3ZN5A

Vp16, a capsid protein of bacteriophage p23-77 (vp16-virus-derived)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
169
structure length
169
Chain Sequence
QEAFNRIKALRPGARPATILRSGPEFSVYSGTQRVKVGEFVVPAGASWVLPNPVPVILKLYDTGGNQLPHTTDVFLAKRTKGFDFPEFLAKVQYASYYDLTEAQLRDAKFYQNILQTLSPLRAPQPPQGVVLREGDVLEVYVEAPAGVTVNLNDPRTRIELPIGVDNSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacteriophage P23-77 Capsid Protein Structures Reveal the Archetype of an Ancient Branch from a Major Virus Lineage.
pubmed doi rcsb
source organism Thermus phage p23-77
molecule tags Viral protein
molecule keywords VP16
total genus 32
structure length 169
sequence length 169
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zn5A00
3ZMOA 3ZN4A 3ZN5A 3ZN6B
chains in the Genus database with same CATH superfamily
3RQ0A 2JECA 1AX1A 1NXD1 2W52A 2OPKA 1CESA 3IDAA 2BU9A 5FP8A 3VBSC 2BUKA 5J36A 2HEYF 2X09A 4AHWA 4IL7A 3RGBA 3CL1A 3GCWA 3PVNA 4CCOA 4DXZA 1S55A 2ZGMA 3ZXLA 1PNFA 1UPIA 4CCCA 2PN5A 4C0BA 1QJEA 2WAAA 2A3YA 4KNCA 4GWIA 4Q4W2 2HWE2 5GLZA 4COUA 2BVBA 3I2OA 3S57A 3B69A 3E6BA 3NKTA 4XJ8A 4AGGA 4BE3A 2AEZA 2GZWA 2H6BA 4TWTA 3DXTA 2RDSA 1GZCA 4QB2A 2TBVA 3U75A 3ZFEC 1OFNA 4EQVA 5DZGA 1CVNA 2Z2SB 2W39A 1EPZA 4LHNA 1NQDA 2EF6A 5CVRA 1GZWA 3QACA 5FOJB 3PHMA 2C9KA 3LCPA 1O5LA 5FP9A 3ZXDA 5DXDA 3T2QA 1NA1C 2V5DA 3MZHA 2YB7A 3APBA 4D6SA 1ONAA 2BERA 2VL4A 1SQ4A 2IXLA 3M2MA 1V6IA 1KRIA 4FO9A 1E5IA 3UYJA 1HXS1 2P3YA 4CCJA 2W47A 2Y6JA 2YZ4A 1GWKA 2EXIA 2VCCA 2EICA 4XF4A 2ZCWA 5FZMA 1BVP1 3WZ1A 5DUXA 1CIYA 4I01A 1F15A 5F9TA 5EP9A 3VZLA 3M1HA 2DVBA 4Q8LA 1Z7S1 2ZTNA 1MZFA 1DGRA 1HN0A 3SCFA 4BISA 5JIUA 4PDWA 4RR3C 5GLUA 5HBAA 3H8OA 1V6MA 1W0OA 1ZZ7A 2A5ZA 2GSYA 2WL1A 2D98A 3I2DA 1FPN3 4B3NA 2VOVA 4YM3A 5C9AA 3C7HA 4F83A 3G6JB 3RYPA 3WF0A 1V9U2 3C7FA 3E5UA 3TYJA 4DEQA 1O59A 2E9QA 4OI1A 3I3QA 3WQBA 2O8OA 1UZWA 2WABA 4KBBA 3HOBA 2PHRA 2DU1A 1Q43A 5F5QA 2WFF1 2AENA 1SFYA 2YUEA 1RMU1 1IKPA 2I2SA 3AMPA 4MXWB 1ZNPA 3TN92 5FRAA 2XJSA 3WEZA 2HWC1 4MYEA 1RUD3 1GMMA 1VAMA 4RL7A 4DB5A 4RGKA 3OYWB 3N35A 1SPPA 2D44A 3ILRA 3D6EA 2ETEA 3CQOA 5A7WB 4A4AA 5A7QA 4M3CE 5DAPA 1Y9MA 1UX7A 2A6ZA 2WT2A 3KQRA 3HNYM 5FYMA 4I09A 1ZRRA 2LTNA 2RJLA 3AXDA 5A3WA 1UL9A 2WN3A 4NIHA 4RN5A 1AL0G 1KJLA 4GWNA 1YHFA 4YVWC 4Y24A 1OH3A 4LE3A 4ZS3A 1UOJA 3ZIXA 1ZRCA 5FY7A 1RUE1 3THCA 1GANA 5D2AA 3IMMA 1DF0A 1ODNA 4H2AA 1D0GA 3CJIA 4NHMA 5DUVA 3S30A 1QEXA 1MS5A 1NCRA 3BN6A 3A4UA 5FPLA 3C8XA 3EMRA 5FYZA 3Q9OA 3FUOA 4F8AA 5FTTC 3R05A 4NR1A 5C71A 1UXXX 2AC1A 3RMYA 3I2HA 4DQAA 2NN8A 4FBFA 1VMJA 2OKXA 4WM8A 4HKWA 2TEPA 4YW2A 2IUWA 1TME3 2C9AA 4YPJA 3U37A 4A6OA 3EYPA 1S2KA 1TMF2 2E31A 1VBB3 3OGJA 2WNUA 3D3AA 4KMQA 4DXTA 5K0UC 4M3CF 4OMCA 1XOYA 2R072 3H0OA 1BLZA 3AP6A 4NPLA 3WG1A 2R1BA 2V5YA 4JKMA 1VB4A 4BDVB 1QHDA 5ANNA 1JU3A 3VHNA 2A6VA 3SC7X 2ZAHA 4PLNA 4ASKA 1NCQC 5C70A 1NE6A 1D4VB 2D6LX 3DPRC 3GZAA 1OPOA 3ON7A 4LKDA 1JZ4A 4GQ7A 3WW2A 1NZIA 1JHJA 2QQLA 2JG9C 4CEWC 4XHXA 3LF7A 2OT7A 2PHFA 4NN0A 4Q29A 3WDVA 3O1OA 1VBA1 1ZBE2 1DGLA 3T0AA 1PIV3 1V9U3 5JUVA 1XU1A 1H1MA 1WCSA 3POWA 4GH4C 4RFT0 4ZPIA 4AEDC 1D0HA 1GZWB 4FPCA 2PAKA 3RDIA 4Q4X1 4D0QA 1RXFA 3T2OA 1YQCA 3BI3A 1ZZCA 4MUVA 3KCYA 3OUIA 4X6RB 1MR5A 1F5JA 4QU2A 4M3CB 3W5NA 1W9FA 3M3QA 3WP5A 2VZPA 5DAVA 5DUWA 3ST7A 4WVVA 3DYOA 3MBWA 1UZ0A 1SDDB 4UFLA 1AYM3 1IS3A 1ZBE1 1PHMA 3DYMA 2A6XA 2QQNA 1IS6A 2Y6GA 1PK6A 4LBKA 1KEXA 3D82A 5K4LA 1J3PA 5JXJA 2KA3A 1S0DA 3ILFA 2VQTA 1V6NA 1CD3G 2SBAA 3MW3A 3JD71 1W6NB 2VNVA 4QKBA 2VTXA 1U12A 2XJTA 3NV1A 4EN6B 1OMIA 1EAH1 3HVDA 4IEXA 4COVA 2BEOA 4D3WA 1ZVFA 5A3UA 3ZO0B 1MEC3 2FZ2A 2BV4A 3MUY1 4P00B 3MW2A 3V0BA 1JZ2A 4ZZ5A 1WMEA 4Q2FA 1HV0A 1BKZA 3R4SA 1PO21 2LALA 3IAQA 4AFBA 3BU0A 3A21A 3AYDA 4CP2A 4N90A 5DAXA 2VW2A 4IEPA 1MS1A 4OHVA 4FP3A 1AR61 1AR73 3H3ZA 3NJZA 3O0WA 2A75A 2F4LA 3BTAA 3OPZA 2DV9A 1JZ3A 3BB6A 4YGEA 1LOAA 1SG3A 2QVSB 1ZZ8A 4CUCA 3VDCA 5C5UA 1RHI1 4IE6A 4YLZA 2A6YA 2B5HA 5CFDB 1VBC2 3MIDA 1UU5A 3UGHA 3B93A 1RXGA 3BYWA 3MEPA 2QDNA 2VBPA 3ZYGA 1Z78A 4LT5A 3THDA 2W68A 4DRVA 2Q4SA 5LZ6A 2VMGA 3RZJA 2BGCA 2P4EA 4KWJA 1N47A 4FFGA 1HRV1 3CBNA 5E88A 4BIOA 1HV1A 3UKVA 5C8CB 3NJVA 1NZCA 2VECA 3LB9A 3FBYA 1BBT1 1LOBA 1HB4A 3OJBA 3DPRB 4LHKA 3TN93 4W8JA 2BFUS 4XFGA 4FSJA 4MXVA 4QGLA 3SLIA 2VBDA 1ZM1A 4XAEA 1PZ9A 2PHUA 4YVSA 5C3SA 3PNAA 5J98B 1BQPA 4YFZA 1WD3A 4YGBA 4CP9A 2X53S 4F7ZA 4AGVA 5J7MA 4E4ZA 5AC91 5F5IA 4PI0A 4M0NA 4FPGA 2VVDA 1TEIA 1S0FA 4I0AA 2XPJA 4C1WA 4Q1RA 3EB7A 2XLFA 3KGLA 1LOCA 1K3IA 3WP4A 4Y3OA 4KU7A 4YW1A 4HK8A 4BA6A 4IEUA 4Q0PA 4QPIB 3ES1A 4DUWA 2HBTA 2NYYA 4C8DA 1GP4A 2QE3A 5DG1A 2Z79A 5LCWL 2HWE1 4FOQA 1IS4A 2BYVE 4D8MA 1PVC2 2XWBB 4GB31 3RI8A 3AMMA 4IV1A 3N7JA 3IPVA 4KWUA 2CDOA 3AM2A 3ZSJA 2H0VA 2FDKA 1ULCA 2UWCA 3FMGA 4UFHA 1TMF1 2WIIB 3W9AA 3ZFGB 1KJRA 3LEGA 4CEYB 2C6SA 3M3OA 5FO8B 2WQ4A 5K0UA 5IVBA 3RZHA 1OURA 4FVVA 1AYN1 1W2OA 3ZPOA 3ZYBA 1DLCA 4B7EA 2BWAA 1K5JA 1KQRA 4XACA 2XJPA 1NQJA 1OOPA 4GULA 1XSRA 5CB7A 1J3RA 3PL0A 4XHBA 2XMLA 1ZZBA 5C4WA 3A0NA 3OY8A 1ZYBA 4HK9A 3S0MA 1OUXA 1ZRDA 1REFA 4LO6B 4L11A 1D4M2 4LOTA 3B02A 