3ZN5A

Vp16, a capsid protein of bacteriophage p23-77 (vp16-virus-derived)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
169
structure length
169
Chain Sequence
QEAFNRIKALRPGARPATILRSGPEFSVYSGTQRVKVGEFVVPAGASWVLPNPVPVILKLYDTGGNQLPHTTDVFLAKRTKGFDFPEFLAKVQYASYYDLTEAQLRDAKFYQNILQTLSPLRAPQPPQGVVLREGDVLEVYVEAPAGVTVNLNDPRTRIELPIGVDNSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords VP16
publication title Bacteriophage P23-77 Capsid Protein Structures Reveal the Archetype of an Ancient Branch from a Major Virus Lineage.
pubmed doi rcsb
source organism Thermus phage p23-77
total genus 32
structure length 169
sequence length 169
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zn5A00
3ZN6B 3ZN5A 3ZN4A 3ZMOA
chains in the Genus database with same CATH superfamily
1HJGA 4XFBA 1S2EA 4FPGA 1OH3A 1AX1A 2QQLA 4GMP3 4JAAA 4JGZB 4O61A 4WVMA 4Y1XA 2MEV2 4ZU7A 4XMIA 1S2BA 4S2DA 1SDWA 5FYBA 1ZM1A 4XQ4A 3ZFGA 3S5AA 1TE1B 3PIJA 2D6MA 4AG4A 4CEYA 3UNPA 1ASJ1 2WO3A 4CEYC 1LOAA 1Z0HA 4FTBA 2WWJA 4M0NA 3HBZA 1S0BA 4FFIA 4WZCA 4O9EA 5A7SA 4DINB 1UN1A 1HN1A 1V6JA 2B4KA 4Y22B 1NA1B 2XUEA 2BV4A 1HIXA 3ZYGA 4BA6A 1VR3A 3MIBA 2IXCA 2DUQA 1ASJ3 2O8OA 4W8JA 5F6KA 2BPA2 2W9XA 1KDMA 3KT4A 2DYCA 1XC6A 2UYAA 4Q27A 1HXS1 5FCCA 3J9SA 3SXWA 2B7YA 1EUUA 2YV8A 4XBQA 1TG7A 5ANQA 1OI6A 3MV01 1PX4A 5F5IA 5FY7A 3P1IA 2YBKA 3K75B 5FPBA 3OEBA 1CESA 3KZ4C 5C8CA 3IT8A 1OSGA 5C8CC 4BXFA 4AQ6A 1Q8VA 1HXS3 2IXIA 4Z82A 4I01A 4M3CF 1MEC1 1DQ2A 1VRBA 1IPKA 2VNGA 4PJYA 3T0BA 5C4WB 3OSDA 5JAXA 1SBDA 2VMHA 3ETPA 5LBEA 2GDFA 1UXXX 4AVSA 3BODA 2WAAA 2NZ9A 2WJSA 2WQ8A 2X29A 3LOIA 5JPMB 4F7ZA 1AVBA 1H1MA 1ZBE1 2VTXJ 3ACIA 1PZ9A 1C8M2 5GM0A 1W6PA 5J98B 4ES8A 4BQ3A 4YW1A 1MEC3 4A42A 2JB4A 1UO9A 4Y5SA 2DVFA 4BQ5A 4WZFA 4FFGA 1CAWB 1VBC2 5D2AA 2KM2A 3PLQA 4YG0A 3KM5A 5EJ1B 1ND2B 2Q1MA 3AP6A 5FPLA 1NCRB 3ZO0B 4HSLA 5KBFA 4UYBA 3VBFA 3PUAA 1ZBE3 1DBNA 3VBFC 4LO6B 2BWAA 3C7HA 4QDSA 4LTAA 5HCFA 3E5XA 3QACA 4DEVA 2UWBA 1MVEA 1XYOA 3H9AA 3LD8A 3EMRA 1NCQB 3GCXA 1YUDA 2GN3A 2JDMA 4IV3A 4XDQA 4NIGA 1O4YA 1S0CA 2VG9A 1W8ZA 4IV3C 1RUC3 1W99A 3MDPA 5FP7A 1SMVA 4G4FA 4Q29A 2R49A 2D5HA 5JMOA 1FATA 2X10A 5FP4A 3AX4A 2CYFA 4K3UA 2V5YA 4GALA 1SDDB 4P9XA 4XF9A 2XVGA 3B3QE 5IK4A 2C0ZA 4IGQA 5JZGA 2E9QA 3LAGA 1X82A 5IVYA 3ZOIA 4LOSA 5JZGC 1G9FA 3TRSB 4FFFA 4C0BA 3RG0A 4QPIB 1LHOA 3JQWA 3VD5A 1VBD1 3D6EA 5DMYA 3IDEA 4RGGA 2YPJA 4RQPB 5FUPA 5LA9A 4FPLA 2CGOA 4Y5TA 4AAPA 3LA7A 5DAQA 3ZXLA 3JBG2 4BMEA 4Y1ZA 1DQ4A 1G9DA 4RFT0 1W2NA 5JXHA 1LEDA 5FYTA 3LSDA 2UY9A 2ADDA 1WCKA 3U75A 1VBD3 5AFBA 4QGLA 4CA9A 4DEQA 1PMJX 4WM7B 3W5NA 5LRSA 3H8XA 3O14A 3WHTA 4DRVA 2E31A 4NWVA 1DYOA 1SHWB 4IESA 1LHWA 3VDCA 3VHRA 3ES1A 3HT1A 2OPKA 1EUTA 3CJIB 5BNPB 5BNNA 4BDVB 1O3TA 2ZTNA 4CDXA 3AB0A 1K12A 3B9IA 5BNNC 4MZUA 4CDXC 2P3JA 1H1AA 2WYSA 4BQWA 4MV2A 4QX0A 3BTYA 1X36A 2ENRA 1SBFA 3WUDA 4AVCA 4CCLA 1R1A2 3VDDB 4GA9A 4LO7A 4OHVA 5C9AA 2VZ3A 2UY8A 5J36A 3DKQA 3KHCA 1ZX5A 3NV1A 3S57A 4OMDA 2PHXA 2QQUA 3OBAA 2ZABA 3RNSA 3RMYA 2HEVF 1WLTA 1CR7A 3CEWA 4KBZA 4A6SA 2ZZJA 4GKYA 2BGCA 1N3OA 3TEYA 4OUMA 5F1RA 3KQ4B 3UL2A 3F2ZA 4URAA 5IK5A 2R072 4P00B 5FYVA 3K4ZA 2GU9A 4FPYA 1RB8G 4HLTA 4M4PA 3CF6E 3N9PA 4XYXA 5FZEA 4CDQB 2OX0A 4COWA 4E4HA 4KQ7A 4CU8A 4YZ4A 3T09A 1Q8SA 2RDSA 1C57A 4GWMA 2DCZA 3VLBB 2QQNA 1O8SA 4YZ1A 3HNBM 4D3WA 1JS9A 1LB2A 3OBRA 2CL2A 2W87A 3AZWA 1W04A 2VUDA 4JTNA 4CTEA 2ZAHA 5IVBA 1AR82 1GNHA 2GH2A 1VBE1 2PHRA 4RHV1 5HBAA 4WVZA 3WG2A 4Q4W1 2PLV1 3VBSB 2Q8DA 5KHHA 4R9CA 3VBRB 4N8MA 2ARCA 5FY0A 3S0MA 4JHTA 2XKPA 5HCAA 1DYPA 4BOWA 4ZS2A 4YARA 3K3OA 5BPXA 3AYAA 4QU2A 1HB3A 3CU7A 4R9BA 3VKMA 1VBE3 1CZVA 1YIFA 4LA2A 4RHV3 1R1ZA 4QXKA 5ANNA 4B7EA 5ACA1 5FOBB 3IPVA 4B4PA 3SH5A 1J84A 3O1UA 1E5IA 4Q4W3 2PLV3 3RMXA 3OJBA 2D98A 2BBVA 2DUPA 3OYWB 2Q5TA 2WNVA 2IXJA 1HB1A 4LBNA 1AXYA 1RVF1 5CKMA 4CCDA 3ZIXA 2QNKA 5A6QA 3W21A 5ACA3 2WS91 1IKQA 3KS7A 1GZCA 4L11A 2R041 2DV9A 5FMOL 4P9GA 3ZYRA 3WQ7A 5C33A 1UZVA 2ET1A 3LEIA 4LE4A 2W39A 1W9FA 5F2SA 3I2IA 3VKOA 3WOGA 3HJRA 1MS5A 5EZWA 4DB5A 1RVF3 4PDWB 2JDAA 3PURA 2BQPA 4LPLA 1RMU1 2WS93 4IV1A 1QKQA 1JBCA 3PUSA 1QQP1 4XFCA 5C3QA 4IV1C 4OCTA 2R043 5LATA 5FBZA 4H3WA 3RYPA 3AM2A 3ZM8A 4AAXA 4BU2A 1SLBA 2BUKA 2QE3A 3U37A 3ZN5A 3PVNA 1KJLA 4Y1UA 1RMU3 3O1SA 2RDRA 1QQP3 5AC91 3O0XA 2WO1A 3NWKA 3RFRA 2WFF2 3ECQA 5C70A 1W03A 1PX3A 3J7LA 2PTMA 3PL0A 4FQ4A 2D3RA 1HQWA 3WVJA 4JKLA 1YQCA 5IK8A 1COV2 4JZRA 4ONUA 4BB3A 1ND2C 5A7QA 2GAUA 2ZJCA 3LEMA 2BGPA 1VMFA 2O14A 1NCRC 2Q30A 3ORJA 4X6RB 1LHUA 2Z4FA 4OVEA 2Q8OA 1EV11 1H6XA 5L73A 3ZN6B 4AFAA 1CN1A 4E4SA 5J1XA 2UURA 3VD9A 3O5SA 5AC93 3O1OA 4IEZA 1JYCA 4XUNA 1NE6A 5CA6A 1W8WA 4TZDA 1JUIA 3VBOA 3I97A 2E53A 2QQJA 4COYA 3VBOC 3WDWA 4Q8KA 1NCQC 2D97A 4MGIE 1UX6A 1PO21 1RUJ2 2Q1FA 4RS5B 1EV13 1G8WA 1L7QA 5LBCA 4A6OA 2A6VA 1F35A 1DYKA 1F4AA 3T2PA 2HWD1 3M70A 5GZEA 4J1WA 2VL4A 1A8MA 4I0BA 4FO9A 3NJYA 4LEJA 4QPGB 2VPVA 1ST8A 1PO23 3LA2A 2W2IA 1WMEA 3O0WA 1UY2A 1URXA 3RZGA 3BN6A 1ZRFA 4JX0A 2WC2A 3WP6A 1MZEA 2QKDA 1CX4A 1DP0A 2D6LX 1C3HA 1WLCA 5FZ7A 3ZXAC 4HVQA 2HWD3 1E5SA 4RQPA 1UQXA 