1UY2A

Binding sub-site dissection of a family 6 carbohydrate-binding module by x-ray crystallography and isothermal titration calorimetry
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
131
structure length
131
Chain Sequence
SPIRRDAFSIIEAEEYNSTNSSTLQVIGTPNNGRGIGYIENGNTVTYSNIDFGSGATGFSATVATEVNTSIQIRSDSPTGTLLGTLYVSSTGSWNTYNTVSTNISKITGVHDIVLVFSGPVNVDNFIFSRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Carbohydrate-binding module
molecule keywords ENDO-1,4-BETA-XYLANASE A
publication title Binding Sub-Site Dissection of a Carbohydrate-Binding Module Reveals the Contribution of Entropy to Oligosaccharide Recognition at "Non-Primary" Binding Subsites.
pubmed doi rcsb
source organism Clostridium stercorarium
total genus 32
structure length 131
sequence length 131
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2004-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uy2A00
1CZSA 2XOMA 1UY3A 2J1TA 3FL7A 3ZM8A 1TVGA 2W95A 4AG4A 1UY0A 2W47A 2W46A 1OF4A 4KWUA 5CYYA 2W1WA 4JX0A 3HJRA 1JU4A 1NUKA 2E31A 3LPGA 2QQJA 2C4XA 2W91A 3IAPA 3MV11 1UMIA 4ZY9A 1KGYA 3C8XA 4GWIA 2VOTA 2WN3A 2BGOA 2VR4A 2VZPA 2W9XA 5IJRA 1UY1A 3LQCA 5DMYA 3U37A 3NNGA 4FI9A 2VJXA 3IAQA 4KMQA 3ACIA 2J1RA 2J7MA 3K4AA 2W3JA 1JYVA 2BGPA 1P8JA 5G04L 3WF1A 1GOFA 1US3A 5C7GA 3HOBA 2J1SA 3K75B 3MUY1 1UXXX 3UNPA 2WO2A 2EIDA 2YC2A 1GUIA 3IB3A 2WAAA 3K77A 4CUCA 2YFUA 1J83A 3J7HA 2CDPA 3ABZA 3CMGA 3OBAA 3DYMA 4A41A 2QQOA 2VZQA 3THDA 4AAXA 3VD9A 4DXSA 4QPWA 2WUHA 2DDUA 3WF0A 3A23A 2ZEXA 4M4PA 4UI9L 3HNMA 5B4NA 2Y64A 1SG3A 1K12A 2VZ1A 2WN2A 3T0DA 2J22A 4CU8A 4P02B 1GOGA 1PMHX 2C9KA 5LA0A 1JYWA 3E1F1 1JZ5A 1D7PM 4QB2A 1SDDB 1BHGA 1F4AA 1IQDC 4JHZA 4DEVA 3W5NA 4OMDA 3EB7A 2VZSA 3ETPA 3K4DA 4QDSA 3T0BA 3F2ZA 1J84A 3DECA 3HNYM 3MBWA 2ORZA 1W9TA 3OGSA 3NRUA 3WF2A 1H6YA 5EJZB 4KI5M 5JXHA 2VMDA 1LNSA 3C7EA 4MO3M 2Y8KA 3VDAA 3SEPA 3K46A 4P00B 1UYXA 1XNAA 3A7QA 3K4ZA 3WNKA 3FN9A 1JHJA 2CDOA 2ID4A 1NX9A 4TXWA 4XURA 2W5FA 5LA2A 2Y6HA 5HPOA 3WNNA 2X10A 3EYPA 5C71A 4ZZ8A 5IFTA 2VCBA 3VD7A 2DCJA 3I2JA 2XQXA 1NAEA 1W9SA 4QX3A 4XZUG 4CUAA 2LS6A 1WCQA 5JXIA 3WNPA 1L7QA 2V72A 2WABA 2Y6GA 4LQRA 3T08A 3I2GA 4JKMA 2ZEZA 3T09A 4QB1A 3OEBA 3SEEA 1H6XA 4OYUA 4MGSA 5JXJA 4W8JA 3VD3A 5JR2A 2WQ8A 4CU6A 5I0DA 1JYNA 1MPXA 1CX1A 2OKXA 4JKKA 5JXGA 1DYOA 2Y6LA 1EUTA 5G05L 2VQUA 2B4KA 2ZEWA 3CZJA 4OZOA 4W50A 4M4RA 1DLCA 3FHAA 5LA1A 4LHSA 3VD5A 1L7RA 3CQOA 4HG6B 4D8MA 2Y6JA 2V5DA 2WO1A 2BZDA 3WF3A 1JI6A 3T2QA 4MGQA 1W99A 3OEAA 4BXSV 2VMFA 4P08A 1K45A 4XUOA 3I2IA 3NJXA 2RJ2A 3UESA 3T2PA 1GOHA 1R64A 3NJVA 2VCAA 4CU9A 4CVUA 3LEGA 4CU7A 5IHRA 3DYPA 5B4XA 2E26A 2QQLA 1O8PA 3T2OA 1UXZA 5DN2A 4LKSA 4A45A 4A3ZA 1T2XA 2EIBA 2VL4A 4ET7A 2EICA 2YB7A 4OUEA 4ZXEA 3VD4A 4A42A 2KD7A 4TTGA 4E8DA 1JZ8A 1UX7A 1PX4A 4ZZ5A 1JYXA 2WDBA 3I2KA 4PQQA 5IYYA 2VQTA 2VZRA 3AC0A 2VMCA 4CUBA 3WSOA 4BDVB 2PQSA 3A22A 2W1UA 1CZVA 1US2A 3FHQA 1JZ3A 4JKLA 2W92A 4DEQA 2BBAA 3I2HA 1ULOA 3I3BA 3GDBA 4UOJA 3ACHA 2R7EB 3A21A 1GMMA 3WNLA 2X05A 2LW8A 2WYSA 2VM9A 2YFZA 2X09A 1W8NA 3DYOA 1UWWA 3OGVA 1UY2A 3WNMA 4BK4A 3MV01 2VTFA 4ARXA 3ECQA 5JMOA 1GU3A 1JZ6A 2YG0A 5J1XA 4P5YA 2JE8A 5CZKA 1EUUA 4DUXA 3PUHA 4RN5A 2VZUA 3GXUA 3GM8A 3OB8A 1NKGA 1JU3A 2VMEA 2WZEA 1DP0A 1XNTA 3LEKA 2HLEA 2WAOA 2QBXA 2VC9A 4XVHA 2Z4FA 2EIEA 1UYYA 1K42A 2VZ3A 4MOAA 3MUZ1 4PT6A 2VO5A 4OMCA 3C7OA 4MADA 3NQHA 3SKJE 3IDAA 4BJ0A 2WZ8A 2BERA 2HYXA 4PF1A 1OD3A 2RV9A 4DUWA 3GGLA 4ARYA 3OG2A 5EJ1B 3BN6A 1GNYA 2C26A 2ORXA 1GQPA 3D3AA 1F4HA 3WEZA 5A1AA 3WF4A 3VDBA 4E8CA 1JZ4A 5C70A 4QDRA 1XPWA 3P6BA 4GZ9A 4QX2A 5DPNA 2VZVA 4QX0A 4QX1A 2B9VA 4W4ZA 2VCCA 4XUNA 2Y6KA 2QQIA 2YC4A 4XUTA 1UY4A 1KEXA 3C7GA 5F7UA 2VZTA 1UYZA 3CIHA 1CZTA 3LEIA 2ZEYA 2XHNA 3T0AA 3SKVA 1JZ2A 2JKXA 3UETA 3HEIA 2W94A 5FUIA 3ACFA 5JUVA 3LPFA 3PUIA 1UZ0A 1K3IA 3I3EA 1W8OA 2QQNA 2ZXQA 1SHWB 3HPNA 3C7FA 3HN3A 4A6OA 4GWJA 3ACGA 1I5PA 1O8SA 1WKYA 1RYYA 1YQ2A 4DXTA 4IUGA 5DQ0A 5IFPA 1W0NA 1ULPA 3OGRA 2WO3A 2XONA 2QQKA 4QAWA 4XUQA 2E32A 4DUVA 5HXMA 2J1UA 2RVAA 3BGAA 4LPLA 4D0QA 4A44A 3WNOA 4RYDA 3P1IA 2L9LA 3IIIA 1HN1A 2W1SA 2J1EA 3CKHA 2JD9A 1JZ7A 2E33A 3THCA 3LE0A 1XC6A 2J1AA 4YPJA 2VZOA 1O59A 3I2FA 4Z2AA 3MO4A 3WQBA 2W87A 1OF3A 4L0PA 3C7HA 1CIYA 3CZUA 2J1VA 5EIYB 1UMHA 2WBKA 4QDQA 4DXRA 4BK5A 1OH4A 1TG7A 1W9WA 4A4AA 3I97A 3I3DA 4QB6A 2QQMA 1PX3A 3HNBM 5LCWL 1PMJX 2DCKA 2V4VA 2W1QA 1OT5A 4XUPA 3W5MA 3JXSA 3CDZB 2JDAA 3VDCA 4UAPA
chains in the Genus database with same CATH superfamily
1DG6A 2A3WA 2BOIA 5F2WA 3OY8A 5CFDC 4NO4A 3I4IA 1DFQA 3VB9A 1HV0A 5AC92 2WFF2 3WXPA 1YI9A 4LA2A 4RS5B 4S2DA 1C28A 4TSVA 2BDRA 5DZGA 4BOWA 4OUSA 5A1LA 1IGOA 5LW9A 2QQJA 2C4XA 1EV11 1O6UA 5A6QA 2RE9A 2HBUA 2W91A 1LHVA 3CLPA 3SLIA 3KHCA 1MZFA 2ZKLA 1TQ5A 3Q8EA 4CP2A 5CKNA 2YYOA 4GMP1 4BQ5A 1KGYA 3E6BA 3FJSA 1VBB2 5FYVA 1NA1B 1SPPA 1UAIA 1O5UA 1FXZA 1ALYA 1S55A 2BGOA 2RS33 2WRAA 4LHNA 4QQOA 4XFBA 2VR4A 4PCRA 5FYIA 5LBBA 2W9XA 1NE6A 5IJRA 1AYM2 3KD4A 3WD5A 4IEWA 4AEDC 5LRRA 3H3UA 2R0FA 5I93A 2RM22 4BH9A 2UWBA 4WM7A 3MW2A 4ATEA 1NZCA 4AVSA 2R073 5JSRA 4YZ1A 5A6ZA 4GIQA 1RUD2 2W3JA 1AXKA 3ZXKA 1P8JA 4B4PA 4A7YA 3UKNA 2JEMA 5JIUA 4AAPA 3HOBA 4LR4A 4NAOA 4CTEA 5C7GA 1HLCA 2NQYA 5FYZA 4EWDA 2W68A 5J3UA 3OSDA 2Y26A 1CAXB 1SFNA 3H7YA 4XIKA 5I0UA 4QPYA 3ZFFC 2IXKA 2GSYA 2YFUA 2IXHA 3AP5A 3IDEA 5FYTA 1J3PA 2CDPA 4ZPIA 4RGAA 1NY71 3MIHA 3DYMA 1KFUL 1EAH2 1TEIA 1CESA 2X5IB 2GC3A 4WM8A 2XBO2 2QKDA 1RUH2 2PMWB 4AAXA 1ZNPA 3VD9A 1N3QA 4JVAA 5FZOB 4CEYC 1W8ZA 2DFCA 4QPWA 4U2AA 5CB7A 3N9LA 2R043 1QJZA 3ZPYA 1O91A 1U5IA 4UI9L 4PJYA 1GWLA 1FV3A 3G6JB 4OHZA 3HBKA 3OTFA 1JW6A 3VHPA 5JI9A 3KQ4B 2YU1A 2RG4A 1PK6C 3N7JA 5EV7A 1W6NA 3UGHA 3T0DA 4CU8A 2HWD2 4P02B 3ZDVA 3SMHA 5GM0A 3AFGA 1SMVA 4FXKB 4NUBA 1D7PM 1VAKA 5T5PA 2VAUA 1BHGA 3WW1A 4DEVA 1OOPC 5C8WA 4QU2A 2RDQA 1RUJ2 3HVDA 4NIGA 1Z7S3 3BIWE 3MDPA 4GWMA 4INDA 4BQ2A 3KV4A 4LO7A 4COUA 1ZA4A 2V5YA 1W0PA 4D94A 1QOSA 1Q43A 1RHI2 2YC0A 4CUGA 1O5LA 2VCMA 1SCRA 4CCCA 3GJBA 3U0ZA 1B35A 1RGSA 1IZ3A 4XBNA 1W9TA 3JD73 1ZRCA 2VVFA 4WBBA 2OQ6A 3OGSA 3MLJA 3ZKUA 2G9ZA 3P3NA 5EJZB 1EAH3 1Q56A 1H2MA 1YHFA 2DVGA 2R16A 2XBO3 3PTYA 4LBQB 4FAHA 3C7EA 1HXS3 3JQXA 3SEPA 5LBCA 1PO13 2VBDA 3K46A 2OA2A 5FO9B 2FDGA 1UYXA 5CAZA 4AHZA 3R4SA 1H8VA 1LOCA 2C5DA 3HQUA 4HK9A 1C8M1 3TN92 2XWBB 4YW3A 1W90A 4K8RB 3UGFA 1E57A 1IHMA 3WW2A 4MH0E 2XVKA 2ZGKA 2VOKA 2BNMA 3L2HA 2Y6HA 2OYZA 4XFCA 4FPCA 1W8WA 2AH2A 1OKQA 2QQUA 4YM3A 1OFNA 1R083 3J8F3 4BIFA 4S2GA 2RMU3 1LESA 4B7KA 3VD7A 2DCJA 2RS11 3PIGA 4CDXB 3LD8A 1CONA 4QPIC 1LGCA 3KT4A 3OPTA 4RQPA 1W9SA 1QJU1 2GDFA 5CKQA 1DBNA 1JYVA 1G9AA 1O4YA 2QTWB 1AR63 1PM7A 2ZX1A 3BODA 4I3GA 5K9YA 3AKTA 4QQLA 2Q0AA 1A34A 1AX1A 1EY2A 1RHI3 4AVCA 1YCIA 1UMZA 1CJDA 2TBVA 2DVBA 2ZEZA 3OEBA 4ISRA 4GH4B 4AI1A 1H6XA 4D6SA 4OYUA 4MGSA 1Y43B 1O4TA 5DAWA 3I3MA 4D7TA 3AK0A 4AI2A 4CP9A 2WQ8A 4XFFA 1LOAA 4XE9A 3LSDA 3IN9A 3QOPA 3POFA 1MPXA 4XJ9A 4Z07A 3WUCA 1ZZ8A 3TNQA 2IWGB 3NMBA 1UU5A 3WDVA 4MGIE 2OPWA 4YGDA 3KF3A 5H9SA 2WNUC 5A7WB 3N7LA 1DLCA 3FHAA 1NCRA 5LA1A 1KFXL 1K5MB 1W2UA 1HRI2 3CQOA 2BTVC 3FFQA 4HG6B 3VBHC 1N3PA 4IE7A 4LO6B 3ZYBA 5JOXA 2JG8B 1F5JA 2VMHA 4L8QA 3WF3A 5FOBB 3AL6A 4JDOA 4MGQA 3ZFGC 5JZGB 4BXSV 5A3NA 1SLTA 5BNPA 5KHGA 2PHFA 1YYNA 2DBNA 2ZGOA 3O12A 4XUOA 5T52A 2GN3A 4GAZA 3AZZA 2BRTA 4DS0A 4FFIA 1VBA1 1GOHA 1Q8VA 4YM2A 1XOYA 1UOJA 2IZWA 2VCAA 2JIGA 4LKEA 5FP3A 2CSGA 3ZDSA 1ASJ2 4CU9A 4CU7A 1OHFA 3DXUA 2WWJA 4GB32 5B4XA 1AYN1 5FYCA 3WP6A 3X29B 5FQ0B 5DABA 1OSGA 3QH7A 3MICA 4LKSA 1ZBE1 2EIBA 2WZPP 4ET7A 5GZCA 2FHRA 2W08A 3B9CA 4ZXEA 4OUEA 1RUI2 4PLMA 3VD4A 2XMLA 3ELNA 1RVF1 4Q8LA 2ATFA 2YBKA 4PIXA 2YUEA 4E4HA 1UX7A 1PX4A 1NZIA 1YQ8A 1DQ2A 4OI0A 4O9GA 1UKGA 1ENXA 2VQTA 4IXLA 4NOTA 5JSPA 1JBCA 4LBKA 3ZXFA 1RMU2 1RUC2 1ENRA 3IM0A 4XJ8A 3WSOA 1ZYBA 1MVEA 3NO8A 1O3SA 1ZM1A 4COVA 4IETA 3OOXA 3VBOB 1YXWA 4YG0A 4Q4X1 5IVCA 2C9AA 2W1UA 3USSA 4NIHA 4GD4A 3C3VA 3POBA 3ZXDA 1O3RA 2GC2A 1ULOA 2WQ4A 4XMIA 2PHDA 1RUE1 1UW8A 4P9GA 4SBVA 2OW4A 1OA4A 2R7EB 4E2GA 4K40A 1ZRFA 1ND3A 3EQEA 3WNLA 4BLJA 4EWEA 2XJSA 3CEWA 1UKRA 2LW8A 4P9IA 2YFZA 3O1RA 4I09A 5F6KA 4AK3A 1U5ZA 2X09A 1QJX2 3VDDB 3WNMA 1FPN1 3LF7A 4EZHA 2R1BA 5ACA2 1QQP1 2HYKA 3EXUA 1PHMA 2CL2A 2YG0A 5J1XA 5CKMA 4P5YA 4R8HA 3RZZA 2JE8A 3O1OA 4LKDA 3T1MA 2NZ9A 3IDCB 1JODA 2SLIA 3TYJA 4XF4A 3RQ0A 4RN5A 2VTXA 3ZIWA 4DB5A 4BWOA 5KXCA 3DGTA 4Y3OA 4XAEA 4YZ5A 2EXKA 4HVOA 4KH9A 4AR2A 1CAVA 2GMPA 5DAVA 2WZEA 4KGGA 4RS5C 5LZ6A 1PO23 1J1TA 5CA6A 1XNTA 3IBMA 4M0HA 3LEKA 5FAXA 3N9NA 2VH9A 2G9FA 3KS7A 3LA3A 2PA7A 4NVPA 2CAVA 1K42A 2DYCA 2DVFA 2VZ3A 1BKZA 1NA1C 5FUPA 5FZKA 5A3UA 2WT2A 2WNOA 3PIJA 1JYIA 3HQRA 4HVRA 4NPMA 4O65A 4PT6A 1BBT1 3J4UH 2CAUA 4JTNA 4P5HA 3NQHA 4PBOA 3IDAA 1QJY2 3SKJE 1ODMA 4MG2A 2R061 4ZU7A 1YQ6A 2WS92 4I0WB 4B1LA 4MLOA 4R9CA 1LHUA 1COV3 1GANA 1I9RA 1DCSA 3AZVA 3LWCA 1VBD2 4ARYA 2WLPA 5ACA3 5HV0A 3BCWA 3PLQA 5EJ1B 5I0SA 3MIFA 3D3AA 3H1YA 4QU1A 5DUWA 1W39A 1LEDA 3WF4A 3O1SA 2JX9A 2XKOA 2ZGMA 4E8CA 1LOFC 2O8QA 3ON7A 3A0KA 3M2MA 1RIRA 1W2OA 1W6QA 3VHOA 1XPWA 1TME1 3JU9A 2YBPA 2X5IC 1XJAA 4QX2A 4Z82A 4HOOA 1GZ9A 2XJPA 2JECA 3AKQA 3KV6A 3ORJA 4NROA 2DCTA 4QWNA 4PI0A 4QX1A 4P9LA 1Q8OA 1YJLA 2ZTNA 4MXWA 2VCCA 2JDMA 4YZ4A 5ANNA 3M3CA 4BQ1A 2JG9A 4Q4V3 3VKNA 4YARA 3IPVA 1OLMA 1Y9MA 3CJIB 3SHRA 2BW8A 5JWPA 1KEXA 3WHTA 1RJ8A 4AVTA 1Q8SA 1ONAA 1FX5A 5A7NA 3EHKA 1SZBA 4XC9A 2E7QA 4IV1C 1CZTA 3NNMA 4R9AA 2PYTA 3LOBA 2PAEA 4EN0A 1MS4A 3ZLIA 1QJY3 4XDPA 5F37A 1V9U1 3FLRA 1V70A 5C33A 3WG2A 3PMEA 1OURA 1GBGA 4NHLA 5J98B 2IXJA 4BQYA 1D4M2 4FPHA 1YRZA 4N7IA 4HONA 4OCTA 3T1LA 2HEYF 3UETA 1JOJA 4FFFA 5FREA 3VBRB 1ZRRA 3AYCA 5CFCA 2QFEA 3VHNA 1YNAA 3PUIA 3B9IA 2PFWA 1UZWA 4OZXA 3ZFEC 3I3EA 4XF1A 1SHWB 2JB8A 2WL1A 1JUIA 1IS3A 3C7FA 4GJZA 4YVWA 3INAA 4LBNA 3RZLA 1OMIA 1ZVFA 4GWJA 4UFLA 3M3IA 2WZR1 4BQWA 1I5PA 1O8SA 1WKYA 1YQ2A 2WNEA 3JBG2 4HPKB 5SV8A 4DXTA 4IUGA 5F5CA 5A3PA 2NM1A 1OVPA 3UNPA 4JGYA 1WMXA 4B8EA 4N90A 1DF0A 4CPBA 2WO3A 5FTTC 1CJPA 1JS9A 4DINB 2ZGRA 5FIXA 5JSOA 3U11A 2AEYA 1AR72 5HXMA 3B69A 2R30A 2PQQA 3LAGA 5C3OA 4ES9A 1CGPA 3BGAA 4D0QA 4IESA 4MX3A 1OVSA 2WR9A 2P3KA 5FKBA 3DKWA 1FMD2 2DCYA 2L9LA 1IOAA 2YXSA 3J7MA 3CJXA 3W58A 2VOXA 3D4KA 3N9MA 1IPJA 1FNZA 2J1EA 5CFDA 1JZ7A 4HANA 5D8AB 1VIWB 4CDXC 5FY5A 5JOYA 2E33A 3I2DA 1GLHA 4Y1YA 2D6MA 3AMHA 1WA4A 3THCA 1D4M3 1RITA 1W6PA 4NRPA 5FXXA 1XC6A 4LBJA 3WZ1A 4B7EA 1RL3A 1PIV1 3I2FA 4QGNA 3NAPB 4Z2AA 4ONUA 2DV9A 1VRH2 4HSLA 4ORFA 1WCUA 1OF3A 1RUF2 2R0HA 4U36A 4UFIA 4NAMA 4ASKA 2R071 4GA9A 