5IK8A 4UBGA 3VD9A 2WS91 2ZA9A 4RR3A 3TEYA 5C3OA 4FXKB 3H8RA 2P17A 1TE1B 3WDTA 1OF3A 3K48A 4YARA 3LA7A 5EJZB 1BCXA 3MW4A 5DZFA 3Q8BA 4UOJA 4XF9A 5E1RA 5FFOC 4NAOA 3AYCA 3T2PA 4KWLA 3WQ1A 2EXKA 4EYUA 5FP3A 3QBQA 3GYDA 1D4M3 4P9XA 1O8PA 3SCHA 3VZKA 2JXAA 1QGLA 1NOVA 1CAUB 4AZZA 3J7LA 5JXGA 5BNPB 4FTEA 2A6WA 1US3A 1D2SA 5CG8A 4A3ZA 2GC0A 1IOAA 1RUC1 4LBNA 2ZGSA 5HI0A 3KV9A 1PVC1 2OS2A 2V4AA 2R6QA 1F35A 4S2DA 2IVJA 1YQ8A 4DMIA 3DN7A 4UFKA 3RI9A 4YZ1A 1BMV2 1QDCA 4IEYA 5SV5A 1HIXA 4QPWA 1YIPA 2XKOA 4CCLA 1H8TC 1VBE2 4Y1VA 1C3HA 3Q8EA 4QD2A 4YVWA 4AI1A 3WF1A 4MHRA 3T4HB 1XE8A 3E5QA 3NNGA 4ZY9A 4JKKA 4DOUA 1DZRA 3DUIA 1EV11 4HETA 2RM21 5GJ6A 1NCRC 4MHUA 1NY72 4QM9A 1W99A 1TNFA 1WLCA 2JDNA 3WNMA 3RZKA 1AR93 1ZZ6A 2HYXA 2OA2A 3A23A 3AYEA 4PT6A 4EJRA 5EIYB 1LGCA 5EFUA 2VG9A 3HT1A 2WBKA 2GN7A 3IM0A 5FZGA 2FDFA 1EPWA 3ABZA 4IQPA 2VMIA 1WA4A 1D7PM 3OBAA 5L7OC 2O14A 1LKNA 4QB1A 1GP6A 2B9VA 2WNUC 1WW4A 3BOWA 4YGDA 1AUYA 2VQUA 1FYUA 4QHZA 1MZ5A 3AFKA 3OD0A 5I0TA 2YFUA 1W28A 5I0RA 2WS92 3WT3A 5FZHA 2Y64A 1WMFA 3AKPA 4QKDA 2PFWA 1AL21 1SLBA 2C5DA 2YMZA 2E53A 2VC9A 3FC0A 3C2UA 2Q1FA 3DF0A 2UYBA 2WZPP 5HCFA 5EPAA 4NHLA 1DP0A 3HT2A 1S4CA 3QOPA 4G3YC 4QX1A 4D7SA 4YW5A 3F2ZA 4QDRA 2VNRA 1AR62 3O7OA 3AFGA 4PJYA 1W2NA 2P2KA 4CUBA 3J8F3 4C0HA 4XAAA 3CNAA 1DGRN 2YU2A 4C91A 5IT6A 4AEDA 3UT0A 1DGWA 4JDMA 4N43A 2WQ8A 3L9JT 5A80A 1AR72 1PGW1 2QQMA 2H6CA 1LHOA 2NM1A 1XNTA 4K21A 4P9LA 4QXHA 1PO12 3U4XA 4RHV1 4E27A 3ZN6A 5A33B 4FPJA 5TSWA 1RMU3 1CIWA 2VE1A 2EA7A 3GCXA 4GXLA 2VQ0A 4Q4Y3 3WP6A 5C33A 2LUWA 5K0UB 1V00A 1A6CA 4E4HA 4QPGB 3LA3A 3BALA 3A22A 4XILA 4YVSC 4AAPA 1CAWB 2RDRA 4NHYA 5CISA 2DTWA 2XUEA 3D8CA 3IBMA 5C7GA 1YYNA 2QZ3A 2JDAA 4TYSA 3AJYA 5KC5A 2HJIA 2PQSA 1K42A 1OBNA 2ZX0A 2BPA2 4A3XA 4O61A 1BXHA 1EYBA 2J1TA 1UY3A 1CJDA 3CJIB 3ASIA 2ADDA 3USSA 3WG4A 2K9ZA 2WNEA 4WVZA 3A0KA 5CKQA 1FV3A 3R0RA 1DCSA 1SLIA 2WSUA 1IG0A 5D8AA 5LEJA 3E6CC 2KM2A 2R32A 3H8UA 1SCRA 2AYHA 2DCKA 1HKDA 4INDA 4P9YA 4YW7A 4M00A 2FDJA 1GNZA 3FHAA 4EN8B 4YSFA 2B46X 3CO2A 2W1WA 4Y26A 4URTA 1P8JA 4CTEA 1IKQA 3LOBA 3N9QA 3IZOA 3PMSA 1BYHA 1QU0A 3POJA 2W1SA 3VDDA 2FCTA 1SZBA 2A71A 3UV9A 2O8QA 1V6OA 2QQVA 1GZTA 1UAIA 5BNPC 3KV4A 5F2SA 1CX4A 3SH5A 4IV1B 4LBMA 4YZ3A 2BTVC 3N36A 4C1XA 1G9CA 1OUSA 1JZ8A 2VVEA 2IXCA 4KGQA 3WXPA 3TRSB 2VUDA 3ECQA 3MLKA 2Q1ZB 2EIBA 3I54A 5A6QA 4OHWA 2R0FA 1R093 3I59A 5FMDA 3OCPA 4Z2AA 5A3OA 1G8WA 1ND2A 4MVTA 4Y33A 5C4WC 2WZ8A 5L9VA 4JV4A 1S0JA 3MIGA 4NWWA 4O9GA 1I5PA 1XYPA 4PF5A 4XFFA 4OFGA 1DU3D 3O1TA 1JODA 5FZ4A 3VZOA 3EXUA 1SHWB 1YQ6A 1G86A 2E6VA 2VO5A 1XPWA 4CE8A 1W39A 4YNIA 4CDWC 5KBFA 2VOKA 1PVXA 3NAPC 1VBA3 3ZSMA 1QKQA 3PJQA 3AC0A 3AKQA 1ND3B 1V9U1 2FZ1A 3GBFA 3MHZA 3ROUA 5I91A 2CYFA 5GM0A 1W8OA 4FQ4A 4HFSA 4MOAA 4RR3B 3I3MA 1YFWA 3EHKA 5AFBA 3ZXAC 4QKNA 2HBUA 1DBNA 1HB2A 4JGZC 5E16A 2XG3A 5FZLA 1A8MA 1O4YA 3MIBA 3AZZA 1HX6A 2VM9A 4S2HA 4FCAA 5LY2A 4AOCA 1X7NA 1VRBA 4AVBA 1PK6B 3ZX7A 1GSLA 1JMUB 4QDSA 1FATA 1MQTB 4W6WA 5FYTA 1HXS3 3BPZA 3KGZA 1E5HA 1X9TA 5JCTA 2YGLA 3M3CA 5C4WB 4ARYA 1WBFA 3VDAA 4Y5Z0 2QNKA 2BFUL 1H1IA 4HVOA 5JZGC 2A7AA 3HWJA 4LO8A 2ARXA 1US2A 3E6DA 4R9BA 1W6PA 3H42B 3NNJA 5DZEA 3WNPA 3ZYPA 5HPOA 5FQ0B 4YM0A 2PTMA 4RS5B 5IFTA 5HCHA 1VBE1 5A32A 5BNNB 3KD4A 3BTXA 3FLTA 3C7OA 4NWVA 5FXZA 2ZGRA 3HMYA 2G9ZA 2B45X 2WLPA 5IHRA 4FTBA 1OH4A 4XF3A 4HVQA 1PO23 2W1QA 1SLTA 4MX3A 4LULA 2CL2A 1RUI1 1QNYA 3I4IA 2Q8DA 1WWYA 2VH9A 2JG8B 3NVCA 1AR63 2VJXA 4L8QA 5CFDA 2QQOA 1CJPA 2XJQA 2W08A 4BQYA 4OCTA 1OPMA 1S2BA 3IDEA 2UU8A 5BV6A 2R30A 1XB9A 3Q8FA 4LITA 1PO11 5I8TA 1SLLA 1DZQA 4AEMA 4AYUA 1RUD1 1FMD3 1I3HA 3PUQA 4WZFA 4OUEA 3NKGA 1IZ3A 1KXGA 4EE2A 5GKAC 3HEIA 4N43C 4I30A 4OHXA 5DAWA 4EWDA 1UF2C 3GNEA 4KG8A 1W3VA 3T2TA 1YI7A 3JUUA 2ZMLA 3WQ0A 1QJU1 3GDBA 3WOGA 4QX0A 1PM4A 1K5MC 4CPBA 4CDUB 5J09A 4AQTA 3SXWA 1GLHA 1BBT2 1UU6A 1XYOA 1JW6A 2JEMA 5F3CA 1RUE2 3A7QA 3BODA 2RS51 1OLME 3CDZB 4QGMA 1YLLA 1Y7BA 2DDUA 2PHXA 3CIHA 4AHZA 5FPVA 3J7HA 1XC6A 4GKYA 1HRV2 4N53B 4RGGA 4JTOA 2UURA 5FPBA 1DG6A 4XFAA 2X10A 1GOGA 1R1A3 1UY4A 3CU7A 2XBO3 4X8NA 1IGOA 1MQTA 3POFA 5DPNA 2QFEA 5AC93 1PGL1 1QIQA 3OG2A 2XR4A 5T52A 5JSRA 2Y0IA 4UW3A 3RVHA 4QWNA 2C24A 2FBEA 2RS52 1RVF3 1XE0A 2VMCA 3QH6A 3ZLIA 4JQRA 5JOZA 1GNHA 1F2NA 1WW6A 1ZA7A 2OQ6A 4AQ6A 4IEQA 1Z0HA 2Z4FA 4P02B 5IUQA 2IXKA 4DZGA 3K4DA 2ZOEB 3DKWA 2OZ6A 3FZ3A 4L92A 2CAUA 4WVMB 1J83A 1LTEA 4Y22B 1JYIA 3TAYA 3TOJA 5CIRA 1G9DA 4DIQA 1QH7A 3PVOA 1ASJ2 5JAXA 2OUJA 1GQPA 3RJ2X 4X8PA 1JOBA 3AP7A 4WM7A 1U5ZA 2W91A 5LA2A 5C3RA 3OB8A 1AR92 2ZXQA 5FY5A 1GOFA 1RUD2 4ZONA 3VBOC 3VDDC 4UBHA 2VTFA 3NNMA 1MEC1 1JHNA 3PIJA 4KWKA 3MF6A 4XQ4A 2MHFA 4XTPA 2BNOA 4FT8A 2PMWB 2WYFA 4Q0SA 3LDBA 4XJAA 3KT1A 4NRPA 1HLCA 3UL2A 3RSJA 1ULGA 5A1FA 1CZSA 2ZPXA 4LMFA 4XJZA 5C8CA 4JHZA 2Y34A 4KGGA 5FMCA 3HN3A 2VUAA 4PLMA 1KS4A 4Q4X3 1GUIA 2WO3A 4ISQA 4UF0A 4DO0A 2FMYA 2VMEA 2B42B 3OGVA 4AG4A 3LFMA 4BQ3A 1G6NA 4H7LA 1W6OB 4HBNA 4AF9A 2GC2A 2IWGB 3ZSEA 5BNOA 5BNQA 1VMHA 1NUKA 2VY0A 1WUVA 2OX0A 5C9AC 5DMYA 2XL9A 3C7GA 4AVAA 3ZYRA 4LA3A 3MPBA 3RWKX 1NLSA 2W46A 2XKPA 2VW1A 4XF1A 2AUYA 1UXZA 