3RPQA

Domain-domain flexibility leads to allostery within the camp receptor protein (crp)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
201
structure length
201
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILFYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain-Domain Flexibility Leads to Allostery within the Cam Receptor Protein (Crp)
rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords Catabolite gene activator
total genus 60
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rpqA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3rpqA01
3RYRA 2DLLA 3Q9SA 3WG9A 5F1RA 2WTEA 2XV4S 4BHCA 3GX4X 4ENKA 2OZ6A 2RN7A 4HBLA 4OU0A 4H0EA 3T1BA 4MGKE 1J0RA 4M9ZA 2VE8A 3GVAA 2XAHA 5TRDA 1OYYA 2EA7A 4L18B 4M72A 1UCXA 1UD1A 4OIOF 5AIQA 5LBQA 4FAGA 1K78B 4B09A 1X7NA 3J81K 5JAXA 2KIFA 1XCBA 2H6BA 4Y15A 3SXYA 4HSLA 4BHBA 2KIMA 2XAJA 3LAGA 1X82A 4O9EA 1WQ2A 3DKWA 3BWGA 4A2UA 1H1MA 4KUMA 3FMSA 2LDUA 2IXJA 3R6SA 4D7TA 3BROA 3CJNA 3COAC 4GXOA 4WCGA 2HQRA 1W7PA 5L3BA 5LHHA 2O8XA 3KLNA 1LJ9A 4IRHA 2GC2A 2VT2A 2QCSB 2EFNA 2EJRA 3F8NA 1V4RA 2JTVA 4ORFA 3BZ6A 3SZPA 1IZ1A 1FPQA 1ZHFA 3HYIA 2G7HA 3LFKA 4YSFA 2PAMA 2X4HA 3TOBA 3JSOA 2PJPA 3ZMVA 3T8TA 2PYTA 4CXFA 3V8KA 4RGSA 2CQKA 1WWXA 4G7HF 3WGIA 4UNOA 1DGWA 5ICCA 1ZZ9A 4XF1A 4I0BA 3ISPA 1YUDA 3HHGA 3NL1A 2NAZA 4UXAA 2HFHA 2DPUA 2O03A 2C0ZA 3IWZA 3GUDA 3F21A 4ZU4A 3JTHA 1OMIA 4LULA 4UVCA 3CF6E 5JFRA 1I5ZA 4L2NA 2EV0A 5I0TA 4M6XA 2M8EA 3HOSA 3JSPA 1TTYA 3JAMZ 2EB7A 4MQ9F 3OF1A 2M30A 3HRUA 3TDZC 2K27A 5J7MA 4A0YA 4GULA 1MKMA 4FHTA 4I7HA 2P4WA 3LWFA 4KA4A 4HZFA 3OTFA 2UXXA 2R7FA 1JHFA 3H1MA 1L0OC 4HW0A 2K0GA 2UYBA 3MWMA 4A0ZA 1Y9QA 4HN0A 2DAOA 3GLXA 1BBYA 2W84A 3UKTA 2PMUA 1ZLKA 3I71A 3E97A 1XMAA 2HWVA 1CAXA 2QVOA 4RGRA 4PIXA 3PVBB 1XD7A 3BPXA 5TJJA 4L9NA 4OMZA 5ICGA 4IPAA 2P5KA 4X6RB 2RGVA 1A04A 3L00A 4PCQA 2IA0A 1IN4A 4LB6B 4EJWA 2QENA 3MCZA 4GYIA 3I54A 3OCPA 2Q1ZB 2HS5A 4O5VA 1OI6A 4TLFA 3SXWA 3I59B 3ZMTA 5LRSA 3ABTA 5FFXA 4QGLA 2V09A 2QNKA 1D3YA 4YNIA 3WW4A 3WE3A 1QZZA 4GYGA 4GO1A 1UFMA 4R8HA 2D2WA 4ETSA 3L09A 2M45A 3GXOA 1AOYA 6PAXA 2XUBA 3NKTA 1NE4A 4L9VA 2DTRA 1QZYA 3ZN1A 3WW3A 1KYWA 5CLSA 4XFBA 5LGUA 4QLCU 1SD6A 4WX9A 5IT9K 4LLLA 3ACLA 2CG4A 1FYKA 3CO7C 3LQRA 2OQRA 5K5RA 2DK8A 1ZZ6A 1YFHA 2QZ8A 2B5HA 1HKTA 4LLOA 2VODA 4Q0SA 1KU7A 2L01A 1USSA 2KJCA 2V6CA 3PQJA 4KMUX 4MTEA 2EFQA 3SHRA 1SFEA 3I7DA 2MA3A 2ZKZA 5E20A 1R22A 1FNNA 4KIFA 2A5YB 4L9TA 3SCHA 2RQPA 3ULQB 3DF8A 2IP2A 3C7JA 1Q5OA 5K1YA 1X8EA 3K1MA 1P4XA 1FC3A 4XFHA 3LA7A 2FMYA 2HTJA 2Z3YA 1K78A 3HHHA 3LZZA 4ZZLA 1LNWA 5K5OA 3ZP5A 2NRAC 1G3YA 4JV4A 1H9GA 1U5TC 4XFGA 2MLGA 2OAZA 2DK5A 1TNSA 2IXCA 3MDPA 2FQPA 3TNPB 2DQRA 4IETA 2Y0OA 2VN2A 2P8TA 3ZQ7A 3JTGA 4BXUA 1F1ZA 4OIQF 1MD0A 3M9AA 5D5UB 4MX3A 2GXGA 4EGZA 4HX8A 1QPMA 1R5GA 5JSPA 4M73A 1V3FA 5HI0A 2CGPA 1J3QA 3BJOA 1YFWA 2GA1A 4HF1A 4F8AA 3HRSA 4U0YA 4UHTA 4XLPF 2O1QA 1KQ8A 1BN5A 5DCFA 4YYOA 3BJAA 2IXIA 1FZPB 4IEVA 3FFQA 1YG2A 4HLYA 2W57A 2KKOA 1ON1A 4QXKA 5D1IA 1J7KA 2XIGA 4L0ZB 3FWEA 4ENNA 3ST7A 2D40A 2IC1A 3U2RA 3MZHA 1WSUA 1W4MA 2PHDA 3J80K 2OZJA 4R79A 3WGGA 4KNYA 1EH7A 4HQEA 1XB4A 1ZRRA 4Q0UA 5CVIA 2FXAA 4MGYE 4ZYGA 3FM3A 2I45A 2OD5A 1ZZ8A 2H94A 2F5DA 4LUKA 2ESNA 3ROUA 2ACJA 3R61A 1F4KA 2ET7A 3V7SA 4AIHA 5I93A 3IHUA 2ISYA 1PDNC 3CLOA 1D8JA 1QY4A 3ZMSA 1YTYA 4RD7A 3F3XA 4P96A 4PIYA 3F8FA 2A6EF 3GZ5A 1IW7F 1LQ1A 4MEYF 4DNCA 1LEBA 3SZTA 1IN7A 1R23A 2A69F 1FP2A 4BYYA 2NNYA 5ED4A 5E8GA 4YFXF 1L3LA 3F22A 4IRIA 3LOIA 2HQNA 2DQLA 2UYAA 2FE3A 4E2QA 2ETEA 2V1UA 5KHHA 1XCVA 5D5XB 1SD7A 2JPBA 2XAGA 5FD5A 4E70A 3RKYA 5L3EA 3T0YA 1O3SA 1U78A 2DFIA 1XE8A 2OZUA 2KXLA 1SMTA 1BIAA 4RGUA 1ZX5A 4QGNA 1FY7A 1HKSA 1QXJA 5CU1A 3R60A 1DZTA 2DPDA 1J2XA 4IF4A 5LRRA 4YRDA 4X6QB 4WBBA 1SQ4A 2ADUA 3KE2A 1YWKA 1CAUA 4Z82A 2CO5A 3LA2A 1HW2A 2LF7A 1CAWB 1YS6A 1P4WA 1O5LA 5LHGA 1SFNA 4HX4A 4I0AA 2QBYA 5CVUA 5KHGA 5J3UA 4HSJA 2IA2A 1BOAA 1UHWA 4BNCA 3EYYA 2XLAA 2ZJ2A 4U7BA 4L9JA 4QM9A 4ENJA 2QQ9A 2X0LA 1WGPA 4QM8A 1KQ9A 2FBKA 1B9NA 3NW4A 3CO6C 2QQBA 2ELHA 2ZNZA 3ECOA 1D5VA 3DPTA 5FD6A 1K6OA 1IN5A 2D1VA 2OU2A 2RV8A 3VEPA 1MDMB 4UXNA 1Z91A 3MYXA 2FOKA 1F5TA 4GGGA 2EFWA 3BPZA 1YQAA 1USTA 5E1ZB 1OYIA 1V70A 4IEZA 2P6TA 3M1EA 5F6FA 4O3MA 3VODA 5I8SA 2ZMEB 4P5OA 4XRFA 5E18F 2FEZA 4AXOA 3UKVA 2PMHA 3KP2A 4JBAA 5J8CA 3LAPA 3S2WA 4EJTA 3K1PA 2PTMA 3W6KB 5D4RA 1I1GA 1QO0D 3HOTA 3FHZA 1BC7C 1EV7A 3H7JA 5I0RA 3E6DA 3FXRA 4AD9A 2CAVA 4I09A 1S3JA 4IRGA 2HJIA 2PFBA 2BGCA 4HF2A 1CX4A 3CUOA 3PNAA 1HBXG 3H1WA 4P9FA 1RIOH 1IUYA 3MAJA 2YX4A 3KETA 3GYDA 4WK8F 4M71A 2QYOA 2YSRA 2ISZA 2IPQX 2TDXA 4XBFA 4IEWA 1Z1DA 3WODF 2H09A 3N4MA 1JE8A 3MZYA 3J81Z 4OFGA 5I91A 1G3WA 3TKYA 3ETQA 4ON0A 5AIPA 4IEQA 2B0LA 5C6CA 4CYDA 4EQQA 1KQ0A 5I0SA 2VBYA 2COMA 3USSA 3ZPLA 2A3SA 1SFXA 2Z2SB 1UPIA 1R1TA 3S7EA 2B8MA 1OR7A 2ZNYA 4XSXF 1Q1HA 5J48A 2VC1A 3FM5A 3H3UA 1KU2A 1U2WA 4QWQA 4MUVA 1B1BA 1MJAA 3EO6A 4Q29A 2PEXA 5J8FA 5DCMB 2KRFA 1OD5A 5BOXA 1R36A 3F8BA 4HDUA 3LQQA 4Q48A 2VBXA 2KJBA 4FAHA 4P9UA 5LGNA 4AVCA 1YYVA 4M6YA 3K9TA 4CDGA 5L3DA 