2J1VA 1AF9A 2WKKA 2B39A 3T2TA 4NIAA 2AC1A 4BK5A 1OH4A 2NLRA 4Q4Y2 1N3OA 3IZOA 1JN2P 3JBG3 1PVXA 4AEDA 4EZ4A 1AX2A 4A4AA 5F32A 3V64A 3H8UA 2V73A 2MEV1 3VBSB 4FAGA 1WW7A 1TMF1 3S5QA 2ZACA 4Y5SA 2DCKA 2BJSA 3ST7A 4F7ZA 1OT5A 2D6OX 2FQPA 4RFRB 3WW4A 2VD7A 1SEFA 2JDAA 5FY8A 5LWBA 4CDWB 3CF6E 4UAPA 3GJAA 5CG9A 1CZSA 5AC91 2GNMA 2WFF1 4CSWA 3ZXJA 1POV1 4YFWA 4QPGB 3FL7A 2JE7A 3ZM8A 1K5MC 4QQHA 2W95A 1F31A 3ZYJB 5BV6A 2Y0IA 4AG4A 2YMZA 5ABJB 4JC1A 2EIGA 5BNNB 1ND2C 1G9CA 5A32B 1X33A 4Q4W3 3ZFFA 5DG2A 5DDJ2 4N53C 5JZGC 1UU6A 2D40A 3GZAA 2VOWA 4KQ7A 4XF3A 1VBB1 3LPGA 2QJVA 4BQXA 1LKNA 3WDUA 4LLFA 2QVSB 1UMIA 1AYM1 1LU1A 1GQGA 1SACA 3QLQA 4CEYA 3NNLA 2VOTA 1NLQA 2RM21 1RUF3 2G19A 2D6LX 3AZWA 4CPBD 1CWPA 3LQCA 3F95A 2DVDA 5DMYA 1AXZA 1NQDA 1RUD1 4FI9A 2A5ZA 1Y9GA 1IPSA 3NL1A 2ZHKA 3H3ZA 4KGQA 1PK6A 2Z5WA 3IAQA 4DPNA 2VULA 4WVMB 4KMQA 4J1XA 3ACIA 2J1RA 2FMDA 2J7MA 5FWEA 1C5IA 2FCUA 1FYUA 2TEPA 5FXWA 1Y4WA 1L3JA 1OOPA 2VW0A 4WZFA 2Q30A 1UXXX 5FYSA 1XBFA 3AZXA 3S5AA 2RR12 4Y20A 3RWNA 2ES3A 4ZXKA 1LAJA 3LSEA 1T6BX 1EAH1 4OLLA 4UFJA 2XB6C 4JAAA 2XBO1 5GLVA 4UF0B 1MR5A 1RUH1 1W6OB 1HDKA 3OBRA 2VNRA 5A6XA 1R092 1S1AA 3J7HA 5I8TA 2TUNA 3ABZA 4FT8A 3VBOC 3OF1A 2A73B 4A41A 1QOOA 1A6CA 4IV3B 3AMNA 3RVHA 3THDA 3MZHA 5JR7B 3BOWA 4DXSA 3UJOA 4LO8A 2WIIB 2VU9A 1KJLA 2BGCA 2WUHA 3ZPOA 1UN1A 3ZVXA 1QDOA 3ZSJA 2JIJA 2ZEXA 4M4PA 1BEV3 5BPXA 3WCSA 1Z0HA 2HWD1 5F3CA 2QZ3A 2JDKA 2BEOA 1Q8PA 5B4NA 3RZHA 1BCXA 5L9RA 3ZYFA 1YJKA 3O0WA 4Z92B 3NKGA 2WN2A 3KVBA 2I2SA 1DGRN 1G86A 2HWB2 2J22A 3AJZA 5FPLA 5GLTA 1RUJ1 3E1F1 4L2NA 5EPAA 3D5OA 1X50A 4Q0QA 1KS5A 1G9BA 3M3QA 1YEWA 1ACCA 4SLIA 1F4AA 3ME2A 1EPWA 2LTNA 1HIXA 1G6NA 1RHI1 2LRPA 2Q1ZB 3M4FA 4QPIA 1BK0A 1OLME 1W03A 3MEPA 5A3OA 2XLFA 5CIRA 1HX6A 4B3NA 1J84A 1RUG3 2RR13 4H55A 4M3CA 4YM0A 2FDJA 3DECA 5FZAA 2F4LA 1J58A 3MBWA 4H14A 4KU7A 1H1MA 2YBSA 2P37A 1SPPB 4RHV3 4XQWA 3VHRA 1H2LA 4HN1A 3ZXGA 1R093 4FXGB 4J6GA 1WCKA 1H6YA 4O61A 5T5LA 4NN0A 4MHUA 4LBOA 4CCMA 1YC61 2RS32 2Y8KA 4MO3M 3Q9OA 3WQ1A 3TN91 2JDNA 1KJRA 5HXVA 5FR3A 4LTAA 1OLRA 4XABA 4F3JA 1XXNA 4XILA 1QHDA 4TZDA 3WP4A 4PIZA 2UY8A 5LEJA 1QWRA 3LB9A 3E5UA 3GZEA 3JQWA 1POQA 4XURA 2W5FA 3KV5A 2FCTA 3N9OA 3WG1A 3O1VA 2PHUA 4XJUA 4N43C 5C71A 5DUXA 3VKLA 2WNUA 3ZYHA 4ZZ8A 1LRHA 5JAXA 1SFPA 3PURA 1YUDA 3S57A 4YW5A 4FTBA 2VCBA 2BVVA 4DMIA 3VBHA 2UY9A 2WO7A 3FLTA 4KL1A 2YDEA 4GMP0 4LORA 1LHNA 2DF7A 4QX3A 4WM8B 4XZUG 3ZFGA 1HB2A 1WCQA 2GNTA 4C90A 1L7QA 1ZX5A 2V72A 1MS0A 2QZ2A 5E6HA 2WNVB 2Y6GA 4I0AA 1XYPA 2PHXA 4HKWA 1WGPA 5C3QA 3QACA 3T08A 4HN0A 4DFSA 3VKOA 4JKMA 2VBBA 3WP5A 3T09A 5FZMA 1PGSA 2R042 1W6NB 1RUOA 5F5IA 1UQXA 4OI2A 1CAWA 5I0DA 2AGSA 3CJIC 4N9IA 4XZPA 1HB4A 2JENA 5GJ6A 1CX1A 4ASLA 3LZZA 2OKXA 5JXGA 1RTVA 4K21A 1HRI1 1EUTA 1W8TA 5A3LA 1GICA 2PHTA 2YHJA 2P5BA 3ILFA 1DQ6A 2ARCA 2DU1A 3JUUA 4I0BA 2KM2A 4W50A 5EP9A 1FOD3 2YU2A 5FMCA 3UK9A 3OD0A 3T4VA 3TRSB 5IAVA 3VBRC 1Z7S2 1G9FA 5HI0A 1KRIA 1BVVA 4BQ3A 4MGYE 1QMJA 2OVUA 2V4AA 1T6GC 3K51A 4BCUA 1C1FA 1MEC3 4IEUA 3KQRA 4JGZB 5AVAA 3KHBA 4Y4RA 1D0HA 1PZ7A 4I2OA 1ASJ1 1LTEA 4PI2A 3JD72 4RR3A 2IVJA 4GB31 4QGLA 4DY3A 5FZEA 1GR3A 5SV5A 1UCXA 4YLZA 4AWDA 3ZN4A 3FLPA 3LEGA 1HXS2 4K20A 2GNBA 4XJAA 3DYPA 3MIBA 4Y33A 1D0GA 1WUVA 1ZBA2 3ZKYA 1PO12 1PNGA 2OXBA 3KMHA 2IUWA 1RUI1 1UO9A 2WT0A 4MGKE 4A2UA 5JVVA 1DZTA 5FZHA 3VLBB 1BQPA 1ULDA 5FYMA 1VBC3 1MS1A 2VL4A 1XB9A 2EICA 2YB7A 3DPRB 4URAA 4QKFA 1H30A 4LKFA 4TTGA 1MQTC 4RQPB 1U5YA 1XNKA 5KXDA 1RMU1 1RUC1 4ZZ5A 5FZ8A 5L7OB 2BBVA 2CHHA 3I2KA 4PQQA 5A33A 1R082 3J8F2 4FP2A 1WWYA 2RMU2 4EWAA 5BNOC 4Q0SA 4TN7A 2FDHA 4CDUB 1CQ9A 2PELA 2VMCA 1LECA 1REFA 5D8AC 1B09A 4NMIA 1N1SA 2IXLA 5FLIA 5K8SA 4CUBA 4BDVB 2LALA 3A22A 3I8TA 4RS5A 3URFA 3QH6A 3VZOA 4XFAA 1AR62 2Q1FA 3RZKA 4HBNA 5IK8A 1CZVA 1JZ3A 3FBMA 4DEQA 2W92A 4K6BA 3TEZA 2BBAA 4AEKA 1DGRA 3I2HA 5GALA 4AFAA 3I3BA 4UOJA 3ACHA 1NA1A 1OQ1A 1QJX1 3A21A 1S0GA 3DN7A 5LBFA 1GMMA 1CAUA 3L2YA 4AFBA 4QXCA 5HCHA 5DZFA 2VM9A 1VB2A 4IEYA 4AEJA 3N36A 1FNYA 4W6XA 5ACA1 2X53S 5IT6A 2PLV3 5APAA 4C1XA 1AJKA 1W8NA 3DYOA 1LOBA 1ZBA3 1BK1A 2ZAAA 1AR83 1LR5A 3OGVA 4Y22A 4BK4A 1NCRB 3MV01 4IEZA 4NRQA 1VBE2 2W0XA 1LGBA 5FMBA 2ZX4A 4QQ2A 1GU3A 3H8XA 3RMYA 1CD3G 2H0VA 4LULA 4NHMA 5FPVA 3TEWA 3ZSKA 2VW1A 4D6RA 5BNPB 2WQZC 4LUKA 1JHNA 2VZUA 5ABJC 3FUOA 2XR4A 3OB8A 5FP9A 1JU3A 4QMAA 2DTWA 2ZMLA 1LOFA 4N7UA 1O3TA 1BLZA 1ULFA 4Q1RA 1WLWA 3UYJA 4BYYA 1V6JA 2XKPA 5FLJA 2QBXA 2R1DA 4IE6A 4QT6A 5KC5A 2X5IA 2Z4FA 5H9PA 2CGPA 1UYYA 4UT5A 1AUYA 3OGGA 4EYUA 2ZOEB 5ABJA 3NW4A 4MUVA 2BU9A 1HJGA 5FBJA 3BYWA 3RWKX 4JTOA 4PHZA 4N8MA 3V56A 1YFXA 2WS91 4OMCA 4YZ2A 1K5JA 3N3HA 4MADA 3DF0A 2VMIA 2ARBA 4UBHA 5L36A 2W39A 3E97A 3ZX7A 2DUQA 1H2NA 4BJ0A 1DQ5A 2E7TA 3AFKA 4QXKA 1HW5A 1VBD1 2HYXA 4IV1A 2XL7A 3QBQA 3FHIB 2D43A 1OD3A 2GN7A 4HETA 5FYBA 5C9AB 1KITA 2HWE3 2RV9A 3PUQA 4W6WA 3ZSMA 3GGLA 1VBE3 1I3HA 3PJQA 2OQ7A 3LIGA 4YGCA 3BN6A 1GNYA 1JUHA 4IEQA 5FKCA 2A6VA 4YWAA 5FZ6A 1PVC2 2ZGLA 2XH6A 1F4HA 4LXLA 4WVZA 5C5UA 3MFCA 2D3PA 4YG3A 5FUNA 3VDBA 5AFEA 3UKTA 4L92A 1LHWA 3ZFEA 5C70A 2K9ZA 1S2KA 1I1EA 2BWCA 3GBGA 1ND3B 4PLNA 4IV3C 2VZVA 4QX0A 3AJYA 5JMCA 1NCQC 4QM8A 2F17A 1D2SA 1ZZ9A 4XUNA 1V6MA 4A6SA 4K3UA 5FBZA 3NWKA 3T4HB 1QXJA 5C3SA 5K0UB 1AR93 3SISA 3W20A 3LA7A 3JB4C 1DLLA 2A7AA 1APNA 4CEWC 3KV9A 5F7UA 2WLQA 2CNAA 3AVSA 4IEXA 3LEIA 4QHZA 4QX7A 1GP5A 3NSTA 3LA2A 1A78A 4EN7B 2ZEYA 1D4M1 4M3CF 1X9TA 2H6CA 4YZ3A 3T0AA 2CTVA 2K46A 2XJTA 3SKVA 4Q8KA 4E9KA 2P6CA 2E7AA 2YZ4A 1JZ2A 1CAVB 1ZREA 2JKXA 2VQAA 2A6XA 3HEIA 3U75A 2DTYA 2ZBJA 1VR3A 4XQ4A 4CDXA 4XF0A 3ACFA 5JUVA 4GKYA 4LBMA 2UWAA 5HCBA 1YQ5A 1O4ZA 4K1YA 3DEMA 1D2QA 1PO22 1PVC3 3QD6A 3ACLA 1OA2A 1W8OA 3JBG1 5T55A 3EMRA 3HN1A 2ZMKA 1U0AA 1WMFA 3HN3A 4A6OA 3JCIA 1RC6A 3ACGA 3KVAA 2Y0OA 4QXBA 5DUUA 1N1VA 3AP9A 3KGLA 3V0AB 1EV13 1H9PA 1W3VA 4NHYA 3R4UA 4WZCA 2AZ5A 4FFHA 4OUMA 1W0NA 1DDLA 3AMMA 1C3HA 3PU8A 1DQ0A 4GMP3 1AR71 2XLAA 3OGRA 2XONA 3AP4A 2DURA 4EN6B 1JYTA 3S6PA 4XUQA 1FMD1 1NOVA 4H2AA 2PHRA 3I49A 2RVAA 4COZA 5LK7B 1DHKB 3ZIXA 4KU8A 4MGTA 4H7MA 1XYOA 2E53A 4RYDA 3P1IA 2JJ6A 4WVVA 2ZX0A 3RI9A 1XU1A 4F8AA 4FTSA 1COV2 3AP7A 5A7WA 3AKPA 1K5MA 2WA3A 2D44A 3LFMA 4V1PA 1NXMA 1ND2A 2HWF2 3Q8AA 4FOYA 1QGLA 1VRH1 3RYPA 5A6YA 3ZO0B 4N53A 5JZGA 3ETQA 2UYAA 1RUF1 2J1AA 4M0NA 3WP3A 3A4UA 2VZOA 1VP6A 2D98A 4HL0A 4MXWB 1W2AX 2WNVC 3CNAA 1QNWA 2JG9B 3AKSA 5J09A 1MS9A 3PVNA 3IPVB 4Q4Y1 4L0PA 5FY4A 2VNVA 4YW7A 1CIYA 2FZ2A 1VMHA 4KWKA 1YFUA 3BALA 3PUAA 5EIYB 5KR7A 4QDQA 2ZGSA 4DXRA 3OD4A 4CYDA 5FYHA 1Y9QA 2XVLA 4Q4V2 4QD2A 3OPZA 1J3RA 1TG7A 3MHZA 3D82A 3LIHA 2ZCWA 1MVQA 4G4FA 3LDBA 3FMGA 5IUQA 2C0ZA 1PX3A 4Z8BA 5F3GA 5FQ0A 1AL22 3WG4A 2OX0A 1GZCA 2HWC2 3FC0A 3JXSA 5FY7A 2B42B 2HEVF 3RRDA 1XNBA 1PGW2 2ZZQA 4XCBA 5CFCB 1KXGA 3ILNA 5DDJ1 2J1TA 2Y33A 2HH9A 2WA4A 3ZN5A 1TVGA 1UY0A 5FXVA 2W46A 3BPZA 1OF4A 4KWUA 4YVWB 1TNRA 1BYHA 1H0BA 4CCDA 1H8TB 3N9QA 1NUKA 3T3YA 3U10A 3VBFB 2Z42A 2E31A 3PJYA 4JGZC 1DU3D 2HWF3 5FZCA 3VBOA 3MW3A 4E4SA 5LEKA 4FSJA 3MV11 4AYUA 2ET1A 4FPOB 2DUPA 4JGYB 4XFHA 5A70A 4ZY9A 4R9BA 3U4XA 1PGL2 2PAMA 3U1XA 2BQPA 2H0BA 3C8XA 1IG0A 4GWIA 5I8YA 2WN3A 3AYAA 1WD3A 4HXCA 3GHMA 2F4PA 2FBEA 1X82A 2KXLA 1S0EA 3ZYGA 3A0NA 1V6LA 3WDXA 4CCEA 3NNGA 1SLBA 1WD4A 2Q4SA 3UV9A 4XDOA 1GQHA 4B4RA 1F15A 3J26N 2I45A 3DPRC 4MXVA 2O14A 1XU2A 3D6EA 4YSFA 2RR11 4J1WA 5CFDB 1AL23 4QX8A 5FK8A 1C8M3 2E51A 5FYYA 4OI1A 2OUJA 5L7OC 5LRSA 1US3A 1HKDA 2HWC3 4FOQA 4CCJA 1JMUB 1W6PB 2GU9A 2J1SA 3AX4A 3MUY1 4PQ9A 2WO2A 4I30A 1R091 4W65A 4ZS3A 3ZYPA 2YC2A 5C4WB 4A3XA 1S0FA 4CDUC 2VE1A 3W59A 4CUCA 1YO8A 1S0IA 2VUJA 1SDWA 4YFZA 1W6MB 1FT9A 3OBAA 4NJ4A 1W28A 1QJU3 1UZYA 3RNSA 1W9YA 3KM5A 5FZBA 2AREA 2VZQA 1U5XA 1PM4A 3SH4A 4AEDB 5CBLA 4AW7A 2NPIA 4LE3A 2RHPA 3WINE 2WJSA 1TNFA 3GHNA 1WW4A 4XFIA 3WF0A 4FQ4A 1V6NA 4BMBA 3OYWA 4PF5A 3LDRA 2Z69A 2HWB1 4JCKA 5LY2A 3J9SA 2XG3A 2Q1MA 4CZSA 1SG3A 2A75A 2XPJA 4Q0UA 1VALA 1OQEA 5J7MA 2ERFA 1R1A2 2ADDA 3RJRA 1PMHX 4RSUA 2C9KA 2RDRA 2XXZA 5EZWA 4O9EA 4XHBA 5FK7A 4D7SA 4IE4A 1DQ1A 1JZ5A 4AHYA 4N43A 1IQDC 3WV6A 3W5NA 2XJUA 2Y6FA 3EB7A 4OMDA 5DZEA 4DRVA 4B29A 4XETA 4Y1ZA 3TWIA 3CO2A 2EXIA 1WBLA 1QEXA 4P9WA 4QHBA 3USUB 4AHXA 4BM8A 3HAGA 4K8FA 3D8CA 4QDSA 5F3EA 4Q4W2 3T0BA 3ZN6A 3F2ZA 1DZQA 5KHHA 4PDWB 2ZHLA 2JKBA 4X6QB 5A1FA 2GNDA 2ZGTA 1V00A 3W21A 2RS31 3MIDA 2XDVA 2ZPXA 1ODNA 3OCPA 4K9SA 3WF2A 4CDQB 2UYBA 5ANQA 4DQAA 4R4ZA 1LNSA 3I3QA 2VNOA 3B94A 3VDAA 1VBA3 2Y38A 2BNNA 2YGMA 5E89A 2ARXA 4CCNA 1W0OA 1XNAA 4OHXA 4YGEA 3A7QA 3K4ZA 1VAMA 5J96B 1POV0 3CJIA 3FN9A 4G9SB 1ENQA 3BTYA 2QNKA 4GH4C 3GNEA 4G3YC 5FP4A 1AYN3 2YV8A 1OOPB 1W9FA 2CDOA 4P9XA 1QU0A 3NNFA 5T3NA 5FPXA 4QKNA 4FPJA 4KG0A 4PIYA 5LA2A 1U12A 3LOIA 4BA6A 5HPOA 1ZBE3 4RFT0 3IKWA 2X10A 3WNNA 1YFYA 2GMMA 1R1A3 4AQSA 5C9AC 5IFTA 3SCFA 1RVF3 2RDSA 1KS4A 4BZ4A 3I2JA 5FJHA 1URXA 2XQXA 3VBRA 2DBIA 4XACA 1AXYA 2YPDA 3POWA 4CUAA 1QNYA 3HIFA 5JPMB 2LS6A 5CNAA 2FZ1A 3WNPA 4NWVA 2JG8C 4BIOA 1D4VB 5HCFA 5TSWA 3SQOA 3HT1A 5ISLA 5FZFA 2R041 5DAPA 2VTXJ 5C8CB 4AE2A 5E88A 4AEMA 3WNXA 1IG3A 1W2TA 5FPAA 1MS5A 4QB1A 4H3WA 3SEEA 4D69A 5C5TA 2VG9A 5GZGA 5JXJA 1BEV2 5E1RA 1F2NA 4L9BA 1LODA 2YROA 5FY0A 2D93A 4KWLA 5JR2A 4YVSB 2WSVA 2B46X 3EJKA 5K0UC 1JYNA 3KCXA 4I3PA 3H50A 3VZMA 5HCAA 2ADEA 1OLQA 5DPNA 2Y6LA 4Q2FA 3SCHA 3RYKA 5G05L 2VQUA 4XXPA 3VN4A 2ZAHA 4QPIB 1MQTA 1Z7S1 2DWRA 4GALA 1FPN3 3ITQA 4M4RA 5K7PA 3RSJA 1NT0A 3DKQA 3MIEA 4RGGA 4JQRA 5K4LA 3KB5A 4M3CB 2I07B 2IFRA 5DG1A 5BNOA 1ZA7A 2Y6JA 2V5DA 3HQXA 4XTMA 2D5HA 2XUEA 2BZDA 3HBZA 1BJQA 2C6SA 4OI4A 5D8AA 1E5RA 1YWKA 3TNPB 3T2QA 3JD71 3NJZA 1RUG2 4HSJA 2A6WA 5A3TA 1HB1A 1S0JA 1YIFA 1K45A 1VE0A 3AKRA 3I2IA 3NJXA 4RHV2 3UGGA 2P3JA 3VBUB 1HXS1 4KNCA 2LROA 5GLWA 1NLRA 1ZBA1 1PO11 4RGKA 3MIGA 5DXDA 3GYDA 2VMGA 3NJVA 3AYDA 1PZ8A 2XJQA 5FLHA 4URTA 4CVUA 4YG6A 4IE0A 5KHIA 4AFDA 1Q3EA 5EYXA 4OQ8A 1O8PA 3T2OA 1J3QA 3O1MA 4A45A 5DN2A 4FFGA 3CL1A 4QGMA 1LEMA 1T2XA 2WNUB 1CX4A 1BBT3 1R081 2QQVA 3J8F1 4C1WA 5FWJA 5IK7A 2RMU1 2KD7A 1F5FA 3VBHB 4E8DA 1JZ8A 4I01A 3VDDC 1JYXA 2WDBA 5IYYA 3OY8B 1FAYA 4F83A 1GNZA 3ZFGB 3BU0A 4KBBA 4Y1UA 4ZKTB 4AF9A 1UPSA 1AR61 4FPKA 4P14A 1OBNA 1C8NA 2C24A 2D6NA 1KQRA 2UWCA 3E5XA 4Q0VA 4QQPA 2SBAA 4Y5Z0 5BYNA 4NIDA 1CIWA 5JI7A 1C4RA 2J42A 1WLTA 2E9QA 3V0BA 1DGWA 3ROUA 3AXEA 3FHQA 1US2A 4ZHNA 3BTZA 2X8KA 4LIUA 2HJIA 1DQ4A 2GP3A 3GDBA 4XHXA 4EE2A 1TE1B 1GZWA 3LGRA 3O0XA 3RMXA 4L11A 3VZKA 2WYSA 2Y60A 1DYKA 2BFUL 2VUDA 1VBE1 4FO9A 4M01A 1LOGA 1OFSA 5AFBA 4LMFA 4LK7A 1IS4A 2NP0A 1XNCA 3DXTA 4IEVA 