3RPQA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
201
structure length
201
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILFYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Catabolite gene activator
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
total genus 60
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rpqA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rpqA01
1CAWA 4MQVA 1BN5A 2D40A 4NQWA 2VOPA 5D8LB 1J7KA 4FT8A 5FLHA 4OINF 3FHIB 3KP2A 2F5EA 1FYMA 3GXOA 1SFXA 2A6EF 4ESBA 5E8GA 2EFWA 4M74A 2WTEA 2IW5A 1OKRA 3CLOA 4B09A 3I54A 4BHPA 5IT3A 2KXLA 4HMZA 2XLGA 4A6DA 3OCPA 5J48A 3MZHA 3L7WA 2BNOA 1FZPB 1W5TA 4GXOA 5J8FA 1NXMA 4P5OA 3P7NA 3V7SA 3V7RA 1A04A 2RDPA 1FC3A 5E18F 3J80K 2EV5A 3E6CC 3BJ6A 3BPVA 1YO5C 2FBKA 4MGYE 2XROA 4TLFA 1CAWB 3VODA 1X7NA 3ML6A 4OFGA 4H7LA 3ABTA 1X8EA 1W7PA 1XE8A 5BS6A 1GQHA 4Y15A 3IL2A 1J75A 1IUYA 1PDNC 2KIUA 1QO0D 3K69A 3F8FA 1ZHFA 3LQRA 4LLNA 5HDGA 4YIFA 3SCHA 3ECOA 3W6KB 4ENKA 4HX7A 3KGLA 3FWEA 4IEZA 2M8EA 1B9MA 2P5VA 3F8MA 3U9GA 5K5QA 3SHRA 3KZZA 2MA3A 1KYWA 2EA4A 3EUHA 3P9CA 2DLLA 3FHZA 5HDNA 2HQRA 2EA2A 2HZTA 1XMAA 1R1VA 3HTSB 1IXSB 1G6NA 5FFXA 1B59A 4M9XA 2UXNA 5HS7A 3QPTA 3L2CA 2VODA 3FZVA 3JTGA 2E7XA 4I3PA 4YARA 4OMYA 4KMFA 3R61A 2A68F 4EJUA 2CAVA 4HN0A 3J81K 3HIFA 4IHSA 3GO5A 4CZZA 3SCFA 2QQ9A 1KA8A 3WG9A 1WLTA 3TNQA 2DU9A 2E9QA 5KVRA 5D8KB 2QNKA 3BWGA 1B6AA 1MJBA 3H7JA 3F6OA 4WXCA 3RKYA 1Q1HA 1R00A 2X4HA 3U11A 5L3EA 1KU2A 2K02A 2PN6A 4N9HA 4B8XA 4RB1A 4L5JA 1LRHA 2CV6A 1PP8F 4B29A 4XFBA 2A69F 4ETSA 4Z07A 2JRTA 2VBXA 2FRHA 2YU3A 2CGPA 2WC2A 1ZZCA 3O3KA 2PG4A 1U8RA 1O4TA 3BPZA 2W25A 2PHLA 1WA4A 3E6MA 1ZGAA 2DW4A 2DT5A 4META 4XF9A 4AXOA 2VQAA 3OTFA 2LSOA 2ESNA 4RB3C 2OAZA 3FFQA 3MZYA 1RUNA 2E1CA 2GZWA 3GLXA 1HW2A 3NKTA 2FA5A 4UVBA 2L01A 4KIBA 4Q0VA 3K0LA 5HI0A 1BI1A 5FLXZ 3R4KA 1HKTA 4BAYA 5AVPA 4EWDA 3PFIA 3U2RA 4ONUA 5E1WA 4LLGF 2GXGA 2LKPA 3C3WA 3COAC 1DZRA 2QBYA 4L9VA 4HA8A 3MCZA 1ZG3A 1EP0A 4QGNA 2HWVA 4MQ9F 5LHHA 1U12A 5BMZA 3WTXC 2G7HA 2H09A 3FF5A 3I53A 1T38A 2B5HA 2ZNZA 4X6RB 5LGNA 3NEUA 4ZYGA 1EV7A 5D5WB 5ILVA 4WVZA 4HQMA 3REOA 3NL1A 2KJBA 2ZFWA 4UBHA 5LEKA 2IPQX 3GFJA 2GA2A 1TQMA 2VC1A 2W57A 3F3XA 3SZPA 5D6EA 2GA1A 4EM2A 3RYKA 2EJRA 2P5KA 4E2QA 4XFIA 2JSCA 3K1NA 4O3MA 2PQQA 4JK1X 2PHDA 3ISPA 1YLFA 1XCVA 2Q4SA 4HDVA 4BYYA 2XUBA 3L2HA 3ES1A 2D1HA 4M71A 2N7GA 5J3UA 1P2FA 2OA2A 4EJVA 3SXYA 4MUVA 3M9AA 3OV8A 2D5HA 1OYIA 1IN6A 2P17A 2HR3A 1S7OA 3LA3A 4R79A 4JVAA 2A07F 3DFGA 4MNUA 1R5HA 2FMYA 3IKVA 4G8XA 2VC0A 4O6JA 3GYHX 1XCBA 3TDUC 4FX4A 1SD4A 2ATFA 4LEJA 1QWRA 2ZKLA 3GFMA 4RGXA 3F8NA 4LG0A 4A0ZA 4DQ2A 2NS0A 5L3CA 3F21A 1OR7A 4R1HA 3WTSC 2UWMA 2D93A 4LMYA 4MGZE 1P4XA 2RNJA 3RI4A 5BY5A 3SFZA 2HDCA 2WWYA 1L3JA 3VEPA 5DCMA 1O3RA 4UNOA 4A5NA 1L0OC 2L3DA 4OU0A 4HLTA 4HF1A 3SCGA 3C7JA 4I0BA 1ZLJA 4BHBA 1DGWA 1EYBA 4Q0UA 2DI3A 4ZU7A 5LEJA 5I8SA 3EQLF 4MTEA 1T6SA 4XETA 3HRUA 5CLSA 5FD5A 1TQ5A 2DO7A 1R58A 3W6JB 5CVJA 1L3LA 5A2QZ 5D4SA 2F5FA 3TGNA 5EZWA 4WK8F 2RN7A 3HHHA 1IPKA 1RGSA 5DCMB 4MV2A 2BNMA 5LHGA 2Q30A 5ED4A 1XDSA 1P4AA 2LNBA 1S29A 4XBFA 4ASNA 5I93A 3DPTA 1Z6RA 1G3SA 3PQJA 2XV4S 4EQQA 2H27A 4RB0A 5FPZA 3WGIA 3KSCA 3VB2A 1O7LA 1CAVB 3FMQA 3H1YA 5FQ0A 5E1RA 4N0BA 5H6RA 3IRRA 5F64A 3L9FA 2A6HF 1YFWA 2JT1A 3BB6A 3H50A 1ODDA 3DKWA 3QP5A 3F72A 4HOBA 4Q4ZF 1YFXA 4OIPF 1YLLA 4K2EA 4GO1A 2FSWA 3NW4A 1ZRDA 1PUEE 4LLOA 1BJAA 1ZZBA 3RIRA 4FBFA 3HRMA 1HW1A 4UUVA 2ISZA 4KWKA 2XAJA 2VBZA 5LRSA 1EY2A 5FQ0B 4NHJA 4WBBA 4EV0A 4HF0A 2QQAA 4HLYA 3D5LA 4OOIA 2K7LA 2P5LC 2NNNA 4KWLA 4KMUX 3JAMK 1RL3A 1XMKA 3KFWX 4WCGA 2BBYA 3ZMVA 4XLNF 4Q47A 3KP5A 4G94A 1SAXA 3H8UA 4QX5A 3LAPA 4D7SA 2VT2A 2MH2A 4IVNA 2FQ3A 1RZ4A 4BIFA 4P55A 5JR3A 3MWMA 2YX7A 4MZUA 1YW8A 5HVQC 3IIAA 4Q0PA 3RZZA 2UYBA 1RUOA 1YG2A 3WGGA 5E20A 2A3SA 2CFXA 2NAZA 2PA7A 2DTRA 5AIQA 2CG4A 3LWCA 2QLZA 2ET1A 2VPVA 5DEQA 1S7AA 3J7AO 1RI7A 2E7WA 3SXWA 2GC0A 5JSRA 1UPIA 2Q1ZB 1QXJA 4IF4A 2MHFA 4KU7A 3ELNA 4MGKE 4LK0F 4NB5A 3C1DA 1TNSA 2VBWA 4A5MA 1DUXC 2HEOA 2EV0A 5I0UA 2Y0MA 2M1BA 2O61A 2G7UA 1I6XA 2BEOA 5TRDA 3GVAA 4AVCA 2K9ZA 3M7GA 1U78A 1LNWA 1DZTA 4UXAA 2XKOA 1USSA 2GQQA 1XGNA 1LJ9A 3H3ZA 3CDHA 2C6YA 4Y13A 1QZZA 3EYIA 4MEXF 3Q9SA 4AVBA 1G3YA 3SHFA 2K4BA 1K79A 1ZRFA 1PM7A 4KIGA 2HFHA 2D1VA 1R22A 5K8SA 2B0LA 1H1IA 5E8IA 3BOQA 3F8BA 3JZVA 4XF3A 1YHFA 4KWJA 2IXHA 4L9JA 3I58A 3FX3A 4EJWA 2V1XA 4HAMA 4RAZA 1UD1A 1R1TA 2OD5A 1SFUA 1Z6TA 5IT9K 5L3GA 2XHKA 2IC1A 1F5TA 4S05A 1S8NA 2GXBA 1AWCA 2WFPA 2MC3A 1FP2A 2IRFG 2PI0A 5H6QA 5BPIA 1FP1D 3RKXA 4L0ZB 4IEXA 4ZYDA 2KIFA 4LULA 4I0AA 1T39A 3FZ3A 1H9GA 3GW2A 3NVCA 5EFUA 1KQ8A 4PGGA 1H9TA 2STWA 5JFRA 1YTYA 2P6TA 3J80Z 5I0RA 3ERED 4WXHA 3M3IA 2DQRA 1QBJA 5BPDA 1E2XA 2PMHA 2PAEA 5CJ9A 2Z9OA 4BHCA 3U10A 1ZG1A 3U0ZA 4R52A 2Z3YA 4KU8A 4ENJA 4O9GA 2VBYA 4AWXB 1LB2A 4L2NA 3HRSA 4UHTA 4RD7A 1IN5A 1LKNA 1W7PB 4M9ZA 2XL7A 4RGUA 4BH9A 1LQ1A 4U7BA 1FYKA 4NVPA 1UB9A 3L00A 1Y9QA 2O03A 5CU1A 3HSFA 2UXXA 1J3RA 4QXKA 2V9VA 3TQNA 1YS6A 3C3VA 2XLFA 3CO2A 3M1EA 3ES4A 2NNYA 2PAMA 