3ZN5A

Vp16, a capsid protein of bacteriophage p23-77 (vp16-virus-derived)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
169
structure length
169
Chain Sequence
QEAFNRIKALRPGARPATILRSGPEFSVYSGTQRVKVGEFVVPAGASWVLPNPVPVILKLYDTGGNQLPHTTDVFLAKRTKGFDFPEFLAKVQYASYYDLTEAQLRDAKFYQNILQTLSPLRAPQPPQGVVLREGDVLEVYVEAPAGVTVNLNDPRTRIELPIGVDNSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP16
publication title Bacteriophage P23-77 Capsid Protein Structures Reveal the Archetype of an Ancient Branch from a Major Virus Lineage.
pubmed doi rcsb
source organism Thermus phage p23-77
molecule tags Viral protein
total genus 32
structure length 169
sequence length 169
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zn5A00
3ZMOA 3ZN6B 3ZN5A 3ZN4A
chains in the Genus database with same CATH superfamily
2R49A 4HMZA 2GU9A 2O1QA 1G9AA 1X82A 3ZO0B 4NR1A 1YHFA 5FZ4A 2G4IA 3PVEA 3KLSA 4AAPA 3ETQA 3LD8A 4LR4A 5FV3A 2FDKA 1KQRA 1F15A 2O8OA 2WZR2 1FAYA 2OYZA 3PJQA 4XYXA 5CNAA 1JZ4A 4Y4YA 1CIWA 3I3BA 4A6SA 4EYUA 2IXKA 5SV5A 2OZJA 4RGAA 1MZFA 1NYWA 5FXZA 3WDTA 2ZAAA 2EAKA 3JBG2 2XBO3 3CJIC 1SCSA 5FYIA 3VBRB 4SBVA 5FPLA 1DQ1A 1LCLA 1QY4A 1XYOA 2VZQA 5JUVA 3VBSB 3NV2A 1VAVA 1I9RA 2DU0A 1RTVA 4BMEA 4OMDA 4C8DA 3HN1A 4GKXA 2DCJA 1G9BA 3VKNA 2X09A 4ARXA 3E5UA 2D6OX 1KFUL 1Z7S2 2OUHA 5JXHA 1BQPA 2GN3A 3VBOA 1ZBE3 4NOTA 3SCFA 1GWKA 2WR9A 1NQDA 3MFCA 4K20A 5T5OA 4KWLA 2JDNA 4QB1A 4B29A 2VM9A 4XJWA 4DO0A 1HDKA 1T6GC 1H8TB 2W68A 3VHOA 2WFF3 5IVFA 4I3PA 4MGKE 4UT5A 1U5ZA 1CZTA 3PL0A 2WO7A 2GP5A 1GYKA 5A3OA 1WW7A 3ZIWA 5JZGB 4BIOA 3GZEA 1GNZA 1JYTA 4XCBA 3WUDA 4IE0A 4HPKA 1NKGA 4E8CA 5F6KA 1E5HA 5ABJC 1CJPA 1HB4A 4LLOA 5A7NA 1IOAA 4WM7C 2B9VA 1AUYA 1UMZA 2E7AA 2EVXA 4Y1UA 5H9RA 3S6PA 4BWOA 3GBFA 1RUI1 3MUY1 1AR63 2X5IC 4LULA 1V9U2 2MEV1 2RM21 2A73B 3NNMA 5LW9A 3GXUA 3M7AA 5DDJ1 4QGNA 2W5FA 3OPTA 4PF5A 1GUIA 1SDDB 2WIIB 3AZZA 3OGSA 3ZFEB 1GFF2 1VBD1 3DCQA 1A34A 1TME1 5F5QA 2W3JA 5BNPA 3AVSA 3IDEA 5AVAA 2WO3A 4UWDA 1RUJ2 4YPJA 1MEC2 3UJOA 2LALA 2WO1A 4QX0A 4UXAA 5DABA 4FPLA 1KGYA 2HBUA 4Q29A 1RITA 2P5BA 3MICA 2DURA 2CV6A 2RS31 2ZS6B 4URTA 3AKTA 3KV9A 4PIZA 2LS6A 4Y1YA 1W2AX 4MGSA 5L36A 1H6XA 2NPIA 1AXZA 2C26A 2LW8A 1Y9QA 1BKZA 5CIRA 1REEA 3U07A 4CU7A 2D6MA 1HRI3 4MUVA 3DPRA 4DUXA 2GC1A 2QDRA 2CDOA 1G7YA 1R093 3GZUC 1CAUB 1N1VA 2BVVA 5A6ZA 4BQWA 1JOPA 4OZOA 2ZBJA 3O12A 3ILFA 5GM0A 2D5HA 3MPPG 1YIPA 5HBAA 5GLZA 1X36A 2QBXA 3GZAA 4L8QA 3AYEA 3HT1A 2OPWA 4QPIA 2VY0A 3FFZA 4K9SA 2VNRA 1APNA 4IEQA 1FPN2 4META 3WX5A 3ZVXA 3B9CA 4JAAA 4BISA 1N1SA 2IFWA 2KM2A 1JOJA 3H3LA 1ASJ3 2KXLA 3PUAA 4KQ7A 1V6IA 3ZYGA 2JE9A 3RFRA 1PMIA 2PFWA 1Z7S1 1RXGA 2R0HA 3K4ZA 2DVDA 2ES3A 2VBDA 3Q8AA 3WINE 3ES4A 5C5UA 1EUTA 1US3A 2BP6A 1GLHA 4UW5A 3MW3A 4HK9A 3MW2A 5F3IA 4AFMA 1OMIA 4CDQA 3AJYA 1ZREA 1MQTC 2WNOA 4F7ZA 3MIGA 1D7PM 2WNVC 1PO21 4PJYA 2ZGOA 3NSTA 5FKCA 1ENQA 4YW6A 4UFJA 4QHBA 3UK9A 4JC1A 3U1XA 1QJY3 1SLBA 3DKWA 1JHJA 3EB7A 2JG8C 5EWSA 2XJSA 2Y26A 2QQMA 5JPNB 4L9BA 4LA3A 4RQPA 5FYSA 1WLCA 4URAA 4E4HA 1W04A 4Q4Y3 1VBA2 1NAEA 1YFXA 4Q8LA 4GMP1 1AX1A 3KQRA 4AXOA 2E7TA 3WXPA 4LE4A 4IV3A 5FQ0B 3J7NA 2PTMA 3PU8A 1HLCA 3RYKA 3OSDA 3V65A 1EUUA 1NCRB 1Y7BA 5I0TA 1VMHA 1WCQA 4B7KA 1ULGA 4P9GA 4AG4A 2JDUA 5A1LA 4DS0A 4NIDA 2D97A 1O3QA 1SBDA 5F2WA 3AX4A 4I30A 2RDSA 3AP6A 1RUJ1 1K3IA 1MEC1 1RUF2 2XG3A 2XHKA 5FO8B 2FDHA 1W3VA 1XNTA 4S2GA 1LJ7A 4XAEA 2WA3A 5FYTA 3FHIB 4WZFA 5FO9B 3CJIA 2ATFA 2XH6A 2Y0OA 4N90A 4Q26A 2IXJA 2TBVA 1DQ0A 2GDFA 1ACCA 3D82A 1NY72 3LKJA 4BMBA 1POV0 1W28A 5JOZA 3N9MA 4AHWA 4QQ2A 4ZONA 3NKTA 1GP5A 3OUJA 4P9JA 3O1MA 4X6RB 1WGPA 3OOXA 1AJKA 4XILA 2PHLA 2WT2A 4UFKA 2UURA 1PK6A 2J1UA 3WCRA 1KS4A 2G19A 3SKVA 3LA2A 4M3CB 1XNDA 2JKBA 4AEDB 5JOXA 2VZOA 4FFGA 2XWBB 4ZXEA 2EXJA 2WT1A 1DGRA 4A44A 3IWZA 1UY3A 5K9YA 3OPZA 1C5IA 3DL3A 4XIOA 2ORXA 2ENRA 2F6BA 4GH4A 4BDVB 4LJHA 2ZZQA 3JB4C 4XF4A 3THDA 4RS5B 5T52A 5BV6A 2K2SA 2W1UA 2YMZA 5A3NA 2JG9B 5EXOA 2VZVA 2JDYA 3POGA 4P9IA 2OKXA 1ND3B 4AVSA 1EP0A 3O1SA 3K3NA 5J98B 1VB2A 5J09A 5F5CA 1W2NA 4DUWA 1H1MA 5DMYA 1JUIA 3UJQA 3A23A 2XHNA 3CBNA 4AFAA 1X50A 2V5YA 2R043 2KR2A 5DG1A 1O59A 2E33A 5F32A 2W46A 2XUMA 3AKPA 4WM7A 4OMCA 2ZGMA 1BK1A 4FP3A 2X5IA 4JTOA 4HK8A 5AVPA 2EAAA 2EXHA 5FZ0A 3FWEA 3MHZA 3IMNA 4G4FA 4XQDA 1V6OA 4OI1A 2IVJA 2I74A 3Q8FA 3RYRA 2VQTA 3EO6A 4NHLA 1ALYA 4KBZA 4YGDA 2BNNA 3WW4A 4JRLA 3TNPB 4R9CA 2X8KA 2QE3A 1U5XA 4CDWC 3T0DA 2UWBA 2P34A 2YPDA 3D3AA 5K0UC 3BIEA 3VBUB 2D6LX 5A32A 2OW4A 1VBA1 4LHSA 5JLVA 2GMEA 3N3HA 4BHPA 1RB8G 3WQ7A 1VB4A 2JB4A 4AZZA 2EIEA 4MVTA 2D98A 2VXRA 5A1AA 1OD5A 1HN1A 5GZDA 1UOJA 2R063 4DFSA 5IVVA 2BOIA 1VJ2A 2PAMA 3RDIA 1ZBA2 2R072 1YJKA 1L7LA 2ZX3A 3DYMA 1V6LA 3FHQA 3BIWE 3T1MA 4OFGA 2BRTA 2QQUA 1RUF1 1X33A 2RJLA 2YC0A 4DUVA 3UGGA 2RR13 3ELNA 1X9TA 2AREA 3HNYM 4XDQA 1IS6A 2Y6FA 2NMNA 1ODMA 1L7QA 1AL22 1MZ6A 3A0NA 4LBNA 4I2OA 5DQ0A 1NY71 3AP5A 1QJU3 1OT5A 4FTSA 4LO5B 3KWVA 4HBNA 5CBLA 4A41A 5A1FA 1RUD2 2RVAA 4R9BA 4QX5A 3CZJA 2Q5TA 2WDBA 2WWJA 4IGPA 5GKAC 1JZ2A 4I0AA 3CEWA 1J84A 1U12A 4FXKB 4OI2A 4YZ4A 1DLLA 3VBRC 4ZKTB 5FR3A 1NA1C 