1UY2A

Binding sub-site dissection of a family 6 carbohydrate-binding module by x-ray crystallography and isothermal titration calorimetry
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
131
structure length
131
Chain Sequence
b'SPIRRDAFSIIEAEEYNSTNSSTLQVIGTPNNGRGIGYIENGNTVTYSNIDFGSGATGFSATVATEVNTSIQIRSDSPTGTLLGTLYVSSTGSWNTYNTVSTNISKITGVHDIVLVFSGPVNVDNFIFSRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE A
molecule tags Carbohydrate-binding module
source organism Clostridium stercorarium
publication title Binding Sub-Site Dissection of a Carbohydrate-Binding Module Reveals the Contribution of Entropy to Oligosaccharide Recognition at "Non-Primary" Binding Subsites.
pubmed doi rcsb
total genus 32
structure length 131
sequence length 131
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2004-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1uy2A00
3JXSA 3CQOA 3C7OA 5IJRA 1IQDC 2VZTA 1JYNA 1H6XA 3IB3A 1JI6A 4QX0A 2J1TA 4OYUA 1WCQA 3MO4A 3WSOA 4Z2AA 3T09A 5F7UA 5JMOA 2XOMA 3EB7A 1PMHX 4DUWA 3FN9A 1OD3A 4HG6B 3CZJA 4ARXA 1O8PA 2C4XA 2VZ3A 1UYZA 3CIHA 3CZUA 2YFZA 2VR4A 4XUTA 4A45A 3HOBA 1CZVA 1K45A 3GGLA 4M4RA 3WF1A 4CU6A 2OKXA 4XUOA 5DPNA 3HN3A 3VDCA 3K75B 4QX3A 4PF1A 2Y6KA 5JXGA 4FI9A 4MGSA 3UESA 2VZ1A 4LHSA 2V5DA 1OF4A 4AAXA 4CU7A 2WDBA 3VD3A 4TTGA 3OGSA 2W1WA 4XUNA 4GZ9A 1OT5A 2BBAA 2YG0A 1DLCA 1GOHA 4XURA 3P6BA 4E8DA 5A1AA 4MOAA 1O8SA 3MBWA 2J1AA 5IHRA 2W3JA 4DUVA 1JZ2A 2VMCA 4YPJA 2CDOA 2W1QA 1OF3A 2VTFA 1W0NA 4ZY9A 3MV11 3MV01 4ARYA 1SDDB 5LA2A 2WN2A 1DYOA 4JX0A 5LCWL 1US3A 2C9KA 5J1XA 3F2ZA 5HXMA 5C70A 2VCBA 1I5PA 1UXXX 2JE8A 3CDZB 4BDVB 3K77A 1W8OA 4BJ0A 5JUVA 1K42A 2Y64A 3MUZ1 3AC0A 3A7QA 3ETPA 2VMDA 4XVHA 3K4ZA 4W50A 4A3ZA 3I2FA 3HJRA 2EIDA 2WYSA 2X10A 4ZZ8A 2J1UA 4XUPA 2QBXA 2WO2A 4DEVA 4CU9A 2W94A 1UY4A 3T2PA 3GXUA 1GOGA 1J84A 3NJXA 4LKSA 3I2IA 2XONA 4RN5A 2DCKA 2VZUA 4QX2A 4QB6A 4A4AA 3E1F1 3K4DA 3I3EA 3NJVA 4QDRA 2X05A 3WNPA 2BZDA 2JDAA 2ZEYA 1UXZA 4QX1A 4JHZA 3SEEA 1JZ5A 4KWUA 3K46A 4JKMA 1UX7A 1EUUA 2X09A 1MPXA 3HEIA 4QB1A 4XUQA 5IFPA 1P8JA 2WZEA 5JXHA 1OH4A 2W92A 1D7PM 3DYMA 4GWJA 2QQKA 4W4ZA 1RYYA 3LE0A 3PUHA 3WNKA 2VZVA 1YQ2A 2W1UA 3I3DA 4AG4A 4ZXEA 4KI5M 4LPLA 3CKHA 2ORXA 2ZEZA 3BGAA 3LPGA 3MUY1 1GNYA 1EUTA 2RV9A 3OG2A 1XPWA 1F4AA 2QQMA 3OGRA 4GWIA 4QDQA 4OMDA 5HPOA 5LA0A 4DXRA 3NQHA 1PX3A 3I2HA 4P08A 1WKYA 3I3BA 1TG7A 1L7RA 1CIYA 4UI9L 1TVGA 2DDUA 2J1SA 3I97A 2ORZA 3U37A 2VZPA 2WO3A 4BXSV 1JU4A 2PQSA 2Y6JA 3K4AA 2W87A 2YC4A 1XC6A 1SHWB 1UZ0A 3WNMA 2VM9A 1XNAA 2WAOA 2KD7A 2W46A 1GQPA 1ULPA 3HNYM 3CMGA 2EIBA 4PT6A 1CZSA 4JKLA 3ZM8A 1NKGA 1JU3A 4QB2A 4A44A 3W5MA 2W5FA 5JR2A 1K3IA 1JZ8A 3FHQA 2W47A 2QQOA 2VZOA 1GOFA 2WO1A 2ID4A 3ACGA 2HLEA 2VQTA 4A42A 3A22A 3WNLA 5C7GA 1JZ7A 2W1SA 1ULOA 3GDBA 3NNGA 4OUEA 5IYYA 1US2A 1GMMA 1KGYA 1GUIA 3VDBA 1UMIA 2W9XA 2JKXA 3A23A 2QQIA 2ZEXA 3IIIA 4QPWA 3FL7A 2QQNA 3T0BA 1UMHA 2C26A 1XNTA 2W95A 1BHGA 3C7EA 5EJ1B 4LQRA 3IAQA 2QQLA 2VQUA 2WUHA 4CU8A 1UWWA 3SKVA 1HN1A 4L0PA 4P5YA 3OBAA 2RJ2A 1K12A 2B9VA 5LA1A 2Y6GA 1CZTA 3SKJE 3BN6A 3OB8A 3HNBM 3WQBA 4DUXA 5FUIA 2WAAA 1JZ6A 1GU3A 3C7GA 1W99A 2VCAA 4DXSA 4JKKA 2L9LA 2B4KA 3DYOA 5B4XA 3ACHA 4A41A 2LS6A 1LNSA 3D3AA 3VD9A 1KEXA 3C7HA 4MGQA 2HYXA 2V72A 4PQQA 1JYWA 4DXTA 4DEQA 2DCJA 3ABZA 3VD7A 3OEBA 5DQ0A 1JZ4A 2VZQA 2WABA 5JXJA 3I2KA 1UY2A 3LEKA 5IFTA 4IUGA 5B4NA 4QAWA 3LEGA 4A6OA 2BERA 4W8JA 4CVUA 2CDPA 2QQJA 2Y6LA 2VMFA 3T0AA 3WNNA 2E31A 1JHJA 4CUBA 3DYPA 3UNPA 1O59A 1W9TA 3EYPA 2VJXA 2YC2A 2J1EA 2VCCA 3ACIA 4RYDA 1L7QA 2VC9A 2E32A 2W91A 3LEIA 3NRUA 1SG3A 2LW8A 4ET7A 2Y6HA 3WF0A 2R7EB 1UYYA 2V4VA 3LQCA 4OZOA 2ZEWA 5CYYA 1NAEA 2RVAA 4OMCA 5EJZB 3VDAA 2E33A 2J22A 2BGPA 1UYXA 2VO5A 1T2XA 1W8NA 3WNOA 4QDSA 5G05L 1UY1A 3I2JA 3GM8A 2YB7A 3T0DA 4P00B 3A21A 3P1IA 2WN3A 3VD5A 4MO3M 2WQ8A 2ZXQA 3PUIA 3HNMA 2J1VA 1JZ3A 4CUAA 3WF2A 4KMQA 3THCA 1NUKA 2J1RA 2J7MA 4ZZ5A 5G04L 3W5NA 4CUCA 1J83A 5DMYA 2JD9A 3J7HA 2YFUA 3T2OA 5C71A 4E8CA 2VZSA 2EICA 2VL4A 2VOTA 1NX9A 3ACFA 1UY0A 4TXWA 3IAPA 3THDA 3OGVA 4P02B 2VZRA 3C7FA 3LPFA 1UY3A 4MADA 3ECQA 1DP0A 5CZKA 3T08A 1JYVA 5JXIA 2BGOA 1F4HA 3T2QA 5DN2A 4D8MA 3VD4A 3OEAA 2Y8KA 1H6YA 1W9SA 3C8XA 3SEPA 1PX4A 3DECA 5EIYB 4BK4A 3UETA 5I0DA 1CX1A 3I2GA 1R64A 3WF4A 2EIEA 1PMJX 2WZ8A 2XHNA 4BK5A 3HPNA 1JYXA 4M4PA 3FHAA 1W9WA 3IDAA 2XQXA 3WF3A 3WEZA 2E26A 4UAPA 2WBKA 4UOJA 2VMEA 4D0QA 2Z4FA 4XZUG
chains in the Genus database with same CATH superfamily
2VNVA 3EBRA 3ES1A 1C1FA 1C28A 4XBNA 4QX8A 3W59A 1YCIA 4I0WB 4GWMA 1JXNA 4AR2A 3T4VA 3MICA 3MLKA 2WZR3 3ACLA 2VZTA 4D7YA 4XFAA 4QX0A 2H0BA 3OBRA 1UCXA 1GICA 2O1QA 4G3YC 5GLUA 3MO4A 4YM1A 5FP7A 1OA4A 3OD4A 1RXFA 4OVEA 4CDWB 1VRH3 4YGEA 4AI1A 3ZFEA 2XJQA 3TYJA 4L9BA 4AI0A 4RHV1 1B35B 4LKEA 4HG6B 4AVAA 3LOIA 3POJA 2Q8CA 1RUC2 3V56A 2VZ3A 2Q8EA 2Q8DA 3CZUA 1NZIA 2YFZA 5AVAA 5FUPA 2R1DA 4XUTA 4A45A 4NIHA 4J1WA 1K45A 3GGLA 1LEDA 1RJ8A 4M4RA 2OKXA 2ZX4A 3VD9A 3KV5A 3K75B 3KCCA 4QX3A 3J7LA 4YVSB 1TMF3 3UKNA 2DCTA 2GAUA 2VZ1A 2EALA 3DKWA 5C5UA 5A3NA 5KC5A 2I74A 2ZACA 2WDBA 1DU3D 4JGYC 4CP2A 5ABJB 3OGSA 1WBFA 3SH4A 3AP5A 4Y4RA 4HMZA 4XUNA 3SLIA 1N1SA 1SBFA 2QQUA 1O3RA 5CVRA 1LU1A 1AVBA 4E9KA 3CO2A 4XURA 3EXUA 2TBVA 4CDQA 1N1VA 4LEJA 1VBE2 5IHRA 5FZ7A 4NHYA 1RUF1 1ULFA 1VALA 3POGA 4IERA 4LJHA 4RFRB 5DABA 4YPJA 4AE2A 4L92A 4WZFA 3PIGA 5DAVA 3F95A 1W8HA 1UPSA 1QQP1 3JUUA 4ZY9A 5H9RA 4ATFA 1QXRA 1WA6X 5FZIA 4ARYA 1CGPA 3Q8EA 3QOPA 2XVKA 5LA2A 2X5IC 3WDXA 4DS0A 3DN7A 5CEHA 1ST8A 2RMU3 2RMU1 4Q2FA 4Y4YA 1US3A 1VAKA 5T5LA 1VPHA 4HKWA 3F2ZA 4Y1VA 2QQPA 5HXMA 4LHLA 2ZHLA 3CDZB 4I3PA 4XQWA 3MUZ1 2WNVB 2YBSA 3DXUA 3AC0A 3A7QA 3ETPA 4WM8C 3OD0A 5F9TA 5LZ6A 4RGGA 1NE6A 4YM2A 5AVPA 4A3ZA 3O0XA 3HJRA 1XYPA 2XBO2 4QX7A 1CESA 2MPFA 2XJRA 5FJHA 1VBD2 2NN8A 4CCOA 1YWKA 2E7AA 3N9MA 4GWNA 5FZ6A 3ZYFA 1NY71 1AL22 4KWLA 3THTA 4I01A 3ZFGC 3JCIA 4XTMA 2HWB3 4CXWA 2HH9A 2ERFA 3D5OA 3EO6A 2O8QA 1PK6B 3ON7A 3KV6A 2DVGA 2D98A 2WNEA 3ES4A 2PHWA 4RS5A 1NCRA 3AL5A 4GXLA 5CU1A 2B42B 1REEA 3I2IA 3RPQA 3U07A 3WQ7A 4CDXA 4DXZA 1W03A 3O1OA 1N1YA 3GCXA 4QDRA 3U10A 5AFBA 3AZVA 1OD5A 2Y33A 4YG6A 1UZYA 1H2KA 2AACA 5A70A 3LD8A 4NHKA 4QX1A 5FZGA 1HRI1 4IGQA 5F3GA 4I0AA 1H2NA 4OHZA 4IEPA 2ZGTA 3ZYIB 5GLZA 2XGXA 3INAA 5L7OA 2QE3A 3USUA 3D0JA 1MPXA 4UFKA 3AZZA 4D3WA 3ZSMA 1GLHA 2Q1MA 4XQDA 3IZOA 4YW2A 1C8M3 4QB1A 1ZRDA 1AJOA 1ENRA 1P8JA 2WS91 4YFWA 3WHTA 5JXHA 1BXHA 2W92A 5A6XA 2HWB2 4FAHA 1LGNA 2VMIA 3AFKA 2GZWA 2I45A 5FPVA 5FRAA 4DINB 2QQKA 4G9SB 5A3LA 1O4ZA 3H7JA 3UGGA 1BLZA 1RYYA 1RC6A 3WNKA 1YQCA 5HCHA 3M3IA 1YQ2A 2C6SA 2W1UA 3I3DA 1U5IA 1ZZCA 2PA7A 4XJUA 2Q8OA 3ZXEA 2RR11 1UX6A 1FPN3 5J36A 4IEWA 2WINB 4FPEA 1DGRA 2WLPA 4COWA 3FHIB 1IOAA 5A32A 3ST7A 2DUPA 4GH4C 5I0RA 1GQHA 2YROA 3ZIXA 5D1IA 3LSDA 5JOWA 3FWEA 1H0BA 4AYUA 5SV5A 5BYNA 3W21A 5CIRA 5DUUA 1ZA4A 1CQ9A 1GNYA 5I8YA 1V9U1 4IV1A 1EUTA 1PVXA 1OHFA 2YBPA 2QQMA 3QLQA 3ZXKA 2HWF3 1Q5OA 3WDTA 5HI0A 5C5TA 3LWCA 1SLIA 1YEWA 2OZ6A 4B4PA 5IK4A 1X7NA 1GZTA 3B00A 1EV12 4ISRA 1BEV2 1FT9A 4PJYA 1R1A3 1PX3A 2XWJB 4IE4A 4YZ4A 5F39A 3SCGA 5DAPA 4EV0A 2WT2A 4P08A 4D6QA 2K9ZA 1WCDJ 4EQVA 4LBQA 4MLOA 2TEPA 4W65A 1STMA 2GH8A 1BVVA 5A32B 1OVPA 1CIYA 2Q4SA 1TVGA 4D69A 2PHRA 4PDWC 5FREA 1RVF1 4L99A 2WR9A 3SXWA 3AZWA 1UIJA 3ZN5A 5BV6A 2ORZA 4S2FA 3SNMA 1C3HA 4P9LA 5EYXA 3ZR5A 4XAAA 2BQPA 1S4CA 1ND2B 2E9QA 4FPHA 1JU4A 1Q8VA 2Y6JA 2W0XA 3HWJA 2W87A 3N9NA 3T2TA 3VV1A 3KGLA 3VZOA 5A33A 1TME3 1W6PB 3ZYBA 5L7OB 3E5XA 3TEWA 5FZ1A 1OOPC 4IGOA 4PQ9A 4UW6A 4COYA 2CGOA 2WAOA 4CEWC 4I02A 3HNYM 1ZZ8A 4M3CF 2LALA 3CMGA 4OFGA 2EAAA 3O12A 4N8MA 3FUOA 3RNSA 5KHJA 3DGTA 2VOXA 5JPMB 3B93A 1NKGA 1JU3A 5FV3A 3WZ1A 2SLIA 1D4M1 3D0SA 2D40A 4LK7A 1PO21 1PO23 2A6VA 2W5FA 2ZGMA 1G8WA 5I0TA 5LK5A 4Z07A 1NCRB 4AVBA 1Z0HA 2AZ5A 1OQ1A 2P3JA 3R6SA 1ZM1A 1RUI2 4L11A 3SCHA 3I49A 4LLOA 1JYIA 3FHQA 1PK6A 2GNDA 4LBJA 1VBD1 3ZYPA 4CYDA 5C4WB 3I3MA 2KXLA 4LUKA 2HLEA 3E6BA 2P2KA 3A22A 2W1SA 3GDBA 3OGGA 4QKNA 2JKBA 4E2GA 1KGYA 4XMAA 3O1MA 2ZKNA 3MLJA 1VBB1 4LOTA 3VDBA 2OW4A 3ZFEB 3OF1A 1RUD2 2VD7A 4LTAA 4ZKTB 4UFIA 2WIIB 4CA9A 2FCVA 1W2UA 3GZUC 4FFHA 5D8AA 3M1HA 1L7LA 1O5UA 1TNFA 1H1IA 1WW4A 5EV7A 1AR62 1YI9A 4LO8A 3HR9A 3T0BA 3IDEA 4YFZA 1GWMA 5IVVA 1IS3A 1DQ0A 3MI8A 1XNTA 2W95A 1R092 1WZXA 3GHNA 3LA2A 4CU8A 3NAPA 1AUYA 2GDFA 4Q4Y2 3JD73 5IVJA 3QD6A 5F1RA 4UW4A 3POIA 4MSVA 1GKBA 1HN1A 2QVSB 4U36A 2UY8A 2BGCA 2QZ3A 3WP3A 1VBC3 1WW7A 4Q4V1 1ASJ1 4KBZA 4HVOA 2WRAA 1H4GA 3I4IA 4MVTA 2B9VA 5FZ4A 2CU5A 3M3CA 4NAOA 5FZAA 5H9QA 5A80A 1Y7BA 4N7UA 1CZTA 1YO8A 4AOCA 3H8XA 4NROA 4OHWA 1UU4A 2Z42A 4XJWA 3DV8A 1F8VA 1GZCA 2CL2A 1UOBA 5DDJ1 3VHRA 3MF6A 5H9SA 2Y6FA 1G9BA 3ETQA 5FUIA 4OI2A 3RS6A 4YVWA 2WNOA 5CG8A 4NPLA 4E2QA 1JZ6A 4AI9A 1UO9A 4XQ4A 3I59B 5CNAA 1VBA3 1LOAA 4DXSA 1W6MA 2B4KA 2ZZJA 1MVQA 1HB4A 2JDZA 3B7MA 4XFFA 3VZNA 1AYM3 4XXPA 3VBUC 1XE0A 1G86A 1MQTC 3MPBA 5FWEA 1Z78A 4AEDB 4DRRA 2SBAA 4EWEA 5BY5A 2GC2A 4LNVA 2MEV3 3J26N 2RS51 1PVC3 2HYXA 2V72A 4S2GA 5FLIA 4HKOA 5GZCA 2AC1A 4B7EA 1N3OA 4DEQA 2Y0IA 2DCJA 4CDUC 1SLLA 4RGKA 2R063 1UIKA 1W04A 2WS93 3IMMA 2TUNA 4BISA 1C5IA 3AB0A 3DEMA 5AC92 5T3NA 5JCTA 1DZRA 3B01A 5JXJA 1UY2A 1ASJ2 2VMGA 4BQ5A 2XB6C 4CDWA 1QHDA 2YY1A 4IUGA 2ZX1A 1MS3A 4UF0A 3LEGA 1OKOA 1PVC1 2JE7A 1QJX1 4A6OA 4V2WA 4AVSA 1U12A 3PVOA 1VRBA 2D6KA 4YGCA 1UAIA 5FZ3A 1IPJA 2RS31 1CAUA 2PHXA 4YW4A 3WQ0A 4CVUA 5C9AC 2HWC3 3FBYA 1W9YA 4DIQA 3CNAA 4JDOA 3BPSA 3LAGA 4PIYA 4EE2A 5KXCA 2XJPA 1UF2C 1WW6A 4B7KA 4B4RA 2ZBJA 4CP1A 4G4FA 1DQ1A 4HONA 4JQRA 3ZMNA 1RUOA 1O59A 1W9TA 3EYPA 4OI4A 5DAQA 3ACIA 4KH9A 4A2UA 5F6LB 3VBOC 3ZR6A 4CEWA 3ZKUA 3Q8BA 1FAYA 3VBFC 4F83A 1CX4A 3WP4A 3HMYA 3WF0A 3AYDA 5A6ZA 1UYYA 2V4VA 3K51A 1XNKA 5FR3A 2EIGA 1I3HA 2BUKA 2FDJA 5CYYA 5GLWA 1NAEA 3TRSB 4FOWA 1LESA 5EJZB 5F5AA 1S0DA 3MEPA 4NRQA 1S2EA 4GKXA 4NPRA 3BIEA 1T2XA 2ATFA 1PO22 4V2VA 2GALA 1W6NB 4AF9A 5IAXA 4DY3A 3RI8A 3THPA 3WDWA 3GBWA 2VQ0A 2HEWF 2IZWA 4RD7A 4B29A 2VY0A 3FFQA 3VD5A 1LULA 3PUIA 4HETA 2P3IA 1RUH2 3MIDA 4FTEA 1AX1A 4Q1PA 4KMQA 2ZMLA 5EWSA 4MH0E 4OCTA 3RMXA 1VBD3 2D5FA 1VBB2 2DVDA 3BALA 2J1RA 1FNYA 4XEZA 4AEDA 1LJ7A 2CTVA 1W2TA 3T1MA 2P5BA 3BCWA 3VZKA 3DXTA 2YGLA 5DMYA 2ZKLA 3J7HA 2ZX0A 1MEC1 1D4M3 2XLAA 3A0NA 4Y33A 3LOBA 3O1PA 2VZSA 3N4MA 2EICA 5J7MA 2UU8A 2HWD2 1DIWA 1GANA 1LRHA 1NX9A 2D3SA 3ACFA 3AMMA 4M3CB 5LBEA 3FLPA 4URAA 5ACA3 3H8UA 3HBZA 5IVYA 1PIV2 3ECQA 2QFEA 3JQWA 3A0KA 1AR83 1D4VB 1MS4A 4V1PA 1W6QA 1EV11 2PHTA 2RJLA 4FFFA 2NQYA 2V5YA 2AEYA 1QOTA 4DZGA 4H3WA 4UBGA 1VBA1 