2OQGA 4QGMA 3F8CA 3I0TA 5KBFA 4TV7A 3J81Z 3T8RA 3NSTA 5K1YA 4WZCA 2QZ8A 1WI9A 2EK5A 2XASA 3R0JA 4EMSA 4R8HA 1BC7C 2QM3A 1Z7UA 2H0VA 5KHHA 1SMTA 1ZRCA 4QWQA 1KU7A 4Q48A 4P9GA 3VFZA 1KQ0A 1K78A 4G6DA 1WSUA 2Z99A 3AAFA 3V8JA 1ZREA 3GYDA 2HTJA 3QU6A 4IEUA 3H3UA 1XB4A 4OMZA 2HYFA 2M30A 3D0JA 2RVCA 3DV8A 1Z05A 4J1WA 2FF4A 5JSPA 2K0GA 4WX9A 1PMIA 1OI6A 3ZMTA 3KP7A 4QM8A 1ULYA 1TBXA 3P9KA 1R7JA 2V79A 3CF6E 4A12A 1XGOA 3E5UA 1J58A 2JPBA 3I5UA 5DD8A 5L3BA 4YNIA 3HYIA 4IJAA 3HQXA 2PEXA 5JVTA 3N4MA 3BDDA 4AVPA 4I09A 2RC4A 2GC1A 3RNSA 1O3TA 2KRFA 2I45A 4CO8A 2PFBA 4HW0A 4YFNF 1CX4A 1ZX5A 1O5UA 2QQBA 2AXLA 2OZUA 3USSA 2AS5F 4GYGA 3IWFA 3TO6A 4HVQA 1XSVA 4CYDA 2EFPA 5D5VB 1D8JA 1T0FA 1MZBA 4L0YB 4HN1A 2ZXJA 2ZNYA 3RPQA 5FFZA 5BQTA 1NE4A 2ZO4A 4XF0A 2LF7A 5J8CA 2UYAA 4Q5SF 3GF2A 3G73A 5BXXA 1MJ9A 2F5CA 2ETHA 3IRQA 4ENMA 3ZMZA 4I2OA 5E16A 3E6BA 2QDRA 5E1XA 1FX7A 3F22A 3DPLC 3HRTA 1DPRA 2DPDA 2LF8A 4LB5A 2F4PA 3EQEA 1R23A 2PLYA 2L4AA 3S2WA 2FOKA 3ZN1A 4P9FA 1BM9A 3DQVC 2QENA 3MEXA 2X0LA 2QBYB 1UCRA 2MLGA 2QCSB 1ZNPA 1HSTA 5L3DA 5BPXA 1O3QA 3HUGA 5ICEA 5TJJA 4EWEA 1TTYA 5CADA 4O9EA 2EWNA 2YX4A 1O3SA 4XFCA 4M6XA 3S7EA 5D6FA 2IVMA 2XL9A 4IESA 1GVJA 5E1ZB 4LLLA 1H1MA 2H6CA 1WQ2A 4WXDA 3BPXA 1LEAA 1UFMA 1KGSA 3RYRA 4FHTA 1HW5A 2QUFA 3EETA 2OBPA 3ZMSA 3H1WA 1QGPA 1I1GA 2XAGA 4PDKA 3N97A 4Q0QA 3WTTC 3SQNA 3WW1A 1HQCA 3I64A 4XFGA 1TNTA 3LAGA 2HKXA 1R1UA 3S7IA 4N9IA 4EM1A 4KA4A 4BQAA 1YWKA 1J2XA 3GFIA 3LWFA 2UZKA 3K1PA 3CUOA 4HV5A 2EFOA 4XRFA 4I7HA 1S3JA 5DV5A 1ZYRF 2GH2A 1XSXA 3T1BA 3GFLA 1UIKA 3HTUA 1I1SA 3ZPLA 1ZZ6A 1P4WA 4IEVA 1MJAA 1O57A 3FXRA 1XDUA 2JPCA 3FE5A 4IXAA 1U5TC 2GU9A 1D8KA 3FM5A 4HLXA 3ROUA 4IRIA 4E70A 1X3UA 4LG0B 2Q0AA 4QM9A 4UXNA 5HS8A 1S6LA 1HBXG 2V09A 3MDPA 5LGUA 2ADUA 4G7HF 2XVCA 1D5VA 3Q5FA 5AIPA 1UHMA 3G7DA 3H7YA 1W5SA 1J0RA 2FU4A 1QZYA 4IEWA 2YR2A 3PNAA 5DUIA 1SD6A 4IRGA 1IZ1A 2Y75A 1XE7A 1ZARA 4FAGA 4U0VA 2C0ZA 5DDGA 2A61A 3E5QA 3ELKA 3ZQ7A 4ZYHA 1YFYA 2F5DA 4HSJA 3EBRA 4G7OF 2MNGA 3ST7A 2P6SA 1DP7P 5DCFA 1V3FA 1XSDA 4XF1A 4EGZA 3DN7A 1Q43A 2MH9A 2BV6A 1U3EM 1FSHA 2KIMA 3H92A 1EPZA 2BNNA 2Y0OA 3KEQA 3FMRA 3FMSA 4OIOF 1VR3A 3BZ6A 4XSZF 2HKOA 3QRFF 2Z5UA 4I98B 2ETEA 5CVRA 2BE5F 4JV4A 4PIXA 3NRVA 4HX8A 3WW3A 4L11A 1ON1A 2V1UA 1J9IA 2EFQA 3CTAA 2Z2SB 3CJXA 1T98A 4CHUA 2OZJA 5HOOA 3F23A 2TDXA 1FI2A 2FMLA 4LK1F 2L54A 4AIJA 5ICGA 4PIYA 1LDJA 1UCXA 3EDPA 4HQEA 3LA2A 1YQAA 4MTDA 1XGMA 3JTHA 3HSEA 5KHIA 4L9TA 1SEFA 4J1XA 2W24A 5JHUA 4KN4X 1UHWA 4MH0E 3ZDSA 1J3QA 1IPJA 4HDUA 3WTYC 2VE8A 2XLAA 5C8WA 4LGWA 1JUHA 3O2PE 1FY7A 2FBIA 1DPUA 3ETQA 1HKQA 2H94A 4F7ZA 3WU0A 4BXUA 5AONA 2Q8KA 1FWZA 4KIFA 4PGHA 1F1ZA 1QPMA 1K6OA 4D7TA 6PAXA 2HS5A 4PZJA 3WGHA 2O3FA 2EB7A 5JR7B 4HYEA 4O5VA 3HT1A 4LD5A 2R7DA 3KCCA 4RGSA 4KT5C 3OD0A 2MD5A 1ZLKA 3JAMZ 1MD0A 2HOEA 1YW9A 2DBBA 4JTNA 4EROA 1CAXA 2UY9A 3HOSA 1WWXA 1EH8A 4KYWA 1QY4A 5D4RA 2Y48A 4DNCA 3E97A 4MX3A 2OU2A 2RQPA 1VTNC 3LQQA 4D0PA 2IXJA 1U5TA 2A5YB 3QP6A 4GULA 1GXPA 2V1DA 1CGPA 2DQLA 5CVVA 5KHGA 1P6RA 2CWEA 1NZCA 4ORFA 3RPUA 3QU3A 4XFHA 3H9AA 2IA1A 3IC7A 4K8FA 3PVBB 3CJNA 3DP7A 4HX4A 1U6GA 1FBQA 2CYYA 1FOKA 1PP7U 3TOAA 4YIIA 4ZU4A 1YYVA 1YFHA 2VE9A 3IBMA 2J5OA 4YRDA 3NJZA 2RV8A 1SD7A 4EJTA 4AQ2A 2CO5A 3WTZA 3WODF 2L4MA 2QJVA 2ZCWA 3RDIA 1FNNA 1J1LA 2HTSA 3QACA 2COMA 4KUMA 5ICCA 3HHGA 3UKVA 1YS7A 1U5TB 4EGYA 4IEOA 5JSOA 3O14A 4LA3A 2W85A 4OLLA 1TQIA 2EVXA 1LEBA 1YW7A 3LFKA 1V4RA 1Z91A 2OPKA 2VOOA 1RTVA 3E6DA 3BU7A 4KDPA 3OF1A 5FCCA 4S04A 4A0YA 1GQGA 4UBGA 2EFNA 2LDUA 1RIOH 3TKYA 4FX0A 1WKMA 1WGPA 1D3YA 2PFWA 3KMHA 4IETA 3S0MA 3WE3A 4HV6A 2P7VB 4FAHA 5CVIA 3QPHA 1E17A 2ET7A 1BIAA 1SFEA 1O7FA 3QOPA 1ON2A 1O5LA 4GGGA 5JAXA 5HLGA 5FDBA 3LA7A 1OMIA 1C0WA 4LTAA 2VONA 3PLQA 3FXQA 4M9SA 5FPXA 4JTOA 3MYXA 5IT9Z 2M45A 3BJAA 3TO9A 1BI3A 4HF2A 4G7ZF 4A6EA 2VXZA 4LA2A 3NQOA 3KLNA 4YFKF 1YFUA 5EEHA 1QXRA 3KP6A 3DF8A 4JQFA 5J6XA 3C18A 2QVSB 2M5WA 4YSFA 3FXUA 2V6CA 3OOPA 3M8FA 4XFFA 4EWAA 2GAUA 2DAOA 2KKOA 3BROA 2XGXA 5H20A 4X6QB 2CQKA 2D2WA 4XSXF 3T0YA 5EEGA 4YFXF 1WRJA 3CEWA 1V70A 2M87A 2MPFA 3CO6C 2Q2EA 3K2ZA 2IXCA 1LDDA 4ZH4F 1FT9A 4PCQA 2STTA 3K1MA 3D82A 3DL3A 1BIBA 4IERA 1FPQA 2B9UA 4HVOA 1JE8A 1Y0UA 5I0TA 2R3SA 5JCTA 4HZFA 3TNPB 2CSOA 2PJPA 4GYIA 4LB6B 3HOTA 3ABUA 3R0AA 2F2EA 2FE3A 2O8XA 3QAHA 4U0WA 3KE2A 4QMAA 3RJPA 1XD7A 4AIKA 5HDKA 1BOAA 3BCWA 4KN7X 3E5XA 5DYMA 5DUKA 3ZMUA 3D0SA 4PIZA 1MKMA 4XFAA 1TW3A 1HKSA 4L5IA 5E17F 1OFNA 1GHCA 2GWRA 3WTUC 4KFCA 5FLXK 1SMYF 1EH6A 3B02A 3ACLA 2CW0F 3KP4A 5I8TA 2EV6A 2O6GE 1BC8C 1USTA 2D45A 4UV8A 1Q3EA 5J7MA 4UVCA 4EVIA 3SMHA 3RYPA 3WTWC 3IHUA 4ZZDA 2ESHA 2BGCA 3LSTA 3JSPA 2GIVA 5FD6A 1K78B 1JXSA 4WF2A 1Z1DA 4RB2C 1NE6A 4KICA 3KLOA 2D5FA 3V4GA 4UVAA 1TLHB 1IF1A 1ONVA 4G9YA 4KL1A 3RKWA 1FXZA 3BALA 4XEZA 3GZ6A 2DK8A 2ACJA 3U1DA 1HXDA 1QNTA 5D5UB 4JBAA 3O6BB 1UW8A 2K27A 3KGZA 2IXIA 2RKHA 4LUMA 5BUVA 2JTVA 4AQ6A 3GX4X 1MGTA 4E2SA 1SQ4A 1KU3A 4PJYA 4YG2F 4IRHA 1DDNA 3WTVC 3V7CA 5BOXA 3L09A 1IRFA 2IA0A 5JI6A 1ZZ8A 2O0YA 4H0EA 5D1IA 1I5ZA 1STZA 3ZMDA 3LZZA 3RTRA 