5LRSA 1FYUA 2HWF2 5A7SA 4ZPIA 4CCCA 2YFUA 4D7TA 1IQAA 1JU4A 3I54A 1VLNA 1YI7A 2LRPA 1V70A 3TNQA 4ATEA 2GZWA 4D7YA 5BNOA 4Q0QA 3DN7A 1D4M2 2WNVA 3ZFGA 3RZLA 4B1LA 1RVF3 1ZRDA 3H50A 3RRDA 4LIUA 1H9PA 1WLDA 1H4HA 2VAUA 5FY9A 2HEWF 2ZGUA 2A6WA 3LAGA 3UKVA 1I5ZA 2GN7A 2Y6GA 2A1XA 3ES1A 1AR73 3VKOA 3H8OA 5DG2A 4AWDA 2XMLA 5C3PA 1H8TC 1DGWA 1IS5A 1LOEA 2YV8A 5DZEA 4CDUC 4LBLA 3KB5A 1SFNA 5ERLA 3DPRB 4N53B 3AMQA 3I2GA 4EN9B 2D7FA 4OUEA 2WRAA 2YBPA 5FLJA 4XUQA 1W6OB 3VKFC 4GWJA 1EV12 3ZYJB 4MGTA 4C1XA 1UU6A 3T2QA 2B9UA 3PVOA 3LPFA 4RD7A 4NIHA 2AYHA 4QPIB 2F4LA 1OC1A 1ENSA 5EQUA 3ZSMA 1B35A 1YI9A 5KXEA 4FOQA 2W1SA 2IXHA 2IFRA 1VP6A 2ZHMA 2VTFA 1W6MA 3ZLIA 1QJX3 4N43A 4CUCA 1E5RA 4A4AA 2A75A 2OS2A 2W92A 3DGTA 1RUG3 2IXIA 2VZ3A 3WG1A 4FCAA 3S7EA 1W99A 4QDRA 1SFYA 1ZBA1 2R071 2NYYA 4WVWA 4EWDA 2RS53 2JECA 2R1DA 5J36A 4KNCA 5C5TA 3I3MA 4CCEA 3KZ4C 1KJLA 1W6QA 4NE9A 4C0BA 1X9PA 5FZAA 1FXZA 4QDSA 3GJBA 5LEKA 1COV1 1DZQA 1AL21 5FP3A 1VBB2 4JZRA 1QH7A 1VMFA 4L11A 4CEWC 3IZOA 1CESA 4LK7A 5D8AC 4PCRA 2Z4FA 4RQPB 1OLME 1HN0A 3FE5A 3MIDA 2TNFA 2QQNA 4B1MA 3OUIA 4YW2A 2YZ4A 3RZMA 2H0VA 2VOTA 4LITA 5CB7A 5LEJA 4IV3B 1DGRN 2WNUA 3ZSKA 4JX0A 1XJAA 2HWF1 4GKYA 5LA1A 1JTZX 1YQ8A 3JUUA 2QQKA 4P02B 2R30A 1WLWA 4Q4W2 1GNHA 1G86A 4M01A 4QKNA 4HN1A 1LOBA 4PDWB 1D4M1 1CWPA 4BXFA 3LOIA 2PLV3 1OXCA 3LB9A 1O5LA 4BYYA 4F3JA 5J3UA 4CDXB 2R32A 4XETA 4BB3A 4IEWA 4ASMB 4E4ZA 2ZHNA 1AR81 1UZVA 2VW0A 3AXEA 4IUGA 4XF9A 2ARAA 2QQWA 1QQP2 4CDWA 2E53A 2GNDA 1YQ2A 3I59A 1EPWA 4L99A 3U75A 2AEYA 1HB3A 2VECA 4H14A 4XFAA 4FPKA 1Q8PA 4RHV3 3SQOA 1PK6B 3HIFA 1C8M2 4Y20A 5GZFA 4CEYC 3VD4A 5L7OC 2W94A 1CIYA 1SMVA 3PUHA 5CFDC 1O4TA 5FK7A 4DXTA 4HFSA 2J1TA 4UOJA 2VO5A 1REDA 1EV11 3QBQA 3R05A 4TSVA 3KMHA 2PHWA 4MZUA 4ZU4A 3B01A 1W6NA 3AXDA 1S2EA 4GH4B 4GIQA 4CP0A 5DUUA 4FVVA 4EROA 1I1EA 2HWC2 3C7GA 5M0TA 4CP9B 1AJOA 2HWD3 3NAPA 5KR7A 4XAAA 5JOYA 4LORA 5L9BA 1OQ1A 4PIYA 3WNLA 3WQBA 3DKQA 1CJDA 2W08A 3B94A 3LEIA 1PO13 1KEXA 4HVRA 4QQLA 5A3WA 3ZPOA 4AI3A 5FPVA 5K8SA 1W3XA 3WDXA 1HB2A 1WW5A 3J8F3 4HVOA 4JKLA 2ZACA 4KWKA 5C4WB 1GZWA 1ZZ6A 3I49A 2DU1A 4XXPA 4I09A 1C4RA 5E1RA 4XZUG 3HBKA 4BA6A 1HKDA 4BIFA 1K42A 2WBKA 4H3WA 4DNYA 3R4UA 2VC9A 2E6VA 2WUHA 1PM7A 3DYPA 4QKDA 2WS92 1RYYA 2JD4A 4YG0A 4BXSV 1RHI2 2ZGRA 2B4KA 5I8YA 3MLKA 3BI3A 1LODA 1VBC2 3R4DB 3WW1A 5CA6A 1Y9GA 1VBB1 4BE3A 2VOKA 3ACGA 3TYJA 4EE2A 1RXFA 2ZMLA 3D8CA 4LOTA 3QLQA 2XKPA 1QKQA 1UNBA 3MV01 3FBYA 5A32B 4D7SA 4KGGA 5FZDA 3V0AA 5APAA 5BUVA 3T09A 1RC6A 3T08A 1O6UA 2YFZA 3WQ0A 3ZYHA 1QNYA 1QXPA 1AZDA 3K75B 5JI9A 5KXDA 2W95A 1J3RA 3I4IA 1H30A 3ZFFB 4OHXA 1Y9MA 2WFPA 4L2NA 4Q4W1 1Y43B 3M8LA 1C5HA 3QH6A 3ZKUA 3ZMOA 1C57A 2O0OA 3HNBM 2RMU2 1R082 1UIKA 3UESA 5KHGA 3W20A 4IQPA 3E6BA 1JN2P 2GP3A 4YM1A 3AMPA 3VBFA 2VR4A 3VDDA 2C5DA 2P37A 2GSYA 5BPXA 4KWUA 3N7MA 3RZJA 2WLPA 4QD2A 4QPGA 5SV8A 4P9LA 2OA2A 4Q4V2 3ZDSA 1V6KA 1QQP1 3H0OA 5T55A 5FDBA 4WM8C 3EJKA 4I3GA 2ZAHA 4ISQA 4P9WA 1C8M1 1JHNA 1AL0G 4NAOA 4KGQA 3KSCA 3KT1A 1N3QA 4W6XA 5FZ1A 4DRRA 3JXSA 1W8HA 4XMIA 3TEWA 3E6CC 3WP4A 3H7YA 3VBUC 3JD73 4AFCA 2HWC1 2CDPA 4RR3B 3THCA 4DXZA 4LA2A 5BNOB 3VL8A 2FCTA 4LIVA 4AHZA 3OGRA 4QKFA 3CMGA 3ZFGB 4E2QA 4P5YA 3M3CA 1CR7A 5LY1A 5E89A 2DWRA 3MF6A 3AFGA 2VQAA 1HRV1 2DVFA 5H9QA 1VBE2 4XBQA 3GCWA 3WNPA 4CEWA 5F7UA 4UFHA 2VUAA 2QQVA 3WZ1A 1S0IA 1ZNPA 4AL9A 4FFIA 5D8AA 1CZVA 5FY0A 5JIUA 1OF4A 4IGOA 4KL1A 3VZLA 1HQLA 4W50A 4HZFA 2BJSA 2P2KA 4IEXA 3W58A 2WS91 4U36A 1RHI1 2ZKLA 2AENA 1E5SA 4C1WA 1LGNA 2QNKA 4JTNA 1WCKA 4Q4X2 4LHNA 3WW2A 1AHSA 5FP7A 2IXCA 3KHCA 1Q8QA 4BU2A 1PGL2 1YFYA 1J3QA 1JYWA 3U11A 2MNGA 3HEIA 5D2AA 3VBHC 3LA3A 4WVMA 1MS1A 4OHZA 5B4NA 3N7KA 3LFMA 3VKLA 4B4PA 3JU9A 2VMFA 2I45A 4QM9A 4QMAA 1YLLA 4AI0A 1PIV3 5EHDA 1R1A2 5IK4A 4N43B 2P6CA 1EAH2 1R1A3 4PQ9A 2V09A 3T3YA 4JGYC 1W9TA 5FZ9A 1KRIA 2B7YA 2EXKA 2HWE2 2XONA 3T1LA 4Q1PA 3AK0A 1YRZA 2X10A 3IT8A 5FYUA 4BCUA 2RMU1 1R081 4FOVA 2XJRA 4XF0A 4AAXA 4CEYA 5L7OA 5CFDA 5A33A 2BV4A 3NO8A 1XNAA 1CPNA 1W6QB 1WCUA 2AUYA 3V0BA 3VDBA 3FL7A 4Y22A 4QU1A 3KF5A 1JMUB 3OD4A 1LHWA 4Q4V1 5C3SA 1K5MB 3ZM8A 1L3JA 3Q8EA 2JB8A 1H0BA 2JENA 2QCSB 5CVRA 3U4SA 4N53C 3HVDA 1W8NA 3R4SA 3ZSLA 4FO9A 3EXUA 3POJA 1JZ6A 3OEBA 5FY4A 2V5DA 4MXVA 1BEV3 4XDOA 1QHDA 2ZTNA 3RI9A 4GB31 2GC0A 3KVAA 2FZ2A 4AQ2A 4OZXA 3ZXAC 4KI5M 4Z07A 1AYM3 3I2JA 4R52A 1AX0A 1X8EA 1OLQA 2HYXA 1N3PA 4M4PA 3TRSB 3VDCA 5FZGA 4CYDA 2XL7A 5JDBA 2HWB2 3BALA 1OSGA 2WABA 4LBJA 3O1OA 3H1MA 1VBE1 4R4XA 4EQVA 5JI7A 4JV4A 4DINB 1ULEA 1RUE3 3HT2A 4XACA 3LDRA 1CZSA 4OUMA 2OXBA 2XJTA 1JYIA 4F83A 5KHJA 1F8VA 1FATA 4UFIA 1LHOA 5FZMA 2MEV3 2GC2A 2RM23 3ZYPA 3A21A 4QHOA 3GHMA 1H2MA 4YZ2A 4XZPA 5DN2A 2XVLA 3DYOA 2BEOA 3V56A 3I3QA 4W6WA 3AL5A 4CUAA 1AR93 4Q4X1 2OQ6A 1NCQB 1TMF1 1UY0A 4UI9L 1DZTA 2WNEA 2XBO2 1BVP1 3NJYA 3C3VA 1I6XA 4Y1ZA 2DTYA 3L2HA 1W6NB 4YVWC 5GLTA 4ZZ8A 2VUJA 4FTBA 4OLLA 1XOYA 3AMNA 4YW4A 5LY2A 5LK7B 3A4UA 4LNVA 3ZXLA 1GICA 3I8TA 3SISA 3PMEA 3NAPB 3ZX7A 2Q8OA 5LBCA 2RS33 3IDBB 1ZM1A 3OY8A 2FDIA 1M06G 3SH4A 3M1HA 5FOBB 3OYWA 2VUDA 5D21A 5FUPA 3CDZB 1EAH1 2FMYA 2ADDA 4NWWA 4W6YA 2HWE1 