1UY2A

Binding sub-site dissection of a family 6 carbohydrate-binding module by x-ray crystallography and isothermal titration calorimetry
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
131
structure length
131
Chain Sequence
SPIRRDAFSIIEAEEYNSTNSSTLQVIGTPNNGRGIGYIENGNTVTYSNIDFGSGATGFSATVATEVNTSIQIRSDSPTGTLLGTLYVSSTGSWNTYNTVSTNISKITGVHDIVLVFSGPVNVDNFIFSRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding Sub-Site Dissection of a Carbohydrate-Binding Module Reveals the Contribution of Entropy to Oligosaccharide Recognition at "Non-Primary" Binding Subsites.
pubmed doi rcsb
source organism Clostridium stercorarium
molecule tags Carbohydrate-binding module
molecule keywords ENDO-1,4-BETA-XYLANASE A
total genus 32
structure length 131
sequence length 131
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2004-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uy2A00
2EICA 2WYSA 2XHNA 5DMYA 1IQDC 5CYYA 4MGSA 1KEXA 3WNKA 5CZKA 1UWWA 4M4PA 3LEIA 1P8JA 2W5FA 1LNSA 2VC9A 3I3BA 3MV11 4DEVA 3ACGA 3I2FA 3T0BA 1L7QA 4BJ0A 1EUTA 2VCCA 4BK4A 3J7HA 4DXSA 1O8PA 4LQRA 4DUWA 1JYNA 4IUGA 3HJRA 4XUOA 5C71A 2QQMA 3K4ZA 5JXJA 1GOFA 5I0DA 3I2KA 4L0PA 1JZ4A 2XQXA 5J1XA 2X10A 1GU3A 3WF1A 1HN1A 1W9TA 5FUIA 2QQJA 1NKGA 2VQTA 3WNNA 3MBWA 1UY2A 3I3DA 1ULOA 1O8SA 4P02B 4JKMA 4KWUA 3OB8A 1JI6A 4JKKA 1JZ8A 2E32A 3BGAA 1K3IA 5IHRA 2J1AA 3CDZB 3GGLA 4XURA 3IB3A 2YC4A 4MGQA 2Y8KA 4PT6A 4JHZA 5LCWL 2VOTA 3C7FA 5IYYA 2VMEA 3EB7A 2J1UA 2Y6KA 2VZ1A 2W1SA 3D3AA 5G04L 3SKJE 1KGYA 4UAPA 3WNMA 2W1UA 3K46A 2W46A 3C7HA 3MO4A 1JYXA 2ZEZA 3ACHA 5DPNA 1GNYA 1W8OA 4OMDA 2VL4A 1JHJA 1F4AA 2RV9A 2W3JA 1BHGA 4A4AA 2W87A 2Y6JA 4CUBA 2W1WA 2EIBA 3WF0A 2XOMA 3ECQA 1GOHA 3WNLA 5LA0A 1XC6A 2CDOA 1W9WA 1GUIA 3CIHA 1US2A 5JUVA 2ID4A 3HPNA 3U37A 3WEZA 5HPOA 3WQBA 4LKSA 3WNPA 5B4XA 4D0QA 2WAOA 3LPGA 3K4DA 1H6YA 2WQ8A 4FI9A 4RN5A 4GWJA 1UY0A 3IDAA 1SDDB 3K4AA 3HEIA 4XUQA 3HOBA 1JZ7A 1F4HA 1GQPA 4BK5A 2EIDA 3OEAA 2YFZA 2YG0A 4W4ZA 3ETPA 4JX0A 3FHAA 4LPLA 3LE0A 1CZTA 3CMGA 3HN3A 5G05L 4CU7A 3THCA 3SKVA 3ACFA 2BBAA 1CZVA 3C7GA 4A42A 2QBXA 3UETA 1NX9A 1CX1A 3VD5A 3GM8A 2CDPA 1R64A 1W8NA 4QX3A 1L7RA 5IFTA 4OUEA 2JDAA 1SHWB 4W8JA 2WZEA 2WO2A 1CIYA 2BZDA 4KMQA 3HNBM 3LEKA 2HLEA 2ZEYA 2OKXA 1JYVA 1OF3A 3VD9A 1GMMA 2J1RA 3FHQA 3THDA 3VDCA 2Y6LA 2DDUA 1T2XA 3W5NA 1OH4A 3K75B 1GOGA 1UZ0A 2VZQA 4KI5M 3VDBA 5IJRA 2C4XA 1ULPA 4ZY9A 3OGVA 3W5MA 4A41A 2YB7A 1DP0A 2YFUA 4XUNA 4Z2AA 3DYPA 1SG3A 4A6OA 2WN2A 1OT5A 1OD3A 4QB6A 2HYXA 2BERA 3WF2A 2WAAA 3A7QA 2C26A 3P1IA 2BGOA 2V4VA 2C9KA 5A1AA 1JZ3A 3MUZ1 3NJVA 1W99A 3LEGA 2Y64A 2B9VA 2E26A 2DCJA 2KD7A 4CU8A 2RJ2A 4OZOA 2DCKA 1UX7A 2JKXA 4LHSA 5JXIA 2RVAA 3NRUA 3OG2A 3K77A 4D8MA 2VZVA 4AAXA 1J84A 1WKYA 3WSOA 2ZXQA 3IAQA 1PMHX 2W47A 3JXSA 2LS6A 2VZSA 2J1VA 2VZPA 2W1QA 5C7GA 1XNTA 1JU3A 2Y6GA 3A23A 2VCBA 3I2JA 5IFPA 4HG6B 2VZ3A 4QX2A 3PUIA 3C8XA 1NAEA 3T2PA 4BDVB 1MPXA 1J83A 2PQSA 1WCQA 2Z4FA 3CQOA 2QQLA 3FL7A 4ZZ5A 1D7PM 4P08A 4MADA 4QDRA 2LW8A 3ZM8A 4JKLA 2WBKA 1JU4A 4E8DA 1UXXX 2J22A 3T2OA 4ZXEA 3I3EA 4E8CA 5B4NA 2WO1A 2J1TA 2VJXA 3HNMA 2X09A 4GZ9A 3ABZA 3T0DA 3OEBA 3OBAA 4P5YA 5EJ1B 1K42A 2VZRA 3I2GA 2X05A 2QQIA 4QAWA 2VO5A 2V72A 3WNOA 1UMIA 4UOJA 4XUTA 1UMHA 2ORZA 5JR2A 1UXZA 2E33A 1JZ5A 3UNPA 1K45A 3F2ZA 3I2IA 2E31A 2VMCA 3OGSA 5F7UA 2EIEA 3A22A 3CZJA 3LPFA 3VDAA 2L9LA 1YQ2A 1JYWA 4OMCA 4RYDA 4CU6A 2WABA 2QQKA 3HNYM 1JZ2A 2VZTA 1PMJX 4QB2A 1PX4A 2WUHA 2B4KA 5JXGA 3GDBA 3T09A 2W9XA 4MOAA 2WZ8A 1I5PA 4ARXA 5DQ0A 4AG4A 4QDSA 3DYOA 3A21A 2V5DA 3VD7A 4XZUG 1DYOA 2W95A 2VQUA 2ZEXA 4QDQA 3MV01 2BGPA 5JXHA 2VCAA 3NQHA 3OGRA 3IIIA 4A44A 2W91A 4QX0A 1UYZA 2W94A 5LA2A 4A45A 4CU9A 2VTFA 3EYPA 4YPJA 3IAPA 3LQCA 2VMFA 2WDBA 3I2HA 1NUKA 2VM9A 1UYYA 3E1F1 4CUAA 3T0AA 3NJXA 1W9SA 2J7MA 3FN9A 3SEPA 3T08A 5DN2A 3CKHA 4CUCA 5HXMA 2ZEWA 3VD3A 1TVGA 4TXWA 1W0NA 2ORXA 4P00B 2JE8A 4XUPA 4ZZ8A 4QB1A 5JMOA 1PX3A 4QPWA 2XONA 1US3A 4UI9L 1UYXA 4QX1A 4W50A 4DXTA 3ACIA 4A3ZA 4DUVA 3DECA 3CZUA 4MO3M 4XVHA 1UY3A 1XNAA 2YC2A 3PUHA 4BXSV 1CZSA 4DUXA 1DLCA 5C70A 3NNGA 5EJZB 3BN6A 3WF3A 3I97A 3DYMA 2W92A 2Y6HA 2VR4A 1JZ6A 2JD9A 3T2QA 4GWIA 4CVUA 5EIYB 1TG7A 4PQQA 1UY4A 1XPWA 1UY1A 4OYUA 3SEEA 1O59A 3AC0A 4TTGA 1H6XA 4M4RA 1RYYA 2VZOA 2VMDA 4DXRA 1K12A 2J1SA 3C7OA 2R7EB 4ET7A 1EUUA 2QQOA 3MUY1 4PF1A 3WF4A 2J1EA 3C7EA 3GXUA 2WN3A 4DEQA 3VD4A 1OF4A 2WO3A 2QQNA 5LA1A 4ARYA 3P6BA 3UESA 2VZUA
chains in the Genus database with same CATH superfamily
1JH5A 1UN1A 2WYSA 2XHNA 5F6LB 5DMYA 4YLZA 1AR92 4RHV1 2FDFA 1TZOA 3H3ZA 5ABJA 4PI2A 2WINB 3WNKA 1AR72 2Q8CA 2R0HA 5CZKA 5DZGA 4M4PA 1ZRCA 2BGCA 3DV8A 3J9SA 1NCQB 4E4SA 4K20A 4LA2A 3N9QA 4FXGB 5T52A 1YQ6A 1V9U1 5FJHA 1LNSA 1ENSA 1JOPA 4UFJA 4R52A 2NQYA 4YSFA 3VN4A 4CDXC 3BOPA 1FMD3 1ODMA 2CWMA 3ACGA 3FBYA 2ET7A 3HVDA 3TN93 3AZVA 5A33A 4LO6B 3E97A 2AEZA 4LO7A 3VBRC 2HWD3 4LOSA 1WD3A 4GWMA 1EUTA 1W3VA 2D6PA 4O9GA 1XU2A 3RG0A 3J7HA 2GH2A 1O8PA 2RDSA 4HOOA 3R6SA 1NQJA 4H14A 1XE8A 3LWCA 1RUH3 4BM8A 5C71A 1JHNA 2BVBA 3U4XA 3VB9A 2QQMA 1GOFA 3I2KA 4L0PA 4XHXA 1JZ4A 2VECA 2VUCA 4BQYA 2XQXA 2VOXA 3OBTA 4NMIA 1N3PA 3DPRC 1W2AX 3M8LA 3IDBB 4Y20A 1GP4A 1W9TA 2IVIB 4CZSA 1NKGA 2BYVE 2FDKA 3MBWA 4EN6B 1XE0A 1UY2A 2ES3A 2GN3A 3J8F2 1OVPA 1VBD3 1D0HA 1O8SA 1W0OA 3EMRA 4FPCA 4P02B 5F32A 3ZR6A 4KWUA 5FY9A 1DZQA 4MSVA 1SCSA 3VGIA 4WVVA 5K9YA 1OVSA 4D7SA 2C6SA 2VUAA 2D43A 3H1YA 4FP2A 1EAH3 4ZXKA 1X9TA 3PL0A 1AR83 4OCTA 4N7UA 3H8RA 4OULA 2Y6FA 4AGVA 5JIUA 3U4SA 2VXRA 2J1AA 4I2OA 1ASJ1 1B35B 5IW0A 2JIGA 2LUWA 4UYBA 2ETEA 3GGLA 4CSWA 3AL6A 3MIBA 4MGQA 4IGPA 3NAPB 4N53A 3C7FA 5IYYA 1AX0A 2BRTA 2PHRA 3EB7A 3O1SA 1V6IA 1MACA 4LULA 2SLIA 3ENRA 1Z0HA 5A7SA 3MFAA 5FZMA 5C5TA 5FKCA 3H42B 3FX3A 5FYTA 1LHOA 5FZ6A 4E4ZA 3SKJE 3ZYPA 1KGYA 4YW1A 4A3XA 2DU0A 4DY3A 2W1UA 5FY4A 3K46A 3QBQA 4W6WA 5TSWA 2W46A 1LAJA 3C7HA 3MO4A 1JYXA 1SLBA 1UKGA 1HRI3 3ACHA 4EN9B 2RS13 1NCRB 1ZZ7A 5DDJ3 1GNZA 5BNNB 4S2HA 2ZHKA 5FY0A 3RJRA 1GNYA 1MS8A 4LBOA 4M3CE 3GZAA 1JXNA 3WCSA 1GICA 1IKQA 2RV9A 1JTZX 4IEUA 1NY71 5GALA 1EYBA 3VBSA 2MNGA 4ES9A 1AJKA 2YDEA 3NNMA 5KBFA 3WG1A 4L99A 4C0BA 1CAXB 5CNAA 2W1WA 2OXBA 3LSDA 3ZKYA 3VBOC 1YFYA 2OS2A 2XOMA 5FXWA 1S0BA 2AEYA 5BNPB 1XC6A 4AFCA 5I0SA 4O9EA 3KF5A 1BBT3 1QJFA 5JUVA 3HPNA 4MGYE 1XYOA 3J26N 3WQ1A 1JODA 2GSYA 3KCYA 1R083 2XJSA 5KHHA 3RRDA 3EO6A 3K4DA 5T55A 4LOTA 5IK4A 3JBG3 1RUG2 2Q8EA 2LRPA 1F9KA 4NR1A 2R1BA 1G6NA 2RM23 3K4AA 2V09A 3GJAA 1RGSA 2R073 2WSVA 3HEIA 4XDQA 5IVCA 3BCWA 3ZFGA 5LW9A 1GQPA 4BK5A 1DGRA 3VKLA 1ZBE2 4ZKTB 4P9XA 3ZFEB 2DBIA 4JGYB 1OD5A 1WMDA 4XBLA 1RUC3 3KT4A 1QJU1 4Z2WA 2RS31 4Q0VA 4LLFA 1AR82 4LPLA 5GZCA 1KQRA 4XTPA 3PUAA 5G05L 3ITQA 5FP4A 4BOWA 3THCA 5IVJA 2GN7A 1C8M2 1Q56A 3D0SA 4ZS3A 4EJRA 3UETA 1NX9A 4YZ2A 2QZ2A 4NWVA 1W6PA 3ORJA 1XB9A 4GMP0 1XSRA 5JAXA 3E6CC 1S4CA 2QQVA 1R64A 1Z7S1 4ZHNA 3OJBA 1L7RA 2WWSA 1OA2A 1BKZA 4LT5A 1U5ZA 1QMJA 4FFHA 2P5BA 1AYN2 2DVDA 5E6HA 3U07A 3USSA 2WQ4A 1PGW1 3MEPA 4CP2A 2P6CA 1OQEA 1HRI2 4W8JA 5DABA 1T6BX 4XF9A 1RUI1 2OZ6A 2R041 3DF0A 4KMQA 1MZ5A 5DZFA 2O14A 5I8SA 3WOGA 4DPNA 4QGLA 1HB1A 2ZEYA 4IGOA 1SLCA 1ULEA 1V6LA 1V6JA 5F37A 4QKDA 1JYVA 3AKQA 2ZGMA 2VBDA 3JCIA 1GMMA 3THDA 2Y33A 2JDMA 3LF7A 3CNAA 4IESA 1UZYA 2ZGRA 1QQP3 3D0JA 4IE5A 4CP9A 3IKWA 4Z92B 1T2XA 3IIAA 5JR7B 3W5NA 1SCRA 3M1HA 4J1WA 3U0ZA 4KI5M 3ZDSA 1RHI2 2D6MA 4I02A 4FPFA 1COV2 4JCKA 4KL1A 4GB32 1LKNA 2X5IB 1PO22 3W5MA 4A41A 2YB7A 4B4PA 1PO11 1B35A 1QOOA 1WW7A 4S2FA 1W8HA 2XBO1 3MICA 1FMD2 5HCBA 5FZIA 1VBC2 4A6OA 5FV3A 5K0UC 2WN2A 1QJX1 1WLWA 1V6KA 5AFBA 3EBRA 2A6VA 4GXLA 2PXJA 1TMF1 4AE2A 1R091 5A7NA 4Q1RA 2DF7A 4YG3A 1ZBA1 4GH4B 3LA2A 1I5ZA 2WAAA 4RQPC 3A7QA 2C26A 2V4VA 3FUOA 4XCBA 3WF2A 4NPMA 4B3NA 3MUZ1 1A6CA 5C5UA 5DDJ1 1W99A 3LEGA 2B9VA 2E26A 5FLIA 3RFRA 4QQOA 4HVOA 3KV5A 1RUC2 2HYKA 4RL7A 2JKXA 5A3OA 4AVVA 1R081 2RVAA 3K3OA 2VOVA 2FHRA 4CDXA 2VOWA 3ZO0B 4D8MA 2QKDA 2VE1A 1JOJA 1RL3A 2XVGA 4LO8A 5GZEA 2XWBB 3AZZA 4AEDB 1JYTA 4LIVA 5FK7A 1WA4A 1C8M3 3WP5A 4C91A 1BBT1 3R4UA 4FCAA 4UFMA 2LALA 3VZLA 4RHV3 1QGLA 2W1QA 2YMZA 4D6QA 5EPAA 1W6NB 5AC92 1VB4A 2O0OA 3I59A 4XJ8A 5F1RA 3UJQA 5FZKA 3AP5A 1PIV2 2GNDA 1W06A 2EA7A 3WUDA 2ZGLA 2HWE3 3HD8B 1N3QA 1DGWA 4XF1A 1HRV2 2AREA 3VL9A 1PVC1 3C8XA 1N3OA 4FPOB 3T2PA 3SLIA 3JZVA 4XFIA 3B9IA 4ES8A 1UIJA 3LA7A 4AZZA 5JSRA 1JBCA 4PLOA 4QHZA 3CEWA 5BNPC 1BXHA 1UOJA 4ZZ5A 5F7UA 4Y1UA 3MIEA 4AHYA 2JG9B 3KMHA 1O91A 2WBKA 1AF9A 4JKLA 3UGGA 5KXDA 2BPA2 1UOGA 1TME1 5T5JA 1WBFA 4IERA 1SACA 3N9PA 4XBQA 2PMWB 3AYEA 4Y5Z0 1MS1A 1ST8A 3NNJA 5EHDA 1QJZA 1O3RA 5FFOC 1MEC1 4GULA 5KHGA 2VJXA 3HNMA 4NHLA 2WLPA 5I0UA 1HXS3 3ZX7A 2XPJA 2XJQA 2DCTA 5L73A 1QJX3 4LKDA 3OEBA 1BYHA 2PHXA 1HN0A 1LEMA 2VZRA 5KXBA 3G6JB 2FDIA 4HKWA 4P9GA 4QAWA 4UW3A 5C9AA 5CADA 4COWA 2EALA 2ZA9A 4OHXA 3ON7A 5CFDA 3KGZA 3NAPA 4WZCA 5HI0A 1LGBA 1NA1C 1PK6A 1H4HA 2BQPA 5LY2A 4LITA 3VZKA 5ACA2 5HCAA 2CL2A 2BNMA 3POBA 5DAVA 5JR2A 1AYN1 4NRPA 4ASMB 3M3QA 1W2UA 2OX0A 2JDPA 4MGTA 4N43C 3PTYA 2RJLA 5J7MA 1K45A 3I7DA 3DN7A 4ZONA 1DQ6A 2EIEA 2ZZJA 3A22A 3OOXA 1W0PA 5F5IA 1DQ1A 5GLWA 2E51A 2BFUS 5LBBA 4BLIA 1N1SA 5FLJA 4BIOA 4RYDA 2DU1A 2WABA 4V1PA 1QXRA 4K8RB 4BH9A 1LOAA 4QB2A 2RS52 1VB2A 1LECA 4NPRA 2ZCWA 1GYKA 4Q4V2 5A3TA 5C8CB 1YI9A 1OQ1A 4YVWC 2B4KA 2OT7A 2RR13 2W2IA 3PMEA 1POV1 3KGLA 5AVAA 3AB0A 2VW1A 4AEKA 4Q4W3 1YQ8A 2VNRA 2WZ8A 5FXXA 3BUCA 4F83A 4LO5B 4JDMA 1AR71 4LHLA 1UF2C 1U12A 3H8UA 4COZA 1RUD3 3MYXA 4O7XA 3A21A 3RVHA 3VD7A 1DYOA 4AEJA 3RWNA 4TLFA 4FSJA 2W95A 2FDJA 2PAMA 4QDQA 1C5HA 1RVF3 1G86A 3U11A 4YGCA 3TOJA 3OGRA 2VY0A 1DG6A 2HH9A 1QH6A 3VBRB 4CU9A 1D0GA 2VTFA 4XCAA 4YPJA 3WR0A 5L9VA 4FOQA 4N9HA 3T3YA 5FTTC 5A1LA 1C1FA 3WP6A 1HB3A 3ZFEA 1HRI1 5CG8A 2VM9A 1UYYA 4IV3A 1VRH2 4Q4W1 2PHFA 3CJXA 4LBLA 5JVVA 2QNKA 2PLV1 3NAPC 3VZNA 3MF6A 3EXUA 2OZJA 3CJIC 5T5PA 3LDKA 4CUAA 4YW5A 1YEWA 2WZPP 1B09A 4RR3C 3T0AA 4NHKA 3O0WA 5FY7A 4LTAA 1BBT2 3JD72 3NJXA 4NIIA 1HDKA 1MQTC 2ZGOA 3CKHA 4QPGB 5E89A 1Q3EA 3ZSEA 1YCIA 3H50A 3IN9A 5A3NA 5JLVA 1REDA 1TVGA 1IS3A 2CGOA 2P37A 2B5HA 1UZVA 5IVBA 4P00B 5JZGB 4XUPA 5F5QA 1O5LA 2PHDA 3QLQA 1W8WA 4YYOA 5JMOA 1ND2A 3ILFA 3NJZA 5HBAA 5KR7A 1US3A 4UI9L 1EAH1 1D4M2 2C9AA 3HQUA 2RDQA 2PHLA 4JGYA 2PLV3 4B1MA 3ACIA 3N9NA 1S2BA 4DUVA 3ACLA 1SLAA 4XVHA 1KD7A 1NXMA 4JRAA 1MS3A 1ZBE1 3DPRA 1UY3A 1CAWB 3PUHA 1V6MA 4A2UA 3NJYA 2TBVA 2VVDA 1A8MA 4DUXA 3AKPA 1IQAA 1DLCA 4FTBA 1FPN3 2NMNA 3VBFA 5JPNB 1PGL2 2P2KA 4Q4V3 1EY2A 3S30A 1WCSA 4HN1A 3D5OA 4QHOA 1X33A 5J96B 3U14A 4GQ7A 1DDLA 2QVSB 