3RPQA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
201
structure length
201
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILFYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 60
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rpqA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rpqA01
2JT1A 4ZU4A 3UKNA 2P5KA 5L3GA 1D3YA 2COMA 1J1LA 1FBQA 4PDKA 2OQRA 3ST7A 4KA4A 4ZZDA 1C0WA 3ZPLA 4B29A 2IXIA 4R1HA 4KIBA 3G3ZA 3ELKA 1KQ0A 1XE7A 1Z7UA 2KIMA 3CJNA 5LHHA 3E3VA 2IVMA 2V79A 3K69A 3R4KA 3R0JA 1BM9A 1QXJA 2XKPA 1U2WA 4LLLA 1EH8A 2GA1A 3LQQA 3ZN1A 1OFNA 4MV2A 4JVAA 1KYWA 2GZWA 4G7OF 2HKOA 2WC2A 1UB9A 1P4WA 4MGIE 3DF8A 1TNTA 1CF7A 4WCGA 4UHTA 3Q9VA 2XRNA 3HIFA 4K8FA 1H9TA 3RPQA 3GO5A 1R00A 4RGSA 3RKWA 3EQLF 2QYOA 3TO7A 4Y13A 2PFWA 3GYDA 5DCMB 5BMZA 2PFBA 2XLFA 3CUOA 3HTUA 2LF7A 1QBJA 3LWFA 3WW4A 3M3IA 1SD4A 2FMLA 2D93A 2C0ZA 2DK8A 2XL9A 3K1MA 3QACA 3C7JA 4HAMA 3I4PA 2O0YA 2E1NA 5HS9A 1G3SA 2VN2A 5L3BA 2ETHA 4QM9A 3WG9A 1NE4A 2Y0OA 2DW4A 4ZYGA 3MQ0A 2YX4A 1TLHB 4LUKA 2O8QA 1CAUB 4A2UA 5BV6A 1CGPA 2HR3A 2H6CA 1A04A 4IEPA 4XRFA 2ZXJA 2L02A 2JTVA 3R6SA 1RZ4A 3L09A 3F8BA 4OMZA 3KZYA 3QOPA 1DUXC 1YIOA 3KFWX 3WODF 3F72A 3LA3A 4KWKA 2V1XA 4HBLA 3FXQA 1YTYA 1D8KA 4UV8A 4AQ2A 2QWWA 3T1BA 1Z91A 4GYGA 1DGWA 5LBQA 2K9ZA 5HLHA 3IKVA 1JGSA 2E1CA 4HSLA 4L0ZB 1W7PB 1FSHA 3WTVC 2H09A 5C6CA 1YFXA 4XF4A 4E2GA 2GQQA 3VFZA 1WLTA 4AVCA 4QX5A 4HLXA 3OD0A 3DL3A 1XSDA 2Q8KA 5E16A 3KP3A 4Q0PA 1WKMA 3MCZA 1Q3EA 1PM7A 2GH2A 1YLFA 3LAGA 1LDKB 4TLFA 5DD4A 2DAOA 4KT5C 5E8GA 3BALA 3KP7A 1ZN2A 4Q0SA 4Z07A 2DU9A 2HYFA 2Z5UA 2FA5A 4WX9A 4CZZA 3RTRA 1IAWA 4O6JA 1H0MA 4N0BA 3ZMDA 2GC1A 1S29A 2RN7A 4LFUA 1ZVFA 2A6HF 3DFGA 1Z6RA 2VECA 2HZTA 4BH9A 5LHGA 1HSJA 1R58A 3ISPA 3WGHA 4M6XA 1QZYA 4NQWA 5LEJA 1J3PA 5HS7A 1CAWB 2FOKA 2M8EA 3KZZA 4JTNA 2CW0F 4DQ2A 1OKRA 3NVCA 2BEOA 2CQKA 4EWDA 1YQAA 4HN0A 4LGWA 3ECHA 2VXZA 5CU1A 4LB6B 1DPUA 1WGPA 1ZNPA 3I53A 3C1DA 2OBPA 3M70A 3BY6A 4ENNA 4XF1A 1LEAA 5ICEA 4IERA 5BY5A 5KBFA 3KP4A 2B0LA 4N9IA 2MH2A 4WF2A 4A12A 3BB6A 1ZLJA 1TBXA 3FM5A 3U11A 2FNAA 1O5LA 3BP8A 1YLLA 1O57A 3UKVA 1S7AA 1P4AA 3KMHA 3RYKA 4PGHA 4AVAA 4M9XA 4H0EA 3L2CA 1UD1A 3CF6E 2V1DA 5JR3A 4Q47A 5L3EA 4MTDA 1H9GA 4LD5A 4HLTA 2N7GA 1ZRFA 1TQPA 5I8YA 3TO6A 4LG0B 1XMAA 4HX8A 5HDKA 3COAC 3L2HA 1T38A 1QZZA 4HN1A 4EVIA 2NAZA 4EM0B 2OZUA 4XFAA 2O1QA 4LB5A 4QGLA 3SCFA 3WW2A 3OTFA 1LR5A 4I0AA 1XGSA 2A61A 4ENMA 2HJIA 3RDIA 3O2PE 2R7DA 1ZRRA 1ODDA 3WGGA 3ROUA 2ISYA 2CSOA 3PQJA 4QXKA 3RYPA 3TNPB 3GVAA 3JTHA 3O3KA 2D1VA 1J5YA 2WFPA 4HBNA 1NYWA 1OMIA 1R7JA 5DCFA 4A6EA 1FYKA 3S0MA 1SD5A 2WV0A 2ZCWA 3I54A 1R1UA 1D5VA 1J3RA 2DI3A 1FZPB 2UWMA 2XL7A 2HS5A 3Q5FA 4ZZLA 1ZYRF 1UHMA 5D5UB 3LAPA 4HF2A 3V4GA 1EYBA 4FHTA 5BS6A 4GGGA 4EGYA 3HRSA 3U2RA 4CICA 1QQIA 3TOBA 5CVIA 4RGXA 1FPQA 5KHIA 3NSTA 3MZYA 5E18F 4L2NA 5ERIA 4LK0F 1RIOH 1BI3A 2IXCA 5HS8A 3V7SA 2HEOA 1YFWA 2X0LA 2Z99A 3T8TA 1SEFA 1VJ2A 4BXUA 4M72A 3FHZA 1QY4A 3W6JB 3LAJA 4OINF 3K2ZA 2QBYB 3DPTA 4OIPF 5LGNA 5E1ZB 1GVJA 3F22A 5BPXA 4MEXF 3QP5A 4M9ZA 4HSJA 1F4KA 2PMUA 4HVQA 1O7FA 3BROA 4LLNA 1GXPA 3F8FA 1LB2A 3I59A 2NRAC 1R22A 1EH7A 4MEYF 3EETA 2G7UA 2XASA 1FBSA 1YUDA 2RVCA 5CLSA 2IC1A 4RAZA 2ZNZA 1ZAOA 1TW2A 5HVQC 4ESBA 2MBFA 2ZFWA 1OYWA 2Y75A 2B8MA 2MD5A 1T0FA 1Z1DA 1ZARA 1IN7A 2JPBA 3HOTA 3VB2A 4YSFA 1KQ9A 3JAMK 4AQ6A 3VHRA 5K5RA 3BWGA 3PLQA 4HV6A 4EQQA 3LA2A 4IEWA 4IHSA 5J8FA 3P9IA 1ZZ9A 2ZMEB 3SQNA 5IT3A 1E2XA 1XSXA 2O6GE 5AONA 4L11A 4CXFA 4FAHA 2IA0A 2EA4A 3ZMUA 3SZPA 4BIFA 1W7PD 1XD7A 4FX4A 2AXLA 3KLNA 3RYRA 4IRIA 1XGOA 5LEKA 3EYIA 1G6NA 2P4WA 3IWFA 4G8XA 2D40A 5EZWA 2FQPA 4G9YA 2CWEA 3GX4X 2VPVA 2FBKA 1I1GA 1BIAA 1YS7A 4YG2F 1U6GA 2ETEA 3REOA 3IRQA 5AIPA 2OPKA 1OD5A 1V70A 2V1UA 2IT0A 3RPUA 5E20A 2C6YA 3BPZA 2UYAA 2GIVA 1HKQA 2DK5A 2W84A 4M74A 4P5OA 2KKOA 3TNQA 3H8UA 3E5UA 3V8KA 3MAJA 3F23A 4UVAA 1U5TB 4B09A 4BHBA 2Z2SB 4OIQF 2L54A 4LUMA 2OA2A 3H92A 5L3CA 5LRSA 3BJ6A 5KVRA 2XAGA 3KEOA 3VEPA 3N4MA 4KWJA 2FF4A 2PQ8A 3HOSA 1J3QA 4ENKA 4L9JA 2UYBA 2PI0A 2A5YB 4XBFA 3HSRA 4R79A 4U7DA 3G73A 3NW4A 2W25A 3F8CA 2DTRA 1P4XA 3DP7A 5J48A 3FWEA 2KXLA 4YIFA 3WE3A 5KK1A 3P7NA 5JHUA 4ONUA 5D5VB 1TW3A 2XKOA 1UIJA 3D0SA 2PEXA 1QPMA 4GCVA 4MGYE 3ULQB 1GQHA 5D5WB 3SCGA 2BE5F 3NRVA 2GC0A 4WXCA 4MTEA 3TDUC 2GAUA 2M45A 5K5OA 3NJZA 2WTEA 1IXCA 2XVCA 5K1YA 1LRHA 4CGZA 1UCXA 3RIRA 1TQMA 5K5QA 2MHFA 1O3SA 3FZVA 2VT3A 4XSXF 4RS8A 1HKTA 4EROA 2K0GA 3E5XA 3NKTA 5FB2A 4HDVA 1T98A 4M9SA 4EJOA 3KE2A 1ZGJA 1YW8A 4XF3A 5I8TA 2O3FA 1EH6A 2OD5A 2E9QA 4UXAA 4Y17A 1ZH5A 1X8EA 4EJVA 1YW7A 3I71A 1HKSA 3FZ3A 1Z05A 5DCMA 4BHPA 1IW7F 5EEGA 1F5TA 4BYYA 4XLPF 3GXOA 1DZTA 4IEVA 4N9HA 3JZVA 1SFXA 4UVCA 1QXRA 1G3TA 4M71A 1ZG3A 1IN4A 3M9AA 3ZDSA 4ZU5A 1PDNC 2FNPA 5DV5A 1WA4A 4B8XA 3ES4A 3F6VA 3K0LA 5CJ9A 2Z3YA 3V8LA 1Q1HA 3WTUC 3C3VA 1O3QA 2PMHA 5EFUA 3ZMTA 4WWCA 4WVZA 1WSUA 3FXRA 1G3WA 2P6TA 1TNSA 3B73A 1HSTA 4A5MA 2IW5A 5I91A 1P2FA 2HQRA 1CAVA 4MQVA 2PQQA 2YR2A 5JI6A 2D2WA 4AWXB 2LNBA 3FFQA 5CVRA 4KNYA 3MWMA 2H0VA 2JRTA 3TO9A 