4Q4Y2

Crystal structure of coxsackievirus a24v soaked with disialyllacto-n-tetraose (dslnt)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
264
structure length
264
Chain Sequence
GYSDRVRQITLGNSTITTQEAANAVVAYGEWPSYLDDKEANPIDAPTEPDVSSNRFYTLDSVQWKSTSRGWWWKLPDALKDMGMFGQNMYYHYLGRSGYTVHVQCNASKFHQGALGVFAIPEYVMACNTEAKTSYVSYVNANPGEKGGVFDNAYNPSAEASEGRKFAALDYLLGCGVLAGNAFVYPHQIINLRTNNSATLVLPYVNSLAIDCMAKHNNWGLVILPLCKLDYAPNSSTEIPITVTIAPMFTEFNGLRNITVPATQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Coxsackievirus capsid protein VP1
publication title A sialic Acid binding site in a human picornavirus.
pubmed doi rcsb
total genus 64
structure length 264
sequence length 264
ec nomenclature
pdb deposition date 2014-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4q4y200
1ZBA2 4IV1C 1RUD3 2RS52 3DPRA 4YVWC 2BPA2 2PLV2 4IV1B 3ZXAC 4RQPC 4YVWB 1VBD3 1MEC3 5BNOA 5FOJB 5A32A 1NCRC 4GH4C 1V9U2 1RUC1 4GH4B 4FTEA 1B35A 2RS12 1FOD3 1COV2 2XBO2 1MQTC 4JGYB 3VDDC 1VRH3 4N53B 4Q4Y1 3VDDB 2BFUS 1E57A 3VBSA 2RMU2 4Q4X2 4N43A 1FMD2 1HRV3 1VAKA 4RHV3 2HWF1 2X5IA 2RM23 2WZR3 2MEV2 1PVC2 2WS93 1QJY3 2GH8A 4Q4V3 1HXS3 2WFF3 1VBC1 3FBMA 4CDQC 4RS5C 1AL0G 1QJU1 4CDQB 1OOPC 5AC91 5CFCB 4WM8B 3JD71 4AEDB 1OOPB 1W39A 1ASJ1 2RR13 4Q4W2 1ZBA3 1RUJ2 2RS53 1AR71 2PLV3 1Z7S2 1QJX1 1HX6A 1VB2A 1V9U3 4FTBA 5CFDC 1PGL1 2HWE1 3ZFFC 1RMU2 4EJRA 1AUYA 2R072 1POV0 2RS13 1RUI2 1COV3 2XBO3 1ND3A 1RUD1 4CDXA 1VBD1 1MEC1 1VBA2 2RMU3 4Q4X3 2FZ1A 4IV1A 1FMD3 3VBUC 1R092 4YVWA 3TN92 3NAPB 1NOVA 1NY72 1PO11 3VBOC 3VBRC 2MEV3 1FOD1 1RUF2 3VBOB 1PVC3 3VBRB 4GB31 4QPGC 1VRH1 4QPGB 1PGW1 4JGYA 4N53A 5C4WB 1HRV1 3VDDA 3M8LA 4RHV1 1D4M2 1RUH2 3ZFEB 3HAGA 2RM21 2WZR1 1NCQC 1RUG2 2R042 2WS91 1QJY1 1NCQB 4Q4W3 4Q4V1 1RUJ3 1PIV2 1EAH1 1HXS1 2WFF1 4NWVA 1Z7S3 3IDEA 5D8AC 1K5MB 2R061 1C8M1 4QPIC 1RMU3 5BNNC 2R073 1FPN2 5CFCA 1ZBE2 4WM8A 1RUI3 4AEDA 2RR11 4Y5Z0 2HWC2 1SMVA 1ZBA1 1ND2B 4CDUC 1BBT2 2RS51 2PLV1 4CDUB 3LOBA 1VBA3 1R093 1QQP1 1V9U1 1RUE2 1NG0A 3TN93 4RQPB 1NCRB 1AR62 2RS11 1COV1 1HQNA 1RUF3 2XBO1 5L7OC 2Y26A 5L7OB 3VBFC 4GMP0 2RS33 1MQTB 2RMU1 4Q4X1 1EV12 1C8NA 1H8TA 1OPOA 1FMD1 2BBVA 1X33A 5BNPC 1D4M3 1RUH3 1WCDJ 4CDWC 2MEV1 4CDWB 1HRI3 3NAPA 1PVC1 1RUG3 2R043 5K0UC 2FZ2A 1PIV3 2DF7A 5ABJC 1QJZA 1IHMA 1RVF1 5ACA2 4QPGA 1R082 2WLPA 1A6CA 3S6PA 1NA1C 4RS5B 5C4WA 5C8CC 2HWB2 3ZFGA 1NA1B 1AR81 5JZGC 3ZFEA 1FPN3 1ZBE3 5JZGB 4Y4YA 2HWC3 4Q4W1 1RUJ1 1BBT3 1AYM1 1AR92 1Z7S1 4YVSC 4CEYA 1RUE3 1K5MA 4PDWA 4BCUA 1RMU1 2R071 1AR63 5DDJ2 5C9AC 1RUI1 5CFDB 3VBHC 1POV3 3ZFFB 3VBHB 1VBE2 3DPRC 1ND2A 1EV13 4RFT0 4CEWC 1R091 3TN91 4CEWB 4WM7C 1NY71 1TME2 5A32B 4RR3C 3VBUB 4WM7B 1B35C 1QJX2 1RUF1 4RQPA 4RR3B 4LLFA 1NCRA 4GH4A 1VBB2 1AYN2 5ACA3 1TMF2 2RS32 1R083 1MQTA 1D4M1 1RUH1 2HWB3 1BEV2 2X5IC 2R041 2HWD2 1HRI2 2BUKA 4CDWA 2X5IB 1PIV1 1AR93 1PO12 1AL22 2GSYA 4GB32 1RHI2 1PO22 1R1A2 4IV3C 5D8AB 1PGW2 4CDQA 1FPN1 4IV3B 4RS5A 5DDJ3 4NWWA 2HWC1 1NA1A 4QPIB 1BBT1 1OOPA 5BNNB 4JGZC 5JZGA 3JBG2 1VBE3 4JGZB 2WWSA 1RUE1 1EAH2 1TME3 1QJX3 2R062 1POV1 2ZAHA 5J96B 1C8M2 1VBB3 1ND3C 5CFDA 4CDXC 3ZFFA 1AYN3 1EV11 3VBHA 1TMF3 3J8F2 4GMP3 3VBFB 1BMV2 5A33B 1BEV3 4CEWA 5BNPB 2HWD3 3VBUA 4WM7A 1QQP2 4RR3A 1PO13 1AL23 5K0UB 3VBOA 1F8VA 1M06G 1RUC2 3VBRA 5ACA1 4JGYC 1R081 4N53C 4GB33 1RHI3 1RB8G 5ABJB 1PO23 1R1A3 2HWB1 2QQPA 4Q4Y2 2TBVA 5GKAC 5C8CB 1DDLA 1AR91 3JBG3 2VQ0A 4SBVA 2HWF2 1NCQA 3CJIC 1EAH3 4YVSB 3CJIB 2IZWA 1RVF2 5DDJ1 5D8AA 1VBC2 2R063 5CFCC 1OHFA 4WM8C 4AEDC 4IV3A 1QJU2 1C8M3 5FMOL 1VBE1 4QPIA 5C9AB 1AR82 5AC92 3JB8A 3JD72 5BNNA 3J8F3 1ASJ2 1VBA1 4JGZA 3DPRB 4CDUA 5BNOC 1AYM2 1TME1 5BNOB 1AR72 4FTSA 1QQP3 1VBB1 1B35B 1AYN1 1PGL2 1RUC3 2HWE2 1TMF1 2ZTNA 2RS31 4GMP1 1CJDA 5L7OA 1H8TC 3VBSC 3VBFA 1H8TB 4N43C 3VBSB 1BEV1 1RUD2 2ZZQA 4N43B 4Q4Y3 2HWD1 1HRI1 5J98B 5A33A 3NAPC 1VBD2 1MEC2 3JB4C 1RUG1 5BNPA 1AL21 2HWF3 5K0UA 1RHI1 1FOD2 1PO21 1R1A1 2BFUL 1X36A 5C4WC 1VRH2 1VB4A 5ABJA 1RVF3 3ZFGC 2XPJA 1VBC3 3ZFEC 3ZFGB 1ZBE1 1QJU3 1HRV2 3JBG1 4RHV2 5C8CA 1AR83 5AC93 3JD73 5FMOS 2RM22 2WZR2 1ASJ3 4CEYC 2WS92 1AYM3 1K5MC 1QJY2 4CEYB 4PDWC 4Q4V2 1F2NA 1HXS2 2WFF2 4PDWB 4YVSA 1AR73 1AR61 3CJIA 1CD3G 2HWE3 4FSJA 1GFF2 1ND2C 3J8F1 5C9AA 1ND3B 4Z92B 4CDXB 2RR12 5LK7B 1BMV1
chains in the Genus database with same CATH superfamily
1IQDC 1MS8A 5GLVA 3ZMOA 2P34A 3DPRA 2XJUA 3MEPA 2JB4A 2VMDA 2PLV2 3Q8EA 3ZXAC 3AYAA 4FPFA 4A7ZA 5BUVA 4FFGA 3WG1A 1MEC3 4AQSA 5FMCA 3WT3A 1Y3TA 1CAXA 2VJXA 2L9LA 4XF3A 4GH4C 5FJHA 1F9KA 1UZ0A 3ZSMA 1GP5A 1TVGA 3RI9A 1URXA 5FXZA 1RUC1 3LSEA 1RTVA 2OX0A 4GH4B 5LBEA 5A3PA 4YARA 1WUVA 2J1VA 4O7XA 2RS12 3IBMA 1I9RA 3RYPA 1RUOA 1G6NA 5GLZA 4JAAA 4NHKA 5E16A 3QH6A 1VRH3 3VDDC 4WVMB 3VKLA 1HB3A 4Q4Y1 3VDDB 3OUJA 1BCXA 3WX5A 4LIVA 4TXWA 1S0GA 1WGPA 1ZNPA 5DN2A 1BK1A 3WDWA 1GZ9A 4N43A 4R9BA 4XIOA 1HRV3 4XUQA 3ZLIA 4XYXA 2JKBA 1AZDA 2BEOA 2OS2A 1I3HA 3K2OA 4YNIA 5DABA 1AJOA 3BUCA 5IW0A 3VKMA 2A1XA 4Q0UA 1ALYA 4NVPA 1SZBA 3GBWA 2WS93 1QJY3 5H9QA 3UGFA 4CP1A 3GJAA 2RHPA 4BMEA 2WFF3 4HSJA 3AYDA 3BOPA 3HQRA 3LB9A 3O12A 2ZGTA 4UF0B 3CEWA 