3RPQA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
201
structure length
201
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILFYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords Catabolite gene activator
total genus 60
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rpqA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rpqA01
3WGIA 5E1RA 3LWCA 1B9NA 4HLYA 1FYLA 3I4PA 2Z9OA 3PLQA 3V4GA 1MD0A 1STZA 3BROA 3JAMK 3IWZA 4LJZF 3WG9A 5L3FA 4JTNA 2XAJA 1UIJA 4R79A 4MNUA 2P7VB 2BE5F 4IETA 3TO9A 2HKXA 5AONA 3ACLA 4OIPF 4EJOA 2DO7A 3HSFA 2F5CA 2M8EA 3BPXA 1T6SA 1PDNC 5BY5A 4S05A 4Q0SA 4LTAA 2L01A 3CO6C 4LLNA 1WWXA 4GO1A 4PIXA 1WRJA 4I09A 3S2WA 2Q2EA 2M1BA 2M45A 2GH2A 2HWVA 5FPXA 1YUDA 4XF4A 4HBNA 2JPBA 3RJPA 3GW2A 3IHUA 2MC3A 2B9UA 5FLJA 4N9IA 4XF3A 4Y17A 2KKOA 3M9AA 5CU1A 2PA7A 2XUBA 1D8KA 2PN6A 2QENA 3UKNA 2DW4A 1H0MA 2C6YA 5HDKA 3SXYA 1ZAOA 3FXRA 4IEYA 3DL3A 3E97A 2FBHA 3GZ5A 2FNPA 3V7RA 1KGSA 3RKXA 2DQLA 2QJVA 2FBKA 4KN4X 4GULA 3P7NA 2HJIA 3F8MA 1FI2A 5E20A 4B8XA 3EBRA 4E70A 5KHJA 1SFEA 3F21A 2Q1ZB 4MUVA 2F5FA 2RC4A 3BALA 3M70A 2V9VA 3PNAA 4Q47A 4LG0A 3R60A 1G3WA 3S7EA 1XRUA 4HLTA 4L9VA 5A2QZ 4QM9A 3SCHA 1MGTA 3SZTA 3EJKA 2VXZA 1Z7UA 1MDMB 1U78A 4BQAA 2NYXA 3SFZA 1YS7A 4L2NA 3V8LA 1HW2A 2VN2A 4DNCA 4WXDA 4Z07A 1ZRFA 2QCSB 1I1SA 4P9UA 2K9ZA 4UHTA 1TQIA 4I02A 3D5LA 2DFIA 4L5JA 1OYWA 5ILUA 1HQCA 5K5QA 4UBGA 4IEOA 1RI7A 1PMIA 1BBYA 3LQQA 3K1NA 1G3TA 4B29A 2FF4A 1O4TA 4UVAA 3HYIA 1JHFA 2BBYA 3F6VA 5FB2A 2D2WA 2CYYA 2GZWA 2DTRA 2A69F 3ETQA 1OYIA 3OGJA 4XFIA 4ETSA 5D1IA 3WGGA 2MHFA 2V79A 2VONA 2DPDA 1W7PB 4KIGA 1T98A 1OFNA 2N7GA 4K2EA 3HT1A 4HX4A 4YFXF 3GLXA 4E2SA 2MLKA 2XLGA 3H9AA 1WSUA 4L0YB 4R8HA 4XFHA 4MEXF 3JTGA 1V3FA 2RV8A 2XAFA 3FXUA 2PBIA 3HRUA 1EYBA 4KICA 4EGYA 1J3RA 4ONUA 1U3EM 4IEQA 1YW8A 2W25A 4G6QA 4EJWA 4ENKA 4PDKA 3GXOA 3ELNA 2KRFA 4LULA 3BJOA 4LK1F 1G6NA 3WTSC 2F2EA 3OCPA 5JHUA 1FBSA 5JSOA 1IRGA 1S7OA 1SD4A 6PAXA 3WE3A 4O3MA 4EJVA 2Y75A 1Q5OA 1W5TA 3NSTA 5L3EA 2ISYA 1IPKA 1XE7A 4LEJA 1H1MA 5LRSA 4A6DA 4HSJA 4LB5A 3L7WA 1X7NA 2W57A 4MZUA 3TDZC 4QXKA 4IF4A 2O0YA 4XFGA 1F1ZA 2GC3A 1Z05A 1RUOA 2O6GE 2VOPA 1ZZ7A 2D93A 3FZVA 1SD6A 2DAOA 3KEQA 2HTJA 2YPRA 3LZZA 1U5TB 1IN6A 1YTYA 1CAUB 4RGSA 3E3VA 1QY4A 2MD5A 4CO8A 5LHIA 3G73A 2EFNA 1FSEA 1IN8A 3KGZA 1OMIA 5D8LB 3S0MA 2PYTA 2F4PA 4A0ZA 4LG0B 1Z1DA 2B5HA 3V8JA 4J1WA 3O2PE 2QBYA 4HQEA 4FBFA 5F1RA 2P17A 1TQMA 2ETEA 1WLTA 1W4MA 3ABUA 2XIGA 3BPVA 5K5OA 5FD5A 1J9IA 3S7IA 4GGGA 4EM1A 3PQJA 1XN7A 1O3SA 3HSRA 1C0WA 3LA2A 4AIJA 4G7HF 3ISPA 1DUXC 5TRDA 1FYKA 3FM5A 3IBMA 1FZPB 1ODDA 3RDIA 1EH6A 2PTMA 3W6KB 1FP1D 3I53A 3W6JB 1IF1A 3K2ZA 3MZHA 3DN7A 4LLOA 2QDRA 5JR7B 4BH9A 3WODF 3KE2A 1R5HA 5E16A 5CLSA 2IT0A 1ZGAA 4MGZE 1NYWA 1O7LA 2JPCA 2EV0A 3CO2A 2Z2SB 5I0SA 3WW4A 1DGRA 3CLOA 1ZLJA 3JW4A 2K7LA 1Z6RA 1KU9A 1T39A 1F9NA 4MEYF 1O3QA 4QGLA 1EPZA 2KXLA 1R00A 1UD1A 2HYFA 3C1DA 5HLGA 1B59A 3RKYA 1FSHA 1S6LA 5CVVA 1E2XA 3EYYA 1NE4A 1ZG3A 2RVCA 2VECA 3KZYA 4XFBA 2QYOA 3SXWA 2LF7A 1U8RA 2V09A 3KSCA 2FNAA 3NEUA 4A0XA 1LEBA 2G7HA 3OF1A 4PCQA 5DYMA 4U0YA 2D45A 2AS5F 3C18A 3TO7A 2VPVA 3CEWA 4XF1A 3GEZA 2DLLA 1FC3A 4KT5C 1D3YA 3RYKA 1LDJA 4RAZA 3SHFA 1IRFA 3CO7C 4QWQA 2W24A 2FBIA 1XGSA 3FMRA 5FGMA 4WXCA 1IPJA 1CAUA 1X8MA 2ZBKA 2GWRA 5LGTA 1U2WA 2Q0OA 4LGWA 1O5LA 4RGRA 1SMTA 2MLGA 3DFGA 3L09A 3ML6A 4JVAA 4IEUA 1VP6A 3H7JA 3H8UA 3CL1A 2IA2A 1B1BA 1FLIA 3IRRA 5D4RA 5BXXA 2FOKA 4IRHA 1UW8A 2V1UA 3VFZA 2QZ8A 1FT9A 1MJBA 2GU9A 1ZZ9A 1ULYA 1UHMA 3DPTA 1CAXA 4OFGA 3N97A 2MBFA 5LGUA 4EVIA 3K69A 3TOAA 1H1IA 3QPTA 5ERIA 5D5UB 1A04A 2DK8A 3O3KA 1SQ4A 1YFYA 4P9FA 2OU2A 2E7WA 3CUQC 2VE8A 2K0GA 4FAGA 4ESFA 2HYGD 2YU3A 3QP5A 2D40A 3MAJA 4IEVA 4X6RB 2CG4A 5ILSA 5DDGA 1KYWA 3R6SA 2ZMEA 3WTVC 1QGPA 4RGUA 4LA2A 1R1VA 5I93A 4Q0VA 4Q0PA 1HKQA 3ABTA 4MGRA 1IN5A 3UKVA 4I0AA 4XSXF 4HOBA 4KDPA 4AWXB 2HEOA 3ZPLA 3HQXA 4O6JA 3V8KA 1SFXA 5EFUA 1G3SA 3ECHA 1RIOH 1CX4A 3CUQA 4FT8A 4EWDA 4KL1A 1YS6A 1R1TA 4P96A 2ZCWA 5JSRA 5I8SA 3WW2A 4UBHA 4G9YA 5CYVA 1HBXG 4IJAA 2HS5A 3NQOA 2XROA 3GF2A 4XFAA 2FRHA 4Z82A 1CAWA 4HYEA 5D4SA 4KWKA 4X6QB 4QGMA 3JZVA 1RZ4A 1FYMA 4M9ZA 1ZNPA 1UCXA 1SD7A 1QPMA 4G8XA 3M1EA 4IEPA 3C3WA 3GVAA 1IXCA 4ZH4F 2IA1A 2GXGA 3DKWA 4BHPA 3WW3A 3EETA 3HHGA 4HN0A 3QOPA 2UYBA 3BB6A 4MX3A 5K1YA 4UV8A 4KIBA 1P4XA 3HRMA 2W84A 2PAMA 1NHAA 4G7OF 1V70A 4AQ6A 4Y15A 1K78B 2CV6A 1MZBA 2RKHA 1YLLA 3HUGA 3RNSA 4I2OA 3IDCB 2VODA 4NHJA 3EQLF 2LSOA 1WKMA 2L4AA 5HDGA 4ZU4A 1DPUA 1ZZ8A 2PMUA 5E8GA 1OYYA 4XLPF 5HLIA 3B02A 1ZGJA 4ZZLA 2ESNA 4UXNA 4I3PA 1KQ8A 2KIMA 2HFHA 2OZUA 4NVPA 1XE8A 1X3UA 2QQAA 4WK8F 4A12A 2NRAC 1L0OC 3GFMA 1S8NA 5FQ0A 4HF0A 1IN7A 3T5XA 2CSOA 2ACJA 1VTNC 1LNWA 1YG2A 3FMSA 3WTUC 4LD5A 4D7SA 2Q8KA 2A6HF 1UPIA 3I71A 5FDBA 1YW9A 3EDPA 4QLCU 3F6OA 4HX7A 3FJSA 4U0WA 4WBBA 1ZZCA 1SAXA 4QGNA 2HQRA 1BC7C 5ICFA 3C3VA 2R3SA 4M73A 3U10A 2XAHA 3BOQA 2PHLA 3QP6A 1I5ZA 1DZTA 4EROA 4YRDA 1J1LA 2EVXA 3F8CA 2EA2A 2DQRA 5FLHA 4LUKA 1I27A 2VC0A 1G4DA 5JR3A 3D82A 1LDKB 2DU9A 2KIFA 4CZZA 1ONVA 