2VT2A 4OMYA 3HHHA 4QLCU 3BDDA 5FPXA 2VQAA 4XFBA 1YO5C 3FHIB 4L0YB 1I27A 2EV0A 1LDJA 2QENA 4L5JA 3E6CC 2IPQX 5E1RA 1EV7A 2PBIA 2K4JA 1ZRDA 3IBMA 2A3SA 3SXYA 4IHTA 2OU2A 5D8KB 1L0OC 2L01A 1OI6A 2EAAA 3NQOA 3MPBA 4I3PA 2GXBA 1KU3A 1JHFA 2V9VA 3LA7A 4QMAA 5JSPA 1XMKA 4WXHA 1FP1D 1S6LA 3BJAA 2IXHA 5CVVA 4YRDA 4MNUA 4UBHA 1AWCA 3IKTA 4ESFA 4NVPA 4O9EA 4MQ9F 4O9GA 1GHCA 1O7LA 2Q30A 4UVBA 1Z6TA 3EQEA 1CAWA 4RAYA 4JBAA 4D7TA 2V6CA 1B1BA 2QZ8A 2ZNYA 2EFPA 4HMZA 1T2KA 1XB4A 4EM2A 2W85A 2XLAA 3GZ6A 3CO7C 2VE8A 4G6QA 4L9VA 2P6SA 1K78A 1OPCA 3S2WA 4J1XA 3GBFA 1I6XA 3EO6A 5LRRA 2NNYA 4F7ZA 1MJ9A 3ZP5A 2EV5A 1FBUA 2FSWA 1BC8C 1ONVA 2XUBA 2IXJA 5HOOA 4LA3A 1ZGAA 4Z2YA 2EVXA 3SXWA 1EPZA 3WE2A 5BQTA 5A2QK 1DP7P 2Q1ZB 3BU7A 3T8RA 1IRFA 2LKPA 2JZYA 3S7IA 2XAQA 2EV6A 3QU3A 3GWZA 2EJRA 1LNWA 3EDPA 3V7CA 3VOEA 4MGRA 1T39A 1PP7U 2QVOA 1SD7A 1U3EM 1WI9A 4L18B 2AS5F 1H1IA 3MYXA 1R36A 3FE5A 1WWXA 4BHCA 5E1WA 4KYWA 4CDGA 4IEXA 2BNMA 2VC1A 3W6KB 4KIFA 3KGZA 1YFHA 2ET1A 2PAMA 4I98B 3HTSB 3BJOA 4IXAA 1BJAA 4P9GA 2P5VA 4HW0A 2Z33A 4EWAA 1V4RA 2GU9A 1BOAA 5E8IA 2Z69A 2CAUA 4I7HA 3ECOA 2FBHA 5ICGA 4LLGF 1R23A 4KWLA 4OFGA 2K4BA 3KCCA 1RC6A 5FPZA 5A2QZ 2HGCA 1XSVA 3F6OA 2RNJA 1XCVA 2QM3A 4OIOF 4ZYEA 3BCWA 3FF5A 1U8RA 1XCBA 2QQAA 5FQ0A 1X8MA 2OZJA 1LQ1A 1W4MA 1PUEE 4ZYHA 5BUVA 2Z9OA 1ZX5A 4BNCA 2M30A 1JHHA 2OA4A 2HTJA 4H7LA 5KHJA 1IPJA 4D0PA 2CG4A 3GLXA 2RGVA 1FYMA 3F21A 1SMTA 1NHAA 3Q9SA 4HF1A 3KGLA 1BI1A 3DN7A 2CYYA 3P9KA 2Q0OA 4WK8F 4A5NA 5HLIA 5F6FA 4PJYA 3EYYA 1R5GA 3GEZA 2F2EA 1UW8A 2GA2A 2KIUA 1IN5A 4FAGA 1CX4A 4XF0A 5CVJA 4IPAA 1D8JA 1FLIA 1IXSB 1S8NA 5ILUA 2BGCA 3HYIA 4Q0VA 3QP6A 5H6QA 1P92A 4D7SA 4HVRA 1ON1A 2Q4SA 4KMUX 1I5ZA 2FMYA 4S04A 3BZ6A 3FM3A 3I59B 3QRFF 5FLJA 3EBRA 4XFIA 1X82A 2CV6A 1DGRA 2HTSA 2P7VB 2QQBA 3CLOA 4HX4A 3D0JA 4NHJA 4ORFA 2LDUA 2YSRA 2EFOA 1OR7A 3IWZA 1ZHFA 2YPRA 2H6BA 4GXOA 3BPXA 1E17A 1MD0A 4YYOA 3CDHA 5T3NA 1P6RA 3HUGA 1ZZ7A 5AVPA 3LQRA 4KDPA 3QPHA 2MPFA 2HWVA 3KP6A 3ZQ7A 2DT5A 1S3JA 2Q2EA 2ZMEA 2R3SA 1IRGA 3FMRA 3MZHA 1B59A 3LOIA 1Y9QA 3K1NA 5H20A 2K27A 3I0TA 4HA8A 5L3DA 5DUIA 3RNSA 4I09A 3CO6C 1L3LA 3R60A 1CAXB 2JPCA 3IIAA 4MGKE 1W5TA 2BNOA 2D45A 2ADUA 3WW1A 2D5HA 2M1BA 2ZJ2A 3SHRA 4A0YA 2DFIA 3HSFA 2O03A 1J0RA 5KHKA 5FLIA 1V3FA 1MJAA 1ULYA 2A68F 1IPKA 3TGNA 5I93A 3ZMSA 3DXJF 1MDMB 4RB1A 3SMHA 1STZA 4QGNA 1DZRA 4Q5SF 2Q0AA 4EV0A 3WTWC 2P5LC 2DCTA 1YYVA 2ZBKA 1T6SA 4OLLA 4Q4ZF 5L3FA 5DD8A 3CUQA 3FXUA 1U5TA 4FT8A 4IVNA 2MLGA 5KHGA 5FD6A 5JSOA 4L5IA 3I64A 3VODA 4XSZF 1IUYA 3RZZA 1FNNA 3HRMA 1ZG1A 1TQ5A 1U12A 3F8MA 1SAXA 1J58A 2XAJA 1ZG5A 1QO0D 3ERED 4P55A 1IN8A 3WTSC 2A07F 3IHUA 1RUOA 3F3XA 5K8SA 3T5XA 3CL1A 4XETA 4KU7A 4Z82A 2VBYA 2Y48A 3NEUA 2NNNA 2HQNA 4QWQA 2VE9A 2XAFA 4MX3A 4L9TA 3CTAA 5ILSA 3JSPA 1IF1A 1EY2A 5BOXA 4XFGA 2VODA 1ZLKA 2DQRA 2UXXA 5LHIA 4LA2A 5JAXA 1SFEA 2MLKA 1XE8A 3JSOA 4ESJA 3OCPA 3DQVC 1O3TA 2VBZA 3IDCB 2XAHA 4NB5A 3GF2A 2VOOA 2D1HA 5E1XA 2KJCA 3E6MA 4IRGA 4YIIA 1MKMA 4IJAA 3NL1A 3I58A 4S05A 2P7CB 1W5SA 3U9GA 1YWKA 5JR7B 5ILVA 2GXGA 3ELNA 4UBGA 4PZJA 3MEXA 3V7RA 2PHDA 1KU9A 3I5UA 3WTTC 4META 3LFKA 2DO7A 1Z9CA 4ETSA 4GYIA 5JSRA 1FXZA 4IEQA 2UY9A 1LEBA 4EWEA 1Q43A 3GW2A 2XLGA 1Y0UA 4ZYDA 4R52A 3CLPA 1VP6A 1YFUA 4OIRF 4AVPA 4U7BA 3SZTA 1LVAA 1SMYF 1UPIA 5DDGA 4XFCA 4HYEA 3WGIA 1J75A 3J81K 3B02A 3E5QA 3H1WA 1ZZBA 4M73A 4QGMA 4CO8A 1ZZ8A 4LLOA 4XFHA 3FX3A 5CADA 2IA1A 4YFKF 3IDBB 3OOPA 1CF7B 4IESA 1UHWA 4O3MA 4IRHA 4J1WA 2MC3A 1USSA 3HSEA 3HRUA 1QGPA 5DYMA 4P9UA 3WU1B 1RL3A 2B9UA 2VBWA 3TDZC 4AIKA 4IF4A 4I0BA 2HFHA 1O4TA 2YU3A 2J5OA 2PA7A 2PHLA 1CAUA 2FRHA 3S7EA 1X7NA 4HF0A 2XGXA 4UV9A 4E70A 4GO1A 3M8EA 1S7OA 3EHKA 2M87A 5HDNA 1L3JA 3QU6A 1PMIA 4YARA 2EA2A 1Y3TA 2L4MA 2CAVA 1WQ2A 2PTMA 1X3UA 3K1PA 1B9NA 4KL1A 1NXMA 3U0ZA 1SD6A 1O3RA 3D82A 2QUFA 1ZRCA 5IT9K 4PIYA 3PVBB 1HBXG 5FLXK 1IZ1A 4KUMA 5I0SA 3EUHA 2HYGD 1W7PA 1ZREA 1JE8A 2L4AA 5FLHA 3TOAA 3KLOA 4EJWA 1USTA 4MH0E 3CJXA 3J81Z 2OYZA 1YW9A 1F9NA 1CAVB 2K7LA 2PJPA 4O5VA 4IEYA 2FQ3A 5AIQA 2FU4A 2FE3A 2IXKA 3R61A 1GQGA 4HOBA 4LEJA 1BI0A 2GC2A 5JFRA 3TQNA 3CO2A 4ZU7A 3HRTA 3PNAA 2FXAA 4FBFA 4HX7A 1XN7A 2NS0A 4UXNA 2O8XA 5CVUA 3WU0A 4DNCA 4HLYA 1OYYA 2MNGA 4WBBA 4EJUA 1UFMA 5BPIA 1BI2A 5CYVA 3CEWA 3ZN0A 4Y15A 1RUNA 1R1TA 2MA3A 3BOQA 4RB3C 4E2QA 4AD9A 3LSTA 4LJZF 4JV4A 3H7JA 2G7HA 3FMQA 3V8JA 5BXXA 3C3WA 5IT9Z 3GZ5A 2BV6A 5FLXZ 3PFIA 2RC4A 1XGMA 3WTYC 1SQ4A 4Q29A 5HI0A 5I8SA 3DKWA 2VC0A 3AAFA 1HW2A 5FO5A 3KEQA 4JTOA 2STWA 3E6DA 5FFZA 3ABTA 4KN7X 5D8LB 2GWRA 4U0WA 4XLNF 6PAXA 4QM8A 4MZUA 4HQEA 4Q0UA 2J5PA 2V09A 4XEZA 1LJ9A 1MGTA 4U88A 1G4DA 2CO5A 2KJBA 2R7FA 1K7AA 4PIXA 1HW1A 2IJLA 2LSOA 3IC7A 5TRDA 1K78B 5F1RA 3U1DA 1MJBA 3HQXA 2YX7A 1SFNA 4HV5A 2L3DA 2CFXA 1HW5A 4WZCA 5F64A 4IEOA 4TV7A 2KRFA 4JK1X 3GFMA 1H1MA 2ZO4A 4XF9A 1FSEA 2EFWA 3I7DA 1HXDA 1FOKA 4LG0A 4EMSA 1LKNA 2XROA 4KFCA 3USSA 1PP8F 2LF8A 3E6BA 2K02A 1K6OA 4A6DA 3DV8A 2ESNA 3WTXC 4CYDA 5J7MA 2HKXA 1TQIA 3DEUA 4AVBA 3KP5A 2PN6A 5D5XB 2ET7A 3TKYA 3P9CA 3H3ZA 3H7YA 2F5EA 3ETQA 2QLZA 