2JDKA 4K8RB 3U4SA 3VBHA 3WDYA 2JX9A 3ZR5A 1OLMA 2UY8A 5AVAA 1D4M1 4MGQA 5FV3A 3H8XA 1ENSA 4NO4A 3T1LA 5HV4A 2ZGOA 1RUE3 5LK7B 1S0EA 1VJ2A 4PIYA 2ERFA 1W6MB 1ZBA2 3BCWA 2V09A 4HL0A 2D93A 4GMP1 5F39A 5LA0A 2JE8A 4JGZB 4LPLA 3WUDA 3ZYFA 1BEV1 4I0WB 4JVAA 3IN9A 1ST8A 4LTAA 1QJFA 1REDA 2AREA 3MIHA 3RZZA 1JN2P 3OYWA 4PQ9A 1Y9GA 2HWF2 4LBJA 1ND3C 4BQ4A 4XUNA 1MS4A 1Q3EA 3LPFA 1VE0A 2DFCA 2Q30A 1SFPA 1W90A 3O0XA 4ZXEA 1MS9A 3SCGA 4DPNA 3BPSA 3D4KA 3CJIC 1R64A 4YG0A 1OQEA 3NNFA 1DYKA 1POQA 3H1MA 4XXAA 1H30A 1EV13 1F5FA 1UPSA 3KT4A 4CXXA 2BGPA 4ZZ8A 4BQXA 2X5IB 2G9FA 1O6UA 1QJY2 1N1VA 5DQ0A 5JSPA 1FOD2 1JXNA 2BWCA 5KHGA 2CGNA 4CDXA 1QH6A 1GU3A 4K6BA 2VZUA 2WO7A 1MZEA 3NV2A 4OHZA 3WVJA 5FKCA 5D1IA 3LOIA 1X9PA 2FHRA 1YQ2A 2C1FA 4EN0A 4IEOA 5A3LA 4XDQA 1H8VA 2YBSA 3BKZA 3KM5A 4HANA 3J7NA 3WHUA 4LQRA 3TNPB 1YQ5A 1TNRA 4UW5A 1GR3A 1H2LA 2WZR2 3IDBB 4LA2A 2PLV3 4CSWA 4JQTA 5IVJA 5CZKA 4A7ZA 1GZ9A 4V1PA 4D94A 4FP2A 1AXKA 3HD8B 2EAKA 2ENRA 3KSCA 4JZRA 1QJX3 4KG0A 3PUSA 5ABJB 4QM8A 2CV6A 5FZKA 4NVPA 2UY9A 4J1WA 3C3VA 3ZKYA 1G9FA 1AJOA 1GICA 2GH8A 2CU5A 2W5FA 3P3NA 4HKLA 3O0VA 2WKKA 1RUF1 2E7TA 2JG8C 2VZOA 1N3PA 3T3YA 3KB5A 4YFWA 4CEWA 1NT0A 2HLEA 3FHIB 3KF3A 2J1UA 1RL3A 2AR6A 4O65A 5DUUA 4K9SA 4DFSA 1EUTA 5FPXA 2VZTA 4DUXA 4NAMA 3J26N 3N7KA 5D8AB 2ZBJA 3DGTA 5LA9A 4WM7B 2YC0A 2E32A 3M8LA 4XQWA 3AXEA 2XJUA 3JD73 4XOGA 2YC2A 1OQ1A 3HPNA 1HQWA 1RHI2 1LHNA 4GB33 5JDBA 1NG0A 3K4AA 5FLHA 3WCSA 1JTZX 1ASJ1 2BW8A 2WNUB 4CP0A 1UO9A 4NJ4A 5DABA 3OTFA 1AYN2 1XNDA 5FMOS 5JPNB 5A6ZA 1RUNA 4NIIA 1AX2A 3LEKA 4NPRA 5GZFA 1IPSA 1DHKB 1VP6A 3C7EA 1O3QA 5IAXA 5LBCA 2LROA 4NRQA 2CDPA 4UAPA 4FXGB 1WCKA 3VBRC 5FUPA 4XBNA 5A3TA 3N9LA 1AR71 1PGW2 1JU4A 1SPPB 5C6CA 1LAJA 1OC1A 3AYAA 5F5AA 2C4XA 1VPHA 4XVHA 3FUQA 3WNXA 2RS12 3IT8A 3DXUA 1SLCA 2W87A 3O1PA 5L9BA 4B4PA 5T54A 4PF1A 4BU2A 4D6QA 4DNYA 2HYKA 4OI0A 4XIOA 4XTMA 1W6NA 3R4DB 3IKWA 3DV8A 3R4UA 2BNMA 4FAHA 3VHOA 3N9NA 4CZSA 2WNVC 3MFCA 1M06G 4OLLA 3OF1A 2R49A 4ZU7A 1X33A 4IEVA 5AC92 3LQCA 4P9IA 3HNMA 2VXRA 2XQXA 5ACA2 2EALA 2OW4A 4QX3A 1WA6X 4R9DA 4TTGA 1N1SA 4XYXA 2ZX1A 4Q4X2 4CU8A 4RQPA 1G9BA 2BGOA 1W9YA 5J1XA 4JAAA 3F95A 5F8PA 3TN91 3PUHA 2X8KA 4FPYA 1WLTA 5ACA1 2QBXA 2V73A 4HSJA 5FY4A 3WD5A 3N9OA 5FPZA 1DQ4A 1RUC3 4L0PA 2IXJA 5L9RA 1AL23 2XH6A 2YC4A 2P6HA 2B4KA 2ZGKA 4RFRB 5JPMB 5J37A 4Q4V3 3MV01 3RJRA 4IV1C 2GDFA 1JYVA 3MDPA 3VBHC 1LOFC 4UFIA 2Y6KA 3V64A 2R062 4QQLA 4YG3A 2R0HA 1DYOA 4Q8KA 1FNYA 3V56A 3U78A 2D5HA 2R043 5I0SA 1UX6A 3GGLA 2BOJA 2B39A 1MVEA 1FMD2 3VKNA 3HN1A 1QNWA 2E7QA 2OIIA 3MI8A 1QXPA 4Z92B 3S6PA 3W58A 1CPMA 4RS5A 5F3EA 4NHKA 4D69A 5CU1A 4NUBA 3ZYIB 5DN2A 3H50A 2P37A 1OOPC 5FZ1A 5A7OA 2JDYA 1WD4A 5A3NA 2WNVB 4NIDA 1C4RA 2RJKA 5LATA 4AVVA 1AR91 3JQXA 1OD3A 3I2IA 4AI2A 3IIAA 4Q4Y1 2GH2A 3WW4A 3MICA 4BPZA 5IWFA 4V2WA 4HXCA 4LKSA 1APNA 2DBNA 4P5YA 1GBGA 3B5LB 2XL7A 5H9QA 3OGSA 1VRH2 2J1EA 5L19A 5F3IA 4XJUA 5F6KA 3WG3A 1J1LA 3B3QE 2QQPA 2CSGA 3ACFA 3SH3A 4Z2WA 3WDWA 2ARBA 4FPOB 1NCQB 1H6XA 1COV3 1WMDA 4O7XA 4PHZA 1XNCA 3E5XA 5JOYA 3ZFFB 4PIZA 4KL1A 4XFCA 4A42A 2K2SA 2EXJA 5CEHA 3GJBA 2DCZA 4A7KA 1N1YA 3NMBA 1YFUA 3AVSA 1O91A 1X82A 3NNLA 5IFPA 3TWIA 2DUOA 1XE7A 4XJWA 2VMHA 2VTXJ 5F7UA 3ACLA 3T08A 5KHKA 5I8SA 3SKVA 2DUPA 2PLV2 2FDIA 1CAVA 1X8MA 2HWD2 2OZJA 1GNYA 5FO7B 1O5UA 3N3HA 5EJ1B 5JR7B 4IDZA 4BK5A 2UWAA 4OQ9A 1OVSA 2PQQA 1W8NA 5FZBA 2OXBA 4I3PA 4XC9A 5EXOA 3WW1A 5CFCB 1XNAA 5IVYA 4Q0UA 2P6CA 4D6RA 1X36A 4XMAA 3WNOA 1U5IA 1ZRIA 2VQAA 2Y60A 1C8M3 4ONUA 4B29A 4CU9A 3HNBM 1R091 5I0DA 1FOD3 2BP6A 1W05A 3I2KA 4FFIA 1I1EA 3JD72 1QDOA 1UMZA 4COWA 5LBEA 4XFHA 3AX4A 4CP9B 5T3NA 4XETA 1CWPA 1R081 1Q8OA 1IPKA 2GMPA 1YJLA 3AK0A 3LKJA 1WCUA 3P1IA 5A7NA 1R092 1VBD2 2D43A 4PDWB 4NE9A 4M3CA 4AQSA 5L7OA 4NIGA 2ILMA 1F31A 1S0GA 3KCXA 5LY1A 2R16A 2ET1A 1OT5A 2JD4A 4HN1A 2RMU3 1VB2A 4Y5SA 3VBFB 2Q8OA 1H2NA 2RS53 4G4FA 1OLRA 5T5PA 5BNNC 4Y20A 5IJRA 2DURA 2YHJA 1IPJA 4HN0A 1J3QA 3I3BA 3NAPB 1GP5A 2IXIA 1H1AA 3GXUA 4HLTA 4P08A 3TB0A 4FTSA 2XHKA 1A3KA 2CTVA 3KV5A 1H9WA 1R1A1 5HCAA 4LHSA 4IE7A 4GWJA 1RUOA 1JOPA 1PMIA 3VBSA 4JDNA 4AE2A 3NJXA 4NOTA 2XLAA 2A3XA 2QCSB 2ZX4A 3HQUA 2P3JA 4NROA 2GP5A 4QT6A 5E6HA 2ZGTA 3O1MA 2RS13 2JDUA 2DCYA 3POEA 1RVF1 5FBZA 2RDNA 4XBLA 4YRDA 2D3RA 2E7AA 3SISA 4NRMA 1LB2A 1B35B 3HJRA 1W6OA 2WNVA 4FPEA 4ITCA 3TNQA 3W21A 4GWMA 1HQNA 1AHSA 3ATGA 4AVSA 3KZ4C 1DGWX 3V0BB 4I2OA 1QJY3 2CGOA 2K46A 4RGAA 4CEYC 2QQWA 1EUUA 5FZEA 1CGPA 1VBE3 4TLGA 3U14A 2RS33 1QJU2 2VZ3A 1E5RA 3PU8A 5KHIA 5JR2A 2BBAA 4A44A 2CGPA 2YPDA 5GZEA 5DAQA 3I2FA 1OI6A 1R1ZA 3ME2A 4CDWB 2G9GA 4YGCA 5B2GB 4LLFA 4IE0A 5FDBA 4PIXA 3KHCA 5DDJ2 3O1VA 1CX1A 2WA3A 2VPVA 5FYUA 4DEVA 4UF0B 1JYXA 3CKHA 1E5SA 1SBFA 1U5YA 1PMJX 2VMFA 3KLSA 1DQ6A 4TXWA 5GZCA 4LOSA 3PDQA 5JWPA 2Z69A 1W6QA 2CNAA 5CKMA 4QX7A 1JUIA 1BJQA 2R063 5FZ3A 1Q8SA 3ZXEA 5BNPA 5IK7A 3JBG1 4D7YA 4MGKE 3WNKA 3POGA 3K4ZA 3PMEA 1FMD1 2F17A 4QPGC 4E4SA 1M4WA 4MGSA 1UOBA 4FPHA 5C3QA 5FK8A 3W20A 1B09A 4I02A 2C0ZA 3HBZA 2DYCA 2VBBA 5FUNA 3OEAA 4MGYE 5A70A 3RWNA 2OQ7A 3WNLA 2RR12 2MEV2 3E97A 4J25A 4A41A 3X29B 1ND2C 