2VBWA 2RVCA 1PUEE 1B6AA 1W5TA 4EROA 3CUQB 4XSZF 3IWFA 1H0MA 5I8TA 4UV9A 1O4TA 1YFXA 1RC6A 4ZYHA 1FOKA 2GWRA 3HTUA 5FGMA 4ZU7A 4Y13A 3NSTA 2L4MA 4K2EA 4LD5A 3FZ3A 4OIRF 5KHJA 2DW4A 3KFWX 3KCCA 2UY9A 3OGJA 3VB2A 2ZCWA 4EM0B 5H6QA 3GWZA 3KP7A 4HQMA 2F4PA 1DP7P 1OPCA 4M9XA 1X3UA 5IT3A 1E17A 1G3SA 1ZYRF 5BQTA 1IRGA 1J9IA 2K9ZA 1RZ4A 1CF7B 2YPRA 4IXAA 1FT9A 3E5QA 3SFZA 2VT3A 2CWEA 3L9FA 5ICFA 5ERIA 1YW9A 4YIIA 3DN7A 3K1NA 3P9KA 3QP5A 2DO7A 3V8LA 4ZU5A 5KHKA 1Y0UA 5BMZA 4NQWA 4KIBA 3ELNA 3H1YA 3H8UA 3GFMA 1G3TA 4EMSA 2F5FA 4G9YA 4YFNF 4BH9A 4Q47A 3K0LA 2P5LC 1SD4A 4FT8A 4D0PA 4AIKA 2STWA 2IJLA 2D5FA 4LK1F 1IPKA 1XGSA 1XGNA 4O6JA 3O6BB 5BS6A 2EWNA 4UVBA 1FX7A 1L3JA 4EWDA 2AXLA 1O57A 5JR3A 4LB5A 5E1XA 4LEJA 3M8EA 1ZRDA 5EEGA 1P4AA 4A5MA 2MNGA 1CGPA 1EH6A 4G7ZF 2YR2A 5ILUA 4IESA 1O7LA 1YS7A 1EY2A 4QGMA 4NB5A 4UV8A 2QLZA 4Q0QA 3BY6A 4LK0F 5JCTA 1XN7A 3LA3A 3IBMA 4AIJA 4CGZA 1YLLA 5FLIA 2RDPA 2P5VA 3R0AA 3OD0A 1C0WA 1H1IA 3RIRA 1O7FA 4XFAA 2GH2A 4RAYA 5BXXA 3D0JA 1S8NA 3MPBA 5FLXK 5F64A 4L5JA 3NJZA 4LA2A 1LVAA 3WW2A 1OYWA 5HVQC 3IDCB 4HYEA 4N9HA 3O2PE 3I5UA 4CZZA 1CF7A 4I3PA 1ZVFA 4UBGA 4LLNA 4YFKF 5FLXZ 2V1XA 3UKNA 3RYKA 1XGOA 2R7DA 2HYGD 4M74A 5FO5A 2FA5A 2MBFA 2EV5A 3IRQA 1R1VA 5DDGA 2A6HF 1GXQA 3LAJA 3DEUA 2N7GA 2EAAA 4WVZA 5DUKA 4G7OF 3D82A 3FMQA 3BB6A 5DUIA 4LMYA 1P2FA 3ZMUA 1JXSA 2XL7A 4HLTA 2Z9OA 3BJ6A 3EBRA 5KHIA 3F8CA 1QQIA 2LSOA 4LG0A 2PQQA 3WGHA 1D8KA 5H20A 2Q8KA 3HTSB 3OOPA 4KWJA 3T5XA 1SFUA 1O3TA 4LA3A 1GXPA 1MJBA 3O14A 1UW8A 5DEQA 2QWWA 4WXDA 2OQGA 2DU9A 4D7SA 4ZYEA 2L3DA 4A6DA 1I6XA 1SD5A 2E9QA 4OMYA 1YW7A 4RB3C 2UZKA 2CYYA 1YIOA 3R0JA 4ENMA 1DGRA 2VC0A 3NEUA 1ULYA 4HV5A 1HKQA 1U6GA 5CJ9A 3KP5A 3B02A 4E2SA 3D5LA 2ZFWA 5BY5A 3H9AA 2PFWA 4IHSA 4MQVA 1CAXB 3HRTA 1TNTA 3H3ZA 2PI0A 1U5TA 2IVMA 1NZCA 2CV6A 3QPTA 1UIKA 1BI0A 2XAQA 3N97A 1LDDA 1NXMA 3MEXA 3RJPA 3C1DA 3JAMK 1RUNA 1ZG1A 4KMFA 4JK1X 4CO8A 4AWXB 1T98A 2IA1A 1J3RA 2HDCA 3QP6A 3GW2A 1BC8C 3NQOA 2IT0A 3WTTC 2E7XA 2E1CA 3KEQA 1XMKA 2MH9A 4RAZA 2QUFA 5FPXA 3FJSA 2K4BA 5ILSA 2LNBA 4HDVA 5HDKA 3NVCA 2PQ8A 2CW0F 4HN1A 5FDBA 4UVAA 4KU7A 1TBXA 2JT1A 1J58A 3F8MA 4HF0A 3TO7A 3BU7A 2EK5A 2ETHA 4WF2A 2PN6A 1ZREA 4XFFA 2H27A 3RPUA 3IL2A 1WLTA 3QACA 2L02A 1R58A 3GFJA 4PJYA 4XFIA 1ZGAA 4P9GA 4A0XA 3ML6A 1ONVA 4ESJA 2Z33A 3WE2A 4K8FA 4PDKA 2NNNA 5K8SA 4XF9A 2XL9A 1WA4A 4M9SA 4EVIA 3S7IA 5A2QK 2E1NA 1KGSA 4A5NA 1IAWA 3TOAA 1YO5C 1FYMA 2O3FA 2FBHA 5BPXA 1KU3A 2Z5UA 4EM1A 3KP3A 3C18A 4LJZF 2WC2A 5CVJA 3CTAA 5CYVA 2DBBA 3QU6A 2BYVE 1DDNA 3NRVA 2VECA 2O6GE 3RKXA 2XROA 2P7CB 1WRJA 3MQ0A 2HEOA 3GF2A 4L11A 4EGYA 4RB2C 2VONA 4L0YB 1YLFA 4HAMA 1Q43A 1E2XA 4HV6A 5LGTA 1J59A 1I1SA 1YHFA 5E1RA 1GQGA 3BCWA 1CAUB 4I2OA 3RTRA 4UUVA 3MFKA 4KWLA 3J80Z 3RKWA 3ZMDA 3L7WA 2L54A 2HKOA 3LSTA 3E6BA 4AVBA 4LG0B 2PAEA 3WU1B 4HVRA 4KN7X 5FLJA 1FBSA 5L3CA 1EP0A 4KU8A 5J6XA 1HW5A 1KA8A 2FMLA 2LF8A 5AONA 2VOOA 5FB2A 3EDPA 2ESHA 5BV6A 2FSWA 3P7NA 4ZYDA 1DPUA 3IIAA 3KMHA 1RGSA 5DV5A 2E7WA 3DV8A 2G9WA 4KT5C 3M7GA 2YU3A 2DCTA 2C6YA 4B8XA 4EWAA 4EJVA 3IKTA 1I27A 3KLOA 3F6OA 4MGIE 4G94A 2FBIA 1XGMA 4HBNA 2BEOA 2A61A 3DFGA 4QX5A 3HIFA 3RNSA 1FBUA 1BJAA 2HTSA 3C3WA 1TW3A 3WTWC 3EQEA 1WKMA 1VP6A 3BALA 4ASNA 3IRRA 1U3EM 3GO5A 1PP7U 1SMYF 2J5OA 5LEKA 2GZWA 5K5QA 2BNMA 4PGGA 3Q9VA 3V7CA 1S7OA 5HDNA 1TQIA 4IEYA 4MHGA 3DXJF 3GFLA 4XF0A 4G6QA 1KYZA 3ERED 5CADA 2FQ3A 3QRFF 2UWMA 4LGWA 1ZNPA 3H92A 5FPZA 4BQAA 2RNJA 4R52A 3EYIA 1P6RA 2P17A 1VR3A 5FLHA 1J1LA 3SCGA 1FBQA 4KWKA 2Z99A 2BBYA 2O0YA 1RUOA 1MJ9A 3KSCA 4OINF 5I8YA 3FXUA 2JSCA 3U10A 2W24A 4CHUA 3FMRA 4Q5SF 5KVRA 3JW4A 5E16A 4IHTA 4HVQA 1IN8A 5LLQA 3BP8A 2H0VA 2GC3A 4EV0A 1NHAA 4IEXA 3U9GA 4OOIA 2FNAA 4EJOA 5T3NA 3GZ6A 4JQFA 1HW1A 3HSFA 1FI2A 3TO6A 1EYBA 5FCCA 4U0WA 4AVPA 3O3KA 5HS7A 4S05A 4Q0VA 2OA2A 2Q4SA 1T2KA 3Q5FA 1ON2A 5JVTA 5ICEA 2D1HA 1LEAA 4EJUA 2ZMEA 3TDUC 4XETA 2MH2A 1MZBA 1XSDA 4RS8A 1ZZCA 4PGHA 3CEWA 4KIGA 1W5SA 2XKOA 2GU9A 2RC4A 3PQKA 2STTA 1IXSB 2IXKA 3KP4A 1HXDA 1O5UA 3KZYA 3TQNA 1EH8A 3REOA 2VPVA 5LEJA 2Q2EA 3DPLC 4WXCA 5HS8A 4I02A 3ES4A 1SAXA 4L5IA 4KICA 1Y3TA 1XSVA 1TQMA 1J75A 2EFOA 3LWCA 4IJAA 1FSHA 1B4AA 1PP8F 2W85A 2ZKLA 3M3IA 1QNTA 1YW8A 1K7AA 1ZAOA 2UXNA 4Z2YA 3WTXC 1ZRCA 1IXRC 4KDPA 3U11A 3WW1A 2Y48A 5FQ0A 3QU3A 1ZGJA 2VOPA 3FXQA 4MZUA 4META 5E1WA 4PZJA 1XRUA 2BNOA 2XLFA 2K86A 5BPDA 1BI2A 5DYMA 1O3RA 3PLQA 5C8WA 1AWCA 2J5PA 3ZDSA 3EQLF 1JHHA 4G8XA 3G7DA 4A6EA 4CICA 2AS5F 1STZA 1VJ2A 1Q3EA 4S04A 1VTNC 4XF4A 3OV8A 4RGXA 3KEOA 2PHLA 1IXCA 3RI4A 3JZVA 5HS9A 3CL1A 3RYPA 3E6MA 3BOQA 4B29A 1LDKB 2QVSB 3GEZA 2MHFA 5EFUA 2A07F 3BDDA 1S7AA 1UB9A 2OYZA 1GQHA 1BI1A 3B73A 1BI3A 2EFPA 2DT5A 4YIFA 1TW2A 2P7VB 4FX4A 4HLXA 5L3GA 5HDGA 1QBJA 3I59A 4IEPA 4F7ZA 5D8KB 2B9UA 3EETA 3WTUC 1T6SA 2H6CA 1YFYA 4BAYA 1LB2A 3WTSC 1ZARA 2PBIA 4AQ6A 4MH0E 2GXBA 4JTNA 4IERA 2JPCA 4I98B 4NHJA 4O9GA 1P92A 1R1UA 2CAUA 4IEUA 5H6RA 2GAUA 1U8RA 2Q30A 1RI7A 5A2QZ 1DPRA 2HYFA 1TQ5A 1PMIA 3ECHA 3DQVC 2ATFA 2WV0A 4XLNF 4PIZA 1RNLA 4ONUA 3L2HA 3SHFA 3F23A 3WU0A 4OLLA 3F72A 1IRFA 2ZO4A 5HLHA 2IRFG 