2W92A 3MPPG 2WSUA 5GZDA 3KVBA 1YNAA 5C3SA 3K3NA 1MEC3 4L8QA 2VD7A 4CVUA 5EIYB 4AEDC 2TEPA 4PQQA 1XPWA 1UY1A 4OYUA 3B00A 1D2SA 2RS51 2XLFA 4RS5B 3SEEA 2JDNA 2RM21 3GYDA 5LB6A 3I2OA 2ZMLA 4KBBA 2R6QA 2RDNA 2VMDA 4Y4YA 1RVF2 3JBG1 5D8AC 5FYSA 3WQ0A 2R7EB 1QHDA 1EUUA 2QQOA 4NWWA 3RS6A 2ZMNA 1W6MB 4OHZA 4IV3C 4PF1A 5FXZA 1MS4A 1Z7S3 2UYBA 2X29A 1WMEA 3QH7A 5CAZA 1FNYA 3C7EA 1GSLA 2GMPA 3GXUA 2MPFA 1JS9A 1HRV3 2K46A 4K7JA 5IWFA 4BYYA 1CD3G 5I8YA 2E7AA 2P3YA 3M4FA 4R4XA 2AYHA 1GP6A 3ZFGB 5D21A 2X53S 3JD71 2ARXA 3H7JA 4NJ4A 3TRSB 5CYYA 1QF3A 1NOVA 4EE2A 3SXWA 4HVQA 1RUJ1 3O1RA 1ALYA 1NE4A 1ZZBA 3RMXA 2D3SA 1SLTA 1LRHA 3NVCA 4YVSC 3VDDB 3NNFA 1PNGA 4CXWA 2A3YA 3POJA 5JMCA 1V0AA 3MV11 4DEVA 3NWKA 4HSJA 4PIZA 1L7QA 5FP7A 5A3WA 2B45X 1S0CA 4D6SA 1OBNA 4DXSA 1YJKA 2F4LA 5DUVA 3EHKA 1Y43B 2B42B 2I74A 1JMUB 2R49A 4IUGA 5FYYA 3HJRA 4DIQA 2BOIA 1HB4A 5BNOC 4S2GA 1HXS1 3K4ZA 5JXJA 5L7OA 3TB0A 1JUHA 1QH7A 5CEHA 2D3RA 5J1XA 1GNHA 1RUJ3 2D40A 4M3CF 4UBGA 4W6YA 4YM1A 3GHNA 2CY6A 1RIRA 1GU3A 2CAVA 4BA6A 4YFZA 2D98A 3FMGA 3ZDVA 2UY8A 4FPLA 3ZSMA 4ZU7A 4C8DA 1NQDA 3J7NA 4FPJA 4YG0A 4YRDA 2Y26A 2G1MA 1SPPA 3TAYA 4YFWA 2R30A 4WM8B 2FDHA 4YGDA 4M0HA 5LWBA 1M06G 4I0WB 3UKNA 4V2WA 5C9AC 4D69A 4JKKA 3PVNA 3SQOA 4LXLA 2E32A 4UW4A 1S0DA 3BGAA 1K3IA 4HL0A 2JWPA 2EXIA 2XGXA 2XLAA 1VIWB 3CDZB 3WUCA 5K8SA 1OMIA 3KWVA 1TNFA 1A3KA 4HN0A 4XURA 4Y26A 3IBMA 3ETQA 2Y8KA 4PT6A 4JHZA 2AR6A 2JDYA 1ND3A 3CHXA 4FVVA 4BQ1A 1IGOA 4N43A 4BPZA 1QXJA 4L9BA 4AEMA 5C33A 1YO8A 4E9KA 3SMHA 2VU9A 4R9CA 3RYRA 4NHMA 3PLQA 3THTA 2VZ1A 2WJSA 3KT7A 1QWRA 2H6BA 2ZGSA 3JB4C 1CAUA 4Q0PA 1MR5A 4OVEA 2VAUA 4LNVA 3TBDA 1WMFA 3AL5A 4XOGA 2XWJB 2D6LX 4BQXA 2ZEZA 3T4VA 3MZHA 5DPNA 2QQPA 2IXHA 3ZMOA 1QJEA 4LBQA 1W8OA 5GZGA 3DPRB 4COVA 3MDPA 1XQNA 2Y60A 3IPVA 1OLQA 2WT1A 2QE3A 4A4AA 4XE9A 3TNQA 2W3JA 1BHGA 1BVVA 1HJFA 2JICA 4GIQA 4QPIB 3AMMA 1W8FA 4C0HA 5IAXA 4AVBA 1UQXA 1U5XA 1W6OA 2Y6JA 4YZ5A 4CUBA 4IE4A 4K3UA 4Z1VA 3V56A 2W39A 1ZNPA 1W8UA 5GJ6A 3AFKA 3KD4A 1O4TA 1CPMA 3WF0A 4BQ3A 1KFUL 3LGRA 3ECQA 3WNLA 3BPSA 1LENA 2TNFA 4GMP3 4CPBD 5LA0A 5IVYA 1ODNA 4OHYA 2ZX4A 2YPJA 1VMFA 4O65A 5JPMB 4OHWA 1B35C 2VBBA 1DZTA 5B4XA 1UNBA 3GZUC 3LD8A 3GNEA 5K4LA 1QQP1 4Y3OA 5FZAA 3RI8A 3ZIWA 5CA6A 1W2NA 3Q8CA 3LEMA 1H6YA 1MVQA 1ZZ6A 1S1AA 3N36A 4RN5A 4IEPA 3SCFA 3IDCB 2XKPA 1UY0A 4LR4A 1CAUB 1DQ4A 1OC1A 4HBNA 1KS4A 3FLRA 4C90A 2RS53 2BP6A 3HOBA 2HEWF 5A3MA 1HQWA 1V6NA 5J36A 3PUSA 3PJQA 4PJYA 4ASKA 1ZBA3 2EIDA 1GZTA 3NV1A 3OEAA 5LBCA 3USUA 2R16A 1FX5A 2PAEA 4PBPA 1DGRN 3F95A 3AK0A 5SV5A 3RZLA 4ZU4A 3KV9A 1D4VB 2ZHLA 3LA3A 4IEYA 4RA0A 4XQDA 5FYZA 3O1OA 1CAWA 5A7PA 3HN3A 2DTWA 2MEV2 1TMF2 2CV6A 1AL22 2D6NA 3UL2A 5C3QA 1SFPA 3E5QA 5A3LA 1QXPA 3C7GA 4A42A 4QT6A 4TSVA 1CAVB 1W05A 2QBXA 3N7LA 4KNCA 1CX1A 1GV9A 4IEXA 3VD5A 3GM8A 2VMGA 4XBNA 1GZ9A 4AAPA 4MUVA 1W8NA 4GB31 1YIFA 5FZ4A 4Y5SA 1G9CA 2XJUA 2ARBA 2NMOA 1JN2P 1SHWB 2C1FA 1W90A 5FWEA 1O3SA 4FOYA 4QKNA 3LDRA 5FYIA 1Z78A 2AACA 1CIYA 3POYA 3RZMA 1UL9A 2WC2A 2X5IA 5FZ3A 4IL7A 2HLEA 2UU8A 5JCTA 1CVNA 1PZ8A 2OKXA 1DZRA 3O1UA 3FUQA 1PK6C 2A70A 2P17A 2BV4A 5IVEA 3SH4A 3FHQA 1ZRDA 2OIIA 4CEWC 2DURA 2JX9A 2R062 2D44A 1HIXA 3L2YA 5I0TA 4QHBA 5FPXA 1SPPB 1GANA 1GWKA 1OH4A 3K75B 1GOGA 1GZCA 3I54A 1UZ0A 2VZQA 5GM0A 5BNOB 4I3PA 5FZOB 4XILA 5A6YA 1UW8A 3VDBA 1VBE3 3WDXA 2XKOA 2Z79A 1ULPA 2GZWA 4HSLA 4AXOA 1VP6A 4ZY9A 4G9SB 2DFBA 4YVWB 3LAGA 4P5HA 1ENXA 3DYPA 4NIHA 3HIFA 1GR3A 4F3JA 3ZFFC 2K2SA 1OT5A 1R082 4Z8BA 1OD3A 3VV1A 4IEOA 4WV8A 3NW4A 1XNDA 4H7LA 5GLUA 2HYXA 2X8KA 3WCRA 3AP9A 3VBHC 1R1A3 2BGOA 1QJU2 2C9KA 4XFCA 3ZYIB 2XB6C 2NP0A 1ZBA2 2P1BA 2ZZQA 3NJVA 4BB3A 4CDUA 4EROA 3KHCA 2DCJA 2XL9A 2KD7A 3CO2A 5KC6A 4OZOA 1MEC2 2DCKA 1UX7A 2WIIB 3BYWA 3ELNA 5FJKA 5LEKA 3BB6A 4DZGA 4G4FA 1VBB1 2WFF3 2JG8C 1XNBA 2MEV3 3VKOA 4AAXA 4YVSB 3J8F3 3IAQA 3MFCA 1PMHX 3ZPYA 2QUOA 2RR12 5FBZA 2RMU2 3JXSA 2PQQA 2NYYA 4CDQC 1VBA3 4JC1A 2J1VA 1D2QA 1RINA 1ZREA 1OSGA 1QOSA 1EAH2 1UU6A 5C7GA 3KB5A 1GBGA 1RUG1 3RDIA 3GHMA 1RUD2 3DKWA 5FUPA 3WDTA 4I0AA 2Y0IA 3A23A 2VCBA 4MXWA 1UAIA 1LHNA 1IS4A 3PIGA 1AYN3 1ZA4A 4KU7A 3PMSA 4LUKA 1TQ5A 1MPXA 3Q8EA 3OD4A 3DEMA 5CU1A 5T5OA 5I0RA 1WCQA 4DMIA 2Z4FA 1XSQA 4XFGA 2VQ0A 3FL7A 1LJ7A 4ATFA 4P08A 1ULGA 4MADA 4QDRA 2A6ZA 1W8ZA 2G19A 1XBFA 4XC9A 2QDRA 3MIHA 1VE0A 5T54A 1ONAA 2J22A 1FV2A 3A0NA 3I3EA 3M70A 1ZRRA 5B4NA 3TEWA 2CWSA 2EVXA 4LA3A 2XDVA 3VDDC 2WZR3 1A8DA 4QPIC 5FZEA 1O4ZA 1KXGA 3ZFFA 3WG2A 4AW7A 3AFGA 4E4DX 2ZS6B 1C5IA 2HWD2 5JSOA 4P5YA 4AK3A 5EJ1B 5EYYA 3I2GA 2VW2A 3U10A 2AZ5A 4TN7A 2QQIA 3AMPA 3OBZA 1UU4A 5A6XA 3HQRA 5JDBA 4QU2A 1XE7A 3S5QA 2VO5A 4D94A 1AXYA 3WZ1A 4UOJA 1OXCA 1VBE1 4QPYA 5M0TA 1MVEA 3NNLA 5CVRA 1UD1A 5A1FA 3L9JT 5FZ0A 4LBJA 5KHKA 4XAEA 2CSGA 1SLLA 2ORZA 3ZMNA 5FCCA 4A7YA 1GFF2 4MGKE 4I01A 1UXZA 2E33A 1CONA 1YIPA 1POV0 1PO21 1QJU3 4W65A 4MHUA 3LPFA 4N7IA 1Y3TA 1CR7A 1JYCA 4I09A 1UOBA 2WNUB 3BODA 4Q29A 2CNAA 4YM0A 4CU6A 1NCQA 1VBA1 1QJY1 5C3PA 1RUNA 2K0GA 1W3XA 3VBFC 1HRV1 2A6YA 5FAXA 2A71A 2VZTA 1GP5A 2R072 2IC1A 3HMYA 2WUHA 1ND3B 3FFQA 4QXCA 1WLTA 4PQ9A 3GDBA 3OCPA 3AMHA 1NT0A 1HW5A 2W9XA 4GH4A 4PDWB 2UYAA 2PYTA 4Q4V1 4QM9A 4Y4RA 1YI7A 1IKPA 2Q0AA 4OLLA 5IT6A 3OUHA 4JQRA 5EP9A 4QDSA 4OI2A 3DYOA 4YARA 2V5DA 2E9QA 4MYEA 3AKSA 3H1WA 2HWE2 3OPWA 5FRAA 4DOUA 2ZEXA 3MV01 5LASA 1I6XA 1STMA 2KR2A 1NXD1 4KG0A 5JXHA 3H8XA 1VMJA 4WVMB 3NQHA 4MG2A 1PK6B 4Q27A 3VDDA 3JQWA 3IIIA 3KZ4C 4QX0A 4A45A 2IVJA 2VH9A 3VBSB 3LDBA 4AQTA 2D7FA 3WQ7A 2P3KA 1QNWA 2ARCA 2ZGQA 3IAPA 4QGNA 5KHJA 2ZX3A 2NLRA 4XXAA 3SCGA 5D1IA 2WDBA 2HBUA 2ZHNA 5C4WA 3ZYGA 3VBUB 4D7YA 1NUKA 2DCYA 2Q30A 2VCMA 4MXWB 4P9LA 4RFT0 3URFA 1G9BA 3EQEA 3RGBA 1WUVA 4XFAA 1OLRA 5C6CA 3POGA 5FR3A 1SBEA 1ULDA 4L92A 4OQ9A 4UW6A 1V70A 1W8TA 3KQRA 5FIXA 5LK7B 1RMU3 2P3IA 4PIYA 3OUIA 2WNVA 3FN9A 4XDPA 2JG9A 2WL1A 3FC0A 3T08A 2FCUA 2TUNA 2HWF1 2ZOEB 5LZ6A 4JTNA 5HXMA 5SV8A 2FCTA 2ZGUA 3VD3A 2IFWA 1A78A 1C8NA 4TXWA 1SLIA 1RXFA 2ORXA 1Q8QA 5EZWA 4BXFA 1PX3A 4QPWA 2XONA 3WG4A 5L7OC 3I3MA 1UYPA 2A3WA 2A75A 4CDWB 2WFPA 4KGGA 2PHTA 2A5ZA 1CJDA 1AYM3 1EV11 1OFSA 1XNAA 4BXSV 2HWB2 1MZFA 2WQZC 4HT1T 1CZSA 3VBOB 2E53A 3ZR5A 2DUQA 3IDEA 2KA3A 3ZYHA 4U2AA 2WS92 5AVPA 4UFIA 1IHMA 3IWZA 2GALA 3KV6A 1AL0G 2D93A 5FPUA 4IW3A 1WA6X 3M3EA 4XJZA 3WF3A 4LIUA 1W6PB 2WNOA 2RDRA 2ZX1A 1KDMA 1RITA 3J4UH 4CP9B 5A3PA 1LHVA 2YYOA 2VR4A 1WLDA 2GNBA 2JD9A 5L19A 5FZOA 4LBQD 3BU7A 4GKYA 4GWIA 5JI9A 2YBPA 2JECA 1LESA 5D8AB 1YWKA 4YGEA 4YW6A 1ACCA 1TG7A 1W03A 1XXNA 2DBNA 2A73B 2ZMKA 4Y5TA 3DL3A 4CTEA 1RUD1 3A0KA 1OKOA 4TTGA 4OHVA 3N7JA 4M4RA 3FJSA 3MW2A 2F6BA 3LB9A 2VZOA 3UKTA 5B2GB 4DXRA 3U75A 2J1SA 5ABJB 1YFUA 3C7OA 1H8TC 4R8HA 3N35A 2DYCA 3SCHA 3EJKA 3MUY1 5IVFA 3BALA 1QJY2 2OPWA 1ULFA 3FBMA 5LATA 1X8EA 4Q8LA 4XFFA 4DB5A 1PIV3 1A34A 5ABJC 4KH9A 2QTWB 3I59B 5GLTA 5A7WA 4DEQA 4H3WA 3ZYRA 1UZZA 1DLLA 3I8TA 3T1MA 2CHHA 3UESA 1ZM1A 1RJ8A 5FP3A 2GU9A 4OI1A 1LEDA 1IQDC 1UPSA 3O1VA 4P9IA 4MGSA 3V0BA 1KEXA 2PHUA 3PUQA 3KT1A 1UWWA 1RHI1 3HT2A 3LEIA 4CDXB 5FYUA 4ISQA 3S57A 3WDUA 3FWEA 4IEVA 1PVC2 4CRQA 5LRSA 1REEA 4KWLA 5A7QA 2W5FA 1CQ9A 1GQHA 1PMIA 3I3BA 4AQ2A 1FI2A 5DAPA 5FDBA 4IE6A 1ZA7A 3RYKA 1CIWA 1VBC3 1XU1A 3H3UA 3ALQA 3I2FA 3ES4A 2OUHA 5KXEA 4BJ0A 5I91A 1LU1A 2WRAA 2XMLA 3Q8FA 4PHZA 4UBHA 4RGGA 4WVZA 4YZ3A 3AZYA 1CWPA 1F5FA 4LQRA 4DUWA 1POV3 2Z42A 4MHRA 1TE1B 3ZYBA 4B4RA 4XUOA 4XQ4A 4WM7C 2YUEA 1R1A2 1ZRIA 3LFMA 4Q0QA 3W20A 2B7YA 2ZHMA 1JW6A 1RUE1 3N7MA 1DQ5A 3KM5A 1UX6A 5FOJB 1VRH1 1RUOA 1DYPA 3WT3A 4GWNA 3ROUA 2Q8DA 5HCHA 2HWB3 2Y38A 2R32A 4WZFA 3RZZA 4YVSA 1RUG3 1W9YA 3WF1A 2UURA 2JDZA 3PVOA 4ONUA 5FY1A 1HN1A 1KITA 1MZEA 4LBKA 5FUIA 3UV9A 2VQTA 1ZZ9A 4QPIA 3WNNA 4DY5A 1AXZA 3AZWA 4WBBA 3AJYA 4HFSA 2RE9A 3ZXFA 1VJ2A 1C8M1 2BBVA 4BLJA 4JKMA 3ES1A 1ZBE3 3R4DB 4LKEA 2C5DA 5I93A 1SBDA 4Y22A 4GJZA 4LK7A 4AVAA 1W28A 4JDNA 4SLIA 5AC93 1J3RA 4XJAA 3WINE 3C3VA 5IHRA 1VALA 2XUMA 1Y9QA 2IXJA 1AL23 2WA4A 3S6PA 3ZSKA 2GMEA 2WYFA 4XTMA 3ZN6B 3WXPA 4UFHA 1NCRA 1S2EA 3IB3A 3R4SA 1O6UA 2YC4A 4AI8A 5LCWL 1IPKA 1DQ2A 1F35A 4M3CA 2JE9A 5C8CA 2VOTA 2HWF3 4AI1A 4JQTA 2P3JA 2VMEA 4YZ1A 1EPWA 2ZX0A 4XF3A 4D3WA 4XPVA 4V2VA 4JGZC 2Y6KA 2W1SA 1J1TA 3D3AA 1YHFA 3M3IA 1XJAA 5FK8A 5G04L 2XQRA 4HKOA 5F39A 3C2UA 4UAPA 3WNMA 5K7PA 5EV7A 4CDUB 1O3TA 3VBSC 1U0AA 3ZXAC 3J7MA 4FAHA 3RQ0A 3OGGA 3ZFEC 3O1PA 4PLNA 1OQDA 1AHSA 2BNNA 1PNFA 1XRUA 4BMEA 1BCXA 1LGNA 1F4AA 1PGW2 4GH4C 5FREA 5EYXA 3VBHB 2J42A 1R093 2W87A 3AYDA 1PVC3 4NPLA 4UFKA 3FLTA 3VKNA 2Z2SB 1ND3C 3MIFA 4NE9A 4EV0A 1HX6A 4MGZE 4Q0UA 1MS9A 4WM8A 4PI0A 3SNMA 1MQTA 1QQP2 3LKJA 3WVJA 2EIBA 4PDWA 3WG3A 2JKBA 5A7WB 5JWPA 1E57A 4R9DA 2LM3A 4XETA 4CP0A 5ACA3 3APBA 1IOAA 2EXJA 2CDOA 2QZ3A 3BVCA 5CKNA 2HWB1 2QCSB 3CIHA 1F8VA 5A6ZA 1NG0A 2ZBJA 4WVWA 5A32B 5BPXA 5A6QA 3M2MA 1J59A 4YGBA 3WEZA 5HPOA 2A6WA 2G9ZA 2JENA 3WQBA 4HMZA 5KHIA 4LKSA 4H7MA 5DUWA 4D0QA 2WAOA 1VBB3 2DVAA 4TYSA 3BIWE 2RS32 3LPGA 4XHBA 2A7AA 2WQ8A 3B02A 4GWJA 4K1ZA 5C4WC 4QX8A 3IDAA 2KXLA 4OZXA 2WNUC 2ADEA 3KF3A 3N9LA 5EFUA 5JOYA 3MLJA 1D4M3 2GAUA 3PNAA 4IEWA 2I2SA 1WW5A 4XUQA 3RWKX 1JZ7A 1F4HA 1N1YA 4KU8A 4S2DA 4W6XA 5IAVA 1ND2B 3O7OA 1C4RA 2YFZA 5BNNC 2YG0A 3PU8A 4IV3B 5H9QA 3TEYA 5CFCC 4E2GA 4Q2FA 2NPIA 4XXPA 4JX0A 5GZFA 3POEA 3FHAA 5FYBA 1IG0A 5A80A 4Q8KA 1CZTA 3CMGA 2AGSA 4TLGA 3LIHA 4CU7A 3VUOA 4ATEA 1YC61 4MX3A 3SKVA 1W2OA 1MQTB 3BOWA 3CU7A 5CISA 3VBFB 3VBRA 3MHZA 5FO7B 2XJTA 1ULCA 2FMYA 5ANNA 4URAA 4EN8B 1APNA 2G9FA 2BDRA 4IXLA 1PIV1 3I49A 4JVAA 4CUGA 1I3HA 5CBLA 5IFTA 3AVSA 3UGFA 5IVVA 5EWSA 1NA1A 5L7OB 2IXLA 3PVEA 5E88A 4B4QA 4DS0A 5A70A 3WDVA 1BMV1 3CLPA 1OPMA 4P14A 4P9JA 1H2NA 1GLHA 3HWJA 3B69A 2WZEA 2JDHA 1Q8SA 1QJY3 2UY9A 3NKTA 5DDJ2 3BU0A 4FFIA 3HNBM 3LEKA 1DBNA 1BEV2 2R061 3VZMA 4D7TA 1X8MA 1OOPB 3HN1A 1YQ5A 3DCQA 1ZZ8A 3WDWA 3VD9A 1Y4WA 5T50A 4XFHA 3QD6A 1OFNA 2JB4A 4CA9A 3VDCA 2Y6LA 3ZSJA 2DDUA 1YQCA 4XEZA 4ASLA 1S0EA 5CIRA 1HXS2 1ENQA 5E1RA 1FOD1 3QH6A 5FO9B 4IV1B 4CCJA 4IE7A 1H8TA 1LULA 3OPTA 4JHTA 3GZEA 2XR4A 4OUMA 2WNUA 3AX4A 3OGVA 1UOFA 1DP0A 2YFUA 2FZ1A 4XUNA 4META 1LHUA 4PCRA 5F3GA 1E5IA 3OYWA 4JZRA 3WP4A 3JU9A 1OA3A 2CAUA 3ZSLA 3ZXJA 1S2KA 4CP1A 3GALA 2HEYF 1MS5A 4XJWA 2YU2A 2BEOA 1YFXA 4HK9A 2WFF1 4QPGC 1MZ6A 5A33B 1H30A 2BERA 4YW4A 5FWJA 4LUMA 4LKFA 1RC6A 1JZ3A 3LOBA 4IV1A 1NLRA 2B46X 4LMFA 2Y64A 5FZ9A 2RJ2A 2LROA 1KJLA 1X50A 2VVFA 3D4KA 5JXIA 3AP4A 1N47A 2Q1MA 2H0BA 3K48A 1M4WA 1LGCA 3PJYA 4L11A 5DG1A 4CPBA 3K77A 4YWAA 2BNOA 2VZVA 3WX5A 1J84A 2ZAHA 3M7AA 3WSOA 2ZXQA 1TMF3 3UT0A 4COUA 1CX4A 