1UY2A

Binding sub-site dissection of a family 6 carbohydrate-binding module by x-ray crystallography and isothermal titration calorimetry
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
131
structure length
131
Chain Sequence
SPIRRDAFSIIEAEEYNSTNSSTLQVIGTPNNGRGIGYIENGNTVTYSNIDFGSGATGFSATVATEVNTSIQIRSDSPTGTLLGTLYVSSTGSWNTYNTVSTNISKITGVHDIVLVFSGPVNVDNFIFSRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE A
publication title Binding Sub-Site Dissection of a Carbohydrate-Binding Module Reveals the Contribution of Entropy to Oligosaccharide Recognition at "Non-Primary" Binding Subsites.
pubmed doi rcsb
source organism Clostridium stercorarium
molecule tags Carbohydrate-binding module
total genus 32
structure length 131
sequence length 131
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2004-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uy2A00
1WKYA 4UI9L 5IFTA 1JYWA 2W47A 2WDBA 1BHGA 2EICA 2DCJA 1L7QA 3CZJA 2Y6JA 4JKMA 3WNNA 2ZEXA 3NJVA 3ECQA 3SEEA 2X09A 2EIEA 2J1TA 1O8PA 2J1AA 4BJ0A 4IUGA 4XVHA 4RYDA 2YG0A 3WF4A 3ACGA 3OGSA 3OGVA 1UYXA 4QX1A 2W1SA 4D8MA 3I3DA 3ZM8A 2Y6LA 1O59A 3E1F1 5IFPA 2WZ8A 4KMQA 1CIYA 3VD7A 5JXIA 2ZEZA 2W9XA 4OYUA 3I2JA 2JD9A 4UOJA 4GWJA 3LE0A 1O8SA 4ZZ8A 3T08A 3WNPA 2VR4A 1J84A 1JZ2A 3I2HA 1TG7A 2VJXA 3EB7A 4AG4A 3HPNA 3MUZ1 4A3ZA 1UY3A 2WUHA 4P5YA 3HEIA 1JZ4A 1K12A 2VO5A 4QB6A 4QX2A 3UETA 2ZEYA 3C7OA 3GDBA 4AAXA 2YFZA 1SG3A 3NNGA 4QDQA 3OEAA 3I2GA 3UESA 3T09A 3T0AA 3GM8A 3FL7A 2Y6GA 1W9WA 2W1QA 3BGAA 1EUTA 3P6BA 2B4KA 1GU3A 4DUXA 2BERA 4TXWA 3W5NA 5HPOA 1F4HA 3DYMA 3VDBA 3IAPA 3HNBM 4MO3M 3HOBA 3WNLA 1CX1A 2WO2A 2QQOA 4ARXA 3LPGA 4OUEA 3OEBA 1TVGA 4XURA 2Y6HA 2Y6KA 2OKXA 2W94A 2Y8KA 3HJRA 3HNYM 1UYYA 1UXXX 4KWUA 2J1SA 4QAWA 2E26A 2ZEWA 1PX4A 3K4DA 4KI5M 4XUQA 3WQBA 2QQKA 3ETPA 1GNYA 5EIYB 2QBXA 3I97A 3WF2A 4DXSA 4CU8A 2KD7A 4A4AA 4LKSA 1GOGA 4CUAA 3FN9A 3K46A 4XZUG 2X05A 5JUVA 3I2FA 3JXSA 4W4ZA 5EJZB 3J7HA 1NAEA 4L0PA 2VZTA 4XUPA 1R64A 3LEKA 1KGYA 1OH4A 2VZ3A 5B4XA 1T2XA 3MO4A 2LS6A 2JDAA 4MGSA 1OF4A 1JYXA 2QQJA 2ZXQA 4GWIA 2E32A 2VCCA 3WF3A 3VD9A 1DP0A 4DEVA 5JXJA 2VZQA 3CZUA 5CZKA 1H6YA 1W8NA 3NQHA 4W8JA 2WQ8A 1JU4A 2VMCA 2VZPA 3HNMA 2XQXA 3GGLA 2VM9A 4E8CA 1W99A 2C9KA 2CDOA 2QQIA 1OF3A 2W91A 3OBAA 2VZOA 4MGQA 4OZOA 1UZ0A 3WF1A 1XPWA 1UMHA 1UY0A 3T2OA 4OMDA 3T2QA 4ZZ5A 4XUNA 1K45A 4ZXEA 2YB7A 2HYXA 2VCBA 1OT5A 2QQMA 4JKKA 2CDPA 5FUIA 3WSOA 2J7MA 3NRUA 4JHZA 4PF1A 4TTGA 1K3IA 4JKLA 5DPNA 5HXMA 2W5FA 4HG6B 1CZVA 2W3JA 2RV9A 2BGOA 2W87A 1MPXA 5DQ0A 2YC4A 3VD4A 1JZ7A 1XC6A 5DMYA 3WNOA 3A22A 1JU3A 1CZTA 2XOMA 3DYPA 2YC2A 3W5MA 2VC9A 3AC0A 3NJXA 2Z4FA 3A7QA 3BN6A 4ZY9A 2RVAA 1CZSA 5LA1A 1D7PM 2J1UA 3CMGA 1UYZA 5LA2A 2B9VA 3ACFA 4CU6A 4DXTA 1RYYA 2VQUA 3C7GA 2PQSA 1K42A 3SKVA 3T0BA 2WN2A 3CIHA 4P00B 4PQQA 3LEIA 4XUOA 3I3BA 2W1WA 1JI6A 4CUCA 2W95A 1UY2A 4GZ9A 1GUIA 1SDDB 1NX9A 2VOTA 5A1AA 3T0DA 2W1UA 3P1IA 1IQDC 3T2PA 2HLEA 1JYVA 2VZ1A 3GXUA 3I2KA 4QX3A 3K77A 4MADA 3HN3A 1W9SA 2EIDA 1JHJA 1PMJX 3DECA 3PUHA 2LW8A 2DCKA 4D0QA 2J1VA 1UWWA 1KEXA 1XNAA 5C7GA 2E33A 5EJ1B 4P02B 3CQOA 3VDAA 4QX0A 3SEPA 1JZ3A 3C7EA 3CDZB 2BZDA 3A21A 4LPLA 1DLCA 3MUY1 2ID4A 4JX0A 2VMFA 4QPWA 3PUIA 5JR2A 1LNSA 3C7HA 3SKJE 3C7FA 4A41A 1WCQA 5I0DA 2ORXA 4BK5A 2BGPA 3OG2A 5G04L 1PMHX 2R7EB 3IB3A 2JE8A 4QB1A 1YQ2A 2WO1A 4P08A 4UAPA 5B4NA 4FI9A 4A42A 3DYOA 1I5PA 2C26A 3FHQA 3IAQA 5LA0A 5C70A 1OD3A 5J1XA 2Y64A 4CVUA 2JKXA 1GQPA 3K75B 1ULPA 2WZEA 1UY1A 3A23A 4DUVA 2YFUA 3K4ZA 1W0NA 1GMMA 1DYOA 2W92A 3K4AA 2XONA 2VMEA 1JZ8A 2E31A 5G05L 3ACIA 3I2IA 4ET7A 4A44A 1JZ5A 3MV01 5JXHA 4DXRA 1XNTA 2VZRA 3THDA 3FHAA 1L7RA 4CUBA 2VTFA 1W9TA 5C71A 4RN5A 2WAOA 2QQLA 1ULOA 2C4XA 1NUKA 2WAAA 2EIBA 5IJRA 4MOAA 2ORZA 2VZUA 3U37A 1HN1A 1JZ6A 2VZVA 3OB8A 5LCWL 5IYYA 1SHWB 3WEZA 5IHRA 2VCAA 3I3EA 3VDCA 1J83A 5JXGA 4BXSV 3WF0A 5DN2A 2QQNA 4XUTA 1UY4A 2RJ2A 2WABA 2VZSA 2WYSA 4ARYA 2XHNA 2J1RA 2V5DA 2WBKA 3WNKA 4QDSA 1P8JA 1UXZA 3THCA 1US3A 1EUUA 2WN3A 3IIIA 2V72A 4DUWA 4QB2A 2J1EA 1GOHA 3D3AA 3ACHA 4OMCA 3IDAA 1H6XA 4A45A 1US2A 5JMOA 4PT6A 4M4RA 1UMIA 2VQTA 4YPJA 4E8DA 2BBAA 1NKGA 4M4PA 3F2ZA 3EYPA 3OGRA 2WO3A 4LQRA 4BK4A 2X10A 5CYYA 3UNPA 3LPFA 3MV11 3VD3A 4QDRA 4BDVB 3WNMA 3MBWA 1JYNA 3ABZA 4Z2AA 3LEGA 3VD5A 4CU9A 4DEQA 3CKHA 2VL4A 1W8OA 2J22A 1UX7A 4LHSA 3C8XA 1PX3A 3LQCA 4CU7A 1GOFA 2L9LA 2VMDA 2V4VA 2DDUA 1F4AA 2W46A 5F7UA 4W50A 4A6OA
chains in the Genus database with same CATH superfamily
1WKYA 2BV4A 1GFF2 2DU0A 4Y20A 2W47A 2WDBA 1BHGA 1IS6A 1GZCA 1YFWA 1ZNPA 2V09A 2Y6JA 5F3IA 5H9PA 3WNNA 2ZHKA 2ZHMA 5FDBA 2XPJA 1REEA 1FMD3 2ADEA 3NJVA 2XUMA 1E5IA 5I0TA 3SEEA 3VBFC 3EMRA 2XL7A 4Z07A 1CPNA 1MVEA 3I2OA 1O8PA 3KCYA 5AFBA 2V4AA 4BLIA 1M4WA 2F17A 4RYDA 2Q1ZB 1YO8A 3AVRA 4SLIA 3TEWA 3QBQA 3WCSA 4D94A 2BOIA 3WHTA 4IV1C 1RUC2 1LOFC 1UOBA 4H7MA 4QX7A 2ZMKA 1VE0A 3JZVA 4LIVA 2D6PA 4QX1A 1ENRA 4J1WA 1IPJA 2WFF1 3ZM8A 2CHHA 4NRPA 2IXJA 3E1F1 4CDXA 5C8CC 5A80A 1QJU1 5FYHA 4YZ2A 1DGWA 2GC1A 2WNOA 1RUJ3 1XXNA 2ARAA 1CIYA 2IXHA 2C1FA 1FPN2 3K51A 3KGLA 4XDOA 4CDUC 1DQ2A 3MIEA 1AYN1 2OIIA 1GV9A 4CDXB 3WQ1A 5J37A 3NJYA 1ZREA 3VHPA 2AR6A 5LY1A 2QCSB 3WNPA 3CLPA 1EV13 1FNYA 2VR4A 5F9TA 1TNFA 2WINB 1LHNA 2DURA 4UFJA 5D8AC 3RFRA 2ZOEB 1TG7A 3WDXA 2G19A 4RA0A 4FOQA 5FYMA 5BXXA 3P3NA 4C91A 5AC93 3FLPA 4NHYA 1RMU2 1R081 1VRBA 1O5UA 1SLLA 3TN92 2JG9C 3IN9A 1U12A 3AZXA 1COV3 1LECA 1KRIA 3ZVXA 1JZ4A 1WBFA 3ZIWA 5T5LA 2PAKA 1R091 4I3PA 5GZEA 4IV3C 1QQP1 4IGPA 1N47A 2YFZA 1REFA 4CCKA 2VBBA 4N7UA 3T0AA 1CN1A 1FOD1 1NZIA 2R1BA 1Q8VA 3IIAA 2MEV2 1AXZA 1W9WA 1ST8A 5FPAA 5HCBA 3URFA 1LR5A 1G9BA 1J1TA 2D7FA 2GN3A 3QOPA 2B4KA 1MZ5A 3EQEA 5A3OA 2BERA 2GNTA 3RSJA 1F8VA 4HPKA 1RUF1 1GP5A 3N9NA 5FP7A 3E5XA 1VMFA 1KITA 1R1A1 1Z78A 3KB5A 3Q8FA 4Q5OA 5DABA 4ARXA 4QQHA 5FY0A 3ETQA 4MV2A 1DIWA 2K46A 3AK0A 4E2QA 3N7MA 3LPGA 4OUEA 4Y26A 4IETA 2RR11 4L97A 2SLIA 1UIJA 4H7LA 1ULFA 1K5JA 3CBNA 2OKXA 3K3OA 2W94A 3PU8A 1H1AA 3B94A 4EROA 3HJRA 2P3IA 1UYYA 3HNYM 3OJBA 4M0NA 1SZBA 5CG9A 5JPMB 1EPWA 3RDIA 1AR63 2ZEWA 1PX4A 3K4DA 4BMEA 4XUQA 3WQBA 2ZBJA 2VGDA 2X8KA 3MLJA 1BCXA 4PJYA 4UFKA 2RM23 4ES9A 1YWKA 3ZDSA 4FAGA 1C5HA 3MHZA 2OS2A 3I97A 4NO4A 1W8FA 3MIDA 5FZBA 2I45A 1QWRA 5ACA1 2B5HA 2RS13 4JGYC 1PIV2 1YEWA 3AMQA 4QD2A 3T4HB 2R1DA 2X05A 1UZZA 1BVVA 4Q4W2 1NLSA 4W4ZA 2D5HA 4DRRA 2QNKA 5A6QA 1JYTA 4BQWA 4L0PA 3JBG1 4OI4A 1PK6A 1PGW2 1VP6A 1UD1A 4HK8A 1HRV3 4WM7A 4XUPA 1ULGA 4IEWA 4DY3A 3LEKA 1KGYA 1STMA 4A7YA 2HJIA 5FY5A 1GR3A 3MO4A 1K5MA 3ZYFA 5BNPB 1KFUL 2LS6A 4CEWA 3KT4A 1S2KA 1RHI1 1TMF3 5JI7A 3ON7A 5I8TA 5LEKA 1AR82 4COWA 1HXS2 2ZXQA 4GH4C 5T55A 3ZFGC 4GULA 3VHRA 2E32A 3ZXGA 4E4HA 4WM7B 2VCCA 5FAXA 3CF6E 5T5OA 3WF3A 3VD9A 1DP0A 4DEVA 1VMJA 5JXJA 3O1SA 1W6OB 4NHXA 5CZKA 1K5MB 2ZABA 2R32A 4CEWB 3BU0A 4W8JA 2XL9A 3ENRA 1QJEA 4UFLA 1FV3A 1Q8QA 2VTXA 3CEWA 1QOTA 1N3PA 3GZEA 4NMIA 4EJRA 3S57A 1W99A 1PO21 3KZ4C 4QQOA 3LIGA 1LHOA 3RZZA 4YFZA 1OF3A 3ILNA 4TLFA 4EN6B 1KDMA 4R52A 1HN0A 5LBBA 4CXWA 1NYWA 5D2AA 3X29B 4AQ6A 4N53C 4K21A 4LBQD 1XPWA 2WFF3 4IQPA 2Y26A 2E9QA 1UY0A 1V6IA 4NN0A 4OUMA 3N9PA 3T2OA 1RUH1 1SLBA 1UN1A 2ZHNA 1QJU3 1J58A 4PDWC 4XJUA 4XUNA 3O7OA 2QQVA 2W52A 1CWPA 3H1YA 1CGPA 3WG2A 5JLVA 1EP0A 1DYKA 4XBQA 1OT5A 4H2AA 3E6CC 3O1VA 1AYN3 2BJSA 3L2YA 2X53S 1XYNA 4Q8LA 2C24A 5IW0A 1ZZ8A 4XQDA 3NNMA 4MXWA 4U36A 1SCRA 4KG8A 4YYOA 4XFGA 1GP6A 2NLRA 4CP1A 2FDGA 2Y6FA 2XH6A 1TQ5A 2JDPA 4XTMA 3TNQA 1CZVA 2ZPXA 5FCCA 1CESA 2JDHA 2VBDA 3WLUA 2ENRA 5K4LA 1NE6A 4TN7A 4ZS2A 3H9AA 4MXWB 3H7YA 2YC4A 1HB4A 3O1TA 1R083 3AP9A 3QH6A 5E89A 4ATEA 5BNOC 4YZ5A 2Y0IA 2MHFA 4UW6A 5FZ6A 1R093 2TUNA 1U5IA 4TYSA 2IXCA 2XOMA 5HI0A 1WW5A 4FPGA 3D4KA 4YZ4A 2FDKA 4BQ2A 4NIHA 5A33A 5A3MA 1I5ZA 2ZMLA 2QQWA 2VC9A 2Z4FA 1GWKA 2WNUA 2PLV2 2DV9A 4HBNA 4HZFA 4K6BA 4CEYA 2RVAA 4CPBD 2FDJA 4MGZE 3WZ1A 2H6BA 3DUIA 2DUQA 3ZKYA 4IEYA 5C5UA 5F3CA 3MICA 2RS52 1NLRA 1RUF3 2J1UA 5LA2A 3BOPA 3LB9A 4DZGA 5C9AC 2OUHA 4QKBA 1BBT3 1RYYA 4TLGA 1KDKA 4GALA 4Y33A 1R1A3 4XFHA 1K42A 3SKVA 3H7JA 4RL7A 4YVSC 3KQRA 4XDQA 1NCRC 3VV1A 3ZKUA 3ZSEA 3KS7A 4PQQA 4YM3A 4CEYB 2VG9A 3LEIA 3O0XA 3T1LA 2RR13 4H14A 3PUQA 1VJ2A 3IMNA 1NCQB 3H8OA 4P14A 3OSDA 4AFCA 4GB31 4GMP1 4QXCA 1BVP1 2I2SA 4GZ9A 4IEUA 2ZGLA 5T54A 5A1AA 3VBFA 3AJYA 3RRDA 2BQPA 1PZ8A 4RFT0 1IQDC 3UGFA 2ZS6B 1PGL1 3FLRA 3JUUA 1PNFA 1YIFA 1O3TA 4KH9A 3GXUA 3I2KA 1XNCA 1OFSA 3PLQA 4R9BA 5F37A 1LOFA 1H1IA 1D4M3 1HJGA 1QOOA 4BM8A 3HN3A 5GLVA 1W9SA 3AKTA 3O1MA 2A3YA 4AI1A 3RS6A 5ACA3 1OSGA 3DECA 2LW8A 2XVGA 1VBD2 1RGSA 3LGRA 5FYVA 1XNKA 4JRLA 4D0QA 1RUJ2 3VHNA 3O1RA 3J8F2 1S0DA 1JTZX 1TNRA 5LBEA 4XCBA 1VBE1 4YGDA 1KEXA 5C7GA 3CHXA 3JBG3 4QU1A 5BNQA 1U0AA 4LBJA 3G6JB 5IVYA 3CQOA 1V9U2 1OUSA 4MZUA 4LITA 5F2WA 5J3UA 4X6RB 4CDUA 1WLWA 2D93A 3N9OA 2GNBA 4LUMA 3LAGA 4N9HA 1N1VA 1GZ9A 1RHI3 1UPIA 3C7EA 4RR3A 3CDZB 2BZDA 1CVNA 3FFQA 1NXMA 3ROUA 1DGRN 2VMFA 1VBA1 4RQPB 4XZPA 5JR2A 1JN2P 1RUE1 2R0HA 1DHKB 1YLLA 1JW6A 2WWSA 3U10A 1UX6A 2G4IA 4GKXA 4UFHA 2RDQA 3C7FA 3PVOA 1WCQA 2X5IA 4DPNA 1COV2 4OLLA 4K8FA 3OG2A 2JG8B 4FQZA 3ITQA 4RR3B 2WT0A 2WLPA 1IZ3A 1RUG1 3PVNA 5SV8A 4CP0A 1GANA 1PO23 2JIJA 4QKDA 3Q8EA 4QB1A 4LHKA 2JG9A 2B42B 2JB8A 1BMV1 5H9QA 2RG4A 3V0BA 4K20A 3S5AA 2IUWA 4A42A 5EWSA 1WZXA 3MDPA 2XJPA 1QXPA 4HMZA 3WG3A 3IAQA 3F95A 5KXCA 2X5IB 4Q27A 2Q1MA 1KD7A 2JDKA 4COZA 1HB3A 5J7MA 2JKXA 5DDJ2 1LULA 2DFBA 1RUH3 5K8SA 1TME1 2R042 3DV8A 2GSYA 4HSLA 5C33A 2WA3A 3V0BB 3K4ZA 4CCEA 1YCIA 2W92A 1WWYA 5CU1A 3M7AA 4XETA 2XONA 5JVVA 5KHGA 2EF6A 4LO5B 4CXXA 3I2IA 1O7FA 5FYTA 5FK8A 3DPRC 1DF0A 3M2MA 3ZXKA 1DZRA 4HN1A 2CGOA 2D6OX 2P2KA 5JXHA 1XNTA 2GMPA 1REDA 2RDNA 2XR4A 1AR91 1YRZA 2EVXA 3AZVA 2BNNA 4L8QA 3GBFA 5F39A 1L7RA 3W59A 2VTFA 3VN4A 1C8M1 1W9TA 1SFNA 1EYBA 4RN5A 2DCYA 1X8EA 4AI3A 2RM22 2HWF2 2C4XA 1VBC1 3B9IA 2IVJA 3N35A 3PUAA 1XQNA 2HH9A 2WAAA 5DUVA 2PAMA 5BV6A 5KHJA 1I9RA 3AP7A 1W2TA 4LK6A 3I4IA 5BUVA 2JDYA 2AEZA 3WW1A 1KJRA 2CWMA 2W2IA 3H3LA 1OPMA 4JGYA 4PLOA 3U37A 2RS31 4CE8A 5FRAA 3RYPA 4CDXC 2NPIA 5IHRA 2JENA 1CQ9A 3I3EA 4UBGA 3ZYIB 2A73B 5E6HA 2OQ6A 1H2LA 1JYIA 1W28A 3PMEA 5FP9A 5DUXA 2A6YA 3WF0A 3ZYHA 5DZGA 4AQ2A 2VECA 1H2NA 4X8NA 4BH9A 3H50A 4IEXA 4M3CA 5FYUA 2YY1A 2R6QA 4JTNA 3RPQA 1WLTA 3ZFGA 4ARYA 3WW2A 2PHXA 5TSWA 2XWBB 2EAKA 2WBKA 5FYZA 2WZR2 2OPWA 2FCUA 4GB33 4GMP3 5FMDA 5FY9A 1C8NA 1UXZA 5EYYA 3OUJA 2WN3A 1SLTA 3MYXA 3Q8CA 3IIIA 4BOWA 2VD7A 3IDCB 2J1EA 4AXOA 3ACHA 4K1ZA 2K0GA 3ZOIA 1ZRDA 1HKDA 4MHRA 3POSA 3MIHA 4HT1T 4E27A 1G86A 1IOAA 2AACA 3WDTA 4B3NA 