4PIZA 1H4HA 1NE4A 3DXTA 1GP4A 3UETA 1QKQA 2EAKA 4QX3A 1UYXA 4RSUA 3LEGA 2BWCA 5FY5A 1SDWA 1OQEA 1ZVFA 2Q8EA 5CFCB 4AQ2A 1ASJ1 3NNFA 3LA7A 2AREA 5C70A 2RR13 4LOSA 5JMCA 1EP0A 2E32A 2VZQA 2LW8A 3VD4A 5JSPA 1Q8PA 2PLV3 3AZVA 4AGGA 4XDPA 2XDVA 4UFLA 4PI0A 4AEKA 1IKPA 1VB2A 1XSQA 4NRQA 3LDBA 3MF6A 3VL8A 4XUPA 5CFDC 4AHYA 1PGL1 2BOJA 1K42A 3POGA 1VPHA 4M4PA 4PBOA 2GP5A 4EJRA 1POV0 2RS13 4XILA 1S55A 4UFJA 2W39A 1JZ6A 4LEJA 3KLSA 2OPWA 3N3HA 4CYDA 5FY4A 1MEC1 1VBA2 1W8FA 5IVVA 5ANQA 3H9AA 2OYZA 4QQOA 2FZ1A 3B01A 4IV1A 3MI8A 4Q29A 4YZ2A 5LWBA 2PFWA 4XXAA 3SCFA 2JG8C 1NOVA 3NAPB 4X6RB 4F8AA 2Y6HA 3VBOC 2DVGA 4L92A 1NT0A 1KDMA 5HV0A 1OSGA 3I2IA 1E5IA 4BYYA 1RUF2 3VBOB 5LEJA 4XAEA 2VBDA 5FZDA 1VRH1 5C3RA 2WO2A 1PGW1 3AXEA 3BOWA 1K12A 3HIFA 1UY0A 3G7DA 2Y38A 1UY1A 2QE3A 4LUMA 4N53A 4YFWA 2YGLA 4LITA 5C4WB 1HRV1 4OHYA 3MLKA 3M8LA 3RDIA 1W0NA 3M4FA 3OD4A 3WNXA 1O6UA 4E9KA 4XZUG 2TNFA 4FFHA 1K3IA 1OVSA 4IXLA 4ASMB 1UY2A 2JX9A 1O8SA 2XUMA 4MZUA 2A75A 4QU1A 4LK6A 1NCQC 1RUG2 5GZEA 3VV1A 3LPFA 5KHGA 3N7KA 5DZEA 1WMXA 2WS91 1QJY1 2VZOA 1NCQB 4LK7A 1PIV2 4MG2A 2WNVC 3M3IA 4CXWA 4EN7B 2WFF1 2DURA 2IXCA 2W91A 2DCZA 4QM9A 3IDEA 2WNVB 5FZFA 1S1AA 4Y5TA 4C8DA 1PK6C 1YCIA 4Q26A 2QKDA 1N3PA 4AWDA 5JOZA 5LA2A 1PVXA 3AMNA 1NLSA 4BM8A 4NN0A 1AX2A 4WM8A 4FPJA 4OZXA 4QB1A 4AEDA 2BP6A 2RR11 2A6XA 4UFIA 4LBMA 3APBA 5CB7A 5DZFA 3ASIA 2EXHA 2VGDA 5FRAA 2Y6KA 1CZVA 2PLV1 3ZSEA 3LOBA 1CESA 1QXPA 3OEAA 3P5BA 1EPWA 1XU2A 1VBA3 5IWFA 4S2FA 4CU7A 1UD1A 3K75B 4UWDA 1RUE2 5DUUA 5EQUA 2XUEA 2VW2A 4AI9A 1YHFA 2A7AA 4YGBA 1XC6A 4FPOB 3PL0A 5IVCA 2G19A 4LBKA 1AR62 4BQWA 3P6BA 2RS11 4FO9A 1AXYA 3T1LA 1RUF3 1U5XA 5L7OC 1LOFA 3MV01 5FR3A 1O3RA 3W9AA 4XJUA 5L7OB 4KWJA 2WAOA 2Z2SB 4XJWA 4BZ4A 1YNAA 4GMP0 3JZVA 5DMYA 1MQTB 1UYZA 4K8RB 1EV12 2DVAA 2R6QA 3VD5A 3FHIB 2BVBA 2BBVA 1KJLA 4L9BA 2ZOEB 1X33A 4MYEA 4ZS3A 5BNPC 3GXUA 2Q4SA 2ZX0A 2I74A 4CDWC 5M0TA 5DUXA 4Y26A 4DUWA 1SBFA 5HCFA 4ATFA 3FLPA 4HL0A 3HT2A 4CDWB 2CL2A 3ZXFA 1U5YA 1RUG3 5K0UC 3OBAA 4XDOA 1G9FA 4W6YA 5LBFA 2VCBA 1PIV3 1SHWB 1V6MA 1YJLA 3ES4A 1IHMA 3VZMA 1GICA 5T55A 2OZJA 4YM1A 5A6XA 2WLPA 4R52A 5I93A 1W28A 1UMHA 4XUTA 3VD7A 4DOUA 1SFNA 1JOPA 2E9QA 2QUOA 4NPLA 2PXJA 2Y6LA 1ZZBA 2WR9A 3ZFGA 1MACA 2WUHA 3BTAA 1H2KA 1AJKA 4MGZE 5FZMA 4M3CF 4KQ7A 3DKWA 5FY0A 1ODNA 5KHKA 3OF1A 4N7IA 2FBEA 3KM5A 1W04A 5C6CA 3GZEA 3OBTA 1UN1A 5BV6A 3ZIWA 5KR7A 1RUE3 1FYUA 1OFSA 2PHLA 4UFHA 2D6MA 3OCPA 1AR63 3N9NA 1V6KA 1WCSA 3I97A 2FCTA 2Q1MA 3VBHC 1VR3A 2VCAA 1POV3 3CDZB 4Y5SA 2CAUA 3J7LA 5F3EA 3ZFFB 2YBKA 3VBHB 3AMPA 3GHMA 1VBE2 5F5CA 1ND2A 5C71A 3B93A 4PQQA 1EV13 2DDUA 4ZONA 4E2SA 2JD9A 4RFT0 4IQPA 2A71A 2QVSB 4QWNA 4A44A 3O0XA 5CNAA 3B69A 5FZGA 5I8SA 5A32B 2EXJA 4H7MA 3B7MA 2ORZA 3C8XA 1QJX2 1RUF1 1W6MB 2J1EA 1UX7A 3OTFA 1O5LA 4AI8A 5LW9A 2D93A 4GH4A 1NXMA 4IEWA 4LMFA 3ZXDA 3SITA 4R8HA 1AYN2 2D6LX 2FMDA 3RNSA 3ZMNA 3WR0A 4BLJA 5JUVA 1W9FA 2RS32 2W46A 1MS4A 3MUZ1 2XVKA 5IK8A 3MF9A 1H1MA 5FZOA 3WUCA 4P5YA 4R4ZA 2LALA 2GMEA 5IFTA 2O8QA 3BTZA 2HWD2 3DYPA 2XKOA 1DU3D 5CYYA 2BUKA 1V6LA 4UAPA 1PIV1 2XVLA 5FK8A 5KXEA 4JHTA 5L36A 4MO3M 3UGHA 4TLGA 5HI0A 4DY5A 4GAZA 3FFQA 4KWLA 1WMFA 3C7HA 4AEMA 4IDZA 1GBGA 4GB32 4BQ2A 3N9OA 4YZ1A 4IV3C 4EWEA 3IPVA 5J3UA 1STMA 2YPJA 1N1TA 2DTYA 4XUNA 1Q8QA 4AVTA 4IV3B 2BGOA 3PJQA 1OKOA 4XVHA 3AVSA 2IFRA 3DYMA 4QPIB 1SACA 4NPRA 5C5UA 4NRPA 2JD4A 2W47A 4JGZC 5JZGA 4QGNA 3JBG2 1VBE3 4QXBA 2E7TA 1LHOA 3VZNA 2HYXA 4JGZB 4AG4A 1QXJA 4PCRA 1YO8A 5C3SA 1RUE1 1AHSA 2VTFA 1DCSA 1I6XA 2F17A 4BH9A 3LQCA 3FMGA 1CQ9A 1DGLA 1QJX3 2VMIA 2WBKA 2G9FA 1POV1 3R05A 3ZPYA 3I59B 1PHMA 1ZZ8A 5A3MA 1OC1A 5CFDA 2ERFA 1H0BA 2ZAAA 1N1VA 4CDXC 3A21A 1AYN3 1B09A 1EV11 1W6QB 3B3QE 5CU1A 5EJ3A 1W8HA 3J8F2 4GMP3 4NROA 3VBFB 2OQ6A 3IDCB 3I2KA 3OGVA 1OQ1A 1SLIA 2BW8A 3ELNA 2PYTA 1SLCA 5FWEA 4IEOA 3M3OA 1W3VA 4QB2A 2HWD3 2YUEA 3FHAA 1W2OA 1JYIA 2JXAA 1XU1A 2Q8OA 1M4WA 3OEBA 3POJA 3Q8BA 5FO7B 2JG8A 2P1BA 2XJTA 1PMHX 4LTAA 5T52A 2R1BA 3VBOA 1JYXA 5A3WA 1XSRA 2WJSA 4K1YA 5APAA 2F6BA 3HOBA 3I2DA 1UL9A 5F2SA 4Z07A 4GB33 3GZTB 1KRIA 1X7NA 1W3XA 3CZUA 2DFBA 3Q8FA 1J1LA 1HDKA 5GLUA 2QQPA 1LOCA 1N47A 4MSVA 4YG0A 4DS0A 5GKAC 2ZCWA 4XPVA 4NIGA 4KBBA 4MXWA 4WV8A 3ES1A 1W90A 5CIRA 5JAXA 3JBG3 2N7GA 4I30A 1AVBA 4K1ZA 5JI7A 2E33A 2R32A 2ZGOA 4ZXKA 1NCQA 4DQAA 2ZHKA 3DXUA 4XCBA 3BPZA 3NJXA 2WSUA 2WNVA 1GV9A 4LHNA 5T5PA 1F31A 5F32A 2YU2A 4NPMA 2IZWA 1LTEA 3EB7A 2G9ZA 3GGLA 3WG3A 1ODMA 4M01A 4C91A 2HEVF 1JBCA 5FY1A 1PK6A 3ZKYA 5FMOL 3TOJA 5L9BA 2YHJA 1VBE1 3KGLA 1J84A 3PIGA 3U4SA 5F37A 3SNMA 4I2OA 4CU6A 1WKYA 2V09A 2VW1A 3J8F3 3MFCA 3ORJA 4JKKA 1LRHA 5FUPA 3RYRA 3K77A 1RJ8A 1L7RA 3POSA 3TWIA 5JXJA 5K7PA 3FX3A 3DPRB 4OUSA 3WDVA 1AYM2 4YYOA 1DQ4A 3EYPA 3H50A 4A6SA 1DGWA 3V64A 3B9CA 1CAXB 2PAMA 2X10A 1W0OA 3NRUA 3AKPA 4Q2FA 3RSJA 2XR4A 5A3LA 2ZGUA 2J1RA 3D8CA 1AYN1 2HWE2 5DXDA 5J36A 2ZTNA 2RS31 3HQXA 1UKGA 4GMP1 2PAEA 5DZGA 5L7OA 1J59A 2I45A 4RYDA 4IUGA 4JRAA 3RVHA 2H6CA 4N43C 4IE5A 2OUHA 2ZZQA 3RJRA 4N43B 1LOGA 4A2UA 2HWD1 4EN6B 1VBD2 4Y1ZA 3S7IA 1JMUB 3LD8A 5BNPA 1SCSA 2UY8A 2JKXA 3AP5A 5F39A 2VOVA 5C3QA 3V0BA 