5D6FA 4AVBA 5BMZA 3NVCA 4L0ZB 2CQKA 5KHIA 3RKWA 3LA7A 3ECOA 4OINF 5K5RA 3R0JA 1BN5A 3KCCA 3OOPA 4EM2A 4HW0A 3K1MA 4LMYA 2HTSA 4D0PA 1FY7A 4IESA 2IXIA 1SD5A 4AVAA 4NB5A 3O6BB 5I8TA 4OU0A 4BAYA 5CVUA 1LR5A 2PLYA 4XF0A 3MCZA 1FBQA 5KK1A 1RUNA 5I0TA 2FSWA 3IDBB 2O3FA 3G3ZA 1OKRA 1O3TA 4D7TA 2ESHA 3TDUC 3VOEA 2UY8A 3GFJA 2K4BA 1F4KA 4U0VA 3LA3A 4YSFA 2WTEA 2ATFA 2W85A 4EWAA 4L5IA 2DPUA 3ZDSA 5D6EA 2VC1A 1ZH5A 3K0LA 2D1VA 3T0YA 2H0VA 2D1HA 3ZP5A 4U88A 3MYXA 2H94A 1J5YA 2QVOA 2P8TA 2UY9A 1G3YA 1R36A 3ZN0A 3KMHA 1U12A 3CLPA 4XSZF 3PVBB 3IL2A 5JVTA 3GO5A 3M8EA 2EFPA 3ERED 2IXHA 1VJ2A 2QQ9A 3H92A 4E2QA 3HOSA 3F72A 3B73A 1Z9CA 3MPBA 3WTZA 1TBXA 3L00A 1EH8A 2VBZA 4BYYA 1S29A 4XF9A 2RQPA 5J48A 4XFFA 3G7DA 1DDNA 3DXJF 3FMQA 5FO5A 3T8RA 2F5EA 3LAJA 1BC8C 3DF8A 3RZZA 4QM8A 3MEXA 4Q48A 4HX8A 5IT3A 3FX3A 2LF8A 1KU3A 3J81K 1HKTA 3CTAA 1R7JA 4MGKE 5J3UA 1I6XA 2K27A 1K79A 2E7XA 2QVSB 1W7PD 2V1XA 5AVPA 4WX9A 1ZHFA 2P5KA 5LEKA 2H09A 4GYGA 5AIQA 3I59A 5E8IA 3GX4X 2PAEA 2ADUA 3HSEA 2A5YB 2DCTA 3LOIA 2FMYA 4LLGF 2HKOA 2BNNA 3I0TA 3M8FA 3GWZA 4J1XA 1XCBA 2XAGA 2L4MA 1YFXA 3J81Z 3UKTA 2KJCA 3TQNA 4IHTA 2ISZA 2BYVE 2ZMEB 2JSCA 3F3XA 2PAKA 4GXOA 3GUDA 3BJAA 4HBLA 2R7DA 4YIIA 5HI0A 1FNNA 5DCMB 3V7CA 2L02A 4FX0A 1U5TA 1EP0A 3J80Z 4M6YA 2GC0A 4KMFA 2LNBA 1JE8A 2XLAA 2O8QA 4HAMA 4EV0A 3H1YA 1YWKA 3ES4A 1Q1HA 3CUQB 4TLFA 2PI0A 4IERA 4IXAA 4PGGA 2IVMA 3HHHA 5FLXK 2F5DA 3E6MA 4HN1A 1GVJA 3M7GA 5LHHA 2P5VA 3VEPA 4META 1ON2A 4FAHA 4UVBA 1J7KA 3T1BA 5E1WA 2ZNZA 4XETA 3I7DA 1XGOA 3I64A 5EZWA 3WU1B 5KHGA 4M9SA 1H9GA 3HIFA 4JQFA 3OTFA 5T3NA 1IZ1A 2Z69A 3LAGA 1D8JA 4GYIA 1H9TA 5E1ZB 3ZMUA 3ELKA 4BXUA 5K8SA 1J58A 3L9FA 2LKPA 4IPAA 4QMAA 2XV4S 1AWCA 3U0ZA 2QQBA 2ZFWA 1XDUA 3WTWC 3COAC 5DUIA 2IJLA 1DGWA 4KA4A 1X8EA 3QU6A 4IRGA 4CHUA 2COMA 5C8WA 1QWRA 1R5GA 3LQRA 3MDPA 4KIFA 4A2UA 1LB2A 5BOXA 3FFQA 1R58A 4AVPA 2ETHA 1ZX5A 3E5QA 1JGSA 1RNLA 4OIQF 5E1XA 2QUFA 4MGIE 4M74A 2FQPA 4HVQA 1QXJA 3FZ3A 1ZG5A 2OA4A 3HRSA 1XGNA 3WTTC 4L18B 4ZYDA 4B09A 3FHIB 1EV7A 2PJPA 2AXLA 2FEZA 2L54A 2EA4A 4YYOA 2EWNA 3EUHA 3E6DA 4BHCA 1KU7A 1KYZA 4EM0B 5LEJA 1DZRA 1SEFA 1CF7A 4ESBA 2MNGA 2QLZA 3IWFA 1REPC 4RB3C 3H1MA 4HDVA 3KETA 2P6SA 1BI0A 1GQGA 3WW1A 2R7FA 1CAWB 5EEHA 3SCFA 1QQIA 1UB9A 4G6DA 2PEXA 4LFUA 3RTRA 1NE6A 1ON1A 5LGNA 1WQ2A 5LHGA 5ICGA 1HSTA 2XHKA 4PZJA 5C6CA 2UXXA 2VT3A 2Y0OA 4U7BA 2Z33A 3R0AA 1T0FA 3EYIA 3F8BA 1PUEE 2GA1A 1IN4A 4I7HA 1O7FA 1UHWA 3PQKA 2FU4A 4PJYA 1BIBA 5ED4A 1LQ1A 5DV5A 1ZZ6A 5JAXA 3GFLA 3NRVA 5D5XB 2DT5A 1K78A 3RYRA 1IXSB 5ICEA 4JBAA 2XASA 4WXHA 4TV7A 2TDXA 5BPDA 3MQ0A 4EGZA 2Q0AA 3KLNA 4CXFA 1FX7A 4CYDA 4M72A 5I0RA 1P6RA 2X4HA 1L3LA 5E17F 5HS7A 3GBFA 1SMYF 3MWMA 3HTUA 2IXLA 4G7ZF 4OIOF 1HW5A 3EHKA 2IPQX 4MQ9F 4KWLA 1OR7A 5KHHA 1U5TC 4JTOA 1LKNA 3QACA 3RI4A 1XMAA 3HRTA 4IVNA 3I54A 5DCFA 1R23A 2KJBA 2JZYA 5JFRA 4A0YA 2UXNA 4AVCA 2BNMA 1TW3A 5HLHA 2ZJ2A 2Z3YA 3TOBA 2X0LA 2IW5A 2PFWA 4OOIA 2EFWA 2O1QA 2C0ZA 1AOYA 3F22A 5FLXZ 3T8TA 3L2HA 2IXKA 1FOKA 5I8YA 2PFBA 2HR3A 1R22A 1ZRDA 1Y0UA 3MZYA 1O5UA 3VHRA 3ZMDA 3FWEA 4EJUA 3GZ6A 1J0RA 2E1CA 5F64A 4CGZA 4ZYGA 1YQAA 1LVAA 2K86A 2I45A 4KMUX 1FWZA 4AIHA 4Q4ZF 5EEGA 2Q30A 1JXSA 1RGSA 2EAAA 4BNCA 5FQ0B 5J6XA 1KQ0A 4M9XA 3MFKA 4A5NA 1TW2A 4QX5A 2EB7A 2O03A 1XMKA 1UIKA 4M71A 4ENJA 3AAFA 2GC1A 5JI6A 2ET7A 4HLXA 3BY6A 3H50A 4HZFA 3F8NA 1MJ9A 4M6XA 1XSVA 4FHTA 4WF2A 2EA7A 3WGHA 1ZREA 3K9TA 1UCRA 1IW7F 5BPIA 2EV5A 3ES1A 5DEQA 3OV8A 1PP8F 2PQ8A 2G9WA 3BP8A 2WFPA 4Y13A 3LAPA 2GC2A 3JSOA 2K02A 2XVCA 1ZYRF 4U7DA 1XSDA 3FHZA 3ZMZA 2MH2A 4RGXA 1CAXB 2ZNYA 2OZ6A 4XEZA 1SFUA 1RC6A 4RB2C 3DV8A 2VOOA 3SHRA 1CAVA 3ZN1A 4HA8A 1P4WA 3NKTA 4OMZA 5BS6A 1KA8A 4ENMA 2UWMA 2OBPA 1O3RA 4HQMA 1HSJA 4ASNA 2B8MA 4JK1X 4L9JA 4UXAA 5HDNA 2BGCA 1B4AA 2DBBA 2V1DA 3WE2A 4ZU7A 1X82A 3KP6A 4MTDA 2MPFA 3U11A 1E17A 3QPHA 2CGPA 4XRFA 3D0JA 5F6FA 3CJNA 2EK5A 4YFNF 1S3JA 2VBYA 4ZU5A 1IXRC 1V4RA 5HVQC 1T2KA 3TNPB 5FCCA 2B0LA 1YFHA 5LBQA 4LUMA 1GQHA 3H3UA 2OQRA 1D5VA 4YIFA 2XL9A 5J7MA 3E5XA 1LEAA 2M5WA 4JV4A 4EJTA 2VBXA 3NL1A 1YW7A 5CADA 2XAQA 4I98B 2JTVA 3FM3A 2EJRA 2WV0A 3BPZA 1W7PA 3BU7A 3CF6E 3NJZA 4L9TA 1R1UA 4KUMA 5CJ9A 2BEOA 1QZZA 2ELHA 3J7AO 2CAUA 1BI3A 4AQ2A 1MJAA 1Y3TA 1QO0D 1DPRA 5ICCA 3KFWX 5DD8A 3CJXA 3LSTA 1TNSA 1J75A 3I5UA 3IRQA 3ROUA 4E2GA 1CGPA 3V7SA 4O5VA 4GCVA 4F8AA 2CW0F 2RN7A 1Q3EA 3L2CA 1HXDA 2D5HA 3REOA 2OAZA 3DP7A 2IXJA 4UUVA 3U1DA 2FA5A 5L3CA 2M30A 1FPQA 4Q5SF 5HS9A 4HV6A 1P92A 1YFWA 2MH9A 2DI3A 2OZJA 2OYZA 4Q0QA 3F23A 4ESJA 4RB1A 3QAHA 3R4KA 4F7ZA 3SCGA 4A6EA 2NAZA 1USSA 1IAWA 1GXPA 4XLNF 1ZRRA 1YO5C 2RGVA 4DQ2A 2P7CB 1K6OA 2OPKA 3RIRA 2E9QA 4RB0A 4YARA 1WA4A 3H3ZA 3LWFA 2O61A 5FLIA 4O9EA 2OD5A 5D8KB 2V6CA 1LRHA 1EY2A 3WU0A 2DK5A 3DQVC 5E18F 4O9GA 1QZYA 1GXQA 2YSRA 2QWWA 1TTYA 4LB6B 3J80K 5L3DA 1BOAA 2YX4A 4CICA 1XD7A 1WGPA 4BHBA 3GYHX 2H6BA 1KQ9A 2FMLA 2Z99A 1NXMA 2D5FA 1BI2A 3TNQA 4HVOA 3FF5A 5ILVA 3P9CA 4WZCA 2XL7A 4G94A 1RL3A 5CVRA 1XGMA 5TJJA 2CFXA 1YFUA 4HV5A 4UNOA 2STTA 3BWGA 3SZPA 2KIUA 2ZKLA 3NW4A 3E5UA 3P9KA 4BIFA 