3RPQA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
201
structure length
201
Chain Sequence
b'TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILFYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 60
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rpqA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rpqA01
4ZU7A 3LWFA 4I02A 1RI7A 3IDBB 2H94A 2V6CA 4HX7A 3HYIA 1KA8A 4IHSA 3E5QA 3E6BA 3ABUA 4Y13A 1X82A 1JHHA 1R1VA 3R6SA 2LF7A 2DPUA 4O6JA 4WZCA 2EB7A 5HDGA 1ZGAA 4UVCA 5FLIA 1DP7P 3ELNA 2V1XA 2VOPA 3GFLA 3P7NA 1FZPB 3QRFF 2PAKA 1LNWA 3U9GA 1X7NA 2BEOA 2HR3A 4LLNA 4MUVA 3WTXC 1O5LA 1LB2A 4XLNF 3IWFA 2IVMA 1KQ8A 3QP5A 4EV0A 1FSHA 1SD7A 4DNCA 2EV0A 3B02A 3QU3A 5HDNA 3KCCA 1B4AA 4RAYA 2PFBA 4CHUA 2XGXA 3JSOA 1TQIA 4UBGA 1KYWA 3Q5FA 4KN4X 4RD7A 2WFPA 2MA3A 3KP2A 3QAHA 4M6XA 6PAXA 5CJ9A 1BM9A 1P4XA 1S6LA 1SMTA 2GC3A 2Z2SB 4RB3C 3SFZA 2FBKA 3T8RA 3M8EA 3EO6A 1DPUA 1I27A 1TTYA 1HKSA 4HDVA 1KQ9A 2JRTA 5L3GA 4A5MA 4UUVA 2VBZA 3AAFA 5F64A 5KHKA 3ML6A 2IXCA 2H09A 2KIFA 3KZZA 2JSCA 1XCVA 4LA3A 1EH7A 2WC2A 3FHIB 4G94A 1STZA 2ZCWA 4IEUA 3H3ZA 2XKOA 1GQHA 3S2WA 2WV0A 4KYWA 3C7JA 3NEUA 2H6CA 2D1HA 4PIYA 2IXJA 1J59A 1YUDA 3IHUA 3EYIA 2HKXA 4WX9A 3I5UA 1B6AA 3BB6A 1CAVB 1EH8A 2ZNYA 2HDCA 5FQ0A 2DK5A 2O0YA 4J1XA 3CF6E 1R23A 1FWZA 2ACJA 1IN4A 3HRSA 4MQ9F 4KN7X 2VECA 3ZPLA 3I0TA 4EM2A 5ILSA 4YYOA 2R7DA 1KU9A 4LLOA 5AVPA 2JT1A 3BU7A 4I3PA 2MH2A 5E1XA 3S7IA 1UPIA 4XLPF 1O7LA 4FBFA 2B9UA 3G73A 5FPZA 3HIFA 1MZBA 2H6BA 2CFXA 3M1EA 5DYMA 5D5XB 1J3PA 4EMSA 1DZTA 4A0YA 2X0LA 2XL9A 4J1WA 1IRFA 4ENKA 1TQPA 4Z07A 4B29A 3KEQA 3J81Z 5JHUA 1D8JA 4HVOA 1FBSA 3K1PA 2H0VA 2O8XA 3EUHA 4X6QB 3ECOA 1QXRA 1QXJA 1W7PB 3WU1B 2QBYA 2Q4SA 1IRGA 5I0TA 1Q43A 4G6QA 2ZXJA 2D1VA 2R3SA 3IKVA 2VODA 4ZZDA 3ES1A 4IEQA 3WW2A 2IC1A 2D5FA 5BPIA 4F7ZA 5ILVA 5DEQA 4HZFA 2EJRA 3JAMZ 1K78B 3TDZC 1Z6TA 3BALA 5T3NA 1FLIA 2L01A 2O61A 5K8SA 4LD5A 1NZCA 3BJ6A 4MNUA 3GLXA 1SD4A 3IWZA 4MTEA 4IRIA 5DUIA 4L18B 5DD4A 1DDNA 2GH2A 5FPXA 3JZVA 2QLZA 1BOAA 3EQLF 2E7WA 4IPAA 1ZH5A 3M3IA 2W85A 2O1QA 5AONA 3W6KB 3FJSA 2XV4S 3HSEA 5H6RA 4IEXA 4FX4A 3PFIA 5BUVA 2PMHA 1YFHA 2OYZA 5IT9Z 3RYRA 4JVAA 5JSOA 3QPHA 1ZGJA 5LGNA 5D5WB 2GIVA 2P7CB 1FT9A 5D4RA 5E18F 5LHHA 4QM8A 1G3WA 2P5LC 1EV7A 1PMIA 2PTMA 4WXDA 3MCZA 2IXKA 3H3UA 2Y0OA 4A6EA 4RGSA 4KMFA 3GW2A 2PAEA 4KDPA 1SAXA 2FA5A 2IPQX 1LDKB 2VC0A 3E6CC 1JUHA 5J8CA 2W84A 2NRAC 1DUXC 4XFIA 2EFQA 1CAWA 3WE2A 5HS9A 3I58A 3MFKA 2VPVA 1MDMA 3DV8A 4JTOA 1HW5A 1UIKA 2PA7A 4GYIA 4KUMA 2ET1A 2P6SA 5DUKA 2L3DA 4TLFA 4YIFA 2A6EF 2DBBA 3SXYA 4S04A 1ZZCA 4EJTA 4MGZE 2EWNA 1S29A 1QQIA 1IAWA 1EPZA 2P8TA 2V9VA 3HSRA 1J1LA 2N7GA 1G3TA 2B0LA 4MEXF 3LAPA 3R0AA 3FXRA 1ZN2A 4HA8A 1QZZA 2ELHA 3H8UA 3I53A 4E2SA 1P4AA 1ULYA 4ESFA 5HS8A 4EVIA 2EFNA 3KP5A 1B59A 2BYVE 2Z33A 3L2HA 3T5XA 3IC7A 1SEFA 1L0OC 1LDJA 3F8BA 3MWMA 2PYTA 1KGSA 3DPTA 4RS8A 4EJWA 2IW5A 4OLLA 5A2QZ 4JV4A 4YFXF 1W7PA 3CJNA 2UXNA 4HW0A 3KZYA 4IRGA 2K0GA 4M6YA 1F1ZA 2CW0F 4CGZA 3LSTA 3HHGA 4M72A 5BS6A 2EVXA 3UKNA 1ZZBA 1UFMA 2BGCA 1XSVA 1RGSA 3HT2A 4LG0A 4HSLA 4LMYA 5E1RA 2QZ8A 5I0RA 1R1TA 2VONA 4WCGA 1SMYF 2ZMEA 3GYDA 1YG2A 4P96A 3SQNA 5AIPA 3C3VA 2HFHA 1CAXA 2G7UA 1R5HA 3BDDA 4PCQA 3GEZA 3WGIA 1Z9CA 2PLYA 3WTSC 1O3QA 3H7YA 2J5PA 4EGYA 3SHRA 4QXKA 1XN7A 2QWWA 1UCXA 3HRTA 5HVQC 5ED4A 1QWRA 4HV6A 5LGTA 1J7KA 4YFKF 4A0XA 3WW3A 3WW4A 2UYAA 1Z91A 4LLGF 1LKNA 4Q0VA 1GQGA 4HF2A 2DCTA 2P4WA 4UXAA 1J75A 1T2KA 3TGNA 3HT1A 1XD7A 2XUBA 4BAYA 4GXOA 5D1IA 1T98A 1YO5C 3H92A 2FBIA 4L11A 4ESBA 4PZJA 3JSPA 3IBMA 4TV7A 1IW7F 1P4WA 1WGPA 3VFZA 3FF5A 5F6FA 5ICCA 1MJBA 3H1WA 4AD9A 2E1CA 4OU0A 2STWA 2FQ3A 1SFUA 1FBQA 3WGGA 2XLFA 2D45A 3KGZA 4U88A 4Q0QA 2Q30A 2ESNA 3HHHA 3UKVA 4BHBA 5FQ0B 5H6QA 1XSDA 1W5SA 1FC3A 2CSOA 1O5UA 4XF9A 4P9UA 2L54A 3CUQC 3R60A 3CO2A 4I7HA 4RB0A 3F23A 4LEJA 4IEYA 5JSPA 2A69F 4HMZA 1AOYA 1IUYA 3WODF 4AXOA 2GQQA 1LVAA 3WU0A 1BBYA 3GUDA 3K69A 1XE8A 2IT0A 2IXIA 3KETA 2FNPA 2MHFA 1YLLA 2ATFA 3LA2A 1XGSA 3RNSA 3E6MA 1XGMA 4MHGA 3L2CA 3GF2A 5JI6A 4ZU4A 2A07F 1XRUA 4ZYHA 2GA1A 3DN7A 2QDRA 2MH9A 2K86A 5D4SA 5FFZA 3RYPA 4UBHA 1Z6RA 4M9SA 2OZJA 3S0MA 1RZ4A 2G9WA 3BP8A 1C0WA 3Q9VA 2EA7A 2GC1A 2Q8KA 4KT5C 1U3EM 4ZYEA 5FLHA 4EWEA 2F5DA 1ZZ7A 3SZPA 3CDHA 5EFUA 5TJJA 2P5VA 4IESA 3F22A 5LLQA 4O9GA 4A5NA 2PHLA 1WWXA 2JZYA 4RAZA 3RI4A 5F1RA 4YIIA 2ISZA 1R5GA 4XF3A 2EK5A 4LUKA 1FBUA 2HQRA 4R8HA 2OZUA 3K9TA 2GAUA 2CYYA 4KA4A 3E6DA 2FNAA 3HTUA 3VOEA 3K2ZA 4P9FA 1LQ1A 4L9VA 4AIHA 1E2XA 1W4MA 1KQ0A 1GXPA 2OPKA 5ILUA 4WXCA 1X8MA 5BV6A 2O8QA 3LA3A 3P9IA 4HV5A 3ZMZA 3MYXA 4AVAA 4I2OA 1KU3A 4IEZA 3HTSB 1IPJA 1OR7A 4HN0A 1S7AA 1RL3A 3SCGA 2F4PA 4DQ2A 4LB5A 3CL1A 4XFCA 2V1UA 3ZN1A 2F5FA 2W25A 4U0YA 1PUEE 4RB1A 1YWKA 1DZRA 2L4AA 3USSA 2K4BA 5I91A 1TW2A 4OIOF 4WVZA 2GWRA 5EEHA 1CAWB 4U7BA 3IRRA 4OIQF 1Z7UA 5D5UB 4WF2A 1MDMB 2BNNA 5BPXA 5CVIA 3FX3A 4RGXA 2O3FA 5E16A 1T38A 3KP3A 2RC4A 1K7AA 1ZNPA 1J0RA 2L4MA 2HYGD 4LJZF 3COAC 2XROA 2E9QA 3M70A 1SFEA 5FD5A 1NYWA 3ETQA 4Q4ZF 3JTGA 3D82A 3E3VA 3WE3A 4CO8A 1YFUA 