3M3CA 1VBB1 4PT6A 4N53A 4AGVA 5JSRA 1OVSA 1SPPB 4QMAA 2Q8DA 5C4WB 4L9BA 1D4VB 4XF4A 5FY1A 4IE5A 4JQRA 4XF0A 1VBE3 2O1QA 1XE7A 3KT7A 2XKOA 3OGRA 2JE9A 2WO3A 4IE0A 1IG3A 1UCXA 2X29A 5C5TA 4XHBA 2X10A 1RUD2 4NJ4A 5CYYA 3UNPA 3LPFA 4AW7A 1JYCA 3RWKX 5FLIA 1SQ4A 2E51A 3MBWA 1JYNA 3ABZA 4Z2AA 5E88A 2GZWA 4QXBA 4DEQA 3GNEA 4HKOA 3R0RA 5LASA 1N1TA 1QU0A 1UX7A 1HLCA 3S30A 1KJLA 5FQ0A 5KHKA 3PVBB 1VBA3 1MS9A 1QH7A 3MF9A 2Q5TA 4LORA 4M0HA 1H9WA 4IEPA 5KWRA 5T3NA 3ZLIA 3N4MA 2XUEA 2HWD2 3NNLA 4AK3A 2WKKA 2YMZA 1VB4A 2J42A 4JTOA 3VBSA 5F7UA 2ZGTA 1XNDA 2BBVA 1VRH2 4W50A 2QJVA 4QHZA 4UI9L 2ZX2A 1RUG3 5A1FA 1RTVA 2EICA 3CZJA 1F15A 2BP6A 3NVCA 5BNOA 1O4TA 1G9DA 2EXIA 2AENA 3AL5A 3LA3A 3POFA 2IVIB 5FYCA 3GALA 2EIEA 1HJFA 1RVF1 3VBRB 1OQDA 1WMDA 5FXWA 3VBSB 2J1TA 4AFMA 4BISA 5ISLA 2ZAHA 1MZ6A 1X9TA 4IUGA 3O1UA 2H6CA 3DXUA 1AYM1 4GD4A 1WLCA 4YG6A 3ACGA 5DAVA 1CAWA 2DCZA 1TME3 5DAQA 5FZCA 5BNPC 3ZYBA 1ULCA 3OGVA 3VKLA 2ZGOA 5FY7A 4BIFA 5I0RA 4UXAA 1BBT2 5F2SA 3KV4A 3I3DA 3UV9A 3ZXJA 4I09A 4CP2A 3ZN6A 4WM7C 3D5OA 4AWDA 5C9AA 5CA6A 4I0BA 5IFPA 2WZ8A 3SCFA 1H9PA 3QH7A 5A7PA 1K5MC 4J6GA 4CEWC 1MS8A 3C2UA 1NCRA 1XBFA 5FMCA 5FPBA 2ZEZA 3U4XA 4R8HA 4XJAA 3NV1A 1TZOA 1BK1A 1H4HA 2A71A 1CONA 4Q1RA 1VLNA 4UOJA 4GWJA 1C8M3 1HB1A 3ZN6B 5F6LB 2R061 1Z0HA 3LA2A 3LE0A 3V65A 3T08A 4BQYA 2XVKA 3PVEA 5A3PA 2R071 3KD4A 3ZSJA 1VBC3 4D3WA 1D4M2 2BNOA 5EZWA 5FZ7A 3VLBB 4AFAA 2YBSA 1QJY2 3AYEA 4XABA 3FBMA 4A3ZA 4EQVA 1UY3A 2D98A 3ZPOA 1W6NA 2WUHA 3CNAA 4WVMA 3LOBA 1S0CA 4S2GA 3MFAA 4WM8C 2A3XA 4BA6A 2Y33A 4MX3A 4XJ9A 3VZJA 4AEDB 4F83A 4QWNA 1C57A 1K12A 1HRI1 2IWGB 2DVBA 2ZEYA 2HWE2 4FFHA 1SG3A 4NPLA 2VTXJ 1C1LA 1Z7S2 1LAJA 1RC6A 1W6NB 4WVMB 4GMP0 3RYRA 3T30A 1I1EA 2VNVA 1C1FA 3USUA 3FL7A 5FZMA 1G8WA 2Y6GA 3QCWA 4NPRA 4ZU7A 4EYUA 1MS1A 1GU3A 4DUXA 3W5NA 5HPOA 1BEV2 1F4HA 2C6SA 3ILRA 4Q29A 1LENA 3MPBA 3BPSA 3FZ3A 4MVTA 2OYZA 4HOOA 2YROA 4EWDA 3C3VA 4ES8A 5F5IA 5FYSA 3USUB 3ES4A 3I3QA 2VUJA 4CDQB 1WMEA 4HETA 1OA2A 2H0BA 3AP5A 2FD8A 4CDWB 3OEBA 2ILMA 1UOJA 1TVGA 4XF9A 2DVFA 1OURA 1T6BX 2P17A 3BALA 4B8EA 1SLCA 2Y6KA 4AHWA 1W0OA 3B00A 1XYPA 3AFGA 3KWVA 2IC1A 1UXXX 3ZR5A 4JDNA 3WNXA 3WDVA 2E26A 3NV3A 4NIAA 1KQRA 2Z2SB 3AYAA 5LATA 4C8DA 1VBB3 1QMJA 3I59A 5DDJ1 3ETPA 4FPCA 1OLQA 3POYA 2AUYA 3T1MA 1X82A 3VBHB 3N7KA 2KD7A 2XLAA 2IXKA 5FREA 2VNGA 1EY2A 1MZFA 1GOGA 4CUAA 2YGMA 3K46A 3KHCA 1U5YA 3CJIB 5JUVA 4CEYC 3SMHA 1XSQA 3J7HA 1OH3A 1NCQC 4AAPA 1Q8SA 1FATA 1PNGA 2HBTA 2HEVF 4HANA 5CB7A 1R64A 5IAXA 3DPRA 5DG1A 1MZEA 2VZ3A 3KSCA 4NR1A 4LBQA 2JDAA 1AL22 2UURA 4MGSA 4B1MA 4PLMA 1JODA 3D0JA 1G6NA 1JYXA 1ZBE1 5I0SA 3SXWA 4FCAA 5I8YA 3FMGA 3PTRB 1SEFA 2ZGQA 3DPRB 3MFCA 1HQWA 2ZGSA 3U75A 3CZUA 1GNZA 3GHMA 3NQHA 4HN0A 4LBQB 1W2NA 2WQ8A 2JIGA 4NRQA 3WINE 5L19A 1RXFA 1RVF3 3OBRA 3ZDVA 3UGGA 4UBHA 4UW3A 1O3SA 3ACLA 1VB2A 2VM9A 3GGLA 3RZKA 4LT5A 4E8CA 2B46X 4XMIA 4Z82A 2Z79A 1AYM3 2CL2A 3NKGA 3WHUA 1QJX1 3SH4A 1ZZ9A 1PMIA 5FY8A 4Z8BA 4Z1VA 1OVPA 5LRSA 3O12A 1V00A 1QGLA 4MGQA 4Y5TA 1UZ0A 3ZXDA 4OFGA 4Q0QA 4Q1PA 4XDPA 1V6MA 1W6PA 3VZKA 4ZS3A 4PI2A 4Y4YA 4C0BA 1JHNA 1PGSA 4OMDA 3OD0A 1FT9A 4RQPC 5CKQA 5F5QA 1NXD1 4ZZ5A 3AP6A 3D0SA 1OKQA 2P1BA 4ZXEA 4Q26A 2HYXA 1S1AA 4RFRB 2XJUA 4UFIA 5FJKA 2EXHA 3J7NA 1W8HA 2JG8C 4RR3C 2QQMA 2VQAA 1W6PB 4JKKA 4EE2A 2WZPP 5FUIA 3WP4A 4Y1XA 4E2SA 3U1XA 2R063 1AR71 4NPMA 1JOPA 3KV6A 4U2AA 3WQ7A 4TTGA 4JVAA 1RUNA 1K3IA 2FMYA 1PVC1 3POGA 4Q4X2 5HXMA 4LBNA 2R073 2X5IC 5FZ8A 1UF2C 4V2VA 3ZX7A 2ZGUA 2QKDA 4XXAA 3O1OA 2RV9A 3POJA 4BIOA 1D0HA 4RGGA 1DQ1A 3O14A 2YBKA 2W87A 2BGCA 4YRDA 5DQ0A 4EZHA 3PJQA 1NA1B 1YQCA 1CAUB 2DU1A 5JAXA 4NIDA 3WP6A 1JZ7A 4KWLA 3USSA 3RMXA 5FR3A 1OLRA 2OW4A 3MPPG 3WNOA 3A22A 1MEC1 1HRI3 5DAXA 5J98B 1JU3A 1WA6X 3UKTA 2P6HA 1Q8PA 3DYPA 4IERA 4Q4Y1 5BY5A 3ZN5A 4AR2A 1MS3A 4YWAA 5H9RA 4ISQA 4NUBA 5L7OA 1H8TA 1LGBA 4ASMB 2NMNA 2CYFA 2YPDA 4OUSA 3AC0A 2GNDA 3WY6A 3NJXA 2WO7A 4XTPA 3A7QA 5KXDA 3EHKA 3BTXA 1MS5A 4QGNA 5EXOA 2V5YA 3JD72 1APNA 1CZSA 4FTEA 1EAH1 2RJKA 3U14A 4LIUA 3UYJA 1UL9A 2IXLA 5ANQA 2FCTA 4PI0A 4EWEA 2ES3A 1ASJ1 2D43A 2D3PA 1CX4A 2A6ZA 2R30A 1H8TB 3C7GA 3RYKA 4DXTA 2BVVA 2PQSA 4AL9A 4JAAA 2VUCA 4P9JA 1FV2A 4W65A 1HV0A 3WD5A 2OPKA 4F8AA 3MGUA 3O1PA 3T2TA 4G4FA 4URAA 4NHMA 3MIBA 3AZWA 4FOYA 3TOJA 5FMOS 4CUCA 5LZ6A 1XRUA 2A1XA 2W95A 1UY2A 4N8MA 3ZMNA 3RZJA 1GUIA 1LHUA 4I01A 4QQPA 1JUHA 5HCHA 4LHNA 5EHDA 2B39A 1ZZ7A 5ANNA 2FHRA 4LNVA 3T2PA 3GZUC 4AI0A 2HLEA 4OHWA 4QPYA 2DTYA 5DDJ3 2Y60A 1OXCA 2WS92 4OQ8A 4KQ7A 3K77A 1S2EA 3KMHA 4PIXA 4NIIA 3S5QA 3CU7A 5BNPA 4BE3A 1GICA 2CTVA 2HWB2 3RZGA 1JOBA 4B4RA 2EIDA 4AVAA 1A8MA 1ZBA2 4ZONA 5FZHA 4RHV2 5FJHA 5EP9A 5JSOA 1NY71 5FZAA 1UWWA 2RMU1 1XSRA 2GALA 1XNAA 1W6OA 5EJ1B 5I8SA 1QH6A 5T50A 1MS4A 4P02B 4S2DA 1B35A 4AI8A 3H0OA 1KS4A 1W03A 1O5LA 4XAAA 3ZSMA 2W08A 4AOCA 2W68A 3T3YA 5LWBA 5KR7A 1ZBE3 2OUJA 5KHHA 4FPJA 3TEYA 1AX2A 1F2NA 3MUY1 2ID4A 1RUI1 2ZACA 4ZU5A 3PUIA 1X50A 1B35B 3C7HA 5A7NA 2VU9A 2DUPA 4FQ4A 4A41A 5C4WC 4LBMA 1ZVFA 3ORJA 4BK5A 3LSEA 4XE9A 4YW5A 5G04L 1KS5A 1PMHX 1DG6A 2R7EB 2EAAA 5FWEA 1ZZCA 5FYIA 4URTA 1QJX3 1DYPA 5I0UA 4WM8A 1V6LA 4FOWA 4FI9A 1MR5A 1I5PA 4LO8A 4XFFA 2C26A 4CZSA 1URXA 4R9DA 3JU9A 3WV6A 4BB3A 1OD3A 2UWAA 4HVRA 1W6QB 5J1XA 2Y64A 5CG8A 1PO11 1YQ6A 1FYUA 3NWKA 1OD5A 3K75B 4NHLA 3HQRA 4WM8B 3ME2A 3Q8BA 4DUVA 1CJPA 1F35A 2JDUA 3ZXAC 2FDFA 3ZO0B 3R6SA 4I2OA 1POQA 5DAWA 3EO6A 4MGIE 4LXLA 5FP8A 1ZZ6A 4LE4A 4OQ9A 3FE5A 4ORFA 2E31A 4IEZA 3ZYJB 1SMVA 1AR73 2D6NA 1LRHA 4A44A 3KVAA 5FZ0A 4XCAA 5JI9A 1J3PA 4QPIC 3MV01 1PVC3 2LRPA 4FP2A 3VBRC 2VZRA 5ABJB 3VBSC 3PUSA 3OPWA 5FO7B 3R05A 5C71A 4UWDA 5FPZA 3ZFFB 4JV4A 2WAOA 3HAGA 4KBBA 1ULOA 3JB8A 3KF5A 3OYWA 4J25A 1GNHA 2XDVA 3FFZA 2DF7A 2WT1A 1MQTC 4KGQA 3GCXA 3MIFA 1H8VA 2D3RA 4COYA 4UT5A 1RB8G 2ATFA 4Q4V2 1QQP3 1MEC3 2B8MA 4D7SA 2NM1A 2ORZA 4LR4A 2HBUA 1UOFA 4BHPA 4Q4Y3 5JWPA 1LOCA 2ARXA 3GZAA 2HWC1 1FOD3 1I6XA 2A5ZA 1X33A 2WIIB 3OYWB 4UW5A 2DVGA 2DVDA 1JZ6A 4RD7A 2XLGA 3U0ZA 4E4SA 3A4UA 4Q0UA 5IYYA 1NCQA 1SHWB 4JHTA 2XHKA 4XFIA 1EAH3 1LEMA 1LTEA 3MW4A 4PBOA 3AKQA 5L73A 2ZZJA 4AVCA 5JXGA 1WMXA 1ASJ3 4LBLA 4NROA 4K9SA 5CVRA 2VMGA 2ZAAA 1W8WA 4F3JA 2DFCA 1UU4A 5DN2A 2QUOA 3AP4A 3SC7X 1CAXA 2ADDA 2ZHLA 1FMD2 2VNRA 4MGTA 4Y3OA 3AXDA 3I54A 1QJZA 1OI6A 4LEJA 2VZSA 2FBEA 1RUC1 4AHXA 4A6SA 5DZEA 4XF3A 4FPEA 4LHLA 3RJRA 2PHFA 2YC0A 3I2DA 4ASKA 3I3MA 2ZX1A 4QM8A 2Q4SA 4WBBA 5FOJB 2BDRA 1ZA4A 1P8JA 4AEDC 1CAXB 5APAA 4ISRA 3THCA 1US3A 4M3CF 1QOSA 3ZSKA 1EUUA 2MNGA 2XWJB 1LOEA 1PM4A 3PMSA 3FX3A 5KBFA 5L36A 4LBOA 2WLQA 3TEXA 2V72A 3SISA 1JBCA 1GOHA 1W8ZA 4OMCA 3IDAA 1FPN1 1H6XA 4YG0A 3VBOA 4A45A 1US2A 4AI2A 5F3GA 4MHUA 2MPFA 1F9KA 1E5RA 1ND2B 1YC61 3IWZA 1LODA 4GAZA 3ZMOA 2BBAA 4RQPA 2RMU3 2GNMA 3PIGA 1POV1 1GQGA 1AXYA 3VBOB 5GLUA 4XPVA 2CGPA 4CDQC 5JOWA 1EV12 1LCLA 4M3CE 4YW4A 1FAYA 4BDVB 3UKVA 2JG8A 4CDWC 3LEGA 1AJKA 3GJAA 1QNWA 1X9PA 3TN91 1RMU1 2Z5WA 3M1HA 2J22A 3V56A 3O5SA 4SBVA 1RUI3 3AKPA 5AC92 2L9LA 5C3SA 1VIWB 4C0HA 2K2SA 2W46A 4MLOA 4A6OA 5A3TA 4AEJA 5A6XA 1UKGA 5GALA 2Y0OA 4EN7B 4Q2FA 3VBHC 4HVQA 5JZGA 2VNOA 3JQXA 4P9IA 2MEV1 3KQ4B 5L9BA 1CR7A 4M00A 3UGHA 2QQUA 1HIXA 4XIKA 3ECQA 3CJIC 2X09A 2PYTA 4DOUA 3BOWA 3RVHA 3PHMA 2J1AA 4BJ0A 4D6RA 3MLLA 2P37A 3N36A 1PO13 1YXWA 2JXAA 3V0AA 3OBTA 3TBDA 1WLDA 1W6MA 5JZGB 3BI3A 1V6NA 2YDEA 3W9AA 2DBNA 4DMIA 1SFYA 3HT2A 1Y43B 4Y1UA 2VXRA 2W1SA 4QX5A 5IK8A 1DDLA 3KT1A 5L7OB 1UIKA 2JX9A 3FLTA 3WVJA 1GYKA 3H3UA 4E2GA 4IEVA 5JDBA 1UMZA 1HQLA 3E97A 1ENSA 2CY6A 3ZXEA 3V0AB 1W6MB 1NZCA 5HCAA 4P9XA 1C4RA 5BNNC 1ZZBA 3VD7A 5JXIA 2TBVA 4D6SA 1XU1A 4Y1ZA 1S0FA 1AR62 2D44A 3I2JA 1YFUA 4FPFA 3KV9A 1UO9A 4Y22A 2VE1A 4AEKA 3RZHA 4N43B 5LK5A 2LM3A 1A34A 2XJVA 1O8SA 1PIV1 4ZZ8A 4LO7A 1ODMA 1W04A 2ZTNA 4QX8A 4TWTA 4Q4W1 4OI0A 5FPXA 5AVAA 2Q0AA 1SDWA 2RS12 1JZ2A 4AVVA 5CBLA 3WX5A 1BZWA 1PGW1 1BK0A 4Y22B 1IS5A 2C0ZA 2C9AA 1YJLA 3EB7A 2GC2A 3HPNA 3MUZ1 3ZYRA 2OT7A 4NOTA 5CKMA 4DO0A 3S6PA 5FXVA 1HRV2 2GMEA 1D0GA 1FI2A 2HWC3 3GHNA 4CUGA 2NP0A 2Q8CA 1ZRIA 3HEIA 1ACCA 4OHVA 1AR81 3JQWA 1HXS1 3H1WA 3DEMA 4AGGA 1YQ5A 3UETA 4QB6A 4DS0A 1TMF2 3C7OA 1UZWA 1UAIA 3NNGA 1KXGA 1DZTA 1BYHA 1YQ8A 4YLZA 1G7YA 3UESA 2PHLA 1L7LA 3T09A 2H0VA 1ZA7A 4NE9A 2O14A 2QZ2A 1S4CA 2CSGA 5HXVA 2W1QA 4G9SB 4Q8KA 3UJOA 4AGRA 3D6EA 1Q56A 4KWKA 5FBZA 2Q30A 3Q9OA 3VL8A 3R4DB 1RUC3 3U11A 1MVQA 3HNBM 1NA1C 4CYDA 4MO3M 2FDHA 3QD6A 5A6YA 1S55A 2QQOA 3IZOA 4XACA 5FMOL 1SPPA 2A75A 5C4WA 3KVBA 4OHYA 2Q8OA 1QJX2 1PHMA 1PVXA 4CSWA 2D3SA 2LROA 1W0PA 2VW1A 3H1MA 3TWIA 3WDWA 2CGNA 3NV2A 4XURA 5FZOA 4D7TA 3LCPA 2Y6HA 4ZXKA 3RNSA 2WFF2 2Y8KA 2XGXA 1YI7A 3I8TA 1FPN3 2ZJCA 3UKNA 4KWUA 4AVTA 2J1SA 1QJU2 2CAVA 1JH5A 2VCMA 5CFCA 5AFEA 2W0XA 3IKWA 4KI5M 2E53A 4YM0A 2QQKA 3AM2A 1RXGA 3R4UA 4K40A 5FZOB 1OBNA 4MXVA 3ZFEA 4YW7A 3WF2A 5L7OC 1AYN2 1H8TC 1POV3 4QHOA 4BQ4A 2WYFA 4A4AA 2R16A 3AL6A 2R0FA 2PTMA 3IDBB 3R4SA 5CFCB 1G9AA 5LBFA 4ZHNA 2PFWA 3I2FA 3J26N 3JXSA 3W21A 1UKRA 1WMFA 3DKQA 5DUUA 5FOBB 3E5UA 5F32A 2VXJA 5K9YA 3TN93 5FBJA 1RMU3 3ZFEB 3B93A 3BTAA 1RUE3 1A78A 1BXHA 4QPIA 1T2XA 3VBRA 2AZ5A 1IS4A 5KXBA 1R082 1LHVA 1VPHA 4K3UA 5FYYA 1Q8OA 1OF4A 1T6GC 2QQJA 3O0WA 5IUQA 5GJ6A 4AFDA 1R092 2YU1A 4FPOB 1PM7A 1Y7BA 1QQP2 2EIGA 2UWBA 4QPIB 2MEV3 3BU7A 5GLTA 2PLV1 1MQTA 4AYUA 1W8NA 2F4LA 2O0OA 3BUCA 2JE7A 1JU4A 4CCMA 2ZCWA 1FOD2 3VZNA 2RS51 1BLZA 1H2MA 2VZPA 3HNMA 2XQXA 3KCXA 4GKYA 3CJXA 5FZ1A 5K0UA 3ZIXA 1OFNA 2QTWB 2CDOA 5FZKA 2O8QA 1I3HA 1RUF2 3GCWA 1DBNA 2FMDA 3AKSA 1MQTB 3N7JA 2W91A 4O61A 4XYXA 1SBEA 4OZOA 2VZOA 1R1A2 3PTYA 1J1LA 1UZYA 4LJHA 4QM9A 2UYBA 2WWJA 5K0UB 4E4DX 2NN8A 4HL0A 4RS5A 1U5ZA 2JDMA 4YSFA 1CAVB 2RR12 3AZYA 3T2QA 4PF5A 3EXUA 4WZCA 1V6KA 3M8LA 4COUA 1B35C 1K45A 4B1LA 5DZFA 3UK9A 1AR93 5A3WA 2CWSA 4P9LA 1UU6A 3FHIB 4RS5B 2FZ2A 3WSOA 2J7MA 1PIV3 4PF1A 3VKMA 1VBD1 2BRTA 4ASLA 3S7EA 4JKLA 5DPNA 1RUJ1 4AEDA 3J8F1 2W5FA 4CRQA 4XJZA 4WVZA 5CFDB 4HG6B 5ACA2 4W6WA 1S0BA 3QLQA 1OUXA 3SNMA 1D2QA 1BJQA 3GJBA 2Z69A 1YHFA 5ERLA 3LD8A 2RJLA 2BGOA 1H0BA 2Q8EA 3I49A 2VVDA 1V9U1 3JBG2 3VD4A 2RS33 4LLFA 1LU1A 5A7WA 5FFOC 1LJ7A 2ZX0A 2QDNA 1OLMA 3GBGA 1HXS3 1S0EA 3IDEA 1TEIA 4WZFA 4FAHA 1CZTA 1WUVA 2GP5A 1RHI2 1VMHA 4YW1A 3BB6A 3AVSA 3WW4A 4F7ZA 1UU5A 2KA3A 1DQ6A 4CCCA 1MACA 4CDQA 5LA9A 5BYNA 5A7WB 3VHOA 4FFIA 5CNAA 4CDWA 4LLOA 4JZRA 5ABJC 4WVVA 4BXFA 5LRRA 3BN6A 1RJ7A 3WQ0A 5D1IA 4ZY9A 2P3YA 4PBPA 2OZJA 3ZFFC 5LA1A 3N3HA 1S2BA 3M4FA 3VKOA 2ZGMA 1G9FA 5GLWA 1QXRA 3WUDA 1UZVA 2B9VA 3ACFA 3LF7A 3MLKA 5KC5A 2I74A 4FXKB 3KV5A 1PO22 2VQUA 2GC3A 4FPKA 