6XA 2A61A 1U5TC 2QZ8A 3ZMTA 5JSRA 3MZHA 4I7HA 4R1HA 3P9KA 1G3SA 1VP6A 2IXIA 2W57A 2Y48A 1XMKA 2WV0A 3USSA 1UW8A 4L18B 4HSJA 2HOEA 4JK1X 3VB2A 1DGWA 4OLLA 1W7PD 4HSLA 4ENNA 2DO7A 3H50A 2JSCA 1J2XA 1QNTA 2OBPA 2JRTA 4ZH4F 3F72A 3CL1A 2DQLA 1V4RA 3CUOA 4O9GA 4Y15A 2GQQA 4HBNA 3UKNA 1W4MA 4IRGA 1RTVA 3OOPA 1IN8A 2M8EA 2Z2SB 2VECA 3W6JB 1SD5A 1J59A 1TBXA 4CZZA 4U7BA 4NB5A 1Q1HA 2CAVA 1YW8A 2EVXA 3V4GA 3I58A 4ASNA 1ZNPA 3P9IA 1DGRA 2XVCA 1RUNA 4BNCA 2EFPA 5HI0A 3BU7A 1BI1A 5D5VB 3WTSC 2X4HA 1BI0A 3B73A 2IT0A 3C3VA 5I0RA 2VT3A 5JSOA 1FSEA 4HF0A 4MEXF 1YW7A 2W25A 4EWDA 3FMRA 3EDPA 4XEZA 1QO0D 3WTWC 2A68F 2RN7A 2M87A 1Q3EA 1VTNC 1ZRRA 4GGGA 4KU8A 2ESHA 5L3GA 2IVMA 4LK0F 4M71A 1MGTA 4N9HA 4XSZF 2F5EA 2UXXA 1Z05A 4Z2YA 4I02A 4KMUX 3JSOA 1CAWB 1NYWA 4FAHA 4HQMA 1TNSA 2VOOA 2C6YA 4OOIA 2F5FA 2ETHA 4GULA 1XGMA 4NHJA 5E1RA 2FMLA 1S3JA 1BBYA 1R1UA 1IN7A 5I8TA 4M74A 1B1BA 2XUBA 4IHTA 3WODF 2GU9A 5L3DA 3LQRA 1JGSA 5E8IA 3SZPA 5I93A 3GFJA 1WGPA 5KHIA 4AD9A 2XAJA 2KRFA 2WWYA 1S6LA 2GAUA 4YFKF 3LAGA 2PQQA 3LWCA 4MQ9F 2XL7A 3WG9A 3WW1A 4EGZA 3BDDA 2IP2A 3BPXA 2PFWA 4XETA 5DCMB 1Z7UA 1YYVA 3GBFA 1KQ0A 3BJOA 4N0BA 3T8TA 4UUVA 2CG4A 2EFOA 4F7ZA 2ADUA 2XAGA 2KKOA 2OD5A 3JSPA 3PLQA 1FT9A 4H0EA 2DTRA 2GH2A 4CICA 5I0SA 4BHCA 4JVAA 1D3YA 3KLOA 4PZJA 3WTUC 1XE8A 4D7SA 2PN6A 3I0TA 1S7AA 2CQKA 3IL2A 3MCZA 3T1BA 3R0JA 4EJTA 3T0YA 2Z3YA 3GO5A 1ZX5A 3WTXC 1B9NA 2VONA 1XSDA 2K9ZA 2V79A 2VPVA 3WTYC 4LA3A 2D1VA 2YX7A 4EV0A 1CF7B 1UCRA 2XGXA 1QXRA 1MKMA 4ZYGA 1ZRCA 3I54A 5LGUA 3DFGA 2HYFA 2RV8A 3FFQA 4HA8A 3L2HA 1B59A 3PQKA 1IRGA 1O7FA 2V1UA 4JBAA 3SXWA 5CVRA 5DD4A 1RGSA 2PMHA 2P7VB 1F1ZA 4XLNF 5FDBA 1EYBA 4RB1A 1T39A 3C18A 2WFPA 3BP8A 5ICCA 1FBSA 5BY5A 5FPZA 3ES1A 5D8LB 3I53A 4IEVA 2YX4A 3RKWA 1HQCA 2OZJA 5BS6A 2XLFA 2QWWA 1D8JA 4MX3A 2JT1A 3GEZA 2GC2A 3HTUA 1XGSA 3CJNA 1XCVA 1ZG5A 3O14A 4L9NA 4OIQF 2DT5A 2EV0A 2QQBA 3QPTA 5A2QK 2EAAA 1BI2A 1NZCA 3GVAA 2L4AA 1OMIA 4Q0PA 4RGXA 5TRDA 2D5FA 4UVCA 4ZU7A 5E8GA 1EH8A 4KA4A 5LRSA 4D7TA 3RYPA 3GFLA 2L02A 1ZZCA 1O3TA 2GA1A 2MC3A 5DYMA 3N4MA 4MTEA 2JPBA 1WWXA 2EFQA 2RVCA 2D45A 2MNGA 2V1DA 3MPBA 5E1XA 5J8FA 3TO9A 2W85A 2O1QA 3JAMK 4CO8A 2BV6A 1WA4A 2HJIA 3WE3A 4UNOA 1DZTA 2HDCA 4R52A 1BIBA 3KZYA 5L3CA 2PLYA 4BHPA 5FQ0A 1SFEA 2IPQX 2MH2A 3F21A 2F5DA 1YS7A 3ELNA 4LFUA 2KIFA 4OIOF 4LLGF 2PG4A 4G94A 3ZMUA 5I0TA 4A5NA 5D5XB 1MDMA 3PNAA 4LK1F 3WGHA 3COAC 1XSXA 1BOAA 2ZMEA 4AQ2A 4IETA 2KIUA 3EO6A 4QWQA 1J3RA 2VBXA 2EK5A 3H9AA 3OTFA 3KP5A 3B02A 1J7KA 5ERIA 2PI0A 5JSPA 2Y0MA 2G9WA 5CVUA 4WVZA 3I7DA 2H6CA 4IEXA 4KU7A 5CADA 1YS6A 1OYIA 2V9VA 3U1DA 2M30A 1U3EM 1OR7A 3E97A 3DP7A 3R61A 5ICFA 5LGTA 2L4MA 2FNAA 2K7LA 2LNBA 2J5OA 1ZZ7A 3VHRA 4HYEA 3ZN1A 2QCSB 3JTHA 1JHFA 4EWEA 1KU3A 4QM8A 2MLGA 3FHZA 2FRHA 2DQRA 5FFXA 4L9VA 2DK5A 3K1MA 4WXHA 3H7JA 4Q29A 4HLXA 4QLCU 1Y9QA 1RZ4A 3QRFF 3CDHA 2FQ3A 2ZO4A 2KJBA 1LB2A 4LUMA 4I01A 1QPMA 2GWRA 3MZYA 1F4KA 3JTGA 2XASA 4Q4ZF 3H1YA 3IKTA 3V7SA 4HDVA 3HSFA 4KUMA 1VJ2A 1WQ2A 5E1ZB 3IDBB 1I1SA 1GHCA 2EFNA 2M1BA 1SFNA 1KU9A 3LOIA 2FBIA 3DQVC 2HTJA 5CLSA 3BCWA 1PUEE 4KIBA 4XBFA 1K78B 4B8XA 3IRQA 2PHLA 3RKYA 1P4WA 4D0PA 1UIKA 1YLFA 1HKTA 4XFHA 3I64A 3GFIA 3OGJA 2NNYA 3I4PA 5DUKA 1ZGAA 2KJCA 4CHUA 4Q0SA 3QP6A 3LA7A 3SHFA 1PMIA 4JTNA 1V70A 3IRRA 2QVSB 4DINB 1ZYRF 1UIJA 1G3TA 2V6CA 1R58A 3I5UA 5FGMA 2O6GE 4X6RB 3MDPA 1YW9A 3ZMVA 1VR3A 4IEPA 4HVQA 3SZTA 1X3UA 4HV5A 3LQQA 1NXMA 5FD5A 2P5LC 3UKTA 4IVNA 2HTSA 4FX4A 2H6BA 1UD1A 4XFBA 1QGPA 1ZRFA 3ZPLA 2F5CA 2O8XA 1R7JA 4MGIE 1QZZA 4YG2F 4S05A 1TQIA 4Q5SF 5HVQC 3L9FA 3S7EA 3KGLA 5E18F 5E17F 4OINF 2Z33A 2E1CA 2NS0A 3MWMA 4HVRA 1G3WA 4HX4A 1FP2A 2UYAA 1OYWA 2LF8A 3M7GA 3EUHA 4UV9A 3M70A 5FB2A 3U9GA 4LB6B 2UY9A 2E1NA 2DCTA 4IEWA 3E6CC 3GX4X 2FF4A 3K1PA 5ICGA 2GC1A 3ZMZA 1FXZA 3WW2A 2IXKA 2P17A 1IF1A 4HVOA 5CVJA 2ZNZA 1FY7A 2MLKA 3NVCA 2B8MA 3ACLA 4LULA 4XRFA 4E2SA 4KT5C 5I8YA 1G6NA 2EV6A 4YFNF 2ETEA 1E2XA 4XLPF 4YFXF 5D4SA 3HUGA 4L0YB 1J5YA 4EROA 3F6OA 4EJOA 5K5RA 3VOEA 3J80K 4GO1A 5JVTA 4BHBA 2IXLA 1SEFA 1ZVFA 4XFIA 4HLYA 3WTTC 2ISYA 4EMSA 2ZMEB 1Z6TA 1P92A 4UBHA 2EB7A 5JR7B 1T38A 2YPRA 2O03A 4ENMA 4WK8F 1TQMA 2A6HF 4LEJA 3H7YA 2FU4A 3O2PE 1CAUA 4AVBA 3ETQA 3CO2A 3BWGA 4RGUA 3V7CA 3CUQC 4MHGA 4ONUA 3KP7A 2VQAA 1X7NA 2IXCA 1YQAA 5JAXA 5KK1A 2A5YB 2ZJ2A 4HBLA 3ZN0A 1IXCA 4X6QB 2ZCWA 3FWEA 1Z9CA 2DK8A 2HQNA 1T0FA 4ZU4A 3LAJA 2MA3A 2FBKA 3NSTA 3SFZA 3HYIA 5CVIA 4P9UA 1T98A 3CLOA 1UPIA 4A12A 3K9TA 4ENJA 2E7WA 1R22A 5LEKA 4QGNA 3K0LA 1HW1A 4J1WA 2HEOA 2Q0AA 1H9GA 5K1YA 4AIJA 1EP0A 2UWMA 3S0MA 2XRNA 5JFRA 4L9JA 4WX9A 1XN7A 3D5LA 3I59B 4IEOA 3M1EA 4MQVA 3QOPA 1R00A 4H7LA 5IT9Z 4R8HA 4Y13A 3CF6E 2G7HA 2ET1A 4QX5A 4Q0QA 4Y17A 3VFZA 4P9FA 5HDNA 4KIGA 3O6BB 3WU1B 4WBBA 1UCXA 3MAJA 5LLQA 1YFYA 1K78A 4EJWA 4IRIA 2GZWA 2P4WA 4RS8A 5HS7A 1D8KA 2COMA 2PQ8A 2Q30A 5L3FA 3RPUA 4MH0E 1AWCA 4Q0VA 3NRVA 4KWJA 2MPFA 2QJVA 3G73A 2P7CB 3HTSB 4HX7A 4K8FA 1KYWA 1K79A 