5LGUA 2W57A 4RB2C 2STTA 2QJVA 1R1VA 2E7WA 4MGZE 3GYHX 2OAZA 4A0ZA 2QQ9A 4G7ZF 4EGZA 1NZCA 2QCSB 4IETA 4ZH4F 5D6EA 2IRFG 3U10A 3N97A 3F8NA 1LDDA 4HVOA 3M7GA 4M6YA 4ASNA 2M5WA 2W24A 2D5FA 3LWCA 4RB0A 4HZFA 4P96A 1NE6A 2BYVE 4F8AA 1BN5A 2EFNA 3GFJA 4AIHA 1FC3A 2F5CA 4OOIA 2FEZA 2ZKLA 3L9FA 4YFXF 3WW3A 1Q5OA 2WWYA 2IA2A 4IEZA 5C8WA 2XHKA 1B9MA 2IXLA 2Y0MA 5D4SA 3H1MA 4HQMA 4A0XA 3KETA 2XIGA 3L7WA 1REPC 1O5UA 3CUQC 1U5TC 3M1EA 3FJSA 4PIZA 1UIKA 3H9AA 2UXNA 5EEHA 1YFYA 4UNOA 4GULA 2IP2A 4G94A 5ED4A 1KU2A 1R5HA 3UKTA 4YNIA 3EJKA 3J80K 1I1SA 2E7XA 3O6BB 2QBYA 1KGSA 2PAKA 5LLQA 4MUVA 4MHGA 5ICCA 5H6RA 2VONA 1ZZ6A 5FQ0B 4I2OA 2JSCA 1IN6A 4CHUA 2F5DA 3JW4A 2EA7A 1FWZA 3J7AO 3HHGA 3OF1A 4Q48A 4KU8A 2EB7A 5D6FA 1TTYA 3T0YA 3ZMVA 1ZZCA 3H3UA 1BBYA 4I02A 4EJTA 1J7KA 3D5LA 3QAHA 3HT2A 1YG2A 2KIFA 2QDRA 4ENJA 1B6AA 3R0AA 1BIBA 3WTZA 3IRRA 5E17F 2ATFA 4UUVA 1FT9A 4FX0A 2DBBA 3RKXA 4IEUA 4ON0A 1QWRA 4LULA 1J9IA 1K79A 4RGRA 2P17A 4AIJA 1XDUA 1OYIA 3ES1A 2ACJA 2F5FA 2EK5A 2BBYA 3GUDA 2RV8A 3GFIA 5HDGA 2B5HA 1FX7A 1UCRA 4U0YA 1KA8A 4KICA 3G7DA 5I0TA 3J80Z 3K9TA 3RKYA 2NYXA 1JUHA 3LZZA 1XRUA 2ESHA 1VTNC 1FP2A 1ON2A 1SFUA 3H1YA 1BC7C 4X6RB 2QVSB 3C18A 4U0VA 1GXQA 2EWNA 1YS6A 4L9NA 1G3YA 3ML6A 5LGTA 5I0RA 1WRJA 3OGJA 4JQFA 5FD5A 1J2XA 1CAXA 3O14A 4Q0QA 3MFKA 1FY7A 1RI7A 1EP0A 1YHFA 4OU0A 4XFFA 3ABUA 5J8CA 5FGMA 3PQKA 1FYLA 5KHHA 5HLGA 1DDNA 2ISZA 2TDXA 2HDCA 2PYTA 1DPRA 2HOEA 1F1ZA 5FCCA 1HQCA 2ZKZA 2PLYA 4LK1F 4KN4X 2QNKA 4DINB 2EFQA 3BPVA 1MDMA 5DUKA 2G9WA 2OQGA 4RGUA 2PG4A 1QNTA 1KU7A 1B4AA 2A69F 3L00A 4P9FA 3IL2A 5FDBA 2DPDA 4PCQA 4R8HA 5TJJA 1RNLA 2OZ6A 5J6XA 2I45A 2H27A 5JVTA 4LTAA 1IXRC 2X4HA 2H94A 2A6EF 3OV8A 1XDSA 3SHFA 5BPDA 1FI2A 4G7HF 4YFNF 4HDUA 2UZKA 1AOYA 3JAMZ 1J59A 2PAEA 4WXDA 2ELHA 3DPLC 2RDPA 5D1IA 1RTVA 3QPTA 5ICFA 3CUQB 4KIGA 3KP2A 2FBIA 3M8FA 1XGNA 3RI4A 4K2EA 2GC3A 4I01A 5JCTA 3RJPA 2RQPA 1RGSA 2VBXA 3H50A 3KSCA 2XV4S 1MZBA 5J3UA 4BAYA 3FMSA 4BQAA 3SFZA 2RKHA 4RD7A 2BNNA 4LMYA 5DEQA 2P8TA 2UY8A 3HT1A 2VOPA 5FFXA 4PGGA 4G6DA 3GFLA 1KYZA 3E97A 4KMFA 3ZMZA 3ACLA 2DQLA 4E2SA 3SCHA 2K86A 2F4PA 4EM1A 5I0UA 1VR3A 4X6QB 1JXSA 5D4RA 2CGPA 4AXOA 2DLLA 2DPUA 2O61A 3MDPA 1U78A 2MH9A 3JTGA 1KQ8A
chains in the Genus database with same CATH superfamily
4ZU4A 3OUJA 2R0HA 5FKMA 1D3YA 1MZ5A 1YJKA 2DTYA 1HXS1 3LCPA 3AP7A 3HB9A 1NH3A 3ECQA 1HQNA 4PDKA 3JD71 5CFCB 2VQLA 1QJEA 4KIBA 3MMYB 3G3ZA 2IVJA 3ELKA 4BMEA 1XE7A 1K5JA 4AI0A 2W87A 1LEDA 1XXNA 2WV1A 3DTKA 3WG3A 3K69A 3V64A 3R0JA 1AA7A 4XONA 4AFCA 1EUTA 3O8HA 3LQQA 3ZN1A 3HEFA 1T2XA 1QHDA 2LBFB 1RUF2 2V9KA 2MGQA 5FZAA 1G86A 2XRNA 3HIFA 3RPQA 3GO5A 3LFIA 4HNUA 1QQP3 3TO7A 1VBD2 3GYDA 5DCMB 5BMZA 2PFBA 3CUOA 3EUKL 2LF7A 3MIHA 3P1IA 2ZFUA 2FMLA 1AR71 3P5BA 2CL2A 3I3DA 3IAS2 1EAH2 3I4PA 4A3XA 3U78A 4XOPA 3TBIA 1G3SA 2ETHA 3WG9A 4XBNA 3INAA 2K85A 1NE4A 3J9SA 4ZYGA 3MQ0A 5LBEA 1BHGA 2PHUA 5A3UA 2RS51 4BQOA 2DBIA 2H6CA 4XRFA 1QOTA 2VTXA 3WDYA 3LEIA 5L9VA 2JTVA 3R6SA 4B48A 3F8BA 1GANA 1H8AC 2EF6A 1DUXC 1SCSA 2BVMA 4A3JJ 4FQGA 3DCQA 3F72A 5IK8A 3FXQA 1JUIA 3N9OA 3T1BA 3V42A 5FLVA 5FKOA 5HLHA 3WF0A 2M7BA 2PN5A 2H1KA 4IKFA 1RUI2 4XXPA 3ZN4A 4YZ4A 4MSVA 5C6CA 2LFBA 2DFEA 4M3EA 5EG0A 3NAPC 4AVCA 3L2VA 4ZKTB 2JDPA 5E3MA 2GN7A 1XSDA 1PMHX 2Q8KA 4AI8A 5A6YA 2DU0A 1E3PA 4UF0A 2ZX3A 4OAYA 3ZQIA 2GH2A 1QHGA 2HWC1 1HDDC 3C7FA 2VVFA 3CQZJ 1ZN2A 1H8TA 2LKXA 4GJYA 2NS7A 2FA5A 5GLUA 3BZKA 2JSPA 4CZZA 4LBKA 4N0BA 1RUH1 1VQKI 3WF2A 5CG8A 2GC1A 2R7TA 1P7IA 2EIEA 5CYYA 3CIHA 5J98B 4J00A 3ISPA 3ACHA 5F3IA 4M6XA 4A3EJ 4AEKA 1UZYA 2GNTA 2R062 5HS7A 2VMEA 1DLCA 3FISA 1RXGA 3KZZA 4P5HA 3QQAA 1OKRA 3NVCA 1RUG3 3AYAA 2ZOEB 2CQKA 4OWRB 5CU1A 2UV1A 4NIAA 1DPUA 1ZNPA 3I53A 3C1DA 2B45X 2YBPA 2OBPA 2BZTA 4JKMA 2LG4A 2XPUA 1OPMA 2L9SA 1VBE3 1QJZA 4PSXA 2J42A 2B0LA 2ENRA 4PJJA 2HLEA 1LUJB 1OCCH 4IHXA 1FAYA 3LSIA 1R081 3MV01 2R7QA 3CP2A 1YRNA 2FNAA 3OS1A 1VRH2 3AKSA 1YLLA 2DWRA 2AXTC 3KMHA 2HVQA 4AVAA 4M9XA 2V1DA 1DGRM 3MV11 2VR4A 3D3AA 1US3A 5I8YA 1XMAA 2P3YA 3L2HA 1OCZH 1T38A 3AKTA 1QZZA 5GAEJ 4XFAA 4XUOA 5CA6A 4NC7A 1ACIA 1FV2A 4ZZ5A 2A61A 3RDIA 5FKNA 2R7DA 3RQ0A 4L92A 3TW7A 3GHNA 2WBMA 2PMZA 2YBKA 2CSOA 4QXKA 5LZ6A 4BLIA 1RUD3 3O3KA 1BVP1 2YBSA 3UK9A 3OUIA 2EH3A 1W8ZA 1Y4WA 4HBNA 4CXYA 5DCFA 2V73A 1TWGJ 1WLDA 5FUPA 1D5VA 1J3RA 3AXDA 1FZPB 3ZM8A 1XNTA 2UWMA 4ITCA 1AL22 3USUB 2HS5A 3Q5FA 1AYN1 2QF7A 1CZVA 4HF2A 4PDWC 3L2QA 4FHTA 5BS6A 3HRSA 3BODA 4LHNA 2RR11 1L7RA 3RZKA 2K9SA 9ANTA 3NSTA 3MZ8A 1BEV2 4IV3A 5E18F 4WM7C 4BQXA 1QOSA 2R041 4JYKA 1PX3A 2WZEA 3BOPA 3V7SA 2X0LA 1FOD3 1J84A 1WJBA 2R6QA 1RUE1 3CJIA 1VJ2A 4BXUA 4EZ4A 5B1AH 4OINF 4FOYA 5E1ZB 4MEXF 1SPPA 2A3YA 4M9ZA 1AJOA 1O7FA 5T50A 1UX6A 1LB2A 1GOGA 5IYDJ 3VZJA 3TW6A 2W1OA 5FOJB 2WIIB 2NRAC 1YJWI 1YQ6A 1MS9A 1HJFA 1EH7A 4MEYF 3BIWE 3CNAA 5LA0A 1SLAA 2ZEYA 1GP6A 2OUHA 5CLSA 5DAWA 3DTEA 5ANNA 4RAZA 4CPBD 5DAVA 1I5PA 4ESBA 2Q8EA 3MW2A 4FOWA 2MD5A 2NYYA 3IH2A 3JB8A 3FXJA 3I2GA 1PO21 1GNZA 1VALA 3BN6A 4AQ6A 2DT6A 1RJ7A 4NIGA 1DGRN 3VZKA 1HJGA 5K5RA 1RVF1 5EJCA 