4JDNA 1QDCA 1ZBE2 2JDZA 1TVGA 4XXAA 1GQGA 4MSVA 3H1YA 3TAYA 2QTWB 5LCWL 4E8DA 4XJAA 2CNAA 1ZA4A 3T4HB 1YFUA 2B45X 5F2SA 2WFF2 1JXNA 4FTEA 4EZHA 5IUQA 1Y3TA 3BYWA 2Q8EA 1V6JA 2R0FA 2ZMKA 3ME2A 3GYDA 2VMHA 4COUA 1UYZA 1IPSA 2BDRA 4HANA 1PGW2 3BKZA 5FXWA 2W47A 2JDMA 3BOPA 4IW3A 4DRVA 4YVSA 3HQXA 3RNSA 2CYFA 1V0AA 2ZHKA 1AR62 2FDGA 1OBNA 2J7MA 3E5XA 1FI2A 3KF3A 1UPIA 4NN0A 1HV0A 4FAHA 5KXCA 2JKXA 4XW3A 3UT0A 4IXLA 3BPSA 2QQPA 3LSEA 3FMGA 5DZFA 4Y1VA 3O7OA 3AM2A 1UYPA 4I0WB 1PO23 3WG3A 4YM3A 4HVQA 5A3TA 1EY2A 2ADEA 3FLRA 5C9AC 2O14A 3FC0A 3PVNA 2TUNA 1O5UA 1CVNA 1W0PA 2BQPA 3VBFB 5CFCA 4YSFA 3U78A 2YGLA 3VDDB 3WG4A 2HWB1 3ZYRA 5C4WC 4PI2A 4XHBA 4PIXA 4QPGB 5IJRA 3HR9A 3MO4A 4R9DA 3ZN6A 4QDQA 3WT3A 1OOPB 2DUQA 2HH9A 3CHXA 3VBHA 5C8CA 1SLCA 1PM4A 2VVFA 4LK6A 3CIHA 1CAXA 3NVCA 4CUGA 1GWMA 3U14A 1W8WA 4GAZA 2Q0AA 1FX5A 1KD7A 4FFFA 4GXLA 3POSA 4RFRB 2WZR1 4K21A 1FNZA 5JOWA 1HJFA 1HRI2 2B42B 5A7PA 4B3NA 4H7MA 5HXMA 1O3RA 2XKOA 4L97A 4LO6B 2OQ7A 2VNOA 3VHNA 1R092 1QEXA 2VPVA 1R1ZA 1BBT3 4Q8KA 3JBG1 5JR2A 3NNJA 3KT4A 1ND2A 5FPXA 4QGMA 2YBKA 4D0QA 3EHKA 4QQOA 2DVAA 3AZXA 3O0VA 1SLLA 3AP7A 4B7EA 2EIBA 2CHHA 3SCHA 4AR2A 5FYMA 2E31A 4MXWA 4A2UA 3PIJA 3ZYBA 1ASJ2 3E1F1 4A7YA 4A7KA 4NRPA 1QOOA 1YO8A 2GALA 3AKQA 4Z92B 4ORFA 3K77A 2ARBA 3AZVA 3FX3A 3URFA 1ZBE1 4QXBA 4LQRA 4BQ3A 4FSJA 5BNNC 4BLIA 5KXBA 4M0HA 4R9AA 3ZPYA 4I01A 2BZDA 1NUKA 3ACHA 1W05A 4YGCA 2WFF1 3NMBA 1H1IA 1W6PA 2N7GA 1V6MA 3MDPA 5E8AA 1WZXA 2ARXA 4K8RB 4AYUA 4LBQD 4BQ4A 5JCTA 3H8UA 4AHXA 3X29B 1QJY2 1PZ8A 4AQSA 2CL2A 1WMEA 1XC6A 3MFAA 3WHTA 3WOGA 2VQUA 1UO9A 4WVMB 1RJ8A 4LOSA 1PGW1 5B4XA 3RSJA 4A7ZA 3K4DA 4DB5A 2HEYF 1CPMA 4XUTA 4DY5A 4Q4Y2 3WVJA 2EALA 1NE6A 3IPVA 5FXXA 1V9U1 3P5BA 3LF7A 1IKQA 3C7FA 4QX8A 3WF3A 1GV9A 1DQ5A 3EYPA 3EMRA 1HXS3 2WN2A 4LMFA 4Z2WA 2AEZA 4WVZA 1GQHA 3K48A 3LZZA 2RG4A 1G9FA 2ZGKA 5A33B 5J96B 2VOWA 4PBPA 3LQCA 3TN93 1H4GA 3NJVA 5F5IA 3V0BB 1QJFA 1DDLA 1GSLA 4CXWA 3O1PA 1AYN3 4Y22B 2EA7A 4EN8B 3LEKA 4NHMA 4PBOA 3TOJA 1VAMA 4JVAA 4IV1C 1OQDA 1RUC3 1W9YA 2DCYA 2XL9A 1XYPA 3WDVA 2JJ6A 1HRI1 1OPOA 5A3LA 3O0WA 4XBLA 1C3HA 1R091 2V72A 5FZ8A 3I3DA 4L0PA 4QWNA 2ZGQA 3LOBA 3GDBA 3OGVA 3KHBA 5JAXA 1BYHA 4CU8A 4DZGA 4YG6A 5K7PA 1CAWB 1SLTA 5FIXA 4WZCA 3SCGA 5BXXA 3PJYA 4AW7A 3H42B 3ENRA 3I97A 1ZZ8A 2BU9A 1RUH3 1ZA7A 3USUB 4ZS3A 2J1RA 2I07B 2WQZC 1FPN1 4RN5A 2D6NA 1ASJ1 5FZ3A 3PMSA 2EICA 3LA7A 1JBCA 3Q8CA 4TWTA 3GNEA 4K40A 1KFXL 4QX1A 4A3ZA 1OKQA 5EIYB 2DVBA 2R042 5ABJA 4NPLA 3ZN5A 1F4HA 1PGSA 2DFCA 3EQEA 5FZKA 2PHUA 3WG2A 4AEMA 2ERFA 5HCFA 2WZPP 1BK0A 1QJEA 2GMPA 4PLMA 5DUVA 4JGZC 4ZHNA 3HN3A 1U5YA 1K5MC 4CXXA 4ET7A 3LDBA 1XB9A 4B4QA 3TEZA 2OX0A 3MIBA 4AEKA 1QJY1 4O9GA 3C2UA 3LDKA 3POEA 1BZWA 2BWAA 2VTXJ 5E6HA 1OA2A 1PZ7A 5T54A 4XUOA 4UBHA 3RMYA 3OCPA 5HCBA 3KV5A 4X8PA 3BODA 3AMMA 3OG2A 5CZKA 3OY8B 2E32A 4Q4Y1 3MYXA 2VTXA 5H9PA 3HWJA 1FMD3 1MVQA 4XBNA 2F4PA 1LHNA 4QXCA 3N7LA 3KGLA 1UY4A 2ET1A 1GZ9A 4QAWA 5FP4A 1OH4A 4QB6A 4GULA 1YIFA 3HQRA 1HW5A 2R062 3AL6A 5FP9A 3VBOB 2B46X 4D8MA 5T3NA 5JXJA 3T2OA 1LU2A 2O8QA 4Q0SA 1N3OA 2VXJA 3GHNA 5C70A 5JMOA 4J25A 4NO4A 3RMXA 2XB6C 4AI1A 1LOAA 2HEVF 2RR12 3KV6A 4ITCA 1UD1A 4YGBA 4BM8A 4CUBA 4DPNA 3BTZA 1N1YA 4LBQA 3VZMA 3GZTB 3CO2A 1T6BX 2ZMNA 4KWJA 4ZXKA 4BH9A 1RJ7A 4CE8A 1AVBA 1CGPA 2FQPA 2QQLA 2AACA 5GALA 1QJU2 3MEPA 4HPKB 1IZ3A 2D5FA 3JCIA 1SCRA 4YZ1A 3TB0A 3I2KA 3LWCA 1A8MA 4YVSB 1NCQC 1SBEA 3GBGA 1S0JA 4IESA 1O91A 3OGGA 5J7MA 2RS13 2DV9A 4QPYA 2D3SA 2ZX2A 5FZFA 1OPMA 2I2SA 2D93A 3WDWA 2C4XA 4H55A 1XYNA 2EIDA 4LLFA 3SMHA 4IE5A 3VBSC 5F3GA 4IEZA 4R4ZA 1UWWA 2KD7A 1MACA 1H9WA 2YU2A 5FKBA 2EXIA 1MQTA 4CCLA 1COV3 1BJQA 1V6NA 1UZWA 4JDMA 4O61A 4XTPA 5CFCB 5BNPB 4CCDA 1RVF2 4ONUA 5KHKA 2OT7A 1VE0A 1Y4WA 3FHAA 5FPAA 1QH6A 2ZKNA 2PXJA 4FFHA 2FCUA 2XQRA 1MS5A 1AXKA 2WINB 4HT1T 5FMCA 5FJKA 1AR72 4H7LA 2JG8A 1UPSA 1VIWB 2PHRA 2R041 2OIIA 4K7JA 4NAMA 1JU3A 4A6OA 5IVBA 3WDYA 4WVVA 4YRDA 1Q56A 2HJIA 3IAQA 3RI8A 2NP0A 3E97A 5C3OA 5JZGC 4UW3A 4GQ7A 2P3KA 3ACFA 5T50A 4OQ9A 1O3TA 4GA9A 1UMHA 2WKKA 3T30A 3N9NA 3N7JA 3UETA 2VCBA 1Q8SA 1ND2B 2CAVA 1XPWA 4KBBA 3ABZA 4AVCA 1CONA 1DQ2A 1JOBA 1WW6A 1GANA 4FPGA 3M70A 3W9AA 1NX9A 3FLPA 3UKTA 3VKMA 5I0RA 2WA4A 2Q8CA 3VUOA 3J4UH 4YYOA 5CG8A 1BMV2 1AR83 1PVC3 2DCTA 4MXWB 5FBJA 1JODA 3H7JA 4XIKA 1IHMA 1ENXA 1OURA 4JDOA 4YZ3A 5AFEA 3MLLA 5C6CA 1C28A 1QJX2 1PNGA 3ZFEC 3AYAA 4FBFA 1RUG2 3MW4A 1FOD3 1DQ6A 2R061 2UWAA 2VZ1A 1LOFC 1RMU3 3WV6A 3RS6A 2WLQA 3GJAA 5FYHA 1WUVA 2RS52 3I7DA 1A8DA 4G3YC 4NHXA 4CDQB 2LUWA 2BBAA 1NZIA 2J1AA 4Y5TA 2C6SA 2RR11 3BGAA 1MS8A 5EV7A 3OGJA 3ITQA 4IEUA 3MLJA 4KG0A 4XEZA 4AOCA 5IAVA 2ZGPA 2D44A 4GMP0 2XWJB 3AC0A 4JCKA 4XFCA 4XQ4A 1ZZ7A 4IEYA 3WHUA 5L9RA 4CCMA 3D0SA 2A7AA 2VOVA 4CTEA 1XBFA 3B7MA 1QJU1 2P6HA 3C7OA 1O8SA 1LR5A 2Y60A 5AC93 3S0MA 1LU1A 1XE7A 1V00A 2JDKA 1RUD1 5ACA3 3OUHA 4FPFA 4YFWA 1XSRA 2G9ZA 3IPVB 4HXCA 1BXHA 1OUSA 2Y34A 3MUZ1 4MH0E 3T2PA 2GNTA 1XNBA 3WNOA 3ACIA 3MZHA 1GOHA 1ZX5A 5FZ7A 5DZGA 3CQOA 3MF9A 2B5HA 3SH5A 1VRH3 2AC1A 2DUOA 2JDPA 4JGZA 3WCSA 4AVVA 1H6YA 1LRHA 1F9KA 1RVF1 2PLV2 1H2LA 5FREA 