1EP0A 4IJAA 2P17A 5C6CA 5ERIA 1G6NA 5E20A 2FQPA 4O5VA 1OYYA 4E2GA 3CUQA 3H50A 4LTAA 2MC3A 1XMKA 2KRFA 4KMUX 2OQRA 2RGVA 4L9NA 3ZQ7A 1FYMA 3FFQA 3DQVC 4LUMA 4ENMA 2QQBA 3FZ3A 2DQLA 1YW9A 2COMA 3WGHA 2CG4A 2QQAA 4E70A 1X8EA 3F72A 1IN5A 4MGRA 4KIGA 2XAJA 5FCCA 4JBAA 1ZLJA 2BBYA 3I59A 1K6OA 3VB2A 1NE4A 5LRSA 3ES4A 2XAHA 4OOIA 3E5XA 3OF1A 4A0ZA 5JVTA 4K8FA 1MJ9A 3LQRA 1XGNA 5J3UA 2R7FA 4LG0B 3IDCB 1QPMA 1O4TA 2STTA 2KJBA 4UNOA 2PQ8A 4HDUA 2ZMEB 1T0FA 2QVOA 4ENJA 1CAXB 3SHFA 4R1HA 3V8JA 2K4JA 1HXDA 2KIUA 2FEZA 3G3ZA 1Q5OA 1ZRRA 4YRDA 1S3JA 1BC8C 1P6RA 4KICA 3I64A 4G8XA 3GZ6A 5FLXZ 4Y17A 4G7HF 5I0UA 2MBFA 2J5OA 2Q1ZB 2NAZA 1FYLA 5ICEA 3MZYA 1HKTA 3SMHA 4CDGA 5E17F 4HLTA 2IXLA 3F3XA 5D8LB 1XSXA 2RVCA 1I1SA 3RJPA 4GULA 1U5TC 4ZH4F 3WTZA 4YARA 4U7DA 3DL3A 5HLIA 4O9EA 2RQPA 2IA2A 1IN6A 3KP6A 2D2WA 1OYIA 3KEOA 2M1BA 1OPCA 1JE8A 1S8NA 2HTSA 1MGTA 1XDSA 3GZ5A 4IETA 4OIRF 1P92A 4MGYE 4R79A 2FE3A 3GWZA 3WTTC 2H27A 3FMRA 3K1NA 2CO5A 1ZREA 4HQEA 2HJIA 5JR7B 3ELKA 5ICGA 3C18A 3ZMTA 4HVQA 5LRRA 3PNAA 1R1UA 3DP7A 4B09A 1CF7A 4QGNA 2LDUA 4P5OA 3DFGA 3WG9A 5D8KB 3NKTA 1Y9QA 1EYBA 3RKXA 1HBXG 1J3RA 3N4MA 3FM5A 4PIZA 3JW4A 4AVBA 3RYKA 4U0VA 3KSCA 4M9XA 3QACA 1V3FA 2VE8A 1IN8A 2V09A 2B5HA 2F5CA 2OQGA 1YTYA 1ON1A 4EWDA 5K1YA 1P2FA 2UZKA 3DF8A 4GGGA 3QU6A 4LFUA 4XF0A 5LHIA 3PQJA 4XFHA 2GXBA 1KU7A 5E1ZB 4L9TA 4U0WA 4HX4A 2Q2EA 2LF8A 3K1MA 3H1MA 4LULA 4Q5SF 1MD0A 1H9GA 1PM7A 2BNMA 2UXXA 4UHTA 4NVPA 3F8NA 1ZAOA 1QZYA 2YX4A 2QENA 2E1NA 5BMZA 5HS7A 1K79A 1FY7A 4HF0A 1QY4A 2EV6A 2ESHA 1YIOA 1PP7U 4QLCU 2YX7A 3HOTA 1BI1A 1O3TA 5JFRA 5ICFA 2B8MA 3RTRA 1TBXA 4IEPA 5EEGA 2BV6A 1ZARA 2VN2A 3BZ6A 5C8WA 1FP2A 1JGSA 3T1BA 1FI2A 4AQ6A 4M73A 3RKYA 5HLHA 3GFMA 4EGZA 3ABTA 4PJYA 1WSUA 1I5ZA 5D5VB 2O6GE 1ZRCA 3BOQA 3F8CA 4HLYA 1V70A 2Y48A 1DGWA 1YHFA 4RB2C 5FDBA 2XIGA 1ZZ8A 2GC2A 3W6JB 5L3DA 1O7FA 1ONVA 1TW3A 1S7OA 2F5EA 1Q3EA 1BJAA 3LAGA 1ON2A 1RUOA 3R4KA 4KNYA 5KHJA 2TDXA 3FMSA 3FXUA 3U10A 1XDUA 1BI3A 1SD6A 3DPLC 3NJZA 1YFWA 3GX4X 2P5KA 2IA0A 4M74A 3V7RA 2FMLA 4Q0PA 2M5WA 4H7LA 1ZRDA 3FZVA 5I8TA 3O2PE 2XLAA 4FAGA 3OGJA 5BQTA 4MX3A 3HQXA 2JTVA 3BJAA 2FOKA 2VT2A 3J81K 4HX8A 2IP2A 1LDDA 4P55A 3ZMUA 1NE6A 5K5RA 3WTVC 4AVCA 4A6DA 2ZBKA 4BHPA 2JPCA 2NYXA 2CWEA 1QBJA 3IRQA 4HAMA 3LZZA 3ZMVA 3ST7A 1CAUB 4OFGA 5J48A 3M9AA 2ETEA 5KBFA 3WTUC 3KLOA 5I0SA 3ROUA 1U5TA 5L3EA 2PMUA 3OD0A 3CUOA 2NNYA 5K5QA 3CLPA 1HW2A 2XLGA 5E8IA 5LGUA 5CVUA 1Q1HA 5I8YA 2RN7A 4MZUA 2E7XA 2PI0A 2EA2A 1IXSB 3KP4A 3NSTA 5CVRA 2FRHA 1ZVFA 2V79A 1KU2A 2FBHA 4L0YB 4XFGA 2QNKA 4I0BA 4R52A 2IA1A 2QJVA 1YQAA 5CU1A 4IXAA 3TO7A 4HQMA 4YG2F 4IHTA 4HVRA 1ZG1A 2D40A 3LWCA 4MTDA 4WXHA 1WRJA 5LEKA 1UW8A 3UKTA 2C0ZA 3LAJA 3T8TA 2VE9A 2A6HF 3CUQB 1WA4A 2HTJA 3ULQB 3TNPB 3IIAA 1FP1D 5J7MA 4Q0UA 4AIKA 1J58A 5HOOA 2FXAA 1OFNA 1F5TA 1UIJA 4KWLA 5E8GA 4IEVA 2OA2A 2LSOA 1TLHB 2Q0AA 3KMHA 3NRVA 3FXQA 1X3UA 2DU9A 3I59B 3O6BB 3N97A 4L2NA 4AVPA 4NQWA 5L3BA 4OIPF 3NW4A 3CO6C 2ZO4A 2HEOA 3REOA 5AIQA 1BC7C 3ZDSA 2HWVA 1QO0D 3R61A 5CYVA 4XF4A 1RIOH 1U12A 3CLOA 1FYKA 1SQ4A 2D5HA 1SFNA 1RTVA 4MGIE 2F2EA 4PDKA 2CGPA 1YS6A 3LQQA 1R36A 1R7JA 1YLFA 3QP6A 1CX4A 3HSFA 4IF4A 4PIXA 1UHWA 3I54A 2Q0OA 3GO5A 2CAVA 4ENNA 2X4HA 2Z5UA 2XAFA 1TNTA 2O03A 4Y15A 1ZX5A 3GBFA 1GVJA 4N0BA 3U2RA 1PDNC 4KL1A 3MDPA 4UVAA 1G3YA 1I1GA 2NS0A 2FSWA 2HOEA 2FU4A 4OMYA 1ZG5A 2PJPA 2A3SA 3H7JA 4CXFA 4M9ZA 4G9YA 1HW1A 1R58A 4HOBA 3U1DA 1FNNA 3VODA 2HGCA 3O3KA 1Z1DA 4P9GA 2L02A 2EA4A 3H1YA 3Q9SA 1L3LA 1ODDA 3BPXA 1O3RA 5I8SA 1IN7A 5CLSA 2DQRA 3V4GA 5A2QK 3VHRA 5L3FA 4KU8A 2PEXA 4HBLA 4CICA 2A61A 2ZKZA 4CYDA 2M87A 2EFOA 1CAUA 4PGGA 3EHKA 2XASA 2M45A 3O14A 2KXLA 1J5YA 5BXXA 1T6SA 1D8KA 3EYYA 2ETHA 2UWMA 2XVCA 1H9TA 3SCHA 4Z82A 5HLGA 3I7DA 4AQ2A 3ZMSA 3OTFA 2DO7A 2OA4A 2WTEA 2GA2A 2PBIA 3KP7A 1E17A 1CF7B 5FO5A 5IT3A 2MPFA 3S7EA 3SCFA 3C1DA 4ASNA 2Z99A 4FX0A 2XKPA 5LBQA 1HKQA 4B8XA 4HYEA 3NL1A 1B9MA 4MEYF 2I45A 2A5YB 4UV8A 1BI2A 4BQAA 1OKRA 4M71A 2K27A 2QQ9A 2C6YA 2M30A 1TQMA 1USTA 5DD8A 3B73A 3MQ0A 1LRHA 2VT3A 1F4KA 1VTNC 4XRFA 4Z2YA 1XB4A 1WLTA 1NHAA 5DV5A 1XE7A 2AXLA 4G7ZF 1AWCA 4KIBA 4PGHA 2QCSB 1CGPA 4BH9A 4N9HA 4EJUA 1D5VA 1FXZA 4QM9A 3GFIA 4UXNA 4GYGA 3ACLA 1UHMA 1O57A 5CVVA 1YFYA 4HF1A 2OD5A 2PN6A 4L9JA 3G7DA 4KIFA 4YNIA 3CEWA 1H1MA 2DLLA 1SD5A 1TNSA 3TO9A 4DINB 2PQQA 4I01A 4GCVA 5KHHA 3D0JA 1QNTA 3FMQA 1RC6A 4MH0E 3U0ZA 2PAMA 1Y0UA 1QGPA 2DTRA 3OCPA 1H0MA 1MJAA 5KVRA 5E1WA 3EJKA 2QUFA 4EQQA 4HN1A 1DPRA 2Y75A 3P9CA 1UD1A 2K9ZA 4FHTA 1YS7A 2YR2A 5FGMA 3V8LA 4BHCA 3VEPA 4ZYGA 4G7OF 2DPDA 5BY5A 5FB2A 5LEJA 4ON0A 1L3JA 4IRHA 3KFWX 1ZRFA 2DAOA 3ISPA 3FM3A 1U8RA 1REPC 1BI0A 4L0ZB 2GU9A 5CVJA 1LR5A 2BE5F 2W57A 1ZZ9A 1OYWA 4EJVA 3M7GA 2GC0A 3ECHA 1J3QA 4ZZLA 2HQNA 4I98B 5DCMB 4L5IA 3HOSA 3PLQA 5K5OA 2V1DA 2HYFA 5JAXA 2LNBA 1J2XA 2RDPA 3EDPA 1LEBA 5JCTA 4O3MA 4RGUA 2P6TA 3NQOA 3RZZA 1HSJA 2D93A 1OMIA 2EV5A 2VOOA 1UB9A 3E97A 2VBYA 4BYYA 2AS5F 3QOPA 3DKWA 3FHZA 1VR3A 1G3SA 1I6XA 4XBFA 4ZU5A 3J80K 4KU7A 1U78A 4G6DA 1BIAA 3L00A 1ZYRF 2P7VB 5KK1A 3L9FA 