5LBCA 3T2QA 3CU7A 1QJY3 1Y9QA 3WG1A 2IFRA 3ILNA 5FMCA 4HT1T 1H6YA 3URFA 5FXVA 3C8XA 3NO8A 4WBBA 4BE3A 1ZREA 2QDNA 5FO8B 2IXJA 4FPFA 5FY1A 4NR1A 4QPYA 3UETA 1R083 3Q8CA 4O65A 3KHBA 3BU7A 1XNBA 4OHXA 4ZS2A 2R043 3RJ2X 1VRH1 3ZVXA 2XVGA 4YVWC 4AQSA 3HQUA 4GALA 2BPA2 4AEKA 4GAZA 4IGPA 4KBBA 1C57A 3C3VA 4MGZE 4EJRA 1PM7A 2Y0OA 4QM8A 5C3QA 5F6KA 4IE5A 1QF3A 2ARXA 2FZ1A 1ACCA 1EPZA 2WZR1 1A78A 1WCKA 2RDNA 2XR4A 4R4XA 1ENSA 2XJVA 3WF3A 4LLFA 3RDIA 2E26A 3E6DA 4UAPA 2HWF2 3WINE 4MXVA 4EN6B 4Z2WA 1M06G 1GWLA 4ITCA 3ZN6A 4IEQA 1JHNA 1RJ7A 1LKNA 3Q8AA 5FYIA 4CDWC 5JSRA 1G9AA 5CFDA 4D0QA 2D6PA 1FYUA 3GJAA 3AX4A 4XFGA 1XSRA 2ZA9A 3OGJA 2CWMA 3GZTB 3JXSA 4D7TA 5K9YA 3CQOA 1UMZA 4E27A 5LK7B 3ZDVA 3C7OA 4GJZA 4LO4B 1XYOA 2FDFA 5IJRA 1IQDC 3J8F1 1CD3G 3R4DB 5DZGA 3WV6A 2ZJCA 1JI6A 1IG3A 3IB3A 4IETA 4X8PA 3BKZA 5LWBA 1DZQA 3NMBA 4Z2AA 4FVVA 2VW2A 1BK1A 1UZWA 2GN3A 5F7UA 3AMHA 2JG8A 2XOMA 4PDWB 1W6PA 2BEOA 1Q8PA 3EB7A 3K3NA 4ZPIA 1VBE1 3N7LA 4L97A 5F5CA 4DUWA 4BIFA 3KCYA 4Y3OA 3FN9A 4JGYB 4R52A 1OD3A 3X29B 1YLLA 1QGLA 1ND2A 2JB4A 2WYFA 1NY72 1WWYA 1H2LA 2XG3A 3R05A 3SISA 3UK9A 3VKOA 4ARXA 1YC61 1RUNA 4LBMA 1F31A 2VR4A 5A7QA 3ZFFC 4MX3A 4CPBA 1GZWB 3WF1A 4BA6A 2R6QA 4NE9A 2P6CA 4XUOA 2ENRA 3HN3A 3VDCA 3KVAA 3ZN4A 4A7YA 4YWAA 1HRV1 1X33A 2Q0AA 1H1AA 3AP7A 4PF1A 1COV1 4LBQB 1UZZA 4FI9A 4Q4W2 2WNUB 2IXCA 2YU1A 5KBFA 3U4SA 5L9VA 3POEA 4CU7A 1DFQA 1BZWA 1UZVA 1E5RA 4YZ3A 2BWCA 4Y1UA 1W28A 3APBA 3FX3A 1F5JA 4WVWA 5LA1A 3J8F2 3LFMA 2BBAA 4E8DA 1DLCA 1GOHA 1O4YA 2PLV3 3P6BA 4IE6A 5A1AA 1OQDA 3IPVA 4MOAA 1RHI1 3WW2A 1SLTA 1QJU1 4IV1B 3G7DA 5FZKA 5JIUA 2I2SA 2ZGSA 4NAMA 3LEMA 3NVCA 1HB2A 5FMOS 5FPXA 2W1QA 2VH9A 5FOJB 1MEC2 3M3QA 5JSOA 1ZZBA 1QMJA 2ZZQA 1LOGA 4YARA 2PHLA 1ENQA 3KQ4B 1SDDB 3AKPA 2RR12 4JX0A 4FPYA 4QXHA 2CAUA 4I3GA 4DFSA 1PGL1 4YYOA 2YBKA 2X29A 3S5QA 3NWKA 5A1LA 4RA0A 2JE8A 1BBT1 4BDVB 1KXGA 1NT0A 3K77A 1W8OA 1SPPB 1LECA 1IS5A 1XOYA 4IEYA 2R30A 4LO7A 5JUVA 4XOGA 5F2WA 3VBRB 1VLNA 4RR3B 5JPNB 2IXIA 3I2FA 2UWBA 2X10A 4MG2A 1NYWA 4Q27A 5FBJA 1NOVA 1YQ6A 1X8MA 3MF9A 5KC6A 1UU5A 1C1LA 4XF0A 2F6BA 3HT2A 5CFCA 4PLNA 1ZBA3 1LHOA 4GIQA 2CNAA 1V6NA 4QKFA 4DQAA 1BMV2 2WO2A 4CU9A 4KQ7A 1UY4A 3T2PA 4XJAA 1UYPA 1RHI2 1QJY1 4NN0A 1SLCA 4E4ZA 1ZZ9A 4LKSA 3U14A 5FZFA 4F3JA 4RSUA 2V4AA 1JODA 4RN5A 2BVVA 4RS5B 2XBO1 2VZUA 4QX2A 3TB0A 5IK8A 2AEZA 1QXJA 2HWC2 1PO11 2XUEA 3K4DA 4WM8B 1ODNA 3O0WA 3N7JA 4KWJA 3ALQA 1QEXA 4QT6A 4Q4X2 1AL0G 1PO13 2JICA 3UJOA 2A7AA 2FCTA 1WLTA 3FLTA 3OSDA 3SEEA 3PMEA 3SITA 4BOWA 5JZGC 1JZ5A 1NG0A 3ZFFB 2A3YA 3T3YA 4QPGC 1J3PA 1NCQA 3D6EA 1EUUA 5DG1A 2X09A 3HEIA 4W6YA 1HLCA 4TLGA 3RQ0A 1N3PA 2R062 4XUQA 3J7MA 1LTEA 2WNVA 3ZMOA 2HEVF 1OH4A 5F32A 5FCCA 1ZYBA 4UFHA 3VBOB 1D7PM 2EF6A 3DYMA 4HPKA 5DUXA 4AFCA 1LU2A 4IXLA 4COZA 5I0SA 2WKKA 4ONUA 3PUHA 3B69A 1AZDA 4XPVA 2VZVA 5JVVA 1A8DA 4NMIA 4AG4A 2CWSA 1WA4A 4UFJA 1F9KA 4XDPA 1BMV1 4LBOA 4E2SA 2I07B 4KI5M 2GMEA 2ZEZA 4FTBA 1OMIA 1UOJA 3G6JB 1NA1B 1E5HA 3EJKA 1QOSA 1XBFA 5C8WA 4CE8A 1RINA 3K48A 3O1UA 2E7TA 1V6MA 3ZXGA 2ZHNA 4QX5A 1RUG1 4ES8A 1F4AA 1NXD1 3OGRA 3JB4C 2DUQA 4OHYA 2B45X 4HFSA 4Y20B 5E89A 3QH6A 3CHXA 2A6XA 1REDA 1NLRA 1YJLA 5DAWA 5JI7A 5A7OA 4CTEA 3DPRA 5C70A 3JD71 1PGW1 4QQLA 5ABJA 4KU8A 1UU6A 4KL1A 4HVRA 1PIV1 3MGUA 4WVMB 1E5IA 1AR71 2VCMA 3WP5A 1AXZA 3SMHA 4P9JA 3I3BA 1POQA 1L3JA 2PHFA 1TG7A 4K6BA 5GM0A 1AR92 5J09A 2XL7A 4NJ4A 4N7IA 3BI3A 3WUCA 3PNAA 4HXCA 2JJ6A 4ASLA 1PGL2 2DDUA 2JIJA 2J1SA 1ZRIA 5FZ9A 2D6LX 2RS33 3UT0A 3ZSEA 2W2IA 3DF0A 5EYYA 1O91A 4B1MA 3TNPB 4AGVA 1K5MC 3V0AA 3LCPA 3VDDB 2WO3A 2PAMA 5C8CA 4IW3A 3OOXA 5FLHA 4CCEA 2JG9B 2ZGOA 2PQSA 3R4SA 3K4AA 4HSJA 5FMDA 4BQ2A 3RZZA 4S2DA 2BP6A 2E53A 1SHWB 3GF6A 2C24A 2P3KA 2R32A 3RWNA 1W8FA 1HV0A 4R4ZA 2A5ZA 1XNAA 3NL1A 1GYKA 3KCXA 3W9AA 5AFEA 4QHZA 2YDEA 3Q9OA 4MYEA 3GHMA 4Y5TA 5J37A 4QPIB 3OUHA 4TZDA 1GQPA 1ULPA 2KA3A 2A6ZA 4FPKA 2NMOA 4F7ZA 1R093 1R091 4MZUA 3ZLIA 3V64A 3AM2A 5DXDA 3AL6A 2HWD3 2P4EA 2WFF2 4JC1A 4XFHA 3W5MA 3WQ1A 2DTWA 1AYM1 1XE8A 1NZCA 5FY5A 4XF3A 2X53S 4XF1A 2RG4A 1K3IA 3LB9A 3S30A 4H2AA 3DUIA 4FPOB 4DMIA 5JAXA 5B2GB 3JBG1 2C1FA 3ZOIA 4EZHA 2VNGA 1S0FA 2VVDA 2VQTA 3ACGA 1MQTA 3JQXA 3LIHA 3N35A 4UW3A 4WVVA 3CL1A 3NNFA 3WNLA 1ULOA 4E4SA 2VW0A 3NNGA 2BBVA 1SBEA 2LTNA 3OYWA 4N9IA 1OC1A 2AREA 1O5LA 3AVSA 3KV4A 4Q29A 3LIGA 4QKBA 4QPGB 3WDYA 4AFDA 2PHUA 4GD4A 3O0VA 5EFUA 2W9XA 3L2YA 4BMBA 3PTYA 5AC91 5BNNC 3H8OA 3A23A 4X6QB 3FC0A 4AQ6A 3FUQA 3ZFGB 1N47A 2GNTA 3R4UA 1CJDA 1UMHA 5IVFA 2XPJA 2C26A 1DF0A 1BHGA 1R1A1 1NCRC 1N3QA 5EJ1B 3IAQA 5T52A 4XFBA 1FXZA 4MXWA 2H0VA 2XXZA 5IUQA 4IE7A 5EJ3A 4Y26A 2Y34A 4Q4X3 1WCSA 2QCSB 2D5HA 1SFYA 1CONA 4P5YA 3V65A 5FOBB 2VTXJ 1LGBA 5LY2A 1YFXA 1RUE1 2D6MA 1RUE3 5D2AA 3RFRA 4CSWA 3MDPA 5AC93 4N43B 3BN6A 3ZXAC 1JH5A 2R071 5FQ0A 1I9RA 1FOD3 2UURA 3WQBA 4DUXA 5ISLA 4AI8A 1OLME 2WAAA 1AJKA 4KNCA 4B8EA 4N90A 4AI3A 1GU3A 2HYKA 3MW2A 1LGCA 3J7NA 4LHNA 1W99A 3KF5A 1K5MB 2CY6A 1GWKA 5I91A 4CXYA 2LROA 3H3UA 3RZKA 3KHCA 3AP9A 3ACHA 2ZGPA 1O6UA 5E1RA 5FZLA 4AGGA 4RQPB 2ZABA 1JYCA 3OCPA 3LDRA 3PU3A 1FPN1 1VJ2A 3C7HA 4MGQA 3VBHA 3W20A 1CAVA 1NE4A 1YHFA 4J1XA 1JBCA 5LB6A 4GH4A 4PQQA 2G4IA 1H4HA 1CJPA 1SACA 4IQPA 4XFCA 5CG9A 1U5YA 2GN7A 1PGW2 3FMGA 5C3RA 3ABZA 3VD7A 5CBLA 1TE1B 1V6OA 5JSPA 3OPTA 1FOD2 2VZQA 4TN7A 3D82A 3JZVA 2DWRA 1AX0A 1QU0A 4ZU7A 1BBT2 3LA7A 4PIZA 5K0UA 3V0BA 2EA7A 1B09A 1MZ5A 3H3LA 3LEKA 2KM2A 5BNOA 1MZFA 1OXCA 2ES3A 5IFTA 3VBUB 3O7OA 4GB33 4QAWA 3VBSA 3JB8A 5BNPB 1EAH3 4W8JA 4BQ1A 5C8CC 2BWAA 4XTPA 1RUI3 2VMHA 5F3CA 4GMP0 1XU1A 4KU7A 5FWJA 2NLRA 4C1WA 4YG0A 4CUBA 2ZHMA 1TME1 5LY1A 5KWRA 1VIWB 1OLMA 1X50A 5IK7A 1MS5A 3UNPA 4C1XA 1E5SA 2WT1A 2VJXA 5J96B 2DU1A 1A6CA 2Y60A 2WJSA 4URTA 3QH7A 4XMIA 1L7QA 5E6HA 2VBBA 5FKBA 2D97A 1OA2A 4K8FA 2OT7A 1SG3A 4YM0A 4EN9B 5APAA 4A3XA 1AYN2 2LW8A 4ET7A 5L73A 3CF6E 1ND2C 3HIFA 4R9BA 4CEYC 4HLTA 1H8TC 2VAUA 2ETEA 2WSUA 2BNOA 3ZIWA 1HXS3 1OOPA 4GQ7A 3WR0A 1BK0A 1OSGA 2J22A 1LOFA 2BGPA 2XHKA 4JGZB 3EQEA 2VO5A 2B46X 5FPUA 1W8NA 4PI0A 5IATA 4MUVA 3UKTA 2ZTNA 5JLVA 5G05L 1OA3A 5CKQA 3L9JT 4OI0A 3I2JA 1QQP3 4YZ5A 3PJYA 2YB7A 4IEVA 1OFSA 4EROA 3RGBA 1DQ4A 2R16A 1RGSA 4IE0A 2OQ6A 2WQ8A 4LORA 1IKQA 1BJQA 1DGLA 4CCCA 2J1VA 5J3UA 5KR7A 4RGAA 1JZ3A 5A3WA 1QDCA 4FSJA 4H7LA 1CVNA 2VOVA 5KXDA 4FT8A 4PHZA 4R8HA 4I30A 1XNDA 4NHLA 3I8TA 5G04L 3VKMA 5F8PA 2QQWA 3TNQA 2UWAA 2W08A 3HD8B 4LKFA 3VGIA 5GLVA 2XKOA 5C71A 1Y3TA 3T4HB 3PTRB 1RMU2 5ERLA 2WLQA 1QNYA 2VL4A 3NJZA 2VOTA 3VBRC 5FLJA 2VUAA 1UY0A 4TXWA 4FPJA 1TNRA 5A7SA 4P02B 2VZRA 1IG0A 1W3VA 3C7FA 1S0IA 4KWKA 2DCZA 4XCBA 4MADA 5C33A 4CUGA 3T08A 2Z79A 5KHGA 4Q0QA 4WM7B 3S5AA 2F17A 4MGIE 1X82A 1DZTA 1VBC2 2D44A 4CP9B 5L9RA 5JXIA 1HIXA 2Q1ZB 1HRV3 1CN1A 3VHNA 1F4HA 1ONAA 2XJUA 2JE9A 5FY0A 5DN2A 2PMWB 2YC0A 4K1YA 5CB7A 4BCUA 1KQRA 2WC2A 1F35A 1WCUA 2DVFA 3ZFEC 5I93A 2V73A 3B9IA 1C5HA 1VR3A 4JDMA 2JDYA 2VGDA 2R49A 2DURA 1ZBA1 3H1MA 4C0BA 3BYWA 1KDMA 3TEXA 1IGOA 3GZEA 1FV2A 1WD3A 1CX1A 1PNGA 1LENA 4LULA 1K5JA 1X9PA 1XYNA 2CYFA 1EPWA 2AENA 4XYXA 3ZO0B 1HDKA 1VE0A 2OZJA 5FKCA 3WG2A 2WZ8A 2VECA 4C91A 3LSEA 1W06A 4M00A 2PFWA 4AFAA 4FFGA 1WD4A 3WW3A 3FHAA 1KS4A 2ZX2A 5T55A 3P3PA 2PXJA 5FMOL 2HJIA 1YIPA 1KD7A 3MPPG 1SFPA 5A7PA 1PK6C 2ET1A 3EMRA 5K4LA 1GP5A 3M4FA 2WBKA 5GZGA 2QTWB 1MS8A 4Z92B 4YGBA 3HQXA 1NCQC 3SH3A 3IT8A 3U0ZA 3H42B 1N1TA 1SMVA 3PUSA 1G7YA 2VVFA 2XWBB 2Q1FA 4JHTA 3VL8A 1EAH2 1V9U3 3M3EA 1AXKA 2VNOA 1V9U2 1MS9A 2W68A 1H6XA 2IFWA 4FQZA 5GJ6A 3WLUA 1OKQA 1JYNA 4OUMA 4M3CE 4KGGA 5FPLA 5M0TA 4YSFA 4BQ3A 2YGMA 1WCQA 3WSOA 3WG3A 4Q26A 4XXAA 3NKTA 5FXZA 1UOFA 5FXWA 2G9ZA 1LHUA 1M4WA 3ZYRA 2BV4A 1QJU2 4IV3B 2YZ4A 1COV3 4JGZA 3WW4A 5HXVA 5LRRA 1LCLA 1R081 3JU9A 2QDRA 4LIUA 5FJKA 5FK8A 2B7YA 4N53C 1H8TA 4PI2A 1O8PA 3IMNA 4XAEA 3W58A 1A34A 2LM3A 1OURA 3MIBA 3MIFA 1UYZA 3CIHA 3M8LA 4UW5A 1V6JA 3BU0A 2QKDA 4C8DA 1Q8QA 1S0JA 4CCMA 5CFCC 1CZVA 4CU6A 5DPNA 4RHV3 3O1VA 4LE3A 4GA9A 4BHPA 2YPJA 2Y6KA 5JXGA 1DCSA 4MGSA 2JDNA 4PBOA 5FPAA 3UESA 5FDBA 4UXAA 2V5DA 1OF4A 3ZDSA 4AZZA 4EYUA 5ACA2 4PLMA 3VD3A 4HVQA 1DYPA 4FFIA 4TTGA 1E57A 2G1MA 2RS32 2W1WA 5E16A 3VHOA 4BB3A 5A1FA 5FYUA 4BIOA 4FCAA 2BW8A 4XC9A 1OT5A 2YG0A 1UQXA 2VOWA 4BH9A 4YNIA 3PVEA 4AGRA 1O8SA 3MBWA 4MHRA 2J1AA 5FTTC 4DUVA 1MEC3 5DUWA 1JZ2A 2VMCA 1HRV2 4LUMA 1YFWA 1LHNA 4U2AA 4Y5Z0 1G9DA 2ARAA 4ZU4A 1KFXL 5LA9A 5E8AA 1OF3A 2ZMNA 4HN1A 4CDUA 2IUWA 2CGNA 3NW4A 3RI9A 1W6OA 5DZFA 5C9AB 1IPSA 2WNUC 1DYOA 4GH4B 1WUVA 1WBLA 2WL1A 4JRLA 5LBFA 1F15A 1W8UA 4D94A 2XLFA 2XJSA 1I5PA 1UXXX 3RZLA 2VXRA 1V00A 3AVRA 4BJ0A 1K42A 3S7EA 4NWWA 1CR7A 2VPVA 1Y4WA 4ORFA 5FZEA 3UYJA 1J59A 1RIRA 1OLRA 2EIDA 2WYSA 4GKYA 4ZZ8A 2J1UA 3EHKA 4AQTA 2WQ4A 4QM9A 4HK9A 1NXMA 2QBXA 5DG2A 4RR3C 2UYAA 1D2SA 4RQPC 2B5HA 3ZYJB 5C3PA 3PMSA 1C8M1 2JDMA 2QUOA 1AL21 2IXKA 2PYTA 2JDUA 2VULA 1ZZ7A 2ET7A 1GOGA 1CAXB 3DPRC 3NJXA 4LK6A 3MZHA 1RHI3 2IC1A 5FIXA 5I0UA 4CEYB 2EAKA 3LF7A 2PLV1 5LASA 3RZGA 5LW9A 2DCKA 4R9AA 3RSJA 4LO6B 5BNNA 4LKDA 2JB8A 4A4AA 3L2HA 1RITA 1ND3A 4XDOA 2P37A 3I3EA 3NJVA 3OY8B 4Q0VA 4ZU5A 4MXWB 4YVSC 3WOGA 4CDQC 2GP3A 2VU9A 3I2OA 2JDAA 2ZEYA 1UXZA 2JWPA 4JAAA 1BVP1 4QQHA 5C6CA 2Q30A 5A6YA 4OQ8A 5D21A 3VBFA 3K46A 3KT1A 4I09A 1UX7A 4PIXA 3IWZA 4YZ2A 4FTSA 1HV1A 2HWB1 3USSA 4AQ2A 5IFPA 3K2OA 1R1ZA 3D4KA 2X5IA 1B35C 5LATA 4XBQA 3OYWB 3P3NA 1GP4A 4BQYA 4W4ZA 1AR91 1LEMA 4XHBA 5CFDC 3LE0A 1NQDA 4XF4A 3O14A 4L8QA 2VNRA 1LAJA 4Q0UA 1DBNA 3KLSA 3PVBB 1RUJ2 3BPZA 1TEIA 3CKHA 4HSLA 2ORXA 1PZ7A 3PIJA 5JDBA 3LPGA 3MLLA 3POYA 1HW5A 3AYCA 3CJIA 1X9TA 5T54A 2RM21 3KT7A 2MNGA 1IPKA 2Q5TA 3SQOA 2PLV2 3IDCB 3MUY1 4N53B 3N9QA 4Y22B 1AXYA 1HXS1 5A7WA 2R0HA 2RV9A 4AEDC 2OXBA 1XPWA 4GWIA 3AZYA 4AHXA 5CADA 3AMNA 2CAVA 2WSVA 4QDQA 5JOXA 1NQJA 4P9IA 5FZBA 2DF7A 4K8RB 4RS5C 5HCBA 2RS13 3WVJA 1RVF3 4N53A 4Y22A 3FZ3A 4UYBA 2HBUA 1WKYA 2JG9A 2VBDA 3N36A 5FY8A 4A42A 3H1YA 4AWDA 4D7SA 2A1XA 3OTFA 4QHOA 5K0UC 4FPLA 4PLOA 3J9SA 1OQEA 3WT3A 2NPIA 2ZGUA 3U78A 1AR82 4UI9L 3WX5A 3LDKA 4OHVA 4QXCA 2CSGA 3HN1A 4A7ZA 1UD1A 4K7JA 1J3QA 4FXGB 3ZYHA 1NLSA 2ADDA 1JW6A 3KMHA 4CDUB 3MYXA 2R041 2HWF1 4BXSV 3ZPYA 1SCSA 2ZGRA 1RUG3 1ZVFA 2BTVC 3BTXA 5FYCA 3B94A 3OUJA 2VUCA 4DOUA 2XH6A 3UGFA 5A3PA 3VL9A 4ZHNA 1VBB3 5L19A 2UWCA 4B3NA 5BNPC 3VBFB 2A73B 2XL9A 2KD7A 2W46A 2BOIA 3H1WA 1C8NA 1RUC3 2OX0A 1CAWA 4Q1RA 3DL3A 4Q5OA 4Y20A 3ZXFA 4JKLA 1JOPA 4XETA 1Z7S1 1ND3B 1MS1A 1HN0A 4LA3A 5BNNB 2EXJA 1LHWA 4HZFA 1NA1A 1QQP2 4Q4W1 3ATGA 3WW1A 1UKRA 1CAXA 2FDHA 1RUE2 1JZ8A 4M01A 2QQOA 2VZOA 1GOFA 3LKJA 1POV1 