1GQGA 4HMZA 1A78A 3VD7A 5KHJA 3DL3A 4XQDA 3LPGA 4QGNA 2WAOA 1RUH2 2I45A 2J1AA 5CFCA 2HWB2 3SEEA 4M01A 3ORJA 2GP3A 3VD5A 2ZHKA 2ZABA 4QPIA 3V0AA 3B7MA 4QHOA 3CF6E 4CDUC 3FHQA 1C57A 5FJHA 3S7EA 2GU9A 5FREA 3OUHA 2YXSA 1J59A 1WLWA 2JE9A 5F32A 2RR11 3WF2A 1S0IA 5CNAA 2XBO1 1AYM2 1BHGA 3KQ4B 4GA9A 2WINB 2ZHLA 3RS6A 3M70A 2HWB3 2YBKA 4K1YA 5GLVA 4K7JA 4JGYC 3UGGA 1QMJA 5LA1A 5FXVA 3OD4A 3M7AA 4H3WA 2JJ6A 1VBA2 4CYDA 4IEZA 2PA7A 4N53A 2VOTA 3D5OA 4IEWA 4OULA 5J96B 2GMMA 3OPTA 2ET7A 1PGSA 1UY1A 2QQIA 4YZ5A 3BVCA 3KVBA 3POIA 4W4ZA 1RB8G 3NO8A 2F4PA 3ZMNA 1ULOA 2OYZA 3ZFFC 2O0OA 3DCQA 5J48A 1UOGA 4XBQA 5JZGA 5CG9A 4GZ9A 4QQHA 4RA0A 1S0BA 2D97A 4TSVA 4B8EA 1W9TA 4YZ2A 1OQDA 4QXBA 1EP0A 4CP1A 4ZS2A 4EROA 1QJU3 3ETPA 2OVUA 1SACA 5BXXA 3KS7A 4ASLA 3V65A 3K51A 2D5FA 3B9IA 3VD4A 4LIVA 3B9CA 4LORA 2FMDA 4QPYA 3VBUC 2PLV1 3AP5A 3DEMA 1WZXA 4NMIA 2ZHNA 4BZ4A 2J7MA 3TEZA 5FBJA 4EN7B 1UW8A 5CFDC 3NJYA 5KHHA 2OUHA 1G7YA 3N9MA 4B4RA 3J8F2 2DVAA 1QOOA 5FLJA 1MVQA 2YY1A 5IVVA 1K45A 2JG9A 4ATFA 4E9KA 2QTWB 1SBDA 4BQWA 3CLPA 3D0SA 4CDWA 3I3DA 2XHNA 5BNNA 3S5QA 2BBVA 1KITA 3PTYA 2BNNA 1ENQA 1QQP2 2NQYA 1DQ1A 3NV3A 4FPKA 4GH4A 4GMP0 1VALA 4XMIA 3S7IA 3ACHA 5F5CA 4AI9A 1AVBA 5FO9B 3K3OA 1ZA4A 3UESA 1HDKA 2ARCA 4AFCA 1KS5A 4XCBA 1VBD1 1LCLA 1LGBA 3LDKA 3DPRA 3VKMA 4AI3A 5LEKA 1B35C 2Y6FA 1OF4A 3ILNA 4XDPA 4EWAA 3O5SA 5C5TA 4HT1T 1Q8PA 4OUSA 2Y6LA 4GMP3 4ZU4A 5FZ0A 3JU9A 1G9AA 1VIWB 2EIEA 4Q4Y2 5M0TA 2XDVA 4GIQA 2ES3A 4OZXA 4FOVA 1CAVB 2R071 4UW6A 4QX8A 2VD7A 2ZGPA 4ZXKA 3AJZA 1OD5A 4P9GA 1MQTC 2CY6A 3GZEA 3H7YA 4QQOA 5FZOA 1O3TA 5FWJA 3BUCA 1T6GC 2XONA 1JBCA 4BXSV 2J42A 4QDQA 3V0AB 5E89A 5FZIA 1UU4A 4BB3A 3OEBA 1RUJ3 4QQPA 1PO13 4PCRA 1IG3A 3I2JA 2D6PA 3JB8A 4RHV2 1XNBA 1AJKA 1C28A 4LUMA 2RV9A 4QX2A 1NAEA 1BK1A 1O3SA 3JXSA 5T5LA 1V0AA 1X50A 3H1WA 4FI9A 2WR9A 3KT7A 4LBQB 2YGMA 4IUGA 4RD7A 5EYXA 4MGTA 5JI7A 3H1YA 3FWEA 5K9YA 4Z82A 2P1BA 4DY5A 2VU9A 5A7SA 2O1QA 1UIJA 5EHDA 1QJZA 5LRRA 1BEV2 2Y0OA 3VKLA 4SLIA 3VBOA 4BYYA 5EJ3A 1ULPA 2HWD3 2CWMA 5FZCA 1NLQA 4UI9L 5FIXA 4CDQC 2FD8A 3WF4A 5JLVA 3VV1A 4UFJA 1GKBA 2D3PA 2EAAA 1QJX1 3CMGA 5IYYA 5A1AA 4HPKA 3B01A 1PX4A 4JX0A 1BEV3 3WF3A 4WM7C 5FLIA 4K8FA 1POV1 2RVAA 1OA3A 2J22A 1SBEA 4HVRA 2Z5WA 1W9SA 3PLQA 5FZ9A 3UK9A 4JGYB 2YDEA 4IV3B 1C8M2 1KDMA 2EIDA 2VXJA 4QPGA 3ZXKA 5LRSA 5A32B 3OGRA 3INAA 3OUJA 4PBOA 4H55A 1GYKA 5C3PA 2XLGA 4OZOA 3RG0A 3URFA 1JZ6A 4AFMA 3J9SA 4IERA 5FOBB 1WLDA 4Q27A 2JIJA 4PI2A 3RFRA 4EV0A 2JIGA 4LUKA 2JD9A 3AZVA 4N9IA 3POYA 1JYCA 3IAPA 5H9RA 4WV8A 2E63A 1C5IA 4XZUG 3ZXJA 5CFCC 2RG4A 5F6LB 1JI6A 2G19A 2ZGLA 4Z07A 1KDKA 1ND2B 1YRZA 2LW8A 5FYVA 4ASMB 3H9AA 4DINB 1UKRA 4LO5B 2R042 3H3LA 4ARXA 3MUZ1 3VN4A 2NMOA 2XVGA 2W3JA 4LBLA 2KD7A 4U36A 2ID4A 1RJ7A 3KV6A 4NHXA 3ZFFA 2E51A 1HXS2 2CHHA 4TN7A 4YVSB 1MS0A 2VZSA 5LWBA 4YM2A 2P3KA 1MPXA 2XBO2 5FMBA 3NQHA 2ZEZA 3T1MA 4Y22A 2DFBA 2YG0A 1HN1A 1VAVA 4M0HA 5JXHA 2JDMA 5KC6A 3ZM8A 2X5IC 3VDBA 3RZGA 1JYTA 1C5HA 5LASA 3ETQA 3LZZA 4FPFA 3CZJA 4K1ZA 4TLFA 2JKBA 5L7OB 1DLLA 1Q8VA 1W8WA 5C9AB 4META 3L2HA 3ZYJB 1PGL2 5IK4A 3MGUA 4CU7A 3SKJE 4L97A 1WMXA 2AEYA 4OQ8A 3I7DA 5FJKA 2YBPA 1W8FA 4ORFA 4LHLA 3IMNA 2MEV1 4K40A 3WX5A 5C8CC 1IHMA 1NCRB 2ZZJA 5T5OA 3SQOA 5FYHA 5EQUA 2VNOA 2YROA 4K3UA 4Y5TA 5ACA3 1VBC1 3RYKA 5CKNA 1TVGA 1H6YA 4LK7A 1BK0A 1V6LA 4FAGA 1W8TA 1W03A 2WUHA 1JYNA 3MIFA 3LEIA 4R4ZA 5DDJ3 1FV2A 2PXJA 1RIRA 4Q4V1 3OPWA 2CWSA 1HB3A 1FOD1 1XJAA 3EBRA 4CDXC 2FCVA 3CJXA 4ET7A 4KH9A 1YJKA 5HV0A 3VBOB 3THTA 1NE4A 2W2IA 3QD6A 4H7MA 1SDWA 4Q4V2 1ENXA 3MV11 1F4HA 2VULA 5H9PA 1W2AX 4MH0E 3OY8B 3RNSA 1CQ9A 2D40A 1LGNA 2JDHA 1CONA 1LJ7A 5ISLA 3H3UA 2QUOA 4YWAA 1BMV1 4W50A 1L3JA 2VOXA 1FXZA 4LNVA 2Y6HA 3VBFC 3R6SA 1UZVA 1QQP3 1XSQA 3RYRA 2BJSA 3IB3A 4V2VA 3ENRA 4QMAA 4AEKA 4JGYA 3U1XA 3J7MA 4FFFA 3VKOA 1FNZA 1RUH1 2IZWA 3GJAA 3WNNA 4BWOA 5KXEA 5EV7A 4AW7A 2WLQA 1GQHA 2UWBA 2VZRA 4N53C 1PM7A 1UOFA 1VMFA 4GJYA 1CPNA 4OVEA 2YU1A 3RPQA 1VRH1 4QQ2A 3LE0A 1URXA 3ACGA 1PIV2 5SV8A 3WLUA 1LEDA 4MXWA 4XE9A 4CUAA 4SBVA 4Z8BA 4WVWA 4ATEA 1YNAA 1LHUA 3ALQA 5A3MA 2WWSA 2WDBA 1PX3A 2VZVA 2ZEYA 1WGPA 2F6BA 3CHXA 4OI2A 3FE5A 2IFWA 3TBDA 2WC2A 3S5AA 2Z42A 1ZZ9A 5FWEA 3VGIA 4UXAA 2VNGA 1RUF3 2MNGA 4UWDA 4XFBA 1JH5A 5HXVA 1XRUA 2RS31 4GH4B 5FAXA 5FXXA 1CAXB 1W0NA 2A73B 5BNOB 5A1LA 3WCRA 3HBKA 2AH2A 4CCDA 5IVCA 1Y3TA 1YCIA 5FYCA 2PAMA 3KF5A 4JHTA 3U11A 1QXJA 3VHRA 4YW6A 4N8MA 3PURA 4OI4A 2ZEXA 4RQPC 4A45A 5JVVA 1ASJ3 1KFUL 4AK3A 4IE4A 2DVGA 1PMHX 4AR2A 1ZX5A 3MF9A 4QHBA 1C8M1 2D3SA 3ZR6A 1XBFA 4TZDA 4QXCA 1KD7A 4CVUA 3B94A 3UKNA 1UMIA 5KXCA 1GFF2 2W94A 1AF9A 4JCKA 3ZXGA 1GV9A 5JSOA 2LM3A 3PUIA 3ZDVA 1R083 1RC6A 2ZJCA 1JOJA 1UY0A 3AZYA 5ANQA 4B7KA 1GWLA 4BLJA 1OHFA 1H4HA 3MPPG 4HPKB 2JKXA 4PQQA 3EO6A 4DY3A 5JZGB 3FLRA 4BXFA 1POV0 2HKXA 3PIGA 2DUQA 1UYPA 4QU1A 1AL22 3FFQA 4IGOA 4Y4RA 5A6XA 4YZ4A 4E4DX 3N4MA 1LOGA 1N3QA 1VAKA 4BQ2A 1DZTA 2DCTA 2HEWF 5LBBA 1Q56A 4IGPA 3BGAA 1UD1A 3LEMA 1Y43B 5FY1A 2GN3A 2SLIA 3T09A 5JI9A 2VCMA 3AKRA 3AMQA 5JIAA 4JRAA 3ZSLA 2HWB1 4AHYA 5CA6A 4G9SB 3T30A 3I49A 3AKTA 5HCBA 1NY71 1LHWA 4Y1XA 