2Z69A 3PVBB 1U5TB 2PFWA 2OBPA 2ZJ2A 2IJLA 3WTYC 4D7SA 1SFXA 2GZWA 3BWGA 2UY9A 1GXQA 2VC1A 4NB5A 4QGLA 4MQVA 2A68F 3E5UA 2DK8A 3ERED 2YSRA 3TQNA 2HZTA 4KWKA 3HRUA 2EFWA 1U6GA 1OI6A 3FE5A 5L3CA 4XFAA 3GVAA 5CADA 1TQ5A 2YU3A 3OV8A 2UY8A 2KIMA 3L7WA 3MPBA 5J8FA 1D3YA 4NHJA 2Z9OA 3GYHX 4HBNA 3C3WA 1YW8A 1OD5A 5HI0A 4WWCA 4QX5A 2MLGA 3TO6A 3LA7A 4LLLA 5H20A 1ZHFA 1B1BA 3TOBA 2K7LA 5D6FA 2G7HA 2RKHA 3F6OA 2XHKA 4EROA 5EZWA 2XAQA 2EAAA 1J9IA 2DW4A 4GO1A 1IXRC 3M8FA 3P9KA 4XEZA 1LEAA 3K0LA 3RPUA 2HS5A 3BROA 4CZZA 2ZFWA 4UV9A 1WQ2A 2QVSB 2XL7A 5JSRA 3D0SA 2HKOA 1CAVA 4IVNA 4X6RB 1UCRA 3BY6A 3OOPA 1V4RA 3ZP5A 3TKYA 3CJXA 2FMYA 4AIJA 1RUNA 1R22A 4IERA 1XMAA 4XETA 2ZKLA 4XF1A 2ZNZA 2DI3A 2FF4A 2OU2A 2PG4A 3KLNA 3TNQA 2M8EA 3F8MA 1FSEA 3WTWC 4JQFA 4Q47A 1MKMA 4JTNA 2EFPA 3V7SA 5TRDA 3F21A 2KKOA 4ZYDA 4EM1A 2K02A 1B9NA 2Z3YA 1GHCA 1A04A 3D5LA 4BXUA 2Y0MA 3LOIA 1JHFA 2W24A 4EM0B 4H0EA 5BOXA 1EY2A 3GFJA 4KWJA 5I93A 4AWXB 2DT5A 5KHGA 4I0AA 5BPDA 1YW7A 3V8KA 1FOKA 4K2EA 4JK1X 4IEOA 1O3SA 3L09A 2MNGA 2MLKA 3IKTA 1IF1A 3ZMDA 2CQKA 1VJ2A 2VQAA 3QPTA 1IXCA 5KHIA 4E2QA 2CV6A 4HSJA 2CAUA 3FWEA 4ONUA 1FX7A 3EETA 2VXZA 2JPBA 1RNLA 2OZ6A 5DCMA 4LGWA 4XFFA 3JTHA 4LK1F 1K78A 3RIRA 1YYVA 2KJCA 1IPKA 4LK0F 1PP8F 2IRFG 4Q0SA 5LHGA 3R0JA 4N9IA 2RNJA 3EBRA 5HDKA 3DXJF 4UVBA 4WK8F 1USSA 1EH6A 3LFKA 5J6XA 2ET7A 2OAZA 4A2UA 1T39A 1HQCA 2RV8A 1YFXA 1XGOA 3MZHA 4OINF 3F6VA 5FLJA 2IXHA 2ISYA 4XFBA 2NNNA 4XSZF 2VBXA 4Q29A 1ZZ6A 4ORFA 3TDUC 4D0PA 4L5JA 1LJ9A 2WWYA 3KE2A 4LA2A 4OMZA 4EWAA 3U11A 1ZG3A 2VBWA 3JAMK 1W5TA 2XAGA 1WKMA 3IL2A 4MV2A 1ZLKA 1BN5A 4S05A 1FPQA 4KFCA 1BIBA 4MGKE 2LKPA 4FAHA 1IZ1A 3MAJA 4ESJA 5FLXK 1WI9A 3HRMA 5D6EA 1R00A 1KYZA 4BNCA 3HUGA 4ETSA 4HLXA 3V7CA 4XSXF 2QYOA 4QGMA 2QM3A 4LB6B 3RDIA 3GXOA 5FD6A 3TOAA 1JXSA 5IT9K 3SXWA 4Q48A 1HSTA 1XCBA 4RGRA 4YFNF 3BCWA 3KGLA 4QMAA 5FFXA 3F8FA 5JR3A 4META 4IEWA 3MEXA 1G4DA 4A12A 1Y3TA 3CO7C 4EJOA 3SZTA 3I4PA 4BIFA 3H9AA 3T0YA 5DDGA 1NXMA 2PHDA 4WBBA 3RKWA 4D7TA 2YPRA 5DCFA 4YSFA 3WW1A 3NVCA 1U2WA 1F9NA 3BPVA 3RPQA 1Z05A 1W7PD 4I09A 2DFIA 2BNOA 3ZN0A 2ADUA 2MD5A 1VP6A 3EQEA 4QWQA 3J7AO 3CTAA 1DGRA 3BJOA 3DEUA 3I71A 2XRNA 1H1IA 3J80Z 4F8AA 3BPZA 2QBYB 3PQKA 2UYBA 2GXGA 4FT8A
chains in the Genus database with same CATH superfamily
5IVYA 3PTYA 3W21A 4IHSA 2EZHA 2ZGKA 3ABUA 2KD7A 3CCSI 2E36A 1H8TA 3CQOA 1W0PA 3KB5A 3LEGA 4WZCA 3R05A 5HDGA 3AX4A 1DP7P 2HPIA 5C5TA 1POV1 4FTBA 1BBT1 2HYJA 1RMU3 4GFBA 4CCEA 4MUVA 1KRIA 1O5LA 1GP4A 3SEEA 1LB2A 4XLNF 2ZGUA 2V26A 3IWFA 5A7OA 2OPTA 5GZDA 2QQ8A 3QP5A 2LC2A 4FPFA 2HU9A 1PK6A 3HPGA 5HDNA 3S32A 1F15A 3N35A 4O65A 4CHUA 3ZXSA 2R071 4D6SA 1KYWA 1ZBE2 2EIEA 1IO2A 3Q5FA 3AJYA 3OGSA 5DZEA 2MA3A 3KZ4C 3URFA 4M6XA 1AL0G 5CJ9A 4EN7B 1W8ZA 4OI1A 4RB3C 1X1CA 4LQRA 1G9AA 4C3JJ 2BOLA 1OA3A 2ZEXA 3I2GA 4QPIA 3OPZA 1VQMI 4A5MA 2VI6A 1HF0A 1LVKA 3PVNA 4AZZA 3AAFA 3PMSA 1QH7A 3ML6A 1IGOA 4F3JA 2BFUL 3W5NA 2JSCA 1XCVA 1GNZA 3G4SI 1AR82 2ID3A 1NY71 1XBFA 2WN3A 5CKNA 3KF3A 2E71A 1GQHA 3S2WA 2WV0A 3S2DJ 2WB1A 3NEUA 2H6CA 4PIYA 2IXJA 3ZYJB 2A73B 3J7HA 1PJRA 1VBC1 3EYIA 2NYYA 1B6AA 1CAVB 1EH8A 2WNVA 3QQAA 5FQ0A 1U9NA 1REDA 1US3A 3ZCOA 2BY2A 5GZGA 2ACJA 2VECA 5FZAA 3KT7A 2WS92 2R7DA 3IZOA 3CJIC 4QKFA 3LFIA 4BPZA 2ARAA 4Y5TA 3TW6A 4EQVA 1O7LA 2B9UA 4KITB 3G73A 3ZQCA 3AP9A 4LNVA 4RA0A 4QDRA 3POGA 1RUD1 5A32B 4CEWA 2ZGSA 4CCOA 1IRZA 1TQPA 1G9FA 3I3EA 1LEDA 3OYJA 1OT5A 4HVOA 2HOSA 3EUHA 4X6QB 1QMJA 1ERDA 1QXJA 1HRV3 3HOUJ 5FZ0A 2JDKA 3OR2C 3N7LA 4QKBA 2F5VA 3S1RJ 1VMHA 3WP3A 1IRGA 3MW2A 3L2QA 1Q43A 2L7FP 3PSIA 2R3SA 2VODA 1OCRH 2L9SA 3O0VA 2V9PA 2LY2A 1SHWB 4L9BA 3KYCB 1UNBA 2L01A 2K9QA 2O61A 4PT6A 5J36A 2QQMA 4L5EA 1VZ0A 1FMWA 3IWZA 1J83A 4IRIA 3GTMJ 2FDIA 1US2A 1VIWB 3OIOA 3BYWA 2HXOA 4GJYA 3LCPA 3APBA 4AEKA 3JRIA 1W8FA 4M3BA 3C2GA 3M3EA 4CA9A 5BUVA 1YFHA 3LSRA 4YZ3A 4BJTA 1EV11 4JVAA 5JSOA 3G6JB 2GIVA 2D6OX 3H9QA 3S17J 2GN7A 2P5LC 1EV7A 5J3LA 2PTMA 2JVGA 4PJJA 4WXDA 3MCZA 5F0HA 2R7QA 3CZ6A 4CPBA 1SDWA 5C71A 2WZR2 4P00B 3GW2A 4FP3A 2HVQA 2FA5A 3JRBA 3UGGA 1UXZA 3E6CC 3OR1C 5J8CA 1JYIA 2W84A 1NCRC 3T1LA 4LHNA 3SEPA 4YM3A 5HS9A 3MFKA 2VPVA 3E7LA 2W47A 1UIKA 3I2IA 4S2HA 2PA7A 1NCRB 4QB2A 3T1MA 4LHKA 4A3FJ 2X8KA 5FZ8A 1Y1VJ 4R9AA 4AIDA 1RUD3 2P6SA 3WU2C 4QPOA 2Y26A 3M8LA 5EP9A 2L0KA 2L3DA 4XTPA 1UY2A 1AXYA 4P5YA 4DXTA 2DBBA 3SXYA 1ZGWA 1B72B 1NXD1 4AI9A 4RFRB 1HKDA 4G6TB 5B5EC 4BQ5A 2VKVA 1S29A 2WNUA 1LAJA 1IAWA 4NOTA 1W6NB 5GZCA 1ZN2A 1P8JA 4D5CA 1QZZA 2ELHA 3I53A 1UU6A 1KXGA 2R062 5B4NA 4EVIA 3KP5A 2L9NA 2WBKA 3P3NA 4N4NB 3T5XA 1ULOA 2OW4A 3BQZA 1LDJA 3MWMA 4XKBA 2VUCA 4RS8A 2KDOA 5A2QZ 4XLEA 2MEV2 3NO8A 1XNDA 3CJNA 3H8RA 3KIOA 2UXNA 1SBDA 2M9HA 2LOOA 2CW0F 4CGZA 3LSTA 3KD4A 1KDKA 3UKNA 5FZFA 3NV3A 5I0RA 5GPAA 4WCGA 1YG2A 4UYBA 4DQAA 1W6MA 1EV13 3FN9A 5AIPA 1CAXA 4LHLA 3LIGA 5FR3A 5FYTA 3GEZA 3POYA 4ANJA 1ZELA 4XRMA 1O3QA 4RM2A 5JIAA 2J5PA 3SHRA 3ZQQA 3KYLA 1XN7A 2QWWA 1ASJ1 3HRTA 1XE0A 5HVQC 4HV6A 4CPBD 3OMYA 5LGTA 5L7OB 4YFKF 4J19A 4NC7A 3WW4A 4NROA 3IPVA 3VD5A 4LLGF 4KISA 