1PX3A 1P8JA 2W1QA 4UYBA 5FXVA 2YHJA 4PLNA 1XNKA 2VZRA 1DBNA 3CJIB 2B8MA 4TLFA 3ST7A 5A70A 5LA9A 2QZ3A 3Q9OA 3VZOA 1NG0A 2YPJA 4AQTA 3PTRB 5FY8A 2DBIA 5FZHA 1OHFA 1WCDJ 5GZEA 3E6DA 5K0UA 2Z2SB 4HSLA 5LWBA 2D6KA 3K51A 4RHV2 5AFBA 5FZOA 3PIGA 4NHKA 1FV3A 3VL9A 5E88A 4DEQA 1ULDA 5GZGA 3BTXA 4Q0PA 2YY1A 4FPOB 2CSGA 5FZCA 2BUKA 5GJ6A 3USSA 1F2NA 1CX4A 1CX1A 2VH9A 4XF1A 5FMBA 4AI8A 4DXRA 4D3WA 2IWGB 2HWD2 3OBTA 1LNSA 1QNWA 3C8XA 1PO12 3ZXGA 1PHMA 2JXAA 1NCRC 4Q2FA 3VD7A 1Q5OA 3J8F2 4AHYA 2VL4A 1F35A 1MVEA 4Z8BA 4XDPA 5ABJB 3MIFA 4XJ9A 2E26A 1MZ5A 1DHKB 1C8NA 4WM7B 3LCPA 4M3CE 5T5PA 4BJ0A 2RS51 3SEPA 4GJZA 4K1ZA 4KG8A 3CJXA 4OVEA 2X5IB 3F2ZA 4Y5SA 3W5MA 2RDRA 1S4CA 2C24A 2ZGLA 4NHYA 5F5AA 3VBRA 1NA1A 1GU3A 2G9GA 1OUXA 5F3CA 4BPZA 5I91A 4K6BA 1BVVA 5L19A 1F31A 1NT0A 3WY6A 5FUIA 1H2NA 1O4YA 2Y38A 2CTVA 3SH3A 1HRV3 1J59A 1ONAA 2Z42A 3D6EA 3CZUA 3K4AA 1DG6A 3RYPA 4AEDC 3BN6A 4EJRA 1XNCA 2UWCA 3I2DA 3ECQA 2D43A 1WKYA 2GNBA 1JYXA 2C1FA 1LAJA 4RS5C 5JVVA 1H8TA 4Q1RA 4S2HA 1H1AA 2JG9C 4CDUA 4FPYA 2E51A 1SEFA 1ND3C 2VMIA 4YGEA 2Q1MA 3ZR5A 2FMDA 2BW8A 2PLV1 3WQ1A 2NM1A 2CY6A 1GQPA 2BNOA 1QOSA 1T2XA 1O8PA 1PX4A 2UY8A 5CYYA 1YNAA 3OBAA 2BOJA 1IGOA 3O1TA 4YW3A 5FLIA 1WWYA 5F8PA 2VGDA 4KMQA 4RHV1 2VG9A 2VULA 1HJGA 4YNIA 4L92A 1QF3A 4UFLA 1S0CA 1LESA 1QOTA 2PA7A 3ZDVA 5A3MA 1DCSA 1FT9A 1UIJA 1E5IA 2VZSA 5I8TA 2J1SA 3SLIA 2OVUA 2YBSA 4LKFA 2XVKA 4LT5A 3JD72 1H8VA 4N7IA 4OI0A 1MS3A 1TEIA 2D40A 1A6CA 4M3CF 2HWD1 1MQTB 4QX7A 3VD9A 2Q30A 3IIIA 3GF6A 4CCJA 3N36A 4LKDA 1OF3A 2WNVB 4LBKA 5HCAA 3GM8A 4CPBD 5IVEA 1SZBA 1W90A 4QXHA 1PO11 3ZXFA 4Y5Z0 1JYVA 2ZA9A 3NW4A 3L9JT 4BQYA 3J8F1 1SPPA 1DLCA 2DUPA 4COVA 1UXXX 2JG8B 3VHRA 5EJZB 1GZTA 4XJZA 3VZJA 1ZRRA 4IDZA 1OA4A 4K1YA 3WD5A 1YJLA 4GB33 1UW8A 4C90A 4KU7A 3AJZA 1WMDA 3WDUA 1LOGA 5LASA 2F17A 4COWA 5IATA 4COYA 5C3QA 1F4AA 5JR7B 4BLJA 1JS9A 3MI8A 3PDQA 3SNMA 2ORZA 1W06A 2ZCWA 1Q3EA 1VBC1 2BERA 3UKNA 4AE2A 3NNFA 3ETPA 2BGCA 3VGIA 4M4RA 3SKJE 4JKMA 4ZU7A 3AZWA 1POQA 4XHXA 2ZHLA 3DV8A 2E7QA 4U2AA 3B9IA 5FWEA 1B35B 2IUWA 3OTFA 2JIGA 4MYEA 1PIV2 1W8OA 2X29A 4NPRA 3ILNA 4P9XA 1W6MB 4YWAA 4RL7A 5FP8A 2QKDA 2E63A 5KHHA 4UF0A 5KC6A 1IKPA 4IE7A 4Z1VA 1YQ5A 4HOOA 2YUEA 3BU7A 1MS4A 1UY2A 3HOBA 1TMF3 3HPNA 3QOPA 4YG3A 3ZSJA 3LE0A 2JIJA 4GWIA 4OI4A 4XUNA 5LBEA 2H6CA 3NNGA 3HQUA 3SHRA 1N47A 4GALA 3MBWA 5IWFA 3I2OA 3I2HA 4MOAA 3EBRA 5IVCA 4TZDA 3NRUA 1UMIA 4FPHA 2XLFA 3AFKA 4Q5OA 4PF1A 3DPRC 3VV1A 3MGUA 2ZGNA 4HONA 4OYUA 5A80A 1K5JA 1UKRA 2PAEA 3B69A 1NCRA 5LRRA 3T0BA 1BEV2 3PVBB 4NWVA 1CQ9A 1IQDC 2WNUB 3ALQA 2PHXA 2WWSA 3PUSA 5L9VA 2ZXQA 5ISLA 2FDJA 2VOXA 3JD71 4QPIC 2QQIA 1AYM2 2VD7A 3SITA 5K4LA 4C0HA 3LPGA 3CKHA 4YW7A 1UN1A 3G6JB 1OH3A 1Z0HA 1PMJX 4UAPA 3HBZA 2WSVA 4CU6A 3KQ4B 4ZZ5A 1YFWA 5KBFA 1AX2A 1K12A 2EF6A 5GLWA 3R6SA 1DYOA 2DBNA 1EYBA 4P00B 1RUE2 5IK8A 2PHDA 1LHUA 1SQ4A 5EP9A 2VNVA 1GOGA 3JB8A 4CDWB 1RUI3 3I59B 1GP4A 2MEV2 2Q1FA 2RM22 2WSUA 4E27A 5K0UB 5FZOB 1S0EA 1W2UA 4Y20B 3G7DA 5DDJ3 5C71A 1POV1 1TNRA 4K3UA 1L7RA 1YYNA 1AR92 1NLQA 4RS5A 1DYKA 5KWRA 3RVHA 1VBD3 2VU9A 2IXLA 2VMGA 2YXSA 1MS9A 2C0ZA 4AGVA 1PGL1 3P1IA 1TME3 3AZYA 5J37A 3GCXA 4GD4A 1WA6X 4RQPC 4UW6A 4N7UA 3RZGA 2A71A 4OQ8A 1OI6A 4DEVA 2XR4A 5FCCA 2ET7A 2GNMA 2RS32 2YG0A 3AB0A 4CPBA 3BTYA 3BUCA 1MPXA 4IV3C 4MX3A 2YYOA 1ZZCA 2PHTA 3SXWA 2CGOA 4OHVA 1PIV1 4LKSA 1R1A1 2DYCA 2WZR3 3JZVA 1GZWB 3AMHA 4QT6A 4BK4A 1XRUA 3VN4A 1X7NA 3FJSA 4PDWC 4WM8A 2XJPA 3O5SA 3P3PA 4FAGA 1TZOA 3FZ3A 4Y3OA 5FK8A 3JBG3 4CDXC 1IG0A 4WBBA 3VLBB 1NA1B 2YGMA 3RZZA 1EPZA 3P3NA 3CLPA 1WW4A 3VBUA 3J9SA 2C9KA 4XJUA 1BCXA 4XPVA 3MPBA 1OQEA 1PK6C 2Y6KA 1G6NA 1N1TA 5FTTC 5DAQA 3WF4A 4MHUA 5FZBA 1DFQA 2XJQA 3WNXA 3ZYIB 1Z7S3 2DTWA 3T4VA 2ZABA 3KM5A 1BEV1 3V0AB 3ZXDA 5FMOL 5JMCA 4DMIA 3VD5A 1O4ZA 4C91A 4GH4C 1UXZA 3CU7A 5C7GA 5C33A 3SEEA 4HSJA 4S2FA 1AYM1 4CDUB 4QHZA 1GOFA 1PO22 3U0ZA 4BQXA 1U5IA 3W21A 3ZSEA 1DP0A 2Y8KA 2WZEA 1RIRA 3CF6E 1UYXA 5EYXA 5FPBA 1NOVA 5FYCA 2P3IA 4ES8A 4LXLA 1LEDA 1RUE1 5HV0A 1LB2A 5H9SA 1UU4A 1OVPA 3WSOA 2A6YA 2W2IA 1GMMA 3CNAA 4A3XA 3ASIA 3DUIA 4X8NA 1SFPA 1QMJA 1V9U3 4GMP3 4YFZA 4ES9A 1MR5A 2VVDA 5FPZA 1YQ6A 2WJSA 4TLGA 4BZ4A 4E4DX 1AR91 1KXGA 1BBT2 4JGYA 3FLTA 3VHPA 1W2OA 2VE1A 1W2TA 2XBO1 1BLZA 1W8ZA 4ATFA 1PZ9A 2DCZA 3K2OA 5F39A 4HN0A 4INDA 3TEXA 3ZOIA 1RUJ3 1MEC3 2CAUA 3B93A 2WC2A 1DGWX 1REFA 4O7XA 3C7EA 4LPLA 1ODNA 2JEMA 3BB6A 5EZWA 5A7QA 2XUEA 3THPA 2BPA2 4GJYA 5HCHA 1SPPB 4UBGA 3ZFFC 4AGGA 1JYCA 2GC3A 2VZPA 3B02A 4CEWB 3WF1A 3KV4A 4N53A 1XE0A 4AK3A 2P4EA 4XC9A 5D8AB 2NN8A 1SLIA 2Y0IA 4NIAA 1ZZBA 3ZXJA 1NLSA 1ULFA 4FOYA 1W6OA 5F6LB 1C1LA 3APBA 1LKNA 1K45A 3WEZA 5FMOS 1SLAA 3AYDA 2HLEA 5C8WA 5DAPA 2ZGTA 3U37A 3N35A 4LHKA 4X6QB 4A45A 3JQXA 4ZY9A 5A7WA 3UNPA 3KD4A 1FPN3 4N9IA 5J48A 4XFIA 2CU5A 2BGOA 3ZKYA 3J7HA 1DQ4A 1QIQA 1W8UA 3HJRA 1URXA 4O9EA 1AR61 2BVBA 2TEPA 4JQTA 5FRAA 5CKNA 1YUDA 3FBMA 4MGIE 2GH2A 1DU3D 4M00A 2ILMA 4RR3C 1O3SA 4HETA 5BNOC 3M3EA 1HXS2 3BCWA 3QACA 4UF0B 1J1TA 3ZFGC 4ZU5A 5HV4A 5FUNA 4WV8A 5IHRA 4CEYB 1D0HA 2CWMA 2MHFA 5L7OB 3O1RA 5CFDB 5IVJA 1YXWA 3TN92 1SHWB 5JXGA 