1MGTA 1S6LA 2IXHA 5FFZA 2ZBKA 5D5VB 3DL3A 1ZN2A 4KL1A 4IVNA 4BHPA 4R1HA 1UHMA 2GQQA 3IDBB 2WWYA 4MEXF 4BIFA 4YG2F 1Z7UA 4MV2A 2IXLA 5JR7B 4U7DA 2MC3A 3G73A 3WTYC 4MNUA 1ZLJA 3BPVA 1GHCA 1CAVA 2FRHA 3U1DA 1G6NA 2FF4A 2L4AA 3HT1A 2XVCA 2QQAA 4HX7A 3SCFA 3VHRA 3CDHA 2A68F 3TNQA 3IKVA 3L2CA 1HQCA 5DCMA 4JVAA 3TO9A 3I4PA 1ZG5A 2D45A 1PM7A 1KU9A 2HGCA 2V9VA 3EHKA 3KGZA 1OKRA 2DI3A 3G3ZA 5E17F 2HZTA 2D93A 3I64A 1B59A 5BUVA 4AQ2A 3KGLA 2Y75A 3RPQA 3I53A 1ZZ7A 3U0ZA 2Z69A 2BE5F 2XASA 5HOOA 1W7PD 3TGNA 5JHUA 2GC1A 4MGRA 2PLYA 4J1WA 1R00A 4MGZE 4A12A 2K7LA 5HLGA 1B9MA 5DD4A 5DD8A 5D4SA 4GCVA 2JRTA 1J5YA 4J1XA 2VQAA 3V7RA 2W25A 2WFPA 1CAVB 3H50A 2JZYA 2OBPA 2UY8A 2K02A 2M5WA 4G6DA 4ZH4F 2NS0A 3DP7A 5IT9Z 1JUHA 1J3PA 2Y0MA 4N0BA 3M8FA 5AVPA 1UCRA 2ET1A 2V1DA 5D5WB 1EPZA 5EZWA 3HUGA 1TLHB 5JSOA 5ILVA 3R4KA 2OPKA 1T0FA 1QWRA 5D6EA 2D5HA 4H7LA 3ZMZA 1S29A 3HT2A 3RDIA 3E6CC 2O61A 4HMZA 4LFUA 5CVRA 1WI9A 1QXRA 2M1BA 3I58A 1O3QA 3GYHX 1HSTA 2YX7A 4HA8A 4LLGF 3VFZA 2HOEA 3QAHA 2VXZA 2FNPA 3E3VA 4HOBA 3PFIA 3W6JB 3ES1A 5D6FA 3V8JA 5EEHA 5D8LB 4LTAA 1DZRA 3QPHA 4MTDA 4TV7A 3GBFA 3WTZA 4HVOA 2VBZA 2PA7A 4U88A 3J7AO 3VOEA 2LKPA 2KIUA 2CSOA 3CLPA 1YFUA 4ESBA 2GA2A 2RKHA 3E5UA 3P9IA 1FWZA 3QOPA 4N9IA 1FLIA 4KN4X 1QGPA 1ZG3A 4EM2A 1CAWA 4YARA 1U12A 5HLIA 3E5XA 1Z05A 5I0UA 4WZCA 1GVJA 1W7PB 1K79A 1U5TB 1Z6RA 3F6VA 1XDSA 3FZVA 4FX0A 3D0SA 2K4JA 3V4GA 4DQ2A 5JI6A 2M87A 2XGXA 1NYWA 4XEZA 2BNNA 1ZH5A 2MLKA 3ELKA 1XE7A 3ABUA 1DUXC 2MPFA 2Q0AA 2QJVA 4RB1A 5JSRA 3CO2A 1R5HA 2EA2A 4Y17A 1Z9CA 1LDJA 2XLGA 1NE6A 1T38A 4OIPF 4FBFA 3M70A 3K69A 4WWCA 2GIVA 1IN6A 4Q0PA 3FE5A 2NYXA 1H9TA 3EJKA 2EVXA 3SQNA 1IPJA 2BV6A 2XKPA 4I01A 2F5CA 1UIJA 3C3VA 4ESFA 1F9NA 5KBFA 4ZZDA 5CVVA 1XDUA 2GC0A 1MDMA 4EWEA 4U0VA 1X8MA 2PG4A 2XRNA 4P55A 5L3FA 2QM3A 3FF5A 2HR3A 2IW5A 3HSRA 3KZZA 2XHKA 1FYLA 3T8RA 2ZXJA 5E8IA 3AAFA 1ZRFA 3IC7A 1RL3A 1LR5A 4NVPA 3HRMA 3RZZA 3P9CA 4UBHA 3ZN0A 1Z6TA 2QBYB 2V79A 4Z07A 1RTVA 2Q0OA 2OA4A 3S0MA 1IF1A 1BM9A 4KFCA 5BPIA 4XF3A 2R3SA 1HSJA 1R7JA 5LHIA 2PAKA 1BIBA 4RB0A 1G4DA 4Q4ZF 4WXHA 1ZZBA 1TQPA 3CUQC 3CUQA 3KP6A 5KK1A 4E2GA 2F5EA 3FX3A 3K2ZA 2CFXA 4XFCA 2P6SA 5FQ0B 1FXZA 2F2EA 4JTOA 1JGSA 4IEOA 3HSEA 3I0TA 3WTVC 3GFIA 1OFNA 4AVAA 2G7UA 4KYWA 1XSXA 1T39A 2XAFA 2MD5A 4LUMA 1LKNA 3CJXA 2QDRA 4QMAA 2EA4A 1REPC 3HQXA 1FSEA 2VE9A 3H7YA 3SMHA 3FHIB 1FP1D 4DINB 2HKXA 1LRHA 2EV6A 2FU4A 1SEFA 2O8QA 1ODDA 3EUHA
chains in the Genus database with same CATH superfamily
5IUQA 4DY3A 1LPQA 2HBTA 4CDXA 3BG9A 4YVWB 4WM8C 3GX4X 2RS33 3VKNA 1TWAJ 4YZ4A 4E7JA 2RN7A 4OU0A 2WB1N 4H0EA 3T1BA 4F55A 2GM4A 2ZBJA 5TRDA 5A1FA 2W87A 2ICWG 3HBZA 4M72A 4QSHA 1HRV1 1UCXA 3LMMA 1UD1A 4OIOF 1FNZA 4XDQA 4KBZA 4BWOA 1XBFA 3J81K 2KIFA 2KP6A 5CYYA 5FREA 2FCTA 3ZPYA 3OIOA 5J1RA 2L0KA 2GMEA 1GZCA 1S55A 4HL0A 1PZ9A 2XB6C 3MFAA 1X82A 1WQ2A 4IE5A 2G19A 2WNEA 1OQYA 3R6SA 4D7TA 3M2MA 4GXOA 1HXS2 5L3BA 5LHHA 4JOMA 2GC2A 2EJRA 1V4RA 4ORFA 3BZ6A 1RMU1 1PZ7A 2A3YA 3HYIA 3K10A 1QKQA 3KZIC 1OVSA 2PAMA 4YSFA 2JICA 3UYJA 4JP0A 4DO0A 4BK4A 2PYTA 4CXFA 4RGSA 2CQKA 3SDBA 4BQ5A 4G7HF 1DGWA 5ICCA 2ARAA 1QNYA 4MHUA 1YIJI 1JKQC 2R5YB 2WFF3 5A1LA 1TE1B 2HFHA 2O03A 4IXLA 1R1A3 3VZMA 3F21A 2IS1A 4D3WA 3VKOA 1OMIA 4LULA 1Q8VA 3FK7A 3CF6E 1I5ZA 2EV0A 1XPXA 3WG7H 3HOSA 1TTYA 3JAMZ 3HRUA 3TDZC 1C8M3 2K27A 1IG0A 4XN3A 5F8PA 3GALA 1G9FA 4GULA 4YVWA 3ZM8A 4FHTA 2D97A 5B4NA 3QYEA 4FFGA 5FTTC 4HZFA 1LFPA 2UXXA 5B3SH 1HRV3 3WF1A 3H1MA 3LSRA 4A7KA 4HW0A 1D0XA 2K0GA 5C4WA 2LOOA 1ITYA 4PLNA 4NBQA 4K20A 3MWMA 4A0ZA 1Y9QA 4COVA 3GLXA 2V9PA 4QKBA 2ZGKA 5CFDA 5SV8A 5IOYA 3I71A 5FLVA 5DMYA 3MV11 1XMAA 3CQOA 1VRH2 2VL4A 1LFBA 4LBNA 4PIXA 2KDZA 4Y1YA 4L9NA 5ICGA 3OYGA 1A8DA 2M0MA 4IPAA 1PK6A 2P5KA 3K4KA 2RGVA 4PCQA 1UZVA 2VNVA 1HRI2 1IN4A 2CFOA 2QENA 4AM3A 3OCPA 2Q1ZB 5A6QA 1N1YA 3I59B 3WG2A 5AFBA 2DDAA 3IH3A 1URXA 4JKKA 2ME0A 1B72A 2BBAA 2CQ7A 4GYGA 2XG3A 4GO1A 1UFMA 4DB5A 1K83J 5GZFA 3GXOA 1IKPA 1JJ8C 4XJAA 2VZ1A 4LIUA 3NKTA 1NE4A 2HWC2 1QZYA 3VD9A 4XFBA 3I55I 3VL8A 5CKQA 5IK4A 4LO6B 5JXIA 3GJBA 2VTXA 2TUNA 1Q8SA 2QQUA 1F4HA 5EGOB 1FOYA 1DFQA 2XB5A 2VODA 1KU7A 3AZXA 5G04L 4ITCA 3PQJA 1S0CA 1SFEA 3I7DA 3CBNA 3HOZJ 2A5YB 4L9TA 2PXJA 3SCHA 3ULQB 4AU7A 3VLBB 1HDPA 3C7JA 4E27A 1KD7A 4W6YA 5K1YA 2VVFA 1FC3A 5FZOB 4QX8A 2IUWA 1RHI1 4B4QA 4AYUA 3TW6A 4BQYA 5FMDA 3LZZA 4CYCA 2L9RA 1R092 1V6LA 4V2FA 4DMIA 4LT5A 5JIAA 4A4AA 1U5XA 3MLKA 2DK5A 4FO9A 2DOEA 2D43A 3MDPA 2FQPA 3TNPB 1ULEA 2LVSA 4BJ0A 2JUCA 2DQRA 4D5FA 3Q8FA 3EUHC 4QQLA 2OQ7A 1F1ZA 4R4ZA 1RUJ3 4OIQF 4AI0A 1MD0A 5CPRB 3M9AA 1OT5A 4L0PA 2E60A 5J36A 2GXGA 2MC4A 4EGZA 1DG6A 1RJ7A 4M73A 5HI0A 4LO7A 2WN3A 2GA1A 4HF1A 3HRSA 2Q2EB 2Y6GA 4M00A 5A3TA 3B69A 3PSIA 4KBBA 5F39A 2VQUA 4IEVA 1WJ5A 2DCYA 4UUSB 4DBRA 2AHQA 4FQ4A 2QTWB 2J7MA 3JBG1 4MSVA 1W4MA 3DUIA 2WO7A 2OPTA 2PHDA 4M3EA 3J80K 1CR7A 4KNYA 1V00A 4HQEA 1XB4A 1UOJA 5CVIA 2QQVA 3MVPA 3FM3A 4K9SA 4BQ1A 5BNPB 1ZZ8A 2F5DA 4LUKA 5GADJ 3A4UA 1REDA 2ET7A 3R61A 2VMCA 5FOJB 1J83A 3UT0A 1D8JA 4XZUG 3VBRC 2X05A 1YTYA 2PMZN 1UMIA 3BTYA 2ZMLA 2WZR2 1W3XA 