3ZN5A

Vp16, a capsid protein of bacteriophage p23-77 (vp16-virus-derived)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
169
structure length
169
Chain Sequence
b'QEAFNRIKALRPGARPATILRSGPEFSVYSGTQRVKVGEFVVPAGASWVLPNPVPVILKLYDTGGNQLPHTTDVFLAKRTKGFDFPEFLAKVQYASYYDLTEAQLRDAKFYQNILQTLSPLRAPQPPQGVVLREGDVLEVYVEAPAGVTVNLNDPRTRIELPIGVDNSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP16
publication title Bacteriophage P23-77 Capsid Protein Structures Reveal the Archetype of an Ancient Branch from a Major Virus Lineage.
pubmed doi rcsb
source organism Thermus phage p23-77
molecule tags Viral protein
total genus 32
structure length 169
sequence length 169
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zn5A00
3ZN6B 3ZN4A 3ZN5A 3ZMOA
chains in the Genus database with same CATH superfamily
2YUEA 5GKAC 3IMMA 1O5UA 2R043 2VMFA 3HPNA 4BQXA 1JU4A 1L7QA 1W9FA 1CWPA 3KCCA 2VZRA 1SLLA 1TG7A 2IXLA 4QPIC 3HT2A 2WNEA 3VD5A 1O3QA 1QDOA 3ILNA 3VV1A 5HV0A 1SLBA 3K2OA 4IEUA 4QX7A 5EXOA 4AQSA 4YVWC 3MPPG 3ZO0B 4QT6A 3GCWA 3N7LA 4EN8B 1YQ5A 4V2VA 3HNYM 3EO6A 3PVBB 1H8TB 3WT3A 1JZ7A 2QDNA 2FCTA 4LBOA 5CFDC 1CIWA 2QE3A 3OG2A 1COV1 3O1RA 5C9AB 4FOYA 2FDIA 3GNEA 4FSJA 1AR91 3CU7A 2FQPA 4ZKTB 3MF9A 1YJLA 4RR3A 3RNSA 4MGSA 2D40A 2VMDA 3AB0A 1LOFA 3HNBM 3K46A 1QJY1 3M4FA 5DDJ1 3SISA 3JB8A 3W20A 3CO2A 3T0AA 5CBLA 1PIV1 2VTXJ 2WZR1 2XONA 1X8EA 4CPBD 4E4HA 1YYNA 2A5ZA 3JCIA 5T55A 3RMYA 1K5MB 2OZ6A 1LEDA 3WQ7A 4IL7A 2H6CA 3E6BA 1HRI2 3AVRA 2QFEA 4M0NA 4N90A 5F5QA 2DYCA 4CEWB 1WLDA 3LD8A 2A3WA 4Q4X2 2R1DA 5FZLA 3AKRA 1RUE3 5LEKA 2D3SA 3H0OA 4AK3A 4DMIA 5HI0A 3MHZA 3GJBA 3GCXA 4BCUA 4FPCA 3IBMA 1XC6A 3W5NA 1LHOA 4EN7B 4Y5SA 1CX1A 2VUDA 1QMJA 4P9IA 1JYVA 4FOQA 2W9XA 4AAXA 5FZ8A 1W9SA 2IC1A 1ENRA 4OHWA 1CAXB 2RMU1 1ULOA 1O4ZA 3S57A 3WNLA 4IV1C 1TZOA 1BKZA 2HBTA 4JQTA 2BWAA 1QY4A 2GNBA 1IPSA 4CA9A 2XKPA 1NLSA 1HV1A 4IE7A 4KL1A 4NR1A 4AFMA 3SKVA 2XH6A 4U36A 3AC0A 1VBD3 4FP3A 4JVAA 3H8UA 4Z82A 3THPA 3H1YA 3E5UA 4LO5B 4HZFA 3VLBB 4E4ZA 3KCYA 2R073 2VC9A 5IFPA 4HKOA 4AI0A 2I45A 3NNLA 3FFZA 4QPGB 3D5OA 2TEPA 2XR4A 4DXSA 5FZIA 3JZVA 4UI9L 2GC0A 4H55A 4CU8A 1NOVA 3DL3A 2MHFA 3LIHA 4Q27A 2NLRA 3C8XA 5CVRA 5KHHA 5FKCA 1IKPA 1C8M3 1R1ZA 2WSUA 3M3OA 4Y4YA 5T5LA 1UF2C 3RSJA 1OFSA 3T3YA 1Z78A 3MLKA 4X8PA 1JOJA 3EJKA 1X36A 2VG9A 5E16A 2DCZA 4IEQA 1J1TA 3AP7A 3T08A 4FI9A 1DQ2A 5FXWA 4FQ4A 4F83A 1AF9A 5FY4A 3WUCA 5FYHA 1V6MA 2EALA 2VNGA 3ES1A 1ZBA1 3NVCA 5A33B 4IGPA 2WJSA 2ZGLA 3HT1A 4PQ9A 4ZPIA 2ZKNA 4KU7A 3HNMA 4ES8A 5C4WB 2A70A 2OW4A 4QQ2A 3MBWA 1LTEA 3CDZB 5FJKA 1OQEA 2WWSA 4AEMA 4N53C 2WNOA 2JE7A 2Y38A 5FDBA 1H8VA 1PGW1 2ARCA 3EMRA 4CUAA 3D3AA 1RUE2 1KJLA 2RS32 1PNGA 1B35A 1DZQA 3H7YA 4QM8A 1F8VA 1X9TA 1BYHA 4YM1A 4OHVA 3CHXA 2BGOA 5J98B 2Q8CA 1OI6A 4CDXA 4JGYA 3AMQA 3THCA 3USUA 5CAZA 4EE2A 3MIBA 5FYYA 3POBA 1X9PA 2J1RA 3M7AA 4LJHA 4LKFA 4UYBA 4XUNA 3GDBA 5H9RA 1ZX5A 4B7KA 1RUC1 4CU9A 1D2SA 4N43A 2D6NA 1JHNA 1OA4A 2RS51 2YMZA 2XVLA 3GBWA 1RINA 2RJKA 2VXRA 4GKYA 1O4TA 2ORXA 4XOGA 1SEFA 4LBQB 3ZKYA 1V6IA 5IT6A 2HKXA 5ACA1 3IDEA 1QHDA 4XFAA 4W50A 1QEXA 1T2XA 1RUI1 1NE6A 2R072 3B9CA 4M01A 3RJ2X 3CJIC 5LB6A 4HLTA 2RS13 3PNAA 4XJ9A 5IK7A 2VZ1A 5DUUA 2IUWA 4K20A 4COZA 1JYCA 4XDPA 5HCFA 3MLLA 2QBXA 5C5UA 3AXDA 4DOUA 1C8M2 1H9WA 1VPHA 1KDMA 4HOOA 1YXWA 2YXSA 3HQRA 5FMBA 1FPN1 1Q56A 3KF3A 3VDDC 1IG3A 3LSDA 3AFGA 4LA2A 2VGDA 3AMHA 4WM8C 2CDPA 4CCNA 4URAA 2VZQA 4Q8LA 5IVJA 4Q26A 2Z69A 4NMIA 1W6MB 1SLTA 4M0HA 1W6QA 4F3JA 2Z4FA 5JMOA 4AVSA 5FQ0A 4XXPA 2D7FA 4QPWA 3ME2A 2OUHA 1W2AX 1MEC3 4AQTA 3SKJE 2R49A 3W21A 1CAVA 4META 1BZWA 4GWNA 1OXCA 3PIGA 1UQXA 4QPIA 4HVRA 2D6PA 4D6SA 3AJYA 5C3QA 4FPEA 2DF7A 4YVWA 1D2QA 4XJAA 2CL2A 3BOWA 2BVBA 3PL0A 2HWF1 2P6HA 3ACFA 1CX4A 2VAUA 2ZEZA 4Q4Y1 3ZXDA 4ZZ8A 1XQNA 3OB8A 3AZZA 4XMAA 5CFDA 3SITA 3ZVXA 4CP2A 3P3PA 2DWRA 4AVAA 2OA2A 5FO7B 4ATEA 3H1MA 1US3A 1ZA7A 3ACHA 1CZVA 3EQEA 1DZTA 2B9UA 3VHRA 2VH9A 2UYAA 1IS3A 1WUVA 1AX2A 1SG3A 4PIYA 4BISA 1G7YA 5FUNA 4Q0QA 2WA4A 2J1SA 1V9U1 1MS1A 5BNQA 2RS12 1P8JA 2R16A 2EIDA 2JDHA 4CUGA 5IW0A 3O1PA 3I2FA 1H8TC 5FZ9A 1ULPA 4R9BA 1AR63 2VMEA 1HRI1 4M3CB 5JCTA 1ZRCA 1QJU1 4AF9A 4GQ7A 3VBRC 5KHIA 4TTGA 2X5IC 1VBB3 2WT1A 3S5AA 1ZBE3 2VQUA 5F32A 2Q1MA 1PO11 1LNSA 4DRRA 1AL22 3E97A 5JXHA 2ZX2A 1ACCA 2I07B 3M3CA 4IV1A 4N7IA 5FZDA 1MZEA 1K5MC 5JUVA 2HWB2 5ANNA 1DYOA 4LIVA 5FPVA 1YIFA 3WXPA 2BPA2 4CEWC 1AR72 2K46A 2NYYA 1U0AA 1UU5A 4XETA 1UW8A 4RYDA 4HK8A 2MEV3 3ZMOA 4NIGA 2ZAHA 4FTEA 1Y7BA 5FLIA 1NXMA 2WAOA 2R041 4Q4V2 1OH4A 1U5IA 2IXCA 3AMMA 2A1XA 5A7OA 2AR6A 2JE8A 3LEGA 2VQAA 3C7GA 5J09A 1EY2A 5IVYA 1GFF2 1DU3D 2F4PA 4DXTA 4LORA 1PNFA 1O59A 5LBCA 3RDIA 5AC93 5IFTA 3N9MA 3SMHA 5I0UA 1Z7S2 1I1EA 1RGSA 5I8SA 1UYYA 2DUPA 5A7NA 4D6QA 2DVGA 2JB4A 4YRDA 3RS6A 2E7QA 4I09A 4IETA 4YGCA 4E4SA 4BMBA 3HMYA 1VAMA 1S2EA 3NKTA 1S0DA 1W8HA 4YNIA 3VD3A 4YW2A 3H3LA 3ZYRA 4LKEA 1GWLA 5L9BA 3MGUA 4WZFA 1W39A 5LA9A 1EAH1 1E5HA 1GP4A 1QJFA 1VBA1 5D1IA 4BQ3A 3P5BA 1RUNA 3PMEA 2ZHMA 3OOXA 3JXSA 4H2AA 2AEZA 4AZZA 1Q43A 3GALA 3IZOA 3ALQA 4N53A 4YZ2A 1H2KA 4AEJA 3VBHB 2AUYA 