3HBZA 4FT8A 2NZ9A 1GKBA 2WN2A 4FBFA 4COVA 1C5IA 3AX4A 2Q1FA 1F5JA 4QU2A 4XHXA 4NVPA 1IPKA 1W9YA 2R041 4UFMA 3DCQA 2ZX3A 3VBHA 4Y1YA 3NNJA 5A7OA 1N3OA 1POV0 2G9FA 3SCGA 3UJQA 3RJ2X 2BTVC 3CJIA 1RUH2 2XXZA 1GZTA 3ES1A 1UYPA 5CEHA 2VW0A 4YGBA 1A6CA 2O8OA 3H3ZA 4L11A 1JYVA 5FXZA 4EWAA 4MGKE 2VZ1A 2VUDA 1VR3A 4QX3A 2P6CA 4QPGA 2ARBA 5E1RA 4CTEA 1J59A 2BVBA 4JGZA 4MADA 4HKWA 2A6WA 1PMJX 3PUHA 1RINA 2XKPA 2ZA9A 2EALA 3FC0A 5M0TA 5IK5A 1WGPA 4DRVA 4AVBA 2BWAA 4K8RB 1ULEA 2G1MA 4BMBA 2RM21 1H4GA 1IHMA 2HWF1 4QPGB 1QDCA 3HD8B 4JGZB 4QKFA 3VZOA 4FOVA 4W6YA 2OA2A 3ZR6A 4QX0A 5DAPA 1OHFA 4XQWA 2CV6A 2I07B 3HMYA 1JZ3A 2WNVA 3SCHA 1WBLA 3A21A 1QJFA 1JXNA 4Y24A 1ND3A 2PA7A 2B9UA 1NT0A 3E6BA 4ONUA 1Q43A 3W58A 4KGGA 1LEDA 4QPWA 4Y1VA 3RZMA 2XJSA 1LNSA 3BPZA 2PLV3 1A8DA 1ND2C 2E7TA 3NAPA 2E7AA 5I0DA 1EPZA 2RS53 2WNVB 2VOXA 2XJTA 2G9ZA 2XB6C 1ND3B 4BWOA 3VBOC 3U4SA 4J1XA 2P4EA 1WCKA 2WO1A 4P08A 5B4NA 1H30A 4JQTA 4JRAA 4WV8A 1WCSA 3DYOA 3NAPB 3PIJA 4XIOA 4XBLA 3FHQA 5LA0A 3GF6A 1DFQA 5C70A 1F31A 2P3JA 5DXDA 2F6BA 1DGLA 1OA3A 2WZR1 4ATFA 4BLJA 3AMPA 3FUQA 5T5PA 4CVUA 3WP3A 1GQPA 5F1RA 2CNAA 1YJKA 2WZEA 4Y20B 5J96B 3A23A 4KBZA 1SACA 2VAUA 4GB32 2BUKA 5A6ZA 1GMMA 2QQPA 2D97A 1AHSA 3INAA 5FO9B 2ET7A 2AYHA 5A32A 2FDIA 2VMEA 2P34A 2AEYA 1V0AA 2WQZC 1PGL2 1VALA 2B45X 1NA1A 1JZ8A 1CAUA 3ACIA 4ET7A 4B7KA 5HV4A 4R4XA 5J36A 3KF3A 5HBAA 4CPBA 1VBD3 2BFUS 1IG0A 1V6OA 1W8UA 4BQ3A 3J8F3 5EV7A 4P9GA 2YUEA 3HWJA 1AXKA 1N1SA 2PELA 3EBRA 3FHAA 3NMBA 4PCRA 5BPXA 5A32B 4CUBA 4TZDA 4DY5A 4L99A 3DXTA 2RE9A 3HR9A 1S0IA 5JMCA 5JZGC 1RUD1 3HQXA 3ELNA 1V9U3 1VBE2 1X8MA 2VQ0A 1NQJA 3ST7A 5A70A 2ZKLA 2D40A 2DCTA 3LZZA 5C3RA 3NNFA 4A7ZA 4GQ7A 5A3NA 1LOAA 2JICA 4OHXA 5IJRA 4MOAA 2G9GA 2VZUA 2HWD1 2WSVA 4YZ3A 2DTWA 1VBA2 1VRH1 5FPLA 5A1LA 3T4VA 1RUE2 2VZVA 3OB8A 1AL0G 3KHBA 4YVWA 4N43C 4FFFA 1LESA 2VMHA 2VOWA 1OA4A 2FQPA 2E6VA 3TRSB 3OPZA 4BXSV 3OGGA 1RUG2 1RJ8A 4ZU4A 2E63A 4D69A 5DUWA 2QQNA 2P5BA 2UY8A 1BMV2 2XBO1 1Y9GA 4XUTA 1UY4A 4HKLA 4B4PA 4YVWB 3LFIA 2LALA 2WYSA 4NHKA 4JCKA 4DFSA 2A6VA 2XHNA 4QGMA 4FP3A 2J1RA 2V5DA 4EN9B 2R043 1SBFA 4Q0PA 3MZHA 3A0KA 3B02A 3ILFA 1BBT1 1TME2 2D6LX 4Y5SA 4MG2A 1JMUB 3WT3A 3FUOA 1OOPA 1X36A 3ZYGA 5T52A 3BTYA 4HONA 1OQEA 3POBA 2DYCA 3GBWA 5F8PA 2DWRA 1A3KA 4QB2A 2BPA2 1UQXA 5FMBA 1YNAA 4HPKB 4G3YC 3E6DA 4GJZA 4E4ZA 1FX5A 4M01A 3U78A 4KL1A 4KWJA 2BYVE 4V1PA 4LULA 4M4RA 1PZ7A 2VQTA 4XEZA 3H8XA 1OOPB 3L2HA 3AKRA 2TNFA 1DQ5A 1NKGA 3DGTA 1HW5A 1AR92 1CD3G 3N9LA 4IXLA 4R4ZA 4BQ1A 4FTSA 3EYPA 2HWF3 1C8M2 5C3QA 5FZEA 1W39A 1D4M1 4LO6B 3AZZA 2VY0A 3MV11 3OY8A 4QDRA 1QJY1 5LBCA 3WNMA 1VBC2 2V73A 3FBYA 4PIZA 3VD5A 3VL9A 1IGOA 2UY9A 1WW6A 1D2SA 1W8OA 4LHSA 1LU2A 4UYBA 3C8XA 5EFUA 1PX3A 5FTTC 5IAVA 3NW4A 3WR0A 3SQOA 3OUHA 1GOFA 2FCVA 2A6XA 3LKJA 2VMDA 4OZXA 3OY8B 4B4QA 1AJOA 2HWE1 4N90A 1W6QA 1VAMA 2K9ZA 2RS32 1Z7S1 3BCWA 2YXSA 2LUWA 3LIHA 4HVOA 4MUVA 5IFTA 1WA4A 3N9QA 1JYWA 3WP5A 3KCCA 1OC1A 4TSVA 2IFRA 4HXCA 4E9KA 1OPOA 4YW6A 2DCJA 1L7QA 4JKMA 1PK6B 1HQNA 1FXZA 2JJ6A 5KHIA 1IPSA 3D82A 1RITA 2TEPA 2ZEXA 2ZGNA 3VBUA 5CFCC 3A0NA 3B5LB 1C28A 1OMIA 1ZRFA 1BEV1 3IBMA 1V70A 3DN7A 1QNYA 4XJ8A 4IEOA 4DB5A 2WZR3 3AFKA 4XVHA 3SH5A 1U5XA 3ZFEC 2YG0A 3VDDA 4IGQA 3CL1A 2WQ4A 1QXJA 3RMYA 3WF4A 4A2UA 3OGSA 4NIGA 5GZFA 3VBUB 2JECA 5ABJA 3FJSA 1UYXA 1Y3TA 2ARCA 2EXJA 3ZYPA 1R1ZA 2AC1A 4D8MA 3ZFFA 1DZQA 4AEMA 1GZWA 2Y6LA 1O59A 3K2OA 5FZDA 4PQ9A 1E5SA 2KR2A 2VMIA 4N9IA 3VDDB 2LTNA 2QFEA 3B3QE 1QIQA 4CP9A 4KMQA 5FLHA 4AQSA 5FZ9A 4EV0A 4Q0VA 4FFGA 2W9XA 3IMMA 4OYUA 1LGCA 3BIEA 4BZ4A 3TEZA 2JD9A 4LA3A 1GZWB 1VBB2 5FY4A 5A3LA 1IKQA 5CADA 1AF9A 1RUD3 4FXGB 3PDQA 4CP9B 4Z2WA 4KU7A 1YYNA 1J84A 1UOGA 3I2HA 5KC6A 4AQTA 5C3OA 2VJXA 5K0UC 4ITCA 3LDKA 4AG4A 4GWMA 1S0GA 5LEJA 1ONAA 2ZGKA 2RHPA 5E8AA 4P5YA 1AL21 4RSUA 3BIWE 5LB6A 2HWD3 1VRH3 2GH8A 3DF0A 3Q8AA 4HLTA 4B7EA 4C1WA 1RUOA 2VO5A 1C3HA 4QX2A 1WW7A 4RS5C 4YFWA 3GDBA 1IKPA 5FYBA 4AAXA 3AYCA 4QDQA 1GSLA 4IL7A 3IM0A 2GN7A 5EQUA 5IWFA 3ZXFA 3OEAA 4LKEA 1O3RA 3MEPA 1AVBA 3I2GA 2NQYA 3GM8A 5F5CA 3E5QA 5CFDC 1NQDA 3NKTA 3LSDA 2ET1A 3RG0A 2PHTA 2GC0A 4OULA 4CCJA 1JS9A 2XBO3 1EUTA 1RIRA 1XNBA 2IFWA 3BGAA 1HDKA 3M3EA 3P6BA 4RGKA 4XJWA 2VVEA 1RVF2 2PMWB 4TXWA 3WDUA 5J09A 2IXIA 2VOKA 2GDFA 2ERFA 2UYAA 3DYMA 3IAPA 3M3QA 3VDBA 4AF9A 2FZ1A 3HOBA 3WNLA 2WO2A 1CX1A 5L9RA 1AYM2 3DKWA 5A33B 4LE3A 1ND2A 3DL3A 5GM0A 3IT8A 1ZYBA 4K7JA 5JOXA 3WOGA 4LA2A 1ODNA 2WNUB 5I93A 4HFSA 2AH2A 3WDYA 3B9CA 1ZM1A 1O91A 2Y34A 2JKBA 1NE4A 5K7PA 4I0AA 4XFBA 2XJQA 3OOXA 2VULA 5FZIA 5IVVA 2EA7A 4ZKTB 2VOVA 4QAWA 5T5JA 3N9MA 4META 4N7IA 4GJYA 3OD4A 1L3JA 2BOJA 2WWUA 3POIA 1GNYA 3OF1A 3VGIA 4XMAA 3WW3A 3B01A 3K3NA 1ENQA 5EIYB 2QBXA 4Q4X1 5FPVA 3TNPB 5A7QA 4DXSA 4CU8A 5IT6A 2A7AA 4LKSA 3LFMA 1W90A 2R062 4IV1A 1LOGA 2ZX4A 4I02A 5C3PA 5CISA 2JWPA 3FN9A 4XZUG 3ZSLA 3VBFB 2R072 1QJY3 1SBDA 3PURA 4L2NA 4L92A 5EJZB 4MGYE 4LOTA 1NAEA 1UNBA 5C6CA 5C8CA 2VZTA 5FV3A 3OTFA 1YFXA 4YGEA 1W05A 5FK7A 1XYOA 1OH4A 4IV1B 5B4XA 2JEMA 5FKCA 5FWJA 1MS0A 1E57A 4CXYA 3D8CA 4IGOA 2VVFA 2HWE3 2PAEA 4A7KA 4EZ4A 3LWCA 5JOYA 1Z7S3 4INDA 2GMMA 5HV0A 3L9JT 4GWIA 3RQ0A 5C8CB 1HRI2 1FNZA 1Y9QA 2HYKA 2VZQA 1H6YA 3JD71 3VZLA 2GP3A 4R9AA 5D8AA 1BEV3 1RL3A 3M3OA 2VMCA 2YYOA 2OVUA 4CDUB 1WD3A 2OZ6A 5GKAC 2Z42A 4QPGC 2YHJA 5F6KA 2C9KA 2GH2A 1GQHA 3W20A 2QQIA 1N3QA 4JGZC 4O7XA 1PZ9A 4DQAA 4EN0A 1WCDJ 4XF1A 2CU5A 2JB4A 5J48A 5EYXA 5FUPA 3OBAA 3RWNA 3WCRA 4N43A 5GZGA 5D8AB 5FLJA 3WF1A 3AMNA 5JIAA 1UMHA 2WRAA 3GYDA 4IV3A 2WT2A 5CKNA 3HQUA 3HN1A 4GXLA 2W39A 1DU3D 2YB7A 2JG9B 2Y38A 1OKOA 2PXJA 2UWCA 2VCBA 2YZ4A 4I3GA 2DBIA 4YARA 2QZ3A 3JB4C 3NL1A 4DXZA 2PHUA 2WNVC 2BFUL 2WS91 4HK9A 3U07A 5FPUA 3RZLA 4LK7A 1ND3C 2CDPA 2HWB1 2JDZA 2VUAA 1XB9A 3NJZA 1NOVA 3HBKA 2D6KA 3NRUA 4GA9A 2OQ7A 4IV3B 1ZBA1 4JHZA 5FUNA 1W8TA 1LB2A 4XQ4A 3K48A 4OHZA 5F3EA 5JOZA 2OX0A 4RHV1 2RDRA 3NAPC 5LK7B 1F5FA 4QXHA 3ATGA 4LO4B 3OUIA 5FZFA 3PL0A 1UW8A 2P3KA 2XJRA 1QHDA 2WC2A 4GWNA 2W3JA 2JDNA 1SLAA 4AFBA 5FZ4A 5JIUA 3PJYA 1MPXA 3OGJA 4C90A 1AL23 4HSJA 2D6MA 2RDSA 2YPJA 1O4YA 2UU8A 1XC6A 4IE7A 5DMYA 5E16A 3THTA 4H3WA 1J3RA 3P3PA 3KLSA 1ZBE2 4KU8A 2YC2A 2PHDA 2BNMA 3LDBA 4YG3A 1QY4A 3W5MA 2C5DA 3B7MA 1AUYA 5I91A 1KFXL 3MI8A 4FPYA 1XU2A 3KM5A 4S2FA 4D6QA 1Y9MA 2NMOA 4WVWA 2GAUA 3VKNA 5FIXA 1D7PM 5H9SA 3CMGA 1UYZA 2BW8A 3POWA 4CU6A 4P9YA 3M70A 1HB2A 4YNIA 3MF6A 2ZGRA 1VAVA 4JGYB 3T0BA 2DVAA 3CIHA 4P00B 2DUOA 3THPA 3J4UH 4XUOA 2PHRA 3I3BA 2W1WA 1JI6A 2BEOA 4RGAA 5JR7B 3OPTA 4GH4A 2ZGPA 3MW3A 3ZPYA 3OCPA 4FTBA 4PIYA 1NX9A 1SDDB 1XOYA 2VOTA 4IDZA 4YM2A 1G9CA 4CCLA 1OLME 3T0DA 1XJAA 4Y5Z0 4MYEA 2W1UA 3P1IA 3TYJA 2XVLA 1Q3EA 1Y4WA 4IW3A 4BYYA 2OXBA 1ZRCA 1M06G 4FSJA 1X7NA 3BODA 4M3CB 3NSTA 1ULDA 5IVCA 3APBA 4GH4B 3H8UA 4NAOA 5FP4A 1H2KA 4Q4X3 3ZFGB 4AZZA 4BPZA 5JCTA 2WSUA 2AGSA 3S0MA 2SBAA 1YIPA 1AX1A 3J7LA 1AR72 1JHJA 3ALQA 4OCTA 2DCKA 4XFAA 1W2OA 1PVC2 1DCSA 4YVWC 3ZN4A 2J1VA 4NWWA 4YM1A 1ALYA 1YI9A 3WUCA 1GLHA 5EPAA 1CPMA 1WW4A 2E33A 1SCSA 4QQLA 4PDWA 4OI1A 1YFYA 3RI9A 1E5HA 4Q4V1 3VDAA 5IVBA 3SEPA 3HIFA 1BKZA 4JDOA 1WCUA 4D7YA 4N53B 1QDOA 5FO8B 4LPLA 3LA7A 3FWEA 5GLZA 4Q0SA 3VKFC 1DLCA 1V6JA 3I7DA 5IVFA 1NLQA 1MEC2 4LMFA 4JX0A 4CCNA 5JSPA 4PDWB 4Q4Y2 2WL1A 4QKNA 2ZMNA 4AHZA 1DLLA 3JD73 5B2GB 3SKJE 1OOPC 3HVDA 3IPVA 4LBKA 4R9CA 4XAEA 5AVPA 5FZGA 4Y4RA 2ORXA 4BQXA 2BGPA 1CJDA 4EN8B 1CAVA 1WD4A 3G7DA 1VAKA 3IB3A 2WFPA 3P5BA 3TB0A 4C1XA 4XILA 2JE8A 1DGRA 1EAH2 4OI2A 1YQ2A 1YUDA 1FMD1 4UAPA 5FQ0B 2QVSB 3PNAA 1ASJ2 3H8RA 3SITA 5L9VA 5LY2A 1QEXA 2YU2A 3IPVB 4NWVA 3H42B 3AJZA 3AXEA 4QXKA 1W3VA 2F4PA 5JPNB 4PLNA 2PQQA 2XBO2 2BU9A 3EJKA 4YGCA 5SV5A 3VUOA 2VBPA 1ULPA 1SFPA 5CFDA 1UY1A 2YFUA 2YBPA 1W0NA 2E7QA 4W6XA 1IS3A 1JUIA 5BNOB 1BQPA 4UF0A 1DYOA 3K4AA 4IE6A 4XBNA 5DG2A 2WS93 1LHWA 3CO2A 3O0VA 1W3XA 1XE0A 3WG4A 1W2AX 2HWB3 5G05L 1B09A 1PK6C 3RGBA 4FPHA 4JC1A 2XG3A 1UPSA 4Q4W3 1ZBA3 3HT1A 4I0WB 3SLIA 1JZ5A 1HX6A 4RHV3 1CAWB 1XE8A 4DXRA 4LUKA 4YVSA 1DQ4A 4UF0B 4BCUA 1O3QA 3THDA 1LOBA 1W06A 1HV1A 5LW9A 5C8WA 2BWCA 5IATA 1NY72 2GU9A 2QQLA 1EV11 5C9AB 2RMU2 4YW3A 3VBUC 4AE2A 2WR9A 2KXLA 2EXKA 4YZ1A 1OQ1A 4B29A 1AR83 1NUKA 2ETEA 2NYYA 4CCOA 4LOSA 4O9GA 4YVSB 4CCDA 1NCRB 4P9WA 1IQAA 1DQ0A 2EIBA 3LEMA 4QT6A 3VDDC 3QACA 4MH0E 2HEWF 4DIQA 4NAMA 2N7GA 1ZRRA 5AC91 3AB0A 2WJSA 3MIGA 5D21A 3MW2A 1COV1 4X6QB 3NV4A 1LGNA 3V64A 1HN1A 1RUI2 2XQRA 4JDMA 2A70A 4O65A 4YW2A 3BKZA 5FZLA 1W9FA 4XOGA 5LCWL 4OVEA 2QDRA 1TE1B 3KGZA 3RI8A 4AHYA 3WEZA 1GWMA 2VCAA 1S0JA 4QGLA 4XC9A 1SLIA 3GZTB 3VDCA 1J83A 3TAYA 1GBGA 4IEQA 4MSVA 2YV8A 3POEA 5IK7A 4Z92B 4P5HA 2CAUA 1ZX5A 5IVJA 5F5AA 3AMMA 3SH3A 4A3XA 3J9SA 4BQ5A 3ZXLA 2XMLA 3UT0A 2RJ2A 2WABA 5BNNA 3PU3A 4FO9A 2PN5A 2D5FA 3NO8A 5KXEA 1LKNA 3AMHA 4FVVA 1NG0A 3VZMA 3WNKA 4DNYA 5GZDA 4V2WA 2ZKNA 1PO12 1QKQA 1AZDA 4QDSA 5CAZA 1CIWA 5IK4A 4XFCA 3WG1A 5EJ3A 5FP3A 1N1YA 2WNEA 1GP4A 5HCFA 4GIQA 5A7SA 4BU2A 2QE3A 4FPLA 5BNNB 5FZ3A 1JOJA 1H1MA 4LKFA 2KM2A 3LOIA 4DUWA 3D3AA 1GWLA 4XXPA 5CIRA 1ENXA 3ASIA 3UL2A 1AR61 2VH9A 1O4ZA 4LTAA 5A3UA 5JMOA 3M3IA 1UMIA 1DGWX 4YPJA 4K1YA 4E8DA 4UW4A 4CA9A 4XW3A 1O6UA 2A3WA 2HEYF 4M4PA 2HKXA 4PHZA 4ZPIA 3SHRA 2B7YA 3BTZA 1QF3A 3AYDA 3F2ZA 3OBZA 2JD4A 2WA4A 4NRMA 4O9EA 2PHWA 4LQRA 2RS11 4KNCA 4AVSA 4BK4A 3BYWA 4LKDA 3WXPA 4IE4A 3VD3A 3JCIA 1Q5OA 3J7MA 4Q4V3 4QQ2A 5FKBA 2XLFA 3LDRA 2WNUC 2AREA 2IZWA 1AX0A 4AI9A 4CU9A 3B69A 3CKHA 4I30A 3I59B 3BVCA 1HRV1 2VL4A 3VB9A 3LQCA 3S7IA 2VW2A 3N7LA 4H55A 4CU7A 2YGLA 5IVEA 1J3QA 4IESA 4X8PA 4KG0A 2ZZQA 2R49A 4QHBA 4S2HA 5FXXA 2HWC2 2V4VA 2DDUA 1F4AA 1TMF1 5GZCA 4DINB 2VPVA 1W2UA
chains in the Genus database with same CATH topology