1Q43A 4YW1A 3VKLA 4NOTA 3WDVA 2ID4A 5FYYA 1PO12 4AXOA 1FMD2 3WG4A 3MW3A 5C7GA 1JZ7A 4QQOA 1H8TB 1FMD3 5F3EA 1HRI3 4OUEA 4QXBA 1W2OA 5FFOC 1IS6A 1US2A 5IYYA 3Q8FA 1GUIA 1J1TA 5LEKA 1JMUB 1UMIA 1SDWA 1GSLA 1GNHA 2JKXA 3B02A 4JTNA 5KHIA 2QQIA 4TLFA 4BLJA 3IIIA 4QPWA 1NCQB 2XDVA 4K21A 2AR6A 3ZFFA 2QQNA 5J98B 2VTXA 3ENRA 2BDRA 2C5DA 4SBVA 1A8MA 4Q4Y1 5BNOC 2BYVE 4CCDA 3C7EA 1XB9A 4LQRA 4Y5SA 4DO0A 1Y43B 5FUNA 3VKNA 1UWWA 2EVXA 1JN2P 4L0PA 5C9AA 1W6OB 2HBTA 2OUJA 1ND3C 1S1AA 5LBBA 3M2MA 1TME2 3OBAA 5FZCA 1MS0A 4FQ4A 5CA6A 1BKZA 1K12A 1S0GA 2RJ2A 5FZOB 3N3HA 3S57A 2XVLA 1SLAA 1ULGA 3SKJE 1AYN1 5DAXA 5FYBA 5FO7B 2YMZA 2KR2A 3POFA 4NPMA 5FP3A 4PCRA 5C4WC 1W9FA 2DV9A 3K3OA 2VUDA 1DYKA 5DDJ2 3U75A 1YQ5A 1XE7A 1EP0A 4UWDA 3VHPA 3JBG3 2PN5A 2D7FA 5BPXA 4DRVA 1Q8SA 4JKKA 2L9LA 1AR93 1ZBE1 1UOGA 2VUJA 2NP0A 1LB2A 3E97A 3DYOA 3CJXA 4A41A 2BNMA 3N9PA 4YGDA 1YI7A 2LS6A 2YPDA 3D3AA 1LOFC 1AR72 1SPPA 1V6IA 2VBPA 2HWC1 4INDA 4ZONA 3M70A 4E4DX 1KEXA 3OPWA 2ZGQA 4FOQA 4FP2A 5HBAA 1AHSA 5T5PA 4AHWA 1PM4A 3LFIA 3VB9A 3TOJA 3H9AA 2G9GA 1JYWA 3RG0A 1RUC1 2ARCA 4DXTA 3B5LB 5KXBA 5HCAA 1DQ2A 4RFT0 3OEBA 1COV2 2PELA 5D8AC 1J1LA 1D4M2 2DFCA 4GMP3 1GV9A 1YYNA 2R1BA 1J3RA 1DQ6A 3I2KA 4Q4W3 4CP9A 3RMYA 4IV3A 4TWTA 1FX5A 5IT6A 4O9GA 2OYZA 2A3WA 3MHZA 1FPN2 5B4NA 1YFUA 2IXHA 3NAPC 4Z8BA 1D0HA 3WDUA 3RZMA 4FPGA 3ILRA 2BERA 5JWPA 5BUVA 2JIGA 3IN9A 3MIHA 3J4UH 3N9OA 3WCSA 4B1LA 2CDPA 4JZRA 3LA3A 2QQJA 5TSWA 4AHYA 2Y6LA 5F5IA 3WNNA 1QH7A 2GNBA 4CRQA 1C4RA 4R9CA 1FOD1 3FBMA 4HN0A 4IEXA 3VKFC 3FFZA 1PZ9A 1ZBE3 1PMIA 2DBNA 3DYPA 1VRH2 1ZBE2 4IEOA 2YC2A 4RL7A 2J1EA 2VCCA 5FYMA 2W91A 1AL23 3LEIA 1OUSA 3GZAA 1ZRRA 1DGRN 4JVAA 1ZBA2 2IVJA 2RS11 3E5UA 2AYHA 2ZMKA 2R7EB 2O14A 2WZR2 3CBNA 1BCXA 4PF5A 3RZJA 4AW7A 2VXJA 4AL9A 2PQQA 3E6CC 1AYN3 2ZEWA 3NV3A 5H9PA 3PLQA 4OQ9A 1Q8OA 4CXXA 3VDAA 4JGYA 2E33A 3O5SA 1UYXA 2JENA 4Q4V2 1MVEA 3WNOA 3BB6A 4XIKA 5FZDA 2ZCWA 4QDSA 3KV9A 2NYYA 4QPIC 2JG8B 2FDGA 1ULEA 3GM8A 4W6WA 1HQLA 2O8OA 1MZ6A 4P00B 3A21A 3SCFA 2QZ2A 3BUCA 2B9UA 4AVVA 1O3SA 4MO3M 1S0EA 4K20A 2MEV2 1A3KA 2AUYA 2WZPP 4AFBA 1MR5A 2WA3A 4LO5B 1HRI2 1QJY2 4IESA 4QKDA 1RUH1 3O1TA 4BXFA 1X36A 1NUKA 3S7IA 2J7MA 4FP3A 1MZEA 2FQPA 3BTYA 4IV1C 4XZPA 3FJSA 3SC7X 3KSCA 1RUJ1 3UJQA 3W5NA 2ZAAA 4IDZA 1JOBA 1J83A 1YIFA 3VLBB 1SFNA 1LHVA 2VQAA 2WS92 2A71A 3GALA 3T2OA 2JD4A 3OPZA 4E8CA 3MIEA 4QD2A 2HWD1 1HQNA 3A4UA 5ABJC 2FZ2A 1GZ9A 3ZSKA 2FMDA 1QH6A 5GZEA 4NUBA 1Q3EA 1SQ4A 1TQ5A 3IAPA 1ZX5A 3OBTA 3THDA 1YQ8A 2ZPXA 2B39A 2D93A 1S55A 3B3QE 4J6GA 1AYM2 2HWE1 2TNFA 3V0BB 5FZOA 2E63A 2JG8C 3KVBA 2JXAA 1VAMA 2JDPA 1VBE3 4D8MA 1EV13 4JGZC 2Y8KA 1ULCA 1AR81 5DDJ3 4NIGA 3SEPA 1PX4A 3IBMA 4ZXKA 2ZGKA 2F4LA 2IVIB 3I3QA 4K40A 4QHBA 3VBHB 2GU9A 3OUIA 3PUQA 4BWOA 4BK4A 4KG0A 5A3TA 5T50A 1VBC1 2JX9A 1XNCA 2HKXA 2XJTA 3TAYA 2MHFA 1QJFA 5EXOA 1TMF2 4CCKA 1AR73 5GZFA 2EIEA 1K5MA 2YYOA 1PMJX 3PVNA 4COUA 1XU2A 4ES9A 2PTMA 2RDSA 5SV8A 2OUHA 3IDAA 3CEWA 4L2NA 4O9EA 2XQXA 5F3IA 1RUH3 1PNFA 2N7GA 4M0HA 2WT0A 5FQ0B 1U0AA 4LOSA 4P9XA 4N43A 3RYRA 1IKPA 4UOJA 4XFIA 4META 4XE9A 4XBLA 4FBFA 1ZA7A 2O0OA 5IW0A 1T6BX 1WMFA 2RM23 3ME2A 4XZUG 1RUD3 3HT1A 5GKAC 4AHZA 1URXA 2R072 2ILMA 3FE5A 2K2SA 1HXS2 3NV4A 2YHJA 1J58A 5T5OA 1UPIA 3BIWE 2CGPA 2EXIA 2EXHA 3IKWA 3GJBA 4IV3C 1CAWB 1Y9MA 1HJGA 3P5BA 4CCJA 2DUOA 2J1TA 3AKSA 4OYUA 4X8NA 3BOWA 1W8ZA 4NHMA 3VBSC 4JTOA 1UKGA 3T09A 5JMOA 3RWKX 2OIIA 3AJYA 5L9BA 1PMHX 2E6VA 2OPKA 5BNOB 4Z1VA 3AKRA 4UT5A 1JUHA 2GH2A 1ODMA 2W39A 3TBDA 1QJU3 4XJ8A 3CZJA 5KXEA 1DG6A 2RDRA 3AP6A 2A3XA 2C4XA 4AFMA 2D3PA 2DU0A 2RS52 4EN0A 1VMFA 2OPWA 1ULDA 2AGSA 2NZ9A 1CAVB 1O7FA 2VW1A 3HOBA 5FZ8A 3VZLA 3AKTA 2ARBA 4MGKE 4RQPA 2BOJA 4Q8KA 2BFUS 1AR61 3DKQA 1OI6A 1R082 3T1LA 4Z82A 1VBA2 3QCWA 1OLQA 1AF9A 4LHSA 4Y24A 4SLIA 4AAXA 1YRZA 2XKPA 4GMP1 3IDBB 3MW4A 2P3YA 4GZ9A 4QPIA 4OZXA 1WLWA 3KZ4C 1PVC2 5BNQA 4YZ1A 4UBHA 3TEZA 1BEV1 4UF0B 1GBGA 2Z69A 4QWNA 5A7WB 2DFBA 2W3JA 4UFLA 4NWVA 3NNJA 4NO4A 1SEFA 1U5ZA 4IL7A 1JYTA 2P6HA 4QU1A 1RUD1 2CDOA 1W8WA 4MHUA 3S0MA 1SZBA 3CJIB 5FO9B 2VTFA 2R0FA 1W0NA 3MIGA 5C8CB 1YJKA 1R1A2 3MV11 3MV01 3V0AB 1XJAA 1BBT3 2XUMA 3GNEA 4Y1YA 3NKGA 4H14A 2D6OX 3N7KA 4BLIA 4EWDA 1QXPA 2GP5A 2WNVC 2WN2A 3PHMA 4BYYA 5LCWL 4OULA 5FZHA 4FOVA 1UN1A 2C9KA 5J1XA 1W39A 3ORJA 3AK0A 1FATA 2OVUA 2LUWA 2VCBA 4YW3A 3VBHC 4CCNA 1X8EA 1APNA 1JTZX 1QKQA 3PURA 5L36A 1EY2A 1XXNA 5BXXA 1H1MA 1KFUL 1VP6A 2Y64A 4LBNA 2X5IB 2VMDA 4XVHA 3ROUA 4CCLA 3K4ZA 1ZZ6A 4W50A 4WVMA 3TWIA 2BU9A 5FYVA 4NHXA 4JQTA 3TN93 3VZJA 4OI1A 4AVTA 1S2BA 2DVAA 3I59A 4BQ4A 1T6GC 5FYZA 2ZHKA 4XUPA 4AVCA 2P34A 2E7QA 1MQTB 4Y1XA 4DEVA 5JR7B 2W94A 4XACA 3OY8A 4YW6A 4P9YA 3RYKA 1IZ3A 4YW5A 3GXUA 3PUAA 5EP9A 1J84A 3HBKA 1AR63 1TMF1 2WFF3 4CEYA 2D6NA 1W0OA 2XONA 2EXKA 3WHUA 1KRIA 3LDBA 4KG8A 4QB6A 3N9LA 4B4QA 2ZS6B 3E1F1 3I2DA 1TZOA 5LRSA 1DLLA 3NAPB 2X05A 3WNPA 5C3OA 2BZDA 4S2HA 2FHRA 1I5ZA 2W52A 1CIWA 2FBEA 1EAH1 4HK8A 4JHZA 2XBO3 3VBOA 3PJQA 5FYTA 5CKNA 5K8SA 4KWUA 5EPAA 1RUF2 1G9CA 4WM7C 4JKMA 2FDKA 3POBA 5D8AB 5JI9A 3M7AA 5DUVA 3DCQA 3AJZA 3AMQA 1PZ8A 2WZEA 2VVEA 2R061 2BNNA 1CPNA 1QJEA 4GWJA 4XILA 3VDDA 5F37A 1W3XA 2GNMA 4O61A 4BU2A 3QBQA 5CKMA 5F2SA 5KHKA 1FV3A 5C4WA 4FXKB 4LBQD 4WM8A 4ZXEA 4LBLA 3UL2A 4LPLA 3R0RA 4GB32 1DDLA 3HVDA 3SHRA 4W6XA 2NM1A 3BGAA 4NRPA 2V09A 4R9DA 3S6PA 2XQRA 3KGZA 2R042 4XABA 5FXXA 5JMCA 1BQPA 3ZSLA 3MFCA 1LOCA 3J8F3 3VUOA 1HX6A 4YG3A 3OG2A 2D43A 1H9WA 4H7MA 5FMBA 4DB5A 3DPRB 1RTVA 4OMDA 2XMLA 4AK3A 5HPOA 1SBDA 4QQ2A 3H0OA 4CZSA 5LA0A 4DXRA 2G19A 3NQHA 4XF9A 4BMEA 4CDXC 5A33B 1OPMA 3I2HA 3VBRA 1Z7S2 2QJVA 4E4HA 3NNMA 4JRAA 2HWE2 1XQNA 3KQRA 1GNZA 1WW5A 1JUIA 1BEV3 2K46A 4LE4A 5CISA 1KS5A 2JEMA 3ZPOA 3ZXDA 4XW3A 1L7RA 2FMYA 3ZSJA 5IWFA 1PHMA 1PIV3 2P1BA 4XJZA 1ENXA 3PU8A 2YV8A 3I97A 2ZGNA 5FY4A 3U37A 3M3OA 1QJX3 1O3TA 1FMD1 3KWVA 4HPKB 2VZPA 4FO9A 4HOOA 2OA2A 4P9GA 4YLZA 4OUSA 3NV2A 1DQ5A 4HANA 2FDIA 1HB3A 2Z5WA 1WGPA 1NLQA 2YC4A 1XC6A 4XJ9A 2BVBA 1VAVA 1UZ0A 4LMFA 3WNMA 2VM9A 3VZMA 1BYHA 1ZRFA 1W05A 3U11A 2B8MA 3TEYA 4H55A 2EIBA 4PT6A 4OLLA 1CZSA 1YUDA 3AP4A 5JOZA 4IEUA 4JV4A 1UW8A 3AYEA 2Z2SB 1Q56A 3ZM8A 5IK5A 2PHDA 3H3ZA 4QB2A 4KGQA 5GLTA 4FOYA 4A44A 4AI2A 3UKVA 2H6CA 1V0AA 1V6KA 3RJRA 3AZXA 2A70A 5JR2A 1W90A 1HKDA 5A3UA 4EZ4A 3I7DA 5ACA1 3AXDA 4QGNA 5EZWA 2W47A 1QDOA 4P14A 3POWA 5FY7A 2VE1A 2WO1A 1UL9A 2ZAHA 1F5FA 1H9PA 1RMU1 1ZRCA 1QWRA 3SH5A 4Q8LA 5K7PA 4QXKA 5CFCB 1QOOA 4LHKA 1GMMA 2G9FA 4GJYA 3VN4A 4A7KA 1PGSA 1DGWA 1G6NA 2R073 1I1EA 5FY9A 4YM3A 1W2NA 4RR3A 3ASIA 3USUB 2Y38A 3BODA 3WD5A 4C90A 2ZEXA 5EQUA 4GULA 5JIAA 1IHMA 3FL7A 4BPZA 2RJKA 5DZEA 2HEYF 5FYHA 2C0ZA 3FLRA 3AKQA 2DBIA 2QQLA 2VQUA 2WUHA 4NIAA 4FAGA 1W2AX 1AX2A 4AEJA 1VMHA 3SKVA 1GQGA 5L7OC 3LGRA 2ZGLA 2NMNA 4PBPA 3C2UA 1S0CA 4CDXB 1DHKB 1VMJA 4WV8A 5C3SA 4K9SA 4NIDA 3RVHA 3MFAA 3WNXA 2Y6GA 4I2OA 2YXSA 2RS12 3VDDC 3OB8A 2RM22 4Q4X1 2LRPA 4MGYE 4WM7A 1I6XA 2GC0A 1F2NA 2JECA 2RE9A 4ISQA 3HNBM 4ZS3A 3HQRA 1WLDA 3IPVB 1KJLA 1XRUA 3WP6A 4D6RA 4EN7B 4BM8A 1GR3A 5FZMA 1RMU3 4HL0A 1OUXA 5FP8A 3U1XA 2RR13 1YNAA 3H50A 1POV3 3C7GA 4GB31 2VCAA 3O1RA 3NSTA 4LBKA 5A6QA 4ATEA 3BTZA 2HWE3 3ZXLA 4TSVA 5B4XA 4JCKA 4LR4A 2WNUA 1U5XA 1LNSA 3POSA 3AXEA 1D0GA 1RUI1 1S2KA 2PAEA 3B9CA 4LXLA 4ASMB 4EWAA 1QY4A 1OFNA 4QQPA 2OS2A 1H8VA 4QMAA 3ZKYA 1GZWA 3AYAA 2ADEA 4NVPA 4A6SA 4HKLA 4QU2A 4WVZA 4QGLA 3GCWA 4O7XA 5EHDA 2IWGB 2QQVA 1H30A 1C8M2 1JZ4A 5DQ0A 5FZ0A 3PDQA 3PL0A 2WABA 3KM5A 3RRDA 3H8RA 1WMEA 1DGWX 4BQWA 2WWSA 3AMPA 1KITA 4WZCA 3N7MA 4XCAA 4YRDA 3U4XA 1W6QB 3NNLA 1D2QA 1KDKA 4PDWA 4Q0SA 5F5QA 5GALA 2K0GA 2P17A 1Z7S3 5T5JA 1HB1A 2RHPA 4CDQB 1OOPB 2RS53 4JDNA 3ZYGA 3UV9A 4BQXA 3JD72 4M3CA 2XLGA 4DPNA 2VOKA 1W0PA 3E5QA 1WLCA 2GMPA 4DY5A 2VMFA 3T0AA 2E31A 4P5HA 1JHJA 2DTYA 2DVBA 2H6BA 2PAKA 5IVBA 3GBGA 5A7NA 3RYPA 4COVA 4YVSA 1GP6A 1CPMA 1RL3A 2AH2A 4X6RB 5I8SA 3KB5A 5CFDB 3BTAA 4RYDA 2VC9A 2BRTA 2E32A 3ZXJA 3ZN6B 3NRUA 1YFYA 1LOEA 3BVCA 5J48A 2Y6HA 3QACA 1REFA 3IIAA 4XDQA 5FP9A 3LQCA 1CWPA 4OZOA 4Q0PA 1FI2A 2RVAA 1B35A 2WFPA 3NJYA 2UY9A 4OMCA 3VBSB 4ASKA 1ASJ3 5A3MA 4P9WA 5BNPA 2YU2A 3VBUA 3GYDA 3UGHA 2UYBA 1W6NA 4EN8B 4AAPA 5ANNA 1OPOA 4HBNA 5KHHA 2A75A 4QGMA 1OH3A 1UY1A 4N9HA 1QJX2 2DYCA 3HAGA 3NV1A 5K0UB 3OJBA 2GC1A 3T0DA 1O4TA 3WXPA 3P1IA 1MACA 2D3RA 2WN3A 2WA4A 4K3UA 1V6LA 1RUF3 2ZXQA 4NIIA 3HNMA 3CJIC 4CUAA 4MV2A 4UFMA 5E88A 3WF2A 4CP0A 3THCA 1Y9GA 1UNBA 3WY6A 2YUEA 1EYBA 3WCRA 3RZHA 5IAVA 4LA2A 4ZZ5A 3TN92 1HJFA 4MGTA 5LEJA 1IQAA 5ANQA 2WQZC 3KF3A 4CUCA 5I8TA 2JD9A 2YFUA 4N43C 2GC3A 3JBG2 1WMXA 1ALYA 4AEMA 1QNWA 1V70A 1SCRA 2X8KA 4YW7A 5HCFA 5IVEA 5FBZA 2MEV1 1CAUB 3BOPA 4C0HA 2FCUA 2RMU2 2ZX3A 2OQ7A 3OGVA 5FAXA 3ITQA 3LPFA 4LT5A 2Y26A 1UY3A 4Y1ZA 4DNYA 1SLBA 1DP0A 4M0NA 5CZKA 5JZGB 5A3OA 2F4PA 1ZNPA 4D6SA 1W8TA 1GFF2 1JYVA 1JS9A 2WFF1 4F8AA 2BGOA 1LOBA 1VB4A 2J42A 1G9FA 1LR5A 1FNZA 1H2MA 3IM0A 2GMMA 5GZDA 5IVCA 1RVF2 1RUG2 1QJZA 3VD4A 3OEAA 1OVSA 4NRMA 3CLPA 3WUDA 1W9SA 3ELNA 4XHXA 1IS4A 4CPBD 1S0BA 2CV6A 2JG9C 5FP4A 2FD8A 2BFUL 3ZX7A 3H7YA 2ZOEB 1RB8G 5FPBA 1KJRA 3KT4A 3DECA 1WMDA 5EIYB 2A6WA 5I0DA 3ZFGA 2WO7A 3AFGA 3GBFA 4Q4V3 5CAZA 1QIQA 3TN91 5JOYA 2QNKA 2C9AA 2WWUA 1R64A 1W6MB 3I2GA 1VB2A 4RHV2 5FYSA 4J25A 3WF4A 3LZZA 4FPCA 5JZGA 2XHNA 1JOJA 2RDQA 3OBZA 1RUJ3 2JDHA 3HPNA 4QPGA 4BK5A 1JYXA 3I54A 2IXLA 4IEZA 4M4PA 3T30A 1RXGA 1OBNA 1W9WA 4Q4Y3 4LITA 4TYSA 4YVWB 5HV0A 4BZ4A 1XSQA 1NA1C 2E51A 1YXWA 5FK7A 1POV0 5HV4A 1O3QA 2WWJA 4I0BA 2VG9A 3O1SA 3WEZA 2CHHA 2GSYA 3ILFA 1HQWA 2JDKA 2A6YA 2BJSA 4XIOA 4CEWB 1LODA 4K1ZA 2VMEA 3KS7A 3D8CA 3KD4A 5FPZA 4LIVA 2Z4FA 2DCYA
chains in the Genus database with same CATH topology