1USTA 5FD6A 3LFKA 4I0BA 4Z2YA 2K4JA 4S04A 4OMYA 4P55A 1LDDA 2RDPA 1MDMA 3BDDA 4IEXA 4RS8A 5D5VB 4RD7A 3BJ6A 4ORFA 4PIZA 2PG4A 3IIAA 4IHSA 5IT9K 1MKMA 5FFZA 1ZVFA 4ENNA 4HVRA 3EQEA 3ZMSA 4LK0F 5L3GA 5CVJA 1B6AA 1QXRA 1GHCA 4WCGA 4WWCA 4ZZDA 5I91A 5KVRA 3RPUA 4KYWA 1XSXA 2P5LC 3HT2A 1XDSA 2VT2A 4XFCA 3BCWA 3RYPA 4HMZA 1RTVA 1YIOA 4PGHA 5AIPA 1TQ5A 5DUKA 3FE5A 1BI1A 4PIYA 3KGLA 3DPLC 4H0EA 1JHHA 3N4MA 3VODA 2XKPA 4HF2A 2Q4SA 3GYDA 5L3BA 5FPZA 4YG2F 4AIKA 2YX7A 1S7AA 3IKVA 3DEUA 1U6GA 1OPCA 1P4AA 2NNYA 1Y9QA 3KP5A 3SQNA 5I0UA 3IKTA 2IP2A 4OIRF 4P5OA 3C7JA 1ZRCA 3I59B 1XB4A 3TO6A 1UFMA 3WTXC 2JRTA 3JSPA 4UVCA 2OA2A 2H6CA 2MA3A 3CUOA 2H27A 1OI6A 1TQPA 4P9GA 3TGNA 1YYVA 2XKOA 2ZXJA 4H7LA 1BIAA 1Q43A 3VB2A 3JTHA 1QNTA 4I01A 2PQQA 1O57A 3EO6A 1OD5A 1W5SA 5FFXA 2M87A 1J3QA 2XGXA 1KU2A 1SFNA 4OLLA 3Q5FA 4YNIA 2XLFA 3Q9VA 2UZKA 4WVZA 1CF7B 3U2RA 1FP2A 1ZG1A 2HDCA 4LLLA 2O8XA 2ZO4A 4UV9A 3ST7A 2J5OA 4Q0UA 2A3SA 2L3DA 1BJAA 2ZKZA 1NZCA 2XRNA 3D0SA 4MGYE 3F8FA 4KWJA 2VQAA 3ZMVA 1L3JA 2IXCA 3OD0A 4KU8A 4CDGA 2FQ3A 1P2FA 2EFQA 1K7AA 3U9GA 5A2QK 1YLFA 5BQTA 4MHGA 2Y0MA 3WTYC 4L9NA 2P6TA 4IEWA 2IRFG 4RAYA 4MQVA 1TNTA 3K1PA 3USSA 2EV6A 2HGCA 3O14A 2ET1A 3KEOA 4KU7A 4R52A 3QU3A 4IEZA 4ZYEA 4FX4A 2STWA 3CDHA 4LA3A 5J8FA 4EWEA 3TKYA 4DINB 3JAMZ 2RNJA 5H6RA 3ZQ7A 5LRRA 4ZYHA 4HSLA 1HKSA 2QNKA 4N0BA 5BV6A 1XCVA 4MV2A 4Q29A 5KBFA 3HOTA 4XBFA 4N9HA 3KLOA 3E6CC 1VR3A 5LLQA 4AD9A 3E6BA 4YFKF 2A07F 1BM9A 2UYAA 2J5PA 1PP7U 3QRFF 3ULQB 5JSPA 2WC2A 2QM3A 5H6QA 2CAVA 2GA2A 4HDUA 4ON0A 3KP3A 2CO5A 2A68F 2FXAA 4A5MA 3Q9SA 2JT1A 1WI9A 3KP7A 2A61A 4IRIA 4K8FA 1J59A 4EQQA 1T38A 2QBYB 5BPXA 4HF1A 4L11A 2BV6A 2GIVA 4KNYA 1I1GA 2A6EF 1EH7A 3HTSB 5D5WB 2GXBA 3SMHA 4EMSA 4MH0E 5DCMA 3KP4A 3H7YA 3PFIA 2PMHA 2PHDA 2HZTA 2NS0A 1J2XA 5BUVA 3IC7A 5KHKA 2NNNA 1B9MA 5HS8A 5H20A 2G7UA 1Z6TA 2VE9A 3KZZA 4MTEA 1HW1A 2YR2A 2FE3A 2HOEA 1FXZA 3RPQA 1YHFA 2BNOA 2IC1A 1LJ9A 1CAVB 3KP2A 2Y48A 5IT9Z 2Z5UA 2OQGA 3FXQA 2WWYA 4KN7X 1Z91A 2E1NA 5CVIA 2HQNA 1FBUA 1ZLKA 5J8CA 2LDUA 3BZ6A 1TLHB 2GAUA 4R1HA 3P9IA 5HOOA 1ZZBA 4KFCA 3ZMTA 4AXOA 3GFIA 5JCTA 2EFOA 1ZARA 3M3IA 1PM7A 1ZN2A 3H1WA 2GQQA 2VBWA 1QBJA 1J3PA 1F5TA 1JUHA 2P4WA 3R61A 1IUYA 2IA0A 2CWEA 5DD4A 1DP7P 4NQWA 3I58A
chains in the Genus database with same CATH superfamily
4D8MA 3WGIA 2NS7A 4B48A 5FRNA 1D2SA 4UFLA 3V4GA 2I07B 1ZTRA 1STZA 4GMP0 5FY5A 2E63A 4G4FA 2E6VA 4LJZF 5FZHA 2KHMA 4CA0A 5JDBA 1UIJA 2WA0A 3OOXA 2LALA 2YS9A 3G1OA 4KMQA 4EN8B 2H1LA 3HQUA 4OULA 2F5CA 3B7MA 5BNQA 3BPXA 1TG7A 2ZMLA 1FPN3 4AAPA 2JJ6A 5GZEA 4LTAA 1OPMA 2WQZC 5A6XA 1TT5B 3S2WA 1W9FA 2BZDA 4QU1A 1GKBA 5C9AA 3ZQLA 4Z2WA 4HBNA 1H6XA 2DWRA 5LK7B 5FLJA 5BNOA 4XF3A 3AKTA 1OH3A 3LQCA 3PTYA 1IQDC 2PLV3 2C6YA 3I9V2 2BERA 2XSJC 3VBUC 2FNPA 4EATA 2FCUA 5K0UB 1G9DA 1GZ9A 2QQPA 5FMBA 4FXKB 2DQLA 3N7LA 2W4SA 1QDOA 2V26A 3F8MA 2CL2A 1NLSA 1V6NA 1FTTA 4DY3A 2NLRA 2WNOA 4OHXA 2BW3A 3UETA 3BALA 1H1AA 4KJZA 2V9VA 2ZJPF 3DGTA 3R60A 5A70A 3QLQA 4NC8A 1XRUA 2RE9A 2QE3A 5A2QZ 3SH5A 5LY2A 1MS9A 2VXZA 2GMPA 5LW9A 1U78A 5A3OA 2NYXA 1B72B 2QQJA 3OSGA 2RS32 4SLIA 1HW2A 3HAGA 3LEKA 2WV1A 2AEYA 1ZRFA 1TMF2 4L99A 3O1TA 1TQIA 1CIWA 2HVQA 3KV4A 2DFIA 2XXZA 1VBE2 2HWD1 4GB31 2AUYA 1ND3A 2PX9A 1QJZA 1W6PA 4C1XA 1ASJ3 4A69C 4AGVA 2Q2EB 3H8RA 1UZZA 5JMOA 1LFBA 1O4TA 2W39A 3Q0WA 1XNKA 1JHFA 5FB2A 2D2WA 3RZGA 3OBAA 5BNOC 5D1IA 2DPDA 3GTJJ 1W7PB 1W6PB 3PNTA 3HT1A 5J09A 1AJOA 4UFKA 5JXHA 5GLVA 5D8AB 2BOLA 3A4UA 1WSUA 4CZCA 4HSRA 1YJNI 4MEXF 4R4ZA 3W3CA 2CU5A 2A70A 3JTGA 5FZOB 2RV8A 1LKXA 4M3CB 3BGAA 4QQ2A 2ZAHA 3HRUA 1DU0A 2C24A 5EJ1B 1J3RA 3ZOBA 5FKNA 4RR3A 3POFA 3K7AJ 4ENKA 5LBEA 1Q8PA 4Q4X2 1S72I 1AX2A 4LULA 5FRMA 1G6NA 4XKBA 1QKQA 3OCPA 1FBSA 1NK2P 4BBSJ 3UKGA 1SD4A 2DN0A 4O3MA 5IATA 1Q5OA 3IB3A 3JD71 5L3EA 4FOYA 4ATEA 2ID3A 1IPKA 1XE7A 4LEJA 3ZXDA 4A6DA 5FY7A 4LB5A 4W4ZA 3L7WA 1X7NA 1CQ9A 5K7FA 2B46X 4MZUA 4N53B 3TP3A 4A3MJ 1QJX3 5FOJB 5JZGA 3U1XA 1FPN2 1F1ZA 1Q8QA 2AC1A 5L7OC 3LL7A 3OG2A 5FYVA 2VOPA 3WQ7A 2VQ0A 1SD6A 4YW2A 4ABZA 1Z0XA 3J8F1 2HTJA 2YPRA 1D4M3 1V5FA 4Q27A 3E3VA 2MD5A 4TXWA 2M0CA 2EFNA 1W2UA 1IN8A 3KGZA 3AL5A 5C4WA 1UAAA 2VKHA 1U9NA 4C3JJ 2PYTA 2F4PA 1BMV2 2YC0A 4A0ZA 3BR1A 3S30A 3O1RA 2NVXJ 4NHYA 1URXA 4FBFA 4HQEA 2QBYA 3IZOA 5KCMA 5CKQA 3ZYHA 1NXD1 4XRMA 2YC4A 2XIGA 1QJY3 3FMGA 1J9IA 3RZDJ 3TYJA 2X05A 4XUNA 4PFPA 1Z77A 1KRIA 2HLEA 1DUXC 4NPRA 5D8AC 2GXAA 1EH6A 2PTMA 3DKYA 4DUVA 3MZHA 1C5HA 4A45A 5JR7B 1IDYA 1IV8A 3D8CA 1OH4A 1R4NB 4HETA 1ZGAA 2VUAA 1ZYBA 4GKYA 2Z2SB 5I0SA 3OD4A 3WW4A 3BU0A 1KFUL 1KD7A 1OPOA 2VMDA 2L7KA 3CLOA 4C2TA 1LCLA 3JW4A 4W97A 1G59A 4FOVA 3BCBA 1Z6RA 1T39A 1YI9A 4MEYF 1WVRA 1JI8A 2VZPA 5A1LA 1B59A 4PHZA 1S6LA 5CVVA 1IS4A 2RVCA 1ZR2A 3V0BA 1X19A 3OEBA 2QYOA 5FP8A 2LF7A 1R6RA 3VKOA 4B43A 3T3YA 2DCEA 2OC6A 2DV9A 5DYMA 2AS5F 1RUJ1 3CD6I 2UWCA 1AR82 3CEWA 4OYUA 4XLEA 3IH3A 2C5DA 2I74A 1OOPC 4RAZA 3F9KA 4IE7A 4MFDA 2G19A 2W24A 2FBIA 1XGSA 5T5OA 2L9RA 2ZBKA 2AR6A 2DUPA 2GWRA 2DYSH 3WZ1A 1IOAA 4KGQA 1XPXA 1LOGA 2RMU3 1VP6A 3M4FA 4C0BA 