1SFPA 3ALQA 1GUUA 1SFKA 5FY9A 5FYHA 4UXAA 1SG3A 3DTKA 1J75A 1TMF2 4M4PA 2QBXA 2JA8J 3VZJA 3TGNA 5HCHA 3ILRA 1XD7A 3VBRB 2HWF2 1T98A 3M8JA 4W6YA 2PHFA 3BR1A 3GCMA 4AI3A 1E5HA 4BE0A 1WGPA 5IK8A 1CPNA 4YLZA 1DYOA 2CY6A 2VOVA 4D7YA 4N43C 4AD9A 5FZDA 1T2XA 1JUIA 2FQ3A 1W5CC 1FEXA 3WGGA 4U88A 3J7LA 1RKWA 2Q30A 1U5IA 3HHHA 3USUA 3Q8AA 1WVRA 1AJOA 1IJWC 1XSDA 3OD4A 4Z8BA 2CSOA 2RDSA 4XBQA 4AOCA 1BKZA 1YI2I 2L54A 4I7HA 1W9WA 3NNJA 4IOCF 2E2IJ 5JSPA 3ACFA 4HMZA 4XN3A 3GGLA 1U0AA 2FD5A 3WDTA 1IUYA 4AXOA 2Y34A 3HM5A 2VZQA 3PL8A 2JB8A 5FP8A 1PX3A 5BNOA 2DOAA 1GNYA 2IXIA 1YIJI 2ATFA 1LPQA 4B47A 1XGSA 2YZ4A 3RNSA 5E8AA 4QX2A 4Y20B 4IUGA 1ULPA 3L2CA 1S0CA 1NG6A 3WHUA 1JODA 4BJ0A 4C0HA 1W9TA 5FBJA 2A07F 1XRUA 4ZYHA 2XMLA 1JZ8A 3TP3A 5D4SA 5JLWA 2KIQA 4UBHA 1Z6RA 2V5DA 3WQ1A 2EA7A 3I2FA 2JSPA 2Z5WA 5FLHA 2DTZA 1IDYA 5DAVA 1ZZ7A 2DOEA 1QQP1 1ASJ3 4QDQA 5EFUA 3DPRC 3UR3C 3F22A 4A5NA 2ZJCA 3HWJA 2QGUA 1FV3A 5A3LA 5F1RA 3DPRB 3KV9A 2ZHNA 3PUBA 4E7KA 2OZUA 4LJHA 3I2HA 2CYYA 1AL22 2DCZA 3E6DA 2A5ZA 4FPGA 3VOEA 3DKXA 1CIWA 2TNFA 2ZGLA 2FMDA 4COUA 4QXCA 4YWAA 4WXCA 4MFDA 4EEFG 5BV6A 3ZMZA 3BG6A 3Q0VA 1KJRA 4I2OA 1KU3A 4IEZA 3AVRA 1IPJA 3WP4A 3CJTB 1UZ0A 3LPFA 1S7AA 2OXBA 3MKYB 5CEHA 4QX8A 4DQ2A 3ZN6B 2PMZA 2GN3A 2IGNA 2Y0SN 4RS5B 5B1AH 1BR4A 1CAWB 3OYAA 3IRRA 2ARBA 3M4FA 4YFZA 5GJ6A 2EIDA 2O3FA 1BLZA 3CF5F 2RC4A 1K7AA 1HV1A 2HXIA 5CB7A 2XROA 2E9QA 3M70A 2P81A 5FD5A 4AGGA 4I0WB 2AZ5A 3U4SA 3ETQA 3D82A 5FROA 2VUMJ 1YFUA 4FFHA 1EP0A 1T56A 2QKMB 1RJ7A 3W2WA 2P17A 3B5LB 4XUPA 3GDBA 3SH5A 1Y56A 1OYYA 4O5VA 2R7RA 5DG2A 3MIGA 3H50A 5FOJB 1TZLA 3KQ4B 1XMKA 4FOWA 3BR6A 3TN91 4L9NA 3ZQ7A 1FYMA 3CP8A 2B39A 4JYKA 2XJRA 1UQXA 3DQVC 4LUMA 1SC7A 4ENMA 4YVWC 1D0HA 1QQP3 1YHQI 1MS0A 2W94A 3FISA 1X8EA 1OUXA 4KIGA 4JBAA 1DQUA 4AG4A 3I59A 5ACA2 3S1QJ 1NE4A 5LRSA 1EJ9A 5IVBA 1LGNA 2E26A 2ZC2A 4JGZB 4B4CA 1MJ9A 3K4MA 3LQRA 2JJ6A 1X2MA 1AR92 3PSFA 3WG3A 1SLCA 1BEV2 3IDCB 5JWPA 4BZ4A 4PHZA 3GNEA 2ZMEB 1QZEA 3OYWA 4HKWA 1GR3A 1YRZA 2KIUA 3KEYA 4A3IJ 3FKJA 4YRDA 1S3JA 1VQNI 4KICA 3LDBA 3I64A 4HRIA 1YIFA 3VN4A 5CQEA 1G8WA 3GZ6A 2M0MA 2Q1ZB 1W6OA 3B6AA 3M07A 1FYLA 3D3AA 4C90A 3R4DB 2BHZA 3MZYA 5J40A 4RQPC 1R1A3 3VUOA 3F3XA 3AZYA 1R6RA 2BUKA 1U5TC 2LREA 3NMBA 2NPIA 3WTZA 1S2BA 1A35A 4O9EA 4ZPIA 1IN6A 2LH9A 5FAXA 2D2WA 2VW1A 3LDKA 5IVEA 4LBNA 3KEOA 2TCTA 1S8NA 1MGTA 1S0BA 4OIRF 1P92A 5A3OA 4NPLA 1XYNA 3C2BA 3UNPA 3K1NA 3N9QA 1ZREA 2CMPA 3ZFFA 2VZ3A 4A4AA 2HJIA 3ELKA 1AHSA 3VKLA 5FWEA 3H42B 5C8CC 3ZXAC 1GMMA 3C18A 1HDPA 1VAKA 3DF0A 4A44A 2FCVA 3ZSEA 1R1UA 4P9JA 1JYTA 3AM2A 4FO9A 4P5OA 3THTA 3DFGA 3WG9A 2GBYA 5D8KB 2A3XA 2X10A 1AYM1 1GOHA 3CDZB 5CKQA 3VD4A 1UX6A 4AVBA 1TWFJ 1H88C 3O8GA 4GZ9A 3QACA 1V3FA 1IN8A 2B5HA 1MBHA 4LO7A 3ZR5A 1ON1A 5K1YA 3DTEA 2WRAA 4URAA 3DF8A 2M7AA 4B4PA 4Z1VA 2CQQA 1X1PA 1OHFA 1TME2 2WINB 2DVBA 2GXBA 3ASNH 1KU7A 2BVLA 4L9TA 4Q4X3 2Q2EA 2DU1A 1R081 3H1MA 1GQPA 1ULDA 4NVPA 1ODMA 1ZAOA 3K51A 2VMDA 1PGW2 2YX4A 1RUG2 3AYEA 5FZ3A 2YBKA 3M1HA 5DG1A 5HS7A 4ZY9A 2CWSA 2ZXHA 2QZ2A 1PP7U 4QLCU 1R092 3WZ1A 3HOTA 5ICFA 3RTRA 5EEGA 3BZ6A 5C8WA 1JGSA 4AQ6A 4M73A 3JD71 4E8DA 3ACHA 3P1IA 1UX7A 4OZXA 3TBDA 2R93J 1WPKA 3WNNA 2A70A 4WM8B 2D6LX 4RB2C 2DTYA 2V73A 3HBZA 1ZZ8A 3IV5A 1O7FA 5FMCA 1TW3A 2K3PA 5E3OA 4E8CA 2F5EA 3KZIC 1RUOA 1OLQA 2ME0A 3FMSA 1E5SA 2VMGA 4P1WA 3DPLC 3NJZA 4UFLA 2P5KA 2PHXA 2ILMA 2E1MB 3PO3J 4BLIA 3DBRB 5I8TA 5BQTA 1QOTA 3HQXA 2JE9A 4MX3A 2KMUA 3UJQA 3QD6A 3BJAA 5FPBA 2VT2A 4ZZ5A 3J81K 3ZXLA 2MGQA 2IP2A 2PLV2 2ZABA 2HWE2 1LDDA 2LY9A 4P55A 4GQ7A 4AVCA 4A6DA 2DT6A 3PUSA 5JZGA 2ZBKA 4BHPA 1FX5A 3IRQA 1DGWY 2VTFA 1W36C 1GV9A 2VOKA 5KBFA 3ROUA 1AYM3 4BQ1A 2W46A 3W3CA 1JW6A 1D0GA 2GALA 3CUOA 5F39A 5K5QA 3CLPA 2DYRH 2QQKA 5E8IA 5CVUA 1Q1HA 2ZGRA 4HPKA 5C44J 2B45X 1FMD2 2E7XA 3KP4A 1LOEA 4DGWB 5KXEA 4V2VA 4GH4C 2AXTC 1ZVFA 1KU2A 2H1LA 4NIGA 1IS3A 3MEPA 4XFGA 1T33A 1ZBA2 3TP0A 4AYBA 2KRCA 2XSJC 3M2MA 1MZFA 1R083 5A80A 1ETWA 4ASMB 3ABLH 2W48A 4IXAA 4JRLA 2ZSHB 4BQ4A 2W1UA 5J4VA 5IUQA 2D40A 2A6ZA 4B1MA 2HEVF 3LAJA 4EATA 4G3YC 2VE9A 1T6GC 3CUQB 1Z0HA 4BDYA 3TNPB 4Q0UA 1J58A 2N8GA 2X9DA 4I99C 1F5TA 3JD73 3T0DA 4GALA 2LK2A 1HDDC 2C4XA 4IEVA 3E1F1 2Q0AA 2DVGA 3DGTA 2DU9A 4L2NA 4AVPA 5E3LA 5L3BA 4OIPF 5JMOA 2BZDA 2WLQA 2VC9A 4K21A 2ZO4A 1Z77A 3REOA 3CCYA 1BC7C 3ZDSA 1XPWA 3MUY1 1E0EA 1JZ7A 4WV8A 4XF4A 3S16J 1ENXA 4YG0A 1DYKA 2Q1MA 1FYKA 3BGAA 3DEMA 1SFNA 1RTVA 3AL5A 2F2EA 4QPGB 3H9GA 4PDKA 2CGPA 3LQQA 1YXWA 1R7JA 2DCJA 4IV1C 3QP6A 1ODNA 5F3GA 3RI8A 4PIXA 4DY5A 4M01A 5FRNA 4WVMB 4FQZA 3FXJA 4Y15A 3FBMA 1YQ6A 3QPSA 5DXDA 2D3PA 4UB6C 1JXNA 2OC6A 4KL1A 3MDPA 1I1GA 5L9BA 3H5AA 2FSWA 3O1RA 3ZR8X 3VHOA 4XYXA 1ZG5A 4DOUA 3OUHA 3AMMA 3VODA 3OG2A 3O3KA 3UNGC 1QNYA 3G71I 2K9LA 3BTCA 1WMXA 5GZEA 1BCXA 3BPXA 3ABKH 5I8SA 2R5ZA 2VMCA 3AJZA 3C7OA 1PZ9A 5L3FA 2PEXA 4CYDA 3JBG1 2EFOA 4RAGA 4PGGA 3ZIWA 3O14A 4GB33 1UU4A 4R4XA 2ETHA 1W6PB 4M6VA 2VAUA 3SCHA 2WO2A 5HLGA 1F8VA 4C0BA 3ZMSA 4Y1XA 1MW7A 3DLAA 2CFOA 1W2TA 3K4ZA 5CFDC 3D8CA 3KP7A 2GA2A 2YBPA 3O1OA 5IT3A 