3VDBA 4RQPC 5FLIA 3K46A 1LOGA 3CNAA 1WUVA 4XHBA 5IVVA 4CDUB 5AVPA 4YW2A 2ZEWA 1GOGA 2WQ4A 1XE0A 4OHXA 4D69A 1CX1A 2QZ2A 4Q4V2 4I0AA 3ZYHA 4ZONA 5HCHA 1DU3D 4YZ3A 4WM7A 4XE9A 4OI0A 4GQ7A 5FP3A 3UKNA 3NKGA 4UF0A 4WM7C 1BK0A 1IQDC 3FC0A 3CJIA 1T2XA 2ZGRA 3UYJA 1OA4A 1DGWA 5FZ8A 3CJIC 2QQKA 5IJRA 5FYSA 1POV1 4QT6A 3CJXA 1XNAA 4R52A 3TWIA 2A70A 2PAEA 4AEJA 5FZAA 1OF4A 2EALA 4D6SA 1DGRN 1S4CA 4QPYA 1UZYA 1LJ7A 3VDDC 5JCTA 4XTMA 4LKDA 1SPPB 3R0RA 3B69A 2VJXA 1GWMA 3NAPB 2F17A 4CU9A 1POV3 1PIV3 3WNNA 3DPRB 1RUI1 2PHDA 3TYJA 2R1DA 2RG4A 5L9RA 2FDHA 1W3VA 1KFXL 1W6NB 1BMV1 1H8TA 4XOGA 2HWF2 2VCMA 3OD4A 5T55A 1H8TC 4CP9A 3D82A 2H0VA 3Q8CA 5EQUA 1F8VA 4PIYA 5L36A 2DVDA 1VB4A 2H0BA 4E2SA 2R7EB 3JXSA 3ZXJA 2K46A 1GQPA 3ZKYA 5CU1A 2P3KA 2WNUA 1RUI3 2VR4A 1H2MA 5F3EA 4CRQA 5JXJA 2JD9A 3VKNA 1IZ3A 1QH7A 1XBFA 4LKEA 4QXCA 3UJQA 2QQVA 4C8DA 1PGL1 4LBKA 1PMIA 3OGGA 4WM8B 3PVOA 5FZFA 3WNMA 2F6BA 1H6YA 5FYZA 5T3NA 5CFCB 5F6LB 4ZS3A 3VBSA 3FHIB 4XIOA 1KXGA 2PA7A 2WWSA 3L2YA 4QX2A 3VBSC 1GNYA 3MLKA 2JICA 4JTOA 2CWSA 4CVUA 2EXKA 1F31A 4XAAA 1OD3A 4A44A 2ID4A 3BVCA 2WLQA 2D6KA 3WT3A 1MZ5A 2V09A 3WG1A 4GWJA 5CFDB 1VRH2 4LIVA 4R9DA 1KS5A 2WR9A 3WY6A 1W28A 4AGVA 1U12A 3HIFA 2JWPA 1Q3EA 3OYWA 1HJFA 1R082 1LGNA 3B7MA 4Q2FA 4P08A 2BVBA 2OQ6A 4M0HA 5E6HA 3SCFA 5JOZA 1O6UA 4YW7A 2BRTA 1J3RA 1PK6B 1QH6A 5CNAA 3POWA 1WMXA 5FJHA 5GZDA 3TB0A 3WCSA 2YC0A 4MXWB 5AVAA 5IK7A 2IXHA 2BVVA 2RS11 1UX7A 4MGTA 3GJBA 1OKOA 1CIYA 3A4UA 1Z7S2 4LHKA 4XUTA 1O3RA 1KS4A 3C7OA 3RYKA 3L9JT 2AREA 4YM0A 1QMJA 4IEVA 2J22A 4L97A 4PDWA 1US3A 1ONAA 1AHSA 1WBLA 1QJZA 3ME2A 4FOWA 2Y6FA 4IEOA 4PDWC 3K48A 3S7IA 3PUHA 3ST7A 3WW4A 3J26N 4LKSA 4R4ZA 2RS13 1JOBA 5D21A 3WP5A 2VOXA 3T08A 4UWDA 5FWEA 3HR9A 4P02B 1FMD3 5JIAA 3ZXKA 1JI6A 1AR61 1YYNA 2RDQA 1JODA 1W9TA 4QX1A 1ZZCA 4QQLA 3LFIA 2ORZA 4N7UA 1OLME 2W46A 4QM9A 4TN7A 1ULOA 1LCLA 3LPFA 1UXZA 1RUE2 5I0SA 2W1QA 3MW4A 3P6BA 1ZBA1 4FBFA 3H50A 1O3SA 4XXAA 1W2UA 3LPGA 3KVAA 1AR63 1UL9A 1OVSA 1YQ8A 2FCUA 3WNPA 3WF4A 3M4FA 1SBEA 3LDBA 4XJWA 4LQRA 2IXKA 1H9WA 4N43A 4P9WA 1UU6A 4LBOA 5G04L 1TME1 2QFEA 2ZOEB 3AP9A 2DTYA 4N43C 4V1PA 5FZOB 4YYOA 3ZFEA 1AR72 1OA2A 3SH4A 4O9GA 1GANA 1RUF1 1QGLA 1ZBA3 2IVIB 5FPAA 3UGGA 4K1YA 5FLJA 3ZFEC 1ZZ6A 2JG8A 2VUCA 3DYPA 1OH4A 5I8SA 4AQSA 2F4LA 2JG8C 5FZGA 1REDA 2ZKNA 4E4ZA 1V9U3 1QF3A 4LBJA 2OIIA 2ZHMA 1TME3 1W0PA 2CGNA 2VZRA 1J1LA 1W90A 3MV11 3BOWA 5BNQA 2YPDA 5IYYA 1RUF3 3T4HB 4MADA 2ARBA 3OPWA 2QUOA 3AZYA 4QPGC 1IPJA 2BOJA 2BZDA 2VMIA 1SLAA 5EJ3A 2Y60A 1GP4A 2QJVA 2QTWB 4NPRA 4HXCA 1XOYA 3VL8A 4NRMA 4JGYA 2SLIA 4XABA 1F5JA 4PLMA 1VP6A 2XJVA 3RI9A 3MFAA 5FPZA 1QNYA 2UWCA 2VD7A 4FVVA 3HPNA 3ILNA 4LO4B 1YNAA 4MYEA 5LW9A 3O12A 1PM4A 1FPN2 4EZ4A 5FKCA 4BIFA 3M3CA 5IWFA 3WNXA 3GXUA 3N7MA 4AW7A 4QGMA 3ZPYA 4HK9A 2UWAA 1B35A 1ASJ2 1LTEA 1M4WA 2W1WA 3FFQA 1JYNA 1B35C 4HN0A 5FMOS 4ISRA 5DN2A 5IW0A 2VTFA 1QJY2 2A7AA 4MVTA 5FP9A 2X5IA 3ZYFA 1DZRA 1ENRA 4P9LA 3FLPA 1GZTA 2VQTA 3C8XA 2DF7A 3O7OA 2Z5WA 3PHMA 4HVRA 1MZ6A 1NE4A 2ZX2A 1K5MB 3RZKA 1CQ9A 5F3CA 5CADA 4YVWA 2CSGA 4YVWC 2GC1A 2BP6A 4CZSA 4ASLA 4E8DA 3NAPC 4D94A 1IQAA 1X50A 1I5PA 1YEWA 2ATFA 2ZPXA 1C8NA 2F4PA 3BTAA 2MNGA 3MUY1 1XPWA 3TBDA 4GWIA 1AJKA 5T5OA 3OPTA 4BHPA 1XU2A 3N7KA 1VAKA 1YHFA 2EVXA 1AZDA 2V72A 1LOEA 1DGLA 3GCWA 3MW3A 4NPMA 4PLNA 4U2AA 4BK5A 3VDAA 2YMZA 1MEC2 1UU5A 1W0NA 5F8PA 2B8MA 4AEDA 5I0DA 4QX8A 1UPSA 3M2MA 4XUOA 3KGZA 1QWRA 2PYTA 2YB7A 3LDKA 4FPKA 3K4DA 5M0TA 1DIWA 4H55A 1H30A 3ON7A 4K20A 4DFSA 3LOBA 3N7LA 4RR3A 4AEMA 1BXHA 4AQ2A 2VOWA 1FV3A 4FP2A 1ULPA 4RR3C 4OHZA 1ZRCA 2BW8A 3I3DA 3POEA 5H9QA 3DEMA 1TVGA 3RQ0A 5J48A 1Y9MA 5JXIA 5LZ6A 4TSVA 2G9GA 3H3UA 4IW3A 2ET7A 5F7UA 4F3JA 2MHFA 2XLAA 3NW4A 1RUC2 4ASKA 1CPMA 1IGOA 4C90A 5LBFA 4V2WA 3GNEA 2WYFA 3DXUA 4XMAA 1NXD1 3OGJA 5CZKA 1W3XA 5FQ0B 2GNBA 2HJIA 3RVHA 1F9KA 1WW6A 3DECA 5ISLA 2XR4A 2ARXA 4IEPA 5GZGA 3M3IA 4L2NA 1TNFA 5L7OB 1V6KA 2B39A 3VZJA 1PK6A 3I2DA 2RMU3 1PK6C 4XCAA 3E6CC 2DCKA 4GIQA 1YCIA 4FQZA 4YM2A 4IEWA 5TSWA 5IVJA 4AI2A 3ZN4A 1U5YA 2WIIB 2Z42A 5FMBA 1LNSA 3K3NA 4JDOA 4FP3A 5DG1A 3GJAA 4OI1A 5CBLA 4FAHA 4I3GA 2GN7A 4A2UA 2BBAA 1BBT1 3CZJA 1VBD2 3I3QA 4YG6A 2PMWB 4H2AA 2GMMA 4M3CE 2CWMA 5A7WA 1FX5A 3WHUA 4BJ0A 5KHJA 3AC0A 1RUH3 1C4RA 1C28A 2YU1A 4NRPA 4K9SA 2WO2A 4HKWA 3LF7A 1BBT3 1UNBA 2HWB1 5FK7A 1HQLA 3P3PA 1GMMA 3ZSLA 4M3CB 1XSQA 3K51A 5L19A 5FUIA 2N7GA 3AXDA 2Y6KA 5DZGA 5FDBA 2R061 2VAUA 5FR3A 4OYUA 1RUG2 1OLMA 2OZJA 3MLJA 4ITCA 2HWB3 1CAVB 2TEPA 1ULCA 1W8TA 4ORFA 4QPWA 2YXSA 4OUEA 3HNYM 2R063 1GWKA 1VLNA 5B4XA 2WN2A 3CIHA 3AL5A 3MPPG 3BYWA 1N3PA 2RS52 1CAUA 4X6QB 2WFPA 5I91A 2DUOA 1AX0A 3R4DB 2R0FA 3ZFFA 3ZFFC 4NIAA 5A7OA 3IN9A 4GWNA 3VHPA 1LGBA 5HV4A 1DQ0A 3MZHA 4MO3M 2FDJA 1OQDA 4Q0PA 1C5IA 3BKZA 3FHQA 2HWE1 4UXAA 1XRUA 1D0HA 3HWJA 3OY8A 4Z2AA 4QKBA 1MVQA 4IE5A 3ZR5A 1OF3A 3MEPA 3GGLA 1RIRA 5FO9B 1GNZA 4YW3A 2VCCA 4IEQA 5E16A 3WF0A 4BQYA 2XJPA 5DDJ1 3VKLA 2OUJA 3ETQA 2IXLA 3MF9A 5JXGA 1V6NA 1ACCA 3MIFA 2W5FA 2JDPA 3AZZA 2HWE3 4Q4W2 2Y6LA 3EXUA 2Y0IA 5B2GB 5HV0A 3V0AB 4BCUA 2AENA 1BJQA 1HV1A 2A6XA 4QKFA 5DAVA 2O1QA 