3CTAA 2XAFA 3KP2A 3HRSA 4U88A 4BQAA 1LQ1A 4Z82A 3G3ZA 4MGZE 1FYKA 2K86A 4BAYA 4HZFA 1Q43A 2A6EF 4DNCA 2K4JA 3BOQA 4LLLA 5F6FA 4PIYA 3L00A 2DAOA 1ZLKA 3LWFA 4FT8A 4KMFA 1ONVA 1S7OA 1TQ5A 2VBYA 1O3QA 3PFIA 5DCFA 2QUFA 4HDUA 4XF0A 2CWEA 2DFIA 2P6TA 3D0JA 4AXOA 1C0WA 1ON2A 4FBFA 4RB3C 2E7XA 1J1LA 1IXSB 1NE4A 3RZZA 4EWAA 1YLLA 4WF2A 3ST7A 5DD8A 4RB0A 1OPCA 1Y3TA 2L01A 1GQGA 1Z1DA 4ZYEA 3K69A 1J3PA 2M45A 4HF2A 1EV7A 4GXOA 2XLGA 4UXNA 2ZXJA 1BC8C 1R23A 3ZDSA 2NAZA 3BJAA 4F8AA 3AAFA 4G7ZF 3MFKA 1IN6A 1Z6RA 3S2WA 1KU7A 2CSOA 5BUVA 3FHIB 1Z91A 4ENKA 5K5QA 4P5OA 3TOBA 3LA2A 1OKRA 4LMYA 4ON0A 2CGPA 1BI3A 5FPXA 4AVCA 5FLXZ 2BE5F 3K1NA 2VN2A 4I2OA 1DPRA 1RUOA 5FLJA 4BYYA 2HZTA 3H92A 3EYYA 4LG0B 2XHKA 2QLZA 4XF3A 3ZQ7A 1PM7A 3FF5A 3ZMDA 1U2WA 5IT3A 4LA2A 3BJ6A 3EETA 4G6DA 3FXQA 3GZ6A 2QNKA 5H6QA 5L3BA 3OCPA 1O3SA 1TNTA 2BNOA 4EM2A 4KICA 5K8SA 5JHUA 4P96A 3G7DA 5D6FA 3RTRA 3RYRA 4M6XA 4RD7A 1ON1A 2XIGA 3CO7C 1PP8F 4M72A 2PBIA 2HKXA 3RKXA 4LB5A 4A0ZA 3IC7A 4O3MA 1JE8A 1UB9A 3NJZA 1IAWA 4HX8A 1DZRA 2Z99A 3VEPA 1XDUA 2QBYA 3WGGA 1MJAA 4EJUA 3TKYA 4I0AA 2VXZA 4L0ZB 2D40A 3LFKA 3KP4A 5HLGA 1D5VA 3TOAA 2PEXA 2EV5A 3HHGA 5IT9K 3V8JA 4YIFA 2BBYA 1B9MA 2B0LA 3KCCA 1L3JA 2IA0A 2Q0OA 2XKOA 4FHTA 4M9XA 3P7NA 3D0SA 1F9NA 1CAVA 3PQJA 2JPCA 3HSRA 2B9UA 1QXJA 1QY4A 5CYVA 4UVAA 2Z69A 1FSHA 5CU1A 1GXQA 2DW4A 3KSCA 5DDGA 3TO6A 2ZNYA 2AS5F 2HGCA 5FLHA 4M9SA 3M8FA 2PTMA 1T2KA 2B5HA 1PDNC 3MEXA 1EPZA 3ROUA 1XSVA 4HN0A 1SD4A 4PJYA 4K2EA 1WKMA 4E70A 4OMZA 4G8XA 2VT2A 3OD0A 1XCBA 4M6YA 2QM3A 4G7OF 2OU2A 1W7PB 2EA2A 1HW2A 4MGRA 2A07F 5AONA 3J7AO 1KGSA 3QACA 1RI7A 2LF7A 1TTYA 2NYXA 2Q4SA 3F8CA 2KIMA 5H6RA 4S04A 3REOA 4L5IA 4PCQA 4KN4X 4FX0A 3RNSA 2N7GA 5LGNA 3F23A 1IXRC 4IEUA 3IKVA 2LDUA 5E20A 2I45A 4YARA 4RAYA 4UV8A 3EQEA 4MGKE 3IHUA 1X8EA 3P9CA 5HDKA 1BN5A 1R5HA 1TW2A 1XDSA 2V09A 2FMYA 4YYOA 4KN7X 1JHHA 4LG0A 2DI3A 5I0UA 1FX7A 3FM3A 2DPDA 2OQGA 3L2CA 1H1MA 3DPLC 3BPZA 1O7LA 1USSA 5HLIA 4EQQA 3M8EA 4ZZLA 2CV6A 5J6XA 1HKQA 2OZ6A 3EYIA 3CUQB 2ET7A 1LEAA 2D5HA 3M9AA 1IUYA 3H1MA 3SMHA 2VC1A 3KLNA 1A04A 1B4AA 3W6KB 1NE6A 3HT1A 1U6GA 4BIFA 1WLTA 2BNNA 2RGVA 1U5TA 4JQFA 4OMYA 2VODA 5I91A 1MJBA 3V8KA 3WE2A 5LHIA 1XRUA 4Z07A 4G9YA 3E6MA 4RGRA 2MD5A 1ZG1A 1FBQA 2OA4A 1RC6A 1SFXA 1G4DA 2PAMA 4AVPA 4GYIA 5HS8A 2CO5A 3N97A 1LDDA 4A6EA 4TV7A 1HXDA 3L09A 1G3YA 5FCCA 3JZVA 4HMZA 3HQXA 2UYBA 4HF1A 5KBFA 5C8WA 3ELKA 2ZFWA 3F6VA 3GZ5A 4QGLA 1XB4A 4PDKA 5DCMA 1CAVB 2O8QA 3KGZA 1J58A 1GVJA 3F22A 2QQAA 5D1IA 2IA2A 2Q8KA 1SFUA 4IHSA 1QBJA 3LA3A 4NVPA 3ZMSA 4EVIA 5KHHA 2PAKA 5BPIA 3F8FA 3GF2A 2H27A 3BZ6A 5KHJA 1DDNA 1LDKB 1DUXC 5EFUA 1KA8A 3TNPB 4ZYDA 2STWA 4OIPF 3HRUA 2JZYA 5FFZA 2F4PA 2PFBA 3I71A 3DXJF 2HS5A 3C7JA 1HW5A 3SQNA 5FLXK 3E3VA 3E6BA 5I8SA 1ZREA 3J81Z 3SCGA 1U78A 4OFGA 1KQ8A 2WC2A 2W24A 1W5SA 3DPTA 3Q9SA 1O4TA 2A69F 3HRTA 1R36A 1YUDA 1YO5C 1FLIA 1O5UA 3GUDA 4B29A 3C1DA 3BY6A 2VBWA 2P8TA 1L0OC 4KFCA 1I1GA 5LEJA 2EWNA 5BMZA 2GC3A 2HYGD 3ULQB 2K4BA 2OAZA 2KXLA 4RB2C 2R7DA 1SMTA 5HLHA 4AIKA 2O61A 1XD7A 1ZZ9A 5J8CA 5D5UB 1Q5OA 5FLIA 1LEBA 2Z5UA 4A5MA 2FQPA 4Q0UA 1OI6A 2VE8A 1DPUA 4I09A 5LBQA 1YWKA 1OFNA 6PAXA 4NQWA 1EY2A 1PP7U 4KYWA 4ORFA 2UXNA 4KL1A 1W7PA 4XF4A 1QQIA 2R3SA 1YFHA 2HQRA 3EJKA 1LDJA 3U10A 4U7DA 5D5WB 4EJVA 3KFWX 4RAZA 4KWKA 3J81K 1FNNA 3GW2A 2Z9OA 1IZ1A 4XF1A 2FEZA 2FSWA 1U5TB 3FX3A 3V8LA 5LHGA 4AQ6A 4MNUA 3FJSA 3IIAA 4E2GA 3DF8A 2M5WA 5JCTA 5DV5A 1YFUA 1HKSA 5D4RA 2H94A 2AXLA 3K2ZA 1BM9A 2OA2A 3H3ZA 3ABUA 2PA7A 2K27A 2WTEA 4IEQA 3BROA 5CVVA 1L3LA 2QDRA 1FPQA 2OPKA 5FQ0B 3KETA 3Q5FA 2L54A 2XV4S 3FXUA 4GCVA 3TQNA 3WGIA 3R60A 3E6DA 2EA7A 4IESA 5HS9A 2L3DA 5ILSA 4LJZF 5L3EA 3E5XA 1TW3A 4R79A 1WI9A 3DL3A 2YU3A 4A6DA 3JAMZ 3E5UA 3CUQA 2BEOA 4I98B 4L9TA 2GIVA 2JTVA 2TDXA 5F64A 1MDMB 2H0VA 1J9IA 1W5TA 1ZG3A 2CYYA 4CGZA 1S8NA 4ESFA 1HBXG 4MTDA 1FI2A 4Q47A 2DBBA 5E1WA 3DV8A 1H9TA 4YSFA 4O6JA 1ZARA 2ACJA 4XFCA 3FM5A 3TNQA 4WWCA 1REPC 5T3NA 1HSJA 2FOKA 3WW4A 3HSEA 1K6OA 2OZUA 5DUIA 1MJ9A 4XFFA 1IRFA 3QAHA 4KDPA 2G7UA 4LLOA 4P9GA 2X0LA 5LRRA 1WRJA 3CLPA 4ESBA 5KHKA 1FOKA 1P4AA 4J1XA 3EBRA 2IJLA 2IRFG 2R7FA 4ZYHA 1QWRA 4I3PA 3GYDA 2EA4A 2XLAA 3SXYA 4MV2A 4M73A 5BQTA 1S29A 1SMYF 1CGPA 5K5OA 2DPUA 1UHMA 4WXCA 3R6SA 1FYLA 4RGSA 4I0BA 4MZUA 4KIFA 1GQHA 4EGYA 3T5XA 3Q9VA 1GXPA 3U0ZA 1R5GA 4O9EA 5A2QZ 1K7AA 5DEQA 1YHFA 2QYOA 2PMUA 2LSOA 4YIIA 4IERA 2VE9A 1LRHA 1CAWA 5HDGA 2HR3A 5AIPA 3TO7A 4QMAA 4LGWA 1O57A 2GXBA 1RNLA 5F1RA 3H1WA 2MBFA 1X82A 3F8MA 2PYTA 1TLHB 4EM0B 4KNYA 3ISPA 4IJAA 1ODDA 4PIZA 2STTA 2CFXA 1OYYA 3F8BA 4U0YA 2H09A 2HFHA 3CJXA 4ESJA 4A0XA 4M9ZA 4AWXB 1FBUA 4MUVA 2RNJA 5AVPA 1ZGJA 5KVRA 5BPXA 2DU9A 3KEOA 2W84A 2RQPA 2MH9A 3CEWA 4PGGA 1BIAA 2F2EA 4QXKA 3UKVA 3FZVA 3D82A 1IN5A 2V1XA 5TJJA 2P5KA 1V3FA 2ZKLA 3HT2A 1HSTA 3NKTA 5EZWA 3GWZA 4ZZDA 2FE3A 3QU3A 3KP6A 2MHFA 1ZLJA 4LD5A 1MZBA 3EQLF 4BH9A 2QENA 2BYVE 5BV6A 1FZPB 2BNMA 3IWZA 2IXHA 2XAQA 3IDCB 1WSUA 