2QVOA 4Y17A 2PTMA 2IP2A 3I4PA 3HSRA 4U7DA 2K4JA 1CAUA 5K5OA 1ZG5A 3K9TA 2ELHA 1X82A 5D5XB 3G3ZA 1B9NA 2VN2A 2JZYA 3B73A 4XLPF 1R5GA 2GC2A 3HT2A 4QLCU 2IT0A 1IRGA 1UIJA 3GWZA 3V8KA 4F8AA 2HQNA 4OIRF 2GC3A 2PMUA 1ZVFA 4QGLA 2KJCA 4LJZF 2L02A 4RGRA 3I59A 3GZ5A 3EJKA 1IN4A 3R60A 3V8LA 2QWWA 1EH7A 5ICFA 2YSRA 3WW4A 4P96A 3TDZC 5I0SA 2HJIA 1YUDA 4AVAA 3VHRA 1KU9A 4MHGA 3TOBA 2W84A 1CAUB 3CUQC 2NYXA 4AD9A 3ZP5A 1T2KA 5L3FA 5KHKA 4ZYEA 1X8MA 1J3PA 1Y3TA 1CF7A 1J5YA 2ISYA 5ERIA 3DEUA 4HSLA 5FO5A 1G3WA 4CGZA 1ZH5A 5LGTA 1IXCA 2E1NA 3BY6A 2PAKA 3I59B 2Z33A 3CLPA 2H6BA 5DD4A 2ZMEA 2IXLA 1FLIA 1VJ2A 1OYYA 1IN7A 4IEYA 2FNPA 1JHFA 3MAJA 2FXAA 3R6SA 5A2QK 2BYVE 5LLQA 3BP8A 4G6QA 3SZTA 1JHHA 4HBLA 4LFUA 2MBFA 3GEZA 3EHKA 2PBIA 2UY8A 1GXQA 4Z82A 3TO7A 1HSJA 4RS8A 2XAHA 5HLIA 1JGSA 5F1RA 1TW2A 4HVRA 1CF7B 1VP6A 1CAVA 4Q29A 4BNCA 5I91A 4CDGA 1ZAOA 4UV9A 2Z69A 3P9IA 4YYOA 4U88A 1TQPA 1RC6A 4Z2YA 3MFKA 5FGMA 1J59A 5FB2A 4L18B 4HBNA 3MPBA 2ZMEB 2OA4A 1XGSA 4I01A 1OD5A 2P8TA 5CYVA 4MEYF 4DINB 3WW2A 3GBFA 3ECHA 2XAQA 4IEPA 3FM3A 2XRNA 2FQPA 2RGVA 3EYYA 1U2WA 3ZN0A 3ULQB 4U0YA 2PYTA 1SFNA 3IDBB 1OYWA 2DFIA 3JSOA 4EM0B 5F6FA 5KK1A 1LR5A 3M8EA 4P9UA 5LHIA 1SD5A 3UKNA 4ENNA 1IW7F 4A2UA 1P92A 2DK5A 1IXRC 2P4WA 2MLKA 1FSEA 3E3VA 2O1QA 2PQ8A 4Q0SA 4AIHA 3CL1A 1W4MA 2OZ6A 1LVAA 5LRRA 1FBSA 1YIOA 1IAWA 3WU1B 5KHJA 2OQRA 4IHTA 3DXJF 5I8YA 2XKPA 3LOIA 2IA2A 3FJSA 2J5PA 4EJOA 3H1MA 4M6YA 4IPAA 5LBQA 5BV6A 4WWCA 1I27A 3CO7C 2FBHA 3IKTA 1Q5OA 4OIQF 3I71A 1MDMA 1ZRRA 5ILSA 4KNYA 1NHAA 4IEQA 2R7FA 2DPUA 4A0XA 1BI0A 1AOYA 3PQKA 4M73A 1F4KA 5FLIA 4ESFA 1R36A 1W7PD 2QYOA 5ILUA 4CICA 2O8QA 4LUKA 1ZGJA 3Q9VA 2WV0A 3KZYA 4MGIE 4I02A 1BBYA 1FBUA 4RAYA 3LAJA 3EO6A 3KETA 2IXKA 2HGCA 2FNAA 2OYZA 2ZBKA 3CUQA 3UKTA 2VECA 2EA7A 3T8TA 3I7DA 4ZZLA 1DGRA 4E2GA 5C6CA 1NYWA 2HYGD 1K7AA 1RNLA 5T3NA 3F6VA 1QQIA 5HLHA 2XIGA 2FEZA 1ZZ7A 3OGJA 3KEOA 1XRUA 5HS9A 1MDMB 3IDCB 5FLJA 2EAAA 1B1BA 2IJLA 4GCVA 3IWZA 1B4AA 1BI2A 3GUDA 2YPRA 2ZJ2A 2P7CB 2CAUA 1G3TA 3MQ0A 3VOEA 4ESJA 1KYZA 2Q0OA 5CVUA 2NRAC 4M72A 2K86A 1LDKB 4ON0A 3T5XA 1OPCA 3CUQB 1Z9CA 2B8MA 1XN7A 2DCTA 3JW4A 2VT3A 3BJOA 4MGRA 5K5RA 3KP3A 1G4DA 3WE2A 1ZN2A 1KQ9A 4ZU5A 1ZZ9A 1IN8A 1F9NA 1FYLA 4L9NA 4CXFA 2ZKZA 2G9WA 1REPC 1CAXB 2XAFA 1H0MA 4XF4A 3M70A
chains in the Genus database with same CATH superfamily
4MQVA 4I76A 4NQWA 2L7FP 4F92B 3GCMA 2AENA 5D8LB 4IQPA 4FT8A 4O65A 5J1XA 2F5EA 2JE7A 1AR91 2ZHMA 2A6EF 4M3BA 4P1WA 2LREA 4ESBA 3PUFA 3S3MA 2IW5A 2PXJA 3I54A 5FKOA 2KXLA 4HMZA 1VQPI 4A6DA 5I0DA 5EV7A 2R7QA 5GLWA 3L7WA 1V5GA 1FZPB 1ZR2A 1W5TA 2Z1DA 2R49A 3IAQA 5LFAA 5FZ6A 2E1MB 3VYUB 1XU2A 1XBFA 4AW7A 3HNMA 1ORKA 3BJ6A 3BPVA 1AXYA 1YO5C 4MGYE 4TLFA 1JYWA 1W99A 2HNHA 2FDHA 1FOYA 2GN7A 5DS9A 5IP6A 2WZPP 2XUEA 1W7PA 3VHOA 1FX5A 1QHDA 1YQCA 1J75A 1QHHD 2C26A 3ACFA 3K69A 1ASJ1 5HDGA 2C9AA 3KGLA 1B9MA 3U9GA 5K5QA 1KYWA 2EA4A 3EUHA 4PUSA 2WNEA 1F4HA 1KS4A 1UOFA 2XJSA 3N9LA 1R1VA 1V54H 1JH5A 5C44J 4M9XA 5HV4A 4LKSA 1C8M3 3KVBA 2D7FA 1N77A 4I3PA 3FBNB 4KMFA 1FTZA 3R61A 3N7JA 3MUZ1 1BMV1 4IHSA 5B4XA 2DYSH 2R043 5CKQA 2QQ9A 3DF0A 3J4UH 2C6SA 4YGCA 1R1A1 2Y38A 2E9QA 1WBLA 1ETYA 3RZGA 1O6UA 4ES8A 2ZKNA 2P0WA 2WY7Q 2OIIA 3F6OA 4BQ4A 3VHPA 4WXCA 1R00A 2WR9A 2VM9A 1KU2A 2PN6A 4I0WB 3CD6I 1VBA2 4QU2A 5ACA1 4N9HA 1JTZX 2VQLA 2JWPA 4L5JA 2CV6A 2NS7A 4XFBA 2JUCA 4NPRA 2VBXA 4N90A 2WC2A 3VYRB 3CCVI 3B7MA 5IFPA 1TT5B 2QQWA 1VBC3 2LP0A 2KPMA 2PHLA 1WA4A 5FOBB 4LO8A 3AMHA 2DW4A 4FXGB 1APNA 1IS5A 1AVBA 3K2OA 2DCEA 1UOJA 1EJ9A 4UFIA 2OAZA 3FFQA 1YRZA 2AHQA 2GZWA 3GHMA 1V6IA 2FA5A 1JXNA 3K4ZA 2C9KA 4XTMA 3ZLIA 2L01A 2Y6HA 3DPUA 4QSHA 3QH7A 2YFUA 3WHBA 4CEWB 3PFIA 3VZMA 2VCMA 5E1WA 4Y1VA 1RHI1 3C3WA 2R7TA 2ZHNA 1Z0HA 2W3JA 1X19A 1ZG3A 1UKRA 2TUNA 1R1ZA 2HWVA 1U12A 1BCXA 3N36A 3FF5A 2LRPA 1JYVA 5FZLA 3V0AA 1T38A 4KGGA 2ZNZA 4X6RB 4NIAA 4PJ0C 1EV7A 2K9LA 2AO9A 1OJLA 4C3HJ 1SBDA 2ECCA 3NL1A 4LORA 3FXJA 2ZOEB 4ZZ8A 2B42B 2ZFWA 3VDDC 5LEKA 3GFJA 1ND3A 5GAGJ 2HU9A 2GA1A 1I5PA 2ZEXA 2P5KA 5KXDA 5LD2C 3HKZA 2LROA 3K1NA 4YW5A 4JK1X 2J1AA 3ISPA 1W8NA 1V5EA 4ZDPA 1YLFA 4BYYA 2B39A 1DU3D 2ENRA 4MSVA 2W5FA 3ES1A 4M71A 3I2IA 1KEXA 3PMSA 2LUWA 4MUVA 3M9AA 3OV8A 3OYLA 5FPLA 2P17A 3WNKA 4BB3A 2HR3A 1WD4A 3V65A 1RUE1 4JVAA 3PUBA 3IKVA 5F08A 1Y56A 4G8XA 4O6JA 2AACA 5L7OA 4EZ4A 2ZABA 2MD0A 4Q27A 1F5FA 1O59A 4Y1XA 2ATFA 3RI8A 1EKEA 3GFMA 5K9YA 4LG0A 5L3CA 4QQOA 4I30A 3JQWA 4MGZE 1P4XA 1FOD3 5FXVA 5LASA 1MNEA 1PZ9A 3SFZA 2HDCA 2WWYA 5T52A 1SG3A 1O3RA 3OSFA 4UNOA 3AMNA 4OU0A 3K2AA 2JDPA 2C24A 3O1OA 4BHBA 1DGWA 3LEMA 5DAPA 4NHKA 3BTXA 1UX6A 2CQQA 1QJU3 1LE8A 2ZXIA 1X50A 3EQLF 4DO0A 1T6SA 4RQPC 4XETA 3HRUA 2ZEWA 2AQEA 5FD5A 4XAAA 2ZXWH 5C8CB 2DO7A 4BS9A 1REEA 2JG9B 3W6JB 1OLMA 1WCQA 3CDLA 2YU9J 5D4SA 1TNRA 1WCMJ 1IPKA 3BQZA 2VVFA 4GJYA 1VQ5I 5DCMB 1S0GA 1H88C 2AREA 4P9JA 5L9VA 2LTNA 2WQ4A 4OQ9A 2XV4S 5IVBA 1N25A 5DZFA 4CPBD 1R091 3KSCA 1Y0NA 1O7LA 1C5IA 1CAVB 1JYCA 3H42B 1QEXA 2HWC1 4LBJA 2G19A 3L9FA 2R071 4ZC3A 2VBDA 3ZXLA 4D5CA 2JT1A 3BB6A 1M1EB 1N1YA 1NLRA 4XN3A 