3F8FA 1ZELA 1BHGA 1N3QA 2X53S 5EWSA 4C3IJ 3KT7A 2WWSA 1BEV1 4UI9L 4URAA 1B35C 4BYYA 4HPQA 2NNYA 1HN0A 2QSFX 3ON7A 4YFXF 3F22A 4IRIA 2K9MA 3CCJI 2H8WA 1QU0A 2UYAA 2V1UA 1XCVA 1WH7A 2JPBA 2XAGA 3MV01 4E70A 3RKYA 4QT6A 1PO22 5JMOA 2C9AA 1O3SA 2XF6A 2OZUA 2KXLA 1SMTA 3OIQA 4QGNA 1X36A 2WA4A 2CQQA 5F08A 3QD6A 3HQUA 1OCOH 1QXJA 1I5PA 4HK8A 3D8CA 1W8ZA 1ALYA 3ABZA 2BY1A 4MXVA 3LA2A 2BVMA 4QU1A 2LF7A 3CNAA 1CAWB 2E36A 3JBG3 1P4WA 4N90A 2ZJRF 1BR1A 1O5LA 1SFNA 2DA4A 1KEXA 1OHFA 5JXGA 1V0AA 4J01A 1B8IB 2IA2A 1BOAA 1UHWA 3L2WA 2ZJ2A 5E79C 4L9JA 3IKWA 3S17J 4ENJA 3GTQJ 2X0LA 3RQIA 3NW4A 2JRMA 1JYTA 1D5VA 3CC2I 1K6OA 2RV8A 2OU2A 1ZBA2 1UY4A 1UJ8A 1F5TA 3BPZA 2IXSA 1JTZX 1JN2P 5E1ZB 2PJRA 1OYIA 3RSJA 4IEZA 2L9SA 2LFBA 3M1EA 2NQYA 1GVDA 1VPHA 1VBE1 2FEZA 5F0CA 1ULPA 3FXKA 3UKVA 3KP2A 4JBAA 2IAIA 5CFDC 3S2WA 3MFCA 2PTMA 2DJIA 4A3BJ 4QAWA 3FHZA 4LO8A 3OBRA 1BC7C 4Q4W3 1ZBE2 2D6KA 5FKMA 3E6DA 2CAVA 1BZWA 3JRFA 2PFBA 4L9BA 1OCZH 1CX4A 1AU7A 3TAYA 1JMUB 3CUOA 4CCJA 1C5HA 5A7NA 3PNAA 3H1WA 3NV3A 4J6GA 4YFZA 3QQAA 3GCWA 3WF3A 3Q0VA 2L7KA 5DXDA 1AYM3 2WYSA 2IS6A 4LG3A 4M71A 2K9LA 2ISZA 4XBFA 3SYTA 3WODF 3I9V2 3QPSA 1RKWA 4E4SA 5GLTA 3J81Z 1G3WA 4W6XA 4A7ZA 3IAM2 3J7AY 1RUI3 3J7MA 4B3XA 4IE4A 4IEQA 5LBEA 5C6CA 5I0SA 4EQQA 2R7UA 3IP4B 1V6IA 1GKBA 2Y26A 5E88A 3ZPLA 3THTA 3BU0A 2ZXWH 1E3OC 1C57A 4B4CA 3M4FA 3S7EA 4ZXEA 2ZNYA 1R1A2 4XSXF 3BQZA 1W04A 2F4MB 3JR9A 4AK3A 2VC1A 3BG5A 4MUVA 4P9JA 2PEXA 3VKFC 2VTXJ 3AVRA 5BOXA 1WGXA 3LD8A 2WNUC 5FOBB 5EGOA 4PJ0C 2VBXA 2NMOA 2KJBA 2TBVA 2Y6JA 1YYVA 3C2BA 4CCLA 2PMWB 4K7JA 5L3DA 5LA1A 2X9DA 2RVCA 4EROA 3PU3A 1H0MA 5I8TA 1JKRC 4A6OA 4ZYHA 2E51A 5FGMA 3V64A 2L4MA 3E1SA 4LD5A 2ZJQF 5IYDJ 1F5JA 4OIRF 3V0BA 2VUCA 4Q4V2 3KP7A 1F35A 2JDHA 2F4PA 2X5IB 4XJZA 4IL7A 1W2NA 5F3GA 5JZGB 1X3UA 1BJZA 2G0EA 1W5CC 1KJLA 1Y43B 2ARBA 1A6IA 5BQTA 2HDWA 1RZ4A 4BB3A 2JXAA 2CNAA 4CCMA 3E5QA 1CIYA 1H8VA 1JHNA 5ERIA 3KB5A 3QP5A 2DO7A 2HOAA 1Y0UA 1MMNA 3VKLA 4ES9A 4NQWA 1VNDA 4KIBA 3IAQA 1LGBA 3H8UA 1G8WA 2IGKA 3VB9A 1XXNA 1W9YA 4FFIA 3Q8BA 2WJSA 3VDCA 2P5LC 4Z2WA 1SD4A 3B6CA 4JX6A 5CISA 1TMF2 2IJLA 2QQPA 2VQCA 1ONAA 2LUWA 4LK1F 4BK5A 1IPKA 4UVBA 2W52A 1FPN3 1FX7A 3WNKA 1L3JA 1TVGA 4ZTFA 2ZGQA 5JR3A 1W2OA 5K7HA 4LK6A 3POFA 4YG0A 1JTXA 3ZSJA 1CQ9A 4LBMA 1CGPA 2OCCH 1EH6A 3JRBA 5ILUA 3GTLJ 2WO1A 3T2QA 4BBRJ 4Y33A 4AGVA 3HOYJ 4RHV3 1BJQA 1XN7A 2ZGUA 4BQ3A 3LA3A 1WMXA 1JT0A 3APBA 1UY3A 1DU6A 4MYEA 3F0CA 3W6VA 3BTXA 3RIRA 1O7FA 2NVQJ 3BKZA 1KITA 3FFZA 5D8AB 4RAYA 2OV7A 2EXIA 2BV4A 5FZ0A 3D0JA 3MPBA 2ARCA 2BOIA 4L5JA 4LA2A 1AXKA 1MEC3 1MBEA 3I5UA 4RGAA 3AG2H 1RUJ2 4UAPA 2EIKH 2JDUA 3OGRA 1RUI1 2P3YA 1XGOA 1AYM1 1XU2A 3QLQA 4GB31 3M3YJ 4N7UA 3O1UA 3I3EA 4M74A 3GF6A 4QDSA 2EV5A 1JZ4A 2OX0A 4CCCA 3SZGA 1GXQA 3ZYFA 4NIAA 3DEUA 2ZX3A 1OFCX 1MNEA 4L5EA 1RUJ1 5DUKA 1PO23 1W05A 1JXSA 1UWWA 1S0FA 4NN0A 2WZPP 4BXFA 3BR1A 4HLTA 2HOSA 2Z9OA 4AEDA 3BJ6A 2K2SA 3DBHB 3F8CA 2LSOA 4A3LJ 1AX1A 3DU6A 2GP3A 3JD72 1BK0A 3HJEA 1UOFA 5LATA 4D7SA 3ORJA 1OCTC 1W6QB 4CCNA 4A6DA 2OKXA 1I6XA 2E9QA 3IDEA 3IDAA 4GWIA 4XACA 2VC0A 1ULYA 2WWUA 5CJ9A 5KCMA 5LWBA 1UMQA 4AI2A 3IPVB 4E2SA 2VOXA 2PFWA 1WFXA 4XR6A 4BXSV 4DBQA 2DURA 4ZZ5A 1ZBA3 2PI0A 2DOFA 1DBNA 2BJSA 3OGVA 1ZK8A 4AEMA 3N97A 4FISA 2O8KA 4XJ8A 3JAMK 1MQTC 2ZSIB 1ZG1A 1RUNA 4A41A 4CO8A 1VMHA 1T98A 2IA1A 2BXZA 2WO3A 3GW2A 3OD4A 2B42B 4MGQA 3ZRGA 3AK0A 1XMXA 2OUJA 2IGNA 3BTZA 1V6NA 5FO7B 1XMKA 3WSOA 5FPXA 2K4BA 3LL7A 2IZWA 2FMDA 4UVAA 2XXZA 3F8MA 1XU1A 1PVC1 2DWRA 2PN6A 3P5JA 1ZREA 1TL8A 2LK2A 1WLTA 2VI6A 3GFJA 1HV0A 4JGYB 3OYLA 4PI2A 3AG4H 5FXXA 3HOXJ 2PHXA 1PNGA 1PO13 1UG2A 4GQ7A 2PLV1 1APLC 2XL9A 4AEKA 1WA4A 2O5RA 2XRLA 4LBJA 3FKIJ 5A7WA 2UV1A 1YO5C 1FYMA 3UNGC 3AKPA 3MLJA 1LHVA 1CVNA 3KP3A 4LJZF 1RB8G 5JR2A 3QU6A 1DDNA 1ZM1A 3NRVA 2V4JC 3RKXA 4XOPA 2P7CB 3JREA 4ZY9A 1H2NA 4DOUA 2A5WA 2BFUS 4C2MJ 1NZIA 2AREA 1CWPA 1ND2C 3AM2A 3V65A 3BI3A 4XUOA 3ENRA 1I1SA 4CEYB 1GQGA 1CAUB 1W2TA 1SDWA 3VBUC 3CZUA 3IB3A 4KWLA 1FMVA 3J80Z 5E3OA 3KV5A 4NC6A 2K9QA 2LKXA 2L54A 1FMD2 2HKOA 3LSTA 1PIV2 1Y4WA 3POYA 4LG0B 2PAEA 1VQ8I 5FLJA 2R4GA 5J6XA 5AONA 5FB2A 1H0BA 4E6KG 5BV6A 1ST8A 4JHTA 1ULFA 1EPWA 4ZYDA 1OSGA 2WWJA 1RGSA 3B9IA 4XUNA 3DV8A 1KS4A 2PLV3 3AKSA 3ZYGA 3M7GA 4KT6A 4CUBA 1D7PM 2DCTA 2C6YA 4ASKA 2FBEA 3A01A 4OCTA 3F6OA 5FYCA 2R7EB 4PJLA 3KV9A 4P08A 4HBNA 3PUQA 2HTSA 2QF7A 3C3WA 2YBPA 2H1KA 1UOBA 3WTWC 1V6MA 3KHCA 4XORA 2ENRA 3IRRA 1JOBA 3SH5A 1SMYF 2JKXA 2DA5A 5LEKA 1VQNI 5IVYA 1N1VA 2KHMA 4IUGA 3TEXA 1S7OA 2ZB9A 2JA2A 5HDNA 3MD2A 2FDJA 4IEYA 2IVJA 4MHGA 2OTLI 4XIKA 1WBFA 1POV3 5CADA 2VTFA 3JXSA 5KXCA 2FQ3A 3DBLB 3QRFF 1VBA1 2JG9C 1BMV1 3PL8A 1ZGWA 2RNJA 4R52A 2BBVA 1HB1A 4BISA 1VR3A 5FLHA 4NHKA 1J1LA 4RYDA 1IC8A 5LBCA 4KWKA 2BBYA 1C4RA 2DUQA 4XQ4A 5I8YA 2JSCA 5GLUA 2Y0SN 3CJTB 3VBOB 3POEA 2W24A 2GNBA 4CDQC 3LEIA 5KVRA 2GMPA 2LC2A 2ZXIA 5E16A 1G59A 3AYEA 1X1PA 2W94A 3ESWB 4BKXA 1FOXA 2FNAA 3KQ4B 1XS9A 1R083 1JHJA 2WBKA 2AUYA 5F2SA 1CZSA 2MW8A 3MIBA 4A69C 5CAZA 2HWD2 5FR3A 4PLOA 3WVJA 2RMU2 2BRTA 3POWA 1LULA 4AEDC 2YB7A 2VH9A 4RS8A 1W5SA 