4Y26A 1JZ3A 3BIWE 4B7KA 5DDJ3 1V6MA 2LS6A 5LY1A 4UFMA 4GB31 3HQUA 1W6OB 2VCBA 4HPKA 4E2QA 1VIWB 3J4UH 2KXLA 1TNRA 2DWRA 2C4XA 4D7SA 2P17A 1AXKA 2VZUA 3H1MA 1HN0A 4XFHA 2W08A 4QB6A 4YFZA 1EY2A 2DU0A 4XZUG 1NY71 2GMPA 4IETA 1FAYA 2QQIA 1UYZA 3W9AA 4NHXA 1O5LA 4GB33 2W52A 2PQSA 4XCBA 1LU1A 4HFSA 2J7MA 4WVWA 2WS92 1PO11 2R32A 2K2SA 3C7FA 3IDBB 3OCPA 5T54A 1LULA 5B4NA 2XBO2 4NJ4A 3Q8BA 1I9RA 4YVSB 5K7PA 3PDQA 3JCIA 3M1HA 4NIHA 1HKDA 1W0OA 2OVUA 3QBQA 3LWCA 5IVEA 1NQJA 5FZ1A 1CZTA 1PO13 1Y4WA 4Q4X2 1QQP2 5SV5A 2VUAA 3H0OA 1LGCA 3GALA 1HRV1 3TN91 4N90A 3S30A 4CCCA 2YFZA 1VAMA 2Q0AA 3TEXA 2ETEA 1LESA 4AF9A 3KHBA 3WINE 1NAEA 2IC1A 3VZMA 3NNGA 4CUAA 2P34A 4COVA 4LBQD 4ZHNA 2ZMKA 5FPVA 5K0UB 1WCDJ 4NO4A 3ZSKA 4C1XA 5K9YA 1YQ2A 1HRV3 1YFXA 3TN93 1PVC2 4Q4Y1 3IIIA 5EP9A 3KCXA 4OQ8A 3UKVA 4BQ4A 5BYNA 4XURA 1BQPA 4UW3A 1WD3A 5FV3A 1NLQA 2RJKA 2ZHKA 3NV4A 4I2OA 5GJ6A 2XB6C 3THCA 4OQ9A 1GLHA 1W6MB 2P1BA 1AYN1 5I8TA 3ZXGA 1ZA7A 4Q4Y3 2BOIA 2PQQA 4L0PA 3WLUA 1RC6A 4KWUA 4QDQA 4LR4A 5FY1A 2E63A 3W59A 1PO22 2JE8A 3USUA 1XNTA 5DZFA 4OI4A 1HB4A 3NNFA 2E33A 5DZEA 1H1IA 1YQ5A 1NOVA 3WF3A 1AYN3 2JDKA 4CCJA 1DCSA 2VOTA 4K7JA 3H42B 1JYTA 1QIQA 2L9LA 1B09A 3TNPB 3WUCA 3VHOA 2CHHA 3N3HA 1NX9A 2JDZA 4K8FA 3EQEA 1G9AA 1KGYA 1MR5A 1NLSA 4W6WA 1J59A 1ZRDA 2PHTA 1RGSA 5T5LA 1GR3A 4R8HA 4LITA 1FI2A 4QKNA 2DVBA 3K77A 5J7MA 3RRDA 1BEV2 1AYM1 1F4HA 3CBNA 3FFZA 3HQRA 2QCSB 3DYOA 2DBNA 4UFJA 2BJSA 4JRAA 3DUIA 1GYKA 5DUUA 3ENRA 4OI2A 3OB8A 1LECA 3PU8A 1Q43A 4P9JA 2WZPP 5IAXA 2XXZA 3MGUA 4M3CA 3AKRA 2VVDA 3DCQA 1AYM3 2ILMA 3POIA 4B4QA 3JD72 2MEV1 5H9SA 2ZHNA 4AHYA 2QQMA 4LLOA 4B3NA 1T6GC 5A33A 1F15A 3WG4A 1PIV2 1E5HA 4Q0VA 1W8NA 4LBQB 3NL1A 4YW5A 2XWBB 5IATA 3E6DA 3H3LA 3T1LA 2FQPA 5FK8A 1QJX2 4JGZA 1H8VA 4JVAA 2HBUA 4UW5A 4LBMA 5F39A 2XDVA 2MEV3 1UY3A 3A0KA 1EPZA 1OMIA 4I0WB 4JGZC 4XDPA 3UV9A 4DUWA 2B42B 2LROA 3DGTA 1W2AX 3WQ0A 2EAKA 1O4ZA 1UF2C 1QU0A 3ACLA 3GHMA 3U78A 4CU6A 1UY4A 1RUI2 4A45A 3IAPA 4AI9A 4LORA 1BMV2 1PNFA 2XVLA 3PMSA 2VQAA 1DF0A 4XF4A 1JH5A 1NA1A 1S0GA 3N9QA 4Y22A 3ZXDA 4QGNA 1NA1C 5FY9A 4UW6A 3SEEA 4FPEA 3AYDA 2NYYA 3T2TA 1LHVA 3I4IA 4X8NA 1QJFA 2JDHA 3KD4A 4HT1T 1QY4A 4AVBA 2FDIA 3QOPA 3FLTA 4OFGA 4R4XA 4ET7A 4Z92B 4YLZA 3BGAA 1UY0A 4AGGA 4QAWA 4WVVA 1ND3B 4XQWA 2J1SA 4H7MA 4Y1VA 3SHRA 1W8UA 2ZCWA 1CVNA 1GZWB 3V0AA 1OOPB 3OBZA 4JDMA 4GULA 3SQOA 1RYYA 3ZYBA 1Q5OA 4Z07A 1UPIA 1WWYA 5JVVA 5BXXA 4XXPA 4A41A 2J1UA 3LEGA 5C4WA 2ZBJA 2JIJA 3KT7A 3PNAA 4ZU4A 5C4WC 1RUD2 3VV1A 3CO2A 1VBC1 1UY1A 3U1XA 4EQVA 4EV0A 4MGYE 2WQZC 2C1FA 1VJ2A 2JXAA 4IEUA 3ELNA 4QQPA 1JZ8A 3JUUA 4N53B 2I07B 2HEWF 1YQ6A 1JHJA 2VZQA 2A1XA 5G05L 2ZACA 4COZA 5C6CA 1A3KA 3MBWA 5F5QA 2ZGQA 4KMQA 5C5TA 4YFWA 2ZXQA 1CAWA 3E5QA 1VBC3 4L99A 1C5HA 1ND2A 4NWWA 5DG2A 1NCRA 1PZ8A 2RHPA 2DFBA 2Y64A 2RS12 4EYUA 2W1UA 3VBHB 2X09A 4YGCA 3U4XA 4KBBA 2D5FA 2D3SA 3W5MA 4YVSC 4PQQA 1FMD2 5FTTC 3IAQA 3AKTA 5FYYA 3A21A 1NCQA 3TNQA 3GM8A 1STMA 3PIGA 3SNMA 3LDRA 1V70A 3FBMA 2DVGA 3IMNA 4TLGA 4EN8B 2WNOA 3FBYA 1JN2P 3UJOA 2ZGMA 1AR91 2XLGA 3THTA 5KXEA 1JZ2A 4J6GA 4EWDA 1UOJA 1N1TA 2C6SA 3MF6A 5FYHA 4A7ZA 5IVFA 1AR62 3LZZA 4JRLA 3HQXA 5K0UA 4QHOA 2VW2A 4KL1A 4AI8A 5K0UC 4FSJA 3LCPA 5FZCA 1MS1A 2UYBA 3R6SA 2OUHA 2EXJA 4MOAA 4AI3A 4QPIA 1AR93 1WA6X 2XL9A 2YDEA 3QH7A 4IE6A 4QPIC 3KLSA 2R30A 1OT5A 1POQA 1GOHA 2DCYA 3WF2A 2ZGUA 4LA3A 3ES4A 5FMCA 4PIZA 4NHKA 4XUQA 4M00A 4BM8A 1V9U2 5FAXA 1NG0A 1BHGA 4PCRA 4DNYA 1KDKA 1LR5A 1TME2 3GBFA 5DABA 4FI9A 4AFMA 1UCXA 3O0VA 4JKMA 4D6RA 4ES9A 4QDRA 2QDRA 2XL7A 5IFTA 1WCSA 1NZCA 3BCWA 4IGOA 4ZXEA 3J8F2 4IEYA 5C7GA 3WP4A 1R1A1 5DUWA 3I8TA 3MUZ1 5BNPA 1T6BX 4UFHA 1XYPA 4EE2A 4GXLA 2RM22 5BNPC 1XNBA 2V5DA 1JYIA 1QDCA 4IE7A 1JYXA 1LAJA 1DGRA 4Q1PA 1UD1A 4AI0A 1U5XA 1OVPA 3BI3A 1AX2A 1FOD1 1XXNA 2BWCA 2VMFA 4XFFA 1R1A3 1IS3A 3VDDA 3C2UA 2VW0A 2V73A 4S2HA 4L9BA 1VBA1 2XUMA 5A3TA 2EF6A 1K45A 2R16A 5HXVA 2G19A 5HXMA 4XBLA 2WBKA 2A3WA 2W1SA 4DPNA 4D7YA 2WZEA 5KXBA 1TMF2 4C0HA 4CXYA 4FPOB 5I0TA 2GP3A 2GNTA 2V4AA 3PVEA 4QB2A 5A32B 1FOD3 4KWLA 1F5FA 1RXFA 4LBLA 4QHBA 3SEPA 4AE2A 1PVXA 1N1SA 3WEZA 2W91A 4Y33A 3GBWA 4XFAA 5FP8A 1VBA3 4FOYA 2C24A 2WSUA 4B8EA 4CDQA 1A8DA 3SCGA 3WDUA 3EBRA 4GAZA 4TLFA 2E32A 1H4HA 2CAVA 4CDQC 4OHYA 3V0BB 4IGPA 3LIHA 3N9OA 2Y0OA 2Z69A 2Q1ZB 1XNDA 5BNOB 4LBQA 3CMGA 4Q0UA 4DZGA 2ZGKA 5LCWL 4TTGA 2DVAA 5CYYA 1GUIA 3GDBA 1D4M2 2WLPA 3N35A 2VH9A 2FD8A 1XYNA 3VBRA 4MX3A 1SEFA 4IEXA 2LRPA 1S0IA 3VBRC 2FBEA 3V64A 5A3UA 4PI0A 1CJPA 4KG0A 2B9VA 2PELA 3F95A 1PHMA 2PN5A 1FT9A 4GD4A 4PIXA 3GZTB 3NV3A 4JQTA 4XW3A 5FZIA 3KB5A 3CQOA 4BQ2A 3IDAA 5C8WA 1QXJA 2ZZQA 4JKKA 1R092 3BB6A 2A6YA 3ZDSA 3VD3A 5H9PA 4PHZA 4LXLA 5J37A 4U36A 4LIUA 1WKYA 2YROA 4ZU5A 3CZUA 3P5BA 4RFRB 4A7KA 2JDUA 5CG9A 5T5JA 2ZGLA 2PHLA 2CAUA 2NMNA 5FJKA 3AP5A 4MLOA 2QVSB 2X53S 5GALA 3AYCA 1ND3A 2VULA 3QLQA 3RZHA 4GH4B 2I74A 3NRUA 1ND3C 2WL1A 2NMOA 3GHNA 3AK0A 2Y6GA 4UFIA 5FXVA 5LY2A 4AHWA 1DZTA 3USSA 1JZ5A 1MPXA 4XPVA 1VBB1 2IVJA 4GMP0 4AWDA 1W2TA 1NKGA 1OUSA 2A6ZA 1D7PM 1MS9A 4OMCA 1AL21 2JG9B 3NNMA 4Q0QA 2A3XA 5DUXA 2AYHA 2WFF1 3N7JA 1D2QA 