1OI6A 5C9AB 1VBD1 5L9RA 2LS6A 4Q26A 4Y1XA 3TEZA 2IUWA 2VZSA 4XABA 5F3EA 1IPSA 2QQWA 5LBEA 4Q4W2 4COYA 4WM7A 1WWYA 3MLLA 3H7YA 4NRMA 4Y1VA 4DXZA 1H9PA 4FQ4A 2BU9A 3K51A 4KWJA 3VBUC 5BNPA 4CCEA 3I2JA 4K21A 5DZEA 4ZU5A 5IFPA 1REFA 3QACA 4QX2A 1FOD3 2QFEA 4BDVB 3IMNA 1UIKA 5DUUA 5A3UA 5HV0A 1J83A 3W9AA 4CEYA 2PQSA 2QJVA 1OKQA 4NIAA 4FTEA 3CQOA 4JGYC 4FBFA 1NZCA 5FO8B 1KDKA 1D7PM 1VPHA 4XJUA 3ZXLA 3ZFGC 2RS11 2LW8A 5J37A 3ZM8A 4LHKA 2VTXJ 2BVVA 1AR63 1FMD1 2CGNA 3RNSA 1JU4A 1UXXX 4RS5C 3T2OA 4PF5A 3OPZA 4HPKA 2FD8A 2RR11 3N3HA 5FPLA 1CN1A 5FP8A 1VRH3 2DVGA 3B3QE 3WW2A 4R9BA 4BU2A 2X09A 3Q9OA 4FAGA 3AMNA 4QD2A 4FP3A 3BTZA 1RHI3 1WGPA 3ABZA 2GC3A 4FPHA 4QQHA 3OBAA 1K42A 3LFIA 1VBE2 4GB33 2X05A 4JRLA 2XHKA 1RJ7A 4FFGA 1G9FA 3B93A 2YBKA 2V72A 3WNOA 1UMIA 3MF9A 4PIXA 4Q4Y3 4XUTA 2VUDA 4O61A 4YG6A 1UMHA 4EWDA 5IATA 4CCMA 4R9AA 4YW7A 2VNOA 4QXHA 1LB2A 3P5BA 3V0AA 1WW4A 4QQLA 4GKXA 4BQ5A 1BMV2 1YYNA 4RD7A 1JZ5A 2HWE1 3P3NA 3F2ZA 3I2IA 2E31A 5F3IA 5ERLA 3POSA 3OGSA 1F15A 4K8FA 5F3CA 3VDAA 5C4WB 3MW3A 1AYM2 3H8OA 1DCSA 5JIAA 2OW4A 3INAA 1S55A 1PGSA 2W52A 2V5YA 2WLQA 1J58A 3NV4A 5FZHA 4GJYA 5LY1A 4WM8C 3OD0A 4MV2A 4EZ4A 4IQPA 1JZ2A 5JOXA 3AYCA 2WFF2 2ZX2A 1K5MA 1GQGA 1PX4A 4M00A 4YM3A 5CB7A 1W6MA 3JQXA 2GNMA 4KGQA 4CXXA 5JXGA 1T6GC 2Y0OA 1H4GA 1OA4A 3DXUA 4OFGA 3PURA 4CYDA 3IT8A 1UMZA 4CCLA 1LOFA 3BTAA 5IK7A 3H0OA 2HWF2 1AR91 4RHV2 4QXBA 1ENRA 2RJKA 1VAMA 2RHPA 2ADDA 4OI4A 4AG4A 1ASJ2 1LOEA 2FCVA 3OBRA 5FMDA 3HBZA 4XZUG 3WP3A 1QU0A 2DCZA 2JXAA 4AL9A 4DNYA 1PZ9A 3V0BB 1FOD2 4J25A 4LBQB 4Y33A 2Z5WA 1PGL1 1H1AA 1CGPA 1NCQC 4OUSA 3AXEA 4QU1A 5FLHA 4IEQA 2SBAA 3ZPOA 5J48A 1LOGA 2HWC3 1UZWA 2W91A 3ASIA 2W94A 3ATGA 4RQPA 2ZGPA 1WMXA 2EF6A 4Y20B 5LA2A 4BE3A 1KRIA 3ILRA 3I4IA 2W0XA 2EXHA 2B9UA 4FPEA 4IEZA 4LBMA 2JG8B 3CJIA 1YLLA 4YM2A 3VZOA 1AR62 2VMFA 4ISRA 4RR3A 4YZ4A 2GMMA 2Q1FA 4XF0A 1DHKB 4XIKA 3AKTA 4JGZB 4CEWA 2O1QA 5FZ1A 2ZACA 4RFRB 1AR93 2MEV1 3E1F1 5FPAA 2PA7A 4Q5OA 3LIGA 4CCNA 2C0ZA 4M0NA 2XJVA 2NM1A 2BOJA 3ILNA 2CU5A 2YXSA 1FV3A 4BCUA 3VZJA 3RYPA 2PTMA 2VGDA 2R1DA 3NL1A 3PU3A 4CCKA 1C3HA 1W9SA 1FNZA 2J7MA 2VNVA 4AVTA 2R0FA 4X6QB 1AVBA 3WD5A 5DN2A 4E4HA 4RR3B 3U78A 4CUCA 1QEXA 2YGLA 3E6BA 3NSTA 3OUJA 4C1XA 4TWTA 1F2NA 2ZEWA 1BJQA 3FFZA 5F5AA 3S7IA 4AFDA 3B5LB 1W0NA 2VNGA 2QDNA 1COV3 2BJSA 4FOWA 4B8EA 3OGJA 1S0JA 4ZZ8A 4EWAA 4ORFA 1GWLA 2RM22 4LORA 3GZTB 3VKMA 3ZFFB 1UYXA 5A7OA 2PELA 4W50A 3MI8A 4KBZA 3T30A 1PO13 4BHPA 1WCDJ 1SFNA 1FPN1 3DECA 3CZUA 4MO3M 1V9U2 1NLSA 3ME2A 4HVRA 4ZPIA 2YC2A 5HV4A 1ND2C 1TME2 4EYUA 4M01A 4U36A 5E16A 1KJRA 2WNVC 2ZGNA 2AH2A 5FZLA 4B7EA 5C70A 3ZLIA 1V6OA 1WD4A 1SDWA 4URTA 3NNGA 4UT5A 2CYFA 5EJZB 1S0IA 5FBJA 4B29A 2VVEA 1E5SA 4JGZA 4CEWB 3I97A 2G9GA 1DFQA 1POQA 3DYMA 4MZUA 4CDQA 2JE7A 2WR9A 5I8TA 1RUE3 2V73A 3I2DA 4B7KA 2ERFA 5FPZA 1ZYBA 1NA1B 1EPZA 4IV1C 3T2QA 3ZYFA 3SH5A 4Q4X3 3SISA 2ZTNA 1AUYA 3LOIA 3W58A 4L2NA 1UY4A 2BFUL 1SZBA 3HAGA 4QWNA 1O59A 1H6XA 1LOBA 4FXKB 1IZ3A 4DQAA 1K12A 4LBNA 3B7MA 5LRRA 5CFDB 4AEDA 1UKRA 1OOPA 5GLZA 2ENRA 5F2SA 4QM8A 3UK9A 1ZVFA 2WWJA 1RUF2 1H1MA 1HV0A 4PDWC 4AWDA 4PBOA 2WN3A 5T3NA 3V64A 2XVLA 3VD4A 2WO3A 4UF0A 2P34A 4LO4B 3QCWA 1WLCA 5LA1A 4ARYA 3P6BA 2VZUA 3POWA 2EICA 3P3PA 4MGIE 4NAMA 3T2TA 2P4EA 4X6RB 3B01A 2VPVA 1L3JA 3X29B 4AI9A 1U5YA 5HXVA 3AP7A 1H9WA 3AM2A 4QX7A 4YVWA 5H9RA 4E2QA 2HKXA 5KXCA 4N8MA 3VHRA 3FLPA 4DFSA 1R092 2V4AA 1P8JA 5DAXA 3W21A 4A6SA 2DVBA 2VC9A 4FTSA 1K5MB 5FZ8A 3BPZA 1TEIA 5DAWA 4HKLA 5IK8A 4EWEA 3N7KA 2NN8A 1AXKA 1H8VA 1UO9A 4YW2A 1MS0A 1BLZA 3T0BA 2G4IA 3KLSA 5KWRA 3L2HA 2VMIA 4BZ4A 4QKFA 3J7LA 4F7ZA 2VCCA 5T5LA 4BK4A 5BNNA 1IG3A 3BIEA 1AZDA 3WV6A 1JYNA 1XYNA 3POFA 3O1MA 3OY8A 1C1LA 2IWGB 3WY6A 4EZHA 3OTFA 5I0DA 3JB8A 2W68A 3ZXEA 1XNKA 1O4YA 2Q8OA 5JOWA 1WW6A 4RS5A 2NZ9A 3SITA 2X10A 1FYUA 2ZAAA 4E2SA 1TME3 4N53C 3E5UA 4AGGA 2D6OX 3HR9A 3KCCA 1L7LA 2QQJA 4UF0B 1AL21 3PTRB 3DGTA 5FZBA 1OH3A 1Q43A 3O0XA 5BXXA 3GCXA 3I3DA 5FQ0A 1ULOA 1PM7A 4QMAA 5JZGC 4HPKB 2Q5TA 1AYM1 1CAXA 1EV13 2GDFA 3OB8A 1RUE2 1OLME 2VQAA 3ZIXA 1JI6A 2CTVA 1WBLA 2A1XA 3G7DA 3M3OA 1JZ8A 4Q4X2 1ZZCA 4FPKA 3MGUA 5FY5A 2YC0A 4CEYB 4K6BA 4HETA 1V00A 4AI0A 4HLTA 1LU2A 2UWCA 3OYWB 3IMMA 1DQ0A 4NAOA 4IGQA 3RI9A 1O5UA 4GAZA 1HJGA 4XW3A 1Y9MA 3GCWA 1XNCA 2J1UA 3VHNA 1RUF3 4FO9A 4CDQB 3RSJA 4GA9A 1HV1A 2ZKNA 1X82A 4NIGA 5JI7A 4MH0E 1J3PA 1AR61 1Y7BA 1AX1A 1SBFA 5D2AA 1HQLA 1GKBA 5JSPA 1G9AA 2HWC2 3RZJA 1W39A 2VOKA 2AC1A 2WZR2 3RZHA 5J98B 4HZFA 3GBGA 1O3QA 4OMDA 4CDUC 1DU3D 2VL4A 1JHJA 2JB8A 4GD4A 2O8QA 3ZN4A 3S5AA 5FZGA 4RQPB 3CF6E 3BTXA 4KWKA 4B1LA 2ZKLA 4K9SA 1YRZA 5C8CC 3CL1A 2ZGTA 4N90A 2UWAA 3TNPB 2JG9C 5EJ3A 2JG8A 3CJIB 1HB2A 1Q8PA 4Q4Y2 2DV9A 3MW4A 4J1XA 1ZRFA 3HQXA 4DRVA 1COV1 5F9TA 4QQPA 3TN92 4NVPA 1GOHA 2GC2A 2DTYA 3DXTA 2ILMA 5FYCA 2WNEA 3WDYA 2GP5A 1W9WA 2D97A 4A7ZA 1GUIA 4I3GA 1RMU2 5D8AA 1G7YA 1US2A 3R0RA 2ID4A 4Y22B 2GC1A 3U37A 2OYZA 1BEV1 2OQ6A 3S0MA 5HCFA 3T4HB 2OA2A 1LHWA 3WNPA 4AFAA 3WW4A 2PN5A 3K2OA 5LBFA 3UGHA 1RUJ2 3MLKA 4FI9A 2QQUA 1SDDB 2JDKA 3VHPA 1GWMA 1K5JA 4XIOA 2PLV2 1R1A1 1VBD2 3VL8A 2R043 4I30A 4UFLA 5ACA1 1V9U3 1EV12 2WT2A 3TEXA 1KS5A 4YNIA 4LEJA 2EAAA 1F5JA 4W4ZA 3TYJA 3ETPA 4LK6A 4AQSA 2WS93 2WS91 2VXJA 3LE0A 4XMIA 2ZGKA 4J6GA 3GF6A 4FPYA 3R05A 4AHXA 4AHWA 2DFCA 2W08A 2I07B 5FXVA 1PZ7A 3ACFA 4ZS2A 1QOTA 2BBAA 1CZVA 2DVFA 5KC5A 2N7GA 1RXGA 1VBA2 4HXCA 5FP9A 2PHWA 4NOTA 3WLUA 4HANA 4AVSA 1RB8G 2CDPA 2HJIA 4XAAA 5IK5A 3V0AB 3O0VA 4H55A 1HLCA 2XH6A 4QX3A 2FBEA 1G9DA 2YZ4A 5A32A 1IPJA 3OY8B 2GNTA 5FMOL 5DG2A 5DUXA 4K1YA 3AMQA 5ANQA 4NO4A 3D82A 1N1TA 2RG4A 4OUEA 3RZGA 4AF9A 5CFCA 2JDAA 1UU5A 4NRQA 2YU1A 3N4MA 2RS12 2BW8A 1OUXA 1WCKA 1J1LA 2WO2A 2BZDA 1CAVA 1Q8OA 1VLNA 3RMYA 4MLOA 2B39A 1LOCA 4GMP1 4AQ6A 4DRRA 4MXVA 2ATFA 4INDA 3WHUA 4BQWA 4KQ7A 1OF3A 4AHZA 2J1RA 1WZXA 3AJZA 1FATA 2Q1ZB 5BNQA 4BISA 2E6VA 5APAA 3Q8AA 3NMBA 1BK1A 2X5IC 4LLOA 4XF4A 2XLGA 3ZXDA 4FFFA 5ISLA 3MIDA 4YW3A 5CFCB 1QDCA 5BV6A 4UXAA 1YJLA 4Q0SA 4JDOA 1X9PA 5IJRA 3U1XA 3WHTA 2C4XA 5CG9A 1O7FA 5C3OA 4RGAA 2WO7A 2O8OA 4H2AA 4R4ZA 5FZCA 4QQ2A 4Z2AA 4N53B 1SG3A 4RGKA 1N1VA 3D8CA 3ZYJB 3RPQA 4M3CB 2RS33 5E8AA 1NYWA 4LE4A 4XJ9A 2KM2A 2A6XA 5BY5A 4QB6A 1OUSA 1RVF1 3JBG2 1YXWA 5FPVA 3T1LA 1HKDA 2YROA 1VRBA 1IS6A 3THPA 1RUH2 5A1AA 3P1IA 4Z82A 1I1EA 2XJPA 5F8PA 1C28A 4CCDA 1BK0A 1GZWB 4XMAA 4RSUA 2UWBA 3TN91 3UYJA 1VBC1 4CU8A 5L9BA 1WCUA 3N9MA 3ZN5A 5C3RA 2I45A 1LR5A 1Q5OA 2YBSA 1DGWX 3CBNA 4LHSA 3NRUA 1DYKA 2RMU1 2ZABA 3AKRA 2XVKA 3E5XA 3OG2A 4K40A 2VTXA 4QKBA 5FY8A 3PHMA 4F8AA 3O1TA 2PAKA 1H2KA 1WKYA 4NROA 4NIDA 5GLVA 2E7TA 2W47A 3KVAA 1LOFC 5LA9A 3W59A 2WNVB 1PVXA 2VZPA 3KSCA 1IS5A 1NE6A 5LK5A 4QPGA 5F5CA 2IXIA 1XNTA 2DUPA 1JU3A 1H8TB 4UWDA 1ASJ3 5FYHA 2D5FA 3I3QA 4XQWA 2BTVC 1UCXA 1W04A 2Y6GA 3HT1A 4HG6B 1BVP1 2VZ3A 5AC91 4FT8A 3PUIA 5FOBB 4LHNA 1NAEA 2E7QA 3H1MA 1JYIA 2JD4A 1Y9GA 5FZFA 3ZN6A 4BWOA 2YGMA 2JDUA 2YPDA 2QQLA 4NUBA 1HQNA 3FZ3A 4OQ8A 1AR73 4IDZA 1QY4A 2F4PA 2IFRA 1RTVA 3HBKA 4OI0A 1PHMA 5DAQA 4AR2A 4L97A 4E8DA 1NY72 4E8CA 3OSDA 4ZXEA 1QKQA 2WO1A 3SC7X 4Q4X1 4FQZA 1EP0A 2GC0A 2IXKA 2J1TA 2B8MA 3AXDA 1RUF1 4EN7B 5J09A 2CGPA 1XYPA 2IXCA 2Q4SA 3AZXA 2ZPXA 4GZ9A 3IZOA 5DXDA 3T0DA 4X8NA 2VG9A 3FHIB 4FOVA 3GBFA 5IUQA 5FYMA 4GALA 1FT9A 3IPVB 3JD73 4PLMA 4CEYC 1W6QB 5FZDA 3PIJA 3O14A 3VKFC 4Z07A 1DIWA 4N43B 3H9AA 1U5IA 3AVRA 5F2WA 5H9SA 3ZOIA 3GBWA 5GKAC 5BYNA 4CCOA 2XL7A 3DKQA 3AYAA 4LE3A 4XYXA 4TZDA 2LTNA 1VR3A 4JTOA 3BTYA 3MPBA 4DINB 1XOYA 5EQUA 3UNPA 3O5SA 5BNOA 3B9CA 2VMCA 4AYUA 4Q4Y1 4BMBA 4JV4A 4XFBA 1PO12 1TNRA 3DUIA 2XJRA 1I9RA 3CZJA 3WW3A 1DGLA 5H9PA 4DO0A 1W6QA 4P9YA 2L9LA 1YQ2A 4C1WA 1JYWA 4OMCA 1W9FA 4NHXA 1D4M1 2QQKA 3D6EA 3HNYM 2YV8A 2JEMA 1LODA 1FPN2 1PMJX 1H2LA 3J8F1 3JUUA 2WZR1 1OURA 4HONA 1RUH1 1W6OB 2R042 4NN0A 1VAVA 1Q8VA 5CKMA 5FYVA 1PM4A 2RMU3 3RJ2X 3SH3A 4AGRA 3OF1A 2A3XA 2IZWA 2WWUA 3SHRA 4MOAA 3T09A 5K0UB 2HWD1 4XZPA 1I5PA 4ARXA 4CXYA 4CDWA 2BWCA 2VMHA 5DQ0A 2JIJA 4QXKA 2VULA 1QNYA 1H1IA 1CESA 1NZIA 1SFYA 1X36A 1RUI2 4Q1PA 1J3QA 1X7NA 5FZ7A 3VBOA 2FDGA 3ST7A 2F17A 2VQUA 3PDQA 2XUEA 1LCLA 2WA3A 5JOZA 1VAKA 4Y24A 3NO8A 2BGPA 1SQ4A 1YFWA 1CPNA 1FAYA 1OOPC 2VCAA 3KHBA 1JOBA 4EN0A 2YHJA 4IE0A 3QOPA 4A44A 1RUC1 2ARAA 1UYZA 3VBHA 1Z7S2 2XBO3 1K5MC 3EYPA 2BUKA 2XXZA 3TWIA 1QDOA 3LQCA 5FQ0B 5LEJA 4WM7B 1KFXL 1C57A 2OQ7A 3POIA 3UJOA 3I2HA 5F6KA 3O12A 3LSEA 2FZ2A 4QGMA 3USUB 2P6HA 1ZX5A 2C24A 2Z69A 2HEVF 3BKZA 4LJHA 1GZWA 1R1ZA 2WT0A 5FKBA 4FPGA 1NLQA 3BI3A 3VLBB 1QJX2 2OPKA 1H0BA 1SMVA 4MVTA 1OHFA 2MHFA 3PVBB 3FE5A 4AI3A 2GH8A 2R063 3SEPA 5AFEA 5CKQA 4G3YC 1E5RA 3E6DA 1LTEA 1OLMA 1W6NA 4AI2A 1VBB2 5CFDC 3ZXKA 2H0VA 2BWAA 3V65A 1NCRC 4ITCA 3ZKUA 3RZKA 5C8WA 4QX5A 5FUNA 4AFMA 2EIGA 2H6CA 2JE8A 3ZXGA 4SBVA 4BQ4A 2HWC1 3WW1A 1PO23 4UW5A 4QB1A 1URXA 4XDOA 4QX1A 4Y1YA 2GP3A 4DXTA 3GJBA 4P9WA 4WVMA 4A3ZA 4N9IA 3KV4A 5EXOA 3Q8BA 2DUOA 4A7KA 4CCCA 3NKGA 1W2TA 3H3LA 3AP6A 4CDWC 1BZWA 4HK8A 2VW0A 3IM0A 4X8PA 4XACA 3NV2A 4CE8A 2Y34A 5JZGA 3N9OA 4NHYA 3BN6A 2D6KA 5FMBA 2OUJA 1YUDA 2DWRA 1S0GA 2FQPA 2Y6HA 2E63A 3LCPA 2EAKA 2ZJCA 3MIGA 1JZ6A 2AENA 5J3UA 2K9ZA 4Y1ZA 1DF0A 4E27A 3S7EA 2OVUA 1SEFA 4BIFA 1G8WA 1RUI3 3B94A 3VBUA 1JUIA 2WKKA 2R071 1AX2A 4KG8A 3AC0A 1CJPA 1S0FA 3KQ4B 4D6RA 3KCXA 1RYYA 4IETA 3NV3A 1RMU1 2HBTA 2D5HA 2PFWA 3A4UA 3LZZA 4AOCA 5L36A 2FMDA 2D3PA 4BQ2A 5FMOS 1F31A 1H2MA 2VBPA 1AR81 4ET7A 4EQVA 5FPBA 2ET1A 2VUJA 2EXKA 2JJ6A 3M3CA 1E5HA 3UKVA 3WF4A 2J1EA 2XBO2 5BUVA 4AFBA 4AVCA 3KS7A 1BEV3 2AUYA 5K0UA 2YY1A 3WNXA 1OF4A 5FMCA 1AJOA 3ZVXA 2QQNA 4JAAA 1BQPA 4I0BA 1UPIA 1QIQA 1FXZA 3VHOA 1OPOA 1VMHA 2XG3A
chains in the Genus database with same CATH topology