4X6AJ 5KNLA 2JG9A 5F6LB 1TMF3 2RC4A 3KZYA 3AG1H 3TQNA 1EH8A 4D7YA 3ASIA 1K5MB 2SLIA 2JIGA 3O1RA 1AR92 5HS8A 1SAXA 1F36A 2YZ4A 3CU7A 5C3PA 3FXOA 4ARXA 4KICA 1Y3TA 1TQMA 1J75A 2EFOA 3ZYRA 4BY7J 4MOAA 1I1EA 4IJAA 1FNYA 1YXWA 1B4AA 2W85A 3EXUA 2ZKLA 1VMJA 1QNTA 4FPFA 2W46A 1IXRC 1W8UA 4CDQA 3WX5A 4QDQA 1JJ6C 4Q1PA 3D4KA 5GAEJ 3I3QA 5KWRA 3LOCA 2WNUA 2BNOA 1A3KA 2HBUA 2ELKA 1VBC1 1W6OB 5ABJA 3GBGA 2WB1A 1IV6A 1YJKA 4PDWA 1JHHA 2C4XA 1UPSA 3G7DA 2JE8A 3WDVA 2FCUA 3OSGA 2W1UA 5JPMB 3O8GA 1JOJA 1I50J 3ACFA 4RGXA 2DA6A 4GJYA 3CL1A 4IHVA 3KCXA 1RUD2 1XC5A 4B29A 1LDKB 2OUMA 2MHFA 4JKMA 3BDDA 1GICA 4IGOA 1C28A 3WUDA 2OCEA 5IYYA 2YXSA 1ETYA 3T3YA 4FX4A 4M3FA 4KITB 4P9YA 1QBJA 2RS51 5D8KB 2HEWF 2MD0A 3SEZA 5C8CB 3R05A 4R4XA 3VBRA 2VZOA 1OXCA 1ZARA 2E71A 2GXBA 1GMMA 3RGBA 4KMQA 1DQ4A 3P1IA 4O9GA 1R1UA 1K3IA 3LSJA 1V54H 1SFOJ 1LODA 1LECA 3LSIA 3T1MA 3CHXA 2ZHMA 2Q30A 2HWF1 3A02A 4MHRA 5A2QZ 1VBA3 1H6XA 3ECHA 3M3CA 4XLNF 3ACHA 1NOVA 1FMD1 2A6YA 4PIZA 3I2OA 3KZ4C 2E5NA 2XJUA 3SHFA 4OLLA 5DG2A 1ORKA 4XAAA 4RGKA 5DABA 2ZGLA 3WHBA 5ACA1 5A3WA 1MGTA 2B63J 2IXHA 1Y7BA 4BU2A 1ZN2A 2DMQA 4IVNA 3LIGA 3HUGB 2CWMA 5FZ4A 4JGZB 2GQQA 3CCMI 4MEXF 5DZEA 2FOWA 1MEC1 1TG7A 4QU2A 3O5SA 2RM23 3ZR5A 4EATA 1S2KA 4MNUA 1HB3A 5IVBA 3VD7A 2X48A 3MO4A 2YU2A 5FMOS 4DXSA 4BY1J 5FPUA 4AF9A 2PN5A 3U1DA 2QKDA 5KXEA 2NVYJ 4Y1XA 4QDRA 4FQZA 3HT1A 5FPLA 2XQXA 3VHRA 1G9BA 1IUFA 3W2AA 4FPEA 1GOHA 2W5FA 1T56A 5L19A 1WHUA 1HQCA 5DCMA 4JVAA 3FDYA 1NCQB 2DF7A 2ZKNA 2W47A 4NAOA 2Y31A 2ZPXA 2VMIA 4OAYA 3WQBA 2VVEA 1W8FA 1VIWB 2WKKA 2WAQN 1OF4A 5C8CA 5FYUA 1KU9A 2Y6KA 3C7OA 4Z92B 3EHKA 5L9BA 1WUVA 1O8SA 3G3ZA 1W36C 4GAZA 2HZTA 3AL5A 5F5QA 5BUVA 5ISLA 4AQ2A 3I53A 1WW5A 3G1OA 4LBKA 3U0ZA 4A3ZA 3AKZA 2DMUA 2D6OX 3J8F3 2GC1A 4AI9A 2PLYA 5FY0A 1POV1 5E3LA 4J1XA 2Z79A 2VLAA 4A45A 2VD7A 4D7NA 4WZFA 2IBDA 3OOXA 2OC6A 4QPWA 2OBPA 2FZ1A 3FMGA 5HV4A 2K02A 3THDA 5J37A 3J26N 4ZH4F 2WUHA 2VOTA 3DP7A 3BLYA 3H3VK 2HDDA 3AMPA 2VBBA 2GBYA 1UCRA 5FZIA 2XBO3 3HUGA 3R4KA 2OPKA 5J4VA 4P9WA 1DLLA 4H7LA 2Q5TA 4TSVA 5LBBA 5EJZB 4H55A 3RDIA 1ODMA 1FIPA 3LFMA 3T09A 3HB9A 4HOOA 2O61A 1O3QA 2KFDA 1OURA 3GYHX 1HSTA 2YX7A 4HA8A 2DVAA 2B9SA 2RNGA 5D6FA 1N77A 5D8LB 3ZN6A 1U8BA 3QPHA 2LROA 4JAAA 3I8TA 3WNXA 4TV7A 4YLZA 2XB0X 1PUFA 3F95A 4U88A 3D5RC 3BOPA 2RKHA 3E5UA 4WM8B 1QGPA 2PX9A 3USUB 4EM2A 1YRZA 3M07A 3E5XA 1Z05A 5EZHA 4EE2A 2FD5A 4AW7A 1DU0A 1EJ9A 2AENA 3DEEA 4CPBD 4J19A 4NAMA 1XDSA 4IZZA 4FX0A 2FX0A 5F32A 1VBB1 3AFGA 3L2UA 2J42A 3V4GA 4DQ2A 3H9JA 3RZGA 1ZH5A 3AP9A 4H3WA 2GNTA 1LOFA 1XYNA 1KGYA 4RB1A 3VL9A 3CO2A 5AC92 2VAUA 2EA2A 2P3IA 1Z9CA 3O0WA 1NE6A 4OIPF 3PURA 3M70A 3H0OA 4Q0PA 4HNUA 1AYN3 2NYXA 3H0GJ 3EJKA 5JOWA 2ZEXA 4W1UA 3SQNA 2YC2A 3R4UA 4I01A 4Y22B 3C3VA 1GLHA 2ORZA 1G2HA 4X8NA 5EZGA 1YRNB 4ZZDA 3P5BA 2MYSA 3FLPA 3TRSB 4LR4A 2GC0A 4AI3A 4EWEA 4U0VA 1X8MA 2PG4A 3OYWB 2XRNA 3KYCB 3HSRA 2HR3A 3KZZA 5A3NA 1UY1A 2XHKA 2R7SA 1FYLA 2BERA 3AAFA 2ZXJA 3IC7A 3CD6I 3BQYA 5IYCJ 1LR5A 5A6YA 1K42A 4K1ZA 3P9CA 4NQWB 3PTYA 2VO5A 2ES3A 1US2A 1Q8QA 1W8OA 1JI8A 4IGPA 1WJEA 3T0DA 3S0MA 4OI2A 5LHIA 4RB0A 1ACIA 3PIPF 3D5SC 1ZZBA 3CUQC 4QD2A 5DAQA 3WP3A 4PJNA 2NN8A 1SZBA 3HR9A 2F5EA 4Y52J 3M1HA 3FX3A 5FJ8J 4EZHA 1T08B 2P6SA 1T8IA 1FXZA 2TRTA 3WDWA 3HN1A 3LEGA 1JGSA 3I0TA 3WTVC 3GFIA 4IEJA 1QDOA 2JDKA 3ZQLA 1VQLI 3RWKX 2P34A 1K5MC 2HH9A 2QDRA 2Y6FA 1VRH1 2EA4A 1REPC 2RDSA 4QPOA 2YUEA 2XHNA 4B44A 4LHNA 5DM6F 2CW7A 1FP1D 3VD3A 2XQRA 2VC9A 2XVLA 1I3QJ 2O8QA 1D2QA 1DHKB 2GLOA 4RHV1 3NQHA 1W9SA 3CMMA 2C5DA 2DLLA 4BDYA 3WG9A 5F1RA 2E34A 1S0GA 2XV4S 4BHCA 4ENKA 4NC7A 2SBAA 2BY3A 3FXLA 5F3IA 2OZ6A 4HBLA 2EIDA 4MGKE 3OEAA 2WRAA 4CSWA 5HXMA 1HJFA 2A6VA 3K4LA 5GPAA 4DIQA 4HSRA 4D6QA 5AIQA 1DQ6A 5LBQA 4B09A 5JVGF 2GN3A 2R5ZB 5JAXA 1XCBA 3HNYM 2L2OA 4BEHB 3RJ2X 4Y15A 1W0PA 1FV3A 1NCQA 1UXZA 5LA2A 5L73A 3WDYA 4BHBA 2KIMA 3OG2A 3U14A 3LAGA 2XONA 3BWGA 3GGLA 1QXPA 2LDUA 2IXJA 4RR3B 3BROA 3JB8A 3CJNA 4IV3B 3COAC 2RM22 5HLTA 2HQRA 4HRIA 4IRHA 4LBQB 3KQRA 4M0NA 2QCSB 3C7FA 3F8NA 1MZ5A 4CEWB 2W39A 2NYYA 1FPQA 4RQPA 1R1A1 1YHQI 2X4HA 5EG0B 3JSOA 3ZMVA 2YPDA 2YBKA 4XRMA 1TME2 3A21A 4UUSA 3V8KA 4UNOA 4M3GA 1SLAA 5IVFA 2A75A 1ZZ9A 2FQ4A 3OJBA 1UKGA 5DAWA 5FIXA 3HHGA 5C8CC 2TNFA 5F3EA 2DPUA 1HB2A 3GUDA 5DUWA 1BW5A 2KT0A 3JTHA 3RSNA 3ALQA 4UVCA 1WJAA 3LDKA 4L2NA 2F4LA 3TWIA 4CRQA 2M8EA 3JSPA 3OF1A 3OUHA 2VZTA 3VBUA 1N78A 2BU9A 1MKMA 1X9TA 2P4WA 3MF9A 2BUKA 1VBD2 1SBFA 4AHZA 1SCSA 5FYBA 4FTBA 3J7HA 2Z42A 4ES8A 4B7EA 1JHFA 5DUUA 5C3RA 3VPRA 1SAUA 4CEWA 4LIVA 1D2SA 3FBIB 2JDPA 3RI9A 4M4RA 4LKDA 4RN5A 2ID4A 2ZAHA 1BBYA 2W84A 1DQ5A 4CE8A 3WG3A 4BPZA 1LKXA 5C33A 2HWVA 3CP8A 4ZDPA 3PJQA 4RGRA 1VBC3 3BPXA 5DAPA 2XWBB 4N4NB 4OMZA 3N7LA 4BOWA 3OR1C 5FV3A 3SFIA 4E4HA 1MR5A 3L00A 4XBQA 2IA0A 4LB6B 3I54A 3FHNA 1PVC3 4O5VA 3S1RJ 2LTPA 2QQNA 1OI6A 1HN1A 3PU8A 2DDBA 3ZN6B 4EYUA 3PNTA 3PTRB 2KQRA 2JA8J 3WW4A 3WE3A 2D2WA 1JI6A 3ZQQA 6PAXA 3VV1A 3WW3A 1KYWA 5CLSA 1QJY1 5LGUA 4QLCU 1SD6A 4WX9A 2BZDA 2ARXA 3AFHA 1RUF1 3GCMA 1Q56A 5JUVA 4B3NA 3LQRA 1MQTB 1Q8OA 2CQXA 2WZEA 