5FIXA 2OA2A 2XQRA 2RMU2 1UYXA 2XKOA 1NZIA 2XMLA 1EAH2 3CHXA 1COV1 5A6ZA 4N53A 1VBB3 5F9TA 4SLIA 3GZUC 2LTNA 2RR11 1FNYA 4N53C 4YGEA 4ZY9A 4CPBD 4ZKTB 2IZWA 3D4KA 4KWJA 4RYDA 5FMDA 3VBUB 3VL9A 1YJKA 3SLIA 1OPMA 1AL23 3AKQA 1JZ4A 3DV8A 1MS4A 2MPFA 4QQOA 2WFF3 5C3RA 2RJLA 1COV3 5FREA 3B94A 4XFGA 5FQ0A 1RUJ1 2WA3A 2A3YA 1L7LA 2RR13 5LA2A 3J7HA 3ZN6A 4N9IA 2W3JA 4XJAA 4XVHA 4LUMA 4M01A 5E8AA 2AACA 2TUNA 5CB7A 4UI9L 1RHI1 4E9KA 1O3QA 1EPWA 2BDRA 3KWVA 3OD0A 4A7YA 3EYPA 1RUH2 2GALA 1Y7BA 1OD5A 3MICA 2XQXA 2DTWA 3J7NA 5A1FA 5A80A 3ZYIB 4RS5A 1RUJ3 2IWGB 4JV4A 4XC9A 5FZMA 3KCCA 3HNMA 4RS5C 1EYBA 5APAA 3M3EA 4CUCA 3AZXA 3T30A 4HANA 1MS8A 1RHI3 3JB4C 5L9BA 1V6OA 3FN9A 2JKBA 1YI9A 2VC9A 1V00A 3IIAA 4FTSA 3N9MA 5FZBA 4QPGA 5IUQA 2H6BA 3LE0A 3UGHA 3NNLA 1GBGA 1H2NA 2YGLA 4EWEA 2HWB2 4UBGA 2Y26A 4G3YC 4B1LA 2BU9A 5JSRA 1OLRA 3PTRB 4NVPA 4Q4V1 3KV4A 3W58A 4JC1A 2ZGOA 1JMUB 2GSYA 1PGW1 5DAPA 5JSPA 4J25A 4ARYA 3ZFGB 3M7AA 4CDUA 5K8SA 3O1VA 3TAYA 5HI0A 4CDUC 3LIGA 5FOJB 4TYSA 4RN5A 4EN9B 1OFSA 2RDNA 3RJRA 3ZXEA 2GMEA 1X9TA 2CU5A 4GZ9A 3ACGA 3S5QA 4BWOA 3HN3A 3ILRA 3KV6A 4TXWA 4CDWB 5A3LA 4NAMA 1O59A 4XJZA 1VPHA 3S7EA 4C1WA 5KR7A 5FY8A 1W06A 2PHUA 2E26A 4OULA 1LKNA 1DQ6A 4HKLA 4P9YA 2HH9A 2JE9A 2VQUA 4LHLA 4Y4RA 4DXZA 1GOFA 2HWF1 1DQ1A 2BFUL 1Q8QA 2X05A 5C8CB 4XEZA 1SPPA 2NM1A 4DRRA 2OPWA 4DS0A 3H1YA 3ALQA 4RSUA 1DGWX 3OPZA 1HXS2 1UZ0A 3NAPA 4P9IA 4A3XA 4DIQA 3DPRA 1VB2A 4LNVA 1DQ5A 4WBBA 5DDJ2 5E88A 1Z78A 2YU2A 5F32A 3DPRC 1W6NA 5A32A 3RZLA 3BPZA 3A23A 3ITQA 4MHRA 3WCRA 4I09A 2HWF3 4MG2A 5F3IA 1GWLA 1HDKA 5T52A 5BY5A 4AL9A 2VTXA 3Q8EA 3U11A 1RL3A 4QWNA 5CISA 2VECA 1IKPA 4MGZE 1W9YA 1HV0A 3BOPA 2IFRA 2EIEA 2KD7A 3IWZA 2B9UA 3FUOA 1W6PB 4FAGA 1DFQA 4E4DX 1K3IA 3ZSJA 3RPQA 5JI9A 2OS2A 4FXGB 2D6PA 1NYWA 2JECA 3GZEA 4NIIA 5BNOA 1GQHA 4WM8A 5BNOC 1U5IA 5EHDA 2ZGSA 3AJZA 4AVAA 5IHRA 1QEXA 3FMGA 4WM8C 3AVRA 1ZBE2 4DQAA 3VBFB 4Q26A 2ZKLA 1VRH1 2H6CA 3WSOA 1LENA 5DUVA 5CFCA 5JUVA 5CFCC 4TWTA 1NY72 3ZX7A 5JIUA 1A34A 4XBNA 2VBPA 2Y38A 4MUVA 1V6IA 3H7JA 4IV3B 2YZ4A 3FJSA 5LASA 3KGLA 5CFDA 5KXDA 5FYMA 2RV9A 1VRH3 5CFDC 3WNLA 2QBXA 4META 4Y20B 4I02A 3JQXA 3T2QA 3O1TA 2G9ZA 4RA0A 4CEWB 1Z7S1 2FZ1A 3EHKA 1W6QB 3BUCA 2WO7A 2YBSA 3HMYA 4BIOA 4E2GA 4AQTA 5JZGB 3FLRA 3TN92 3AFKA 3TEWA 4KU7A 4MXWA 2XJUA 3POFA 2VM9A 4UW4A 2TBVA 4QMAA 3WQ1A 1C1LA 1WLWA 1X9PA 1OUXA 2EXHA 3IDCB 1IS6A 3CLPA 2E7TA 1Z7S3 2ZS6B 4GH4C 1N1VA 2EIGA 2EXIA 2WDBA 4LKFA 3NJVA 1UOGA 5FUNA 2RE9A 5FZ9A 2G9FA 2HBTA 3SISA 2Y33A 2OZ6A 1SQ4A 5I0UA 5KHIA 2GZWA 2BEOA 1CAXB 2JG9C 4GJYA 1QOSA 1SCSA 2A5ZA 3R4UA 1GV9A 5JI7A 3I2GA 4Y1YA 2BERA 4NR1A 1LOCA 1CONA 2XONA 1RUE1 5EJZB 4DUVA 5FYCA 4UFLA 1LRHA 3VKFC 5LA0A 1S0FA 2WAOA 3CL1A 2BTVC 1JUHA 2VE1A 1AYN2 1BKZA 1CIWA 3RGBA 3ZYJB 4ATFA 5BNNB 1QOOA 4EN7B 4PBOA 2J1EA 3OGRA 4XACA 3M3QA 4IE0A 1RINA 2W92A 2XH6A 2XJSA 4PF5A 1OHFA 1AR71 1RUE3 3VGIA 5K4LA 5IVCA 3MIDA 3VD7A 5CVRA 3OGVA 1GKBA 5C9AB 2FMYA 4ZPIA 1Y43B 3SC7X 2ZMNA 1UMIA 5F37A 5FY4A 4FPCA 4MHUA 5FZOA 2YC2A 1AR73 1VMJA 1PZ7A 4LHSA 4URTA 2VZVA 1QDOA 5GKAC 1VE0A 1WGPA 5LK5A 3OUHA 2VZ1A 3WG3A 4ISQA 3N9NA 2B46X 2RS31 4Q0SA 3VD4A 4I30A 2YHJA 3R05A 5A3NA 1Q8OA 2Q8EA 3VZOA 1G9BA 2Y6JA 2JDNA 2WZR1 1SFNA 4K21A 2NQYA 4UOJA 1AYM2 4GMP1 5GZFA 5SV8A 1YXWA 1OA3A 2HYKA 3A22A 2P3IA 4JHZA 1RJ7A 1QJU1 1QXRA 3I2KA 1MACA 1UZZA 2YBPA 1FV2A 5F5CA 2W0XA 3RDIA 2RS33 3FHAA 2DFCA 3LFMA 4CE8A 3J7MA 2D44A 2WZR3 5EYYA 1ZA4A 1FPN1 2XHNA 3ATGA 3FWEA 3TOJA 1FXZA 1QJU3 3RZJA 1OKQA 4XFIA 3GZAA 3AMHA 3NJZA 3ZPOA 5GZCA 3WDYA 4PBPA 1ZYBA 3ZFGC 1VBE2 2OT7A 4CCOA 4RHV2 4AFBA 2FDFA 4XHXA 5JLVA 1QJY1 3IPVB 2PLV2 3AMQA 4FPJA 1H2KA 1FPN3 4O7XA 3C7GA 5JWPA 3HD8B 1ZRRA 3WW1A 4NE9A 5FKBA 4CDWA 1R64A 1P8JA 4W6YA 5F3GA 4E27A 3BTXA 4FPFA 4CDWC 2WNVB 3PVBB 5JR7B 1REFA 3GYDA 3H8RA 4YSFA 3VZLA 3ILFA 5GLTA 1K42A 3URFA 1U0AA 4UT5A 3Q9OA 5ACA2 1QJY3 4O65A 2QZ3A 4XAEA 4YRDA 4CPBA 3N9LA 2VVFA 3NJXA 1D2SA 4ATEA 4EWAA 4Y3OA 3V65A 1K5MA 4P14A 3DKWA 3PUQA 4XUPA 3RZMA 5A1AA 1K5MC 2ZEYA 5AFEA 4YWAA 2VMCA 1RVF2 4BLIA 2CDOA 3KVBA 3K4AA 4M4RA 2WT2A 2XHKA 5F5AA 2PAMA 4IV1B 3ZR6A 4EN6B 1LOFA 1SLCA 2QQWA 2R042 3DL3A 4HSJA 2HWC1 2VQ0A 4PF1A 1LOFC 1W9WA 4BPZA 4JQRA 2FHRA 4Y4YA 5I0RA 3T2OA 2P2KA 3I3MA 1JW6A 1UOFA 1H0BA 3VN4A 1RMU2 1GP6A 3DF0A 2O8QA 1JU4A 2PAKA 4QU1A 3SCHA 2ARAA 1A78A 2HWC3 2WT0A 4F8AA 5A6YA 5FXZA 2OXBA 4G9SB 2G1MA 4OLLA 4UBHA 4QQ2A 5EFUA 5T5PA 3POSA 4RGAA 1IPSA 3WNOA 4AK3A 2AR6A 3CKHA 2UU8A 3MYXA 1HW5A 1S1AA 1SG3A 5EXOA 1LU2A 2WRAA 3B93A 1RUC1 2NN8A 2YYOA 4LK6A 5J96B 1F2NA 1WBFA 2XOMA 3B9CA 1W8HA 5AC92 3ZKUA 3AMPA 2VNVA 3VBOB 2IFWA 4B29A 4FOQA 1POV0 1X33A 3PU3A 2ZHLA 3MLLA 2OW4A 3I59B 5ABJB 1EV12 1SLLA 3MO4A 4CXWA 2OKXA 4Y20A 1YFYA 1G9CA 5KHGA 4HMZA 2VW1A 1DG6A 2VGDA 4CEWA 1W6QA 2ZGPA 1CJDA 4Z2WA 4YW6A 4CEWC 1BK1A 1DLLA 3OG2A 5L7OA 1I6XA 2R1BA 5FZ0A 5L7OC 3MIEA 5FWJA 2XJTA 1FYUA 1MQTB 3WD5A 2W68A 1AR92 5KHKA 4YPJA 3M8LA 2XLFA 1QOTA 1W9SA 2I2SA 2HWD2 3NV2A 3MW2A 2DDUA 1UKGA 4K1ZA 4DMIA 1CD3G 3AKSA 3KMHA 3UGFA 3IBMA 1UW8A 1SFYA 2R6QA 1UIJA 4SBVA 3BU7A 3LB9A 1HRI1 1TQ5A 4AEKA 2WZ8A 1DLCA 3QD6A 1CAXA 