1MZEA 3ILRA 5EYYA 1AYN2 1XSQA 1GP6A 1WA4A 3LSDA 4AF9A 2K9ZA 2PQSA 4MO3M 4EN6B 1KJRA 3IMMA 1C1FA 4YVWA 1LHVA 3GALA 2D6PA 1GZCA 5JSRA 4P08A 1VBA3 3IB3A 3VZKA 1RUC2 1UAIA 1G9DA 3OJBA 5FBZA 2ZEXA 2XOMA 4YW1A 1I3HA 3OD0A 2VW2A 4QU2A 5HXVA 4MG2A 1BBT1 3OBRA 1TQ5A 3ON7A 4J1XA 4PDWA 2JDAA 4LO8A 3SC7X 5JXIA 4I0BA 1A3KA 4HG6B 4AFDA 1RUF3 1QGLA 1B35C 4XTMA 3RJ2X 4BOWA 2QQOA 5T5LA 2WQ8A 1UX6A 2A6VA 2UYAA 2EIGA 3MIEA 4CDXA 1RUH2 3AP9A 3NL1A 5HPOA 2XVGA 4N43C 5FYVA 2RDQA 3WNMA 4IE6A 4Z82A 3I3EA 3PUQA 2VCAA 2Y33A 2ZEZA 2AR6A 2GAUA 4EN7B 5A7OA 3WNNA 4CA9A 5JIAA 2ZEWA 5F37A 5J1XA 3HD8B 1YWKA 1F5FA 4IEPA 5EJ1B 1KITA 3I2FA 5I0UA 1D0GA 3KVBA 1SG3A 1UZ0A 2RJKA 4UFMA 4CP9A 1XQNA 2WAOA 2G1MA 4PT6A 2ID4A 4KU8A 3P6BA 3KGZA 2XLGA 4R8HA 5C9AA 5FYBA 1UQXA 2SLIA 5C3RA 4TTGA 3A0KA 5IK5A 5FYYA 1W9SA 3QCWA 5FLHA 5C4WA 2VQ0A 1W03A 4W8JA 1WMXA 3M3OA 3RWKX 3ZIXA 1FMD2 2WNUC 2WT0A 5FY7A 2D3PA 2NQYA 2YDEA 3OYWB 1UOBA 3H8RA 4YZ5A 5DAXA 5JPMB 1ZRFA 2VMCA 3N9QA 4Y24A 4COZA 1HXS1 4WM8B 3M3IA 5C8CB 1JZ5A 4AQ6A 2Y6HA 3H3ZA 2WL1A 1OA3A 2YU1A 3N9PA 3TN91 2QDNA 4AVBA 1J58A 1QXJA 4P14A 1AXYA 4OULA 2XLAA 1AYN1 3I2IA 4DQAA 2ZJCA 2AZ5A 5FZ6A 2P1BA 1D4VB 4FT8A 3NJZA 3QD6A 3LEMA 1S0BA 1STMA 5LBFA 4TXWA 4AGRA 3NQHA 4LHLA 4S2DA 1UOGA 2Y6JA 1A78A 1RUC1 4Q0VA 2DCKA 4W65A 5F9TA 3PHMA 3AYCA 2CGPA 1LGBA 2VCMA 2VUCA 2RS12 4N8MA 3ZFFA 3WLUA 1SACA 5FFOC 2BYVE 4UW4A 2JDHA 3M2MA 5E16A 1E57A 2WYFA 3HMYA 4LEJA 4Q0UA 1ZBA3 2R073 5TSWA 4NJ4A 1B09A 1NXD1 3S5QA 3WP3A 4AI2A 5BNNA 1Q8OA 4GZ9A 1ZVFA 3NAPC 3POIA 3RG0A 5CKQA 2AGSA 2QJVA 2X53S 1RUH1 1COV2 4LBOA 4RSUA 5DUXA 3IM0A 1TG7A 3A22A 4OHWA 5CISA 1AL23 3N9OA 2XPJA 2WAAA 3KS7A 3O1VA 3ZMNA 1ULCA 2UY9A 1UF2C 1AF9A 3S57A 3ZN6B 3T0AA 3VBHB 3B3QE 2RV9A 1D2QA 1RUD3 2OPKA 3VDAA 1CAXB 4O65A 2BFUL 3INAA 3WUCA 3H1WA 1S2BA 3B00A 2CGNA 4IGQA 2HWF3 3FFQA 4OCTA 3J26N 5CAZA 1WLTA 3FUOA 3NKGA 3WW3A 4MHRA 2P3JA 4RR3A 1IS3A 3MV11 1X8MA 4IERA 4JGYB 5FY1A 1VMJA 3U4XA 3NNLA 2VZTA 5I0DA 2PELA 4YM0A 3RZKA 1W8FA 2PHFA 1D4M3 2ZGSA 4CXYA 3BPZA 3POYA 1W39A 2C9AA 5DPNA 4FP2A 3R0RA 4AI9A 1JUHA 2LM3A 4QX3A 5KHIA 4Y4RA 4I02A 1AR82 1PVC2 2BTVC 4SLIA 1FMD1 5IVYA 5A6XA 1DYPA 5FYZA 5IW0A 1NQJA 2JE8A 2DF7A 2A70A 1MS0A 4J1WA 5DAWA 4N9HA 5F3EA 5IT6A 2JE7A 4EV0A 1IPJA 1IG3A 2A6XA 1GBGA 1FOD2 4HKLA 4IV1A 1OLRA 5FY5A 2R1BA 4QQPA 1RMU2 1XXNA 1WBLA 5I8SA 3VBFC 5CG9A 3WR0A 3VDDC 4TN7A 1CD3G 3F95A 3LFIA 4F8AA 3NV4A 4QPGC 1EV13 3D4KA 3ORJA 1OOPC 2LROA 4DXSA 1J1LA 3BU0A 1W6PB 2IZWA 4DIQA 1WD4A 1WCSA 2W1WA 4KH9A 5F1RA 3PNAA 3UL2A 1UX7A 5A7WB 1YCIA 1KDMA 2GH8A 2RE9A 2Q1ZB 5LBBA 2UU8A 4JQRA 3RQ0A 3AP4A 1XU2A 4NRMA 5I0SA 3DXUA 2DDUA 4RYDA 1GR3A 4RFT0 1ENRA 2VNGA 5AC92 2L9LA 1W9WA 5FO7B 2Q4SA 2YC4A 3ZXEA 2BWCA 2KA3A 2RS11 4D6RA 4D6QA 2YC2A 3GGLA 2YB7A 5ACA2 4LO4B 1JZ7A 3O14A 5FWJA 1S1AA 2HKXA 2B39A 4XFFA 1U0AA 4CU9A 4EWAA 4CCOA 2BFUS 4MGZE 4XJ8A 1UY1A 2AH2A 5EFUA 1VRH2 1RGSA 4QKBA 2D3RA 4IL7A 2Y64A 3W59A 1K5MA 2V73A 1VBB3 3NV1A 4EWEA 2BGPA 3IBMA 3POFA 3WNKA 1VAKA 5FPUA 2A3WA 2ZOEB 3VZNA 4YVWB 1UL9A 5DUWA 3OEAA 5IK7A 3PU3A 1AR71 4D6SA 2J42A 2LTNA 4RGGA 1JI6A 5A6YA 1YQCA 2PAKA 4Q27A 2YROA 4J6GA 2VVEA 4V2VA 3HNMA 4H2AA 5CADA 4LE3A 4Y33A 3WP5A 4D69A 1F5JA 4B8EA 4DOUA 4G9SB 4MGQA 4FXGB 2XQXA 3RWNA 1HV1A 4JHTA 1DIWA 2QZ2A 4PQQA 1IS4A 4Q4W3 4HL0A 1UZZA 1CAVA 4QM8A 5D1IA 1UOFA 2VJXA 2HYKA 4FPCA 2IC1A 4LBMA 4NRQA 3ROUA 3ZXKA 2WN3A 1G8WA 2NZ9A 3V64A 4FQ4A 1PVC1 3S5AA 1BMV1 2MPFA 2P17A 1QQP3 4V2WA 3PURA 1S55A 2VW1A 1J83A 3BVCA 1QJX1 3KCYA 4NIGA 4HKWA 4QXKA 4Y26A 1FOD1 4XFBA 1RUG1 3CL1A 1DF0A 2QVSB 1C8M3 3IN9A 2FDFA 1RMU1 3TEYA 2IVIB 4LUKA 4CP2A 2VMEA 4AFBA 2G9FA 2P3YA 1NCQA 2GMMA 2CWSA 3POWA 4E2GA 1JYNA 3O0XA 1RUNA 1W8TA 1Q43A 2E9QA 3LIGA 2SBAA 2W91A 5LZ6A 1SBFA 3S7IA 1HQWA 5A3UA 5JWPA 1NE4A 2HWC3 4IE4A 4MGYE 3VBSA 4CP1A 1HQNA 5CU1A 3BTAA 2ZEYA 2FZ1A 4NVPA 4CRQA 3OPWA 5C9AB 3L2YA 4XFHA 1YC61 5CEHA 1HRV2 5T5JA 5AC91 4XUPA 3N4MA 1W0OA 2BBVA 3QH7A 1DZRA 3ACLA 3THTA 3UGHA 4FPJA 4NUBA 2RHPA 5ACA1 2VCCA 3JQWA 1FV2A 1LTEA 4QX2A 1Q8VA 1RL3A 3D0JA 2PN5A 5G04L 3DEMA 4GWMA 4Y1XA 3WP6A 2W39A 2WS93 1VPHA 1VRBA 4XCAA 5FZEA 1TE1B 1RHI3 2K0GA 3NV3A 5HI0A 1VRH1 3OF1A 3C7HA 5JZGA 5LB6A 3LIHA 5IFPA 1PVXA 1VBC3 5DAVA 2H0BA 2PQQA 2QFEA 4QGLA 2NLRA 4XFGA 5ANNA 1ZRCA 5GZCA 4LO7A 2A6ZA 2PYTA 3VD3A 5FZIA 4LBQB 3IDAA 1HB1A 4K8FA 3OB8A 4BQ2A 2ZX0A 2A3YA 4XE9A 2ZPXA 3RPQA 4XQWA 4ZS2A 1QJZA 2HBTA 3ZR6A 3WF0A 5B2GB 5GLVA 4QB2A 1I5PA 4XVHA 5FZLA 5LK5A 3Q8BA 1CN1A 4OHYA 2ARCA 3ZFEA 3FUQA 3J7LA 1KS5A 1GNYA 5IFTA 2RDNA 1R083 2RMU3 4FPEA 4CVUA 5BNNB 1LOFA 4LTAA 3M4FA 5LA0A 2FCVA 4IEOA 1QWRA 3E5QA 5L73A 1S0DA 3IKWA 3NJXA 2WZ8A 3UYJA 2VMDA 1OVSA 1OOPA 4Z2AA 3AVRA 1US2A 1ULOA 4Q4V3 1W9FA 1GKBA 2Y6LA 4HLTA 2RJ2A 4ISRA 4MLOA 1GWLA 3J7MA 3RJRA 5I93A 3HAGA 4LUMA 4XF3A 4D94A 1UZYA 1TNFA 4DY3A 3VBOC 1ZRIA 4PHZA 1RINA 2VBBA 4HKOA 1ST8A 1NZCA 4MADA 3TBDA 4CZSA 4FOWA 3ZYFA 3RZHA 1UU5A 2DVGA 2XGXA 1QU0A 4GB32 2W52A 4V1PA 2W0XA 2Z79A 3MIHA 1CAUA 2VZUA 5DXDA 2J1VA 5FJHA 3UGFA 5EPAA 3PUIA 3UV9A 5FOJB 1LEMA 1H2KA 3K46A 1UKGA 4ASLA 4IEVA 4JHZA 1XE8A 4LKEA 4YM2A 1LENA 2XJUA 2JICA 1LULA 2OZ6A 1WBFA 