4WM7B 4LBLA 3RS6A 3I59A 1WMEA 2GC1A 1UWWA 2QQPA 1UY2A 2JD4A 2UU8A 1ULEA 1SLAA 1UOBA 2VTFA 1EYBA 4ARXA 3RYRA 5LY1A 4Q1PA 1UIJA 3POEA 2A3YA 4LNVA 1LULA 2WSUA 3ZOIA 4UW4A 2P2KA 4MVTA 1IKPA 2AUYA 5CFCC 1VMJA 2XJVA 1FOD2 2PTMA 4XAAA 3KLSA 5CZKA 1EUUA 4MHRA 1GWMA 5GZFA 3ZXLA 2O8OA 4BB3A 1V9U3 3AL5A 3AVRA 5GZDA 4BE3A 4C91A 3WQ7A 1NKGA 4UW3A 2VMEA 4RR3B 2O1QA 3O14A 4UF0A 1H8TC 2R32A 1MEC2 3PNAA 1DP0A 2HEWF 2CGOA 3VBFC 1O7FA 1IS6A 3PDQA 4AI0A 4JHTA 2VC9A 4CCLA 3RPQA 2P6HA 2WFPA 2ZKNA 4LHLA 2P4EA 2E63A 2EIEA 3N7MA 4IV3A 2Q8OA 1XSRA 2VW2A 3BKZA 1YI7A 5FXZA 5FO8B 5CISA 1E5IA 1NCQA 4NPLA 4RL7A 4BHPA 1ZRDA 4CXWA 4JRAA 1LJ7A 2WZR3 4YYOA 1BMV2 1YIPA 4FCAA 2TNFA 3SCGA 2BFUS 4WVWA 4LIVA 4R4XA 1V6OA 3TEXA 1E5SA 3WY6A 4EQVA 5FRAA 4Y4YA 4CEWA 1VBC2 4X8NA 2ZMNA 1F35A 2P1BA 4QM9A 1NG0A 2BERA 2G1MA 2WZ8A 1H1AA 3KCYA 5FZ1A 1FV2A 3NJYA 4AHWA 5CG8A 1SQ4A 4PF1A 1PVC1 3NV1A 4V2WA 5T5JA 4DUWA 2GH8A 4JV4A 4FP3A 1OH3A 2ORXA 5GKAC 5JOZA 5C4WC 1GQPA 5KXEA 3FUQA 2RS52 4IE5A 4MV2A 5A1AA 2B45X 3OBTA 2EVXA 2IXIA 2RDNA 3J7LA 1WA6X 1L7LA 3MI8A 3ASIA 1V0AA 1B35B 3HMYA 1OXCA 3U4SA 2DFBA 3N7KA 4QXHA 1N1YA 5HV4A 3AYEA 4GZ9A 4EV0A 1CAUB 5EXOA 5HBAA 3OUHA 4IL7A 4OHVA 2B9VA 3ATGA 4AFCA 4NRMA 1FATA 1WLDA 1PIV3 3ZR6A 5FZ9A 3WW3A 2OIIA 5FDBA 4LLOA 2Y6KA 2QQIA 4Y22B 4IEOA 4JQTA 1PNFA 3VKFC 1G7YA 4XUTA 3WLUA 2WINB 5FZ0A 1SLIA 1UY4A 2VXJA 3KF5A 2PLV2 3PTRB 3O5SA 3PVBB 4RA0A 1AR82 1JH5A 2ZX2A 1Z78A 5KHJA 1I6XA 2Q5TA 1GV9A 2MEV3 5IVBA 1BVP1 2CYFA 3NV2A 1TMF3 2XL9A 3M3EA 2JDYA 2XHNA 4IEPA 5FOJB 1QJFA 1AL0G 4ASMB 1MZ6A 1LHOA 5A3MA 3KCCA 1UZZA 1UU4A 2B8MA 1PO21 2W94A 5KBFA 2WWUA 1XE7A 3N35A 5FUIA 5F5QA 2WFF3 5AC93 4K7JA 4HFSA 1POV3 3LPFA 2Y34A 3WDYA 5IVJA 1OA3A 1UZ0A 1K3IA 3DUIA 4ISQA 2D6KA 4PDWC 4QX5A 5I8SA 1KDKA 1H9WA 1WW6A 2QQNA 2RS53 2ZXQA 3D0JA 3OJBA 3VZNA 2CWSA 4AQTA 1SCSA 3AB0A 4NHKA 2WNVA 5FZ7A 1IPKA 4TLGA 1VBB3 1RYYA 3D0SA 4CDQC 3SXWA 1HRV2 5A80A 3LKJA 3TB0A 5IK5A 4DNYA 2IC1A 3NAPC 4CCKA 1XRUA 4DY5A 1AYM3 3POYA 4XTPA 4IV1B 4CP9B 2QQKA 4QAWA 1NE4A 2YGLA 4OFGA 1HQWA 4FPEA 3MW4A 3VL9A 3ZYRA 2RM23 2E32A 3THTA 3MLLA 1ZZBA 1UYPA 4OHWA 1COV1 3J7NA 4LT5A 4QKDA 2J1UA 1GZTA 1OI6A 2VVEA 4LPLA 3VKMA 3VBSC 4LA3A 1RUD3 5F6LB 2ET7A 1N47A 3IIIA 4L99A 4ZONA 4YW2A 2HWE2 2HWF1 2PHWA 4EJRA 2EXJA 2OT7A 4IGQA 4HVQA 1XE8A 3Q8BA 2JD9A 1RUNA 1TZOA 3ZFEB 4CDWC 3VV1A 3PU3A 4IERA 1LOEA 2JDPA 1H2KA 4QPGC 1PZ9A 2I74A 5KXBA 3B01A 2FCVA 3WR0A 3ZR5A 5BNNC 4JGZA 1O59A 1CAXA 3MF9A 2A1XA 1RUH3 2AYHA 3BB6A 4C0HA 1REEA 3WQBA 4Q4V1 4S2HA 1UPIA 2W87A 3H8RA 3BI3A 3C7HA 1QF3A 5C8CC 3H42B 3P3PA 3CZUA 5F2SA 2OZJA 1XYNA 1UMHA 1AL21 3AM2A 1X7NA 1HRV3 3AP6A 1W9WA 2HWC1 3PUSA 1UZVA 3I97A 4YM1A 5FZOA 2FDKA 1AR92 2E6VA 4YVSC 1QJY1 4M00A 2QQMA 4QB6A 4XBLA 2FD8A 3HNBM 3K3NA 1PGW1 2GMEA 2ZA9A 5FYUA 1OD5A 5LCWL 5CADA 2V4VA 2IVIB 3R0RA 2HWD3 2VNGA 4XUPA 1VAVA 3PMSA 3W5MA 4XJZA 3UKVA 3ZMOA 1ZRIA 3DPRA 1W05A 4M3CE 3O1TA 3ZMNA 3MF6A 3VDCA 4DXZA 4BU2A 2WWSA 3FWEA 2XOMA 1A8DA 1RINA 5LATA 5LBEA 5L7OA 1UY3A 1IKQA 1GP4A 1RUJ3 2Z79A 3WG3A 4Y26A 5D21A 1W2NA 2W47A 4AI8A 4CDUA 4NWWA 5CYYA 2W1WA 2MPFA 4JX0A 2WYFA 3HJRA 1JU4A 3N9PA 2HKXA 2ZHMA 4LO4B 5F8PA 4EROA 1MZEA 1PGL1 1EP0A 3CBNA 4OULA 3KT1A 2PN5A 3S0MA 3WDTA 3IAPA 4HK8A 4UW5A 3VBUC 3VGIA 3IMNA 1WZXA 2O0OA 5T50A 4GULA 4J25A 4OQ9A 2BUKA 4UFKA 2AR6A 1EV12 2D3RA 5JDBA 4LO5B 2RJKA 2VPVA 3KT7A 4HKLA 4ZS2A 2VZPA 5LK5A 1UY1A 2GALA 3B3QE 4LBQA 4FOWA 3U37A 5L19A 2B7YA 1HQLA 4NIIA 1KD7A 4JDNA 1C57A 1ENSA 3TN93 2VJXA 3ZSLA 4BMEA 3VZLA 4TLFA 2YY1A 4XF9A 3RJ2X 3PVOA 3H7JA 4LITA 1W8HA 2VXRA 3K4AA 4GKXA 1LGNA 2BGPA 1ND2B 2R6QA 5G04L 3WF1A 4YRDA 5J36A 1GOFA 3CHXA 3NNJA 5M0TA 1MZ5A 3V65A 3K75B 4N53B 1LB2A 2C1FA 2JDHA 2A6YA 3B93A 2EIDA 5IVVA 3WQ0A 1GUIA 3IB3A 2WAAA 3K77A 3H1WA 2Q8DA 5JOWA 3HWJA 4Q29A 3OBZA 1LU2A 1J83A 2NMNA 2XJRA 3E6DA 2PHLA 5A33B 4HT1T 5C3RA 1LCLA 3CMGA 5E16A 2KR2A 3LEMA 4UW6A 1XSQA 2XQRA 1NLSA 2QQOA 1UNBA 2AENA 4BQ4A 1NY72 5D1IA 4DO0A 4KBZA 2R49A 4HLTA 5IAXA 3ZYIB 2ZGQA 2DDUA 1SBDA 2ETEA 3A23A 4CXYA 1ZZ7A 3HNMA 4KG8A 5F3IA 5FY9A 1R1A1 2JDZA 4PLOA 3BPSA 1CR7A 2Y64A 4Y1XA 4YGBA 4E2QA 2OPKA 5FPZA 1GKBA 1K12A 2VVDA 2VZ1A 4GH4A 4WM7C 1STMA 5BUVA 4Y5TA 1SFYA 3AXDA 4EN8B 2JICA 5LA0A 1GOGA 1OC1A 1GSLA 1JYWA 2A70A 4WV8A 3U07A 3E6CC 2Q8EA 1A8MA 2ZGNA 4QB2A 1SDDB 2V09A 2NN8A 4JHZA 4Q4W1 5C9AA 1J59A 5JCTA 1HRI3 4GWNA 4BLIA 2VZSA 3PVEA 1JOPA 3IMMA 1XNDA 4XBQA 4ZU4A 3POIA 3ETPA 1S0CA 2ZHNA 3K4DA 2WT1A 2VUAA 4K1ZA 4JZRA 1GNHA 1Y3TA 2XLGA 3DCQA 4RR3C 3M70A 1HV1A 1W6QB 4HKOA 4BISA 3HNYM 3BTAA 3EBRA 1R1ZA 4WM8C 4MGZE 3O1PA 2JG8A 2ORZA 2P3YA 4CA9A 1RJ7A 3UL2A 3NRUA 4CE8A 1SLCA 4KI5M 5JXHA 2UURA 2VMDA 4Q5OA 1ASJ3 5EQUA 1VMFA 3WVJA 3MGUA 3H1MA 3OGJA 5EWSA 4A7ZA 1QH6A 2IXCA 4GB33 2VY0A 4IDZA 4P00B 2FDFA 3IIAA 4LBQD 3WNKA 4XFGA 4XIOA 5LASA 5K0UA 1C1LA 2KA3A 1QIQA 1JHJA 3I2OA 4AZZA 2ARAA 3VUOA 3BIEA 3NVCA 3O0VA 4YW6A 5GLUA 1RUI3 2ID4A 4Y1VA 3VZJA 1NX9A 4TXWA 3FBYA 3WCRA 3L9JT 1C8M2 5GZEA 1MS8A 3EYPA 3RG0A 1SBFA 1UOGA 1RB8G 2CY6A 5CEHA 3TAYA 3BOPA 1C5HA 2QDRA 4C0BA 1EPZA 5KC6A 3ENRA 3SITA 1AX0A 1NAEA 1RMU3 1RUC3 3O7OA 5L73A 4A7KA 2FDIA 2QDNA 1V6IA 2BYVE 1LENA 4AGVA 2RS12 5JXIA 1AZDA 1B35C 5IW0A 2GAUA 2JE9A 2WABA 4XOGA 2XHKA 2G4IA 1QJU2 5CU1A 1Q5OA 2XGXA 1AHSA 4MYEA 3N4MA 3OYWB 4LQRA 5A7OA 1BEV1 2P34A 3I2GA 5D2AA 5T54A 5DAQA 1QKQA 2DCZA 3FX3A 1ULGA 5FPUA 3O1UA 3AMQA 3V0AA 4B4QA 1J1LA 3B7MA 1HB3A 2JWPA 3RI8A 1JOBA 4Z1VA 1VPHA 3ZXEA 4FTEA 4AGRA 3MLKA 4W8JA 5L9VA 3B02A 4RD7A 2GC0A 3VD3A 2QCSB 4AGGA 2VQ0A 4CU6A 1QJX3 2MNGA 4MZUA 5FZDA 1RXFA 1CPMA 4E2SA 4N43B 2VOVA 3WOGA 1AJOA 1NYWA 1UD1A 2CV6A 2BVBA 3PHMA 3S30A 2ZX3A 4JKKA 5B2GB 1DYOA 2DVAA 2ZEWA 2B4KA 3CZJA 4OZOA 2QQWA 2IFWA 5IVYA 2X29A 3VDDA 3ZN6B 1V6KA 4GXLA 4LHSA 3VD5A 4N9HA 4AVAA 1L7RA 1RUG1 3OUIA 3UJQA 4D8MA 3KGZA 3POJA 1MACA 4RQPC 2WO1A 4RHV1 3KWVA 4FPLA 1JI6A 3RFRA 1E5HA 1W99A 3OEAA 4FPGA 2VMFA 3OUJA 4IGOA 4COYA 3BUCA 2JDUA 3THPA 4P08A 5A7PA 4Q0PA 5A3WA 3NV4A 3U78A 4UFMA 4TYSA 4GJYA 2RJ2A 3UESA 3T2PA 3K3OA 2RS13 4HZFA 1R64A 1Y7BA 3MPPG 3LCPA 5FMDA 3W9AA 5LB6A 1QDCA 2XUMA 1VBA2 5IHRA 1OUXA 2D97A 2ZS6B 2E26A 2QQLA 4CCOA 2CU5A 2W52A 1UXZA 3C2UA 4A3ZA 5F9TA 5C6CA 1AYN2 3TBDA 4YNIA 2WS93 4IW3A 5FMOL 2B5HA 1OPOA 1QXPA 1H4HA 4LJHA 5F5AA 4A42A 1WBFA 3EO6A 3I7DA 4E4DX 3GCWA 2ZZJA 3MPBA 4NHXA 4R52A 1ZBE2 5EYYA 3WUDA 4E27A 1O3QA 1WMDA 1NCRC 1VBD3 2VZRA 4D7YA 1RVF2 3ALQA 3AC0A 1GWKA 5T5OA 3POGA 3ZFFB 4XEZA 5FZ3A 2EAAA 4V2VA 4ZU5A 5BNPC 3IT8A 2PQSA 2EA7A 1UOFA 1H8TA 3SH5A 4Z2WA 4UXAA 4XDQA 3TEYA 4EN9B 4L97A 3MFAA 3VBFA 3UT0A 2AEZA 2ZABA 3IWZA 4JKLA 2A71A 3FZ3A 3BVCA 4XYXA 4CEYB 4UBGA 5FZIA 1M06G 4XW3A 4Q4X2 3NKTA 1UF2C 2BV4A 2K0GA 4DIQA 1X8MA 1ST8A 2BNOA 1S2BA 2GZWA 5FZLA 2X05A 1HJFA 1QH7A 5FP8A 3RGBA 1XE0A 4H7LA 1G8WA 1A3KA 1RUE2 4X8PA 4CP1A 2P17A 5E8AA 3VL8A 1MQTB 2PXJA 5FP7A 4Q26A 4Y24A 1PK6B 4AI3A 3GF6A 5IVFA 3JB8A 1FOD1 5JIAA 5IATA 4BPZA 1MS3A 3H3LA 1S0BA 3M7AA 5FMOS 5BNOB 3ECQA 5JMOA 1ULCA 1SBEA 1JZ6A 1HN0A 2OUHA 4DOUA 4XCAA 1CN1A 1FPN2 5C3PA 3WX5A 4DUXA 3PUHA 4Y20B 1NXD1 1QQP2 3B00A 3M1HA 1MEC1 5H9QA 4ITCA 3R6SA 3GXUA 5C4WA 3GM8A 5A7QA 3MYXA 3H9AA 1OKOA 5I0RA 3DL3A 4XMAA 4COWA 3IDBB 5F39A 3SNMA 3RZJA 1AVBA 2BPA2 3Q8CA 1S2EA 2G9GA 3B5LB 2HLEA 1VB4A 1W6MA 2WAOA 3BU7A 4XXAA 4Q27A 4XVHA 1VLNA 3JZVA 4MSVA 1QY4A 2ZGPA 4AVBA 1BMV1 4FQZA 3RDIA 3ZXAC 3LFIA 4LEJA 3BTXA 2Z2SB 4MOAA 2XVGA 4E4ZA 1ND3C 4CRQA 3MUZ1 2W2IA 1VBC1 4Q4X3 5BY5A 2A3XA 2VO5A 4HPKA 3C7OA 1UIKA 5BXXA 3KZ4C 2DU0A 4META 5GLZA 1AR73 1VJ2A 5I91A 4LOSA 4CP0A 4XPVA 1RUE3 1BBT2 3AZYA 3GALA 4YW4A 1ZZ6A 1FMD3 3GBWA 2CWMA 1Q8QA 4AOCA 1G9DA 1X36A 1DGLA 2P3IA 2RS51 3I54A 2R062 1YLLA 4LOTA 1XQNA 4GQ7A 2OS2A 3OG2A 4AQ6A 2C26A 2OZ6A 3H0OA 5IK4A 4CXXA 1RXGA 3V0BB 3USUA 2ENRA 3WEZA 1X8EA 3WT3A 4AVVA 1QQP3 2NMOA 1JZ4A 3PL0A 4AQ2A 4NPRA 2B9UA 4W6YA 1S0DA 2Q8CA 4PDWA 4AXOA 4HMZA 3SH3A 5FJKA 4O7XA 4QDRA 3P6BA 5J48A 3ES1A 1OQDA 3DV8A 1IS5A 3P5BA 3WHUA 4FOVA 1VRH3 1GZWB 2JB4A 3T30A 4OHYA 1YFWA 4W4ZA 4CDQA 5F1RA 1TME2 1W8UA 3SC7X 2N7GA 2MHFA 2PLV1 3NAPA 3I59B 4Q4Y3 4FBFA 1QOTA 2YC4A 1AR81 2FMYA 3M8LA 5FV3A 2A6ZA 4JDMA 3RZMA 3S7EA 3HD8B 3C7GA 2RJLA 2EAKA 2LM3A 4R9DA 3KSCA 5AVPA 2VZTA 5KHKA 1UYZA 1IQAA 2BWAA 3CIHA 4NE9A 1N1TA 4QHOA 5KWRA 5EJ3A 1GP6A 3APBA 5IWFA 1OUSA 5DUVA 3VBSA 3HR9A 4XQDA 1UL9A 5FZ4A 1F9KA 3HT2A 4UFHA 1WCDJ 5FO7B 1ZZCA 3FE5A 3QCWA 2BP6A 2WC2A 3GBFA 2F6BA 1V9U2 4CDWA 2EALA 1JYCA 2R063 2DUOA 2D3SA 1OPMA 4IQPA 2GH2A 4S2FA 5DDJ3 2VBPA 4X6RB 5JLVA 4QPGA 4BXFA 1NQJA 4YW1A 1W8FA 2XWJB 2EXHA 1NCQB 1HRV1 1JTZX 5BNNA 3GZTB 2H6BA 5A7SA 3HPNA 5A32A 5L9BA 4C8DA 1X9PA 1BZWA 1GFF2 2EF6A 1BXHA 5C8CA 2QUOA 4JRLA 4B1MA 3M3OA 5DQ0A 3AMPA 1VRBA 5IFPA 1KDMA 4D3WA 4LUMA 3FFZA 2JG9C 4CEWB 2HBTA 3POSA 1ULPA 2WZR2 1CAWB 3U14A 4ATFA 1WCSA 1TME3 4UWDA 3GCXA 5IVEA 4DRRA 3S7IA 1WW5A 1DGWX 2YPJA 4YVSA 5BNQA 1YQCA 4DUVA 1CPNA 2HWE1 5EHDA 2BOJA 1DYPA 1JXNA 5H9RA 3NV3A 4FPYA 3G7DA 4A44A 2AACA 5FY1A 3WNOA 2NYYA 4AL9A 1HN1A 3H8OA 5FFOC 2W1SA 3CU7A 1UX6A 4LE4A 4QKBA 5FPBA 1H1IA 2D6PA 2ZGUA 3CKHA 4WVMA 5LA9A 1FI2A 1W3XA 4XJWA 2LUWA 4AI9A 5EFUA 2GP5A 4P9JA 3K48A 2CGNA 2D5FA 2VECA 4NR1A 4D6QA 5J37A 3R05A 3LE0A 4YPJA 3WDWA 4PBPA 2D7FA 1S4CA 1GYKA 5ERLA 1SLLA 4YVWC 2K2SA 1QJEA 2VGDA 4DZGA 5FCCA 1QXRA 1W6OA 3MO4A 3VBUA 1H4GA 2JXAA 2PAKA 1REDA 4P9YA 1PMIA 3GZUC 1I5ZA 4KWJA 2ILMA 4UYBA 1PIV2 5CVRA 1F8VA 1AR91 4ES8A 5I0TA 2WBKA 4JGYC 4IGPA 1CVNA 4LK6A 3LDKA 3ZSEA 4TWTA 4AFMA 2R072 5FZGA 3ILRA 3I3DA 3Q8FA 4LHKA 3RZGA 1DZRA 5JPNB 4I02A 3TOJA 1M4WA 1PMJX 2ZJCA 4FPFA 2HWB3 1W06A 1HQNA 1W04A 2W1QA 3E5QA 3K2OA 1WLCA 3OPWA 1DIWA 3CDZB 3ES4A 4OVEA 2MEV2 2VUCA 2QE3A 3R4DB 5DAXA 1TMF2 4FVVA
chains in the Genus database with same CATH topology