3JXSA 3CQOA 3C7OA 5IJRA 1IQDC 2VZTA 1JYNA 1H6XA 3IB3A 1JI6A 4QX0A 2J1TA 4OYUA 1WCQA 3MO4A 3WSOA 4Z2AA 3T09A 5F7UA 5JMOA 2XOMA 3EB7A 1PMHX 4DUWA 3FN9A 1OD3A 4HG6B 3CZJA 4ARXA 1O8PA 2C4XA 2VZ3A 1UYZA 3CIHA 3CZUA 2YFZA 2VR4A 4XUTA 4A45A 3HOBA 1CZVA 1K45A 3GGLA 4M4RA 3WF1A 4CU6A 2OKXA 4XUOA 5DPNA 3HN3A 3VDCA 3K75B 4QX3A 4PF1A 2Y6KA 5JXGA 4FI9A 4MGSA 3UESA 2VZ1A 4LHSA 2V5DA 1OF4A 4AAXA 4CU7A 2WDBA 3VD3A 4TTGA 3OGSA 2W1WA 4XUNA 4GZ9A 1OT5A 2BBAA 2YG0A 1DLCA 1GOHA 4XURA 3P6BA 4E8DA 5A1AA 4MOAA 1O8SA 3MBWA 2J1AA 5IHRA 2W3JA 4DUVA 1JZ2A 2VMCA 4YPJA 2CDOA 2W1QA 1OF3A 2VTFA 1W0NA 4ZY9A 3MV11 3MV01 4ARYA 1SDDB 5LA2A 2WN2A 1DYOA 4JX0A 5LCWL 1US3A 2C9KA 5J1XA 3F2ZA 5HXMA 5C70A 2VCBA 1I5PA 1UXXX 2JE8A 3CDZB 4BDVB 3K77A 1W8OA 4BJ0A 5JUVA 1K42A 2Y64A 3MUZ1 3AC0A 3A7QA 3ETPA 2VMDA 4XVHA 3K4ZA 4W50A 4A3ZA 3I2FA 3HJRA 2EIDA 2WYSA 2X10A 4ZZ8A 2J1UA 4XUPA 2QBXA 2WO2A 4DEVA 4CU9A 2W94A 1UY4A 3T2PA 3GXUA 1GOGA 1J84A 3NJXA 4LKSA 3I2IA 2XONA 4RN5A 2DCKA 2VZUA 4QX2A 4QB6A 4A4AA 3E1F1 3K4DA 3I3EA 3NJVA 4QDRA 2X05A 3WNPA 2BZDA 2JDAA 2ZEYA 1UXZA 4QX1A 4JHZA 3SEEA 1JZ5A 4KWUA 3K46A 4JKMA 1UX7A 1EUUA 2X09A 1MPXA 3HEIA 4QB1A 4XUQA 5IFPA 1P8JA 2WZEA 5JXHA 1OH4A 2W92A 1D7PM 3DYMA 4GWJA 2QQKA 4W4ZA 1RYYA 3LE0A 3PUHA 3WNKA 2VZVA 1YQ2A 2W1UA 3I3DA 4AG4A 4ZXEA 4KI5M 4LPLA 3CKHA 2ORXA 2ZEZA 3BGAA 3LPGA 3MUY1 1GNYA 1EUTA 2RV9A 3OG2A 1XPWA 1F4AA 2QQMA 3OGRA 4GWIA 4QDQA 4OMDA 5HPOA 5LA0A 4DXRA 3NQHA 1PX3A 3I2HA 4P08A 1WKYA 3I3BA 1TG7A 1L7RA 1CIYA 4UI9L 1TVGA 2DDUA 2J1SA 3I97A 2ORZA 3U37A 2VZPA 2WO3A 4BXSV 1JU4A 2PQSA 2Y6JA 3K4AA 2W87A 2YC4A 1XC6A 1SHWB 1UZ0A 3WNMA 2VM9A 1XNAA 2WAOA 2KD7A 2W46A 1GQPA 1ULPA 3HNYM 3CMGA 2EIBA 4PT6A 1CZSA 4JKLA 3ZM8A 1NKGA 1JU3A 4QB2A 4A44A 3W5MA 2W5FA 5JR2A 1K3IA 1JZ8A 3FHQA 2W47A 2QQOA 2VZOA 1GOFA 2WO1A 2ID4A 3ACGA 2HLEA 2VQTA 4A42A 3A22A 3WNLA 5C7GA 1JZ7A 2W1SA 1ULOA 3GDBA 3NNGA 4OUEA 5IYYA 1US2A 1GMMA 1KGYA 1GUIA 3VDBA 1UMIA 2W9XA 2JKXA 3A23A 2QQIA 2ZEXA 3IIIA 4QPWA 3FL7A 2QQNA 3T0BA 1UMHA 2C26A 1XNTA 2W95A 1BHGA 3C7EA 5EJ1B 4LQRA 3IAQA 2QQLA 2VQUA 2WUHA 4CU8A 1UWWA 3SKVA 1HN1A 4L0PA 4P5YA 3OBAA 2RJ2A 1K12A 2B9VA 5LA1A 2Y6GA 1CZTA 3SKJE 3BN6A 3OB8A 3HNBM 3WQBA 4DUXA 5FUIA 2WAAA 1JZ6A 1GU3A 3C7GA 1W99A 2VCAA 4DXSA 4JKKA 2L9LA 2B4KA 3DYOA 5B4XA 3ACHA 4A41A 2LS6A 1LNSA 3D3AA 3VD9A 1KEXA 3C7HA 4MGQA 2HYXA 2V72A 4PQQA 1JYWA 4DXTA 4DEQA 2DCJA 3ABZA 3VD7A 3OEBA 5DQ0A 1JZ4A 2VZQA 2WABA 5JXJA 3I2KA 1UY2A 3LEKA 5IFTA 4IUGA 5B4NA 4QAWA 3LEGA 4A6OA 2BERA 4W8JA 4CVUA 2CDPA 2QQJA 2Y6LA 2VMFA 3T0AA 3WNNA 2E31A 1JHJA 4CUBA 3DYPA 3UNPA 1O59A 1W9TA 3EYPA 2VJXA 2YC2A 2J1EA 2VCCA 3ACIA 4RYDA 1L7QA 2VC9A 2E32A 2W91A 3LEIA 3NRUA 1SG3A 2LW8A 4ET7A 2Y6HA 3WF0A 2R7EB 1UYYA 2V4VA 3LQCA 4OZOA 2ZEWA 5CYYA 1NAEA 2RVAA 4OMCA 5EJZB 3VDAA 2E33A 2J22A 2BGPA 1UYXA 2VO5A 1T2XA 1W8NA 3WNOA 4QDSA 5G05L 1UY1A 3I2JA 3GM8A 2YB7A 3T0DA 4P00B 3A21A 3P1IA 2WN3A 3VD5A 4MO3M 2WQ8A 2ZXQA 3PUIA 3HNMA 2J1VA 1JZ3A 4CUAA 3WF2A 4KMQA 3THCA 1NUKA 2J1RA 2J7MA 4ZZ5A 5G04L 3W5NA 4CUCA 1J83A 5DMYA 2JD9A 3J7HA 2YFUA 3T2OA 5C71A 4E8CA 2VZSA 2EICA 2VL4A 2VOTA 1NX9A 3ACFA 1UY0A 4TXWA 3IAPA 3THDA 3OGVA 4P02B 2VZRA 3C7FA 3LPFA 1UY3A 4MADA 3ECQA 1DP0A 5CZKA 3T08A 1JYVA 5JXIA 2BGOA 1F4HA 3T2QA 5DN2A 4D8MA 3VD4A 3OEAA 2Y8KA 1H6YA 1W9SA 3C8XA 3SEPA 1PX4A 3DECA 5EIYB 4BK4A 3UETA 5I0DA 1CX1A 3I2GA 1R64A 3WF4A 2EIEA 1PMJX 2WZ8A 2XHNA 4BK5A 3HPNA 1JYXA 4M4PA 3FHAA 1W9WA 3IDAA 2XQXA 3WF3A 3WEZA 2E26A 4UAPA 2WBKA 4UOJA 2VMEA 4D0QA 2Z4FA 4XZUG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JXS A;  3CQO A;  3C7O A;  5IJR A;  1IQD C;  2VZT A;  1JYN A;  1H6X A;  3IB3 A;  1JI6 A;  4QX0 A;  2J1T A;  4OYU A;  1WCQ A;  3MO4 A;  3WSO A;  4Z2A A;  3T09 A;  5F7U A;  5JMO A;  2XOM A;  3EB7 A;  1PMH X;  4DUW A;  3FN9 A;  1OD3 A;  4HG6 B;  3CZJ A;  4ARX A;  1O8P A;  2C4X A;  2VZ3 A;  1UYZ A;  3CIH A;  3CZU A;  2YFZ A;  2VR4 A;  4XUT A;  4A45 A;  3HOB A;  1CZV A;  1K45 A;  3GGL A;  4M4R A;  3WF1 A;  4CU6 A;  2OKX A;  4XUO A;  5DPN A;  3HN3 A;  3VDC A;  3K75 B;  4QX3 A;  4PF1 A;  2Y6K A;  5JXG A;  4FI9 A;  4MGS A;  3UES A;  2VZ1 A;  4LHS A;  2V5D A;  1OF4 A;  4AAX A;  4CU7 A;  2WDB A;  3VD3 A;  4TTG A;  3OGS A;  2W1W A;  4XUN A;  4GZ9 A;  1OT5 A;  2BBA A;  2YG0 A;  1DLC A;  1GOH A;  4XUR A;  3P6B A;  4E8D A;  5A1A A;  4MOA A;  1O8S A;  3MBW A;  2J1A A;  5IHR A;  2W3J A;  4DUV A;  1JZ2 A;  2VMC A;  4YPJ A;  2CDO A;  2W1Q A;  1OF3 A;  2VTF A;  1W0N A;  4ZY9 A;  3MV1 1;  3MV0 1;  4ARY A;  1SDD B;  5LA2 A;  2WN2 A;  1DYO A;  4JX0 A;  5LCW L;  1US3 A;  2C9K A;  5J1X A;  3F2Z A;  5HXM A;  5C70 A;  2VCB A;  1I5P A;  1UXX X;  2JE8 A;  3CDZ B;  4BDV B;  3K77 A;  1W8O A;  4BJ0 A;  5JUV A;  1K42 A;  2Y64 A;  3MUZ 1;  3AC0 A;  3A7Q A;  3ETP A;  2VMD A;  4XVH A;  3K4Z A;  4W50 A;  4A3Z A;  3I2F A;  3HJR A;  2EID A;  2WYS A;  2X10 A;  4ZZ8 A;  2J1U A;  4XUP A;  2QBX A;  2WO2 A;  4DEV A;  4CU9 A;  2W94 A;  1UY4 A;  3T2P A;  3GXU A;  1GOG A;  1J84 A;  3NJX A;  4LKS A;  3I2I A;  2XON A;  4RN5 A;  2DCK A;  2VZU A;  4QX2 A;  4QB6 A;  4A4A A;  3E1F 1;  3K4D A;  3I3E A;  3NJV A;  4QDR A;  2X05 A;  3WNP A;  2BZD A;  2JDA A;  2ZEY A;  1UXZ A;  4QX1 A;  4JHZ A;  3SEE A;  1JZ5 A;  4KWU A;  3K46 A;  4JKM A;  1UX7 A;  1EUU A;  2X09 A;  1MPX A;  3HEI A;  4QB1 A;  4XUQ A;  5IFP A;  1P8J A;  2WZE A;  5JXH A;  1OH4 A;  2W92 A;  1D7P M;  3DYM A;  4GWJ A;  2QQK A;  4W4Z A;  1RYY A;  3LE0 A;  3PUH A;  3WNK A;  2VZV A;  1YQ2 A;  2W1U A;  3I3D A;  4AG4 A;  4ZXE A;  4KI5 M;  4LPL A;  3CKH A;  2ORX A;  2ZEZ A;  3BGA A;  3LPG A;  3MUY 1;  1GNY A;  1EUT A;  2RV9 A;  3OG2 A;  1XPW A;  1F4A A;  2QQM A;  3OGR A;  4GWI A;  4QDQ A;  4OMD A;  5HPO A;  5LA0 A;  4DXR A;  3NQH A;  1PX3 A;  3I2H A;  4P08 A;  1WKY A;  3I3B A;  1TG7 A;  1L7R A;  1CIY A;  4UI9 L;  1TVG A;  2DDU A;  2J1S A;  3I97 A;  2ORZ A;  3U37 A;  2VZP A;  2WO3 A;  4BXS V;  1JU4 A;  2PQS A;  2Y6J A;  3K4A A;  2W87 A;  2YC4 A;  1XC6 A;  1SHW B;  1UZ0 A;  3WNM A;  2VM9 A;  1XNA A;  2WAO A;  2KD7 A;  2W46 A;  1GQP A;  1ULP A;  3HNY M;  3CMG A;  2EIB A;  4PT6 A;  1CZS A;  4JKL A;  3ZM8 A;  1NKG A;  1JU3 A;  4QB2 A;  4A44 A;  3W5M A;  2W5F A;  5JR2 A;  1K3I A;  1JZ8 A;  3FHQ A;  2W47 A;  2QQO A;  2VZO A;  1GOF A;  2WO1 A;  2ID4 A;  3ACG A;  2HLE A;  2VQT A;  4A42 A;  3A22 A;  3WNL A;  5C7G A;  1JZ7 A;  2W1S A;  1ULO A;  3GDB A;  3NNG A;  4OUE A;  5IYY A;  1US2 A;  1GMM A;  1KGY A;  1GUI A;  3VDB A;  1UMI A;  2W9X A;  2JKX A;  3A23 A;  2QQI A;  2ZEX A;  3III A;  4QPW A;  3FL7 A;  2QQN A;  3T0B A;  1UMH A;  2C26 A;  1XNT A;  2W95 A;  1BHG A;  3C7E A;  5EJ1 B;  4LQR A;  3IAQ A;  2QQL A;  2VQU A;  2WUH A;  4CU8 A;  1UWW A;  3SKV A;  1HN1 A;  4L0P A;  4P5Y A;  3OBA A;  2RJ2 A;  1K12 A;  2B9V A;  5LA1 A;  2Y6G A;  1CZT A;  3SKJ E;  3BN6 A;  3OB8 A;  3HNB M;  3WQB A;  4DUX A;  5FUI A;  2WAA A;  1JZ6 A;  1GU3 A;  3C7G A;  1W99 A;  2VCA A;  4DXS A;  4JKK A;  2L9L A;  2B4K A;  3DYO A;  5B4X A;  3ACH A;  4A41 A;  2LS6 A;  1LNS A;  3D3A A;  3VD9 A;  1KEX A;  3C7H A;  4MGQ A;  2HYX A;  2V72 A;  4PQQ A;  1JYW A;  4DXT A;  4DEQ A;  2DCJ A;  3ABZ A;  3VD7 A;  3OEB A;  5DQ0 A;  1JZ4 A;  2VZQ A;  2WAB A;  5JXJ A;  3I2K A;  1UY2 A;  3LEK A;  5IFT A;  4IUG A;  5B4N A;  4QAW A;  3LEG A;  4A6O A;  2BER A;  4W8J A;  4CVU A;  2CDP A;  2QQJ A;  2Y6L A;  2VMF A;  3T0A A;  3WNN A;  2E31 A;  1JHJ A;  4CUB A;  3DYP A;  3UNP A;  1O59 A;  1W9T A;  3EYP A;  2VJX A;  2YC2 A;  2J1E A;  2VCC A;  3ACI A;  4RYD A;  1L7Q A;  2VC9 A;  2E32 A;  2W91 A;  3LEI A;  3NRU A;  1SG3 A;  2LW8 A;  4ET7 A;  2Y6H A;  3WF0 A;  2R7E B;  1UYY A;  2V4V A;  3LQC A;  4OZO A;  2ZEW A;  5CYY A;  1NAE A;  2RVA A;  4OMC A;  5EJZ B;  3VDA A;  2E33 A;  2J22 A;  2BGP A;  1UYX A;  2VO5 A;  1T2X A;  1W8N A;  3WNO A;  4QDS A;  5G05 L;  1UY1 A;  3I2J A;  3GM8 A;  2YB7 A;  3T0D A;  4P00 B;  3A21 A;  3P1I A;  2WN3 A;  3VD5 A;  4MO3 M;  2WQ8 A;  2ZXQ A;  3PUI A;  3HNM A;  2J1V A;  1JZ3 A;  4CUA A;  3WF2 A;  4KMQ A;  3THC A;  1NUK A;  2J1R A;  2J7M A;  4ZZ5 A;  5G04 L;  3W5N A;  4CUC A;  1J83 A;  5DMY A;  2JD9 A;  3J7H A;  2YFU A;  3T2O A;  5C71 A;  4E8C A;  2VZS A;  2EIC A;  2VL4 A;  2VOT A;  1NX9 A;  3ACF A;  1UY0 A;  4TXW A;  3IAP A;  3THD A;  3OGV A;  4P02 B;  2VZR A;  3C7F A;  3LPF A;  1UY3 A;  4MAD A;  3ECQ A;  1DP0 A;  5CZK A;  3T08 A;  1JYV A;  5JXI A;  2BGO A;  1F4H A;  3T2Q A;  5DN2 A;  4D8M A;  3VD4 A;  3OEA A;  2Y8K A;  1H6Y A;  1W9S A;  3C8X A;  3SEP A;  1PX4 A;  3DEC A;  5EIY B;  4BK4 A;  3UET A;  5I0D A;  1CX1 A;  3I2G A;  1R64 A;  3WF4 A;  2EIE A;  1PMJ X;  2WZ8 A;  2XHN A;  4BK5 A;  3HPN A;  1JYX A;  4M4P A;  3FHA A;  1W9W A;  3IDA A;  2XQX A;  3WF3 A;  3WEZ A;  2E26 A;  4UAP A;  2WBK A;  4UOJ A;  2VME A;  4D0Q A;  2Z4F A;  4XZU G; 
#chains in the Genus database with same CATH topology
 2VNV A;  3EBR A;  3ES1 A;  1C1F A;  1C28 A;  4XBN A;  4QX8 A;  3W59 A;  1YCI A;  4I0W B;  4GWM A;  1JXN A;  4AR2 A;  3T4V A;  3MIC A;  3MLK A;  2WZR 3;  3ACL A;  2VZT A;  4D7Y A;  4XFA A;  4QX0 A;  2H0B A;  3OBR A;  1UCX A;  1GIC A;  2O1Q A;  4G3Y C;  5GLU A;  3MO4 A;  4YM1 A;  5FP7 A;  1OA4 A;  3OD4 A;  1RXF A;  4OVE A;  4CDW B;  1VRH 3;  4YGE A;  4AI1 A;  3ZFE A;  2XJQ A;  3TYJ A;  4L9B A;  4AI0 A;  4RHV 1;  1B35 B;  4LKE A;  4HG6 B;  4AVA A;  3LOI A;  3POJ A;  2Q8C A;  1RUC 2;  3V56 A;  2VZ3 A;  2Q8E A;  2Q8D A;  3CZU A;  1NZI A;  2YFZ A;  5AVA A;  5FUP A;  2R1D A;  4XUT A;  4A45 A;  4NIH A;  4J1W A;  1K45 A;  3GGL A;  1LED A;  1RJ8 A;  4M4R A;  2OKX A;  2ZX4 A;  3VD9 A;  3KV5 A;  3K75 B;  3KCC A;  4QX3 A;  3J7L A;  4YVS B;  1TMF 3;  3UKN A;  2DCT A;  2GAU A;  2VZ1 A;  2EAL A;  3DKW A;  5C5U A;  5A3N A;  5KC5 A;  2I74 A;  2ZAC A;  2WDB A;  1DU3 D;  4JGY C;  4CP2 A;  5ABJ B;  3OGS A;  1WBF A;  3SH4 A;  3AP5 A;  4Y4R A;  4HMZ A;  4XUN A;  3SLI A;  1N1S A;  1SBF A;  2QQU A;  1O3R A;  5CVR A;  1LU1 A;  1AVB A;  4E9K A;  3CO2 A;  4XUR A;  3EXU A;  2TBV A;  4CDQ A;  1N1V A;  4LEJ A;  1VBE 2;  5IHR A;  5FZ7 A;  4NHY A;  1RUF 1;  1ULF A;  1VAL A;  3POG A;  4IER A;  4LJH A;  4RFR B;  5DAB A;  4YPJ A;  4AE2 A;  4L92 A;  4WZF A;  3PIG A;  5DAV A;  3F95 A;  1W8H A;  1UPS A;  1QQP 1;  3JUU A;  4ZY9 A;  5H9R A;  4ATF A;  1QXR A;  1WA6 X;  5FZI A;  4ARY A;  1CGP A;  3Q8E A;  3QOP A;  2XVK A;  5LA2 A;  2X5I C;  3WDX A;  4DS0 A;  3DN7 A;  5CEH A;  1ST8 A;  2RMU 3;  2RMU 1;  4Q2F A;  4Y4Y A;  1US3 A;  1VAK A;  5T5L A;  1VPH A;  4HKW A;  3F2Z A;  4Y1V A;  2QQP A;  5HXM A;  4LHL A;  2ZHL A;  3CDZ B;  4I3P A;  4XQW A;  3MUZ 1;  2WNV B;  2YBS A;  3DXU A;  3AC0 A;  3A7Q A;  3ETP A;  4WM8 C;  3OD0 A;  5F9T A;  5LZ6 A;  4RGG A;  1NE6 A;  4YM2 A;  5AVP A;  4A3Z A;  3O0X A;  3HJR A;  1XYP A;  2XBO 2;  4QX7 A;  1CES A;  2MPF A;  2XJR A;  5FJH A;  1VBD 2;  2NN8 A;  4CCO A;  1YWK A;  2E7A A;  3N9M A;  4GWN A;  5FZ6 A;  3ZYF A;  1NY7 1;  1AL2 2;  4KWL A;  3THT A;  4I01 A;  3ZFG C;  3JCI A;  4XTM A;  2HWB 3;  4CXW A;  2HH9 A;  2ERF A;  3D5O A;  3EO6 A;  2O8Q A;  1PK6 B;  3ON7 A;  3KV6 A;  2DVG A;  2D98 A;  2WNE A;  3ES4 A;  2PHW A;  4RS5 A;  1NCR A;  3AL5 A;  4GXL A;  5CU1 A;  2B42 B;  1REE A;  3I2I A;  3RPQ A;  3U07 A;  3WQ7 A;  4CDX A;  4DXZ A;  1W03 A;  3O1O A;  1N1Y A;  3GCX A;  4QDR A;  3U10 A;  5AFB A;  3AZV A;  1OD5 A;  2Y33 A;  4YG6 A;  1UZY A;  1H2K A;  2AAC A;  