3MIDA 3LSDA 2E26A 2VZSA 1JYVA 1MR5A 5K0UA 5L19A 1I5PA 4HANA 4LULA 5A1FA 3WDXA 2BFUL 2JDNA 4EN9B 1PX4A 1KXGA 2XWJB 1X36A 3ENRA 1OQDA 3NNJA 2AACA 1UXZA 1G86A 4QXHA 1W2TA 3M3QA 2VW0A 3U07A 1BVVA 2EXIA 3DV8A 2Q0AA 1IKQA 3PDQA 1DG6A 1ZBE1 1OLMA 1FV3A 2B39A 2VBPA 4FI9A 4YZ3A 3JBG1 4NMIA 4GWJA 5IATA 5ANNA 1YIFA 2RV9A 5I0UA 4M0HA 2ENRA 3KMHA 5I91A 4Y22B 5FMOS 1E5SA 3WG4A 2WZR2 4KH9A 5A7SA 1AYM3 3CKHA 3E5QA 4PDWC 3LZZA 1PMIA 4D0QA 1HXS2 3M3CA 4PDWB 3FL7A 5GZGA 2W5FA 4LIUA 4XABA 4F83A 5IVBA 5LY1A 4P5HA 1CD3G 1S2BA 1Q3EA 3FLRA 3D6EA 1GUIA 4HKLA 4CUBA 4HN1A 4CUCA 2VECA 2ZX3A 3PMSA 2HWE3 5GJ6A 4FSJA 3J8F1 3VZJA 5LATA 2A3WA 2DCTA 3NKTA 1X82A 2VC9A 3H8XA 4A3XA 4LHLA 1TNFA 3AYEA 4IV1C 4QDSA 2JIJA 5F6KA 2RS52 3R4SA 1IPSA 1DQ0A 1DZTA 1IPJA 2BPA2 4IV1B 3DUIA 1OF4A 1R64A 4RQPC 1VBD3 4IGOA 3WP4A 1HN1A 1XBFA 1JOJA 4KGQA 5A32A 1NCRC 5KXCA 1UPIA 2DBIA 2VULA 1W6MA 2AENA 3VD9A 1H9WA 1LHUA 3MLLA 4FTEA 1ZZ6A 2ET7A 3ABZA 4Y24A 2JDKA 5HBAA 2XBO2 3RWNA 5FP4A 3DGTA 4XF0A 1DGRA 3K4ZA 4N53B 4B8EA 1JTZX 2WA3A 2BFUS 4DXZA 2FQPA 4Q4X2 3ZR5A 1IS4A 5FYYA 3W5NA 4DINB 3ZOIA 5T3NA 3PIJA 5IT6A 2ES3A 1VAKA 2UY9A 1CX4A 2JB8A 2AEZA 1ULFA 2XL7A 1KS4A 4NAMA 1HJFA 2W0XA 4QKBA 4ASLA 2VPVA 2QQOA 1QIQA 2WZR3 2ZGNA 1ZX5A 2WABA 1HQLA 4AVBA 4TN7A 1PVC2 5JR7B 4CPBD 5T5LA 2ZEXA 3D0SA 3HMYA 4MOAA 3M3EA 1HXS3 4Y20B 5FXWA 4PBPA 4HKOA 3RWKX 3OOXA 5J37A 1S0CA 3VHPA 1IS3A 4ZXEA 1MS3A 2Y0IA 2VTXA 3LE0A 4D7SA 3G6JB 4LBJA 1ZRCA 2DFCA 4WM8B 4AEDB 4P9IA 2K46A 4AL9A 2JDZA 2PHFA 2VMFA 3CO2A 4HMZA 1YIPA 5C9AA 4NIHA 3N9PA 4Q8LA 5T50A 1RUJ2 3ON7A 5F6LB 3T08A 3OGGA 4CCMA 2RS53 1ZRIA 5DQ0A 3TB0A 4E8DA 1F4HA 1W8UA 1Z7S2 2EICA 3PUHA 4H55A 1ULGA 4GA9A 4ASKA 4IEPA 4C90A 4AVSA 2ARXA 4FTBA 1H2MA 4DZGA 5C8WA 1GR3A 1BVP1 1UF2C 1FT9A 2HWE1 3A22A 3H7JA 1C5HA 2XJVA 3KCYA 3N35A 3I59A 2QBXA 5FZ0A 3MV11 1QXRA 3WNNA 2XBO3 4LBQA 5IVEA 3MBWA 2BQPA 2XQRA 3NJYA 1XYPA 4M3CA 4XFIA 4XW3A 1ULCA 2CGNA 5FYBA 3OB8A 1CGPA 4CDXA 2PHTA 3HEIA 1D0GA 1OA3A 1JW6A 1AXKA 4L97A 1EUTA 1VBD1 2QQVA 2VNVA 4Q4X3 4WVWA 4BOWA 2CWMA 2H0VA 2XMLA 3EHKA 3CBNA 1QH6A 4IE7A 3VBUC 4AI1A 4CCCA 4MGIE 2PTMA 4XBNA 3I2FA 1UYYA 4LBOA 2QDNA 1DYPA 1PVC3 3OBZA 1SBEA 5B2GB 2EIDA 2JIGA 4PF5A 2WNOA 1WLDA 4ZS2A 5FY8A 3TBDA 3BU0A 1BLZA 3OY8A 1YXWA 5EXOA 2XKPA 4QX5A 1ZZ9A 4J1WA 3WSOA 1CIWA 3ZXEA 1U0AA 4WZFA 2WZR1 4GJZA 1N1SA 3ACIA 4UFMA 2WNEA 2R042 3DECA 3LWCA 3WF2A 1SEFA 2JEMA 4UT5A 1TZOA 3C2UA 5FK7A 4B3NA 2DVFA 2VVDA 1RUJ3 2QNKA 2VQUA 4CCKA 4MUVA 4WVVA 3WNMA 1HXS1 1XE7A 3MW3A 4NWVA 2E7QA 1Z7S3 2YV8A 2ZJCA 3MW4A 5HV4A 2DWRA 1JYTA 4DO0A 4BXFA 4I01A 1C8M1 5FMBA 4DY3A 4WZCA 4CCEA 1QOTA 4KL1A 5BNNC 3SC7X 3T0BA 1WWYA 5HCBA 5K9YA 2CV6A 2HWC2 2VVEA 1ND2B 3HWJA 3ILRA 4GIQA 4LQRA 2RS51 3CLPA 1DZRA 1MVEA 1QU0A 3BTXA 1NKGA 2WT1A 3MGUA 1CPNA 4ZU4A 4C1XA 4JDNA 2E6VA 2WYSA 1W6PA 4FOYA 5FYTA 4ZZ8A 1ENQA 2VD7A 1DYKA 4KU8A 2UYBA 1L7QA 1FXZA 3AKTA 3L9JT 4FCAA 3ZN4A 5CVRA 2JDAA 3ZSKA 2E51A 2P17A 4KU7A 2XBO1 4ZU5A 5FZEA 4ORFA 1Y4WA 4A41A 4FBFA 2R0HA 2ETEA 5FUIA 4Q0VA 2MNGA 1LGCA 3V65A 3FE5A 3HQUA 3AK0A 4Q4X1 4LHSA 5FZOB 5E6HA 2YC2A 2Z5WA 4AHZA 4QXCA 1WCDJ 3MIHA 3T30A 4Z2WA 2K0GA 3NJZA 4FPLA 2IXLA 3S30A 2DYCA 1PVC1 2QCSB 2R043 4IEZA 2XJQA 5AVAA 2FZ2A 2BJSA 5FZ6A 4EZHA 1MZ6A 1VMFA 3AM2A 5ABJC 2LS6A 1QJZA 1QOOA 3BODA 4JRLA 3TEXA 5ACA2 5FO8B 1R082 3WW3A 1RITA 3IPVB 3UJQA 3ZKUA 1XXNA 4OUMA 5H9SA 2HWB2 1WW7A 4YGCA 3IZOA 1AR81 3OGJA 5JZGC 3K46A 1PZ7A 5AFEA 5JZGB 3K3NA 2HWC3 1KFUL 1SG3A 4XZPA 4EYUA 1RUJ1 2CDPA 4E4SA 4Y22A 1GLHA 1MZ5A 2YMZA 3PLQA 1AR92 2OA2A 2A73B 1Z7S1 3MIGA 4IGPA 4YM2A 3X29B 1OMIA 4M0NA 4YVSC 1NLQA 1ZRFA 4R9AA 2OPKA 5J7MA 1SPPA 2QQJA 3AKQA 4PDWA 3AFKA 3IMMA 4FPKA 1RGSA 2ZGMA 4LOTA 1TEIA 1U5IA 4IGQA 2VVFA 1SLBA 5C9AC 2W2IA 5CFDB 5SV5A 5FYIA 3SH5A 1QOSA 5G04L 4HG6B 3ECQA 4URAA 3ACFA 3O0WA 4H3WA 4UBGA 4D3WA 1WLTA 1DBNA 1VAMA 4JCKA 4XIKA 1C57A 3PURA 3BIEA 1CAWA 1WBLA 1J83A 3IM0A 5C33A 3ZIXA 2XVGA 4IERA 4AAXA 5A1AA 3NWKA 4W4ZA 2GP3A 1TME2 2R1DA 2PHDA 1XNAA 3I4IA 4DEVA 2J42A 1JH5A 1UU4A 4RQPA 4V1PA 2Y6GA 3RMYA 4AHWA 4AK3A 5A7QA 2JG8B 4QKDA 2EIEA 2TEPA 5DAWA 1NCRA 4QU2A 3NQHA 3AP4A 2UURA 3SQOA 2QZ3A 3OUIA 2JECA 3THTA 3USUA 5FP7A 2VMEA 5ACA3 1R083 4LO4B 5CBLA 3M1HA 1OUSA 1UKRA 3V56A 1KITA 3DEMA 2VU9A 3GZUC 3VKNA 4YSFA 5JSRA 4MGQA 4XFCA 2HWB3 3E6DA 5EHDA 5EV7A 5FZ7A 5FBZA 3THPA 4MXWB 5DG1A 5F7UA 3OG2A 2R041 5IVFA 1JZ3A 1LENA 3PVEA 1YWKA 3DCQA 3K51A 3NV4A 2VMGA 5LK5A 3ZYIB 1AR93 1PO12 2ILMA 5EFUA 2DU1A 2WSVA 3AMMA 4UXAA 1JZ5A 1QNYA 3MZHA 2GSYA 1JZ2A 3BPSA 1UOGA 2ZZJA 4E2QA 1PO22 3H1WA 4Y20A 3UL2A 2ZEYA 3T2QA 5FYSA 3K4DA 4MGSA 1IPKA 1WA4A 1PK6B 3AZWA 3FZ3A 1N3OA 1W0PA 2IWGB 1G7YA 4NWWA 1W9WA 5FBJA 2HWC1 1YQ2A 5J09A 1L3JA 1UXXX 3KVBA 4P9XA 3T4VA 1ST8A 1QH7A 5SV8A 5CAZA 1LECA 2FMYA 4M00A 5E1RA 2IC1A 2VG9A 3E5XA 3GYDA 2BGCA 2XHKA 2BGPA 2EAAA 1JYNA 1VIWB 1AX0A 4EROA 1LCLA 4CCLA 1EAH2 4QX1A 1TME3 2BYVE 4KBZA 5L9VA 2D43A 3POIA 1W9SA 1OA2A 5FQ0A 4AVVA 2R062 4AFBA 3KV6A 4DFSA 5FZ8A 1N3QA 3I3BA 3WQBA 1QEXA 1ENSA 1ND3C 1ZYBA 1D7PM 2H6BA 5FZKA 4CRQA 2WT2A 3WF0A 4AFMA 2VNRA 1CX1A 4FQ4A 4OZOA 1GANA 1OVPA 1VLNA 2C1FA 1C4RA 2ZGSA 5FKCA 