2QQ9A 4N9IA 5FD6A 3GFMA 3GLXA 5J3UA 1USTA 5BPDA 1RL3A 2K0GA 2VOPA 5JR3A 2UZKA 1J75A 2CW0F 2Q1ZB 1NHAA 4L11A 4XFAA 3TGNA 3RDIA 4UXAA 2J5PA 1H0MA 1SAXA 4LTAA 4MEYF 1SD7A 5BXXA 3H8UA 3SCFA 1AOYA 1XGNA 2YR2A 3ABTA 5E16A 3KZZA 4U0VA 2QVOA 3ML6A 4HV6A 1O5LA 2GC0A 3HIFA 4WZCA 3FZ3A 5C6CA 2RDPA 2D1HA 2ESNA 2DLLA 4B09A 1ZAOA 3ES4A 1CF7A 4L5JA 4BXUA 4KWLA 2IA1A 4U0WA 4P55A 1BC7C 3GYHX 3QP5A 3T8RA 2FNPA 2HWVA 1ZZ8A 1ZN2A 2XKPA 3NL1A 5KHGA 4JTOA 2ELHA 2NNNA 3LAPA 3ERED 4E2QA 1OD5A 1J3QA 4UVBA 1UHWA 2RKHA 2XL9A 1YIOA 4QM9A 3QPHA 2Y0OA 4WXDA 5ILVA 2CAUA 2P5VA 1Y0UA 1CAUB 1LNWA 3ECOA 3SHRA 1LR5A 1O3RA 2OYZA 4A0YA 3KEQA 3LZZA 1XMAA 3NEUA 4XSXF 4FAGA 2FA5A 5ICEA 3RI4A 1X8MA 3MQ0A 3OF1A 4CYDA 3RYKA 4LLNA 1IW7F 2GXGA 5BOXA 3BPVA 4A2UA 2IXJA 4HQEA 5J7MA 2GA2A 1FYMA 2O3FA 2BGCA 3KP3A 5CJ9A 3L7WA 3E5QA 3FE5A 3DKWA 1LVAA 5HOOA 2PJPA 3GXOA 1CAXA 1YFWA 3SCHA 4ZU5A 2ISZA 2XAHA 1R1TA 2PHDA 3RIRA 1B6AA 5FO5A 2HKOA 4AVAA 5D6EA 3WU0A 2E9QA 4META 3QU6A 2NRAC 2P6SA 4Q48A 3I59A 4CXFA 4UHTA 3BALA 1FP1D 3HOTA 1YFXA 3H3UA 2VBZA 3LSTA 2VC0A 1STZA 3MYXA 3F3XA 1KU2A 1R1VA 1DP7P 3IWFA 3TDZC 4YNIA 3J80Z 4HOBA 2A3SA 2D2WA 3U11A 4IF4A 4GYGA 1LKNA 1H1IA 1P6RA 3CO6C 4IEYA 1E17A 4ETSA 1SQ4A 1XGOA 3R4KA 2ZKZA 2IW5A 3RJPA 3OV8A 1XE7A 1F5TA 4PIXA 1JUHA 2UY8A 2FBHA 4IRHA 2IC1A 4HW0A 5JI6A 3WTZA 1IPKA 4HAMA 1ZZBA 1KYZA 4XFGA 4CDGA 4IEZA 4IPAA 5ED4A 2XROA 3TDUC 2RC4A 3ECHA 4MGYE 4G6QA 3R0AA 3WTVC 2ATFA 1I5ZA 4HN1A 1KQ9A 4UBGA 1U8RA 3HOSA 3IBMA 1RIOH 2YSRA 2FXAA 3U2RA 3DEUA 4JV4A 1P4XA 2K02A 3FXRA 4PGHA 1CX4A 4WCGA 3F8NA 4QGMA 5LHHA 1TQPA
chains in the Genus database with same CATH superfamily
1ZRDA 2RM21 2UWAA 3TEYA 2CUFA 2YC0A 3HG9A 1LTEA 5HV4A 1OCZH 1ZH5A 2VZ1A 3DEMA 2LK2A 1O4YA 1BJAA 3ZXDA 3VODA 3WW3A 1SFKA 3NQOA 5EEHA 3GALA 4MFEA 2GH8A 1PO11 1WH5A 3D3AA 1RUH1 5EEGA 5J48A 4HETA 2GMPA 3ACFA 5FBZA 5AC92 1Z7LA 4FI9A 2W9XA 2GALA 1PIV1 2CH0A 1WJDA 2NN8A 3KMHA 4ISQA 3PVBB 5JWPA 3VBRA 1U12A 1MD0A 3THTA 1FC3A 3UR3C 2D93A 1ULYA 4YRDA 1M4WA 4CZCA 2ENRA 4AI3A 4QXCA 2PHRA 1COV1 4LKDA 2QBYB 2PAEA 4CRQA 5LBFA 1U5TC 3NMBA 3ZMTA 2P34A 4Q4V3 4XLCA 2A6XA 5JOXA 3ZOBA 1VBB1 1VP6A 3MI8A 2Y48A 2WT1A 4P9XA 3CCEI 1UW8A 4L18B 4BE2A 1SVMA 2LREA 1W7PD 3FBYA 3GHNA 4HSLA 1DLLA 4ANJA 2JSCA 1RKTA 2WS92 2OBPA 2X6WA 2P1BA 3F72A 3CL1A 4E9KA 2G9ZA 2E6VA 1DGLA 1UG2A 4AF9A 3W2WA 1SVOA 3AL5A 2Y0IA 1N25A 4IRGA 2ZJRF 2E36A 4JKLA 1VBC2 4QPWA 1QQP3 4LG3A 1V00A 4HANA 1PO23 4KG8A 2A6VA 4CA0A 3W6JB 3MGUA 4NC7A 1SD5A 3IH3A 3S32A 2DCKA 3FK7A 5DMYA 2Y30A 4CZZA 4U7BA 2R7OA 4NB5A 1X2NA 4PDWB 1YW8A 2RG4A 2JDKA 3ZN5A 4LK7A 1ZNPA 3P9IA 2XVCA 4PJMA 2MEV2 5D5VB 3MZ8A 4MSVA 1A6IA 1BI0A 4QSHA 4XILA 3WDTA 2DFCA 4NIGA 4NHXA 1HB2A 3RZMA 5JSOA 2LR8A 3JCUC 4HF0A 2LUWA 2W25A 1NZIA 2K3PA 3VBOC 4EWDA 2L9RA 3ZSEA 1REDA 3EDPA 1TWAJ 4ZDLA 4B4CA 3AJYA 3RPUD 1QO0D 2Y9YA 4XJ9A 3BR6A 3WTWC 1IO2A 2WO1A 3WLUA 5FREA 2ZB9A 4KU8A 5FZKA 3NKGA 1NG7A 1OFSA 3A01A 4M71A 1K5MA 4XSZF 3VSLA 2F5EA 1MZ5A 2UXXA 2JG9C 5L7OC 1RUE2 2VQTA 3JSOA 3UGGA 2JDMA 5ACA2 4HQMA 2C6YA 4XICA 1W2AX 2XONA 3ZDVA 3ZFEB 2OC6A 4C0HA 1U9NA 3HM5A 1CZVA 3LIHA 3L9JT 4QX7A 3GF6A 2E7AA 4K1ZA 4M74A 1B1BA 5L3DA 2W3JA 4CDUC 1Y1WJ 4XN3A 2BGOA 2R0QC 1FOD1 1H8TB 3GGLA 4UW4A 4B8EA 1A8DA 5A3TA 3KIOA 3QD6A 3WY6A 4FETA 1NLQA 5FJ8J 2NPIA 3NV1A 4MQ9F 1EAH1 3HNBM 2XL7A 4UUSB 1XYNA 4XAEA 5FRAA 2X9DA 2RS51 5A33B 2NMNA 2HVRA 2R4GA 3M3EA 2IP2A 2PFWA 1T33A 3GBFA 1KQ0A 3BJOA 2CG4A 3HOYJ 2ADUA 2XAGA 2FD8A 3RSJA 1WW7A 4COYA 1PVC2 2WWUA 2QQJA 5I0SA 4BHCA 3HPGA 3CDIA 5FZ7A 2R072 1ITYA 4CH7A 1QJU1 4DZGA 1V6JA 1HIXA 2PN6A 1S7AA 2HWD3 3MCZA 3IV5A 3VBRC 1E5HA 4COVA 2WZR3 4NJ4A 4XABA 2ZX0A 1F4AA 1XSDA 2V79A 5HPOA 4ES8A 4KMQA 1ND3B 2X5IC 4IX7A 1KDKA 2OKXA 1RUD3 4PI0A 5B1BH 3FKIJ 1QXRA 1XSQA 1MKMA 4U36A 5FZEA 2OCCH 3O1RA 3VPRA 5LGUA 3DFGA 2RV8A 4CP1A 5L9VA 3VBUA 1DFQA 1XX5A 3PQKA 4BE0A 1IRGA 2CFOA 4JBAA 5CVRA 5J3LA 2PMHA 4A45A 3HR9A 3W21A 3OYJA 3PVNA 4P9LA 3I2KA 3C8XA 4LK6A 1FBSA 5BY5A 4PBPA 1W36C 4IEVA 2CY6A 1HQCA 4XHXA 4AM3A 1F5FA 3GEZA 4P00B 2DT5A 2VJJA 5EZHA 1MNDA 2EAAA 2ICWG 1VB4A 3GVAA 2X1CA 1OMIA 2X05A 4XQFA 4C3JJ 3ZKUA 3RI9A 2D5FA 4UVCA 3JUUA 1TME2 1EH8A 2QA4I 1VBC3 4MHRA 1ZZCA 1ETQA 1VQ4I 5J1YA 2GA1A 4F93B 2XPWA 2MC3A 5DYMA 2JKBA 1YQ5A 4FOQA 1JUIA 5LK7B 2D45A 3ACGA 5J8FA 3TO9A 2R6QA 3AMNA 2O1QA 5JPNB 2O5RA 3G6JB 1VNDA 4YVSC 2SLIA 2HJIA 3HOXJ 3KZYA 5L3CA 2D6KA 1B8IA 5FQ0A 3PJYA 5IK4A 2JWPA 2IPQX 2MH2A 3LDRA 3ELNA 1W0PA 2KIFA 1ETKA 3ZMUA 5I0TA 3I9V2 4A5NA 5FPLA 1ULOA 3OY8B 1IOAA 4BMEA 1QHGA 1GANA 4MOAA 3LL7A 3COAC 1N1YA 4QKBA 1BEV1 3HB9A 4QWQA 2HEWF 2QCOA 2YGMA 4CDWC 1J7KA 4PI2A 5JSPA 3D1NI 3S8PA 3OIQA 2R7QA 5CVUA 4XMIA 1QGLA 3I7DA 4BMBA 5IATA 4IEXA 4KU7A 4YELA 2DFFA 2V9VA 3RS6A 1OR7A 1W6OA 1OCCH 2RS31 3R61A 1SFYA 3O1OA 2ZA9A 2KA3A 4ZONA 1ETYA 5FPVA 2WBMA 4CDUA 2WFF1 2VMGA 2DURA 2W95A 3IMNA 2QCSB 4QKDA 3OPTA 3J9SA 4II3A 5FFXA 4L9VA 3SKJE 3H0DA 3K1MA 4W50A 2PHFA 4Z2AA 1Y9QA 1RZ4A 