1WKYA 4UI9L 5IFTA 1JYWA 2W47A 2WDBA 1BHGA 2EICA 2DCJA 1L7QA 3CZJA 2Y6JA 4JKMA 3WNNA 2ZEXA 3NJVA 3ECQA 3SEEA 2X09A 2EIEA 2J1TA 1O8PA 2J1AA 4BJ0A 4IUGA 4XVHA 4RYDA 2YG0A 3WF4A 3ACGA 3OGSA 3OGVA 1UYXA 4QX1A 2W1SA 4D8MA 3I3DA 3ZM8A 2Y6LA 1O59A 3E1F1 5IFPA 2WZ8A 4KMQA 1CIYA 3VD7A 5JXIA 2ZEZA 2W9XA 4OYUA 3I2JA 2JD9A 4UOJA 4GWJA 3LE0A 1O8SA 4ZZ8A 3T08A 3WNPA 2VR4A 1J84A 1JZ2A 3I2HA 1TG7A 2VJXA 3EB7A 4AG4A 3HPNA 3MUZ1 4A3ZA 1UY3A 2WUHA 4P5YA 3HEIA 1JZ4A 1K12A 2VO5A 4QB6A 4QX2A 3UETA 2ZEYA 3C7OA 3GDBA 4AAXA 2YFZA 1SG3A 3NNGA 4QDQA 3OEAA 3I2GA 3UESA 3T09A 3T0AA 3GM8A 3FL7A 2Y6GA 1W9WA 2W1QA 3BGAA 1EUTA 3P6BA 2B4KA 1GU3A 4DUXA 2BERA 4TXWA 3W5NA 5HPOA 1F4HA 3DYMA 3VDBA 3IAPA 3HNBM 4MO3M 3HOBA 3WNLA 1CX1A 2WO2A 2QQOA 4ARXA 3LPGA 4OUEA 3OEBA 1TVGA 4XURA 2Y6HA 2Y6KA 2OKXA 2W94A 2Y8KA 3HJRA 3HNYM 1UYYA 1UXXX 4KWUA 2J1SA 4QAWA 2E26A 2ZEWA 1PX4A 3K4DA 4KI5M 4XUQA 3WQBA 2QQKA 3ETPA 1GNYA 5EIYB 2QBXA 3I97A 3WF2A 4DXSA 4CU8A 2KD7A 4A4AA 4LKSA 1GOGA 4CUAA 3FN9A 3K46A 4XZUG 2X05A 5JUVA 3I2FA 3JXSA 4W4ZA 5EJZB 3J7HA 1NAEA 4L0PA 2VZTA 4XUPA 1R64A 3LEKA 1KGYA 1OH4A 2VZ3A 5B4XA 1T2XA 3MO4A 2LS6A 2JDAA 4MGSA 1OF4A 1JYXA 2QQJA 2ZXQA 4GWIA 2E32A 2VCCA 3WF3A 3VD9A 1DP0A 4DEVA 5JXJA 2VZQA 3CZUA 5CZKA 1H6YA 1W8NA 3NQHA 4W8JA 2WQ8A 1JU4A 2VMCA 2VZPA 3HNMA 2XQXA 3GGLA 2VM9A 4E8CA 1W99A 2C9KA 2CDOA 2QQIA 1OF3A 2W91A 3OBAA 2VZOA 4MGQA 4OZOA 1UZ0A 3WF1A 1XPWA 1UMHA 1UY0A 3T2OA 4OMDA 3T2QA 4ZZ5A 4XUNA 1K45A 4ZXEA 2YB7A 2HYXA 2VCBA 1OT5A 2QQMA 4JKKA 2CDPA 5FUIA 3WSOA 2J7MA 3NRUA 4JHZA 4PF1A 4TTGA 1K3IA 4JKLA 5DPNA 5HXMA 2W5FA 4HG6B 1CZVA 2W3JA 2RV9A 2BGOA 2W87A 1MPXA 5DQ0A 2YC4A 3VD4A 1JZ7A 1XC6A 5DMYA 3WNOA 3A22A 1JU3A 1CZTA 2XOMA 3DYPA 2YC2A 3W5MA 2VC9A 3AC0A 3NJXA 2Z4FA 3A7QA 3BN6A 4ZY9A 2RVAA 1CZSA 5LA1A 1D7PM 2J1UA 3CMGA 1UYZA 5LA2A 2B9VA 3ACFA 4CU6A 4DXTA 1RYYA 2VQUA 3C7GA 2PQSA 1K42A 3SKVA 3T0BA 2WN2A 3CIHA 4P00B 4PQQA 3LEIA 4XUOA 3I3BA 2W1WA 1JI6A 4CUCA 2W95A 1UY2A 4GZ9A 1GUIA 1SDDB 1NX9A 2VOTA 5A1AA 3T0DA 2W1UA 3P1IA 1IQDC 3T2PA 2HLEA 1JYVA 2VZ1A 3GXUA 3I2KA 4QX3A 3K77A 4MADA 3HN3A 1W9SA 2EIDA 1JHJA 1PMJX 3DECA 3PUHA 2LW8A 2DCKA 4D0QA 2J1VA 1UWWA 1KEXA 1XNAA 5C7GA 2E33A 5EJ1B 4P02B 3CQOA 3VDAA 4QX0A 3SEPA 1JZ3A 3C7EA 3CDZB 2BZDA 3A21A 4LPLA 1DLCA 3MUY1 2ID4A 4JX0A 2VMFA 4QPWA 3PUIA 5JR2A 1LNSA 3C7HA 3SKJE 3C7FA 4A41A 1WCQA 5I0DA 2ORXA 4BK5A 2BGPA 3OG2A 5G04L 1PMHX 2R7EB 3IB3A 2JE8A 4QB1A 1YQ2A 2WO1A 4P08A 4UAPA 5B4NA 4FI9A 4A42A 3DYOA 1I5PA 2C26A 3FHQA 3IAQA 5LA0A 5C70A 1OD3A 5J1XA 2Y64A 4CVUA 2JKXA 1GQPA 3K75B 1ULPA 2WZEA 1UY1A 3A23A 4DUVA 2YFUA 3K4ZA 1W0NA 1GMMA 1DYOA 2W92A 3K4AA 2XONA 2VMEA 1JZ8A 2E31A 5G05L 3ACIA 3I2IA 4ET7A 4A44A 1JZ5A 3MV01 5JXHA 4DXRA 1XNTA 2VZRA 3THDA 3FHAA 1L7RA 4CUBA 2VTFA 1W9TA 5C71A 4RN5A 2WAOA 2QQLA 1ULOA 2C4XA 1NUKA 2WAAA 2EIBA 5IJRA 4MOAA 2ORZA 2VZUA 3U37A 1HN1A 1JZ6A 2VZVA 3OB8A 5LCWL 5IYYA 1SHWB 3WEZA 5IHRA 2VCAA 3I3EA 3VDCA 1J83A 5JXGA 4BXSV 3WF0A 5DN2A 2QQNA 4XUTA 1UY4A 2RJ2A 2WABA 2VZSA 2WYSA 4ARYA 2XHNA 2J1RA 2V5DA 2WBKA 3WNKA 4QDSA 1P8JA 1UXZA 3THCA 1US3A 1EUUA 2WN3A 3IIIA 2V72A 4DUWA 4QB2A 2J1EA 1GOHA 3D3AA 3ACHA 4OMCA 3IDAA 1H6XA 4A45A 1US2A 5JMOA 4PT6A 4M4RA 1UMIA 2VQTA 4YPJA 4E8DA 2BBAA 1NKGA 4M4PA 3F2ZA 3EYPA 3OGRA 2WO3A 4LQRA 4BK4A 2X10A 5CYYA 3UNPA 3LPFA 3MV11 3VD3A 4QDRA 4BDVB 3WNMA 3MBWA 1JYNA 3ABZA 4Z2AA 3LEGA 3VD5A 4CU9A 4DEQA 3CKHA 2VL4A 1W8OA 2J22A 1UX7A 4LHSA 3C8XA 1PX3A 3LQCA 4CU7A 1GOFA 2L9LA 2VMDA 2V4VA 2DDUA 1F4AA 2W46A 5F7UA 4W50A 4A6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WKY A;  4UI9 L;  5IFT A;  1JYW A;  2W47 A;  2WDB A;  1BHG A;  2EIC A;  2DCJ A;  1L7Q A;  3CZJ A;  2Y6J A;  4JKM A;  3WNN A;  2ZEX A;  3NJV A;  3ECQ A;  3SEE A;  2X09 A;  2EIE A;  2J1T A;  1O8P A;  2J1A A;  4BJ0 A;  4IUG A;  4XVH A;  4RYD A;  2YG0 A;  3WF4 A;  3ACG A;  3OGS A;  3OGV A;  1UYX A;  4QX1 A;  2W1S A;  4D8M A;  3I3D A;  3ZM8 A;  2Y6L A;  1O59 A;  3E1F 1;  5IFP A;  2WZ8 A;  4KMQ A;  1CIY A;  3VD7 A;  5JXI A;  2ZEZ A;  2W9X A;  4OYU A;  3I2J A;  2JD9 A;  4UOJ A;  4GWJ A;  3LE0 A;  1O8S A;  4ZZ8 A;  3T08 A;  3WNP A;  2VR4 A;  1J84 A;  1JZ2 A;  3I2H A;  1TG7 A;  2VJX A;  3EB7 A;  4AG4 A;  3HPN A;  3MUZ 1;  4A3Z A;  1UY3 A;  2WUH A;  4P5Y A;  3HEI A;  1JZ4 A;  1K12 A;  2VO5 A;  4QB6 A;  4QX2 A;  3UET A;  2ZEY A;  3C7O A;  3GDB A;  4AAX A;  2YFZ A;  1SG3 A;  3NNG A;  4QDQ A;  3OEA A;  3I2G A;  3UES A;  3T09 A;  3T0A A;  3GM8 A;  3FL7 A;  2Y6G A;  1W9W A;  2W1Q A;  3BGA A;  1EUT A;  3P6B A;  2B4K A;  1GU3 A;  4DUX A;  2BER A;  4TXW A;  3W5N A;  5HPO A;  1F4H A;  3DYM A;  3VDB A;  3IAP A;  3HNB M;  4MO3 M;  3HOB A;  3WNL A;  1CX1 A;  2WO2 A;  2QQO A;  4ARX A;  3LPG A;  4OUE A;  3OEB A;  1TVG A;  4XUR A;  2Y6H A;  2Y6K A;  2OKX A;  2W94 A;  2Y8K A;  3HJR A;  3HNY M;  1UYY A;  1UXX X;  4KWU A;  2J1S A;  4QAW A;  2E26 A;  2ZEW A;  1PX4 A;  3K4D A;  4KI5 M;  4XUQ A;  3WQB A;  2QQK A;  3ETP A;  1GNY A;  5EIY B;  2QBX A;  3I97 A;  3WF2 A;  4DXS A;  4CU8 A;  2KD7 A;  4A4A A;  4LKS A;  1GOG A;  4CUA A;  3FN9 A;  3K46 A;  4XZU G;  2X05 A;  5JUV A;  3I2F A;  3JXS A;  4W4Z A;  5EJZ B;  3J7H A;  1NAE A;  4L0P A;  2VZT A;  4XUP A;  1R64 A;  3LEK A;  1KGY A;  1OH4 A;  2VZ3 A;  5B4X A;  1T2X A;  3MO4 A;  2LS6 A;  2JDA A;  4MGS A;  1OF4 A;  1JYX A;  2QQJ A;  2ZXQ A;  4GWI A;  2E32 A;  2VCC A;  3WF3 A;  3VD9 A;  1DP0 A;  4DEV A;  5JXJ A;  2VZQ A;  3CZU A;  5CZK A;  1H6Y A;  1W8N A;  3NQH A;  4W8J A;  2WQ8 A;  1JU4 A;  2VMC A;  2VZP A;  3HNM A;  2XQX A;  3GGL A;  2VM9 A;  4E8C A;  1W99 A;  2C9K A;  2CDO A;  2QQI A;  1OF3 A;  2W91 A;  3OBA A;  2VZO A;  4MGQ A;  4OZO A;  1UZ0 A;  3WF1 A;  1XPW A;  1UMH A;  1UY0 A;  3T2O A;  4OMD A;  3T2Q A;  4ZZ5 A;  4XUN A;  1K45 A;  4ZXE A;  2YB7 A;  2HYX A;  2VCB A;  1OT5 A;  2QQM A;  4JKK A;  2CDP A;  5FUI A;  3WSO A;  2J7M A;  3NRU A;  4JHZ A;  4PF1 A;  4TTG A;  1K3I A;  4JKL A;  5DPN A;  5HXM A;  2W5F A;  4HG6 B;  1CZV A;  2W3J A;  2RV9 A;  2BGO A;  2W87 A;  1MPX A;  5DQ0 A;  2YC4 A;  3VD4 A;  1JZ7 A;  1XC6 A;  5DMY A;  3WNO A;  3A22 A;  1JU3 A;  1CZT A;  2XOM A;  3DYP A;  2YC2 A;  3W5M A;  2VC9 A;  3AC0 A;  3NJX A;  2Z4F A;  3A7Q A;  3BN6 A;  4ZY9 A;  2RVA A;  1CZS A;  5LA1 A;  1D7P M;  2J1U A;  3CMG A;  1UYZ A;  5LA2 A;  2B9V A;  3ACF A;  4CU6 A;  4DXT A;  1RYY A;  2VQU A;  3C7G A;  2PQS A;  1K42 A;  3SKV A;  3T0B A;  2WN2 A;  3CIH A;  4P00 B;  4PQQ A;  3LEI A;  4XUO A;  3I3B A;  2W1W A;  1JI6 A;  4CUC A;  2W95 A;  1UY2 A;  4GZ9 A;  1GUI A;  1SDD B;  1NX9 A;  2VOT A;  5A1A A;  3T0D A;  2W1U A;  3P1I A;  1IQD C;  3T2P A;  2HLE A;  1JYV A;  2VZ1 A;  3GXU A;  3I2K A;  4QX3 A;  3K77 A;  4MAD A;  3HN3 A;  1W9S A;  2EID A;  1JHJ A;  1PMJ X;  3DEC A;  3PUH A;  2LW8 A;  2DCK A;  4D0Q A;  2J1V A;  1UWW A;  1KEX A;  1XNA A;  5C7G A;  2E33 A;  5EJ1 B;  4P02 B;  3CQO A;  3VDA A;  4QX0 A;  3SEP A;  1JZ3 A;  3C7E A;  3CDZ B;  2BZD A;  3A21 A;  4LPL A;  1DLC A;  3MUY 1;  2ID4 A;  4JX0 A;  2VMF A;  4QPW A;  3PUI A;  5JR2 A;  1LNS A;  3C7H A;  3SKJ E;  3C7F A;  4A41 A;  1WCQ A;  5I0D A;  2ORX A;  4BK5 A;  2BGP A;  3OG2 A;  5G04 L;  1PMH X;  2R7E B;  3IB3 A;  2JE8 A;  4QB1 A;  1YQ2 A;  2WO1 A;  4P08 A;  4UAP A;  5B4N A;  4FI9 A;  4A42 A;  3DYO A;  1I5P A;  2C26 A;  3FHQ A;  3IAQ A;  5LA0 A;  5C70 A;  1OD3 A;  5J1X A;  2Y64 A;  4CVU A;  2JKX A;  1GQP A;  3K75 B;  1ULP A;  2WZE A;  1UY1 A;  3A23 A;  4DUV A;  2YFU A;  3K4Z A;  1W0N A;  1GMM A;  1DYO A;  2W92 A;  3K4A A;  2XON A;  2VME A;  1JZ8 A;  2E31 A;  5G05 L;  3ACI A;  3I2I A;  4ET7 A;  4A44 A;  1JZ5 A;  3MV0 1;  5JXH A;  4DXR A;  1XNT A;  2VZR A;  3THD A;  3FHA A;  1L7R A;  4CUB A;  2VTF A;  1W9T A;  5C71 A;  4RN5 A;  2WAO A;  2QQL A;  1ULO A;  2C4X A;  1NUK A;  2WAA A;  2EIB A;  5IJR A;  4MOA A;  2ORZ A;  2VZU A;  3U37 A;  1HN1 A;  1JZ6 A;  2VZV A;  3OB8 A;  5LCW L;  5IYY A;  1SHW B;  3WEZ A;  5IHR A;  2VCA A;  3I3E A;  3VDC A;  1J83 A;  5JXG A;  4BXS V;  3WF0 A;  5DN2 A;  2QQN A;  4XUT A;  1UY4 A;  2RJ2 A;  2WAB A;  2VZS A;  2WYS A;  4ARY A;  2XHN A;  2J1R A;  2V5D A;  2WBK A;  3WNK A;  4QDS A;  1P8J A;  1UXZ A;  3THC A;  1US3 A;  1EUU A;  2WN3 A;  3III A;  2V72 A;  4DUW A;  4QB2 A;  2J1E A;  1GOH A;  3D3A A;  3ACH A;  4OMC A;  3IDA A;  1H6X A;  4A45 A;  1US2 A;  5JMO A;  4PT6 A;  4M4R A;  1UMI A;  2VQT A;  4YPJ A;  4E8D A;  2BBA A;  1NKG A;  4M4P A;  3F2Z A;  3EYP A;  3OGR A;  2WO3 A;  4LQR A;  4BK4 A;  2X10 A;  5CYY A;  3UNP A;  3LPF A;  3MV1 1;  3VD3 A;  4QDR A;  4BDV B;  3WNM A;  3MBW A;  1JYN A;  3ABZ A;  4Z2A A;  3LEG A;  3VD5 A;  4CU9 A;  4DEQ A;  3CKH A;  2VL4 A;  1W8O A;  2J22 A;  1UX7 A;  4LHS A;  3C8X A;  1PX3 A;  3LQC A;  4CU7 A;  1GOF A;  2L9L A;  2VMD A;  2V4V A;  2DDU A;  1F4A A;  2W46 A;  5F7U A;  4W50 A;  4A6O A; 
#chains in the Genus database with same CATH topology
 1WKY A;  2BV4 A;  1GFF 2;  2DU0 A;  4Y20 A;  2W47 A;  2WDB A;  1BHG A;  1IS6 A;  1GZC A;  1YFW A;  1ZNP A;  2V09 A;  2Y6J A;  5F3I A;  5H9P A;  3WNN A;  2ZHK A;  2ZHM A;  5FDB A;  2XPJ A;  1REE A;  1FMD 3;  2ADE A;  3NJV A;  2XUM A;  1E5I A;  5I0T A;  3SEE A;  3VBF C;  3EMR A;  2XL7 A;  4Z07 A;  1CPN A;  1MVE A;  3I2O A;  1O8P A;  3KCY A;  5AFB A;  2V4A A;  4BLI A;  1M4W A;  2F17 A;  4RYD A;  2Q1Z B;  1YO8 A;  3AVR A;  4SLI A;  3TEW A;  3QBQ A;  3WCS A;  4D94 A;  2BOI A;  3WHT A;  4IV1 C;  1RUC 2;  1LOF C;  1UOB A;  4H7M A;  4QX7 A;  2ZMK A;  1VE0 A;  3JZV A;  4LIV A;  2D6P A;  4QX1 A;  1ENR A;  4J1W A;  1IPJ A;  2WFF 1;  3ZM8 A;  2CHH A;  4NRP A;  2IXJ A;  3E1F 1;  4CDX A;  5C8C C;  5A80 A;  1QJU 1;  5FYH A;  4YZ2 A;  1DGW A;  2GC1 A;  2WNO A;  1RUJ 3;  1XXN A;  2ARA A;  1CIY A;  2IXH A;  2C1F A;  1FPN 2;  3K51 A;  3KGL A;  4XDO A;  4CDU C;  1DQ2 A;  3MIE A;  1AYN 1;  2OII A;  1GV9 A;  4CDX B;  3WQ1 A;  5J37 A;  3NJY A;  1ZRE A;  3VHP A;  2AR6 A;  5LY1 A;  2QCS B;  3WNP A;  3CLP A;  1EV1 3;  1FNY A;  2VR4 A;  5F9T A;  1TNF A;  2WIN B;  1LHN A;  2DUR A;  4UFJ A;  5D8A C;  3RFR A;  2ZOE B;  1TG7 A;  3WDX A;  2G19 A;  4RA0 A;  4FOQ A;  5FYM A;  5BXX A;  3P3N A;  4C91 A;  5AC9 3;  3FLP A;  4NHY A;  1RMU 2;  1R08 1;  1VRB A;  1O5U A;  1SLL A;  3TN9 2;  2JG9 C;  3IN9 A;  1U12 A;  3AZX A;  1COV 3;  1LEC A;  1KRI A;  3ZVX A;  1JZ4 A;  1WBF A;  3ZIW A;  5T5L A;  2PAK A;  1R09 1;  4I3P A;  5GZE A;  4IV3 C;  1QQP 1;  4IGP A;  1N47 A;  2YFZ A;  1REF A;  4CCK A;  2VBB A;  4N7U A;  3T0A A;  1CN1 A;  1FOD 1;  1NZI A;  2R1B A;  1Q8V A;  3IIA A;  2MEV 2;  1AXZ A;  1W9W A;  1ST8 A;  5FPA A;  5HCB A;  3URF A;  1LR5 A;  1G9B A;  1J1T A;  2D7F A;  2GN3 A;  3QOP A;  2B4K A;  1MZ5 A;  3EQE A;  5A3O A;  2BER A;  2GNT A;  3RSJ A;  1F8V A;  4HPK A;  1RUF 1;  1GP5 A;  3N9N A;  5FP7 A;  3E5X A;  1VMF A;  1KIT A;  1R1A 1;  1Z78 A;  3KB5 A;  3Q8F A;  4Q5O A;  5DAB A;  4ARX A;  4QQH A;  5FY0 A;  3ETQ A;  4MV2 A;  1DIW A;  2K46 A;  3AK0 A;  4E2Q A;  3N7M A;  3LPG A;  4OUE A;  4Y26 A;  4IET A;  2RR1 1;  4L97 A;  2SLI A;  1UIJ A;  4H7L A;  1ULF A;  1K5J A;  3CBN A;  2OKX A;  3K3O A;  2W94 A;  3PU8 A;  1H1A A;  3B94 A;  4ERO A;  3HJR A;  2P3I A;  1UYY A;  3HNY M;  3OJB A;  4M0N A;  1SZB A;  5CG9 A;  5JPM B;  1EPW A;  3RDI A;  1AR6 3;  2ZEW A;  1PX4 A;  3K4D A;  4BME A;  4XUQ A;  3WQB A;  2ZBJ A;  2VGD A;  2X8K A;  3MLJ A;  1BCX A;  4PJY A;  4UFK A;  2RM2 3;  4ES9 A;  1YWK A;  