5A70 A;  3LD8 A;  4NHK A;  4QX1 A;  5FZG A;  1HRI 1;  4IGQ A;  5F3G A;  4I0A A;  1H2N A;  4OHZ A;  4IEP A;  2ZGT A;  3ZYI B;  5GLZ A;  2XGX A;  3INA A;  5L7O A;  2QE3 A;  3USU A;  3D0J A;  1MPX A;  4UFK A;  3AZZ A;  4D3W A;  3ZSM A;  1GLH A;  2Q1M A;  4XQD A;  3IZO A;  4YW2 A;  1C8M 3;  4QB1 A;  1ZRD A;  1AJO A;  1ENR A;  1P8J A;  2WS9 1;  4YFW A;  3WHT A;  5JXH A;  1BXH A;  2W92 A;  5A6X A;  2HWB 2;  4FAH A;  1LGN A;  2VMI A;  3AFK A;  2GZW A;  2I45 A;  5FPV A;  5FRA A;  4DIN B;  2QQK A;  4G9S B;  5A3L A;  1O4Z A;  3H7J A;  3UGG A;  1BLZ A;  1RYY A;  1RC6 A;  3WNK A;  1YQC A;  5HCH A;  3M3I A;  1YQ2 A;  2C6S A;  2W1U A;  3I3D A;  1U5I A;  1ZZC A;  2PA7 A;  4XJU A;  2Q8O A;  3ZXE A;  2RR1 1;  1UX6 A;  1FPN 3;  5J36 A;  4IEW A;  2WIN B;  4FPE A;  1DGR A;  2WLP A;  4COW A;  3FHI B;  1IOA A;  5A32 A;  3ST7 A;  2DUP A;  4GH4 C;  5I0R A;  1GQH A;  2YRO A;  3ZIX A;  5D1I A;  3LSD A;  5JOW A;  3FWE A;  1H0B A;  4AYU A;  5SV5 A;  5BYN A;  3W21 A;  5CIR A;  5DUU A;  1ZA4 A;  1CQ9 A;  1GNY A;  5I8Y A;  1V9U 1;  4IV1 A;  1EUT A;  1PVX A;  1OHF A;  2YBP A;  2QQM A;  3QLQ A;  3ZXK A;  2HWF 3;  1Q5O A;  3WDT A;  5HI0 A;  5C5T A;  3LWC A;  1SLI A;  1YEW A;  2OZ6 A;  4B4P A;  5IK4 A;  1X7N A;  1GZT A;  3B00 A;  1EV1 2;  4ISR A;  1BEV 2;  1FT9 A;  4PJY A;  1R1A 3;  1PX3 A;  2XWJ B;  4IE4 A;  4YZ4 A;  5F39 A;  3SCG A;  5DAP A;  4EV0 A;  2WT2 A;  4P08 A;  4D6Q A;  2K9Z A;  1WCD J;  4EQV A;  4LBQ A;  4MLO A;  2TEP A;  4W65 A;  1STM A;  2GH8 A;  1BVV A;  5A32 B;  1OVP A;  1CIY A;  2Q4S A;  1TVG A;  4D69 A;  2PHR A;  4PDW C;  5FRE A;  1RVF 1;  4L99 A;  2WR9 A;  3SXW A;  3AZW A;  1UIJ A;  3ZN5 A;  5BV6 A;  2ORZ A;  4S2F A;  3SNM A;  1C3H A;  4P9L A;  5EYX A;  3ZR5 A;  4XAA A;  2BQP A;  1S4C A;  1ND2 B;  2E9Q A;  4FPH A;  1JU4 A;  1Q8V A;  2Y6J A;  2W0X A;  3HWJ A;  2W87 A;  3N9N A;  3T2T A;  3VV1 A;  3KGL A;  3VZO A;  5A33 A;  1TME 3;  1W6P B;  3ZYB A;  5L7O B;  3E5X A;  3TEW A;  5FZ1 A;  1OOP C;  4IGO A;  4PQ9 A;  4UW6 A;  4COY A;  2CGO A;  2WAO A;  4CEW C;  4I02 A;  3HNY M;  1ZZ8 A;  4M3C F;  2LAL A;  3CMG A;  4OFG A;  2EAA A;  3O12 A;  4N8M A;  3FUO A;  3RNS A;  5KHJ A;  3DGT A;  2VOX A;  5JPM B;  3B93 A;  1NKG A;  1JU3 A;  5FV3 A;  3WZ1 A;  2SLI A;  1D4M 1;  3D0S A;  2D40 A;  4LK7 A;  1PO2 1;  1PO2 3;  2A6V A;  2W5F A;  2ZGM A;  1G8W A;  5I0T A;  5LK5 A;  4Z07 A;  1NCR B;  4AVB A;  1Z0H A;  2AZ5 A;  1OQ1 A;  2P3J A;  3R6S A;  1ZM1 A;  1RUI 2;  4L11 A;  3SCH A;  3I49 A;  4LLO A;  1JYI A;  3FHQ A;  1PK6 A;  2GND A;  4LBJ A;  1VBD 1;  3ZYP A;  4CYD A;  5C4W B;  3I3M A;  2KXL A;  4LUK A;  2HLE A;  3E6B A;  2P2K A;  3A22 A;  2W1S A;  3GDB A;  3OGG A;  4QKN A;  2JKB A;  4E2G A;  1KGY A;  4XMA A;  3O1M A;  2ZKN A;  3MLJ A;  1VBB 1;  4LOT A;  3VDB A;  2OW4 A;  3ZFE B;  3OF1 A;  1RUD 2;  2VD7 A;  4LTA A;  4ZKT B;  4UFI A;  2WII B;  4CA9 A;  2FCV A;  1W2U A;  3GZU C;  4FFH A;  5D8A A;  3M1H A;  1L7L A;  1O5U A;  1TNF A;  1H1I A;  1WW4 A;  5EV7 A;  1AR6 2;  1YI9 A;  4LO8 A;  3HR9 A;  3T0B A;  3IDE A;  4YFZ A;  1GWM A;  5IVV A;  1IS3 A;  1DQ0 A;  3MI8 A;  1XNT A;  2W95 A;  1R09 2;  1WZX A;  3GHN A;  3LA2 A;  4CU8 A;  3NAP A;  1AUY A;  2GDF A;  4Q4Y 2;  3JD7 3;  5IVJ A;  3QD6 A;  5F1R A;  4UW4 A;  3POI A;  4MSV A;  1GKB A;  1HN1 A;  2QVS B;  4U36 A;  2UY8 A;  2BGC A;  2QZ3 A;  3WP3 A;  1VBC 3;  1WW7 A;  4Q4V 1;  1ASJ 1;  4KBZ A;  4HVO A;  2WRA A;  1H4G A;  3I4I A;  4MVT A;  2B9V A;  5FZ4 A;  2CU5 A;  3M3C A;  4NAO A;  5FZA A;  5H9Q A;  5A80 A;  1Y7B A;  4N7U A;  1CZT A;  1YO8 A;  4AOC A;  3H8X A;  4NRO A;  4OHW A;  1UU4 A;  2Z42 A;  4XJW A;  3DV8 A;  1F8V A;  1GZC A;  2CL2 A;  1UOB A;  5DDJ 1;  3VHR A;  3MF6 A;  5H9S A;  2Y6F A;  1G9B A;  3ETQ A;  5FUI A;  4OI2 A;  3RS6 A;  4YVW A;  2WNO A;  5CG8 A;  4NPL A;  4E2Q A;  1JZ6 A;  4AI9 A;  1UO9 A;  4XQ4 A;  3I59 B;  5CNA A;  1VBA 3;  1LOA A;  4DXS A;  1W6M A;  2B4K A;  2ZZJ A;  1MVQ A;  1HB4 A;  2JDZ A;  3B7M A;  4XFF A;  3VZN A;  1AYM 3;  4XXP A;  3VBU C;  1XE0 A;  1G86 A;  1MQT C;  3MPB A;  5FWE A;  1Z78 A;  4AED B;  4DRR A;  2SBA A;  4EWE A;  5BY5 A;  2GC2 A;  4LNV A;  2MEV 3;  3J26 N;  2RS5 1;  1PVC 3;  2HYX A;  2V72 A;  4S2G A;  5FLI A;  4HKO A;  5GZC A;  2AC1 A;  4B7E A;  1N3O A;  4DEQ A;  2Y0I A;  2DCJ A;  4CDU C;  1SLL A;  4RGK A;  2R06 3;  1UIK A;  1W04 A;  2WS9 3;  3IMM A;  2TUN A;  4BIS A;  1C5I A;  3AB0 A;  3DEM A;  5AC9 2;  5T3N A;  5JCT A;  1DZR A;  3B01 A;  5JXJ A;  1UY2 A;  1ASJ 2;  2VMG A;  4BQ5 A;  2XB6 C;  4CDW A;  1QHD A;  2YY1 A;  4IUG A;  2ZX1 A;  1MS3 A;  4UF0 A;  3LEG A;  1OKO A;  1PVC 1;  2JE7 A;  1QJX 1;  4A6O A;  4V2W A;  4AVS A;  1U12 A;  3PVO A;  1VRB A;  2D6K A;  4YGC A;  1UAI A;  5FZ3 A;  1IPJ A;  2RS3 1;  1CAU A;  2PHX A;  4YW4 A;  3WQ0 A;  4CVU A;  5C9A C;  2HWC 3;  3FBY A;  1W9Y A;  4DIQ A;  3CNA A;  4JDO A;  3BPS A;  3LAG A;  4PIY A;  4EE2 A;  5KXC A;  2XJP A;  1UF2 C;  1WW6 A;  4B7K A;  4B4R A;  2ZBJ A;  4CP1 A;  4G4F A;  1DQ1 A;  4HON A;  4JQR A;  3ZMN A;  1RUO A;  1O59 A;  1W9T A;  3EYP A;  4OI4 A;  5DAQ A;  3ACI A;  4KH9 A;  4A2U A;  5F6L B;  3VBO C;  3ZR6 A;  4CEW A;  3ZKU A;  3Q8B A;  1FAY A;  3VBF C;  4F83 A;  1CX4 A;  3WP4 A;  3HMY A;  3WF0 A;  3AYD A;  5A6Z A;  1UYY A;  2V4V A;  3K51 A;  1XNK A;  5FR3 A;  2EIG A;  1I3H A;  2BUK A;  2FDJ A;  5CYY A;  5GLW A;  1NAE A;  3TRS B;  4FOW A;  1LES A;  5EJZ B;  5F5A A;  1S0D A;  3MEP A;  4NRQ A;  1S2E A;  4GKX A;  4NPR A;  3BIE A;  1T2X A;  2ATF A;  1PO2 2;  4V2V A;  2GAL A;  1W6N B;  4AF9 A;  5IAX A;  4DY3 A;  3RI8 A;  3THP A;  3WDW A;  3GBW A;  2VQ0 A;  2HEW F;  2IZW A;  4RD7 A;  4B29 A;  2VY0 A;  3FFQ A;  3VD5 A;  1LUL A;  3PUI A;  4HET A;  2P3I A;  1RUH 2;  3MID A;  4FTE A;  1AX1 A;  4Q1P A;  4KMQ A;  2ZML A;  5EWS A;  4MH0 E;  4OCT A;  3RMX A;  1VBD 3;  2D5F A;  1VBB 2;  2DVD A;  3BAL A;  2J1R A;  1FNY A;  4XEZ A;  4AED A;  1LJ7 A;  2CTV A;  1W2T A;  3T1M A;  2P5B A;  3BCW A;  3VZK A;  3DXT A;  2YGL A;  5DMY A;  2ZKL A;  3J7H A;  2ZX0 A;  1MEC 1;  1D4M 3;  2XLA A;  3A0N A;  4Y33 A;  3LOB A;  3O1P A;  2VZS A;  3N4M A;  2EIC A;  5J7M A;  2UU8 A;  2HWD 2;  1DIW A;  1GAN A;  1LRH A;  1NX9 A;  2D3S A;  3ACF A;  3AMM A;  4M3C B;  5LBE A;  3FLP A;  4URA A;  5ACA 3;  3H8U A;  3HBZ A;  5IVY A;  1PIV 2;  3ECQ A;  2QFE A;  3JQW A;  3A0K A;  1AR8 3;  1D4V B;  1MS4 A;  4V1P A;  1W6Q A;  1EV1 1;  2PHT A;  2RJL A;  4FFF A;  2NQY A;  2V5Y A;  2AEY A;  1QOT A;  4DZG A;  4H3W A;  4UBG A;  1VBA 1;  5LBC A;  3T2Q A;  3CU7 A;  1QJY 3;  1Y9Q A;  3WG1 A;  2IFR A;  3ILN A;  5FMC A;  4HT1 T;  1H6Y A;  3URF A;  5FXV A;  3C8X A;  3NO8 A;  4WBB A;  4BE3 A;  1ZRE A;  2QDN A;  5FO8 B;  2IXJ A;  4FPF A;  5FY1 A;  4NR1 A;  4QPY A;  3UET A;  1R08 3;  3Q8C A;  4O65 A;  3KHB A;  3BU7 A;  1XNB A;  4OHX A;  4ZS2 A;  2R04 3;  3RJ2 X;  1VRH 1;  3ZVX A;  2XVG A;  4YVW C;  4AQS A;  3HQU A;  4GAL A;  2BPA 2;  4AEK A;  4GAZ A;  4IGP A;  4KBB A;  1C57 A;  3C3V A;  4MGZ E;  4EJR A;  1PM7 A;  2Y0O A;  4QM8 A;  5C3Q A;  5F6K A;  4IE5 A;  1QF3 A;  2ARX A;  2FZ1 A;  1ACC A;  1EPZ A;  2WZR 1;  1A78 A;  1WCK A;  2RDN A;  2XR4 A;  4R4X A;  1ENS A;  2XJV A;  3WF3 A;  4LLF A;  3RDI A;  2E26 A;  3E6D A;  4UAP A;  2HWF 2;  3WIN E;  4MXV A;  4EN6 B;  4Z2W A;  1M06 G;  1GWL A;  4ITC A;  3ZN6 A;  4IEQ A;  1JHN A;  1RJ7 A;  1LKN A;  3Q8A A;  5FYI A;  4CDW C;  5JSR A;  1G9A A;  5CFD A;  4D0Q A;  2D6P A;  1FYU A;  3GJA A;  3AX4 A;  4XFG A;  1XSR A;  2ZA9 A;  3OGJ A;  2CWM A;  3GZT B;  3JXS A;  4D7T A;  5K9Y A;  3CQO A;  1UMZ A;  4E27 A;  5LK7 B;  3ZDV A;  3C7O A;  4GJZ A;  4LO4 B;  1XYO A;  2FDF A;  5IJR A;  1IQD C;  3J8F 1;  1CD3 G;  3R4D B;  5DZG A;  3WV6 A;  2ZJC A;  1JI6 A;  1IG3 A;  3IB3 A;  4IET A;  4X8P A;  3BKZ A;  5LWB A;  1DZQ A;  3NMB A;  4Z2A A;  4FVV A;  2VW2 A;  1BK1 A;  1UZW A;  2GN3 A;  5F7U A;  3AMH A;  2JG8 A;  2XOM A;  4PDW B;  1W6P A;  2BEO A;  1Q8P A;  3EB7 A;  3K3N A;  4ZPI A;  1VBE 1;  3N7L A;  4L97 A;  5F5C A;  4DUW A;  4BIF A;  3KCY A;  4Y3O A;  3FN9 A;  4JGY B;  4R52 A;  1OD3 A;  3X29 B;  1YLL A;  1QGL A;  1ND2 A;  2JB4 A;  2WYF A;  1NY7 2;  1WWY A;  1H2L A;  2XG3 A;  3R05 A;  3SIS A;  3UK9 A;  3VKO A;  4ARX A;  1YC6 1;  1RUN A;  4LBM A;  1F31 A;  2VR4 A;  5A7Q A;  3ZFF C;  4MX3 A;  4CPB A;  1GZW B;  3WF1 A;  4BA6 A;  2R6Q A;  4NE9 A;  2P6C A;  4XUO A;  2ENR A;  3HN3 A;  3VDC A;  3KVA A;  3ZN4 A;  4A7Y A;  4YWA A;  1HRV 1;  1X33 A;  2Q0A A;  1H1A A;  3AP7 A;  4PF1 A;  1COV 1;  4LBQ B;  1UZZ A;  4FI9 A;  4Q4W 2;  2WNU B;  2IXC A;  2YU1 A;  5KBF A;  3U4S A;  5L9V A;  3POE A;  4CU7 A;  1DFQ A;  1BZW A;  1UZV A;  1E5R A;  4YZ3 A;  2BWC A;  4Y1U A;  1W28 A;  3APB A;  3FX3 A;  1F5J A;  4WVW A;  5LA1 A;  3J8F 2;  3LFM A;  2BBA A;  4E8D A;  1DLC A;  1GOH A;  1O4Y A;  2PLV 3;  3P6B A;  4IE6 A;  5A1A A;  1OQD A;  3IPV A;  4MOA A;  1RHI 1;  3WW2 A;  1SLT A;  1QJU 1;  4IV1 B;  3G7D A;  5FZK A;  5JIU A;  2I2S A;  2ZGS A;  4NAM A;  3LEM A;  3NVC A;  1HB2 A;  5FMO S;  5FPX A;  2W1Q A;  2VH9 A;  5FOJ B;  1MEC 2;  3M3Q A;  5JSO A;  1ZZB A;  1QMJ A;  2ZZQ A;  1LOG A;  4YAR A;  2PHL A;  1ENQ A;  3KQ4 B;  1SDD B;  3AKP A;  2RR1 2;  4JX0 A;  4FPY A;  4QXH A;  2CAU A;  4I3G A;  4DFS A;  1PGL 1;  4YYO A;  2YBK A;  2X29 A;  3S5Q A;  3NWK A;  5A1L A;  4RA0 A;  2JE8 A;  1BBT 1;  4BDV B;  1KXG A;  1NT0 A;  3K77 A;  1W8O A;  1SPP B;  1LEC A;  1IS5 A;  1XOY A;  4IEY A;  2R30 A;  4LO7 A;  5JUV A;  4XOG A;  5F2W A;  3VBR B;  1VLN A;  4RR3 B;  5JPN B;  2IXI A;  3I2F A;  2UWB A;  2X10 A;  4MG2 A;  1NYW A;  4Q27 A;  5FBJ A;  1NOV A;  1YQ6 A;  1X8M A;  3MF9 A;  5KC6 A;  1UU5 A;  1C1L A;  4XF0 A;  2F6B A;  3HT2 A;  5CFC A;  4PLN A;  1ZBA 3;  1LHO A;  4GIQ A;  2CNA A;  1V6N A;  4QKF A;  4DQA A;  1BMV 2;  2WO2 A;  4CU9 A;  4KQ7 A;  1UY4 A;  3T2P A;  4XJA A;  1UYP A;  1RHI 2;  1QJY 1;  4NN0 A;  1SLC A;  4E4Z A;  1ZZ9 A;  4LKS A;  3U14 A;  5FZF A;  4F3J A;  4RSU A;  2V4A A;  1JOD A;  4RN5 A;  2BVV A;  4RS5 B;  2XBO 1;  2VZU A;  4QX2 A;  3TB0 A;  5IK8 A;  2AEZ A;  1QXJ A;  2HWC 2;  1PO1 1;  2XUE A;  3K4D A;  4WM8 B;  1ODN A;  3O0W A;  3N7J A;  4KWJ A;  3ALQ A;  1QEX A;  4QT6 A;  4Q4X 2;  1AL0 G;  1PO1 3;  2JIC A;  3UJO A;  2A7A A;  2FCT A;  1WLT A;  3FLT A;  3OSD A;  3SEE A;  3PME A;  3SIT A;  4BOW A;  5JZG C;  1JZ5 A;  1NG0 A;  3ZFF B;  2A3Y A;  3T3Y A;  4QPG C;  1J3P A;  1NCQ A;  3D6E A;  1EUU A;  5DG1 A;  2X09 A;  3HEI A;  4W6Y A;  1HLC A;  4TLG A;  3RQ0 A;  