1PZ9A 4CRQA 1MS1A 2GMEA 4IHSA 3P9IA 4PF5A 2ZMEB 2D6PA 5AONA 1TME1 4L11A 1IDZA 4M3FA 4NUBA 5IP7J 4QKDA 1YIPA 5T55A 3SZPA 4CP0A 4BQYA 3VHNA 3EYIA 2RG4A 2P4WA 3IWFA 4G9YA 3SYTA 5DS9A 4IGQA 2JA7J 1PGW2 5E88A 1YS7A 3O1UA 1U6GA 1US2A 2RVAA 4COYA 2OPKA 1Q8SA 2V1UA 1LECA 1WJAA 1JZ8A 3PSIA 2QGUA 2BFUL 3VDBA 3Q0UA 2XPWA 1HKQA 1V55H 2JB8A 3S2DJ 2DDUA 2W1WA 3LE0A 3H1CA 3MUY1 3MAJA 3ZXLA 1HB2A 1QQP1 4BJ5C 3F23A 3I2DA 3VBSA 1U5TB 4XM3A 4BHBA 2HWF1 2L54A 2WFF3 2E36A 3CDLA 4AI2A 4BLJA 1IQDC 5LRSA 1U5YA 2HBUA 5K0UB 3KEOA 4BMBA 1DQ5A 1UYYA 2PQ8A 3U14A 4XBFA 4U7DA 4C8DA 5CKTA 1TZLA 4HFSA 1H4HA 1XYOA 1VBB3 4FCAA 1WJEA 4XMYA 4NC8A 1YQCA 2A75A 1ENSA 1W8TA 4XKBA 3RI8A 4MGYE 4GCVA 2KZGA 3P6BA 5D5WB 2FD5A 3BR2A 4NMIA 5HCAA 1PIV1 3MGUA 1UHSA 3K48A 5E3NA 2WLQA 4XACA 3WSOA 3ACGA 5EQUA 2BTVC 2IBDA 4XSXF 1HN1A 4RS8A 4EROA 3PIJA 3VBHB 1DQ4A 5FZOA 1PK6A 3E5XA 4HKLA 1T98A 2JN6A 3KE2A 3ZYGA 4NR1A 4XF3A 2O3FA 1AU7A 5F3GA 1E5RA 2FMDA 3VBUC 3P3NA 2A70A 1TC3C 2YHJA 3LSMA 1HKSA 4BHPA 5EIYB 5EEGA 1SMVA 3FLRA 5J1RA 2JG8A 4EN7B 5FJKA 3GXOA 4IEVA 4N9HA 3JZVA 3ZXEA 1MNEA 1SFXA 3PTRB 4Z8BA 1DG6A 1YOVB 1QXRA 1G3TA 1EKEA 1EV13 2ZGRA 1HRV2 4XZPA 4ZU5A 1FX5A 2CQ7A 3LL7A 3AG4H 2FNPA 1VBC3 2K40A 2RMU2 4FXGB 4A3BJ 3WTUC 3C3VA 2XQRA 2W00A 2PMHA 1LGBA 1SAUA 3KD4A 3ZMTA 1WSUA 2WAOA 1BOBA 5FJHA 2HWE2 1MBHA 5FKKA 5JI7A 2IW5A 2ZAAA 1P2FA 3QD6A 1ORKA 5F0CA 1NOVA 2GNDA 2VIXA 2QQIA 1JTZX 2H0VA 3ON7A 2AREA 5C3RA 2JRTA 2XXZA 2VT2A 1QJX3 3ILNA 3HHHA 3BDDA 4HSRA 3N9PA 2JQ7A 1MEC1 5F08A 2B46X 5FZBA 5BNPA 4OHWA 4QX1A 3AMNA 4NAOA 3GXUA 3W5MA 4Q4Y3 5C9AA 2K4JA 4FXKB 3IBMA 3K3OA 3SXYA 5C8CA 2OU2A 1TT0A 2F6BA 2E1OA 2L01A 1OI6A 1JTYA 1MBJA 1K4TA 1ENQA 2AENA 5FXXA 2BPA2 3WNXA 1HQWA 3PFYA 4NWWA 3HL2A 5EG0B 1JHFA 2VZ3A 3GTQJ 4QMAA 2FZ2A 3POBA 1FP1D 1S6LA 3BJAA 1Z3YA 2JXAA 5CVVA 2YUEA 4MNUA 1UL9A 4YGDA 3IKTA 2DUPA 4UF0B 4O9GA 5F27A 2Q30A 4FQZA 5L7OB 3PNYA 4A3DJ 5IVFA 3SQOA 4D7TA 1C1LA 4IQPA 3WT3A 2DVFA 2JD4A 4CDXC 2XLAA 3GZ6A 3CO7C 2VE8A 4C1XA 2XJPA 5D8AC 3AKZA 5DABA 4DB5A 4J1XA 1I6XA 4CEWA 4JGYC 4ANJA 4E7JA 1Z0HA 2DDBA 4F7ZA 4EQVA 2M4GA 1W9YA 3PUSA 1FOD1 4E8DA 2NMNA 1N75A 1GOFA 1ZGAA 3SXWA 1EPZA 3LD8A 1T0FC 4L97A 4A4AA 1IRFA 1CR7A 2JZYA 1DYKA 2VJ5A 5DUWA 3OPWA 1SLBA 5JOWA 1LNWA 1ONAA 1DU6A 1YRNB 1H8VA 5ABJC 1PP7U 3A23A 1HRI3 1UMHA 4L18B 1WI9A 3A22A 4C0BA 4GMP1 4W1UA 1R36A 1UY2A 5IY5H 2EICA 2CUJA 3WNPA 1OPOA 3W6KB 4HONA 5FLMJ 3KGZA 1AJKA 2K2SA 5FYYA 4DMIA 3HTSB 4IXAA 1BJAA 1JMUB 1UN1A 1QEXA 4D7MA 2BBAA 3THPA 2FBHA 4XQ4A 5ICGA 3MUZ1 2XF5A 1LFUP 3MEPA 4KWLA 1NCQA 2PJRA 1YI9A 1RC6A 5T5OA 2CDOA 5A2QZ 2HGCA 3U1KA 3ZYPA 3T2TA 3F6OA 3OEBA 3OEAA 3LFMA 4CP1A 3VLBB 2XH6A 5FQ0A 1SDDB 3FKIJ 2DVGA 1O91A 2OA4A 4R9DA 2RE9A 3K4JA 3RFRA 1D2SA 2M8GX 1W6PB 3S8PA 5GAHJ 3WXPA 2E26A 3Q0WA 3Q9SA 3KGLA 1MS3A 3PM1A 4IV3B 1OUSA 2CYYA 2Y34A 2Q0OA 4ZDOA 4A5NA 5HLIA 1GVDA 3LSRA 3D5SC 3TN93 5FKLA 4RA0A 1A6CA 3N7KA 3CJIB 1AR63 4W6XA 2QTWB 3K4ZA 4WZFA 4RSUA 3CQOA 4P9WA 1D8JA 1JS9A 1IXSB 1SPPB 3QP6A 4D7SA 2R7UA 4YW5A 4MHUA 2KMUA 2Y38A 4KMUX 3Q9OA 3BZ6A 3C7OA 2VASA 2A05A 4E7SA 3S16J 3EBRA 4QDRA 4XFIA 3W2WA 1DGRA 2E1MB 1N3QA 3D4KA 4E4ZA 2QQBA 2VM9A 4CCNA 4KMQA 4AVSA 1XBFA 4W8JA 4UWDA 1VQ9I 4HX4A 2P37A 2YSRA 1F5JA 3QOEA 3M1CA 2J7MA 2JIJA 3B00A 5FREA 2UUZA 1YJ9I 1Z3XA 2H6BA 4GXOA 2VXRA 4PFOA 4YYOA 3CDHA 3HDDA 5K7FA 2PHXA 3LQRA 3KYCB 3CJQB 1ERDA 1CJDA 4JC1A 3ZQ7A 1S3JA 3A0NA 3NMBA 2AH2A 1XOYA 1UYPA 4DIQA 1IRGA 2YPJA 4P9JA 5M3MJ 2DMQA 1Y1WJ 5L3DA 3SFIA 3RNSA 3CO6C 4X1EA 3I2HA 3R60A 1D0YA 1WPKA 5A7PA 3A2KA 3LSGA 2BNOA 2D45A 3WW1A 1ETKA 3B01A 3OUHA 2GLOA 1AF9A 2M34A 3SHRA 1E5SA 4FPOB 1J0RA 3L1PA 3AMHA 1O8PA 3W59A 1ULYA 3N9MA 2A68F 1IUFA 3RKQA 3ESWB 1C3HA 1MDMB 5IFTA 2XMLA 2F17A 3URFA 2HH9A 2ZBKA 3DEMA 3W2AA 2DFBA 1ND3B 1OOPC 1OUXA 4OLLA 5CB7A 3CUQA 5T5LA 5EZGA 1JUMA 1D2QA 3NV3A 4XSZF 2VE1A 1U12A 3F8MA 1SAXA 2RREA 1RXFA 1QO0D 3ERED 4N7IA 2FDGA 1IN8A 3CLQA 2A07F 4ZXKA 2E63A 2NVQJ 5K8SA 4GJZA 3T5XA 1WMEA 4OI2A 4XETA 3NARA 2NNNA 3NAUA 3VD4A 4PI0A 4QWQA 3BG3A 1S2KA 4RGAA 5ILSA 3JSPA 5BOXA 4Q4W1 2DQRA 3WP4A 2F5VA 3M8JA 1XE8A 2L7ZA 4BBRJ 3OCPA 3DQVC 2ELKA 3PUBA 1Q8OA 1W8NA 3HN1A 3VUOA 5GALA 1QXPA 1OCPA 1SBFA 4UUTA 5A6QA 1F4AA 2P7CB 1YWKA 5FY7A 1W0NA 4Q4Y1 5ILVA 2GXGA 3KT7A 1JZ7A 3P5JA 4PZJA 3MEXA 1IV8A 1RUC1 2HU9A 2DO7A 3AL6A 1R091 3CCMI 4ETSA 1FXZA 4PJNA 1DLLA 5IYYA 4XBQA 5GP9A 2PLV1 1TZOA 3I2IA 3GW2A 5SV5A 2WY7Q 2VZPA 5H9PA 2X09A 1X1PA 3CLPA 1N1TA 1RMU3 1R1A1 3O7OA 4CXWA 4DEQA 2BY1A 2LMDA 4XFCA 1J75A 1HB1A 4GB32 5FZOB 1PK6B 1CPMA 3H1WA 1ENXA 1ZZBA 1B35C 4QGMA 4LLOA 2R32A 3M07A 1OF4A 1CF7B 1JXNA 2MC3A 5JWPA 3HSEA 4LQRA 2R071 4AE2A 3WV6A 4KBZA 2Q5TA 3TDZC 2HFHA 2JG8B 5DG1A 2PA7A 2J5OA 4TLGA 1CAUA 1X7NA 1HN0A 4CA0A 4E70A 2TRTA 1S7OA 4YZ5A 3O1RA 2OX0A 1U0JA 5FZ4A 3QU6A 1XPWA 2E7QA 1D0XA 1Y3TA 1LE8A 1POV3 4XURA 1C1FA 3WUDA 4KL1A 1ZRCA 5LWBA 4UFLA 1D4M2 4JQRA 4PIYA 3RS6A 2ZEXA 1IZ1A 1RUJ2 1U8BA 2WYSA 1U5IA 5A1AA 2WN3A 4CDUA 4IQ4A 3AKRA 5F2SA 1JE8A 1ZK8A 5FLHA 3GZNB 3TOAA 4G3YC 3NJXA 3KPHA 3KLOA 3SDGA 4EJWA 1LU1A 2HWD3 