3RQ0A 1H2LA 2VNOA 4HT1T 1PZ9A 3D5OA 4COVA 4XHBA 2WC2A 3OPWA 4GD4A 2BRTA 4CEWA 2A3YA 2GNDA 2O1QA 1C3HA 4YZ4A 5BNPB 1BHGA 4HVOA 2J1AA 4LXLA 3O1TA 1J58A 3ZN5A 2Z69A 1JU3A 5LBBA 3VBUA 2C5DA 1QQP2 2V5DA 3AJYA 5JIUA 3V0BB 3AL5A 4IETA 2YYOA 4P9YA 4QHZA 4U36A 1PO13 4DXRA 5K0UB 4G4FA 3CMGA 2K9ZA 4AFCA 5ACA1 4JGYC 1R081 1G9CA 2PMWB 3HN1A 4P9GA 2YC0A 1NUKA 4D6SA 1GSLA 4YG6A 5KHHA 1PO23 4BQYA 5JOWA 2UWBA 3AMHA 4OHWA 2HWB1 1LESA 3IMNA 5FCCA 2D5HA 3QBQA 4XQWA 3U14A 3UGGA 4N7UA 2Q30A 4MGTA 2R49A 3VDAA 4AW7A 2GN7A 1BK0A 3POWA 1F4AA 3I8TA 1DDLA 1AR91 2BNOA 1W8OA 1REFA 4QX8A 3VUOA 3U1XA 2VZUA 1YJKA 1OT5A 1S0JA 1WMEA 5A3NA 1O91A 3HBZA 1JN2P 3C7GA 4OHVA 5GZDA 1EAH3 4OFGA 4OI1A 4N90A 3O7OA 5GLWA 2P3KA 1RVF2 3AB0A 1H6YA 1NQDA 4FAHA 1VBC2 2R063 2C26A 1OHFA 1V00A 2VXJA 3T1MA 4FOWA 3H8RA 3ALQA 1HV1A 1VP6A 2IXKA 2P2KA 1NXD1 1QF3A 2ZKLA 5AVPA 5IAVA 1GNZA 3JD72 5AC92 5BNNA 3O1MA 2DCYA 2NMNA 3GZAA 1VBA1 3H1YA 2W9XA 4HK9A 1CAVB 1UOJA 4L11A 2FDIA 2WL1A 4W6WA 3WY6A 1TME1 1X8MA 2OUJA 2XONA 3J9SA 4ZY9A 4B4QA 5A3UA 4ZHNA 2LM3A 1AR72 3H1MA 3U78A 4DUXA 4FTSA 1BKZA 5GALA 1QQP3 1PM4A 1GZCA 2JWPA 2C0ZA 4O9EA 4HVQA 5FLJA 4NIAA 2C9KA 2FDJA 4BK4A 4RGKA 3OD0A 3RI8A 2LRPA 2JDMA 1H8TC 3AJZA 5FV3A 1UOFA 4A45A 1CVNA 3E5UA 1H8TB 4XFGA 5FTTC 4QX0A 5BXXA 5FLIA 3TEYA 1RUD2 3RPQA 1QJFA 1PM7A 1YFYA 1F35A 2WYFA 3OGRA 3PNAA 1VAVA 1X50A 4DIQA 5A33A 1ULOA 3JB4C 1RUG1 3GF6A 3KV4A 2GNMA 4ARXA 2ADDA 4Q0PA 4P9LA 5G05L 2PAKA 2AC1A 3RZGA 1CONA 2UU8A 4BIOA 3EXUA 2ZBJA 2ZACA 4AE2A 2YPDA 3N9MA 1F5JA 2NYYA 1SBDA 3ILNA 4IEQA 5JPMB 1FOD2 3ZM8A 5CG9A 1PO21 1OLME 4LHKA 5IVJA 3RZLA 2ZXQA 3P3PA 2NM1A 2WNUC 4FT8A 5ABJA 2C4XA 3AC0A 1HKDA 1RVF3 1EY2A 1W2NA 1NLRA 1VBC3 2WNUB 3AP9A 3POBA 4Q5OA 2PN5A 4W6XA 3WLUA 3ZFEC 3T0DA 4BXSV 2P4EA 5DPNA 1HB2A 5FP9A 2D6NA 1YQ5A 5FIXA 4RHV2 1NYWA 5AC93 4W8JA 3JD73 3O0VA 3SKVA 5I0RA 3LIHA 1REEA 2HBTA 2DUPA 2RDSA 4CEYC 4PLNA 4JVAA 2GMPA 1HJGA 3H3LA 3VB9A 4XJZA 2Y34A 4CEYB 1K5MC 2DUOA 3IN9A 4CXYA 2XGXA 1QGLA 2C6SA 4Y1XA 2P3YA 4XUOA 3C7FA 5DAXA 3OPZA 1AR73 4YVSA 1AR61 3CJIA 3JQXA 4HETA 2BERA 1OBNA 5A7WA 5LRRA 4COYA 5JR2A 1GU3A 4QGLA 1E5RA 1OLQA 2VUDA 1APNA 2VZ3A 2E63A 3GCWA 4LBQB 5CA6A 1FI2A 2WO1A 2JE9A 3EBRA 3MDPA 4M3CB 3LA3A 3T2OA 3HNBM 5FYMA 2B42B 3T3YA 4B4RA 3NNLA 4FOQA 4CDXB 5FJKA 5LK7B 1PNFA 5B4XA 1ZBA2 2OXBA 4QD2A 1RUD3 4DEQA 4ZKTB 3SHRA 3U10A 2AEYA 1UU5A 1ULEA 5FPXA 1O8PA 3IB3A 4AXOA 2XLFA 4RD7A 4NR1A 1V9U2 2P37A 5BY5A 5CKNA 3TAYA 2Y33A 1QMJA 1YFUA 2VAUA 4GWIA 1YFXA 4B7EA 4BPZA 1MPXA 2BDRA 2Y60A 1FOD3 2YDEA 5DUWA 1IGOA 4V2VA 2WWUA 2XLAA 1UW8A 3OY8B 4JKLA 2B5HA 4JTNA 4LJHA 4QHOA 1C28A 2PHRA 2B45X 3ZXLA 1E57A 5IAXA 2J1TA 2RMU2 3PVOA 1PNGA 5D2AA 5JMOA 2FDKA 4Q8KA 4RHV3 3D0JA 1DLCA 3BALA 5JXIA 2RJ2A 3FUQA 2MEV2 4WBBA 4ES9A 2G9GA 3I2HA 1GZWA 3T09A 1DLLA 2QQNA 1RUNA 4HPKA 4RFRB 1S2EA 4YM0A 1VBC1 1OH4A 4RS5C 1WLCA 1WW6A 3LPGA 4BIFA 2VMCA 4XF1A 3LA2A 1V0AA 4S2HA 1OOPC 3I7DA 4DRVA 1SFPA 2X09A 1KEXA 1PZ8A 2CSGA 2XHNA 3JD71 5AC91 4OI0A 1OOPB 4BQXA 2YY1A 2GMMA 3WEZA 2WIIB 2XL9A 3RZKA 1CR7A 2IXHA 2QZ2A 4BE3A 4Q4W2 1ZBA3 2CHHA 4AFAA 3U37A 4EN0A 1W6PB 4HZFA 1CJPA 1US2A 4XBQA 4E8CA 4Q1RA 5T54A 5C3OA 1AR71 3N9QA 2FHRA 1QJX1 2CGOA 4J6GA 2ET1A 3PVBB 3ZX7A 5HXMA 3F2ZA 1VMHA 4XJ9A 4M3CE 1HV0A 1V9U3 1YI7A 4DXSA 3KVAA 2ZX2A 5JI9A 3O1RA 1RMU2 1CZTA 2V4AA 2LTNA 4RA0A 3ZDVA 1RUI2 1SDDB 5TSWA 1ND3A 4OHXA 4QQPA 1WD3A 4Y3OA 4EWAA 1RUD1 3PHMA 4DUVA 1GOGA 2K2SA 2Y0OA 5FZLA 2F4LA 4FPGA 3H8OA 2Y8KA 1GMMA 2RMU3 4Z2AA 1XE8A 3EO6A 4QT6A 2HH9A 5D21A 4XMAA 1R092 3B9IA 2WWJA 4S2GA 4YVWA 3U75A 4YW5A 1YI9A 5A6ZA 4COWA 3ZYGA 2ZGPA 3KD4A 4YZ5A 3WW2A 4Y1VA 3VBRC 2VOTA 2MEV3 2ZA9A 1FOD1 3VKOA 3VGIA 5I8TA 3TEWA 3BI3A 1KQRA 4XMIA 2QQKA 3VBRB 2AR6A 4GB31 1REDA 1MS9A 4D6RA 3QOPA 1UNBA 4L8QA 3WNOA 1MS1A 2X05A 1L7LA 4YWAA 1IZ3A 1ULPA 4JGYA 2JDPA 1DYOA 4GWMA 4I02A 4I0BA 4Z82A 1LJ7A 1FX5A 4RHV1 3SEEA 3H42B 1SLTA 4H14A 3W21A 1WW5A 2VTXJ 2IFWA 3HAGA 1H4GA 1Y43B 4BQ5A 1LHWA 1WD4A 4XFFA 4XXPA 1TE1B 3IKWA 3THDA 4A42A 1G9BA 3O1UA 1UZWA 4V2WA 4AVAA 5FZ4A 2XJRA 1LU2A 4Q4W3 3TEZA 3UT0A 5D1IA 4KGGA 4XOGA 1GQHA 5FO9B 3P3NA 4CXXA 4HLTA 1O7FA 4DB5A 5D8AC 1SPPB 4IEUA 3JU9A 5KXDA 4HKWA 1VJ2A 1IS5A 1ZZCA 1CIYA 5LB6A 3R0RA 1LGNA 2B9VA 1H1AA 2E31A 2Q1ZB 3BN6A 4IESA 4FP2A 3ROUA 3WCSA 1JODA 1W9YA 4A7KA 4Q0SA 1RMU3 2JG9C 3CZJA 4G3YC 2JICA 2PHXA 4XHXA 3RS6A 3RRDA 4A4AA 3J26N 1RUI3 5FPBA 5DAQA 3ZYPA 4Y5Z0 4AVCA 2VZPA 1ZBA1 4CDUC 1SQ4A 4K40A 4PLOA 5JXHA 1K5JA 1CAWB 4K3UA 2CAVA 3PTYA 4CDUB 4PIYA 5F3IA 5IK5A 1CAVA 1LULA 2PA7A 4PLMA 5IK7A 4XQDA 1R093 1V9U1 4SLIA 4K21A 4RQPB 1F5FA 4RGGA 4CCJA 1NCRB 3BGAA 3MIEA 5F5QA 1HB4A 1W6NA 2O0OA 3IAQA 1HQNA 4L0PA 4R9DA 4Z8BA 3USUB 3CQOA 3KT7A 1XNBA 4B7KA 1CPMA 4AOCA 3AZXA 1YLLA 4H2AA 1UWWA 2ZX4A 2JDHA 2RMU1 4JX0A 4KNCA 4OQ8A 5K4LA 1H8TA 3UV9A 2DTWA 2FCUA 2NN8A 2X8KA 4IE4A 3A0KA 4QPYA 1A34A 5FPUA 5FPAA 4QB6A 3WP5A 4BJ0A 4KWKA 4Z1VA 2MEV1 1HRI3 4Q0QA 3RZHA 2WZEA 2G4IA 1VE0A 4CP9A 1H6XA 2HKXA 2YBPA 4U2AA 2CU5A 2V72A 1J3PA 4WVZA 1WLWA 1SFYA 2B4KA 3FN9A 2TUNA 1YQ8A 5LA0A 1O59A 2BVVA 3O5SA 4LA2A 1Q43A 1XOYA 4AYUA 5FLHA 4QPGA 5HCHA 2PQSA 5FYVA 1A6CA 1NZCA 