3ZDS A;  4FAG A;  1C5H A;  3MHZ A;  2OS2 A;  3I97 A;  4NO4 A;  1W8F A;  3MID A;  5FZB A;  2I45 A;  1QWR A;  5ACA 1;  2B5H A;  2RS1 3;  4JGY C;  1PIV 2;  1YEW A;  3AMQ A;  4QD2 A;  3T4H B;  2R1D A;  2X05 A;  1UZZ A;  1BVV A;  4Q4W 2;  1NLS A;  4W4Z A;  2D5H A;  4DRR A;  2QNK A;  5A6Q A;  1JYT A;  4BQW A;  4L0P A;  3JBG 1;  4OI4 A;  1PK6 A;  1PGW 2;  1VP6 A;  1UD1 A;  4HK8 A;  1HRV 3;  4WM7 A;  4XUP A;  1ULG A;  4IEW A;  4DY3 A;  3LEK A;  1KGY A;  1STM A;  4A7Y A;  2HJI A;  5FY5 A;  1GR3 A;  3MO4 A;  1K5M A;  3ZYF A;  5BNP B;  1KFU L;  2LS6 A;  4CEW A;  3KT4 A;  1S2K A;  1RHI 1;  1TMF 3;  5JI7 A;  3ON7 A;  5I8T A;  5LEK A;  1AR8 2;  4COW A;  1HXS 2;  2ZXQ A;  4GH4 C;  5T55 A;  3ZFG C;  4GUL A;  3VHR A;  2E32 A;  3ZXG A;  4E4H A;  4WM7 B;  2VCC A;  5FAX A;  3CF6 E;  5T5O A;  3WF3 A;  3VD9 A;  1DP0 A;  4DEV A;  1VMJ A;  5JXJ A;  3O1S A;  1W6O B;  4NHX A;  5CZK A;  1K5M B;  2ZAB A;  2R32 A;  4CEW B;  3BU0 A;  4W8J A;  2XL9 A;  3ENR A;  1QJE A;  4UFL A;  1FV3 A;  1Q8Q A;  2VTX A;  3CEW A;  1QOT A;  1N3P A;  3GZE A;  4NMI A;  4EJR A;  3S57 A;  1W99 A;  1PO2 1;  3KZ4 C;  4QQO A;  3LIG A;  1LHO A;  3RZZ A;  4YFZ A;  1OF3 A;  3ILN A;  4TLF A;  4EN6 B;  1KDM A;  4R52 A;  1HN0 A;  5LBB A;  4CXW A;  1NYW A;  5D2A A;  3X29 B;  4AQ6 A;  4N53 C;  4K21 A;  4LBQ D;  1XPW A;  2WFF 3;  4IQP A;  2Y26 A;  2E9Q A;  1UY0 A;  1V6I A;  4NN0 A;  4OUM A;  3N9P A;  3T2O A;  1RUH 1;  1SLB A;  1UN1 A;  2ZHN A;  1QJU 3;  1J58 A;  4PDW C;  4XJU A;  4XUN A;  3O7O A;  2QQV A;  2W52 A;  1CWP A;  3H1Y A;  1CGP A;  3WG2 A;  5JLV A;  1EP0 A;  1DYK A;  4XBQ A;  1OT5 A;  4H2A A;  3E6C C;  3O1V A;  1AYN 3;  2BJS A;  3L2Y A;  2X53 S;  1XYN A;  4Q8L A;  2C24 A;  5IW0 A;  1ZZ8 A;  4XQD A;  3NNM A;  4MXW A;  4U36 A;  1SCR A;  4KG8 A;  4YYO A;  4XFG A;  1GP6 A;  2NLR A;  4CP1 A;  2FDG A;  2Y6F A;  2XH6 A;  1TQ5 A;  2JDP A;  4XTM A;  3TNQ A;  1CZV A;  2ZPX A;  5FCC A;  1CES A;  2JDH A;  2VBD A;  3WLU A;  2ENR A;  5K4L A;  1NE6 A;  4TN7 A;  4ZS2 A;  3H9A A;  4MXW B;  3H7Y A;  2YC4 A;  1HB4 A;  3O1T A;  1R08 3;  3AP9 A;  3QH6 A;  5E89 A;  4ATE A;  5BNO C;  4YZ5 A;  2Y0I A;  2MHF A;  4UW6 A;  5FZ6 A;  1R09 3;  2TUN A;  1U5I A;  4TYS A;  2IXC A;  2XOM A;  5HI0 A;  1WW5 A;  4FPG A;  3D4K A;  4YZ4 A;  2FDK A;  4BQ2 A;  4NIH A;  5A33 A;  5A3M A;  1I5Z A;  2ZML A;  2QQW A;  2VC9 A;  2Z4F A;  1GWK A;  2WNU A;  2PLV 2;  2DV9 A;  4HBN A;  4HZF A;  4K6B A;  4CEY A;  2RVA A;  4CPB D;  2FDJ A;  4MGZ E;  3WZ1 A;  2H6B A;  3DUI A;  2DUQ A;  3ZKY A;  4IEY A;  5C5U A;  5F3C A;  3MIC A;  2RS5 2;  1NLR A;  1RUF 3;  2J1U A;  5LA2 A;  3BOP A;  3LB9 A;  4DZG A;  5C9A C;  2OUH A;  4QKB A;  1BBT 3;  1RYY A;  4TLG A;  1KDK A;  4GAL A;  4Y33 A;  1R1A 3;  4XFH A;  1K42 A;  3SKV A;  3H7J A;  4RL7 A;  4YVS C;  3KQR A;  4XDQ A;  1NCR C;  3VV1 A;  3ZKU A;  3ZSE A;  3KS7 A;  4PQQ A;  4YM3 A;  4CEY B;  2VG9 A;  3LEI A;  3O0X A;  3T1L A;  2RR1 3;  4H14 A;  3PUQ A;  1VJ2 A;  3IMN A;  1NCQ B;  3H8O A;  4P14 A;  3OSD A;  4AFC A;  4GB3 1;  4GMP 1;  4QXC A;  1BVP 1;  2I2S A;  4GZ9 A;  4IEU A;  2ZGL A;  5T54 A;  5A1A A;  3VBF A;  3AJY A;  3RRD A;  2BQP A;  1PZ8 A;  4RFT 0;  1IQD C;  3UGF A;  2ZS6 B;  1PGL 1;  3FLR A;  3JUU A;  1PNF A;  1YIF A;  1O3T A;  4KH9 A;  3GXU A;  3I2K A;  1XNC A;  1OFS A;  3PLQ A;  4R9B A;  5F37 A;  1LOF A;  1H1I A;  1D4M 3;  1HJG A;  1QOO A;  4BM8 A;  3HN3 A;  5GLV A;  1W9S A;  3AKT A;  3O1M A;  2A3Y A;  4AI1 A;  3RS6 A;  5ACA 3;  1OSG A;  3DEC A;  2LW8 A;  2XVG A;  1VBD 2;  1RGS A;  3LGR A;  5FYV A;  1XNK A;  4JRL A;  4D0Q A;  1RUJ 2;  3VHN A;  3O1R A;  3J8F 2;  1S0D A;  1JTZ X;  1TNR A;  5LBE A;  4XCB A;  1VBE 1;  4YGD A;  1KEX A;  5C7G A;  3CHX A;  3JBG 3;  4QU1 A;  5BNQ A;  1U0A A;  4LBJ A;  3G6J B;  5IVY A;  3CQO A;  1V9U 2;  1OUS A;  4MZU A;  4LIT A;  5F2W A;  5J3U A;  4X6R B;  4CDU A;  1WLW A;  2D93 A;  3N9O A;  2GNB A;  4LUM A;  3LAG A;  4N9H A;  1N1V A;  1GZ9 A;  1RHI 3;  1UPI A;  3C7E A;  4RR3 A;  3CDZ B;  2BZD A;  1CVN A;  3FFQ A;  1NXM A;  3ROU A;  1DGR N;  2VMF A;  1VBA 1;  4RQP B;  4XZP A;  5JR2 A;  1JN2 P;  1RUE 1;  2R0H A;  1DHK B;  1YLL A;  1JW6 A;  2WWS A;  3U10 A;  1UX6 A;  2G4I A;  4GKX A;  4UFH A;  2RDQ A;  3C7F A;  3PVO A;  1WCQ A;  2X5I A;  4DPN A;  1COV 2;  4OLL A;  4K8F A;  3OG2 A;  2JG8 B;  4FQZ A;  3ITQ A;  4RR3 B;  2WT0 A;  2WLP A;  1IZ3 A;  1RUG 1;  3PVN A;  5SV8 A;  4CP0 A;  1GAN A;  1PO2 3;  2JIJ A;  4QKD A;  3Q8E A;  4QB1 A;  4LHK A;  2JG9 A;  2B42 B;  2JB8 A;  1BMV 1;  5H9Q A;  2RG4 A;  3V0B A;  4K20 A;  3S5A A;  2IUW A;  4A42 A;  5EWS A;  1WZX A;  3MDP A;  2XJP A;  1QXP A;  4HMZ A;  3WG3 A;  3IAQ A;  3F95 A;  5KXC A;  2X5I B;  4Q27 A;  2Q1M A;  1KD7 A;  2JDK A;  4COZ A;  1HB3 A;  5J7M A;  2JKX A;  5DDJ 2;  1LUL A;  2DFB A;  1RUH 3;  5K8S A;  1TME 1;  2R04 2;  3DV8 A;  2GSY A;  4HSL A;  5C33 A;  2WA3 A;  3V0B B;  3K4Z A;  4CCE A;  1YCI A;  2W92 A;  1WWY A;  5CU1 A;  3M7A A;  4XET A;  2XON A;  5JVV A;  5KHG A;  2EF6 A;  4LO5 B;  4CXX A;  3I2I A;  1O7F A;  5FYT A;  5FK8 A;  3DPR C;  1DF0 A;  3M2M A;  3ZXK A;  1DZR A;  4HN1 A;  2CGO A;  2D6O X;  2P2K A;  5JXH A;  1XNT A;  2GMP A;  1RED A;  2RDN A;  2XR4 A;  1AR9 1;  1YRZ A;  2EVX A;  3AZV A;  2BNN A;  4L8Q A;  3GBF A;  5F39 A;  1L7R A;  3W59 A;  2VTF A;  3VN4 A;  1C8M 1;  1W9T A;  1SFN A;  1EYB A;  4RN5 A;  2DCY A;  1X8E A;  4AI3 A;  2RM2 2;  2HWF 2;  2C4X A;  1VBC 1;  3B9I A;  2IVJ A;  3N35 A;  3PUA A;  1XQN A;  2HH9 A;  2WAA A;  5DUV A;  2PAM A;  5BV6 A;  5KHJ A;  1I9R A;  3AP7 A;  1W2T A;  4LK6 A;  3I4I A;  5BUV A;  2JDY A;  2AEZ A;  3WW1 A;  1KJR A;  2CWM A;  2W2I A;  3H3L A;  1OPM A;  4JGY A;  4PLO A;  3U37 A;  2RS3 1;  4CE8 A;  5FRA A;  3RYP A;  4CDX C;  2NPI A;  5IHR A;  2JEN A;  1CQ9 A;  3I3E A;  4UBG A;  3ZYI B;  2A73 B;  5E6H A;  2OQ6 A;  1H2L A;  1JYI A;  1W28 A;  3PME A;  5FP9 A;  5DUX A;  2A6Y A;  3WF0 A;  3ZYH A;  5DZG A;  4AQ2 A;  2VEC A;  1H2N A;  4X8N A;  4BH9 A;  3H50 A;  4IEX A;  4M3C A;  5FYU A;  2YY1 A;  2R6Q A;  4JTN A;  3RPQ A;  1WLT A;  3ZFG A;  4ARY A;  3WW2 A;  2PHX A;  5TSW A;  2XWB B;  2EAK A;  2WBK A;  5FYZ A;  2WZR 2;  2OPW A;  2FCU A;  4GB3 3;  4GMP 3;  5FMD A;  5FY9 A;  1C8N A;  1UXZ A;  5EYY A;  3OUJ A;  2WN3 A;  1SLT A;  3MYX A;  3Q8C A;  3III A;  4BOW A;  2VD7 A;  3IDC B;  2J1E A;  4AXO A;  3ACH A;  4K1Z A;  2K0G A;  3ZOI A;  1ZRD A;  1HKD A;  4MHR A;  3POS A;  3MIH A;  4HT1 T;  4E27 A;  1G86 A;  1IOA A;  2AAC A;  3WDT A;  4B3N A;  3M3C A;  1VBB 1;  4PT6 A;  4N53 A;  4AGV A;  5JSR A;  1OVS A;  1SPP B;  4QMA A;  2Q8D A;  5C4W B;  4L9B A;  1D4V B;  4XF4 A;  5FY1 A;  4IE5 A;  4JQR A;  4XF0 A;  1VBE 3;  2O1Q A;  1XE7 A;  3KT7 A;  2XKO A;  3OGR A;  2JE9 A;  2WO3 A;  4IE0 A;  1IG3 A;  1UCX A;  2X29 A;  5C5T A;  4XHB A;  2X10 A;  1RUD 2;  4NJ4 A;  5CYY A;  3UNP A;  3LPF A;  4AW7 A;  1JYC A;  3RWK X;  5FLI A;  1SQ4 A;  2E51 A;  3MBW A;  1JYN A;  3ABZ A;  4Z2A A;  5E88 A;  2GZW A;  4QXB A;  4DEQ A;  3GNE A;  4HKO A;  3R0R A;  5LAS A;  1N1T A;  1QU0 A;  1UX7 A;  1HLC A;  3S30 A;  1KJL A;  5FQ0 A;  5KHK A;  3PVB B;  1VBA 3;  1MS9 A;  1QH7 A;  3MF9 A;  2Q5T A;  4LOR A;  4M0H A;  1H9W A;  4IEP A;  5KWR A;  5T3N A;  3ZLI A;  3N4M A;  2XUE A;  2HWD 2;  3NNL A;  4AK3 A;  2WKK A;  2YMZ A;  1VB4 A;  2J42 A;  4JTO A;  3VBS A;  5F7U A;  2ZGT A;  1XND A;  2BBV A;  1VRH 2;  4W50 A;  2QJV A;  4QHZ A;  4UI9 L;  2ZX2 A;  1RUG 3;  5A1F A;  1RTV A;  2EIC A;  3CZJ A;  1F15 A;  2BP6 A;  3NVC A;  5BNO A;  1O4T A;  1G9D A;  2EXI A;  2AEN A;  3AL5 A;  3LA3 A;  3POF A;  2IVI B;  5FYC A;  3GAL A;  2EIE A;  1HJF A;  1RVF 1;  3VBR B;  1OQD A;  1WMD A;  5FXW A;  3VBS B;  2J1T A;  4AFM A;  4BIS A;  5ISL A;  2ZAH A;  1MZ6 A;  1X9T A;  4IUG A;  3O1U A;  2H6C A;  3DXU A;  1AYM 1;  4GD4 A;  1WLC A;  4YG6 A;  3ACG A;  5DAV A;  1CAW A;  2DCZ A;  1TME 3;  5DAQ A;  5FZC A;  5BNP C;  3ZYB A;  1ULC A;  3OGV A;  3VKL A;  2ZGO A;  5FY7 A;  4BIF A;  5I0R A;  4UXA A;  1BBT 2;  5F2S A;  3KV4 A;  3I3D A;  3UV9 A;  3ZXJ A;  4I09 A;  4CP2 A;  3ZN6 A;  4WM7 C;  3D5O A;  4AWD A;  5C9A A;  5CA6 A;  4I0B A;  5IFP A;  2WZ8 A;  3SCF A;  1H9P A;  3QH7 A;  5A7P A;  1K5M C;  4J6G A;  4CEW C;  1MS8 A;  3C2U A;  1NCR A;  1XBF A;  5FMC A;  5FPB A;  2ZEZ A;  3U4X A;  4R8H A;  4XJA A;  3NV1 A;  1TZO A;  1BK1 A;  1H4H A;  2A71 A;  1CON A;  4Q1R A;  1VLN A;  4UOJ A;  4GWJ A;  1C8M 3;  1HB1 A;  3ZN6 B;  5F6L B;  2R06 1;  1Z0H A;  3LA2 A;  3LE0 A;  3V65 A;  3T08 A;  4BQY A;  2XVK A;  3PVE A;  5A3P A;  2R07 1;  3KD4 A;  3ZSJ A;  1VBC 3;  4D3W A;  1D4M 2;  2BNO A;  5EZW A;  5FZ7 A;  3VLB B;  4AFA A;  2YBS A;  1QJY 2;  3AYE A;  4XAB A;  3FBM A;  4A3Z A;  4EQV A;  1UY3 A;  2D98 A;  3ZPO A;  1W6N A;  2WUH A;  3CNA A;  4WVM A;  3LOB A;  1S0C A;  4S2G A;  3MFA A;  4WM8 C;  2A3X A;  4BA6 A;  2Y33 A;  4MX3 A;  4XJ9 A;  3VZJ A;  4AED B;  4F83 A;  4QWN A;  1C57 A;  1K12 A;  1HRI 1;  2IWG B;  2DVB A;  2ZEY A;  2HWE 2;  4FFH A;  1SG3 A;  4NPL A;  2VTX J;  1C1L A;  1Z7S 2;  1LAJ A;  1RC6 A;  1W6N B;  4WVM B;  4GMP 0;  3RYR A;  3T30 A;  1I1E A;  2VNV A;  1C1F A;  3USU A;  3FL7 A;  5FZM A;  1G8W A;  2Y6G A;  3QCW A;  4NPR A;  4ZU7 A;  4EYU A;  1MS1 A;  1GU3 A;  4DUX A;  3W5N A;  5HPO A;  1BEV 2;  1F4H A;  2C6S A;  3ILR A;  4Q29 A;  1LEN A;  3MPB A;  3BPS A;  3FZ3 A;  4MVT A;  2OYZ A;  4HOO A;  2YRO A;  4EWD A;  3C3V A;  4ES8 A;  5F5I A;  5FYS A;  3USU B;  3ES4 A;  3I3Q A;  2VUJ A;  4CDQ B;  1WME A;  4HET A;  1OA2 A;  2H0B A;  3AP5 A;  2FD8 A;  4CDW B;  3OEB A;  2ILM A;  1UOJ A;  1TVG A;  4XF9 A;  2DVF A;  1OUR A;  1T6B X;  2P17 A;  3BAL A;  4B8E A;  1SLC A;  2Y6K A;  4AHW A;  1W0O A;  3B00 A;  1XYP A;  3AFG A;  3KWV A;  2IC1 A;  1UXX X;  3ZR5 A;  4JDN A;  3WNX A;  3WDV A;  2E26 A;  3NV3 A;  4NIA A;  1KQR A;  2Z2S B;  3AYA A;  5LAT A;  4C8D A;  1VBB 3;  1QMJ A;  3I59 A;  5DDJ 1;  3ETP A;  4FPC A;  1OLQ A;  3POY A;  2AUY A;  3T1M A;  1X82 A;  3VBH B;  3N7K A;  2KD7 A;  2XLA A;  2IXK A;  5FRE A;  2VNG A;  1EY2 A;  1MZF A;  1GOG A;  4CUA A;  2YGM A;  3K46 A;  3KHC A;  1U5Y A;  3CJI B;  5JUV A;  4CEY C;  3SMH A;  1XSQ A;  3J7H A;  1OH3 A;  1NCQ C;  4AAP A;  1Q8S A;  1FAT A;  1PNG A;  2HBT A;  2HEV F;  4HAN A;  5CB7 A;  1R64 A;  5IAX A;  3DPR A;  5DG1 A;  1MZE A;  2VZ3 A;  3KSC A;  4NR1 A;  4LBQ A;  2JDA A;  1AL2 2;  2UUR A;  4MGS A;  4B1M A;  4PLM A;  1JOD A;  3D0J A;  1G6N A;  1JYX A;  1ZBE 1;  5I0S A;  3SXW A;  4FCA A;  5I8Y A;  