3NRUA 3ZN6B 2DCJA 2VCAA 3LD8A 1VBB1 3W59A 3L2YA 1GWMA 4AHXA 3NAPA 1QY4A 1IS5A 2GNDA 1RUG2 3UKTA 4RS5C 5IAVA 3LFIA 4Y1ZA 4XXPA 5T5JA 5APAA 1LHVA 4E2QA 3ELNA 1DQ5A 2KXLA 3OBRA 4Q4W3 5I0UA 1AR83 2DWRA 3P3PA 4N7UA 5BY5A 2Q8EA 1RUG3 1WBLA 1LESA 3LIHA 5FMOL 5GZDA 5AFEA 3UJQA 2DVFA 5FY8A 1WCQA 4XIKA 2NPIA 4R4XA 4Q5OA 2NZ9A 3OSDA 2WO2A 1SLAA 3I97A 4I3GA 2W0XA 5AVPA 4CUGA 2R041 2A70A 4UW4A 4A2UA 1RGSA 1W04A 1C8NA 3MLLA 3OBTA 4URAA 2QJVA 3ZFEB 1LEMA 3N7LA 2W92A 3Q8AA 1MZ6A 3SH4A 4CDXB 4HG6B 3HQXA 5D8AC 2GC1A 2RMU1 1PO22 4U2AA 4BM8A 2B9UA 2WN2A 3UNPA 3RZLA 2QQUA 4KQ7A 4Q1PA 2RDQA 2WFF3 1NKGA 2XJRA 2ZACA 3PVEA 2QQJA 4XZPA 5FPUA 5KR7A 2ZEWA 1NCQA 4RSUA 3JBG3 2LS6A 2J1SA 2HWC3 2W9XA 3KCCA 4X6QB 3GHNA 4AXOA 3FLPA 4JTNA 4MZUA 5T50A 2JE7A 3RMXA 1CAXA 4AWDA 1F8VA 2DU0A 2VOWA 3ZVXA 2MPFA 4L2NA 4YW3A 2E26A 2VGDA 3QH7A 1UMHA 2KR2A 1ZBE3 2V4VA 4EWEA 1AXZA 1JS9A 3AZXA 3ZOIA 3VL9A 4Y1UA 5FUIA 1LODA 3LIGA 5IVFA 3BIEA 3ZPYA 1COV1 4CCKA 1V70A 5A3PA 2WZR3 1Q8QA 2XJVA 4AFAA 2EIGA 3IPVB 1F9KA 2L9LA 1QJY1 1Z7S3 2VZ1A 2VAUA 3HQRA 3NSTA 3QLQA 4FOWA 4UT5A 4NIAA 2GALA 5ABJA 1HRI1 1LENA 3FJSA 4LIUA 1ZREA 1A8DA 2C26A 2RR13 2WT1A 3PJYA 4WZCA 1RUJ2 5GALA 2XGXA 4BH9A 5H9SA 4LJHA 4M4PA 3M3IA 4EZ4A 1YWKA 2Y38A 3N9PA 2G1MA 3GM8A 4XABA 3I2GA 4Q0QA 3ZN4A 2EVXA 3AMHA 4BOWA 2FCUA 3MFAA 2JB8A 1UYYA 3AP9A 2XB6C 4FFHA 1DIWA 3HIFA 5FZDA 2P3IA 1YO8A 3FBMA 2JICA 3I8TA 4R8HA 1OKQA 5T55A 2RMU2 1H0BA 1RUI2 1QXRA 1L7QA 5I8YA 1RUJ1 4Y1YA 2R061 1PZ7A 1AR82 5I93A 5GLWA 5BPXA 3P6BA 4WVMA 4DRRA 1T6BX 2YFZA 2XUMA 2RS32 1W2UA 1ZBA1 4IV3A 3ITQA 4YW4A 2GAUA 4B4QA 1MEC2 2ORXA 3QCWA 5GZGA 2GC3A 4COYA 2HWF3 1WW7A 4AI0A 3ES4A 1VLNA 4L99A 4N9HA 2WQZC 4OUMA 4N43B 3K75B 2XXZA 1TQ5A 4KBZA 4LEJA 2FDGA 2Q1MA 3UJOA 1FI2A 2WT0A 4EN9B 3EQEA 4C90A 3NV4A 5A33A 4CEWB 3K2OA 2ZAAA 1PIV1 2HWD1 3MO4A 2HEVF 5G04L 1UZZA 2CAVA 1TME2 1SFNA 3VZJA 3ZSKA 1MS3A 2TNFA 4DS0A 5JXIA 3FN9A 2RJ2A 1LU2A 1RYYA 1J1TA 3ACIA 2P34A 2YYOA 4RQPB 4CPBD 4F3JA 1ZRFA 4E8DA 4LBOA 4XUPA 4BIFA 1DQ0A 4B1LA 2GNBA 1S1AA 1I5ZA 1UWWA 1KFXL 4JDOA 4CEYA 4HOOA 5FP4A 4FOYA 4QAWA 2D7FA 4HZFA 5FR3A 2ZGUA 5JMOA 4A7YA 4CA9A 5F1RA 1RITA 1X8EA 2RS11 3AB0A 1YI9A 4MO3M 1TME1 5FZ6A 3T0BA 3UGFA 1C1FA 4W6XA 3USUA 2BVVA 3WY6A 2ZGNA 4PLOA 3ZIWA 1J84A 2X29A 1OVPA 2WRAA 5BNOC 3DYPA 4ZKTB 3LDRA 4Q26A 3FX3A 1HW5A 5B4XA 2E33A 4R52A 1IQDC 2OPWA 3KHBA 5FY0A 4LR4A 3T4VA 1VBD3 4M4RA 3JQWA 4A6SA 5LB6A 3VBFA 1YFXA 2P5BA 3D0JA 2Q8CA 3WP3A 2DTYA 1DQ2A 1UKGA 4R9CA 4ZHNA 1EAH3 4OHYA 2K0GA 2WYSA 2XWJB 3LA2A 1E57A 3VDDB 5KXBA 3M4FA 3WR0A 4YVWB 4BQ5A 4NPMA 1FPN1 4CDUA 5BUVA 1LOEA 3GHMA 1Q5OA 1EAH2 4LK6A 3AVRA 1AYN3 4IESA 2ZX2A 4QX5A 1JUHA 4BCUA 1UNBA 4GB32 1UCXA 2IFRA 4MV2A 2WNOA 3I3EA 2DVDA 1HQLA 3JB4C 4W65A 4BQ1A 3ZMOA 3LWCA 2WZEA 2B8MA 2RE9A 1ULEA 2B7YA 4E8CA 4Z1VA 4FQZA 4P9WA 5CAZA 3U07A 4ES8A 1RVF2 2FDHA 4XUQA 4J1XA 1CN1A 1RTVA 1XU2A 3DECA 4L9BA 4LE4A 5FYYA 3U10A 5HXMA 1YEWA 5A6YA 2PHWA 2Q5TA 2JWPA 4JRLA 4ZU5A 5GLTA 1CZVA 1H8TB 1AYM1 3K3NA 3VHPA 2QQKA 4ISRA 5A7WA 1W3XA 4S2GA 1NX9A 1ODMA 3KMHA 2VVFA 2D6NA 2JDPA 4LBQD 4XUTA 1K5MB 2VW0A 2LRPA 2GNMA 3UETA 4KU8A 1OA4A 3J4UH 5CBLA 1ENRA 3BTYA 3PVBB 1PVC3 3WG2A 1W6QB 4UFMA 4LO7A 4Y20B 3ZFEA 3MIEA 3ZFGC 3GZUC 3POSA 1CAWA 1C1LA 2VMDA 5C8WA 4AEJA 4RYDA 4AEDB 1WKYA 2D6MA 3TEWA 3BOPA 3WDXA 1A34A 2WSVA 2GNTA 2A3WA 3GZTB 4LLOA 1NA1A 2Y33A 3ZKUA 3VBRB 2ZGQA 4CCNA 1W2TA 4YG6A 3GBGA 3HAGA 4DUVA 1PZ8A 4Q0VA 4GKXA 1PNGA 4WM8B 4ES9A 2BQPA 2J1RA 1NYWA 5ABJC 2W1UA 1MACA 2IXHA 1Z7S2 3JBG2 3NL1A 5CYYA 3LGRA 5EYYA 2ZMNA 3WSOA 3CEWA 1JYWA 1H2KA 1RHI3 4K20A 4QPIC 5F2WA 1H4GA 3DKQA 5IW0A 1DFQA 4XF0A 5FZAA 4IETA 3AP4A 3FL7A 5FPAA 3VBUA 4GALA 3IDCB 1UQXA 5FZFA 1YC61 5LK5A 5L36A 1FPN2 5KWRA 1XYNA 1CR7A 1OXCA 4IW3A 5KXDA 4CXYA 2ZS6B 4E2GA 5J3UA 4XFIA 2PHDA 4LKFA 4E2SA 3T0DA 1F4AA 1HRV3 1ND3A 3AL5A 4BK4A 3LSDA 4XCAA 2QKDA 4COZA 1JZ7A 4BMEA 1RUH3 3ZDSA 5FCCA 2QDRA 5IVEA 2AGSA 4AL9A 2PHTA 1ACCA 2V72A 3P5BA 3VBSB 4QB6A 1XQNA 1VRH3 4XPVA 1U5XA 3K46A 2W95A 3M3EA 3AL6A 1RUF2 2X05A 1Y4WA 1RJ8A 2WO1A 4LKEA 3O1RA 1TG7A 1V6KA 3JCIA 1B35A 2AZ5A 2ZMKA 4W6YA 4YM1A 3SMHA 2VZQA 3VUOA 1H8TA 4OYUA 4EZHA 3AZWA 1POV3 1FAYA 1CZTA 1HB1A 3K77A 3USUB 1QOTA 1LRHA 1WW5A 2A1XA 3O14A 2D6OX 4IV3C 3VZNA 4XJ9A 3Q8CA 4MGIE 3OOXA 4UYBA 1YFYA 2NP0A 4AAXA 2PAEA 3AKSA 4WBBA 3O12A 2IVIB 5FQ0A 4R9AA 2FQPA 5F37A 3SITA 1EV12 2R1DA 4BLIA 1FX5A 4P5HA 1VBC3 1FT9A 1GOHA 3LSEA 4B1MA 1IQAA 2WFF2 1LR5A 3ZYHA 4XURA 2NLRA 3RRDA 3GBWA 3VZMA 2BOIA 2WWUA 1NA1B 4P9JA 1TMF3 2JG8A 2H0BA 4LXLA 2JDZA 5K7PA 3BTZA 1R082 2AACA 1RINA 3WINE 4LBQA 3O1UA 2R073 2VCBA 4CCMA 3PUAA 3SEPA 4WM8C 2I07B 4MSVA 5DG2A 5K8SA 1VBB2 4QKFA 1UYZA 3HR9A 3FFZA 4OMDA 4O9EA 4Y4YA 2XQRA 1OSGA 5FYBA 1W6PB 1NLRA 5E8AA 4D7TA 1W8HA 1ULDA 2WWJA 1L7RA 2G4IA 4PDWC 4CDQA 4JKLA 4H14A 5FYIA 1L7LA 1LNSA 2WS93 1R1A2 1W8UA 3PTRB 3NW4A 1QOSA 4J6GA 1QQP1 3NWKA 1HRI2 5ERLA 2ATFA 1UIKA 1V6JA 3VBRA 3VB9A 2Y26A 2ZX3A 5EZWA 4S2FA 2YV8A 3B00A 1T2XA 4XW3A 4AVCA 1BBT3 2MEV3 1I9RA 1COV2 1H2MA 5A7PA 3N7MA 1JZ5A 4BMBA 1NXMA 3TEXA 2VUCA 2JB4A 3WV6A 3VBUB 3G7DA 2BDRA 2WJSA 1UN1A 3IWZA 1XNKA 4XDOA 1U0AA 