1CZSA 2XOMA 1UY3A 2J1TA 3FL7A 3ZM8A 1TVGA 2W95A 4AG4A 1UY0A 2W47A 2W46A 1OF4A 4KWUA 5CYYA 2W1WA 4JX0A 3HJRA 1JU4A 1NUKA 2E31A 3LPGA 2QQJA 2C4XA 2W91A 3IAPA 3MV11 1UMIA 4ZY9A 1KGYA 3C8XA 4GWIA 2VOTA 2WN3A 2BGOA 2VR4A 2VZPA 2W9XA 5IJRA 1UY1A 3LQCA 5DMYA 3U37A 3NNGA 4FI9A 2VJXA 3IAQA 4KMQA 3ACIA 2J1RA 2J7MA 3K4AA 2W3JA 1JYVA 2BGPA 1P8JA 5G04L 3WF1A 1GOFA 1US3A 5C7GA 3HOBA 2J1SA 3K75B 3MUY1 1UXXX 3UNPA 2WO2A 2EIDA 2YC2A 1GUIA 3IB3A 2WAAA 3K77A 4CUCA 2YFUA 1J83A 3J7HA 2CDPA 3ABZA 3CMGA 3OBAA 3DYMA 4A41A 2QQOA 2VZQA 3THDA 4AAXA 3VD9A 4DXSA 4QPWA 2WUHA 2DDUA 3WF0A 3A23A 2ZEXA 4M4PA 4UI9L 3HNMA 5B4NA 2Y64A 1SG3A 1K12A 2VZ1A 2WN2A 3T0DA 2J22A 4CU8A 4P02B 1GOGA 1PMHX 2C9KA 5LA0A 1JYWA 3E1F1 1JZ5A 1D7PM 4QB2A 1SDDB 1BHGA 1F4AA 1IQDC 4JHZA 4DEVA 3W5NA 4OMDA 3EB7A 2VZSA 3ETPA 3K4DA 4QDSA 3T0BA 3F2ZA 1J84A 3DECA 3HNYM 3MBWA 2ORZA 1W9TA 3OGSA 3NRUA 3WF2A 1H6YA 5EJZB 4KI5M 5JXHA 2VMDA 1LNSA 3C7EA 4MO3M 2Y8KA 3VDAA 3SEPA 3K46A 4P00B 1UYXA 1XNAA 3A7QA 3K4ZA 3WNKA 3FN9A 1JHJA 2CDOA 2ID4A 1NX9A 4TXWA 4XURA 2W5FA 5LA2A 2Y6HA 5HPOA 3WNNA 2X10A 3EYPA 5C71A 4ZZ8A 5IFTA 2VCBA 3VD7A 2DCJA 3I2JA 2XQXA 1NAEA 1W9SA 4QX3A 4XZUG 4CUAA 2LS6A 1WCQA 5JXIA 3WNPA 1L7QA 2V72A 2WABA 2Y6GA 4LQRA 3T08A 3I2GA 4JKMA 2ZEZA 3T09A 4QB1A 3OEBA 3SEEA 1H6XA 4OYUA 4MGSA 5JXJA 4W8JA 3VD3A 5JR2A 2WQ8A 4CU6A 5I0DA 1JYNA 1MPXA 1CX1A 2OKXA 4JKKA 5JXGA 1DYOA 2Y6LA 1EUTA 5G05L 2VQUA 2B4KA 2ZEWA 3CZJA 4OZOA 4W50A 4M4RA 1DLCA 3FHAA 5LA1A 4LHSA 3VD5A 1L7RA 3CQOA 4HG6B 4D8MA 2Y6JA 2V5DA 2WO1A 2BZDA 3WF3A 1JI6A 3T2QA 4MGQA 1W99A 3OEAA 4BXSV 2VMFA 4P08A 1K45A 4XUOA 3I2IA 3NJXA 2RJ2A 3UESA 3T2PA 1GOHA 1R64A 3NJVA 2VCAA 4CU9A 4CVUA 3LEGA 4CU7A 5IHRA 3DYPA 5B4XA 2E26A 2QQLA 1O8PA 3T2OA 1UXZA 5DN2A 4LKSA 4A45A 4A3ZA 1T2XA 2EIBA 2VL4A 4ET7A 2EICA 2YB7A 4OUEA 4ZXEA 3VD4A 4A42A 2KD7A 4TTGA 4E8DA 1JZ8A 1UX7A 1PX4A 4ZZ5A 1JYXA 2WDBA 3I2KA 4PQQA 5IYYA 2VQTA 2VZRA 3AC0A 2VMCA 4CUBA 3WSOA 4BDVB 2PQSA 3A22A 2W1UA 1CZVA 1US2A 3FHQA 1JZ3A 4JKLA 2W92A 4DEQA 2BBAA 3I2HA 1ULOA 3I3BA 3GDBA 4UOJA 3ACHA 2R7EB 3A21A 1GMMA 3WNLA 2X05A 2LW8A 2WYSA 2VM9A 2YFZA 2X09A 1W8NA 3DYOA 1UWWA 3OGVA 1UY2A 3WNMA 4BK4A 3MV01 2VTFA 4ARXA 3ECQA 5JMOA 1GU3A 1JZ6A 2YG0A 5J1XA 4P5YA 2JE8A 5CZKA 1EUUA 4DUXA 3PUHA 4RN5A 2VZUA 3GXUA 3GM8A 3OB8A 1NKGA 1JU3A 2VMEA 2WZEA 1DP0A 1XNTA 3LEKA 2HLEA 2WAOA 2QBXA 2VC9A 4XVHA 2Z4FA 2EIEA 1UYYA 1K42A 2VZ3A 4MOAA 3MUZ1 4PT6A 2VO5A 4OMCA 3C7OA 4MADA 3NQHA 3SKJE 3IDAA 4BJ0A 2WZ8A 2BERA 2HYXA 4PF1A 1OD3A 2RV9A 4DUWA 3GGLA 4ARYA 3OG2A 5EJ1B 3BN6A 1GNYA 2C26A 2ORXA 1GQPA 3D3AA 1F4HA 3WEZA 5A1AA 3WF4A 3VDBA 4E8CA 1JZ4A 5C70A 4QDRA 1XPWA 3P6BA 4GZ9A 4QX2A 5DPNA 2VZVA 4QX0A 4QX1A 2B9VA 4W4ZA 2VCCA 4XUNA 2Y6KA 2QQIA 2YC4A 4XUTA 1UY4A 1KEXA 3C7GA 5F7UA 2VZTA 1UYZA 3CIHA 1CZTA 3LEIA 2ZEYA 2XHNA 3T0AA 3SKVA 1JZ2A 2JKXA 3UETA 3HEIA 2W94A 5FUIA 3ACFA 5JUVA 3LPFA 3PUIA 1UZ0A 1K3IA 3I3EA 1W8OA 2QQNA 2ZXQA 1SHWB 3HPNA 3C7FA 3HN3A 4A6OA 4GWJA 3ACGA 1I5PA 1O8SA 1WKYA 1RYYA 1YQ2A 4DXTA 4IUGA 5DQ0A 5IFPA 1W0NA 1ULPA 3OGRA 2WO3A 2XONA 2QQKA 4QAWA 4XUQA 2E32A 4DUVA 5HXMA 2J1UA 2RVAA 3BGAA 4LPLA 4D0QA 4A44A 3WNOA 4RYDA 3P1IA 2L9LA 3IIIA 1HN1A 2W1SA 2J1EA 3CKHA 2JD9A 1JZ7A 2E33A 3THCA 3LE0A 1XC6A 2J1AA 4YPJA 2VZOA 1O59A 3I2FA 4Z2AA 3MO4A 3WQBA 2W87A 1OF3A 4L0PA 3C7HA 1CIYA 3CZUA 2J1VA 5EIYB 1UMHA 2WBKA 4QDQA 4DXRA 4BK5A 1OH4A 1TG7A 1W9WA 4A4AA 3I97A 3I3DA 4QB6A 2QQMA 1PX3A 3HNBM 5LCWL 1PMJX 2DCKA 2V4VA 2W1QA 1OT5A 4XUPA 3W5MA 3JXSA 3CDZB 2JDAA 3VDCA 4UAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CZS A;  2XOM A;  1UY3 A;  2J1T A;  3FL7 A;  3ZM8 A;  1TVG A;  2W95 A;  4AG4 A;  1UY0 A;  2W47 A;  2W46 A;  1OF4 A;  4KWU A;  5CYY A;  2W1W A;  4JX0 A;  3HJR A;  1JU4 A;  1NUK A;  2E31 A;  3LPG A;  2QQJ A;  2C4X A;  2W91 A;  3IAP A;  3MV1 1;  1UMI A;  4ZY9 A;  1KGY A;  3C8X A;  4GWI A;  2VOT A;  2WN3 A;  2BGO A;  2VR4 A;  2VZP A;  2W9X A;  5IJR A;  1UY1 A;  3LQC A;  5DMY A;  3U37 A;  3NNG A;  4FI9 A;  2VJX A;  3IAQ A;  4KMQ A;  3ACI A;  2J1R A;  2J7M A;  3K4A A;  2W3J A;  1JYV A;  2BGP A;  1P8J A;  5G04 L;  3WF1 A;  1GOF A;  1US3 A;  5C7G A;  3HOB A;  2J1S A;  3K75 B;  3MUY 1;  1UXX X;  3UNP A;  2WO2 A;  2EID A;  2YC2 A;  1GUI A;  3IB3 A;  2WAA A;  3K77 A;  4CUC A;  2YFU A;  1J83 A;  3J7H A;  2CDP A;  3ABZ A;  3CMG A;  3OBA A;  3DYM A;  4A41 A;  2QQO A;  2VZQ A;  3THD A;  4AAX A;  3VD9 A;  4DXS A;  4QPW A;  2WUH A;  2DDU A;  3WF0 A;  3A23 A;  2ZEX A;  4M4P A;  4UI9 L;  3HNM A;  5B4N A;  2Y64 A;  1SG3 A;  1K12 A;  2VZ1 A;  2WN2 A;  3T0D A;  2J22 A;  4CU8 A;  4P02 B;  1GOG A;  1PMH X;  2C9K A;  5LA0 A;  1JYW A;  3E1F 1;  1JZ5 A;  1D7P M;  4QB2 A;  1SDD B;  1BHG A;  1F4A A;  1IQD C;  4JHZ A;  4DEV A;  3W5N A;  4OMD A;  3EB7 A;  2VZS A;  3ETP A;  3K4D A;  4QDS A;  3T0B A;  3F2Z A;  1J84 A;  3DEC A;  3HNY M;  3MBW A;  2ORZ A;  1W9T A;  3OGS A;  3NRU A;  3WF2 A;  1H6Y A;  5EJZ B;  4KI5 M;  5JXH A;  2VMD A;  1LNS A;  3C7E A;  4MO3 M;  2Y8K A;  3VDA A;  3SEP A;  3K46 A;  4P00 B;  1UYX A;  1XNA A;  3A7Q A;  3K4Z A;  3WNK A;  3FN9 A;  1JHJ A;  2CDO A;  2ID4 A;  1NX9 A;  4TXW A;  4XUR A;  2W5F A;  5LA2 A;  2Y6H A;  5HPO A;  3WNN A;  2X10 A;  3EYP A;  5C71 A;  4ZZ8 A;  5IFT A;  2VCB A;  3VD7 A;  2DCJ A;  3I2J A;  2XQX A;  1NAE A;  1W9S A;  4QX3 A;  4XZU G;  4CUA A;  2LS6 A;  1WCQ A;  5JXI A;  3WNP A;  1L7Q A;  2V72 A;  2WAB A;  2Y6G A;  4LQR A;  3T08 A;  3I2G A;  4JKM A;  2ZEZ A;  3T09 A;  4QB1 A;  3OEB A;  3SEE A;  1H6X A;  4OYU A;  4MGS A;  5JXJ A;  4W8J A;  3VD3 A;  5JR2 A;  2WQ8 A;  4CU6 A;  5I0D A;  1JYN A;  1MPX A;  1CX1 A;  2OKX A;  4JKK A;  5JXG A;  1DYO A;  2Y6L A;  1EUT A;  5G05 L;  2VQU A;  2B4K A;  2ZEW A;  3CZJ A;  4OZO A;  4W50 A;  4M4R A;  1DLC A;  3FHA A;  5LA1 A;  4LHS A;  3VD5 A;  1L7R A;  3CQO A;  4HG6 B;  4D8M A;  2Y6J A;  2V5D A;  2WO1 A;  2BZD A;  3WF3 A;  1JI6 A;  3T2Q A;  4MGQ A;  1W99 A;  3OEA A;  4BXS V;  2VMF A;  4P08 A;  1K45 A;  4XUO A;  3I2I A;  3NJX A;  2RJ2 A;  3UES A;  3T2P A;  1GOH A;  1R64 A;  3NJV A;  2VCA A;  4CU9 A;  4CVU A;  3LEG A;  4CU7 A;  5IHR A;  3DYP A;  5B4X A;  2E26 A;  2QQL A;  1O8P A;  3T2O A;  1UXZ A;  5DN2 A;  4LKS A;  4A45 A;  4A3Z A;  1T2X A;  2EIB A;  2VL4 A;  4ET7 A;  2EIC A;  2YB7 A;  4OUE A;  4ZXE A;  3VD4 A;  4A42 A;  2KD7 A;  4TTG A;  4E8D A;  1JZ8 A;  1UX7 A;  1PX4 A;  4ZZ5 A;  1JYX A;  2WDB A;  3I2K A;  4PQQ A;  5IYY A;  2VQT A;  2VZR A;  3AC0 A;  2VMC A;  4CUB A;  3WSO A;  4BDV B;  2PQS A;  3A22 A;  2W1U A;  1CZV A;  1US2 A;  3FHQ A;  1JZ3 A;  4JKL A;  2W92 A;  4DEQ A;  2BBA A;  3I2H A;  1ULO A;  3I3B A;  3GDB A;  4UOJ A;  3ACH A;  2R7E B;  3A21 A;  1GMM A;  3WNL A;  2X05 A;  2LW8 A;  2WYS A;  2VM9 A;  2YFZ A;  2X09 A;  1W8N A;  3DYO A;  1UWW A;  3OGV A;  1UY2 A;  3WNM A;  4BK4 A;  3MV0 1;  2VTF A;  4ARX A;  3ECQ A;  5JMO A;  1GU3 A;  1JZ6 A;  2YG0 A;  5J1X A;  4P5Y A;  2JE8 A;  5CZK A;  1EUU A;  4DUX A;  3PUH A;  4RN5 A;  2VZU A;  3GXU A;  3GM8 A;  3OB8 A;  1NKG A;  1JU3 A;  2VME A;  2WZE A;  1DP0 A;  1XNT A;  3LEK A;  2HLE A;  2WAO A;  2QBX A;  2VC9 A;  4XVH A;  2Z4F A;  2EIE A;  1UYY A;  1K42 A;  2VZ3 A;  4MOA A;  3MUZ 1;  4PT6 A;  2VO5 A;  4OMC A;  3C7O A;  4MAD A;  3NQH A;  3SKJ E;  3IDA A;  4BJ0 A;  2WZ8 A;  2BER A;  2HYX A;  4PF1 A;  1OD3 A;  2RV9 A;  4DUW A;  3GGL A;  4ARY A;  3OG2 A;  5EJ1 B;  3BN6 A;  1GNY A;  2C26 A;  2ORX A;  1GQP A;  3D3A A;  1F4H A;  3WEZ A;  5A1A A;  3WF4 A;  3VDB A;  4E8C A;  1JZ4 A;  5C70 A;  4QDR A;  1XPW A;  3P6B A;  4GZ9 A;  4QX2 A;  5DPN A;  2VZV A;  4QX0 A;  4QX1 A;  2B9V A;  4W4Z A;  2VCC A;  4XUN A;  2Y6K A;  2QQI A;  2YC4 A;  4XUT A;  1UY4 A;  1KEX A;  3C7G A;  5F7U A;  2VZT A;  1UYZ A;  3CIH A;  1CZT A;  3LEI A;  2ZEY A;  2XHN A;  3T0A A;  3SKV A;  1JZ2 A;  2JKX A;  3UET A;  3HEI A;  2W94 A;  5FUI A;  3ACF A;  5JUV A;  3LPF A;  3PUI A;  1UZ0 A;  1K3I A;  3I3E A;  1W8O A;  2QQN A;  2ZXQ A;  1SHW B;  3HPN A;  3C7F A;  3HN3 A;  4A6O A;  4GWJ A;  3ACG A;  1I5P A;  1O8S A;  1WKY A;  1RYY A;  1YQ2 A;  4DXT A;  4IUG A;  5DQ0 A;  5IFP A;  1W0N A;  1ULP A;  3OGR A;  2WO3 A;  2XON A;  2QQK A;  4QAW A;  4XUQ A;  2E32 A;  4DUV A;  5HXM A;  2J1U A;  2RVA A;  3BGA A;  4LPL A;  4D0Q A;  4A44 A;  3WNO A;  4RYD A;  3P1I A;  2L9L A;  3III A;  1HN1 A;  2W1S A;  2J1E A;  3CKH A;  2JD9 A;  1JZ7 A;  2E33 A;  3THC A;  3LE0 A;  1XC6 A;  2J1A A;  4YPJ A;  2VZO A;  1O59 A;  3I2F A;  4Z2A A;  3MO4 A;  3WQB A;  2W87 A;  1OF3 A;  4L0P A;  3C7H A;  1CIY A;  3CZU A;  2J1V A;  5EIY B;  1UMH A;  2WBK A;  4QDQ A;  4DXR A;  4BK5 A;  1OH4 A;  1TG7 A;  1W9W A;  4A4A A;  3I97 A;  3I3D A;  4QB6 A;  2QQM A;  1PX3 A;  3HNB M;  5LCW L;  1PMJ X;  2DCK A;  2V4V A;  2W1Q A;  1OT5 A;  4XUP A;  3W5M A;  3JXS A;  3CDZ B;  2JDA A;  3VDC A;  4UAP A; 
#chains in the Genus database with same CATH topology
 1DG6 A;  2A3W A;  2BOI A;  5F2W A;  3OY8 A;  5CFD C;  4NO4 A;  3I4I A;  1DFQ A;  3VB9 A;  1HV0 A;  5AC9 2;  2WFF 2;  3WXP A;  1YI9 A;  4LA2 A;  4RS5 B;  4S2D A;  1C28 A;  4TSV A;  2BDR A;  5DZG A;  4BOW A;  4OUS A;  5A1L A;  1IGO A;  5LW9 A;  2QQJ A;  2C4X A;  1EV1 1;  1O6U A;  5A6Q A;  2RE9 A;  2HBU A;  2W91 A;  1LHV A;  3CLP A;  3SLI A;  3KHC A;  1MZF A;  2ZKL A;  1TQ5 A;  3Q8E A;  4CP2 A;  5CKN A;  2YYO A;  4GMP 1;  4BQ5 A;  1KGY A;  3E6B A;  3FJS A;  1VBB 2;  5FYV A;  1NA1 B;  1SPP A;  1UAI A;  1O5U A;  1FXZ A;  1ALY A;  1S55 A;  2BGO A;  2RS3 3;  2WRA A;  4LHN A;  4QQO A;  4XFB A;  2VR4 A;  4PCR A;  5FYI A;  5LBB A;  2W9X A;  1NE6 A;  5IJR A;  1AYM 2;  3KD4 A;  3WD5 A;  4IEW A;  4AED C;  5LRR A;  3H3U A;  2R0F A;  5I93 A;  2RM2 2;  4BH9 A;  2UWB A;  4WM7 A;  3MW2 A;  4ATE A;  1NZC A;  4AVS A;  2R07 3;  5JSR A;  4YZ1 A;  5A6Z A;  4GIQ A;  1RUD 2;  2W3J A;  1AXK A;  3ZXK A;  1P8J A;  4B4P A;  4A7Y A;  3UKN A;  2JEM A;  5JIU A;  4AAP A;  3HOB A;  4LR4 A;  4NAO A;  4CTE A;  5C7G A;  1HLC A;  2NQY A;  5FYZ A;  4EWD A;  2W68 A;  5J3U A;  3OSD A;  2Y26 A;  1CAX B;  1SFN A;  3H7Y A;  4XIK A;  5I0U A;  4QPY A;  3ZFF C;  2IXK A;  2GSY A;  2YFU A;  2IXH A;  3AP5 A;  3IDE A;  5FYT A;  1J3P A;  2CDP A;  4ZPI A;  4RGA A;  1NY7 1;  3MIH A;  3DYM A;  1KFU L;  1EAH 2;  1TEI A;  1CES A;  2X5I B;  2GC3 A;  4WM8 A;  2XBO 2;  2QKD A;  1RUH 2;  2PMW B;  4AAX A;  1ZNP A;  3VD9 A;  1N3Q A;  4JVA A;  5FZO B;  4CEY C;  1W8Z A;  2DFC A;  4QPW A;  4U2A A;  5CB7 A;  3N9L A;  2R04 3;  1QJZ A;  3ZPY A;  1O91 A;  1U5I A;  4UI9 L;  4PJY A;  1GWL A;  1FV3 A;  3G6J B;  4OHZ A;  3HBK A;  3OTF A;  1JW6 A;  3VHP A;  5JI9 A;  3KQ4 B;  2YU1 A;  2RG4 A;  1PK6 C;  3N7J A;  5EV7 A;  1W6N A;  3UGH A;  3T0D A;  4CU8 A;  2HWD 2;  4P02 B;  3ZDV A;  3SMH A;  5GM0 A;  3AFG A;  1SMV A;  4FXK B;  4NUB A;  1D7P M;  1VAK A;  5T5P A;  2VAU A;  1BHG A;  3WW1 A;  4DEV A;  1OOP C;  5C8W A;  4QU2 A;  2RDQ A;  1RUJ 2;  3HVD A;  4NIG A;  1Z7S 3;  3BIW E;  3MDP A;  4GWM A;  4IND A;  4BQ2 A;  3KV4 A;  4LO7 A;  4COU A;  1ZA4 A;  2V5Y A;  1W0P A;  4D94 A;  1QOS A;  1Q43 A;  1RHI 2;  2YC0 A;  4CUG A;  1O5L A;  2VCM A;  1SCR A;  4CCC A;  3GJB A;  3U0Z A;  1B35 A;  1RGS A;  1IZ3 A;  4XBN A;  1W9T A;  3JD7 3;  1ZRC A;  2VVF A;  4WBB A;  2OQ6 A;  3OGS A;  3MLJ A;  3ZKU A;  2G9Z A;  3P3N A;  5EJZ B;  1EAH 3;  1Q56 A;  1H2M A;  1YHF A;  2DVG A;  2R16 A;  2XBO 3;  3PTY A;  4LBQ B;  4FAH A;  3C7E A;  