5EV7A 2FZ2A 3RWKX 1UMZA 2PHFA 4LHNA 4NRQA 2EA7A 4YM3A 3B02A 5FZHA 4ARXA 1ODMA 4UF0B 4IUGA 2LALA 1IG3A 4MXVA 4ZXKA 1KFUL 2R0HA 3MPBA 4KU8A 4DY3A 3E6BA 4QB1A 3SH3A 3WDTA 5FPUA 1HRI3 4PI2A 5JOXA 1ZRIA 1XQNA 2JENA 4LMFA 1RUG1 4OHWA 5FZLA 4BH9A 4QM8A 2BFUS 1ULFA 1UZWA 2ORXA 5FZDA 2GP5A 5A70A 5CAZA 1IHMA 1JOPA 4LE3A 3RJ2X 1CGPA 2A71A 4RGKA 4YW4A 4AVTA 1J1TA 1XB9A 1N1YA 3LGRA 2NPIA 2WKKA 3KQRA 1G86A 3NKTA 4HL0A 3SKVA 5C9AC 2O0OA 5FRAA 2WN3A 3Q8AA 5JSOA 4AOCA 2E7AA 4AHXA 1RUG3 1S0EA 1CAVA 2RS51 2YY1A 2YGMA 2JKXA 4CCKA 1FOD2 2GC2A 2VMEA 3Q8FA 2C5DA 1H8TB 3ABZA 3L2HA 4MGQA 2YFUA 3BALA 5A3WA 2XPJA 2QQPA 1AXZA 1J3QA 1VBA2 1Y9QA 3NO8A 2IUWA 4ZZ5A 4W50A 3AXEA 5FY5A 2VOKA 3OGSA 1JOJA 2RS53 2WNUB 2ZAAA 3U4SA 5LK7B 2B45X 4QQHA 5GLWA 1H2LA 5J3UA 5A3PA 4V2VA 3ACFA 4KI5M 4DXTA 1V6LA 4QHZA 1JHNA 3KSCA 4K8RB 2EAAA 5C5UA 3I54A 3H1WA 4FOVA 3O1PA 4D6QA 2ZMLA 3WP3A 5KWRA 1RUNA 1PGL2 5C71A 4YM1A 5DAWA 4FTEA 4R9AA 4AR2A 5FBJA 5LEKA 4C91A 3NNJA 1ZZ7A 3V56A 4GJZA 5E1RA 1IOAA 4AFCA 3E97A 4CP1A 2GC0A 3H3ZA 2P3YA 3IKWA 4L8QA 1KITA 2Y8KA 4EZHA 1ZZ8A 5CEHA 1ENQA 1N3QA 2Q8CA 1C8M1 2WNEA 1KQRA 5FXXA 4Y24A 1H4GA 1W6OA 2WNVC 1DDLA 1KJRA 2K9ZA 2BNMA 4PQ9A 1IG0A 2J42A 2VO5A 4P5YA 4AVVA 3I2JA 1UMHA 2PHWA 3M3OA 2AEYA 2FDGA 1AF9A 2XBO1 1SLIA 1UIKA 1C8M3 2XJQA 3T0DA 2J1VA 4BISA 2HYXA 2VZOA 3E5UA 2RJ2A 1XNKA 1WMDA 4N7IA 4CYDA 1WCQA 4MGKE 3TEZA 1ZVFA 1LHNA 2XGXA 1X8EA 1J83A 3AP7A 1XJAA 4LO5B 4Q1RA 5C3OA 1GZ9A 4UAPA 4Q4X1 4XILA 1HQNA 3WW2A 2XVKA 4NPLA 4YVSA 2CY6A 4AXOA 1HX6A 4S2GA 4LT5A 2XBO3 1KRIA 1OQ1A 4XJUA 2K0GA 1LODA 2E7QA 4QD2A 5FZKA 5JOWA 1VBB2 1WCUA 2DCJA 5FXWA 1D0GA 3I3BA 1GSLA 5DXDA 4UFKA 4NUBA 2D6OX 1NXMA 5LRRA 2W95A 1OURA 2ZEZA 4Q4X3 2VOVA 1AL22 2WUHA 4QXHA 4CCMA 5D8AB 1YWKA 1PVC1 1BLZA 3A0NA 1WW4A 1Q8PA 4Y5Z0 4AZZA 1TEIA 2QQOA 1SCRA 1XNCA 1G7YA 2AH2A 3AKPA 5KC6A 1UYYA 2RR12 4CXXA 3PUIA 5A3OA 2ERFA 2I45A 3D0JA 4IL7A 3AP4A 4EJRA 1JZ6A 3JBG1 4N43B 4OUSA 3UKTA 3DN7A 1VALA 3I2HA 1PVC3 4XJ8A 1S55A 4FCAA 3ZFEB 4DXSA 4PLOA 5D1IA 1ZBA2 3G7DA 5BV6A 4K6BA 2AUYA 1O4TA 3LKJA 1XU1A 4FXKB 3WX5A 2E6VA 3ZLIA 3BIEA 3I59A 5ABJA 2JG8B 1S2KA 3R4SA 3ZSMA 5ABJC 5KC5A 2VNOA 1RHI2 1W6MA 3KT1A 4RL7A 4AI1A 1WW7A 3JBG3 3LA3A 3PJQA 1SZBA 4LLFA 4QKDA 4NMIA 4W6XA 5I93A 2CGPA 2BYVE 2ZX1A 5JPNB 2WWUA 1RUF2 4NN0A 4A3ZA 3B5LB 2ZGTA 3MHZA 4CP2A 1G6NA 1TZOA 1QNWA 2AZ5A 2WABA 3OUIA 1MQTA 1O5UA 3SMHA 2EICA 1ENXA 2HLEA 1MQTC 1YI7A 1CPNA 1KEXA 3I3EA 3JU9A 2Z79A 3POBA 4HONA 4IERA 4NROA 3LSEA 4AGRA 5A6XA 4PT6A 4JGYB 4D0QA 3BU0A 1HLCA 1IS4A 4XIKA 1GFF2 1ENSA 5JR2A 1ZZ9A 1BEV1 1W05A 1XSRA 2VZTA 5I8YA 3POYA 4EN0A 2D43A 4ASMB 1QXPA 2R071 3C3VA 5JOYA 3NQHA 1XE7A 4KWKA 1YFUA 2VBDA 2VUJA 1PGW2 4L92A 1NLRA 4LO8A 2C9KA 1BEV3 5LEJA 5L9VA 3JD71 2NP0A 3AMMA 1UU4A 2ZEXA 1B35B 1WA4A 2EIBA 2E51A 3THDA 5F2WA 2C9AA 5FYUA 1AR81 3E1F1 1PIV1 2X5IB 1C1FA 2R073 3APBA 3MIGA 2JDYA 1JXNA 1YRZA 4LOTA 1QJX1 1SFPA 5H9RA 1REEA 1J3PA 3JD73 1BVVA 3EO6A 4IE4A 2PXJA 4YVWB 3ZDVA 1JU3A 2QDNA 1ULDA 4FPHA 1AR83 3PMEA 4FFHA 5DQ0A 1CZSA 1XE8A 4IQPA 5A7PA 1J58A 2LUWA 3AZVA 2FCVA 3X29B 1QJX3 1GICA 3T3YA 3C7EA 2LM3A 1ZNPA 4HKOA 4S2FA 4YGDA 3N4MA 4JDNA 4CP9B 3ZYPA 3AYEA 4QX5A 3BPSA 4AEDB 4X8PA 5CKNA 2WNUC 1K5JA 1WLDA 3P3NA 4E8CA 1YC61 4JCKA 5HCBA 5CKQA 4Q5OA 1H9PA 3I49A 3B01A 1BYHA 2GNDA 2JIGA 2W94A 2YC4A 5FLHA 5FZ4A 3JZVA 1AUYA 5T50A 3RI8A 3ZIWA 4HETA 1ULEA 5FPXA 3QH6A 4RR3B 1PNGA 1V0AA 1OFNA 3I2FA 2Y34A 3ACHA 4CSWA 4Z1VA 1QJEA 2ZA9A 4AHZA 3NVCA 4DO0A 4NAOA 3W20A 1RUD1 4XDOA 3IZOA 4OZXA 1IS5A 2LW8A 4YNIA 1M06G 4D7TA 4LK7A 1GZWA 1OOPA 1RTVA 5LBBA 2JJ6A 4K40A 2VCAA 1OOPC 1JTZX 1PM7A 5IFPA 3T4VA 3IM0A 4BMBA 1FNZA 1I5ZA 3KV9A 1U5ZA 1RUD3 1N47A 3FL7A 4KNCA 3WDVA 2G4IA 5CIRA 3FZ3A 1GQGA 1YO8A 4XTPA 1LEMA 2D40A 4IDZA 1WZXA 5C3PA 3VUOA 2JEMA 4D8MA 4HBNA 1FMD1 3GBGA 1UAIA 1WMFA 2ZGNA 5A7NA 1CWPA 3B00A 1UYPA 2P4EA 3DYMA 5LB6A 5BUVA 3T1MA 4A4AA 4BYYA 3HN1A 3VBHA 4B4RA 2JD4A 3EJKA 3U10A 3ZMOA 1ZZBA 5J09A 1MS0A 3LQCA 3VBHC 1YLLA 3NMBA 1O8PA 3WV6A 4AFDA 4NIDA 1S0DA 2DCTA 3QCWA 2GH8A 5JDBA 1UKRA 5A7WB 4GKXA 1GP5A 1OBNA 4QX7A 4CCNA 3UK9A 4YZ2A 1VMHA 4XZPA 2DBIA 3WZ1A 4BQXA 3I2OA 1OQEA 3D8CA 1BBT2 5D8AA 3IMMA 3ZMNA 5D8AC 3JB8A 2ES3A 5CG8A 3PJYA 2J1RA 2WSVA 5EPAA 3HT2A 2VMDA 3THPA 1BVP1 5FYIA 2VZPA 2ADEA 5FO7B 4Z8BA 3WDXA 3O1MA 1V9U1 1O91A 2OQ7A 4XJ9A 4ZZ8A 2D3PA 1DHKB 1OXCA 5IT6A 2ZX4A 1S0JA 2VZSA 3NSTA 2Q4SA 5A3MA 3AMNA 3DXTA 2YG0A 4WVMB 2R062 2DU1A 4XETA 3J8F1 1ODNA 4XF0A 4CEYB 2CNAA 5GLZA 1CAUB 1AL0G 4HK8A 3ZXFA 3CDZB 3WXPA 2RM21 5GLUA 1YFWA 3N36A 3ZFFB 2HKXA 2HEYF 4Q4V3 1W2OA 3ASIA 4XQDA 5ERLA 2VY0A 2RS32 3J8F3 3A7QA 4DOUA 4DY5A 1ULGA 2V4VA 2GC3A 1APNA 5E89A 2WZR2 4P5HA 4Q8LA 1X7NA 3SITA 1WD4A 4BQ1A 3OY8B 4YGBA 3ZVXA 1PMHX 4H14A 3OTFA 2A75A 2RM23 4JGYC 2XG3A 4N9HA 1QJU2 1OPOA 3MFCA 1JYWA 2P6HA 3D0SA 3KF3A 1TMF1 4I3PA 3G6JB 1MZFA 2ZX3A 3U07A 3UT0A 1RUOA 3H8UA 4CU7A 2WT1A 3OEAA 2GNMA 2HWE2 1HB2A 4YG3A 4BLJA 4COUA 5LWBA 1KD7A 1SACA 3AFGA 2VNRA 5LA1A 2FMDA 4LULA 3MI8A 1TMF3 2DURA 3KF5A 1Q56A 3RWNA 1NQDA 2A73B 3I7DA 1EP0A 3OBTA 3ROUA 4HPKB 3S6PA 5DAXA 1RITA 2X5IC 2KA3A 2JE7A 2KR2A 3POJA 2Z2SB 