1VR3A 4LHNA 1J59A 2YFUA 4LKDA 3B00A 2RDQA 1KITA 3U07A 4LOSA 2XKOA 4YVSB 4E2GA 2VNRA 3VHPA 3ZN4A 3RPQA 1WCKA 1V6OA 1ZBE2 2HWD3 2Y60A 3KV6A 2ILMA 1GKBA 1QKQA 1W3VA 2XG3A 3OYWB 1VB2A 1LB2A 3VKMA 3WP4A 5FP4A 1IG0A 2D5HA 4CUBA 1GZWA 2LM3A 2W2IA 2XUEA 2W3JA 4XABA 2YBPA 4FXKB 2QJVA 4IE5A 5C4WC 1XYOA 2AREA 5FWEA 3IMNA 2HWC1 2VUCA 3DPRB 2MEV2 1OC1A 4HPKA 2A3XA 2W0XA 3CJIA 2Y26A 1VBD1 2P5BA 4FQZA 4FCAA 5JPMB 4YPJA 5FMOL 2Y6FA 5A7QA 5LA1A 3GZUC 3H42B 2R071 1AX0A 4NHMA 3SXWA 2PELA 2QUOA 4NAMA 2ZXQA 4YZ4A 2RR13 3DYMA 5AC92 3LKJA 2ZHLA 2ZHNA 2V72A 4Z1VA 5CZKA 1NX9A 3UL2A 2VOWA 5FPUA 4V1PA 4RHV3 1DGRN 5FMOS 2VJXA 2WFF3 3VDDA 3EB7A 4FFGA 5C3RA 4UAPA 2NN8A 5CISA 1V6LA 4K7JA 4OUMA 4WM8A 4ATFA 1ULFA 4AE2A 5LWBA 4NRMA 2Q1ZB 2AZ5A 2JG8B 3I3DA 1J1LA 4P5HA 3RFRA 2A6ZA 2J1EA 2QQMA 3LDRA 1FMD3 3BB6A 2J1UA 3EYPA 2G19A 2EF6A 4Y20A 3CIHA 3PDQA 4WVMB 1R1A3 1S0FA 2GAUA 5T5OA 4AVCA 1XE0A 4CEYB 1HJGA 3M3IA 1VBC1 3OY8A 4A7ZA 3IAPA 5HCHA 3A7QA 1C4RA 1NY72 2K0GA 5GZDA 5SV5A 3RRDA 4AHXA 5C71A 4K3UA 1UMHA 1LKNA 2Q1FA 2YYOA 3ZFFC 3WSOA 5FZOB 1G9BA 2ZGSA 5A3OA 5A3PA 2CAUA 2RM23 5A6QA 3RQ0A 2HWD2 1SLCA 3S30A 3O1SA 4Q2FA 2V09A 3BKZA 3C7OA 2VY0A 3WF3A 3I54A 5IVBA 2IXHA 2AYHA 5DUXA 2WN3A 4I01A 3THTA 2JD4A 1A3KA 1HXS3 1SBEA 4XFFA 4CU6A 3B5LB 4FFIA 4OUEA 2LUWA 3RZGA 3WW1A 5K7PA 2P3JA 3D82A 1COV3 4PLMA 1UN1A 2VE1A 3VD7A 1QJEA 2VUAA 5DUVA 3WQ0A 1GYKA 2ES3A 4GH4C 2VCBA 3PVNA 5DDJ3 3RYPA 4LHKA 2QQNA 2V73A 3WG2A 1PIV3 2EIEA 1HN1A 1H8TA 2I2SA 2WZR3 1KS4A 4LIUA 4QXHA 4S2DA 3LFIA 3CZJA 5FZ6A 2RR12 2F6BA 3HEIA 4COWA 3WDWA 5DAPA 5J36A 1F5FA 4KWJA 2WINB 4EWAA 4ZZ5A 5CFCB 2GP5A 2MNGA 3VBRA 1H6YA 2BNMA 5C9AA 3LFMA 2X5IA 2WFF2 3PJQA 3K51A 3CF6E 1WCQA 1UOFA 5CIRA 4V2WA 1NZCA 2XUMA 3B3QE 3BOPA 4QXBA 1CJPA 4GXLA 3DCQA 3LDKA 4WBBA 3BVCA 1DIWA 1K5MA 1GNHA 3AYDA 3EHKA 1SZBA 2RMU3 2LW8A 2O0OA 2W95A 3N9QA 5FYCA 4CEWA 1FMD2 2VZVA 1H2MA 4L11A 5DZFA 4XFIA 4ZU4A 3OD4A 5FZMA 5C8WA 1UOGA 3B93A 2DCJA 1LHNA 3GZTB 3J4UH 1ZYBA 2VZTA 3MFCA 5EWSA 1LGNA 2XVKA 1MEC1 3I59B 2W92A 2XJUA 4LE3A 4KNCA 1NQDA 3U75A 1CESA 3RVHA 2CWSA 4FPHA 4EROA 1LR5A 4NIHA 2ADEA 1WWYA 4XYXA 4AAPA 5GLTA 4BE3A 5I0RA 2DFCA 4Y1YA 3W9AA 1QOTA 4UBGA 1VALA 1K12A 2VM9A 3MF6A 1LOCA 4NHYA 4ZXEA 3I3MA 4YW1A 1DFQA 2NP0A 2EIGA 2N7GA 3UKVA 3TYJA 2QKDA 2ARXA 1WLTA 1HW5A 3HOBA 3BODA 4ISQA 1PZ8A 3AVSA 3O12A 4LBMA 3WNOA 3GHMA 5C70A 3WF0A 3ABZA 3RWNA 1Q8QA 4A41A 1COV2 4IE4A 4BB3A 3IM0A 2BFUL 1AR92 1CD3G 4W65A 5CKMA 3ZYJB 3BIEA 1ZBA3 3VHOA 4ORFA 1UZYA 5DDJ2 3WEZA 4NJ4A 3WNXA 2E9QA 4ASMB 4QXKA 4CRQA 4C90A 4DUWA 5IVVA 1PIV2 1WLCA 2DFBA 1QIQA 2WZR2 3WV6A 4A7YA 3A4UA 4XIKA 5GZCA 4ONUA 3K4ZA 2BFUS 2PHFA 5LA0A 2YZ4A 4IXLA 2QQLA 3QD6A 1HRV1 5L36A 5L9VA 3RG0A 3R4UA 2EA7A 5LK5A 4BXSV 3I7DA 1WW4A 1AR61 2PMWB 1HB3A 1NYWA 3WG3A 5A33A 4TYSA 1CGPA 3QBQA 1QU0A 4AGGA 4FXGB 1XRUA 4DEVA 5DUWA 1VBB1 4NWWA 2XLGA 4UT5A 5C3SA 2PHWA 3ACIA 2YC0A 3INAA 5FFOC 5C4WA 1U5ZA 2WRAA 5AFEA 2QQWA 5L9RA 3ZOIA 5L7OB 3O5SA 2RMU2 4TLFA 2ZGPA 3KV9A 4K40A 3N9OA 1OKQA 4OI4A 1LHWA 3UGGA 2ZBJA 4NOTA 1RHI1 1AR81 2PLV3 2ZGOA 3OCPA 3P6BA 1S0IA 4W6XA 5FBJA 5ACA3 4OCTA 4FP2A 3JBG3 1ENSA 4QX5A 1D4M1 1RUI3 1NA1B 3UESA 1UY1A 1NCQB 4B29A 1RUOA 3OGRA 2DUQA 3VN4A 2W91A 4NAOA 5CADA 2BYVE 2EAAA 2WS91 1YRZA 3ES4A 5C5TA 4MZUA 4UOJA 5I8TA 2J1AA 2D5FA 4QX0A 3K77A 2C24A 4YYOA 4XUOA 5F9TA 4BQ5A 3GZAA 2EVXA 4BM8A 3LCPA 1CONA 5FY7A 1O3SA 4OFGA 2D43A 3DPRC 1FPN3 2J7MA 3K4AA 2DVAA 1HX6A 2EICA 3THDA 3TBDA 3WDTA 1ST8A 1ND2B 5FZHA 5JXJA 1XSQA 2P1BA 4QGLA 2XDVA 2BERA 3EBRA 1RB8G 5LBBA 1AL0G 5A70A 1SCSA 1ZBA2 3ITQA 4XE9A 4YM2A 2JEMA 3PUHA 3A21A 4GULA 5JOZA 5FZEA 4Q8KA 3KSCA 2XLAA 1X7NA 1PK6B 1ZNPA 4B7EA 1GICA 2CGNA 5F7UA 1SACA 2ADDA 3B9IA 3POWA 3ZFFA 5A1AA 3NMBA 5JIUA 4AFAA 1PGW2 2VO5A 4AHYA 1N3PA 3F95A 3VBSB 5IWFA 1W6MA 5A6ZA 1H4GA 2ZGTA 3KS7A 5KR7A 4MX3A 1DF0A 3P3NA 3AMNA 4Q0UA 3OJBA 1JI6A 4AYUA 3HD8B 1JH5A 3VZNA 4CCDA 1YFXA 5C3OA 4Q4Y3 1R091 1Y9MA 2FDJA 4C1WA 3IN9A 1RUC2 2A73B 2RS52 1CAWB 1OPOA 3SHRA 4QHBA 4CEYC 4IEXA 5FP7A 4UF0B 3J8F1 1VAVA 3LQCA 3UGFA 5ACA2 1ZM1A 2PFWA 4BK4A 2IXIA 4PDWB 2DBIA 4GH4A 3ZIWA 3JBG2 1WMXA 2HEVF 3LAGA 3DUIA 3AZWA 1RUI2 3Q8AA 4YM0A 3WNKA 5F37A 1FV2A 2P2KA 4C0BA 1V9U3 3BTZA 4OVEA 4YFZA 2WNVC 3KLSA 1EPWA 3AMPA 4XIOA 2ARAA 1ENXA 2GMPA 4EQVA 1JW6A 2KD7A 4KMQA 4YG6A 1R081 3ZSKA 4CP9B 1ZRRA 4GWMA 2W08A 3SC7X 2OQ6A 5ABJC 4PIZA 4B1LA 5I0SA 4XW3A 5IYYA 4RHV1 1FPN2 2VQ0A 3Q8CA 1MVEA 3HN3A 1QNYA 5BY5A 1PO13 4BH9A 2X29A 2Z79A 4E2QA 2BGCA 3JUUA 2BOIA 2YV8A 3I2GA 5DAWA 4K1ZA 4SLIA 1W9WA 5FYBA 2QNKA 5IUQA 4AW7A 4A45A 2E7TA 1YC61 5CFCC 4LR4A 1KS5A 1ZZBA 1F15A 1CAUB 2W39A 5FP9A 3MZHA 3PMSA 2ARBA 4LA3A 4NHKA 4QDQA 3UV9A 4QU2A 3T0DA 1R1A1 3OGJA 4YG0A 4HN1A 4XCAA 3ZXLA 1YFUA 4FOVA 4LK7A 5ANQA 1YJKA 1H30A 2RV9A 3WW4A 3TNQA 2YU1A 1Q3EA 3AL6A 1ZRIA 3IPVB 4Z2AA 2HWF2 1TMF3 2TBVA 4J6GA 2ATFA 3J7HA 2RM21 4FPKA 3VD4A 1NLRA 1UX7A 3I2DA 4Q4Y2 1WW5A 1T6BX 3O14A 1BHGA 4Y26A 1HB4A 4RS5B 1HXS1 2RDNA 1MQTB 3LZZA 2YGMA 3NNGA 4JTNA 2P17A 4MXVA 5I0DA 2W87A 2BVVA 3U4SA 4DY5A 3LB9A 4RN5A 1O8PA 4XUQA 4I0BA 1EAH3 2OPKA 4CCLA 1VBA3 4UFKA 1V9U2 1YQ8A 2CGOA 3AKSA 