1HXS 3;  3JQX A;  3SEP A;  5LBC A;  1PO1 3;  2VBD A;  3K46 A;  2OA2 A;  5FO9 B;  2FDG A;  1UYX A;  5CAZ A;  4AHZ A;  3R4S A;  1H8V A;  1LOC A;  2C5D A;  3HQU A;  4HK9 A;  1C8M 1;  3TN9 2;  2XWB B;  4YW3 A;  1W90 A;  4K8R B;  3UGF A;  1E57 A;  1IHM A;  3WW2 A;  4MH0 E;  2XVK A;  2ZGK A;  2VOK A;  2BNM A;  3L2H A;  2Y6H A;  2OYZ A;  4XFC A;  4FPC A;  1W8W A;  2AH2 A;  1OKQ A;  2QQU A;  4YM3 A;  1OFN A;  1R08 3;  3J8F 3;  4BIF A;  4S2G A;  2RMU 3;  1LES A;  4B7K A;  3VD7 A;  2DCJ A;  2RS1 1;  3PIG A;  4CDX B;  3LD8 A;  1CON A;  4QPI C;  1LGC A;  3KT4 A;  3OPT A;  4RQP A;  1W9S A;  1QJU 1;  2GDF A;  5CKQ A;  1DBN A;  1JYV A;  1G9A A;  1O4Y A;  2QTW B;  1AR6 3;  1PM7 A;  2ZX1 A;  3BOD A;  4I3G A;  5K9Y A;  3AKT A;  4QQL A;  2Q0A A;  1A34 A;  1AX1 A;  1EY2 A;  1RHI 3;  4AVC A;  1YCI A;  1UMZ A;  1CJD A;  2TBV A;  2DVB A;  2ZEZ A;  3OEB A;  4ISR A;  4GH4 B;  4AI1 A;  1H6X A;  4D6S A;  4OYU A;  4MGS A;  1Y43 B;  1O4T A;  5DAW A;  3I3M A;  4D7T A;  3AK0 A;  4AI2 A;  4CP9 A;  2WQ8 A;  4XFF A;  1LOA A;  4XE9 A;  3LSD A;  3IN9 A;  3QOP A;  3POF A;  1MPX A;  4XJ9 A;  4Z07 A;  3WUC A;  1ZZ8 A;  3TNQ A;  2IWG B;  3NMB A;  1UU5 A;  3WDV A;  4MGI E;  2OPW A;  4YGD A;  3KF3 A;  5H9S A;  2WNU C;  5A7W B;  3N7L A;  1DLC A;  3FHA A;  1NCR A;  5LA1 A;  1KFX L;  1K5M B;  1W2U A;  1HRI 2;  3CQO A;  2BTV C;  3FFQ A;  4HG6 B;  3VBH C;  1N3P A;  4IE7 A;  4LO6 B;  3ZYB A;  5JOX A;  2JG8 B;  1F5J A;  2VMH A;  4L8Q A;  3WF3 A;  5FOB B;  3AL6 A;  4JDO A;  4MGQ A;  3ZFG C;  5JZG B;  4BXS V;  5A3N A;  1SLT A;  5BNP A;  5KHG A;  2PHF A;  1YYN A;  2DBN A;  2ZGO A;  3O12 A;  4XUO A;  5T52 A;  2GN3 A;  4GAZ A;  3AZZ A;  2BRT A;  4DS0 A;  4FFI A;  1VBA 1;  1GOH A;  1Q8V A;  4YM2 A;  1XOY A;  1UOJ A;  2IZW A;  2VCA A;  2JIG A;  4LKE A;  5FP3 A;  2CSG A;  3ZDS A;  1ASJ 2;  4CU9 A;  4CU7 A;  1OHF A;  3DXU A;  2WWJ A;  4GB3 2;  5B4X A;  1AYN 1;  5FYC A;  3WP6 A;  3X29 B;  5FQ0 B;  5DAB A;  1OSG A;  3QH7 A;  3MIC A;  4LKS A;  1ZBE 1;  2EIB A;  2WZP P;  4ET7 A;  5GZC A;  2FHR A;  2W08 A;  3B9C A;  4ZXE A;  4OUE A;  1RUI 2;  4PLM A;  3VD4 A;  2XML A;  3ELN A;  1RVF 1;  4Q8L A;  2ATF A;  2YBK A;  4PIX A;  2YUE A;  4E4H A;  1UX7 A;  1PX4 A;  1NZI A;  1YQ8 A;  1DQ2 A;  4OI0 A;  4O9G A;  1UKG A;  1ENX A;  2VQT A;  4IXL A;  4NOT A;  5JSP A;  1JBC A;  4LBK A;  3ZXF A;  1RMU 2;  1RUC 2;  1ENR A;  3IM0 A;  4XJ8 A;  3WSO A;  1ZYB A;  1MVE A;  3NO8 A;  1O3S A;  1ZM1 A;  4COV A;  4IET A;  3OOX A;  3VBO B;  1YXW A;  4YG0 A;  4Q4X 1;  5IVC A;  2C9A A;  2W1U A;  3USS A;  4NIH A;  4GD4 A;  3C3V A;  3POB A;  3ZXD A;  1O3R A;  2GC2 A;  1ULO A;  2WQ4 A;  4XMI A;  2PHD A;  1RUE 1;  1UW8 A;  4P9G A;  4SBV A;  2OW4 A;  1OA4 A;  2R7E B;  4E2G A;  4K40 A;  1ZRF A;  1ND3 A;  3EQE A;  3WNL A;  4BLJ A;  4EWE A;  2XJS A;  3CEW A;  1UKR A;  2LW8 A;  4P9I A;  2YFZ A;  3O1R A;  4I09 A;  5F6K A;  4AK3 A;  1U5Z A;  2X09 A;  1QJX 2;  3VDD B;  3WNM A;  1FPN 1;  3LF7 A;  4EZH A;  2R1B A;  5ACA 2;  1QQP 1;  2HYK A;  3EXU A;  1PHM A;  2CL2 A;  2YG0 A;  5J1X A;  5CKM A;  4P5Y A;  4R8H A;  3RZZ A;  2JE8 A;  3O1O A;  4LKD A;  3T1M A;  2NZ9 A;  3IDC B;  1JOD A;  2SLI A;  3TYJ A;  4XF4 A;  3RQ0 A;  4RN5 A;  2VTX A;  3ZIW A;  4DB5 A;  4BWO A;  5KXC A;  3DGT A;  4Y3O A;  4XAE A;  4YZ5 A;  2EXK A;  4HVO A;  4KH9 A;  4AR2 A;  1CAV A;  2GMP A;  5DAV A;  2WZE A;  4KGG A;  4RS5 C;  5LZ6 A;  1PO2 3;  1J1T A;  5CA6 A;  1XNT A;  3IBM A;  4M0H A;  3LEK A;  5FAX A;  3N9N A;  2VH9 A;  2G9F A;  3KS7 A;  3LA3 A;  2PA7 A;  4NVP A;  2CAV A;  1K42 A;  2DYC A;  2DVF A;  2VZ3 A;  1BKZ A;  1NA1 C;  5FUP A;  5FZK A;  5A3U A;  2WT2 A;  2WNO A;  3PIJ A;  1JYI A;  3HQR A;  4HVR A;  4NPM A;  4O65 A;  4PT6 A;  1BBT 1;  3J4U H;  2CAU A;  4JTN A;  4P5H A;  3NQH A;  4PBO A;  3IDA A;  1QJY 2;  3SKJ E;  1ODM A;  4MG2 A;  2R06 1;  4ZU7 A;  1YQ6 A;  2WS9 2;  4I0W B;  4B1L A;  4MLO A;  4R9C A;  1LHU A;  1COV 3;  1GAN A;  1I9R A;  1DCS A;  3AZV A;  3LWC A;  1VBD 2;  4ARY A;  2WLP A;  5ACA 3;  5HV0 A;  3BCW A;  3PLQ A;  5EJ1 B;  5I0S A;  3MIF A;  3D3A A;  3H1Y A;  4QU1 A;  5DUW A;  1W39 A;  1LED A;  3WF4 A;  3O1S A;  2JX9 A;  2XKO A;  2ZGM A;  4E8C A;  1LOF C;  2O8Q A;  3ON7 A;  3A0K A;  3M2M A;  1RIR A;  1W2O A;  1W6Q A;  3VHO A;  1XPW A;  1TME 1;  3JU9 A;  2YBP A;  2X5I C;  1XJA A;  4QX2 A;  4Z82 A;  4HOO A;  1GZ9 A;  2XJP A;  2JEC A;  3AKQ A;  3KV6 A;  3ORJ A;  4NRO A;  2DCT A;  4QWN A;  4PI0 A;  4QX1 A;  4P9L A;  1Q8O A;  1YJL A;  2ZTN A;  4MXW A;  2VCC A;  2JDM A;  4YZ4 A;  5ANN A;  3M3C A;  4BQ1 A;  2JG9 A;  4Q4V 3;  3VKN A;  4YAR A;  3IPV A;  1OLM A;  1Y9M A;  3CJI B;  3SHR A;  2BW8 A;  5JWP A;  1KEX A;  3WHT A;  1RJ8 A;  4AVT A;  1Q8S A;  1ONA A;  1FX5 A;  5A7N A;  3EHK A;  1SZB A;  4XC9 A;  2E7Q A;  4IV1 C;  1CZT A;  3NNM A;  4R9A A;  2PYT A;  3LOB A;  2PAE A;  4EN0 A;  1MS4 A;  3ZLI A;  1QJY 3;  4XDP A;  5F37 A;  1V9U 1;  3FLR A;  1V70 A;  5C33 A;  3WG2 A;  3PME A;  1OUR A;  1GBG A;  4NHL A;  5J98 B;  2IXJ A;  4BQY A;  1D4M 2;  4FPH A;  1YRZ A;  4N7I A;  4HON A;  4OCT A;  3T1L A;  2HEY F;  3UET A;  1JOJ A;  4FFF A;  5FRE A;  3VBR B;  1ZRR A;  3AYC A;  5CFC A;  2QFE A;  3VHN A;  1YNA A;  3PUI A;  3B9I A;  2PFW A;  1UZW A;  4OZX A;  3ZFE C;  3I3E A;  4XF1 A;  1SHW B;  2JB8 A;  2WL1 A;  1JUI A;  1IS3 A;  3C7F A;  4GJZ A;  4YVW A;  3INA A;  4LBN A;  3RZL A;  1OMI A;  1ZVF A;  4GWJ A;  4UFL A;  3M3I A;  2WZR 1;  4BQW A;  1I5P A;  1O8S A;  1WKY A;  1YQ2 A;  2WNE A;  3JBG 2;  4HPK B;  5SV8 A;  4DXT A;  4IUG A;  5F5C A;  5A3P A;  2NM1 A;  1OVP A;  3UNP A;  4JGY A;  1WMX A;  4B8E A;  4N90 A;  1DF0 A;  4CPB A;  2WO3 A;  5FTT C;  1CJP A;  1JS9 A;  4DIN B;  2ZGR A;  5FIX A;  5JSO A;  3U11 A;  2AEY A;  1AR7 2;  5HXM A;  3B69 A;  2R30 A;  2PQQ A;  3LAG A;  5C3O A;  4ES9 A;  1CGP A;  3BGA A;  4D0Q A;  4IES A;  4MX3 A;  1OVS A;  2WR9 A;  2P3K A;  5FKB A;  3DKW A;  1FMD 2;  2DCY A;  2L9L A;  1IOA A;  2YXS A;  3J7M A;  3CJX A;  3W58 A;  2VOX A;  3D4K A;  3N9M A;  1IPJ A;  1FNZ A;  2J1E A;  5CFD A;  1JZ7 A;  4HAN A;  5D8A B;  1VIW B;  4CDX C;  5FY5 A;  5JOY A;  2E33 A;  3I2D A;  1GLH A;  4Y1Y A;  2D6M A;  3AMH A;  1WA4 A;  3THC A;  1D4M 3;  1RIT A;  1W6P A;  4NRP A;  5FXX A;  1XC6 A;  4LBJ A;  3WZ1 A;  4B7E A;  1RL3 A;  1PIV 1;  3I2F A;  4QGN A;  3NAP B;  4Z2A A;  4ONU A;  2DV9 A;  1VRH 2;  4HSL A;  4ORF A;  1WCU A;  1OF3 A;  1RUF 2;  2R0H A;  4U36 A;  4UFI A;  4NAM A;  4ASK A;  2R07 1;  4GA9 A;  2J1V A;  1AF9 A;  2WKK A;  2B39 A;  3T2T A;  4NIA A;  2AC1 A;  4BK5 A;  1OH4 A;  2NLR A;  4Q4Y 2;  1N3O A;  3IZO A;  1JN2 P;  3JBG 3;  1PVX A;  4AED A;  4EZ4 A;  1AX2 A;  4A4A A;  5F32 A;  3V64 A;  3H8U A;  2V73 A;  2MEV 1;  3VBS B;  4FAG A;  1WW7 A;  1TMF 1;  3S5Q A;  2ZAC A;  4Y5S A;  2DCK A;  2BJS A;  3ST7 A;  4F7Z A;  1OT5 A;  2D6O X;  2FQP A;  4RFR B;  3WW4 A;  2VD7 A;  1SEF A;  2JDA A;  5FY8 A;  5LWB A;  4CDW B;  3CF6 E;  4UAP A;  3GJA A;  5CG9 A;  1CZS A;  5AC9 1;  2GNM A;  2WFF 1;  4CSW A;  3ZXJ A;  1POV 1;  4YFW A;  4QPG B;  3FL7 A;  2JE7 A;  3ZM8 A;  1K5M C;  4QQH A;  2W95 A;  1F31 A;  3ZYJ B;  5BV6 A;  2Y0I A;  4AG4 A;  2YMZ A;  5ABJ B;  4JC1 A;  2EIG A;  5BNN B;  1ND2 C;  1G9C A;  5A32 B;  1X33 A;  4Q4W 3;  3ZFF A;  5DG2 A;  5DDJ 2;  4N53 C;  5JZG C;  1UU6 A;  2D40 A;  3GZA A;  2VOW A;  4KQ7 A;  4XF3 A;  1VBB 1;  3LPG A;  2QJV A;  4BQX A;  1LKN A;  3WDU A;  4LLF A;  2QVS B;  1UMI A;  1AYM 1;  1LU1 A;  1GQG A;  1SAC A;  3QLQ A;  4CEY A;  3NNL A;  2VOT A;  1NLQ A;  2RM2 1;  1RUF 3;  2G19 A;  2D6L X;  3AZW A;  4CPB D;  1CWP A;  3LQC A;  3F95 A;  2DVD A;  5DMY A;  1AXZ A;  1NQD A;  1RUD 1;  4FI9 A;  2A5Z A;  1Y9G A;  1IPS A;  3NL1 A;  2ZHK A;  3H3Z A;  4KGQ A;  1PK6 A;  2Z5W A;  3IAQ A;  4DPN A;  2VUL A;  4WVM B;  4KMQ A;  4J1X A;  3ACI A;  2J1R A;  2FMD A;  2J7M A;  5FWE A;  1C5I A;  2FCU A;  1FYU A;  2TEP A;  5FXW A;  1Y4W A;  1L3J A;  1OOP A;  2VW0 A;  4WZF A;  2Q30 A;  1UXX X;  5FYS A;  1XBF A;  3AZX A;  3S5A A;  2RR1 2;  4Y20 A;  3RWN A;  2ES3 A;  4ZXK A;  1LAJ A;  3LSE A;  1T6B X;  1EAH 1;  4OLL A;  4UFJ A;  2XB6 C;  4JAA A;  2XBO 1;  5GLV A;  4UF0 B;  1MR5 A;  1RUH 1;  1W6O B;  1HDK A;  3OBR A;  2VNR A;  5A6X A;  1R09 2;  1S1A A;  3J7H A;  5I8T A;  2TUN A;  3ABZ A;  4FT8 A;  3VBO C;  3OF1 A;  2A73 B;  4A41 A;  1QOO A;  1A6C A;  4IV3 B;  3AMN A;  3RVH A;  3THD A;  3MZH A;  5JR7 B;  3BOW A;  4DXS A;  3UJO A;  4LO8 A;  2WII B;  2VU9 A;  1KJL A;  2BGC A;  2WUH A;  3ZPO A;  1UN1 A;  3ZVX A;  1QDO A;  3ZSJ A;  2JIJ A;  2ZEX A;  4M4P A;  1BEV 3;  5BPX A;  3WCS A;  1Z0H A;  2HWD 1;  5F3C A;  2QZ3 A;  2JDK A;  2BEO A;  1Q8P A;  5B4N A;  3RZH A;  1BCX A;  5L9R A;  3ZYF A;  1YJK A;  3O0W A;  4Z92 B;  3NKG A;  2WN2 A;  3KVB A;  2I2S A;  1DGR N;  1G86 A;  2HWB 2;  2J22 A;  3AJZ A;  5FPL A;  5GLT A;  1RUJ 1;  3E1F 1;  4L2N A;  5EPA A;  3D5O A;  1X50 A;  4Q0Q A;  1KS5 A;  1G9B A;  3M3Q A;  1YEW A;  1ACC A;  4SLI A;  1F4A A;  3ME2 A;  1EPW A;  2LTN A;  1HIX A;  1G6N A;  1RHI 1;  2LRP A;  2Q1Z B;  3M4F A;  4QPI A;  1BK0 A;  1OLM E;  1W03 A;  3MEP A;  5A3O A;  2XLF A;  5CIR A;  1HX6 A;  4B3N A;  1J84 A;  1RUG 3;  2RR1 3;  4H55 A;  4M3C A;  4YM0 A;  2FDJ A;  3DEC A;  5FZA A;  2F4L A;  1J58 A;  3MBW A;  4H14 A;  4KU7 A;  1H1M A;  2YBS A;  2P37 A;  1SPP B;  4RHV 3;  4XQW A;  3VHR A;  1H2L A;  4HN1 A;  3ZXG A;  1R09 3;  4FXG B;  4J6G A;  1WCK A;  1H6Y A;  4O61 A;  5T5L A;  4NN0 A;  4MHU A;  4LBO A;  4CCM A;  1YC6 1;  2RS3 2;  2Y8K A;  4MO3 M;  3Q9O A;  3WQ1 A;  3TN9 1;  2JDN A;  1KJR A;  5HXV A;  5FR3 A;  4LTA A;  1OLR A;  4XAB A;  4F3J A;  1XXN A;  4XIL A;  1QHD A;  4TZD A;  3WP4 A;  4PIZ A;  2UY8 A;  5LEJ A;  1QWR A;  3LB9 A;  3E5U A;  3GZE A;  3JQW A;  1POQ A;  4XUR A;  2W5F A;  3KV5 A;  2FCT A;  3N9O A;  3WG1 A;  3O1V A;  2PHU A;  4XJU A;  4N43 C;  5C71 A;  5DUX A;  3VKL A;  2WNU A;  3ZYH A;  4ZZ8 A;  1LRH A;  5JAX A;  1SFP A;  3PUR A;  1YUD A;  3S57 A;  4YW5 A;  4FTB A;  2VCB A;  2BVV A;  4DMI A;  3VBH A;  2UY9 A;  2WO7 A;  3FLT A;  4KL1 A;  2YDE A;  4GMP 0;  4LOR A;  1LHN A;  2DF7 A;  4QX3 A;  4WM8 B;  4XZU G;  3ZFG A;  1HB2 A;  1WCQ A;  2GNT A;  4C90 A;  1L7Q A;  1ZX5 A;  2V72 A;  1MS0 A;  2QZ2 A;  5E6H A;  2WNV B;  2Y6G A;  4I0A A;  1XYP A;  2PHX A;  4HKW A;  1WGP A;  5C3Q A;  3QAC A;  3T08 A;  4HN0 A;  4DFS A;  3VKO A;  4JKM A;  2VBB A;  3WP5 A;  3T09 A;  5FZM A;  1PGS A;  2R04 2;  1W6N B;  1RUO A;  5F5I A;  1UQX A;  4OI2 A;  