5ABJA 5FJHA 3NWSA 3VBUB 1WW6A 1B1BA 3V42A 2ZHLA 2NP0A 2F6BA 1BW6A 3K4DA 4IRHA 2XDVA 1MJBA 2BWCA 3LGRA 1ZZ9A 3LDKA 2XF5A 1D2QA 3WDYA 3LIGA 3MICA 1ODMA 5ERIA 1QVUA 4Y1UA 2DK8A 3ZDVA 5FR3A 5IJRA 4B3XA 2WO1A 2EICA 1FAYA 1SQ4A 1HRI2 2PELA 2DXIA 1K4TA 1ULPA 1WKYA 1R1ZA 3AZYA 2VE8A 1VBB2 1S4CA 4V2GA 1CD3G 2MFZA 3JD72 1HRV2 3NMBA 5F3GA 1XBFA 3MAJA 3ZGKA 4IEVA 4DNYA 5DDGA 2XB5A 1Y8RB 2QQKA 1U0AA 4LA2A 1XC6A 3H3LA 4Q0VA 4MGRA 1ETWA 1EJ9A 4A3JJ 4LXLA 1UOJA 3HOYJ 2JX9A 2ARCA 1EUUA 4PJLA 4QKDA 3CJTB 3FLTA 4CXYA 4O6JA 3ZLIA 5EFUA 2NVQJ 4FT8A 1GZCA 4EWDA 3WNXA 2R5YB 4KL1A 4QXHA 1R093 5I8SA 1ETXA 2X53S 1W6NB 1LHWA 5CYVA 3CNAA 2GALA 2LKXA 4WVMA 1G9CA 4CDQC 3BTXA 3D6EA 3FBYA 4BQYA 5FOBB 2C1FA 4C3IJ 2CUJA 5J4YA 3DUIA 4LBLA 2J1UA 1ODNA 4G8XA 1PUFB 4QB1A 3M1EA 3CCEI 3N9PA 4Z6YA 5IYCJ 3GVAA 2QKLB 3VYTB 5LA0A 1MMNA 2IA1A 2GXGA 4BHPA 5F7UA 1WBFA 3VBOC 2X9DA 3AJYA 4BXFA 1DDLA 3ZKYA 3HXLA 2M2EA 4HKWA 4URTA 2CUZA 3VKNA 3HRMA 3GZUC 2W84A 4F83A 4Q4Y1 2R063 1K78B 4KWUA 4XOTA 3BG9A 1DQ2A 1OCPA 2KP6A 5AC91 5T54A 3SJMA 2ZSHB 1DPUA 1NOVA 2PMUA 4AC0A 5FWJA 1ZGJA 4ZZLA 1IS6A 5GPAA 2L9SA 4UXNA 1KQ8A 4XJ9A 1ZR4A 2QQNA 3CC7I 2YFZA 1ETOA 1BR4A 1RVF1 4RS5B 3AVRA 4A12A 1HV0A 4DFSA 4NRPA 5EPAA 1WCSA 1IN7A 2CSOA 2NMOA 1YG2A 3OBTA 4D7SA 3VB9A 2A6HF 3I71A 2CQ7A 5HBAA 3WDWA 3EDPA 3P6BA 1WMFA 4NC6A 2YFUA 2ZGNA 3U14A 1OBNA 1BC7C 4JQTA 5ICFA 4XK4A 4MIMA 1W0TA 1Z67A 1FATA 3U10A 3HKZA 2D6PA 2V72A 3CZJA 1DZTA 4AFBA 3JR9A 1J1LA 2FDKA 3T1LA 2ZSIB 4LUKA 3WEZA 1Y6IA 1LDKB 3RS6A 4CZZA 1ONVA 1DLCA 4OAYA 2FZ1A 3S1NJ 3WDUA 3NAPC 3LA7A 3ECOA 4D6QA 1JKOC 1BN5A 4H55A 5GTHC 2IS6A 2VR4A 1GV5A 2HU9A 3D3AA 1FY7A 1U9OA 1KQRA 1DQ1A 5ACA1 3O6BB 1YIJI 3ZXEA 3WR0A 4XXPA 1OFSA 3JREA 2PLYA 5F1JA 1Z7S3 5KK1A 1BQPA 1RKTA 2M7AA 2HWB3 3IDBB 3POBA 5DMYA 3G3ZA 2X5IB 3BQYA 2ESHA 3EMRA 2OKXA 5HCHA 2UY8A 4LORA 4F55A 2W1UA 2E7AA 4YSFA 4EWAA 3ZDSA 5D6EA 2BY3A 5C7GA 1ZH5A 1V6KA 3T0YA 5EG0B 1WD3A 2VE1A 2EIDA 3K70C 1XC5A 2WNUA 3ZP5A 4U88A 2QVOA 4E4HA 1R36A 3KMHA 2D97A 3KYLA 3BG3A 1OQ1A 1W8HA 4GWIA 4TWTA 1AR72 3PVBB 1QHDA 1GQPA 2EFPA 5FPUA 3PO2J 1VJ2A 4XKVA 1IG0A 1QXPA 5FZMA 2E71A 1AR93 2VIXA 2W82A 3RQ0A 4PQ9A 3MPBA 3WTZA 2RS12 2DA3A 1S29A 2IVJA 1PNFA 5J48A 3URFA 2XF6A 2HWC2 4W6XA 2DVFA 3DU6A 3F2ZA 4AIDA 3FMQA 4AFCA 3T8RA 2F5EA 2VL8A 3RZZA 2MD0A 3FX3A 4O61A 2D3PA 1KU3A 1HKTA 1UZYA 4ES8A 2P4EA 3ASNH 5E79C 1C1FA 2HXIA 1WCDJ 3USUA 1YO8A 2E7XA 5E3MA 3SQOA 3MI8A 1ZHFA 2P5KA 2ZJRF 1BKZA 4C8DA 4G3YC 2PAEA 3W6VA 2E2IJ 2FMYA 1W05A 2XB6C 2ZEWA 4WM7B 3LSJA 2ZXIA 4ITCA 1XCBA 2XAGA 3CHXA 4COVA 5C4WB 1CVNA 5AFEA 4JX4A 1OA2A 1UY4A 1AVBA 4IHTA 2JSCA 3AKZA 3ZR5A 3THDA 5KNLA 5DCMB 3V7CA 3MIGA 3LSIA 4FX0A 1S0EA 1FIAA 1EP0A 4JHZA 2GC0A 1JYTA 1H89C 3MGUA 4LO6B 4N7IA 2XPUA 1H9WA 3VDAA 4HAMA 5FZBA 3H1YA 4JC1A 1FV3A 4M0HA 4IERA 2IVMA 2Q8CA 4XCAA 3HHHA 5FLXK 2JMWA 4C1WA 1WW5A 1XNTA 2P34A 2XAUA 2ZFUA 3NQHA 1DYOA 3ENRA 2DBNA 2VPLA 2P5VA 4S0HB 1XSRA 2D6MA 4UWDA 1LECA 4ZXKA 2FD5A 5E1WA 5F04A 2JG8B 3KEYA 2OPTA 1MS4A 4JQFA 1K45A 4BOWA 2JDNA 5KXEA 2CU7A 3LAGA 1VBC2 4GYIA 3ALQA 3K4KA 2K40A 3ELKA 4RR3C 3LFIA 2VQGA 1PK6B 2VASA 4IPAA 1F35A 3ETPA 4ISQA 4CP0A 4XBNA 3S1RJ 3A02A 4PBOA 5EV7A 1VQMI 3VBRC 4RAFA 3COAC 1JMUB 3AFGA 3GF6A 2IJLA 5IFPA 5F5AA 4KA4A 4LG3A 1RVF3 4CHUA 2PLV1 3K2OA 5C8WA 3KIOA 2GOXB 3JBG2 2J1EA 4HRIA 1R58A 2BHYA 1ZX5A 3E5QA 3HOXJ 1JGSA 5EYRA 3OYNA 1O4XA 5DUVA 2COBA 2FQPA 4HVQA 3QH6A 5FTTC 2FOWA 2O9LA 4L18B 1W2AX 4B09A 3HD8B 3KHBA 1W6QB 2XMLA 3JQXA 4FPHA 2CH0A 4JAAA 2AXLA 2ZEYA 1X58A 1IC8A 2EA4A 1GMMA 1S0CA 2EWNA 1RESA 3E6DA 5LA2A 4BHCA 1KU7A 2LS6A 3ZOIA 4WM8B 4QU2A 4ESBA 2Y6JA 1ACCA 3IWFA 5JXIA 4OUSA 1NA1A 3H1MA 1BVVA 1POV3 3WINE 2P6SA 5IVBA 1BI0A 3PL0A 1X9PA 1QQIA 5C3SA 2ZB9A 4G6DA 1UOGA 2JA5J 3BZKA 4RA2A 3DU5A 2OVUA 2XVKA 4A6OA 1GZWB 1O7FA 4CCMA 1DP3A 5C8CB 2FU4A 5GAHJ 3IAS2 2H1KA 4PJYA 4MGTA 1BIBA 2QQ8A 2DDUA 5JAXA 3AP7A 3NRVA 2VZOA 3LE0A 1UPSA 1IXSB 2G1MA 5JLWA 1T6BX 2YBSA 2ELKA 4LO4B 4FPOB 5BPDA 5BYNA 1CJPA 2Q0AA 2DTYA 4LO8A 3PUSA 4QPGA 1C4RA 2X4HA 5E17F 4ASLA 3CC4I 4ANJA 3THTA 1SMYF 3OY9A 3VSLA 3NWKA 4AG4A 3I2JA 1MW7A 5FZAA 4JTOA 3P3NA 3ECQA 4FI9A 3ASIA 3SKVA 1QJX2 1XMAA 5DCFA 4MADA 4QX7A 2IS4A 3ZMNA 3AYAA 4IHWA 3KM5A 1A35A 1ASJ1 2UXNA 4RS5A 1YYNA 2HOTA 2V73A 1TW3A 2V1NA 2IW5A 1GWMA 1WWYA 2ZJCA 2PFWA 3SITA 3F22A 5FLXZ 5JVVA 1GLHA 3L2HA 1SC7A 1JHNA 1ZRDA 3FHQA 3MZYA 3ZMDA 2J1VA 2V4AA 3M1CA 1PYVA 4UUSB 5F64A 4CGZA 3S5AA 4ARXA 1L7QA 5CFDA 2XOMA 3KHCA 4BJ6C 2XJTA 5APAA 1IJWC 2EAAA 1RR7A 4NC7A 3A2KA 3LSPA 2I8DA 5J6XA 1X9TA 2Q8OA 3MFKA 1TW2A 4AQTA 3SC7X 2EB7A 4WM7C 5EQUA 3MBWA 1UIKA 4PSXA 3N7JA 3AAFA 4IV1B 4LE3A 5JI6A 5C4JJ 4E7HA 2ET7A 3ZFGA 4HLXA 1U5XA 4TLGA 4FHTA 3T4VA 4BUPA 2OTJI 1HXS1 2NOJB 3POEA 2EV5A 3WV6A 3HVDA 3CCJI 3HN1A 3ZO0B 1W2TA 2GC2A 3PVOA 3ILNA 3KV5A 3FHZA 1ZBE2 1C57A 3J9SA 3CU7A 1E5HA 5FYCA 1UKGA 1WMXA 4XEZA 1RC6A 4LBMA 2RJ2A 3IMMA 5EWSA 3WU2C 1ULDA 4F3QA 1XNBA 1JYCA 2H0BA 4ENMA 5D21A 4AEDB 2ME6A 3VZKA 4GMP3 3ZQQA 1HSJA 1UY1A 5HDNA 1H2LA 2KR2A 2BGCA 4TYSA 2DBBA 2WY8Q 4YFWA 4QD2A 5FZKA 1COV2 4BQ4A 