3BZCA 3SCFA 2ORZA 5GAGJ 4ASNA 5FO8B 2IGMA 2P0WA 2XKPA 3WUDA 2L9LA 2XJQA 4QKNA 4HYEA 1B9MA 4DYQA 2F6BA 4DNYA 3BCAA 4PI0A 1BI2A 2LR8A 3H9JA 3OL4A 3GTPJ 3HB9A 5CZKA 3LOBA 4NE9A 1USTA 4QPYA 3TWIA 1LRHA 3MQ0A 5TGTA 1HN0A 1Y8RB 1SPPA 2GNBA 3GJAA 5T55A 4XRFA 4Z2YA 5ABJC 1XB4A 3W2VA 2DMUA 1WLTA 1AWCA 4CEYB 4KIBA 4BH9A 4CP1A 3QYBA 2CV0A 3PL0A 4UW5A 2OUMA 1O57A 3RI9A 4KIFA 2HBUA 3U78A 3CEWA 5KWRA 4E7JA 1MSEC 3OYMA 3GTGJ 2ZGOA 3ZXJA 1PVEA 2NQYA 2VUDA 3HNMA 2EXJA 4U36A 1D1CA 4CDXB 1KD7A 3FMQA 1RC6A 1AUYA 4BCUA 4J01A 4RHV1 2HYXA 1AR72 1REFA 2Y75A 3OYEA 3C2UA 5M3MJ 3RVHA 3VB9A 3LOCA 2YR2A 4XW3A 3OS0A 3FK7A 3NV1A 2OTJI 3CMMA 4URTA 4L0ZB 3LSGA 1LR5A 4G4FA 4EJVA 1J3QA 4ZZLA 2ENRA 4ZS2A 2P3JA 2HQNA 3JBG3 3DXUA 3PLQA 5K5OA 4A3LJ 2V1DA 3BLYA 3KWVA 2HYFA 5JAXA 3WDWA 1Z7LA 1CQTA 3UETA 2HVSA 2IS2A 4QQOA 3E97A 2C6SA 4BYYA 1SACA 3WNXA 5KR7A 3A0NA 4GDFA 2XJTA 2DUOA 5LK7B 1NQDA 2OBPA 1HQWA 1BYHA 1MSFC 1MIJA 4KQ7A 5FJKA 3BWGA 4AFBA 2E2HJ 2K9NA 5FKLA 4MQVA 3I9V2 3B6CA 2YSRA 3VBUC 2E63A 3TQNA 5F04A 5F7UA 4E7IA 1NQJA 3HRUA 2R1BA 1OI6A 2EZIA 3FE5A 3HL2A 2DA5A 2ZXQA 4RR3A 4IE0A 2R7TA 3OV8A 1SVOA 3MPBA 3NJXA 3AXEA 4NHJA 4AI8A 3MFAA 3C3WA 1LTEA 5HI0A 1R5ID 4QX5A 3TO6A 3LA7A 5C4WC 5DUWA 5D8AA 1X1DA 1B1BA 2DA3A 2P3YA 2K7LA 5D6FA 4NRPA 1DZQA 1WD3A 4EROA 3QYFA 5EZWA 2XAQA 1N3PA 1S0GA 2CUZA 1IXRC 3NARA 1LEAA 3K0LA 3PJRA 3OB8A 5FLMJ 2XF5A 4FETA 2ZFWA 4UV9A 1VE0A 2GMEA 1AR81 2XL7A 5IJRA 5JSRA 2HKOA 4RHV3 4BS9A 5LY2A 4IVNA 3DLLF 4X6RB 1UCRA 3SYTA 4AIJA 5GADJ 1RUNA 5FKOA 4XETA 3AMQA 2V72A 5L19A 1RKTA 3WHBA 1GSLA 3VBHB 4XF1A 5DS9A 2DI3A 5IAXA 2OU2A 3KLNA 3F8MA 2QQPA 2LP0A 3ZYHA 2Y6HA 4UB8C 4AQSA 1Y6IA 3IT8A 1MKMA 2DXIA 2EFPA 2XHNA 2WS91 2F4IA 4ZYDA 3G1LA 1I6HJ 3M3CA 1V6JA 4CCMA 1NK3P 4GAZA 4PI2A 2PHUA 2XWBB 2CU5A 3LOIA 2H1KA 1KS5A 1JHFA 4EM0B 2EIGA 4FPHA 1POQA 4H0EA 4FFIA 3GFJA 5KHGA 1FOKA 4K2EA 4JK1X 1ENSA 3L09A 4OMCA 2BZTA 2WV1A 2ARCA 3ZR6A 4L99A 1UG2A 1BBT2 1XTAA 3O8HA 1POV0 2WY7Q 3ABMH 1IXCA 3INAA 4E2QA 2Y31A 1Q8VA 4JGYC 4HSJA 3VD3A 1UZZA 1R49A 1OQ1A 1FX7A 5IW0A 3THCA 4AAPA 1RNLA 2OZ6A 3TEYA 3ZYFA 1DYPA 4BBSJ 3RIRA 2KJCA 4JGYB 4NO4A 4LK0F 4Q0SA 4HNUA 2QEXI 2VXDA 2RNJA 4N9IA 4CDQA 1GBGA 3LEIA 1ZBE3 4BQYA 1O91A 4NBQA 4UI9L 2W9XA 2WO3A 1YFXA 1XGOA 1GP5A 4X8PA 3F6VA 5FLJA 4UFJA 1NCQC 2NNNA 3AP5A 4W97A 4XSZF 1AKHA 2BJSA 2QQLA 1ZZ6A 5GLTA 4NC6A 2V9KA 1LJ9A 4XIDA 4LA2A 1RHI2 3SJMA 1UMZA 2IVJA 2VBWA 4E4HA 3O1PA 2HLEA 2JICA 2BWCA 4MGTA 1M06G 3OYBA 4A3XA 1AR83 4FAHA 4D3WA 1VBC2 2BWAA 1I1EA 4UFHA 4E6KG 3IH2A 3HRMA 4IE5A 1KYZA 3VKMA 4WM7A 2BW3A 2WZR1 4QGMA 3I3BA 4LB6B 1QVUA 1COV2 4KMQA 4AEDC 3ZDVA 3T3YA 1GV5A 4UUSA 3GXOA 3OSFA 3EMRA 3PDQA 4KWUA 3SXWA 4Q48A 1GZWB 1HSTA 4XLHA 1OQYA 2FDHA 2WS93 2WADA 5C3RA 1WMDA 4AEDB 1LOBA 1QOSA 1H8AC 3F8FA 5JR3A 4META 1G4DA 3MO4A 1DF0A 4A12A 1NLRA 2R7EB 4SLIA 4CDUC 4BIFA 2R5YA 4KBBA 2LKSA 4MHRA 4BUPA 2PHDA 2PN5A 5EGOB 2VB6A 2MD0A 3RKWA 3GZTB 3BTJA 2ZB9A 1CESA 4ATFA 2YPRA 5DCFA 4MXWA 3Q3SA 3NVCA 3BPVA 4CDUB 5EYXA 1Z05A 2DFIA 2R0FA 2BNOA 1QKQA 1ETVA 5M3FJ 1YOVB 2MD5A 4QIWN 4AL9A 4AVZA 5IYYA 4RLQA 1HQLA 2A6WA 3I71A 4A7KA 1VQ6I 1H1IA 3WX5A 1HOMA 4OHYA 2KHMA 2UYBA 1CWPA 1M4WA 3K2AA 4QHBA 4FT8A 3F0CA 2Y60A 2XUEA 4I02A 2V6CA 3GJBA 5FP4A 4Y13A 1X82A 3JRAA 1LFPA 4XM3A 1JHHA 5A6XA 1A3KA 1WW7A 3R6SA 2MEV1 2EB7A 4YW2A 1ZGAA 4D6QA 4ZXEA 3ELNA 4C30A 2VOPA 1JN2P 3GFLA 5E89A 1Y4WA 2VPRA 2DF7A 1V55H 2ZGTA 2VGDA 5FY5A 2VM9A 5A6QA 3SEZA 3AG1H 4IQ4A 4FI9A 1UOFA 1XMXA 2XGEA 4Z6YA 3ZXGA 4LLNA 2VMIA 3IAM2 5A7WB 3AMNA 3S57A 1KQ8A 2R7OA 3NAPA 1SD7A 3FDYA 4DNCA 2EV0A 1VBE2 1VQLI 4RAYA 2PFBA 2UUZA 1K45A 1N47A 2XGXA 1CPMA 3OIQA 3JSOA 2XPWA 2WO1A 5IK7A 4KN4X 4YGDA 1UYYA 5LW9A 4GIQA 2WFPA 3UV9A 1J84A 1YQ8A 4XLCA 4YVSC 2BY0A 1GZTA 1MS8A 1P4XA 1SMTA 2GC3A 2WZR3 4ASKA 5M0TA 2JQ7A 3SFZA 1VB2A 4MGQA 3T8RA 3EO6A 1DPUA 4Y4YA 4QB1A 5DABA 2J7MA 1H2KA 1KQ9A 1OISA 2VD7A 2YHJA 5FO7B 4UUVA 1MQTA 1AXKA 1TMF1 5JOYA 2PXJA 1XSRA 1EAH2 1V54H 5CAZA 2EXHA 2WC2A 1STZA 2V7FA 1YC61 3C7FA 5LASA 3VDDA 1RINA 1YUDA 2VL4A 2XWJB 2HKXA 4WX9A 3VDXA 1OOPA 4BMEA 3PIJA 2KT0A 2HDCA 2DK5A 5A7SA 4J1XA 4E7LA 1FWZA 2LFBA 1GICA 3HRSA 3MF6A 5G04L 4II3A 5ILSA 4YYOA 2NVTJ 1KU9A 2JG8A 2JT1A 3BU7A 3S7IA 3G6EI 1UZWA 4JQRA 3RZMA 5FZCA 2R063 4QTRA 4FBFA 2WO7A 5FPZA 1HV0A 4HSRA 1MZBA 2H6BA 2CFXA 5DYMA 5D5XB 5FXZA 5DQ0A 1DZTA 1IUFA 1U8BA 3U07A 2W95A 2YY1A 2MEV3 3A23A 5F5AA 3SDGA 2X5IA 5C3EJ 5K0UB 2AUYA 2BOIA 1W7PB 1NA1B 3THPA 5FRMA 2Q4SA 4DEVA 3BOPA 5I0TA 3B00A 1F35A 4ZZDA 3L9JT 3ES1A 3WW2A 2IC1A 3ZFEC 3POFA 1SVMA 4F7ZA 3RWKX 4QQHA 5ILVA 1B35B 4IDZA 2PHWA 2EJRA 4AWDA 4PFPA 1JTXA 2NMNA 5T3NA 3FXMA 3ZFEB 4LD5A 3CMAI 2R32A 1C8M1 1IS6A 4AI2A 3O12A 4MTEA 3SC7X 2YU2A 2HYKA 4ZHNA 5FPXA 3JZVA 4M3CA 1H2MA 4B4RA 2D6PA 4IPAA 4IX7A 1ZH5A 3M3IA 5EG0A 2VMHA 3WG2A 5AONA 3AG3H 3IAQA 4K20A 1Y7BA 3FJSA 2XV4S 5EPAA 4DYCA 1S5LC 3HSEA 1IHMA 4IEXA 4FX4A 1Q8PA 5JI9A 2PMHA 1BA5A 3RYRA 4GWIA 1ZA7A 2CH0A 3QH7A 1ZGJA 2JG9C 1JZ4A 2HWF3 2P7CB 1FT9A 4AC0A 4DW6A 4A7YA 2WQ8A 4JQTA 4FOVA 3BCBA 1ULEA 3ZXDA 3GTQJ 4GKYA 3CZUA 2X1CA 