3IDCB 1D2SA 4RGKA 1LECA 2NMOA 4YVSC 2A3XA 3DECA 1UCXA 4E2SA 4YW5A 1VBE3 3W5NA 5CKMA 1OLMA 1OFNA 3DF0A 1IPKA 1O7FA 2DFBA 2FBEA 3K3OA 5BYNA 5IYYA 4PI0A 1JW6A 2FD8A 2WWUA 2V4VA 3KT7A 2K46A 4IV1B 4NROA 4XABA 4TYSA 1G9CA 4BK5A 1ZYBA 3POBA 1WMFA 1POV3 2Z5WA 3OBZA 5CFCC 5BY5A 3D5OA 5BNPC 1UYYA 1OD3A 5BNQA 4QQHA 1WD3A 3H9AA 1BHGA 1TMF2 4Q4X3 2X05A 2JWPA 1PMHX 1QXRA 2QUOA 4CSWA 2WQ4A 4QPWA 1RUOA 4PLOA 4IETA 5C8CC 3IAPA 1NLRA 4E9KA 4OUSA 4BQ1A 1KDKA 2OUJA 3LGRA 2R6QA 1VR3A 5ANQA 4NPMA 1S2KA 1W0NA 3S30A 2ZZJA 1SDWA 2R7EB 2W9XA 2WYSA 4FQZA 4JRAA 1Z78A 4NIIA 4AVAA 2V4AA 2JD9A 5FQ0A 1NXMA 3ZN4A 1EAH3 3AKSA 3H8XA 2BNMA 3N9LA 2XXZA 4A42A 4XMAA 4W4ZA 1ND2C 2HWE3 3AKRA 3ATGA 1DGLA 1JZ3A 1LGCA 1QDOA 3NWKA 4P5HA 2W87A 2PMWB 5EJ3A 3IIAA 4ASKA 5JSPA 3T2TA 3PTYA 4FI9A 1VALA 4MV2A 1OKOA 5LATA 4YARA 3DXTA 3FN9A 2Z69A 1J3PA 4EN0A 5A6QA 1S0GA 5LA2A 3A7QA 4JGZB 5FAXA 3PLQA 4JKKA 2UYBA 1JZ8A 1S0FA 4XOGA 3O1UA 3B5LB 5GLUA 2JX9A 3BOWA 1JH5A 5JSOA 4AVTA 1OFSA 1YEWA 3KCXA 4CCNA 4M0NA 3VB9A 1FNYA 2ETEA 3GBWA 1RUI2 4EZ4A 4CDQC 5IAXA 4M3CA 1HIXA 1R64A 1PNFA 4AEJA 4AEDA 4CCKA 2R16A 2FHRA 5KC5A 2J22A 1ZZ9A 5DDJ2 2ZX4A 4GWNA 2XDVA 1CAWA 3WF2A 4B4RA 2QQJA 1HX6A 2ZX1A 5A3PA 1LOCA 3U10A 1ULPA 1VBD2 3LEGA 4XURA 1CAVB 2VBPA 3USUA 5G05L 2JG9A 1TME2 5FMDA 2J1EA 3KCCA 1XU1A 4RA0A 1ND3A 4E4SA 2A5ZA 2WO2A 2XJVA 2H6BA 1M4WA 2HWB3 3H3UA 4NMIA 4P9YA 4ARYA 4BQ5A 3RGBA 3TWIA 2Q8DA 4YLZA 3M3QA
chains in the Genus database with same CATH topology
2R49A 4HMZA 2GU9A 2O1QA 1G9AA 1X82A 3ZO0B 4NR1A 1YHFA 2G4IA 3PVEA 3KLSA 3ETQA 4LR4A 1KQRA 2O8OA 2WZR2 1FAYA 2OYZA 3PJQA 4XYXA 5CNAA 4Y4YA 1CIWA 2IXKA 5SV5A 2OZJA 4RGAA 1MZFA 1NYWA 3WDTA 2ZAAA 2EAKA 3JBG2 2XBO3 3CJIC 1SCSA 3VBRB 4SBVA 1DQ1A 1LCLA 1QY4A 1XYOA 3VBSB 3NV2A 1VAVA 1I9RA 2DU0A 1RTVA 4BMEA 3HN1A 4GKXA 2DCJA 1G9BA 3VKNA 3E5UA 2D6OX 1KFUL 1Z7S2 2OUHA 1BQPA 2GN3A 3VBOA 1ZBE3 4NOTA 3SCFA 1NQDA 3MFCA 4K20A 5T5OA 4KWLA 4B29A 4XJWA 1HDKA 1T6GC 1H8TB 2W68A 3VHOA 2WFF3 4I3PA 4MGKE 1U5ZA 1GYKA 3ZIWA 1WW7A 5JZGB 4BIOA 1GNZA 3WUDA 4HPKA 5F6KA 5ABJC 1CJPA 4LLOA 1IOAA 4WM7C 1AUYA 1UMZA 2E7AA 2EVXA 4Y1UA 5H9RA 3S6PA 4BWOA 3GBFA 1RUI1 1AR63 2X5IC 4LULA 1V9U2 2MEV1 2RM21 2A73B 3M7AA 5DDJ1 4QGNA 4PF5A 2WIIB 3AZZA 3ZFEB 1GFF2 1VBD1 1TME1 5F5QA 5BNPA 3IDEA 5AVAA 1RUJ2 3UJOA 1MEC2 2LALA 4UXAA 4FPLA 4Q29A 1RITA 3MICA 2DURA 2CV6A 2RS31 2ZS6B 4URTA 3AKTA 4PIZA 4Y1YA 5L36A 2NPIA 1AXZA 1Y9QA 1BKZA 5CIRA 1REEA 3U07A 2D6MA 1HRI3 3DPRA 2GC1A 2QDRA 1G7YA 1R093 3GZUC 1CAUB 1N1VA 2BVVA 2ZBJA 3O12A 3ILFA 5GM0A 2D5HA 3MPPG 1YIPA 5HBAA 5GLZA 1X36A 3GZAA 4L8QA 3AYEA 3HT1A 4QPIA 2VY0A 3FFZA 4K9SA 2VNRA 1APNA 4IEQA 1FPN2 4META 3WX5A 3ZVXA 3B9CA 4JAAA 1N1SA 2IFWA 2KM2A 1JOJA 1ASJ3 2KXLA 4KQ7A 3ZYGA 1V6IA 2JE9A 1PMIA 2PFWA 1Z7S1 2R0HA 2DVDA 2ES3A 3WINE 3ES4A 1GLHA 4UW5A 3MW3A 4HK9A 3MW2A 4AFMA 1OMIA 4CDQA 3AJYA 1ZREA 1MQTC 4F7ZA 3MIGA 2WNVC 1PO21 4PJYA 2ZGOA 3NSTA 1ENQA 4QHBA 3UK9A 4JC1A 1QJY3 1SLBA 3DKWA 2JG8C 5EWSA 2XJSA 2Y26A 5JPNB 4L9BA 4LA3A 4RQPA 1WLCA 4Q4Y3 1VBA2 1YFXA 4Q8LA 4GMP1 1AX1A 3KQRA 4AXOA 2E7TA 3WXPA 4LE4A 4IV3A 5FQ0B 2PTMA 1HLCA 3RYKA 3V65A 1NCRB 1Y7BA 5I0TA 4B7KA 1ULGA 4P9GA 4AG4A 4DS0A 2D97A 1O3QA 1SBDA 3AX4A 4I30A 3AP6A 1RUJ1 1RUF2 1MEC1 2XG3A 2XHKA 5FO8B 4S2GA 1LJ7A 2WA3A 3FHIB 4WZFA 5FO9B 3CJIA 2ATFA 2XH6A 2Y0OA 4N90A 4Q26A 2IXJA 2TBVA 1DQ0A 2GDFA 3D82A 3LKJA 1NY72 4BMBA 1POV0 5JOZA 4AHWA 4QQ2A 3NKTA 4P9JA 4X6RB 1WGPA 1AJKA 4XILA 2PHLA 2WT2A 2UURA 1PK6A 3WCRA 1KS4A 3LA2A 4M3CB 1XNDA 2JKBA 4AEDB 5JOXA 2XWBB 2EXJA 2WT1A 1DGRA 3IWZA 5K9YA 3OPZA 1C5IA 3DL3A 4XIOA 2ENRA 2F6BA 4GH4A 2ZZQA 3JB4C 4XF4A 4RS5B 5T52A 5BV6A 2K2SA 2YMZA 2JG9B 5EXOA 4P9IA 1ND3B 4AVSA 1EP0A 5J98B 1VB2A 5J09A 1H1MA 1JUIA 3UJQA 4AFAA 1X50A 2V5YA 2R043 5DG1A 3AKPA 2XUMA 4WM7A 2ZGMA 1BK1A 4FP3A 2X5IA 4JTOA 4HK8A 5AVPA 2EAAA 2EXHA 3FWEA 3IMNA 4G4FA 4XQDA 1V6OA 4OI1A 2I74A 3RYRA 3EO6A 4NHLA 1ALYA 4YGDA 2BNNA 3WW4A 4JRLA 3TNPB 4R9CA 2X8KA 2QE3A 1U5XA 4CDWC 2UWBA 2P34A 5K0UC 3VBUB 2D6LX 5A32A 2OW4A 1VBA1 5JLVA 2GMEA 3N3HA 4BHPA 1RB8G 3WQ7A 1VB4A 4MVTA 2D98A 2VXRA 1OD5A 5GZDA 2R063 4DFSA 1VJ2A 2PAMA 3RDIA 1ZBA2 2R072 1YJKA 2ZX3A 1V6LA 3BIWE 3T1MA 4OFGA 2YC0A 1RUF1 1X33A 2RJLA 2RR13 3ELNA 2AREA 4XDQA 1IS6A 2NMNA 1AL22 1MZ6A 3A0NA 4LBNA 4I2OA 1NY71 3AP5A 1QJU3 4FTSA 4LO5B 4HBNA 5CBLA 1RUD2 4R9BA 4QX5A 2Q5TA 5GKAC 4I0AA 3CEWA 1U12A 4FXKB 4OI2A 4YZ4A 3VBRC 1DLLA 4ZKTB 1NA1C 5LRSA 1FYUA 2HWF2 4D7TA 1IQAA 3I54A 3TNQA 1VLNA 1YI7A 4D7YA 1V70A 4ATEA 5BNOA 2GZWA 4Q0QA 3DN7A 1D4M2 2WNVA 3ZFGA 1RVF3 1ZRDA 3H50A 3RRDA 1H9PA 1WLDA 1H4HA 2HEWF 2ZGUA 2A6WA 3LAGA 3UKVA 1I5ZA 2GN7A 3ES1A 1AR73 3VKOA 5DG2A 4AWDA 1H8TC 1DGWA 1IS5A 1LOEA 2YV8A 5DZEA 4CDUC 4LBLA 3KB5A 1SFNA 3DPRB 4N53B 3AMQA 4EN9B 2D7FA 5FLJA 1W6OB 3VKFC 1EV12 3ZYJB 4C1XA 1UU6A 2B9UA 3PVOA 4RD7A 2AYHA 4QPIB 1ENSA 3ZSMA 5KXEA 1B35A 1YI9A 4FOQA 2IXHA 2IFRA 1VP6A 2ZHMA 1W6MA 1QJX3 4N43A 2A75A 3DGTA 1RUG3 2IXIA 3WG1A 4FCAA 3S7EA 1SFYA 1ZBA1 2R071 2NYYA 4WVWA 4EWDA 2RS53 2JECA 2R1DA 5J36A 4KNCA 3KZ4C 1KJLA 1W6QA 4C0BA 1FXZA 5LEKA 1COV1 1DZQA 1AL21 1VBB2 1QH7A 4L11A 4CEWC 1CESA 