4FPLA 4MG2A 2VR4A 5G05L 5FY9A 4YYOA 4AQ2A 5DDJ1 4DXSA 1AR81 1DDLA 1O3RA 1HJGA 1UYXA 5JOWA 3KWVA 3LAGA 4KI5M 4HONA 4I0BA 1HJFA 1YUDA 2JENA 4PBPA 5FP7A 4AVTA 1SCSA 2NMNA 5CADA 2UYAA 4IE5A 4HKOA 3SNMA 1O7FA 2ARAA 2VUJA 4IGQA 3VLBB 3RZMA 4BJ0A 1Y9QA 2RM22 1OFSA 3WHTA 3ZXFA 3U0ZA 1AZDA 1KGYA 1W8ZA 1W9WA 4AGRA 4CRQA 1W0PA 3BU7A 2YPJA 2PYTA 1MS8A 2HWE3 3H7JA 5LW9A 1QWRA 4MGZE 5EWSA 2RM23 3I59B 3THPA 1WCDJ 3JZVA 4QXKA 1EY2A 3WQ7A 2WFPA 5FZOB 3WUCA 2N7GA 1UY2A 1LULA 1SMVA 4GD4A 2TUNA 1YXWA 2QZ2A 5F3GA 5FYSA 2D6KA 1REEA 5FK7A 3VD3A 4JC1A 1QJX2 1YIFA 2DBIA 2RHPA 4CU6A 3AMNA 1O8SA 1ALYA 3WW3A 2PHLA 4MADA 4CCEA 2BRTA 3IIIA 2J1VA 1ULFA 4AFDA 1BVVA 2PELA 2R7EB 4AI8A 4XEZA 1I6XA 4P14A 1O4TA 4N7IA 3ZFGA 5IK5A 4XUOA 5FKBA 1RUC2 1J58A 1W06A 3SHRA 3KVAA 3GALA 3E1F1 2JG9B 1XXNA 3OGGA 1DYPA 5JMCA 2WA4A 4IXLA 4LO4B 1H9PA 3VKFC 5LBFA 1LU1A 4GAZA 1LOFA 2I74A 2WZR1 1SEFA 4JGZA 2EXHA 1VR3A 5D21A 2HWC2 1HRI3 1O4ZA 2XVKA 1N3OA 2XOMA 1STMA 3VBHB 2ORZA 1S2EA 5BYNA 5FZ7A 1RMU2 3W5MA 1N1TA 3J8F1 3PU3A 5B4NA 1S0CA 4BHPA 1OLQA 1BZWA 1AXYA 2ZZQA 3OBZA 1OKOA 2DF7A 2HH9A 2GMEA 2ADEA 5FZ8A 3CZUA 1TZOA 1RUI3 2XVLA 1W6MA 1OA2A 3GF6A 1QF3A 2IC1A 1K5MA 4HSLA 3O1SA 2Q0AA 4GJZA 3MLJA 3VL8A 3ZN5A 3MYXA 4CDQB 4RHV3 5FXWA 2Y8KA 5IATA 1AX0A 1K12A 2ZHMA 3BIWE 2ZKNA 1LECA 3POBA 2X5IA 3WDUA 1CAUA 4Q4W1 4CXWA 1D2QA 4MLOA 4DXRA 1OOPB 1ZBA3 1RUG1 2ZKLA 5L73A 5JOXA 3EJKA 1PK6C 2BZDA 1UZYA 2HWF1
chains in the Genus database with same CATH topology
3RQ0A 2JECA 1AX1A 1NXD1 2W52A 2OPKA 1CESA 3VBSC 2BUKA 5J36A 2HEYF 4AHWA 4IL7A 3CL1A 3PVNA 4DXZA 1S55A 2ZGMA 3ZXLA 1PNFA 1UPIA 2PN5A 4C0BA 4KNCA 2A3YA 4Q4W2 4COUA 5GLZA 2HWE2 2BVBA 3B69A 3E6BA 3NKTA 4XJ8A 4AGGA 4BE3A 2GZWA 2H6BA 4TWTA 1GZCA 2TBVA 3ZFEC 1OFNA 5DZGA 1CVNA 2Z2SB 2W39A 1EPZA 4LHNA 1NQDA 2EF6A 5CVRA 1GZWA 3QACA 5FOJB 3PHMA 3LCPA 1O5LA 3ZXDA 5DXDA 1NA1C 3MZHA 3APBA 1ONAA 1SQ4A 2IXLA 3M2MA 1V6IA 4FO9A 1HXS1 2YZ4A 2EXIA 4XF4A 2ZCWA 1BVP1 3WZ1A 5DUXA 4I01A 5F9TA 3VZLA 3M1HA 2DVBA 4Q8LA 1Z7S1 2ZTNA 1MZFA 1DGRA 3SCFA 5JIUA 4PDWA 4RR3C 5GLUA 5HBAA 1V6MA 1W0OA 1ZZ7A 2A5ZA 2GSYA 2WL1A 2D98A 3I2DA 1FPN3 4B3NA 2VOVA 4YM3A 5C9AA 4F83A 3G6JB 3RYPA 1V9U2 3E5UA 3TYJA 2E9QA 4OI1A 2O8OA 4KBBA 2PHRA 2DU1A 1Q43A 5F5QA 2WFF1 2AENA 1SFYA 2YUEA 1RMU1 1IKPA 2I2SA 3AMPA 4MXWB 1ZNPA 3TN92 5FRAA 2XJSA 2HWC1 4MYEA 1RUD3 1VAMA 4RL7A 4DB5A 3OYWB 3N35A 2D44A 3ILRA 3D6EA 2ETEA 4M3CE 2A6ZA 2WT2A 3KQRA 4I09A 1ZRRA 2LTNA 2RJLA 3AXDA 1UL9A 1AL0G 1KJLA 4GWNA 1YHFA 4YVWC 4Y24A 4LE3A 3ZIXA 1ZRCA 1RUE1 1GANA 1DF0A 1D0GA 3CJIA 4NHMA 5DUVA 3S30A 1MS5A 1NCRA 3A4UA 3Q9OA 3FUOA 4F8AA 5FTTC 3R05A 4NR1A 3RMYA 4DQAA 2NN8A 4FBFA 4WM8A 4HKWA 2TEPA 4YW2A 1TME3 2C9AA 1S2KA 1TMF2 1VBB3 3OGJA 2WNUA 5K0UC 4M3CF 2R072 3H0OA 3AP6A 3WG1A 2R1BA 2V5YA 1VB4A 1QHDA 3VHNA 2A6VA 2ZAHA 4PLNA 1NCQC 1NE6A 1D4VB 2D6LX 3DPRC 3GZAA 1OPOA 4GQ7A 3WW2A 2JG9C 4CEWC 4XHXA 2PHFA 4NN0A 4Q29A 3WDVA 1VBA1 1ZBE2 1DGLA 1PIV3 1V9U3 1XU1A 1H1MA 1WCSA 3POWA 4GH4C 4RFT0 4AEDC 1D0HA 1GZWB 4FPCA 2PAKA 3RDIA 4Q4X1 1ZZCA 4MUVA 3KCYA 4X6RB 1MR5A 1F5JA 4QU2A 4M3CB 3M3QA 3WP5A 5DUWA 3ST7A 4WVVA 1AYM3 1IS3A 1ZBE1 1PHMA 2A6XA 1IS6A 1PK6A 4LBKA 3D82A 1J3PA 2KA3A 1S0DA 3ILFA 1V6NA 1CD3G 2SBAA 3MW3A 3JD71 1W6NB 1U12A 2XJTA 3NV1A 4EN6B 1OMIA 1EAH1 4IEXA 4COVA 2BEOA 4D3WA 1ZVFA 3ZO0B 1MEC3 2FZ2A 3MW2A 3V0BA 1WMEA 4Q2FA 1HV0A 1BKZA 3R4SA 1PO21 2LALA 4AFBA 3AYDA 4CP2A 4N90A 2VW2A 4IEPA 1MS1A 4OHVA 4FP3A 1AR61 1AR73 3H3ZA 3NJZA 3O0WA 2A75A 3BTAA 3OPZA 2DV9A 3BB6A 4YGEA 1LOAA 2QVSB 1ZZ8A 1RHI1 4YLZA 2A6YA 2B5HA 5CFDB 1VBC2 3MIDA 1UU5A 3B93A 3MEPA 2QDNA 3ZYGA 1Z78A 4LT5A 2W68A 4DRVA 2Q4SA 2VMGA 2BGCA 4KWJA 1N47A 5E88A 1HRV1 4BIOA 1HV1A 3UKVA 5C8CB 1NZCA 2VECA 3LB9A 3FBYA 1BBT1 1LOBA 3OJBA 3DPRB 4LHKA 3TN93 2BFUS 4XFGA 4FSJA 4MXVA 4QGLA 3SLIA 1ZM1A 1PZ9A 2PHUA 4YVSA 3PNAA 5J98B 1BQPA 4YFZA 1WD3A 4YGBA 2X53S 4F7ZA 4AGVA 5J7MA 4E4ZA 5AC91 4M0NA 4FPGA 2VVDA 1TEIA 1S0FA 4I0AA 2XPJA 4C1WA 4Q1RA 2XLFA 3KGLA 1LOCA 3WP4A 4KU7A 4YW1A 4HK8A 4BA6A 4IEUA 4Q0PA 4QPIB 3ES1A 2NYYA 2QE3A 5DG1A 2Z79A 2HWE1 4FOQA 1IS4A 2BYVE 1PVC2 2XWBB 4GB31 3RI8A 3AMMA 4IV1A 3N7JA 3IPVA 3AM2A 3ZSJA 2H0VA 1ULCA 2UWCA 3FMGA 1TMF1 2WIIB 3W9AA 3ZFGB 1KJRA 4CEYB 5FO8B 3M3OA 2WQ4A 5K0UA 4FVVA 1AYN1 4B7EA 2BWAA 1KQRA 2XJPA 1NQJA 1OOPA 4GULA 5CB7A 1J3RA 4XHBA 5C4WA 1ZZBA 3A0NA 3OY8A 1ZYBA 4HK9A 3S0MA 1ZRDA 1REFA 4LO6B 4L11A 1D4M2 3B02A 5IK8A 4UBGA 2WS91 2ZA9A 4RR3A 4FXKB 2P17A 1TE1B 3WDTA 3K48A 4YARA 3LA7A 1BCXA 3MW4A 5DZFA 4XF9A 5E1RA 5FFOC 3AYCA 4KWLA 3WQ1A 2EXKA 3QBQA 3GYDA 1D4M3 4P9XA 3SCHA 3VZKA 2JXAA 1QGLA 1NOVA 1CAUB 4FTEA 5CG8A 5BNPB 2A6WA 1D2SA 2GC0A 1IOAA 1RUC1 4LBNA 2ZGSA 5HI0A 1PVC1 2R6QA 4S2DA 4DMIA 3DN7A 3RI9A 4YZ1A 1BMV2 1QDCA 4IEYA 5SV5A 1HIXA 1YIPA 2XKOA 1H8TC 1VBE2 4Y1VA 1C3HA 4QD2A 4YVWA 4AI1A 1XE8A 3E5QA 4DOUA 1DZRA 3DUIA 1EV11 4HETA 2RM21 5GJ6A 1NCRC 1NY72 4QM9A 1WLCA 1TNFA 1AR93 1ZZ6A 2OA2A 3AYEA 4EJRA 1LGCA 5EFUA 2VG9A 3HT1A 3IM0A 2GN7A 1EPWA 4IQPA 2VMIA 1WA4A 5L7OC 1LKNA 2WNUC 1WW4A 3BOWA 4YGDA 1AUYA 1FYUA 1MZ5A 3AFKA 3OD0A 5I0TA 5I0RA 2WS92 3WT3A 1WMFA 3AKPA 2PFWA 1AL21 2YMZA 