2IXKA 3UT0A 2KFDA 3I49A 3VZNA 1VQOI 3RSNA 3CCEI 2X29A 3ASIA 3Q0UA 4KDPA 2DFEA 2X1DA 3OUJA 1HDKA 2IPQX 1LDKB 3QYEA 3L2WA 1K5JA 3HUGB 2PMZN 3WNMA 5F3IA 5BNNC 2YV8A 4AUXA 4IW3A 1MDMA 4II2A 4RSUA 2ZAHA 5FYYA 4CCJA 3WCRA 3ORJA 1I39A 2V5YA 3J7MA 3POJA 5DUKA 4K1YA 4YIFA 5KNLA 1ZZCA 4R4ZA 4H3WA 2JB4A 4KT6A 4MGZE 3I3DA 1D1BA 1QQIA 4M3EA 1EPZA 1J1LA 1K83J 4FE4A 1G3TA 2B0LA 1BK0A 2B46X 2XGCA 3ACGA 1URXA 4J25A 4NN0A 2XPJA 3R0AA 3FXRA 1NT0A 3WDVA 1KFXL 3VBFC 1BK1A 4UW6A 3CJIA 1ULYA 4ESFA 4AEJA 4CH7A 1B59A 2BYVE 5FZOB 3PU3A 3L2HA 3IC7A 1UOJA 1J1TA 4J00A 1SEFA 2LBFA 5JVGF 3F8BA 1O8SA 3IP4B 3QLQA 2YXSA 3H0DA 2E7TA 4JV4A 1MMDA 4IRGA 1CX1A 3MN2A 5ACA1 4M72A 5BS6A 2EVXA 2DTWA 4CYCA 1XXNA 1MBKA 4LG0A 3UGFA 2Z42A 2QZ8A 2CQNA 1S0DA 1R1TA 1JKQC 3AYAA 1AL23 1AR91 3FL7A 3C3VA 4COZA 3KT4A 1BEV1 4E7ZA 3BTYA 4Z92B 1P7JA 1YO8A 2PLYA 1PK6B 3WTSC 1AXZA 4AVVA 1MMNA 3JQXA 4EN8B 2VKEA 2D43A 4XKVA 3DWLE 1MS4A 1SDDB 2NS8A 4XJUA 3X2QH 3CZJA 4G12A 4MYEA 5I0DA 2LRPA 3HVDA 4QPIC 2E53A 4LOCA 3GM8A 1Z91A 3ECQA 2JECA 4RBOA 1LKNA 4Q0VA 4HF2A 2UWCA 1IG3A 2JKXA 5H9SA 1ZYBA 1W9FA 5E6HA 4QPIB 5DM6F 4BY7J 4E4ZA 1UU5A 3BKZA 1Q8OA 2JENA 1VI0A 3QPLA 4OCTA 3H92A 1C8NA 1K3IA 4UUTA 1ETXA 1KDMA 3JSPA 2HOTA 3ZQFA 1LHNA 4TV7A 5IVVA 3M4OJ 3FF5A 5F6FA 1Y9GA 1U0JA 2GSYA 2RS52 5LBCA 1VF9A 2LMDA 2GOMA 1SFUA 2HEWF 1FBQA 2XLFA 1G8XA 1QEXA 3CMGA 4Q0QA 2W4SA 2LM3A 2ESNA 4D1QA 2WNVB 3UKVA 5FQ0B 2Y69H 1GP6A 1NCRA 1FC3A 4HL0A 4F92B 4LORA 5E88A 4P9UA 2M4GA 3CO2A 4RB0A 1NAEA 4LEJA 3K2OA 1BMV2 3WUCA 2XB5A 1R4NB 4QDSA 4Y33A 5FZHA 4CEWC 3WODF 4QHZA 3ZKUA 4PJMA 3ILFA 3WU0A 1BBYA 4W1UA 5FYZA 4FPYA 5DAQA 3GTJJ 2P37A 2FNPA 2MHFA 3KCXA 4IV3C 4PBPA 2XGDA 4CEWB 5ACA3 3S3MA 5IWFA 3E6MA 1XGMA 4MHGA 3GF2A 2JUGA 3U1XA 4YW5A 4BQ3A 4UW3A 3I2OA 1TME1 4IV3B 3O7OA 4DO0A 2VE1A 3TL4X 4FPCA 2VOXA 1QDCA 2LALA 5K7FA 1AR93 2I10A 2HZDA 3DYPA 1UWWA 3RYPA 1MBFA 1BEV3 3S0MA 3BP8A 1C1FA 1C0WA 1LHVA 2ID4A 1RUG1 1S4CA 4A45A 2EICA 3A7QA 2JJ7A 1ND3C 1R091 3A21A 5TJJA 1F36A 5FFOC 4O9GA 3CESA 4P9XA 3HD8B 2PHLA 1DU0A 3S1MJ 5J37A 2R6QA 3PJQA 3GBWA 2VBDA 2VZ1A 3WF3A 2ISZA 4XF3A 3IDAA 4LUKA 1BJQA 3GCXA 5A6ZA 3KLSA 2FNAA 2HOAA 3K2ZA 5GTIC 5KC6A 2RJKA 1ND2A 2C5DA 3RQ4A 1U5ZA 2LYCA 3WNLA 1GXPA 5HV4A 3TEZA 4V19K 1QJY2 4HV5A 4RGGA 2ERFA 2JIJA 1C3HA 1OLTA 1OR7A 2E5NA 3BG3A 2ELKA 1RL3A 2F4PA 4ZDPA 2LROA 3RKQA 3MIBA 4LO4B 1X1BA 4R9CA 2V1UA 3RZGA 5J1YA 1DQ4A 3JCUC 4U0YA 2RMU2 5FREA 2PLV1 2HWE1 1YWKA 3USSA 1OCPA 2VQHA 4AI1A 4YM2A 1Z7S2 5FY1A 1BL0A 5L36A 2R0QC 1L7QA 2I5UA 4OIOF 3MBWA 4ISRA 3UYJA 5A3WA 1Z7UA 3FX3A 4RGXA 2A71A 3KP3A 2DJIA 1DQ0A 1W9SA 1K12A 2VMFA 1FMD1 5F27A 4R9BA 4F83A 2P3KA 3P6BA 1SFEA 3JQWA 3TW7A 4BEHA 1HB3A 3I3QA 4N43A 1HB2A 5C9AA 2XOMA 1ZBA1 1TME3 1RUH2 4P5HA 1W2UA 4XUQA 4QSHA 3Q8CA 2WNUB 5C6CA 5E20A 5LA0A 1ETKA 4M00A 3GF6A 4LTAA 2I8DA 3EUAA 3HMYA 1WKYA 1T95A 1D2SA 1RUG3 3LSDA 2X6YA 3FFQA 4IQPA 1JTZX 3GTLJ 3BIWE 3GLLA 1NG0A 3VD9A 2QQBA 3FZ3A 1OH4A 2CW7A 1R093 3IB3A 2CL2A 2VKHA 2WQZC 2QQAA 4E70A 2L2OA 1IN5A 4XICA 3VSKA 2XQXA 2BBYA 2VL8A 1K6OA 5FP7A 2YC0A 3ES4A 2XAHA 5C7GA 2A6XA 4DZPA 4CUAA 4B3XA 1UZCA 5GP9A 3B01A 3T2QA 1BVVA 4HFSA 3KPHA 3RZKA 2P4EA 3K3OA 1X4OA 3OBAA 5C4XJ 5DN2A 2D6MA 2WBMA 1O4TA 1UYXA 5DZGA 5T52A 4C2TA 4P9YA 3A0HC 4PDWC 2RJ2A 3J7NA 2R4GA 4GXLA 2JE7A 1CAXB 1OA2A 4TZDA 5A1LA 1TP4A 3S5QA 2P6CA 4CCDA 2XSDC 4NMIA 1BC8C 1P6RA 4PDWB 2VJ5A 4H4KC 5FLXZ 5M5WJ 4G7HF 4JAAA 4LLFA 5I0UA 2J5OA 4LBOA 3N9NA 2NAZA 3ZYIB 2PLV3 1OKQA 2HWE3 5FZ7A 4LBJA 4XZUG 1ZKGA 1OLRA 2LUWA 1HKTA 2JMWA 3MD2A 1BW5A 3MKLA 3IPVB 5E17F 4FPJA 4HLTA 3V65A 4DXRA 2RVCA 3P5BA 2VQ0A 3RJPA 1QU0A 3RJRA 4ZH4F 4BMBA 5A1FA 4U7DA 3K4AA 2Y9ZA 1YQCA 3KP6A 2IA2A 2JDYA 3H5RA 5C5UA 3HG9A 5F08A 4XJWA 3CMYA 4YIRX 1AF9A 2L7ZA 1JE8A 1FMD3 2HTSA 1PO11 1SMVA 4NPMA 4MGYE 1K61A 4A93J 3MMYB 1ZBA3 4C3IJ 2XC7A 4HQEA 3JR9A 3G1OA 1JU3A 2JDMA 4CCCA 5JR7B 4KGGA 1SLAA 1M1EB 2EQRA 3ZMTA 4FPEA 3DP7A 4B09A 2CDPA 3USUB 2HI3A 1QJZA 1Y9QA 5JXGA 1EYBA 3N4MA 3FM5A 4GD4A 4M9XA 3B94A 4AHWA 2ZA9A 4Y1VA 4HG6B 2W52A 2F5CA 3K4LA 4C3HJ 2Q1FA 1BOBA 2PX9A 3BI3A 5FY0A 2ECBA 2BDRA 1C1LA 4U0WA 1DQ1A 2LF8A 3K1MA 2RNGA 4LULA 4BDZA 1MD0A 1DLCA 4XQWA 4UHTA 4GMP1 4BQNA 4H14A 1XPXA 1W2NA 4KJZA 2E1NA 2KDZA 5BMZA 2FZ2A 1FY7A 4HF0A 1QY4A 2EV6A 1WW4A 2RS11 5FKBA 2G0EA 1K5MA 2VNRA 5IATA 4MLOA 2GM4A 1BI1A 4YVWA 1TG7A 3T30A 2TEPA 2VN2A 4Q4W2 1FP2A 1WCMJ 1MR5A 3OYLA 1DGRM 3GFMA 3LL7A 4EGZA 1I5ZA 1X4PA 2K2SA 2ZZJA 5D5VB 2QQUA 2W3JA 1YHFA 1AR71 2DODA 2XIGA 2QZ3A 4BK5A 4LG3A 1S7OA 3PFYA 1BJAA 4Y26A 4L0PA 4X1EA 4NIHA 5KCMA 4KNYA 5KHJA 3D5OA 2UV1A 3FXUA 1WCQA 2DN0A 2DUPA 4M74A 3DEWA 4Q0PA 2M5WA 2L9RA 1IG7A 1ZRDA 3HJEA 3A03A 2B42B 3OYHA 3FZVA 3O2PE 4DZGA 4YM0A 2FOKA 3CC2I 1DQ5A 1HXS2 2VBBA 3CQZJ 1OVSA 4DPNA 4ES8A 2D7FA 2ZX1A 2CWEA 3CJRB 3HC7A 1ZR4A 4FISA 3ZMVA 1VBA2 5A3PA 1CAUB 4ITVA 3TBIA 1UZVA 4IHYA 4RQPA 3WF1A 3WF4A 3NNLA 3VBOA 3W9AA 1U5TA 3FXLA 3F2ZA 2NNYA 2Y6LA 2MG4A 3I2DA 3ZKYA 5LGUA 4GJZA 2XPVA 2PI0A 4COYA 3I4NJ 2IVIB 5A6YA 5D2AA 2FRHA 5FMDA 1F4AA 4L0YB 4IZZA 1YIPA 3BG9A 4R52A 1GOFA 3VBSC 