4MTDA 2MPFA 2XR4A 1QJU1 3NARA 3QPHA 4XRFA 2BBVA 3D0JA 3HWJA 3CJNA 1LHUA 2EK5A 1S3JA 3TN91 1T2KA 5FCCA 1YFHA 3PIOF 4S2GA 3VD3A 3WF2A 3OUHA 2YV8A 2ZZJA 1D5VA 1B35A 2M5WA 4JZRA 2QTWB 3CQOA 4EJTA 4MVTA 3I2FA 5CADA 1ZA7A 2JTVA 2RR11 3FM3A 4DIQA 3U1KA 3BPZA 3I2HA 1W7PA 1R1UA 5C71A 1W2NA 2BJSA 3V65A 1NG0A 1R49A 1B35B 1H8TB 2QF7A 4ISRA 1JOJA 4JDOA 1Y3TA 4YW1A 5FZ8A 2EIKH 4JX5A 3T2QA 1Z7S2 1RJ7A 4CUCA 3DBHB 1KJRA 2WQ8A 4Q1RA 1Z78A 1TNSA 1OUXA 5HV4A 3AZVA 3I2GA 3IRQA 1UMHA 2ZXWH 2VUDA 3S8PA 2WO2A 2CW0F 4PJNA 4AOCA 3AL0C 2D5HA 5L9RA 1QGLA 2IXJA 3U1DA 3KS7A 5L3CA 3OGGA 4DXZA 4Q5SF 1S1AA 3AMPA 1S5LC 2DI3A 3ZFGC 4Z92B 3JB4C 4XDQA 1LOFA 3M2MA 3R4KA 4A6EA 4XURA 4BDZA 1GXPA 3T0DA 3MUY1 1YO5C 1IPSA 2P7CB 3RIRA 2A6WA 4RB0A 3MIFA 4NWVA 2WWSA 1MBEA 4CCJA 5FYBA 2WADA 1PO12 5FLIA 4O9EA 4BQQA 1LRHA 2R5ZA 2V5YA 3WU0A 1N78A 1PX4A 3N36A 3H8XA 2DK5A 5E18F 1GXQA 3CLQA 2QWWA 3H1CA 3ACIA 4XBLA 5JWPA 3W21A 4BHBA 2H6BA 1ZA4A 4BK4A 1PO23 1BI2A 4RLQA 4N53A 2WS92 2JUCA 4HEA2 1XSQA 4XR6A 1XGMA 2DMTA 2WZR3 3CMYA 2CFXA 3WF4A 4UNOA 1ULFA 3ZQIA 5EGOA 2XVLA 3NW4A 5F9TA 3E5UA 2E1MC 2LY9A 3D1NI 3P9KA 3ZSEA 2B42B 1USTA 5FD6A 2PJRB 3MKYB 2QQVA 4P55A 2RDPA 5H9RA 2QZ3A 3K10A 4RS8A 3CP8A 2X48A 1YRNA 1QHHD 3ZXAC 1LJ7A 1H0BA 3K46A 5FYYA 4LK0F 3L9JT 1GHCA 4WCGA 4WWCA 1M06G 1TMF1 5KVRA 1Z3YA 2W91A 2P5LC 5JLVA 3AZWA 1Z21A 4HMZA 4CUBA 3MFCA 4AEDC 3GTQJ 5AIPA 5DUKA 1BI1A 5GZDA 1UYZA 3EUKL 4PIYA 3S6PA 4FOWA 3CC2I 4I99C 1BR2A 3KGLA 2VMGA 4CH7A 3N4MA 1CQTA 4IQPA 5L36A 5L9BA 4Y20A 3HJEA 3WQBA 1X1PA 3TEXA 1AUYA 3HEFA 3HGGA 1P4AA 3C8XA 3GLLA 3IKTA 2MC4A 1O4ZA 1XB4A 5B4XA 1ENXA 3JSPA 4UVCA 4BM8A 4DZJA 3CUOA 5C5TA 2YU1A 1TQPA 1V6LA 4P9GA 5CQEA 1NAEA 1YXWA 2XKOA 4EN7B 3VBFC 1UHSA 2X51A 3JTHA 1QNTA 4I01A 3EO6A 4LBJA 2M9HA 1J3QA 4FETA 3O8HA 1SFNA 4OLLA 5EEAA 4UW3A 3Q5FA 5FZOA 2GOMA 2XJUA 2EH3A 4QXCA 4QQHA 4YVWB 2ZO4A 1T6GC 3H3VK 4Q0UA 4BE0A 2ZACA 2FDFA 2KT0A 3AKSA 3VYUB 1Y56A 3LSHA 2E51A 5F3IA 3VHOA 1PVC3 4AEMA 3N7MA 3V0AA 4CDGA 2FQ3A 4II3A 1VQ9I 5B4NA 2R49A 1FIPA 3KVBA 1FYUA 5A2QK 5BQTA 4FCAA 4B4CA 3WTYC 1QOSA 3KWVA 2P6TA 2IGMA 2IRFG 4RAYA 1COV3 4MQVA 1TNTA 2EALA 3B3QE 3MN2A 1RUJ2 2HBTA 3KQRA 1GV9A 2M34A 1QJY2 3FBNB 1US2A 3RZMA 3RQ4A 1ND3B 4FX4A 2FHRA 4EWEA 5J8FA 1RUC2 4AK3A 3OYKA 2RNJA 5HLTA 1S0JA 3H8OA 1YCIA 5IVCA 2LYCA 1DP0A 4N9HA 3LNQA 5C9AB 3QYBA 5LLQA 3W58A 4YM1A 1BM9A 1PP7U 1ENQA 4DYQA 4LNVA 4BJTA 1BR1A 1H4HA 2WC2A 3AYCA 1ZQ3P 1HN1A 5LA9A 2VCBA 4OMCA 2YBKA 5C8CC 4P5YA 2D3RA 4LKFA 2L5QA 2FXAA 4P9XA 1WI9A 1BCXA 2TRTA 4N43C 1WCQA 4HF1A 2HH9A 3KQ4B 3IT8A 1B09A 4KNYA 3OYDA 1EH7A 1SBDA 2DJIA 1HRV3 5A7WA 1FTZA 4XUTA 5A1AA 3L2RA 2NQYA 5JPNB 2PMHA 2J1TA 4RQPC 2HZTA 4P9IA 2NS0A 2X6WA 3BR5A 4JRLA 1QZEA 1B9MA 2HWC3 5H20A 5F5IA 3SLIA 2G7UA 1T0FC 2BGOA 3KZZA 4KISA 1B72A 4YM0A 1XYOA 1XNCA 5L7OA 1CAVB 4A7YA 3RMXA 2BFUL 2Z5UA 3OR1C 2WWYA 2NN8A 1LUJB 2E1NA 1AXYA 3N3HA 5A7NA 1HDKA 5G04L 4AVTA 2GN3A 5J8CA 2FCVA 2LDUA 4Q1PA 2GAUA 5HOOA 1Q56A 4KFCA 3ZMTA 5A7QA 1OLRA 2EFOA 1ZARA 5JI9A 1L7LA 3JU9A 2WZR2 2VBWA 2XPVA 1QBJA 1DF0A 1J3PA 4Q4X1 3R61A 2IA0A 2OUHA 2CWEA 3LDBA 3AKPA 1R091 4NQWA 3I58A 1SBEA 1ITYA 5J1RA 3GHMA 5E1RA 3LWCA 3JB8A 4XICA 2LRDA 3S15J 3BROA 5FUNA 3JUUA 3IWZA 3CCMI 2L9NA 3WG9A 2RS13 4DXSA 4B3AA 1TP4A 4XN0A 4WM8C 5AONA 3ACLA 4CEYB 3PNVA 2OIIA 2PMZN 2W0XA 4LQRA 2R7SA 1SZBA 5EYXA 4Y3OA 2IGNA 3ZXKA 2WFF2 2YGLA 3UNGC 4N53C 2L01A 3CO6C 2VUMJ 4LOCA 4GB33 4I09A 5BNNA 2Q2EA 4ZHNA 4RM2A 1W6MB 2M45A 4Q4X3 1I5PA 4ZONA 5FPXA 1YUDA 3K4NA 2WLQA 3RZJA 2JPBA 1U5ZA 2JA7J 1W39A 1AXZA 1LNSA 2KKOA 5CU1A 2PA7A 2W48A 3RWKX 4D69A 2QENA 2DW4A 2OUMA 4BEHA 1H0MA 1GUUA 3AVSA 5HDKA 1ZAOA 3FXRA 4IEYA 3W59A 2VQCA 2FBHA 1PMHX 4B7EA 3RKXA 5FFOC 4CU8A 4NIGA 5F8PA 2FBKA 4DO0A 3G6JB 4B8XA 4JGZB 3VL8A 2WQ4A 3UESA 2WZPP 4NJ4A 2R0QC 4Y5Z0 2Q1ZB 4MUVA 4CDWA 2ZABA 1UQXA 1B35C 2D44A 3ZXLA 1DGLA 1RUD3 3ASOH 2RDNA 1F9KA 4LG0A 3ZRGA 4IHXA 4NDLA 1MMDA 1G3WA 3S7EA 4YGCA 4L9VA 1O91A 5L73A 1X1DA 3G1LA 2Y0IA 1JYVA 3RI9A 3FKJA 2EINH 4BQAA 2E26A 3SFZA 1YS7A 4L2NA 1GNZA 2Q8DA 3M3YJ 3ZSKA 1W9YA 3SISA 3P5BA 4M3CF 4WXDA 3VBSA 4AGRA 4UHTA 1MIJA 3OS2A 5DDJ1 2GIZA 3PSFA 5FMDA 3WSOA 4EN6B 4UBGA 5ACA3 1RI7A 1PMIA 1YJKA 1BBYA 3DTKA 3K1NA 1G3TA 4XILA 1XYNA 3ZXGA 2CUEA 3AP5A 4AHXA 3F6VA 3MIEA 1GNYA 1V55H 4IHVA 1AKHA 3CCRI 2DTRA 3ETQA 4H2AA 3RKQA 3T2TA 3E1SA 4JX0A 2BQPA 4V2VA 4KIGA 2VY0A 2P3IA 1AR81 4YFXF 5LD2C 3GLXA 1JUMA 4TSVA 3KT1A 3H9AA 4R8HA 2OV7A 4XFHA 4S2FA 2RG4A 2R7EB 3GJAA 3NV2A 1KONA 1V3FA 2WIIB 1BVP1 3LFMA 2AGSA 1ZK8A 3IAPA 3S3NA 1S7EA 2WNUC 2WWJA 2W25A 4G6QA 4CYCA 3KX2A 5FXXA 2UU8A 2WABA 3MUZ1 3AG2H 3GXOA 4UFJA 5G05L 2B39A 2VG9A 3BJOA 4LK1F 4S2HA 2F2EA 5GM0A 4CTEA 1IRGA 3GTLJ 4DY5A 3CJQB 3HBZA 4HK8A 5GKAC 1LGNA 4D5FA 4QDRA 1RYYA 4AI9A 3WUDA 2HWE3 4NIIA 3MV01 3QOEA 4CEYC 2W57A 3ZFFC 2TBVA 3OL4A 5JR2A 3ZFEC 4Y1ZA 1VMFA 4QXKA 4IV3C 1GYKA 5IAVA 2Q8EA 1UZCA 2GC3A 3N9LA 1XTAA 4FSJA 2OX0A 4Q2FA 4YVSC 2C9AA 1RUOA 4WVVA 2D7FA 3KCYA 4CP1A 3WNMA 1XNAA 3J4UH 1IN6A 3VD9A 4CXWA 1M1EB 2OTLI 3SH3A 1C3HA 1QY4A 4CO8A 3AFHA 5LHIA 3G73A 3BKZA 