2EICA 2WYSA 2XHNA 5DMYA 1IQDC 5CYYA 4MGSA 1KEXA 3WNKA 5CZKA 1UWWA 4M4PA 3LEIA 1P8JA 2W5FA 1LNSA 2VC9A 3I3BA 3MV11 4DEVA 3ACGA 3I2FA 3T0BA 1L7QA 4BJ0A 1EUTA 2VCCA 4BK4A 3J7HA 4DXSA 1O8PA 4LQRA 4DUWA 1JYNA 4IUGA 3HJRA 4XUOA 5C71A 2QQMA 3K4ZA 5JXJA 1GOFA 5I0DA 3I2KA 4L0PA 1JZ4A 2XQXA 5J1XA 2X10A 1GU3A 3WF1A 1HN1A 1W9TA 5FUIA 2QQJA 1NKGA 2VQTA 3WNNA 3MBWA 1UY2A 3I3DA 1ULOA 1O8SA 4P02B 4JKMA 4KWUA 3OB8A 1JI6A 4JKKA 1JZ8A 2E32A 3BGAA 1K3IA 5IHRA 2J1AA 3CDZB 3GGLA 4XURA 3IB3A 2YC4A 4MGQA 2Y8KA 4PT6A 4JHZA 5LCWL 2VOTA 3C7FA 5IYYA 2VMEA 3EB7A 2J1UA 2Y6KA 2VZ1A 2W1SA 3D3AA 5G04L 3SKJE 1KGYA 4UAPA 3WNMA 2W1UA 3K46A 2W46A 3C7HA 3MO4A 1JYXA 2ZEZA 3ACHA 5DPNA 1GNYA 1W8OA 4OMDA 2VL4A 1JHJA 1F4AA 2RV9A 2W3JA 1BHGA 4A4AA 2W87A 2Y6JA 4CUBA 2W1WA 2EIBA 3WF0A 2XOMA 3ECQA 1GOHA 3WNLA 5LA0A 1XC6A 2CDOA 1W9WA 1GUIA 3CIHA 1US2A 5JUVA 2ID4A 3HPNA 3U37A 3WEZA 5HPOA 3WQBA 4LKSA 3WNPA 5B4XA 4D0QA 2WAOA 3LPGA 3K4DA 1H6YA 2WQ8A 4FI9A 4RN5A 4GWJA 1UY0A 3IDAA 1SDDB 3K4AA 3HEIA 4XUQA 3HOBA 1JZ7A 1F4HA 1GQPA 4BK5A 2EIDA 3OEAA 2YFZA 2YG0A 4W4ZA 3ETPA 4JX0A 3FHAA 4LPLA 3LE0A 1CZTA 3CMGA 3HN3A 5G05L 4CU7A 3THCA 3SKVA 3ACFA 2BBAA 1CZVA 3C7GA 4A42A 2QBXA 3UETA 1NX9A 1CX1A 3VD5A 3GM8A 2CDPA 1R64A 1W8NA 4QX3A 1L7RA 5IFTA 4OUEA 2JDAA 1SHWB 4W8JA 2WZEA 2WO2A 1CIYA 2BZDA 4KMQA 3HNBM 3LEKA 2HLEA 2ZEYA 2OKXA 1JYVA 1OF3A 3VD9A 1GMMA 2J1RA 3FHQA 3THDA 3VDCA 2Y6LA 2DDUA 1T2XA 3W5NA 1OH4A 3K75B 1GOGA 1UZ0A 2VZQA 4KI5M 3VDBA 5IJRA 2C4XA 1ULPA 4ZY9A 3OGVA 3W5MA 4A41A 2YB7A 1DP0A 2YFUA 4XUNA 4Z2AA 3DYPA 1SG3A 4A6OA 2WN2A 1OT5A 1OD3A 4QB6A 2HYXA 2BERA 3WF2A 2WAAA 3A7QA 2C26A 3P1IA 2BGOA 2V4VA 2C9KA 5A1AA 1JZ3A 3MUZ1 3NJVA 1W99A 3LEGA 2Y64A 2B9VA 2E26A 2DCJA 2KD7A 4CU8A 2RJ2A 4OZOA 2DCKA 1UX7A 2JKXA 4LHSA 5JXIA 2RVAA 3NRUA 3OG2A 3K77A 4D8MA 2VZVA 4AAXA 1J84A 1WKYA 3WSOA 2ZXQA 3IAQA 1PMHX 2W47A 3JXSA 2LS6A 2VZSA 2J1VA 2VZPA 2W1QA 5C7GA 1XNTA 1JU3A 2Y6GA 3A23A 2VCBA 3I2JA 5IFPA 4HG6B 2VZ3A 4QX2A 3PUIA 3C8XA 1NAEA 3T2PA 4BDVB 1MPXA 1J83A 2PQSA 1WCQA 2Z4FA 3CQOA 2QQLA 3FL7A 4ZZ5A 1D7PM 4P08A 4MADA 4QDRA 2LW8A 3ZM8A 4JKLA 2WBKA 1JU4A 4E8DA 1UXXX 2J22A 3T2OA 4ZXEA 3I3EA 4E8CA 5B4NA 2WO1A 2J1TA 2VJXA 3HNMA 2X09A 4GZ9A 3ABZA 3T0DA 3OEBA 3OBAA 4P5YA 5EJ1B 1K42A 2VZRA 3I2GA 2X05A 2QQIA 4QAWA 2VO5A 2V72A 3WNOA 1UMIA 4UOJA 4XUTA 1UMHA 2ORZA 5JR2A 1UXZA 2E33A 1JZ5A 3UNPA 1K45A 3F2ZA 3I2IA 2E31A 2VMCA 3OGSA 5F7UA 2EIEA 3A22A 3CZJA 3LPFA 3VDAA 2L9LA 1YQ2A 1JYWA 4OMCA 4RYDA 4CU6A 2WABA 2QQKA 3HNYM 1JZ2A 2VZTA 1PMJX 4QB2A 1PX4A 2WUHA 2B4KA 5JXGA 3GDBA 3T09A 2W9XA 4MOAA 2WZ8A 1I5PA 4ARXA 5DQ0A 4AG4A 4QDSA 3DYOA 3A21A 2V5DA 3VD7A 4XZUG 1DYOA 2W95A 2VQUA 2ZEXA 4QDQA 3MV01 2BGPA 5JXHA 2VCAA 3NQHA 3OGRA 3IIIA 4A44A 2W91A 4QX0A 1UYZA 2W94A 5LA2A 4A45A 4CU9A 2VTFA 3EYPA 4YPJA 3IAPA 3LQCA 2VMFA 2WDBA 3I2HA 1NUKA 2VM9A 1UYYA 3E1F1 4CUAA 3T0AA 3NJXA 1W9SA 2J7MA 3FN9A 3SEPA 3T08A 5DN2A 3CKHA 4CUCA 5HXMA 2ZEWA 3VD3A 1TVGA 4TXWA 1W0NA 2ORXA 4P00B 2JE8A 4XUPA 4ZZ8A 4QB1A 5JMOA 1PX3A 4QPWA 2XONA 1US3A 4UI9L 1UYXA 4QX1A 4W50A 4DXTA 3ACIA 4A3ZA 4DUVA 3DECA 3CZUA 4MO3M 4XVHA 1UY3A 1XNAA 2YC2A 3PUHA 4BXSV 1CZSA 4DUXA 1DLCA 5C70A 3NNGA 5EJZB 3BN6A 3WF3A 3I97A 3DYMA 2W92A 2Y6HA 2VR4A 1JZ6A 2JD9A 3T2QA 4GWIA 4CVUA 5EIYB 1TG7A 4PQQA 1UY4A 1XPWA 1UY1A 4OYUA 3SEEA 1O59A 3AC0A 4TTGA 1H6XA 4M4RA 1RYYA 2VZOA 2VMDA 4DXRA 1K12A 2J1SA 3C7OA 2R7EB 4ET7A 1EUUA 2QQOA 3MUY1 4PF1A 3WF4A 2J1EA 3C7EA 3GXUA 2WN3A 4DEQA 3VD4A 1OF4A 2WO3A 2QQNA 5LA1A 4ARYA 3P6BA 3UESA 2VZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIC A;  2WYS A;  2XHN A;  5DMY A;  1IQD C;  5CYY A;  4MGS A;  1KEX A;  3WNK A;  5CZK A;  1UWW A;  4M4P A;  3LEI A;  1P8J A;  2W5F A;  1LNS A;  2VC9 A;  3I3B A;  3MV1 1;  4DEV A;  3ACG A;  3I2F A;  3T0B A;  1L7Q A;  4BJ0 A;  1EUT A;  2VCC A;  4BK4 A;  3J7H A;  4DXS A;  1O8P A;  4LQR A;  4DUW A;  1JYN A;  4IUG A;  3HJR A;  4XUO A;  5C71 A;  2QQM A;  3K4Z A;  5JXJ A;  1GOF A;  5I0D A;  3I2K A;  4L0P A;  1JZ4 A;  2XQX A;  5J1X A;  2X10 A;  1GU3 A;  3WF1 A;  1HN1 A;  1W9T A;  5FUI A;  2QQJ A;  1NKG A;  2VQT A;  3WNN A;  3MBW A;  1UY2 A;  3I3D A;  1ULO A;  1O8S A;  4P02 B;  4JKM A;  4KWU A;  3OB8 A;  1JI6 A;  4JKK A;  1JZ8 A;  2E32 A;  3BGA A;  1K3I A;  5IHR A;  2J1A A;  3CDZ B;  3GGL A;  4XUR A;  3IB3 A;  2YC4 A;  4MGQ A;  2Y8K A;  4PT6 A;  4JHZ A;  5LCW L;  2VOT A;  3C7F A;  5IYY A;  2VME A;  3EB7 A;  2J1U A;  2Y6K A;  2VZ1 A;  2W1S A;  3D3A A;  5G04 L;  3SKJ E;  1KGY A;  4UAP A;  3WNM A;  2W1U A;  3K46 A;  2W46 A;  3C7H A;  3MO4 A;  1JYX A;  2ZEZ A;  3ACH A;  5DPN A;  1GNY A;  1W8O A;  4OMD A;  2VL4 A;  1JHJ A;  1F4A A;  2RV9 A;  2W3J A;  1BHG A;  4A4A A;  2W87 A;  2Y6J A;  4CUB A;  2W1W A;  2EIB A;  3WF0 A;  2XOM A;  3ECQ A;  1GOH A;  3WNL A;  5LA0 A;  1XC6 A;  2CDO A;  1W9W A;  1GUI A;  3CIH A;  1US2 A;  5JUV A;  2ID4 A;  3HPN A;  3U37 A;  3WEZ A;  5HPO A;  3WQB A;  4LKS A;  3WNP A;  5B4X A;  4D0Q A;  2WAO A;  3LPG A;  3K4D A;  1H6Y A;  2WQ8 A;  4FI9 A;  4RN5 A;  4GWJ A;  1UY0 A;  3IDA A;  1SDD B;  3K4A A;  3HEI A;  4XUQ A;  3HOB A;  1JZ7 A;  1F4H A;  1GQP A;  4BK5 A;  2EID A;  3OEA A;  2YFZ A;  2YG0 A;  4W4Z A;  3ETP A;  4JX0 A;  3FHA A;  4LPL A;  3LE0 A;  1CZT A;  3CMG A;  3HN3 A;  5G05 L;  4CU7 A;  3THC A;  3SKV A;  3ACF A;  2BBA A;  1CZV A;  3C7G A;  4A42 A;  2QBX A;  3UET A;  1NX9 A;  1CX1 A;  3VD5 A;  3GM8 A;  2CDP A;  1R64 A;  1W8N A;  4QX3 A;  1L7R A;  5IFT A;  4OUE A;  2JDA A;  1SHW B;  4W8J A;  2WZE A;  2WO2 A;  1CIY A;  2BZD A;  4KMQ A;  3HNB M;  3LEK A;  2HLE A;  2ZEY A;  2OKX A;  1JYV A;  1OF3 A;  3VD9 A;  1GMM A;  2J1R A;  3FHQ A;  3THD A;  3VDC A;  2Y6L A;  2DDU A;  1T2X A;  3W5N A;  1OH4 A;  3K75 B;  1GOG A;  1UZ0 A;  2VZQ A;  4KI5 M;  3VDB A;  5IJR A;  2C4X A;  1ULP A;  4ZY9 A;  3OGV A;  3W5M A;  4A41 A;  2YB7 A;  1DP0 A;  2YFU A;  4XUN A;  4Z2A A;  3DYP A;  1SG3 A;  4A6O A;  2WN2 A;  1OT5 A;  1OD3 A;  4QB6 A;  2HYX A;  2BER A;  3WF2 A;  2WAA A;  3A7Q A;  2C26 A;  3P1I A;  2BGO A;  2V4V A;  2C9K A;  5A1A A;  1JZ3 A;  3MUZ 1;  3NJV A;  1W99 A;  3LEG A;  2Y64 A;  2B9V A;  2E26 A;  2DCJ A;  2KD7 A;  4CU8 A;  2RJ2 A;  4OZO A;  2DCK A;  1UX7 A;  2JKX A;  4LHS A;  5JXI A;  2RVA A;  3NRU A;  3OG2 A;  3K77 A;  4D8M A;  2VZV A;  4AAX A;  1J84 A;  1WKY A;  3WSO A;  2ZXQ A;  3IAQ A;  1PMH X;  2W47 A;  3JXS A;  2LS6 A;  2VZS A;  2J1V A;  2VZP A;  2W1Q A;  5C7G A;  1XNT A;  1JU3 A;  2Y6G A;  3A23 A;  2VCB A;  3I2J A;  5IFP A;  4HG6 B;  2VZ3 A;  4QX2 A;  3PUI A;  3C8X A;  1NAE A;  3T2P A;  4BDV B;  1MPX A;  1J83 A;  2PQS A;  1WCQ A;  2Z4F A;  3CQO A;  2QQL A;  3FL7 A;  4ZZ5 A;  1D7P M;  4P08 A;  4MAD A;  4QDR A;  2LW8 A;  3ZM8 A;  4JKL A;  2WBK A;  1JU4 A;  4E8D A;  1UXX X;  2J22 A;  3T2O A;  4ZXE A;  3I3E A;  4E8C A;  5B4N A;  2WO1 A;  2J1T A;  2VJX A;  3HNM A;  2X09 A;  4GZ9 A;  3ABZ A;  3T0D A;  3OEB A;  3OBA A;  4P5Y A;  5EJ1 B;  1K42 A;  2VZR A;  3I2G A;  2X05 A;  2QQI A;  4QAW A;  2VO5 A;  2V72 A;  3WNO A;  1UMI A;  4UOJ A;  4XUT A;  1UMH A;  2ORZ A;  5JR2 A;  1UXZ A;  2E33 A;  1JZ5 A;  3UNP A;  1K45 A;  3F2Z A;  3I2I A;  2E31 A;  2VMC A;  3OGS A;  5F7U A;  2EIE A;  3A22 A;  3CZJ A;  3LPF A;  3VDA A;  2L9L A;  1YQ2 A;  1JYW A;  4OMC A;  4RYD A;  4CU6 A;  2WAB A;  2QQK A;  3HNY M;  1JZ2 A;  2VZT A;  1PMJ X;  4QB2 A;  1PX4 A;  2WUH A;  2B4K A;  5JXG A;  3GDB A;  3T09 A;  2W9X A;  4MOA A;  2WZ8 A;  1I5P A;  4ARX A;  5DQ0 A;  4AG4 A;  4QDS A;  3DYO A;  3A21 A;  2V5D A;  3VD7 A;  4XZU G;  1DYO A;  2W95 A;  2VQU A;  2ZEX A;  4QDQ A;  3MV0 1;  2BGP A;  5JXH A;  2VCA A;  3NQH A;  3OGR A;  3III A;  4A44 A;  2W91 A;  4QX0 A;  1UYZ A;  2W94 A;  5LA2 A;  4A45 A;  4CU9 A;  2VTF A;  3EYP A;  4YPJ A;  3IAP A;  3LQC A;  2VMF A;  2WDB A;  3I2H A;  1NUK A;  2VM9 A;  1UYY A;  3E1F 1;  4CUA A;  3T0A A;  3NJX A;  1W9S A;  2J7M A;  3FN9 A;  3SEP A;  3T08 A;  5DN2 A;  3CKH A;  4CUC A;  5HXM A;  2ZEW A;  3VD3 A;  1TVG A;  4TXW A;  1W0N A;  2ORX A;  4P00 B;  2JE8 A;  4XUP A;  4ZZ8 A;  4QB1 A;  5JMO A;  1PX3 A;  4QPW A;  2XON A;  1US3 A;  4UI9 L;  1UYX A;  4QX1 A;  4W50 A;  4DXT A;  3ACI A;  4A3Z A;  4DUV A;  3DEC A;  3CZU A;  4MO3 M;  4XVH A;  1UY3 A;  1XNA A;  2YC2 A;  3PUH A;  4BXS V;  1CZS A;  4DUX A;  1DLC A;  5C70 A;  3NNG A;  5EJZ B;  3BN6 A;  3WF3 A;  3I97 A;  3DYM A;  2W92 A;  2Y6H A;  2VR4 A;  1JZ6 A;  2JD9 A;  3T2Q A;  4GWI A;  4CVU A;  5EIY B;  1TG7 A;  4PQQ A;  1UY4 A;  1XPW A;  1UY1 A;  4OYU A;  3SEE A;  1O59 A;  3AC0 A;  4TTG A;  1H6X A;  4M4R A;  1RYY A;  2VZO A;  2VMD A;  4DXR A;  1K12 A;  2J1S A;  3C7O A;  2R7E B;  4ET7 A;  1EUU A;  2QQO A;  3MUY 1;  4PF1 A;  3WF4 A;  2J1E A;  3C7E A;  3GXU A;  2WN3 A;  4DEQ A;  3VD4 A;  1OF4 A;  2WO3 A;  2QQN A;  5LA1 A;  4ARY A;  3P6B A;  3UES A;  2VZU A; 
#chains in the Genus database with same CATH topology
 1JH5 A;  1UN1 A;  2WYS A;  2XHN A;  5F6L B;  5DMY A;  4YLZ A;  1AR9 2;  4RHV 1;  2FDF A;  1TZO A;  3H3Z A;  5ABJ A;  4PI2 A;  2WIN B;  3WNK A;  1AR7 2;  2Q8C A;  2R0H A;  5CZK A;  5DZG A;  4M4P A;  1ZRC A;  2BGC A;  3DV8 A;  3J9S A;  1NCQ B;  4E4S A;  4K20 A;  4LA2 A;  3N9Q A;  4FXG B;  5T52 A;  1YQ6 A;  1V9U 1;  5FJH A;  1LNS A;  1ENS A;  1JOP A;  4UFJ A;  4R52 A;  2NQY A;  4YSF A;  3VN4 A;  4CDX C;  3BOP A;  1FMD 3;  1ODM A;  2CWM A;  3ACG A;  3FBY A;  2ET7 A;  3HVD A;  3TN9 3;  3AZV A;  5A33 A;  4LO6 B;  3E97 A;  2AEZ A;  4LO7 A;  3VBR C;  2HWD 3;  4LOS A;  1WD3 A;  4GWM A;  1EUT A;  1W3V A;  2D6P A;  4O9G A;  1XU2 A;  3RG0 A;  3J7H A;  2GH2 A;  1O8P A;  2RDS A;  4HOO A;  3R6S A;  1NQJ A;  4H14 A;  1XE8 A;  3LWC A;  1RUH 3;  4BM8 A;  5C71 A;  1JHN A;  2BVB A;  3U4X A;  3VB9 A;  2QQM A;  1GOF A;  3I2K A;  4L0P A;  4XHX A;  1JZ4 A;  2VEC A;  2VUC A;  4BQY A;  2XQX A;  2VOX A;  3OBT A;  4NMI A;  1N3P A;  3DPR C;  1W2A X;  3M8L A;  3IDB B;  4Y20 A;  1GP4 A;  1W9T A;  2IVI B;  4CZS A;  1NKG A;  2BYV E;  2FDK A;  3MBW A;  4EN6 B;  1XE0 A;  1UY2 A;  2ES3 A;  2GN3 A;  3J8F 2;  1OVP A;  1VBD 3;  1D0H A;  1O8S A;  1W0O A;  3EMR A;  4FPC A;  4P02 B;  5F32 A;  3ZR6 A;  4KWU A;  5FY9 A;  1DZQ A;  4MSV A;  1SCS A;  3VGI A;  4WVV A;  5K9Y A;  1OVS A;  4D7S A;  2C6S A;  2VUA A;  2D43 A;  3H1Y A;  4FP2 A;  1EAH 3;  4ZXK A;  1X9T A;  3PL0 A;  1AR8 3;  4OCT A;  4N7U A;  3H8R A;  4OUL A;  2Y6F A;  4AGV A;  5JIU A;  3U4S A;  2VXR A;  2J1A A;  4I2O A;  1ASJ 1;  1B35 B;  5IW0 A;  2JIG A;  2LUW A;  4UYB A;  2ETE A;  3GGL A;  4CSW A;  3AL6 A;  3MIB A;  4MGQ A;  4IGP A;  3NAP B;  4N53 A;  3C7F A;  5IYY A;  1AX0 A;  2BRT A;  2PHR A;  3EB7 A;  3O1S A;  1V6I A;  1MAC A;  4LUL A;  2SLI A;  3ENR A;  1Z0H A;  5A7S A;  3MFA A;  5FZM A;  5C5T A;  5FKC A;  3H42 B;  3FX3 A;  5FYT A;  1LHO A;  5FZ6 A;  4E4Z A;  3SKJ E;  3ZYP A;  1KGY A;  4YW1 A;  4A3X A;  2DU0 A;  4DY3 A;  2W1U A;  5FY4 A;  3K46 A;  3QBQ A;  4W6W A;  5TSW A;  2W46 A;  1LAJ A;  3C7H A;  3MO4 A;  1JYX A;  1SLB A;  1UKG A;  1HRI 3;  3ACH A;  4EN9 B;  2RS1 3;  1NCR B;  1ZZ7 A;  5DDJ 3;  1GNZ A;  5BNN B;  4S2H A;  2ZHK A;  5FY0 A;  3RJR A;  1GNY A;  1MS8 A;  4LBO A;  4M3C E;  3GZA A;  1JXN A;  3WCS A;  1GIC A;  1IKQ A;  2RV9 A;  1JTZ X;  4IEU A;  1NY7 1;  5GAL A;  1EYB A;  3VBS A;  2MNG A;  4ES9 A;  1AJK A;  2YDE A;  3NNM A;  5KBF A;  3WG1 A;  4L99 A;  4C0B A;  1CAX B;  5CNA A;  2W1W A;  2OXB A;  3LSD A;  3ZKY