1USTA 3E1F1 1SG3A 3S93A 5ACA1 1F9NA 4Q5OA 2NN8A 1X19A 3Q0VA 2CWSA 4IEYA 2A7AA 1MMNA 2Y6FA 1GQGA 4CCMA 3LDRA 1T6GC 3HRTA 2IUWA 2QQ8A 4K6BA 3T30A 1ETXA 5BNPB 3OR2C 3ACIA 1FMD3 2KLOA 4AEDA 5B4XA 4EJUA 2WNVA 5KNLA 1UFMA 3HWJA 2XBO1 1WBLA 2RDNA 4Y15A 5LY1A 1EA3A 4P08A 1R1TA 3ZXGA 2GP5A 4AGGA 5C8CB 3H8XA 5EYYA 4QQLA 2X6XA 4RB3C 4AD9A 4AHWA 2KQRA 2V4JC 3LEKA 3FXKA 1DYPA 5F5CA 3H3LA 3K4AA 3FMQA 5FYZA 3C3WA 5IT9Z 5HXVA 1XGMA 1POV0 2XJTA 4W6YA 3RJRA 4Q29A 1ETOA 4JX4A 1OD3A 3SC7X 3DKWA 2VC0A 3KEQA 5EYXA 1CZSA 4JTOA 2STWA 3M3EA 5FFZA 3R05A 4P14A 4KN7X 3OB8A 5D8LB 1ODNA 2B4KA 3H9QA 5JOYA 2R7RA 1IG0A 4NQWB 2DFFA 4QM8A 2L9LA 1X9TA 5AC91 1BCXA 2QEXI 1FATA 5T5PA 3OR1C 2J1SA 4U88A 1WCSA 3SEPA 4DW6A 1G4DA 3DYOA 3AX4A 4Z1VA 4JX6A 1K7AA 3WHBA 3VD9A 4A44A 3CMGA 1O59A 1EUUA 4BJ6C 5TRDA 5C70A 3A03A 5HCFA 1HXS2 1K5MC 2OPTA 1D5YA 2G9ZA 2WAAA 3JD72 4HV5A 4CDQA 2IGMA 5EYRA 4CEYB 2F4IA 4AUXA 4YW2A 1HXDA 4BQ2A 4OAZA 1C8M2 4Z6YA 1PP8F 2K02A 4YVWC 4A6DA 2Y8KA 4XW3A 1RESA 3WTXC 4YW6A 3WHTA 3POFA 4CYDA 5J7MA 2BOIA 1UKGA 1TQIA 2PN6A 5D5XB 2NS8A 3I3EA 3S3OA 1J1TA 1B72A 2R49A 2ZXWH 2W57A 3FHAA 2STTA 3I9V2 3N9LA 5FK8A 1R1VA 1OA3A 4ZPIA 3SEQA 3VBFC 3ZQGA 5FO9B 1RHI3 4EGZA 2RJKA 2QCSB 4ZH4F 3KCYA 4QT6A 5IOYA 2DA1A 3N97A 2YC4A 3M7GA 4M6YA 2FDIA 5EP9A 1AR72 3PUIA 2W24A 4TTGA 3LWCA 3FN9A 1NE6A 2EFNA 2X8KA 5FP4A 2FEZA 4DYQA 3L9FA 2WWYA 3PHMA 2CQQA 4CZCA 2W2IA 3OYHA 5D4SA 1VAMA 3PO3J 4HQMA 4JAAA 4A0XA 3M7AA 1RKWA 4LT5A 2RS52 5EWSA 3M1EA 3FJSA 3ZOBA 4UNOA 2PJRB 3OJBA 1HLVA 4M3CF 5ED4A 1KU2A 1R5HA 5CFDA 4Q27A 4X0GA 5A6XA 2E7XA 3MIGA 1AYM2 3MLJA 2XGCA 2RS31 1COV1 2L9VA 5LLQA 4MUVA 3ZFGB 5HBAA 1BW5A 3GHMA 5FQ0B 5A70A 2JSCA 3RZHA 3L2RA 5DN2A 2A6WA 2FDKA 1ZBE2 1OFSA 4JP0A 4Q48A 3BTXA 1X1AA 2EB7A 3T0YA 3OYFA 5FZ0A 1VLNA 2AQEA 1BBT2 1J7KA 2L9NA 4ET7A 1YG2A 3ZMOA 2Y0SA 2KIFA 1VQ4I 3R0AA 3WTZA 2JDUA 4UUVA 2HDDA 2DBBA 2BV4A 1QWRA 5CFCC 2M3AA 2ZGNA 1RR7A 2P17A 3DU5A 2DCKA 4RS5A 2D3SA 1A3KA 2R4GA 4MVTA 3PMSA 3WEZA 2JJ7A 5HDGA 1UCRA 1NG6A 4U0YA 1DYOA 3HC7A 3J80Z 3LZZA 1O4YA 1VTNC 3JRCA 1VBD1 3AFGA 3C2BA 2GMPA 1BC7C 4C0HA 1GXQA 3AYCA 2WT1A 1YS6A 1HV0A 1S2BA 4M3DA 2XF6A 4L9NA 2I8DA 3OGJA 2Y33A 1FNYA 2XUMA 5GLVA 5FD5A 1J2XA 3O14A 4DRRA 5DDJ1 3MFKA 2HXOA 1FYLA 3VZOA 4CCJA 3WINE 4ARXA 1NUKA 2ISZA 2XJRA 1VQ6I 1R082 1PZ7A 4UW3A 1DPRA 2VTXJ 1VBA3 2C6SA 4KN4X 2WBKA 3A01A 3CCUI 5DUKA 4NIHA 4YGEA 4COZA 2AEYA 1O6UA 3OBTA 2WNEA 3L00A 3MKYB 5FDBA 2DPDA 2QQOA 3A0BC 2QA4I 2VTFA 1OC1A 3N3HA 3I4IA 5FYBA 1CONA 4IHYA 1UU6A 3JQWA 1YX5A 2BP6A 4L8QA 3KZ4C 1VRBA 2X4HA 3T2OA 4Q4V1 2A6EF 1X2NA 1Y6IA 1T56A 4G7HF 2Y2ZA 1UXXX 1F2NA 1XNBA 3H36A 1Z67A 1CN1A 1J59A 3EUHC 3ASOH 3H35A 4MXWA 2DFHA 4XK4A 2ELHA 2FJ1A 2W0XA 2RDPA 2LVSA 1RTVA 4E7LA 1VQ7I 4PCRA 1E5HA 5TGTA 3CUQB 4DBRA 4QQPA 3S5QA 4XLFA 3KP2A 2FBIA 3M8FA 1A8DA 1XGNA 2GNBA 3M8LA 1W6MA 1TWCJ 1RGSA 4AIDA 4FVVA 3BTJA 5C5UA 2VB6A 3O5SA 4WV8A 1WD4A 1CIWA 1AYN2 3SFZA 2X10A 1D1CA 1R1ZA 2ZMNA 5FFXA 2YGMA 1ZR4A 3F0CA 4G6DA 3OPTA 3EXUA 2RV9A 5FZDA 1KYZA 3ZMZA 2VBDA 1UZVA 3GMEA 2K86A 4JDOA 3VGIA 3H5NA 2CGPA 4N8MA 1QJY1 1KJLA 2R042 4E27A 1GBGA 3H42B 4CCKA 3CCVI 4KNCA 3IUOA 1U78A 1RUE2 2MH9A 3JTGA 2BVLA 1J1LA 1FBQA 3ABMH 3FXLA 3QPSA 2LUWA 4WVMA 1KQ0A 4UI9L 4Z92B 1JW6A 4K40A 3T3YA 5A7NA 1VRH1 2KM2A 2JKXA 3NJYA 2YFZA 5A3PA 3OWTA 4DXZA 1HIXA 2ZEWA 1EH8A 1OFNA 2C24A 2CU7A 4MV2A 4JVAA 1DP3A 1KYWA 4FFFA 2JIGA 1R71A 2VZSA 4MGIE 1TNTA 3O1MA 4WCGA 1JOBA 1FPN2 2ZTNA 1VMHA 1WJFA 1H9TA 5DM6F 4RGSA 1Z7LA 3RKWA 2QYOA 4Y13A 4BQ3A 4ATEA 4Y1ZA 1OBNA 1QBJA 3LWFA 3OYKA 2MW8A 5H2FC 1U0AA 1PO22 1SD4A 5DAPA 2D93A 4JKLA 2V9PA 2XL9A 1RKTA 2MG4A 3K1MA 4CSWA 1MR5A 5AFEA 2W1QA 1G2HA 1BKZA 2CY6A 2WABA 2HOSA 3CKHA 3JRGA 2O0YA 1RVF2 5KAIC 2E1NA 1ZKGA 5HS9A 3SDBA 1XJAA 4JKKA 3ZXJA 1LNSA 1D0HA 4QM9A 1SANA 2FDHA 1W6OA 1IS4A 3GTMJ 1UWWA 4LUKA 1TME2 4E8CA 1CAUB 3PNTA 4A2UA 1GR3A 4B47A 2IWGB 1CGPA 3CMAI 1NT0A 5KXEA 5F9TA 5EV7A 3DEEA 4YGCA 2UWCA 4CCOA 3LMMA 2ZXJA 1ZA4A 2G0EA 2YV8A 1LE8B 4OMZA 4CUCA 3KZYA 1YIOA 3ZFFA 2JDZA 4M3CE 5FZ8A 3G71I 5FZ7A 1BEV1 4AGVA 4AQ2A 1WMDA 1YRZA 1Z91A 1YCIA 1DGWA 2QBXA 1OLME 5FYSA 2E1CA 4HSLA 4CDUB 1W5CC 1FSHA 3WTVC 5GLTA 2W94A 3CDZB 4AFDA 1ZBA1 2VNRA 1Z21A 3NNFA 1SLLA 1WLTA 4QX5A 4HLXA 3OD0A 3RSJA 4DUWA 4H7MA 1RJ8A 3MCZA 1Y9GA 4XRMA 1QQP2 1FOYA 2HWF2 3BALA 5KXDA 3KP7A 4Q0SA 4Z07A 4HG6B 1U5XA 2O8OA 3RTRA 1XE0A 4XJWA 5FXWA 2XSDC 4AEDB 5BNOA 2WNVB 1JT0A 2RN7A 2PHFA 3TRSB 1ZVFA 1V9U3 4JGZB 2KRHA 2HZTA 4BH9A 1X4PA 2R5YA 1OCRH 2ZX0A 2VZRA 1QZYA 2XAUA 1S4CA 3PUQA 5EDNA 1XC5A 2RM23 2M8EA 4YRVA 1TNFA 1E5IA 3K75B 4JTNA 3HAGA 2CW0F 1QH7A 2BEOA 2VQHA 3JRIA 1YQAA 3W3CA 1QHHD 4EWDA 1LKXA 2VXZA 1E3HA 4UFHA 1JZ5A 1WGPA 4AHYA 3M70A 3MHZA 5FZKA 4BL0B 1LEAA 5ICEA 4IERA 4CU8A 5K7HA 3KP4A 2VVEA 4OUMA 4N9IA 3UR3C 5LASA 3C2HA 4LG3A 4YVSC 1PIV2 2MH2A 3BB6A 5EF6A 1TBXA 2Y6LA 3VDCA 3WQ0A 3ZFEA 1NCRA 2XPVA 5IHRA 3BP8A 2WDBA 4LBMA 3UKVA 5JVGF 3RYKA 4PGHA 1X58A 3L2CA 4HPKA 5JOZA 4Q47A 5L3EA 1Y9MA 4HLTA 3A4UA 1PGW1 3TEWA 1TQPA 2ZZQA 5GPAA 1SFYA 4EM0B 4G12A 5JZGC 2O1QA 4LB5A 1KS5A 