1CAW A;  5I0D A;  2AGS A;  3CJI C;  4N9I A;  4XZP A;  1HB4 A;  2JEN A;  5GJ6 A;  1CX1 A;  4ASL A;  3LZZ A;  2OKX A;  5JXG A;  1RTV A;  4K21 A;  1HRI 1;  1EUT A;  1W8T A;  5A3L A;  1GIC A;  2PHT A;  2YHJ A;  2P5B A;  3ILF A;  1DQ6 A;  2ARC A;  2DU1 A;  3JUU A;  4I0B A;  2KM2 A;  4W50 A;  5EP9 A;  1FOD 3;  2YU2 A;  5FMC A;  3UK9 A;  3OD0 A;  3T4V A;  3TRS B;  5IAV A;  3VBR C;  1Z7S 2;  1G9F A;  5HI0 A;  1KRI A;  1BVV A;  4BQ3 A;  4MGY E;  1QMJ A;  2OVU A;  2V4A A;  1T6G C;  3K51 A;  4BCU A;  1C1F A;  1MEC 3;  4IEU A;  3KQR A;  4JGZ B;  5AVA A;  3KHB A;  4Y4R A;  1D0H A;  1PZ7 A;  4I2O A;  1ASJ 1;  1LTE A;  4PI2 A;  3JD7 2;  4RR3 A;  2IVJ A;  4GB3 1;  4QGL A;  4DY3 A;  5FZE A;  1GR3 A;  5SV5 A;  1UCX A;  4YLZ A;  4AWD A;  3ZN4 A;  3FLP A;  3LEG A;  1HXS 2;  4K20 A;  2GNB A;  4XJA A;  3DYP A;  3MIB A;  4Y33 A;  1D0G A;  1WUV A;  1ZBA 2;  3ZKY A;  1PO1 2;  1PNG A;  2OXB A;  3KMH A;  2IUW A;  1RUI 1;  1UO9 A;  2WT0 A;  4MGK E;  4A2U A;  5JVV A;  1DZT A;  5FZH A;  3VLB B;  1BQP A;  1ULD A;  5FYM A;  1VBC 3;  1MS1 A;  2VL4 A;  1XB9 A;  2EIC A;  2YB7 A;  3DPR B;  4URA A;  4QKF A;  1H30 A;  4LKF A;  4TTG A;  1MQT C;  4RQP B;  1U5Y A;  1XNK A;  5KXD A;  1RMU 1;  1RUC 1;  4ZZ5 A;  5FZ8 A;  5L7O B;  2BBV A;  2CHH A;  3I2K A;  4PQQ A;  5A33 A;  1R08 2;  3J8F 2;  4FP2 A;  1WWY A;  2RMU 2;  4EWA A;  5BNO C;  4Q0S A;  4TN7 A;  2FDH A;  4CDU B;  1CQ9 A;  2PEL A;  2VMC A;  1LEC A;  1REF A;  5D8A C;  1B09 A;  4NMI A;  1N1S A;  2IXL A;  5FLI A;  5K8S A;  4CUB A;  4BDV B;  2LAL A;  3A22 A;  3I8T A;  4RS5 A;  3URF A;  3QH6 A;  3VZO A;  4XFA A;  1AR6 2;  2Q1F A;  3RZK A;  4HBN A;  5IK8 A;  1CZV A;  1JZ3 A;  3FBM A;  4DEQ A;  2W92 A;  4K6B A;  3TEZ A;  2BBA A;  4AEK A;  1DGR A;  3I2H A;  5GAL A;  4AFA A;  3I3B A;  4UOJ A;  3ACH A;  1NA1 A;  1OQ1 A;  1QJX 1;  3A21 A;  1S0G A;  3DN7 A;  5LBF A;  1GMM A;  1CAU A;  3L2Y A;  4AFB A;  4QXC A;  5HCH A;  5DZF A;  2VM9 A;  1VB2 A;  4IEY A;  4AEJ A;  3N36 A;  1FNY A;  4W6X A;  5ACA 1;  2X53 S;  5IT6 A;  2PLV 3;  5APA A;  4C1X A;  1AJK A;  1W8N A;  3DYO A;  1LOB A;  1ZBA 3;  1BK1 A;  2ZAA A;  1AR8 3;  1LR5 A;  3OGV A;  4Y22 A;  4BK4 A;  1NCR B;  3MV0 1;  4IEZ A;  4NRQ A;  1VBE 2;  2W0X A;  1LGB A;  5FMB A;  2ZX4 A;  4QQ2 A;  1GU3 A;  3H8X A;  3RMY A;  1CD3 G;  2H0V A;  4LUL A;  4NHM A;  5FPV A;  3TEW A;  3ZSK A;  2VW1 A;  4D6R A;  5BNP B;  2WQZ C;  4LUK A;  1JHN A;  2VZU A;  5ABJ C;  3FUO A;  2XR4 A;  3OB8 A;  5FP9 A;  1JU3 A;  4QMA A;  2DTW A;  2ZML A;  1LOF A;  4N7U A;  1O3T A;  1BLZ A;  1ULF A;  4Q1R A;  1WLW A;  3UYJ A;  4BYY A;  1V6J A;  2XKP A;  5FLJ A;  2QBX A;  2R1D A;  4IE6 A;  4QT6 A;  5KC5 A;  2X5I A;  2Z4F A;  5H9P A;  2CGP A;  1UYY A;  4UT5 A;  1AUY A;  3OGG A;  4EYU A;  2ZOE B;  5ABJ A;  3NW4 A;  4MUV A;  2BU9 A;  1HJG A;  5FBJ A;  3BYW A;  3RWK X;  4JTO A;  4PHZ A;  4N8M A;  3V56 A;  1YFX A;  2WS9 1;  4OMC A;  4YZ2 A;  1K5J A;  3N3H A;  4MAD A;  3DF0 A;  2VMI A;  2ARB A;  4UBH A;  5L36 A;  2W39 A;  3E97 A;  3ZX7 A;  2DUQ A;  1H2N A;  4BJ0 A;  1DQ5 A;  2E7T A;  3AFK A;  4QXK A;  1HW5 A;  1VBD 1;  2HYX A;  4IV1 A;  2XL7 A;  3QBQ A;  3FHI B;  2D43 A;  1OD3 A;  2GN7 A;  4HET A;  5FYB A;  5C9A B;  1KIT A;  2HWE 3;  2RV9 A;  3PUQ A;  4W6W A;  3ZSM A;  3GGL A;  1VBE 3;  1I3H A;  3PJQ A;  2OQ7 A;  3LIG A;  4YGC A;  3BN6 A;  1GNY A;  1JUH A;  4IEQ A;  5FKC A;  2A6V A;  4YWA A;  5FZ6 A;  1PVC 2;  2ZGL A;  2XH6 A;  1F4H A;  4LXL A;  4WVZ A;  5C5U A;  3MFC A;  2D3P A;  4YG3 A;  5FUN A;  3VDB A;  5AFE A;  3UKT A;  4L92 A;  1LHW A;  3ZFE A;  5C70 A;  2K9Z A;  1S2K A;  1I1E A;  2BWC A;  3GBG A;  1ND3 B;  4PLN A;  4IV3 C;  2VZV A;  4QX0 A;  3AJY A;  5JMC A;  1NCQ C;  4QM8 A;  2F17 A;  1D2S A;  1ZZ9 A;  4XUN A;  1V6M A;  4A6S A;  4K3U A;  5FBZ A;  3NWK A;  3T4H B;  1QXJ A;  5C3S A;  5K0U B;  1AR9 3;  3SIS A;  3W20 A;  3LA7 A;  3JB4 C;  1DLL A;  2A7A A;  1APN A;  4CEW C;  3KV9 A;  5F7U A;  2WLQ A;  2CNA A;  3AVS A;  4IEX A;  3LEI A;  4QHZ A;  4QX7 A;  1GP5 A;  3NST A;  3LA2 A;  1A78 A;  4EN7 B;  2ZEY A;  1D4M 1;  4M3C F;  1X9T A;  2H6C A;  4YZ3 A;  3T0A A;  2CTV A;  2K46 A;  2XJT A;  3SKV A;  4Q8K A;  4E9K A;  2P6C A;  2E7A A;  2YZ4 A;  1JZ2 A;  1CAV B;  1ZRE A;  2JKX A;  2VQA A;  2A6X A;  3HEI A;  3U75 A;  2DTY A;  2ZBJ A;  1VR3 A;  4XQ4 A;  4CDX A;  4XF0 A;  3ACF A;  5JUV A;  4GKY A;  4LBM A;  2UWA A;  5HCB A;  1YQ5 A;  1O4Z A;  4K1Y A;  3DEM A;  1D2Q A;  1PO2 2;  1PVC 3;  3QD6 A;  3ACL A;  1OA2 A;  1W8O A;  3JBG 1;  5T55 A;  3EMR A;  3HN1 A;  2ZMK A;  1U0A A;  1WMF A;  3HN3 A;  4A6O A;  3JCI A;  1RC6 A;  3ACG A;  3KVA A;  2Y0O A;  4QXB A;  5DUU A;  1N1V A;  3AP9 A;  3KGL A;  3V0A B;  1EV1 3;  1H9P A;  1W3V A;  4NHY A;  3R4U A;  4WZC A;  2AZ5 A;  4FFH A;  4OUM A;  1W0N A;  1DDL A;  3AMM A;  1C3H A;  3PU8 A;  1DQ0 A;  4GMP 3;  1AR7 1;  2XLA A;  3OGR A;  2XON A;  3AP4 A;  2DUR A;  4EN6 B;  1JYT A;  3S6P A;  4XUQ A;  1FMD 1;  1NOV A;  4H2A A;  2PHR A;  3I49 A;  2RVA A;  4COZ A;  5LK7 B;  1DHK B;  3ZIX A;  4KU8 A;  4MGT A;  4H7M A;  1XYO A;  2E53 A;  4RYD A;  3P1I A;  2JJ6 A;  4WVV A;  2ZX0 A;  3RI9 A;  1XU1 A;  4F8A A;  4FTS A;  1COV 2;  3AP7 A;  5A7W A;  3AKP A;  1K5M A;  2WA3 A;  2D44 A;  3LFM A;  4V1P A;  1NXM A;  1ND2 A;  2HWF 2;  3Q8A A;  4FOY A;  1QGL A;  1VRH 1;  3RYP A;  5A6Y A;  3ZO0 B;  4N53 A;  5JZG A;  3ETQ A;  2UYA A;  1RUF 1;  2J1A A;  4M0N A;  3WP3 A;  3A4U A;  2VZO A;  1VP6 A;  2D98 A;  4HL0 A;  4MXW B;  1W2A X;  2WNV C;  3CNA A;  1QNW A;  2JG9 B;  3AKS A;  5J09 A;  1MS9 A;  3PVN A;  3IPV B;  4Q4Y 1;  4L0P A;  5FY4 A;  2VNV A;  4YW7 A;  1CIY A;  2FZ2 A;  1VMH A;  4KWK A;  1YFU A;  3BAL A;  3PUA A;  5EIY B;  5KR7 A;  4QDQ A;  2ZGS A;  4DXR A;  3OD4 A;  4CYD A;  5FYH A;  1Y9Q A;  2XVL A;  4Q4V 2;  4QD2 A;  3OPZ A;  1J3R A;  1TG7 A;  3MHZ A;  3D82 A;  3LIH A;  2ZCW A;  1MVQ A;  4G4F A;  3LDB A;  3FMG A;  5IUQ A;  2C0Z A;  1PX3 A;  4Z8B A;  5F3G A;  5FQ0 A;  1AL2 2;  3WG4 A;  2OX0 A;  1GZC A;  2HWC 2;  3FC0 A;  3JXS A;  5FY7 A;  2B42 B;  2HEV F;  3RRD A;  1XNB A;  1PGW 2;  2ZZQ A;  4XCB A;  5CFC B;  1KXG A;  3ILN A;  5DDJ 1;  2J1T A;  2Y33 A;  2HH9 A;  2WA4 A;  3ZN5 A;  1TVG A;  1UY0 A;  5FXV A;  2W46 A;  3BPZ A;  1OF4 A;  4KWU A;  4YVW B;  1TNR A;  1BYH A;  1H0B A;  4CCD A;  1H8T B;  3N9Q A;  1NUK A;  3T3Y A;  3U10 A;  3VBF B;  2Z42 A;  2E31 A;  3PJY A;  4JGZ C;  1DU3 D;  2HWF 3;  5FZC A;  3VBO A;  3MW3 A;  4E4S A;  5LEK A;  4FSJ A;  3MV1 1;  4AYU A;  2ET1 A;  4FPO B;  2DUP A;  4JGY B;  4XFH A;  5A70 A;  4ZY9 A;  4R9B A;  3U4X A;  1PGL 2;  2PAM A;  3U1X A;  2BQP A;  2H0B A;  3C8X A;  1IG0 A;  4GWI A;  5I8Y A;  2WN3 A;  3AYA A;  1WD3 A;  4HXC A;  3GHM A;  2F4P A;  2FBE A;  1X82 A;  2KXL A;  1S0E A;  3ZYG A;  3A0N A;  1V6L A;  3WDX A;  4CCE A;  3NNG A;  1SLB A;  1WD4 A;  2Q4S A;  3UV9 A;  4XDO A;  1GQH A;  4B4R A;  1F15 A;  3J26 N;  2I45 A;  3DPR C;  4MXV A;  2O14 A;  1XU2 A;  3D6E A;  4YSF A;  2RR1 1;  4J1W A;  5CFD B;  1AL2 3;  4QX8 A;  5FK8 A;  1C8M 3;  2E51 A;  5FYY A;  4OI1 A;  2OUJ A;  5L7O C;  5LRS A;  1US3 A;  1HKD A;  2HWC 3;  4FOQ A;  4CCJ A;  1JMU B;  1W6P B;  2GU9 A;  2J1S A;  3AX4 A;  3MUY 1;  4PQ9 A;  2WO2 A;  4I30 A;  1R09 1;  4W65 A;  4ZS3 A;  3ZYP A;  2YC2 A;  5C4W B;  4A3X A;  1S0F A;  4CDU C;  2VE1 A;  3W59 A;  4CUC A;  1YO8 A;  1S0I A;  2VUJ A;  1SDW A;  4YFZ A;  1W6M B;  1FT9 A;  3OBA A;  4NJ4 A;  1W28 A;  1QJU 3;  1UZY A;  3RNS A;  1W9Y A;  3KM5 A;  5FZB A;  2ARE A;  2VZQ A;  1U5X A;  1PM4 A;  3SH4 A;  4AED B;  5CBL A;  4AW7 A;  2NPI A;  4LE3 A;  2RHP A;  3WIN E;  2WJS A;  1TNF A;  3GHN A;  1WW4 A;  4XFI A;  3WF0 A;  4FQ4 A;  1V6N A;  4BMB A;  3OYW A;  4PF5 A;  3LDR A;  2Z69 A;  2HWB 1;  4JCK A;  5LY2 A;  3J9S A;  2XG3 A;  2Q1M A;  4CZS A;  1SG3 A;  2A75 A;  2XPJ A;  4Q0U A;  1VAL A;  1OQE A;  5J7M A;  2ERF A;  1R1A 2;  2ADD A;  3RJR A;  1PMH X;  4RSU A;  2C9K A;  2RDR A;  2XXZ A;  5EZW A;  4O9E A;  4XHB A;  5FK7 A;  4D7S A;  4IE4 A;  1DQ1 A;  1JZ5 A;  4AHY A;  4N43 A;  1IQD C;  3WV6 A;  3W5N A;  2XJU A;  2Y6F A;  3EB7 A;  4OMD A;  5DZE A;  4DRV A;  4B29 A;  4XET A;  4Y1Z A;  3TWI A;  3CO2 A;  2EXI A;  1WBL A;  1QEX A;  4P9W A;  4QHB A;  3USU B;  4AHX A;  4BM8 A;  3HAG A;  4K8F A;  3D8C A;  4QDS A;  5F3E A;  4Q4W 2;  3T0B A;  3ZN6 A;  3F2Z A;  1DZQ A;  5KHH A;  4PDW B;  2ZHL A;  2JKB A;  4X6Q B;  5A1F A;  2GND A;  2ZGT A;  1V00 A;  3W21 A;  2RS3 1;  3MID A;  2XDV A;  2ZPX A;  1ODN A;  3OCP A;  4K9S A;  3WF2 A;  4CDQ B;  2UYB A;  5ANQ A;  4DQA A;  4R4Z A;  1LNS A;  3I3Q A;  2VNO A;  3B94 A;  3VDA A;  1VBA 3;  2Y38 A;  2BNN A;  2YGM A;  5E89 A;  2ARX A;  4CCN A;  1W0O A;  1XNA A;  4OHX A;  4YGE A;  3A7Q A;  3K4Z A;  1VAM A;  5J96 B;  1POV 0;  3CJI A;  3FN9 A;  4G9S B;  1ENQ A;  3BTY A;  2QNK A;  4GH4 C;  3GNE A;  4G3Y C;  5FP4 A;  1AYN 3;  2YV8 A;  1OOP B;  1W9F A;  2CDO A;  4P9X A;  1QU0 A;  3NNF A;  5T3N A;  5FPX A;  4QKN A;  4FPJ A;  4KG0 A;  4PIY A;  5LA2 A;  1U12 A;  3LOI A;  4BA6 A;  5HPO A;  1ZBE 3;  4RFT 0;  3IKW A;  2X10 A;  3WNN A;  1YFY A;  2GMM A;  1R1A 3;  4AQS A;  5C9A C;  5IFT A;  3SCF A;  1RVF 3;  2RDS A;  1KS4 A;  4BZ4 A;  3I2J A;  5FJH A;  1URX A;  2XQX A;  3VBR A;  2DBI A;  4XAC A;  1AXY A;  2YPD A;  3POW A;  4CUA A;  1QNY A;  3HIF A;  5JPM B;  2LS6 A;  5CNA A;  2FZ1 A;  3WNP A;  4NWV A;  2JG8 C;  4BIO A;  1D4V B;  5HCF A;  5TSW A;  3SQO A;  3HT1 A;  5ISL A;  5FZF A;  2R04 1;  5DAP A;  2VTX J;  5C8C B;  4AE2 A;  5E88 A;  4AEM A;  3WNX A;  1IG3 A;  1W2T A;  5FPA A;  1MS5 A;  4QB1 A;  4H3W A;  3SEE A;  4D69 A;  5C5T A;  2VG9 A;  5GZG A;  5JXJ A;  1BEV 2;  5E1R A;  1F2N A;  4L9B A;  1LOD A;  2YRO A;  5FY0 A;  2D93 A;  4KWL A;  5JR2 A;  4YVS B;  2WSV A;  2B46 X;  3EJK A;  5K0U C;  1JYN A;  3KCX A;  4I3P A;  3H50 A;  3VZM A;  5HCA A;  2ADE A;  1OLQ A;  5DPN A;  2Y6L A;  4Q2F A;  3SCH A;  3RYK A;  5G05 L;  2VQU A;  4XXP A;  3VN4 A;  2ZAH A;  4QPI B;  1MQT A;  1Z7S 1;  2DWR A;  4GAL A;  1FPN 3;  3ITQ A;  4M4R A;  5K7P A;  3RSJ A;  1NT0 A;  3DKQ A;  3MIE A;  4RGG A;  4JQR A;  5K4L A;  3KB5 A;  4M3C B;  2I07 B;  2IFR A;  5DG1 A;  5BNO A;  1ZA7 A;  2Y6J A;  2V5D A;  3HQX A;  4XTM A;  2D5H A;  2XUE A;  2BZD A;  3HBZ A;  1BJQ A;  2C6S A;  4OI4 A;  5D8A A;  1E5R A;  1YWK A;  3TNP B;  3T2Q A;  3JD7 1;  3NJZ A;  1RUG 2;  4HSJ A;  2A6W A;  5A3T A;  1HB1 A;  1S0J A;  1YIF A;  1K45 A;  1VE0 A;  3AKR A;  3I2I A;  3NJX A;  4RHV 2;  3UGG A;  2P3J A;  