5A32B 4FPJA 2KA3A 1UKGA 2W52A 3FUQA 5T3NA 5K0UB 2WLPA 5EFUA 2GNMA 1HLCA 4C0HA 1LOEA 2JECA 3FBMA 4CUCA 1QJU2 1BVP1 1VMFA 1G9DA 1FXZA 3UNPA 2CU5A 2ZAAA 3AX4A 2HWE3 4W6WA 3B7MA 4IUGA 1BCXA 2V5DA 4AFCA 1HIXA 1PO12 4HSLA 3IAQA 4N7UA 4IE0A 4OHXA 1V70A 1UWWA 4QWNA 5FBZA 3VBUB 3VBFB 4XFGA 4OZOA 1LGBA 4LT5A 2LS6A 2A6XA 4KBBA 1GV9A 4I0WB 4B4PA 3PUAA 2HWC3 3RYRA 4MHRA 3T2QA 2BNNA 2FBEA 4CCJA 3NV1A 2BGPA 1DBNA 5FK8A 3T4VA 4CCMA 4DZGA 2R042 5EIYB 1W9YA 5FPZA 1UYXA 1UPSA 3WW2A 1DQ1A 3LGRA 1VB4A 4AVVA 1RYYA 3PTRB 4O65A 1FNZA 4LXLA 3U4XA 2VQTA 1ZRDA 1Q5OA 2JDYA 1JMUB 2YB7A 3POYA 3DPRA 4GJZA 5A80A 5J1XA 4ES9A 2QQUA 5JOYA 1BEV1 5JIAA 3O1MA 1N1YA 5DAXA 5JVVA 1RIRA 1AVBA 4GMP0 5DZGA 2VVFA 3LF7A 1F4HA 4O9GA 3VZKA 4GAZA 3NNFA 4DUXA 1HDKA 1NCQC 4YZ1A 2B4KA 2Q30A 2D6LX 4LO8A 4WVWA 1EP0A 2Z2SB 1EAH2 1VBA2 1RJ8A 1POV3 1T6GC 2VNVA 5SV8A 5DN2A 1QXJA 2QVSB 5DG2A 1KFXL 1VRBA 5JAXA 2VW0A 1ZZCA 4LUMA 4LULA 3VDCA 4C1XA 2XXZA 4PCRA 2WQ8A 1RUF1 1RJ7A 5HXMA 1JUHA 1MS4A 1TNRA 4CXWA 1VBC3 2DURA 4QB1A 1JYIA 2BJSA 1W9TA 3S7IA 4UWDA 5A7PA 5TSWA 5B4NA 3AP5A 1K42A 2WT0A 4B4QA 5LK7B 2F17A 3HBZA 2C9KA 2ZMNA 3NJZA 1K45A 1NZIA 3ZYFA 1MS9A 3WINE 1SBFA 4QMAA 3BI3A 1PMJX 4WVMA 2JD9A 3OPZA 4A3XA 5FO9B 5JSPA 4LUKA 4KU8A 1GP5A 3KT7A 4CEYA 3VZOA 1VJ2A 1UZ0A 3GGLA 4XFCA 5LY1A 3TEZA 2GZWA 1I9RA 3WHTA 4WM7B 4DO0A 5T50A 4EYUA 4IEPA 1U12A 2HWC2 1RVF1 2R6QA 2BEOA 1L3JA 3KMHA 1UXXX 2PLV1 1AYM3 1CQ9A 3UGHA 3A0KA 3VBSC 1IKQA 1LRHA 1ND3B 2BOJA 2WNVA 5T52A 1VBD2 3T2PA 3JBG1 5FUPA 4AEDC 1HV0A 1N47A 3ZFGC 1MS8A 3GXUA 5F6LB 1CN1A 3S7EA 4WVZA 3VL9A 4P9JA 3MIEA 1A8MA 1QJX3 4BU2A 5ABJA 4YGDA 5EJ3A 2FDGA 5IAXA 1C5IA 2NM1A 4OI0A 3UYJA 2WO2A 5FPLA 2ZTNA 4J1WA 2FDKA 2GH8A 4OULA 2HJIA 5FWJA 4D3WA 2BNOA 3LDBA 1W06A 1OLQA 4DB5A 2JIJA 4E8DA 1W04A 5FREA 4NN0A 3LOBA 3V0BA 1O6UA 2B7YA 1OFNA 4LLFA 5FXXA 1IGOA 1YLLA 4Z07A 5CFCA 1PVC1 4AI2A 3ZYIB 2WUHA 3DN7A 1MZ5A 4CTEA 1YWKA 1J3PA 3NSTA 3MLJA 4AG4A 1XYNA 4LBJA 3ZXGA 3V64A 1IOAA 4EZHA 4D0QA 1VBC2 3POFA 5FYTA 3I3BA 1M06G 1JUIA 1X8MA 3KV4A 4COUA 1RMU1 1D4VB 1GWMA 4GWIA 4LQRA 1W05A 1C57A 1UL9A 1UO9A 4JTOA 3KGZA 5JR7B 1RUH1 2H6BA 1LULA 3T30A 4XF1A 3ETPA 5J37A 3RZKA 5CG9A 1LU2A 2GNDA 4XPVA 1HN0A 1VBE3 3I59A 4AHWA 5M0TA 3C3VA 2HBUA 5JMCA 1SDWA 4ZS2A 4M3CE 5BXXA 3J7LA 1H6XA 2PHXA 4MGIE 5BNPB 2W1WA 2CY6A 3LSEA 4ZU7A 5T54A 1PZ7A 1YFYA 3U1XA 4MV2A 1V00A 2VOXA 1OUSA 4XILA 3KVAA 4B3NA 3TOJA 3WCRA 1O91A 1QXRA 2V4AA 3SNMA 1TE1B 4LITA 1C5HA 3FLRA 1TVGA 4LTAA 5KBFA 4M3CF 4RS5C 1HRV3 4G3YC 4ZHNA 1MQTC 1CJDA 1UIKA 1JZ4A 4L2NA 5BUVA 1LEMA 4P02B 2E53A 3WDXA 1RUG3 2XQXA 4E2SA 5F3CA 3VKFC 3N36A 5FYUA 5C9AC 4OYUA 5K9YA 2YROA 4YW5A 3JQXA 3SH4A 3O1UA 1S0GA 3AZVA 1RUD1 1H4HA 2C4XA 2YPJA 4Z8BA 5K0UC 1H0BA 2WIIB 4OZXA 2V4VA 4BZ4A 3MICA 1IS5A 1YIPA 2DVBA 4K8FA 1AZDA 3U10A 4D7TA 1RHI3 1AR83 2UY9A 5FZ1A 5FZ3A 2RJ2A 2ZGMA 1NE4A 4OI2A 4QX8A 3MIFA 2VMIA 1MEC2 4LO7A 2CV6A 1D4M3 2VW1A 3L9JT 4OUSA 1XNTA 4KH9A 3SQOA 5L19A 2J1VA 1S2BA 2JB8A 2P6CA 3JU9A 4MYEA 4WVVA 1U5YA 5A1FA 3BU0A 1UCXA 1V0AA 2WS93 5FP3A 3WG4A 3AXEA 4XAEA 3VBUC 4H3WA 4P9YA 4PT6A 3VBFC 1ULEA 4HK9A 4D7YA 3GM8A 2UY8A 1OQDA 2VNOA 4LBKA 1O3TA 1TMF1 1RUJ3 4LBLA 4SBVA 3TN93 2JDPA 1UOJA 3BTXA 4IESA 3AP6A 1NA1A 4RFRB 1NCQA 1W8ZA 1W8NA 4XQWA 4QD2A 2WNUB 2OXBA 3RZZA 3NV2A 5GJ6A 3ENRA 3UJQA 1F2NA 2ZGQA 4QPGC 4W6YA 1F31A 3I3EA 4DUVA 4ARXA 1LAJA 1I6XA 4AFBA 3ZFEB 2W46A 1XU2A 3VBOB 1JZ5A 3NV4A 1A6CA 5GALA 5BNOB 3FLTA 2Y8KA 1HRV2 2GSYA 3LA7A 4RR3B 4TLGA 1STMA 5DAVA 3WP5A 1BK0A 4NO4A 4KWLA 1AR62 4YM3A 1J83A 2ZMLA 2Q4SA 5FV3A 4KI5M 5FK7A 3FWEA 4HL0A 5FZFA 3BCWA 4HVQA 1VBB2 2HWE1 5GZGA 1BJQA 2HEYF 2D3PA 1J3RA 5KHKA 4C91A 3VL8A 2DU1A 1E5RA 1R093 2BU9A 3DEMA 5FR3A 4M4RA 4D8MA 1XPWA 1FT9A 3WNNA 4DPNA 2DU0A 3WHUA 4IERA 1RHI2 1AR82 2WQ4A 3QACA 3J8F3 3QLQA 4Y5Z0 2EXHA 3VBSA 4NPMA 5DABA 4XURA 2VCMA 5H9PA 1D4M2 4AEDA 4MGTA 2CSGA 2VZOA 3MPBA 5EQUA 3ZFGA 3FHAA 5APAA 2Y6LA 2WS92 3WOGA 2C1FA 3FLPA 2VTXA 2BP6A 2D6MA 2ZGUA 5KHJA 1WMDA 3MW2A 4FBFA 3TEXA 1CAWA 1WCUA 4BLIA 1R083 3O7OA 3ON7A 2FCUA 4XDOA 1OQ1A 3VKNA 5KHGA 4UF0A 5FZ4A 5H9QA 3PVOA 4XJUA 4WM7C 3TN92 1O7FA 3ZSLA 4YW3A 2FD8A 2ZPXA 4BQ2A 1H1MA 2OT7A 5FMCA 2OX0A 4JC1A 5ERLA 1GR3A 1NT0A 5E1RA 4BQ1A 5C3PA 1ND3C 2P34A 3WDUA 5A6XA 3ZN6A 1NAEA 2E31A 4QQLA 4HVOA 5FAXA 2ZX1A 5A1LA 4GIQA 1SPPA 2XHNA 4PI0A 1U5XA 1VP6A 1O5LA 3URFA 4CP9A 2DTWA 4JAAA 5CB7A 3ZR6A 4KWUA 1G9CA 1POV1 2CYFA 2TUNA 5G05L 1EYBA 3ZXKA 4OMDA 3H3UA 4GB31 4FOWA 2JKXA 4CDWB 2RVAA 2XOMA 1J84A 3PIJA 1QH7A 4ISRA 4CE8A 2IZWA 5F3EA 5D2AA 4XFBA 1E5SA 3ACLA 4PF5A 5I8YA 1S0EA 5A3UA 3C7FA 3M1HA 4ET7A 1JHJA 2BBVA 4AI8A 4JV4A 2DUOA 1GQHA 1DGLA 4JKKA 1WBLA 4Q4W1 5IVFA 1R092 3I49A 2WYSA 3NQHA 3V56A 3D0SA 1RXGA 4LNVA 1JYTA 1WCSA 3R4DB 2C9AA 3NKGA 3KCXA 3B01A 1W6PB 4R4XA 3J8F2 3T4HB 3USUB 3N7KA 4NROA 3N9LA 4R8HA 1KRIA 4BIOA 1OT5A 2Z42A 3HJRA 1CR7A 1US2A 3CL1A 3IPVA 2VBDA 3ZXJA 5JZGB 3TAYA 1MS5A 3FFQA 5G04L 2DCTA 3DYPA 1AYM1 3BGAA 4MUVA 4N43B 4NE9A 2JDUA 1DQ0A 5LRRA 1A78A 3HWJA 2ZJCA 4NPLA 4QKNA 2FHRA 1DLLA 1OMIA 4RS5A 4XFHA 2H0BA 1NCRB 1MQTA 1R082 4RFT0 1OUXA 3OEBA 3E6CC 1QJX1 4CDQB 2WABA 1GUIA 1XNBA 