2ZHMA 2RJKA 3GNEA 1MMAA 2JXAA 2XQXA 4NHKA 4AI1A 1D1CA 1AU7A 3OL3A 1Z1DA 3LCPA 2XBO1 4EQVA 4CCKA 2L7MP 2LC2A 1REDA 5F1RA 4FPYA 5M5YJ 3H9JA 3BPVA 2QSHX 5FD5A 2W1WA 1GZWA 2RS51 4PK4A 1O3SA 3HSRA 4EN0A 2XHNA 3J7NA 1PM4A 1APLC 3HOVJ 3IBMA 1ODDA 2QSGX 4Y24A 2CUFA 1SACA 1IF1A 4XMIA 3K2ZA 3DN7A 4LLOA 1P7JA 3VBRA 1IUFA 1LENA 3KF3A 1B8IB 2JD4A 3H9GA 3Q0VA 3VDXA 2FQ4A 1U0JA 4MGZE 4KBZA 2JPCA 3ZFEA 4LBQB 2EV0A 2R7RA 2DTWA 1DGRA 1ZLJA 1ZBA2 2W94A 2CWMA 3ZIXA 4KITB 3PO3J 1OCTC 3IIIA 4P00B 1O3QA 2O7OA 1EPZA 2MEV2 1UD1A 2QA4I 2RS33 2ZEXA 5HLGA 4RFT0 1FSHA 1AL21 1UU4A 2DTZA 3ILFA 4EN9B 3EYYA 4XE9A 4XFBA 4LO5B 3MW3A 2Q1MA 1U8RA 2DCKA 4XJ8A 3POSA 5FMOS 1QJY1 2D3SA 4G12A 4C2MJ 3R0RA 3GMEA 2Y64A 1TE1B 5B2GB 3GEZA 3WNPA 3W5NA 5FXZA 4KT5C 3Q0UA 3RYKA 1HJFA 3SHFA 1FJLA 2XBO2 3CO7C 5FY8A 4UI9L 4K8RB 1IPJA 2RV9A 1CAUA 1U2WA 1TVGA 2ZGKA 1ZBA3 3JRBA 2MLGA 3L09A 4P1WA 1JW6A 2ES3A 3H8UA 2A6YA 2X09A 2PMWB 2R043 4NHMA 1R1A1 1FLIA 2DVAA 2VZVA 1JUPA 2CRGA 2ADDA 3K77A 2QQOA 3BPSA 2QZ8A 1FT9A 2VBDA 2GU9A 5IW0A 4BK5A 5A33B 3DPTA 1OKQA 3BR0A 1NK3P 3LEIA 1RUD2 3Q3SA 2K3PA 4UOJA 2ELJA 1A04A 2BOIA 4CDWB 5CAZA 2QSFX 4IQ4A 4YZ5A 1CN1A 2WRAA 2VH9A 3MIDA 1YFYA 4P9FA 1OXCA 4ESFA 1SLIA 2A75A 2YU3A 3QCWA 1JZ2A 4ZZ5A 5ILSA 4XHBA 5FZ4A 3WOGA 5FKBA 5J1UA 1K4SA 2B7YA 3BR2A 2XJVA 2XC7A 2W08A 5M3MJ 4XSXF 5C4WC 5F6KA 1UL9A 3ZPLA 2GNTA 3VZJA 3V8KA 5FZ9A 1JODA 1SFXA 3ECHA 1CX4A 1TZOA 1YS6A 2W3JA 4P96A 2PHXA 5JSRA 3VHNA 5E89A 2BXYA 4GFBA 4GH4A 3O7OA 3GTPJ 4LIUA 4IJAA 4HPKA 3WHBA 3NQOA 4CE8A 2ARXA 1FEXA 2Y33A 3MIBA 2XROA 3DEEA 3NJXA 4QPGB 3A22A 1W0PA 4IOCF 2R7WA 4A3LJ 1X4OA 3OPZA 1GV2A 2WFF1 4KWKA 1RJ8A 3JZVA 4JGZA 2XH6A 3K4ZA 5HCFA 1UCXA 3GGLA 2ZGSA 1VZ0A 4IEPA 2IFRA 1L7RA 1IXCA 3A03A 4OZOA 3HHGA 3U4SA 3QOPA 2UYBA 4MX3A 2NXNB 5K1YA 2K9SA 4UV8A 3Q9OA 1P4XA 2LG4A 1QJX1 5K7ZA 1YLLA 3I3BA 3HUGA 3FUOA 1EF4A 3DPRC 4U36A 5C3OA 3EQLF 1F4AA 2LSOA 2L4AA 4ZU4A 4OHVA 3OOUA 2EXKA 1ZZ8A 3FXKA 2E31A 4XLPF 1BBT3 4LK7A 1SLAA 2ESNA 3DCQA 4I3PA 2HFHA 1RUH1 2DA7A 4WVWA 2QQAA 1LHNA 4WK8F 5CKTA 3CJIA 2NRAC 1W90A 1L0OC 3VD7A 3GFMA 1H8TC 2AYHA 4QQPA 5FQ0A 3AG1H 4AW7A 2JDZA 3W2WA 2JK3A 2ACJA 4XORA 3WTUC 2EZHA 4LD5A 3A4CA 1OKOA 2ICWG 5FDBA 4K21A 3ORJA 4YWAA 1WGXA 1DQUA 4QLCU 3HNYM 3F6OA 1PGW1 1AR61 4HK9A 1WZXA 4NWWA 4DEVA 4U0WA 4A3CJ 3M1HA 1K83J 1SAXA 1AR71 3NAPB 5FIXA 5B5EC 5J4VA 4COUA 2RR12 2VVDA 1UO9A 2VZ3A 5IAXA 3BOQA 2VM9A 2IEKA 3QP6A 1QHGA 2FDGA 4W65A 1RUE1 4YRDA 2VBBA 1W1WE 5FLHA 2VUCA 2VC0A 2X85A 1WJEA 1EV12 3D82A 3A23A 2F17A 4BJ0A 2HPMA 5D6FA 4L0ZB 4H7MA 4OINF 5FAXA 2OS2A 3N05A 3KCCA 4NROA 4HW0A 3K1MA 4LMYA 2HTSA 2WNEA 2IXIA 1V5EA 1SD5A 2LROA 4AVAA 4AYBN 4NB5A 1AA7A 4TTGA 4PT6A 1E0EA 3A0NA 1FBQA 3GTMJ 1CZSA 1RUNA 1VB2A 5I0TA 3O5SA 4LHLA 1Y39A 5GZFA 5DTDA 2O3FA 5SV8A 3VOEA 3GFJA 5FXWA 3VD5A 4D6RA 1JU4A 3B5LB 1H2NA 5BNPC 3LA3A 2ATFA 2W85A 4L5IA 2HOSA 2KRCA 2JN6A 4E4SA 3KZ4C 2D1VA 1GVDA 2R5YA 2PN5A 1UMZA 1AL0G 1R083 4QPIA 1QJFA 3CCLI 3MYXA 1FV2A 1J5YA 4GMP1 3VL9A 4C30A 1U12A 5C3QA 2EXHA 4XJAA 1C5IA 3O0WA 2IGKA 2EXIA 5JVTA 3GO5A 3M8EA 1TNFA 4UY8I 3BCAA 2VTFA 1HQNA 1SCRA 1VQ8I 3HOSA 3B73A 1AL22 1Z9CA 2C26A 3H5AA 4CDQA 1F8VA 3Q8BA 2DA4A 3E7LA 4BPZA 2VBZA 5C3EJ 3VBOB 2Q1FA 4OI1A 4LO7A 2X5IC 3G7DA 5FO5A 2XGDA 2XGEA 3NV1A 4JOMA 5KR7A 3MEXA 4BDYA 1DYKA 4OQ9A 3WF3A 1YHQI 5IT3A 1V6MA 2FJ1A 4RL7A 2LF8A 5DG1A 1RUF1 2JIJA 3CTAA 1R7JA 1TME3 1I6XA 3AZZA 5EP9A 1YX5A 3KZIC 1K79A 3T0BA 1W7PD 2PHFA 5AVPA 4WX9A 3ZPOA 3ABMH 5C9AC 5E8IA 2M4KA 3GX4X 5FUIA 3HSEA 3MD2A 3BOWA 5K0UC 4QXBA 4CEWB 2G9GA 3H9QA 4LLGF 3CBNA 3P3PA 2HKOA 5CISA 3I0TA 3HZJA 4U2AA 2HBUA 2KQRA 4Z2AA 2E36A 3ZR8X 3J81Z 3TQNA 2ISZA 4QTRA 3GUDA 1MEC1 5HCBA 3UK9A 2WKKA 1W3XA 3VBUA 2L02A 4FISA 5J47A 1U5TA 2GDFA 3AKRA 4KMFA 2LNBA 2E35A 4DYRA 1NZIA 3SH4A 1OFCX 3ERMA 2ZEZA 1VQKI 4RBOA 1MVEA 2E5NA 3EUAA 1MZ6A 5FZGA 1XYPA 5IVVA 1GVJA 1IGOA 5LHHA 2Z1DA 3VEPA 4META 1YQ6A 3B93A 1WUVA 3DXTA 4B4QA 2ZNZA 2O0OA 2RS53 1XGOA 3I7DA 4LIVA 5HODA 5KHGA 1W03A 4LBQA 2WL1A 4M9SA 3CMGA 4QKBA 4WM8A 1H9TA 3ZMUA 3RFRA 1KDKA 4DQAA 2VJ5A 1RUH3 3JCIA 4QMAA 1AWCA 1ND3C 4RSUA 2VJ4A 2VMHA 2VNGA 3W9AA 1VBB1 3FKIJ 3IP4B 2L9LA 4DZGA 3QU6A 4AFDA 1WZ2A 2COMA 2L2OA 3I3MA 4BQWA 4KIFA 3N7KA 1LB2A 1VAKA 3L1PA 3FFQA 2ETHA 1Y1VJ 1TWGJ 2VNVA 1RNLA 1Q8OA 1AYN2 5E1XA 4MGIE 2BY0A 4CP9B 4M74A 3WNLA 1QXJA 2DDAA 1H2MA 4A3ZA 5SV5A 3K4LA 4J19A 4M4RA 2JDMA 1OUSA 2A73B 4ZYDA 4XQ4A 3LSRA 3VKLA 3P5JA 1VE0A 5CEHA 4RR3B 2RDRA 2KMUA 2DT7B 2PJPA 2YC2A 1DBNA 1OOPB 1BZWA 5JXJA 3UV9A 3D5RC 1XU1A 4EM0B 1PGW2 3OB8A 2W68A 3J26N 5CPRB 3PUQA 4I6ZA 3ZSJA 1LEDA 2QLZA 2R042 4RB3C 4HDVA 3KETA 2WZEA 2WBMA 1F4HA 2W1OA 3SCFA 1WCKA 2D98A 2R32A 3K4MA 4IZZA 1ON1A 2E60A 5JIAA 2PHWA 1H8TA 2R30A 3R0AA 2HWF2 3EYIA 2Y6KA 2GM4A 3M07A 3CMAI 1Y1WJ 2W95A 3ESWB 1PUEE 2GA1A 3BR6A 4JKMA 2NM1A 1UHWA 2RVAA 1JJ8C 1RUI3 3LOCA 4Q4W1 5F3CA 3UL2A 2DT5A 3LEMA 3OJBA 2XASA 2ZX1A 3MQ0A 3OYGA 4L5EA 2BWAA 3CZUA 4M72A 1EPWA 4DPNA 5HS7A 4UF0B 4E7JA 3GBFA 2WO7A 2DODA 1HW5A 2JKBA 3AXDA 1XQNA 1Z7LA 4KWLA 3S1MJ 1OR7A 1E5RA 4PLOA 1V6IA 1G9BA 