A;  3VBO C;  1YFY A;  2OS2 A;  2XOM A;  5FXW A;  1S0B A;  2AEY A;  5BNP B;  1XC6 A;  4AFC A;  5I0S A;  4O9E A;  3KF5 A;  1BBT 3;  1QJF A;  5JUV A;  3HPN A;  4MGY E;  1XYO A;  3J26 N;  3WQ1 A;  1JOD A;  2GSY A;  3KCY A;  1R08 3;  2XJS A;  5KHH A;  3RRD A;  3EO6 A;  3K4D A;  5T55 A;  4LOT A;  5IK4 A;  3JBG 3;  1RUG 2;  2Q8E A;  2LRP A;  1F9K A;  4NR1 A;  2R1B A;  1G6N A;  2RM2 3;  3K4A A;  2V09 A;  3GJA A;  1RGS A;  2R07 3;  2WSV A;  3HEI A;  4XDQ A;  5IVC A;  3BCW A;  3ZFG A;  5LW9 A;  1GQP A;  4BK5 A;  1DGR A;  3VKL A;  1ZBE 2;  4ZKT B;  4P9X A;  3ZFE B;  2DBI A;  4JGY B;  1OD5 A;  1WMD A;  4XBL A;  1RUC 3;  3KT4 A;  1QJU 1;  4Z2W A;  2RS3 1;  4Q0V A;  4LLF A;  1AR8 2;  4LPL A;  5GZC A;  1KQR A;  4XTP A;  3PUA A;  5G05 L;  3ITQ A;  5FP4 A;  4BOW A;  3THC A;  5IVJ A;  2GN7 A;  1C8M 2;  1Q56 A;  3D0S A;  4ZS3 A;  4EJR A;  3UET A;  1NX9 A;  4YZ2 A;  2QZ2 A;  4NWV A;  1W6P A;  3ORJ A;  1XB9 A;  4GMP 0;  1XSR A;  5JAX A;  3E6C C;  1S4C A;  2QQV A;  1R64 A;  1Z7S 1;  4ZHN A;  3OJB A;  1L7R A;  2WWS A;  1OA2 A;  1BKZ A;  4LT5 A;  1U5Z A;  1QMJ A;  4FFH A;  2P5B A;  1AYN 2;  2DVD A;  5E6H A;  3U07 A;  3USS A;  2WQ4 A;  1PGW 1;  3MEP A;  4CP2 A;  2P6C A;  1OQE A;  1HRI 2;  4W8J A;  5DAB A;  1T6B X;  4XF9 A;  1RUI 1;  2OZ6 A;  2R04 1;  3DF0 A;  4KMQ A;  1MZ5 A;  5DZF A;  2O14 A;  5I8S A;  3WOG A;  4DPN A;  4QGL A;  1HB1 A;  2ZEY A;  4IGO A;  1SLC A;  1ULE A;  1V6L A;  1V6J A;  5F37 A;  4QKD A;  1JYV A;  3AKQ A;  2ZGM A;  2VBD A;  3JCI A;  1GMM A;  3THD A;  2Y33 A;  2JDM A;  3LF7 A;  3CNA A;  4IES A;  1UZY A;  2ZGR A;  1QQP 3;  3D0J A;  4IE5 A;  4CP9 A;  3IKW A;  4Z92 B;  1T2X A;  3IIA A;  5JR7 B;  3W5N A;  1SCR A;  3M1H A;  4J1W A;  3U0Z A;  4KI5 M;  3ZDS A;  1RHI 2;  2D6M A;  4I02 A;  4FPF A;  1COV 2;  4JCK A;  4KL1 A;  4GB3 2;  1LKN A;  2X5I B;  1PO2 2;  3W5M A;  4A41 A;  2YB7 A;  4B4P A;  1PO1 1;  1B35 A;  1QOO A;  1WW7 A;  4S2F A;  1W8H A;  2XBO 1;  3MIC A;  1FMD 2;  5HCB A;  5FZI A;  1VBC 2;  4A6O A;  5FV3 A;  5K0U C;  2WN2 A;  1QJX 1;  1WLW A;  1V6K A;  5AFB A;  3EBR A;  2A6V A;  4GXL A;  2PXJ A;  1TMF 1;  4AE2 A;  1R09 1;  5A7N A;  4Q1R A;  2DF7 A;  4YG3 A;  1ZBA 1;  4GH4 B;  3LA2 A;  1I5Z A;  2WAA A;  4RQP C;  3A7Q A;  2C26 A;  2V4V A;  3FUO A;  4XCB A;  3WF2 A;  4NPM A;  4B3N A;  3MUZ 1;  1A6C A;  5C5U A;  5DDJ 1;  1W99 A;  3LEG A;  2B9V A;  2E26 A;  5FLI A;  3RFR A;  4QQO A;  4HVO A;  3KV5 A;  1RUC 2;  2HYK A;  4RL7 A;  2JKX A;  5A3O A;  4AVV A;  1R08 1;  2RVA A;  3K3O A;  2VOV A;  2FHR A;  4CDX A;  2VOW A;  3ZO0 B;  4D8M A;  2QKD A;  2VE1 A;  1JOJ A;  1RL3 A;  2XVG A;  4LO8 A;  5GZE A;  2XWB B;  3AZZ A;  4AED B;  1JYT A;  4LIV A;  5FK7 A;  1WA4 A;  1C8M 3;  3WP5 A;  4C91 A;  1BBT 1;  3R4U A;  4FCA A;  4UFM A;  2LAL A;  3VZL A;  4RHV 3;  1QGL A;  2W1Q A;  2YMZ A;  4D6Q A;  5EPA A;  1W6N B;  5AC9 2;  1VB4 A;  2O0O A;  3I59 A;  4XJ8 A;  5F1R A;  3UJQ A;  5FZK A;  3AP5 A;  1PIV 2;  2GND A;  1W06 A;  2EA7 A;  3WUD A;  2ZGL A;  2HWE 3;  3HD8 B;  1N3Q A;  1DGW A;  4XF1 A;  1HRV 2;  2ARE A;  3VL9 A;  1PVC 1;  3C8X A;  1N3O A;  4FPO B;  3T2P A;  3SLI A;  3JZV A;  4XFI A;  3B9I A;  4ES8 A;  1UIJ A;  3LA7 A;  4AZZ A;  5JSR A;  1JBC A;  4PLO A;  4QHZ A;  3CEW A;  5BNP C;  1BXH A;  1UOJ A;  4ZZ5 A;  5F7U A;  4Y1U A;  3MIE A;  4AHY A;  2JG9 B;  3KMH A;  1O91 A;  2WBK A;  1AF9 A;  4JKL A;  3UGG A;  5KXD A;  2BPA 2;  1UOG A;  1TME 1;  5T5J A;  1WBF A;  4IER A;  1SAC A;  3N9P A;  4XBQ A;  2PMW B;  3AYE A;  4Y5Z 0;  1MS1 A;  1ST8 A;  3NNJ A;  5EHD A;  1QJZ A;  1O3R A;  5FFO C;  1MEC 1;  4GUL A;  5KHG A;  2VJX A;  3HNM A;  4NHL A;  2WLP A;  5I0U A;  1HXS 3;  3ZX7 A;  2XPJ A;  2XJQ A;  2DCT A;  5L73 A;  1QJX 3;  4LKD A;  3OEB A;  1BYH A;  2PHX A;  1HN0 A;  1LEM A;  2VZR A;  5KXB A;  3G6J B;  2FDI A;  4HKW A;  4P9G A;  4QAW A;  4UW3 A;  5C9A A;  5CAD A;  4COW A;  2EAL A;  2ZA9 A;  4OHX A;  3ON7 A;  5CFD A;  3KGZ A;  3NAP A;  4WZC A;  5HI0 A;  1LGB A;  1NA1 C;  1PK6 A;  1H4H A;  2BQP A;  5LY2 A;  4LIT A;  3VZK A;  5ACA 2;  5HCA A;  2CL2 A;  2BNM A;  3POB A;  5DAV A;  5JR2 A;  1AYN 1;  4NRP A;  4ASM B;  3M3Q A;  1W2U A;  2OX0 A;  2JDP A;  4MGT A;  4N43 C;  3PTY A;  2RJL A;  5J7M A;  1K45 A;  3I7D A;  3DN7 A;  4ZON A;  1DQ6 A;  2EIE A;  2ZZJ A;  3A22 A;  3OOX A;  1W0P A;  5F5I A;  1DQ1 A;  5GLW A;  2E51 A;  2BFU S;  5LBB A;  4BLI A;  1N1S A;  5FLJ A;  4BIO A;  4RYD A;  2DU1 A;  2WAB A;  4V1P A;  1QXR A;  4K8R B;  4BH9 A;  1LOA A;  4QB2 A;  2RS5 2;  1VB2 A;  1LEC A;  4NPR A;  2ZCW A;  1GYK A;  4Q4V 2;  5A3T A;  5C8C B;  1YI9 A;  1OQ1 A;  4YVW C;  2B4K A;  2OT7 A;  2RR1 3;  2W2I A;  3PME A;  1POV 1;  3KGL A;  5AVA A;  3AB0 A;  2VW1 A;  4AEK A;  4Q4W 3;  1YQ8 A;  2VNR A;  2WZ8 A;  5FXX A;  3BUC A;  4F83 A;  4LO5 B;  4JDM A;  1AR7 1;  4LHL A;  1UF2 C;  1U12 A;  3H8U A;  4COZ A;  1RUD 3;  3MYX A;  4O7X A;  3A21 A;  3RVH A;  3VD7 A;  1DYO A;  4AEJ A;  3RWN A;  4TLF A;  4FSJ A;  2W95 A;  2FDJ A;  2PAM A;  4QDQ A;  1C5H A;  1RVF 3;  1G86 A;  3U11 A;  4YGC A;  3TOJ A;  3OGR A;  2VY0 A;  1DG6 A;  2HH9 A;  1QH6 A;  3VBR B;  4CU9 A;  1D0G A;  2VTF A;  4XCA A;  4YPJ A;  3WR0 A;  5L9V A;  4FOQ A;  4N9H A;  3T3Y A;  5FTT C;  5A1L A;  1C1F A;  3WP6 A;  1HB3 A;  3ZFE A;  1HRI 1;  5CG8 A;  2VM9 A;  1UYY A;  4IV3 A;  1VRH 2;  4Q4W 1;  2PHF A;  3CJX A;  4LBL A;  5JVV A;  2QNK A;  2PLV 1;  3NAP C;  3VZN A;  3MF6 A;  3EXU A;  2OZJ A;  3CJI C;  5T5P A;  3LDK A;  4CUA A;  4YW5 A;  1YEW A;  2WZP P;  1B09 A;  4RR3 C;  3T0A A;  4NHK A;  3O0W A;  5FY7 A;  4LTA A;  1BBT 2;  3JD7 2;  3NJX A;  4NII A;  1HDK A;  1MQT C;  2ZGO A;  3CKH A;  4QPG B;  5E89 A;  1Q3E A;  3ZSE A;  1YCI A;  3H50 A;  3IN9 A;  5A3N A;  5JLV A;  1RED A;  1TVG A;  1IS3 A;  2CGO A;  2P37 A;  2B5H A;  1UZV A;  5IVB A;  4P00 B;  5JZG B;  4XUP A;  5F5Q A;  1O5L A;  2PHD A;  3QLQ A;  1W8W A;  4YYO A;  5JMO A;  1ND2 A;  3ILF A;  3NJZ A;  5HBA A;  5KR7 A;  1US3 A;  4UI9 L;  1EAH 1;  1D4M 2;  2C9A A;  3HQU A;  2RDQ A;  2PHL A;  4JGY A;  2PLV 3;  4B1M A;  3ACI A;  3N9N A;  1S2B A;  4DUV A;  3ACL A;  1SLA A;  4XVH A;  1KD7 A;  1NXM A;  4JRA A;  1MS3 A;  1ZBE 1;  3DPR A;  1UY3 A;  1CAW B;  3PUH A;  1V6M A;  4A2U A;  3NJY A;  2TBV A;  2VVD A;  1A8M A;  4DUX A;  3AKP A;  1IQA A;  1DLC A;  4FTB A;  1FPN 3;  2NMN A;  3VBF A;  5JPN B;  1PGL 2;  2P2K A;  4Q4V 3;  1EY2 A;  3S30 A;  1WCS A;  4HN1 A;  3D5O A;  4QHO A;  1X33 A;  5J96 B;  3U14 A;  4GQ7 A;  1DDL A;  2QVS B;  2W92 A;  3MPP G;  2WSU A;  5GZD A;  3KVB A;  1YNA A;  5C3S A;  3K3N A;  1MEC 3;  4L8Q A;  2VD7 A;  4CVU A;  5EIY B;  4AED C;  2TEP A;  4PQQ A;  1XPW A;  1UY1 A;  4OYU A;  3B00 A;  1D2S A;  2RS5 1;  2XLF A;  4RS5 B;  3SEE A;  2JDN A;  2RM2 1;  3GYD A;  5LB6 A;  3I2O A;  2ZML A;  4KBB A;  2R6Q A;  2RDN A;  2VMD A;  4Y4Y A;  1RVF 2;  3JBG 1;  5D8A C;  5FYS A;  3WQ0 A;  2R7E B;  1QHD A;  1EUU A;  2QQO A;  4NWW A;  3RS6 A;  2ZMN A;  1W6M B;  4OHZ A;  4IV3 C;  4PF1 A;  5FXZ A;  1MS4 A;  1Z7S 3;  2UYB A;  2X29 A;  1WME A;  3QH7 A;  5CAZ A;  1FNY A;  3C7E A;  1GSL A;  2GMP A;  3GXU A;  2MPF A;  1JS9 A;  1HRV 3;  2K46 A;  4K7J A;  5IWF A;  4BYY A;  1CD3 G;  5I8Y A;  2E7A A;  2P3Y A;  3M4F A;  4R4X A;  2AYH A;  1GP6 A;  3ZFG B;  5D21 A;  2X53 S;  3JD7 1;  2ARX A;  3H7J A;  4NJ4 A;  3TRS B;  5CYY A;  1QF3 A;  1NOV A;  4EE2 A;  3SXW A;  4HVQ A;  1RUJ 1;  3O1R A;  1ALY A;  1NE4 A;  1ZZB A;  3RMX A;  2D3S A;  1SLT A;  1LRH A;  3NVC A;  4YVS C;  3VDD B;  3NNF A;  1PNG A;  4CXW A;  2A3Y A;  3POJ A;  5JMC A;  1V0A A;  3MV1 1;  4DEV A;  3NWK A;  4HSJ A;  4PIZ A;  1L7Q A;  5FP7 A;  5A3W A;  2B45 X;  1S0C A;  4D6S A;  1OBN A;  4DXS A;  1YJK A;  2F4L A;  5DUV A;  3EHK A;  1Y43 B;  2B42 B;  2I74 A;  1JMU B;  2R49 A;  4IUG A;  5FYY A;  3HJR A;  4DIQ A;  2BOI A;  1HB4 A;  5BNO C;  4S2G A;  1HXS 1;  3K4Z A;  5JXJ A;  5L7O A;  3TB0 A;  1JUH A;  1QH7 A;  5CEH A;  2D3R A;  5J1X A;  1GNH A;  1RUJ 3;  2D40 A;  4M3C F;  4UBG A;  4W6Y A;  4YM1 A;  3GHN A;  2CY6 A;  1RIR A;  1GU3 A;  2CAV A;  4BA6 A;  4YFZ A;  2D98 A;  3FMG A;  3ZDV A;  2UY8 A;  4FPL A;  3ZSM A;  4ZU7 A;  4C8D A;  1NQD A;  3J7N A;  4FPJ A;  4YG0 A;  4YRD A;  2Y26 A;  2G1M A;  1SPP A;  3TAY A;  4YFW A;  2R30 A;  4WM8 B;  2FDH A;  4YGD A;  4M0H A;  5LWB A;  1M06 G;  4I0W B;  3UKN A;  4V2W A;  5C9A C;  4D69 A;  4JKK A;  3PVN A;  3SQO A;  4LXL A;  2E32 A;  4UW4 A;  1S0D A;  3BGA A;  1K3I A;  4HL0 A;  2JWP A;  2EXI A;  2XGX A;  2XLA A;  1VIW B;  3CDZ B;  3WUC A;  5K8S A;  1OMI A;  3KWV A;  1TNF A;  1A3K A;  4HN0 A;  4XUR A;  4Y26 A;  3IBM A;  3ETQ A;  2Y8K A;  4PT6 A;  4JHZ A;  2AR6 A;  2JDY A;  1ND3 A;  3CHX A;  4FVV A;  4BQ1 A;  1IGO A;  4N43 A;  4BPZ A;  1QXJ A;  4L9B A;  4AEM A;  5C33 A;  1YO8 A;  4E9K A;  3SMH A;  2VU9 A;  4R9C A;  3RYR A;  4NHM A;  3PLQ A;  3THT A;  2VZ1 A;  2WJS A;  3KT7 A;  1QWR A;  2H6B A;  2ZGS A;  3JB4 C;  1CAU A;  4Q0P A;  1MR5 A;  4OVE A;  2VAU A;  4LNV A;  3TBD A;  1WMF A;  3AL5 A;  4XOG A;  2XWJ B;  2D6L X;  4BQX A;  2ZEZ A;  3T4V A;  3MZH A;  5DPN A;  2QQP A;  2IXH A;  3ZMO A;  1QJE A;  4LBQ A;  1W8O A;  5GZG A;  3DPR B;  4COV A;  3MDP A;  1XQN A;  2Y60 A;  3IPV A;  1OLQ A;  2WT1 A;  2QE3 A;  4A4A A;  4XE9 A;  3TNQ A;  2W3J A;  1BHG A;  1BVV A;  1HJF A;  2JIC A;  4GIQ A;  4QPI B;  3AMM A;  1W8F A;  4C0H A;  5IAX A;  4AVB A;  1UQX A;  1U5X A;  1W6O A;  2Y6J A;  4YZ5 A;  4CUB A;  4IE4 A;  4K3U A;  4Z1V A;  3V56 A;  2W39 A;  1ZNP A;  1W8U A;  5GJ6 A;  3AFK A;  3KD4 A;  1O4T A;  1CPM A;  3WF0 A;  4BQ3 A;  1KFU L;  3LGR A;  3ECQ A;  3WNL A;  3BPS A;  1LEN A;  2TNF A;  4GMP 3;  4CPB D;  5LA0 A;  5IVY A;  1ODN A;  4OHY A;  2ZX4 A;  2YPJ A;  1VMF A;  4O65 A;  5JPM B;  4OHW A;  1B35 C;  2VBB A;  1DZT A;  5B4X A;  1UNB A;  3GZU C;  3LD8 A;  3GNE A;  5K4L A;  1QQP 1;  4Y3O A;  5FZA A;  3RI8 A;  3ZIW A;  5CA6 A;  1W2N A;  3Q8C A;  3LEM A;  1H6Y A;  1MVQ A;  1ZZ6 A;  1S1A A;  3N36 A;  4RN5 A;  4IEP A;  3SCF A;  3IDC B;  2XKP A;  1UY0 A;  4LR4 A;  1CAU B;  1DQ4 A;  1OC1 A;  4HBN A;  1KS4 A;  3FLR A;  4C90 A;  2RS5 3;  2BP6 A;  3HOB A;  2HEW F;  5A3M A;  1HQW A;  1V6N A;  5J36 A;  3PUS A;  3PJQ A;  4PJY A;  4ASK A;  1ZBA 3;  2EID A;  1GZT A;  3NV1 A;  3OEA A;  5LBC A;  3USU A;  2R16 A;  1FX5 A;  2PAE A;  4PBP A;  1DGR N;  3F95 A;  3AK0 A;  5SV5 A;  3RZL A;  4ZU4 A;  3KV9 A;  1D4V B;  2ZHL A;  3LA3 A;  4IEY A;  4RA0 A;  4XQD A;  5FYZ A;  3O1O A;  1CAW A;  5A7P A;  3HN3 A;  2DTW