1SLBA 2C5DA 2E53A 3FC0A 3C2UA 3DF0A 2UYBA 2WZPP 5HCFA 4NHLA 3HT2A 3QOPA 4G3YC 4D7SA 4YW5A 1AR62 2VNRA 3O7OA 3AFGA 4PJYA 2P2KA 3J8F3 4C0HA 3CNAA 1DGRN 4C91A 5IT6A 4AEDA 1DGWA 4JDMA 4N43A 3L9JT 1AR72 1PGW1 2H6CA 1LHOA 2NM1A 4K21A 4P9LA 1PO12 3U4XA 4RHV1 4E27A 3ZN6A 5A33B 4FPJA 5TSWA 1RMU3 1CIWA 2EA7A 4GXLA 5C33A 2VQ0A 4Q4Y3 3WP6A 2LUWA 5K0UB 1V00A 1A6CA 4QPGB 3LA3A 3BALA 4XILA 4YVSC 1CAWB 2DTWA 3D8CA 3IBMA 1YYNA 2QZ3A 4TYSA 3AJYA 5KC5A 2HJIA 2ZX0A 2BPA2 4A3XA 1BXHA 1EYBA 3CJIB 1CJDA 3ASIA 3USSA 3WG4A 2K9ZA 2WNEA 4WVZA 3A0KA 1FV3A 3R0RA 2WSUA 1SLIA 5D8AA 5LEJA 3E6CC 2KM2A 2R32A 3H8UA 1SCRA 2AYHA 2DCKA 1HKDA 4INDA 4P9YA 4M00A 1GNZA 4YSFA 4EN8B 2B46X 3CO2A 4Y26A 4URTA 4CTEA 1IKQA 3LOBA 3PMSA 1BYHA 1QU0A 3VDDA 3UV9A 2A71A 2O8QA 1V6OA 5BNPC 1UAIA 3SH5A 1CX4A 4IV1B 4LBMA 4YZ3A 2BTVC 3N36A 4C1XA 1G9CA 2VVEA 2IXCA 4KGQA 3WXPA 3TRSB 3ECQA 3MLKA 2Q1ZB 3I54A 4OHWA 2R0FA 1R093 3I59A 3OCPA 1G8WA 1ND2A 4MVTA 5C4WC 4JV4A 1S0JA 3MIGA 4NWWA 4O9GA 4PF5A 1XYPA 4XFFA 4OFGA 1DU3D 3VZOA 3EXUA 1G86A 2E6VA 1W39A 4YNIA 4CDWC 5KBFA 2VOKA 1PVXA 3NAPC 1VBA3 3ZSMA 1QKQA 3PJQA 3AKQA 1ND3B 1V9U1 2FZ1A 3GBFA 3ROUA 5I91A 2CYFA 5GM0A 4FQ4A 4HFSA 4RR3B 1YFWA 3EHKA 5AFBA 3ZXAC 1DBNA 4JGZC 5E16A 2XG3A 1A8MA 1O4YA 3MIBA 3AZZA 1HX6A 4S2HA 4FCAA 1X7NA 4AVBA 1PK6B 3ZX7A 1GSLA 1FATA 1MQTB 4W6WA 1HXS3 3BPZA 3KGZA 5JCTA 2YGLA 3M3CA 5C4WB 1WBFA 4Y5Z0 2QNKA 2BFUL 1H1IA 4HVOA 5JZGC 2A7AA 3HWJA 4LO8A 2ARXA 3E6DA 4R9BA 1W6PA 5DZEA 3ZYPA 5FQ0B 4YM0A 2PTMA 4RS5B 1VBE1 5A32A 5BNNB 3KD4A 3FLTA 4NWVA 2ZGRA 3HMYA 2B45X 2WLPA 4FTBA 4XF3A 4HVQA 1PO23 4MX3A 1SLTA 4LULA 2CL2A 1RUI1 1QNYA 3I4IA 2VH9A 2JG8B 3NVCA 1AR63 4L8QA 5CFDA 2XJQA 1CJPA 2W08A 1OPMA 1S2BA 3IDEA 2UU8A 5BV6A 2R30A 1PO11 5I8TA 1SLLA 1DZQA 4AEMA 4AYUA 1RUD1 1FMD3 1I3HA 4WZFA 3NKGA 1IZ3A 1KXGA 5GKAC 4N43C 4I30A 4OHXA 4EWDA 1UF2C 3GNEA 4KG8A 3T2TA 1YI7A 3JUUA 2ZMLA 3WQ0A 1QJU1 3WOGA 1K5MC 4CDUB 5J09A 4AQTA 3SXWA 1GLHA 1BBT2 1UU6A 1XYOA 1JW6A 2JEMA 1RUE2 3BODA 2RS51 4QGMA 1YLLA 1Y7BA 2PHXA 4AHZA 4GKYA 1HRV2 4N53B 4RGGA 4JTOA 2UURA 1DG6A 4XFAA 1R1A3 3CU7A 4X8NA 2XBO3 1IGOA 1MQTA 2QFEA 5AC93 1PGL1 5T52A 5JSRA 2Y0IA 4UW3A 2FBEA 2RS52 1RVF3 3QH6A 4JQRA 5JOZA 1GNHA 1F2NA 1WW6A 4AQ6A 4IEQA 1Z0HA 5IUQA 4DZGA 2IXKA 2ZOEB 3DKWA 2OZ6A 3FZ3A 4L92A 2CAUA 4WVMB 1LTEA 4Y22B 1JYIA 3TAYA 3TOJA 5CIRA 1G9DA 5JAXA 1QH7A 3PVOA 1ASJ2 2OUJA 3RJ2X 4X8PA 3AP7A 4WM7A 1U5ZA 1AR92 3VDDC 1RUD2 3VBOC 4UBHA 1MEC1 1JHNA 4KWKA 3MF6A 4XQ4A 2MHFA 4XTPA 2BNOA 4FT8A 4Q0SA 4XJAA 3KT1A 1HLCA 3UL2A 3RSJA 1ULGA 2ZPXA 4XJZA 4KGGA 2VUAA 4PLMA 1KS4A 4Q4X3 4ISQA 2FMYA 2B42B 4AG4A 1G6NA 4H7LA 1W6OB 4HBNA 4AF9A 2GC2A 2IWGB 3ZSEA 5BNOA 5BNQA 2VY0A 1WUVA 5C9AC 2XL9A 4AVAA 3ZYRA 4LA3A 3MPBA 1NLSA 2XKPA 2VW1A 4XF1A 2AUYA 3VBHA 3WDYA 1KRIA 2JX9A 2UY8A 5AVAA 1D4M1 1ENSA 4NO4A 3T1LA 2ZGOA 1RUE3 5LK7B 1S0EA 1VJ2A 4PIYA 2ERFA 1W6MB 1ZBA2 3BCWA 2V09A 4HL0A 2D93A 4GMP1 4JGZB 3WUDA 1BEV1 4I0WB 4JVAA 3IN9A 4LTAA 1REDA 2AREA 3MIHA 3RZZA 1JN2P 3OYWA 4PQ9A 2HWF2 4LBJA 1ND3C 1MS4A 1Q3EA 2DFCA 2Q30A 3O0XA 1MS9A 3SCGA 4DPNA 3D4KA 3CJIC 4YG0A 1OQEA 1DYKA 3H1MA 4XXAA 1H30A 1EV13 1F5FA 1UPSA 3KT4A 2X5IB 2G9FA 5JSPA 1QJY2 1N1VA 1FOD2 1JXNA 2BWCA 5KHGA 2CGNA 4CDXA 1QH6A 4K6BA 3NV2A 1MZEA 4OHZA 3WVJA 5D1IA 3LOIA 2FHRA 2C1FA 4EN0A 4IEOA 5A3LA 4XDQA 1H8VA 3KM5A 4HANA 3WHUA 3TNPB 1TNRA 4UW5A 1GR3A 1H2LA 2WZR2 3IDBB 4LA2A 2PLV3 4A7ZA 1GZ9A 4V1PA 4D94A 4FP2A 1AXKA 3HD8B 2EAKA 2ENRA 3KSCA 4KG0A 1QJX3 5ABJB 4QM8A 2CV6A 4NVPA 2UY9A 4J1WA 3C3VA 1G9FA 1AJOA 1GICA 2GH8A 3P3NA 4HKLA 3O0VA 2WKKA 1RUF1 2E7TA 2JG8C 1N3PA 4CEWA 3KB5A 4YFWA 3FHIB 1RL3A 2AR6A 5DUUA 4K9SA 4DFSA 5FPXA 5D8AB 3J26N 3N7KA 2ZBJA 3DGTA 4WM7B 2YC0A 3M8LA 4XQWA 3AXEA 2XJUA 3JD73 4XOGA 1OQ1A 1HQWA 1RHI2 1LHNA 4GB33 5JDBA 1NG0A 5FLHA 3WCSA 1JTZX 1ASJ1 2BW8A 2WNUB 4CP0A 5JPNB 3OTFA 1AYN2 1XNDA 5FMOS 1RUNA 1AX2A 4NPRA 5GZFA 1DHKB 1VP6A 1O3QA 4FXGB 1WCKA 3VBRC 4XBNA 1AR71 1PGW2 5C6CA 3AYAA 3FUQA 3WNXA 2RS12 3IT8A 1SLCA 4B4PA 5T54A 4DNYA 2HYKA 4OI0A 4XIOA 4XTMA 1W6NA 3R4DB 3IKWA 3DV8A 3R4UA 2BNMA 4FAHA 3VHOA 4CZSA 2WNVC 3MFCA 1M06G 4OLLA 3OF1A 2R49A 4ZU7A 1X33A 4IEVA 5AC92 4P9IA 2VXRA 5ACA2 2EALA 2OW4A 4R9DA 1N1SA 4XYXA 2ZX1A 4Q4X2 1G9BA 4RQPA 4JAAA 3TN91 4FPYA 2X8KA 1WLTA 5ACA1 2V73A 4HSJA 3WD5A 5FPZA 1DQ4A 1RUC3 2IXJA 2XH6A 1AL23 2ZGKA 5JPMB 5J37A 4Q4V3 3RJRA 4IV1C 2GDFA 3MDPA 3VBHC 1LOFC 3V64A 2R062 4QQLA 4YG3A 2R0HA 4Q8KA 1FNYA 3V56A 2D5HA 2R043 5I0SA 1UX6A 2B39A 1MVEA 1FMD2 3VKNA 3HN1A 1QNWA 2E7QA 2OIIA 3MI8A 1QXPA 4Z92B 3S6PA 3W58A 1CPMA 4RS5A 4NHKA 4D69A 5CU1A 3ZYIB 3H50A 2P37A 1OOPC 1WD4A 2WNVB 1C4RA 2RJKA 4AVVA 1AR91 3JQXA 4AI2A 3IIAA 4Q4Y1 2GH2A 3WW4A 3MICA 4BPZA 1APNA 1GBGA 3B5LB 2XL7A 5H9QA 1VRH2 5L19A 4XJUA 5F6KA 3WG3A 1J1LA 3B3QE 3SH3A 4Z2WA 3WDWA 2ARBA 4FPOB 1NCQB 1WMDA 1COV3 5JOYA 1XNCA 3E5XA 3ZFFB 4PIZA 4KL1A 4XFCA 2K2SA 2EXJA 2DCZA 4A7KA 1N1YA 1YFUA 1O91A 1X82A 3TWIA 2DUOA 1XE7A 4XJWA 2VMHA 3ACLA 5KHKA 5I8SA 2DUPA 2PLV2 1CAVA 1X8MA 2HWD2 2OZJA 5JR7B 5FO7B 1O5UA 3N3HA 2UWAA 2PQQA 4I3PA 3WW1A 5EXOA 5CFCB 4Q0UA 1X36A 4XMAA 1U5IA 2VQAA 4ONUA 4B29A 1C8M3 1R091 