3F72A 4OIPF 3GZTB 4K1YA 2VTXJ 5SV5A 3I2GA 2ZSIB 4A3LJ 2RS31 4FBFA 3HRMA 2ISZA 2BP6A 2E5NA 3SEPA 2VQTA 3QYBA 2VZOA 2XAJA 4H14A 4NRMA 3WG1A 4WBBA 4OI1A 1W5CC 1H8TB 3M3OA 3OD4A 1GP6A 4HF0A 4HLYA 3D5LA 1BHGA 2IS1A 1PGW2 3WQBA 3N35A 2EAKA 2BBYA 3OY9A 3AMPA 4Q47A 4LHLA 4D7NA 2RE9A 4LITA 3IN9A 2VT2A 4IVNA 2AEZA 2V9PA 5JR3A 3MWMA 1JOBA 4MZUA 1MBJA 3NAPB 4A41A 3RZZA 3BG6A 1JUPA 5E20A 2A3SA 2CFXA 3HJEA 1C1FA 5J47A 2PA7A 3NJYA 2EQRA 3HEIA 4P00B 2ZX3A 1S7AA 3J7AO 2WS92 1RI7A 1F8VA 1KRIA 2V9KA 2QQUA 4EEFG 2E7WA 1MSEC 1QXJA 3S16J 2VI6A 3GCWA 3ELNA 4MGKE 1RMU2 5CYYA 5A6ZA 4Y26A 1DUXC 5JI9A 2EV0A 2TCTA 2Y0MA 3GZEA 3S17J 4NPLA 1I6XA 1DGRN 3LDBA 3VBHB 2RS52 4DPNA 3FBYA 5KR7A 4GWNA 5LWBA 1QU0A 1XGNA 2XQRA 1U9OA 2HXOA 1DQ2A 4Y13A 1QF3A 1QZZA 3DBLB 2PX9A 2HVRA 3EYIA 2WAQA 4AEKA 4MEXF 3SHFA 1H2MA 5FREA 1NG7A 3HQRA 2EIKH 1K79A 2HQ5A 2PMZN 2HFHA 2X8KA 2D1VA 2Y60A 1R22A 1UNBA 1QOOA 1LFBA 3VBUC 5E8IA 1S5LC 3BOQA 5F0CA 3QPSA 2VZ1A 1NA1C 4Q4X2 3FX3A 3AYAA 4IV3B 1FOXA 2ZGQA 1MMDA 2B63J 2YGMA 4RS5C 3VD7A 1UD1A 5F3EA 2R7XA 4PCRA 2B7EA 1YI9A 5IT9K 2QQMA 4NQWB 2IC1A 2WNUB 1S8NA 1LOGA 4HT1T 5D8AC 3ZFGC 3POWA 2HWB1 3OOXA 4PJLA 1ENSA 2DF7A 2XWJB 1PO13 3W2AA 1HJFA 2FZ1A 2PLV3 1H9GA 3BCAA 4XKVA 5IWFA 3LSHA 5T55A 3B00A 2DUQA 1YYNA 2P6TA 1GOFA 4WXHA 3M3IA 4Y5TA 1ZRIA 2C1FA 5BPDA 1BEV3 3KWVA 1AUYA 2R1DA 3OEBA 4AAXA 2HWF3 1ZG1A 2CW7A 4ENJA 3BR1A 4XOTA 1F36A 1WJBA 4KMQA 1LB2A 4AR2A 1S2EA 3RZMA 3HRSA 2Y6FA 3BTJA 2BY0A 3UGHA 1S0EA 3J7NA 1W7PB 2J22A 3GM8A 4RGUA 4LBMA 4R9CA 2Y30A 3A1YA 2A5WA 1UB9A 1K45A 3ZQHA 3L00A 5IVEA 1WCSA 2O03A 3LSKA 3CQZJ 1DGRM 4FPKA 4ZJZA 2V9VA 1LU2A 4I99C 1Y9MA 2RM21 3MF9A 4QPGC 5FZIA 1UG2A 3ES4A 3N9NA 2PAMA 2OQGA 4XNFA 3FLPA 4P9YA 1WW7A 3TN93 2ES3A 5FZMA 5FYUA 3J81Z 2W4SA 5K1YA 2QZ8A 3BVCA 4QPYA 1QJX3 2E63A 4RA2A 1V6LA 2W2IA 4EMSA 1BLZA 4R8HA 4LQRA 2QM3A 1Z7UA 4J00A 1SMTA 5M5XJ 3T0DA 1KU7A 4QTRA 3OEAA 2R5ZA 1TWCJ 1YIJI 3QOEA 5A7QA 1O4XA 4BXSV 4BE0A 4P9GA 1K78A 2ZJCA 1WSUA 2Z99A 3WG4A 1W6PB 3GYDA 2YS9A 2DURA 3QU6A 3HEFA 5GPAA 3R0RA 4JX6A 4YG6A 3ATGA 1OBNA 1WMFA 3ZMTA 2HLEA 4S2FA 3HG9A 3P9KA 4YZ3A 1R7JA 5GKAC 5F0HA 1B35C 1UF2C 4XUNA 1OCZH 1J58A 5BNOC 3I5UA 5L3BA 4B7EA 1UPSA 1JYIA 3JRIA 1G8WA 3OPTA 4FVVA 4AC0A 3BDDA 4AVPA 5IOZA 1KONA 4XVHA 1WKYA 2Z5WA 3RNSA 2I45A 2PFBA 5J1RA 1YX3A 2W52A 4HW0A 1MEC2 4AWDA 4DNYA 2B9SA 4PF5A 1K83J 2WY8Q 5FYTA 3USSA 3OR1C 3IWFA 4CYDA 4CCCA 4GDFA 3CMYA 4E7IA 2BERA 1MZBA 3RPQA 5FFZA 2ZO4A 1R6RA 2VVEA 4RL7A 4FP2A 2ETHA 3LNQA 1QJU1 4ENMA 5FZBA 4I3GA 1U5IA 2F4IA 2VNVA 3HRTA 4AHWA 3I49A 3KHBA 2F4PA 2LF8A 4LB5A 2X53S 3J26N 3CJIB 1BM9A 4OHXA 2OF7A 1JTXA 1IV6A 1QIQA 1YC61 2X0LA 4YPJA 1LODA 3VD4A 5L3DA 1O3QA 1AR83 5ICEA 3W20A 1MQTA 2WZEA 5CADA 1RUI3 3V0AB 4XFCA 3PL0A 3VD9A 4ZXEA 3G71I 2VAUA 1GVJA 4LLLA 4CP2A 2K9QA 1H1MA 1CQTA 4LK7A 4WXDA 2CV1A 1QJY2 4YG0A 1KGSA 2R5YA 2OCCH 1CVNA 4A3ZA 3H1WA 1GT0C 1WPKA 4QD2A 4Q0QA 5T50A 3SQNA 3NMBA 5IJRA 1R1UA 4EM1A 4KA4A 1W06A 3FK7A 1S2KA 4XOGA 5FJ8J 2UZKA 1VQ4I 4XRFA 4P08A 3O1VA 4XQFA 4I7HA 1KXGA 2CWMA 1AL23 2RMU2 4B3NA 4D0QA 4WVWA 5C3QA 1A8DA 1UIKA 3ZPLA 4S2GA 2OJED 1ZZ6A 5KWRA 4KT6A 1MJAA 3FXRA 4GRIA 1XDUA 5L7OB 2JPCA 1RUJ3 4OI0A 1Y9GA 4IXAA 1U5TC 1W0OA 2GU9A 1OCOH 1D8KA 3M8LA 3ROUA 4E70A 2VMIA 2ZGMA 4LG0B 1GZWB 2XF5A 4BIOA 1S6LA 3KQ4B 2ADUA 1PGSA 3Q0WA 5AIPA 1UHMA 3G7DA 3VDCA 1NK2P 2VMFA 4QPWA 4OCTA 5DQ0A 3J8F3 1A6QA 3K3OA 1W9SA 4YW4A 4DYRA 4GZ9A 5DUIA 2E1MC 2R92J 3KB5A 4QHOA 2Y75A 1XE7A 1MIJA 5FYYA 2DJNA 2A61A 3E5QA 2HYJA 3ELKA 3ZQ7A 4NR1A 1I50J 2X05A 2F5DA 3EBRA 2YU2A 1RUH3 5DCFA 4A3EJ 1XSDA 2BFUS 1UYPA 1OUSA 4XF1A 1DQUA 3DN7A 1R64A 1OISA 4Z6YA 1BKZA 2KIMA 1X1PA 4M00A 3BZ6A 4XSZF 1YX5A 3NV4A 3L2YA 1GNYA 1VBD2 4I98B 2ETEA 3PVOA 5CVRA 1AZDA 1XNAA 2J1SA 2Q8OA 1ON1A 2V1UA 1J9IA 3AG4H 2EFQA 4CDUB 4AEJA 1PNFA 3LSRA 1T98A 4NAMA 3BIEA 4HOOA 2Z4FA 2W47A 2DA3A 4FOYA 2WKKA 1FI2A 2FMLA 4AIJA 3ZRGA 2VW0A 1LDJA 2W7NA 1UCXA 3EDPA 2EXKA 3OYAA 4LHSA 5CQGA 1YQAA 1STMA 3HSEA 3L2RA 5KHIA 1OD3A 3U4SA 2W24A 5K0UB 2DA2A 1Z7S2 2OUHA 4RM2A 1X33A 1GKBA 1DQ6A 1A34A 3ZDSA 2KDOA 1VQ7I 3POBA 4XBNA 4D9JA 2LBFB 4Q2FA 4LGWA 3K48A 1IS3A 5L36A 2FBIA 3DYOA 1DPUA 2ORZA 3WU0A 2Q8KA 4PGHA 3OUIA 1JU3A 1VQ9I 1QPMA 4Q1PA 2DN0A 4PZJA 3WGHA 3WP5A 5HPOA 1LTEA 1JKOC 2EB7A 2HZDA 1AF9A 4IGQA 4CUBA 1RRJA 5HXMA 3OY8A 4M01A 4KT5C 3OD0A 2MD5A 1ZLKA 5E3LA 3HOSA 2VQ0A 1EH8A 4KYWA 1QY4A 3AFHA 3MKYB 3PL8A 3IIIA 3JRGA 1PHMA 1UY2A 3I8TA 1VTNC 4O61A 1X9TA 2W08A 4OAYA 3JD73 2A5YB 4GULA 4NC8A 1GXPA 3PUAA 4XQ4A 4J01A 1P6RA 1BEV1 4QHZA 4A7KA 3CDIA 3WCSA 1CZVA 2HWF1 1FV3A 1W8HA 4K8FA 3DP7A 1FBQA 3K70C 4K7JA 4QQLA 1FOKA 5J40A 3ZYHA 3HVDA 4GB32 4MVTA 2YZ4A 1YRNB 2VE9A 3IBMA 2VC9A 2RV8A 4AQ2A 2JA2A 3S57A 3WTZA 2V1NA 4IUGA 3I2KA 2ZCWA 5EYYA 4KUMA 3DKYA 5FXXA 3VZNA 1YS7A 1AXKA 3HGYA 1NG0A 1Y8RB 3HB9A 4EGYA 5JSOA 2EINH 3O14A 3POFA 4LA3A 2W85A 1TQIA 3ZFEA 1LEBA 1YW7A 3K4NA 1CJDA 3TN91 2VOOA 2GP5A 3BU7A 1Z3YA 1W6QA 3KV4A 5IAXA 2XB5A 3OYEA 1E3OC 1QJX1 2LDUA 1RIOH 2SBAA 3GGLA 4FFHA 1SVOA 3DU5A 1UY4A 3SZGA 2ERFA 5DM6F 1WGPA 2W94A 4IETA 3KMHA 4CUCA 