3VBU B;  1HXS 1;  4KNC A;  2LRO A;  5GLW A;  1NLR A;  1ZBA 1;  1PO1 1;  4RGK A;  3MIG A;  5DXD A;  3GYD A;  2VMG A;  3NJV A;  3AYD A;  1PZ8 A;  2XJQ A;  5FLH A;  4URT A;  4CVU A;  4YG6 A;  4IE0 A;  5KHI A;  4AFD A;  1Q3E A;  5EYX A;  4OQ8 A;  1O8P A;  3T2O A;  1J3Q A;  3O1M A;  4A45 A;  5DN2 A;  4FFG A;  3CL1 A;  4QGM A;  1LEM A;  1T2X A;  2WNU B;  1CX4 A;  1BBT 3;  1R08 1;  2QQV A;  3J8F 1;  4C1W A;  5FWJ A;  5IK7 A;  2RMU 1;  2KD7 A;  1F5F A;  3VBH B;  4E8D A;  1JZ8 A;  4I01 A;  3VDD C;  1JYX A;  2WDB A;  5IYY A;  3OY8 B;  1FAY A;  4F83 A;  1GNZ A;  3ZFG B;  3BU0 A;  4KBB A;  4Y1U A;  4ZKT B;  4AF9 A;  1UPS A;  1AR6 1;  4FPK A;  4P14 A;  1OBN A;  1C8N A;  2C24 A;  2D6N A;  1KQR A;  2UWC A;  3E5X A;  4Q0V A;  4QQP A;  2SBA A;  4Y5Z 0;  5BYN A;  4NID A;  1CIW A;  5JI7 A;  1C4R A;  2J42 A;  1WLT A;  2E9Q A;  3V0B A;  1DGW A;  3ROU A;  3AXE A;  3FHQ A;  1US2 A;  4ZHN A;  3BTZ A;  2X8K A;  4LIU A;  2HJI A;  1DQ4 A;  2GP3 A;  3GDB A;  4XHX A;  4EE2 A;  1TE1 B;  1GZW A;  3LGR A;  3O0X A;  3RMX A;  4L11 A;  3VZK A;  2WYS A;  2Y60 A;  1DYK A;  2BFU L;  2VUD A;  1VBE 1;  4FO9 A;  4M01 A;  1LOG A;  1OFS A;  5AFB A;  4LMF A;  4LK7 A;  1IS4 A;  2NP0 A;  1XNC A;  3DXT A;  4IEV A;  4WM7 B;  4LBL A;  3RS6 A;  3I59 A;  1WME A;  2GC1 A;  1UWW A;  2QQP A;  1UY2 A;  2JD4 A;  2UU8 A;  1ULE A;  1SLA A;  1UOB A;  2VTF A;  1EYB A;  4ARX A;  3RYR A;  5LY1 A;  4Q1P A;  1UIJ A;  3POE A;  2A3Y A;  4LNV A;  1LUL A;  2WSU A;  3ZOI A;  4UW4 A;  2P2K A;  4MVT A;  1IKP A;  2AUY A;  5CFC C;  1VMJ A;  2XJV A;  1FOD 2;  2PTM A;  4XAA A;  3KLS A;  5CZK A;  1EUU A;  4MHR A;  1GWM A;  5GZF A;  3ZXL A;  2O8O A;  4BB3 A;  1V9U 3;  3AL5 A;  3AVR A;  5GZD A;  4BE3 A;  4C91 A;  3WQ7 A;  1NKG A;  4UW3 A;  2VME A;  4RR3 B;  2O1Q A;  3O14 A;  4UF0 A;  1H8T C;  2R32 A;  1MEC 2;  3PNA A;  1DP0 A;  2HEW F;  2CGO A;  3VBF C;  1O7F A;  1IS6 A;  3PDQ A;  4AI0 A;  4JHT A;  2VC9 A;  4CCL A;  3RPQ A;  2P6H A;  2WFP A;  2ZKN A;  4LHL A;  2P4E A;  2E63 A;  2EIE A;  3N7M A;  4IV3 A;  2Q8O A;  1XSR A;  2VW2 A;  3BKZ A;  1YI7 A;  5FXZ A;  5FO8 B;  5CIS A;  1E5I A;  1NCQ A;  4NPL A;  4RL7 A;  4BHP A;  1ZRD A;  4CXW A;  4JRA A;  1LJ7 A;  2WZR 3;  4YYO A;  1BMV 2;  1YIP A;  4FCA A;  2TNF A;  3SCG A;  2BFU S;  4WVW A;  4LIV A;  4R4X A;  1V6O A;  3TEX A;  1E5S A;  3WY6 A;  4EQV A;  5FRA A;  4Y4Y A;  4CEW A;  1VBC 2;  4X8N A;  2ZMN A;  1F35 A;  2P1B A;  4QM9 A;  1NG0 A;  2BER A;  2G1M A;  2WZ8 A;  1H1A A;  3KCY A;  5FZ1 A;  1FV2 A;  3NJY A;  4AHW A;  5CG8 A;  1SQ4 A;  4PF1 A;  1PVC 1;  3NV1 A;  4V2W A;  5T5J A;  4DUW A;  2GH8 A;  4JV4 A;  4FP3 A;  1OH3 A;  2ORX A;  5GKA C;  5JOZ A;  5C4W C;  1GQP A;  5KXE A;  3FUQ A;  2RS5 2;  4IE5 A;  4MV2 A;  5A1A A;  2B45 X;  3OBT A;  2EVX A;  2IXI A;  2RDN A;  3J7L A;  1WA6 X;  1L7L A;  3MI8 A;  3ASI A;  1V0A A;  1B35 B;  3HMY A;  1OXC A;  3U4S A;  2DFB A;  3N7K A;  4QXH A;  1N1Y A;  5HV4 A;  3AYE A;  4GZ9 A;  4EV0 A;  1CAU B;  5EXO A;  5HBA A;  3OUH A;  4IL7 A;  4OHV A;  2B9V A;  3ATG A;  4AFC A;  4NRM A;  1FAT A;  1WLD A;  1PIV 3;  3ZR6 A;  5FZ9 A;  3WW3 A;  2OII A;  5FDB A;  4LLO A;  2Y6K A;  2QQI A;  4Y22 B;  4IEO A;  4JQT A;  1PNF A;  3VKF C;  1G7Y A;  4XUT A;  3WLU A;  2WIN B;  5FZ0 A;  1SLI A;  1UY4 A;  2VXJ A;  3KF5 A;  2PLV 2;  3PTR B;  3O5S A;  3PVB B;  4RA0 A;  1AR8 2;  1JH5 A;  2ZX2 A;  1Z78 A;  5KHJ A;  1I6X A;  2Q5T A;  1GV9 A;  2MEV 3;  5IVB A;  1BVP 1;  2CYF A;  3NV2 A;  1TMF 3;  2XL9 A;  3M3E A;  2JDY A;  2XHN A;  4IEP A;  5FOJ B;  1QJF A;  1AL0 G;  4ASM B;  1MZ6 A;  1LHO A;  5A3M A;  3KCC A;  1UZZ A;  1UU4 A;  2B8M A;  1PO2 1;  2W94 A;  5KBF A;  2WWU A;  1XE7 A;  3N35 A;  5FUI A;  5F5Q A;  2WFF 3;  5AC9 3;  4K7J A;  4HFS A;  1POV 3;  3LPF A;  2Y34 A;  3WDY A;  5IVJ A;  1OA3 A;  1UZ0 A;  1K3I A;  3DUI A;  4ISQ A;  2D6K A;  4PDW C;  4QX5 A;  5I8S A;  1KDK A;  1H9W A;  1WW6 A;  2QQN A;  2RS5 3;  2ZXQ A;  3D0J A;  3OJB A;  3VZN A;  2CWS A;  4AQT A;  1SCS A;  3AB0 A;  4NHK A;  2WNV A;  5FZ7 A;  1IPK A;  4TLG A;  1VBB 3;  1RYY A;  3D0S A;  4CDQ C;  3SXW A;  1HRV 2;  5A80 A;  3LKJ A;  3TB0 A;  5IK5 A;  4DNY A;  2IC1 A;  3NAP C;  4CCK A;  1XRU A;  4DY5 A;  1AYM 3;  3POY A;  4XTP A;  4IV1 B;  4CP9 B;  2QQK A;  4QAW A;  1NE4 A;  2YGL A;  4OFG A;  1HQW A;  4FPE A;  3MW4 A;  3VL9 A;  3ZYR A;  2RM2 3;  2E32 A;  3THT A;  3MLL A;  1ZZB A;  1UYP A;  4OHW A;  1COV 1;  3J7N A;  4LT5 A;  4QKD A;  2J1U A;  1GZT A;  1OI6 A;  2VVE A;  4LPL A;  3VKM A;  3VBS C;  4LA3 A;  1RUD 3;  5F6L B;  2ET7 A;  1N47 A;  3III A;  4L99 A;  4ZON A;  4YW2 A;  2HWE 2;  2HWF 1;  2PHW A;  4EJR A;  2EXJ A;  2OT7 A;  4IGQ A;  4HVQ A;  1XE8 A;  3Q8B A;  2JD9 A;  1RUN A;  1TZO A;  3ZFE B;  4CDW C;  3VV1 A;  3PU3 A;  4IER A;  1LOE A;  2JDP A;  1H2K A;  4QPG C;  1PZ9 A;  2I74 A;  5KXB A;  3B01 A;  2FCV A;  3WR0 A;  3ZR5 A;  5BNN C;  4JGZ A;  1O59 A;  1CAX A;  3MF9 A;  2A1X A;  1RUH 3;  2AYH A;  3BB6 A;  4C0H A;  1REE A;  3WQB A;  4Q4V 1;  4S2H A;  1UPI A;  2W87 A;  3H8R A;  3BI3 A;  3C7H A;  1QF3 A;  5C8C C;  3H42 B;  3P3P A;  3CZU A;  5F2S A;  2OZJ A;  1XYN A;  1UMH A;  1AL2 1;  3AM2 A;  1X7N A;  1HRV 3;  3AP6 A;  1W9W A;  2HWC 1;  3PUS A;  1UZV A;  3I97 A;  4YM1 A;  5FZO A;  2FDK A;  1AR9 2;  2E6V A;  4YVS C;  1QJY 1;  4M00 A;  2QQM A;  4QB6 A;  4XBL A;  2FD8 A;  3HNB M;  3K3N A;  1PGW 1;  2GME A;  2ZA9 A;  5FYU A;  1OD5 A;  5LCW L;  5CAD A;  2V4V A;  2IVI B;  3R0R A;  2HWD 3;  2VNG A;  4XUP A;  1VAV A;  3PMS A;  3W5M A;  4XJZ A;  3UKV A;  3ZMO A;  1ZRI A;  3DPR A;  1W05 A;  4M3C E;  3O1T A;  3ZMN A;  3MF6 A;  3VDC A;  4DXZ A;  4BU2 A;  2WWS A;  3FWE A;  2XOM A;  1A8D A;  1RIN A;  5LAT A;  5LBE A;  5L7O A;  1UY3 A;  1IKQ A;  1GP4 A;  1RUJ 3;  2Z79 A;  3WG3 A;  4Y26 A;  5D21 A;  1W2N A;  2W47 A;  4AI8 A;  4CDU A;  4NWW A;  5CYY A;  2W1W A;  2MPF A;  4JX0 A;  2WYF A;  3HJR A;  1JU4 A;  3N9P A;  2HKX A;  2ZHM A;  4LO4 B;  5F8P A;  4ERO A;  1MZE A;  1PGL 1;  1EP0 A;  3CBN A;  4OUL A;  3KT1 A;  2PN5 A;  3S0M A;  3WDT A;  3IAP A;  4HK8 A;  4UW5 A;  3VBU C;  3VGI A;  3IMN A;  1WZX A;  2O0O A;  5T50 A;  4GUL A;  4J25 A;  4OQ9 A;  2BUK A;  4UFK A;  2AR6 A;  1EV1 2;  2D3R A;  5JDB A;  4LO5 B;  2RJK A;  2VPV A;  3KT7 A;  4HKL A;  4ZS2 A;  2VZP A;  5LK5 A;  1UY1 A;  2GAL A;  3B3Q E;  4LBQ A;  4FOW A;  3U37 A;  5L19 A;  2B7Y A;  1HQL A;  4NII A;  1KD7 A;  4JDN A;  1C57 A;  1ENS A;  3TN9 3;  2VJX A;  3ZSL A;  4BME A;  3VZL A;  4TLF A;  2YY1 A;  4XF9 A;  3RJ2 X;  3PVO A;  3H7J A;  4LIT A;  1W8H A;  2VXR A;  3K4A A;  4GKX A;  1LGN A;  2BGP A;  1ND2 B;  2R6Q A;  5G04 L;  3WF1 A;  4YRD A;  5J36 A;  1GOF A;  3CHX A;  3NNJ A;  5M0T A;  1MZ5 A;  3V65 A;  3K75 B;  4N53 B;  1LB2 A;  2C1F A;  2JDH A;  2A6Y A;  3B93 A;  2EID A;  5IVV A;  3WQ0 A;  1GUI A;  3IB3 A;  2WAA A;  3K77 A;  3H1W A;  2Q8D A;  5JOW A;  3HWJ A;  4Q29 A;  3OBZ A;  1LU2 A;  1J83 A;  2NMN A;  2XJR A;  3E6D A;  2PHL A;  5A33 B;  4HT1 T;  5C3R A;  1LCL A;  3CMG A;  5E16 A;  2KR2 A;  3LEM A;  4UW6 A;  1XSQ A;  2XQR A;  1NLS A;  2QQO A;  1UNB A;  2AEN A;  4BQ4 A;  1NY7 2;  5D1I A;  4DO0 A;  4KBZ A;  2R49 A;  4HLT A;  5IAX A;  3ZYI B;  2ZGQ A;  2DDU A;  1SBD A;  2ETE A;  3A23 A;  4CXY A;  1ZZ7 A;  3HNM A;  4KG8 A;  5F3I A;  5FY9 A;  1R1A 1;  2JDZ A;  4PLO A;  3BPS A;  1CR7 A;  2Y64 A;  4Y1X A;  4YGB A;  4E2Q A;  2OPK A;  5FPZ A;  1GKB A;  1K12 A;  2VVD A;  2VZ1 A;  4GH4 A;  4WM7 C;  1STM A;  5BUV A;  4Y5T A;  1SFY A;  3AXD A;  4EN8 B;  2JIC A;  5LA0 A;  1GOG A;  1OC1 A;  1GSL A;  1JYW A;  2A70 A;  4WV8 A;  3U07 A;  3E6C C;  2Q8E A;  1A8M A;  2ZGN A;  4QB2 A;  1SDD B;  2V09 A;  2NN8 A;  4JHZ A;  4Q4W 1;  5C9A A;  1J59 A;  5JCT A;  1HRI 3;  4GWN A;  4BLI A;  2VZS A;  3PVE A;  1JOP A;  3IMM A;  1XND A;  4XBQ A;  4ZU4 A;  3POI A;  3ETP A;  1S0C A;  2ZHN A;  3K4D A;  2WT1 A;  2VUA A;  4K1Z A;  4JZR A;  1GNH A;  1Y3T A;  2XLG A;  3DCQ A;  4RR3 C;  3M70 A;  1HV1 A;  1W6Q B;  4HKO A;  4BIS A;  3HNY M;  3BTA A;  3EBR A;  1R1Z A;  4WM8 C;  4MGZ E;  3O1P A;  2JG8 A;  2ORZ A;  2P3Y A;  4CA9 A;  1RJ7 A;  3UL2 A;  3NRU A;  4CE8 A;  1SLC A;  4KI5 M;  5JXH A;  2UUR A;  2VMD A;  4Q5O A;  1ASJ 3;  5EQU A;  1VMF A;  3WVJ A;  3MGU A;  3H1M A;  3OGJ A;  5EWS A;  4A7Z A;  1QH6 A;  2IXC A;  4GB3 3;  2VY0 A;  4IDZ A;  4P00 B;  2FDF A;  3IIA A;  4LBQ D;  3WNK A;  4XFG A;  4XIO A;  5LAS A;  5K0U A;  1C1L A;  2KA3 A;  1QIQ A;  1JHJ A;  3I2O A;  4AZZ A;  2ARA A;  3VUO A;  3BIE A;  3NVC A;  3O0V A;  4YW6 A;  5GLU A;  1RUI 3;  2ID4 A;  4Y1V A;  3VZJ A;  1NX9 A;  4TXW A;  3FBY A;  3WCR A;  3L9J T;  1C8M 2;  5GZE A;  1MS8 A;  3EYP A;  3RG0 A;  1SBF A;  1UOG A;  1RB8 G;  2CY6 A;  5CEH A;  3TAY A;  3BOP A;  1C5H A;  2QDR A;  4C0B A;  1EPZ A;  5KC6 A;  3ENR A;  3SIT A;  1AX0 A;  1NAE A;  1RMU 3;  1RUC 3;  3O7O A;  5L73 A;  4A7K A;  2FDI A;  2QDN A;  1V6I A;  2BYV E;  1LEN A;  4AGV A;  2RS1 2;  5JXI A;  1AZD A;  1B35 C;  5IW0 A;  2GAU A;  2JE9 A;  2WAB A;  4XOG A;  2XHK A;  2G4I A;  1QJU 2;  5CU1 A;  1Q5O A;  2XGX A;  1AHS A;  4MYE A;  3N4M A;  3OYW B;  4LQR A;  5A7O A;  1BEV 1;  2P34 A;  3I2G A;  5D2A A;  5T54 A;  5DAQ A;  1QKQ A;  2DCZ A;  3FX3 A;  1ULG A;  5FPU A;  3O1U A;  3AMQ A;  3V0A A;  4B4Q A;  1J1L A;  3B7M A;  1HB3 A;  2JWP A;  3RI8 A;  1JOB A;  4Z1V A;  1VPH A;  3ZXE A;  4FTE A;  4AGR A;  3MLK A;  4W8J A;  5L9V A;  3B02 A;  4RD7 A;  2GC0 A;  3VD3 A;  2QCS B;  4AGG A;  2VQ0 A;  4CU6 A;  1QJX 3;  2MNG A;  4MZU A;  5FZD A;  1RXF A;  1CPM A;  4E2S A;  4N43 B;  2VOV A;  3WOG A;  1AJO A;  1NYW A;  1UD1 A;  2CV6 A;  2BVB A;  3PHM A;  3S30 A;  2ZX3 A;  4JKK A;  5B2G B;  1DYO A;  2DVA A;  2ZEW A;  2B4K A;  3CZJ A;  4OZO A;  2QQW A;  2IFW A;  5IVY A;  2X29 A;  3VDD A;  3ZN6 B;  1V6K A;  4GXL A;  4LHS A;  3VD5 A;  4N9H A;  4AVA A;  1L7R A;  1RUG 1;  3OUI A;  3UJQ A;  4D8M A;  3KGZ A;  3POJ A;  1MAC A;  4RQP C;  2WO1 A;  4RHV 1;  3KWV A;  4FPL A;  1JI6 A;  3RFR A;  1E5H A;  1W99 A;  3OEA A;  4FPG A;  2VMF A;  3OUJ A;  4IGO A;  4COY A;  3BUC A;  2JDU A;  3THP A;  4P08 A;  5A7P A;  4Q0P A;  5A3W A;  3NV4 A;  3U78 A;  4UFM A;  4TYS A;  4GJY A;  2RJ2 A;  3UES A;  3T2P A;  3K3O A;  2RS1 3;  4HZF A;  1R64 A;  1Y7B A;  3MPP G;  3LCP A;  5FMD A;  3W9A A;  5LB6 A;  1QDC A;  2XUM A;  1VBA 2;  5IHR A;  1OUX A;  2D97 A;  2ZS6 B;  2E26 A;  2QQL A;  4CCO A;  2CU5 A;  2W52 A;  1UXZ A;  3C2U A;  4A3Z A;  5F9T A;  5C6C A;  1AYN 2;  3TBD A;  4YNI A;  2WS9 3;  4IW3 