4JDMA 1YCIA 2DK8A 2L9NA 2B5HA 4KNCA 4P00B 2E1MC 5F1JA 4XAEA 4N4OB 2L01A 1USSA 2KJCA 3RZHA 4KMUX 4R9AA 4MTEA 3J7ZI 2HWD1 2MA3A 5E20A 2ADDA 4KIFA 1UMHA 3S2HJ 2IP2A 3I4IA 3ZXAC 1W90A 1GYKA 3HOWJ 1X8EA 1AR83 1C8NA 3K1MA 4GZ9A 2X29A 2FMYA 3N9PA 5CFDB 2AC1A 3OYDA 2Z3YA 1K78A 3PJRA 2VZSA 1D1BA 4LKEA 5TISC 4QB6A 1G3YA 2F6CA 1H9GA 3KX2A 4FCYA 1YE9A 1GNYA 5K0UC 4XKCA 1FTTA 4Q5OA 2ZEYA 1UX6A 1Z3XA 2DJNA 5FKCA 3RRDA 4IETA 3ABKH 5M0TA 3VBHC 2P8TA 5DUVA 3ZQ7A 3ZSKA 2XPJA 3PDQA 4G6TB 4F92B 4AUXA 5FUNA 5D5UB 1YI2I 1S0BA 2Y0SA 2X51A 1V3FA 1SHWB 3J4UH 2CGPA 4ZDOA 4JCKA 2XJTA 3BJOA 3S1MJ 3S5AA 1OPMA 2YFZA 4XLPF 4QQPA 4LITA 1EAH2 1BN5A 4MFDA 1H89C 1L7QA 2IXIA 1XPWA 2WT1A 1AL21 4JKLA 1ON1A 1NLQA 1OJLA 5D1IA 1J7KA 3NNLA 2XSJC 3LSEA 2XIGA 4L0ZB 5F27A 2YGMA 4RAFA 3FWEA 3B93A 4ENNA 1S0JA 2D40A 2IC1A 1WSUA 2AQFA 3TL4X 4L8QA 1KQRA 5J47A 4PBPA 1AR82 4R79A 3WGGA 1EH7A 1ZRRA 1D4M3 2FXAA 2HOTA 3MIFA 3WP6A 2VQ0A 5H9PA 3WNMA 4AG4A 2RS13 5FXZA 1MNDA 2ZMKA 3KVBA 1F4KA 1ZBA1 5A32B 4YELA 3V7SA 4AIHA 1ASJ2 2WSVA 1PDNC 4DPNA 4ANJA 3CLOA 1QOSA 1HDDC 1GQPA 3ZMSA 2PHFA 2XH6A 4RD7A 3F3XA 4P96A 3T1LA 3G6JB 1LQ1A 1RUE2 3H8XA 1AXZA 4MEYF 1Z7LA 1LEBA 3BOWA 2X8KA 4P5YA 2A69F 2WA0A 4FPKA 1MVQA 3ZGKA 3WOGA 2W2IA 4U2AA 5ED4A 2R0HA 2WDBA 5E8GA 1KDKA 2ZXHA 5TSWA 3ZXKA 2MEV3 2VKDA 2JWPA 5KHHA 5C3QA 2E31A 1SD7A 4CUAA 2OQ6A 5L3EA 3WV6A 1U78A 2W68A 4WVMA 1ZX5A 4W65A 3A23A 1HKSA 4IE0A 4HPKB 4IF4A 5JI7A 3TEWA 3NAUA 1SQ4A 2GXAA 2ADUA 3KE2A 2PHUA 3SDGA 2QQ8A 1LOCA 1GZWA 4B43A 3N7KA 3LSDA 2RMU1 2BHZA 4HX4A 4I0AA 1GUIA 5J3UA 4AFCA 3T4VA 2V9KA 3VDAA 2E2JJ 1QA6A 2QQ9A 4QM8A 1KQ9A 2FBKA 1B9NA 3C7EA 3CO6C 1UU6A 1Z67A 2DBIA 1WA6X 2ELHA 2ZNZA 4WVVA 3DPTA 1WH5A 1IN5A 3VEPA 1PMHX 4UXNA 1Z91A 2VXJA 3OYWA 4GGGA 1HQWA 3VBFA 4CDUB 3HVDA 4Y1VA 4CU9A 2B39A 3CDZB 3VODA 3BGAA 2ZMEB 1IGOA 5E18F 4AXOA 1MMAA 2QCOA 2VR4A 5J8CA 3W3CA 5GZDA 3L2RA 3LAPA 2HWF3 3ZCOA 3K1PA 3OY8B 3ZMOA 3CCYA 5K7ZA 3AFKA 3HOTA 1QO0D 2Z1DA 5I0RA 4AD9A 2V26A 4I09A 2Q8CA 1Y8RB 1R6RA 2WNVA 1PGL2 1HBXG 4JDNA 1UYZA 4Q4Y1 1WJCA 1TZLA 2YX4A 3ZQHA 2JDMA 5EJ3A 3GYDA 1W03A 4NRMA 2K9NA 4H7MA 4YZ2A 1Z1DA 4CP9B 3N4MA 1HDKA 3MZYA 1W6MB 4NRQA 3W9AA 2GMMA 2MFZA 3ETQA 4ON0A 2QSGX 3S30A 2QE3A 1KQ0A 1LE8A 1JKOC 2EZKA 5FRAA 1DQUA 1KFUL 2COMA 5FMOL 1G9DA 3VYRB 1F2NA 1SLBA 1R1TA 2B8MA 1OR7A 3ZXFA 2CH0A 2E33A 3SEEA 3AYAA 3GNEA 3VUOA 4Q26A 2AYHA 1B1BA 1MJAA 3JRIA 2PHTA 4Q29A 3EUKL 2KRFA 5M3MJ 3F8BA 2V4VA 5F7UA 1SANA 1H9WA 3LQQA 4P14A 4EZ4A 4JZRA 4L97A 4K40A 2TCTA 4FAHA 4P9UA 5LGNA 4AVCA 2VMDA 4D6SA 4M6YA 3K9TA 1OOPA 2P6CA 3UK9A 4IQ4A 4XM3A 1PUEE 1CZTA 3GMEA 4DUVA 1O4TA 3MW2A 5DAVA 1W28A 2VBPA 1AR62 4M01A 4I30A 4XCBA 5FYIA 4Q1RA 5IAXA 3RZLA 3N35A 3KFWX 2UY9A 2VY0A 3VB2A 2VNGA 3GWZA 4RS5A 3DLAA 5DG1A 4PBOA 4FSJA 3HD8B 3H1CA 4GMP3 4XQDA 1OPCA 3RQ0A 2FDKA 4MLOA 5KC6A 3I2HA 3PHMA 1G3SA 5CIRA 3INAA 1ZYRF 1J9IA 2K9ZA 4FPHA 1ZA7A 4IXAA 2MEV1 5ICFA 1YW9A 4YIIA 1GV9A 3DN7A 5FUIA 5KHKA 1YIFA 1JYXA 2D6NA 4DUWA 3NWTA 3D3AA 1GOGA 1Z0HA 1K12A 1VBC2 2FDIA 1AL23 2E6VA 5F0FA 4G9YA 3GTMJ 4YFNF 4QHZA 4XJUA 3S2DJ 2ZGMA 4BLJA 1AA7A 3K0LA 3PUIA 4AIKA 4C0BA 5FWEA 2PMZA 2Y33A 4QPYA 1XGNA 2R5YA 2EWNA 4NRPA 2VCMA 5FKKA 3Q8CA 1YYNA 4EWDA 4ARYA 4LB5A 3U07A 2W1WA 3M8EA 2DMPA 2IS2A 1NG6A 2DVDA 3JB4C 2XGCA 5EEGA 2FDFA 4A5MA 4YGCA 3OYKA 5EXOA 4GH4A 4P9IA 4YG6A 1LHUA 2WV1A 2ZABA 5LK7B 2YFUA 3K4DA 3QPLA 4A93J 4Q0QA 1S72I 4DS0A 4AIJA 4CGZA 1YLLA 1ASJ3 1LJ7A 4BQWA 1C0WA 1H1IA 1NK3P 5EQUA 2A05A 3U75A 3OYJA 3R0RA 4XFAA 4GB33 2CL2A 1MS5A 2YG0A 1AF9A 2EIBA 3PMEA 1R4NB 3TW7A 3NWKA 5FLXK 5F64A 3N7MA 5HVQC 1LGCA 4HYEA 3IDCB 3AJYA 1UX7A 3FLRA 5LW9A 1QOTA 4N9HA 4CZZA 2ZAAA 4I3PA 3DCQA 1ZVFA 2P4EA 3VBHB 4FQGA 4LLNA 1OPOA 1WMEA 3AMQA 3LCPA 3HOVJ 1H8TC 1UZ0A 2EH3A 3X2QH 2QQWA 3UKNA 4RFT0 3DCFA 5IK7A 3WZ1A 1GR3A 2XBO2 4NDLA 4DXTA 2HYGD 5FO5A 2KDOA 3X29B 1R1VA 4Q4V1 1V55H 5DDGA 4L99A 3NJYA 1MQTA 4WVZA 1B72B 1QJX3 1JYNA 2HU9A 5DUIA 5CKTA 3BIEA 1P2FA 5A33B 3JD71 5FKLA 2JJ7A 1R9TJ 2H1LA 3EBRA 4P02B 1UQXA 1GSLA 2EF6A 4RLFA 2PQQA 5J3LA 2D3RA 1D8KA 5H20A 4BMBA 1JYVA 2B7YA 3VSLA 4KWJA 5JIUA 3MKYB 4Q4Y3 3T5XA 1O3TA 1GXPA 3PSFA 1E5IA 5CFCB 2PQSA 2QUOA 4WXDA 1GNZA 3HOUJ 2YROA 5IYBJ 4OMYA 2JA6J 4DRVA 2CYYA 1N1SA 3EB7A 1BL0A 1YIOA 5FYVA 2ZGTA 1IRXA 2A6WA 4ENMA 1VLNA 1ZRIA 3AP5A 1HKQA 1JGGA 1QQP3 3KP5A 3O8HA 2NVTJ 3D5LA 5BY5A 3H9AA 4IHSA 2CYFA 4MQVA 1Z3YA 1W8HA 1CAXB 2WY7Q 1XNDA 1VMFA 4Q4W2 4YM0A 5FBJA 1AL0G 2IVMA 1NZCA 2Y60A 4DGWB 3ZIXA 1N47A 2XAQA 2VUJA 3NAPB 1MMSA 1NXMA 3MEXA 3MUY1 1RHI2 3KWVA 2XJQA 4F52A 2DMTA 1EAH1 2YHJA 4AWXB 4F3QA 2IT0A 4OI0A 2E7XA 1PIV1 2WABA 2Y0IA 1RHI3 2JDYA 2BW8A 1ETQA 1I6HJ 3KEQA 3CDLA 4C3JJ 2VULA 3QCWA 2QUFA 3BYWA 1SFYA 3B5LB 5ILSA 4OVEA 5HDKA 4UFMA 2BY0A 5EYXA 2CW0F 1DIWA 2YC0A 4HN1A 2NVUB 5FDBA 2OIIA 1J58A 5F2WA 3VHOA 1ETOA 3TO7A 1N3OA 5LD2C 5FY1A 3T08A 2EK5A 4FXGB 2ETHA 1O59A 1K6YA 1QQP2 2H27A 2JECA 3QACA 1PHMA 4OI1A 4PJYA 4M0HA 1W6NA 3WE2A 2JG9B 2NNNA 3GM8A 1COV3 4M9SA 3ABLH 2WQZC 4AVTA 4A5NA 1TT0A 4E8CA 2EXJA 4QXCA 2Z5UA 4CUCA 3C18A 1R093 3CTAA 2ZJPF 4PQ9A 4IOCF 3BTAA 1PZ8A 4NHYA 1VRBA 