3V0BA 5IAVA 1D4M1 1UWWA 1YJLA 3EB7A 3OF1A 2C26A 4NHYA 4DUXA 5FO8B 3BTZA 1SLTA 4GB32 4OZOA 3HBKA 4LUKA 1D4VB 3K2OA 4CP0A 1DZQA 4XF3A 3RZZA 2VBBA 2BGOA 3WF1A 3RS6A 2BNNA 2SBAA 4EROA 4W65A 1PGSA 5JMCA 1ALYA 2J1TA 1JYVA 1RXGA 1D4M3 2XJRA 1R091 1GU3A 2VXRA 1R081 4BZ4A 1LOBA 1O7FA 2VXJA 1PO12 3HVDA 4YZ5A 3WQBA 4IXLA 2EIDA 2HWC2 1AJOA 1VAVA 2WINB 4AEDC 5EIYB 1Y9GA 1US2A 4KGQA 4MGSA 1E5RA 2AGSA 3MIHA 4FT8A 2CDPA 5A1LA 3GF6A 1R093 3HOBA 2JX9A 1I1EA 4NOTA 2D7FA 4KGGA 1R083 4CUGA 3VHNA 4MH0E 2WA4A 2NLRA 3VZNA 2PFWA 1Y3TA 2BNOA 1HRV2 3T0AA 1W8OA 4DXRA 2D6NA 1L3JA 1UOBA 3O1RA 4CCEA 1RJ8A 2AC1A 3FE5A 4GH4A 1NT0A 4HZFA 3WR0A 4F83A 5FFOC 1I3HA 2RMU1 3OOXA 1WW5A 2AEZA 5FZ6A 2OYZA 2FDKA 1EAH1 4BE3A 2JB8A 3INAA 4RD7A 3LEKA 2A6WA 3AVSA 4Q4Y2 1JZ7A 3AL6A 4HVOA 3H8OA 4NHLA 2JG9A 3H7YA 3VZKA 3UESA 4INDA 3D3AA 3WNKA 1QHDA 3RYRA 4BXSV 3U0ZA 4WV8A 3USUB 5KXCA 1W39A 3POGA 3WW3A 3FX3A 4XF1A 2YUEA 3ZSEA 4AYUA 1EAH3 5C3SA 3D5OA 1OLQA 4HG6B 3PTYA 2VVEA 2J1AA 3VBUA 1BCXA 2CTVA 4CUBA 3FUQA 1E57A 3VBUC 4CDXB 4NHMA 5EYXA 1YIPA 3IB3A 1RUH1 3AJYA 1W8FA 1OC1A 3VB9A 4W4ZA 2VMGA 1X8MA 4HN1A 2Y6HA 2TNFA 4QXBA 4KH9A 4BK4A 1MS3A 4B1MA 2B5HA 2ZX0A 2P37A 2XWJB 3UETA 2RVAA 4MSVA 3SKJE 5DPNA 4J1XA 2D93A 4LJHA 1NUKA 2VU9A 1ZREA 3HAGA 1HRI2 5GLVA 1BZWA 2P5BA 3RSJA 2X8KA 3OUJA 2CV6A 1A6CA 4QX3A 3U14A 3KV5A 1L7RA 4H7LA 2W47A 5HPOA 5FZ3A 5A33B 5EWSA 3KCYA 2FCTA 4HOOA 2P6CA 3HEIA 4KG8A
chains in the Genus database with same CATH topology
4XFBA 4FPGA 1AX1A 4GMP3 4JAAA 4Y1XA 4JGZB 4WVMA 2MEV2 4ZU7A 4XMIA 1S2BA 4S2DA 1SDWA 1ZM1A 4XQ4A 3ZFGA 1TE1B 4CEYA 2D6MA 4AG4A 1ASJ1 4CEYC 1LOAA 1Z0HA 4FTBA 4M0NA 3HBZA 1S0BA 4WZCA 4DINB 4O9EA 1UN1A 1V6JA 4Y22B 1NA1B 1HIXA 3ZYGA 4BA6A 1VR3A 3MIBA 2IXCA 2DUQA 1ASJ3 2O8OA 5F6KA 2BPA2 1KDMA 3KT4A 2DYCA 2UYAA 4Q27A 1HXS1 5FCCA 3J9SA 3SXWA 2B7YA 4XBQA 2YV8A 1OI6A 1CESA 3KZ4C 5C8CA 3IT8A 1OSGA 5C8CC 4AQ6A 1Q8VA 1HXS3 2IXIA 4Z82A 4I01A 4M3CF 1MEC1 1DQ2A 2VNGA 1IPKA 4PJYA 5C4WB 5JAXA 3VUOA 1SBDA 2VMHA 2GDFA 4AVSA 3BODA 2NZ9A 2WJSA 2X29A 3LOIA 4F7ZA 1AVBA 1H1MA 1ZBE1 1PZ9A 1C8M2 5GM0A 1W6PA 5J98B 4ES8A 4YW1A 1MEC3 2DVFA 4WZFA 1CAWB 1VBC2 2KM2A 3PLQA 4YG0A 3KM5A 1ND2B 2Q1MA 3AP6A 1NCRB 3ZO0B 4HSLA 5KBFA 3VBFA 1ZBE3 1DBNA 3VBFC 4LO6B 2BWAA 4LTAA 5HCFA 3E5XA 3QACA 2UWBA 1MVEA 1XYOA 3H9AA 1NCQB 1YUDA 2GN3A 4XDQA 4IV3A 1O4YA 1S0CA 2VG9A 4IV3C 1RUC3 3MDPA 1SMVA 4G4FA 4Q29A 2R49A 2D5HA 1FATA 3AX4A 2CYFA 4K3UA 2V5YA 4GALA 4P9XA 4XF9A 5IK4A 2XVGA 3B3QE 5JZGA 2C0ZA 2E9QA 3LAGA 1X82A 5JZGC 1G9FA 3TRSB 4C0BA 3RG0A 4QPIB 1LHOA 3JQWA 1VBD1 3D6EA 3IDEA 4RGGA 2YPJA 4RQPB 4FPLA 2CGOA 3LA7A 3ZXLA 3JBG2 4BMEA 4Y1ZA 1DQ4A 1G9DA 4RFT0 1LEDA 3LSDA 2UY9A 1WCKA 5AFBA 1VBD3 4QGLA 4WM7B 5LRSA 3O14A 3WHTA 4DRVA 4NWVA 4IESA 1LHWA 3VHRA 3ES1A 3HT1A 2OPKA 3CJIB 1O3TA 5BNPB 5BNNA 2ZTNA 4CDXA 3AB0A 3B9IA 5BNNC 4MZUA 4CDXC 2P3JA 1H1AA 4MV2A 1X36A 2ENRA 1SBFA 3WUDA 4AVCA 1R1A2 3VDDB 4GA9A 4LO7A 4OHVA 5C9AA 2UY8A 5J36A 1ZX5A 3NV1A 2PHXA 3RNSA 2ZABA 3RMYA 2HEVF 1WLTA 1CR7A 3CEWA 2ZZJA 4GKYA 2BGCA 1N3OA 4OUMA 5F1RA 3UL2A 5IK5A 2R072 2GU9A 4FPYA 1RB8G 4HLTA 4XYXA 3CF6E 4CDQB 4COWA 4KQ7A 4YZ4A 1Q8SA 1C57A 4GWMA 2DCZA 3VLBB 4YZ1A 4D3WA 1LB2A 3OBRA 2CL2A 3AZWA 4JTNA 4CTEA 5JPMB 2ZAHA 1AR82 1GNHA 2GH2A 1VBE1 2PHRA 4RHV1 5HBAA 4WVZA 3WG2A 4Q4W1 2PLV1 3VBSB 5KHHA 4R9CA 3VBRB 3S0MA 2XKPA 5HCAA 1DYPA 4BOWA 4YARA 5BPXA 3AYAA 4QU2A 3CU7A 4R9BA 3VKMA 1VBE3 1YIFA 4LA2A 4RHV3 4B7EA 1R1ZA 4QXKA 5FOBB 5ACA1 3IPVA 4B4PA 3SH5A 4Q4W3 2PLV3 3RMXA 3OJBA 2D98A 2BBVA 2DUPA 3OYWB 2Q5TA 2WNVA 2IXJA 4LBNA 1AXYA 1RVF1 3ZIXA 2QNKA 5ACA3 2WS91 1IKQA 3KS7A 1GZCA 4L11A 2R041 2DV9A 5FMOL 4P9GA 3ZYRA 3WQ7A 5C33A 2ET1A 4LE4A 3VKOA 2W39A 3WOGA 1MS5A 5EZWA 4DB5A 1RVF3 4PDWB 2BQPA 1RMU1 2WS93 4IV1A 1QKQA 1JBCA 1QQP1 4XFCA 4IV1C 2R043 5FBZA 4H3WA 3RYPA 3AM2A 1SLBA 2BUKA 2QE3A 3ZN5A 3PVNA 1KJLA 4Y1UA 1RMU3 1QQP3 5AC91 3O0XA 3NWKA 2WFF2 3ECQA 2PTMA 4FQ4A 2D3RA 1HQWA 3WVJA 5IK8A 1COV2 4ONUA 1ND2C 2GAUA 2ZJCA 5FQ0B 2Q30A 1NCRC 4X6RB 2Q8OA 1LHUA 3ZN6B 4OVEA 1EV11 4AFAA 5L73A 4E4SA 1CN1A 2UURA 3O5SA 5AC93 4IEZA 1JYCA 5CA6A 1NE6A 4TZDA 1JUIA 3VBOA 2E53A 4COYA 3VBOC 3WDWA 4Q8KA 1NCQC 2D97A 4MGIE 1UX6A 1PO21 1RUJ2 4RS5B 1EV13 1G8WA 2A6VA 1DYKA 2HWD1 3M70A 5GZEA 4J1WA 1A8MA 4I0BA 4FO9A 4LEJA 4QPGB 2VPVA 1PO23 3LA2A 1WMEA 3O0WA 1URXA 1ZRFA 3WP6A 2WC2A 1MZEA 2QKDA 1CX4A 2D6LX 1C3HA 1WLCA 3ZXAC 4HVQA 2HWD3 4RQPA 4RQPC 5FLIA 1LOGA 3CNAA 1WUVA 4XHBA 4CDUB 5AVPA 4YW2A 2WQ4A 4OHXA 4D69A 2QZ2A 4Q4V2 4I0AA 1DU3D 4YZ3A 4WM7A 4XE9A 4OI0A 4GQ7A 3UKNA 3NKGA 4WM7C 3FC0A 3CJIA 2ZGRA 1OA4A 1DGWA 3CJIC 1POV1 4QT6A 3CJXA 4R52A 3TWIA 2A70A 2PAEA 4AEJA 2EALA 1DGRN 4QPYA 1UZYA 1LJ7A 3VDDC 5JCTA 4XTMA 3R0RA 3B69A 3NAPB 1POV3 1PIV3 3DPRB 1RUI1 2PHDA 3TYJA 2R1DA 1W6NB 1KFXL 1BMV1 1H8TA 4XOGA 2HWF2 3OD4A 5T55A 1H8TC 3D82A 2H0VA 1F8VA 4PIYA 5L36A 2DVDA 1VB4A 2H0BA 4E2SA 3ZXJA 5CU1A 2P3KA 2WNUA 1RUI3 4CRQA 1H2MA 3VKNA 1IZ3A 1QH7A 3UJQA 1PGL1 4LBKA 1PMIA 3OGGA 4WM8B 3PVOA 2F6BA 5T3NA 5CFCB 5F6LB 3VBSA 3FHIB 4XIOA 1KXGA 2PA7A 2WWSA 3L2YA 3VBSC 3MLKA 2JICA 4JTOA 2CWSA 2EXKA 1F31A 3WT3A 2WLQA 2D6KA 