A;  2MEV 2;  1TMF 2;  2CV6 A;  1AL2 2;  2D6N A;  3UL2 A;  5C3Q A;  1SFP A;  3E5Q A;  5A3L A;  1QXP A;  3C7G A;  4A42 A;  4QT6 A;  4TSV A;  1CAV B;  1W05 A;  2QBX A;  3N7L A;  4KNC A;  1CX1 A;  1GV9 A;  4IEX A;  3VD5 A;  3GM8 A;  2VMG A;  4XBN A;  1GZ9 A;  4AAP A;  4MUV A;  1W8N A;  4GB3 1;  1YIF A;  5FZ4 A;  4Y5S A;  1G9C A;  2XJU A;  2ARB A;  2NMO A;  1JN2 P;  1SHW B;  2C1F A;  1W90 A;  5FWE A;  1O3S A;  4FOY A;  4QKN A;  3LDR A;  5FYI A;  1Z78 A;  2AAC A;  1CIY A;  3POY A;  3RZM A;  1UL9 A;  2WC2 A;  2X5I A;  5FZ3 A;  4IL7 A;  2HLE A;  2UU8 A;  5JCT A;  1CVN A;  1PZ8 A;  2OKX A;  1DZR A;  3O1U A;  3FUQ A;  1PK6 C;  2A70 A;  2P17 A;  2BV4 A;  5IVE A;  3SH4 A;  3FHQ A;  1ZRD A;  2OII A;  4CEW C;  2DUR A;  2JX9 A;  2R06 2;  2D44 A;  1HIX A;  3L2Y A;  5I0T A;  4QHB A;  5FPX A;  1SPP B;  1GAN A;  1GWK A;  1OH4 A;  3K75 B;  1GOG A;  1GZC A;  3I54 A;  1UZ0 A;  2VZQ A;  5GM0 A;  5BNO B;  4I3P A;  5FZO B;  4XIL A;  5A6Y A;  1UW8 A;  3VDB A;  1VBE 3;  3WDX A;  2XKO A;  2Z79 A;  1ULP A;  2GZW A;  4HSL A;  4AXO A;  1VP6 A;  4ZY9 A;  4G9S B;  2DFB A;  4YVW B;  3LAG A;  4P5H A;  1ENX A;  3DYP A;  4NIH A;  3HIF A;  1GR3 A;  4F3J A;  3ZFF C;  2K2S A;  1OT5 A;  1R08 2;  4Z8B A;  1OD3 A;  3VV1 A;  4IEO A;  4WV8 A;  3NW4 A;  1XND A;  4H7L A;  5GLU A;  2HYX A;  2X8K A;  3WCR A;  3AP9 A;  3VBH C;  1R1A 3;  2BGO A;  1QJU 2;  2C9K A;  4XFC A;  3ZYI B;  2XB6 C;  2NP0 A;  1ZBA 2;  2P1B A;  2ZZQ A;  3NJV A;  4BB3 A;  4CDU A;  4ERO A;  3KHC A;  2DCJ A;  2XL9 A;  2KD7 A;  3CO2 A;  5KC6 A;  4OZO A;  1MEC 2;  2DCK A;  1UX7 A;  2WII B;  3BYW A;  3ELN A;  5FJK A;  5LEK A;  3BB6 A;  4DZG A;  4G4F A;  1VBB 1;  2WFF 3;  2JG8 C;  1XNB A;  2MEV 3;  3VKO A;  4AAX A;  4YVS B;  3J8F 3;  3IAQ A;  3MFC A;  1PMH X;  3ZPY A;  2QUO A;  2RR1 2;  5FBZ A;  2RMU 2;  3JXS A;  2PQQ A;  2NYY A;  4CDQ C;  1VBA 3;  4JC1 A;  2J1V A;  1D2Q A;  1RIN A;  1ZRE A;  1OSG A;  1QOS A;  1EAH 2;  1UU6 A;  5C7G A;  3KB5 A;  1GBG A;  1RUG 1;  3RDI A;  3GHM A;  1RUD 2;  3DKW A;  5FUP A;  3WDT A;  4I0A A;  2Y0I A;  3A23 A;  2VCB A;  4MXW A;  1UAI A;  1LHN A;  1IS4 A;  3PIG A;  1AYN 3;  1ZA4 A;  4KU7 A;  3PMS A;  4LUK A;  1TQ5 A;  1MPX A;  3Q8E A;  3OD4 A;  3DEM A;  5CU1 A;  5T5O A;  5I0R A;  1WCQ A;  4DMI A;  2Z4F A;  1XSQ A;  4XFG A;  2VQ0 A;  3FL7 A;  1LJ7 A;  4ATF A;  4P08 A;  1ULG A;  4MAD A;  4QDR A;  2A6Z A;  1W8Z A;  2G19 A;  1XBF A;  4XC9 A;  2QDR A;  3MIH A;  1VE0 A;  5T54 A;  1ONA A;  2J22 A;  1FV2 A;  3A0N A;  3I3E A;  3M70 A;  1ZRR A;  5B4N A;  3TEW A;  2CWS A;  2EVX A;  4LA3 A;  2XDV A;  3VDD C;  2WZR 3;  1A8D A;  4QPI C;  5FZE A;  1O4Z A;  1KXG A;  3ZFF A;  3WG2 A;  4AW7 A;  3AFG A;  4E4D X;  2ZS6 B;  1C5I A;  2HWD 2;  5JSO A;  4P5Y A;  4AK3 A;  5EJ1 B;  5EYY A;  3I2G A;  2VW2 A;  3U10 A;  2AZ5 A;  4TN7 A;  2QQI A;  3AMP A;  3OBZ A;  1UU4 A;  5A6X A;  3HQR A;  5JDB A;  4QU2 A;  1XE7 A;  3S5Q A;  2VO5 A;  4D94 A;  1AXY A;  3WZ1 A;  4UOJ A;  1OXC A;  1VBE 1;  4QPY A;  5M0T A;  1MVE A;  3NNL A;  5CVR A;  1UD1 A;  5A1F A;  3L9J T;  5FZ0 A;  4LBJ A;  5KHK A;  4XAE A;  2CSG A;  1SLL A;  2ORZ A;  3ZMN A;  5FCC A;  4A7Y A;  1GFF 2;  4MGK E;  4I01 A;  1UXZ A;  2E33 A;  1CON A;  1YIP A;  1POV 0;  1PO2 1;  1QJU 3;  4W65 A;  4MHU A;  3LPF A;  4N7I A;  1Y3T A;  1CR7 A;  1JYC A;  4I09 A;  1UOB A;  2WNU B;  3BOD A;  4Q29 A;  2CNA A;  4YM0 A;  4CU6 A;  1NCQ A;  1VBA 1;  1QJY 1;  5C3P A;  1RUN A;  2K0G A;  1W3X A;  3VBF C;  1HRV 1;  2A6Y A;  5FAX A;  2A71 A;  2VZT A;  1GP5 A;  2R07 2;  2IC1 A;  3HMY A;  2WUH A;  1ND3 B;  3FFQ A;  4QXC A;  1WLT A;  4PQ9 A;  3GDB A;  3OCP A;  3AMH A;  1NT0 A;  1HW5 A;  2W9X A;  4GH4 A;  4PDW B;  2UYA A;  2PYT A;  4Q4V 1;  4QM9 A;  4Y4R A;  1YI7 A;  1IKP A;  2Q0A A;  4OLL A;  5IT6 A;  3OUH A;  4JQR A;  5EP9 A;  4QDS A;  4OI2 A;  3DYO A;  4YAR A;  2V5D A;  2E9Q A;  4MYE A;  3AKS A;  3H1W A;  2HWE 2;  3OPW A;  5FRA A;  4DOU A;  2ZEX A;  3MV0 1;  5LAS A;  1I6X A;  1STM A;  2KR2 A;  1NXD 1;  4KG0 A;  5JXH A;  3H8X A;  1VMJ A;  4WVM B;  3NQH A;  4MG2 A;  1PK6 B;  4Q27 A;  3VDD A;  3JQW A;  3III A;  3KZ4 C;  4QX0 A;  4A45 A;  2IVJ A;  2VH9 A;  3VBS B;  3LDB A;  4AQT A;  2D7F A;  3WQ7 A;  2P3K A;  1QNW A;  2ARC A;  2ZGQ A;  3IAP A;  4QGN A;  5KHJ A;  2ZX3 A;  2NLR A;  4XXA A;  3SCG A;  5D1I A;  2WDB A;  2HBU A;  2ZHN A;  5C4W A;  3ZYG A;  3VBU B;  4D7Y A;  1NUK A;  2DCY A;  2Q30 A;  2VCM A;  4MXW B;  4P9L A;  4RFT 0;  3URF A;  1G9B A;  3EQE A;  3RGB A;  1WUV A;  4XFA A;  1OLR A;  5C6C A;  3POG A;  5FR3 A;  1SBE A;  1ULD A;  4L92 A;  4OQ9 A;  4UW6 A;  1V70 A;  1W8T A;  3KQR A;  5FIX A;  5LK7 B;  1RMU 3;  2P3I A;  4PIY A;  3OUI A;  2WNV A;  3FN9 A;  4XDP A;  2JG9 A;  2WL1 A;  3FC0 A;  3T08 A;  2FCU A;  2TUN A;  2HWF 1;  2ZOE B;  5LZ6 A;  4JTN A;  5HXM A;  5SV8 A;  2FCT A;  2ZGU A;  3VD3 A;  2IFW A;  1A78 A;  1C8N A;  4TXW A;  1SLI A;  1RXF A;  2ORX A;  1Q8Q A;  5EZW A;  4BXF A;  1PX3 A;  4QPW A;  2XON A;  3WG4 A;  5L7O C;  3I3M A;  1UYP A;  2A3W A;  2A75 A;  4CDW B;  2WFP A;  4KGG A;  2PHT A;  2A5Z A;  1CJD A;  1AYM 3;  1EV1 1;  1OFS A;  1XNA A;  4BXS V;  2HWB 2;  1MZF A;  2WQZ C;  4HT1 T;  1CZS A;  3VBO B;  2E53 A;  3ZR5 A;  2DUQ A;  3IDE A;  2KA3 A;  3ZYH A;  4U2A A;  2WS9 2;  5AVP A;  4UFI A;  1IHM A;  3IWZ A;  2GAL A;  3KV6 A;  1AL0 G;  2D93 A;  5FPU A;  4IW3 A;  1WA6 X;  3M3E A;  4XJZ A;  3WF3 A;  4LIU A;  1W6P B;  2WNO A;  2RDR A;  2ZX1 A;  1KDM A;  1RIT A;  3J4U H;  4CP9 B;  5A3P A;  1LHV A;  2YYO A;  2VR4 A;  1WLD A;  2GNB A;  2JD9 A;  5L19 A;  5FZO A;  4LBQ D;  3BU7 A;  4GKY A;  4GWI A;  5JI9 A;  2YBP A;  2JEC A;  1LES A;  5D8A B;  1YWK A;  4YGE A;  4YW6 A;  1ACC A;  1TG7 A;  1W03 A;  1XXN A;  2DBN A;  2A73 B;  2ZMK A;  4Y5T A;  3DL3 A;  4CTE A;  1RUD 1;  3A0K A;  1OKO A;  4TTG A;  4OHV A;  3N7J A;  4M4R A;  3FJS A;  3MW2 A;  2F6B A;  3LB9 A;  2VZO A;  3UKT A;  5B2G B;  4DXR A;  3U75 A;  2J1S A;  5ABJ B;  1YFU A;  3C7O A;  1H8T C;  4R8H A;  3N35 A;  2DYC A;  3SCH A;  3EJK A;  3MUY 1;  5IVF A;  3BAL A;  1QJY 2;  2OPW A;  1ULF A;  3FBM A;  5LAT A;  1X8E A;  4Q8L A;  4XFF A;  4DB5 A;  1PIV 3;  1A34 A;  5ABJ C;  4KH9 A;  2QTW B;  3I59 B;  5GLT A;  5A7W A;  4DEQ A;  4H3W A;  3ZYR A;  1UZZ A;  1DLL A;  3I8T A;  3T1M A;  2CHH A;  3UES A;  1ZM1 A;  1RJ8 A;  5FP3 A;  2GU9 A;  4OI1 A;  1LED A;  1IQD C;  1UPS A;  3O1V A;  4P9I A;  4MGS A;  3V0B A;  1KEX A;  2PHU A;  3PUQ A;  3KT1 A;  1UWW A;  1RHI 1;  3HT2 A;  3LEI A;  4CDX B;  5FYU A;  4ISQ A;  3S57 A;  3WDU A;  3FWE A;  4IEV A;  1PVC 2;  4CRQ A;  5LRS A;  1REE A;  4KWL A;  5A7Q A;  2W5F A;  1CQ9 A;  1GQH A;  1PMI A;  3I3B A;  4AQ2 A;  1FI2 A;  5DAP A;  5FDB A;  4IE6 A;  1ZA7 A;  3RYK A;  1CIW A;  1VBC 3;  1XU1 A;  3H3U A;  3ALQ A;  3I2F A;  3ES4 A;  2OUH A;  5KXE A;  4BJ0 A;  5I91 A;  1LU1 A;  2WRA A;  2XML A;  3Q8F A;  4PHZ A;  4UBH A;  4RGG A;  4WVZ A;  4YZ3 A;  3AZY A;  1CWP A;  1F5F A;  4LQR A;  4DUW A;  1POV 3;  2Z42 A;  4MHR A;  1TE1 B;  3ZYB A;  4B4R A;  4XUO A;  4XQ4 A;  4WM7 C;  2YUE A;  1R1A 2;  1ZRI A;  3LFM A;  4Q0Q A;  3W20 A;  2B7Y A;  2ZHM A;  1JW6 A;  1RUE 1;  3N7M A;  1DQ5 A;  3KM5 A;  1UX6 A;  5FOJ B;  1VRH 1;  1RUO A;  1DYP A;  3WT3 A;  4GWN A;  3ROU A;  2Q8D A;  5HCH A;  2HWB 3;  2Y38 A;  2R32 A;  4WZF A;  3RZZ A;  4YVS A;  1RUG 3;  1W9Y A;  3WF1 A;  2UUR A;  2JDZ A;  3PVO A;  4ONU A;  5FY1 A;  1HN1 A;  1KIT A;  1MZE A;  4LBK A;  5FUI A;  3UV9 A;  2VQT A;  1ZZ9 A;  4QPI A;  3WNN A;  4DY5 A;  1AXZ A;  3AZW A;  4WBB A;  3AJY A;  4HFS A;  2RE9 A;  3ZXF A;  1VJ2 A;  1C8M 1;  2BBV A;  4BLJ A;  4JKM A;  3ES1 A;  1ZBE 3;  3R4D B;  4LKE A;  2C5D A;  5I93 A;  1SBD A;  4Y22 A;  4GJZ A;  4LK7 A;  4AVA A;  1W28 A;  4JDN A;  4SLI A;  5AC9 3;  1J3R A;  4XJA A;  3WIN E;  3C3V A;  5IHR A;  1VAL A;  2XUM A;  1Y9Q A;  2IXJ A;  1AL2 3;  2WA4 A;  3S6P A;  3ZSK A;  2GME A;  2WYF A;  4XTM A;  3ZN6 B;  3WXP A;  4UFH A;  1NCR A;  1S2E A;  3IB3 A;  3R4S A;  1O6U A;  2YC4 A;  4AI8 A;  5LCW L;  1IPK A;  1DQ2 A;  1F35 A;  4M3C A;  2JE9 A;  5C8C A;  2VOT A;  2HWF 3;  4AI1 A;  4JQT A;  2P3J A;  2VME A;  4YZ1 A;  1EPW A;  2ZX0 A;  4XF3 A;  4D3W A;  4XPV A;  4V2V A;  4JGZ C;  2Y6K A;  2W1S A;  1J1T A;  3D3A A;  1YHF A;  3M3I A;  1XJA A;  5FK8 A;  5G04 L;  2XQR A;  4HKO A;  5F39 A;  3C2U A;  4UAP A;  3WNM A;  5K7P A;  5EV7 A;  4CDU B;  1O3T A;  3VBS C;  1U0A A;  3ZXA C;  3J7M A;  4FAH A;  3RQ0 A;  3OGG A;  3ZFE C;  3O1P A;  4PLN A;  1OQD A;  1AHS A;  2BNN A;  1PNF A;  1XRU A;  4BME A;  1BCX A;  1LGN A;  1F4A A;  1PGW 2;  4GH4 C;  5FRE A;  5EYX A;  3VBH B;  2J42 A;  1R09 3;  2W87 A;  3AYD A;  1PVC 3;  4NPL A;  4UFK A;  3FLT A;  3VKN A;  2Z2S B;  1ND3 C;  3MIF A;  4NE9 A;  4EV0 A;  1HX6 A;  4MGZ E;  4Q0U A;  1MS9 A;  4WM8 A;  4PI0 A;  3SNM A;  1MQT A;  1QQP 2;  3LKJ A;  3WVJ A;  2EIB A;  4PDW A;  3WG3 A;  2JKB A;  5A7W B;  5JWP A;  1E57 A;  4R9D A;  2LM3 A;  4XET A;  4CP0 A;  5ACA 3;  3APB A;  1IOA A;  2EXJ A;  2CDO A;  2QZ3 A;  3BVC A;  5CKN A;  2HWB 1;  2QCS B;  3CIH A;  1F8V A;  5A6Z A;  1NG0 A;  2ZBJ A;  4WVW A;  5A32 B;  5BPX A;  5A6Q A;  3M2M A;  1J59 A;  4YGB A;  3WEZ A;  5HPO A;  2A6W A;  2G9Z A;  2JEN A;  3WQB A;  4HMZ A;  5KHI A;  4LKS A;  4H7M A;  5DUW A;  4D0Q A;  2WAO A;  1VBB 3;  2DVA A;  4TYS A;  3BIW E;  2RS3 2;  3LPG A;  4XHB A;  2A7A A;  2WQ8 A;  3B02 A;  4GWJ A;  4K1Z A;  5C4W C;  4QX8 A;  3IDA A;  2KXL A;  4OZX A;  2WNU C;  2ADE A;  3KF3 A;  3N9L A;  5EFU A;  5JOY A;  3MLJ A;  1D4M 3;  2GAU A;  3PNA A;  4IEW A;  2I2S A;  1WW5 A;  4XUQ A;  3RWK X;  1JZ7 A;  1F4H A;  1N1Y A;  4KU8 A;  4S2D A;  4W6X A;  5IAV A;  1ND2 B;  3O7O A;  1C4R A;  2YFZ A;  5BNN C;  2YG0 A;  3PU8 A;  4IV3 B;  5H9Q A;  3TEY A;  5CFC C;  4E2G A;  4Q2F A;  2NPI A;  4XXP A;  4JX0 A;  5GZF A;  3POE A;  3FHA A;  5FYB A;  1IG0 A;  5A80 A;  4Q8K A;  1CZT A;  3CMG A;  2AGS A;  4TLG A;  3LIH A;  4CU7 A;  3VUO A;  4ATE A;  1YC6 1;  4MX3 A;  3SKV A;  1W2O A;  1MQT B;  3BOW A;  3CU7 A;  5CIS A;  3VBF B;  3VBR A;  3MHZ A;  5FO7 B;  2XJT A;  1ULC A;  2FMY A;  5ANN A;  4URA A;  4EN8 B;  1APN A;  2G9F A;  2BDR A;  4IXL A;  1PIV 1;  3I49 A;  4JVA A;  4CUG A;  1I3H A;  5CBL A;  5IFT A;  3AVS A;  3UGF A;  5IVV A;  5EWS A;  1NA1 A;  5L7O B;  2IXL A;  3PVE A;  5E88 A;  4B4Q A;  4DS0 A;  5A70 A;  3WDV A;  1BMV 1;  3CLP A;  1OPM A;  4P14 A;  4P9J A;  1H2N A;  1GLH A;  3HWJ A;  3B69 A;  2WZE A;  2JDH A;  1Q8S A;  1QJY 3;  2UY9 A;  3NKT