3MUZ1 2XROA 4XTPA 1WRJA 4XRSG 2HEOA 3GF2A 2M2EA 2VONA 4L0YB 3VZLA 3NAPA 1K61A 3DYOA 1NCRB 4QQ2A 4XTMA 1YHFA 5E1RA 4FVVA 4OWRB 3RTRA 1LOGA 2ME6A 3ZMDA 1WCMJ 3LE0A 4GIQA 4CDXB 2WR9A 3WU1B 4YW5A 2RM21 4XE9A 4C2UA 1EP0A 1OF3A 3GZNB 3KV4A 5D2AA 4XBNA 2LF8A 3EDPA 1GNHA 2A6XA 4IO9F 2FSWA 3CC7I 3VKMA 2KLOA 4AE2A 1JZ5A 2DCZA 4YGEA 5IJRA 5DV5A 1R4MB 2RHPA 2E7WA 3NKGA 4KT5C 2ZZQA 1WW7A 4EWAA 4HONA 3H3LA 2KISA 4Y20B 3OGGA 1PO11 2LKSA 1RMU2 1OOPC 2PHRA 2DT7B 4XNFA 4LBQA 4GWMA 2FBIA 1XGMA 1YJWI 2CDPA 4I3GA 2A61A 3HIFA 3RNSA 4ZZ8A 5JI9A 2VJIA 4YW4A 3OYNA 1IQDC 5JLVA 3I4MJ 1WLWA 3EQEA 4XUQA 1WKMA 3UR3C 4RHV2 3BALA 1HX6A 3N9NA 2O0OA 4Q2FA 1DF0A 3GO5A 1RUG1 1WCQA 5K5QA 1Y1WJ 5CFCC 4D0QA 1BR2A 4XIOA 2OVUA 3V7CA 2VMEA 5IPAA 2CY6A 5B2GB 1KYZA 1WPKA 3ERED 1C5IA 5GZGA 4LGWA 3C7HA 3IAPA 1TME1 2TEPA 4BA6A 4AR2A 2AGSA 4JX5A 3JRHA 2CS3A 2O0YA 1MJ9A 3KSCA 4JGZC 5KAFC 3FIWA 2LG4A 1RUD1 5DAXA 2X1EA 4IQJA 4RAGA 4LE3A 3NV2A 1KONA 4PK4A 4JYKA 5C44J 3KHBA 2JDAA 3JW4A 1XX5A 1UKRA 4HVQA 5LLQA 5EYYA 3BP8A 1W0TA 4IEXA 2UURA 1AR72 3U9GA 4EJOA 1K5MA 5GPCA 3LOBA 5F0HA 3OYMA 1HW1A 4KG0A 2XWJB 1IZ3A 5FCCA 4LOTA 5A33A 1H6YA 4UW4A 4Q0VA 1AR73 2I2SA 2Y2ZA 3T0BA 3Q5FA 1ON2A 1NAEA 4MGSA 5JVTA 1T6GC 5ICEA 2X6WA 1LEAA 1D1CA 1W8TA 3LNQA 5A3UA 3AMNA 1ZZCA 5FROA 3CEWA 4KIGA 2A3WA 3PQKA 1IXSB 1VZ0A 1XSQA 2VPVA 2VJJA 4B8EA 2EQRA 5LEJA 4BMEA 4P5HA 5HCBA 2EAKA 1MZEA 4WXCA 2R49A 1JKPC 1YJNI 3A0BC 1IPSA 4CXWA 4L5IA 2YC4A 4CDUA 3PFYA 1PP8F 1PO21 3R4DB 3M3IA 1ZBE3 4KQ7A 3J7NA 1YW8A 1S2EA 1LHNA 3PVOA 3WQ0A 4LO4B 4KDPA 4GD4A 5FQ0A 1AR81 4HG6B 1ZGJA 2CSGA 1IG3A 2HWE2 5GZEA 1DQ1A 4PZJA 1XRUA 4G3YC 1H8AC 1S4CA 3PLQA 3PM1A 3ZDSA 2OF7A 1AHDP 4NPLA 3JCUC 4EN8B 4C0HA 2BOLA 2AS5F 3L2YA 1JW6A 2WBMA 4MFEA 3M4OJ 3KEOA 1LHWA 3HL2A 1ZA4A 2PHLA 5EF6A 1HQLA 3T2PA 2IGOA 1E0EA 5JOZA 5EFUA 5FZEA 2YS9A 1OH4A 2QGUA 2A07F 4NPRA 3M7AA 1S7AA 4PDWC 4BJTA 1GQHA 3WINE 1SVLA 4QXBA 1ZQ3P 2VOKA 1POV0 5GLVA 3KM5A 1BI3A 2OJED 1S5LC 2EFPA 4YIFA 4JRAA 1TW2A 5L3GA 1PO12 1V6KA 4IEPA 4F7ZA 3G4SI 2V4AA 4OUEA 3I2GA 4HG2A 1X50A 3HGGA 5L7OB 1YFYA 5GALA 3DECA 4A3IJ 3WTSC 1DP3A 5HNFA 4AQ6A 1P9QC 2Y9YA 2D3PA 3ZQCA 1IGNA 1A5JA 4DZGA 4IEUA 4HK9A 5H6RA 2P3JA 2WFF2 4AHXA 1H4HA 1X3WB 4D5CA 4CEYC 3VZKA 4JGZA 1TQ5A 3WU2C 3DQVC 2RR13 4GKXA 1NA1A 3A0HC 2HEVF 4WM7C 3ZYHA 5FZAA 1VF9A 1RNLA 1OCPA 1HRI3 1WLCA 1IRFA 4BQ2A 4II2A 4YM1A 2IRFG 4ZXKA 2Y8KA 5FFZA 2EIMH 1FMWA 5D5VB 3H36A 4CEYA 4KL1A 2GDFA 1MIJA 2D6PA 2DYSH 1ENXA 2ZACA 1VQPI 5CZKA 1UYXA 1FJLA 2E7TA 1ND2A 2WWYA 3NAPC 2WAFA 2IXLA 4YPJA 2R0FA 1WI3A 1NTCA 1D5YA 2LP0A 3ZO0B 2VCCA 1COV1 4YVWC 5B1BH 2XVCA 3QYFA 4HX7A 3CDHA 4CH7A 3WNOA 3D6EA 3K51A 2VASA 3TNQA 3L2CA 4HNTA 3MIEA 1MEC2 2W95A 2GP5A 2J1TA 3S8PA 1BA5A 1RUH2 5HXVA 1ULDA 2QQMA 2W1QA 2GNDA 1I3HA 2RS12 3VN4A 4KISA 2HYKA 3LFIA 4AQTA 3KGZA 2JDNA 2DI3A 5HBAA 3DPRA 1QJX1 5T5JA 5E17F 2OT7A 1E3HA 5B66C 4AFBA 3MKWB 1B59A 4DXZA 4D1QA 3RPQA 4OUMA 2YDEA 2VBDA 1I3AA 4B1RA 2XJPA 5H9RA 2DFHA 3I2JA 2BE5F 3TGNA 3N9QA 3T30A 2FDGA 5JHUA 3HPNA 4MGZE 3OYFA 5HLGA 3O12A 5DD4A 3UL2A 2KA3A 1COV2 3S1QJ 1J5YA 2VQAA 2G4IA 4JX4A 1XNBA 2WFPA 4FPCA 3VD5A 2DA1A 4G9SB 2M5WA 3HPHA 1UHSA 4MO7A 5IT9Z 2R7OA 1J3PA 1JUHA 2Y0MA 1UO9A 1AYN1 2WSUA 5FPVA 3M8FA 5AVPA 3OBZA 4AC0A 5IT6A 3AL6A 1RVF2 4Q4X3 4E4DX 2R071 5EJCA 3B3QE 1T0FA 5D6EA 3RZOJ 2BHYA 1MS4A 3ZMZA 4PHZA 2NM1A 2W08A 1X2NA 3QWLA 5CVRA 3RFRA 1OUXA 2M1BA 2WFF1 1N3PA 1B8IA 4LLGF 4AGGA 2HOEA 3QAHA 2FNPA 3HNMA 4EQVA 4HOBA 3PFIA 3DLLF 4L92A 1SG3A 3SLIA 4FOYA 4XOGA 3GBFA 4A6SA 1AZDA 3VOEA 2LKPA 2HVQA 2CSOA 2Z16A 1RYYA 1FWZA 2L7ZA 4N9IA 4KN4X 3SKJE 5KAIC 5FUPA 2X1CA 3JCIA 4BQ4A 2AXTC 5I0UA 2VOWA 3JD73 4QPQA 2E53A 1GVJA 1U5TB 1Z6RA 3CDIA 4BE2A 3D0SA 3PUHA 2V5DA 5JI6A 2M87A 2XGXA 3ELKA 1HLVA 1LE8B 5K7FA 1LAJA 1AJKA 2W82A 1FAYA 2Q0AA 2W1OA 3ETPA 1R5HA 5KHDA 4HNVA 4JQTA 5C4XJ 2ZGSA 2EXHA 5FPBA 4DNYA 3A7QA 4FBFA 5F9TA 2EINH 1YJ9I 2GIVA 1IN6A 4A3JJ 2KZGA 4IV3C 1RUC1 2JWTA 2XKPA 3L9JT 5KBFA 4QQHA 5FJHA 1HQNA 2ZS6B 2Y69H 2WNVC 4AWDA 5CB7A 5EHDA 2VXRA 5FZMA 5C3EJ 1MDMA 2HWE1 4HXCA 2DCJA 4P55A 3V42A 3FF5A 4P1WA 4Y24A 2JUGA 4QPIA 3OBTA 4ET7A 1GZTA 4B3AA 5E8IA 1ZRFA 2X6XA 5FZGA 4WVWA 4N8MA 3GZEA 3RZZA 1OLMA 3DTIA 4UBHA 1VBE3 3VDDC 3ZN0A 1BBT2 1DGLA 3N9LA 2OA4A 2M34A 1BM9A 3SC7X 2R063 2BP6A 1HSJA 1R7JA 5IK5A 3OPZA 4BZ4A 3KYDB 5LZ6A 4CXXA 3CUQA 2LM3A 3AX4A 4PSXA 4E2GA 2YV8A 3THCA 3K2ZA 3G2BA 3ZYIB 2F2EA 4P9XA 2BGOA 4JTOA 4TYSA 4QX7A 3FLTA 5GAGJ 3G1MA 3TN91 4IEOA 3I3MA 3HSEA 4A3GJ 2G7UA 4Y5Z0 4KYWA 4MIMA 3DXUA 2QZ2A 3BVCA 1LOEA 1OKOA 4A42A 1BCXA 3K2OA 2ZEZA 1XNTA 1JYWA 2WLQA 3C2GA 3HQXA 3H7YA 1FOD2 2VW2A 3SMHA 5I0DA 1ZTRA 1SEFA 1ODDA 5K0UA 4IW3A 5IW0A 2ZGOA 3Q9SA 2D3SA 2P37A 4IHYA 4AAXA 1E57A 3EMRA 1FIAA 1NX9A 3OUIA 5BNNA 2E26A 4F83A 4M9ZA 2A1XA 1QJEA 2XUEA 3GVAA 1Y0NA 2EIJH 2AR6A 3HM5A 2L7FP 4CDWA 1QPIA 3SNMA 1K78B 1X7NA 1GLNA 2QBXA 3ZQIA 3MGUA 4Y7NJ 2H6BA 5JLWA 3IMMA 1NG0A 3WNPA 1EA3A 1ND2B 4HSLA 4PLMA 3BR2A 1RUG2 4TWTA 3MICA 1X58A 4JGYA 4A2UA 2HYJA 4QX3A 4KUMA 2RAEA 4WCGA 1W7PA 1UY0A 1MSEC 2R7TA 2EFNA 2JTVA 2M7BA 1IZ1A 2AZ5A 2G7HA 4AI8A 3CESA 