3BG9A 5HODA 2DJIA 3QRFF 4GWMA 4R4ZA 3DPRC 5C9AA 3FHQA 1LB2A 3POYA 2A1XA 3MZYA 2KR2A 3V7SA 2ZHKA 3SEPA 5J98B 1WJ5A 3JRIA 1LHUA 1HCRA 4IZZA 1I1SA 2OS2A 1SFNA 3LOIA 1OLME 5FPBA 2FBIA 4V2VA 3POFA 3DQVC 3IAM2 3WD5A 4QHOA 1OCPA 3BODA 3ZN4A 2PHLA 4D0PA 2ZEWA 4RQPC 3ZXSA 4FTSA 4LOCA 4U2AA 3I64A 3OGJA 4OZOA 3LMMA 5E3LA 3I4PA 5DUKA 3SQOA 1YX5A 4OHYA 5HNFA 4DGWB 1SPPA 1QJU2 3IRRA 3W5NA 1ODNA 1UIJA 3ZCOA 3W5MA 3ZMVA 5FLVA 4IEPA 1HB4A 4BY1J 1NXMA 5EG0A 1GV5A 2ZHLA 1ZRFA 4QIWN 1GWLA 4M4RA 1SFPA 2O8XA 4ZJZA 1QZZA 2RS52 4Q5SF 4Y5SA 5HVQC 3KGLA 5FP7A 4OINF 3LOBA 2GNMA 2ZX2A 2DU0A 1UMIA 4S2HA 3VDCA 3C7HA 5C7GA 4UV9A 3TP3A 5F2SA 2E51A 3M70A 3JRGA 5T5JA 3R4UA 5LATA 4GWNA 4LB6B 1W9FA 1QOTA 4IEWA 3E6CC 5FJHA 1E3PA 2YPJA 2IXKA 4HVOA 1QVTA 1ASJ2 1W8ZA 1G2HA 1FY7A 3KX2A 1LU1A 5M5YJ 5L7OA 4BXSV 4BBRJ 4L9BA 2VMHA 4QPQA 3T2QA 2K9QA 2JXAA 2HQAA 1E2XA 4UT5A 2KT0A 2FCTA 3IIIA 4EZHA 4L0YB 1J5YA 2EZLA 1UZWA 3F6OA 4PJJA 1U0JA 3VOEA 5BNPA 3HL2A 4S2FA 2CQQA 4GO1A 4NC6A 4OUEA 4HLYA 1LHVA 3HVDA 4JRLA 2ISYA 2ZMEB 1R9TJ 1GR3A 2ZXWH 1B72B 3NV2A 2MABA 4LBQB 3PTYA 1TQMA 1HDKA 1RC9A 3I3EA 2R30A 3RWNA 2FU4A 3IAQA 2R061 4LIVA 3CUQC 2X8KA 2WZ8A 3CF5F 5JXJA 5KK1A 1CPMA 4UW3A 2A5YB 4E6KG 2VULA 1IXCA 3ZXLA 1MS4A 2DOAA 2DK8A 5FYZA 1T0FA 2DCJA 4ZU4A 2FBKA 1HRI3 3HYIA 2COBA 3K9TA 1R22A 1ASJ3 5LEKA 1AR61 3K0LA 3A03A 4J1WA 2HEOA 3Q8EA 3B01A 1EP0A 1TME1 3MIEA 3OSFA 1TWCJ 1H8TA 4AI1A 3AP9A 3CD6I 1FPN2 3QOPA 4H7LA 2L0KA 1OOPC 1VAVA 4KT6A 2BW8A 3CF6E 3LDKA 5SV5A 4HEA2 3VFZA 1MMAA 2ME0A 1CESA 3APBA 1K78A 4EJWA 2VC9A 3BIWE 4PJNA 4RS8A 1AL22 1D8KA 2JA2A 1NCRB 2W7NA 2ZGPA 3PO3J 3VHPA 2W1SA 3B6AA 3K4JA 1C8M2 1QXPA 3NRVA 3FXLA 4IGOA 4JAAA 2LS6A 4QQHA 5B1AH 1JYTA 1KYWA 3CTAA 1DLCA 1VQOI 1I6HJ 3KP2A 3HRSA 4U88A 1TEIA 4BQAA 2KQRA 3G3ZA 4Z92B 2A71A 3RQIA 4RQPB 3IUOA 4DRRA 1DG6A 5A1LA 4P02B 2OUMA 3JQXA 4IV3A 4DNCA 1RUF3 1W6PA 1H6XA 1PX4A 1ZLKA 1C28A 3GJBA 4FT8A 4BZ4A 2J42A 1ND3A 4LMFA 3PJRA 1S7OA 1HB3A 3VV1A 3OR1C 3OYNA 1Q8QA 2ZEZA 1QJU3 4XF0A 4JX6A 2P6TA 1D4M1 2XDVA 3MIBA 1JTYA 2ZKNA 1VAMA 1EJ9A 2M7BA 3ZYRA 1E3OC 1OPCA 1MBFA 2W82A 3A0NA 1T6BX 4E4SA 5C4JJ 1EAH3 1RUH3 3MFCA 3ACIA 2DYSH 2M45A 4HF2A 4ZZ8A 4WVMA 2R063 2ECCA 4GD4A 4GXOA 4CEWB 1A3KA 5KXEA 3HEFA 3LSKA 1W04A 4P08A 2Q2EB 3I55I 1A6QA 3JD72 2CMPA 1KU7A 4B7EA 5LK5A 1T56A 1JKQC 4FPCA 2JQ7A 3FHIB 4JC1A 5J36A 4W97A 4NOTA 1WGXA 1BI3A 1J09A 3RZOJ 5FPXA 1AXYA 4JDOA 3SC7X 3K1NA 3FIWA 3OS1A 1H88C 4I2OA 5EP9A 1RUOA 4DS0A 2W1QA 3H92A 2R93J 2CV0A 5F32A 3OL4A 2KP6A 3SNMA 1PM7A 3ZMDA 3FXJA 2BP6A 3FXQA 3M3YJ 3KPHA 1APNA 5H6QA 3A22A 4RR3A 1JI8A 3RMYA 1JODA 5D6FA 3RTRA 1ON1A 4HPQA 1P7JA 5LD2C 2EQRA 3WP5A 4CDXB 5FBJA 3IC7A 3BG7A 1HLVA 2CDOA 4XMAA 3LGRA 3VD7A 1UB9A 3MMYB 5A32B 1JH5A 5FUPA 1DZRA 4CCCA 3VEPA 2BFUS 3EMRA 1MJAA 3PO2J 4EJUA 4QDSA 3MKLA 2EPFA 5FZGA 2VXZA 4L0ZB 1W6MB 4RL7A 1CQ9A 1D5VA 4DYCA 1JUMA 3TOAA 3AMHA 2EV5A 5FWJA 4QPIC 4BJ5C 2QEXI 2X5IB 5EIYB 2YY1A 1S5LC 2DT7B 1W0OA 1PO22 5E3NA 3VHOA 4Q4V2 5CYVA 1FSHA 1A6CA 1VBE2 3C7GA 3UETA 2HGCA 1LUJB 1N75A 4M9SA 4YEJA 3WQ7A 1OQDA 2YXSA 3M8FA 1AVBA 2B5HA 3ZGKA 1DQUA 3OMYA 1BEV2 4EZ4A 4KBBA 1SD4A 4PJYA 4K2EA 4E70A 4OMZA 2E7TA 1R4MB 1LOFC 2ERFA 4RLFA 3OD0A 1XCBA 4OHXA 4TXWA 2QM3A 5FZ6A 5A80A 2VQLA 4FQZA 4ISRA 4QPGC 1MVQA 1COV2 5F27A 1TNFA 4DXRA 1ACIA 1UXXX 2KIMA 4B3AA 1CWPA 3DPRA 5FZOA 5C9AC 3B9CA 2I8DA 2L7KA 3WNMA 4YW4A 3F23A 1IXRC 4IEUA 5FMCA 1X1PA 4YARA 3FLPA 5GZGA 4UV8A 2CJJA 2AH2A 3NWSA 1CX1A 1X8EA 5IYCJ 5JOWA 1BN5A 1R5HA 3WQBA 1RUF2 4DZJA 4YYOA 4LG0A 2RR12 3ZMNA 4GAZA 3H0OA 4EN6B 1FX7A 3M4OJ 2GMEA 3GBGA 3OEBA 3JRDA 4EQQA 2G0EA 4RHV1 4F92B 3PFYA 4XUNA 4UB8C 2D5HA 1W36D 3KLNA 2RJ2A 1GNZA 3S30A 3CCSI 4YLZA 2Q1MA 4ATEA 1U6GA 4BIFA 3ZPOA 5CFCB 4DO0A 1MJBA 5FYCA 3ZXKA 5JPMB 3CZ6A 1G86A 1NT0A 4NAMA 2MD5A 2E60A 2EIKH 3D8CA 1SFXA 1G4DA 5L7OB 4HKLA 4XONA 1SG3A 2ZJQF 4A6EA 2VH9A 3BC8A 4XKBA 3HGYA 3AK0A 4AG4A 4ZKTB 5C8WA 3ELKA 4D9JA 1W2NA 2OQ6A 1U8BA 1ZGWA 3F6VA 1ZQ3P 3KGZA 3MW2A 1J58A 3Q8CA 4CP0A 5FZMA 2W4SA 2L7MP 2QQAA 2IA2A 5D1IA 1FYUA 2XVGA 4CEYB 4NUBA 3LA3A 4NVPA 1ZBA1 1PGSA 3DCQA 3F8FA 3KYCB 2H27A 3VBHC 1Q8PA 5KHJA 2GM4A 4OQ8A 5EFUA 1KA8A 4L0PA 4ZYDA 1GZWA 3K4AA 2JZYA 5K7FA 1UKRA 3C7JA 1HW5A 5FYBA 2ME6A 3POJA 3W2AA 3ZR8X 1UG0A 2HYKA 5FLXK 4OI0A 5I8SA 4XNFA 1ZREA 3LEKA 3J81Z 4OAZA 3B3QE 1U78A 4OFGA 1BA5A 1QIQA 1RPWA 2HWD2 2WLPA 3WDVA 1NXD1 3JB4C 5FZBA 1FLIA 1PK6B 5F3CA 2WAFA 1AR71 1Y43B 3KCYA 3C1DA 4OUMA 4C2UA 1W9WA 2VBWA 4IL7A 1L0OC 4UW5A 2Q1FA 2AQFA 2MEV3 1VBA2 2GC3A 1VBE3 3LFMA 2HYGD 9ANTA 5FPAA 3PUHA 1SMTA 2X51A 4AIKA 1ZZ9A 1XD7A 5D5UB 2Z5UA 2FQPA 3ZYJB 3AVRA 2VE8A 5LBQA 1OFNA 5DG2A 2HEVF 2HLEA 4IUGA 4NQWA 1VALA 1PP7U 3OGGA 2K85A 3P3NA 3DUIA 2R3SA 3DWLE 1YFHA 2HQRA 3F9KA 1LDJA 1T0FC 3VDDC 1KITA 1HRV2 2BW3A 3J81K 3GW2A 5GM0A 2FHRA 4XF1A 2FEZA 2VBBA 2GNDA 5L9RA 2AHQA 2VBDA 1RUF1 5IVJA 2AQEA 1YFUA 2XJRA 5F2WA 1LENA 1HKSA 1OH4A 4ZPIA 2AXLA 1SBEA 2WSUA 1US3A 1UYYA 2VG9A 3P3PA 1JXNA 