1N3P A;  2R06 2;  4XUQ A;  3J7M A;  1LTE A;  2WNV A;  3ZMO A;  2HEV F;  1OH4 A;  5F32 A;  5FCC A;  1ZYB A;  4UFH A;  3VBO B;  1D7P M;  2EF6 A;  3DYM A;  4HPK A;  5DUX A;  4AFC A;  1LU2 A;  4IXL A;  4COZ A;  5I0S A;  2WKK A;  4ONU A;  3PUH A;  3B69 A;  1AZD A;  4XPV A;  2VZV A;  5JVV A;  1A8D A;  4NMI A;  4AG4 A;  2CWS A;  1WA4 A;  4UFJ A;  1F9K A;  4XDP A;  1BMV 1;  4LBO A;  4E2S A;  2I07 B;  4KI5 M;  2GME A;  2ZEZ A;  4FTB A;  1OMI A;  1UOJ A;  3G6J B;  1NA1 B;  1E5H A;  3EJK A;  1QOS A;  1XBF A;  5C8W A;  4CE8 A;  1RIN A;  3K48 A;  3O1U A;  2E7T A;  1V6M A;  3ZXG A;  2ZHN A;  4QX5 A;  1RUG 1;  4ES8 A;  1F4A A;  1NXD 1;  3OGR A;  3JB4 C;  2DUQ A;  4OHY A;  2B45 X;  4HFS A;  4Y20 B;  5E89 A;  3QH6 A;  3CHX A;  2A6X A;  1RED A;  1NLR A;  1YJL A;  5DAW A;  5JI7 A;  5A7O A;  4CTE A;  3DPR A;  5C70 A;  3JD7 1;  1PGW 1;  4QQL A;  5ABJ A;  4KU8 A;  1UU6 A;  4KL1 A;  4HVR A;  1PIV 1;  3MGU A;  4WVM B;  1E5I A;  1AR7 1;  2VCM A;  3WP5 A;  1AXZ A;  3SMH A;  4P9J A;  3I3B A;  1POQ A;  1L3J A;  2PHF A;  1TG7 A;  4K6B A;  5GM0 A;  1AR9 2;  5J09 A;  2XL7 A;  4NJ4 A;  4N7I A;  3BI3 A;  3WUC A;  3PNA A;  4HXC A;  2JJ6 A;  4ASL A;  1PGL 2;  2DDU A;  2JIJ A;  2J1S A;  1ZRI A;  5FZ9 A;  2D6L X;  2RS3 3;  3UT0 A;  3ZSE A;  2W2I A;  3DF0 A;  5EYY A;  1O91 A;  4B1M A;  3TNP B;  4AGV A;  1K5M C;  3V0A A;  3LCP A;  3VDD B;  2WO3 A;  2PAM A;  5C8C A;  4IW3 A;  3OOX A;  5FLH A;  4CCE A;  2JG9 B;  2ZGO A;  2PQS A;  3R4S A;  3K4A A;  4HSJ A;  5FMD A;  4BQ2 A;  3RZZ A;  4S2D A;  2BP6 A;  2E53 A;  1SHW B;  3GF6 A;  2C24 A;  2P3K A;  2R32 A;  3RWN A;  1W8F A;  1HV0 A;  4R4Z A;  2A5Z A;  1XNA A;  3NL1 A;  1GYK A;  3KCX A;  3W9A A;  5AFE A;  4QHZ A;  2YDE A;  3Q9O A;  4MYE A;  3GHM A;  4Y5T A;  5J37 A;  4QPI B;  3OUH A;  4TZD A;  1GQP A;  1ULP A;  2KA3 A;  2A6Z A;  4FPK A;  2NMO A;  4F7Z A;  1R09 3;  1R09 1;  4MZU A;  3ZLI A;  3V64 A;  3AM2 A;  5DXD A;  3AL6 A;  2HWD 3;  2P4E A;  2WFF 2;  4JC1 A;  4XFH A;  3W5M A;  3WQ1 A;  2DTW A;  1AYM 1;  1XE8 A;  1NZC A;  5FY5 A;  4XF3 A;  2X53 S;  4XF1 A;  2RG4 A;  1K3I A;  3LB9 A;  3S30 A;  4H2A A;  3DUI A;  4FPO B;  4DMI A;  5JAX A;  5B2G B;  3JBG 1;  2C1F A;  3ZOI A;  4EZH A;  2VNG A;  1S0F A;  2VVD A;  2VQT A;  3ACG A;  1MQT A;  3JQX A;  3LIH A;  3N35 A;  4UW3 A;  4WVV A;  3CL1 A;  3NNF A;  3WNL A;  1ULO A;  4E4S A;  2VW0 A;  3NNG A;  2BBV A;  1SBE A;  2LTN A;  3OYW A;  4N9I A;  1OC1 A;  2ARE A;  1O5L A;  3AVS A;  3KV4 A;  4Q29 A;  3LIG A;  4QKB A;  4QPG B;  3WDY A;  4AFD A;  2PHU A;  4GD4 A;  3O0V A;  5EFU A;  2W9X A;  3L2Y A;  4BMB A;  3PTY A;  5AC9 1;  5BNN C;  3H8O A;  3A23 A;  4X6Q B;  3FC0 A;  4AQ6 A;  3FUQ A;  3ZFG B;  1N47 A;  2GNT A;  3R4U A;  1CJD A;  1UMH A;  5IVF A;  2XPJ A;  2C26 A;  1DF0 A;  1BHG A;  1R1A 1;  1NCR C;  1N3Q A;  5EJ1 B;  3IAQ A;  5T52 A;  4XFB A;  1FXZ A;  4MXW A;  2H0V A;  2XXZ A;  5IUQ A;  4IE7 A;  5EJ3 A;  4Y26 A;  2Y34 A;  4Q4X 3;  1WCS A;  2QCS B;  2D5H A;  1SFY A;  1CON A;  4P5Y A;  3V65 A;  5FOB B;  2VTX J;  1LGB A;  5LY2 A;  1YFX A;  1RUE 1;  2D6M A;  1RUE 3;  5D2A A;  3RFR A;  4CSW A;  3MDP A;  5AC9 3;  4N43 B;  3BN6 A;  3ZXA C;  1JH5 A;  2R07 1;  5FQ0 A;  1I9R A;  1FOD 3;  2UUR A;  3WQB A;  4DUX A;  5ISL A;  4AI8 A;  1OLM E;  2WAA A;  1AJK A;  4KNC A;  4B8E A;  4N90 A;  4AI3 A;  1GU3 A;  2HYK A;  3MW2 A;  1LGC A;  3J7N A;  4LHN A;  1W99 A;  3KF5 A;  1K5M B;  2CY6 A;  1GWK A;  5I91 A;  4CXY A;  2LRO A;  3H3U A;  3RZK A;  3KHC A;  3AP9 A;  3ACH A;  2ZGP A;  1O6U A;  5E1R A;  5FZL A;  4AGG A;  4RQP B;  2ZAB A;  1JYC A;  3OCP A;  3LDR A;  3PU3 A;  1FPN 1;  1VJ2 A;  3C7H A;  4MGQ A;  3VBH A;  3W20 A;  1CAV A;  1NE4 A;  1YHF A;  4J1X A;  1JBC A;  5LB6 A;  4GH4 A;  4PQQ A;  2G4I A;  1H4H A;  1CJP A;  1SAC A;  4IQP A;  4XFC A;  5CG9 A;  1U5Y A;  2GN7 A;  1PGW 2;  3FMG A;  5C3R A;  3ABZ A;  3VD7 A;  5CBL A;  1TE1 B;  1V6O A;  5JSP A;  3OPT A;  1FOD 2;  2VZQ A;  4TN7 A;  3D82 A;  3JZV A;  2DWR A;  1AX0 A;  1QU0 A;  4ZU7 A;  1BBT 2;  3LA7 A;  4PIZ A;  5K0U A;  3V0B A;  2EA7 A;  1B09 A;  1MZ5 A;  3H3L A;  3LEK A;  2KM2 A;  5BNO A;  1MZF A;  1OXC A;  2ES3 A;  5IFT A;  3VBU B;  3O7O A;  4GB3 3;  4QAW A;  3VBS A;  3JB8 A;  5BNP B;  1EAH 3;  4W8J A;  4BQ1 A;  5C8C C;  2BWA A;  4XTP A;  1RUI 3;  2VMH A;  5F3C A;  4GMP 0;  1XU1 A;  4KU7 A;  5FWJ A;  2NLR A;  4C1W A;  4YG0 A;  4CUB A;  2ZHM A;  1TME 1;  5LY1 A;  5KWR A;  1VIW B;  1OLM A;  1X50 A;  5IK7 A;  1MS5 A;  3UNP A;  4C1X A;  1E5S A;  2WT1 A;  2VJX A;  5J96 B;  2DU1 A;  1A6C A;  2Y60 A;  2WJS A;  4URT A;  3QH7 A;  4XMI A;  1L7Q A;  5E6H A;  2VBB A;  5FKB A;  2D97 A;  1OA2 A;  4K8F A;  2OT7 A;  1SG3 A;  4YM0 A;  4EN9 B;  5APA A;  4A3X A;  1AYN 2;  2LW8 A;  4ET7 A;  5L73 A;  3CF6 E;  1ND2 C;  3HIF A;  4R9B A;  4CEY C;  4HLT A;  1H8T C;  2VAU A;  2ETE A;  2WSU A;  2BNO A;  3ZIW A;  1HXS 3;  1OOP A;  4GQ7 A;  3WR0 A;  1BK0 A;  1OSG A;  2J22 A;  1LOF A;  2BGP A;  2XHK A;  4JGZ B;  3EQE A;  2VO5 A;  2B46 X;  5FPU A;  1W8N A;  4PI0 A;  5IAT A;  4MUV A;  3UKT A;  2ZTN A;  5JLV A;  5G05 L;  1OA3 A;  5CKQ A;  3L9J T;  4OI0 A;  3I2J A;  1QQP 3;  4YZ5 A;  3PJY A;  2YB7 A;  4IEV A;  1OFS A;  4ERO A;  3RGB A;  1DQ4 A;  2R16 A;  1RGS A;  4IE0 A;  2OQ6 A;  2WQ8 A;  4LOR A;  1IKQ A;  1BJQ A;  1DGL A;  4CCC A;  2J1V A;  5J3U A;  5KR7 A;  4RGA A;  1JZ3 A;  5A3W A;  1QDC A;  4FSJ A;  4H7L A;  1CVN A;  2VOV A;  5KXD A;  4FT8 A;  4PHZ A;  4R8H A;  4I30 A;  1XND A;  4NHL A;  3I8T A;  5G04 L;  3VKM A;  5F8P A;  2QQW A;  3TNQ A;  2UWA A;  2W08 A;  3HD8 B;  4LKF A;  3VGI A;  5GLV A;  2XKO A;  5C71 A;  1Y3T A;  3T4H B;  3PTR B;  1RMU 2;  5ERL A;  2WLQ A;  1QNY A;  2VL4 A;  3NJZ A;  2VOT A;  3VBR C;  5FLJ A;  2VUA A;  1UY0 A;  4TXW A;  4FPJ A;  1TNR A;  5A7S A;  4P02 B;  2VZR A;  1IG0 A;  1W3V A;  3C7F A;  1S0I A;  4KWK A;  2DCZ A;  4XCB A;  4MAD A;  5C33 A;  4CUG A;  3T08 A;  2Z79 A;  5KHG A;  4Q0Q A;  4WM7 B;  3S5A A;  2F17 A;  4MGI E;  1X82 A;  1DZT A;  1VBC 2;  2D44 A;  4CP9 B;  5L9R A;  5JXI A;  1HIX A;  2Q1Z B;  1HRV 3;  1CN1 A;  3VHN A;  1F4H A;  1ONA A;  2XJU A;  2JE9 A;  5FY0 A;  5DN2 A;  2PMW B;  2YC0 A;  4K1Y A;  5CB7 A;  4BCU A;  1KQR A;  2WC2 A;  1F35 A;  1WCU A;  2DVF A;  3ZFE C;  5I93 A;  2V73 A;  3B9I A;  1C5H A;  1VR3 A;  4JDM A;  2JDY A;  2VGD A;  2R49 A;  2DUR A;  1ZBA 1;  3H1M A;  4C0B A;  3BYW A;  1KDM A;  3TEX A;  1IGO A;  3GZE A;  1FV2 A;  1WD3 A;  1CX1 A;  1PNG A;  1LEN A;  4LUL A;  1K5J A;  1X9P A;  1XYN A;  2CYF A;  1EPW A;  2AEN A;  4XYX A;  3ZO0 B;  1HDK A;  1VE0 A;  2OZJ A;  5FKC A;  3WG2 A;  2WZ8 A;  2VEC A;  4C91 A;  3LSE A;  1W06 A;  4M00 A;  2PFW A;  4AFA A;  4FFG A;  1WD4 A;  3WW3 A;  3FHA A;  1KS4 A;  2ZX2 A;  5T55 A;  3P3P A;  2PXJ A;  5FMO L;  2HJI A;  1YIP A;  1KD7 A;  3MPP G;  1SFP A;  5A7P A;  1PK6 C;  2ET1 A;  3EMR A;  5K4L A;  1GP5 A;  3M4F A;  2WBK A;  5GZG A;  2QTW B;  1MS8 A;  4Z92 B;  4YGB A;  3HQX A;  1NCQ C;  3SH3 A;  3IT8 A;  3U0Z A;  3H42 B;  1N1T A;  1SMV A;  3PUS A;  1G7Y A;  2VVF A;  2XWB B;  2Q1F A;  4JHT A;  3VL8 A;  1EAH 2;  1V9U 3;  3M3E A;  1AXK A;  2VNO A;  1V9U 2;  1MS9 A;  2W68 A;  1H6X A;  2IFW A;  4FQZ A;  5GJ6 A;  3WLU A;  1OKQ A;  1JYN A;  4OUM A;  4M3C E;  4KGG A;  5FPL A;  5M0T A;  4YSF A;  4BQ3 A;  2YGM A;  1WCQ A;  3WSO A;  3WG3 A;  4Q26 A;  4XXA A;  3NKT A;  5FXZ A;  1UOF A;  5FXW A;  2G9Z A;  1LHU A;  1M4W A;  3ZYR A;  2BV4 A;  1QJU 2;  4IV3 B;  2YZ4 A;  1COV 3;  4JGZ A;  3WW4 A;  5HXV A;  5LRR A;  1LCL A;  1R08 1;  3JU9 A;  2QDR A;  4LIU A;  5FJK A;  5FK8 A;  2B7Y A;  4N53 C;  1H8T A;  4PI2 A;  1O8P A;  3IMN A;  4XAE A;  3W58 A;  1A34 A;  2LM3 A;  1OUR A;  3MIB A;  3MIF A;  1UYZ A;  3CIH A;  3M8L A;  4UW5 A;  1V6J A;  3BU0 A;  2QKD A;  4C8D A;  1Q8Q A;  1S0J A;  4CCM A;  5CFC C;  1CZV A;  4CU6 A;  5DPN A;  4RHV 3;  3O1V A;  4LE3 A;  4GA9 A;  4BHP A;  2YPJ A;  2Y6K A;  5JXG A;  1DCS A;  4MGS A;  2JDN A;  4PBO A;  5FPA A;  3UES A;  5FDB A;  4UXA A;  2V5D A;  1OF4 A;  3ZDS A;  4AZZ A;  4EYU A;  5ACA 2;  4PLM A;  3VD3 A;  4HVQ A;  1DYP A;  4FFI A;  4TTG A;  1E57 A;  2G1M A;  2RS3 2;  2W1W A;  5E16 A;  3VHO A;  4BB3 A;  5A1F A;  5FYU A;  4BIO A;  4FCA A;  2BW8 A;  4XC9 A;  1OT5 A;  2YG0 A;  1UQX A;  2VOW A;  4BH9 A;  4YNI A;  3PVE A;  4AGR A;  1O8S A;  3MBW A;  4MHR A;  2J1A A;  5FTT C;  4DUV A;  1MEC 3;  5DUW A;  1JZ2 A;  2VMC A;  1HRV 2;  4LUM A;  1YFW A;  1LHN A;  4U2A A;  4Y5Z 0;  1G9D A;  2ARA A;  4ZU4 A;  1KFX L;  5LA9 A;  5E8A A;  1OF3 A;  2ZMN A;  4HN1 A;  4CDU A;  2IUW A;  2CGN A;  3NW4 A;  3RI9 A;  1W6O A;  5DZF A;  5C9A B;  1IPS A;  2WNU C;  1DYO A;  4GH4 B;  1WUV A;  1WBL A;  2WL1 A;  4JRL A;  5LBF A;  1F15 A;  1W8U A;  4D94 A;  2XLF A;  2XJS A;  1I5P A;  1UXX X;  3RZL A;  2VXR A;  1V00 A;  3AVR A;  4BJ0 A;  1K42 A;  3S7E A;  4NWW A;  1CR7 A;  2VPV A;  1Y4W A;  4ORF A;  5FZE A;  3UYJ A;  1J59 A;  1RIR A;  1OLR A;  2EID A;  2WYS A;  4GKY A;  4ZZ8 A;  2J1U A;  3EHK A;  4AQT A;  2WQ4 A;  4QM9 A;  4HK9 A;  1NXM A;  2QBX A;  5DG2 A;  4RR3 C;  2UYA A;  1D2S A;  4RQP C;  2B5H A;  3ZYJ B;  5C3P A;  3PMS A;  1C8M 1;  2JDM A;  2QUO A;  1AL2 1;  2IXK A;  2PYT A;  2JDU A;  2VUL A;  1ZZ7 A;  2ET7 A;  1GOG A;  1CAX B;  3DPR C;  3NJX A;  4LK6 A;  3MZH A;  1RHI 3;  2IC1 A;  5FIX A;  5I0U A;  4CEY B;  2EAK A;  3LF7 A;  2PLV 1;  5LAS A;  3RZG A;  5LW9 A;  2DCK A;  4R9A A;  3RSJ A;  4LO6 B;  5BNN A;  4LKD A;  2JB8 A;  4A4A A;  3L2H A;  1RIT A;  1ND3 A;  4XDO A;  2P37 A;  3I3E A;  3NJV A;  3OY8 B;  4Q0V A;  4ZU5 A;  4MXW B;  4YVS C;  3WOG A;  4CDQ C;  2GP3 A;  2VU9 A;  3I2O A;  2JDA A;  2ZEY A;  1UXZ A;  2JWP A;  4JAA A;  1BVP 1;  4QQH A;  5C6C A;  2Q30 A;  5A6Y A;  4OQ8 A;  5D21 A;  3VBF A;  3K46 A;  3KT1 A;  4I09 A;  1UX7 A;  4PIX A;  3IWZ A;  4YZ2 A;  4FTS A;  1HV1 A;  2HWB 1;  3USS A;  4AQ2 A;  5IFP A;  3K2O A;  1R1Z A;  3D4K A;  2X5I A;  1B35 C;  5LAT A;  4XBQ A;  3OYW B;  3P3N A;  1GP4 A;  4BQY A;  4W4Z A;  1AR9 1;  1LEM A;  4XHB A;  5CFD C;  3LE0 A;  1NQD A;  4XF4 A;  3O14 A;  4L8Q A;  2VNR A;  1LAJ A;  4Q0U A;  1DBN A;  3KLS A;  3PVB B;  1RUJ 2;  3BPZ A;  1TEI A;  3CKH A;  4HSL A;  2ORX A;  1PZ7 A;  3PIJ A;  5JDB A;  3LPG A;  3MLL A;  3POY A;  1HW5 A;  3AYC A;  3CJI A;  1X9T A;  5T54 A;  2RM2 1;  3KT7 A;  2MNG A;  1IPK A;  2Q5T A;  3SQO A;  2PLV 2;  3IDC B;  3MUY 1;  4N53 B;  3N9Q A;  4Y22 B;  1AXY A;  1HXS 1;  5A7W A;  2R0H A;  2RV9 A;  4AED C;  2OXB A;  1XPW A;  