3WW2A 5C3PA 1S2EA 5JVVA 3O2PE 5LCWL 3OOUA 1B72B 1SDWA 2DMUA 2ZEZA 2ISYA 4BDZA 3PQJA 4NRQA 3GVAA 5SV8A 1VB2A 1F43A 2WN2A 1VQPI 2BVVA 3HQRA 5A1LA 4YW3A 5C3EJ 1OMIA 1W2NA 4ZONA 1SD5A 3I54A 1R1UA 2DI3A 1Z7S3 1BMV1 3MICA 2XL7A 4GA9A 5FY4A 1IS3A 1LHWA 1MS5A 1OF3A 5F7UA 3IN9A 5L36A 1NQDA 4MXVA 3LAPA 1V54H 4IE4A 1PZ8A 2VKVA 2VJIA 4Q2FA 1QKQA 1SHWB 4KBBA 5K0UC 1RIRA 5L9RA 2VNGA 4B4QA 1FPQA 2ECBA 5KHIA 2WS91 4MOAA 2ICWG 3BPSA 4L2NA 5ERIA 4LK0F 1RIOH 5CAZA 4FFGA 1YFWA 1MEC2 3ZCOA 4PI2A 3PUAA 5CFDB 2DXIA 5FYTA 3FHZA 4GH4A 4DO0A 4LPLA 1JT6A 4BQ5A 2YMZA 3DPTA 1AZDA 2QZ3A 4BXXJ 5EHDA 5FY0A 5EJZB 5GZEA 3F22A 1QJU1 2Z4FA 2VZVA 1UMZA 4DJAA 2PMUA 5CKNA 1WWYA 3F8FA 1WH5A 4H4KC 1Y56A 3IPVA 4X8NA 1SZBA 5A7QA 1WCQA 3HOXJ 3LB9A 5LA9A 3THDA 4CXXA 4FCYA 2ZGUA 3EETA 2QSFX 2WB1A 1I3AA 4CP9A 5GZGA 1KXGA 2AZ5A 3OGRA 1YUDA 5FIXA 1MMGA 2CYFA 2YU2A 1TW2A 5HVQC 2ARBA 4BE0A 5EGOA 2BVBA 3ABLH 5TISC 2ZFWA 2B8MA 1Z1DA 2CGOA 1QNWA 3SH5A 4RS5B 3ITQA 1IN7A 3PU8A 2ZPXA 3HOTA 3WP6A 3VB2A 1I3QJ 3JAMK 4XIDA 1MMSA 1HRV1 5A33A 1D7PM 1QIQA 3FBIB 3C7GA 3DBRB 3CCJI 4HV6A 4A93J 4UY8I 1R5ID 2H8RA 2W52A 4XDPA 3HUGB 4H55A 1ASJ1 4V2VA 1ZZ9A 3PL0A 4LBLA 1XSXA 5FYCA 2O6GE 1FOD2 3DTIA 2W3JA 4CXFA 4FAHA 1KONA 2EA4A 3ZMUA 1Q56A 4Q1RA 1XD7A 5C4XJ 3OSGA 2VW1A 2AXLA 3KLNA 1XGOA 5LEKA 2CQXA 3NWSA 1G6NA 4G8XA 2FQPA 1WW6A 2W92A 1ND2A 2CWEA 3GX4X 2VPVA 2FBKA 1DQ0A 3REOA 3N7JA 5FBJA 3JBG1 5GPCA 2JICA 2V5DA 5E20A 2MEV3 5CZKA 5A3NA 5HNFA 5F39A 2D6OX 2DK5A 2ZHMA 4WVWA 1CQ9A 4P5OA 4LNVA 4Y26A 3OYIA 1LOFA 1ODMA 3VZMA 3LNQA 3MLLA 4V19K 1IO2A 1Q8VA 4UVAA 2ID4A 3D1NI 4L0PA 1W6NA 3T09A 2Z2SB 2DMTA 4GAZA 4QPGA 4HKOA 3JREA 2BW8A 2Y9ZA 3MBWA 4BZ4A 2X9DA 3H92A 2YXSA 5L3CA 3BJ6A 2VL8A 1FIAA 4MXWB 4AK3A 3VEPA 2E51A 2ZGQA 3KF5A 2FF4A 4ENKA 4L9JA 2UYBA 3SEZA 1PNFA 3G73A 2W25A 4CYCA 1EAH3 2C4XA 1W6MB 1JU3A 2WA3A 1MH3A 3FWEA 2KXLA 3FLPA 4ONUA 1H8TC 4XHBA 1MBEA 2XKOA 3D0SA 5JHFA 3ULQB 2LTPA 3SCGA 3VYRB 1U9OA 2NPIA 3GGLA 3WDWA 2CW8A 4IQJA 4HNVA 5E79C 2O14A 1IJWC 5FK7A 1V6NA 1TQMA 2MHFA 3DPRA 1O3SA 2VT3A 2ZX4A 1NA1A 1RUI3 4E7KA 3FUQA 4P00B 4K9SA 3B6CA 2WZ8A 1BR2A 3K4NA 4FETA 1ACCA 2K3FA 1PX4A 3DBHB 5I8TA 4WVMB 3O1VA 2OD5A 2E9QA 4UXAA 1ZH5A 2WFF2 1X8EA 4EJVA 5GJ6A 5DCMA 5FRAA 1IW7F 2E5ZA 5FR3A 1DZTA 2KR2A 3O0XA 4UVCA 4A6OA 4M71A 1ZG3A 2R1BA 3M9AA 2J1TA 3KQ4B 3A0HC 2B9VA 5DV5A 1WA4A 4XIKA 2JX9A 2VD7A 3F6VA 5FRNA 3BTAA 4LXLA 2DA2A 5J3LA 1Q1HA 3CJTB 5EJ3A 3T1MA 3WNMA 3VV1A 2R063 5EFUA 1MW7A 2L2OA 1G3WA 2ID3A 2K9QA 1TNSA 1CX1A 1FEXA 3B73A 3IIIA 2LLKA 1HSTA 2QQPA 4A5MA 3DEWA 4RMNA 1RPWA 3GZTB 2HQRA 4MQVA 2JA6J 3M4OJ 1G9CA 1W6OB 4XQWA 4AWXB 2LNBA 2DTWA 4B1RA 4MLOA 3TO9A 2R93J 5HNHA 2VQAA 1NG0A 4LE3A 4L0YB 3MFAA 2NOGA 2WJSA 5DZFA 2QENA 2IPQX 2X6WA 5FZEA 3WQBA 2X6OA 2A3SA 5G04L 1PO13 3NQOA 4YGBA 4I3PA 1BW6A 4BQQA 2NXNB 5FYHA 3LA7A 2W39A 4IV3C 2JG9A 2D7FA 2IXHA 1AHDP 1GFF2 4KT6A 1AWCA 3H8RA 4XQFA 4AEJA 1AR81 3LIHA 4PJLA 4NVPA 4FP2A 4O9EA 3CJIC 1GHCA 1JN2P 1VAVA 3BG6A 3F2ZA 4MADA 1Z6TA 3M3OA 3EQEA 2V4VA 4JBAA 4NPLA 1ZGWA 2ZNYA 4DEVA 4NBQA 4PQ9A 5LW9A 3FFZA 5BNOB 4AU7A 4EM2A 3TAYA 4AVTA 4L9VA 2P6SA 1AL23 3LSPA 4QD2A 1KQRA 3GBFA 2E1MC 2FCVA 1VQNI 1CPNA 3EO6A 4M3BA 2NNYA 2XOMA 2P3IA 3ALQA 3UNGC 2JE8A 5KXBA 1QJX2 1V6IA 1XSRA 2YB7A 1DGWX 1X36A 1ONVA 2BW3A 1NLSA 4LA3A 4RM3A 4Q4Y2 2ZSHB 4M00A 3FKJA 1GOHA 2X1CA 3BU7A 3T8RA 1RUC2 2K3PA 2VCBA 3WNKA 1K45A 4QDQA 2EV6A 3NO8A 4QPIA 1N47A 3B9CA 3RI9A 4QXBA 3EDPA 1P7JA 4YM0A 3ZFEB 1NCRB 1JTXA 1T39A 1R1A2 4KG8A 3O1SA 4HPKB 1RETA 2JDYA 4LBNA 4XLHA 3GCMA 5CKQA 1DQUA 4CDGA 3MKZA 3K2OA 4RN5A 4IEXA 2BNMA 2VC1A 1LU2A 4KIFA 1GZ9A 4I98B 2BZDA 1LODA 4COUA 4P9GA 2A71A 4RQPA 2E60A 1JUSA 5E8IA 3DPUA 1GP4A 3AVRA 3HBZA 3K4LA 1H2MA 4LLGF 4PJMA 3RQ4A 1ULPA 4XKVA 2K4BA 3KCCA 5J36A 1S0EA 1XSVA 2M0CA 1PMJX 1W3XA 2RNJA 1XCVA 4OIOF 2VJXA 3D5OA 4ZYEA 4FTEA 2MABA 4G9SB 3AYDA 2F48A 4ZS2A 2NVYJ 1PUEE 4ZYHA 3NAPB 1BL0A 1K61A 2RJLA 3VBSC 5BUVA 5L19A 3O0VA 3NV4A 1NAEA 4WVVA 4E6KG 4D0PA 3WG4A 4A6SA 3QH7A 3GLXA 5ACA2 2UWAA 2ZX2A 3IDAA 3F21A 3FDYA 5B66C 1SMTA 1W9WA 2XB6C 4C3HJ 4GDFA 4PLNA 2R5ZB 2MEV1 4IGOA 3CD6I 1CIYA 4AVVA 5FBZA 4OI0A 2LY9A 4PJYA 1VQOI 1R5GA 3BOWA 1UW8A 3LQCA 1IG3A 2WO1A 4GH4B 2KIUA 1R49A 2XB5A 3AC0A 2JA2A 5KCMA 1CX4A 4XF0A 2XBO2 3OS2A 4Q0VA 3GCWA 5H6QA 1IPSA 1P92A 3AL0B 1JJ6C 4HVRA 2H8WA 2Q4SA 3LFUA 5EZHA 1JJ8C 5C3OA 4S04A 3HOZJ 3SITA 5JIUA 3FM3A 3ZIXA 1HX6A 3IPVB 3KWVA 1OSGA 4D9JA 4XBLA 4QHOA 3RWNA 4AYBA 2CV6A 1W6QA 5F8PA 2P7VB 3VN4A 4NHJA 2LDUA 3RZDJ 2EFOA 1PYVA 4CP9B 3I2KA 2XWJB 2HYXA 2WZR1 3WQ1A 2X85A 3BPXA 1ZZ7A 5AVPA 1PK6C 2IGKA 2MPFA 5ABJA 5EGOB 2HWVA 2IS6A 2BHZA 2ZMEA 3AKQA 2R3SA 3S57A 1W0PA 3H5AA 2LKSA 2W08A 3FMRA 3MZHA 4XJ9A 1B59A 2K27A 3OSFA 5BNNA 1N77A 2BWCA 2K46A 1RR8C 5DUIA 4RGKA 3VL8A 4JX0A 2DBNA 3DKXA 4ZTFA 2JG8C 1L3LA 5F37A 2JPCA 1Y8QB 1W8HA 2ADUA 2D3RA 2D5HA 5IVYA 3UESA 4QB6A 1SEUA 1N3PA 2WKKA 5KHKA 3TN92 4AFBA 1MJAA 1IPKA 2IAIA 4I0WB 5FAXA 2I74A 3WDTA 1MS0A 5E3OA 2Y6GA 4QGNA 2HNHA 4OZXA 4EV0A 3WTWC 2HEWF 3BTLA 2DCTA 1YYVA 3WLUA 3JCUC 5HXMA 3FXUA 1U5TA 1UKRA 