4IV3B 2F4IA 1FPQA 3KETA 4XQ4A 3U78A 3CZJA 1HDDC 3EXUA 4GCVA 4CCMA 2XBO2 1BBT3 2EA7A 1JTZX 4IESA 4XIKA 4C2TA 1TW3A 2KRCA 2RS13 4IXLA 4I98B 5F64A 1VE0A 2Z42A 3FMGA 4CGZA 1YYNA 2CGOA 1HBXG 2PMZN 4AAXA 3DV8A 4NWWA 5T5OA 4O6JA 4BQQA 2R1BA 1UYZA 4JKMA 4IE7A 1IKPA 2ACJA 1FNZA 5FO8B 5T3NA 5F3EA 2VBPA 3KYLA 2FOKA 2EF6A 3HOBA 3ZOIA 4BXXJ 1AL23 3G1LA 5CFDB 5FK8A 2OZUA 4C1WA 1IRFA 5F5CA 1UJ8A 2WN3A 4LLOA 5LFAA 3ZXFA 1YXWA 2OCEA 3CLPA 1FJLA 2JDNA 3P1IA 3OYKA 2IVIB 1V6NA 5KNLA 4DW6A 5HNHA 5KAIC 2IRFG 2DA2A 1QWRA 4I3PA 4B47A 4CPBA 2CUZA 1OXCA 5EQUA 5BQTA 2JDYA 2KHMA 1RUG3 1W2TA 1Y9GA 1OLTA 3OD4A 2J1AA 5FAXA 1C8NA 2WYFA 5E8AA 2TBVA 3VDBA 1BQPA 4EE2A 2VZRA 3T5XA 3Q9VA 1GXPA 3U0ZA 1R5GA 4O9EA 5M5WJ 1K7AA 3ATGA 4B3XA 3RZHA 1T95A 3PNYA 4NR1A 2LSOA 5DDJ3 2VE9A 5AIPA 3TO7A 5BNOB 3CKHA 4M4PA 1O57A 1RNLA 4AVSA 2KL4A 4FOWA 1GYKA 3ZXGA 2PYTA 3WDXA 4KNYA 1UOFA 3ISPA 1RUI2 4PIZA 1MQTA 1OYYA 5FY8A 3JRFA 2HFHA 4Y7NJ 1QJFA 3OYWA 3VKLA 1FBUA 4MUVA 2RNJA 3SITA 1KXGA 2QKDA 3JD73 3J8F3 1E5IA 2WIIB 1AR92 1BIAA 2FUG2 3TEXA 3VZOA 2V1XA 3OL3A 5TJJA 3HT2A 1Z21A 4ARYA 2F4MB 3GWZA 5A3NA 3CMYA 4D6SA 1CD3G 3PM1A 2FE3A 1JT0A 2QQMA 1UWWA 2IS6A 4FPLA 4DJAA 1TZOA 3EQLF 4BH9A 2QENA 4N4OB 4DNYA 4M0NA 4LOSA 1OVPA 1FZPB 5EJ3A 1QPIA 1IGNA 3VBHA 2IXHA 2XAQA 2H8WA 1WSUA 5FD6A 2YU2A 5FZDA 1DGRM 3O1VA 2YUEA 3MO4A 2VOPA 1IS6A 3KZIC 4XFAA 3S2HJ 2WAQA 5HCAA 3WG7H 4XOGA 4C8DA 4AW7A 4XPVA 1FOWA 5FYIA 1GZCA 3T30A 2WT2A 2YR2A 1BW5A 3IB3A 1VF9A 3FHNA 3CCLI 3I4NJ 3OY9A 4A93J 1APLC 3T0BA 1R082 1URXA 5LA2A 2ZFUA 2DCZA 1K45A 2D1HA 1BBT2 3M1CA 1K3IA 2HXOA 2ZTNA 1BXHA 4ZDPA 5AFBA 2IA1A 4AFDA 3K51A 4GH4C 4F3JA 1VI0A 1WA6X 2VTFA 2M4KA 2FNPA 2NS7A 2JG8A 3MKZA 1GV9A 1TT0A 1F36A 3A4CA 3H9GA 4JTOA 2ELHA 3LAPA 4EN0A 1OD5A 1UHWA 2XL9A 4QM9A 3WHUA 3QPHA 1K12A 5ILVA 2P5VA 1CAUB 3ECOA 5H2FC 1F31A 1LR5A 2OYZA 1OUSA 3LZZA 1YCIA 2TCTA 4ZXKA 5ICEA 1RUJ1 3RI4A 1X8MA 1NAEA 4UFJA 4A2UA 4HQEA 3AZYA 5J7MA 1RR8C 5ANQA 2FX0A 1NQDA 2BGCA 1TC3C 3VKFC 3L7WA 3FE5A 1LVAA 4BU2A 1MBHA 3GXOA 1YFWA 2IFRA 2LYCA 4ZU5A 3CESA 3K4NA 2D43A 2ISZA 2LBFB 1CN1A 3K75B 1QJX1 5DN2A 2FDHA 3RIRA 3J7MA 3PUAA 4LITA 1OHFA 1QU0A 1LULA 3QU6A 2XF7A 2P6SA 2XGDA 2ADDA 3ETPA 3FLRA 1UZYA 4HFSA 1IZ3A 2W92A 2OV7A 3VSKA 3T0AA 1RUE1 3ME2A 4PDWA 3F3XA 1KU2A 3U4SA 4YPJA 1MMNA 3KZ4C 4BEHB 3TDZC 1P8JA 4RSUA 3U11A 2NVQJ 3KHBA 5EZGA 4EEFG 4E7ZA 5IY5H 1MS3A 1P6RA 4IEYA 5B66C 3NAPB 4ETSA 1SQ4A 4CXXA 2Y9ZA 1VQ8I 4CYCB 1S0JA 5LBEA 3SKVA 3M3CA 2NVUB 4ARXA 3PTRB 2DOEA 2WAQN 1JUHA 4V2GA 5GKAC 2UY8A 1JHNA 2FBHA 1Z7S3 2VVEA 2XBO1 1QJY1 5ABJA 1XU1A 2Y34A 3ECHA 3ZO0B 4MGYE 4G6QA 1U9OA 1YC61 5CAZA 4IDZA 3HOSA 3N9LA 3ILNA 4CU8A 1SLTA 2ARAA 2HWF3 1JYXA 1VBC1 2FXAA 4NO4A 1CX4A 2PELA 2X1EA 2LVSA 2DA5A 2YG0A 3HEIA 2R062 4YIRX 2VZQA 1ZHFA 1UFMA 1HRV1 3OBRA 2ARBA 1EH6A 4AQSA 5H20A 2RDNA 1YG2A 4HK9A 1G9DA 4NIIA 2HWE3 2VQUA 2K3FA 4SBVA 4A3DJ 4OIRF 3TW7A 1KFUL 1JXSA 2WNVA 1LJ9A 2ZXQA 2JIJA 5K7ZA 5GAHJ 4XF9A 4B1RA 2BWAA 3TAYA 3M7AA 3FMSA 4G3YC 3JW4A 3OYEA 4UAPA 2K9SA 5AIQA 4GDFA 4Q4X1 1P2FA 2Q8EA 1MMDA 4G7HF 4HK8A 4MXWA 1T6SA 5FMBA 2ZGMA 1QEXA 1BMV2 4LUKA 4BY7J 2B45X 2VMEA 4HNTA 3BB6A 3RPQA 2XUMA 4R9AA 2XJSA 3KE2A 3QCWA 3S7IA 3C3WA 3V7RA 4B48A 4AGGA 4DEQA 5F0FA 5JZGA 1JZ3A 2HWB2 4LHLA 5DUVA 4CZSA 3V42A 3P9KA 1G3SA 2IUWA 1RUJ2 2L7ZA 2WV0A 2E2JJ 1X33A 4JK1X 2KLOA 1DGWA 3K2OA 3O1PA 4PQQA 4OLLA 1UELB 3TYJA 4ENNA 1UKGA 3H50A 5C3QA 2WSVA 3WHTA 4BOWA 1D1AA 2ZHNA 4ZH4F 1W8OA 1V4RA 3IMMA 3H9QA 1LGBA 4Y15A 4QXHA 2GQQA 3G1OA 1LPQA 2XJUA 3NNGA 3ABMH 4QX2A 5GLWA 1LFPA 1FMWA 4MGTA 2C26A 1WH7A 2VECA 2LLKA 1QMJA 4ES9A 3DCFA 1J59A 2VKVA 3MD2A 3ZYFA 4Y1UA 3K48A 1Q1HA 5C4WB 1YI2I 1ZA7A 2EVXA 4H2AA 4ASNA 2D3PA 3WP4A 3FKJA 1DGRA 1K5JA 1RUNA 2ZGKA 2OIIA 3WP6A 1BI1A 5JIAA 3ZR6A 2H1LA 4OI1A 5LA0A 1W03A 2IT0A 4FASD 2QQNA 4MFDA 2E33A 3DXTA 4G9SB 3WCSA 2QQOA 1YW7A 3AKSA 2RS11 1WW6A 2VOVA 1SVLA 3WV6A 1Q3EA 3VUOA 4GGGA 5J96B 3BG5A 1SLCA 2ZMNA 3ZQFA 3S15J 1GDTA 4AEJA 3OSDA 1MGTA 4N9HA 3WT3A 4RN5A 1MMGA 3WR0A 1RXFA 1R092 1G7YA 2JG9B 4FAHA 3VYRB 1TNSA 2VOOA 2G9FA 2VM9A 4UF0A 1XGMA 5E1RA 1S3JA 1BBYA 2DDAA 1R1UA 1IN7A 5GZCA 2JEMA 3OYWB 2L5QA 2GU9A 1Z7S2 1X1DA 2C9AA 3LQRA 4AEDB 4YW1A 1H1AA 4Y5Z0 2IGKA 4KISA 3RJ2X 4XTPA 5B3SH 5FP9A 2KRFA 3E1F1 1S6LA 4YFKF 1Z7S1 5FOJB 2QZ2A 5J37A 3LAGA 1HJFA 2A7AA 2TEPA 4IE4A 1BYHA 3BDDA 1GZ9A 4L97A 4XETA 5DCMB 1Z7UA 1YYVA 3Q9OA 4YM2A 4N0BA 5KAFC 2EFOA 4F7ZA 2DDUA 2XOMA 4Q5OA 3JRCA 5F37A 2M3AA 1F8VA 2OD5A 3H1CA 3PLQA 4H0EA 1OUXA 1G8WA 4PCRA 2GH2A 1KFXL 4JVAA 1AR81 3HZJA 3KLOA 1V54H 1XE8A 1N77A 3HC7A 4D7SA 1UF2C 1LGNA 2VQHA 3I0TA 5K7PA 2E32A 1POV1 4JGYA 3C2UA 4EJTA 2E1OA 5FXZA 5JXGA 3GO5A 5A3UA 4BPZA 1B35B 4DB5A 1ZX5A 3WTXC 2NZ9A 2VONA 2K9ZA 3WSOA 5L19A 2SBAA 1W8UA 3AJZA 2W68A 4MIMA 4NHKA 2RJLA 5IVFA 1T8IA 2NM1A 3IDEA 4YM3A 1OISA 4EV0A 1CF7B 1UCRA 3WEZA 3CJTB 1HKDA 5J4VA 1Y7BA 4ZYGA 2HYFA 3MKYB 1MPXA 5K0UB 3OIOA 2NLRA 3L2HA 3UESA 4Q8KA 2RV9A 3ZQGA 4AYUA 2V1UA 3WQ0A 