3ZSEA 3R4SA 4ASLA 5BNPC 2FCVA 4RHV2 4RSUA 1GP6A 1H2NA 1OVSA 4KBZA 4XAAA 1C3HA 5A32A 2P3YA 2VD7A 3I2KA 1D0GA 4MO3M 2WT2A 3VUOA 1MS3A 3PLQA 2BTVC 5K0UA 4Q1RA 3M70A 4YWAA 3LEMA 3HQUA 2D98A 3WQBA 2VULA 1S0CA 3RMXA 1FV3A 1SQ4A 1JBCA 5KC6A 4PLNA 4OHYA 4BYYA 1GZTA 2ZEYA 4IEWA 5FPXA 4I2OA 2VTFA 4L97A 1R1A2 1UY0A 3WNPA 4AQ6A 5HPOA 4ZONA 1PGL1 1TME3 1Q8SA 3T1LA 3VBUA 4H7LA 3VBFA 5FQ0B 2YC4A 5FYVA 3AKQA 5LW9A 2B46X 2HLEA 1AYN1 4UFJA 4E4DX 1CAXA 4Y22B 1CAVB 2RM22 4QPIB 2XBO1 1BEV3 4A7KA 5HXVA 1VMJA 1WA6X 4LBQD 1Q8PA 4YVWB 1HXS2 1GOHA 1VBE1 1W99A 2BRTA 2C5DA 2ZX0A 3ECQA 3IIIA 4DNYA 2A6YA 2W47A 5A6YA 5FY5A 2AENA 1YFWA 2XPJA 2A75A 4NVPA 2XL9A 1BBT3 2AC1A 4QPGA 4ZS3A 2PAKA 2UU8A 1OH3A 2QZ2A 2JKBA 5KXBA 5KWRA 1JU3A 2OS2A 3WW3A 4KG0A 4D7SA 4Q29A 4FO9A 5JSOA 4I02A 5JR2A 1DG6A 3SCHA 1I5PA 1RUF3 2GH2A 4MOAA 1UD1A 1CZTA 4Y1UA 2ZGRA 2Q8EA 3A22A 3ILRA 2WNUC 2AGSA 3DXTA 1SFNA 2WYFA 1G86A 3BIWE 2A7AA 3BALA 1RUG1 1PMHX 3FJSA 2YC2A 2XJQA 4HXCA 4A42A 4AI9A 5F5AA 2R1BA 4CCCA 1FATA 4AQ2A 4CDUB 3ZFEC 3VBOC 2GALA 3K48A 1LU1A 3B94A 3ZR5A 5BNOC 3TEWA 2W5FA 4R9CA 1HB1A 1W6NB 4JHZA 3VBHC 1RVF3 5EYYA 5AFBA 3ZSJA 5IJRA 4XF9A 1AJKA 1PX4A 4YW6A 4X8NA 5T5PA 1LJ7A 1UX6A 4IV1B 2B39A 4XCBA 1ALYA 2DDUA 4YVSC 2Y33A 4EN9B 2WFPA 5AVAA 3A23A 2C6SA 2OUJA 4KQ7A 4MG2A 1MZ6A 4PQQA 4WM7A 4UW5A 3IT8A 1YQ2A 3MUZ1 1MVQA 5LY2A 3H9AA 5C8CB 1REDA 3VZMA 2NMNA 4LBQA 4HONA 1BEV2 1RUJ1 1SFYA 4LE4A 1ND3A 3TN91 5FZKA 1SMVA 3ZYPA 1WMFA 1GZCA 5F2SA 4BK5A 1QNWA 3ZN5A 3NJYA 3H8OA 2NQYA 3FUOA 4LEJA 1QOOA 1QQP1 1VIWB 3J7NA 3MUY1 4RL7A 3WY6A 1OOPB 3D8CA 3OUHA 4IV3B 2HYKA 4QU1A 1PVC3 4U2AA 1JYNA 1ULGA 2AEYA 1JTZX 3RZLA 3CLPA 5F6KA 2VR4A 4P08A 3WVJA 5C6CA 5CG8A 2WBKA 1H9PA 1HQNA 1RUF2 2W94A 1ZZ9A 2Y34A 1B09A 1UMIA 5FUIA 5ISLA 4AL9A 4K21A 2RHPA 4IEOA 4NHLA 3RZMA 2SBAA 2E26A 2VBBA 2CTVA 3VDAA 2PHRA 1RMU3 1LCLA 5FXZA 5GLWA 4GA9A 5A3LA 2DCKA 2RE9A 5EHDA 1UKRA 3TB0A 3Q9OA 5FKBA 2JG8C 3NNMA 3PUIA 4DRVA 4UW3A 3O1OA 1LECA 1RUH3 1WLWA 3ZMNA 1PMIA 4CP0A 3AZYA 1LOGA 2PHTA 4CDWC 1ASJ1 1M4WA 4A4AA 2D3RA 1OKOA 1RVF2 1UZVA 3ZPYA 1E57A 1UIJA 2PLV2 3FL7A 3WCSA 1ZREA 2J42A 4QHZA 5EZWA 5GLVA 3POEA 4F8AA 4PF1A 4XC9A 2XWJB 1Y4WA 3WF2A 1GQPA 2VMCA 1RL3A 5JWPA 4RGGA 1OHFA 5CA6A 5A3MA 1XXNA 3CJIB 5BNPA 2GU9A 2A71A 3H1WA 4G9SB 4DXZA 1REEA 4BQWA 1N1TA 3B02A 3J7MA 3HAGA 3AL5A 2QTWB 1IPKA 4FPYA 5FCCA 2YHJA 5BNNB 3AZXA 1MS0A 3IB3A 3MV11 4XUTA 2EXJA 2R30A 4COYA 2KM2A 2VW2A 1BLZA 1RXFA 4UXAA 2JDMA 2WKKA 5LASA 1LGCA 1RUD3 1HQWA 4UFHA 3VDDB 4O9EA 1VAKA 3U11A 1PVC2 2JIGA 3O0XA 2YG0A 4L8QA 1NCRC 3E5QA 1QOSA 2O14A 4CDQC 4YGEA 4M3CA 4DINB 2ERFA 5J48A 4XBQA 4YGBA 3ZXFA 2IFWA 2ZABA 3U14A 4RGAA 4AI1A 4JGZB 4HN0A 1KXGA 1RMU2 4Y20B 3Q8BA 2W1QA 3I2JA 4S2HA 1OVPA 1CPMA 2OIIA 2Y6HA 3GF6A 4RQPB 5D21A 2JG9B 1RUH2 2VVEA 3AP4A 4BHPA 1UY3A 1L7LA 4JCKA 5CNAA 4NIDA 4DXRA 5LCWL 2G9GA 4N8MA 2XHKA 2XGXA 4OHZA 3KT1A 1BXHA 4Y24A 4D94A 2OZJA 2WQZC 5FLHA 3E1F1 2P3KA 2VXJA 5FYMA 1WW6A 3E6DA 3H50A 1XNAA 1XNDA 4XQ4A 1CZSA 1PM4A 2BW8A 1LENA 4N9IA 2YPDA 4TSVA 3X29B 4UW6A 1YI9A 3D4KA 4KWKA 2EXKA 2VOVA 2WWJA 4CYDA 1EV13 5EYXA 2ZHKA 4I3PA 1BQPA 2WNUA 4XMIA 2VPVA 2GMMA 3NAPB 4OQ9A 1KQRA 3VDBA 5JI9A 3H8XA 1JZ6A 1YEWA 3FMGA 5C7GA 1W2UA 3KQ4B 4CVUA 1H1IA 2LRPA 4D69A 1W2TA 1L7RA 2VZSA 3AK0A 2YU2A 1CVNA 3NNJA 4DS0A 4DIQA 1BMV1 5E88A 3ZFEA 3VBOA 3VBRB 2WLQA 2X5IB 2XJTA 1H1AA 1RUD2 5BNOA 4E8CA 4E9KA 3MIHA 5IHRA 3RJRA 3VBHA 3WR0A 2D6OX 3H8RA 4AWDA 3JD71 3FHIB 4EWEA 4W4ZA 1W90A 4I3GA 3N7JA 5JXIA 3PJYA 4RGKA 4XZUG 2PA7A 4YVSA 3APBA 5DQ0A 4A44A 2PQQA 4QQOA 1X33A 3OUJA 4J25A 3OYWA 4FPGA 5IK8A 1TME1 3LPGA 3N35A 3NRUA 5DAQA 2RS33 1OA2A 5EP9A 5FYIA 2WAAA 1WD3A 1XB9A 4CDUC 2JJ6A 2Y64A 2Q8OA 3KGLA 4Q5OA 2J1TA 3LE0A 1K3IA 5GLZA 4NHXA 4B1MA 1TMF2 5FY0A 1DDLA 4X6QB 5L7OC 2PHUA 3W59A 1OBNA 5A7WB 2YBKA 2GC1A 1KJRA 4XZPA 2QQIA 2C26A 2PAMA 2W1UA 4KG8A 1G8WA 3GBGA 2WZPP 4PIXA 2ETEA 3AFKA 1NA1C 1FYUA 1W0PA 1KEXA 3C7HA 5T5JA 2ET1A 4ZU5A 4P9GA 2B42B 1BBT1 2VECA 2NPIA 4K1YA 4GALA 3AKTA 1LHUA 3M3EA 1HQLA 3LA3A 4HG6B 4NPRA 3PURA 5GZEA 3WDVA 5C33A 2VOKA 3OBTA 5C8CC 4GB33 4D6RA 2W68A 1EV12 3G6JB 4L9BA 3U0ZA 3ZX7A 5F3GA 3VZLA 1O4YA 4MGQA 1PO21 3GBFA 1GBGA 4IEVA 4XBLA 4J1XA 4WV8A 2JG8A 3TWIA 3LOIA 1ND2C 4AR2A 4I0AA 4B8EA 3UT0A 2VZUA 1EUTA 1OOPC 2Y0IA 4IV3C 1DLCA 1W6OB 2HWE2 3RI8A 3ZYBA 1VE0A 3WDYA 4A6OA 5FZGA 4BPZA 5KXCA 4Q4W3 1O3RA 4CDWA 4IE6A 5IATA 1JYWA 3A0NA 1XE8A 4JDNA 3SCFA 2XMLA 2A6VA 3SEPA 1PK6C 4X6RB 4CPBA 1UXZA 1XSRA 2FZ1A 2VOTA 3CNAA 4MADA 3AP9A 1ZZ7A 5BYNA 5FZOA 3QH7A 1ZZ6A 5JXGA 4QX3A 2P4EA 3CJXA 1OD5A 1S4CA 1UU4A 1OLME 4UBHA 2XJSA 4M00A 1LHVA 3O0WA 1JZ2A 3RZJA 1GOGA 1WGPA 4QQHA 1XJAA 2D93A 5H9SA 1OPMA 3CKHA 5EV7A 1NLQA 4AHZA 1W6PA 2PYTA 5BV6A 4CU7A 4G4FA 1IZ3A 1KD7A 2WL1A 2X05A 3HIFA 3KD4A 1OD3A 4AI3A 3UKTA 1FAYA 2RG4A 1F35A 1GNYA 1YO8A 3MIGA 1GZ9A 3SEEA 1HB2A 1W8TA 4QKFA 1ODMA 4PDWC 1GSLA 4ZXKA 3D0JA 4BMEA 2CGPA 1ZVFA 3U37A 3RI9A 1FX5A 2LTNA 3Q8EA 1VMHA 3N7MA 1OURA 1NCRA 4MHUA 4BIFA 5F1RA 1UNBA 2E32A 4A6SA 2Q0AA 3ST7A 4ZY9A 2FDFA 1D0HA 5KC5A 4Q1PA 4CDQA 2Y6GA 4YZ3A 2ZS6B 1SHWB 3I3QA 5FJHA 1X82A 2QDRA 4GB32 2FZ2A 1S55A 