5D8AC 4PCRA 4RQPB 3FE5A 3MIDA 2TNFA 4YW2A 2YZ4A 2H0VA 5CB7A 5LEJA 4IV3B 1DGRN 2WNUA 3ZSKA 2HWF1 4GKYA 1JTZX 3JUUA 2R30A 1WLWA 4Q4W2 1GNHA 1G86A 4M01A 4HN1A 1LOBA 4PDWB 1D4M1 3LOIA 2PLV3 3LB9A 1O5LA 4BYYA 4F3JA 5J3UA 4CDXB 2R32A 4XETA 4IEWA 4ASMB 4E4ZA 2ZHNA 1AR81 2VW0A 3AXEA 4XF9A 1QQP2 4CDWA 2E53A 2GNDA 3I59A 1EPWA 4L99A 2VECA 4H14A 4XFAA 4FPKA 1Q8PA 4RHV3 1PK6B 3HIFA 1C8M2 4Y20A 5GZFA 4CEYC 5L7OC 5CFDC 1SMVA 1O4TA 4HFSA 1REDA 1EV11 3QBQA 3R05A 4TSVA 3KMHA 2PHWA 4MZUA 4ZU4A 3B01A 1W6NA 3AXDA 4GH4B 4GIQA 4CP0A 4EROA 5DUUA 4FVVA 1I1EA 2HWC2 1AJOA 2HWD3 3NAPA 5JOYA 1OQ1A 4PIYA 1CJDA 2W08A 3B94A 4QQLA 1PO13 4HVRA 4AI3A 5K8SA 3WDXA 1WW5A 3J8F3 4HVOA 4KWKA 2ZACA 5C4WB 1GZWA 1ZZ6A 2DU1A 4XXPA 4I09A 1C4RA 5E1RA 4BA6A 1HKDA 4BIFA 4H3WA 4DNYA 3R4UA 2E6VA 4C91A 1PM7A 4YG0A 2WS92 2JD4A 1RHI2 2ZGRA 5I8YA 3MLKA 1LODA 1VBC2 3R4DB 3WW1A 5CA6A 1VBB1 4BE3A 2VOKA 3TYJA 3D8CA 2ZMLA 3QLQA 2XKPA 1QKQA 3FBYA 5A32B 4D7SA 4KGGA 3V0AA 5BUVA 1RC6A 3WQ0A 1QNYA 1QXPA 1AZDA 5KXDA 5JI9A 1J3RA 3I4IA 1H30A 3ZFFB 4OHXA 2WFPA 4L2NA 4Q4W1 1Y43B 3M8LA 1C5HA 3QH6A 3ZMOA 1C57A 2O0OA 2RMU2 1R082 1UIKA 5KHGA 4IQPA 3E6BA 1JN2P 4YM1A 3VBFA 3AMPA 3VDDA 2C5DA 2P37A 2GSYA 5BPXA 3N7MA 2WLPA 4QD2A 4QPGA 5SV8A 4P9LA 2OA2A 4Q4V2 3ZDSA 1V6KA 1QQP1 3H0OA 5T55A 5FDBA 4WM8C 3EJKA 4I3GA 2ZAHA 4ISQA 4P9WA 1C8M1 1JHNA 1AL0G 4KGQA 3KSCA 3KT1A 1N3QA 4W6XA 4DRRA 4XMIA 3E6CC 3WP4A 3H7YA 3VBUC 3JD73 4AFCA 2HWC1 4RR3B 4DXZA 5BNOB 4LA2A 3VL8A 4AHZA 3ZFGB 4E2QA 3M3CA 1CR7A 5E89A 2DWRA 3MF6A 3AFGA 2VQAA 1HRV1 2DVFA 5H9QA 1VBE2 4XBQA 4CEWA 2VUAA 3WZ1A 1S0IA 1ZNPA 5D8AA 5JIUA 4KL1A 3VZLA 1HQLA 4HZFA 2P2KA 4IEXA 3W58A 2WS91 4U36A 1RHI1 2ZKLA 2AENA 4C1WA 1LGNA 2QNKA 4JTNA 1WCKA 4Q4X2 4LHNA 3WW2A 1AHSA 2IXCA 1Q8QA 1PGL2 1YFYA 1J3QA 3U11A 2MNGA 3VBHC 3LA3A 4WVMA 1MS1A 4OHZA 3N7KA 3VKLA 4B4PA 3JU9A 4QM9A 2I45A 4QMAA 1YLLA 4AI0A 1PIV3 5IK4A 1R1A2 4N43B 1EAH2 1R1A3 4PQ9A 2V09A 4JGYC 1KRIA 2B7YA 2EXKA 2HWE2 3T1LA 4Q1PA 3AK0A 1YRZA 3IT8A 4BCUA 2RMU1 1R081 4FOVA 2XJRA 4XF0A 4CEYA 5L7OA 5CFDA 5A33A 3NO8A 1CPNA 1W6QB 2AUYA 3V0BA 4Y22A 4Q4V1 3OD4A 1LHWA 1K5MB 1L3JA 1H0BA 2JENA 2QCSB 5CVRA 4N53C 3R4SA 3ZSLA 4FO9A 3EXUA 4MXVA 1BEV3 3RI9A 1QHDA 2ZTNA 4GB31 2GC0A 2FZ2A 4AQ2A 4OZXA 3ZXAC 4Z07A 1AYM3 4R52A 1AX0A 1X8EA 1OLQA 1N3PA 3TRSB 4CYDA 2XL7A 5JDBA 2HWB2 3BALA 1OSGA 4LBJA 3H1MA 1VBE1 4R4XA 5JI7A 4JV4A 4DINB 1ULEA 1RUE3 3HT2A 4OUMA 2XJTA 4F83A 5KHJA 1F8VA 1FATA 1LHOA 2MEV3 2GC2A 2RM23 3ZYPA 3GHMA 1H2MA 4YZ2A 4XZPA 2XVLA 3V56A 2BEOA 4W6WA 1AR93 4Q4X1 1NCQB 1TMF1 1DZTA 2WNEA 2XBO2 1BVP1 3C3VA 1I6XA 4Y1ZA 2DTYA 3L2HA 1W6NB 4YVWC 5GLTA 4FTBA 2VUJA 4OLLA 3AMNA 4YW4A 5LK7B 3A4UA 4LNVA 3ZXLA 1GICA 3I8TA 3SISA 3PMEA 3NAPB 3ZX7A 2Q8OA 2RS33 3IDBB 1ZM1A 3OY8A 1M06G 3SH4A 3M1HA 5FOBB 3OYWA 1EAH1 2FMYA 4NWWA 4W6YA 2HWE1 4JDNA 1QDCA 1ZBE2 2JDZA 4XXAA 1GQGA 4MSVA 3H1YA 3TAYA 4XJAA 2CNAA 1ZA4A 1YFUA 2B45X 2WFF2 1JXNA 4FTEA 5IUQA 1Y3TA 1V6JA 2R0FA 2ZMKA 3ME2A 3GYDA 2VMHA 4COUA 4HANA 1PGW2 3BOPA 4DRVA 4YVSA 3HQXA 3RNSA 2CYFA 2ZHKA 1AR62 3E5XA 1FI2A 1UPIA 4NN0A 1HV0A 4FAHA 5KXCA 4XW3A 4IXLA 2QQPA 3LSEA 3FMGA 5DZFA 4Y1VA 3O7OA 3AM2A 4I0WB 3WG3A 1PO23 4YM3A 4HVQA 5C9AC 1EY2A 3FLRA 3FC0A 3PVNA 2TUNA 1O5UA 1CVNA 1W0PA 2BQPA 3VBFB 5CFCA 4YSFA 3ZYRA 2YGLA 3VDDB 3WG4A 2HWB1 5C4WC 4XHBA 4PIXA 4QPGB 3ZN6A 3HR9A 4R9DA 4C90A 1JYIA 3WT3A 1OOPB 2DUQA 3VBHA 5C8CA 1SLCA 2VVFA 1CAXA 3NVCA 2Q0AA 1FX5A 1KD7A 4GXLA 3POSA 2WZR1 4K21A 1FNZA 5JOWA 1O3RA 1HRI2 2B42B 4B3NA 4H7MA 2XKOA 4L97A 4LO6B 2VNOA 3VHNA 1R092 2VPVA 1R1ZA 1BBT3 4Q8KA 3JBG1 3KT4A 1ND2A 5FPXA 4QGMA 3EHKA 4QQOA 2DVAA 3AZXA 3O0VA 1SLLA 3AP7A 4B7EA 3SCHA 4MXWA 4A2UA 1ASJ2 4A7YA 4A7KA 1QOOA 1YO8A 2GALA 3AKQA 4Z92B 4ORFA 2ARBA 3AZVA 3FX3A 3URFA 1ZBE1 4FSJA 5BNNC 4BLIA 5KXBA 4M0HA 4R9AA 3ZPYA 4I01A 4YGCA 2WFF1 1H1IA 1W6PA 2N7GA 1V6MA 3MDPA 5E8AA 2ARXA 4AYUA 4LBQD 5JCTA 3H8UA 4AHXA 3X29B 1QJY2 1PZ8A 4AQSA 2CL2A 1WMEA 3WOGA 3MFAA 3WHTA 4WVMB 1RJ8A 1PGW1 3RSJA 4A7ZA 4DB5A 2HEYF 1CPMA 4DY5A 4Q4Y2 3WVJA 2EALA 1NE6A 3IPVA 1V9U1 1IKQA 1GV9A 1DQ5A 1HXS3 4Z2WA 4WVZA 1GQHA 3K48A 3LZZA 2ZGKA 1G9FA 5A33B 5J96B 2VOWA 4PBPA 3TN93 1H4GA 3V0BB 1DDLA 1GSLA 1AYN3 4Y22B 2EA7A 4EN8B 4NHMA 4PBOA 3TOJA 1VAMA 4JVAA 4IV1C 1OQDA 1RUC3 2DCYA 2XL9A 1XYPA 3WDVA 2JJ6A 1HRI1 1OPOA 5A3LA 3O0WA 4XBLA 1C3HA 1R091 2ZGQA 3LOBA 5JAXA 1BYHA 4DZGA 4YG6A 5K7PA 1CAWB 1SLTA 3SCGA 4WZCA 5BXXA 3PJYA 4AW7A 3ENRA 1ZZ8A 1RUH3 3USUB 2I07B 2WQZC 1FPN1 2D6NA 1ASJ1 3PMSA 3LA7A 1JBCA 4TWTA 3GNEA 4K40A 1KFXL 1OKQA 2DVBA 2R042 5ABJA 3ZN5A 1PGSA 2DFCA 3EQEA 2PHUA 3WG2A 4AEMA 2ERFA 5HCFA 2WZPP 2GMPA 4PLMA 5DUVA 4JGZC 1U5YA 1K5MC 4B4QA 3MIBA 4AEKA 1QJY1 4O9GA 3C2UA 1BZWA 2BWAA 1OA2A 1PZ7A 5T54A 3RMYA 4UBHA 3OCPA 5HCBA 4X8PA 3BODA 3AMMA 3OY8B 4Q4Y1 3MYXA 5H9PA 3HWJA 1FMD3 1MVQA 4XBNA 2F4PA 1LHNA 3N7LA 3KGLA 2ET1A 1GZ9A 4GULA 1YIFA 1HW5A 2R062 3VBOB 2B46X 5T3NA 1LU2A 2O8QA 4Q0SA 1N3OA 3GHNA 4NO4A 3RMXA 2XB6C 4AI1A 1LOAA 2HEVF 2RR12 4ITCA 4YGBA 1UD1A 4BM8A 4DPNA 1N1YA 4LBQA 3VZMA 3GZTB 3CO2A 2ZMNA 4KWJA 4ZXKA 4BH9A 1RJ7A 1AVBA 1CGPA 2FQPA 5GALA 1QJU2 3MEPA 4HPKB 1IZ3A 2D5FA 