1MZ5A 2V09A 3WG1A 5CFDB 1VRH2 4R9DA 1KS5A 3WY6A 4AGVA 1U12A 3HIFA 1Q3EA 3OYWA 1R082 1LGNA 3B7MA 4Q2FA 2BVBA 4M0HA 3SCFA 5JOZA 1J3RA 1PK6B 1QH6A 5CNAA 3POWA 5GZDA 3TB0A 3WCSA 2YC0A 4MXWB 5AVAA 2IXHA 2BVVA 2RS11 4LHKA 3A4UA 1Z7S2 1KS4A 3RYKA 3L9JT 2AREA 4YM0A 1QMJA 4IEVA 4L97A 4PDWA 4FOWA 1ONAA 1AHSA 1WBLA 1QJZA 3ME2A 4IEOA 3ST7A 4PDWC 3S7IA 3K48A 3WW4A 3J26N 4R4ZA 2RS13 3WP5A 2VOXA 3HR9A 1FMD3 5JIAA 3ZXKA 1AR61 1YYNA 1ZZCA 4QQLA 4QM9A 4N7UA 1LCLA 1RUE2 5I0SA 3MW4A 4FBFA 1ZBA1 3H50A 1O3SA 4XXAA 1W2UA 1AR63 1UL9A 3M4FA 1SBEA 4XJWA 4N43A 2IXKA 1H9WA 4P9WA 1UU6A 4LBOA 1TME1 2QFEA 2ZOEB 3AP9A 2DTYA 4N43C 4V1PA 4YYOA 3ZFEA 1AR72 1OA2A 3SH4A 4O9GA 1GANA 1RUF1 1QGLA 1ZBA3 3ZFEC 4K1YA 5FLJA 1ZZ6A 2JG8A 5I8SA 4AQSA 2JG8C 1REDA 2ZKNA 4E4ZA 1V9U3 1QF3A 4LBJA 2OIIA 2ZHMA 1TME3 1W0PA 2CGNA 1J1LA 3BOWA 5BNQA 1RUF3 2ARBA 2QUOA 3AZYA 4QPGC 1IPJA 2VMIA 1SLAA 5EJ3A 2QJVA 4NPRA 3VL8A 4JGYA 2SLIA 1F5JA 4PLMA 1VP6A 2XJVA 3RI9A 3MFAA 5FPZA 1QNYA 2UWCA 4FVVA 3ILNA 4LO4B 1YNAA 4MYEA 3O12A 1FPN2 4BIFA 3M3CA 3WNXA 3N7MA 4AW7A 4QGMA 3ZPYA 4HK9A 2UWAA 1B35A 1ASJ2 1LTEA 1M4WA 3FFQA 1B35C 4HN0A 5FMOS 4ISRA 1QJY2 2A7AA 4MVTA 2X5IA 1DZRA 1ENRA 4P9LA 3FLPA 2DF7A 3O7OA 2Z5WA 3PHMA 4HVRA 1MZ6A 1NE4A 2ZX2A 1K5MB 1CQ9A 5CADA 4YVWA 4YVWC 2GC1A 4CZSA 4ASLA 3NAPC 4D94A 1IQAA 1X50A 2ATFA 2ZPXA 3BTAA 4XTPA 1C8NA 2F4PA 2MNGA 3TBDA 1AJKA 5T5OA 4BHPA 1XU2A 3N7KA 1VAKA 1YHFA 2EVXA 1AZDA 3MW3A 1LOEA 1DGLA 4PLNA 4U2AA 4AEDA 2YMZA 1MEC2 1UU5A 2B8MA 1UPSA 3M2MA 3KGZA 1QWRA 2PYTA 4FPKA 1DIWA 4H55A 1H30A 4K20A 4DFSA 3LOBA 3N7LA 4RR3A 4AEMA 1BXHA 4AQ2A 2VOWA 1FV3A 4FP2A 4RR3C 1ZRCA 4OHZA 2BW8A 5H9QA 5J48A 3RQ0A 4TSVA 2G9GA 3H3UA 2ET7A 4F3JA 2MHFA 2XLAA 3NW4A 1RUC2 1CPMA 1IGOA 3GNEA 4XMAA 1NXD1 3OGJA 2GNBA 2HJIA 1F9KA 1WW6A 2ARXA 4IEPA 5GZGA 3M3IA 4L2NA 1TNFA 5L7OB 1V6KA 2B39A 3VZJA 1PK6A 3I2DA 2RMU3 1PK6C 3E6CC 2DCKA 4GIQA 1YCIA 4FQZA 4YM2A 4IEWA 5TSWA 4AI2A 3ZN4A 1U5YA 2WIIB 2Z42A 4JDOA 4FP3A 5DG1A 4OI1A 5CBLA 4FAHA 4I3GA 2GN7A 4A2UA 1BBT1 1VBD2 4YG6A 2GMMA 4M3CE 2CWMA 1FX5A 3WHUA 5KHJA 1RUH3 1C4RA 1C28A 4K9SA 4HKWA 1BBT3 2HWB1 1HQLA 3P3PA 3ZSLA 4M3CB 3K51A 5L19A 2N7GA 3AXDA 5DZGA 5FDBA 2R061 1RUG2 2OZJA 3MLJA 4ITCA 2HWB3 1CAVB 2TEPA 1ULCA 4ORFA 2YXSA 2R063 1VLNA 3MPPG 1N3PA 2RS52 1CAUA 4X6QB 2WFPA 2DUOA 1AX0A 3R4DB 2R0FA 3ZFFA 3ZFFC 3IN9A 4GWNA 3VHPA 1LGBA 1DQ0A 3MZHA 1OQDA 4Q0PA 1C5IA 2HWE1 4UXAA 1XRUA 1D0HA 3HWJA 3OY8A 1MVQA 3MEPA 1RIRA 5FO9B 1GNZA 4YW3A 4IEQA 5E16A 2XJPA 5DDJ1 3VKLA 2OUJA 3ETQA 2IXLA 3MF9A 1V6NA 3MIFA 3AZZA 2HWE3 4Q4W2 5B2GB 3EXUA 2Y0IA 3V0AB 4BCUA 2AENA 1BJQA 1HV1A 2A6XA 2O1QA 4Y26A 3BIWE 4B7KA 5DDJ3 1V6MA 4GB31 1W6OB 4HPKA 4E2QA 1VIWB 3J4UH 2KXLA 1TNRA 2DWRA 4D7SA 2P17A 1AXKA 3H1MA 4XFHA 2W08A 4YFZA 1EY2A 2DU0A 1NY71 2GMPA 4IETA 1FAYA 3W9AA 1O5LA 4GB33 2W52A 1LU1A 4HFSA 4WVWA 2WS92 1PO11 2R32A 2K2SA 3IDBB 3OCPA 5T54A 1LULA 2XBO2 4YVSB 5K7PA 1I9RA 3JCIA 3M1HA 1HKDA 1W0OA 2OVUA 3QBQA 3LWCA 1NQJA 1PO13 4Q4X2 5SV5A 1QQP2 2VUAA 3H0OA 1LGCA 3GALA 1HRV1 3TN91 4N90A 3S30A 1VAMA 2Q0AA 2ETEA 1LESA 4AF9A 3WINE 2IC1A 3VZMA 2P34A 4COVA 4LBQD 2ZMKA 5K0UB 1WCDJ 4NO4A 3ZSKA 4C1XA 5K9YA 1HRV3 1YFXA 3TN93 1PVC2 4Q4Y1 3KCXA 3UKVA 5BYNA 1BQPA 4UW3A 1WD3A 2RJKA 2ZHKA 3NV4A 4I2OA 5GJ6A 2XB6C 1GLHA 1W6MB 1AYN1 5I8TA 3ZXGA 4Q4Y3 2PQQA 3WLUA 1RC6A 4LR4A 2E63A 3W59A 1PO22 3USUA 5DZFA 4OI4A 5DZEA 1H1IA 1NOVA 1AYN3 4K7JA 1B09A 3TNPB 3WUCA 3VHOA 3N3HA 2JDZA 4K8FA 3EQEA 1G9AA 1MR5A 1NLSA 1ZRDA 4W6WA 2PHTA 1RGSA 5T5LA 1GR3A 4R8HA 1FI2A 2DVBA 5J7MA 3RRDA 1BEV2 1AYM1 3FFZA 2QCSB 4JRAA 3DUIA 1GYKA 5DUUA 3ENRA 4OI2A 1LECA 1Q43A 4P9JA 2WZPP 3MGUA 4M3CA 3AKRA 2VVDA 4B4QA 1AYM3 2ILMA 3JD72 2MEV1 5H9SA 2ZHNA 4AHYA 4LLOA 4B3NA 1T6GC 5A33A 3WG4A 1PIV2 4Q0VA 4LBQB 3NL1A 4YW5A 2XWBB 3E6DA 3T1LA 2FQPA 1QJX2 4JGZA 1H8VA 4JVAA 4UW5A 4LBMA 2MEV3 3A0KA 4I0WB 1EPZA 1OMIA 4JGZC 3UV9A 1J59A 2B42B 3DGTA 3WQ0A 2EAKA 1O4ZA 1UF2C 1QU0A 3ACLA 3GHMA 1RUI2 1BMV2 1PNFA 2XVLA 3PMSA 2VQAA 1DF0A 4XF4A 1JH5A 1NA1A 1S0GA 4Y22A 3ZXDA 4QGNA 1NA1C 4UW6A 4FPEA 3AYDA 2NYYA 3T2TA 1LHVA 3I4IA 4X8NA 3KD4A 4HT1T 4AVBA 1QY4A 3QOPA 3FLTA 4OFGA 4R4XA 4Z92B 4YLZA 4AGGA 4WVVA 1ND3B 4XQWA 4H7MA 4Y1VA 3SHRA 2ZCWA 1CVNA 1GZWB 3V0AA 1OOPB 1G9CA 4JDMA 4GULA 1Q5OA 4Z07A 1UPIA 5BXXA 5JVVA 4XXPA 5C4WA 2ZBJA 3PNAA 3KT7A 4ZU4A 5C4WC 1RUD2 3VV1A 3CO2A 1VBC1 4EV0A 4MGYE 2WQZC 2C1FA 1VJ2A 2JXAA 4IEUA 3ELNA 4QQPA 3JUUA 4N53B 2I07B 2HEWF 2ZACA 4COZA 5C6CA 1A3KA 5F5QA 2ZGQA 4YFWA 1CAWA 3E5QA 1VBC3 4L99A 1C5HA 1ND2A 4NWWA 5DG2A 1NCRA 1PZ8A 2RHPA 2DFBA 2RS12 3VBHB 4YGCA 3U4XA 4KBBA 2D5FA 2D3SA 4YVSC 1FMD2 5FTTC 3AKTA 3TNQA 1NCQA 3SNMA 1V70A 3FBMA 2DVGA 3IMNA 4EN8B 3FBYA 1JN2P 3UJOA 2ZGMA 1AR91 2XLGA 3THTA 5KXEA 4J6GA 4EWDA 4A7ZA 1N1TA 3MF6A 1AR62 3LZZA 4JRLA 3HQXA 5K0UA 2VW2A 4KL1A 4AI8A 5K0UC 4FSJA 3LCPA 1MS1A 2UYBA 3R6SA 2OUHA 2EXJA 4AI3A 4QPIA 1AR93 2XL9A 2YDEA 3QH7A 4QPIC 3KLSA 2R30A 2DCYA 2ZGUA 4LA3A 3ES4A 4PIZA 4NHKA 4BM8A 4M00A 1V9U2 5FAXA 1NG0A 4PCRA 4DNYA 1KDKA 1LR5A 1TME2 3GBFA 4AFMA 1UCXA 3O0VA 4ES9A 2QDRA 2XL7A 1WCSA 1NZCA 3BCWA 3J8F2 4IEYA 3WP4A 1R1A1 5DUWA 3I8TA 5BNPA 