4GWI A;  3AZY A;  4AHX A;  5CAD A;  3AMN A;  2CAV A;  2WSV A;  4QDQ A;  5JOX A;  1NQJ A;  4P9I A;  5FZB A;  2DF7 A;  4K8R B;  4RS5 C;  5HCB A;  2RS1 3;  3WVJ A;  1RVF 3;  4N53 A;  4Y22 A;  3FZ3 A;  4UYB A;  2HBU A;  1WKY A;  2JG9 A;  2VBD A;  3N36 A;  5FY8 A;  4A42 A;  3H1Y A;  4AWD A;  4D7S A;  2A1X A;  3OTF A;  4QHO A;  5K0U C;  4FPL A;  4PLO A;  3J9S A;  1OQE A;  3WT3 A;  2NPI A;  2ZGU A;  3U78 A;  1AR8 2;  4UI9 L;  3WX5 A;  3LDK A;  4OHV A;  4QXC A;  2CSG A;  3HN1 A;  4A7Z A;  1UD1 A;  4K7J A;  1J3Q A;  4FXG B;  3ZYH A;  1NLS A;  2ADD A;  1JW6 A;  3KMH A;  4CDU B;  3MYX A;  2R04 1;  2HWF 1;  4BXS V;  3ZPY A;  1SCS A;  2ZGR A;  1RUG 3;  1ZVF A;  2BTV C;  3BTX A;  5FYC A;  3B94 A;  3OUJ A;  2VUC A;  4DOU A;  2XH6 A;  3UGF A;  5A3P A;  3VL9 A;  4ZHN A;  1VBB 3;  5L19 A;  2UWC A;  4B3N A;  5BNP C;  3VBF B;  2A73 B;  2XL9 A;  2KD7 A;  2W46 A;  2BOI A;  3H1W A;  1C8N A;  1RUC 3;  2OX0 A;  1CAW A;  4Q1R A;  3DL3 A;  4Q5O A;  4Y20 A;  3ZXF A;  4JKL A;  1JOP A;  4XET A;  1Z7S 1;  1ND3 B;  1MS1 A;  1HN0 A;  4LA3 A;  5BNN B;  2EXJ A;  1LHW A;  4HZF A;  1NA1 A;  1QQP 2;  4Q4W 1;  3ATG A;  3WW1 A;  1UKR A;  1CAX A;  2FDH A;  1RUE 2;  1JZ8 A;  4M01 A;  2QQO A;  2VZO A;  1GOF A;  3LKJ A;  1POV 1;  1Q43 A;  4YW1 A;  3VKL A;  4NOT A;  3WDV A;  2ID4 A;  5FYY A;  1PO1 2;  4AXO A;  1FMD 2;  3WG4 A;  3MW3 A;  5C7G A;  1JZ7 A;  4QQO A;  1H8T B;  1FMD 3;  5F3E A;  1HRI 3;  4OUE A;  4QXB A;  1W2O A;  5FFO C;  1IS6 A;  1US2 A;  5IYY A;  3Q8F A;  1GUI A;  1J1T A;  5LEK A;  1JMU B;  1UMI A;  1SDW A;  1GSL A;  1GNH A;  2JKX A;  3B02 A;  4JTN A;  5KHI A;  2QQI A;  4TLF A;  4BLJ A;  3III A;  4QPW A;  1NCQ B;  2XDV A;  4K21 A;  2AR6 A;  3ZFF A;  2QQN A;  5J98 B;  2VTX A;  3ENR A;  2BDR A;  2C5D A;  4SBV A;  1A8M A;  4Q4Y 1;  5BNO C;  2BYV E;  4CCD A;  3C7E A;  1XB9 A;  4LQR A;  4Y5S A;  4DO0 A;  1Y43 B;  5FUN A;  3VKN A;  1UWW A;  2EVX A;  1JN2 P;  4L0P A;  5C9A A;  1W6O B;  2HBT A;  2OUJ A;  1ND3 C;  1S1A A;  5LBB A;  3M2M A;  1TME 2;  3OBA A;  5FZC A;  1MS0 A;  4FQ4 A;  5CA6 A;  1BKZ A;  1K12 A;  1S0G A;  2RJ2 A;  5FZO B;  3N3H A;  3S57 A;  2XVL A;  1SLA A;  1ULG A;  3SKJ E;  1AYN 1;  5DAX A;  5FYB A;  5FO7 B;  2YMZ A;  2KR2 A;  3POF A;  4NPM A;  5FP3 A;  4PCR A;  5C4W C;  1W9F A;  2DV9 A;  3K3O A;  2VUD A;  1DYK A;  5DDJ 2;  3U75 A;  1YQ5 A;  1XE7 A;  1EP0 A;  4UWD A;  3VHP A;  3JBG 3;  2PN5 A;  2D7F A;  5BPX A;  4DRV A;  1Q8S A;  4JKK A;  2L9L A;  1AR9 3;  1ZBE 1;  1UOG A;  2VUJ A;  2NP0 A;  1LB2 A;  3E97 A;  3DYO A;  3CJX A;  4A41 A;  2BNM A;  3N9P A;  4YGD A;  1YI7 A;  2LS6 A;  2YPD A;  3D3A A;  1LOF C;  1AR7 2;  1SPP A;  1V6I A;  2VBP A;  2HWC 1;  4IND A;  4ZON A;  3M70 A;  4E4D X;  1KEX A;  3OPW A;  2ZGQ A;  4FOQ A;  4FP2 A;  5HBA A;  1AHS A;  5T5P A;  4AHW A;  1PM4 A;  3LFI A;  3VB9 A;  3TOJ A;  3H9A A;  2G9G A;  1JYW A;  3RG0 A;  1RUC 1;  2ARC A;  4DXT A;  3B5L B;  5KXB A;  5HCA A;  1DQ2 A;  4RFT 0;  3OEB A;  1COV 2;  2PEL A;  5D8A C;  1J1L A;  1D4M 2;  2DFC A;  4GMP 3;  1GV9 A;  1YYN A;  2R1B A;  1J3R A;  1DQ6 A;  3I2K A;  4Q4W 3;  4CP9 A;  3RMY A;  4IV3 A;  4TWT A;  1FX5 A;  5IT6 A;  4O9G A;  2OYZ A;  2A3W A;  3MHZ A;  1FPN 2;  5B4N A;  1YFU A;  2IXH A;  3NAP C;  4Z8B A;  1D0H A;  3WDU A;  3RZM A;  4FPG A;  3ILR A;  2BER A;  5JWP A;  5BUV A;  2JIG A;  3IN9 A;  3MIH A;  3J4U H;  3N9O A;  3WCS A;  4B1L A;  2CDP A;  4JZR A;  3LA3 A;  2QQJ A;  5TSW A;  4AHY A;  2Y6L A;  5F5I A;  3WNN A;  1QH7 A;  2GNB A;  4CRQ A;  1C4R A;  4R9C A;  1FOD 1;  3FBM A;  4HN0 A;  4IEX A;  3VKF C;  3FFZ A;  1PZ9 A;  1ZBE 3;  1PMI A;  2DBN A;  3DYP A;  1VRH 2;  1ZBE 2;  4IEO A;  2YC2 A;  4RL7 A;  2J1E A;  2VCC A;  5FYM A;  2W91 A;  1AL2 3;  3LEI A;  1OUS A;  3GZA A;  1ZRR A;  1DGR N;  4JVA A;  1ZBA 2;  2IVJ A;  2RS1 1;  3E5U A;  2AYH A;  2ZMK A;  2R7E B;  2O14 A;  2WZR 2;  3CBN A;  1BCX A;  4PF5 A;  3RZJ A;  4AW7 A;  2VXJ A;  4AL9 A;  2PQQ A;  3E6C C;  1AYN 3;  2ZEW A;  3NV3 A;  5H9P A;  3PLQ A;  4OQ9 A;  1Q8O A;  4CXX A;  3VDA A;  4JGY A;  2E33 A;  3O5S A;  1UYX A;  2JEN A;  4Q4V 2;  1MVE A;  3WNO A;  3BB6 A;  4XIK A;  5FZD A;  2ZCW A;  4QDS A;  3KV9 A;  2NYY A;  4QPI C;  2JG8 B;  2FDG A;  1ULE A;  3GM8 A;  4W6W A;  1HQL A;  2O8O A;  1MZ6 A;  4P00 B;  3A21 A;  3SCF A;  2QZ2 A;  3BUC A;  2B9U A;  4AVV A;  1O3S A;  4MO3 M;  1S0E A;  4K20 A;  2MEV 2;  1A3K A;  2AUY A;  2WZP P;  4AFB A;  1MR5 A;  2WA3 A;  4LO5 B;  1HRI 2;  1QJY 2;  4IES A;  4QKD A;  1RUH 1;  3O1T A;  4BXF A;  1X36 A;  1NUK A;  3S7I A;  2J7M A;  4FP3 A;  1MZE A;  2FQP A;  3BTY A;  4IV1 C;  4XZP A;  3FJS A;  3SC7 X;  3KSC A;  1RUJ 1;  3UJQ A;  3W5N A;  2ZAA A;  4IDZ A;  1JOB A;  1J83 A;  1YIF A;  3VLB B;  1SFN A;  1LHV A;  2VQA A;  2WS9 2;  2A71 A;  3GAL A;  3T2O A;  2JD4 A;  3OPZ A;  4E8C A;  3MIE A;  4QD2 A;  2HWD 1;  1HQN A;  3A4U A;  5ABJ C;  2FZ2 A;  1GZ9 A;  3ZSK A;  2FMD A;  1QH6 A;  5GZE A;  4NUB A;  1Q3E A;  1SQ4 A;  1TQ5 A;  3IAP A;  1ZX5 A;  3OBT A;  3THD A;  1YQ8 A;  2ZPX A;  2B39 A;  2D93 A;  1S55 A;  3B3Q E;  4J6G A;  1AYM 2;  2HWE 1;  2TNF A;  3V0B B;  5FZO A;  2E63 A;  2JG8 C;  3KVB A;  2JXA A;  1VAM A;  2JDP A;  1VBE 3;  4D8M A;  1EV1 3;  4JGZ C;  2Y8K A;  1ULC A;  1AR8 1;  5DDJ 3;  4NIG A;  3SEP A;  1PX4 A;  3IBM A;  4ZXK A;  2ZGK A;  2F4L A;  2IVI B;  3I3Q A;  4K40 A;  4QHB A;  3VBH B;  2GU9 A;  3OUI A;  3PUQ A;  4BWO A;  4BK4 A;  4KG0 A;  5A3T A;  5T50 A;  1VBC 1;  2JX9 A;  1XNC A;  2HKX A;  2XJT A;  3TAY A;  2MHF A;  1QJF A;  5EXO A;  1TMF 2;  4CCK A;  1AR7 3;  5GZF A;  2EIE A;  1K5M A;  2YYO A;  1PMJ X;  3PVN A;  4COU A;  1XU2 A;  4ES9 A;  2PTM A;  2RDS A;  5SV8 A;  2OUH A;  3IDA A;  3CEW A;  4L2N A;  4O9E A;  2XQX A;  5F3I A;  1RUH 3;  1PNF A;  2N7G A;  4M0H A;  2WT0 A;  5FQ0 B;  1U0A A;  4LOS A;  4P9X A;  4N43 A;  3RYR A;  1IKP A;  4UOJ A;  4XFI A;  4MET A;  4XE9 A;  4XBL A;  4FBF A;  1ZA7 A;  2O0O A;  5IW0 A;  1T6B X;  1WMF A;  2RM2 3;  3ME2 A;  4XZU G;  1RUD 3;  3HT1 A;  5GKA C;  4AHZ A;  1URX A;  2R07 2;  2ILM A;  3FE5 A;  2K2S A;  1HXS 2;  3NV4 A;  2YHJ A;  1J58 A;  5T5O A;  1UPI A;  3BIW E;  2CGP A;  2EXI A;  2EXH A;  3IKW A;  3GJB A;  4IV3 C;  1CAW B;  1Y9M A;  1HJG A;  3P5B A;  4CCJ A;  2DUO A;  2J1T A;  3AKS A;  4OYU A;  4X8N A;  3BOW A;  1W8Z A;  4NHM A;  3VBS C;  4JTO A;  1UKG A;  3T09 A;  5JMO A;  3RWK X;  2OII A;  3AJY A;  5L9B A;  1PMH X;  2E6V A;  2OPK A;  5BNO B;  4Z1V A;  3AKR A;  4UT5 A;  1JUH A;  2GH2 A;  1ODM A;  2W39 A;  3TBD A;  1QJU 3;  4XJ8 A;  3CZJ A;  5KXE A;  1DG6 A;  2RDR A;  3AP6 A;  2A3X A;  2C4X A;  4AFM A;  2D3P A;  2DU0 A;  2RS5 2;  4EN0 A;  1VMF A;  2OPW A;  1ULD A;  2AGS A;  2NZ9 A;  1CAV B;  1O7F A;  2VW1 A;  3HOB A;  5FZ8 A;  3VZL A;  3AKT A;  2ARB A;  4MGK E;  4RQP A;  2BOJ A;  4Q8K A;  2BFU S;  1AR6 1;  3DKQ A;  1OI6 A;  1R08 2;  3T1L A;  4Z82 A;  1VBA 2;  3QCW A;  1OLQ A;  1AF9 A;  4LHS A;  4Y24 A;  4SLI A;  4AAX A;  1YRZ A;  2XKP A;  4GMP 1;  3IDB B;  3MW4 A;  2P3Y A;  4GZ9 A;  4QPI A;  4OZX A;  1WLW A;  3KZ4 C;  1PVC 2;  5BNQ A;  4YZ1 A;  4UBH A;  3TEZ A;  1BEV 1;  4UF0 B;  1GBG A;  2Z69 A;  4QWN A;  5A7W B;  2DFB A;  2W3J A;  4UFL A;  4NWV A;  3NNJ A;  4NO4 A;  1SEF A;  1U5Z A;  4IL7 A;  1JYT A;  2P6H A;  4QU1 A;  1RUD 1;  2CDO A;  1W8W A;  4MHU A;  3S0M A;  1SZB A;  3CJI B;  5FO9 B;  2VTF A;  2R0F A;  1W0N A;  3MIG A;  5C8C B;  1YJK A;  1R1A 2;  3MV1 1;  3MV0 1;  3V0A B;  1XJA A;  1BBT 3;  2XUM A;  3GNE A;  4Y1Y A;  3NKG A;  4H14 A;  2D6O X;  3N7K A;  4BLI A;  4EWD A;  1QXP A;  2GP5 A;  2WNV C;  2WN2 A;  3PHM A;  4BYY A;  5LCW L;  4OUL A;  5FZH A;  4FOV A;  1UN1 A;  2C9K A;  5J1X A;  1W39 A;  3ORJ A;  3AK0 A;  1FAT A;  2OVU A;  2LUW A;  2VCB A;  4YW3 A;  3VBH C;  4CCN A;  1X8E A;  1APN A;  1JTZ X;  1QKQ A;  3PUR A;  5L36 A;  1EY2 A;  1XXN A;  5BXX A;  1H1M A;  1KFU L;  1VP6 A;  2Y64 A;  4LBN A;  2X5I B;  2VMD A;  4XVH A;  3ROU A;  4CCL A;  3K4Z A;  1ZZ6 A;  4W50 A;  4WVM A;  3TWI A;  2BU9 A;  5FYV A;  4NHX A;  4JQT A;  3TN9 3;  3VZJ A;  4OI1 A;  4AVT A;  1S2B A;  2DVA A;  3I59 A;  4BQ4 A;  1T6G C;  5FYZ A;  2ZHK A;  4XUP A;  4AVC A;  2P34 A;  2E7Q A;  1MQT B;  4Y1X A;  4DEV A;  5JR7 B;  2W94 A;  4XAC A;  3OY8 A;  4YW6 A;  4P9Y A;  3RYK A;  1IZ3 A;  4YW5 A;  3GXU A;  3PUA A;  5EP9 A;  1J84 A;  3HBK A;  1AR6 3;  1TMF 1;  2WFF 3;  4CEY A;  2D6N A;  1W0O A;  2XON A;  2EXK A;  3WHU A;  1KRI A;  3LDB A;  4KG8 A;  4QB6 A;  3N9L A;  4B4Q A;  2ZS6 B;  3E1F 1;  3I2D A;  1TZO A;  5LRS A;  1DLL A;  3NAP B;  2X05 A;  3WNP A;  5C3O A;  2BZD A;  4S2H A;  2FHR A;  1I5Z A;  2W52 A;  1CIW A;  2FBE A;  1EAH 1;  4HK8 A;  4JHZ A;  2XBO 3;  3VBO A;  3PJQ A;  5FYT A;  5CKN A;  5K8S A;  4KWU A;  5EPA A;  1RUF 2;  1G9C A;  4WM7 C;  4JKM A;  2FDK A;  3POB A;  5D8A B;  5JI9 A;  3M7A A;  5DUV A;  3DCQ A;  3AJZ A;  3AMQ A;  1PZ8 A;  2WZE A;  2VVE A;  2R06 1;  2BNN A;  1CPN A;  1QJE A;  4GWJ A;  4XIL A;  3VDD A;  5F37 A;  1W3X A;  2GNM A;  4O61 A;  4BU2 A;  3QBQ A;  5CKM A;  5F2S A;  5KHK A;  1FV3 A;  5C4W A;  4FXK B;  4LBQ D;  4WM8 A;  4ZXE A;  4LBL A;  3UL2 A;  4LPL A;  3R0R A;  4GB3 2;  1DDL A;  3HVD A;  3SHR A;  4W6X A;  2NM1 A;  3BGA A;  4NRP A;  2V09 A;  4R9D A;  3S6P A;  2XQR A;  3KGZ A;  2R04 2;  4XAB A;  5FXX A;  5JMC A;  1BQP A;  3ZSL A;  3MFC A;  1LOC A;  3J8F 3;  3VUO A;  1HX6 A;  4YG3 A;  3OG2 A;  2D43 A;  1H9W A;  4H7M A;  5FMB A;  4DB5 A;  3DPR B;  1RTV A;  4OMD A;  2XML A;  4AK3 A;  5HPO A;  1SBD A;  4QQ2 A;  3H0O A;  4CZS A;  5LA0 A;  4DXR A;  2G19 A;  3NQH A;  4XF9 A;  4BME A;  4CDX C;  5A33 B;  1OPM A;  3I2H A;  3VBR A;  1Z7S 2;  2QJV A;  4E4H A;  3NNM A;  4JRA A;  2HWE 2;  1XQN A;  3KQR A;  1GNZ A;  1WW5 A;  1JUI A;  1BEV 3;  2K46 A;  4LE4 A;  5CIS A;  1KS5 A;  2JEM A;  3ZPO A;  3ZXD A;  4XW3 A;  1L7R A;  2FMY A;  3ZSJ A;  5IWF A;  1PHM A;  1PIV 3;  2P1B A;  4XJZ A;  1ENX A;  3PU8 A;  2YV8 A;  3I97 A;  2ZGN A;  5FY4 A;  3U37 A;  3M3O A;  1QJX 3;  1O3T A;  1FMD 1;  3KWV A;  4HPK B;  2VZP A;  4FO9 A;  4HOO A;  2OA2 A;  4P9G A;  4YLZ A;  4OUS A;  3NV2 A;  1DQ5 A;  4HAN A;  2FDI A;  1HB3 A;  2Z5W A;  1WGP A;  1NLQ A;  2YC4 A;  1XC6 A;  4XJ9 A;  2BVB A;  1VAV A;  1UZ0 A;  4LMF A;  3WNM A;  2VM9 A;  3VZM A;  1BYH A;  1ZRF A;  1W05 A;  3U11 A;  2B8M A;  3TEY A;  4H55 A;  2EIB A;  4PT6 A;  4OLL A;  1CZS A;  1YUD A;  3AP4 A;  5JOZ A;  4IEU A;  4JV4 A;  1UW8 A;  3AYE A;  2Z2S B;  1Q56 A;  3ZM8 A;  5IK5 A;  2PHD A;  3H3Z A;  