1FOD3 1I1EA 3JD72 1QDOA 1UMZA 4COWA 4XFHA 3AX4A 5T3NA 4XETA 1R081 1Q8OA 1IPKA 2GMPA 1YJLA 3AK0A 3LKJA 3V0BB 1R092 1VBD2 2D43A 4PDWB 4M3CA 4AQSA 5L7OA 2ILMA 1F31A 1S0GA 3KCXA 2R16A 2ET1A 2JD4A 4HN1A 2RMU3 1VB2A 3VBFB 1H2NA 2RS53 4G4FA 1OLRA 5T5PA 5BNNC 4Y20A 2DURA 2YHJA 1IPJA 4HN0A 1J3QA 3NAPB 2IXIA 1H1AA 4HLTA 3TB0A 4FTSA 2XHKA 1A3KA 2CTVA 5HCAA 1H9WA 1R1A1 1RUOA 1PMIA 3VBSA 4JDNA 4AE2A 4NOTA 2XLAA 2A3XA 2QCSB 2ZX4A 4QT6A 2P3JA 2ZGTA 2RS13 2DCYA 1RVF1 5FBZA 4XBLA 4YRDA 2D3RA 2E7AA 3SISA 1LB2A 1B35B 1W6OA 2WNVA 4FPEA 4ITCA 3TNQA 4AVSA 4GWMA 1HQNA 1AHSA 3ATGA 3KZ4C 1DGWX 4I2OA 1QJY3 2CGOA 4CEYC 4RGAA 1CGPA 1VBE3 2RS33 1QJU2 5KHIA 2CGPA 5GZEA 1OI6A 1R1ZA 3ME2A 4CDWB 2G9GA 4YGCA 5B2GB 4LLFA 5FDBA 4PIXA 5DDJ2 2WA3A 2VPVA 1SBFA 1U5YA 3KLSA 5JWPA 1DQ6A 5GZCA 2Z69A 1W6QA 2CNAA 1JUIA 1BJQA 2R063 5IK7A 1Q8SA 3ZXEA 5BNPA 3JBG1 4D7YA 4MGKE 3PMEA 1FMD1 4QPGC 4E4SA 1M4WA 4FPHA 1B09A 4I02A 2C0ZA 3HBZA 2DYCA 4MGYE 3RWNA 2RR12 2MEV2 3E97A 3X29B 1ND2C 1GQGA 4HMZA 1A78A 5KHJA 3DL3A 4XQDA 4QGNA 1RUH2 2I45A 5CFCA 2HWB2 4M01A 2ZHKA 2ZABA 4QPIA 3V0AA 3B7MA 3CF6E 4CDUC 3S7EA 1C57A 2GU9A 5FREA 2YXSA 1J59A 1WLWA 2JE9A 2RR11 1S0IA 5CNAA 2XBO1 1AYM2 4GA9A 2WINB 2ZHLA 3RS6A 3M70A 2HWB3 4K1YA 5GLVA 4K7JA 4JGYC 1QMJA 3OD4A 3M7AA 4H3WA 2JJ6A 1VBA2 4CYDA 4IEZA 2PA7A 4N53A 3D5OA 4IEWA 4OULA 5J96B 2GMMA 2ET7A 1PGSA 4YZ5A 1RB8G 3NO8A 2F4PA 3ZMNA 2OYZA 3ZFFC 2O0OA 5J48A 4XBQA 5JZGA 5CG9A 4QQHA 4RA0A 1S0BA 2D97A 4TSVA 4B8EA 4YZ2A 1OQDA 1EP0A 4CP1A 4EROA 1QJU3 2OVUA 1SACA 5BXXA 3KS7A 4ASLA 3V65A 3K51A 2D5FA 3B9IA 3B9CA 4QPYA 2FMDA 3VBUC 2PLV1 3AP5A 2ZHNA 4BZ4A 4EN7B 1UW8A 5CFDC 5KHHA 2OUHA 1G7YA 4B4RA 3J8F2 2DVAA 1QOOA 5FLJA 1MVQA 2YY1A 4E9KA 2JG9A 4ATFA 1SBDA 3CLPA 3D0SA 4CDWA 5BNNA 2BBVA 1KITA 3PTYA 2BNNA 1ENQA 1QQP2 2NQYA 1DQ1A 3NV3A 4FPKA 4GH4A 4GMP0 1VALA 4XMIA 3S7IA 1AVBA 5FO9B 1ZA4A 1HDKA 1KS5A 1VBD1 1LCLA 1LGBA 4AI3A 3DPRA 3VKMA 5LEKA 1B35C 3ILNA 4EWAA 3O5SA 4HT1T 1Q8PA 4OUSA 4GMP3 4ZU4A 3JU9A 1G9AA 1VIWB 4Q4Y2 4GIQA 2ES3A 4OZXA 4FOVA 1CAVB 2R071 4UW6A 2ZGPA 4ZXKA 3AJZA 1OD5A 4P9GA 1MQTC 2CY6A 3H7YA 4QQOA 1O3TA 1T6GC 1JBCA 3V0AB 5E89A 1UU4A 1RUJ3 4QQPA 1PO13 4PCRA 2D6PA 3JB8A 4RHV2 1XNBA 1AJKA 1C28A 4LUMA 1BK1A 1O3SA 5T5LA 4LBQB 1X50A 3H1WA 4RD7A 3KT7A 2Q8OA 4AFCA 2YGMA 5EYXA 5JI7A 3H1YA 3FWEA 5K9YA 4Z82A 4DY5A 2VU9A 2O1QA 1UIJA 1QJZA 5LRRA 1BEV2 2Y0OA 3VKLA 4SLIA 3VBOA 4BYYA 5EJ3A 2HWD3 2CWMA 4CDQC 5JLVA 3VV1A 1GKBA 2D3PA 2EAAA 1QJX1 4HPKA 3B01A 1BEV3 4WM7C 5FLIA 4K8FA 1POV1 1OA3A 1SBEA 4HVRA 2Z5WA 3PLQA 3UK9A 4JGYB 2YDEA 4IV3B 1C8M2 1KDMA 4QPGA 3ZXKA 5LRSA 5A32B 3INAA 4PBOA 4H55A 1GYKA 2XLGA 3URFA 3RG0A 4AFMA 3J9SA 4IERA 5FOBB 1WLDA 4Q27A 4EV0A 4LUKA 3AZVA 4N9IA 3POYA 1JYCA 5H9RA 4WV8A 2E63A 1C5IA 3ZXJA 5CFCC 5F6LB 2ZGLA 4Z07A 1KDKA 1ND2B 1YRZA 4DINB 4ASMB 3H9AA 1UKRA 4LO5B 2R042 3VN4A 2NMOA 2XVGA 4LBLA 4U36A 1RJ7A 3ZFFA 2E51A 1HXS2 4YVSB 1MS0A 4YM2A 2P3KA 2XBO2 3T1MA 4Y22A 2DFBA 1VAVA 4M0HA 5KC6A 2X5IC 1C5HA 3ETQA 3LZZA 4FPFA 4K1ZA 4TLFA 2JKBA 5L7OB 1DLLA 1Q8VA 5C9AB 4META 3L2HA 3ZYJB 1PGL2 5IK4A 3MGUA 4L97A 3I7DA 3WX5A 4ORFA 4LHLA 3IMNA 2MEV1 4K40A 5C8CC 1IHMA 1NCRB 2ZZJA 5T5OA 2VNOA 2YROA 4K3UA 5ACA3 1VBC1 3RYKA 1V6LA 4FAGA 3MIFA 5DDJ3 4R4ZA 1FV2A 1RIRA 4Q4V1 2CWSA 1FOD1 3EBRA 4CDXC 3CJXA 4KH9A 1YJKA 3VBOB 3THTA 1NE4A 3QD6A 4H7MA 1SDWA 4Q4V2 1ENXA 5H9PA 2VULA 4MH0E 3OY8B 3RNSA 1CQ9A 2D40A 1LGNA 1CONA 1LJ7A 3H3UA 2QUOA 1BMV1 1L3JA 2VOXA 1FXZA 4LNVA 3VBFC 3R6SA 1QQP3 3RYRA 3ENRA 4QMAA 4AEKA 4JGYA 3VKOA 1FNZA 1RUH1 2IZWA 4BWOA 5KXEA 5EV7A 4AW7A 2WLQA 1GQHA 2UWBA 4N53C 1PM7A 1CPNA 4OVEA 3RPQA 1VRH1 4QQ2A 1URXA 1PIV2 5SV8A 3WLUA 1LEDA 4MXWA 4XE9A 4SBVA 4Z8BA 4WVWA 4ATEA 1YNAA 1LHUA 3ALQA 5A3MA 2WWSA 1WGPA 2F6BA 4OI2A 3FE5A 2IFWA 3TBDA 2WC2A 2Z42A 1ZZ9A 3VGIA 4UXAA 2VNGA 1RUF3 2MNGA 4XFBA 1JH5A 5HXVA 1XRUA 2RS31 4GH4B 5FAXA 1CAXB 2A73B 5BNOB 3WCRA 2AH2A 1Y3TA 1YCIA 2PAMA 3U11A 1QXJA 3VHRA 4OI4A 4RQPC 4AK3A 5JVVA 1ASJ3 1KFUL 2DVGA 1ZX5A 3MF9A 4QHBA 1C8M1 2D3SA 4TZDA 1KD7A 3B94A 3UKNA 5KXCA 1GFF2 1AF9A 4JCKA 3ZXGA 1GV9A 5JSOA 2LM3A 1R083 1RC6A 2ZJCA 1JOJA 3AZYA 4B7KA 4BLJA 1OHFA 1H4HA 3MPPG 4HPKB 3EO6A 4DY3A 5JZGB 3FLRA 1POV0 2HKXA 2DUQA 1AL22 3FFQA 4YZ4A 4E4DX 3N4MA 1LOGA 1N3QA 1VAKA 1DZTA 2DCTA 2HEWF 1Q56A 1UD1A 1Y43B 2GN3A 2SLIA 5JI9A 3AKRA 3AMQA 5JIAA 4JRAA 3ZSLA 2HWB1 4AHYA 5CA6A 4G9SB 3AKTA 5HCBA 1NY71 1LHWA 4Y1XA 3ZN6B 2DCJA 1VBB1 3W59A 3L2YA 4AHXA 3NAPA 1QY4A 1IS5A 2GNDA 1RUG2 3UKTA 4RS5C 4Y1ZA 4XXPA 5T5JA 1LHVA 4E2QA 3ELNA 1DQ5A 2KXLA 3OBRA 4Q4W3 5I0UA 1AR83 2DWRA 3P3PA 4N7UA 5BY5A 1RUG3 1WBLA 1LESA 5FMOL 5GZDA 5AFEA 3UJQA 2DVFA 4XIKA 2NPIA 4R4XA 2NZ9A 4I3GA 5C8CA 1SLAA 2W0XA 5AVPA 2R041 2A70A 4UW4A 4A2UA 1RGSA 3MLLA 1C8NA 3OBTA 2QJVA 3ZFEB 1LEMA 3N7LA 1MZ6A 3SH4A 4CDXB 3HQXA 5D8AC 2GC1A 2RMU1 1PO22 4U2AA 4BM8A 2B9UA 4KQ7A 4Q1PA 2WFF3 2XJRA 3PVEA 2ZACA 4XZPA 1NCQA 4RSUA 3JBG3 2HWC3 3KCCA 4X6QB 3GHNA 4AXOA 3FLPA 4JTNA 4MZUA 5T50A 2JE7A 3RMXA 1CAXA 4AWDA 1F8VA 2DU0A 2VOWA 3ZVXA 2MPFA 4L2NA 4YW3A 2VGDA 3QH7A 1ZBE3 1AXZA 3AZXA 3VL9A 4Y1UA 1LODA 3ZPYA 1COV1 1V70A 2WZR3 1Q8QA 2XJVA 4AFAA 2EIGA