4LPLA 2RDSA 4A3LJ 2XSDC 4XLNF 1WZXA 2YB7A 1Q1VA 3WX5A 4D7NA 3UKGA 1VQNI 3USUB 1C3HA 1MS0A 2AACA 3ES1A 5D8LB 1PO13 2YX4A 2XLFA 2FD5A 3VN4A 4CSWA 4MX3A 5FZ3A 2GC2A 4QHBA 3CJNA 1ZG5A 3O14A 3AYAA 2BV4A 2EV0A 4XACA 2QQBA 3OEAA 3VZNA 1UQXA 1BI2A 1NZCA 3ZYIB 2PJRB 4QQOA 1AL0G 4UFMA 4Y22B 4Q0PA 2BY2A 1LHWA 5E8GA 3I4IA 4AEMA 1D5YA 2CU5A 5LRSA 3UT0A 3GZEA 3GFLA 2JD4A 1I3AA 1FEXA 5B4NA 1GNHA 1O3TA 3CMEI 1SPPB 4Y3OA 1WWXA 5FY9A 5FPUA 2MNGA 1L7RA 2V1DA 3MPBA 5E1XA 4NROA 2VW0A 4CO8A 4UNOA 1AR72 1BL0A 1H6YA 4R52A 1BIBA 1FOXA 4YVSB 4XR6A 4FXGB 4BHPA 1SFEA 1UOJA 4QT6A 5FV3A 1H30A 2E26A 3F21A 2F5DA 1YS7A 2BHYA 1Z78A 1SACA 3VD4A 2ZEXA 4LFUA 4LLGF 2PG4A 1HV0A 1R71A 1ZBE1 1MDMA 5AFEA 4J00A 2CW7A 4LK1F 4WM7A 2ZMEA 1BOAA 3HDDA 2WY8Q 4IETA 2FCVA 3CJIC 5J4YA 2VMCA 3NAPA 1J3RA 4LBQA 5DXDA 2EK5A 3KP5A 3B02A 1W0NA 2X6OA 2HVSA 3LIGA 2H6CA 1YS6A 4RDUA 3U1DA 2M30A 3ZXEA 2HWB1 5LGTA 3LSIA 2LM3A 1IHMA 2FNAA 1QRYA 2R5YA 1ZZ7A 1RUD2 3ZVXA 1D1BA 3BTJA 5FIXA 1JUSA 4EWEA 3WF0A 5JR2A 3ZR5A 2FRHA 2HBUA 1JU3A 4AHZA 4WXHA 4HLXA 4QLCU 1BEV3 3IT8A 4Y4YA 3U21A 2KJBA 2E63A 5T52A 1GP6A 4LUMA 1F4KA 3JTGA 4Q4X2 2XASA 3H1YA 3IKTA 4A42A 5DDJ1 1VJ2A 3KVAA 4BB3A 1GHCA 2R7VA 2AC1A 4CU7A 3Q0VA 2BRTA 3AFKA 5CLSA 1QKQA 4K21A 3BCWA 1C5IA 1PUEE 4KIBA 4QB2A 1POQA 2WNVB 3LSMA 3S1RJ 4B7KA 1AU7A 4B8XA 3RKYA 1P4WA 2DT6A 2WAOA 5IFPA 3H8RA 2VKHA 4JGYC 1OCTC 1WLCA 1X1BA 3BR0A 1E57A 1HKTA 4XFHA 4XE9A 2RR13 3HOWJ 4Q0SA 4CDQA 3SHFA 4JTNA 3RQ0A 1WCSA 5LA1A 4AVZA 4OCTA 1K42A 3CQOA 4YWAA 2V6CA 3X2QH 4IGPA 1US2A 5BNQA 2O6GE 4FXKB 3MDPA 2NYYA 2FBEA 3SJMA 2VOWA 4HVQA 3OWTA 1X3UA 1NCQC 2F5VA 3ZSMA 4F52A 4XFBA 2H6BA 1UD1A 5F5IA 3ZPLA 2R49A 1V0AA 1WHUA 2E2HJ 5F5QA 4YG2F 2P3YA 4S05A 1TQIA 1H8VA 2W00A 5A7WA 2GOMA 2Z33A 4AYBN 3UGFA 5JXIA 1G3WA 4HX4A 2BY3A 3LSRA 4NIDA 3EUHA 5FB2A 3U9GA 2VTXA 3ERMA 2UY9A 4RFT0 4HL0A 4I0WB 1W0TA 4BXFA 2DCTA 2FF4A 3K1PA 4ZS2A 5T5PA 1ULEA 2D5VA 3VB9A 4V19K 2RQQA 4WVMB 1UU5A 2MLKA 3FHAA 5KCMA 4XRFA 2VY0A 4YG6A 2V4AA 2D6MA 4D69A 3LFIA 1AR93 3HUGA 1TMF3 2R7WA 4N43B 3U4XA 3KF3A 4EJOA 2ILMA 4N43C 1SCSA 1QOOA 3DBLB 3J80K 3VDXA 1OF4A 1D2QA 1MZEA 4LBKA 1W9TA 1IC8A 4YG3A 1P92A 3Q8BA 2EB7A 1VFCA 1T38A 3GZNB 5FZAA 2A6HF 1POV0 4LEJA 3DBHB 2DWRA 1Z3YA 1JZ6A 1NOVA 2PN5A 3BWGA 4RGUA 1DDLA 4MHGA 5A7NA 3KP7A 2VQAA 3H8XA 1X7NA 1TT5B 2IXCA 5JAXA 2Q5TA 2VW2A 1ETWA 3IM0A 3ZN0A 1XMXA 2JG9A 2QZ3A 2ZCWA 3BIEA 3FWEA 2HQNA 2JB4A 2YFZA 5JVGF 4AFCA 1X50A 2MA3A 3ENRA 3K6GA 1SDDB 2NP0A 1T98A 1UPIA 3OYCA 1YEWA 2Z4FA 4A7KA 4QGNA 4RM3A 2YBSA 5JLXA 1HW1A 2YV8A 3Q8AA 1R1A2 2Q0AA 1H9GA 5K1YA 1LAJA 2ZAHA 5C8CB 1PGW2 3I59B 3OYLA 4IEOA 1AA7A 1R00A 3POGA 4I99C 5IT9Z 4R8HA 3CHXA 3LE0A 2VQCA 4Q0QA 1OOPB 4DUXA 4P9FA 4KIGA 3O6BB 1PVC1 2DFEA 2ECBA 4WBBA 3G71I 5LLQA 3S16J 4NE9A 1YFYA 4Y52J 4W6WA 1KS5A 1S4CA 4XLEA 2P4WA 3OSGA 2COMA 4COZA 2Q30A 1GMMA 2RE9A 1ZBA3 4AC0A 2RNGA 5T50A 3ZX7A 2MPFA 1W8NA 5GZFA 4HX7A 3FC0A 3KV9A 3EUAA 3HGGA 2BOJA 4K3UA 5EDNA 2XJTA 2DMTA 1FV2A 3I3DA 4Z82A 5B2GB 1UOGA 2E34A 2K86A 1ND2B 4HZFA 1Q43A 1TWHJ 2IWGB 2VLAA 4LJHA 5DZFA 4QX1A 4URTA 4LLLA 1QQP1 4AFBA 3L00A 3DTIA 1ONVA 1TQ5A 1O3QA 4BIOA 1OA3A 5H9SA 5DCFA 1O8PA 1NUKA 4DYRA 3M8JA 2X5IA 3J7NA 3LPFA 4O61A 5FZOB 1C0WA 4FBFA 1VQMI 2ADEA 3TW6A 1J1LA 2VCMA 1IXSB 3WDYA 3RZZA 2B63J 1YLLA 4WF2A 2DUPA 3VBUB 3ST7A 3BTXA 1Y3TA 3R0RA 2L01A 2H8RA 4JGZC 5CEHA 1Z1DA 1J3PA 4AUXA 3WF4A 1AJKA 4DBRA 4Y4RA 1EV7A 3S6PA 4UXNA 4A3JJ 2ZXJA 1BC8C 1W6QA 1EKEA 4E27A 5GTIC 4F8AA 1ST8A 2P81A 1OA2A 2GP3A 2Y6HA 3LEIA 5DQ0A 5C33A 2JA6J 1Z6RA 3QYBA 3IPVB 3BR2A 1RRJA 4QPYA 4ITVA 2NVXJ 1Z91A 3S17J 1QJY2 1S2EA 3G4SI 4ENKA 1RB8G 5K5QA 4XDOA 1SCRA 2IS1A 3LA2A 1OKRA 4FOYA 1YX3A 2HWC3 4XQDA 1D0XA 4YGBA 2R7UA 4JP0A 5EGOA 2B4KA 5FLXZ 1PUFA 4BCUA 3HOVJ 2GXAA 4XL9A 2VN2A 4OUSA 1OQYA 4ITCA 2V4JC 1G9CA 2HWF2 5FLJA 4BYYA 5E3OA 3CCQI 4LG0B 2QLZA 2IGNA 3FF5A 3I4MJ 3NNLA 5A1FA 3GZ6A 1KZHA 1GLNA 1UZZA 4C3HJ 2VXJA 2ID3A 2VXDA 3OCPA 4N7IA 5DABA 4EM2A 3MIGA 5DUWA 4RD7A 2BHZA 4W6YA 5BYNA 3N9QA 1DP0A 2BBAA 5LZ6A 2A3YA 3CO7C 2VZOA 3ABKH 3K3NA 3R4DB 1PP8F 2P3JA 2GNTA 4M72A 3MF9A 4LB5A 3VBFC 2ZGSA 2LW8A 4AFMA 1H2KA 2ZXHA 2QBYA 5E79C 3CU7A 2VCBA 2HZDA 3N9PA 4I0AA 3B94A 1VAKA 1YIPA 2P0WA 2VMIA 4YZ2A 4DUVA 5HLGA 1O91A 2PEXA 3ZXJA 5FP4A 3HHGA 5IT9K 4YIFA 1AYM3 5FKNA 2B0LA 1L3JA 2XKOA 4M9XA 3D0SA 3BTCA 4YFZA 1NX9A 4BQ5A 3PUBA 2D3RA 1ETOA 1X1CA 1QY4A 5CU1A 4UVAA 2Z69A 4YGDA 1RUH2 5EYXA 1YJLA 1GXQA 3KSCA 2XQRA 5JDBA 2D98A 2ID6A 1JZ7A 4JX4A 4EYUA 2C1FA 3ZN6B 4Q2FA 2CGNA 5C5TA 2GDFA 3WQ1A 4AI2A 4J6GA 1PDNC 3O0VA 3MEXA 1EPZA 3ROUA 2CV2A 2X29A 1YIJI 1XSVA 4LBLA 2LG4A 2FZ1A 5LWBA 1XPXA 5GADJ 3NO8A 1NA1A 2UURA 3OYDA 3WNXA 2VT2A 3TEDA 5IK5A 2VVDA 1ERDA 1HW2A 2QQIA 4MGRA 2A07F 5AONA 3AMPA 1YJNI 3J7AO 4AOCA 1PNGA 2LKXA 1JYWA 1Z67A 4QPGB 3T3YA 2MFZA 4XUPA 3F8CA 4S04A 3OYGA 1JZ2A 1JUPA 2DBIA 3REOA 4L5IA 4PCQA 3GZAA 2Y60A 3PIJA 1BZWA 3RNSA 1OPMA 2N7GA 3I3MA 2Y0SA 2H1KA 5LGNA 4JKKA 2LDUA 2I45A 2ID4A 