5LRSA 4JX0A 5A3NA 1YCIA 4I30A 1W8UA 3LPFA 4QM9A 4INDA 4XF0A 3WD5A 3JQWA 4K8RB 5LBEA 4FVVA 5BNNC 4JDMA 3MFAA 3PUSA 1S0BA 2GNTA 2I74A 4XTPA 3MYXA 5FP8A 3SLIA 2AACA 1ENQA 2VMGA 4NRPA 1AYN3 1DQ5A 1G9AA 3V65A 2GMEA 2ZX4A 3POJA 4Q4W2 3ZFFB 1I3HA 5LBFA 1F5JA 1AL23 2BQPA 2XBO3 4XJ8A 5LA2A 3HVDA 2OQ7A 3WG1A 2GDFA 3T09A 2HWB3 3V0AB 3M3QA 5FOBB 3BPZA 1BVVA 1AR73 4GD4A 4JHTA 4JGZC 3TEYA 3PUQA 4LO4B 1GLHA 2YBSA 1KGYA 4R4ZA 2QZ3A 4XF3A 4Y22A 1AYM2 5F39A 2K2SA 4MGYE 2A3YA 4RQPC 1DYKA 4P5YA 2JG9C 1C1FA 4Q4V3 4R9DA 3O1TA 1A34A 2WZ8A 3P1IA 3POIA 4IQPA 4QQPA 1URXA 3ZKUA 4F7ZA 4GH4B 1VLNA 4L99A 1Y9GA 2R32A 1QJX2 4K9SA 1W0NA 2BBAA 1Z7S3 5IVEA 1DZRA 3OGVA 2ZGNA 3NV3A 5KXEA 4W8JA 1RC6A 3IKWA 2DTYA 4YW7A 5CKNA 3LEKA 3ZM8A 4RA0A 4L92A 4QKDA 5E89A 5B4XA 4QXCA 3DECA 5FZ0A 1C28A 4MXWB 1AHSA 4OI1A 1D7PM 4HFSA 4S2GA 4UFIA 1NUKA 3ZYGA 2UWCA 5D8AB 4QHOA 2IFRA 2QQJA 2XWBB 1Z0HA 2RJLA 3AYCA 3NAPC 3OPTA 2AH2A 1UYZA 4JRLA 3DV8A 1GWKA 2VCAA 2P3IA 4TN7A 4XJZA 4XVHA 2OKXA 3D6EA 4MH0E 1PGL2 2IXKA 2DVFA 4KGQA 5EJ1B 2D6KA 4QPYA 1O8SA 4RD7A 5DG1A 2Q8DA 3FX3A 1MPXA 5FZ7A 3VZJA 4QAWA 2QQOA 4CDUA 1VRH3 3KB5A 4HMZA 5JLVA 3PHMA 3K75B 1AYN2 4PBOA 4Q4X1 5E8AA 4BXFA 2O8QA 1ULDA 4Z2WA 5L7OA 2JICA 1W6NA 2QCSB 4NIAA 2D97A 5FZAA 4AVBA 1DQ6A 5IVCA 4FTSA 1JS9A 2XBO2 3OUIA 2NMOA 1GQGA 1VBE2 3BUCA 3DYOA 3WX5A 1NXD1 2ZX3A 3GJAA 4GMP3 4GJYA 2P37A 3IDAA 1C1LA 3VKLA 5F2WA 4NIIA 1QQP3 1DQ4A 2K9ZA 3N4MA 2B9VA 4JQRA 3WZ1A 2FMDA 1GOFA 4H7MA 4O61A 5C8CA 3MW4A 5AVPA 1YQ6A 1DHKB 3W58A 1OF4A 1WD4A 3TNPB 3LWCA 4Y3OA 4XXAA 3O1VA 2JWPA 1EV11 2ZZJA 4N9HA 3U78A 1UU6A 2DVDA 5F5CA 2YDEA 1BK1A 1ND2A 4C8DA 4QKBA 1SLAA 3I2IA 1Y3TA 3CZUA 3ZSMA 1OOPA 1XNKA 4IV3A 5BPXA 2CWMA 1RUG2 3K3NA 1W8WA 2JENA 2OVUA 2BUKA 3N9NA 1W3XA 4LK6A 5FPAA 4AGRA 5IK5A 1OSGA 2BDRA 3LEIA 1PK6A 3FN9A 2D44A 1UY2A 5FIXA 1OLRA 4A3ZA 1UOBA 1ASJ3 2DBNA 4FPLA 2ID4A 3UETA 3FE5A 3E5XA 5HBAA 3W5MA 1QXPA 2XLFA 2VUJA 3MI8A 5FYSA 4UW4A 4NRQA 2LROA 5JOWA 3WNMA 3POSA 1SFPA 4QDRA 2Y0OA 3HN1A 4XUPA 1QDCA 2XJRA 1VRH2 2WO3A 4Y33A 3NJXA 5CU1A 5E6HA 4YARA 4HBNA 3MDPA 3ASIA 1RUE1 2GP3A 2RS31 2HYXA 2ZZQA 5JSRA 2JDKA 2PQSA 2KXLA 4QB6A 4FFHA 1X50A 4XQDA 4MGZE 3H7JA 1I5ZA 2VL4A 4UFMA 1RUJ2 5DXDA 1UYPA 2JDZA 4PDWA 3WP6A 5FY9A 1CIYA 4QX2A 1FOD3 1QWRA 3I2HA 4YLZA 3L2YA 3ORJA 5DZEA 1YNAA 2UURA 5FXVA 5FZBA 4COVA 5HCAA 2PHLA 1QQP2 1XOYA 2RDRA 3NL1A 4DY3A 4DFSA 1QJZA 3H3ZA 3HQXA 3L2HA 4CP1A 4Y1ZA 1ZRFA 4Q0PA 3WF4A 1Q8OA 1JOPA 2G1MA 3BPSA 1WZXA 1PHMA 2G9FA 1ZZ8A 2ENRA 3N9PA 3T0BA 2CHHA 2XQRA 4XJWA 5BNNA 2JXAA 3WQ1A 3I97A 4ASKA 4P9LA 2OPWA 4CCOA 3CBNA 1N3OA 1G9FA 5FPBA 1AJOA 1JN2P 3NO8A 5FY8A 1C8M1 4LHLA 1PZ9A 3ROUA 3ZXAC 1WMEA 4OLLA 2IVJA 1WKYA 1IS6A 4QB2A 1EPZA 2WDBA 3KF5A 3OEAA 4TXWA 5A3WA 1HJFA 2JE9A 5F3IA 1CAUA 1C8NA 2BWCA 2ZA9A 1MR5A 1E5IA 4BA6A 3MW3A 1ASJ2 2R063 4LHSA 1OA3A 1S1AA 4JGZA 2R0FA 1B35B 2IVIB 4A2UA 1JZ3A 1GNZA 4JDOA 4LOTA 4YW4A 1UMZA 1V6KA 1APNA 2E63A 3LIGA 4JKLA 4MVTA 4CDXB 4IEYA 1SBDA 4JGYB 1N3QA 4P00B 4RQPA 4YZ5A 3VD9A 2JG9A 2NZ9A 3KVBA 4YFWA 4UFLA 2MPFA 2L9LA 2VVDA 3F2ZA 2KR2A 1W0OA 5GZFA 4BWOA 2Q5TA 5FYZA 5JOXA 1POQA 1UPIA 2IXJA 3GYDA 4FFFA 3S5QA 3TRSB 1AUYA 4PI2A 3M8LA 3RZHA 1IPJA 1GU3A 2WNVB 2GN7A 2GC2A 3ACGA 1UY4A 2CNAA 1UZZA 3J26N 1W8OA 3CEWA 3LA2A 2WWUA 2PTMA 3HBKA 4LKSA 5HV4A 5IK4A 1FOD2 2DV9A 4E27A 4LLOA 4Q0VA 5ABJB 3ETQA 5CYYA 4AFDA 1IHMA 1AR93 3GZEA 3JB4C 1G6NA 3NAPA 1XNCA 5I0TA 1W2NA 1NG0A 5FY1A 1YI7A 1QJY3 3JD73 3KQRA 4QGMA 1JXNA 3V0BB 2RS11 3DF0A 3AYAA 3K3OA 4CSWA 1F4AA 3RYKA 1RTVA 3KT4A 3PVEA 3G7DA 4HKLA 1DGRA 1PM7A 1W6QB 3I8TA 3POGA 4XHBA 5FLJA 3VB9A 2PHDA 1YUDA 2WZEA 3AYEA 3ZYHA 4YG3A 2IWGB 3OF1A 4DQAA 4DEQA 1WCDJ 4IW3A 1RITA 2Y6KA 3KWVA 4PLOA 3AKPA 4XACA 5D8AC 3OSDA 2ZOEB 2H0VA 2Y6JA 3FZ3A 1AL21 1IQDC 4P14A 4CXYA 2R062 1LODA 4MGKE 4XEZA 2EAKA 4BJ0A 1ODNA 4JZRA 3ELNA 2O8OA 1ONAA 2HWB1 1KFUL 2VZPA 5FZCA 2XL7A 4CXXA 5I91A 3FHQA 3C2UA 1AR71 4GZ9A 3UK9A 2WR9A 3QH6A 4OQ8A 1AXYA 3ZIXA 2C0ZA 4Y4RA 4BQYA 5CFDB 1YQCA 2F4LA 2G9ZA 1DGWA 2BZDA 5A7WA 2UWAA 2QQKA 1XYPA 3ATGA 4AXOA 4Q4V1 2ZGKA 5EJZB 1XU1A 1AXZA 4IEZA 3RWKX 3UKNA 1S2KA 2JDNA 2WO7A 4AGVA 1PO23 3MIDA 1AXKA 1N1SA 2CDOA 2SLIA 2VU9A 1SCRA 1TQ5A 1Z7S1 1WA4A 5J3UA 2YGLA 4XBNA 5FOJB 5JPNB 5J7MA 1BMV2 4LO6B 4XHXA 1GMMA 1H2LA 2E7AA 2XJVA 4L0PA 2FDHA 4P9WA 5LEJA 3IDBB 3ILFA 3QOPA 4FT8A 1QF3A 4HETA 3WP3A 4IDZA 5JDBA 4AVTA 4EWDA 1DGWX 1QH6A 4QDSA 1FI2A 4FPFA 4HKWA 2E33A 1QJY2 2XVGA 3JD72 4Y1XA 4PHZA 4LPLA 4QGNA 4EV0A 1W28A 2JDAA 1S0JA 2VMHA 5EPAA 2ZACA 4RR3C 3KHCA 3BYWA 4S2FA 1J58A 2PXJA 3M2MA 3R6SA 1LOFC 1W6OA 4PJYA 2YFZA 3CMGA 1J3QA 2EIBA 1DP0A 1GANA 1JOBA 3DGTA 1PVXA 2WA3A 1TME2 3OTFA 4MSVA 4R9AA 5LATA 5FO8B 4XTMA 4HANA 4BDVB 3DXUA 1VRH1 3O0VA 2XB6C 4O7XA 2UWBA 1ZBE1 3IIAA 1K5JA 1Q8VA 2O1QA 4H14A 5IAVA 3QCWA 4GWJA 4IGQA 4JKMA 5DMYA 4NUBA 1RUC3 4BOWA 5KXDA 2VCCA 5GLUA 2RS53 4OMCA 4TZDA 3T2TA 4URTA 1W8FA 1W03A 2VZ3A 3KZ4C 4K6BA 4GMP1 4CCKA 2RDSA 1JODA 1PGSA 2XJPA 3MEPA 3WLUA 3MO4A 1SDDB 1BBT2 3BTYA 1QGLA 1OF3A 2MEV1 4GKXA 2B8MA 1NKGA 1ULCA 4LBNA 3UJOA 5JZGA 2R0HA 1UZWA 1UAIA 3NW4A 2QQPA 4Y1VA 4WZCA 4XF4A 3BTAA 3C7EA 3SCGA 