5EEAA 2W48A 4CU6A 4IZZA 5LBFA 4HPKA 4JGYA 2XBO3 2E7AA 2ET7A 1WMXA 1O5LA 2Y0SA 5JAXA 5HLGA 3BR3A 3LA7A 4UUSA 4LTAA 4KI5M 2WO1A 3N3HA 5FPXA 4JTOA 4PQ9A 2RNGA 3AKRA 2DCZA 2QZ2A 3MW3A 3WF0A 4ZONA 5J36A 3KP6A 3VBOA 3C18A 4MO7A 3WNXA 5B66C 2R16A 2V6CA 1F9KA 3MBWA 4XSXF 1ODNA 5IW0A 4QDQA 5FYMA 3CEWA 4XHBA 4YZ2A 1HQNA 5F5IA 2MPFA 4LR4A 3Q9OA 4L97A 2VW1A 3GBGA 3T09A 2W68A 1CN1A 3GALA 4QT6A 4RR3A 1UAAA 4DUWA 4XLAA 3JRBA 3K1MA 5IHRA 3DL3A 1FPQA 3BTLA 5IYBJ 1JE8A 1Y0UA 5I0TA 3OL3A 3A01A 3GMEA 3V56A 2VBBA 3TNPB 2PJPA 3AB0A 2A6TA 4DEVA 2FDKA 1QQP3 3GTOJ 2PHFA 1QOSA 3HOTA 3ABUA 3ZYJB 4XR6A 2JG9C 1F2NA 1GBGA 4LIVA 9ANTA 3AP4A 4YGBA 2KHMA 2XPWA 2ZMEC 5L9RA 3FXLA 5IATA 2F4MB 3PUIA 3K7AJ 1JW6A 3RJPA 1OH4A 4WVMB 1BOAA 1Q56A 2DOEA 4KN7X 1AR81 5DYMA 4PIZA 2JJ6A 4H4KC 1WI3A 1RUI1 2HBUA 1HKSA 1SDWA 4L5IA 4BLIA 3Q8CA 1EH6A 3KP4A 1OOPA 5A3PA 4NIIA 2IEKA 2O6GE 1UMZA 3MICA 1MS9A 3VDBA 1Q3EA 3BZKA 1GV9A 1UZVA 3A0BC 3ZN4A 2R5ZB 3FLTA 4QKFA 4HFSA 4XDQA 3HN1A 5FD6A 3LKJA 1K78B 3WT3A 4PDWC 1E57A 1NE6A 4KICA 4XCBA 1XQNA 4FP3A 3V4GA 1TLHB 5C4XJ 5FUPA 1AL21 3NNJA 4G9YA 2E36A 2JQ7A 4C2TA 5C5UA 3BALA 4XEZA 2DK8A 4XUTA 1QNTA 4JBAA 5FZAA 1SLAA 4XL9A 3HD8B 5C3EJ 2RKHA 4OULA 3GX4X 1W05A 2MW8A 1RUJ1 1KU3A 1YJNI 1FMD2 1YO8A 2MEV1 4YG2F 1XJAA 3WTVC 5BOXA 1IRFA 4Y4RA 1H8TC 5JI6A 3BT9A 2O0YA 1RUF3 3LZZA 4URAA 4JGZA 2F6BA 3RTRA 4Y17A 4KG0A 5AC92 2IP2A 3JCUC 2DCKA 1HRV3 5IK8A 5EIYB 2IXSA 2KZVA 3G3ZA 2VN2A 4HXCA 1R5GA 2GC2A 5CFDC 4C0HA 3GWZA 1H6XA 4F8AA 2HQNA 5HODA 3J8F1 4XQWA 2E34A 4LO5B 2KJCA 4LJZF 4RGRA 3JUUA 2HPIA 2JDHA 1VQ8I 2A70A 2M7AA 3R60A 2QWWA 4XQDA 1GSLA 4Y5SA 3N9MA 5A80A 2D6OX 4P96A 1RUH1 3TDZC 1HLCA 5I0SA 2HJIA 3ZYBA 3AM2A 4AVAA 2WO2A 3VHRA 1KU9A 4MHGA 3TOBA 3KQRA 3VBRA 3D5SC 4ZYEA 1X8MA 4ZZ5A 1CF7A 1OCRH 4N43B 4DBQA 3MIGA 3CHXA 2HYKA 2RVAA 3DEUA 2VCAA 2K2SA 4CGZA 1ZH5A 2M7BA 3I59B 3VBHC 3KZ4C 2H6BA 5FFOC 5DD4A 3H9QA 2R5YB 1OYYA 1Y1VJ 1FPN3 3T4VA 3HBKA 4XUPA 4FXKB 4CXYA 2JA7J 2KM2A 1RUC2 4P5HA 4BE2A 4G6QA 4UFLA 4DEQA 3GEZA 3RZDJ 2PBIA 2UY8A 3BUCA 1G2HA 4Z82A 3TO7A 1HSJA 2XAHA 1JGSA 1TW2A 4HVRA 2EIEA 3AKPA 2M3AA 3BKZA 2XB6C 3NQHA 3P9IA 1LESA 4U88A 4URTA 3OGVA 3MFKA 1RUG2 4CCEA 3VPRA 4L18B 3PSFA 1PVC2 1C3HA 4HSTA 1ND2A 1XGSA 4I01A 3ECHA 5CIRA 4IEPA 2RGVA 3EYYA 3B69A 3ULQB 1QH6A 4XDPA 1KQRA 4BDZA 3AZYA 4RSUA 4MOAA 5F6FA 5KK1A 3M8EA 4XJAA 4NC7A 2EILH 2DK5A 4MYEA 3E3VA 5A1AA 1XYPA 1G86A 3JD71 1VFCA 3BCBA 2VOTA 1LVAA 5CFCA 2R7EB 3HC7A 2NP0A 5T5JA 4JAAA 1WWYA 2JECA 2IVIB 4FOVA 2O7OA 3DXJF 2CL2A 2DOFA 3I97A 3TRSB 2WFF2 2VCCA 1W8ZA 4M6YA 3WU2C 2ZAAA 3S15J 3C7GA 5LBQA 5BV6A 2WSVA 3MW2A 3CO7C 1IPSA 1DP3A 3OIPA 2P3YA 1CZSA 4R4XA 2ZGNA 1NHAA 2DPUA 1AOYA 4C90A 1F4KA 3DEWA 3W5MA 1W7PD 5DG1A 1HJGA 2K3FA 4CICA 3M3YJ 2NPIA 2O8QA 1SAUA 4BEHA 2L9NA 3KZYA 4C3JJ 1FBUA 3EUHC 1N1TA 3EO6A 5E79C 1TMF1 2IXKA 3CESA 4NHXA 1HRI1 2KD7A 2OYZA 5CAZA 2IZWA 2ZBKA 3LEGA 3CUQA 3TWIA 3VSKA 3T8TA 4ZZLA 1XOYA 3HPNA 3GLLA 5FZ0A 4IXLA 3F6VA 3WDWA 3VL8A 1ZZ7A 3KEOA 3K4MA 2EIGA 1F43A 1MDMB 2X6XA 5GZEA 5CKTA 4HK8A 4GCVA 2XBO1 4F91B 1XPXA 1XE0A 4I6ZA 3GUDA 1AX0A 4BQNA 1ZTRA 2YPRA 2WZR1 2P7CB 1QVUA 1V00A 4MXWA 4UAPA 3VOEA 2Q0OA 2M34A 3ZQFA 3WF1A 2K86A 3WNMA 2I8DA 4ON0A 3T5XA 1OPCA 5C4WB 4YVSB 3JW4A 5K5RA 1JZ2A 2DMPA 3WE2A 2DV9A 1EF4A 4WM7B 1IN8A 3H0OA 5A33A 1F9NA 4CXFA 3PO3J 2WBKA 3NNFA 4Y5Z0 2HEYF 2C4XA 1LCLA 4PBOA 2PJRB 5FY1A 3UJOA 3WW2A 3JCIA 3DLAA 2R062 1SBEA 1BN5A 2A75A 2D40A 3IH2A 4AAPA 2EXHA 4CUGA 3K46A 2B45X 3W6VA 5GZCA 4OINF 3KP2A 1KFXL 1WJEA 2JXAA 2AQFA 1FYMA 1ACCA 3GXOA 1SFXA 3LOBA 4DXTA 1EAH1 4YM3A 2EFWA 2VL8A 1OKRA 5GZGA 3ZIWA 2KFDA 4LLFA 4YM0A 3PTRB 4FPHA 1REFA 1AR62 1SANA 4OQ8A 5J8FA 4GXOA 3A02A 4P5OA 3P7NA 4S2HA 3V7SA 2QKMB 2CDOA 1FOD2 3OGGA 2VKHA 1FC3A 5E18F 4NWVA 1DP0A 1CAWB 4Q4V2 4OFGA 4QPIA 5IUQA 3V0BA 4H7LA 4PK4A 1W3VA 5FIXA 4YZ4A 1X8EA 5J98B 1XE8A 4LKFA 1GQHA 4Y15A 2WNOA 2ZGPA 1IUYA 1PDNC 2ZGRA 2FDJA 2AZ5A 2QFEA 1ZHFA 1BW6A 1W6QB 3SCHA 2ELKA 2QE3A 2HI3A 2M8EA 4P9WA 2P5VA 1ND3C 2R7UA 3S6PA 3FHZA 2EF6A 3ZIXA 4YW6A 2VD7A 2HZTA 3HTSB 1GV2A 2N8GA 5FFXA 1B59A 2ICWG 4PJMA 4JGYB 3WNOA 1POV3 3IDAA 2VMEA 4S0HB 3QPTA 2VODA 3FZVA 4UUTA 3JTGA 2QQVA 2EALA 4JQTA 3DXTA 2X6WA 4EJUA 3ASOH 2RR12 3J81K 1EV12 3OPZA 2FCVA 3Q8BA 2X1CA 1ENXA 1WLTA 3C2UA 1MS3A 5FY5A 2LMDA 3H9JA 4KGQA 2GOXB 2WQ8A 3VBOB 4B1LA 5L7OC 1MJBA 1S0CA 3H7JA 4XDOA 4PI0A 4KWUA 5EPAA 1ZBE3 1COV1 1YQ6A 1RYYA 4LKEA 5GJ6A 1VIWB 5L3EA 2AGSA 4AVTA 2WSUA 1VB2A 1DGLA 2CV0A 1LRHA 1PP8F 1HRV1 2G1MA 3OS1A 4ETSA 2J1VA 4Z07A 3OS2A 2ILMA 3DUIA 1AJOA 2PG4A 4RR3B 1OQDA 2W25A 2VMDA 1UYXA 3X2QH 3N9OA 3E6MA 1IG7A 2VMHA 2O8OA 4HG2A 5GTHC 4PFOA 1X4OA 1YITI 4AXOA 3JBG1 2EZLA 2VQAA 2A3WA 5K7FA 2ESNA 2TNFA 2B7YA 3ZX7A 2DU1A 2R7SA 4ZXKA 4BQ1A 4IOAF 4XYXA 1IGNA 3GLXA 3S8PA 3NKTA 1Q8QA 4RBOA 4FQGA 4KIBA 5HI0A 2NXNB 4HKWA 5FLXZ 3R4KA 5AFBA 4P9XA 3N9PA 4E7JA 4CVUA 5L9BA 2LKPA 3COAC 4X1EA 1DZRA 2QBYA 4L9VA 1G9AA 3CZUA 3TAYA 4QGNA 2EH3A 5LHHA 3WTXC 2H09A 3VYTB 3BN6A 5FZFA 5LGNA 4DB5A 5D5WB 5ILVA 4AG4A 4B48A 4COVA 4H3WA 1CPMA 1IOAA 2IPQX 5A3UA 1SVMA 4MADA 