3FMG A;  3PTR B;  1SEF A;  2ZGQ A;  3DPR B;  3MFC A;  1HQW A;  2ZGS A;  3U75 A;  3CZU A;  1GNZ A;  3GHM A;  3NQH A;  4HN0 A;  4LBQ B;  1W2N A;  2WQ8 A;  2JIG A;  4NRQ A;  3WIN E;  5L19 A;  1RXF A;  1RVF 3;  3OBR A;  3ZDV A;  3UGG A;  4UBH A;  4UW3 A;  1O3S A;  3ACL A;  1VB2 A;  2VM9 A;  3GGL A;  3RZK A;  4LT5 A;  4E8C A;  2B46 X;  4XMI A;  4Z82 A;  2Z79 A;  1AYM 3;  2CL2 A;  3NKG A;  3WHU A;  1QJX 1;  3SH4 A;  1ZZ9 A;  1PMI A;  5FY8 A;  4Z8B A;  4Z1V A;  1OVP A;  5LRS A;  3O12 A;  1V00 A;  1QGL A;  4MGQ A;  4Y5T A;  1UZ0 A;  3ZXD A;  4OFG A;  4Q0Q A;  4Q1P A;  4XDP A;  1V6M A;  1W6P A;  3VZK A;  4ZS3 A;  4PI2 A;  4Y4Y A;  4C0B A;  1JHN A;  1PGS A;  4OMD A;  3OD0 A;  1FT9 A;  4RQP C;  5CKQ A;  5F5Q A;  1NXD 1;  4ZZ5 A;  3AP6 A;  3D0S A;  1OKQ A;  2P1B A;  4ZXE A;  4Q26 A;  2HYX A;  1S1A A;  4RFR B;  2XJU A;  4UFI A;  5FJK A;  2EXH A;  3J7N A;  1W8H A;  2JG8 C;  4RR3 C;  2QQM A;  2VQA A;  1W6P B;  4JKK A;  4EE2 A;  2WZP P;  5FUI A;  3WP4 A;  4Y1X A;  4E2S A;  3U1X A;  2R06 3;  1AR7 1;  4NPM A;  1JOP A;  3KV6 A;  4U2A A;  3WQ7 A;  4TTG A;  4JVA A;  1RUN A;  1K3I A;  2FMY A;  1PVC 1;  3POG A;  4Q4X 2;  5HXM A;  4LBN A;  2R07 3;  2X5I C;  5FZ8 A;  1UF2 C;  4V2V A;  3ZX7 A;  2ZGU A;  2QKD A;  4XXA A;  3O1O A;  2RV9 A;  3POJ A;  4BIO A;  1D0H A;  4RGG A;  1DQ1 A;  3O14 A;  2YBK A;  2W87 A;  2BGC A;  4YRD A;  5DQ0 A;  4EZH A;  3PJQ A;  1NA1 B;  1YQC A;  1CAU B;  2DU1 A;  5JAX A;  4NID A;  3WP6 A;  1JZ7 A;  4KWL A;  3USS A;  3RMX A;  5FR3 A;  1OLR A;  2OW4 A;  3MPP G;  3WNO A;  3A22 A;  1MEC 1;  1HRI 3;  5DAX A;  5J98 B;  1JU3 A;  1WA6 X;  3UKT A;  2P6H A;  1Q8P A;  3DYP A;  4IER A;  4Q4Y 1;  5BY5 A;  3ZN5 A;  4AR2 A;  1MS3 A;  4YWA A;  5H9R A;  4ISQ A;  4NUB A;  5L7O A;  1H8T A;  1LGB A;  4ASM B;  2NMN A;  2CYF A;  2YPD A;  4OUS A;  3AC0 A;  2GND A;  3WY6 A;  3NJX A;  2WO7 A;  4XTP A;  3A7Q A;  5KXD A;  3EHK A;  3BTX A;  1MS5 A;  4QGN A;  5EXO A;  2V5Y A;  3JD7 2;  1APN A;  1CZS A;  4FTE A;  1EAH 1;  2RJK A;  3U14 A;  4LIU A;  3UYJ A;  1UL9 A;  2IXL A;  5ANQ A;  2FCT A;  4PI0 A;  4EWE A;  2ES3 A;  1ASJ 1;  2D43 A;  2D3P A;  1CX4 A;  2A6Z A;  2R30 A;  1H8T B;  3C7G A;  3RYK A;  4DXT A;  2BVV A;  2PQS A;  4AL9 A;  4JAA A;  2VUC A;  4P9J A;  1FV2 A;  4W65 A;  1HV0 A;  3WD5 A;  2OPK A;  4F8A A;  3MGU A;  3O1P A;  3T2T A;  4G4F A;  4URA A;  4NHM A;  3MIB A;  3AZW A;  4FOY A;  3TOJ A;  5FMO S;  4CUC A;  5LZ6 A;  1XRU A;  2A1X A;  2W95 A;  1UY2 A;  4N8M A;  3ZMN A;  3RZJ A;  1GUI A;  1LHU A;  4I01 A;  4QQP A;  1JUH A;  5HCH A;  4LHN A;  5EHD A;  2B39 A;  1ZZ7 A;  5ANN A;  2FHR A;  4LNV A;  3T2P A;  3GZU C;  4AI0 A;  2HLE A;  4OHW A;  4QPY A;  2DTY A;  5DDJ 3;  2Y60 A;  1OXC A;  2WS9 2;  4OQ8 A;  4KQ7 A;  3K77 A;  1S2E A;  3KMH A;  4PIX A;  4NII A;  3S5Q A;  3CU7 A;  5BNP A;  4BE3 A;  1GIC A;  2CTV A;  2HWB 2;  3RZG A;  1JOB A;  4B4R A;  2EID A;  4AVA A;  1A8M A;  1ZBA 2;  4ZON A;  5FZH A;  4RHV 2;  5FJH A;  5EP9 A;  5JSO A;  1NY7 1;  5FZA A;  1UWW A;  2RMU 1;  1XSR A;  2GAL A;  1XNA A;  1W6O A;  5EJ1 B;  5I8S A;  1QH6 A;  5T50 A;  1MS4 A;  4P02 B;  4S2D A;  1B35 A;  4AI8 A;  3H0O A;  1KS4 A;  1W03 A;  1O5L A;  4XAA A;  3ZSM A;  2W08 A;  4AOC A;  2W68 A;  3T3Y A;  5LWB A;  5KR7 A;  1ZBE 3;  2OUJ A;  5KHH A;  4FPJ A;  3TEY A;  1AX2 A;  1F2N A;  3MUY 1;  2ID4 A;  1RUI 1;  2ZAC A;  4ZU5 A;  3PUI A;  1X50 A;  1B35 B;  3C7H A;  5A7N A;  2VU9 A;  2DUP A;  4FQ4 A;  4A41 A;  5C4W C;  4LBM A;  1ZVF A;  3ORJ A;  4BK5 A;  3LSE A;  4XE9 A;  4YW5 A;  5G04 L;  1KS5 A;  1PMH X;  1DG6 A;  2R7E B;  2EAA A;  5FWE A;  1ZZC A;  5FYI A;  4URT A;  1QJX 3;  1DYP A;  5I0U A;  4WM8 A;  1V6L A;  4FOW A;  4FI9 A;  1MR5 A;  1I5P A;  4LO8 A;  4XFF A;  2C26 A;  4CZS A;  1URX A;  4R9D A;  3JU9 A;  3WV6 A;  4BB3 A;  1OD3 A;  2UWA A;  4HVR A;  1W6Q B;  5J1X A;  2Y64 A;  5CG8 A;  1PO1 1;  1YQ6 A;  1FYU A;  3NWK A;  1OD5 A;  3K75 B;  4NHL A;  3HQR A;  4WM8 B;  3ME2 A;  3Q8B A;  4DUV A;  1CJP A;  1F35 A;  2JDU A;  3ZXA C;  2FDF A;  3ZO0 B;  3R6S A;  4I2O A;  1POQ A;  5DAW A;  3EO6 A;  4MGI E;  4LXL A;  5FP8 A;  1ZZ6 A;  4LE4 A;  4OQ9 A;  3FE5 A;  4ORF A;  2E31 A;  4IEZ A;  3ZYJ B;  1SMV A;  1AR7 3;  2D6N A;  1LRH A;  4A44 A;  3KVA A;  5FZ0 A;  4XCA A;  5JI9 A;  1J3P A;  4QPI C;  3MV0 1;  1PVC 3;  2LRP A;  4FP2 A;  3VBR C;  2VZR A;  5ABJ B;  3VBS C;  3PUS A;  3OPW A;  5FO7 B;  3R05 A;  5C71 A;  4UWD A;  5FPZ A;  3ZFF B;  4JV4 A;  2WAO A;  3HAG A;  4KBB A;  1ULO A;  3JB8 A;  3KF5 A;  3OYW A;  4J25 A;  1GNH A;  2XDV A;  3FFZ A;  2DF7 A;  2WT1 A;  1MQT C;  4KGQ A;  3GCX A;  3MIF A;  1H8V A;  2D3R A;  4COY A;  4UT5 A;  1RB8 G;  2ATF A;  4Q4V 2;  1QQP 3;  1MEC 3;  2B8M A;  4D7S A;  2NM1 A;  2ORZ A;  4LR4 A;  2HBU A;  1UOF A;  4BHP A;  4Q4Y 3;  5JWP A;  1LOC A;  2ARX A;  3GZA A;  2HWC 1;  1FOD 3;  1I6X A;  2A5Z A;  1X33 A;  2WII B;  3OYW B;  4UW5 A;  2DVG A;  2DVD A;  1JZ6 A;  4RD7 A;  2XLG A;  3U0Z A;  4E4S A;  3A4U A;  4Q0U A;  5IYY A;  1NCQ A;  1SHW B;  4JHT A;  2XHK A;  4XFI A;  1EAH 3;  1LEM A;  1LTE A;  3MW4 A;  4PBO A;  3AKQ A;  5L73 A;  2ZZJ A;  4AVC A;  5JXG A;  1WMX A;  1ASJ 3;  4LBL A;  4NRO A;  4K9S A;  5CVR A;  2VMG A;  2ZAA A;  1W8W A;  4F3J A;  2DFC A;  1UU4 A;  5DN2 A;  2QUO A;  3AP4 A;  3SC7 X;  1CAX A;  2ADD A;  2ZHL A;  1FMD 2;  2VNR A;  4MGT A;  4Y3O A;  3AXD A;  3I54 A;  1QJZ A;  1OI6 A;  4LEJ A;  2VZS A;  2FBE A;  1RUC 1;  4AHX A;  4A6S A;  5DZE A;  4XF3 A;  4FPE A;  4LHL A;  3RJR A;  2PHF A;  2YC0 A;  3I2D A;  4ASK A;  3I3M A;  2ZX1 A;  4QM8 A;  2Q4S A;  4WBB A;  5FOJ B;  2BDR A;  1ZA4 A;  1P8J A;  4AED C;  1CAX B;  5APA A;  4ISR A;  3THC A;  1US3 A;  4M3C F;  1QOS A;  3ZSK A;  1EUU A;  2MNG A;  2XWJ B;  1LOE A;  1PM4 A;  3PMS A;  3FX3 A;  5KBF A;  5L36 A;  4LBO A;  2WLQ A;  3TEX A;  2V72 A;  3SIS A;  1JBC A;  1GOH A;  1W8Z A;  4OMC A;  3IDA A;  1FPN 1;  1H6X A;  4YG0 A;  3VBO A;  4A45 A;  1US2 A;  4AI2 A;  5F3G A;  4MHU A;  2MPF A;  1F9K A;  1E5R A;  1ND2 B;  1YC6 1;  3IWZ A;  1LOD A;  4GAZ A;  3ZMO A;  2BBA A;  4RQP A;  2RMU 3;  2GNM A;  3PIG A;  1POV 1;  1GQG A;  1AXY A;  3VBO B;  5GLU A;  4XPV A;  2CGP A;  4CDQ C;  5JOW A;  1EV1 2;  1LCL A;  4M3C E;  4YW4 A;  1FAY A;  4BDV B;  3UKV A;  2JG8 A;  4CDW C;  3LEG A;  1AJK A;  3GJA A;  1QNW A;  1X9P A;  3TN9 1;  1RMU 1;  2Z5W A;  3M1H A;  2J22 A;  3V56 A;  3O5S A;  4SBV A;  1RUI 3;  3AKP A;  5AC9 2;  2L9L A;  5C3S A;  1VIW B;  4C0H A;  2K2S A;  2W46 A;  4MLO A;  4A6O A;  5A3T A;  4AEJ A;  5A6X A;  1UKG A;  5GAL A;  2Y0O A;  4EN7 B;  4Q2F A;  3VBH C;  4HVQ A;  5JZG A;  2VNO A;  3JQX A;  4P9I A;  2MEV 1;  3KQ4 B;  5L9B A;  1CR7 A;  4M00 A;  3UGH A;  2QQU A;  1HIX A;  4XIK A;  3ECQ A;  3CJI C;  2X09 A;  2PYT A;  4DOU A;  3BOW A;  3RVH A;  3PHM A;  2J1A A;  4BJ0 A;  4D6R A;  3MLL A;  2P37 A;  3N36 A;  1PO1 3;  1YXW A;  2JXA A;  3V0A A;  3OBT A;  3TBD A;  1WLD A;  1W6M A;  5JZG B;  3BI3 A;  1V6N A;  2YDE A;  3W9A A;  2DBN A;  4DMI A;  1SFY A;  3HT2 A;  1Y43 B;  4Y1U A;  2VXR A;  2W1S A;  4QX5 A;  5IK8 A;  1DDL A;  3KT1 A;  5L7O B;  1UIK A;  2JX9 A;  3FLT A;  3WVJ A;  1GYK A;  3H3U A;  4E2G A;  4IEV A;  5JDB A;  1UMZ A;  1HQL A;  3E97 A;  1ENS A;  2CY6 A;  3ZXE A;  3V0A B;  1W6M B;  1NZC A;  5HCA A;  4P9X A;  1C4R A;  5BNN C;  1ZZB A;  3VD7 A;  5JXI A;  2TBV A;  4D6S A;  1XU1 A;  4Y1Z A;  1S0F A;  1AR6 2;  2D44 A;  3I2J A;  1YFU A;  4FPF A;  3KV9 A;  1UO9 A;  4Y22 A;  2VE1 A;  4AEK A;  3RZH A;  4N43 B;  5LK5 A;  2LM3 A;  1A34 A;  2XJV A;  1O8S A;  1PIV 1;  4ZZ8 A;  4LO7 A;  1ODM A;  1W04 A;  2ZTN A;  4QX8 A;  4TWT A;  4Q4W 1;  4OI0 A;  5FPX A;  5AVA A;  2Q0A A;  1SDW A;  2RS1 2;  1JZ2 A;  4AVV A;  5CBL A;  3WX5 A;  1BZW A;  1PGW 1;  1BK0 A;  4Y22 B;  1IS5 A;  2C0Z A;  2C9A A;  1YJL A;  3EB7 A;  2GC2 A;  3HPN A;  3MUZ 1;  3ZYR A;  2OT7 A;  4NOT A;  5CKM A;  4DO0 A;  3S6P A;  5FXV A;  1HRV 2;  2GME A;  1D0G A;  1FI2 A;  2HWC 3;  3GHN A;  4CUG A;  2NP0 A;  2Q8C A;  1ZRI A;  3HEI A;  1ACC A;  4OHV A;  1AR8 1;  3JQW A;  1HXS 1;  3H1W A;  3DEM A;  4AGG A;  1YQ5 A;  3UET A;  4QB6 A;  4DS0 A;  1TMF 2;  3C7O A;  1UZW A;  1UAI A;  3NNG A;  1KXG A;  1DZT A;  1BYH A;  1YQ8 A;  4YLZ A;  1G7Y A;  3UES A;  2PHL A;  1L7L A;  3T09 A;  2H0V A;  1ZA7 A;  4NE9 A;  2O14 A;  2QZ2 A;  1S4C A;  2CSG A;  5HXV A;  2W1Q A;  4G9S B;  4Q8K A;  3UJO A;  4AGR A;  3D6E A;  1Q56 A;  4KWK A;  5FBZ A;  2Q30 A;  3Q9O A;  3VL8 A;  3R4D B;  1RUC 3;  3U11 A;  1MVQ A;  3HNB M;  1NA1 C;  4CYD A;  4MO3 M;  2FDH A;  3QD6 A;  5A6Y A;  1S55 A;  2QQO A;  3IZO A;  4XAC A;  5FMO L;  1SPP A;  2A75 A;  5C4W A;  3KVB A;  4OHY A;  2Q8O A;  1QJX 2;  1PHM A;  1PVX A;  4CSW A;  2D3S A;  2LRO A;  1W0P A;  2VW1 A;  3H1M A;  3TWI A;  3WDW A;  2CGN A;  3NV2 A;  4XUR A;  5FZO A;  4D7T A;  3LCP A;  2Y6H A;  4ZXK A;  3RNS A;  2WFF 2;  2Y8K A;  2XGX A;  1YI7 A;  3I8T A;  1FPN 3;  2ZJC A;  3UKN A;  4KWU A;  4AVT A;  2J1S A;  1QJU 2;  2CAV A;  1JH5 A;  2VCM A;  5CFC A;  5AFE A;  2W0X A;  3IKW A;  4KI5 M;  2E53 A;  4YM0 A;  2QQK A;  3AM2 A;  1RXG A;  3R4U A;  4K40 A;  5FZO B;  1OBN A;  4MXV A;  3ZFE A;  4YW7 A;  3WF2 A;  5L7O C;  1AYN 2;  1H8T C;  1POV 3;  4QHO A;  4BQ4 A;  2WYF A;  4A4A A;  2R16 A;  3AL6 A;  2R0F A;  2PTM A;  3IDB B;  3R4S A;  5CFC B;  1G9A A;  5LBF A;  4ZHN A;  2PFW A;  3I2F A;  3J26 N;  3JXS A;  3W21 A;  1UKR A;  1WMF A;  3DKQ A;  5DUU A;  5FOB B;  3E5U A;  5F32 A;  2VXJ A;  5K9Y A;  3TN9 3;  5FBJ A;  1RMU 3;  3ZFE B;  3B93 A;  3BTA A;  1RUE 3;  1A78 A;  1BXH A;  4QPI A;  1T2X A;  3VBR A;  2AZ5 A;  1IS4 A;  5KXB A;  1R08 2;  1LHV A;  1VPH A;  4K3U A;  5FYY A;  1Q8O A;  1OF4 A;  1T6G C;  2QQJ A;  3O0W A;  5IUQ A;  5GJ6 A;  4AFD A;  1R09 2;  2YU1 A;  4FPO B;  1PM7 A;  1Y7B A;  1QQP 2;  2EIG A;  2UWB A;  4QPI B;  2MEV 3;  3BU7 A;  5GLT A;  2PLV 1;  1MQT A;  4AYU A;  1W8N A;  2F4L A;  2O0O A;  3BUC A;  2JE7 A;  1JU4 A;  4CCM A;  2ZCW A;  1FOD 2;  3VZN A;  2RS5 1;  1BLZ A;  1H2M A;  2VZP A;  3HNM A;  2XQX A;  3KCX A;  4GKY A;  3CJX A;  5FZ1 A;  5K0U A;  3ZIX A;  1OFN A;  2QTW B;  2CDO A;  5FZK A;  2O8Q A;  1I3H A;  1RUF 2;  3GCW A;  1DBN A;  2FMD A;  3AKS A;  1MQT B;  3N7J A;  2W91 A;  4O61 A;  4XYX A;  1SBE A;  4OZO A;  2VZO A;  1R1A 2;  3PTY A;  1J1L A;  1UZY A;  4LJH A;  4QM9 A;  2UYB A;  2WWJ A;  5K0U B;  4E4D X;  2NN8 A;  4HL0 A;  4RS5 A;  1U5Z A;  2JDM A;  4YSF A;  1CAV B;  2RR1 2;  3AZY A;  3T2Q A;  4PF5 A;  3EXU A;  4WZC A;  