4IVNA 4ZDPA 2BBVA 3BZCA 2ME6A 1GDTA 1K12A 3CP8A 3VD5A 4L5IA 1S0CA 3AKPA 5IUQA 1SLIA 4PJ0C 2PHWA 3RZZA 4PDWB 4FE4A 3HRMA 2DVDA 4Q4X3 3GDBA 4A3IJ 1SC7A 5A3OA 3OIQA 4RHV3 4P55A 3WTSC 3IHUA 4HETA 4QIWN 5BNPC 2WRAA 1YQ2A 2A5ZA 4DY5A 1W6NB 5C9AC 2QFEA 2KDOA 3DYPA 2YPDA 4JDNA 4QPGB 4KU7A 2BXZA 4Z82A 4KGGA 2VPLA 4CDWA 4YWAA 2VE9A 5C8CC 2RMU3 4L9TA 1W2AX 1IF1A 3N36A 5J1XA 1LCLA 2VCAA 2UXXA 4XRSG 1JOPA 4LA2A 1SFEA 2WYFA 2V5YA 4ESJA 2AHQA 4UB6C 5IYBJ 4CYCB 1NKGA 2VBZA 3T2PA 2HWE3 3RMYA 2XB0X 3GF2A 2OQ6A 1VMFA 2D1HA 1YJLA 5E1XA 3WHUA 4IV1A 2FCUA 5FKBA 2KJCA 3E6MA 5B3SH 3GTJJ 4S05A 1W5SA 3U9GA 1PVC3 3ASIA 1Q8QA 5TSWA 3VBHA 3V7RA 3I5UA 3WTTC 2B9SA 5JSRA 4DOZA 1MBFA 2UY9A 4U2AA 4KGQA 1PO11 1IKQA 3BG5A 4UUSA 2XLGA 1Y0UA 1C8M1 1Y43B 4ASKA 4CEWC 3IB3A 1UPSA 2WQ4A 3M2MA 5E8AA 1YFUA 3DPRB 2OXBA 4U7BA 1SMYF 2AO9A 2P6HA 1NA1B 4HYEA 5JLWA 3WGIA 2R92J 4INDA 5D21A 3J81K 2JWPA 3E5QA 2PHTA 4M73A 2RQQA 4G4FA 4K7JA 3QYFA 4AAXA 2E7AA 4LOCA 2IA1A 5H9QA 3KV6A 3PL8A 4O3MA 4IRHA 5FY9A 5I0DA 3K51A 5CEHA 3HRUA 2WT0A 4PBOA 2G9GA 2VBWA 1UY1A 1O4TA 2YU3A 2FRHA 4HF0A 4XMAA 4MO7A 5F3CA 4KQ7A 4HRIA 2VKHA 1MACA 3GBWA 2YY1A 2QCOA 4N53A 3S1NJ 2CAVA 1WQ2A 5DDJ2 2PTMA 2KIQA 4J01A 4LO5B 2Z16A 3HM5A 3ZQLA 5KR7A 3D82A 2P1BA 4S2GA 1F5FA 3E1SA 4C2TA 4QKFA 5I0SA 4PSWA 2JECA 2OVUA 2DA5A 3HOWJ 4QKBA 1W7PA 2L4AA 4XC9A 1LOEA 4RDUA 2GNMA 3HJRA 3PO2J 1KFUL 1XNAA 1AYM1 2UU8A 1W1WE 2FDFA 2PJPA 1T33A 1NCQC 5FMBA 3BCAA 2FQ3A 2XRLA 4IXLA 5F2WA 3TBDA 2IXKA 4XICA 3NNJA 1W9FA 1ZBE1 1BI0A 2OT7A 4I30A 3ZGKA 3TQNA 1FYUA 4Q4V2 1NZIA 3PNAA 3OL4A 4HX7A 2VW2A 2O8XA 2NQYA 5FPAA 3WU0A 2MNGA 1OYYA 1BBT1 4CCCA 1R4NB 3VKLA 5BPIA 1GU3A 2JDMA 1DDLA 4BCUA 4E4DX 5C7GA 4DFSA 3BOQA 5FZFA 5L7OA 3LSTA 4LJZF 3KS7A 5LK7B 2G7HA 3MO4A 5BXXA 4FPJA 1NLQA 2OCCH 2BV6A 3WTYC 2W5FA 5J1UA 2JG9B 5HI0A 3I3LA 5I8SA 3M3YJ 3CZ6A 2ZKNA 5IAVA 2ZJQF 1DU0A 3ABTA 2LM3A 5M0TA 5C5TA 3VPRA 4KWUA 2GWRA 3HN3A 2R7ZJ 4R9CA 1AX2A 5IATA 4XLNF 6PAXA 2Z42A 3RZLA 4MZUA 3N35A 2J5PA 2V09A 1SVOA 1BR1A 4O61A 3ZIWA 1QJY2 3B7MA 2QQUA 2KJBA 2HWD2 5FMOL 1OQEA 4YM1A 2LSOA 3IC7A 5F1RA 5IVBA 2HEVF 2Y26A 3HQXA 3K2AA 2CFXA 3CU7A 5F64A 4IEOA 4HSTA 3GFMA 3T08A 1FSEA 2EFWA 5ERLA 1FOKA 1V6JA 4EMSA 3LPFA 1HDPA 1CJPA 2BW3B 1FMD2 4IOCF 1K6OA 3DV8A 2ESNA 3ZRGA 3MN2A 2O8KA 2Y6KA 1NX9A 2L7MP 2HKXA 2CDPA 2AGSA 4OUSA 5FP7A 5FZIA 2JDKA 3WNOA 2DYSH 3TKYA 5C44J 4QPIB 3H7YA 3ETQA 3R4DB 1C28A 2C26A 4LBOA 4A0ZA 4FPEA 2E2HJ 3VSKA 4G7ZF 2C9KA 4IETA 5D6EA 3F8NA 4YW1A 3RWKX 3BLYA 2VL4A 2BRTA 1TMF3 3HOBA 4ABZA 3AMMA 2KPMA 2BYVE 1H2NA 4QX2A 5J4VA 4AIHA 4CE8A 2WO7A 2VI6A 4YFXF 2YU1A 4RQPB 2XHKA 4CCDA 2IXLA 4NO4A 5LK5A 2ZHLA 2GOMA 1U9NA 5JDBA 3UGGA 3WOGA 2CV1A 2XIGA 3L7WA 3FHQA 1O5UA 3CUQC 2A6YA 1LAJA 4PIZA 4QX0A 1H9WA 4DXSA 3T2QA 1X3ZB 2IP2A 3HR9A 4G94A 4HANA 1EJ9A 3AP5A 4YNIA 4P9YA 4DZJA 1W6PA 1JOJA 4J25A 2Y31A 2ZA9A 2QBYA 2PAKA 5LATA 1Z77A 2VVDA 1NY71 3JW4A 1YI7A 2EA7A 4AEMA 1OA4A 3OF1A 5EEAA 4BGDA 2GM4A 1ZBA2 1JYXA 4BA6A 4F91B 2WAQN 1BBYA 1RYYA 5A80A 3HT2A 2P5BA 2QDRA 3DBLB 5FPUA 5DQ0A 1RHI2 2DDAA 2F4OB 1FT9A 2V4AA 2FZ1A 3WZ1A 4CDXB 3RKXA 1W0TA 4FPKA 4CUBA 4LBQA 4LULA 3JR9A 4BB3A 1K79A 3GTPJ 4QDSA 4AIJA 4IE6A 4BDVB 2D6LX 2EK5A 5FYIA 2ZZJA 1DQ2A 3RMXA 3GUDA 5DUXA 3T0DA 2B5HA 1KFXL 2JB4A 1APNA 3BR6A 1XU1A 1FPN1 3K9TA 1JUHA 4F83A 1XRUA 1SFUA 3S30A 2QVSB 2EALA 3C18A 3D8CA 2P34A 1GUUA 1W6QB 4DS0A 3UGFA 2LRDA 1G3YA 4BQNA 2RS11 2EZKA 1Z0XA 3OYWA 2JVHA 2OKXA 4LR4A 1UAIA 3OG2A 3ETPA 4QWNA 1EP0A 4ZS3A 4XNFA 4Z2AA 5ABJB 5HLGA 1DDNA 2JJ6A 2TDXA 1IGOA 4MHRA 3CC2I 5KHDA 1HQCA 4EN6B 2LC2A 5BNNB 3OBRA 4DINB 2EFQA 3BPVA 1MDMA 4XOGA 4RGUA 1B4AA 1QH6A 1LGCA 4A3FJ 1WW5A 1ND3A 2AR6A 1VFCA 4R8HA 1CQTA 5F1JA 4U87A 4NDLA 5JUVA 1RNLA 1G9DA 4MFDA 5FZ9A 2OZ6A 1POQA 4BJ0A 1XB9A 2H27A 1JKQC 1HF0A 1XDSA 3SHFA 5C3SA 4DXTA 2M4KA 3CZJA 2UZKA 4CDUC 4BQ4A 3AZWA 2DV9A 4URAA 4GB33 4YZ1A 1OXCA 2BWAA 3T0AA 1BLZA 2XGDA 3VKFC 3RI4A 1H1AA 4K2EA 2GC3A 4I01A 4LBJA 3BR0A 3RJPA 1YJNI 4BKXA 2W48A 4ZJZA 3H50A 1OFCX 1GT0C 4R9BA 2RJ2A 1BMV2 4FP3A 5FP9A 2XV4S 3SKVA 4BAYA 3FMSA 1OISA 4AG4A 2RKHA 4QAWA 4RD7A 2BNNA 2UY8A 2P8TA 1LULA 3BCBA 2VOPA 4A3CJ 1TP4A 2IGNA 4PGGA 1F31A 1JYCA 1BK0A 5GZDA 1RINA 3F9KA 3AJYA 4KMFA 4AEDC 2P2KA 2WNVC 4E2SA 3QWLA 2F4PA 4EM1A 1XC6A 3A21A 5I0UA 1DGLA 1VR3A 3BYWA 4X6QB 4CDWB 3IP4B 2WS92 2VQGA 3DWLE 2OIIA 4QU2A 3CCLI 1URXA 2JENA 4XLEA 2DPUA 1D4M3 4DBQA 3MDPA 1RUJ3 2QKMB 4JQTA 1IC8A 1MQTA 2AACA 2D6MA 1A6QA 1DZQA 5L3GA 4E9KA 5A32A 2Q1MA 2Y0IA 2COMA 2SLIA 2EZHA 1S7EA 4KA4A 4URTA 4B29A 1QJU2 4R1HA 2IXIA 4AOCA 1RRJA 1AX1A 4IV1B 1VZ0A 3AZXA 3CBNA 3GJAA 3CJNA 3E3VA 1MNDA 4ATFA 2V79A 1QF3A 1BM9A 4FPYA 1U2WA 4Y52J 2GA1A 3I55I 3PVEA 1JKOC 1XMXA 2GZWA 4I3GA 2HKOA 2Q1FA 3A0KA 4QPWA 3I3MA 1P4WA 2KD7A 2IFRA 1CF7A 4UHTA 5K7ZA 3KHCA 4UUSB 1S0BA 4S2HA 2QE3A 3WP3A 3D6EA 1R00A 2DOAA 4CDQC 2PFWA 1VPHA 3FLTA 4JDMA 2Y6JA 1PJRA 3HTUA 4Y1XA 3ZPOA 4XR6A 1GZWA 3H8OA 3ZQFA 2VUMJ 4FI9A 3VYTB 2LW8A 4HAMA 2X1DA 5IVVA 2XC7A 3H0DA 1ZELA 2VN2A 1F4HA 2VOKA 3FBNB 1ASJ2 4K1YA 1V5EA 4XTPA 3WG1A 3GCXA 4BWOA 1JYNA 