4EN7B 2VC1A 2YMZA 1XMXA 5D6EA 2VJJA 4EM2A 4AI2A 1MVEA 2BFUL 4ZS3A 4QHBA 4LXLA 4XFIA 2JSCA 4O3MA 4WM8A 3HN3A 2PQQA 3VSLA 3K4DA 4CEYA 1XCVA 3P1IA 2Q4SA 2XUBA 4N53A 1CX1A 5CA6A 1P2FA 4L5EA 4EJVA 3SXYA 4AI3A 2RS53 4JGZB 3T2TA 3LA3A 4Y20B 1NCQA 1R5HA 3OR2C 1QNYA 3J7AY 4CTEA 1BA5A 4MGQA 2VC0A 1DF0A 4NBQA 1XCBA 4FX4A 1ITYA 4LEJA 4RGXA 5IYCJ 2FMDA 4A0ZA 1GFF2 4DQ2A 1YE9A 2NS0A 1JZ6A 4YM1A 4X8NA 1OR7A 4F52A 2X5IA 3AX4A 2GIZA 2D93A 4Q4X3 3UNPA 3O0VA 2RNJA 4IO9F 1PO12 3LSPA 3W58A 5IK4A 2BJSA 1NX9A 1GMMA 5JXGA 2L3DA 1VBA1 3GTPJ 4HF1A 3GZAA 1W2NA 3VBRB 2ZGUA 5I8SA 5J37A 4JHZA 4Q4W1 2DXIA 1PVXA 1C8NA 2Y6JA 3GHNA 4LBLA 5L19A 1R58A 3ZSKA 1MZ6A 3TGNA 4BPZA 3G1MA 2RN7A 4WK8F 5A32B 1RGSA 5E3NA 3J9SA 2QCOA 3UV9A 2LNBA 2BVMA 1Z6RA 3PQJA 2XHNA 4EQQA 5FPZA 1A5JA 3ME2A 4Y7NJ 1UZ0A 3MV01 5B1BH 2CU5A 4ES9A 3L2WA 5JHFA 4N0BA 2UURA 5H6RA 3KCYA 2W82A 5F64A 5DAXA 1XXNA 1ONAA 1OFCX 4DIQA 3UGFA 5EQUA 3QP5A 4AZZA 4FFIA 4Q4ZF 2CUFA 5FBZA 1PUEE 5HCAA 2GN3A 1TE1B 5JXIA 3ERMA 5JMOA 4NIDA 1ZZBA 3HM5A 5IOYA 2YV8A 5FZ1A 3H36A 4M3CE 3AXEA 2FD5A 5DXDA 2PHTA 4Y4YA 3K75B 1QKQA 3ZXDA 1W0TA 5DABA 2PN5A 1EY2A 3MFAA 5FQ0B 3ONQA 4NHJA 4WVVA 5CFCB 4EV0A 2IGKA 1PM4A 2QQNA 2JD4A 5FKKA 1ZA7A 4OOIA 2BOJA 5IYYA 5TSWA 3HOVJ 4CU7A 2NNNA 2JA8J 3KFWX 1K12A 2K40A 3ZMVA 4XLNF 3PMEA 5JVGF 4G94A 1SAXA 2HEVF 4D7SA 2Y26A 2M9HA 2AH2A 1TWHJ 1RZ4A 1DQ5A 5FO7B 1CIWA 4BIFA 1SCRA 2A3YA 4P55A 4CA0A 3OIQA 1PJRA 4XMYA 1APLC 1Z21A 3IIAA 4Q0PA 2UYBA 1V9U1 4BEHB 5ACA2 2CUJA 4LBQA 2LKXA 1MEC3 2NAZA 1GZ9A 3M4FA 3DEMA 5JDBA 2VPVA 1PNGA 2VQCA 1REDA 2DVFA 2GC0A 3SXWA 2Q1ZB 1ZA4A 3AZVA 1JTYA 2VKDA 5GM0A 3S5QA 3RRDA 1JYNA 5EJ3A 1TNSA 4AM3A 5FRAA 3M8JA 2M1BA 2VZVA 4AF9A 4XURA 4AVCA 5F8PA 1POV1 1IKPA 4V2VA 4BDVB 2OCEA 3M7GA 1U78A 2PHUA 4GWMA 1LNWA 2GMMA 4BQQA 4BJ6C 1LJ9A 1QH7A 1GLNA 2G9GA 4MXWB 4YW7A 1UOGA 2BZDA 2C6YA 1GV5A 4CCMA 3S32A 5F3IA 3ZKUA 3MPPG 3Q9SA 2K46A 2IGNA 2GH8A 3VKOA 2RDQA 1VQLI 2D6KA 4RFT0 2XG3A 3K4JA 1GNZA 1W90A 5K8SA 3F8BA 1RHI2 5DG2A 2NVYJ 1YHFA 4KWJA 5A33B 2A73B 4EJWA 1DQ4A 2V1XA 4HAMA 4RAZA 5LATA 3U1XA 3TEXA 1YOVB 1I9RA 2OD5A 5A3NA 4S05A 1AWCA 3DTEA 4INDA 2J1TA 5FUIA 3DTIA 5H6QA 4XE9A 1FP1D 4BQWA 1V6NA 4M3CA 4E7SA 4LT5A 1TZOA 2BXZA 2DTZA 4CYCB 1RIRA 4GH4A 4ZDLA 1KQ8A 2DT7B 3ZSJA 2STWA 1YI7A 2RDNA 2QA4I 3J80Z 2BU9A 5M3MJ 2JENA 2DQRA 3ZR8X 1E2XA 2GMEA 1LECA 5CJ9A 2Z9OA 4BHCA 3U10A 3AG1H 1CESA 4KU8A 2VBYA 3WZ1A 4MG2A 1HN1A 4L2NA 5KAFC 4RD7A 3B5LB 5F3GA 1UYYA 1MQTC 1RUE2 1LKNA 1NY71 4M3GA 3TW7A 5F5QA 3NNLA 4BH9A 1LQ1A 3ZVXA 1PGW1 2WJSA 4U7BA 3FL7A 2D3PA 1OURA 3PVNA 2NLRA 2MFZA 3H3VK 2VZTA 3MF6A 5LA0A 5CU1A 3HSFA 3H8OA 1IKQA 1J3RA 4QXKA 3SH3A 5C9AA 5JLWA 2DVBA 5FP9A 3TQNA 3OYBA 4D6RA 2NNYA 5HNHA 1W04A 4QGMA 3P3NA 3SKJE 2RHPA 3DPRB 5KBFA 4TV7A 2DBNA 3SH5A 4YIRX 1LU1A 4ASMB 3S1QJ 4XORA 4E6KG 1X2NA 2XASA 3PJRA 1HOMA 4QX3A 5KHHA 5FMCA 4F93B 4Z92B 3IB3A 2WS91 3OBAA 4AK3A 4QWQA 4CDWA 1ERDA 4CZCA 4Q48A 4NWWA 1FTTA 3KX2A 1VBD3 4XLCA 4HNUA 2DA1A 1RMU1 5CBLA 2ME6A 2E2IJ 3ZXSA 3VN4A 5DAVA 3V8JA 3Q8EA 5EG0B 3ZN5A 4PQQA 4IEUA 1XB4A 4XK4A 2WLQA 2HYFA 2M30A 2RVCA 5JSPA 2K0GA 3ZYPA 1PMIA 3T4HB 1OI6A 2ZB9A 1ULYA 2D6PA 3VBSA 3CF6E 2DA7A 1SPPB 2RV9A 3E5UA 4YNIA 3POJA 1OQ1A 4IJAA 5FP7A 1ETVA 4GD4A 2CUEA 1PIV1 3V64A 3N4MA 1Z7S3 2QQ8A 4OI4A 1OUXA 2KRFA 5A6YA 3KHCA 4CO8A 1W2AX 2L9LA 1ZX5A 3TBDA 2HWC2 2QQBA 5F1JA 3A0HC 2LS6A 2AXLA 3J7MA 4HVQA 4FQ4A 5A7NA 2QSHX 5FKNA 4A3JJ 4LPLA 1T0FA 4QX0A 4BQ5A 1KDMA 2ZXJA 2ZNYA 2L5QA 4Y33A 1LKXA 2E32A 5BXXA 1UZZA 4I2OA 3ZMZA 5BNNA 1QGLA 4MGSA 1FX7A 1K5MA 1NA1B 5DMYA 2DPDA 3EXUA 4AHZA 3ILNA 3W2VA 3ZN1A 4P9FA 2VTFA 2FDFA 3LOCA 3ASNH 5DDJ2 4H2AA 4U2AA 2QBYB 4P9LA 4CDQA 4KH9A 2OQ6A 3VZKA 3HUGA 3OSGA 4TN7A 5TJJA 1ETWA 4RHV1 3JR9A 1O3SA 3S7EA 1FNYA 2FQ4A 2BW3A 3IH3A 3OYWA 5E1ZB 2H6CA 3H5AA 4GB33 3QODA 1XNDA 1HW5A 3EETA 1ALYA 1W6NA 4YLZA 4PDKA 2CDPA 3N97A 4AI1A 5KAIC 2ID6A 1S9HA 1HQCA 4XFGA 3RVHA 4BQAA 1J2XA 2YC2A 3LWFA 1PX3A 5C4WC 1QU3A 2OT7A 4N53B 3UYJA 4HV5A 3FLRA 2XF6A 5DV5A 2LD5A 3RGBA 3BG9A 3BYWA 1W6MB 3WR0A 1XSXA 1Z78A 5FYIA 3UK9A 1WLCA 1I1SA 1NCQB 1QJEA 2V7FA 2XGCA 4IV1B 4FTBA 5FTTC 4IRIA 4S2DA 3HMYA 3WHTA 1YJKA 1W39A 1OA3A 2IFRA 2VCBA 3I3BA 2KDZA 1OT5A 4W1UA 1CPNA 4YRVA 3H7YA 4W6XA 3VBFA 4RGKA 4IEWA 3PNAA 2VE1A 5KXEA 1IQAA 1L7RA 4AFBA 4LOTA 1SD6A 2E7TA 4IHYA 2Y64A 1ZARA 4GQ7A 2CQNA 2O14A 4ZYHA 5KC5A 4UI9L 3ZFEC 2P6SA 4EGZA 2DCYA 5H9PA 3NV3A 2HWB2 2XJUA 2Q5TA 1QQP2 2BNNA 2Y0OA 4DY3A 3QBQA 5BNOB 2FZ2A 3HGGA 3BU0A 4QB1A 1OF4A 3QRFF 2VZUA 1IUFA 3UGGA 2WYSA 2BE5F 4AFDA 5EZHA 5DUXA 4G9SB 3RQ0A 2ZBJA 2JKXA 3AJZA 4JGYC 3TOJA 3ZXJA 4Z2WA 4XILA 5FPUA 3CJXA 4P9IA 3T1MA 2JDKA 2ZA9A 2OZJA 3DYPA 4RN5A 2XB0X 4OI2A 4NROA 4AE2A 1JZ7A 2F48A 2PHRA 2HWE3 3S3OA 4Z1VA 4MTDA 4BY1J 3S93A 3VZJA 4KN4X 4TZDA 1UHWA 1Y8QB 4P02B 1VBB2 3ZXEA 1IPJA 3VBOC 4HDUA 4COUA 1R4NB 2VE8A 2DUOA 5C8WA 4LG3A 1FY7A 1HKQA 2H94A 3IPVB 4F7ZA 1QJY1 4E7KA 4DOUA 2RM22 5AONA 1DQ0A 1FWZA 3HNBM 4IW3A 3BR2A 4OAZA 1W28A 2ZGSA 4FFGA 3PM1A 3HT1A 3RZOJ 4LD5A 4RGSA 3JAMZ 2HOEA 1YW9A 4B4QA 4EROA 4RR3C 1K3IA 5E3OA 4HL0A 1CAXA 