5A3WA 4YRVA 2ZACA 3GZTB 1RVF1 5HDKA 3DKQA 1FMVA 3PUQA 3T09A 2FMYA 4KN7X 4YW5A 5I0UA 1YJKA 3SH3A 3FM3A 3D5OA 2OQGA 2MG4A 3L2CA 3BPZA 1PMJX 3M8EA 1I3QJ 1YITI 1UY0A 5A7WB 3M9AA 1IUYA 2DTWA 2VQGA 3SMHA 2L9SA 2L9NA 1JYNA 3UGHA 2XMLA 3UJQA 1QNWA 4A3MJ 3CIHA 4CP9B 3CJIB 5GTHC 2VODA 5I91A 5CG9A 2AUYA 1XRUA 1W8TA 4G9YA 4RS5C 3TEZA 2QUOA 2R0HA 5GLTA 2YFUA 1AYN3 2L9VA 1FBQA 5FUNA 2X48A 4KITB 1VQ9I 4AVPA 5HS8A 3OUHA 2CO5A 5E88A 1LDDA 2ZX3A 5F39A 3UL2A 1FOD3 1HXDA 4D3WA 4N4NB 2LTPA 4WZFA 2LH9A 2J7MA 4HF1A 5KBFA 2AEYA 4P5HA 3OPZA 2ZFWA 4FPKA 1XB4A 1V9U1 2QFEA 2B39A 3PNTA 1CAVB 2FJ1A 5HBAA 1UO9A 1GVJA 3F22A 4IHSA 5G04L 2F48A 4EVIA 5KHHA 4K1YA 2ZX1A 4XORA 1LDKB 2HVQA 2DJNA 2HWE1 2XC7A 2KZVA 1IGOA 3HRUA 5FFZA 3MW4A 3I71A 5FZHA 2HS5A 1OA4A 3T4VA 4L99A 3KVBA 3E6BA 1TME3 3IN9A 2A5WA 3PDQA 2P3IA 4MLOA 3SCGA 4NN0A 2WZR1 3AFHA 1WFXA 1KQ8A 4XKWA 1D7PM 5F3GA 1W5SA 3OGVA 3DPTA 3JB8A 2X6XA 1UZVA 3AYEA 2A69F 4K40A 4DQAA 1R36A 1O5UA 1VIWB 3AB0A 1FMD3 2WA4A 5EXOA 4KFCA 3Q3SA 2XH6A 1I1GA 4X8NA 1AYN2 2QBXA 5BMZA 2PXJA 2WRAA 5F6KA 2OQ7A 5HLHA 2O61A 2WN2A 1ULDA 5FLIA 4IO9F 5JMCA 4A5MA 1HRI2 4Q0UA 2X09A 1DPUA 3KWVA 3J7YJ 2WQZC 4N90A 1Y0NA 3W6VA 1HV1A 4NC8A 2Y2ZA 3PHMA 2AENA 1EY2A 5J09A 2JG8C 3ONQA 4KL1A 4FQ4A 5D8AA 2W1UA 1W7PA 1QQIA 3SH5A 1VBE1 3CCMI 1IJWC 5FXWA 2YU9J 2W1WA 3KFWX 3GNEA 4KWKA 1DCSA 3J4UH 4FP3A 5GPCA 2VCAA 1VBB3 3LPGA 1RESA 3SZGA 1IZ1A 3OYMA 4JGZA 4RHV3 3ZSJA 1S0GA 2A6YA 4B3NA 4F55A 3HN3A 2M5WA 3BQZA 1XOYA 5DV5A 3BYWA 4YW2A 2OA2A 1T08B 5HLTA 1SBFA 5EV7A 1OBNA 3H3ZA 1OKQA 2BUKA 2K27A 1L7LA 1ETVA 5CISA 1ND2A 4M00A 3BROA 5CVVA 3N7JA 2R7TA 4X6AJ 4BJ0A 3TQNA 3KT7A 3E6DA 2ZPXA 3QPSA 5ILSA 1QDOA 3AP7A 4XIOA 5L3EA 5GLVA 1H9WA 3PMSA 1WI9A 4R9BA 1G9AA 3JAMZ 3PIPF 3E5UA 3CUQA 5C9AB 2JTVA 2TDXA 2VMDA 4JCKA 4YVWA 2H0VA 1CJDA 3HQRA 4BJ6C 5F8PA 4D6QA 3E1SA 4MTDA 2DBBA 1H9TA 4XCBA 1UMZA 1JYCA 4XFCA 4PDWC 4WWCA 1REPC 1HSJA 3GTKJ 3BOPA 4Y20A 1KJRA 1IV6A 1MJ9A 2KD7A 5CFDC 3QAHA 5FKMA 1DQ6A 2WWJA 3ZPYA 2XVKA 4P9GA 3RQ4A 2X0LA 3FBIB 4KGGA 3HJRA 2VGDA 4MADA 3EBRA 3DKYA 2FOWA 3O7OA 1HDPA 2QKLB 4HNVA 4QDQA 4PFPA 3GYDA 2IZWA 2R5ZA 2EA4A 2XLAA 3SXYA 1JKPC 1NY71 2NMOA 4MV2A 3MUZ1 1UY2A 2DF7A 1S29A 1MZFA 5F08A 2CU7A 2ZGRA 3ABZA 2EIJH 1VBA3 5K5OA 1UHMA 1ZRIA 1IS4A 2O8KA 2TRTA 2AO9A 1FYLA 3WG3A 4RGSA 4UFLA 4JHZA 4MZUA 1WPKA 4AQTA 4MYEA 1GQHA 3RZLA 3CMAI 1EUTA 5A2QZ 5DEQA 1YHFA 3VL9A 2TUNA 3AG2H 2DODA 2PMUA 4YIIA 4IERA 1CAWA 1RHI2 4QMAA 2I2SA 4LGWA 2VVFA 5F1RA 1Y4WA 1W3XA 1X82A 2PMZA 1N3PA 4IJAA 4FCAA 1ODDA 3LNQA 2STTA 3VD5A 2CFXA 4OHVA 2EIGA 2X85A 4R4XA 4ESJA 2Y6GA 2V7FA 2BZDA 4COUA 4M9ZA 3ZQIA 4XAAA 3M8LA 4LKFA 3NRUA 1ZGJA 2DU9A 5CG8A 1OD3A 4A3IJ 4QXKA 3UKVA 3B93A 5FXXA 5ERLA 3MV01 3D82A 1IN5A 1AR62 1WD3A 3NKTA 5EZWA 5FKBA 3RKQA 1ZLJA 4LD5A 5BNPC 2WB1N 3KB5A 2C5DA 4Q4Y1 5BNPB 1S9HA 1M06G 2BNMA 3IWZA 2ORZA 4N9IA 4XJWA 2ZC2A 2LRPA 3GFMA 4S2DA 5J3UA 3WNNA 3K4MA 4LO8A 1RL3A 2WT0A 3K4CA 1AUYA 2CW0F 1NHAA 4QPIB 4JOMA 4UUTA 3RDIA 4B43A 2LMDA 4UXAA 4BWOA 4KJZA 1LODA 4MEYF 2O7OA 4ATFA 1KONA 3SCFA 2E1MC 4XBNA 3H36A 4YGCA 1JGGA 4YZ1A 4W65A 3C7FA 2PQSA 2XXZA 4E4DX 4WZCA 4NPLA 3AL0C 4E8DA 3ECQA 1ZAOA 4BXUA 4KWLA 2JDUA 4B44A 1AX0A 2VXRA 3QP5A 2XUEA 4MXWB 2P37A 4GH4B 2HWVA 4XQWA 1LOBA 3RZJA 3H35A 1ZN2A 1JMUB 2XKPA 2M34A 5KHGA 1A31A 5FYTA 3PNVA 4IEJA 1MS8A 3LCPA 1RUC1 1J3QA 2RKHA 1CVNA 1SLAA 3QQAA 1Y0UA 2DN0A 1DIWA 3IH4A 1GUUA 2X1DA 1W0UA 1H2MA 2XAUA 2W46A 1WMEA 2JE9A 4QTRA 2QQKA 3U07A 2FA5A 1IDZA 3MQ0A 3I2OA 3FXOA 2OJED 4LLNA 2GXGA 5BOXA 1PO12 1MIJA 2VUCA 2GA2A 1XNKA 4YG0A 5CJ9A 1HLCA 3E5QA 1BVVA 3VBRB 3AKQA 3SCHA 3S1NJ 2FDJA 4GB32 5CFCA 4XURA 2XAHA 5C3EJ 4UFKA 1R1TA 2PHDA 3S5AA 1B6AA 2HOAA 4MGSA 4LT5A 5FO5A 2HKOA 4AVAA 5D6EA 4TWTA 1ZYBA 4META 1MEC2 5EWSA 4Q48A 4PUSA 1E5RA 4UHTA 1K4SA 5FY7A 5IVVA 2HWD1 1REFA 1YFXA 2VBZA 3LSTA 2HYXA 1WJFA 2M8GX 4BK4A 5LW9A 2P3KA 1R1VA 3D4KA 1NG0A 1NG6A 3IWFA 4YNIA 3CCJI 3J80Z 5K9YA 3QPLA 2CSGA 5KC5A 4IF4A 3UJOA 4GYGA 3NJYA 1WZ2A 2LROA 1H1IA 3CO6C 1KDMA 3BZKA 1HOMA 4DEVA 1Y39A 3PUSA 1W2OA 2G4IA 1GICA 3SDGA 2VNRA 2VZTA 2XJVA 1UX7A 3ILFA 2L9LA 1A5JA 3A02A 4N53B 4HW0A 5JI6A 1GZWB 3AG3H 3WTZA 4IV1C 5FXVA 1ZZBA 1KYZA 4LO7A 1YQ8A 4CDGA 4D0QA 2YPDA 4CCKA 4IEZA 3LD8A 5ED4A 4LO5B 2FZ2A 3TDUC 4XJAA 3WTVC 2ATFA 3L2YA 4CU9A 4LBOA 1NLSA 1U8RA 4ZTFA 1GBGA 3HQUA 2KDZA 1RIOH 5CKQA 1IRZA 1P4XA 2K02A 4G12A 4PGHA 3F8NA 4NRQA 3W9AA 5FMDA 4CU6A 2DYRH 4XUQA 3WHCA 1FWZA 2O0YA 3FMQA 5KHDA 1N78A 4OU0A 1ZZ6A 5J47A 2Y75A 1W99A 4RYDA 3HHHA 2BBVA 2OQRA 1YTYA 4DQ2A 3B00A 3JCIA 5FYHA 1UX6A 1EH7A 2DFHA 1GLHA 3T2PA 5FY5A 3C7EA 2LOOA 5FZ1A 1Y1VJ 3HRMA 3W58A 4IXAA 2EFWA 1UU6A 1I27A 5IP9J 5C3RA 1MEC1 4A6SA 4B4PA 3TMOA 1CAXB 2ZBKA 2EH3A 3EHKA 4CCEA 3DYOA 1W05A 1DGWY 2AYHA 2BQPA 4BE3A 4K20A 4EM1A 1IV8A 1QZYA 4CDQC 3CJRB 3ZP5A 4IHWA 5F04A 2JVGA 3N7KA 4RS5B 2EJRA 1LHNA 3BR3A 2C0ZA 2WZR2 3FUQA 4A41A 2E35A 2QZ8A 4FCYA 3AC0A 2Y64A 3MZHA 1F35A 4I7HA 5H9PA 3LEMA 4BQ1A 2W57A 