3I2OA 1PX3A 2WO1A 1ZA4A 3DKQA 3ZPOA 2GC3A 1IQAA 2ZEXA 1PO22 1Y43B 5AC91 2EXIA 4TWTA 5JI7A 1TEIA 1F9KA 3T2OA 2PAEA 4P9XA 5GM0A 3S0MA 1OLMA 1V6JA 2UYBA 2GN3A 3BN6A 3VHNA 1JZ8A 4Z92B 4N53B 4BLJA 3GHNA 3OD0A 5F8PA 1WBFA 1LOBA 2JX9A 3EXUA 4JRAA 2B5HA 2HH9A 3K4DA 3J9SA 4AOCA 1POV0 1LESA 1XBFA 4AEKA 1LOAA 3AM2A 5HCBA 4FAHA 2CAVA 2A6WA 2ZMKA 2ORZA 5FMDA 2LALA 2OYZA 5B2GB 5CKQA 5K4LA 5I93A 3I4IA 1V6NA 2Z5WA 1GZWB 1KDKA 3VKOA 5FTTC 3WF1A 3FC0A 3HR9A 4QX1A 5A7SA 4ARYA 1NY71 2W1SA 2B45X 2YY1A 2ZCWA 3OGSA 4M4PA 4Y5TA 2G4IA 3FBYA 4PBPA 3V0AA 2HWF3 3B69A 3BU7A 4AEDB 2WSVA 1Y9QA 4HPKB 5DPNA 3ZFGB 2HWD1 3DKWA 1B35C 2ZEWA 4XDQA 2WC2A 4LMFA 3OBAA 2TNFA 3SH3A 3ZDSA 2X53S 5CEHA 4CDXC 4JGYC 4ITCA 1DCSA 5A3TA 5JZGC 3R0RA 4EN6B 1FOD1 3ZXEA 2ET7A 2BV4A 2FMYA 4N43C 2ZKLA 3IWZA 3T1MA 3S6PA 4B4RA 1AX1A 1HKDA 3RGBA 2X09A 3NJVA 3PTYA 4Q0SA 3ZDVA 1N1VA 2WN2A 1MACA 1YHFA 3KM5A 2E6VA 3ZN6B 5LZ6A 4WM8B 5L73A 1SPPB 5FRAA 1XE7A 3N3HA 5K8SA 4BQ4A 3MV01 3VGIA 3OBRA 2E51A 5F5IA 3ZLIA 3Q8FA 1JYXA 3WUDA 2DCYA 2QQVA 2RR11 1NQJA 1REFA 1W2OA 3NWKA 3CQOA 3OGGA 1HRI3 3KV5A 4R52A 1QJU3 2VBPA 4EJRA 4FAGA 4MXWA 3OPWA 1TNFA 5J96B 2X8KA 4Q4X3 2WFF1 4EZ4A 5D8AA 3IDCB 3PU8A 1SLIA 3R05A 4HSJA 3OY8B 4YSFA 1FNYA 3PU3A 1WW7A 3KHBA 4MLOA 4CZSA 4FPOB 2X10A 4IGOA 2HEWF 2R7EB 4HT1T 1R64A 2V5YA 4CCEA 4KGGA 3AJZA 1CPNA 2R061 1MZFA 4NWVA 1DYPA 3SH5A 3USSA 1FMD1 3OBZA 4FTBA 1A8DA 2J22A 1EUUA 4EN0A 1IS4A 2PN5A
chains in the Genus database with same CATH topology
2YUEA 5GKAC 1O5UA 2R043 3KCCA 4QPIC 1SLLA 2IXLA 1O3QA 3HT2A 2WNEA 1QDOA 3ILNA 3VV1A 1SLBA 5EXOA 4IEUA 4YVWC 3MPPG 3ZO0B 4QT6A 3N7LA 4EN8B 3EO6A 3PVBB 1H8TB 3WT3A 2QDNA 4LBOA 5CFDC 1CIWA 2QE3A 1COV1 5C9AB 4FOYA 3GNEA 4FSJA 1AR91 3CU7A 2FQPA 4ZKTB 3MF9A 1YJLA 4RR3A 3RNSA 2D40A 3AB0A 1LOFA 3M4FA 5DDJ1 1QJY1 3SISA 3JB8A 3CO2A 5CBLA 1PIV1 2WZR1 1X8EA 1YYNA 2A5ZA 3JCIA 5T55A 3RMYA 1K5MB 2OZ6A 1LEDA 3WQ7A 4IL7A 2H6CA 3E6BA 1HRI2 4M0NA 2QFEA 5F5QA 4N90A 4CEWB 2DYCA 1WLDA 2A3WA 4Q4X2 2R1DA 3AKRA 1RUE3 5LEKA 2D3SA 3H0OA 4AK3A 4DMIA 5HI0A 4BCUA 4FPCA 3IBMA 1LHOA 4EN7B 1QMJA 4P9IA 4FOQA 2IC1A 1ENRA 4OHWA 1CAXB 2RMU1 1O4ZA 4IV1C 1BKZA 2BWAA 1QY4A 2GNBA 2XKPA 1NLSA 1HV1A 4KL1A 4NR1A 4AFMA 2XH6A 4U36A 4JVAA 1VBD3 4FP3A 4Z82A 3H8UA 3THPA 3H1YA 3E5UA 4LO5B 4HZFA 3VLBB 4E4ZA 3KCYA 2R073 4HKOA 4AI0A 2I45A 3FFZA 4QPGB 3D5OA 2TEPA 3JZVA 2GC0A 4H55A 1NOVA 3DL3A 2MHFA 4Q27A 2NLRA 5CVRA 5KHHA 5T5LA 1IKPA 1C8M3 1R1ZA 2WSUA 3M3OA 4Y4YA 3RSJA 1UF2C 1OFSA 1Z78A 3MLKA 4X8PA 1JOJA 3EJKA 1X36A 2VG9A 5E16A 2DCZA 4IEQA 1J1TA 3AP7A 4F83A 1DQ2A 4FQ4A 1AF9A 3WUCA 1V6MA 2EALA 2VNGA 3ES1A 1ZBA1 3NVCA 5A33B 2WJSA 2ZGLA 3HT1A 4PQ9A 2ZKNA 4KU7A 4ES8A 5C4WB 2A70A 2OW4A 4QQ2A 1LTEA 4AEMA 1OQEA 2WWSA 4N53C 2JE7A 2Y38A 5FDBA 1H8VA 1PGW1 1RUE2 1KJLA 2RS32 1PNGA 1B35A 1DZQA 3H7YA 4QM8A 1F8VA 4YM1A 1BYHA 4OHVA 5J98B 1OI6A 4CDXA 4JGYA 3AMQA 3USUA 5CAZA 3MIBA 3U07A 3M7AA 5JZGA 5H9RA 4Q8KA 1ZX5A 4B7KA 1RUC1 1D2SA 4N43A 1JHNA 1OA4A 2D6NA 2RS51 2YMZA 2XVLA 3GBWA 1RINA 2RJKA 2VXRA 4GKYA 1O4TA 4XOGA 1SEFA 4LBQB 1V6IA 5IT6A 2HKXA 5ACA1 3IDEA 1QHDA 4XFAA 1RUI1 1NE6A 2R072 3B9CA 4M01A 3RJ2X 3CJIC 4HLTA 2RS13 3PNAA 4XJ9A 5IK7A 5DUUA 4K20A 1JYCA 5HCFA 3MLLA 3AXDA 4DOUA 1C8M2 1H9WA 1KDMA 1YXWA 2YXSA 1FPN1 1Q56A 3VDDC 3LSDA 3AFGA 4LA2A 2VGDA 3AMHA 4WM8C 4Q8LA 4Q26A 2Z69A 1W6MB 1SLTA 4M0HA 1W6QA 4F3JA 4AVSA 5FQ0A 4XXPA 2D7FA 3ME2A 2OUHA 1MEC3 4AQTA 2R49A 1CAVA 4META 1BZWA 4GWNA 4QPIA 4HVRA 2D6PA 3AJYA 4FPEA 2DF7A 4YVWA 1D2QA 4XJAA 2CL2A 3BOWA 2BVBA 2HWF1 1CX4A 4Q4Y1 3ZXDA 1XQNA 5CFDA 3AZZA 4XMAA 3ZVXA 3SITA 4CP2A 1G9DA 3P3PA 2DWRA 4AVAA 2OA2A 5FO7B 4ATEA 3H1MA 3EQEA 1DZTA 2B9UA 3VHRA 2VH9A 2UYAA 1IS3A 1WUVA 1AX2A 4PIYA 1G7YA 4Q0QA 2WA4A 1V9U1 1MS1A 5BNQA 2RS12 2R16A 1H8TC 4R9BA 1AR63 1HRI1 4M3CB 5JCTA 1ZRCA 1QJU1 4AF9A 4GQ7A 3VBRC 5KHIA 2X5IC 1VBB3 2WT1A 1ZBE3 2Q1MA 1PO11 4DRRA 1AL22 3E97A 2ZX2A 2I07B 3M3CA 4IV1A 4N7IA 1MZEA 1K5MC 2HWB2 3WXPA 1YIFA 2BPA2 4CEWC 1AR72 2NYYA 4XETA 1U0AA 1UU5A 1UW8A 3ZMOA 4HK8A 2MEV3 2ZAHA 4FTEA 1Y7BA 5FLIA 1NXMA 2R041 4Q4V2 1U5IA 2IXCA 3AMMA 2AR6A 5J09A 2VQAA 1EY2A 1GFF2 1DU3D 2F4PA 5AC93 1PNFA 3RDIA 3SMHA 5I0UA 1Z7S2 1I1EA 1RGSA 5I8SA 2DUPA 2DVGA 4YRDA 3RS6A 2E7QA 4I09A 4IETA 4YGCA 4E4SA 4BMBA 3HMYA 1VAMA 3NKTA 1S0DA 4YNIA 4YW2A 3ZYRA 3MGUA 4WZFA 1W39A 1EAH1 1VBA1 5D1IA 1RUNA 3PMEA 2ZHMA 1Q43A 3GALA 3ALQA 4N53A 4YZ2A 1H2KA 4AEJA 3VBHB 2AUYA 1VR3A 4LHNA 1J59A 3B00A 1KITA 2XKOA 4YVSB 4E2GA 2VNRA 3VHPA 3ZN4A 3RPQA 1WCKA 1V6OA 1ZBE2 2HWD3 2ILMA 1GKBA 1QKQA 2XG3A 3OYWB 1VB2A 1LB2A 3VKMA 3WP4A 2D5HA 1GZWA 2LM3A 4FXKB 2QJVA 5C4WC 1XYOA 2AREA 3IMNA 2HWC1 3DPRB 2MEV2 4HPKA 2A3XA 2W0XA 3CJIA 2Y26A 1VBD1 4FQZA 5JPMB 4FCAA 5FMOL 3GZUC 2R071 1AX0A 4NHMA 3SXWA 2PELA 2QUOA 4YZ4A 2RR13 5AC92 3LKJA 2ZHLA 2ZHNA 4Z1VA 3UL2A 2VOWA 4V1PA 4RHV3 1DGRN 5FMOS 2WFF3 3VDDA 2NN8A 1V6LA 4K7JA 4OUMA 4WM8A 4ATFA 1ULFA 4AE2A 2Q1ZB 2AZ5A 2JG8B 1J1LA 4P5HA 2A6ZA 1FMD3 3BB6A 4Y20A 2EF6A 4WVMB 1R1A3 1S0FA 2GAUA 5T5OA 4AVCA 4CEYB 3M3IA 4A7ZA 1VBC1 3OY8A 1C4RA 1NY72 2K0GA 5GZDA 5SV5A 3RRDA 4AHXA 4K3UA 1LKNA 3ZFFC 2YYOA 1G9BA 2ZGSA 2CAUA 