1UKGA 3SKVA 1UMQA 4DNCA 2JG8A 3OYJA 4MX3A 2RMU1 5DUUA 2RQPA 4BJ5C 3L2UA 1NAEA 4YFZA 3KZIC 5KCMA 2XSDC 2VKEA 3CCMI 1CGPA 5CVVA 1S1AA 3QLQA 1K6YA 3O5SA 4ORFA 3QU3A 4BACA 3RI9A 1FMD3 3IC7A 3PVBB 3CJNA 4EQVA 2CH0A 5H9SA 2DJIA 1U6GA 2XVLA 4M6VA 4CPBA 5AC93 4J19A 4ZU4A 1UX7A 4YRDA 2J5OA 3NJZA 1SD7A 4EJTA 1MBFA 1D4M2 4UF0A 2L4MA 2QJVA 3RDIA 4DW6A 1J1LA 1OOPC 5LBCA 3OPWA 3UKVA 1W2TA 1U5TB 4IEOA 1IS4A 3EUKL 4L8QA 4A3FJ 2KIQA 1UY0A 3AVSA 1XS9A 1V4RA 3FISA 3OYIA 3C7OA 2EPFA 2HBTA 2J1EA 5FCCA 4S04A 3H0GJ 4M3EA 4QB6A 2DOAA 3TKYA 2JB4A 2JVHA 1W0UA 1FPN2 3S0MA 1U0AA 2KRHA 3WE3A 1GU3A 1VBD1 1RJ7A 2AYHA 1LNSA 1B09A 3NV2A 1O7FA 3QOPA 1NLQA 4GGGA 1LOCA 3D5OA 3GTJJ 1OMIA 4K21A 3UESA 1C0WA 4Y24A 5FZOA 1GWMA 2NVQJ 4M9SA 3MYXA 4JGZC 2PMWB 2VY0A 3WD5A 1RUC3 4N4OB 3KLNA 4F3QA 2VB6A 1AHSA 2HVQA 2M5WA 3S2HJ 1VB4A 4M3CB 1IQDC 1Z7S1 4XFFA 2KKOA 3BROA 5H20A 4XJUA 2CQKA 3T0YA 4YFXF 5JUVA 4GXLA 2EICA 2M0CA 1LJ7A 1US3A 4DGWB 3SEQA 1RUG3 5M3FJ 1Z3XA 5F2SA 3CO6C 1U5YA 2IGOA 1SEUA 2AUYA 2MC4A 2E5ZA 2IXCA 5DAQA 3EUAA 3RSNA 2ZJRF 1LDDA 1PVC3 4XACA 4ATEA 1FT9A 4PCQA 4BMEA 1OXCA 1H8VA 3L9JT 1B72A 4JYKA 1UQXA 2B9UA 3VBRC 4FTHA 5JCTA 1ULFA 2XUMA 4HZFA 4NHLA 3VDXA 4HKOA 2CU7A 4J6GA 4HG6B 1GQPA 2WO7A 2O8XA 3JREA 4KBZA 3LSDA 4D94A 2W1OA 4U0WA 4QMAA 1I3HA 4IQJA 2WN2A 3SJMA 4AIKA 2BOLA 4AGGA 1CQ9A 4UFHA 3LB9A 2V4AA 4CP0A 3ZMUA 1GNHA 2WFF3 4COWA 3RQIA 3FBMA 5E17F 1OFNA 1GHCA 5FLXK 1S7EA 5K4LA 4AFAA 4GB31 1MR5A 2EV6A 5GALA 2GNDA 4RA0A 3DWLE 1B8IA 4CDWB 4UVCA 4EVIA 3RYPA 3WTWC 3IHUA 4ITVA 1MBGA 2ESHA 3I3QA 3ECQA 1MVQA 4RB2C 3WQ1A 1OLME 2ZPXA 3O8HA 1ND2C 1JUIA 2YU1A 4PBPA 2D5FA 3GJBA 5D8AA 5FBJA 1AX2A 2LK2A 5FXWA 3ZMNA 4Z8BA 2DA4A 4NIHA 1R71A 4XJ9A 4W97A 3GZ6A 2ACJA 1HXDA 3VKNA 1MNDA 1RXGA 1UW8A 2YYOA 2KR2A 1S2BA 3BPSA 2K27A 4LUMA 2IXIA 5BUVA 2JTVA 4YGEA 2I07B 1NKGA 5FO9B 1HV0A 5GZDA 1LFUP 3TW6A 4A3MJ 3V7CA 5CFCC 2WNVA 2IA0A 3RZHA 3ZMDA 3CC4I 5EGOA 4BGDA 2QVOA 2X85A 3I4PA 2K4JA 1CAUA 4XHXA 4SLIA 4OHWA 2BW8A 5D5XB 2R7WA 4FE7A 4XLPF 2JICA 1X9PA 2QGUA 2XR4A 3OYMA 4CE8A 2FUG2 2PHXA 2YBPA 2BGOA 1TP4A 3WLUA 4H7MA 5EJCA 3JRAA 2VXJA 5JR2A 1ZVFA 2WADA 3JRCA 5DZGA 2VUAA 4RM3A 3WSOA 1DFQA 1IN4A 5ICFA 1K5MB 2CWSA 4QPGA 2R063 4XW3A 1H4HA 1GDTA 4GAZA 2ID3A 3CUQC 3MIDA 4AD9A 2BXYA 1TZLA 3FN9A 4CDQB 5L3FA 4NN0A 1DHKB 1J3PA 1Y3TA 3OMYA 2L9VA 5A7OA 2BV4A 5ERIA 4ET7A 3LFMA 3WOGA 3MD2A 4RLFA 2ZS6B 1POV0 2F4LA 3MHZA 5F6KA 2VGDA 4F3JA 2BW3B 4TYSA 2H1LA 4FPJA 3AMMA 3OYWB 5LGTA 1AR63 3VKLA 3BY6A 3ACHA 2LY1A 2I5UA 2HDDA 1VJ2A 3BR6A 2LC2A 2FNPA 2GOMA 1JHFA 3UR3C 3MAJA 3VZLA 3QYEA 2VZ3A 1HXS3 4Q4V3 3HNYM 3LIHA 4QB2A 1JHHA 1OCPA 3EHKA 1GXQA 1BVVA 2F4OB 1IZ3A 4JRAA 3POIA 5F1RA 3LSEA 3I9V2 1AL0G 5I91A 4CDGA 3AL0B 1ZAOA 4YYOA 2M4GA 2CSGA 5DM7F 3OL4A 5FB2A 1J1TA 1LOFA 2VUJA 1WVRA 2ZMEB 2OA4A 1IDZA 2CYFA 2VIXA 4DQAA 2P8TA 5CYVA 3GBFA 5JOXA 1QJZA 5B5EC 3T2PA 4A3GJ 1D2QA 4RGAA 1DLCA 1DGWX 1SFNA 1OYWA 3JSOA 3L2VA 1ZBE2 2RR13 2DMQA 1EV13 2E33A 2CTVA 2WABA 4ENNA 1MACA 4A2UA 1P92A 2IUWA 4OHYA 1IXRC 2MLKA 1FSEA 3DLLF 3CF5F 4W6YA 1D7PM 3CL1A 2BRTA 4IE6A 2OZ6A 2RG4A 2E51A 5LRRA 4AYBN 1G59A 3HOUJ 4G4FA 1SLTA 2ZMLA 2RDRA 3WU1B 4IX7A 4XC9A 2OQRA 4IHTA 2QQIA 4PDWB 1IG3A 4FCYA 1VBE2 1FMD1 4QPIC 2XKPA 2J5PA 3BZCA 2P37A 5AC91 4QU1A 2FBHA 1NTCA 1UY1A 2X6OA 5A7SA 5D2AA 3I56I 1WMDA 3I71A 1U5XA 1ZRRA 1MH3A 5ILSA 4KNYA 4A0XA 3TEWA 5FLIA 4ESFA 2QYOA 3AMQA 2VJ4A 3OIOA 3K4CA 2BVBA 3MUY1 1TEIA 5HBAA 3PSIA 4C1WA 3EB7A 3AZZA 2HGCA 3DPRC 1OPOA 3OYDA 1I6HJ 2EA7A 3S5AA 3I7DA 1DGRA 4LMFA 1PX4A 2DVAA 2HYGD 1K7AA 4E4HA 3FFZA 4XUQA 5CFDB 1LPQA 1D0YA 3CDZB 2WB1N 4J25A 4BY7J 3ZYGA 4A6OA 3IWZA 1B4AA 1BI2A 5F0FA 1G9DA 2CAUA 3FKJA 1PGL1 2E19A 5A7WB 1X58A 2PMZA 3MQ0A 3H8XA 1I39A 3AP5A 1OA4A 5EZGA 1PMHX 3OBRA 1SFOJ 5CVUA 1U8BA 2NRAC 1XNBA 4L99A 1LDKB 2KQRA 3O1SA 4BLJA 3W21A 2DA5A 4A45A 4E9KA 1EUUA 4PJJA 2YB7A 3ZFFA 3VKFC 1XN7A 3OGSA 1MZ5A 3POGA 3KP3A 4NDLA 1G4DA 4DFSA 1K42A 1ZN2A 1VRBA 1KQ9A 4ZU5A 2G0EA 5C33A 2P3KA 3S14J 1REPC 1CAXB 1JHNA 3IMMA 4V2WA 2DFFA 4QQHA 1H0MA 4XF4A 3M70A 5LZ6A 1C8M1 5EYRA 1L7QA 2VOPA 2JB8A 5FLHA 1R082 3I2HA 3OBZA 2VR4A 2R041 4X8PA 4NHMA 2L9SA 1BQPA 2AC1A 4M74A 1VQ6I 3CLOA 4B09A 2HEWF 4BHPA 4E8CA 2XLGA 3HJRA 3OCPA 5J48A 3MZHA 1QHGA 3MKLA 1XYNA 3NKGA 3MMYB 1NXMA 2ZGKA 4HK9A 4A69C 1G9BA 4FPCA 5FZEA 3J80K 2EV5A 3C8XA 3M4OJ 2MEV2 5KXBA 3CQOA 2XROA 5KXCA 3RG0A 1X7NA 3AP6A 5TGTA 3C7FA 2QQJA 5JLVA 3MIHA 3GXUA 5FZGA 3ABTA 3KYDB 3ZDVA 3O1UA 5BS6A 3GZNB 2GM4A 1JOPA 3FC0A 2WFF1 2KIUA 1QO0D 1VBC1 1VNDA 1YQ5A 3HBLA 1Y6IA 4YIFA 4E4DX 1L7LA 3ECOA 3W6KB 1MS5A 5H2FC 4HX7A 3FWEA 3DYMA 1UJ8A 3SHRA 2X1DA 2DLLA 2HVSA 4D69A 3OYHA 2EA2A 4G12A 1QDOA 1XMAA 2QTWB 1IXSB 1G6NA 1VALA 5C7GA 3I2JA 2DVDA 2UXNA 5HS7A 3QQAA 1A36A 4WM8C 2LALA 3L2CA 3B6AA 4CEYC 4YARA 2A68F 4N53C 2L2OA 2CAVA 3OBTA 5FZOB 5FZKA 3HIFA 1AR93 2XJPA 3GO5A 1PK6A 1KA8A 3WG9A 1S4CA 3T2OA 2ZXHA 4DYQA 1NCQC 1P8JA 2RS12 5KVRA 4CCJA 2DT6A 1HB4A 3T1LA 4IV1C 1B6AA 1G9FA 2FJ1A 4TWTA 3LEKA 1QPIA 1HLVA 3RKYA 2R30A 1Q1HA 2X4HA 3U11A 4D8MA 2K02A 1OR7C 2X5IC 1PZ8A 2CMPA 3JU9A 