1V6K A;  3M8L A;  4COU A;  1B35 C;  1K45 A;  4B1L A;  5DZF A;  3UK9 A;  1AR9 3;  5A3W A;  2CWS A;  4P9L A;  1UU6 A;  3FHI B;  4RS5 B;  2FZ2 A;  3WSO A;  2J7M A;  1PIV 3;  4PF1 A;  3VKM A;  1VBD 1;  2BRT A;  4ASL A;  3S7E A;  4JKL A;  5DPN A;  1RUJ 1;  4AED A;  3J8F 1;  2W5F A;  4CRQ A;  4XJZ A;  4WVZ A;  5CFD B;  4HG6 B;  5ACA 2;  4W6W A;  1S0B A;  3QLQ A;  1OUX A;  3SNM A;  1D2Q A;  1BJQ A;  3GJB A;  2Z69 A;  1YHF A;  5ERL A;  3LD8 A;  2RJL A;  2BGO A;  1H0B A;  2Q8E A;  3I49 A;  2VVD A;  1V9U 1;  3JBG 2;  3VD4 A;  2RS3 3;  4LLF A;  1LU1 A;  5A7W A;  5FFO C;  1LJ7 A;  2ZX0 A;  2QDN A;  1OLM A;  3GBG A;  1HXS 3;  1S0E A;  3IDE A;  1TEI A;  4WZF A;  4FAH A;  1CZT A;  1WUV A;  2GP5 A;  1RHI 2;  1VMH A;  4YW1 A;  3BB6 A;  3AVS A;  3WW4 A;  4F7Z A;  1UU5 A;  2KA3 A;  1DQ6 A;  4CCC A;  1MAC A;  4CDQ A;  5LA9 A;  5BYN A;  5A7W B;  3VHO A;  4FFI A;  5CNA A;  4CDW A;  4LLO A;  4JZR A;  5ABJ C;  4WVV A;  4BXF A;  5LRR A;  3BN6 A;  1RJ7 A;  3WQ0 A;  5D1I A;  4ZY9 A;  2P3Y A;  4PBP A;  2OZJ A;  3ZFF C;  5LA1 A;  3N3H A;  1S2B A;  3M4F A;  3VKO A;  2ZGM A;  1G9F A;  5GLW A;  1QXR A;  3WUD A;  1UZV A;  2B9V A;  3ACF A;  3LF7 A;  3MLK A;  5KC5 A;  2I74 A;  4FXK B;  3KV5 A;  1PO2 2;  2VQU A;  2GC3 A;  4FPK A;  3HBZ A;  4FT8 A;  2NZ9 A;  1GKB A;  2WN2 A;  4FBF A;  4COV A;  1C5I A;  3AX4 A;  2Q1F A;  1F5J A;  4QU2 A;  4XHX A;  4NVP A;  1IPK A;  1W9Y A;  2R04 1;  4UFM A;  3DCQ A;  2ZX3 A;  3VBH A;  4Y1Y A;  3NNJ A;  5A7O A;  1N3O A;  1POV 0;  2G9F A;  3SCG A;  3UJQ A;  3RJ2 X;  2BTV C;  3CJI A;  1RUH 2;  2XXZ A;  1GZT A;  3ES1 A;  1UYP A;  5CEH A;  2VW0 A;  4YGB A;  1A6C A;  2O8O A;  3H3Z A;  4L11 A;  1JYV A;  5FXZ A;  4EWA A;  4MGK E;  2VZ1 A;  2VUD A;  1VR3 A;  4QX3 A;  2P6C A;  4QPG A;  2ARB A;  5E1R A;  4CTE A;  1J59 A;  2BVB A;  4JGZ A;  4MAD A;  4HKW A;  2A6W A;  1PMJ X;  3PUH A;  1RIN A;  2XKP A;  2ZA9 A;  2EAL A;  3FC0 A;  5M0T A;  5IK5 A;  1WGP A;  4DRV A;  4AVB A;  2BWA A;  4K8R B;  1ULE A;  2G1M A;  4BMB A;  2RM2 1;  1H4G A;  1IHM A;  2HWF 1;  4QPG B;  1QDC A;  3HD8 B;  4JGZ B;  4QKF A;  3VZO A;  4FOV A;  4W6Y A;  2OA2 A;  3ZR6 A;  4QX0 A;  5DAP A;  1OHF A;  4XQW A;  2CV6 A;  2I07 B;  3HMY A;  1JZ3 A;  2WNV A;  3SCH A;  1WBL A;  3A21 A;  1QJF A;  1JXN A;  4Y24 A;  1ND3 A;  2PA7 A;  2B9U A;  1NT0 A;  3E6B A;  4ONU A;  1Q43 A;  3W58 A;  4KGG A;  1LED A;  4QPW A;  4Y1V A;  3RZM A;  2XJS A;  1LNS A;  3BPZ A;  2PLV 3;  1A8D A;  1ND2 C;  2E7T A;  3NAP A;  2E7A A;  5I0D A;  1EPZ A;  2RS5 3;  2WNV B;  2VOX A;  2XJT A;  2G9Z A;  2XB6 C;  1ND3 B;  4BWO A;  3VBO C;  3U4S A;  4J1X A;  2P4E A;  1WCK A;  2WO1 A;  4P08 A;  5B4N A;  1H30 A;  4JQT A;  4JRA A;  4WV8 A;  1WCS A;  3DYO A;  3NAP B;  3PIJ A;  4XIO A;  4XBL A;  3FHQ A;  5LA0 A;  3GF6 A;  1DFQ A;  5C70 A;  1F31 A;  2P3J A;  5DXD A;  2F6B A;  1DGL A;  1OA3 A;  2WZR 1;  4ATF A;  4BLJ A;  3AMP A;  3FUQ A;  5T5P A;  4CVU A;  3WP3 A;  1GQP A;  5F1R A;  2CNA A;  1YJK A;  2WZE A;  4Y20 B;  5J96 B;  3A23 A;  4KBZ A;  1SAC A;  2VAU A;  4GB3 2;  2BUK A;  5A6Z A;  1GMM A;  2QQP A;  2D97 A;  1AHS A;  3INA A;  5FO9 B;  2ET7 A;  2AYH A;  5A32 A;  2FDI A;  2VME A;  2P34 A;  2AEY A;  1V0A A;  2WQZ C;  1PGL 2;  1VAL A;  2B45 X;  1NA1 A;  1JZ8 A;  1CAU A;  3ACI A;  4ET7 A;  4B7K A;  5HV4 A;  4R4X A;  5J36 A;  3KF3 A;  5HBA A;  4CPB A;  1VBD 3;  2BFU S;  1IG0 A;  1V6O A;  1W8U A;  4BQ3 A;  3J8F 3;  5EV7 A;  4P9G A;  2YUE A;  3HWJ A;  1AXK A;  1N1S A;  2PEL A;  3EBR A;  3FHA A;  3NMB A;  4PCR A;  5BPX A;  5A32 B;  4CUB A;  4TZD A;  4DY5 A;  4L99 A;  3DXT A;  2RE9 A;  3HR9 A;  1S0I A;  5JMC A;  5JZG C;  1RUD 1;  3HQX A;  3ELN A;  1V9U 3;  1VBE 2;  1X8M A;  2VQ0 A;  1NQJ A;  3ST7 A;  5A70 A;  2ZKL A;  2D40 A;  2DCT A;  3LZZ A;  5C3R A;  3NNF A;  4A7Z A;  4GQ7 A;  5A3N A;  1LOA A;  2JIC A;  4OHX A;  5IJR A;  4MOA A;  2G9G A;  2VZU A;  2HWD 1;  2WSV A;  4YZ3 A;  2DTW A;  1VBA 2;  1VRH 1;  5FPL A;  5A1L A;  3T4V A;  1RUE 2;  2VZV A;  3OB8 A;  1AL0 G;  3KHB A;  4YVW A;  4N43 C;  4FFF A;  1LES A;  2VMH A;  2VOW A;  1OA4 A;  2FQP A;  2E6V A;  3TRS B;  3OPZ A;  4BXS V;  3OGG A;  1RUG 2;  1RJ8 A;  4ZU4 A;  2E63 A;  4D69 A;  5DUW A;  2QQN A;  2P5B A;  2UY8 A;  1BMV 2;  2XBO 1;  1Y9G A;  4XUT A;  1UY4 A;  4HKL A;  4B4P A;  4YVW B;  3LFI A;  2LAL A;  2WYS A;  4NHK A;  4JCK A;  4DFS A;  2A6V A;  2XHN A;  4QGM A;  4FP3 A;  2J1R A;  2V5D A;  4EN9 B;  2R04 3;  1SBF A;  4Q0P A;  3MZH A;  3A0K A;  3B02 A;  3ILF A;  1BBT 1;  1TME 2;  2D6L X;  4Y5S A;  4MG2 A;  1JMU B;  3WT3 A;  3FUO A;  1OOP A;  1X36 A;  3ZYG A;  5T52 A;  3BTY A;  4HON A;  1OQE A;  3POB A;  2DYC A;  3GBW A;  5F8P A;  2DWR A;  1A3K A;  4QB2 A;  2BPA 2;  1UQX A;  5FMB A;  1YNA A;  4HPK B;  4G3Y C;  3E6D A;  4GJZ A;  4E4Z A;  1FX5 A;  4M01 A;  3U78 A;  4KL1 A;  4KWJ A;  2BYV E;  4V1P A;  4LUL A;  4M4R A;  1PZ7 A;  2VQT A;  4XEZ A;  3H8X A;  1OOP B;  3L2H A;  3AKR A;  2TNF A;  1DQ5 A;  1NKG A;  3DGT A;  1HW5 A;  1AR9 2;  1CD3 G;  3N9L A;  4IXL A;  4R4Z A;  4BQ1 A;  4FTS A;  3EYP A;  2HWF 3;  1C8M 2;  5C3Q A;  5FZE A;  1W39 A;  1D4M 1;  4LO6 B;  3AZZ A;  2VY0 A;  3MV1 1;  3OY8 A;  4QDR A;  1QJY 1;  5LBC A;  3WNM A;  1VBC 2;  2V73 A;  3FBY A;  4PIZ A;  3VD5 A;  3VL9 A;  1IGO A;  2UY9 A;  1WW6 A;  1D2S A;  1W8O A;  4LHS A;  1LU2 A;  4UYB A;  3C8X A;  5EFU A;  1PX3 A;  5FTT C;  5IAV A;  3NW4 A;  3WR0 A;  3SQO A;  3OUH A;  1GOF A;  2FCV A;  2A6X A;  3LKJ A;  2VMD A;  4OZX A;  3OY8 B;  4B4Q A;  1AJO A;  2HWE 1;  4N90 A;  1W6Q A;  1VAM A;  2K9Z A;  2RS3 2;  1Z7S 1;  3BCW A;  2YXS A;  2LUW A;  3LIH A;  4HVO A;  4MUV A;  5IFT A;  1WA4 A;  3N9Q A;  1JYW A;  3WP5 A;  3KCC A;  1OC1 A;  4TSV A;  2IFR A;  4HXC A;  4E9K A;  1OPO A;  4YW6 A;  2DCJ A;  1L7Q A;  4JKM A;  1PK6 B;  1HQN A;  1FXZ A;  2JJ6 A;  5KHI A;  1IPS A;  3D82 A;  1RIT A;  2TEP A;  2ZEX A;  2ZGN A;  3VBU A;  5CFC C;  3A0N A;  3B5L B;  1C28 A;  1OMI A;  1ZRF A;  1BEV 1;  3IBM A;  1V70 A;  3DN7 A;  1QNY A;  4XJ8 A;  4IEO A;  4DB5 A;  2WZR 3;  3AFK A;  4XVH A;  3SH5 A;  1U5X A;  3ZFE C;  2YG0 A;  3VDD A;  4IGQ A;  3CL1 A;  2WQ4 A;  1QXJ A;  3RMY A;  3WF4 A;  4A2U A;  3OGS A;  4NIG A;  5GZF A;  3VBU B;  2JEC A;  5ABJ A;  3FJS A;  1UYX A;  1Y3T A;  2ARC A;  2EXJ A;  3ZYP A;  1R1Z A;  2AC1 A;  4D8M A;  3ZFF A;  1DZQ A;  4AEM A;  1GZW A;  2Y6L A;  1O59 A;  3K2O A;  5FZD A;  4PQ9 A;  1E5S A;  2KR2 A;  2VMI A;  4N9I A;  3VDD B;  2LTN A;  2QFE A;  3B3Q E;  1QIQ A;  4CP9 A;  4KMQ A;  5FLH A;  4AQS A;  5FZ9 A;  4EV0 A;  4Q0V A;  4FFG A;  2W9X A;  3IMM A;  4OYU A;  1LGC A;  3BIE A;  4BZ4 A;  3TEZ A;  2JD9 A;  4LA3 A;  1GZW B;  1VBB 2;  5FY4 A;  5A3L A;  1IKQ A;  5CAD A;  1AF9 A;  1RUD 3;  4FXG B;  3PDQ A;  4CP9 B;  4Z2W A;  4KU7 A;  1YYN A;  1J84 A;  1UOG A;  3I2H A;  5KC6 A;  4AQT A;  5C3O A;  2VJX A;  5K0U C;  4ITC A;  3LDK A;  4AG4 A;  4GWM A;  1S0G A;  5LEJ A;  1ONA A;  2ZGK A;  2RHP A;  5E8A A;  4P5Y A;  1AL2 1;  4RSU A;  3BIW E;  5LB6 A;  2HWD 3;  1VRH 3;  2GH8 A;  3DF0 A;  3Q8A A;  4HLT A;  4B7E A;  4C1W A;  1RUO A;  2VO5 A;  1C3H A;  4QX2 A;  1WW7 A;  4RS5 C;  4YFW A;  3GDB A;  1IKP A;  5FYB A;  4AAX A;  3AYC A;  4QDQ A;  1GSL A;  4IL7 A;  3IM0 A;  2GN7 A;  5EQU A;  5IWF A;  3ZXF A;  3OEA A;  4LKE A;  1O3R A;  3MEP A;  1AVB A;  3I2G A;  2NQY A;  3GM8 A;  5F5C A;  3E5Q A;  5CFD C;  1NQD A;  3NKT A;  3LSD A;  2ET1 A;  3RG0 A;  2PHT A;  2GC0 A;  4OUL A;  4CCJ A;  1JS9 A;  2XBO 3;  1EUT A;  1RIR A;  1XNB A;  2IFW A;  3BGA A;  1HDK A;  3M3E A;  3P6B A;  4RGK A;  4XJW A;  2VVE A;  1RVF 2;  2PMW B;  4TXW A;  3WDU A;  5J09 A;  2IXI A;  2VOK A;  2GDF A;  2ERF A;  2UYA A;  3DYM A;  3IAP A;  3M3Q A;  3VDB A;  4AF9 A;  2FZ1 A;  3HOB A;  3WNL A;  2WO2 A;  1CX1 A;  5L9R A;  1AYM 2;  3DKW A;  5A33 B;  4LE3 A;  1ND2 A;  3DL3 A;  5GM0 A;  3IT8 A;  1ZYB A;  4K7J A;  5JOX A;  3WOG A;  4LA2 A;  1ODN A;  2WNU B;  5I93 A;  4HFS A;  2AH2 A;  3WDY A;  3B9C A;  1ZM1 A;  1O91 A;  2Y34 A;  2JKB A;  1NE4 A;  5K7P A;  4I0A A;  4XFB A;  2XJQ A;  3OOX A;  2VUL A;  5FZI A;  5IVV A;  2EA7 A;  4ZKT B;  2VOV A;  4QAW A;  5T5J A;  3N9M A;  4MET A;  4N7I A;  4GJY A;  3OD4 A;  1L3J A;  2BOJ A;  2WWU A;  3POI A;  1GNY A;  3OF1 A;  3VGI A;  4XMA A;  3WW3 A;  3B01 A;  3K3N A;  1ENQ A;  5EIY B;  2QBX A;  4Q4X 1;  5FPV A;  3TNP B;  5A7Q A;  4DXS A;  4CU8 A;  5IT6 A;  2A7A A;  4LKS A;  3LFM A;  1W90 A;  2R06 2;  4IV1 A;  1LOG A;  2ZX4 A;  4I02 A;  5C3P A;  5CIS A;  2JWP A;  3FN9 A;  4XZU G;  3ZSL A;  3VBF B;  2R07 2;  1QJY 3;  1SBD A;  3PUR A;  4L2N A;  4L92 A;  5EJZ B;  4MGY E;  4LOT A;  1NAE A;  1UNB A;  5C6C A;  5C8C A;  2VZT A;  5FV3 A;  3OTF A;  1YFX A;  4YGE A;  1W05 A;  5FK7 A;  1XYO A;  1OH4 A;  4IV1 B;  5B4X A;  2JEM A;  5FKC A;  5FWJ A;  1MS0 A;  1E57 A;  4CXY A;  3D8C A;  4IGO A;  2VVF A;  2HWE 3;  2PAE A;  4A7K A;  4EZ4 A;  3LWC A;  5JOY A;  1Z7S 3;  4IND A;  2GMM A;  5HV0 A;  3L9J T;  4GWI A;  3RQ0 A;  5C8C B;  1HRI 2;  1FNZ A;  1Y9Q A;  2HYK A;  2VZQ A;  1H6Y A;  3JD7 1;  3VZL A;  2GP3 A;  4R9A A;  5D8A A;  1BEV 3;  1RL3 A;  3M3O A;  2VMC A;  2YYO A;  2OVU A;  4CDU B;  1WD3 A;  2OZ6 A;  5GKA C;  2Z42 A;  4QPG C;  2YHJ A;  5F6K A;  2C9K A;  2GH2 A;  1GQH A;  3W20 A;  2QQI A;  1N3Q A;  4JGZ C;  4O7X A;  1PZ9 A;  4DQA A;  4EN0 A;  1WCD J;  4XF1 A;  2CU5 A;  2JB4 A;  5J48 A;  5EYX A;  5FUP A;  3OBA A;  3RWN A;  3WCR A;  4N43 A;  5GZG A;  5D8A B;  5FLJ A;  3WF1 A;  3AMN A;  5JIA A;  1UMH A;  2WRA A;  3GYD A;  4IV3 A;  2WT2 A;  5CKN A;  3HQU A;  3HN1 A;  4GXL A;  2W39 A;  1DU3 D;  2YB7 A;  2JG9 B;  2Y38 A;  1OKO A;  2PXJ A;  2UWC A;  2VCB A;  2YZ4 A;  4I3G A;  2DBI A;  4YAR A;  2QZ3 A;  3JB4 C;  3NL1 A;  4DXZ A;  2PHU A;  2WNV C;  2BFU L;  2WS9 1;  4HK9 A;  3U07 A;  5FPU A;  3RZL A;  4LK7 A;  1ND3 C;  2CDP A;  2HWB 1;  2JDZ A;  2VUA A;  1XB9 A;  3NJZ A;  1NOV A;  3HBK A;  2D6K A;  3NRU A;  4GA9 A;  2OQ7 A;  4IV3 B;  1ZBA 1;  4JHZ A;  5FUN A;  1W8T A;  1LB2 A;  4XQ4 A;  3K48 A;  4OHZ A;  5F3E A;  5JOZ A;  2OX0 A;  4RHV 1;  2RDR A;  3NAP C;  5LK7 B;  1F5F A;  4QXH A;  3ATG A;  4LO4 B;  3OUI A;  5FZF A;  3PL0 A;  1UW8 A;  2P3K A;  2XJR A;  1QHD A;  2WC2 A;  4GWN A;  2W3J A;  2JDN A;  1SLA A;  4AFB A;  5FZ4 A;  5JIU A;  3PJY A;  1MPX A;  3OGJ A;  4C90 A;  1AL2 3;  4HSJ A;  2D6M A;  2RDS A;  2YPJ A;  1O4Y A;  2UU8 A;  1XC6 A;  4IE7 A;  5DMY A;  5E16 A;  3THT A;  4H3W A;  1J3R A;  3P3P A;  3KLS A;  1ZBE 2;  4KU8 A;  2YC2 A;  