5HCAA 5HV0A 2LW8A 2JZYA 4A0YA 2CDOA 3WHTA 1H8AC 4AVCA 4M3CE 4R9CA 3K4JA 5ERLA 2X0LA 4UW6A 3N9QA 2WO3A 1R64A 4PDWB 1AOYA 1FOKA 2PFBA 1R22A 4YVWC 1BMV1 3FWEA 2E1CA 3QD6A 4Y26A 2AXTC 5A3WA 3JRIA 4IHYA 4NMIA 3ZKUA 1LVAA 2K86A 3C7HA 1BXHA 3VBSB 2Y6GA 1TL8A 1RUG2 4OVEA 4XJWA 5FKCA 4YFZA 5A6QA 4AI0A 2KPMA 3I49A 4M9XA 3GCWA 4IV3B 5LBCA 2HEVF 4BEHB 4QX5A 2O03A 1XMKA 2YHJA 4X6AJ 5DN2A 2GC1A 3I2IA 4K1YA 1GLNA 3ZFFB 4C90A 2B63J 1P9QC 1S9HA 4HZFA 4BJ5C 1MJ9A 4HNUA 3TEDA 1XSVA 2VTXJ 4WF2A 3WGHA 3NAPA 2YY1A 2PQ8A 2JENA 2G9WA 3ZVXA 2VKDA 4P14A 2LBFB 2XVCA 1ZYRF 4U7DA 5DQ0A 1XSDA 3O12A 4LHSA 3ZMZA 4HL0A 2MH2A 4AFMA 2ZNYA 3X2QH 2B4KA 4WVMB 3I3LA 1IKQA 3RQIA 3LKJA 4YGBA 4V2FA 2A6XA 3LOBA 3EUHC 2PJRA 2EIJH 5DS9A 2VZ1A 2X6YA 3IAM2 1QRYA 3TEWA 1MSEC 5J40A 4V1PA 1B4AA 1DQ4A 3WDVA 1UY2A 3TN92 3U11A 5K0UA 1SFYA 1AYN1 1JKPC 1IXRC 4FQ4A 3G1MA 3O1SA 1VI0A 1XNDA 3VBHB 2IAIA 3GZEA 2XL9A 4AEKA 5J7MA 3E5XA 5GLZA 2XG3A 4AVVA 4UAPA 4QKFA 3NL1A 1OR7C 1YW7A 2XAQA 5L7OB 1I3QJ 3HR9A 1H8VA 1CPNA 4DEQA 2WV0A 5EG0A 4CZSA 5CJ9A 2BVBA 2BEOA 1IS5A 1QZZA 4FCYA 2DCZA 1RB8G 1MACA 3VBSC 5EGOB 1UU5A 1VQOI 2OPWA 3H5NA 2YUEA 3OGRA 1JUSA 1JTYA 1MJAA 2R7QA 1VQ7I 1DPRA 2IS1A 4G9SB 1H4GA 3BN6A 2QUOA 1MS3A 3OS1A 2Z4FA 5FZIA 2W9XA 3I5UA 4XXAA 2DJNA 3CMEI 1CGPA 5HNFA 1JU3A 4F8AA 4BQ3A 1OLME 2WAEA 3WCSA 2OAZA 4CEWA 3BVCA 5FZFA 5FZ6A 3I2DA 1TME1 3OSDA 1I6HJ 1JZ5A 4E4DX 3MHZA 2MYSA 4Q5OA 1NY72 2NOGA 2AQFA 5FYHA 1E5IA 4HPKB 1LULA 3KT4A 1LAJA 4DRRA 3SCGA 1W36C 2NAZA 1USSA 1FX5A 1ZRRA 2OPKA 5C44J 2E9QA 4H3WA 4DBQA 4Y1XA 2VQLA 2O61A 3H35A 1QQP2 3R4UA 3TBDA 1MVQA 2OD5A 4RQPB 1AYM2 4B3NA 5FMCA 4O9GA 1QZYA 4LT5A 4TZDA 1TMF3 1BOAA 4CDQB 2YX4A 4CICA 2K9NA 3I4MJ 1WGPA 1W06A 2D5FA 1IZ3A 4COZA 3FF5A 1T8IA 2ORZA 2R073 1JT6A 4TN7A 3P9CA 2XL7A 1RL3A 3H42B 3HOUJ 1AR73 2QGUA 4HV5A 2P3KA 4RFRB 3SZPA 1NKGA 2KIUA 2ZKLA 1NTCA 4FTBA 1VBD1 2WWUA 3ZXFA 1JZ6A 4MLOA 4BIFA 3HNBM 5A7OA 3O1UA 4Z2YA 2K4JA 4S04A 2BOJA 4OMYA 4JQRA 1OURA 2VCAA 3UGFA 3G2BA 1MDMA 4YVSA 1SMVA 4E8CA 3BJ6A 3Q8CA 4PIZA 3NNMA 4YPJA 2PG4A 4IEJA 5IT9K 1MKMA 2R7XA 1ZVFA 4DGWB 4HVRA 1PO21 5F5QA 3ZMSA 3TP0A 1RMU1 3K3OA 1RHI2 2VT2A 4XMAA 2R92J 5KC6A 5TISC 1REEA 1EV13 4BACA 3FIWA 1NCRC 4ZPIA 5CB7A 4M3FA 4PGHA 4YELA 1HDPA 3OYJA 3NAUA 5LWBA 1LTEA 5J96B 3LMMA 3DPLC 1RINA 3VODA 2AEZA 1OOPA 4HF2A 3F0CA 2WN3A 2CFOA 4AM3A 3FHAA 4ZS2A 1S7AA 1TT0A 2K85A 5KWRA 4ZXEA 3O0VA 1OPCA 1NX9A 1S55A 1N3OA 3ZPYA 1H30A 2NVUB 1UFMA 3GTGJ 2F4MB 3WTXC 2IFWA 1ZGWA 1O59A 2DFBA 5FWEA 1QEXA 3VN4A 4BLJA 3ZYJB 2WT1A 2BDRA 5T5JA 4BQ2A 3VZNA 2H27A 2WLPA 2N8GA 3MLLA 1LOCA 4MHUA 4PLNA 3QWLA 1GANA 1Q43A 2PQQA 1O57A 3B00A 2R7UA 1XOYA 2M87A 2XGXA 1FOD3 3HEIA 4RAGA 1DU3D 4YNIA 4Y7NJ 3Q9VA 3U2RA 1ZG1A 2W92A 2O8XA 3ST7A 4UV9A 4HXCA 4XIOA 1LGCA 1QOOA 5A7SA 1I1EA 2YPJA 4CP9A 5EHDA 1NZCA 3K70D 5DDJ2 3W5MA 2CQQA 3F8FA 2IXSA 3DF0A 4II2A 2KIQA 3ZMVA 1L3JA 3OD0A 2RDQA 5GAGJ 4KU8A 4I3GA 2ZX4A 1ETVA 2ZAAA 2EFQA 1K7AA 3C7FA 3U9GA 1YLFA 4LKDA 1P7IA 4MHGA 2JB4A 2DMQA 3QODA 4IEWA 3K1PA 3USSA 4BKXA 1QJU3 4R52A 2DU1A 2LKSA 1OQEA 2GLOA 3G6EI 2STWA 1VBA2 3CDHA 1P8JA 1PIV3 2A3XA 3NNGA 1GP5A 5C3RA 1OISA 3ZQ7A 5A7PA 1UYXA 4AFAA 2RS11 2WA4A 2QNKA 4N0BA 4XBFA 3ZN4A 2Y6HA 4AD9A 2DOFA 4QIWN 3ULQB 1QH7A 3BODA 3JRAA 5H6QA 2L0KA 2CAVA 3G4SI 4HDUA 5FXVA 2GN7A 5HNHA 1F36A 1JYXA 3K2AA 2QQIA 3AXEA 3HQRA 4NIHA 4AL9A 1RC9A 1VMJA 4YW7A 3PNYA 1WD4A 2M8GX 4DYCA 3DKXA 2A61A 1W8ZA 2JG9A 3S57A 5IP7J 1AYM3 5A3PA 2P81A 5D5WB 2XUEA 4XLAA 2GXBA 2WSUA 3SMHA 5DCMA 1WJFA 1F15A 4HKLA 1KGYA 3PFIA 2W7NA 4Q4V1 3O1OA 3SEZA 1GU3A 4X1EA 2LRPA 5BUVA 3PTRB 3A0BC 5IK8A 4XCBA 1RUF2 3CESA 1VBB3 1Z6TA 1HQWA 3RJRA 2OQ6A 2VE9A 1J1TA 2VU9A 1J84A 4MTEA 1EUTA 2AACA 2FE3A 2BW8A 4FPEA 2E2HJ 2MEV1 1PK6A 4GB32 1LJ9A 3KP2A 4NE9A 1POQA 1EAH2 3LF7A 1MQTB 3G71I 3FXQA 4AE2A 2VLAA 1C8M1 3WF0A 2JD9A 3B01A 5CVIA 2VKEA 2HQNA 4AHYA 1FBUA 3VPRA 5IY5H 1ZLKA 1K12A 3BZ6A 1CIYA 4R1HA 3P9IA 1SFPA 1ZZBA 1S0BA 3OMYA 3GFIA 2J1AA 1KITA 4QAWA 1MS0A 3OBZA 1PM7A 5LFAA 4IL7A 2WNVB 1JUHA 2MABA 2R7ZJ 4EE2A 1IUYA 3FC0A 1Y4WA 2VOWA 1GNHA 2QQMA 1FNYA 1RUH2 4GJZA 4N4OB 1GSLA 4K3UA 1B9NA 4EEFG 3I4PA 2Z9OA 3PLQA 4RGKA 2ADEA 1W3VA 1MD0A 3EXUA 2KL4A 1OD3A 3JAMK 2L9VA 4JDNA 4QPIC 2JG8C 2WAQN 4F93B 5B3SH 1W5CC 4JTNA 1FMWA 2XAJA 1JKRC 4GDFA 4R79A 2P7VB 2XSDC 4IETA 2HKXA 1EAH1 5B66C 1FOYA 2DO7A 2JQ7A 2B9VA 3OYMA 1AXKA 5FZ1A 1T6SA 2HDDA 3AP4A 1V6OA 3K51A 2DFCA 4Q0SA 3JRHA 5IPAA 4LLNA 5GADJ 1M4WA 3LFUA 4GO1A 4PIXA 1S0GA 5LK5A 2WAFA 3WUCA 4XOPA 3S16J 3K3NA 3JRGA 4XF4A 3RJPA 3VBFA 2IBDA 2LREA 4N9IA 1IRXA 3B6CA 4Y17A 2M7BA 3M9AA 3DEMA 1D8KA 2PN6A 1VALA 3OIOA 1KS4A 2ZGUA 3UGHA 1ETQA 3DYOA 3DL3A 4HNTA 3VUOA 3GZ5A 1KGSA 1X3ZB 4IUGA 5F5CA 4XHXA 1VBE1 2HWD2 1QQP1 2CY6A 1D4M1 4AQSA 1QH6A 1VRH3 2HJIA 3JCUC 1FI2A 1ZBA1 2PQSA 5KHJA 2OJED 3D5OA 1WW4A 1K3IA 4NN0A 3U21A 3ZYFA 1MMSA 2RC4A 1HLVA 4DOZA 3OYIA 2HWB2 1A5JA 2VW2A 2DMNA 3K4CA 3U07A 3PNAA 4Q47A 4HG2A 4KH9A 2JB8A 3PURA 5FBZA 5JVGF 3SCHA 1MGTA 4ZDLA 3SZTA 1NLQA 3ZYIB 3EJKA 4ZKTB 1Z7UA 1A3KA 4BCUA 4A7KA 4RHV2 2DVGA 4QPGC 4GWMA 3GTOJ 