2ZHNA 3AXDA 3S6PA 3BTYA 1W06A 5F2WA 5FZ1A 2WNUA 4IE0A 4QDQA 1NE6A 3DYOA 2E53A 3KT1A 2D6KA 1MZFA 4QAWA 4UW3A 1XB9A 4UW5A 1V6JA 2VUJA 3ITQA 3MO4A 3SH3A 1O4YA 3ZFEA 4J25A 5F5AA 2NP0A 1V6OA 2D6PA 2D6OX 3VZOA 3N7LA 3ME2A 4OI4A 4Q4W1 1DGRN 5JDBA 1AYM1 3OSDA 3KZ4C 4CPBA 4F7ZA 3E6CC 2VOWA 1OUXA 2WFPA 4CSWA 3H8UA 4Y1UA 1H2NA 2CYFA 4YW7A 1YC61 4AF9A 4CEYA 2Q5TA 3WF3A 3W58A 1K5MA 3KSCA 3L2HA 2LUWA 4ATEA 5EJZB 5LA9A 3ZPOA 1D2SA 4BCUA 5FQ0B 3L2YA 1RMU1 2QTWB 2VR4A 4DMIA 1RUI1 3PMEA 4YG3A 3LIGA 3T2TA 3KHCA 3PU8A 3LEMA 2E7AA 5FAXA 2ZX1A 3LDRA 4IEVA 4FQZA 2V4VA 2RVAA 3J7MA 4JQTA 4CEWC 4XJAA 1W8WA 1R091 3A4UA 5GZFA 3FWEA 2XOMA 5A7PA 3WDTA 4CEWB 4UI9L 4CU8A 4BU2A 3VD3A 3I54A 4S2DA 3VBUB 1DIWA 1LODA 2UWCA 3LAGA 1B35C 4IW3A 3AMQA 4JQRA 5EZWA 1FV2A 4HFSA 4Y33A 5L73A 3O1VA 4OHZA 3RG0A 1WW4A 1SLLA 3IT8A 2KA3A 1LOBA 1KS5A 2Z4FA 4UYBA 3KQ4B 2YU1A 4C0HA 4KMQA 5E88A 5IVYA 1TMF2 2W1QA 1NZIA 2G1MA 3LFIA 4P02B 4E2GA 2VCCA 2FD8A 1LEDA 3H3ZA 5FP3A 1BEV2 1OXCA 4BHPA 2X5IC 2OVUA 2KR2A 1BYHA 1NAEA 3AFGA 3VZLA 3PUQA 4NIIA 4JC1A 3S5AA 2X5IB 4AI0A 2NLRA 1POQA 2WO3A 1QNWA 2P6HA 2D7FA 2OW4A 1Q5OA 1RJ7A 1X9TA 4L2NA 1W9TA 2BWAA 2AYHA 3CHXA 2GH2A 3Q8AA 4KWUA 1W2AX 1LEMA 1HB1A 3UKVA 3RZMA 2EXKA 2HLEA 1PGW2 2W08A 2W94A 3B94A 3TNPB 4EN8B 3HD8B 1O3SA 1BZWA 1GOHA 1A3KA 1OFNA 2KM2A 4RS5A 1NA1A 1CAUA 2C9AA 2RDRA 3DF0A 4MHRA 1OOPA 3I3DA 5BNNB 4OVEA 4YW2A 5I0TA 2WA4A 5FYCA 1KD7A 4A6OA 1IS6A 1GQGA 2RDNA 5CISA 2FDFA 1MZEA 5FP8A 4OLLA 1XPWA 1GZTA 1OPMA 2V5YA 2ZHLA 3WINE 4LKFA 4R9CA 3UK9A 2XQXA 3I2JA 3OYWA 2VUCA 4P00B 4UBHA 4IEYA 4PI2A 2FDHA 2D3PA 5DUVA 2KXLA 3I2GA 4AZZA 2ZAHA 5J96B 2ZGQA 3QD6A 4XJ8A 3B00A 2X29A 4UW6A 1GNHA 4MHUA 1O4TA 4O61A 5IFPA 4QX7A 2A6YA 3LFMA 3ZSLA 2CDOA 1UIJA 1TMF3 4BA6A 5IYYA 1A8MA 1LHNA 5F1RA 4P9JA 3VL9A 2ARBA 3S5QA 1FNZA 2Z42A 4YGDA 1OF3A 1ZA7A 2HJIA 2WDBA 4NOTA 1BMV2 1S0FA 2IVIB 3IDAA 4HBNA 2BOIA 1BEV3 1X8EA 5A33B 4CCDA 5KWRA 4K6BA 1LR5A 4GALA 1RC6A 2D3RA 2GNBA 2CY6A 4WM7A 3VHOA 4BQ4A 4R4XA 2CNAA 4RR3A 2ATFA 2SLIA 1Q56A 3CU7A 1LNSA 3BB6A 1XNKA 5FZ3A 1T6BX 1SLAA 2WN2A 4NHMA 3VBRA 1M06G 1QJEA 2WLQA 1OI6A 2ADEA 2GNTA 2YROA 4F3JA 3WF4A 5L9RA 3SH4A 3N4MA 3WD5A 1U12A 1RB8G 5ABJB 1DQ6A 3PU3A 2VZVA 3GDBA 2DV9A 4FP3A 1HIXA 4XFHA 4E4DX 3WQ7A 4MX3A 3ZR6A 1S4CA 3VDCA 4A7YA 5EIYB 2TBVA 3QACA 3GBGA 4LNVA 1MS0A 4I0WB 3RZJA 5FZCA 3BCWA 4KG0A 4EQVA 3ZXJA 4ARYA 2CGPA 2DU0A 2BTVC 3IDBB 3TYJA 2VQ0A 4JDMA 1YRZA 2XXZA 2HWF2 3VHNA 4QKFA 1W8TA 1XE0A 3CJIC 5EWSA 3WDYA 1JYWA 2R30A 3DN7A 4YVSB 1O5UA 2ZMNA 3CJIB 3MHZA 4QM8A 5HCAA 2BBAA 5A7WB 3OUHA 4PF1A 5D8AA 4AQ6A 5BNQA 5CFCC 1JZ8A 1QJU2 4EWDA 5C9AB 5LASA 2JG9A 3JB8A 1H30A 2UYAA 1Y9GA 2JE8A 4IL7A 3EQEA 4CDUA 1FATA 3K3OA 1G9AA 1OH3A 1JOBA 1IG3A 4B4PA 4CU9A 5LZ6A 5JWPA 5JSOA 4NJ4A 4K8FA 3WZ1A 1EYBA 1E5HA 2P6CA 1TMF1 2KD7A 1OLRA 4ES8A 1BJQA 3OBRA 1JZ4A 1O4ZA 2CWSA 3PVNA 2P3JA 3ZVXA 1BEV1 3MPBA 4COZA 2VL4A 2J22A 1W05A 4Q27A 2LROA 2R16A 3Q9OA 1UQXA 3NAPC 4YRDA 2GC0A 5EYYA 4XE9A 3KQRA 1ZREA 3QH7A 2QQMA 3RJ2X 4OMDA 5J48A 1GZWB 2HWF3 2IVJA 3V0AA 4XURA 3WHUA 2NMOA 3NO8A 4FOVA 1DF0A 3NV1A 4HPKB 4O65A 2B9UA 3HBKA 2IUWA 4OQ9A 4N9HA 5C4WC 4QGMA 5FY7A 4CUAA 4INDA 3R6SA 4LUKA 1XJAA 2I07B 3HJRA 3SCHA 2XPJA 3J7NA 2Y6JA 5JLVA 3ZYRA 1YQ6A 1GWKA 1KGYA 1QJU3 4AEJA 1ENRA 4FAGA 2YG0A 1WZXA 4AHXA 5C8CA 3VHRA 4QX2A 5H9RA 4E27A 1WCUA 1N1YA 2D3SA 2RM22 4NUBA 1UU6A 1J1TA 3PUAA 3FLTA 3GM8A 4TLFA 3AP6A 2A3XA 3DKQA 1S0IA 1IOAA 4Q4V2 4FXKB 4BQ1A 3IIIA 5FPZA 5CKMA 5CZKA 2RJLA 4A3ZA 4LR4A 2VZ1A 4LBNA 2BZDA 1NX9A 2OQ7A 1UMZA 1WCKA 5A70A 3URFA 1WA6X 1ND3B 3KCXA 4MLOA 4AAPA 4Z92B 3AX4A 3N9LA 3OPTA 5FYZA 1BMV1 4CP2A 4PJYA 4YVWC 2AZ5A 2ZGLA 1NQJA 4TYSA 4YVWB 2D5FA 5BNOA 5FOJB 2WO7A 3AVRA 1UZVA 1W6OA 3D3AA 4B29A 5GZCA 2EVXA 4KG8A 2YC4A 3TRSB 2W3JA 2SBAA 1B35A 2XH6A 2ZABA 3GCXA 1CWPA 2HYKA 1COV2 5J1XA 2YZ4A 1ENXA 1MQTC 3IWZA 4N9IA 5JOYA 3UJOA 4JGYB 4M4RA 4MADA 4EE2A 2XWBB 1BQPA 5C7GA 1HN0A 3TNQA 3VBSA 2HEWF 1WBFA 2VCMA 1LOEA 2ZKNA 3ZN6A 1FMD2 4QQLA 3LKJA 2DCKA 2VY0A 4DRRA 3PTRB 2QQLA 2HWF1 4B1MA 1OA4A 4LORA 2W92A 5F3CA 2X5IA 2RM23 2CTVA 2Q1FA 1UZYA 3KF5A 5A7NA 1KFXL 2YFUA 4MXVA 2JE7A 4L99A 4META 2AH2A 4YLZA 2GH8A 4LKEA 1JXNA 4Q4V3 4MH0E 1LB2A 1OD5A 2GC2A 1JYCA 5GLTA 4JDOA 3FBMA 4CDQC 2W1WA 1AL0G 1QJU1 1ZA4A 4YW4A 5FYHA 4CDQB 1VMJA 4CA9A 2ORXA 2AUYA 3W59A 3D82A 3F95A 3PJYA 3NSTA 4TZDA 2Y64A 2VNGA 1C5IA 4I3PA 3AZZA 1XYNA 4CE8A 3S57A 3ZSJA 4CUGA 1W39A 2YBSA 3W5MA 3ACHA 2ZMLA 1G8WA 5A80A 3JXSA 4LLOA 5FZIA 1H9PA 2A5ZA 4AFDA 4KI5M 1YQCA 2WRAA 2RDQA 3E1F1 1R1ZA 2ZEZA 1HX6A 1DHKB 4GXLA 4LO6B 4QMAA 1IQAA 1Q8VA 5ISLA 1TQ5A 5IK4A 1W6NB 2GU9A 3ZFFC 3LEIA 1O3QA 1Q8OA 2B7YA 4NHLA 1AUYA 1GNYA 2R072 3WXPA 4MV2A 4K9SA 1COV3 1DQ5A 1LHVA 2JDUA 3GJBA 3RZZA 2HEYF 1Y7BA 3HNYM 3T2PA 2EF6A 5FREA 3SEPA 1HW5A 2J1SA 1GP6A 3A0NA 4HVRA 5GM0A 1DFQA 4MGYE 5LA1A 4CCOA 1FMD3 4NE9A 5IUQA 3TN92 5A1LA 1CZSA 2WN3A 4PT6A 1NY72 1PO11 3H7YA 1AXZA 1JI6A 4CP9B 4DPNA 3QCWA 1U5ZA 2A6WA 5LCWL 5FUNA 3E6BA 1HLCA 1UO9A 4I09A 3T0AA 4CTEA 1UPSA 5K8SA 5KXBA 4HXCA 4QPGC 4YW3A 2VBBA 3D4KA 1C1FA 3RGBA 3NVCA 4GZ9A 4QPGB 1IG0A 3AKRA 3ZO0B 4D6QA 4WVMA 5ERLA 4AI2A 