2PHD A;  2BNM A;  3LDB A;  4YG3 A;  1QY4 A;  3W5M A;  2C5D A;  3B7M A;  1AUY A;  5I91 A;  1KFX L;  3MI8 A;  4FPY A;  1XU2 A;  3KM5 A;  4S2F A;  4D6Q A;  1Y9M A;  2NMO A;  4WVW A;  2GAU A;  3VKN A;  5FIX A;  1D7P M;  5H9S A;  3CMG A;  1UYZ A;  2BW8 A;  3POW A;  4CU6 A;  4P9Y A;  3M70 A;  1HB2 A;  4YNI A;  3MF6 A;  2ZGR A;  1VAV A;  4JGY B;  3T0B A;  2DVA A;  3CIH A;  4P00 B;  2DUO A;  3THP A;  3J4U H;  4XUO A;  2PHR A;  3I3B A;  2W1W A;  1JI6 A;  2BEO A;  4RGA A;  5JR7 B;  3OPT A;  4GH4 A;  2ZGP A;  3MW3 A;  3ZPY A;  3OCP A;  4FTB A;  4PIY A;  1NX9 A;  1SDD B;  1XOY A;  2VOT A;  4IDZ A;  4YM2 A;  1G9C A;  4CCL A;  1OLM E;  3T0D A;  1XJA A;  4Y5Z 0;  4MYE A;  2W1U A;  3P1I A;  3TYJ A;  2XVL A;  1Q3E A;  1Y4W A;  4IW3 A;  4BYY A;  2OXB A;  1ZRC A;  1M06 G;  4FSJ A;  1X7N A;  3BOD A;  4M3C B;  3NST A;  1ULD A;  5IVC A;  3APB A;  4GH4 B;  3H8U A;  4NAO A;  5FP4 A;  1H2K A;  4Q4X 3;  3ZFG B;  4AZZ A;  4BPZ A;  5JCT A;  2WSU A;  2AGS A;  3S0M A;  2SBA A;  1YIP A;  1AX1 A;  3J7L A;  1AR7 2;  1JHJ A;  3ALQ A;  4OCT A;  2DCK A;  4XFA A;  1W2O A;  1PVC 2;  1DCS A;  4YVW C;  3ZN4 A;  2J1V A;  4NWW A;  4YM1 A;  1ALY A;  1YI9 A;  3WUC A;  1GLH A;  5EPA A;  1CPM A;  1WW4 A;  2E33 A;  1SCS A;  4QQL A;  4PDW A;  4OI1 A;  1YFY A;  3RI9 A;  1E5H A;  4Q4V 1;  3VDA A;  5IVB A;  3SEP A;  3HIF A;  1BKZ A;  4JDO A;  1WCU A;  4D7Y A;  4N53 B;  1QDO A;  5FO8 B;  4LPL A;  3LA7 A;  3FWE A;  5GLZ A;  4Q0S A;  3VKF C;  1DLC A;  1V6J A;  3I7D A;  5IVF A;  1NLQ A;  1MEC 2;  4LMF A;  4JX0 A;  4CCN A;  5JSP A;  4PDW B;  4Q4Y 2;  2WL1 A;  4QKN A;  2ZMN A;  4AHZ A;  1DLL A;  3JD7 3;  5B2G B;  3SKJ E;  1OOP C;  3HVD A;  3IPV A;  4LBK A;  4R9C A;  4XAE A;  5AVP A;  5FZG A;  4Y4R A;  2ORX A;  4BQX A;  2BGP A;  1CJD A;  4EN8 B;  1CAV A;  1WD4 A;  3G7D A;  1VAK A;  3IB3 A;  2WFP A;  3P5B A;  3TB0 A;  4C1X A;  4XIL A;  2JE8 A;  1DGR A;  1EAH 2;  4OI2 A;  1YQ2 A;  1YUD A;  1FMD 1;  4UAP A;  5FQ0 B;  2QVS B;  3PNA A;  1ASJ 2;  3H8R A;  3SIT A;  5L9V A;  5LY2 A;  1QEX A;  2YU2 A;  3IPV B;  4NWV A;  3H42 B;  3AJZ A;  3AXE A;  4QXK A;  1W3V A;  2F4P A;  5JPN B;  4PLN A;  2PQQ A;  2XBO 2;  2BU9 A;  3EJK A;  4YGC A;  5SV5 A;  3VUO A;  2VBP A;  1ULP A;  1SFP A;  5CFD A;  1UY1 A;  2YFU A;  2YBP A;  1W0N A;  2E7Q A;  4W6X A;  1IS3 A;  1JUI A;  5BNO B;  1BQP A;  4UF0 A;  1DYO A;  3K4A A;  4IE6 A;  4XBN A;  5DG2 A;  2WS9 3;  1LHW A;  3CO2 A;  3O0V A;  1W3X A;  1XE0 A;  3WG4 A;  1W2A X;  2HWB 3;  5G05 L;  1B09 A;  1PK6 C;  3RGB A;  4FPH A;  4JC1 A;  2XG3 A;  1UPS A;  4Q4W 3;  1ZBA 3;  3HT1 A;  4I0W B;  3SLI A;  1JZ5 A;  1HX6 A;  4RHV 3;  1CAW B;  1XE8 A;  4DXR A;  4LUK A;  4YVS A;  1DQ4 A;  4UF0 B;  4BCU A;  1O3Q A;  3THD A;  1LOB A;  1W06 A;  1HV1 A;  5LW9 A;  5C8W A;  2BWC A;  5IAT A;  1NY7 2;  2GU9 A;  2QQL A;  1EV1 1;  5C9A B;  2RMU 2;  4YW3 A;  3VBU C;  4AE2 A;  2WR9 A;  2KXL A;  2EXK A;  4YZ1 A;  1OQ1 A;  4B29 A;  1AR8 3;  1NUK A;  2ETE A;  2NYY A;  4CCO A;  4LOS A;  4O9G A;  4YVS B;  4CCD A;  1NCR B;  4P9W A;  1IQA A;  1DQ0 A;  2EIB A;  3LEM A;  4QT6 A;  3VDD C;  3QAC A;  4MH0 E;  2HEW F;  4DIQ A;  4NAM A;  2N7G A;  1ZRR A;  5AC9 1;  3AB0 A;  2WJS A;  3MIG A;  5D21 A;  3MW2 A;  1COV 1;  4X6Q B;  3NV4 A;  1LGN A;  3V64 A;  1HN1 A;  1RUI 2;  2XQR A;  4JDM A;  2A70 A;  4O65 A;  4YW2 A;  3BKZ A;  5FZL A;  1W9F A;  4XOG A;  5LCW L;  4OVE A;  2QDR A;  1TE1 B;  3KGZ A;  3RI8 A;  4AHY A;  3WEZ A;  1GWM A;  2VCA A;  1S0J A;  4QGL A;  4XC9 A;  1SLI A;  3GZT B;  3VDC A;  1J83 A;  3TAY A;  1GBG A;  4IEQ A;  4MSV A;  2YV8 A;  3POE A;  5IK7 A;  4Z92 B;  4P5H A;  2CAU A;  1ZX5 A;  5IVJ A;  5F5A A;  3AMM A;  3SH3 A;  4A3X A;  3J9S A;  4BQ5 A;  3ZXL A;  2XML A;  3UT0 A;  2RJ2 A;  2WAB A;  5BNN A;  3PU3 A;  4FO9 A;  2PN5 A;  2D5F A;  3NO8 A;  5KXE A;  1LKN A;  3AMH A;  4FVV A;  1NG0 A;  3VZM A;  3WNK A;  4DNY A;  5GZD A;  4V2W A;  2ZKN A;  1PO1 2;  1QKQ A;  1AZD A;  4QDS A;  5CAZ A;  1CIW A;  5IK4 A;  4XFC A;  3WG1 A;  5EJ3 A;  5FP3 A;  1N1Y A;  2WNE A;  1GP4 A;  5HCF A;  4GIQ A;  5A7S A;  4BU2 A;  2QE3 A;  4FPL A;  5BNN B;  5FZ3 A;  1JOJ A;  1H1M A;  4LKF A;  2KM2 A;  3LOI A;  4DUW A;  3D3A A;  1GWL A;  4XXP A;  5CIR A;  1ENX A;  3ASI A;  3UL2 A;  1AR6 1;  2VH9 A;  1O4Z A;  4LTA A;  5A3U A;  5JMO A;  3M3I A;  1UMI A;  1DGW X;  4YPJ A;  4K1Y A;  4E8D A;  4UW4 A;  4CA9 A;  4XW3 A;  1O6U A;  2A3W A;  2HEY F;  4M4P A;  2HKX A;  4PHZ A;  4ZPI A;  3SHR A;  2B7Y A;  3BTZ A;  1QF3 A;  3AYD A;  3F2Z A;  3OBZ A;  2JD4 A;  2WA4 A;  4NRM A;  4O9E A;  2PHW A;  4LQR A;  2RS1 1;  4KNC A;  4AVS A;  4BK4 A;  3BYW A;  4LKD A;  3WXP A;  4IE4 A;  3VD3 A;  3JCI A;  1Q5O A;  3J7M A;  4Q4V 3;  4QQ2 A;  5FKB A;  2XLF A;  3LDR A;  2WNU C;  2ARE A;  2IZW A;  1AX0 A;  4AI9 A;  4CU9 A;  3B69 A;  3CKH A;  4I30 A;  3I59 B;  3BVC A;  1HRV 1;  2VL4 A;  3VB9 A;  3LQC A;  3S7I A;  2VW2 A;  3N7L A;  4H55 A;  4CU7 A;  2YGL A;  5IVE A;  1J3Q A;  4IES A;  4X8P A;  4KG0 A;  2ZZQ A;  2R49 A;  4QHB A;  4S2H A;  5FXX A;  2HWC 2;  2V4V A;  2DDU A;  1F4A A;  1TMF 1;  5GZC A;  4DIN B;  2VPV A;  1W2U A; 
#chains in the Genus database with same CATH homology
 1WKY A;  4UI9 L;  5IFT A;  1JYW A;  2W47 A;  2WDB A;  1BHG A;  2EIC A;  2DCJ A;  1L7Q A;  3CZJ A;  2Y6J A;  4JKM A;  3WNN A;  2ZEX A;  3NJV A;  3ECQ A;  3SEE A;  2X09 A;  2EIE A;  2J1T A;  1O8P A;  2J1A A;  4BJ0 A;  4IUG A;  4XVH A;  4RYD A;  2YG0 A;  3WF4 A;  3ACG A;  3OGS A;  3OGV A;  1UYX A;  4QX1 A;  2W1S A;  4D8M A;  3I3D A;  3ZM8 A;  2Y6L A;  1O59 A;  3E1F 1;  5IFP A;  2WZ8 A;  4KMQ A;  1CIY A;  3VD7 A;  5JXI A;  2ZEZ A;  2W9X A;  4OYU A;  3I2J A;  2JD9 A;  4UOJ A;  4GWJ A;  3LE0 A;  1O8S A;  4ZZ8 A;  3T08 A;  3WNP A;  2VR4 A;  1J84 A;  1JZ2 A;  3I2H A;  1TG7 A;  2VJX A;  3EB7 A;  4AG4 A;  3HPN A;  3MUZ 1;  4A3Z A;  1UY3 A;  2WUH A;  4P5Y A;  3HEI A;  1JZ4 A;  1K12 A;  2VO5 A;  4QB6 A;  4QX2 A;  3UET A;  2ZEY A;  3C7O A;  3GDB A;  4AAX A;  2YFZ A;  1SG3 A;  3NNG A;  4QDQ A;  3OEA A;  3I2G A;  3UES A;  3T09 A;  3T0A A;  3GM8 A;  3FL7 A;  2Y6G A;  1W9W A;  2W1Q A;  3BGA A;  1EUT A;  3P6B A;  2B4K A;  1GU3 A;  4DUX A;  2BER A;  4TXW A;  3W5N A;  5HPO A;  1F4H A;  3DYM A;  3VDB A;  3IAP A;  3HNB M;  4MO3 M;  3HOB A;  3WNL A;  1CX1 A;  2WO2 A;  2QQO A;  4ARX A;  3LPG A;  4OUE A;  3OEB A;  1TVG A;  4XUR A;  2Y6H A;  2Y6K A;  2OKX A;  2W94 A;  2Y8K A;  3HJR A;  3HNY M;  1UYY A;  1UXX X;  4KWU A;  2J1S A;  4QAW A;  2E26 A;  2ZEW A;  1PX4 A;  3K4D A;  4KI5 M;  4XUQ A;  3WQB A;  2QQK A;  3ETP A;  1GNY A;  5EIY B;  2QBX A;  3I97 A;  3WF2 A;  4DXS A;  4CU8 A;  2KD7 A;  4A4A A;  4LKS A;  1GOG A;  4CUA A;  3FN9 A;  3K46 A;  4XZU G;  2X05 A;  5JUV A;  3I2F A;  3JXS A;  4W4Z A;  5EJZ B;  3J7H A;  1NAE A;  4L0P A;  2VZT A;  4XUP A;  1R64 A;  3LEK A;  1KGY A;  1OH4 A;  2VZ3 A;  5B4X A;  1T2X A;  3MO4 A;  2LS6 A;  2JDA A;  4MGS A;  1OF4 A;  1JYX A;  2QQJ A;  2ZXQ A;  4GWI A;  2E32 A;  2VCC A;  3WF3 A;  3VD9 A;  1DP0 A;  4DEV A;  5JXJ A;  2VZQ A;  3CZU A;  5CZK A;  1H6Y A;  1W8N A;  3NQH A;  4W8J A;  2WQ8 A;  1JU4 A;  2VMC A;  2VZP A;  3HNM A;  2XQX A;  3GGL A;  2VM9 A;  4E8C A;  1W99 A;  2C9K A;  2CDO A;  2QQI A;  1OF3 A;  2W91 A;  3OBA A;  2VZO A;  4MGQ A;  4OZO A;  1UZ0 A;  3WF1 A;  1XPW A;  1UMH A;  1UY0 A;  3T2O A;  4OMD A;  3T2Q A;  4ZZ5 A;  4XUN A;  1K45 A;  4ZXE A;  2YB7 A;  2HYX A;  2VCB A;  1OT5 A;  2QQM A;  4JKK A;  2CDP A;  5FUI A;  3WSO A;  2J7M A;  3NRU A;  4JHZ A;  4PF1 A;  4TTG A;  1K3I A;  4JKL A;  5DPN A;  5HXM A;  2W5F A;  4HG6 B;  1CZV A;  2W3J A;  2RV9 A;  2BGO A;  2W87 A;  1MPX A;  5DQ0 A;  2YC4 A;  3VD4 A;  1JZ7 A;  1XC6 A;  5DMY A;  3WNO A;  3A22 A;  1JU3 A;  1CZT A;  2XOM A;  3DYP A;  2YC2 A;  3W5M A;  2VC9 A;  3AC0 A;  3NJX A;  2Z4F A;  3A7Q A;  3BN6 A;  4ZY9 A;  2RVA A;  1CZS A;  5LA1 A;  1D7P M;  2J1U A;  3CMG A;  1UYZ A;  5LA2 A;  2B9V A;  3ACF A;  4CU6 A;  4DXT A;  1RYY A;  2VQU A;  3C7G A;  2PQS A;  1K42 A;  3SKV A;  3T0B A;  2WN2 A;  3CIH A;  4P00 B;  4PQQ A;  3LEI A;  4XUO A;  3I3B A;  2W1W A;  1JI6 A;  4CUC A;  2W95 A;  1UY2 A;  4GZ9 A;  1GUI A;  1SDD B;  1NX9 A;  2VOT A;  5A1A A;  3T0D A;  2W1U A;  3P1I A;  1IQD C;  3T2P A;  2HLE A;  1JYV A;  2VZ1 A;  3GXU A;  3I2K A;  4QX3 A;  3K77 A;  4MAD A;  3HN3 A;  1W9S A;  2EID A;  1JHJ A;  1PMJ X;  3DEC A;  3PUH A;  2LW8 A;  2DCK A;  4D0Q A;  2J1V A;  1UWW A;  1KEX A;  1XNA A;  5C7G A;  2E33 A;  5EJ1 B;  4P02 B;  3CQO A;  3VDA A;  4QX0 A;  3SEP A;  1JZ3 A;  3C7E A;  3CDZ B;  2BZD A;  3A21 A;  4LPL A;  1DLC A;  3MUY 1;  2ID4 A;  4JX0 A;  2VMF A;  4QPW A;  3PUI A;  5JR2 A;  1LNS A;  3C7H A;  3SKJ E;  3C7F A;  4A41 A;  1WCQ A;  5I0D A;  2ORX A;  4BK5 A;  2BGP A;  3OG2 A;  5G04 L;  1PMH X;  2R7E B;  3IB3 A;  2JE8 A;  4QB1 A;  1YQ2 A;  2WO1 A;  4P08 A;  4UAP A;  5B4N A;  4FI9 A;  4A42 A;  3DYO A;  1I5P A;  2C26 A;  3FHQ A;  3IAQ A;  5LA0 A;  5C70 A;  1OD3 A;  5J1X A;  2Y64 A;  4CVU A;  2JKX A;  1GQP A;  3K75 B;  1ULP A;  2WZE A;  1UY1 A;  3A23 A;  4DUV A;  2YFU A;  3K4Z A;  1W0N A;  1GMM A;  1DYO A;  2W92 A;  3K4A A;  2XON A;  2VME A;  1JZ8 A;  2E31 A;  5G05 L;  3ACI A;  3I2I A;  4ET7 A;  4A44 A;  1JZ5 A;  3MV0 1;  5JXH A;  4DXR A;  1XNT A;  2VZR A;  3THD A;  3FHA A;  1L7R A;  4CUB A;  2VTF A;  1W9T A;  5C71 A;  4RN5 A;  2WAO A;  2QQL A;  1ULO A;  2C4X A;  1NUK A;  2WAA A;  2EIB A;  5IJR A;  4MOA A;  2ORZ A;  2VZU A;  3U37 A;  1HN1 A;  1JZ6 A;  2VZV A;  3OB8 A;  5LCW L;  5IYY A;  1SHW B;  3WEZ A;  5IHR A;  2VCA A;  3I3E A;  3VDC A;  1J83 A;  5JXG A;  4BXS V;  3WF0 A;  5DN2 A;  2QQN A;  4XUT A;  1UY4 A;  2RJ2 A;  2WAB A;  2VZS A;  2WYS A;  4ARY A;  2XHN A;  2J1R A;  2V5D A;  2WBK A;  3WNK A;  4QDS A;  1P8J A;  1UXZ A;  3THC A;  1US3 A;  1EUU A;  2WN3 A;  3III A;  2V72 A;  4DUW A;  4QB2 A;  2J1E A;  1GOH A;  3D3A A;  3ACH A;  4OMC A;  3IDA A;  1H6X A;  4A45 A;  1US2 A;  5JMO A;  4PT6 A;  4M4R A;  1UMI A;  2VQT A;  4YPJ A;  4E8D A;  2BBA A;  1NKG A;  4M4P A;  3F2Z A;  3EYP A;  3OGR A;  2WO3 A;  4LQR A;  4BK4 A;  2X10 A;  5CYY A;  3UNP A;  3LPF A;  3MV1 1;  3VD3 A;  4QDR A;  4BDV B;  3WNM A;  3MBW A;  1JYN A;  3ABZ A;  4Z2A A;  3LEG A;  3VD5 A;  4CU9 A;  4DEQ A;  3CKH A;  2VL4 A;  1W8O A;  2J22 A;  1UX7 A;  4LHS A;  3C8X A;  1PX3 A;  3LQC A;  4CU7 A;  1GOF A;  2L9L A;  2VMD A;  2V4V A;  2DDU A;  1F4A A;  2W46 A;  5F7U A;  4W50 A;  4A6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...