4XPVA 5E3OA 5IP9J 2VN2A 5BNGA 1A34A 1I1SA 1LVKA 4P9UA 2K9ZA 5CFDB 4M6VA 4CP2A 2R5ZB 3VV1A 1OYWA 3SKJE 1STMA 1RR8C 3FN9A 5M5XJ 1QIQA 1HQCA 5K5QA 3LPGA 1JXNA 2L7FP 1ERDA 1VBE3 1ETYA 4IEOA 2RHPA 4CDUB 3LQQA 4BQXA 3L2QA 3BT9A 5DAQA 3AP6A 4XONA 3WG2A 3HYIA 4E9KA 2CYYA 2GZWA 2R0FA 3O0XA 2F6CA 2A69F 1OYIA 3OGJA 4XFIA 5EJCA 2D6OX 4JDMA 5IUQA 3WGGA 4UUSA 2MHFA 2SBAA 3TRSB 4P5HA 5GP9A 1T98A 4K2EA 4HX4A 1E3PA 1SLBA 4KI5M 1GFF2 4AI3A 2MLKA 2C4XA 3LSGA 2M3AA 4L0YB 4V19K 4O65A 2VMFA 1OVSA 1FPN1 2XAFA 3FXUA 1QVTA 2PBIA 5HXMA 2JWPA 4CXXA 2RAEA 4EGYA 4ONUA 4BQ1A 3PDQA 2PLV2 4IEQA 5ANQA 1YW8A 2E34A 2X8KA 3W2VA 1EAH3 2KRFA 3DKQA 3ME2A 3WTSC 5JHUA 1S7OA 4LMFA 3WE3A 4EJVA 2DMPA 3NSTA 5IWFA 4UYBA 1OCOH 2ZKNA 2H8WA 5FP3A 5FY1A 1F31A 5LRSA 4HSJA 5HXVA 1CX1A 4NPMA 2J1SA 5EZGA 2RMU1 5H2FC 3CDZB 1TNRA 5FO7B 2CDPA 4IF4A 2O0YA 4XRSA 3AG4H 3JBG3 2CV1A 4N8MA 2O6GE 2D93A 1RHI1 3FZVA 2TCTA 2DAOA 1LPQA 1X33A 1H88C 1IHMA 4OHWA 1YTYA 4H14A 2AZ5A 3WP3A 1V0AA 4QX3A 4NIDA 2BFUS 1FSEA 4FPLA 1V9U3 2JDPA 1AZDA 5ABJC 3QH7A 3C2HA 1H6YA 3S0MA 3MMYB 1GP4A 3ACHA 4LG0B 2B5HA 3V8JA 2LOOA 2K9MA 1GOHA 1MEC2 3OEAA 1RUI2 1TQMA 2ETEA 1WLTA 2YGMA 1W4MA 3ABUA 2V7FA 1K5MA 3RG0A 4XQDA 4GGGA 1VQLI 4EM1A 5LBBA 3I4NJ 3T1MA 1YIFA 2E33A 1XN7A 1C0WA 4DUXA 4PFOA 4G7HF 5TRDA 3MW4A 1FYKA 1OLTA 1NA1C 2UV1A 3RDIA 2RS31 1J09A 1QDCA 4XZUG 5H9PA 1WLCA 2HOAA 3I53A 1AYM1 2WZR1 1NCQB 3VKMA 5FJ8J 3WODF 2ENRA 3TN93 1QNWA 1R5HA 5C4XJ 5CLSA 2ZHNA 2K46A 4EZHA 3DLAA 5CKMA 2ZJQF 1NYWA 1Y0NA 1YX3A 3CO2A 4XLCA 1SANA 2WJSA 3GZAA 5EJZB 2RMU2 5CFCA 5JXGA 3UNPA 4ZY9A 1KU9A 1HXS2 1R00A 3C1DA 3VYSB 3IAQA 2Z16A 1DGRN 1BW5A 3FUQA 1E2XA 2VECA 3UJQA 1RUC1 3KZYA 4MSVA 3KSCA 2FNAA 2JG8A 2FCTA 4E8DA 3OWTA 1C8M2 3TEYA 1LEBA 4U0YA 5IOZA 2VQHA 1AKHB 3C18A 3TO7A 5JZGC 1ND2A 2GNBA 2R6QA 4Y20B 1PZ7A 5LZ6A 4J00A 3E1F1 3CJIB 3CCUI 4QWQA 5FGMA 1U5IA 1ZELA 1X8MA 4J25A 4YG3A 5LGTA 1ORKA 1LHVA 5F0HA 4LGWA 2RNGA 1WFXA 2ZGPA 4RGRA 1SMTA 1R081 2ZX3A 3DFGA 4YM2A 4PJJA 3ML6A 2ID4A 3H7JA 4LBNA 3CJIC 3QPLA 3L2VA 4AZZA 3I55I 1F43A 2W2IA 5BXXA 2FOKA 2V1UA 1HRI3 3THPA 1ULYA 3GM8A 3NKGA 4Y22A 1CAXA 2X1EA 4OFGA 3CJRB 5LGUA 1POV0 2JG9C 3MLJA 5GLTA 1N1YA 4JKLA 4EVIA 3K69A 3TOAA 2FX0A 5D5UB 1W0UA 1QNYA 4N90A 3ZXJA 2XJSA 1FOWA 1G8XA 3GTKJ 3TEZA 4KG0A 4BWOA 2DUQA 4E7IA 2C9KA 1US3A 2HYGD 1HLCA 3QP5A 2WS93 2XPWA 4LBQD 1C28A 2CG4A 1KS5A 2LM3A 3R6SA 2ZMEA 1QGPA 4FFGA 1R1VA 2QQWA 3IKWA 3A01B 5IVYA 4B4RA 1IN5A 1VQPI 3UKVA 4I0AA 1W8OA 4HOBA 5FYTA 4AWXB 3HQXA 5GLWA 3AC0A 3VDDC 1G3SA 1RIOH 5J3LA 3CUQA 3IH2A 4M00A 3QPSA 4IGPA 1VBD2 1NG6A 5FZCA 1UX7A 1HBXG 1VIWB 2HS5A 3IPVB 5A6YA 4PJ0C 4UFIA 4XUQA 3BZCA 4P9LA 4QX8A 4RMNA 4XFAA 3LEGA 4PF5A 1W36D 2DVBA 4X6QB 4B1LA 1SPPB 4S2DA 2A6ZA 3WVJA 1FYMA 1UF2C 4XIKA 4QDQA 1QPMA 4W6WA 2VMCA 3C3WA 1C8NA 1WJBA 2HZDA 3W2AA 3DKWA 1JGGA 3V56A 3EETA 3ZYPA 2GP3A 4Y33A 1ULGA 4IO9F 5GLUA 3JXSA 4KIBA 2FZ2A 3EYPA 1I50J 2PAMA 3GDBA 1NHAA 4G7OF 4AQ6A 4Y15A 4A6SA 2RKHA 3IDCB 2VODA 4NHJA 4GRIA 3KT7A 5HDGA 1HKDA 5JZGB 3MZ8A 4LITA 5A1FA 2W1SA 2WDBA 4W8JA 3SDBA 1OYYA 5HLIA 2DOEA 1A6IA 2OZUA 3ITQA 4NVPA 2VAUA 2C6SA 4UF0A 4GXLA 3AFKA 2F5VA 1DYPA 3HN3A 1S8NA 4QWNA 1D1BA 1VTNC 4A4AA 1YEWA 3FMSA 1K61A 1K5JA 2JA8J 2ARBA 2R16A 5FP7A 2AENA 1DZQA 2WSVA 5DAWA 3BTYA 3AP9A 4HX7A 1HB3A 3H0GJ 4LOTA 4WBBA 4XKWA 1ZZCA 3HGYA 4QGNA 3SEQA 2A5WA 1HRV1 4N43A 4XAEA 4KNCA 1BL0A 4A3BJ 4L92A 1W04A 1SFOJ 4GALA 4M73A 1W0OA 3VWBA 4IKFA 2O8OA 4EROA 3NRUA 2EVXA 2XJRA 2EA2A 2DQRA 3GXUA 1I27A 3FK7A 4R9BA 4UFMA 5JIUA 5D2AA 1Z0HA 5JR3A 1SFKA 2KIFA 3WG7H 3POGA 4C3HJ 5B1BH 3EB7A 1PGSA 2MGQA 4OHYA 4XDOA 4AVBA 5BMZA 3NVCA 3ZN5A 4DB5A 4NBQA 3UJOA 5KHIA 5K5RA 2WT0A 3OOPA 3VBOA 2R4GA 1S2BA 3B94A 1XPWA 2V4JC 5I8TA 4OU0A 2ZBJA 5CVUA 3ZQCA 2Z5WA 4XL9A 2HNHA 2JJ7A 3J7HA 3JRCA 1VRH2 1MZEA 1OKRA 3VKFC 3N9NA 1OCZH 3TDUC 5DPNA 3APBA 2K4BA 4U0VA 1GUIA 2DPUA 2O8KA 2CQXA 2Y9ZA 4CCCA 3K0LA 4XBQA 1YE9A 3O8GA 2RM21 1I3HA 1X2MA 4JKKA 2HXOA 4EYUA 3B6AA 1RUE3 2D6LX 2H94A 3ZX7A 5IK5A 5FP4A 2P8TA 4XN3A 1G3YA 3BG6A 2UY9A 3ZN0A 4AF9A 2LUWA 4GA9A 1QOTA 3TOJA 4XSZF 1T56A 3IL2A 2JDKA 3ERED 4FP3A 4CEWC 2QQ9A 3H92A 3ZQFA 3F72A 4IL6C 2LFBA 4CCDA 1TBXA 1EH8A 3NWTA 3V64A 4XF9A 1S2KA 1HOMA 1X1AA 3N9OA 5T50A 2O14A 2WAQA 3PJYA 4XFFA 2K5CA 3DXJF 1DDNA 2RQQA 2VOTA 3Q8EA 2MG4A 4Q48A 4F92B 5K9YA 3HBKA 1GWLA 2P0WA 4A3DJ 2JDAA 5FBJA 2LTPA 1DGWY 4XYXA 1D7PM 2KRHA 5J3UA 2K27A 2WAOA 1UMIA 4NIAA 3W20A 3H36A 1APNA 2V6EA 4GYGA 2VTXA 5AIQA 1LGBA 3I59A 4BXXJ 2ADUA 1UG0A 2X6XA 2VULA 4IE0A 3WQ1A 3CQZJ 4AYUA 3HUGB 1GT0C 1H9PA 3M8FA 2Y30A 4BDVB 5IYDJ 4XRSG 1JUIA 2L4MA 1YFXA 3UKTA 2LK2A 2ZX2A 2BYVE 2ZMEB 3DCFA 4XZPA 2PAKA 4GXOA 1UMQA 1HF0A 2CYFA 1X1CA 4HBLA 1LEMA 2R7DA 3PM1A 3GCXA 4RA0A 4YIIA 4M3BA 2R7OA 2XUMA 4MOAA 4OMDA 4M6YA 4MXWA 5DZEA 4F3JA 3SEEA 5KAFC 3J7ZI 3EPZA 1YWKA 1BBT2 3ES4A 3BTJA 4A42A 2IS2A 3H0DA 3VZMA 3CUQB 4TLFA 1N1VA 4IXAA 1SVOA 2EBIA 4NHLA 2A3YA 1FMD1 3OIQA 1MS1A 3DPRA 4NO4A 2F5DA 3SYTA 4HN1A 4RYDA 5FY9A 3M7GA 3U75A 4M0NA 2XB0X 1W0NA 3LSKA 1YRNB 2E5ZA 1ON2A 1ENSA 1WHUA 4AU7A 2YU9J 4UVBA 4FAHA