1JUHA 3WV6A 2VO5A 3VDDA 1Y9MA 1MVQA 1QHDA 3O14A 3ZXGA 1D4M2 3USSA 2VOKA 1RUH2 3AKSA 3ZFEB 4JZRA 3WP3A 2A6VA 3EMRA 3KCCA 4XF4A 2RM21 3ZYHA 4TTGA 3KT4A 4EZ4A 4Q4V1 1S0EA 2IXJA 1EAH1 2YGMA 4ITCA 2FCVA 1UY3A 4OMCA 3WNPA 3M2MA 4XC9A 1XNTA 3S0MA 4OULA 1AX1A 4URTA 1K5MB 1LU1A 2I2SA 2R061 1JU4A 3R4UA 4UF0A 4TSVA 4P14A 4QPIC 3MPPG 1LOAA 3VDBA 1XYOA 2R073 3I3MA 1FPN2 4MVTA 4FFIA 5CFCA 1SCRA 1ZBE2 1SMVA 3MYXA 1BBT2 1WMDA 3U11A 3CL1A 2VXRA 3MICA 4ET7A 2XJSA 2BNMA 5HXVA 3UESA 2PQQA 1DP0A 1W03A 4XBLA 2EIBA 3NV2A 4ISQA 4Y1YA 4CP0A 1OD3A 1QQP1 5A6QA 1F15A 1NG0A 1RXGA 2R0FA 2VMHA 3TN93 1H1IA 3M7AA 2H0BA 1PMJX 2GALA 2WKKA 3FJSA 2Q8DA 4X8NA 1VALA 4JHZA 4AQTA 3R4DB 1COV1 5KC6A 3VLBB 2ARAA 3UNPA 3ZYBA 5FZ9A 2VM9A 2Y26A 3K4AA 5EJ1B 1KDKA 3VBFC 1VRBA 1BXHA 1UOBA 3UKTA 4LKSA 3HNMA 3H0OA 5FPLA 2RS33 3ZDSA 1C8NA 5C5TA 1GWLA 1OPOA 1FMD1 3S7EA 1D4M3 4FVVA 3WW1A 1RUH3 3FBYA 5FXVA 2XJPA 2RJKA 2WQ8A 1JS9A 4HK8A 3SLIA 5JPNB 3VN4A 2YFZA 3NAPA 4GQ7A 1WCQA 3HR9A 4I0AA 4E4ZA 1A78A 3I3QA 5E8AA 1J3RA 3ILFA 3SXWA 5FZAA 3W20A 4YFZA 1V6NA 4BDVB 2W95A 2DF7A 2ID4A 2YXSA 3AZYA 2QFEA 1RVF1 3N7JA 4I3GA 1JUIA 3KB5A 4G9SB 3NV3A 1XRUA 1FAYA 3SKJE 2D98A 2XB6C 3POFA 5LEKA 1NA1C 2RE9A 3N36A 4RS5B 5C4WA 1RL3A 4C1WA 4OCTA 2W1SA 3H3UA 1NA1B 1CAUB 2EIGA 1W8ZA 4ZU7A 2OT7A 1FPN3 5AFBA 1ZBE3 4Y4YA 3KS7A 3J7HA 3BYWA 5E89A 4AI3A 1BBT3 1O3TA 4FPYA 2DVBA 4FPEA 2Z79A 2D97A 3KGZA 3LCPA 1DGWX 2GC1A 5BPXA 1V70A 2NQYA 3OYWB 1Z0HA 5T5JA 4BQ3A 4RGAA 1A8DA 1JZ7A 2PELA 4HOOA 2P3IA 2GC3A 2R071 5CADA 3ETPA 5DDJ2 5A3OA 3WCRA 4BLIA 2RG4A 5JCTA 5I0SA 1V6IA 3UYJA 3FUOA 1DQ1A 1GYKA 3WOGA 3MIBA 4XTMA 4Q1PA 3NW4A 2OKXA 3DPRC 3SISA 4DXTA 3JCIA 3WUDA 2PHUA 4NO4A 4D8MA 3OJBA 3TN91 5KHIA 5H9PA 2W52A 4WM7C 3THCA 4W50A 1NY71 5EP9A 4RR3C 5CKQA 2BV4A 3NNGA 4WM7B 5FFOC 4RR3B 3CF6E 4LLFA 2GDFA 3HN3A 4PQ9A 2WAAA 3ZYFA 3U4XA 1VBB2 4OI2A 3WHTA 3Q8CA 3HPNA 4YW1A 3SCGA 5BYNA 3IIAA 5T5OA 1TG7A 4D94A 4QDRA 3AL6A 2ZHMA 3C3VA 3POYA 1MQTA 1D4M1 2QJVA 1RUH1 1XNCA 3BU7A 3I2OA 5FDBA 1C1LA 3ZXKA 3ATGA 1UZZA 1ZRDA 3GHNA 4NRMA 1Z78A 4COUA 4LBLA 1HRI2 1LGBA 5JOXA 1Y9QA 2B8MA 4CDWA 3KWVA 5F5IA 4E4HA 3BVCA 4LPLA 2J1UA 1UY4A 1RINA 3ACLA 1AL22 4BMBA 2GN3A 1D4VB 4ZPIA 2VZTA 3WQ1A 1P8JA 1T6GC 1RHI2 4NAOA 1R1A2 1GOFA 3A7QA 2WQZC 5D8AB 1DZQA 3LGRA 4PHZA 5JVVA 4RN5A 4CDQA 2D44A 1FPN1 1YEWA 2JDYA 2QQUA 2VUAA 3B5LB 2NPIA 5DDJ3 3QLQA 1BBT1 3JUUA 2JG9B 5FYUA 5A7OA 4YGEA 4GJYA 5F3GA 3WW4A 1YUDA 3C7EA 3KF3A 3ST7A 4LE3A 1MS5A 4XCAA 2WWSA 4XF9A 3NMBA 1PX3A 1LAJA 2VQAA 4ONUA 2QDRA 5KC5A 1OKQA 4HSLA 3WF1A 1KJRA 5FKBA 1UIKA 3JQWA 3KV5A 4XTPA 3MUY1 1C8M2 1VBB3 4IE6A 1GQPA 3NJVA 2W1UA 3ZFFA 1J3QA 4C0BA 3C7OA 3VBHA 2VH9A 4X8PA 4XDQA 2QQIA 4DNYA 4MGKE 2D40A 4N8MA 4Y4RA 3BKZA 2ZGRA 4O9GA 2R7EB 3I49A 3AP7A 2EA7A 4K20A 5HPOA 4XEZA 4QQ2A 2BU9A 4NIDA 4GKYA 3OGSA 2WT0A 4J1XA 1YFWA 3V0AB 5DAPA 1F8VA 1AL23 4P9WA 1RUC2 1LKNA 2QQWA 3A23A 3KV9A 4XETA 4NHXA 5FOBB 1S0DA 4N53C 1DQ2A 1RHI3 2GZWA 4QPWA 1R1A3 1ZM1A 2J7MA 4LO8A 5DG2A 2YB7A 5F8PA 2OIIA 1Q8SA 4JTOA 2MPFA 1XQNA 2IXIA 4GULA 1ULDA 1US3A 3ACGA 4Q4Y2 4YM3A 2VQTA 1UCXA 3WNKA 4P08A 2JENA 5C8CB 1W8NA 2ZMKA 4GWNA 4ZZ5A 1UYPA 4AR2A 2DBNA 4TWTA 2NZ9A 4QHBA 5FZHA 1PGSA 2VOXA 2WQ4A 4BK5A 1RYYA 4SBVA 2WINB 4GKXA 2B46X 4LKDA 4CCNA 4BWOA 5IJRA 2O14A 5DAVA 5IHRA 1RXFA 3B02A 3DL3A 3INAA 2AGSA 1QWRA 1TNRA 3GBFA 4JV4A 1GKBA 4FPCA 3MLJA 4ISRA 3NNMA 5DDJ1 1W2UA 1XNDA 4RL7A 2ZGKA 4BISA 4WM8C 3NL1A 4AEDC 3CNAA 1YYNA 4IV3A 2F4PA 2DVDA 1C8M3 3O1OA 4UW4A 3IAPA 4QPIA 3EJKA 5LY2A 1QY4A 1ZRRA 1UX6A 1AR82 4H7LA 2ZEWA 4D7YA 2W68A 1FNYA 4LBQD 4YW6A 5FPVA 3MW2A 1G9DA 3CIHA 1ASJ2 4JGZA 1RIRA 5BNOC 4XAAA 3O1PA 5F9TA 4FXGB 4UFKA 5BNOB 5C8CC 3RYKA 3FC0A 1H8VA 1D0HA 1W6OB 2V73A 4XFBA 2ARCA 5LRSA 1D2QA 4OUEA 1LOFC 1VBB1 4QKNA 5FZBA 4YPJA 3HVDA 1I1EA 4XQ4A 4LE4A 1B35B 1X9PA 4NHYA 2Y6FA 3WP6A 1PGL2 1RUC3 4FFFA 3CJXA 4X6QB 2GAUA 5A6YA 1CJDA 2JJ6A 2WZPP 3J4UH 4QQHA 3WNLA 1I5ZA 3NKGA 1W6QA 3VBSC 2PHWA 2ZS6B 2OZ6A 3VBFA 1UAIA 4CZSA 4D69A 4D7TA 2O8OA 3I3EA 3VBSB 5KBFA 5EYXA 2Q8CA 4LT5A 2DCJA 3AYCA 3MFAA 3ZN6B 4Q4Y3 4IEXA 2MHFA 3K48A 4LO7A 1HRI1 4LA3A 5J98B 1JHNA 1MEC2 3WDUA 5KHJA 4UOJA 4JKMA 3UKNA 1AL21 2BNNA 5FY9A 3BIWE 1S0BA 1RHI1 2HBUA 2W87A 5FXXA 1R1A1 4OYUA 1ZZ7A 3FFZA 1ACCA 3KHBA 1CN1A 1VRH2 1VB4A 5CEHA 3LEKA 3N7MA 3ZFGC 1EPZA 4HN0A 3LDKA 2XLGA 5JIAA 3VZKA 5B4NA 3RFRA 3ZFGB 3HT1A 4AGVA 3GNEA 3O1SA 2EALA 5CG8A 1HRV2 3M70A 2P5BA 3MIFA 4XACA 2C24A 3PUIA 4HONA 4B1LA 5A3TA 3WQ0A 1AR83 4LO5B 3T4HB 5I0DA 3RMXA 1ASJ3 2UWAA 3LOIA 3PUSA 2A70A 1S2KA 1T2XA 4FPHA 3ETQA 5EPAA 5JXGA 4K7JA 2WS92 2ZPXA 1QJY2 3POEA 5FMDA 1JHJA 4PIXA 3SMHA 5I8YA 2WZ8A 3U0ZA 2XG3A 2FDGA 1F2NA 2WFF2 1QDCA 3E97A 1HQWA 1UMIA 1AF9A 3WG2A 2DUQA 4EV0A 4QXKA 1OURA 1GWMA 3GALA 3WVJA 4W65A 1W99A 2X53S 5LBCA 3VKFC 3ZYJB 4AGRA 4BB3A 1EUUA 3LF7A 1GFF2 1ND2C 1ONAA 2A6ZA 3FHQA 2VZRA 4CVUA 5FWJA 3P1IA 5C3PA 2VE1A 4XFAA 2RR12 1QDOA 1K45A
chains in the Genus database with same CATH topology