2RM23 3RQ0A 2HWD2 1SLCA 3S30A 4Q2FA 2V09A 2VY0A 3I54A 2IXHA 2AYHA 5DUXA 4I01A 3THTA 2JD4A 1A3KA 1HXS3 1SBEA 4XFFA 3B5LB 2LUWA 3WW1A 2P3JA 3D82A 1COV3 4PLMA 1UN1A 2VUAA 5DUVA 3WQ0A 1GYKA 2ES3A 4GH4C 3PVNA 3RYPA 5DDJ3 4LHKA 2V73A 3WG2A 1PIV3 1H8TA 2I2SA 2WZR3 1KS4A 4S2DA 2RR12 2F6BA 4COWA 3WDWA 5J36A 1F5FA 4KWJA 2WINB 4EWAA 5CFCB 2MNGA 3VBRA 2BNMA 5C9AA 2X5IA 2WFF2 3PJQA 3K51A 3CF6E 5CIRA 1NZCA 2XUMA 3B3QE 3BOPA 1CJPA 4GXLA 4WBBA 1DIWA 1K5MA 1GNHA 3AYDA 3EHKA 4COZA 2RMU3 2O0OA 4CEWA 1FMD2 1H2MA 4L11A 5DZFA 4XFIA 4ZU4A 3OD4A 5C8WA 3B93A 2DCJA 1LHNA 3GZTB 3J4UH 1ZYBA 3MFCA 5EWSA 1LGNA 2XVKA 1MEC1 3I59B 2XJUA 4LE3A 4KNCA 1NQDA 1CESA 2CWSA 4FPHA 4EROA 1LR5A 4XYXA 4BE3A 5GLTA 5I0RA 2DFCA 4Y1YA 3W9AA 1QOTA 4UBGA 1VALA 3MF6A 1LOCA 4YW1A 1DFQA 2NP0A 2EIGA 2N7GA 3UKVA 3TYJA 2QKDA 2ARXA 1WLTA 1HW5A 4ISQA 3BODA 1PZ8A 3O12A 4LBMA 3GHMA 3RWNA 1Q8QA 1COV2 3IM0A 2BFUL 1AR92 1CD3G 4W65A 3ZYJB 1ZBA3 3VHOA 4ORFA 1UZYA 5DDJ2 4CRQA 3WNXA 2E9QA 4ASMB 4QXKA 4C90A 1PIV2 1WLCA 2DFBA 2WZR2 4A7YA 3WV6A 5GZCA 3A4UA 4XIKA 4ONUA 2BFUS 2PHFA 2YZ4A 4IXLA 3QD6A 1HRV1 5L36A 3RG0A 3R4UA 2EA7A 5LK5A 3I7DA 1WW4A 1AR61 1NYWA 3WG3A 5A33A 4TYSA 1CGPA 3QBQA 1QU0A 4AGGA 4FXGB 1XRUA 5DUWA 1VBB1 4NWWA 2XLGA 2PHWA 2YC0A 3INAA 5FFOC 5C4WA 1U5ZA 5AFEA 5L7OB 3O5SA 2RMU2 4TLFA 2ZGPA 4K40A 4OI4A 1OKQA 1LHWA 2ZBJA 4NOTA 1RHI1 1AR81 2PLV3 2ZGOA 3OCPA 4W6XA 1S0IA 5ACA3 4FP2A 3JBG3 1ENSA 4QX5A 1D4M1 1RUI3 1NA1B 1RUOA 4B29A 1NCQB 2DUQA 3VN4A 5CADA 2BYVE 2EAAA 2WS91 1YRZA 3ES4A 4MZUA 5I8TA 2D5FA 4YYOA 5F9TA 3GZAA 2EVXA 4BM8A 3LCPA 1CONA 1O3SA 4OFGA 2D43A 3DPRC 1FPN3 2DVAA 1HX6A 3TBDA 3WDTA 1ND2B 4QGLA 3EBRA 1RB8G 1AL0G 1SCSA 1ZBA2 4XE9A 4YM2A 2JEMA 4GULA 5JOZA 3KSCA 2XLAA 1X7NA 1PK6B 1ZNPA 4B7EA 1GICA 2CGNA 1SACA 3B9IA 3POWA 3ZFFA 5JIUA 4AFAA 1PGW2 4AHYA 1N3PA 3VBSB 1W6MA 1H4GA 2ZGTA 3KS7A 4MX3A 1DF0A 3P3NA 3AMNA 4Q0UA 3OJBA 4AYUA 3HD8B 1JH5A 3VZNA 1YFXA 4Q4Y3 1R091 4C1WA 3IN9A 1RUC2 2A73B 2RS52 1CAWB 1OPOA 3SHRA 4QHBA 4CEYC 4IEXA 3J8F1 1VAVA 5ACA2 1ZM1A 2PFWA 2IXIA 4PDWB 4GH4A 3ZIWA 3JBG2 2HEVF 3LAGA 3DUIA 3AZWA 1RUI2 4YM0A 1FV2A 2P2KA 4C0BA 1V9U3 4OVEA 4YFZA 2WNVC 3KLSA 1EPWA 3AMPA 4XIOA 1ENXA 2GMPA 1JW6A 3ZSKA 4YG6A 1R081 1ZRRA 4GWMA 2W08A 5ABJC 4PIZA 5I0SA 4XW3A 4RHV1 1FPN2 2VQ0A 1MVEA 1QNYA 5BY5A 1PO13 4BH9A 2X29A 2Z79A 4E2QA 2BGCA 3JUUA 2YV8A 4K1ZA 4SLIA 2QNKA 5IUQA 4AW7A 2E7TA 5CFCC 4LR4A 1KS5A 1ZZBA 1CAUB 2W39A 3MZHA 3PMSA 2ARBA 4LA3A 4NHKA 3UV9A 4QU2A 1R1A1 3OGJA 4YG0A 4HN1A 3ZXLA 1YFUA 4FOVA 1YJKA 1H30A 3WW4A 3TNQA 1Q3EA 3IPVB 2HWF2 1TMF3 2TBVA 4J6GA 2ATFA 2RM21 4FPKA 1NLRA 4Q4Y2 3I2DA 1WW5A 3O14A 4Y26A 4RS5B 1HXS1 1MQTB 3LZZA 2YGMA 4JTNA 2P17A 4MXVA 2BVVA 4DY5A 3LB9A 4I0BA 1EAH3 2OPKA 1VBA3 1V9U2 2CGOA 3AKSA 5A32B 4FPJA 2KA3A 1UKGA 2W52A 3FUQA 5T3NA 5K0UB 2WLPA 5EFUA 2GNMA 1HLCA 4C0HA 1LOEA 2JECA 3FBMA 1QJU2 1BVP1 1FXZA 2ZAAA 3AX4A 4W6WA 2HWE3 3B7MA 1BCXA 4AFCA 1HIXA 1PO12 4HSLA 4N7UA 4OHXA 5FBZA 1V70A 3VBUB 3VBFB 4XFGA 4LT5A 1LGBA 2A6XA 4KBBA 1GV9A 4I0WB 4B4PA 2HWC3 3RYRA 2BNNA 2FBEA 3NV1A 1DBNA 4DZGA 2R042 5FPZA 1UPSA 3WW2A 1DQ1A 3LGRA 1VB4A 4AVVA 1FNZA 3U4XA 1ZRDA 1Q5OA 3POYA 3DPRA 4ES9A 5JOYA 1BEV1 5JIAA 1N1YA 5JVVA 1RIRA 1AVBA 4GMP0 5DZGA 2VVFA 4O9GA 3VZKA 1HDKA 1NCQC 4YZ1A 2Q30A 4LO8A 2D6LX 4WVWA 1EP0A 2Z2SB 1EAH2 1VBA2 1RJ8A 1POV3 1T6GC 5SV8A 1QXJA 2QVSB 5DG2A 1KFXL 5JAXA 2VW0A 1ZZCA 4LUMA 4LULA 4C1XA 4PCRA 1RUF1 1RJ7A 1JUHA 1MS4A 1TNRA 1JYIA 1VBC3 2DURA 3S7IA 5TSWA 3AP5A 2WT0A 4B4QA 5LK7B 3HBZA 2ZMNA 3NJZA 1MS9A 3WINE 1SBFA 4QMAA 4WVMA 3OPZA 4A3XA 5FO9B 5JSPA 4LUKA 4KU8A 3KT7A 4CEYA 3VZOA 1VJ2A 4XFCA 2GZWA 1I9RA 3WHTA 4WM7B 5T50A 4IEPA 1U12A 1RVF1 2HWC2 2R6QA 2BEOA 1L3JA 3KMHA 2PLV1 1AYM3 1CQ9A 3A0KA 3VBSC 1IKQA 1LRHA 1ND3B 2WNVA 5T52A 1VBD2 3JBG1 4AEDC 1HV0A 1N47A 3ZFGC 1MS8A 5F6LB 3S7EA 1CN1A 4WVZA 3VL9A 4P9JA 3MIEA 1A8MA 1QJX3 5ABJA 4YGDA 5EJ3A 1C5IA 2NM1A 4OI0A 2ZTNA 4J1WA 2GH8A 4OULA 2HJIA 4D3WA 2BNOA 1OLQA 4DB5A 5FREA 4NN0A 3LOBA 3V0BA 2B7YA 4LLFA 1OFNA 1IGOA 1YLLA 4Z07A 5CFCA 1PVC1 4AI2A 3ZYIB 3DN7A 1MZ5A 4CTEA 1YWKA 1J3PA 3NSTA 3MLJA 4AG4A 1XYNA 4LBJA 3ZXGA 3V64A 1IOAA 1VBC2 1M06G 1JUIA 1X8MA 4COUA 1RMU1 1D4VB 1C57A 1UL9A 4JTOA 3KGZA 5JR7B 1RUH1 2H6BA 1LULA 4XF1A 5CG9A 5J37A 1LU2A 2GNDA 4XPVA 4AHWA 1VBE3 3I59A 3C3VA 5JMCA 1SDWA 4M3CE 5BXXA 2PHXA 4MGIE 5BNPB 2CY6A 3LSEA 4ZU7A 5T54A 1PZ7A 1YFYA 4MV2A 1V00A 2VOXA 4XILA 4B3NA 3TOJA 3WCRA 1O91A 1QXRA 3SNMA 1TE1B 1C5HA 3FLRA 4LTAA 5KBFA 4M3CF 4RS5C 1HRV3 4G3YC 1MQTC 1CJDA 1UIKA 4L2NA 5BUVA 1LEMA 3WDXA 2E53A 1RUG3 4E2SA 3VKFC 3N36A 5C9AC 5K9YA 2YROA 4YW5A 3JQXA 3SH4A 1S0GA 3AZVA 1RUD1 1H4HA 2YPJA 4Z8BA 5K0UC 1H0BA 2WIIB 4OZXA 4BZ4A 3MICA 1IS5A 1YIPA 2DVBA 4K8FA 1AZDA 3U10A 4D7TA 1RHI3 1AR83 2UY9A 2ZGMA 1NE4A 4OI2A 3MIFA 2VMIA 1MEC2 4LO7A 2CV6A 1D4M3 2VW1A 3L9JT 4OUSA 4KH9A 5L19A 1S2BA 4MYEA 4WVVA 3JU9A 1U5YA 1UCXA 2WS93 3WG4A 3AXEA 3VBUC 4H3WA 4P9YA 3VBFC 1ULEA 4HK9A 4D7YA 2UY8A 1OQDA 2VNOA 4LBKA 1O3TA 1TMF1 1RUJ3 4LBLA 4SBVA 3TN93 4IESA 3AP6A 1NA1A 1NCQA 4XQWA 4QD2A 2WNUB 3RZZA 3NV2A 5GJ6A 3ENRA 3UJQA 1F2NA 2ZGQA 4QPGC 4W6YA 1F31A 1I6XA 4AFBA 