2IA1A 1QHGA 4XOGA 1G9DA 5FMOS 3PIPF 5JOXA 5AVAA 4LOSA 4AE2A 3PNVA 5CU1A 4BQWA 3ZMOA 3FXKA 4GMP3 4FPLA 5C8CA 2JX9A 4YG2F 4IHTA 4DZJA 1XC5A 4MTDA 3BU0A 4ZDLA 1UPSA 1WRJA 5LEKA 1N75A 1W8HA 1UW8A 3JUUA 3K70D 3HJRA 2C0ZA 4A3DJ 1WA4A 4E7SA 1OA4A 4AYUA 5J7MA 2B4KA 1KEXA 1UIJA 3S3OA 4I3GA 2WZ8A 4KWLA 4AGVA 1PO22 4YM1A 3KMHA 3NRVA 3FXQA 2B9VA 1IRXA 4Y3OA 2FBEA 3I59B 3O6BB 1G9CA 2CSGA 1NG7A 4NQWA 3FC0A 1AR73 3CO6C 5AIQA 4N90A 2PJRA 1LJ7A 1QO0D 3R61A 3H8XA 3QH6A 2OUHA 1B8IA 2WWSA 1RXGA 4N53A 1SQ4A 2YFUA 1AZDA 4CXWA 1NUKA 3N7KA 2EALA 4HNVA 2ZACA 3AZXA 3WOGA 2E33A 3ZM8A 1UHWA 3I54A 4F91B 2CAVA 3I56I 2IS4A 1XQNA 2X4HA 4EN0A 5FZ6A 3A22A 1ZX5A 3GBFA 3EPZA 3SQOA 4LOTA 4AW7A 1VQ8I 2FZ1A 1VQ5I 1TNRA 1PDNC 4UVAA 4Z2AA 1UY1A 4GKXA 2NS0A 1JUPA 1EPWA 1SFYA 2RS32 1GVDA 2HOEA 2PJPA 2O8KA 4CXFA 2A7AA 1RUF2 1R71A 1GZCA 2HGCA 3OL3A 4M3FA 2L02A 3ZVXA 2EINH 3H1YA 2JDAA 4OULA 2XVGA 1PZ8A 2QQOA 3VKFC 4PCRA 5CLSA 3OYIA 3V4GA 3JRGA 5A2QK 2O8OA 1GWMA 3ZFFC 4CICA 1IGNA 4QX0A 5FPLA 3EHKA 4OYUA 2XASA 1BHGA 3CDLA 1HIXA 1J5YA 2C24A 5BXXA 1D8KA 2VKDA 4OUEA 1JGGA 1H9TA 3ZFFB 2CGOA 3AG4H 3WHTA 2GH8A 2JWTA 1UKGA 5F1JA 5HPOA 3JRDA 2DO7A 2OA4A 2WTEA 4MIMA 3K6GA 3LDRA 2IZWA 2MPFA 4BXXJ 3CD6I 3ZRGA 4FX0A 1JT6A 3ZXEA 1RHI1 3K75B 5F6LB 5A3UA 3M1CA 3HZJA 2I45A 4BQAA 1WD4A 1A8MA 4GH4A 2QQ9A 4Q8KA 5HBAA 1D0YA 4QX7A 3WCSA 5DD8A 4Y1UA 4XBLA 3K3NA 5CBLA 1MS5A 2VT3A 3F9KA 5FK8A 2D98A 2Q2EB 1XE7A 4G7ZF 1CGPA 1H4HA 1COV1 5F5QA 1YQ2A 2ARXA 2FX0A 2WAAA 3K7AJ 3PM1A 2EPFA 3HOYJ 3ONQA 5GLWA 3ACLA 1UHMA 1TZOA 2OD5A 2PN6A 3V42A 1JYCA 5FMOL 4ARYA 2DLLA 3SFIA 2OCEA 1YJKA 4I01A 4BWOA 2E31A 2J1SA 4GCVA 2FCUA 1WH5A 5JHFA 1FOD2 4UF0B 3FBIB 1MJAA 2P34A 1DU6A 2DV9A 4XILA 3SH4A 2WA4A 4HN1A 4H2AA 1UD1A 3DCFA 5HNFA 1XU1A 5FGMA 3V8LA 1POV3 4BHCA 4G7OF 2DPDA 1BBT3 2E51A 4AI0A 4DUXA 5LEJA 5JPNB 4IRHA 2ELJA 5EYRA 1H6XA 4ATEA 2DBIA 3ISPA 1U8RA 2BRTA 5FPAA 5EDNA 2KISA 1ZZ9A 3OPTA 1O59A 4IV1A 3TEDA 1JKRC 2R073 5CKMA 5DCMB 1OURA 5LCWL 3L2YA 2RDPA 3ZOIA 5JCTA 5J1XA 2P6TA 2VCAA 3NJVA 1HSJA 2D93A 2EV5A 1LGCA 2KA3A 4YW3A 4XONA 3DKWA 3M3YJ 2WFF2 4XNFA 4Q4Y2 5JZGB 1WLWA 1G3SA 2RVAA 4YZ2A 4ZU5A 4XCBA 4AFMA 1U78A 4AGRA 4OHVA 1ZYRF 3CNAA 4XVHA 5C3SA 4JX0A 1DP3A 2PFWA 3BR3A 1RHI3 1A78A 2HQAA 2ZJ2A 2IJLA 2YUSA 5T5PA 3WTYC 4D7SA 1SFXA 2UY9A 1VBE1 1GXQA 3OYGA 2VC1A 2LD5A 4NB5A 2A3WA 4HPKB 2A68F 4BBRJ 1W6PA 5ISLA 1QPIA 5FZLA 4KWKA 1VBC3 2EFWA 1U6GA 3VDBA 4A69C 2JIGA 4HNTA 3GVAA 4XFAA 4E4SA 1TQ5A 2UY8A 3L7WA 3J7YJ 3AC0A 4BK4A 4CU9A 2XG3A 2Z9OA 3GYHX 1COV3 4HBNA 4WWCA 2YPDA 4DBQA 3PUHA 5CFDA 1PM4A 1E3HA 1IG0A 1CD3G 3ZSJA 3AP4A 3O1UA 4FFGA 2G7HA 5JXHA 1LU2A 2ECCA 2OT7A 1BJZA 4QX3A 4XEZA 4KNCA 4CZZA 2HS5A 1EAH1 1KONA 4DUWA 2QVSB 5FO9B 2ZX2A 4MGSA 3BC8A 2ZOEB 2D44A 3BTZA 2NVXJ 2D6KA 4ZTJA 1R22A 2WT2A 3JB4C 5LBFA 5JUVA 1TEIA 1ULGA 4FCAA 2ZKLA 5ABJA 5LA2A 4TSVA 3HGGA 1FSEA 3WTWC 5T54A 4BY1J 1R4MB 1LHOA 2X85A 4JQFA 1W06A 3AMHA 5TRDA 5IP7J 2K02A 1B9NA 1GHCA 1A04A 2YYOA 2Q5TA 1GWKA 2Y0MA 1W99A 1PMJX 2WYFA 4ZDOA 2IGKA 1D2QA 5BOXA 4UFKA 1YX5A 4NDLA 4KWJA 2FD8A 4I0AA 4IL7A 4GRIA 1YW7A 3J7AY 4AU7A 4QX1A 2VO5A 2NOGA 3S93A 1BR2A 2MNGA 1MH4A 4LKSA 2MLKA 3IKTA 1IS4A 3ZMDA 1D0ZA 1VJ2A 2J1VA 3QPTA 2VOTA 2JDHA 1VQ7I 4P9WA 4EN9B 1HA8A 2CAUA 5K7PA 2DCEA 2CNAA 2DUQA 4FPKA 4LGWA 4LK1F 1K78A 2BERA 3F95A 5GM0A 1VBE3 3T0BA 3KT1A 1PP8F 1UHSA 3VZKA 5LHGA 1DCSA 5HDKA 2JA7J 5L7OC 1RUJ2 2TUNA 2R5ZB 3OSGA 4A42A 1C28A 2ET7A 3K4CA 1R1A2 5IOZA 4BXFA 1HQCA 2VJ4A 2X6WA 3QCWA 3MZHA 4AVTA 2IXHA 1OD3A 4LO8A 2W2IA 1V5GA 3PNTA 1H30A 3A0KA 1V6MA 2VBXA 1RC9A 4Q29A 5IK5A 4IE6A 3VBRC 2KP6A 1R64A 4L5JA 4C91A 3KE2A 1UF2C 1MEC2 4LITA 1ZG3A 2XAGA 1W2AX 2WA3A 3N7JA 1EAH3 3HPHA 1ZLKA 4MV2A 1BN5A 4CCKA 3CHXA 3R4UA 3H3VK 1XJAA 3H5NA 1IZ1A 1QJFA 2X09A 4LT5A 5CPRB 3VBUA 4XPVA 1A36A 5BNGA 3VKOA 4QKDA 4JCKA 3QODA 5FZ1A 3SH3A 5FZ9A 3OY8A 1VAVA 3FBNB 2Q8EA 4CU7A 3V7CA 4CSWA 5DDJ2 4M3DA 3EUKL 4PUSA 3KCYA 3RDIA 1N25A 2BV4A 1SPPB 4UY8I 2WZPP 4KI5M 5FD6A 1VQ9I 5LK5A 4B43A 5BYNA 4OHZA 5C4WA 1I9RA 4A3EJ 4RGRA 4YFNF 3ZYBA 4QMAA 5IFPA 4IEWA 4BM8A 4CXXA 3HPNA 3EB7A 1IS5A 2J1UA 3I4PA 1QDOA 5GPCA 1LE8A 3T0YA 4A41A 1F4HA 3AL0C 4ZTFA 2W1SA 3RPQA 1XX5A 2VNGA 5FYCA 2ADUA 1RUE2 2EXKA 3AL0B 4QWQA 1DGRA 2A3YA 1Y0NA 4OWRB 2XRNA 2GNMA 2VQUA 2QBYB 3PQKA 3M3QA 2AEZA 2YROA 4PJLA 2KL4A 1RI7A 3IDBB 3OWTA 4V2WA 4HX7A 3WT3A 5JMCA 3E5QA 1H6YA 1C8M2 3C8XA 3WD5A 4JRAA 2LF7A 4MOAA 2DPUA 2XJUA 3ZO0B 2W7NA 5FLIA 1LESA 2V1XA 5EJCA 3P7NA 3HNBM 1L7RA 1ULCA 2PQSA 2DVAA 4FPOB 1W3XA 5F9TA 3CCQI 4B7EA 3KM5A 1DDLA 3WTXC 2VCBA 3SISA 4LBQA 3L2UA 3ENRA 3QU3A 5FV3A 5LATA 3BTXA 2AGSA 1MPXA 4YGBA 1TQIA 4U87A 5LY1A 1JZ5A 1E57A 4D7NA 1MS1A 2E7AA 6PAXA 3AKTA 4CP2A 1S6LA 2COBA 2E2JJ 2NLRA 1O4YA 5IVFA 2FBKA 2FOWA 4XL9A 4RS5C 4RR3B 1PIV2 2WABA 1I27A 1TTYA 3UKGA 1NCQA 1HKSA 4BLJA 4HDVA 1Z21A 1AA7A 4LKEA 2VQTA 5KHKA 5A3NA 2WY8Q 2IXCA 2H09A 3KZZA 4MG2A 4F3QA 5D8AB 4XBNA 5GLZA 1EH7A 3WP6A 4NHYA 4NRQA 3W5MA 3QWLA 3H3ZA 2XKOA 4KYWA 2VQGA 3C7JA 3ITQA 4A6OA 3O0XA 3IHUA 3I5UA 3TEWA 1TNFA 4F52A 2ZNYA 3DBHB 1WJEA 2RS51 1I3HA 