A;  5DDJ 2;  3BU0 A;  4FFI A;  3HNB M;  3LEK A;  1DBN A;  1BEV 2;  2R06 1;  3VZM A;  4D7T A;  1X8M A;  1OOP B;  3HN1 A;  1YQ5 A;  3DCQ A;  1ZZ8 A;  3WDW A;  3VD9 A;  1Y4W A;  5T50 A;  4XFH A;  3QD6 A;  1OFN A;  2JB4 A;  4CA9 A;  3VDC A;  2Y6L A;  3ZSJ A;  2DDU A;  1YQC A;  4XEZ A;  4ASL A;  1S0E A;  5CIR A;  1HXS 2;  1ENQ A;  5E1R A;  1FOD 1;  3QH6 A;  5FO9 B;  4IV1 B;  4CCJ A;  4IE7 A;  1H8T A;  1LUL A;  3OPT A;  4JHT A;  3GZE A;  2XR4 A;  4OUM A;  2WNU A;  3AX4 A;  3OGV A;  1UOF A;  1DP0 A;  2YFU A;  2FZ1 A;  4XUN A;  4MET A;  1LHU A;  4PCR A;  5F3G A;  1E5I A;  3OYW A;  4JZR A;  3WP4 A;  3JU9 A;  1OA3 A;  2CAU A;  3ZSL A;  3ZXJ A;  1S2K A;  4CP1 A;  3GAL A;  2HEY F;  1MS5 A;  4XJW A;  2YU2 A;  2BEO A;  1YFX A;  4HK9 A;  2WFF 1;  4QPG C;  1MZ6 A;  5A33 B;  1H30 A;  2BER A;  4YW4 A;  5FWJ A;  4LUM A;  4LKF A;  1RC6 A;  1JZ3 A;  3LOB A;  4IV1 A;  1NLR A;  2B46 X;  4LMF A;  2Y64 A;  5FZ9 A;  2RJ2 A;  2LRO A;  1KJL A;  1X50 A;  2VVF A;  3D4K A;  5JXI A;  3AP4 A;  1N47 A;  2Q1M A;  2H0B A;  3K48 A;  1M4W A;  1LGC A;  3PJY A;  4L11 A;  5DG1 A;  4CPB A;  3K77 A;  4YWA A;  2BNO A;  2VZV A;  3WX5 A;  1J84 A;  2ZAH A;  3M7A A;  3WSO A;  2ZXQ A;  1TMF 3;  3UT0 A;  4COU A;  1CX4 A;  1OI6 A;  5C9A B;  1VBD 1;  5L9R A;  2LS6 A;  4Q26 A;  4Y1X A;  3TEZ A;  2IUW A;  2VZS A;  4XAB A;  5F3E A;  1IPS A;  2QQW A;  5LBE A;  4Q4W 2;  4COY A;  4WM7 A;  1WWY A;  3MLL A;  3H7Y A;  4NRM A;  4Y1V A;  4DXZ A;  1H9P A;  4FQ4 A;  2BU9 A;  3K51 A;  4KWJ A;  3VBU C;  5BNP A;  4CCE A;  3I2J A;  4K21 A;  5DZE A;  4ZU5 A;  5IFP A;  1REF A;  3QAC A;  4QX2 A;  1FOD 3;  2QFE A;  4BDV B;  3IMN A;  1UIK A;  5DUU A;  5A3U A;  5HV0 A;  1J83 A;  3W9A A;  4CEY A;  2PQS A;  2QJV A;  1OKQ A;  4NIA A;  4FTE A;  3CQO A;  4JGY C;  4FBF A;  1NZC A;  5FO8 B;  1KDK A;  1D7P M;  1VPH A;  4XJU A;  3ZXL A;  3ZFG C;  2RS1 1;  2LW8 A;  5J37 A;  3ZM8 A;  4LHK A;  2VTX J;  2BVV A;  1AR6 3;  1FMD 1;  2CGN A;  3RNS A;  1JU4 A;  1UXX X;  4RS5 C;  3T2O A;  4PF5 A;  3OPZ A;  4HPK A;  2FD8 A;  2RR1 1;  3N3H A;  5FPL A;  1CN1 A;  5FP8 A;  1VRH 3;  2DVG A;  3B3Q E;  3WW2 A;  4R9B A;  4BU2 A;  2X09 A;  3Q9O A;  4FAG A;  3AMN A;  4QD2 A;  4FP3 A;  3BTZ A;  1RHI 3;  1WGP A;  3ABZ A;  2GC3 A;  4FPH A;  4QQH A;  3OBA A;  1K42 A;  3LFI A;  1VBE 2;  4GB3 3;  2X05 A;  4JRL A;  2XHK A;  1RJ7 A;  4FFG A;  1G9F A;  3B93 A;  2YBK A;  2V72 A;  3WNO A;  1UMI A;  3MF9 A;  4PIX A;  4Q4Y 3;  4XUT A;  2VUD A;  4O61 A;  4YG6 A;  1UMH A;  4EWD A;  5IAT A;  4CCM A;  4R9A A;  4YW7 A;  2VNO A;  4QXH A;  1LB2 A;  3P5B A;  3V0A A;  1WW4 A;  4QQL A;  4GKX A;  4BQ5 A;  1BMV 2;  1YYN A;  4RD7 A;  1JZ5 A;  2HWE 1;  3P3N A;  3F2Z A;  3I2I A;  2E31 A;  5F3I A;  5ERL A;  3POS A;  3OGS A;  1F15 A;  4K8F A;  5F3C A;  3VDA A;  5C4W B;  3MW3 A;  1AYM 2;  3H8O A;  1DCS A;  5JIA A;  2OW4 A;  3INA A;  1S55 A;  1PGS A;  2W52 A;  2V5Y A;  2WLQ A;  1J58 A;  3NV4 A;  5FZH A;  4GJY A;  5LY1 A;  4WM8 C;  3OD0 A;  4MV2 A;  4EZ4 A;  4IQP A;  1JZ2 A;  5JOX A;  3AYC A;  2WFF 2;  2ZX2 A;  1K5M A;  1GQG A;  1PX4 A;  4M00 A;  4YM3 A;  5CB7 A;  1W6M A;  3JQX A;  2GNM A;  4KGQ A;  4CXX A;  5JXG A;  1T6G C;  2Y0O A;  1H4G A;  1OA4 A;  3DXU A;  4OFG A;  3PUR A;  4CYD A;  3IT8 A;  1UMZ A;  4CCL A;  1LOF A;  3BTA A;  5IK7 A;  3H0O A;  2HWF 2;  1AR9 1;  4RHV 2;  4QXB A;  1ENR A;  2RJK A;  1VAM A;  2RHP A;  2ADD A;  4OI4 A;  4AG4 A;  1ASJ 2;  1LOE A;  2FCV A;  3OBR A;  5FMD A;  3HBZ A;  4XZU G;  3WP3 A;  1QU0 A;  2DCZ A;  2JXA A;  4AL9 A;  4DNY A;  1PZ9 A;  3V0B B;  1FOD 2;  4J25 A;  4LBQ B;  4Y33 A;  2Z5W A;  1PGL 1;  1H1A A;  1CGP A;  1NCQ C;  4OUS A;  3AXE A;  4QU1 A;  5FLH A;  4IEQ A;  2SBA A;  3ZPO A;  5J48 A;  1LOG A;  2HWC 3;  1UZW A;  2W91 A;  3ASI A;  2W94 A;  3ATG A;  4RQP A;  2ZGP A;  1WMX A;  2EF6 A;  4Y20 B;  5LA2 A;  4BE3 A;  1KRI A;  3ILR A;  3I4I A;  2W0X A;  2EXH A;  2B9U A;  4FPE A;  4IEZ A;  4LBM A;  2JG8 B;  3CJI A;  1YLL A;  4YM2 A;  3VZO A;  1AR6 2;  2VMF A;  4ISR A;  4RR3 A;  4YZ4 A;  2GMM A;  2Q1F A;  4XF0 A;  1DHK B;  4XIK A;  3AKT A;  4JGZ B;  4CEW A;  2O1Q A;  5FZ1 A;  2ZAC A;  4RFR B;  1AR9 3;  2MEV 1;  3E1F 1;  5FPA A;  2PA7 A;  4Q5O A;  3LIG A;  4CCN A;  2C0Z A;  4M0N A;  2XJV A;  2NM1 A;  2BOJ A;  3ILN A;  2CU5 A;  2YXS A;  1FV3 A;  4BCU A;  3VZJ A;  3RYP A;  2PTM A;  2VGD A;  2R1D A;  3NL1 A;  3PU3 A;  4CCK A;  1C3H A;  1W9S A;  1FNZ A;  2J7M A;  2VNV A;  4AVT A;  2R0F A;  4X6Q B;  1AVB A;  3WD5 A;  5DN2 A;  4E4H A;  4RR3 B;  3U78 A;  4CUC A;  1QEX A;  2YGL A;  3E6B A;  3NST A;  3OUJ A;  4C1X A;  4TWT A;  1F2N A;  2ZEW A;  1BJQ A;  3FFZ A;  5F5A A;  3S7I A;  4AFD A;  3B5L B;  1W0N A;  2VNG A;  2QDN A;  1COV 3;  2BJS A;  4FOW A;  4B8E A;  3OGJ A;  1S0J A;  4ZZ8 A;  4EWA A;  4ORF A;  1GWL A;  2RM2 2;  4LOR A;  3GZT B;  3VKM A;  3ZFF B;  1UYX A;  5A7O A;  2PEL A;  4W50 A;  3MI8 A;  4KBZ A;  3T30 A;  1PO1 3;  4BHP A;  1WCD J;  1SFN A;  1FPN 1;  3DEC A;  3CZU A;  4MO3 M;  1V9U 2;  1NLS A;  3ME2 A;  4HVR A;  4ZPI A;  2YC2 A;  5HV4 A;  1ND2 C;  1TME 2;  4EYU A;  4M01 A;  4U36 A;  5E16 A;  1KJR A;  2WNV C;  2ZGN A;  2AH2 A;  5FZL A;  4B7E A;  5C70 A;  3ZLI A;  1V6O A;  1WD4 A;  1SDW A;  4URT A;  3NNG A;  4UT5 A;  2CYF A;  5EJZ B;  1S0I A;  5FBJ A;  4B29 A;  2VVE A;  1E5S A;  4JGZ A;  4CEW B;  3I97 A;  2G9G A;  1DFQ A;  1POQ A;  3DYM A;  4MZU A;  4CDQ A;  2JE7 A;  2WR9 A;  5I8T A;  1RUE 3;  2V73 A;  3I2D A;  4B7K A;  2ERF A;  5FPZ A;  1ZYB A;  1NA1 B;  1EPZ A;  4IV1 C;  3T2Q A;  3ZYF A;  3SH5 A;  4Q4X 3;  3SIS A;  2ZTN A;  1AUY A;  3LOI A;  3W58 A;  4L2N A;  1UY4 A;  2BFU L;  1SZB A;  3HAG A;  4QWN A;  1O59 A;  1H6X A;  1LOB A;  4FXK B;  1IZ3 A;  4DQA A;  1K12 A;  4LBN A;  3B7M A;  5LRR A;  5CFD B;  4AED A;  1UKR A;  1OOP A;  5GLZ A;  2ENR A;  5F2S A;  4QM8 A;  3UK9 A;  1ZVF A;  2WWJ A;  1RUF 2;  1H1M A;  1HV0 A;  4PDW C;  4AWD A;  4PBO A;  2WN3 A;  5T3N A;  3V64 A;  2XVL A;  3VD4 A;  2WO3 A;  4UF0 A;  2P34 A;  4LO4 B;  3QCW A;  1WLC A;  5LA1 A;  4ARY A;  3P6B A;  2VZU A;  3POW A;  2EIC A;  3P3P A;  4MGI E;  4NAM A;  3T2T A;  2P4E A;  4X6R B;  3B01 A;  2VPV A;  1L3J A;  3X29 B;  4AI9 A;  1U5Y A;  5HXV A;  3AP7 A;  1H9W A;  3AM2 A;  4QX7 A;  4YVW A;  5H9R A;  4E2Q A;  2HKX A;  5KXC A;  4N8M A;  3VHR A;  3FLP A;  4DFS A;  1R09 2;  2V4A A;  1P8J A;  5DAX A;  3W21 A;  4A6S A;  2DVB A;  2VC9 A;  4FTS A;  1K5M B;  5FZ8 A;  3BPZ A;  1TEI A;  5DAW A;  4HKL A;  5IK8 A;  4EWE A;  3N7K A;  2NN8 A;  1AXK A;  1H8V A;  1UO9 A;  4YW2 A;  1MS0 A;  1BLZ A;  3T0B A;  2G4I A;  3KLS A;  5KWR A;  3L2H A;  2VMI A;  4BZ4 A;  4QKF A;  3J7L A;  4F7Z A;  2VCC A;  5T5L A;  4BK4 A;  5BNN A;  1IG3 A;  3BIE A;  1AZD A;  3WV6 A;  1JYN A;  1XYN A;  3POF A;  3O1M A;  3OY8 A;  1C1L A;  2IWG B;  3WY6 A;  4EZH A;  3OTF A;  5I0D A;  3JB8 A;  2W68 A;  3ZXE A;  1XNK A;  1O4Y A;  2Q8O A;  5JOW A;  1WW6 A;  4RS5 A;  2NZ9 A;  3SIT A;  2X10 A;  1FYU A;  2ZAA A;  4E2S A;  1TME 3;  4N53 C;  3E5U A;  4AGG A;  2D6O X;  3HR9 A;  3KCC A;  1L7L A;  2QQJ A;  4UF0 B;  1AL2 1;  3PTR B;  3DGT A;  5FZB A;  1OH3 A;  1Q43 A;  3O0X A;  5BXX A;  3GCX A;  3I3D A;  5FQ0 A;  1ULO A;  1PM7 A;  4QMA A;  5JZG C;  4HPK B;  2Q5T A;  1AYM 1;  1CAX A;  1EV1 3;  2GDF A;  3OB8 A;  1RUE 2;  1OLM E;  2VQA A;  3ZIX A;  1JI6 A;  2CTV A;  1WBL A;  2A1X A;  3G7D A;  3M3O A;  1JZ8 A;  4Q4X 2;  1ZZC A;  4FPK A;  3MGU A;  5FY5 A;  2YC0 A;  4CEY B;  4K6B A;  4HET A;  1V00 A;  4AI0 A;  4HLT A;  1LU2 A;  2UWC A;  3OYW B;  3IMM A;  1DQ0 A;  4NAO A;  4IGQ A;  3RI9 A;  1O5U A;  4GAZ A;  1HJG A;  4XW3 A;  1Y9M A;  3GCW A;  1XNC A;  2J1U A;  3VHN A;  1RUF 3;  4FO9 A;  4CDQ B;  3RSJ A;  4GA9 A;  1HV1 A;  2ZKN A;  1X82 A;  4NIG A;  5JI7 A;  4MH0 E;  1J3P A;  1AR6 1;  1Y7B A;  1AX1 A;  1SBF A;  5D2A A;  1HQL A;  1GKB A;  5JSP A;  1G9A A;  2HWC 2;  3RZJ A;  1W39 A;  2VOK A;  2AC1 A;  2WZR 2;  3RZH A;  5J98 B;  4HZF A;  3GBG A;  1O3Q A;  4OMD A;  4CDU C;  1DU3 D;  2VL4 A;  1JHJ A;  2JB8 A;  4GD4 A;  2O8Q A;  3ZN4 A;  3S5A A;  5FZG A;  4RQP B;  3CF6 E;  3BTX A;  4KWK A;  4B1L A;  2ZKL A;  4K9S A;  1YRZ A;  5C8C C;  3CL1 A;  2ZGT A;  4N90 A;  2UWA A;  3TNP B;  2JG9 C;  5EJ3 A;  2JG8 A;  3CJI B;  1HB2 A;  1Q8P A;  4Q4Y 2;  2DV9 A;  3MW4 A;  4J1X A;  1ZRF A;  3HQX A;  4DRV A;  1COV 1;  5F9T A;  4QQP A;  3TN9 2;  4NVP A;  1GOH A;  2GC2 A;  2DTY A;  3DXT A;  2ILM A;  5FYC A;  2WNE A;  3WDY A;  2GP5 A;  1W9W A;  2D97 A;  4A7Z A;  1GUI A;  4I3G A;  1RMU 2;  5D8A A;  1G7Y A;  1US2 A;  3R0R A;  2ID4 A;  4Y22 B;  2GC1 A;  3U37 A;  2OYZ A;  1BEV 1;  2OQ6 A;  3S0M A;  5HCF A;  3T4H B;  2OA2 A;  1LHW A;  3WNP A;  4AFA A;  3WW4 A;  2PN5 A;  3K2O A;  5LBF A;  3UGH A;  1RUJ 2;  3MLK A;  4FI9 A;  2QQU A;  1SDD B;  2JDK A;  3VHP A;  1GWM A;  1K5J A;  4XIO A;  2PLV 2;  1R1A 1;  1VBD 2;  3VL8 A;  2R04 3;  4I30 A;  4UFL A;  5ACA 1;  1V9U 3;  1EV1 2;  2WT2 A;  3TEX A;  1KS5 A;  4YNI A;  4LEJ A;  2EAA A;  1F5J A;  4W4Z A;  3TYJ A;  3ETP A;  4LK6 A;  4AQS A;  2WS9 3;  2WS9 1;  2VXJ A;  3LE0 A;  4XMI A;  2ZGK A;  4J6G A;  3GF6 A;  4FPY A;  3R05 A;  4AHX A;  4AHW A;  2DFC A;  2W08 A;  2I07 B;  5FXV A;  1PZ7 A;  3ACF A;  4ZS2 A;  1QOT A;  2BBA A;  1CZV A;  2DVF A;  5KC5 A;  2N7G A;  1RXG A;  1VBA 2;  4HXC A;  5FP9 A;  2PHW A;  4NOT A;  3WLU A;  4HAN A;  4AVS A;  1RB8 G;  2CDP A;  2HJI A;  4XAA A;  5IK5 A;  3V0A B;  3O0V A;  4H55 A;  1HLC A;  2XH6 A;  4QX3 A;  2FBE A;  1G9D A;  2YZ4 A;  5A32 A;  1IPJ A;  3OY8 B;  2GNT A;  5FMO L;  5DG2 A;  5DUX A;  4K1Y A;  3AMQ A;  5ANQ A;  4NO4 A;  3D82 A;  1N1T A;  2RG4 A;  4OUE A;  3RZG A;  4AF9 A;  5CFC A;  2JDA A;  1UU5 A;  4NRQ A;  2YU1 A;  3N4M A;  2RS1 2;  2BW8 A;  1OUX A;  1WCK A;  1J1L A;  2WO2 A;  2BZD A;  1CAV A;  1Q8O A;  1VLN A;  3RMY A;  4MLO A;  2B39 A;  1LOC A;  4GMP 1;  4AQ6 A;  4DRR A;  4MXV A;  2ATF A;  4IND A;  3WHU A;  4BQW A;  4KQ7 A;  1OF3 A;  4AHZ A;  2J1R A;  1WZX A;  3AJZ A;  1FAT A;  2Q1Z B;  5BNQ A;  4BIS A;  2E6V A;  5APA A;  3Q8A A;  3NMB A;  1BK1 A;  2X5I C;  4LLO A;  4XF4 A;  2XLG A;  3ZXD A;  4FFF A;  5ISL A;  3MID A;  4YW3 A;  5CFC B;  1QDC A;  5BV6 A;  4UXA A;  1YJL A;  4Q0S A;  4JDO A;  1X9P A;  5IJR A;  3U1X A;  3WHT A;  2C4X A;  5CG9 A;  1O7F A;  5C3O A;  4RGA A;  2WO7 A;  2O8O A;  4H2A A;  4R4Z A;  5FZC A;  4QQ2 A;  4Z2A A;  4N53 B;  1SG3 A;  4RGK A;  1N1V A;  3D8C A;  3ZYJ B;  3RPQ A;  4M3C B;  2RS3 3;  5E8A A;  1NYW A;  4LE4 A;  4XJ9 