2JD9A 3T8TA 2NMNA 2M4GA 1WWXA 1ZKGA 3AL0B 4GA9A 1S1AA 4XF1A 4I0BA 3J7YJ 5IP7J 1YUDA 1QJFA 2ZHNA 3NL1A 2LREA 4A44A 4UXAA 1W2UA 3OBAA 4A3MJ 3NJVA 5FP4A 1AXYA 4YW7A 4JX0A 2QZ3A 4R9CA 1JODA 5JFRA 2WZ8A 4CU6A 1SLIA 5I0TA 1XE0A 4NE9A 4M6XA 5JMCA 2EB7A 3CJRB 2M30A 5BNOA 4A0YA 2CV1A 2K9SA 3H9GA 4Q8LA 1RVF1 4XHBA 4XXPA 1L0OC 1LHOA 4WVMB 2UYBA 4EN0A 1V9U3 4HN0A 4BS9A 2RJKA 4X1EA 2K85A 2E2HJ 5DQ0A 3UKTA 2PMUA 4DOZA 1ZLKA 4N43C 4M6VA 3N9MA 3WHUA 3O0XA 4E7HA 1WMDA 2QVOA 3PVBB 5TJJA 1YX5A 2HVSA 1TNRA 4X6RB 1V6JA 4ZS2A 1A04A 4DRRA 4QX1A 1ENSA 4KGQA 2R30A 3B01A 2QDNA 1YNAA 2HS5A 3BN6A 3SXWA 5BNPC 4XLHA 2JVHA 3TBDA 3ZMTA 2A6TA 1Y1VJ 2FCVA 3VYTB 2MEV2 1UG0A 5LRSA 3ABTA 2HXOA 4UF0B 4XABA 2OXBA 2QNKA 4YNIA 1A8MA 5F04A 1TWFJ 4R8HA 4M3CB 4NO4A 3L09A 1S0DA 4XVHA 4L9VA 2DTRA 4CP1A 1FOWA 4GWNA 1QQP1 4XLEA 3ACGA 1J1TA 4LLLA 3ITQA 3ACLA 3CQZJ 3I97A 1FYKA 1BQPA 1WWYA 3WNLA 1DCSA 1LOAA 1ZZ6A 1A34A 2R061 4W97A 1ND3C 4OUSA 3A1YA 3V0AB 4C91A 1QH7A 2V6CA 4BEHA 3G71I 2EFQA 1MBKA 1DU3D 1R22A 3W21A 4QPIB 5IFPA 1RUE1 3A0NA 3DF8A 1OA3A 2RS31 2M7AA 2R7VA 1UL9A 2YUSA 2WLPA 3LIHA 5EJ1B 1AJOA 1CPNA 1Q5OA 1LOBA 1UU5A 4XFHA 2HTJA 1UAIA 3W2WA 1K4TA 4NROA 1LNWA 3W20A 5K5OA 4NC8A 3ZP5A 2O7OA 1U5TC 2HWD3 2MLGA 2OAZA 3O1MA 1CIWA 4XHXA 2D6MA 3B6AA 3HBKA 2Y0OA 1VALA 4B7KA 1SPPA 2VL8A 3JTGA 1BOBA 4I0WB 2JE7A 4MX3A 4S2FA 4B1LA 4HX8A 1R5GA 5JSPA 2WNOA 3CCUI 1B09A 1KZHA 1J3QA 2WINB 1ZYBA 1ENRA 4Y4YA 4U0YA 4UHTA 4E7IA 5FZKA 4XQWA 3BTCA 5DCFA 2G9GA 2KR2A 4YYOA 4FTSA 3BJAA 1X1BA 3KT4A 3TB0A 3FFQA 4CYCB 1QJU3 3J9SA 3LB9A 1YG2A 4CCDA 4HLYA 2KKOA 3I4NJ 4QXKA 2RS53 3GHNA 2BVLA 3GZUC 1XNAA 3ST7A 1O4XA 5F3CA 3U2RA 1U9OA 3DWLE 2DUOA 3PVEA 4Y3OA 2R042 2OZJA 3VDDA 3ZVXA 4LKSA 4YW1A 2UUZA 2C24A 4ZYGA 4BDVB 5FYZA 2RQQA 4N53B 1NKGA 3ROUA 3ABMH 3WT3A 3O1TA 2DOAA 3POJA 1F8VA 5H9SA 1BEV3 2GOXB 2ACJA 2RV9A 4QB1A 2ISYA 3JBG2 1QY4A 2VVDA 1GZWB 5FXWA 3C2UA 3RPUD 2JEMA 5FP7A 3HDDA 3CCLI 4OHWA 2A6EF 3GZ5A 4RLQA 3UESA 1IW7F 3FBMA 4DNCA 3SZTA 1IN7A 2I07B 4BM8A 3H5NA 1R23A 1FP2A 4NHMA 1MS1A 1ULCA 1NY72 3BTLA 4XYXA 2AH2A 4AVVA 3LOIA 1EV12 3I3LA 2FE3A 4GB32 4FOVA 1A6QA 5FXVA 5D5XB 4OULA 4DYCA 1VQ6I 4LHKA 3T0YA 4CCKA 1VE0A 2DFIA 2ZX4A 1XE8A 2BWAA 2RDNA 2IFRA 4QX0A 1SBEA 2E7QA 2QFEA 1SACA 3R60A 1DZTA 1J2XA 1LTEA 4Y1ZA 5C70A 2EIGA 4X6QB 4CPBA 5C3SA 1YWKA 1VQ9I 2WQ8A 4A7YA 3MI8A 3KLSA 4MO3M 2JDZA 3SEPA 1YS6A 2RS32 2DFCA 1CZVA 4NIGA 2GH8A 1X19A 2QQKA 5CVUA 5KHGA 2VZVA 4HSJA 4KI5M 1POQA 2HPIA 4U87A 4BNCA 3EYYA 2XLAA 4LE4A 4QM9A 3I2DA 1WGPA 1YITI 1Y8QB 4M3BA 2ZZJA 2QA4I 3LSMA 4FTEA 4ASMB 5FD6A 3MKLA 4OHYA 2VZUA 2ID3A 1MDMB 2FOKA 3VZOA 2EFWA 1YQAA 1V70A 2HWC1 5F6FA 4BIOA 5I8SA 4P5OA 2RVAA 2YMZA 1HA8A 4EJTA 3W6KB 3S3NA 1XB9A 3MBWA 4BCUA 3WCRA 2DTYA 1EV7A 1FMD3 1S3JA 1VFCA 1HRI1 1DYKA 2W9XA 1RUC3 2BGCA 4HF2A 2JG8B 5KR7A 3VBSA 3CJQB 2WAQA 1XSRA 1D1AA 4P9FA 1RIOH 1IS5A 1F31A 1XOYA 1LFUP 1IUYA 3UETA 4XLCA 3KETA 3O1PA 1JBCA 4CDWB 4BLIA 2QYOA 2JMWA 2YSRA 2HZDA 2TDXA 3DPRB 2M8GX 4FXKB 3R4SA 4O65A 1H2KA 2H09A 1AUYA 1G9CA 1JE8A 4FTHA 2D6LX 4OFGA 4E9KA 5I91A 2JN6A 3OY9A 2LTNA 2EPFA 5F5IA 4PDWB 1GT0C 4LBLA 2E1MB 3F2ZA 2Y34A 3IH2A 3OPTA 2CDOA 2VUMJ 4UF0A 2VBYA 4YGDA 5JVVA 1HOMA 4XJWA 3WDUA 1BVVA 2VQTA 3ZXLA 2A3SA 3GDBA 1UPIA 4XICA 4N43B 4EN6B 2E63A 4D94A 3GTJJ 2ZX0A 1HC8A 1Q1HA 3FM5A 1U2WA 4F93B 4QWQA 3L2VA 3RCOA 4W50A 3EO6A 3W2VA 1H30A 5J8FA 1UOGA 1XYPA 1OD5A 4G12A 3TEDA 1PGL1 4HDUA 4A3CJ 4DEQA 1SEUA 4Q48A 4XIDA 1NUKA 5A7PA 3ZXSA 5L7OA 4CDGA 2HWB2 2PLV2 1B6AA 2LRPA 4XSZF 4NOTA 4UV9A 4JGYC 5AC93 1YFXA 5IP6A 1RC6A 4NHLA 2GWRA 3S3OA 4Y13A 3NSTA 3W5MA 3FZ3A 3BR3A 2BGPA 5KHJA 3KCCA 3OL4A 3OGJA 4XDPA 2ZCWA 2XVGA 4NR1A 1U5YA 4EM0B 1GP5A 4IHXA 3ASOH 2DTWA 4HQMA 5GLWA 3RI8A 1DP7P 3HKZN 3CC4I 3UGFA 3VBFC 3B7MA 4TZDA 1LEMA 3AXDA 5FZ6A 3W58A 5IVCA 1ENHA 1O4ZA 2JVGA 2VT3A 2CWEA 3ZDVA 3L9FA 2V7FA 4SBVA 5FPAA 1R5ID 3K1NA 3P9KA 4E7ZA 4ZU5A 5JXJA 2VUDA 4CCEA 3H1YA 1G3TA 3K4NA 4EMSA 2R92J 2FDHA 1R49A 3ZKYA 4BQQA 1HRV2 4K6BA 5ANNA 5DDJ1 3V56A 3S16J 4Q47A 3A4CA 2AACA 4D0PA 4FT8A 3DYPA 3NNJA 2RJLA 4OQ9A 1MH4A 1XGSA 4O6JA 3SH3A 3O6BB 4OI4A 3RZJA 1JOPA 3POSA 4Z6YA 1H4GA 1PMJX 1P7JA 2W4SA 3DKYA 1O57A 2L7MP 1JH5A 5FP3A 2RS11 3IAS2 4MADA 2HWC3 3VDDB 1MS8A 4UWDA 1ZRDA 2Y9ZA 1ND3B 5A32A 2MNGA 1A31A 3WQ1A 1AHSA 1O7LA 4RMNA 3OOUA 1UAAA 4NB5A 4HKWA 4XDOA 1Z21A 2QLZA 2R041 4LK0F 5JCTA 1WLDA 3IBMA 2RMU3 1UYPA 1OLTA 2P5VA 3OD0A 4IOAF 2Q1MA 1FYUA 2LH9A 3K48A 3G1LA 3KF5A 5BXXA 4COYA 1S8NA 1AR71 1LVAA 1OYWA 1W6MA 2J1SA 1MH3A 1YQ2A 1ERDA 4E4ZA 3K70C 3DTKA 5FLXZ 3AC0A 5C9AB 2HNHA 4QX2A 3RYKA 1W3VA 3IRQA 1KXGA 3MZ8A 3ECQA 1U0AA 2A6HF 3ZYPA 2JG8C 4YEJA 2XJVA 1NLRA 5BNPA 4S2GA 2EAAA 1L7RA 2WS93 3HOBA 3D82A 1GWMA 3FMQA 3TP3A 3BB6A 1ENQA 2J22A 4LMYA 1BEV2 4BQNA 1Z78A 3ZMUA 2LY9A 3LEMA 2RDQA 2J1UA 1QOOA 3MHZA 2JE9A 4FP2A 5KHIA 3WGHA 2Q8KA 4UW5A 3HTSB 3DF0A 3OOPA 5L36A 4ATFA 4JHZA 1SLCA 2KIQA 4Z2AA 1PYVA 1SFUA 5CEHA 1UW8A 2I8DA 2MABA 2QWWA 3GHMA 2DU9A 1YC61 2B45X 4ZYEA 1VBD3 4DZJA 1YW7A 4RB3C 2UZKA 3ZFGB 1MZ6A 2MG4A 3RG0A 2R062 3L2QA 1UU4A 1D4M1 1YI7A 4RGGA 4Q8KA 2JB8A 2ZFWA