4JHTA 1MNMC 5L9BA 4M3CA 3USSA 3HWJA 4HSJA 4FFIA 2QF7A 2HOEA 3VB2A 2GMMA 5FWEA 3MKWB 2DA7A 1J2XA 1QNTA 3AZVA 3DBRB 2JRTA 5FYYA 4GMP0 3WNLA 5M5XJ 1O59A 3DYPA 2W47A 3M3OA 1BK0A 1W4MA 4E8CA 4BGDA 4Q27A 3ZKYA 1RHI3 3OOPA 3Q0WA 1FTTA 1SAUA 5AVAA 5G05L 2JE8A 1GUIA 5A32A 4AU7A 2M8EA 4JGYB 2XPJA 1OCRH 3NNFA 5A3OA 2UWCA 2ZZJA 5FZFA 1YIFA 1TBXA 5A6YA 4U87A 3ASOH 2ZBJA 3AG4H 1O4XA 1KGYA 3I58A 4Y22A 2VPRA 2EFPA 5HI0A 1FTZA 2R0FA 1N3OA 5GALA 2VT3A 4AI0A 3N35A 1TMF2 3CC2I 3J7LA 1FSEA 4MEXF 4UYBA 1GFF2 1NCQB 1DQ1A 2DFBA 2QSGX 1WWYA 1X19A 2YYOA 2DXIA 1MVEA 4AE2A 3MEPA 3AFGA 4FQGA 2ESHA 5L3GA 2IVMA 4LK0F 3W3CA 1W28A 1IRXA 1OFCX 2EICA 1Z05A 4Z2YA 4KMUX 5DM7F 3CJQB 2JJ6A 2F5FA 3EYPA 1S0EA 1KD7A 1XB9A 4N8MA 4GULA 1BLZA 4NHJA 1QNYA 2VQ0A 1W3VA 3FBNB 1JZ4A 2EXJA 5I8TA 5HXMA 3J7AY 2B42B 1V6MA 4BQ3A 1QQP2 3CCRI 3AKTA 5E8IA 1UY4A 5I93A 5GP9A 3L1PA 1WGPA 2EXKA 1WW5A 2HWB3 2WWYA 2GAUA 3RZKA 3VDDA 2WUHA 2JDPA 2PQQA 1LCLA 3DECA 3AM2A 1WCKA 3ZIXA 4XN0A 4ZS3A 4DXZA 2KM2A 4XJ8A 3WG9A 3S3OA 1OLQA 4EGZA 3WW1A 1GOFA 5KC6A 4B4RA 3NNJA 1X58A 1AXKA 3T8TA 1MACA 4TLGA 3BN6A 3S3MA 1AF9A 2VASA 3TBIA 3OY8A 2VKEA 2W39A 3VZKA 4GKXA 2QQWA 2WA0A 4Z8BA 1T2XA 3VLBB 4CICA 3N36A 4LKSA 3VBFB 4BL0B 1D3YA 3KT4A 1KQRA 4Y24A 2VOKA 2XJQA 1F9KA 4XOPA 1ZBA2 2CQKA 3VD9A 2HYJA 4XIDA 4XRSA 1NY72 2JD9A 3BR1A 1YNAA 5FO7B 3LB9A 2C24A 2Y31A 2ES3A 1S0CA 1B9NA 3A7QA 2JE7A 3J26N 1FATA 1BKZA 2HNHA 3TN91 5C4XJ 2VPVA 2D1VA 1JBCA 2YX7A 1RUG2 3LSDA 2XGXA 1ZK8A 3I54A 2PLV2 1XNDA 1BMV1 4OAYA 1F2NA 2XF5A 1U5IA 3AMQA 4HA8A 1NKGA 5T55A 3ZLIA 1JYVA 2X10A 4CEYA 4BQ4A 1O7FA 4DXSA 1GV2A 4KBZA 4YFWA 5DD4A 1RGSA 4DPNA 3CP2A 2P7VB 2NQYA 4GQ7A 5F7UA 4PJLA 5FDBA 1T39A 5CQGA 3C18A 2WFPA 2X6YA 3BP8A 2QKMB 5ICCA 3MLKA 5FPZA 3OPWA 2J1EA 1MBJA 3RKWA 2OZJA 1D8JA 2DA1A 1NCRC 1XGSA 2M7AA 4OIQF 3QPTA 2RREA 5A2QK 3ACHA 4NIAA 3T1MA 2ZS6B 4XOTA 3JU9A 4RGXA 4H55A 3ESWB 4FOVA 3OYFA 2E7QA 4ZU7A 4AI9A 5EPAA 3POBA 3MF6A 3RYPA 1RJ7A 3AZWA 5CKNA 2ZMEC 5JVVA 2EFQA 1X9TA 2W85A 5T54A 1AR82 2DVFA 3A2KA 3WE3A 4DFSA 1OCOH 1DZTA 1UOBA 2PLYA 2GSYA 3L2UA 2HEYF 3LFUA 4MO3M 2WDBA 4H3WA 2JX9A 3BLYA 4PF5A 3VBUC 3IDAA 4PLMA 2CWMA 3H5NA 1XSXA 4EN9B 3VBOB 2KIUA 3EO6A 3J7HA 1VQ6I 5ERIA 1W1WE 2Y0MA 2G9WA 1IKQA 4WVZA 5FYMA 3VL8A 1XTAA 4M3GA 3JRHA 5LASA 2XPUA 3E97A 3I2GA 3DP7A 2VZ3A 1I39A 1W8WA 2K7LA 3I2IA 1UZ0A 4COWA 1XJAA 2XVLA 5EJCA 4FPEA 3ZN1A 2W48A 1R091 1JHFA 2F6CA 4KH9A 1R1ZA 2MLGA 3POEA 2DQRA 1R5ID 3H7JA 3SEZA 5EJZB 3FN9A 1MEC3 2FQ3A 2ZO4A 4HOOA 4I01A 2D7FA 2GWRA 4ZYAA 5FKOA 2VUMJ 4Q4ZF 4HG6B 2JENA 1DF0A 3HSFA 4KUMA 1WQ2A 2R073 4BQNA 5C8CA 4GJYA 3IDBB 1GWMA 5EF6A 2EFNA 2M1BA 2YUSA 4HSRA 2V6EA 1OOPA 4XW3A 4XBFA 1XS9A 5GPAA 1K78B 3QWLA 1UMQA 1VBD3 1YLFA 3GBWA 2AEZA 4UFHA 3BR5A 3GFIA 4L92A 1ZGAA 2KJCA 2A6WA 3T08A 3PSIA 3QP6A 3LA7A 3AKPA 4AEKA 3WU2C 3BU0A 5A70A 1X36A 1V70A 2VNGA 3VGIA 2Y33A 3KYDB 2QVSB 2PMWB 3TN93 4DINB 2ZHMA 1ZYRF 1G3TA 5FGMA 2JN6A 1MS9A 4V2WA 3WP3A 3HAGA 4DY3A 1RJ8A 3DTEA 4X6RB 1TVGA 1VR3A 1J1TA 4ABZA 2P4EA 3JRBA 4HV5A 1W6PB 3LQQA 1LOAA 2RJKA 2P5LC 4IVNA 3JBG2 4WV8A 3HOZJ 1QGPA 3J8F2 4GMP1 3V0BA 2F5CA 1R7JA 4MGIE 5H9RA 3L9FA 4M3CB 3CMMA 5E18F 5E17F 4M3FA 2R7SA 2BTVC 2E1CA 2NS0A 1YJWI 4HVRA 3JQWA 1FP2A 4BUPA 1OYWA 3PURA 2WAEA 1DU6A 1QDCA 4E4ZA 2GIZA 2E1NA 1AR63 3GX4X 3QODA 5IYDJ 2H0BA 3G2BA 2YMZA 1FXZA 2P17A 2ZOEB 5FRMA 1FAYA 2ZNZA 1SEUA 2YROA 4CEWA 1RUC2 4XZUG 4ASMB 3ACLA 1I50J 1R49A 4E2SA 4Y1VA 4KT5C 1G59A 2R16A 1UZCA 2QTWB 3BI3A 2ELKA 2DVBA 2ETEA 4A6OA 3RJRA 4MHUA 4C2MJ 1HN0A 3GMEA 3VBHB 3VDAA 4UWDA 1JTXA 5JVTA 4BHBA 5TISC 2IXLA 2AREA 4J19A 1SEFA 4DRVA 4XFIA 5F9TA 3WTTC 2DA6A 2ZAAA 1BR4A 3RFRA 1Z6TA 3ZFFB 3QH7A 2K9MA 5C3OA 5GZEA 5J1RA 2YPRA 4PJ0C 1PUFB 2O03A 4ENMA 4D7YA 5DG1A 3KHCA 3O2PE 4AVBA 4BLIA 1REEA 3POIA 2WKKA 5A7QA 4XZPA 4ONUA 5LA9A 1G9FA 2BGPA 1MBGA 1PZ8A 1YQAA 2NS8A 2HXIA 2ZJ2A 2LY9A 5K4LA 1P9QC 4X6QB 2VNVA 1UAIA 1Z9CA 5J40A 4F3QA 4ZDOA 3SEQA 1D0ZA 2Z16A 5IPAA 3SFZA 4K9SA 1X2MA 2HWF1 5FKCA 3DU6A 4RGAA 3CLOA 1ND3C 2CYFA 3TRSB 4A12A 2E7WA 3H9JA 2N8GA 3AL6A 2QQ8A 2JUGA 4AIJA 3S0MA 2OT7A 1UXZA 3K4LA 2XRNA 1E0EA 4BE1A 1PNFA 4L9JA 4WX9A 5JLVA 1EF4A 1QH7A 1BHGA 2G9GA 3M1EA 4MQVA 5FRNA 3ZFEC 4Y13A 1W6MA 4C30A 2ET1A 3VDDB 1XNBA 4Y17A 4C90A 5HDNA 3WU1B 1K83J 4B4QA 4OVEA 1UCXA 3MICA 1W5CC 5C70A 5EEAA 1MW7A 2GZWA 3Q0UA 5L3FA 5C44J 4HKOA 1GVDA 1AWCA 2WWSA 2I5UA 4DOZA 3G73A 2P7CB 3HTSB 1K79A 1V6IA 4CDXA 1LOEA 3DPUA 2PLV1 5B4XA 1LQ1A 2WYSA 1FYKA 4NIHA 5EHDA 1PIV2 2A6EF 2HU9A 2R7EB 1NA1B 1VBD2 4FE4A 5FY1A 4OHWA 2BOLA 2CHHA 4PIYA 3DGTA 5FY4A 2UWBA 2EIEA 4WM8C 1CONA 1N1VA 3PFIA 3J7ZI 4BEHA 4AHXA 1IS5A 3FDYA 3K46A 2CWEA 2DFIA 2BVLA 2QQVA 3D0JA 4AXOA 4RB3C 2QE3A 4YW6A 1NLRA 1JN2P 4A7YA 2HDWA 4EWAA 2R1DA 1ULCA 2VZVA 5DD8A 1WCDJ 1CIWA 1X4OA 1GQGA 3L2VA 2VJXA 3MFAA 3JBG3 2BZTA 3ZRGA 5GAGJ 2WS93 2XLGA 4EN7B 1R23A 2NAZA 2VB6A 3BJAA 5CPRB 3HJEA 4W6XA 3AXDA 2Y6LA 2VI6A 4G7ZF 3MFKA 5M3MJ 2JRMA 3N9MA 4TZDA 2E19A 5FMOS