1RUG1 2DW4A 2YX4A 1DGWY 2O8QA 2HWB3 3M4FA 3IZOA 2XUEA 1A04A 2HI3A 1LGNA 4N7UA 1VBE1 2L02A 4N53B 1RZ4A 2BFUS 1WKYA 2GP3A 2O7OA 2OS2A 1SLCA 3IM0A 1ULEA 2JDAA 3WODF 3B9IA 3LA3A 4KWKA 4HBLA 1HXS3 5B5EC 1SCRA 3JD73 4GYGA 4XCAA 2K9ZA 3JBG2 1UF2C 1QVUA 1XG1A 1W7PB 3ZYFA 4NHXA 2OCEA 4E7ZA 4XF4A 5J1YA 4E2GA 5A3WA 4GXLA 1VI0A 4UFIA 3DL3A 1HV1A 1JODA 1IS5A 1MS8A 5E16A 5IP6A 4Q0PA 1X2MA 3APBA 1WKMA 3WDUA 4B1MA 1Q3EA 2CFOA 1PM7A 2ADDA 3GZEA 1YLFA 4PT6A 1LDKB 5CFDC 1HB4A 5DD4A 1FTZA 5C4WC 2Z5UA 4WX9A 2LRPA 1IAWA 4QB1A 1H0MA 3VHOA 3ZMDA 1PGL2 4ZYAA 4LFUA 2E53A 1RUD1 2V72A 2A6HF 1ZM1A 3AZYA 2E35A 2VECA 2X48A 1AR73 2XQXA 2HBTA 2GH8A 1G9AA 1D0ZA 1R58A 4XAAA 1WGXA 2QQLA 2JA5J 5IK7A 2A6XA 3CZUA 1DQ6A 4NQWA 2DCEA 5LEJA 1PHMA 4Y33A 1CAWB 2XJVA 2L7KA 4FTHA 4EN0A 3PIGA 2WWUA 3W58A 1X1DA 5FOBB 4QB2A 4FPLA 3OYNA 4HN0A 2EIMH 2HVRA 4LB6B 2RS53 3ONQA 5CQEA 2IXSA 4ENNA 4RS5C 2JVGA 4XF1A 1X1CA 4AAPA 5KBFA 4W65A 2XJUA 4CEYA 1GV9A 3OL3A 3KV5A 5A6ZA 4WF2A 4A12A 1K3IA 3FM5A 5J4YA 1O5LA 5JMCA 5FJ8J 1O57A 3ZXSA 1P4AA 5IK5A 3WNLA 1A31A 3AP9A 3KT4A 4MTDA 1H9GA 4LD5A 3I3QA 4QQHA 1OCTC 2BY3A 4HX8A 3S32A 2YGLA 3KV9A 2HWC3 4YPJA 2NAZA 2OZUA 4I99C 4OI4A 1C5IA 3SCFA 2CNAA 3K4BA 4I0AA 2LROA 2HJIA 2L7FP 4NOTA 1FIPA 3WGGA 2XVKA 3ROUA 3UYJA 1RUH3 3VBOA 3CESA 3RYPA 5C33A 3JTHA 1W0OA 1IQAA 4PFPA 1APLC 2BOLA 2ZGMA 2WFPA 4NE9A 4SBVA 2PMZN 1FYKA 4CU6A 4DZGA 4CTEA 5IAXA 2ZCWA 4D3WA 1IS6A 1IRXA 4HXCA 2D98A 3BT9A 4Y4YA 3HJEA 1UELB 2ME0A 2X1EA 1F8VA 1ZYRF 1UHMA 4AM3A 3OYJA 5LBBA 4TXWA 4BEHA 4NAMA 4PBPA 4Y24A 4OHYA 2WO2A 2XDVA 1YHQI 3U2RA 3ZFGA 4CVUA 1QQIA 2GIZA 4CU7A 5CVIA 2Q8OA 5K9YA 4IEJA 2WNUA 2ES3A 1R083 1BI3A 3T8TA 2E5NA 3G1OA 1PUFB 3MF6A 3VKMA 4MGTA 3AB0A 4M72A 4BQ1A 2DCJA 1G9BA 3LAJA 2QBYB 4UOJA 4OIPF 4LLFA 3WUCA 5LGNA 3VZNA 2JUCA 2D6NA 1GVJA 2GXAA 3QP5A 4GKYA 1LHOA 4HSJA 1F4KA 1OHFA 4ZY9A 3BROA 2W1UA 3WCSA 4LLNA 4O65A 4DRVA 1GXPA 3U1XA 5FY1A 2CQNA 1FMWA 1LOCA 1D1AA 5FPLA 1GLNA 5CIRA 4YM2A 3J7YJ 1AR82 4IW3A 3GF6A 2XASA 3LEMA 3FXOA 1MSFC 3PUHA 4HK8A 2WFF1 4AHXA 1LJ7A 2ZNZA 1ZAOA 4P02B 5FXZA 2K9LA 4LBQB 1Z7S2 1OYWA 4LO8A 3QLQA 3POEA 4XDOA 2ZBJA 1LOAA 2JDNA 4QPOA 3ABKH 4YSFA 1KQ9A 4EATA 4XJUA 1AL0G 1HC8A 3VHRA 1DBNA 3BWGA 3LSJA 1QOOA 4AI1A 3O1TA 2A6ZA 3LA2A 4IEWA 4YVWB 1VBB1 5FFOC 4HNTA 5IT3A 4FSJA 4XLCA 3FC0A 2RR13 1DCSA 1Y39A 3SJMA 1KDMA 5B1BH 4OHVA 4OYUA 2IA0A 4LKEA 3BVCA 3OYWB 4BIFA 3UJQA 3GLLA 1W7PD 2R043 3U21A 4FX4A 3RYRA 4IRIA 3VBFB 5GLZA 2YDEA 1RUE3 1XS9A 1HOMA 2D40A 3K70D 3K46A 4RLQA 2X5IA 1FMVA 1S0IA 1RB8G 1BIAA 3IRQA 1OD5A 1BK1A 1V70A 2IT0A 1WMFA 3BR3A 2W46A 4UYBA 4UAPA 3BPZA 2GIVA 2G4IA 3OBZA 2W84A 4M74A 3TNQA 3H8UA 1MMAA 3E5UA 4DZPA 5DG2A 3HEIA 1YYNA 1KD7A 4B09A 4BISA 3J7HA 4BOWA 4OIQF 3ZFFC 2YS9A 3S15J 4LUMA 2OA2A 1H0BA 5H9SA 1EV11 2X53S 2V26A 3NNGA 1GWLA 2C1FA 2VMDA 3UETA 5KVRA 2XAGA 3VHPA 4QX3A 1UOFA 3WX5A 1SFKA 2HXIA 3FK7A 3VDDA 1PO23 4KWJA 1VBC1 1J3QA 2Z1DA 4XN0A 2PI0A 2A5YB 2LR8A 2GN3A 4Y1YA 1A35A 2ZB9A 2J1UA 3NW4A 4OCTA 1RVF3 5T5JA 4D5FA 3V65A 1P4XA 2LK2A 2VMGA 1J09A 2BU9A 4A7ZA 5J48A 4M3CA 4YIFA 5FPBA 5KK1A 3P7NA 5JHUA 4GD4A 4U36A 1OLMA 4Y20A 1TME3 4RAGA 1UIJA 1YQ8A 3FHNA 2I07B 2PEXA 4K20A 5BNOC 1I3HA 3KB5A 2YC0A 2BE5F 3TOJA 1VQ5I 2KDZA 3PIOF 4WXCA 4MTEA 2GAUA 1QJX1 1IXCA 4W50A 3B6AA 1LRHA 2MEV2 1W36D 4CGZA 1UCXA 2VUDA 1AR93 3AXEA 2YG0A 4SLIA 5K5QA 4OMCA 3FZVA 3P3PA 1MQTB 4CA9A 3T1LA 5A32B 3VBRA 3JXSA 3NKTA 1W8WA 4HDVA 4M9SA 4EJOA 1V0AA 1DFQA 1YW8A 2GMMA 2M9HA 5HODA 4D1QA 2C9AA 5FZMA 4M0NA 4RR3A 1YW7A 3FZ3A 1BXHA 3CDIA 3ATGA 4BYYA 2HWF3 2YYOA 3OYLA 3T0BA 3ZFEC 1NCRC 5IFPA 1CD3G 2ORXA 2E2IJ 1M4WA 2WZR2 4YELA 4DYRA 2B7YA 3UT0A 4B8XA 3ES4A 2D3PA 1V6LA 1NG7A 2Z3YA 1GZCA 3ZR5A 3DKQA 3I2FA 1GZWB 5F6LB 1O3QA 2HVSA 3S14J 4WWCA 4WVZA 1WCDJ 1G9FA 1LVKA 3TEZA 3C2GA 3HNBM 3B69A 3ZKYA 2DT7B 5I91A 4NPRA 3ZLIA 3QYEA 2PQQA 4XORA 1TE1B 5JI6A 1O8SA 3OIOA 5ANQA 3RVHA 4ASMB 3FFQA 5JPNB 5CVRA 4KNYA 3MWMA 3CCRI 1DU3D 1PIV3 4QLCU 3NJVA 2R0QC 4MFEA 1TG7A 1YO5C 1DQ1A 3FHIB 5G05L 4XL9A 2VNOA 1ZYBA 2KRCA 1LDJA 3CCYA 2NP0A 3E6CC 5E1RA 2PBIA 5DMYA 1N1VA 4WM8A 1ZRDA 4BK4A 4OHXA 4IHTA 1L0OC 1HRI1 3R4UA 2EAAA 4BUPA 2GXBA 3GTKJ 1IGNA 4XQDA 4FPGA 4LBQD 3SLIA 4JHZA 4JGZA 4UBHA 3LOBA 2WWSA 3RZGA 4YFZA 2ZGKA 3WF1A 1FNZA 4O7XA 5IK4A 3HPGA 1UQXA 1O7LA 4FTSA 3ILFA 4GH4C 1YXWA 2EXIA 1QZEA 3ENRA 4QKNA 1WCMJ 1ETQA 2V6CA 1B1BA 2QZ8A 2GOXB 3AL0C 1XB4A 2LS6A 4QX7A 1JGGA 1JKPC 2D5VA 2W85A 4NHKA 4G6QA 4PLMA 1K78A 2QZ2A 1OPCA 3S2WA 3A02A 2ADEA 5DPNA 5BNQA 5LRRA 4D0QA 3I4MJ 2VY0A 2DA7A 1MJ9A 2FSWA 1BC8C 4AR2A 4COWA 2XUBA 2B63J 1G8WA 2OTLI 5L73A 4RM2A 4PUSA 4OUEA 1DP7P 2Q1ZB 2E32A 3DYMA 1MEC3 4FPFA 3LGRA 1C57A 2ZXHA 2XAQA 2L0KA 5EXOA 3KYLA 4K8RB 3VKNA 1VF9A 4ISQA 1V5FA 3GWZA 1PO12 4W6WA 3TN91 4FASD 2KL4A 5FY5A 3ZSKA 4GWIA 1GZTA 2EQRA 2N8GA 3V7CA 3VOEA 1AR61 5KWRA 3ZN5A 2X05A 1XQNA 1SD7A 1U3EM 4GALA 2BDRA 1H1IA 1PVEA 1A78A 4X8PA 2VKDA 3FE5A 4L99A 4TWTA 2DA6A 5CG9A 3HG9A 3V56A 4XILA 2PAMA 3BJOA 3ZVXA 2P5VA 4HW0A 4RYDA 4B8EA 1V4RA 1BOAA 1ND2C 2Z69A 5KC6A 1WLCA 4I7HA 1YO8A 1F9KA 2VNVA