1MS8A 5GLVA 3ZMOA 2P34A 3DPRA 2XJUA 3MEPA 4A7ZA 2PLV2 3ZXAC 5BUVA 3AYAA 4FPFA 4AQSA 3WG1A 1MEC3 3WT3A 1Y3TA 1CAXA 4XF3A 4GH4C 1F9KA 3ZSMA 3RI9A 1URXA 1RUC1 3LSEA 1RTVA 4GH4B 4YARA 1WUVA 2RS12 3IBMA 1I9RA 3RYPA 1RUOA 1G6NA 5GLZA 4JAAA 4NHKA 5E16A 3QH6A 1VRH3 3VDDC 4WVMB 3VKLA 4Q4Y1 3VDDB 1BCXA 3WX5A 1S0GA 1WGPA 1ZNPA 3WDWA 1BK1A 1GZ9A 4N43A 4R9BA 4XIOA 1HRV3 4XYXA 2JKBA 1AZDA 2BEOA 1I3HA 4YNIA 1AJOA 3VKMA 4Q0UA 1ALYA 4NVPA 3GBWA 2WS93 1QJY3 5H9QA 4CP1A 2RHPA 4BMEA 2WFF3 4HSJA 3AYDA 3BOPA 3LB9A 3O12A 2ZGTA 3CEWA 4PIZA 1H4HA 1NE4A 1QKQA 2EAKA 4RSUA 5CFCB 2BWCA 1SDWA 1OQEA 1ZVFA 4AQ2A 1ASJ1 3LA7A 2AREA 2RR13 5JMCA 1EP0A 5JSPA 1Q8PA 2PLV3 3AZVA 4AGGA 4AEKA 1IKPA 1VB2A 3MF6A 5CFDC 4AHYA 1PGL1 4PBOA 4EJRA 1POV0 2RS13 4XILA 1S55A 2W39A 4LEJA 3KLSA 3N3HA 4CYDA 1MEC1 1VBA2 3H9AA 2OYZA 4QQOA 2FZ1A 3B01A 4IV1A 3MI8A 4Q29A 4YZ2A 2PFWA 4XXAA 3SCFA 2JG8C 1NOVA 3NAPB 4X6RB 4F8AA 3VBOC 2DVGA 4L92A 1KDMA 1OSGA 4BYYA 1RUF2 3VBOB 5LEJA 1VRH1 1PGW1 3AXEA 3BOWA 3HIFA 3G7DA 2Y38A 2QE3A 4LUMA 4N53A 4YFWA 2YGLA 5C4WB 4OHYA 1HRV1 3MLKA 3M8LA 3RDIA 3OD4A 3M4FA 3WNXA 4E9KA 2TNFA 4IXLA 4ASMB 4MZUA 2JX9A 2XUMA 5GZEA 3VV1A 2A75A 5LEKA 1NCQC 1RUG2 5KHGA 3N7KA 5DZEA 2WS91 1QJY1 1NCQB 1PIV2 2WNVC 3M3IA 4EN7B 2WFF1 2DURA 2IXCA 2DCZA 4QM9A 3IDEA 2WNVB 1S1AA 1PK6C 1YCIA 4Q26A 2QKDA 1N3PA 4AWDA 5JOZA 1PVXA 3AMNA 1NLSA 4BM8A 4NN0A 1AX2A 4WM8A 4FPJA 4OZXA 4AEDA 2RR11 2A6XA 4LBMA 3APBA 5CB7A 5DZFA 3ASIA 2EXHA 2VGDA 5FRAA 2PLV1 3ZSEA 3LOBA 1CESA 1QXPA 1EPWA 1XU2A 1VBA3 4S2FA 1UD1A 1RUE2 5DUUA 2VW2A 1YHFA 2A7AA 4YGBA 4FPOB 4LBKA 1AR62 2RS11 4FO9A 1AXYA 3T1LA 1RUF3 1U5XA 5L7OC 1LOFA 1O3RA 3W9AA 4XJUA 5L7OB 4KWJA 2Z2SB 4XJWA 4BZ4A 1YNAA 4GMP0 3JZVA 1MQTB 1EV12 2DVAA 2R6QA 3FHIB 2BVBA 2BBVA 1KJLA 4L9BA 2ZOEB 1X33A 4MYEA 5BNPC 2Q4SA 2ZX0A 2I74A 4CDWC 5DUXA 4Y26A 1SBFA 5HCFA 4ATFA 3FLPA 4HL0A 3HT2A 4CDWB 2CL2A 3ZXFA 1U5YA 1RUG3 5K0UC 1G9FA 4W6YA 1PIV3 1V6MA 1YJLA 3ES4A 1IHMA 3VZMA 1GICA 5T55A 2OZJA 4YM1A 2WLPA 4R52A 5I93A 4DOUA 1SFNA 2E9QA 2QUOA 1ZZBA 3ZFGA 1MACA 3BTAA 1H2KA 1AJKA 4MGZE 4M3CF 4KQ7A 3DKWA 5KHKA 3OF1A 4N7IA 2FBEA 3KM5A 5C6CA 3OBTA 1UN1A 5BV6A 3ZIWA 1RUE3 1FYUA 1OFSA 2PHLA 2D6MA 3OCPA 1AR63 1V6KA 1WCSA 2Q1MA 3VBHC 1VR3A 1POV3 3ZFFB 2CAUA 3VBHB 3AMPA 3GHMA 1VBE2 1ND2A 3B93A 1EV13 4E2SA 4RFT0 4IQPA 2A71A 2QVSB 3O0XA 5CNAA 3B69A 5I8SA 5A32B 2EXJA 4H7MA 3B7MA 1QJX2 1RUF1 1W6MB 3OTFA 1O5LA 4AI8A 2D93A 4GH4A 1NXMA 4IEWA 3ZXDA 3SITA 4R8HA 1AYN2 2D6LX 2FMDA 3RNSA 3ZMNA 3WR0A 4BLJA 2RS32 1MS4A 2XVKA 5IK8A 3MF9A 1H1MA 3WUCA 4R4ZA 2LALA 2GMEA 2O8QA 2HWD2 2XKOA 1DU3D 2BUKA 1V6LA 1PIV1 2XVLA 5KXEA 5L36A 5HI0A 4DY5A 3FFQA 4KWLA 1WMFA 4AEMA 1GBGA 4GB32 4YZ1A 4IV3C 4EWEA 3IPVA 5J3UA 2YPJA 1N1TA 2DTYA 4AVTA 1Q8QA 4IV3B 3PJQA 2IFRA 4QPIB 1SACA 4NPRA 2JD4A 4JGZC 5JZGA 4QGNA 3JBG2 1VBE3 3VZNA 2E7TA 1LHOA 4JGZB 4AG4A 1QXJA 4PCRA 1YO8A 1RUE1 1AHSA 1I6XA 4BH9A 3FMGA 1CQ9A 1DGLA 1QJX3 2VMIA 2G9FA 1POV1 3R05A 3ZPYA 3I59B 1PHMA 1ZZ8A 5A3MA 5CFDA 2ERFA 1H0BA 2ZAAA 1N1VA 4CDXC 1AYN3 1B09A 1EV11 1W6QB 3B3QE 5CU1A 5EJ3A 3J8F2 4GMP3 3VBFB 3IDCB 1OQ1A 1SLIA 2BW8A 3ELNA 2PYTA 1SLCA 4IEOA 3M3OA 2HWD3 2YUEA 1JYIA 2JXAA 1XU1A 1M4WA 5FO7B 2JG8A 2XJTA 4LTAA 5T52A 2R1BA 3VBOA 2WJSA 4K1YA 2F6BA 3I2DA 1UL9A 4Z07A 4GB33 3GZTB 1KRIA 1X7NA 2DFBA 1J1LA 1HDKA 5GLUA 2QQPA 1LOCA 1N47A 4MSVA 4YG0A 4DS0A 5GKAC 2ZCWA 4XPVA 4KBBA 4MXWA 4WV8A 3ES1A 5CIRA 5JAXA 3JBG3 2N7GA 4I30A 1AVBA 4K1ZA 5JI7A 2R32A 2ZGOA 4ZXKA 1NCQA 4DQAA 2ZHKA 3BPZA 2WSUA 2WNVA 1GV9A 4LHNA 5T5PA 1F31A 2IZWA 1LTEA 3WG3A 4M01A 4C91A 2HEVF 1JBCA 1PK6A 5FMOL 3TOJA 2YHJA 1VBE1 3KGLA 3SNMA 4I2OA 2V09A 2VW1A 3J8F3 3MFCA 3RYRA 1LRHA 5K8SA 3POSA 1RJ8A 3TWIA 1O3SA 5K7PA 3FX3A 3DPRB 4OUSA 3WDVA 1AYM2 4YYOA 1DQ4A 3H50A 1DGWA 3V64A 3B9CA 1CAXB 2PAMA 4Q2FA 1W0OA 3AKPA 3RSJA 5A3LA 2ZGUA 3D8CA 1AYN1 2HWE2 5DXDA 5J36A 2ZTNA 2RS31 3HQXA 1UKGA 4GMP1 2PAEA 5DZGA 5L7OA 1J59A 2I45A 4JRAA 2H6CA 4N43C 2OUHA 2ZZQA 3RJRA 4N43B 1LOGA 4A2UA 2HWD1 4EN6B 1VBD2 4Y1ZA 3S7IA 5BNPA 1SCSA 2UY8A 3AP5A 2VOVA 3V0BA 3MIDA 3LSDA 1MR5A 5K0UA 5L19A 4HANA 4LULA 3WDXA 2BFUL 4EN9B 1KXGA 2XWJB 1X36A 3ENRA 1OQDA 1G86A 3M3QA 3U07A 2VW0A 1BVVA 2EXIA 3DV8A 2Q0AA 1IKQA 1DG6A 1ZBE1 1FV3A 2B39A 4YZ3A 3JBG1 1YIFA 5I91A 5I0UA 4M0HA 2ENRA 3KMHA 4Y22B 5FMOS 3WG4A 2WZR2 4KH9A 1AYM3 3E5QA 4PDWC 3LZZA 1PMIA 1HXS2 3M3CA 4PDWB 5GZGA 4F83A 4P5HA 1CD3G 1S2BA 1Q3EA 3FLRA 3D6EA 4HKLA 4HN1A 2VECA 2ZX3A 3PMSA 2HWE3 5GJ6A 4FSJA 3J8F1 3VZJA 2A3WA 2DCTA 3NKTA 1X82A 4A3XA 4LHLA 1TNFA 3AYEA 4IV1C 5F6KA 2RS52 3R4SA 1DQ0A 1DZTA 1IPJA 2BPA2 4IV1B 3DUIA 4RQPC 1VBD3 3WP4A 1JOJA 4KGQA 5A32A 1NCRC 5KXCA 1UPIA 2VULA 1W6MA 2AENA 1H9WA 1LHUA 3MLLA 4FTEA 1ZZ6A 2ET7A 4Y24A 5HBAA 2XBO2 3RWNA 3DGTA 4XF0A 1DGRA 4N53B 4B8EA 1JTZX 2WA3A 2BFUS 4DXZA 2FQPA 4Q4X2 1IS4A 4DINB 5T3NA 5IT6A 2ES3A 1VAKA 2UY9A 1CX4A 1ULFA 2XL7A 1KS4A 2W0XA 4ASLA 2VPVA 2WZR3 2ZGNA 1ZX5A 4AVBA 1HQLA 1PVC2 5JR7B 5T5LA 3D0SA 3HMYA 3M3EA 1HXS3 4Y20B 4PBPA 4HKOA 5J37A 1S0CA 3VHPA 1IS3A 1MS3A 2Y0IA 4D7SA 3G6JB 4LBJA 1ZRCA 2DFCA 4WM8B 4AEDB 4P9IA 2JDZA 2PHFA 3CO2A 4HMZA 1YIPA 4Q8LA 5T50A 1RUJ2 5F6LB 3OGGA 2RS53 3TB0A 1Z7S2 4H55A 1ULGA 4GA9A 4IEPA 4C90A 4AVSA 2ARXA 4FTBA 1H2MA 4DZGA 5C8WA 1GR3A 1BVP1 1UF2C 1FT9A 2HWE1 3H7JA 3KCYA 1C5HA 2XJVA 3N35A 3I59A 