3RCOA 1EF4A 5FP3A 1UJ8A 1Z67A 3CF6E 1AYN2 4DBRA 3IAPA 1IN4A 4AEDA 2CQXA 4KN7X 3ZPLA 3I0TA 4EM2A 1UZYA 2DA2A 1WGXA 1X58A 2C1FA 4B1RA 4I3PA 2MH2A 4IO9F 1CZTA 3I8TA 1BMV1 3M1EA 3K46A 4JX4A 2X0LA 1JKOC 4YW6A 4ENKA 5E3NA 4M3CF 4B29A 4RGKA 1LU1A 4JGZC 1FBSA 4V2FA 4YW1A 2AACA 2DU0A 1GNHA 1ETQA 1I5PA 2QSHX 4G6QA 2ZXJA 2D1VA 2ZMEC 3IKVA 2NM1A 2LKXA 1IZ3A 5FZEA 4LBQD 2UU8A 5A1AA 3HKZN 5BPIA 4N8MA 1JU4A 4AK3A 5DEQA 1WLCA 3TDZC 4PQ9A 5IY5H 1JOBA 1HLVA 3PU8A 1J09A 3IH3A 1NZCA 3BJ6A 4LPLA 4CDQB 4MNUA 1LOFC 3KV4A 4M0HA 1I3QJ 1YJLA 4L18B 1DDNA 2CTVA 4E27A 5FWJA 4OHWA 1BOAA 2W85A 2O1QA 3W6KB 4Y7NJ 2BBAA 4RFT0 3DKYA 2RDNA 4GWJA 2KZVA 5H6RA 5JR2A 1AKHB 5A7QA 2OYZA 5FYIA 4QHOA 5D5WB 3AZZA 5D4RA 5E18F 3OYFA 5LHHA 3HGYA 4GB32 1G3WA 5FIXA 1PMIA 1TWHJ 4AR2A 1UOGA 1SFOJ 5C3QA 2F4OB 1QJY1 1UMHA 4WM7C 4I6ZA 3H3UA 3HBLA 3JRFA 2L9VA 4JDMA 2BVMA 1YRNA 4YVSA 4RGSA 2RS53 2PAEA 1SAXA 5C3PA 4LKFA 2VC0A 4WM7B 2BW3B 4XFIA 1JJ8C 2EFQA 1MZ5A 2OS2A 2RMU1 3WE2A 4XJ8A 1FIAA 3I58A 4UUSB 5EJ3A 4JTOA 1HW5A 1ST8A 1F9KA 1Z7S1 4YPJA 4DXZA 3TN93 3KV6A 1CVNA 2D97A 1OUSA 4KUMA 3ZYRA 1RRJA 2PHRA 3I97A 2ZX0A 1SEUA 1RUI2 3CBNA 4EJTA 2EWNA 2W68A 1HQNA 2P8TA 2V9VA 1JTYA 4MXWB 2PHTA 3LAPA 4LR4A 1WZ2A 3TYJA 4DY3A 5FTTC 1RUH1 4HA8A 2JD9A 3N7MA 2EFNA 2A05A 3G2BA 4XUTA 2W08A 1L0OC 2WAQA 2PYTA 1KGSA 3V0AA 4NIDA 4EJWA 4OLLA 2Z79A 4CUBA 1W7PA 4MFEA 2Z4FA 4XCAA 5A3TA 1W90A 3OEBA 4WM8C 4HW0A 2ZBJA 3KZYA 2K0GA 4M6YA 1F1ZA 2D5VA 3HHGA 3VV1A 3OOUA 1ZZBA 1UFMA 5EIYB 1XSVA 3HT2A 4EE2A 3LGRA 4HSLA 4LMYA 1HC8A 5E1RA 1SMYF 4P96A 1E3PA 3ZFEA 2G7UA 1FPN2 2E1MC 1R5HA 3BDDA 4V2GA 2XJSA 4PCQA 3ZFGA 2RAEA 5F37A 3WGIA 1Z9CA 4L97A 4DOZA 1KQRA 1QJY3 1X9PA 4F55A 4EGYA 1UAAA 4QXKA 3CCVI 4EZHA 1UCXA 4A3GJ 1MMSA 1QWRA 1YQ5A 3O0WA 1J7KA 1LOAA 3HOWJ 4GA9A 3JB8A 4Q27A 3ASOH 2UYAA 1OCOH 1PGL1 4MHUA 1YCIA 5D21A 2RMU3 3WQBA 2P4WA 1ZRIA 1T2KA 4UFIA 1Z7S3 3CJQB 3HT1A 3W59A 1OCCH 5D1IA 3RJ2X 1YO5C 2FBIA 4X0GA 2JG9A 1VBB2 4ZKTB 4XMIA 2IFWA 4XUOA 1S0JA 2ADEA 2CU7A 3NWKA 4KGQA 1MJBA 3H1WA 2E1CA 4OU0A 3FBYA 3VDDB 2BGOA 2D45A 2DVFA 5FRAA 1RUH3 2IS1A 5H6QA 1Y8QB 5BNNA 1O5UA 2R042 4XF9A 3CUQC 3IMMA 3F23A 4B1LA 1W0UA 4QT6A 1MH3A 4IEYA 2EIKH 2VVDA 2A69F 2JG8B 3S14J 3WG7H 4JOMA 4JDOA 1VQ4I 3BG7A 1LVAA 2VCCA 3OYKA 3ZLIA 2HWC2 4HOOA 5GALA 2FUG2 4OZOA 1BXHA 3KETA 4XLFA 1YLLA 3AZVA 3LA2A 2EIMH 5FP9A 1SCSA 3DU5A 3MICA 4FFFA 4XHBA 1X9TA 5LZ6A 2X5IB 2FDGA 2CQ7A 2XB0X 3C2HA 1GLHA 4ZU4A 2YB7A 5CFCC 3PHMA 4HANA 1MZ6A 1PUFA 4QPGC 3VBFA 5FYMA 2OZJA 2RQQA 3MIFA 1RZ4A 1RJ8A 3X29B 5CFCB 1XNCA 2GC1A 2Q8KA 3E1SA 4KT5C 3W20A 4OHXA 4EWEA 2F5DA 4RL7A 4BB3A 3SZPA 3CDHA 2LTNA 3I4IA 4IESA 4D8MA 5LLQA 1JS9A 2VJIA 2R16A 4Q4W1 4JKMA 3PVOA 4CUCA 4FSJA 4RAZA 2DMTA 1HRV1 1POGA 5B1BH 4YIIA 4BGDA 1R5GA 1OVPA 1FMVA 2EK5A 1ETYA 4XXAA 4M3CB 3UJOA 2HQRA 4R8HA 2QQWA 5EG0B 2I74A 1ZQ3P 2GAUA 3OGRA 1VNDA 2XVLA 1SLBA 3HTUA 4P9FA 2O7OA 4AIHA 4FOYA 1E2XA 5DTDA 1CONA 1LHWA 3ZMNA 1KQ0A 5CIRA 2R49A 1UOBA 1OFSA 1JUMA 2O8QA 3LA3A 3P9IA 3HAGA 5EZGA 1PO12 4AVAA 4W6WA 1NTCA 2DMPA 2AEYA 2VZTA 3FHNA 4XC9A 2DURA 3SCGA 1YX3A 4XORA 3CL1A 2W1WA 2G9GA 2NMOA 1HXS1 1APNA 4XHXA 1DZRA 2L4AA 2XBO2 4GWNA 3O1VA 2RR12 3IN9A 2K4BA 5F8PA 3HEFA 4WVZA 1VBA1 3ZXKA 5FXWA 1WW5A 3A4CA 5KAFC 3HDDA 4LBMA 4WVVA 1LENA 1WBFA 5D5UB 4WF2A 1MDMB 2F48A 4K9SA 2E19A 3U21A 1WMEA 4XRSA 5E16A 1T38A 1W6QA 1ZNPA 2J1EA 3UL2A 4YGCA 4LKDA 2NVUB 3WDUA 2DCKA 1SLIA 2W91A 1DFQA 1VBD2 1Y43B 3ILNA 3E3VA 3WE3A 4CO8A 4CEYC 4TN7A 1A34A 3BPSA 4QWNA 5LA1A 4IJAA 5FY7A 3IKWA 3FIWA 4RGAA 1G6NA 4XK4A 4GMP0 2Y0IA 4E2GA 2ZMNA 2MC3A 4KMUX 2RGVA 2RS12 2HVRA 3CU7A 3CJIB 4YW4A 1YW9A 2DQLA 3AVSA 1WJ5A 1UKRA 4HXCA 1QH6A 3SKJE 4CDXC 2LBFB 2IXSA 4KG8A 5FCCA 1ZLJA 4Q4W3 3T2TA 3WVJA 1A8DA 4IV3A 5EQUA 4EZ4A 1QNWA 3E5XA 3OF1A 4K8FA 1PO21 4FASD 1N78A 1UY3A 4Q4V2 5J3UA 1WA6X 4CYCB 4W6XA 3K77A 1RETA 4LG0B 1CJDA 1QPMA 1IQAA 3ZQHA 5FKMA 2CGNA 2KJBA 4UNOA 4HDUA 1D4M2 1A6CA 2L5QA 1T0FA 1H4GA 4NHXA 3SHFA 4R1HA 3V8JA 3G3ZA 2WT1A 1ND3A 3SLIA 4G8XA 5KHDA 5HXVA 4Y17A 2HBTA 2MBFA 1XYOA 1HXS3 3LFUA 5ICEA 4CU8A 4S2GA 3AYDA 3SMHA 4CDGA 3CCUI 2OTLI 1VBA3 4DXSA 1XSXA 4CP9B 4YZ5A 1I1SA 4H55A 4GULA 2OIIA 3LQCA 2KM2A 2GNDA 3DL3A 4DFSA 4A3BJ 2RS31 2DJNA 4ZYAA 3AB0A 1RUF1 1PVC2 2DWRA 2G9ZA 1DLLA 2AHQA 1XDSA 3GZ5A 4I30A 2WDBA 4IETA 1SVLA 1JUSA 1MVEA 4RDUA 2VZOA 3AKQA 3GWZA 2DDAA 3WTTC 3FMRA 2YGMA 1PYVA 4RMNA 1CZVA 2NVYJ 4DYRA 2OVUA 1FJLA 3ZSKA 4RAFA 1BQPA 3GTOJ 4HVQA 5LRRA 3DPUA 3QOEA 3PNAA 1ENHA 4UW4A 4Y5Z0 1CF7A 4QGNA 3OOXA 3CCRI 5CNAA 2LDUA 4D0QA 3A02A 4XTMA 4G9SB 3NKTA 3MIEA 4K3UA 1MBGA 4OUSA 3VSLA 5EZHA 3SZGA 1HBXG 1J3RA 4PIZA 3RYKA 4W8JA 3KSCA 4JHZA 2V09A 2GMMA 2OQGA 1YTYA 1QJEA 4EWDA 2WJSA 1P2FA 3QU6A 5J98B 2EH3A 4LFUA 4XF0A 1PO23 3PQJA 4JX6A 5ANNA 1Y39A 3VBHC 3HXLA 4HX4A 3HOVJ 5CG8A 2WB1N 2CWMA 2DYSH 1XNAA 4Y22B 3L1PA 2BNMA 4XUNA 3KVBA 1EUUA 1QZYA 5H2FC 2VG9A 2WLPA 1D5YA 1IC8A 2QENA 4BA6A 4IHXA 3OUIA 2YUEA 4A7ZA 4BE3A 1W2OA 3H0OA 1X19A 1YIOA 3J8F2 3WQ0A 2YX7A 1OPOA 1O3TA 2B8MA 2ZJQF 2BV6A 2ZX4A 2A75A 3T1BA 5FZ4A 3RKYA 2ZEYA 2Q8OA 4PJYA