1XYPA 4GXLA 2RM22 5BNPC 1XNBA 1JYIA 1QDCA 1DGRA 4Q1PA 1UD1A 4AI0A 1U5XA 1AX2A 1FOD1 1XXNA 2BWCA 4XFFA 1R1A3 1IS3A 3VDDA 3C2UA 2VW0A 2V73A 4S2HA 4L9BA 1VBA1 2XUMA 2EF6A 2R16A 5HXVA 4XBLA 2A3WA 4DPNA 4D7YA 5KXBA 1TMF2 4C0HA 4FPOB 5I0TA 5A32B 2GNTA 3PVEA 1FOD3 4KWLA 1F5FA 4LBLA 4QHBA 4AE2A 1PVXA 1N1SA 3GBWA 4XFAA 1VBA3 4FOYA 2WSUA 4B8EA 4CDQA 1A8DA 3SCGA 3WDUA 3EBRA 4TLFA 4CDQC 1H4HA 2CAVA 4OHYA 3V0BB 2Y0OA 2Z69A 2Q1ZB 1XNDA 5BNOB 4LBQA 4Q0UA 4DZGA 2ZGKA 2DVAA 1D4M2 2WLPA 3N35A 2VH9A 1XYNA 3VBRA 4MX3A 1SEFA 4IEXA 1S0IA 3VBRC 2FBEA 3V64A 1CJPA 4KG0A 2PELA 1PHMA 2PN5A 1FT9A 4PIXA 3GZTB 3NV3A 4XW3A 3KB5A 5C8WA 1QXJA 2ZZQA 1R092 3BB6A 2A6YA 3ZDSA 5H9PA 5J37A 4U36A 2YROA 4ZU5A 4A7KA 5CG9A 5T5JA 2ZGLA 2PHLA 2CAUA 2NMNA 3AP5A 4MLOA 2QVSB 2X53S 5GALA 3AYCA 1ND3A 2VULA 3QLQA 4GH4B 2I74A 1ND3C 2WL1A 2NMOA 3GHNA 3AK0A 4AHWA 1DZTA 3USSA 4XPVA 1VBB1 4GMP0 4AWDA 2A6ZA 1MS9A 1AL21 2JG9B 4Q0QA 2A3XA 5DUXA 2AYHA 2WFF1 3N7JA 1D2QA 2OA2A 2RMU2 2XKOA 1EAH2 1COV1 4N53A 1VBB3 5F9TA 4SLIA 3GZUC 2LTNA 2RR11 1FNYA 4N53C 4YGEA 1O3RA 5I91A 4ZKTB 2IZWA 3D4KA 4KWJA 3VBUB 3VL9A 1YJKA 3SLIA 1OPMA 1AL23 3AKQA 3DV8A 1MS4A 2MPFA 4QQOA 2WFF3 2RJLA 1COV3 5FREA 3B94A 4XFGA 5FQ0A 1RUJ1 2WA3A 2A3YA 2RR13 3ZN6A 4N9IA 4XJAA 5E8AA 4LUMA 4M01A 5CB7A 2TUNA 1RHI1 4E9KA 1O3QA 1EPWA 3OD0A 4A7YA 1RUH2 2GALA 1Y7BA 1OD5A 3MICA 2DTWA 3ZYIB 4RS5A 1RUJ3 2IWGB 4JV4A 3KCCA 4RS5C 1EYBA 3M3EA 3AZXA 4HANA 1MS8A 1RHI3 3JB4C 1V6OA 2JKBA 1YI9A 1V00A 3IIAA 4FTSA 4QPGA 5IUQA 2H6BA 1GBGA 1H2NA 2YGLA 4EWEA 2HWB2 4UBGA 2Y26A 4G3YC 5JSRA 1OLRA 4NVPA 4Q4V1 3W58A 4JC1A 2ZGOA 2GSYA 1PGW1 5JSPA 3ZFGB 3M7AA 4CDUA 5K8SA 3TAYA 5HI0A 4CDUC 5FOJB 4TYSA 4EN9B 1OFSA 3RJRA 3ZXEA 2GMEA 5IK7A 4BWOA 5A3LA 3ILRA 4CDWB 4XJZA 3S7EA 4C1WA 2PHUA 4OULA 1LKNA 1DQ6A 4HKLA 4P9YA 2JE9A 4LHLA 4DXZA 2HWF1 1DQ1A 2BFUL 1Q8QA 5C8CB 4XEZA 2NM1A 4DRRA 4DS0A 3H1YA 3ALQA 4RSUA 1DGWX 3OPZA 1HXS2 3NAPA 4P9IA 4A3XA 3DPRA 1VB2A 4LNVA 1DQ5A 4WBBA 5DDJ2 5E88A 1Z78A 5A32A 3DPRC 1W6NA 3BPZA 3WCRA 4I09A 2HWF3 1HDKA 5BY5A 5T52A 3U11A 1RL3A 2VECA 1IKPA 4MGZE 1HV0A 3BOPA 2IFRA 3IWZA 2B9UA 3FUOA 1W6PB 4FAGA 1DFQA 4E4DX 3ZSJA 3RPQA 5JI9A 4FXGB 2D6PA 1NYWA 2JECA 5BNOA 1GQHA 4WM8A 5BNOC 1U5IA 2ZGSA 3AJZA 4AVAA 4WM8C 3FMGA 4DQAA 1ZBE2 3VBFB 4Q26A 2ZKLA 1VRH1 2H6CA 5CFCA 1LENA 5DUVA 5CFCC 4TWTA 1NY72 3ZX7A 5JIUA 4XBNA 2Y38A 4MUVA 1V6IA 3H7JA 4IV3B 2YZ4A 3FJSA 5CFDA 3KGLA 5KXDA 1VRH3 5CFDC 4META 4Y20B 4I02A 3JQXA 4RA0A 4CEWB 1Z7S1 2FZ1A 3EHKA 1W6QB 3HMYA 4BIOA 4E2GA 4AQTA 5JZGB 3FLRA 3TN92 3AFKA 4KU7A 4MXWA 2XJUA 4UW4A 3WQ1A 2TBVA 4QMAA 1C1LA 1WLWA 3IDCB 2EXHA 1IS6A 3CLPA 2E7TA 1Z7S3 2ZS6B 4GH4C 1N1VA 2EIGA 2EXIA 2RE9A 2G9FA 3SISA 2OZ6A 1SQ4A 5I0UA 5KHIA 2GZWA 2BEOA 1CAXB 2JG9C 1QOSA 1SCSA 2A5ZA 3R4UA 1GV9A 5JI7A 4C90A 4Y1YA 4NR1A 1LOCA 1CONA 1RUE1 1LRHA 3VKFC 1S0FA 3CL1A 2BTVC 1JUHA 1AYN2 1BKZA 1CIWA 4ATFA 3ZYJB 5BNNB 1QOOA 4EN7B 4PBOA 3M3QA 1RINA 2XH6A 2XJSA 4PF5A 3VGIA 1OHFA 1AR71 1RUE3 3MIDA 5CVRA 1GKBA 5C9AB 2FMYA 1Y43B 2ZMNA 4FPCA 1AR73 1PZ7A 4URTA 1QDOA 5GKAC 1WGPA 5LK5A 3WG3A 4ISQA 2B46X 2RS31 4Q0SA 4I30A 2YHJA 3R05A 1Q8OA 3VZOA 1G9BA 2WZR1 1SFNA 4K21A 2NQYA 5GZFA 1AYM2 4GMP1 5SV8A 1YXWA 1OA3A 2HYKA 2P3IA 1RJ7A 1QJU1 1QXRA 1MACA 1UZZA 1FV2A 2W0XA 3RDIA 2RS33 2DFCA 2D44A 2WZR3 5EYYA 1ZA4A 1FPN1 3ATGA 3FWEA 3TOJA 1FXZA 1QJU3 1OKQA 4XFIA 3GZAA 3AMHA 3NJZA 5GZCA 3WDYA 4PBPA 1ZYBA 3ZFGC 1VBE2 4RHV2 4AFBA 4XHXA 5JLVA 1QJY1 3IPVB 2PLV2 3AMQA 4FPJA 1H2KA 1FPN3 5JWPA 3HD8B 1ZRRA 3WW1A 4CDWA 4W6YA 4E27A 4FPFA 4CDWC 2WNVB 3PVBB 5JR7B 1REFA 3GYDA 4YSFA 3VZLA 3ILFA 5GLTA 3URFA 1U0AA 5ACA2 3Q9OA 1QJY3 4YRDA 2QZ3A 2VVFA 4ATEA 1D2SA 4EWAA 3V65A 1K5MA 4P14A 3DKWA 1K5MC 5AFEA 1RVF2 4BLIA 2WT2A 2XHKA 2PAMA 4IV1B 4EN6B 1LOFA 1SLCA 2R042 3DL3A 4HSJA 2HWC1 2VQ0A 1LOFC 4BPZA 4JQRA 2FHRA 4Y4YA 5I0RA 2P2KA 1JW6A 1H0BA 3VN4A 1RMU2 3DF0A 2O8QA 2PAKA 3SCHA 1A78A 2HWC3 2WT0A 4F8AA 4G9SB 4OLLA 4UBHA 5T5PA 4QQ2A 5EFUA 3POSA 4RGAA 4AK3A 2AR6A 3MYXA 2UU8A 1HW5A 1S1AA 5EXOA 1LU2A 3B93A 1RUC1 2NN8A 2YYOA 5J96B 1F2NA 1WBFA 3B9CA 5AC92 3AMPA 3VBOB 2IFWA 4B29A 4FOQA 1POV0 1X33A 2ZHLA 3MLLA 2OW4A 3I59B 5ABJB 1EV12 1SLLA 4Y20A 1YFYA 5KHGA 4HMZA 2VW1A 1DG6A 2VGDA 4CEWA 1W6QA 2ZGPA 1CJDA 4Z2WA 4CEWC 1BK1A 1DLLA 5L7OA 1I6XA 2R1BA 5L7OC 3MIEA 2XJTA 1FYUA 1MQTB 3WD5A 2W68A 1AR92 5KHKA 3M8LA 2XLFA 1QOTA 2I2SA 2HWD2 3NV2A 3MW2A 1UKGA 4K1ZA 4DMIA 1CD3G 3AKSA 3KMHA 3IBMA 1UW8A 1SFYA 2R6QA 1UIJA 4SBVA 3BU7A 3LB9A 1HRI1 1TQ5A 4AEKA 2FZ2A 3QD6A 5EV7A 1CAXA 1UMZA 2PHFA 4LHNA 2EA7A 4YM3A 3B02A 2LALA 4MXVA 4ZXKA 1KFUL 2R0HA 3MPBA 4KU8A 4DY3A 3E6BA 3WDTA 3SH3A 1HRI3 5JOXA 2JENA 1XQNA 1RUG1 4OHWA 4BH9A 4QM8A 2BFUS 1ULFA 5CAZA 1IHMA 3RJ2X 1CGPA 2A71A 4YW4A 4AVTA 1J1TA 1N1YA 3LGRA 2NPIA 2WKKA 3KQRA 1G86A 3NKTA 4HL0A 5C9AC 2O0OA 5FRAA 5JSOA 2E7AA 4AHXA 1RUG3 1S0EA 1CAVA 2RS51 2YY1A 2YGMA 1FOD2 2GC2A 2C5DA 1H8TB 3L2HA 3BALA 2XPJA 2QQPA 1AXZA 1J3QA 1VBA2 1Y9QA 3NO8A 3AXEA 2VOKA 1JOJA 2RS53 2WNUB 2ZAAA 5LK7B 2B45X 4QQHA 5GLWA 1H2LA 5J3UA 1V6LA 1JHNA 3KSCA 2EAAA 3I54A 3H1WA 4FOVA 2ZMLA 3WP3A 5KWRA 1RUNA 1PGL2 4YM1A 4FTEA 4R9AA 5LEKA