4QB2 A;  4KGQ A;  5GLT A;  4FOY A;  4A44 A;  4AI2 A;  3UKV A;  2H6C A;  1V0A A;  1V6K A;  3RJR A;  3AZX A;  2A70 A;  5JR2 A;  1W90 A;  1HKD A;  5A3U A;  4EZ4 A;  3I7D A;  5ACA 1;  3AXD A;  4QGN A;  5EZW A;  2W47 A;  1QDO A;  4P14 A;  3POW A;  5FY7 A;  2VE1 A;  2WO1 A;  1UL9 A;  2ZAH A;  1F5F A;  1H9P A;  1RMU 1;  1ZRC A;  1QWR A;  3SH5 A;  4Q8L A;  5K7P A;  4QXK A;  5CFC B;  1QOO A;  4LHK A;  1GMM A;  2G9F A;  4GJY A;  3VN4 A;  4A7K A;  1PGS A;  1DGW A;  1G6N A;  2R07 3;  1I1E A;  5FY9 A;  4YM3 A;  1W2N A;  4RR3 A;  3ASI A;  3USU B;  2Y38 A;  3BOD A;  3WD5 A;  4C90 A;  2ZEX A;  5EQU A;  4GUL A;  5JIA A;  1IHM A;  3FL7 A;  4BPZ A;  2RJK A;  5DZE A;  2HEY F;  5FYH A;  2C0Z A;  3FLR A;  3AKQ A;  2DBI A;  2QQL A;  2VQU A;  2WUH A;  4NIA A;  4FAG A;  1W2A X;  1AX2 A;  4AEJ A;  1VMH A;  3SKV A;  1GQG A;  5L7O C;  3LGR A;  2ZGL A;  2NMN A;  4PBP A;  3C2U A;  1S0C A;  4CDX B;  1DHK B;  1VMJ A;  4WV8 A;  5C3S A;  4K9S A;  4NID A;  3RVH A;  3MFA A;  3WNX A;  2Y6G A;  4I2O A;  2YXS A;  2RS1 2;  3VDD C;  3OB8 A;  2RM2 2;  4Q4X 1;  2LRP A;  4MGY E;  4WM7 A;  1I6X A;  2GC0 A;  1F2N A;  2JEC A;  2RE9 A;  4ISQ A;  3HNB M;  4ZS3 A;  3HQR A;  1WLD A;  3IPV B;  1KJL A;  1XRU A;  3WP6 A;  4D6R A;  4EN7 B;  4BM8 A;  1GR3 A;  5FZM A;  1RMU 3;  4HL0 A;  1OUX A;  5FP8 A;  3U1X A;  2RR1 3;  1YNA A;  3H50 A;  1POV 3;  3C7G A;  4GB3 1;  2VCA A;  3O1R A;  3NST A;  4LBK A;  5A6Q A;  4ATE A;  3BTZ A;  2HWE 3;  3ZXL A;  4TSV A;  5B4X A;  4JCK A;  4LR4 A;  2WNU A;  1U5X A;  1LNS A;  3POS A;  3AXE A;  1D0G A;  1RUI 1;  1S2K A;  2PAE A;  3B9C A;  4LXL A;  4ASM B;  4EWA A;  1QY4 A;  1OFN A;  4QQP A;  2OS2 A;  1H8V A;  4QMA A;  3ZKY A;  1GZW A;  3AYA A;  2ADE A;  4NVP A;  4A6S A;  4HKL A;  4QU2 A;  4WVZ A;  4QGL A;  3GCW A;  4O7X A;  5EHD A;  2IWG B;  2QQV A;  1H30 A;  1C8M 2;  1JZ4 A;  5DQ0 A;  5FZ0 A;  3PDQ A;  3PL0 A;  2WAB A;  3KM5 A;  3RRD A;  3H8R A;  1WME A;  1DGW X;  4BQW A;  2WWS A;  3AMP A;  1KIT A;  4WZC A;  3N7M A;  4XCA A;  4YRD A;  3U4X A;  1W6Q B;  3NNL A;  1D2Q A;  1KDK A;  4PDW A;  4Q0S A;  5F5Q A;  5GAL A;  2K0G A;  2P17 A;  1Z7S 3;  5T5J A;  1HB1 A;  2RHP A;  4CDQ B;  1OOP B;  2RS5 3;  4JDN A;  3ZYG A;  3UV9 A;  4BQX A;  3JD7 2;  4M3C A;  2XLG A;  4DPN A;  2VOK A;  1W0P A;  3E5Q A;  1WLC A;  2GMP A;  4DY5 A;  2VMF A;  3T0A A;  2E31 A;  4P5H A;  1JHJ A;  2DTY A;  2DVB A;  2H6B A;  2PAK A;  5IVB A;  3GBG A;  5A7N A;  3RYP A;  4COV A;  4YVS A;  1GP6 A;  1CPM A;  1RL3 A;  2AH2 A;  4X6R B;  5I8S A;  3KB5 A;  5CFD B;  3BTA A;  4RYD A;  2VC9 A;  2BRT A;  2E32 A;  3ZXJ A;  3ZN6 B;  3NRU A;  1YFY A;  1LOE A;  3BVC A;  5J48 A;  2Y6H A;  3QAC A;  1REF A;  3IIA A;  4XDQ A;  5FP9 A;  3LQC A;  1CWP A;  4OZO A;  4Q0P A;  1FI2 A;  2RVA A;  1B35 A;  2WFP A;  3NJY A;  2UY9 A;  4OMC A;  3VBS B;  4ASK A;  1ASJ 3;  5A3M A;  4P9W A;  5BNP A;  2YU2 A;  3VBU A;  3GYD A;  3UGH A;  2UYB A;  1W6N A;  4EN8 B;  4AAP A;  5ANN A;  1OPO A;  4HBN A;  5KHH A;  2A75 A;  4QGM A;  1OH3 A;  1UY1 A;  4N9H A;  1QJX 2;  2DYC A;  3HAG A;  3NV1 A;  5K0U B;  3OJB A;  2GC1 A;  3T0D A;  1O4T A;  3WXP A;  3P1I A;  1MAC A;  2D3R A;  2WN3 A;  2WA4 A;  4K3U A;  1V6L A;  1RUF 3;  2ZXQ A;  4NII A;  3HNM A;  3CJI C;  4CUA A;  4MV2 A;  4UFM A;  5E88 A;  3WF2 A;  4CP0 A;  3THC A;  1Y9G A;  1UNB A;  3WY6 A;  2YUE A;  1EYB A;  3WCR A;  3RZH A;  5IAV A;  4LA2 A;  4ZZ5 A;  3TN9 2;  1HJF A;  4MGT A;  5LEJ A;  1IQA A;  5ANQ A;  2WQZ C;  3KF3 A;  4CUC A;  5I8T A;  2JD9 A;  2YFU A;  4N43 C;  2GC3 A;  3JBG 2;  1WMX A;  1ALY A;  4AEM A;  1QNW A;  1V70 A;  1SCR A;  2X8K A;  4YW7 A;  5HCF A;  5IVE A;  5FBZ A;  2MEV 1;  1CAU B;  3BOP A;  4C0H A;  2FCU A;  2RMU 2;  2ZX3 A;  2OQ7 A;  3OGV A;  5FAX A;  3ITQ A;  3LPF A;  4LT5 A;  2Y26 A;  1UY3 A;  4Y1Z A;  4DNY A;  1SLB A;  1DP0 A;  4M0N A;  5CZK A;  5JZG B;  5A3O A;  2F4P A;  1ZNP A;  4D6S A;  1W8T A;  1GFF 2;  1JYV A;  1JS9 A;  2WFF 1;  4F8A A;  2BGO A;  1LOB A;  1VB4 A;  2J42 A;  1G9F A;  1LR5 A;  1FNZ A;  1H2M A;  3IM0 A;  2GMM A;  5GZD A;  5IVC A;  1RVF 2;  1RUG 2;  1QJZ A;  3VD4 A;  3OEA A;  1OVS A;  4NRM A;  3CLP A;  3WUD A;  1W9S A;  3ELN A;  4XHX A;  1IS4 A;  4CPB D;  1S0B A;  2CV6 A;  2JG9 C;  5FP4 A;  2FD8 A;  2BFU L;  3ZX7 A;  3H7Y A;  2ZOE B;  1RB8 G;  5FPB A;  1KJR A;  3KT4 A;  3DEC A;  1WMD A;  5EIY B;  2A6W A;  5I0D A;  3ZFG A;  2WO7 A;  3AFG A;  3GBF A;  4Q4V 3;  5CAZ A;  1QIQ A;  3TN9 1;  5JOY A;  2QNK A;  2C9A A;  2WWU A;  1R64 A;  1W6M B;  3I2G A;  1VB2 A;  4RHV 2;  5FYS A;  4J25 A;  3WF4 A;  3LZZ A;  4FPC A;  5JZG A;  2XHN A;  1JOJ A;  2RDQ A;  3OBZ A;  1RUJ 3;  2JDH A;  3HPN A;  4QPG A;  4BK5 A;  1JYX A;  3I54 A;  2IXL A;  4IEZ A;  4M4P A;  3T30 A;  1RXG A;  1OBN A;  1W9W A;  4Q4Y 3;  4LIT A;  4TYS A;  4YVW B;  5HV0 A;  4BZ4 A;  1XSQ A;  1NA1 C;  2E51 A;  1YXW A;  5FK7 A;  1POV 0;  5HV4 A;  1O3Q A;  2WWJ A;  4I0B A;  2VG9 A;  3O1S A;  3WEZ A;  2CHH A;  2GSY A;  3ILF A;  1HQW A;  2JDK A;  2A6Y A;  2BJS A;  4XIO A;  4CEW B;  1LOD A;  4K1Z A;  2VME A;  3KS7 A;  3D8C A;  3KD4 A;  5FPZ A;  4LIV A;  2Z4F A;  2DCY A; 
#chains in the Genus database with same CATH homology
 3JXS A;  3CQO A;  3C7O A;  5IJR A;  1IQD C;  2VZT A;  1JYN A;  1H6X A;  3IB3 A;  1JI6 A;  4QX0 A;  2J1T A;  4OYU A;  1WCQ A;  3MO4 A;  3WSO A;  4Z2A A;  3T09 A;  5F7U A;  5JMO A;  2XOM A;  3EB7 A;  1PMH X;  4DUW A;  3FN9 A;  1OD3 A;  4HG6 B;  3CZJ A;  4ARX A;  1O8P A;  2C4X A;  2VZ3 A;  1UYZ A;  3CIH A;  3CZU A;  2YFZ A;  2VR4 A;  4XUT A;  4A45 A;  3HOB A;  1CZV A;  1K45 A;  3GGL A;  4M4R A;  3WF1 A;  4CU6 A;  2OKX A;  4XUO A;  5DPN A;  3HN3 A;  3VDC A;  3K75 B;  4QX3 A;  4PF1 A;  2Y6K A;  5JXG A;  4FI9 A;  4MGS A;  3UES A;  2VZ1 A;  4LHS A;  2V5D A;  1OF4 A;  4AAX A;  4CU7 A;  2WDB A;  3VD3 A;  4TTG A;  3OGS A;  2W1W A;  4XUN A;  4GZ9 A;  1OT5 A;  2BBA A;  2YG0 A;  1DLC A;  1GOH A;  4XUR A;  3P6B A;  4E8D A;  5A1A A;  4MOA A;  1O8S A;  3MBW A;  2J1A A;  5IHR A;  2W3J A;  4DUV A;  1JZ2 A;  2VMC A;  4YPJ A;  2CDO A;  2W1Q A;  1OF3 A;  2VTF A;  1W0N A;  4ZY9 A;  3MV1 1;  3MV0 1;  4ARY A;  1SDD B;  5LA2 A;  2WN2 A;  1DYO A;  4JX0 A;  5LCW L;  1US3 A;  2C9K A;  5J1X A;  3F2Z A;  5HXM A;  5C70 A;  2VCB A;  1I5P A;  1UXX X;  2JE8 A;  3CDZ B;  4BDV B;  3K77 A;  1W8O A;  4BJ0 A;  5JUV A;  1K42 A;  2Y64 A;  3MUZ 1;  3AC0 A;  3A7Q A;  3ETP A;  2VMD A;  4XVH A;  3K4Z A;  4W50 A;  4A3Z A;  3I2F A;  3HJR A;  2EID A;  2WYS A;  2X10 A;  4ZZ8 A;  2J1U A;  4XUP A;  2QBX A;  2WO2 A;  4DEV A;  4CU9 A;  2W94 A;  1UY4 A;  3T2P A;  3GXU A;  1GOG A;  1J84 A;  3NJX A;  4LKS A;  3I2I A;  2XON A;  4RN5 A;  2DCK A;  2VZU A;  4QX2 A;  4QB6 A;  4A4A A;  3E1F 1;  3K4D A;  3I3E A;  3NJV A;  4QDR A;  2X05 A;  3WNP A;  2BZD A;  2JDA A;  2ZEY A;  1UXZ A;  4QX1 A;  4JHZ A;  3SEE A;  1JZ5 A;  4KWU A;  3K46 A;  4JKM A;  1UX7 A;  1EUU A;  2X09 A;  1MPX A;  3HEI A;  4QB1 A;  4XUQ A;  5IFP A;  1P8J A;  2WZE A;  5JXH A;  1OH4 A;  2W92 A;  1D7P M;  3DYM A;  4GWJ A;  2QQK A;  4W4Z A;  1RYY A;  3LE0 A;  3PUH A;  3WNK A;  2VZV A;  1YQ2 A;  2W1U A;  3I3D A;  4AG4 A;  4ZXE A;  4KI5 M;  4LPL A;  3CKH A;  2ORX A;  2ZEZ A;  3BGA A;  3LPG A;  3MUY 1;  1GNY A;  1EUT A;  2RV9 A;  3OG2 A;  1XPW A;  1F4A A;  2QQM A;  3OGR A;  4GWI A;  4QDQ A;  4OMD A;  5HPO A;  5LA0 A;  4DXR A;  3NQH A;  1PX3 A;  3I2H A;  4P08 A;  1WKY A;  3I3B A;  1TG7 A;  1L7R A;  1CIY A;  4UI9 L;  1TVG A;  2DDU A;  2J1S A;  3I97 A;  2ORZ A;  3U37 A;  2VZP A;  2WO3 A;  4BXS V;  1JU4 A;  2PQS A;  2Y6J A;  3K4A A;  2W87 A;  2YC4 A;  1XC6 A;  1SHW B;  1UZ0 A;  3WNM A;  2VM9 A;  1XNA A;  2WAO A;  2KD7 A;  2W46 A;  1GQP A;  1ULP A;  3HNY M;  3CMG A;  2EIB A;  4PT6 A;  1CZS A;  4JKL A;  3ZM8 A;  1NKG A;  1JU3 A;  4QB2 A;  4A44 A;  3W5M A;  2W5F A;  5JR2 A;  1K3I A;  1JZ8 A;  3FHQ A;  2W47 A;  2QQO A;  2VZO A;  1GOF A;  2WO1 A;  2ID4 A;  3ACG A;  2HLE A;  2VQT A;  4A42 A;  3A22 A;  3WNL A;  5C7G A;  1JZ7 A;  2W1S A;  1ULO A;  3GDB A;  3NNG A;  4OUE A;  5IYY A;  1US2 A;  1GMM A;  1KGY A;  1GUI A;  3VDB A;  1UMI A;  2W9X A;  2JKX A;  3A23 A;  2QQI A;  2ZEX A;  3III A;  4QPW A;  3FL7 A;  2QQN A;  3T0B A;  1UMH A;  2C26 A;  1XNT A;  2W95 A;  1BHG A;  3C7E A;  5EJ1 B;  4LQR A;  3IAQ A;  2QQL A;  2VQU A;  2WUH A;  4CU8 A;  1UWW A;  3SKV A;  1HN1 A;  4L0P A;  4P5Y A;  3OBA A;  2RJ2 A;  1K12 A;  2B9V A;  5LA1 A;  2Y6G A;  1CZT A;  3SKJ E;  3BN6 A;  3OB8 A;  3HNB M;  3WQB A;  4DUX A;  5FUI A;  2WAA A;  1JZ6 A;  1GU3 A;  3C7G A;  1W99 A;  2VCA A;  4DXS A;  4JKK A;  2L9L A;  2B4K A;  3DYO A;  5B4X A;  3ACH A;  4A41 A;  2LS6 A;  1LNS A;  3D3A A;  3VD9 A;  1KEX A;  3C7H A;  4MGQ A;  2HYX A;  2V72 A;  4PQQ A;  1JYW A;  4DXT A;  4DEQ A;  2DCJ A;  3ABZ A;  3VD7 A;  3OEB A;  5DQ0 A;  1JZ4 A;  2VZQ A;  2WAB A;  5JXJ A;  3I2K A;  1UY2 A;  3LEK A;  5IFT A;  4IUG A;  5B4N A;  4QAW A;  3LEG A;  4A6O A;  2BER A;  4W8J A;  4CVU A;  2CDP A;  2QQJ A;  2Y6L A;  2VMF A;  3T0A A;  3WNN A;  2E31 A;  1JHJ A;  4CUB A;  3DYP A;  3UNP A;  1O59 A;  1W9T A;  3EYP A;  2VJX A;  2YC2 A;  2J1E A;  2VCC A;  3ACI A;  4RYD A;  1L7Q A;  2VC9 A;  2E32 A;  2W91 A;  3LEI A;  3NRU A;  1SG3 A;  2LW8 A;  4ET7 A;  2Y6H A;  3WF0 A;  2R7E B;  1UYY A;  2V4V A;  3LQC A;  4OZO A;  2ZEW A;  5CYY A;  1NAE A;  2RVA A;  4OMC A;  5EJZ B;  3VDA A;  2E33 A;  2J22 A;  2BGP A;  1UYX A;  2VO5 A;  1T2X A;  1W8N A;  3WNO A;  4QDS A;  5G05 L;  1UY1 A;  3I2J A;  3GM8 A;  2YB7 A;  3T0D A;  4P00 B;  3A21 A;  3P1I A;  2WN3 A;  3VD5 A;  4MO3 M;  2WQ8 A;  2ZXQ A;  3PUI A;  3HNM A;  2J1V A;  1JZ3 A;  4CUA A;  3WF2 A;  4KMQ A;  3THC A;  1NUK A;  2J1R A;  2J7M A;  4ZZ5 A;  5G04 L;  3W5N A;  4CUC A;  1J83 A;  5DMY A;  2JD9 A;  3J7H A;  2YFU A;  3T2O A;  5C71 A;  4E8C A;  2VZS A;  2EIC A;  2VL4 A;  2VOT A;  1NX9 A;  3ACF A;  1UY0 A;  4TXW A;  3IAP A;  3THD A;  3OGV A;  4P02 B;  2VZR A;  3C7F A;  3LPF A;  1UY3 A;  4MAD A;  3ECQ A;  1DP0 A;  5CZK A;  3T08 A;  1JYV A;  5JXI A;  2BGO A;  1F4H A;  3T2Q A;  5DN2 A;  4D8M A;  3VD4 A;  3OEA A;  2Y8K A;  1H6Y A;  1W9S A;  3C8X A;  3SEP A;  1PX4 A;  3DEC A;  5EIY B;  4BK4 A;  3UET A;  5I0D A;  1CX1 A;  3I2G A;  1R64 A;  3WF4 A;  2EIE A;  1PMJ X;  2WZ8 A;  2XHN A;  4BK5 A;  3HPN A;  1JYX A;  4M4P A;  3FHA A;  1W9W A;  3IDA A;  2XQX A;  3WF3 A;  3WEZ A;  2E26 A;  4UAP A;  2WBK A;  4UOJ A;  2VME A;  4D0Q A;  2Z4F A;  4XZU G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...