3JCIA 1SCRA 4YZ1A 3TB0A 3LWCA 1A8MA 4YVSB 1NCQC 1SBEA 3GBGA 1S0JA 4IESA 1O91A 3OGGA 5J7MA 2RS13 2DV9A 4QPYA 2D3SA 2ZX2A 1OPMA 2I2SA 2D93A 3WDWA 4H55A 1XYNA 4LLFA 3SMHA 3VBSC 4IEZA 4R4ZA 1MACA 1H9WA 2EXIA 1MQTA 1COV3 1BJQA 1V6NA 4JDMA 4XTPA 5CFCB 5BNPB 1RVF2 4ONUA 5KHKA 1QH6A 2ZKNA 1MS5A 1AXKA 2WINB 4HT1T 5C8CB 1AR72 4H7LA 2JG8A 1UPSA 1VIWB 2PHRA 2R041 2OIIA 4K7JA 3WDYA 4WVVA 4YRDA 1Q56A 2HJIA 3RI8A 2NP0A 3E97A 5JZGC 4UW3A 4GQ7A 2P3KA 1O3TA 5T50A 4GA9A 2WKKA 3N7JA 1Q8SA 1ND2B 2CAVA 4KBBA 4AVCA 1CONA 1DQ2A 3W9AA 1WW6A 1GANA 4FPGA 3M70A 3FLPA 3UKTA 3VKMA 5I0RA 2WA4A 3VUOA 3J4UH 4YYOA 5CG8A 1BMV2 1AR83 1PVC3 2DCTA 4MXWB 3H7JA 4XIKA 1IHMA 1ENXA 4JDOA 4YZ3A 5AFEA 3MLLA 5C6CA 1C28A 1QJX2 1PNGA 3ZFEC 3AYAA 4FBFA 1RUG2 3MW4A 1FOD3 1DQ6A 2R061 2UWAA 1LOFC 1RMU3 3WV6A 3RS6A 2WLQA 1WUVA 2RS52 3I7DA 1A8DA 4G3YC 4CDQB 2LUWA 5EV7A 2RR11 1MS8A 3OGJA 4KG0A 4IEUA 3MLJA 4XEZA 2ZGPA 2D44A 4GMP0 2XWJB 4JCKA 4XFCA 4XQ4A 1ZZ7A 4IEYA 3WHUA 4CTEA 3D0SA 2A7AA 2VOVA 3B7MA 1QJU1 1LR5A 5AC93 3S0MA 1LU1A 1XE7A 1V00A 1RUD1 5ACA3 4FPFA 4YFWA 3IPVB 1BXHA 4MH0E 2GNTA 1XNBA 3MZHA 1ZX5A 5DZGA 3MF9A 2B5HA 3SH5A 1VRH3 2DUOA 4AVVA 3WCSA 4JGZA 1LRHA 1RVF1 1F9KA 2PLV2 1H2LA 5FREA 2YHJA 4PLNA 1XNKA 4TLFA 1DBNA 3CJIB 2B8MA 3ST7A 3VZOA 2QZ3A 3Q9OA 1NG0A 2YPJA 4AQTA 1OHFA 1WCDJ 5GZEA 3E6DA 5K0UA 2Z2SB 4HSLA 2D6KA 3K51A 4RHV2 4NHKA 1FV3A 3VL9A 5E88A 1ULDA 5GZGA 4Q0PA 2YY1A 4FPOB 2BUKA 5GJ6A 3USSA 1F2NA 1CX4A 2VH9A 4XF1A 4AI8A 4D3WA 2IWGB 2HWD2 3OBTA 1QNWA 1PO12 3ZXGA 1PHMA 2JXAA 1NCRC 4Q2FA 1Q5OA 3J8F2 4AHYA 1MVEA 4Z8BA 5ABJB 3MIFA 4XJ9A 1MZ5A 1DHKB 1C8NA 4WM7B 3LCPA 4M3CE 5T5PA 2RS51 4K1ZA 4KG8A 3CJXA 4OVEA 2X5IB 2ZGLA 3VBRA 1NA1A 2G9GA 4BPZA 5I91A 4K6BA 1BVVA 5L19A 1F31A 3WY6A 1H2NA 1O4YA 2Y38A 2CTVA 3SH3A 1HRV3 1J59A 1ONAA 2Z42A 3D6EA 1DG6A 3RYPA 4AEDC 4EJRA 1XNCA 2UWCA 3I2DA 3ECQA 2D43A 2GNBA 2C1FA 4RS5C 5JVVA 1H8TA 4Q1RA 4S2HA 1H1AA 2JG9C 4CDUA 4FPYA 2E51A 1SEFA 1ND3C 2VMIA 4YGEA 2Q1MA 2FMDA 2BW8A 2PLV1 3WQ1A 2NM1A 2CY6A 2BNOA 1QOSA 2UY8A 1YNAA 1IGOA 4YW3A 5FLIA 2VGDA 4RHV1 2VG9A 2VULA 4YNIA 4L92A 1QF3A 1S0CA 1LESA 1QOTA 2PA7A 5A3MA 1FT9A 1UIJA 5I8TA 3SLIA 2OVUA 2XVKA 4LT5A 3JD72 1H8VA 4N7IA 4OI0A 1MS3A 1TEIA 2D40A 1A6CA 4M3CF 2HWD1 1MQTB 2Q30A 3GF6A 3N36A 2WNVB 4LBKA 5HCAA 1PO11 3ZXFA 4Y5Z0 2ZA9A 3NW4A 3L9JT 3J8F1 2DUPA 4COVA 3VHRA 2JG8B 4XJZA 3VZJA 1ZRRA 1OA4A 4K1YA 3WD5A 1YJLA 4GB33 1UW8A 4KU7A 3AJZA 1WMDA 3WDUA 1LOGA 4COWA 4COYA 5JR7B 4BLJA 3MI8A 3SNMA 2ZCWA 1Q3EA 1VBC1 3UKNA 4AE2A 2BGCA 3VGIA 4ZU7A 3AZWA 4XHXA 2ZHLA 3DV8A 2E7QA 4U2AA 3B9IA 1B35B 3OTFA 4MYEA 1PIV2 2X29A 4NPRA 3ILNA 4P9XA 1W6MB 4RL7A 2QKDA 2E63A 5KHHA 5KC6A 1IKPA 4Z1VA 4MUVA 2YUEA 3BU7A 1MS4A 4YG3A 1TMF3 3QOPA 3ZSJA 4OI4A 2H6CA 3SHRA 1N47A 4GALA 4TZDA 3EBRA 4FPHA 2XLFA 3AFKA 3DPRC 3VV1A 3MGUA 2ZGNA 1UKRA 2PAEA 3B69A 5LRRA 1NCRA 1BEV2 3PVBB 4NWVA 1CQ9A 2WNUB 3ALQA 2PHXA 2WWSA 2VOXA 3JD71 4QPIC 1AYM2 3SITA 4C0HA 1UN1A 3G6JB 1Z0HA 3HBZA 2WSVA 1YFWA 5KBFA 1AX2A 2EF6A 5GLWA 3R6SA 1EYBA 1RUE2 5IK8A 2PHDA 1LHUA 1SQ4A 3JB8A 4CDWB 1RUI3 3I59B 4E27A 2MEV2 2WSUA 2RM22 5K0UB 1S0EA 1W2UA 4Y20B 3G7DA 5DDJ3 1POV1 1TNRA 4K3UA 1YYNA 1AR92 4RS5A 1DYKA 5KWRA 1VBD3 2VU9A 2IXLA 2VMGA 2YXSA 1MS9A 2C0ZA 4AGVA 1PGL1 1TME3 3AZYA 5J37A 4RQPC 4UW6A 4N7UA 2A71A 1OI6A 5FCCA 2ET7A 2GNMA 2RS32 3AB0A 4IV3C 4MX3A 2YYOA 1ZZCA 2PHTA 3SXWA 2CGOA 4OHVA 1PIV1 1R1A1 2DYCA 2WZR3 3JZVA 1GZWB 3AMHA 4QT6A 1XRUA 3VN4A 1X7NA 3FJSA 4PDWC 4WM8A 2XJPA 3O5SA 3P3PA 4FAGA 3FZ3A 3JBG3 4CDXC 4WBBA 3VLBB 1NA1B 2YGMA 3RZZA 1EPZA 3P3NA 3CLPA 1WW4A 3VBUA 3J9SA 4XJUA 1BCXA 4XPVA 3MPBA 1OQEA 1PK6C 1G6NA 1N1TA 5FTTC 1DFQA 2XJQA 3WNXA 3ZYIB 1Z7S3 2DTWA 2ZABA 3KM5A 1BEV1 3V0AB 3ZXDA 5FMOL 5JMCA 4DMIA 1O4ZA 4GH4C 3CU7A 5C33A 4HSJA 4S2FA 1AYM1 4CDUB 1PO22 3U0ZA 1U5IA 3ZSEA 1RIRA 3CF6E 5EYXA 1NOVA 2P3IA 4ES8A 1LEDA 1RUE1 1LB2A 5H9SA 1UU4A 2A6YA 3CNAA 4A3XA 3ASIA 3DUIA 4X8NA 1QMJA 1V9U3 4GMP3 4YFZA 4ES9A 1MR5A 2VVDA 5FPZA 2WJSA 4BZ4A 4E4DX 1AR91 1KXGA 1BBT2 4JGYA 3FLTA 3VHPA 2XBO1 4ATFA 1PZ9A 2DCZA 4HN0A 4INDA 1RUJ3 1MEC3 2CAUA 3B93A 2WC2A 1DGWX 1REFA 2JEMA 3BB6A 5EZWA 3THPA 2BPA2 4UBGA 3ZFFC 4AGGA 1JYCA 2GC3A 3B02A 4CEWB 4N53A 4AK3A 5D8AB 2NN8A 1SLIA 2Y0IA 1ZZBA 3ZXJA 1NLSA 1ULFA 4FOYA 1W6OA 5F6LB 1C1LA 3APBA 1LKNA 5FMOS 1SLAA 3AYDA 5C8WA 2ZGTA 3N35A 4LHKA 4X6QB 3JQXA 3KD4A 1FPN3 4N9IA 5J48A 4XFIA 1DQ4A 1URXA 4O9EA 1AR61 2BVBA 2TEPA 5FRAA 1YUDA 3FBMA 4MGIE 2GH2A 1DU3D 4M00A 2ILMA 4RR3C 1O3SA 4HETA 5BNOC 3M3EA 1HXS2 3BCWA 3QACA 1J1TA 3ZFGC 4ZU5A 4WV8A 4CEYB 1D0HA 2CWMA 2MHFA 5L7OB 5CFDB 1YXWA 3TN92 1MZEA 3ILRA 5EYYA 1AYN2 1WA4A 3LSDA 4AF9A 2K9ZA 4EN6B 1KJRA 1C1FA 4YVWA 1LHVA 3GALA 2D6PA 1GZCA 5JSRA 1VBA3 3VZKA 1RUC2 1UAIA 1G9DA 3OJBA 5FBZA 4YW1A 1I3HA 3OD0A 2VW2A 4QU2A 5HXVA 1BBT1 3OBRA 1TQ5A 4J1XA 4PDWA 4LO8A 4I0BA 1A3KA 4AFDA 1RUF3 1QGLA 1B35C 4XTMA 3RJ2X 4BOWA 4CDXA 5T5LA 5AFBA 1UX6A 2A6VA 2UYAA 2EIGA 3MIEA 1RUH2 3AP9A 3NL1A 2XVGA 4N43C 4Z82A 2AR6A 2GAUA 4EN7B 5JIAA 3HD8B 1YWKA 1F5FA 4IEPA 1KITA 5I0UA 1D0GA 2RJKA 1XQNA 4KU8A 3KGZA 2XLGA 4R8HA 5C9AA 2SLIA 3A0KA 5IK5A 3QCWA 5FLHA 5C4WA 3ZIXA 2VQ0A