A;  5FMO L;  2B5H A;  1OPO A;  1QXP A;  1H4H A;  4LJH A;  5F5A A;  4A42 A;  1WBF A;  3EO6 A;  3I7D A;  4E4D X;  3GCW A;  2ZZJ A;  3MPB A;  4NHX A;  4R52 A;  1ZBE 2;  5EYY A;  3WUD A;  4E27 A;  1O3Q A;  1WMD A;  1NCR C;  1VBD 3;  2VZR A;  4D7Y A;  1RVF 2;  3ALQ A;  3AC0 A;  1GWK A;  5T5O A;  3POG A;  3ZFF B;  4XEZ A;  5FZ3 A;  2EAA A;  4V2V A;  4ZU5 A;  5BNP C;  3IT8 A;  2PQS A;  2EA7 A;  1UOF A;  1H8T A;  3SH5 A;  4Z2W A;  4UXA A;  4XDQ A;  3TEY A;  4EN9 B;  4L97 A;  3MFA A;  3VBF A;  3UT0 A;  2AEZ A;  2ZAB A;  3IWZ A;  4JKL A;  2A71 A;  3FZ3 A;  3BVC A;  4XYX A;  4CEY B;  4UBG A;  5FZI A;  1M06 G;  4XW3 A;  4Q4X 2;  3NKT A;  1UF2 C;  2BV4 A;  2K0G A;  4DIQ A;  1X8M A;  1ST8 A;  2BNO A;  1S2B A;  2GZW A;  5FZL A;  2X05 A;  1HJF A;  1QH7 A;  5FP8 A;  3RGB A;  1XE0 A;  4H7L A;  1G8W A;  1A3K A;  1RUE 2;  4X8P A;  4CP1 A;  2P17 A;  5E8A A;  3VL8 A;  1MQT B;  2PXJ A;  5FP7 A;  4Q26 A;  4Y24 A;  1PK6 B;  4AI3 A;  3GF6 A;  5IVF A;  3JB8 A;  1FOD 1;  5JIA A;  5IAT A;  4BPZ A;  1MS3 A;  3H3L A;  1S0B A;  3M7A A;  5FMO S;  5BNO B;  3ECQ A;  5JMO A;  1ULC A;  1SBE A;  1JZ6 A;  1HN0 A;  2OUH A;  4DOU A;  4XCA A;  1CN1 A;  1FPN 2;  5C3P A;  3WX5 A;  4DUX A;  3PUH A;  4Y20 B;  1NXD 1;  1QQP 2;  3B00 A;  3M1H A;  1MEC 1;  5H9Q A;  4ITC A;  3R6S A;  3GXU A;  5C4W A;  3GM8 A;  5A7Q A;  3MYX A;  3H9A A;  1OKO A;  5I0R A;  3DL3 A;  4XMA A;  4COW A;  3IDB B;  5F39 A;  3SNM A;  3RZJ A;  1AVB A;  2BPA 2;  3Q8C A;  1S2E A;  2G9G A;  3B5L B;  2HLE A;  1VB4 A;  1W6M A;  2WAO A;  3BU7 A;  4XXA A;  4Q27 A;  4XVH A;  1VLN A;  3JZV A;  4MSV A;  1QY4 A;  2ZGP A;  4AVB A;  1BMV 1;  4FQZ A;  3RDI A;  3ZXA C;  3LFI A;  4LEJ A;  3BTX A;  2Z2S B;  4MOA A;  2XVG A;  4E4Z A;  1ND3 C;  4CRQ A;  3MUZ 1;  2W2I A;  1VBC 1;  4Q4X 3;  5BY5 A;  2A3X A;  2VO5 A;  4HPK A;  3C7O A;  1UIK A;  5BXX A;  3KZ4 C;  2DU0 A;  4MET A;  5GLZ A;  1AR7 3;  1VJ2 A;  5I91 A;  4LOS A;  4CP0 A;  4XPV A;  1RUE 3;  1BBT 2;  3AZY A;  3GAL A;  4YW4 A;  1ZZ6 A;  1FMD 3;  3GBW A;  2CWM A;  1Q8Q A;  4AOC A;  1G9D A;  1X36 A;  1DGL A;  2P3I A;  2RS5 1;  3I54 A;  2R06 2;  1YLL A;  4LOT A;  1XQN A;  4GQ7 A;  2OS2 A;  3OG2 A;  4AQ6 A;  2C26 A;  2OZ6 A;  3H0O A;  5IK4 A;  4CXX A;  1RXG A;  3V0B B;  3USU A;  2ENR A;  3WEZ A;  1X8E A;  3WT3 A;  4AVV A;  1QQP 3;  2NMO A;  1JZ4 A;  3PL0 A;  4AQ2 A;  4NPR A;  2B9U A;  4W6Y A;  1S0D A;  2Q8C A;  4PDW A;  4AXO A;  4HMZ A;  3SH3 A;  5FJK A;  4O7X A;  4QDR A;  3P6B A;  5J48 A;  3ES1 A;  1OQD A;  3DV8 A;  1IS5 A;  3P5B A;  3WHU A;  4FOV A;  1VRH 3;  1GZW B;  2JB4 A;  3T30 A;  4OHY A;  1YFW A;  4W4Z A;  4CDQ A;  5F1R A;  1TME 2;  1W8U A;  3SC7 X;  2N7G A;  2MHF A;  2PLV 1;  3NAP A;  3I59 B;  4Q4Y 3;  4FBF A;  1QOT A;  2YC4 A;  1AR8 1;  2FMY A;  3M8L A;  5FV3 A;  2A6Z A;  4JDM A;  3RZM A;  3S7E A;  3HD8 B;  3C7G A;  2RJL A;  2EAK A;  2LM3 A;  4R9D A;  3KSC A;  5AVP A;  2VZT A;  5KHK A;  1UYZ A;  1IQA A;  2BWA A;  3CIH A;  4NE9 A;  1N1T A;  4QHO A;  5KWR A;  5EJ3 A;  1GP6 A;  3APB A;  5IWF A;  1OUS A;  5DUV A;  3VBS A;  3HR9 A;  4XQD A;  1UL9 A;  5FZ4 A;  1F9K A;  3HT2 A;  4UFH A;  1WCD J;  5FO7 B;  1ZZC A;  3FE5 A;  3QCW A;  2BP6 A;  2WC2 A;  3GBF A;  2F6B A;  1V9U 2;  4CDW A;  2EAL A;  1JYC A;  2R06 3;  2DUO A;  2D3S A;  1OPM A;  4IQP A;  2GH2 A;  4S2F A;  5DDJ 3;  2VBP A;  4X6R B;  5JLV A;  4QPG A;  4BXF A;  1NQJ A;  4YW1 A;  1W8F A;  2XWJ B;  2EXH A;  1NCQ B;  1HRV 1;  1JTZ X;  5BNN A;  3GZT B;  2H6B A;  5A7S A;  3HPN A;  5A32 A;  5L9B A;  4C8D A;  1X9P A;  1BZW A;  1GFF 2;  2EF6 A;  1BXH A;  5C8C A;  2QUO A;  4JRL A;  4B1M A;  3M3O A;  5DQ0 A;  3AMP A;  1VRB A;  5IFP A;  1KDM A;  4D3W A;  4LUM A;  3FFZ A;  2JG9 C;  4CEW B;  2HBT A;  3POS A;  1ULP A;  2WZR 2;  1CAW B;  3U14 A;  4ATF A;  1WCS A;  1TME 3;  4UWD A;  3GCX A;  5IVE A;  4DRR A;  3S7I A;  1WW5 A;  1DGW X;  2YPJ A;  4YVS A;  5BNQ A;  1YQC A;  4DUV A;  1CPN A;  2HWE 1;  5EHD A;  2BOJ A;  1DYP A;  1JXN A;  5H9R A;  3NV3 A;  4FPY A;  3G7D A;  4A44 A;  2AAC A;  5FY1 A;  3WNO A;  2NYY A;  4AL9 A;  1HN1 A;  3H8O A;  5FFO C;  2W1S A;  3CU7 A;  1UX6 A;  4LE4 A;  4QKB A;  5FPB A;  1H1I A;  2D6P A;  2ZGU A;  3CKH A;  4WVM A;  5LA9 A;  1FI2 A;  1W3X A;  4XJW A;  2LUW A;  4AI9 A;  5EFU A;  2GP5 A;  4P9J A;  3K48 A;  2CGN A;  2D5F A;  2VEC A;  4NR1 A;  4D6Q A;  5J37 A;  3R05 A;  3LE0 A;  4YPJ A;  3WDW A;  4PBP A;  2D7F A;  1S4C A;  1GYK A;  5ERL A;  1SLL A;  4YVW C;  2K2S A;  1QJE A;  2VGD A;  4DZG A;  5FCC A;  1QXR A;  1W6O A;  3MO4 A;  3VBU A;  1H4G A;  2JXA A;  2PAK A;  1RED A;  4P9Y A;  1PMI A;  3GZU C;  1I5Z A;  4KWJ A;  2ILM A;  4UYB A;  1PIV 2;  5CVR A;  1F8V A;  1AR9 1;  4ES8 A;  5I0T A;  2WBK A;  4JGY C;  4IGP A;  1CVN A;  4LK6 A;  3LDK A;  3ZSE A;  4TWT A;  4AFM A;  2R07 2;  5FZG A;  3ILR A;  3I3D A;  3Q8F A;  4LHK A;  3RZG A;  1DZR A;  5JPN B;  4I02 A;  3TOJ A;  1M4W A;  1PMJ X;  2ZJC A;  4FPF A;  2HWB 3;  1W06 A;  1HQN A;  1W04 A;  2W1Q A;  3E5Q A;  3K2O A;  1WLC A;  3OPW A;  1DIW A;  3CDZ B;  3ES4 A;  4OVE A;  2MEV 2;  2VUC A;  2QE3 A;  3R4D B;  5DAX A;  1TMF 2;  4FVV A; 
#chains in the Genus database with same CATH homology
 1CZS A;  2XOM A;  1UY3 A;  2J1T A;  3FL7 A;  3ZM8 A;  1TVG A;  2W95 A;  4AG4 A;  1UY0 A;  2W47 A;  2W46 A;  1OF4 A;  4KWU A;  5CYY A;  2W1W A;  4JX0 A;  3HJR A;  1JU4 A;  1NUK A;  2E31 A;  3LPG A;  2QQJ A;  2C4X A;  2W91 A;  3IAP A;  3MV1 1;  1UMI A;  4ZY9 A;  1KGY A;  3C8X A;  4GWI A;  2VOT A;  2WN3 A;  2BGO A;  2VR4 A;  2VZP A;  2W9X A;  5IJR A;  1UY1 A;  3LQC A;  5DMY A;  3U37 A;  3NNG A;  4FI9 A;  2VJX A;  3IAQ A;  4KMQ A;  3ACI A;  2J1R A;  2J7M A;  3K4A A;  2W3J A;  1JYV A;  2BGP A;  1P8J A;  5G04 L;  3WF1 A;  1GOF A;  1US3 A;  5C7G A;  3HOB A;  2J1S A;  3K75 B;  3MUY 1;  1UXX X;  3UNP A;  2WO2 A;  2EID A;  2YC2 A;  1GUI A;  3IB3 A;  2WAA A;  3K77 A;  4CUC A;  2YFU A;  1J83 A;  3J7H A;  2CDP A;  3ABZ A;  3CMG A;  3OBA A;  3DYM A;  4A41 A;  2QQO A;  2VZQ A;  3THD A;  4AAX A;  3VD9 A;  4DXS A;  4QPW A;  2WUH A;  2DDU A;  3WF0 A;  3A23 A;  2ZEX A;  4M4P A;  4UI9 L;  3HNM A;  5B4N A;  2Y64 A;  1SG3 A;  1K12 A;  2VZ1 A;  2WN2 A;  3T0D A;  2J22 A;  4CU8 A;  4P02 B;  1GOG A;  1PMH X;  2C9K A;  5LA0 A;  1JYW A;  3E1F 1;  1JZ5 A;  1D7P M;  4QB2 A;  1SDD B;  1BHG A;  1F4A A;  1IQD C;  4JHZ A;  4DEV A;  3W5N A;  4OMD A;  3EB7 A;  2VZS A;  3ETP A;  3K4D A;  4QDS A;  3T0B A;  3F2Z A;  1J84 A;  3DEC A;  3HNY M;  3MBW A;  2ORZ A;  1W9T A;  3OGS A;  3NRU A;  3WF2 A;  1H6Y A;  5EJZ B;  4KI5 M;  5JXH A;  2VMD A;  1LNS A;  3C7E A;  4MO3 M;  2Y8K A;  3VDA A;  3SEP A;  3K46 A;  4P00 B;  1UYX A;  1XNA A;  3A7Q A;  3K4Z A;  3WNK A;  3FN9 A;  1JHJ A;  2CDO A;  2ID4 A;  1NX9 A;  4TXW A;  4XUR A;  2W5F A;  5LA2 A;  2Y6H A;  5HPO A;  3WNN A;  2X10 A;  3EYP A;  5C71 A;  4ZZ8 A;  5IFT A;  2VCB A;  3VD7 A;  2DCJ A;  3I2J A;  2XQX A;  1NAE A;  1W9S A;  4QX3 A;  4XZU G;  4CUA A;  2LS6 A;  1WCQ A;  5JXI A;  3WNP A;  1L7Q A;  2V72 A;  2WAB A;  2Y6G A;  4LQR A;  3T08 A;  3I2G A;  4JKM A;  2ZEZ A;  3T09 A;  4QB1 A;  3OEB A;  3SEE A;  1H6X A;  4OYU A;  4MGS A;  5JXJ A;  4W8J A;  3VD3 A;  5JR2 A;  2WQ8 A;  4CU6 A;  5I0D A;  1JYN A;  1MPX A;  1CX1 A;  2OKX A;  4JKK A;  5JXG A;  1DYO A;  2Y6L A;  1EUT A;  5G05 L;  2VQU A;  2B4K A;  2ZEW A;  3CZJ A;  4OZO A;  4W50 A;  4M4R A;  1DLC A;  3FHA A;  5LA1 A;  4LHS A;  3VD5 A;  1L7R A;  3CQO A;  4HG6 B;  4D8M A;  2Y6J A;  2V5D A;  2WO1 A;  2BZD A;  3WF3 A;  1JI6 A;  3T2Q A;  4MGQ A;  1W99 A;  3OEA A;  4BXS V;  2VMF A;  4P08 A;  1K45 A;  4XUO A;  3I2I A;  3NJX A;  2RJ2 A;  3UES A;  3T2P A;  1GOH A;  1R64 A;  3NJV A;  2VCA A;  4CU9 A;  4CVU A;  3LEG A;  4CU7 A;  5IHR A;  3DYP A;  5B4X A;  2E26 A;  2QQL A;  1O8P A;  3T2O A;  1UXZ A;  5DN2 A;  4LKS A;  4A45 A;  4A3Z A;  1T2X A;  2EIB A;  2VL4 A;  4ET7 A;  2EIC A;  2YB7 A;  4OUE A;  4ZXE A;  3VD4 A;  4A42 A;  2KD7 A;  4TTG A;  4E8D A;  1JZ8 A;  1UX7 A;  1PX4 A;  4ZZ5 A;  1JYX A;  2WDB A;  3I2K A;  4PQQ A;  5IYY A;  2VQT A;  2VZR A;  3AC0 A;  2VMC A;  4CUB A;  3WSO A;  4BDV B;  2PQS A;  3A22 A;  2W1U A;  1CZV A;  1US2 A;  3FHQ A;  1JZ3 A;  4JKL A;  2W92 A;  4DEQ A;  2BBA A;  3I2H A;  1ULO A;  3I3B A;  3GDB A;  4UOJ A;  3ACH A;  2R7E B;  3A21 A;  1GMM A;  3WNL A;  2X05 A;  2LW8 A;  2WYS A;  2VM9 A;  2YFZ A;  2X09 A;  1W8N A;  3DYO A;  1UWW A;  3OGV A;  1UY2 A;  3WNM A;  4BK4 A;  3MV0 1;  2VTF A;  4ARX A;  3ECQ A;  5JMO A;  1GU3 A;  1JZ6 A;  2YG0 A;  5J1X A;  4P5Y A;  2JE8 A;  5CZK A;  1EUU A;  4DUX A;  3PUH A;  4RN5 A;  2VZU A;  3GXU A;  3GM8 A;  3OB8 A;  1NKG A;  1JU3 A;  2VME A;  2WZE A;  1DP0 A;  1XNT A;  3LEK A;  2HLE A;  2WAO A;  2QBX A;  2VC9 A;  4XVH A;  2Z4F A;  2EIE A;  1UYY A;  1K42 A;  2VZ3 A;  4MOA A;  3MUZ 1;  4PT6 A;  2VO5 A;  4OMC A;  3C7O A;  4MAD A;  3NQH A;  3SKJ E;  3IDA A;  4BJ0 A;  2WZ8 A;  2BER A;  2HYX A;  4PF1 A;  1OD3 A;  2RV9 A;  4DUW A;  3GGL A;  4ARY A;  3OG2 A;  5EJ1 B;  3BN6 A;  1GNY A;  2C26 A;  2ORX A;  1GQP A;  3D3A A;  1F4H A;  3WEZ A;  5A1A A;  3WF4 A;  3VDB A;  4E8C A;  1JZ4 A;  5C70 A;  4QDR A;  1XPW A;  3P6B A;  4GZ9 A;  4QX2 A;  5DPN A;  2VZV A;  4QX0 A;  4QX1 A;  2B9V A;  4W4Z A;  2VCC A;  4XUN A;  2Y6K A;  2QQI A;  2YC4 A;  4XUT A;  1UY4 A;  1KEX A;  3C7G A;  5F7U A;  2VZT A;  1UYZ A;  3CIH A;  1CZT A;  3LEI A;  2ZEY A;  2XHN A;  3T0A A;  3SKV A;  1JZ2 A;  2JKX A;  3UET A;  3HEI A;  2W94 A;  5FUI A;  3ACF A;  5JUV A;  3LPF A;  3PUI A;  1UZ0 A;  1K3I A;  3I3E A;  1W8O A;  2QQN A;  2ZXQ A;  1SHW B;  3HPN A;  3C7F A;  3HN3 A;  4A6O A;  4GWJ A;  3ACG A;  1I5P A;  1O8S A;  1WKY A;  1RYY A;  1YQ2 A;  4DXT A;  4IUG A;  5DQ0 A;  5IFP A;  1W0N A;  1ULP A;  3OGR A;  2WO3 A;  2XON A;  2QQK A;  4QAW A;  4XUQ A;  2E32 A;  4DUV A;  5HXM A;  2J1U A;  2RVA A;  3BGA A;  4LPL A;  4D0Q A;  4A44 A;  3WNO A;  4RYD A;  3P1I A;  2L9L A;  3III A;  1HN1 A;  2W1S A;  2J1E A;  3CKH A;  2JD9 A;  1JZ7 A;  2E33 A;  3THC A;  3LE0 A;  1XC6 A;  2J1A A;  4YPJ A;  2VZO A;  1O59 A;  3I2F A;  4Z2A A;  3MO4 A;  3WQB A;  2W87 A;  1OF3 A;  4L0P A;  3C7H A;  1CIY A;  3CZU A;  2J1V A;  5EIY B;  1UMH A;  2WBK A;  4QDQ A;  4DXR A;  4BK5 A;  1OH4 A;  1TG7 A;  1W9W A;  4A4A A;  3I97 A;  3I3D A;  4QB6 A;  2QQM A;  1PX3 A;  3HNB M;  5LCW L;  1PMJ X;  2DCK A;  2V4V A;  2W1Q A;  1OT5 A;  4XUP A;  3W5M A;  3JXS A;  3CDZ B;  2JDA A;  3VDC A;  4UAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...