1QXRA 2XBO3 4LBQA 4XFIA 2BQPA 4M3CA 4XW3A 1XYPA 3VL8A 1ULCA 2CGNA 1CGPA 4CDXA 2PHTA 1D0GA 1OA3A 1JW6A 1AXKA 4L97A 4WVWA 1VBD1 4BOWA 4Q4X3 2CWMA 2H0VA 3EHKA 4AI1A 3VBUC 1QH6A 4MGIE 2PTMA 4XBNA 4LBOA 2QDNA 1DYPA 1PVC3 1SBEA 5B2GB 4PF5A 1WLDA 3TBDA 3OY8A 1YXWA 5EXOA 2XKPA 4QX5A 1ZZ9A 4J1WA 1CIWA 3ZXEA 1U0AA 4WZFA 2WZR1 1N1SA 2WNEA 2R042 3LWCA 4B3NA 1SEFA 2JEMA 3C2UA 2DVFA 2VVDA 1RUJ3 2QNKA 4MUVA 4WVVA 1HXS1 1XE7A 3MW3A 4NWVA 2E7QA 1Z7S3 2YV8A 2ZJCA 3MW4A 2DWRA 4I01A 1C8M1 4DY3A 4WZCA 1QOTA 4KL1A 5BNNC 5HCBA 5K9YA 2CV6A 2HWC2 2VVEA 1ND2B 3HWJA 3ILRA 4GIQA 2RS51 3CLPA 1DZRA 1MVEA 1QU0A 2WT1A 3MGUA 1CPNA 4ZU4A 4C1XA 4JDNA 2E6VA 4FOYA 1W6PA 1ENQA 1DYKA 4KU8A 2UYBA 1FXZA 3AKTA 3L9JT 4FCAA 3ZN4A 5CVRA 3ZSKA 2E51A 2P17A 4KU7A 2XBO1 4ZU5A 4ORFA 4FBFA 2R0HA 2ETEA 4Q0VA 2MNGA 1LGCA 3V65A 3FE5A 3AK0A 4Q4X1 4AHZA 2Z5WA 1WCDJ 3MIHA 4Z2WA 2K0GA 3NJZA 4FPLA 2IXLA 3S30A 2DYCA 1PVC1 2QCSB 2R043 4IEZA 2XJQA 5AVAA 2FZ2A 1MZ6A 3AM2A 5ABJC 1QJZA 1QOOA 3BODA 4JRLA 5FO8B 5ACA2 1R082 3WW3A 1RITA 3IPVB 3UJQA 1XXNA 4OUMA 5H9SA 2HWB2 1WW7A 4YGCA 1AR81 3OGJA 5JZGC 5AFEA 1PZ7A 5JZGB 2HWC3 1KFUL 4XZPA 1RUJ1 4E4SA 4Y22A 1GLHA 1MZ5A 2YMZA 3PLQA 1AR92 2OA2A 2A73B 1Z7S1 3MIGA 4YM2A 3X29B 1OMIA 4M0NA 4YVSC 1ZRFA 4R9AA 2OPKA 5J7MA 3AKQA 4PDWA 3AFKA 4FPKA 1RGSA 2ZGMA 1TEIA 1U5IA 2VVFA 1SLBA 5C9AC 5CFDB 5SV5A 3SH5A 1QOSA 3ECQA 4UBGA 3O0WA 4H3WA 4D3WA 1WLTA 1DBNA 1VAMA 4JCKA 4XIKA 1C57A 1CAWA 1WBLA 3IM0A 5C33A 3ZIXA 2XVGA 4IERA 3NWKA 1TME2 2R1DA 2PHDA 3I4IA 1JH5A 1UU4A 4RQPA 4V1PA 3RMYA 4AHWA 4AK3A 2JG8B 2TEPA 1NCRA 4QU2A 3AP4A 2UURA 2QZ3A 2JECA 3THTA 3USUA 5ACA3 1R083 4LO4B 5CBLA 3M1HA 1UKRA 3V56A 1KITA 2VU9A 3GZUC 3VKNA 4YSFA 5JSRA 4XFCA 2HWB3 3E6DA 5EV7A 5FBZA 3THPA 4MXWB 5DG1A 2R041 1LENA 3PVEA 1YWKA 3K51A 3NV4A 2VMGA 5LK5A 3ZYIB 1AR93 1PO12 2ILMA 5EFUA 2DU1A 2WSVA 3AMMA 4UXAA 1QNYA 3MZHA 2GSYA 2ZZJA 4E2QA 1PO22 3H1WA 4Y20A 3UL2A 1IPKA 1WA4A 1PK6B 3AZWA 3FZ3A 1N3OA 1W0PA 2IWGB 1G7YA 4NWWA 2HWC1 5J09A 1L3JA 4P9XA 1QH7A 5SV8A 5CAZA 1LECA 2FMYA 4M00A 5E1RA 2IC1A 2VG9A 3E5XA 3GYDA 2BGCA 2XHKA 2EAAA 1VIWB 1AX0A 4EROA 1LCLA 1EAH2 1TME3 2BYVE 2D43A 1OA2A 5FQ0A 4AVVA 2R062 4AFBA 4DFSA 1N3QA 4CRQA 1ENSA 1ND3C 1ZYBA 2H6BA 2WT2A 4AFMA 2VNRA 4FQ4A 1GANA 1VLNA 2C1FA 2ZGSA 1C4RA 3RQ0A 1H2LA 2VNOA 4HT1T 1PZ9A 3D5OA 4COVA 4XHBA 2WC2A 4CEWA 2A3YA 2GNDA 2O1QA 1C3HA 4YZ4A 5BNPB 4HVOA 1J58A 3ZN5A 2Z69A 3V0BB 3VBUA 2C5DA 1QQP2 3AJYA 5JIUA 4IETA 4P9YA 2YYOA 4U36A 1PO13 5K0UB 4G4FA 4AFCA 2K9ZA 5ACA1 4JGYC 1R081 1G9CA 3HN1A 4P9GA 2YC0A 1GSLA 4YG6A 5KHHA 1PO23 5JOWA 2UWBA 3AMHA 4OHWA 2HWB1 1LESA 3IMNA 5FCCA 2D5HA 3QBQA 4XQWA 4N7UA 2Q30A 2R49A 4AW7A 2GN7A 3POWA 3I8TA 1DDLA 1AR91 2BNOA 1REFA 3VUOA 1YJKA 1S0JA 1WMEA 1O91A 3HBZA 1JN2P 4OHVA 5GZDA 1EAH3 4OFGA 4OI1A 4N90A 3O7OA 5GLWA 2P3KA 1RVF2 3AB0A 1NQDA 4FAHA 1VBC2 2R063 1OHFA 1V00A 3T1MA 4FOWA 3ALQA 1HV1A 1VP6A 2IXKA 2P2KA 1NXD1 1QF3A 2ZKLA 5AVPA 5AC92 1GNZA 3JD72 5BNNA 2DCYA 2NMNA 3GZAA 1VBA1 3H1YA 4HK9A 1CAVB 4L11A 2WL1A 4W6WA 3WY6A 1TME1 1X8MA 2OUJA 3J9SA 4B4QA 2LM3A 1AR72 3H1MA 4FTSA 1BKZA 5GALA 1QQP3 1GZCA 2C0ZA 4O9EA 4HVQA 5FLJA 3OD0A 3RI8A 1H8TC 3AJZA 1CVNA 3E5UA 1H8TB 4XFGA 5FTTC 5BXXA 5FLIA 1RUD2 3RPQA 1YFYA 1PM7A 3PNAA 1VAVA 1X50A 5A33A 3JB4C 1RUG1 3GF6A 2GNMA 4Q0PA 4P9LA 2PAKA 1CONA 2UU8A 4BIOA 3EXUA 2ZBJA 2ZACA 4AE2A 1F5JA 2NYYA 1SBDA 3ILNA 4IEQA 5JPMB 1FOD2 5CG9A 1PO21 4LHKA 3P3PA 2NM1A 2WNUC 4FT8A 5ABJA 1HKDA 1RVF3 1EY2A 3AP9A 1NLRA 1VBC3 2WNUB 4W6XA 3ROUA 3WLUA 2PN5A 3ZFEC 2D6NA 4RHV2 1NYWA 5AC93 3JD73 3O0VA 5I0RA 1REEA 2DUPA 4CEYC 4PLNA 4JVAA 2GMPA 4XJZA 4CEYB 1K5MC 2DUOA 3IN9A 2XGXA 1QGLA 4Y1XA 4YVSA 3OPZA 1AR73 1AR61 3CJIA 3JQXA 4HETA 5LRRA 4COYA 4QGLA 1OLQA 1APNA 2E63A 4LBQB 5CA6A 1FI2A 4M3CB 2JE9A 3EBRA 3MDPA 5C9AA 3LA3A 2B42B 4B4RA 4FOQA 4CDXB 5LK7B 1PNFA 1ZBA2 4QD2A 1RUD3 4ZKTB 3SHRA 3U10A 1UU5A 1ULEA 5FPXA 4AXOA 2XLFA 4RD7A 4NR1A 1V9U2 2P37A 5BY5A 3TAYA 1QMJA 1YFUA 4B7EA 4BPZA 1YFXA 1FOD3 2YDEA 5DUWA 1IGOA 2XLAA 1UW8A 3OY8B 2B5HA 4JTNA 1C28A 2PHRA 2B45X 3ZXLA 1E57A 2RMU2 3PVOA 1PNGA 4Q8KA 4RHV3 3D0JA 3BALA 3FUQA 2MEV2 4WBBA 4ES9A 2G9GA 1GZWA 1DLLA 1RUNA 4HPKA 4YM0A 1VBC1 4RS5C 1WLCA 1WW6A 4BIFA 4XF1A 3LA2A 4S2HA 1OOPC 3I7DA 4DRVA 5AC91 1PZ8A 3JD71 4OI0A 1OOPB 2YY1A 2GMMA 2WIIB 2XL9A 1CR7A 2IXHA 2QZ2A 4BE3A 4Q4W2 1ZBA3 4EN0A 4AFAA 1W6PB 4HZFA 1CJPA 4XBQA 4Q1RA 5T54A 1AR71 2FHRA 1QJX1 2CGOA 4J6GA 2ET1A 3PVBB 3ZX7A 4XJ9A 4M3CE 1HV0A 1V9U3 1YI7A 5JI9A 2ZX2A 1RMU2 4RA0A 2LTNA 1RUI2 5TSWA 1ND3A 4OHXA 4QQPA 1WD3A 4EWAA 1RUD1 3PHMA 2K2SA 2Y0OA 4FPGA 2RMU3 1XE8A 3EO6A 4QT6A 4XMAA 1R092 3B9IA 4S2GA 4YVWA 4YW5A 1YI9A 4COWA 3ZYGA 2ZGPA 3KD4A 4YZ5A 3WW2A 4Y1VA 3VBRC 2MEV3 2ZA9A 1FOD1 3VKOA 3VGIA 5I8TA 1KQRA 4XMIA 3VBRB 2AR6A 4GB31 1REDA 1MS9A 3QOPA 4L8QA 1MS1A 1IZ3A 4JGYA 4GWMA 4I02A 4I0BA 4Z82A 1LJ7A 1FX5A 4RHV1 1SLTA 4H14A 1WW5A 2IFWA 3HAGA 1H4GA 1Y43B 1LHWA 1WD4A 4XFFA 4XXPA 1TE1B 3IKWA 1G9BA 4AVAA 2XJRA 1LU2A 4Q4W3 5D1IA 4KGGA 4XOGA 1GQHA 5FO9B 3P3NA 4HLTA 1O7FA 4DB5A 5D8AC 4IEUA 3JU9A 5KXDA 4HKWA 1VJ2A 1IS5A 1ZZCA 3R0RA 1LGNA 3WCSA 1H1AA 2Q1ZB 4IESA 4A7KA 4FP2A 4Q0SA