3ZFEB 3VBOB 1XU2A 3NV4A 1A6CA 5GALA 5BNOB 3FLTA 1HRV2 2GSYA 3LA7A 4RR3B 3WP5A 4NO4A 4KWLA 1AR62 4YM3A 2ZMLA 2Q4SA 4HVQA 3FWEA 4HL0A 3BCWA 1VBB2 2HWE1 5GZGA 1BJQA 2HEYF 2D3PA 1J3RA 5KHKA 4C91A 3VL8A 1R093 2DU1A 1FT9A 4DPNA 2DU0A 3WHUA 4IERA 1RHI2 1AR82 2WQ4A 3QACA 3J8F3 3QLQA 4Y5Z0 2EXHA 3VBSA 5H9PA 1D4M2 4AEDA 3MPBA 3ZFGA 2WS92 3WOGA 2C1FA 3FLPA 2ZGUA 2D6MA 5KHJA 1WMDA 3MW2A 4FBFA 1CAWA 4BLIA 1R083 3O7OA 5KHGA 3VKNA 1OQ1A 5H9QA 3PVOA 4XJUA 4WM7C 3TN92 1O7FA 3ZSLA 4YW3A 2ZPXA 1H1MA 4JC1A 1GR3A 5E1RA 4BQ1A 1ND3C 2P34A 3WDUA 5K7PA 3ZN6A 4QQLA 5FAXA 4HVOA 2ZX1A 4GIQA 1U5XA 1VP6A 1O5LA 3URFA 2DTWA 4JAAA 5CB7A 1G9CA 1POV1 2CYFA 2TUNA 1EYBA 3ZXKA 3H3UA 4GB31 4FOWA 4CDWB 1QH7A 4ISRA 2IZWA 4XFBA 3ACLA 4PF5A 5I8YA 1S0EA 3M1HA 2BBVA 4AI8A 4JV4A 2DUOA 1GQHA 1DGLA 1WBLA 4Q4W1 1R092 3V56A 3D0SA 4LNVA 1WCSA 3R4DB 2C9AA 3NKGA 3KCXA 3B01A 1W6PB 4R4XA 3J8F2 1KRIA 3USUB 3N7KA 4R8HA 4BIOA 2Z42A 3ZXJA 3IPVA 1CR7A 3CL1A 5JZGB 3TAYA 1MS5A 3FFQA 2DCTA 5LRRA 1AYM1 4MUVA 4N43B 1DQ0A 1A78A 3HWJA 2ZJCA 2FHRA 1DLLA 1OMIA 4RS5A 4XFHA 2H0BA 1NCRB 1MQTA 1R082 4RFT0 3E6CC 1QJX1 4CDQB 1XNBA 3ZSEA 3R4SA 4ASLA 5BNPC 4RHV2 4RSUA 1H2NA 1C3HA 5A32A 1D0GA 3VUOA 2WT2A 1MS3A 3PLQA 2BTVC 5K0UA 4Q1RA 3M70A 2D98A 2VULA 1S0CA 3RMXA 1FV3A 1SQ4A 1JBCA 5KC6A 4PLNA 4OHYA 4BYYA 4IEWA 5FPXA 4I2OA 4L97A 1R1A2 4AQ6A 1PGL1 1TME3 1Q8SA 3T1LA 3VBUA 4H7LA 3VBFA 5FQ0B 3AKQA 2B46X 1AYN1 4E4DX 1CAXA 4Y22B 1CAVB 2RM22 4QPIB 2XBO1 1BEV3 4A7KA 5HXVA 4LBQD 1Q8PA 4YVWB 1HXS2 1VBE1 2C5DA 2ZX0A 3ECQA 4DNYA 2A6YA 2AENA 1YFWA 2XPJA 2A75A 4NVPA 2XL9A 1BBT3 4QPGA 2PAKA 2UU8A 2QZ2A 2JKBA 5KXBA 5KWRA 3WW3A 4KG0A 4D7SA 4Q29A 4FO9A 5JSOA 4I02A 1DG6A 3SCHA 1RUF3 2GH2A 1UD1A 4Y1UA 2ZGRA 3ILRA 2WNUC 2AGSA 1SFNA 1G86A 3BIWE 2A7AA 3BALA 1RUG1 3FJSA 2XJQA 2R1BA 1FATA 4AQ2A 4CDUB 3ZFEC 3VBOC 2GALA 3K48A 1LU1A 3B94A 5BNOC 4R9CA 1W6NB 3VBHC 1RVF3 5EYYA 5AFBA 3ZSJA 4XF9A 1AJKA 5T5PA 4X8NA 1LJ7A 1UX6A 4IV1B 2B39A 1ALYA 4YVSC 4EN9B 2WFPA 5AVAA 2OUJA 4KQ7A 1MZ6A 4WM7A 4UW5A 3IT8A 1MVQA 3H9AA 5C8CB 1REDA 3VZMA 2NMNA 4LBQA 1BEV2 1RUJ1 1SFYA 4LE4A 1ND3A 3TN91 1SMVA 3ZYPA 1WMFA 1GZCA 1QNWA 3ZN5A 2NQYA 3FUOA 4LEJA 1QOOA 1QQP1 1VIWB 4RL7A 3WY6A 1OOPB 3D8CA 4IV3B 4U2AA 2HYKA 1PVC3 1ULGA 1JTZX 3CLPA 5F6KA 3WVJA 5C6CA 5CG8A 1H9PA 1HQNA 1RUF2 1ZZ9A 1B09A 4K21A 2RHPA 4IEOA 4NHLA 2SBAA 2CTVA 2PHRA 1RMU3 1LCLA 5GLWA 4GA9A 5A3LA 2DCKA 2RE9A 3TB0A 1UKRA 3Q9OA 2JG8C 4DRVA 4UW3A 1LECA 1RUH3 1WLWA 3ZMNA 1PMIA 4CP0A 3AZYA 1LOGA 2PHTA 4CDWC 1ASJ1 1M4WA 2D3RA 1RVF2 3ZPYA 1E57A 1UIJA 2PLV2 3WCSA 1ZREA 5EZWA 5GLVA 4F8AA 2XWJB 1RL3A 5JWPA 4RGGA 1OHFA 5CA6A 5A3MA 1XXNA 3CJIB 5BNPA 2GU9A 2A71A 3H1WA 4G9SB 4DXZA 1REEA 1N1TA 3B02A 3HAGA 1IPKA 4FPYA 5FCCA 2YHJA 5BNNB 3AZXA 1MS0A 2EXJA 2R30A 4COYA 2KM2A 2VW2A 4UXAA 2WKKA 1LGCA 1RUD3 3VDDB 4O9EA 1VAKA 3U11A 1PVC2 3O0XA 4L8QA 1NCRC 3E5QA 1QOSA 4CDQC 4YGEA 4M3CA 4DINB 2ERFA 5J48A 4XBQA 4YGBA 3ZXFA 2IFWA 2ZABA 4RGAA 4AI1A 4JGZB 4HN0A 1KXGA 1RMU2 4Y20B 4S2HA 1CPMA 2OIIA 4RQPB 3GF6A 2JG9B 1RUH2 2VVEA 3AP4A 4BHPA 4JCKA 5CNAA 2G9GA 2XHKA 2XGXA 4OHZA 3KT1A 1BXHA 4Y24A 4D94A 2OZJA 2WQZC 5FLHA 2P3KA 1WW6A 3E6DA 3H50A 1XNDA 4XQ4A 2BW8A 1LENA 4N9IA 4TSVA 3X29B 4UW6A 1YI9A 3D4KA 4KWKA 2EXKA 2VOVA 4CYDA 1EV13 5EYXA 2ZHKA 4I3PA 1BQPA 2WNUA 4XMIA 2VPVA 2GMMA 3NAPB 1KQRA 5JI9A 3FMGA 1W2UA 1H1IA 4D69A 3AK0A 4DS0A 1BMV1 1CVNA 5E88A 3ZFEA 3VBOA 3VBRB 2WLQA 2X5IB 2XJTA 1H1AA 1RUD2 5BNOA 4E9KA 3MIHA 3RJRA 3VBHA 3WR0A 2D6OX 4AWDA 3JD71 3FHIB 4EWEA 4I3GA 3N7JA 3PJYA 2PA7A 4YVSA 3APBA 2PQQA 4QQOA 1X33A 3OYWA 4FPGA 5IK8A 1TME1 3N35A 2RS33 1OA2A 1WD3A 4CDUC 2JJ6A 2Q8OA 3KGLA 5GLZA 1DDLA 1TMF2 4X6QB 5L7OC 2PHUA 3W59A 4XZPA 2GC1A 1KJRA 2PAMA 4KG8A 1G8WA 3GBGA 2WZPP 4PIXA 2ETEA 3AFKA 1NA1C 1FYUA 1W0PA 5T5JA 2ET1A 4ZU5A 4P9GA 2B42B 1BBT1 2VECA 2NPIA 4K1YA 4GALA 3AKTA 1LHUA 3M3EA 1HQLA 3LA3A 4NPRA 3WDVA 5GZEA 5C33A 2VOKA 3OBTA 5C8CC 4GB33 2W68A 1EV12 3G6JB 4L9BA 3U0ZA 3ZX7A 3VZLA 1O4YA 1PO21 3GBFA 1GBGA 4IEVA 4XBLA 4J1XA 4WV8A 2JG8A 3TWIA 3LOIA 1ND2C 4I0AA 4B8EA 1OOPC 4IV3C 2Y0IA 2HWE2 1W6OB 3RI8A 1O3RA 3WDYA 4BPZA 5KXCA 4Q4W3 4CDWA 3A0NA 1XE8A 4JDNA 3SCFA 2A6VA 1PK6C 4X6RB 3CNAA 2FZ1A 3AP9A 1ZZ7A 5BYNA 3QH7A 1ZZ6A 3CJXA 1OD5A 1UU4A 4UBHA 2XJSA 4M00A 1LHVA 3O0WA 1WGPA 4QQHA 2D93A 5H9SA 1OPMA 4AHZA 5EV7A 1W6PA 2PYTA 5BV6A 4G4FA 1IZ3A 1KD7A 2WL1A 3HIFA 3KD4A 4AI3A 3UKTA 1FAYA 1YO8A 3MIGA 1GZ9A 2CGPA 4PDWC 1GSLA 4ZXKA 3D0JA 4BMEA 1ZVFA 3RI9A 1FX5A 2LTNA 3N7MA 5F1RA 1NCRA 4BIFA 2Q0AA 3ST7A 1D0HA 5KC5A 4Q1PA 4CDQA 4YZ3A 2ZS6B 1X82A 2QDRA 4GB32 2FZ2A 1S55A 5LRSA 1YCIA 4I30A 4QM9A 4INDA 4XF0A 3WD5A 3JQWA 5BNNC 4FVVA 4JDMA 3MFAA 1S0BA 2GNTA 2I74A 4XTPA 3MYXA 3SLIA 2VMGA 1ENQA 1AYN3 1DQ5A 1G9AA 3V65A 2GMEA 2ZX4A 4Q4W2 3ZFFB 1I3HA 1F5JA 1AL23 2BQPA 2XBO3 4XJ8A 3WG1A 2GDFA 2HWB3 3V0AB 3M3QA 5FOBB 3BPZA 1BVVA 1AR73 4JGZC 4LO4B 1GLHA 4R4ZA 2QZ3A 4XF3A 4Y22A 1AYM2 2K2SA 4MGYE 2A3YA 4RQPC 1DYKA 2JG9C 1C1FA 4Q4V3 4R9DA 4IQPA 4QQPA 4F7ZA 1URXA 4GH4B 1VLNA 4L99A 2R32A 1QJX2 4K9SA 1Z7S3 1DZRA 2ZGNA 3NV3A 5KXEA 1RC6A 3IKWA 2DTYA 4RA0A 4L92A 5E89A 1C28A 4MXWB 1AHSA 4OI1A 4HFSA 4S2GA