4QAWA 2AR6A 1TT0A 4NJ4A 4B29A 2A69F 1S0DA 2JRTA 2FRHA 2YU3A 2CGPA 2VQUA 1ZZCA 2O9LA 1XC5A 4CEWA 1ZBA2 1W36C 4RAGA 4LOCA 2M2EA 4E8DA 1B72B 2D3RA 5FYZA 1X4PA 2MYSA 1ZGAA 3THTA 4AEMA 1SLBA 2DT5A 4META 4CUAA 5GLZA 4FPGA 2WYFA 4QQPA 4JKLA 1AYM2 3OTFA 2R7OA 2LSOA 3WVJA 4RB3C 3HDDA 1MSFC 2VQHA 5IVCA 3L2QA 4BISA 2E1CA 1FATA 4W6WA 5A1FA 5ABJA 1HW2A 2WLPA 3W59A 1HDPA 4UVBA 1H0BA 3K0LA 1BI1A 4TXWA 2WWSA 2HOTA 3AL6A 4M0NA 3D5RC 2DYRH 3KV5A 5AVPA 2Y8KA 1XX5A 2V5YA 1IRXA 3CMMA 3TEZA 4ONUA 4LLGF 3JRHA 1D2SA 1LHVA 3VHNA 3WDVA 1S0JA 3W2WA 3K6GA 1HX6A 1FOD1 2J7MA 3SNMA 4QPQA 4B44A 3MCZA 1XU1A 2QEXI 1QJFA 1EP0A 1OKQA 3NNMA 3CNAA 2CQXA 3W9AA 1B8IB 5BMZA 3A2KA 3HOZJ 1UY3A 2XXZA 2G7HA 3ZXKA 3I53A 3TBIA 4AIDA 3NRUA 1SMVA 3L1PA 4XN0A 2ORXA 4PF1A 3NEUA 3LIGA 4ZYGA 4L9BA 5E6HA 4WVZA 5ACA3 3REOA 5GPCA 2NQYA 2KJBA 1MMGA 3SDBA 4UBHA 3T0AA 3GJAA 2O5RA 5FAXA 2VASA 3WNLA 1TQMA 3D3AA 1TWAJ 2W57A 2ECBA 3RYKA 3RJ2X 3AP7A 2NZ9A 4E2QA 1N78A 1M4WA 1WW6A 2WT1A 1W0NA 2PHDA 1TMF2 2ARCA 4HDVA 2ARAA 3QCWA 3SITA 1HRI2 2D1HA 2N7GA 5J3UA 2OA2A 2ZX2A 3A21A 4QX8A 3ZGKA 4NRQA 1VMHA 4EATA 4CSWA 2WNVB 1LHWA 2D98A 4A3CJ 2WT0A 1OYIA 3CCLI 4KBBA 1IN6A 4Q4Y2 1A3KA 1S7OA 1JT0A 1DU6A 1G8XA 5E89A 4MNUA 2FMYA 3H8RA 3MKWB 1BBT2 2UWBA 1ND3B 3GYHX 5LK5A 3USUA 3ZXAC 1RXFA 1QWRA 4MIMA 2ZKLA 1WHUA 3UKGA 2WZR2 1WA6X 3F8NA 5FMOS 1MZEA 1LULA 3GBWA 5C8CA 1RHI3 4YVWA 3F21A 2VZRA 3WTSC 2UWMA 3BR5A 3CCEI 4A3IJ 1O91A 1Z77A 3RI4A 5BY5A 1AKHA 4IE5A 1L3JA 3AYDA 5FYVA 3B3QE 2Q1FA 3CJRB 2XSJC 5DCMA 3A22A 4A5NA 1L0OC 1KITA 3Q8FA 4HLTA 2BDRA 3SCGA 3CZ6A 4KJZA 1ZLJA 1YNAA 1EYBA 2XVKA 4Q0UA 5CEHA 5LA1A 5LEJA 5FYBA 2LM3A 1HA8A 3U4XA 1WJFA 3H3LA 4B4CA 3MKZA 3KCXA 2QQPA 1CD3G 4NPMA 5KHDA 3ZQCA 3KT4A 2XDVA 4ANJA 1Q8PA 1OVPA 4OUEA 5CVJA 1YJWI 5EZWA 1EAH2 2ZTNA 2OPTA 4D6SA 3RPUD 4N8MA 4MV2A 5FZCA 3FXOA 2BNMA 3RFRA 1IO2A 1JJ8C 2RJLA 1NOVA 1RVF2 5LY1A 1P4AA 2LOOA 4UW3A 4XBFA 4G6TB 4ASNA 5I93A 3DPTA 2WZ8A 4BBSJ 2H27A 4RB0A 1RUE3 1LE8B 3VB2A 1BYHA 2TEPA 5FJKA 3CMEI 4KITB 4BQ2A 1OLQA 5E1RA 3I2DA 1OCTC 3POYA 1X3ZB 5J1UA 3KYCB 3IRRA 3DCQA 4JRLA 3FHQA 1YFWA 2XJQA 3H50A 1HQWA 1K4SA 1ODDA 3DKWA 3D4KA 1T6BX 2UWCA 5EJ1B 1RKTA 5FY4A 1YFXA 1YLLA 4K2EA 4GO1A 1LUJB 2WA3A 5JZGA 1FMWA 3NW4A 1EUTA 1ZRDA 2BHYA 4KG8A 1BJAA 2WT2A 3RIRA 1UHSA 4LBOA 1I1EA 2V72A 1HW1A 4GH4C 3RJRA 1UYZA 3NJXA 3NAPA 4KWKA 2E35A 1JHJA 1NH3A 2K9NA 5LB6A 5C70A 2ZX0A 4QIWN 5F32A 3URFA 3E7LA 2YBKA 1WCKA 2ZAHA 2OPWA 4RDUA 2P5LC 4KMUX 1BZWA 4GWJA 3JAMK 2K5CA 1XMKA 1AU7A 4JP0A 3KP5A 5FZDA 5E3MA 2VU9A 1LGNA 2FD8A 4QX5A 2EIMH 4DZJA 3LAPA 2R1BA 1QNWA 3MI8A 2LH9A 4A7ZA 4HKLA 2DBIA 1COV2 1H89C 1UZWA 5C9AC 3SEZA 1TNFA 1H2LA 1RUOA 1YG2A 3LGRA 1MS1A 3BTZA 3WGGA 2HWC3 4PSWA 1IDYA 4IE4A 2DTRA 2CG4A 2DDAA 2XC7A 3LWCA 2QLZA 1OQYA 1SC7A 5DEQA 1PO11 3BOPA 2PLV1 3P6BA 2ZHKA 2E26A 3DEEA 4IF4A 2MHFA 1JOJA 5F5CA 3CC7I 4XICA 4LK0F 3C1DA 3LSGA 4CDWC 2HEOA 2WBMA 1U0JA 5B4NA 5I0UA 2X48A 4IV3A 1KJRA 3JBG2 2O61A 3K4KA 4AQTA 4D1QA 3LF7A 5TRDA 5FV3A 5BNQA 5LA2A 2WNUA 4OUSA 2XKOA 2GQQA 4K1ZA 4C0BA 3CCRI 4L0PA 3SLIA 3Q8AA 5FPBA 4XPVA 1GOHA 5DDJ3 2PQSA 2A05A 1PVEA 3CF2A 2JMWA 1AR72 3LE0A 2JDNA 4P5YA 4PFPA 5GTIC 3K70D 3BGAA 3VBSC 2BUKA 2WAAA 3WX5A 3ZFFB 4ARYA 1FIAA 1PM7A 3CCYA 1WJCA 2B0LA 2V73A 4YELA 2J1UA 3JZVA 4XF3A 1KFUL 4BWOA 5B2GB 2IXHA 4L9JA 2W92A 3LFIA 1S72I 2QSGX 2OXBA 1XYOA 1Q8SA 2A6XA 4IHVA 3WG3A 2DUPA 2XHKA 5FWJA 4Q5OA 3HWJA 4A3XA 1F5TA 1I3QJ 3DBHB 4JDMA 2MC3A 4MO3M 5FMDA 1T0FC 1F4AA 1D5YA 4I0AA 1T39A 3FZ3A 3GW2A 1RITA 2KLOA 3PDQA 4PGGA 5BNNC 1YTYA 3E1F1 5I0RA 3ERED 1TWFJ 1K5MC 2EZHA 4EN8B 4E4SA 1QBJA 3F9KA 2PAEA 4UT5A 3U0ZA 4R52A 2Z3YA 2NVXJ 2YUSA 4AWXB 5C3SA 4CDQC 4WV8A 5C5TA 2Y9YA 2DFBA 4BJ0A 1XPWA 4M9ZA 4OZXA 3VB9A 4NVPA 3G2BA 2GNTA 3S1RJ 3A4UA 3RKQA 2FOWA 5LK7B 2UXXA 4N7UA 3KV6A 1W6PA 3CCJI 1T08B 1YS6A 3C3VA 2ZC2A 1V6MA 1QMJA 3CO2A 4YEJA 3M1EA 4UW4A 3VGIA 5DZEA 4HETA 1MMNA 2K9SA 3F8CA 4AU7A 1RKWA 3I0TA 3K10A 3WHCA 4XJ8A 4XLFA 1Y39A 1VMFA 3AYEA 1XNTA 4WZCA 3LSMA 4PJNA 1WI9A 2WIIB 2EK5A 2DTYA 3R0JA 2WAFA 2H0VA 1GOGA 4O7XA 1ZRCA 2HWB3 3AL0C 2UV1A 3ZQGA 1PK6B 2GSYA 1UU6A 4Q4W2 5FYCA 3U1KA 2CY6A 2HWE2 3WDTA 5IK7A 1ZREA 3VKMA 3H3UA 2OVUA 5FPAA 2FCTA 3O1MA 1Y7BA 2VNGA 3ZSMA 4WX9A 2NYYA 5CB7A 5BNGA 4F55A 3KF3A 3KP7A 1DDLA 3KIOA 1W8UA 2X1EA 4PT6A 4V1PA 1XGOA 4DXRA 1GICA 5IVYA 4GALA 3OYGA 2LY2A 3HYIA 3HQXA 2VG9A 3VBFC 2WWJA 5JVTA 5JMCA 2RC4A 1Y4WA 5FR3A 1O3TA 2HQAA 1H1AA 1VBB3 3CJIA 4YFNF 1CX4A 2YY1A 2QQKA 2YPDA 4K3UA 2OZUA 1VQOI 2AS5F 4GYGA 2RM23 3TO6A 5GP9A 2EFPA 1D8JA 4B3XA 1ULGA 3IT8A 2OC6A 4HN1A 3LSJA 5FKCA 3WF3A 4OVEA 4XF0A 1EPWA 5ABJB 5J8CA 4Q5SF 3G73A 1WGXA 1MJ9A 3AKQA 3IRQA 1HF0A 5E16A 3E6BA 3G4SI 5EXOA 2LRDA 5E1XA 1J09A 4ISRA 5IT6A 3DPLC 1GP5A 1DPRA 3EQEA 2JA5J 3CCQI 4DOZA 2BQPA 2WUHA 1XNCA 5HCBA 2L4AA 3S2WA 2FOKA 4BQXA 2GBYA 2RQQA 1N1VA 2QENA 3LMMA 4DXZA 3MEXA 3PJQA 2MLGA 4MFEA 1BK0A 2QCSB 2JUGA 1HSTA 2DDBA 1A31A 4IL7A 4EWEA 1VI0A 1TTYA 2XGDA 4O9EA 2EWNA 1KZHA 5D6FA 4RLQA 2XJTA 4SBVA 4IESA 3A0NA 1T8IA 3BPXA 1X1BA 3CP8A 4FQZA 4FHTA 2QUFA 1F31A 2OBPA 2E71A 1X36A</