A;  2KM2 A;  2A6X A;  5BY5 A;  4QB6 A;  1OUS A;  1RVF 1;  3JBG 2;  1YXW A;  5FPV A;  3T1L A;  1HKD A;  2YRO A;  1VRB A;  1IS6 A;  3THP A;  1RUH 2;  5A1A A;  3P1I A;  4Z82 A;  1I1E A;  2XJP A;  5F8P A;  1C28 A;  4CCD A;  1BK0 A;  1GZW B;  4XMA A;  4RSU A;  2UWB A;  3TN9 1;  3UYJ A;  1VBC 1;  4CU8 A;  5L9B A;  1WCU A;  3N9M A;  3ZN5 A;  5C3R A;  2I45 A;  1LR5 A;  1Q5O A;  2YBS A;  1DGW X;  3CBN A;  4LHS A;  3NRU A;  1DYK A;  2RMU 1;  2ZAB A;  3AKR A;  2XVK A;  3E5X A;  3OG2 A;  4K40 A;  2VTX A;  4QKB A;  5FY8 A;  3PHM A;  4F8A A;  3O1T A;  2PAK A;  1H2K A;  1WKY A;  4NRO A;  4NID A;  5GLV A;  2E7T A;  2W47 A;  3KVA A;  1LOF C;  5LA9 A;  3W59 A;  2WNV B;  1PVX A;  2VZP A;  3KSC A;  1IS5 A;  1NE6 A;  5LK5 A;  4QPG A;  5F5C A;  2IXI A;  1XNT A;  2DUP A;  1JU3 A;  1H8T B;  4UWD A;  1ASJ 3;  5FYH A;  2D5F A;  3I3Q A;  4XQW A;  2BTV C;  1UCX A;  1W04 A;  2Y6G A;  3HT1 A;  4HG6 B;  1BVP 1;  2VZ3 A;  5AC9 1;  4FT8 A;  3PUI A;  5FOB B;  4LHN A;  1NAE A;  2E7Q A;  3H1M A;  1JYI A;  2JD4 A;  1Y9G A;  5FZF A;  3ZN6 A;  4BWO A;  2YGM A;  2JDU A;  2YPD A;  2QQL A;  4NUB A;  1HQN A;  3FZ3 A;  4OQ8 A;  1AR7 3;  4IDZ A;  1QY4 A;  2F4P A;  2IFR A;  1RTV A;  3HBK A;  4OI0 A;  1PHM A;  5DAQ A;  4AR2 A;  4L97 A;  4E8D A;  1NY7 2;  4E8C A;  3OSD A;  4ZXE A;  1QKQ A;  2WO1 A;  3SC7 X;  4Q4X 1;  4FQZ A;  1EP0 A;  2GC0 A;  2IXK A;  2J1T A;  2B8M A;  3AXD A;  1RUF 1;  4EN7 B;  5J09 A;  2CGP A;  1XYP A;  2IXC A;  2Q4S A;  3AZX A;  2ZPX A;  4GZ9 A;  3IZO A;  5DXD A;  3T0D A;  4X8N A;  2VG9 A;  3FHI B;  4FOV A;  3GBF A;  5IUQ A;  5FYM A;  4GAL A;  1FT9 A;  3IPV B;  3JD7 3;  4PLM A;  4CEY C;  1W6Q B;  5FZD A;  3PIJ A;  3O14 A;  3VKF C;  4Z07 A;  1DIW A;  4N43 B;  3H9A A;  1U5I A;  3AVR A;  5F2W A;  5H9S A;  3ZOI A;  3GBW A;  5GKA C;  5BYN A;  4CCO A;  2XL7 A;  3DKQ A;  3AYA A;  4LE3 A;  4XYX A;  4TZD A;  2LTN A;  1VR3 A;  4JTO A;  3BTY A;  3MPB A;  4DIN B;  1XOY A;  5EQU A;  3UNP A;  3O5S A;  5BNO A;  3B9C A;  2VMC A;  4AYU A;  4Q4Y 1;  4BMB A;  4JV4 A;  4XFB A;  1PO1 2;  1TNR A;  3DUI A;  2XJR A;  1I9R A;  3CZJ A;  3WW3 A;  1DGL A;  5H9P A;  4DO0 A;  1W6Q A;  4P9Y A;  2L9L A;  1YQ2 A;  4C1W A;  1JYW A;  4OMC A;  1W9F A;  4NHX A;  1D4M 1;  2QQK A;  3D6E A;  3HNY M;  2YV8 A;  2JEM A;  1LOD A;  1FPN 2;  1PMJ X;  1H2L A;  3J8F 1;  3JUU A;  2WZR 1;  1OUR A;  4HON A;  1RUH 1;  1W6O B;  2R04 2;  4NN0 A;  1VAV A;  1Q8V A;  5CKM A;  5FYV A;  1PM4 A;  2RMU 3;  3RJ2 X;  3SH3 A;  4AGR A;  3OF1 A;  2A3X A;  2IZW A;  2WWU A;  3SHR A;  4MOA A;  3T09 A;  5K0U B;  2HWD 1;  4XZP A;  1I5P A;  4ARX A;  4CXY A;  4CDW A;  2BWC A;  2VMH A;  5DQ0 A;  2JIJ A;  4QXK A;  2VUL A;  1QNY A;  1H1I A;  1CES A;  1NZI A;  1SFY A;  1X36 A;  1RUI 2;  4Q1P A;  1J3Q A;  1X7N A;  5FZ7 A;  3VBO A;  2FDG A;  3ST7 A;  2F17 A;  2VQU A;  3PDQ A;  2XUE A;  1LCL A;  2WA3 A;  5JOZ A;  1VAK A;  4Y24 A;  3NO8 A;  2BGP A;  1SQ4 A;  1YFW A;  1CPN A;  1FAY A;  1OOP C;  2VCA A;  3KHB A;  1JOB A;  4EN0 A;  2YHJ A;  4IE0 A;  3QOP A;  4A44 A;  1RUC 1;  2ARA A;  1UYZ A;  3VBH A;  1Z7S 2;  2XBO 3;  1K5M C;  3EYP A;  2BUK A;  2XXZ A;  3TWI A;  1QDO A;  3LQC A;  5FQ0 B;  5LEJ A;  4WM7 B;  1KFX L;  1C57 A;  2OQ7 A;  3POI A;  3UJO A;  3I2H A;  5F6K A;  3O12 A;  3LSE A;  2FZ2 A;  4QGM A;  3USU B;  2P6H A;  1ZX5 A;  2C24 A;  2Z69 A;  2HEV F;  3BKZ A;  4LJH A;  1GZW A;  1R1Z A;  2WT0 A;  5FKB A;  4FPG A;  1NLQ A;  3BI3 A;  3VLB B;  1QJX 2;  2OPK A;  1H0B A;  1SMV A;  4MVT A;  1OHF A;  2MHF A;  3PVB B;  3FE5 A;  4AI3 A;  2GH8 A;  2R06 3;  3SEP A;  5AFE A;  5CKQ A;  4G3Y C;  1E5R A;  3E6D A;  1LTE A;  1OLM A;  1W6N A;  4AI2 A;  1VBB 2;  5CFD C;  3ZXK A;  2H0V A;  2BWA A;  3V65 A;  1NCR C;  4ITC A;  3ZKU A;  3RZK A;  5C8W A;  4QX5 A;  5FUN A;  4AFM A;  2EIG A;  2H6C A;  2JE8 A;  3ZXG A;  4SBV A;  4BQ4 A;  2HWC 1;  3WW1 A;  1PO2 3;  4UW5 A;  4QB1 A;  1URX A;  4XDO A;  4QX1 A;  4Y1Y A;  2GP3 A;  4DXT A;  3GJB A;  4P9W A;  4WVM A;  4A3Z A;  4N9I A;  3KV4 A;  5EXO A;  3Q8B A;  2DUO A;  4A7K A;  4CCC A;  3NKG A;  1W2T A;  3H3L A;  3AP6 A;  4CDW C;  1BZW A;  4HK8 A;  2VW0 A;  3IM0 A;  4X8P A;  4XAC A;  3NV2 A;  4CE8 A;  2Y34 A;  5JZG A;  3N9O A;  4NHY A;  3BN6 A;  2D6K A;  5FMB A;  2OUJ A;  1YUD A;  2DWR A;  1S0G A;  2FQP A;  2Y6H A;  2E63 A;  3LCP A;  2EAK A;  2ZJC A;  3MIG A;  1JZ6 A;  2AEN A;  5J3U A;  2K9Z A;  4Y1Z A;  1DF0 A;  4E27 A;  3S7E A;  2OVU A;  1SEF A;  4BIF A;  1G8W A;  1RUI 3;  3B94 A;  3VBU A;  1JUI A;  2WKK A;  2R07 1;  1AX2 A;  4KG8 A;  3AC0 A;  1CJP A;  1S0F A;  3KQ4 B;  4D6R A;  3KCX A;  1RYY A;  4IET A;  3NV3 A;  1RMU 1;  2HBT A;  2D5H A;  2PFW A;  3A4U A;  3LZZ A;  4AOC A;  5L36 A;  2FMD A;  2D3P A;  4BQ2 A;  5FMO S;  1F31 A;  1H2M A;  2VBP A;  1AR8 1;  4ET7 A;  4EQV A;  5FPB A;  2ET1 A;  2VUJ A;  2EXK A;  2JJ6 A;  3M3C A;  1E5H A;  3UKV A;  3WF4 A;  2J1E A;  2XBO 2;  5BUV A;  4AFB A;  4AVC A;  3KS7 A;  1BEV 3;  2AUY A;  5K0U A;  2YY1 A;  3WNX A;  1OF4 A;  5FMC A;  1AJO A;  3ZVX A;  2QQN A;  4JAA A;  1BQP A;  4I0B A;  1UPI A;  1QIQ A;  1FXZ A;  3VHO A;  1OPO A;  1VMH A;  2XG3 A; 
#chains in the Genus database with same CATH homology
 2EIC A;  2WYS A;  2XHN A;  5DMY A;  1IQD C;  5CYY A;  4MGS A;  1KEX A;  3WNK A;  5CZK A;  1UWW A;  4M4P A;  3LEI A;  1P8J A;  2W5F A;  1LNS A;  2VC9 A;  3I3B A;  3MV1 1;  4DEV A;  3ACG A;  3I2F A;  3T0B A;  1L7Q A;  4BJ0 A;  1EUT A;  2VCC A;  4BK4 A;  3J7H A;  4DXS A;  1O8P A;  4LQR A;  4DUW A;  1JYN A;  4IUG A;  3HJR A;  4XUO A;  5C71 A;  2QQM A;  3K4Z A;  5JXJ A;  1GOF A;  5I0D A;  3I2K A;  4L0P A;  1JZ4 A;  2XQX A;  5J1X A;  2X10 A;  1GU3 A;  3WF1 A;  1HN1 A;  1W9T A;  5FUI A;  2QQJ A;  1NKG A;  2VQT A;  3WNN A;  3MBW A;  1UY2 A;  3I3D A;  1ULO A;  1O8S A;  4P02 B;  4JKM A;  4KWU A;  3OB8 A;  1JI6 A;  4JKK A;  1JZ8 A;  2E32 A;  3BGA A;  1K3I A;  5IHR A;  2J1A A;  3CDZ B;  3GGL A;  4XUR A;  3IB3 A;  2YC4 A;  4MGQ A;  2Y8K A;  4PT6 A;  4JHZ A;  5LCW L;  2VOT A;  3C7F A;  5IYY A;  2VME A;  3EB7 A;  2J1U A;  2Y6K A;  2VZ1 A;  2W1S A;  3D3A A;  5G04 L;  3SKJ E;  1KGY A;  4UAP A;  3WNM A;  2W1U A;  3K46 A;  2W46 A;  3C7H A;  3MO4 A;  1JYX A;  2ZEZ A;  3ACH A;  5DPN A;  1GNY A;  1W8O A;  4OMD A;  2VL4 A;  1JHJ A;  1F4A A;  2RV9 A;  2W3J A;  1BHG A;  4A4A A;  2W87 A;  2Y6J A;  4CUB A;  2W1W A;  2EIB A;  3WF0 A;  2XOM A;  3ECQ A;  1GOH A;  3WNL A;  5LA0 A;  1XC6 A;  2CDO A;  1W9W A;  1GUI A;  3CIH A;  1US2 A;  5JUV A;  2ID4 A;  3HPN A;  3U37 A;  3WEZ A;  5HPO A;  3WQB A;  4LKS A;  3WNP A;  5B4X A;  4D0Q A;  2WAO A;  3LPG A;  3K4D A;  1H6Y A;  2WQ8 A;  4FI9 A;  4RN5 A;  4GWJ A;  1UY0 A;  3IDA A;  1SDD B;  3K4A A;  3HEI A;  4XUQ A;  3HOB A;  1JZ7 A;  1F4H A;  1GQP A;  4BK5 A;  2EID A;  3OEA A;  2YFZ A;  2YG0 A;  4W4Z A;  3ETP A;  4JX0 A;  3FHA A;  4LPL A;  3LE0 A;  1CZT A;  3CMG A;  3HN3 A;  5G05 L;  4CU7 A;  3THC A;  3SKV A;  3ACF A;  2BBA A;  1CZV A;  3C7G A;  4A42 A;  2QBX A;  3UET A;  1NX9 A;  1CX1 A;  3VD5 A;  3GM8 A;  2CDP A;  1R64 A;  1W8N A;  4QX3 A;  1L7R A;  5IFT A;  4OUE A;  2JDA A;  1SHW B;  4W8J A;  2WZE A;  2WO2 A;  1CIY A;  2BZD A;  4KMQ A;  3HNB M;  3LEK A;  2HLE A;  2ZEY A;  2OKX A;  1JYV A;  1OF3 A;  3VD9 A;  1GMM A;  2J1R A;  3FHQ A;  3THD A;  3VDC A;  2Y6L A;  2DDU A;  1T2X A;  3W5N A;  1OH4 A;  3K75 B;  1GOG A;  1UZ0 A;  2VZQ A;  4KI5 M;  3VDB A;  5IJR A;  2C4X A;  1ULP A;  4ZY9 A;  3OGV A;  3W5M A;  4A41 A;  2YB7 A;  1DP0 A;  2YFU A;  4XUN A;  4Z2A A;  3DYP A;  1SG3 A;  4A6O A;  2WN2 A;  1OT5 A;  1OD3 A;  4QB6 A;  2HYX A;  2BER A;  3WF2 A;  2WAA A;  3A7Q A;  2C26 A;  3P1I A;  2BGO A;  2V4V A;  2C9K A;  5A1A A;  1JZ3 A;  3MUZ 1;  3NJV A;  1W99 A;  3LEG A;  2Y64 A;  2B9V A;  2E26 A;  2DCJ A;  2KD7 A;  4CU8 A;  2RJ2 A;  4OZO A;  2DCK A;  1UX7 A;  2JKX A;  4LHS A;  5JXI A;  2RVA A;  3NRU A;  3OG2 A;  3K77 A;  4D8M A;  2VZV A;  4AAX A;  1J84 A;  1WKY A;  3WSO A;  2ZXQ A;  3IAQ A;  1PMH X;  2W47 A;  3JXS A;  2LS6 A;  2VZS A;  2J1V A;  2VZP A;  2W1Q A;  5C7G A;  1XNT A;  1JU3 A;  2Y6G A;  3A23 A;  2VCB A;  3I2J A;  5IFP A;  4HG6 B;  2VZ3 A;  4QX2 A;  3PUI A;  3C8X A;  1NAE A;  3T2P A;  4BDV B;  1MPX A;  1J83 A;  2PQS A;  1WCQ A;  2Z4F A;  3CQO A;  2QQL A;  3FL7 A;  4ZZ5 A;  1D7P M;  4P08 A;  4MAD A;  4QDR A;  2LW8 A;  3ZM8 A;  4JKL A;  2WBK A;  1JU4 A;  4E8D A;  1UXX X;  2J22 A;  3T2O A;  4ZXE A;  3I3E A;  4E8C A;  5B4N A;  2WO1 A;  2J1T A;  2VJX A;  3HNM A;  2X09 A;  4GZ9 A;  3ABZ A;  3T0D A;  3OEB A;  3OBA A;  4P5Y A;  5EJ1 B;  1K42 A;  2VZR A;  3I2G A;  2X05 A;  2QQI A;  4QAW A;  2VO5 A;  2V72 A;  3WNO A;  1UMI A;  4UOJ A;  4XUT A;  1UMH A;  2ORZ A;  5JR2 A;  1UXZ A;  2E33 A;  1JZ5 A;  3UNP A;  1K45 A;  3F2Z A;  3I2I A;  2E31 A;  2VMC A;  3OGS A;  5F7U A;  2EIE A;  3A22 A;  3CZJ A;  3LPF A;  3VDA A;  2L9L A;  1YQ2 A;  1JYW A;  4OMC A;  4RYD A;  4CU6 A;  2WAB A;  2QQK A;  3HNY M;  1JZ2 A;  2VZT A;  1PMJ X;  4QB2 A;  1PX4 A;  2WUH A;  2B4K A;  5JXG A;  3GDB A;  3T09 A;  2W9X A;  4MOA A;  2WZ8 A;  1I5P A;  4ARX A;  5DQ0 A;  4AG4 A;  4QDS A;  3DYO A;  3A21 A;  2V5D A;  3VD7 A;  4XZU G;  1DYO A;  2W95 A;  2VQU A;  2ZEX A;  4QDQ A;  3MV0 1;  2BGP A;  5JXH A;  2VCA A;  3NQH A;  3OGR A;  3III A;  4A44 A;  2W91 A;  4QX0 A;  1UYZ A;  2W94 A;  5LA2 A;  4A45 A;  4CU9 A;  2VTF A;  3EYP A;  4YPJ A;  3IAP A;  3LQC A;  2VMF A;  2WDB A;  3I2H A;  1NUK A;  2VM9 A;  1UYY A;  3E1F 1;  4CUA A;  3T0A A;  3NJX A;  1W9S A;  2J7M A;  3FN9 A;  3SEP A;  3T08 A;  5DN2 A;  3CKH A;  4CUC A;  5HXM A;  2ZEW A;  3VD3 A;  1TVG A;  4TXW A;  1W0N A;  2ORX A;  4P00 B;  2JE8 A;  4XUP A;  4ZZ8 A;  4QB1 A;  5JMO A;  1PX3 A;  4QPW A;  2XON A;  1US3 A;  4UI9 L;  1UYX A;  4QX1 A;  4W50 A;  4DXT A;  3ACI A;  4A3Z A;  4DUV A;  3DEC A;  3CZU A;  4MO3 M;  4XVH A;  1UY3 A;  1XNA A;  2YC2 A;  3PUH A;  4BXS V;  1CZS A;  4DUX A;  1DLC A;  5C70 A;  3NNG A;  5EJZ B;  3BN6 A;  3WF3 A;  3I97 A;  3DYM A;  2W92 A;  2Y6H A;  2VR4 A;  1JZ6 A;  2JD9 A;  3T2Q A;  4GWI A;  4CVU A;  5EIY B;  1TG7 A;  4PQQ A;  1UY4 A;  1XPW A;  1UY1 A;  4OYU A;  3SEE A;  1O59 A;  3AC0 A;  4TTG A;  1H6X A;  4M4R A;  1RYY A;  2VZO A;  2VMD A;  4DXR A;  1K12 A;  2J1S A;  3C7O A;  2R7E B;  4ET7 A;  1EUU A;  2QQO A;  3MUY 1;  4PF1 A;  3WF4 A;  2J1E A;  3C7E A;  3GXU A;  2WN3 A;  4DEQ A;  3VD4 A;  1OF4 A;  2WO3 A;  2QQN A;  5LA1 A;  4ARY A;  3P6B A;  3UES A;  2VZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...