4Q4Y2

Crystal structure of coxsackievirus a24v soaked with disialyllacto-n-tetraose (dslnt)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
264
structure length
264
Chain Sequence
b'GYSDRVRQITLGNSTITTQEAANAVVAYGEWPSYLDDKEANPIDAPTEPDVSSNRFYTLDSVQWKSTSRGWWWKLPDALKDMGMFGQNMYYHYLGRSGYTVHVQCNASKFHQGALGVFAIPEYVMACNTEAKTSYVSYVNANPGEKGGVFDNAYNPSAEASEGRKFAALDYLLGCGVLAGNAFVYPHQIINLRTNNSATLVLPYVNSLAIDCMAKHNNWGLVILPLCKLDYAPNSSTEIPITVTIAPMFTEFNGLRNITVPATQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coxsackievirus capsid protein VP1
publication title A sialic Acid binding site in a human picornavirus.
pubmed doi rcsb
molecule tags Virus
total genus 64
structure length 264
sequence length 264
ec nomenclature
pdb deposition date 2014-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4q4y200
1RUJ1 1B35B 1AR71 1B35C 4N43A 3VBSB 1PIV2 4Y4YA 4QPGC 1PVC2 1C8M1 1QJU1 3VBRA 1QQP2 2XBO1 5BNPB 5BNPC 1ZBA1 1NA1B 1NA1C 2RMU3 1ND2B 3ZFGC 3ZFGB 1CJDA 1RMU2 5J98B 2RS12 4RHV3 1K5MA 1FPN2 4RS5C 4PDWA 1D4M2 1IHMA 4CDWA 1AYN2 1RUH1 5JZGA 1SMVA 4CDUA 1MQTA 2RMU1 3JBG1 1RHI3 1R083 4IV3C 1RUG3 4RHV1 4WM7A 2Y26A 1QJY3 1Z7S3 4GB32 4CDXC 4CDXB 1COV3 4Q4Y2 4CEYA 1BBT2 2HWE3 1VBA2 1RHI1 1AR92 1HRV3 1VBB2 3VBUB 3VBUC 1ZBE2 3ZFEC 4Q4X3 4GMP0 2IZWA 5C4WB 5C4WC 2MEV2 5CFCB 2X5IA 1HRI1 4RS5A 4YVWB 4YVWC 1QJZA 1RUJ2 4N53A 1AR72 1AL0G 1COV1 3ZXAC 5K0UA 2R043 4JGYA 1PO23 1C8M2 3CJIA 1QJU2 1H8TC 4Q4X1 3VBOA 2XBO2 1ND3B 2GSYA 1M06G 1ZBA2 4RR3A 1VAKA 5CFDB 4AEDB 4AEDC 1VBD2 5C9AA 1R1A1 4RQPC 4FTBA 1F8VA 2RS51 1EAH1 5ABJC 2PLV1 1RUC1 5ABJB 3DPRA 1VB2A 1ASJ1 1RUH2 1RVF3 3ZFEA 5BNNC 5BNNB 2HWD3 1MEC2 3JBG2 5ACA3 1OPOA 5FMOS 1AYM1 4JGZA 5L7OA 2RS32 5DDJ2 1VBC1 1PO13 4IV1A 1RUE1 2BFUS 4Q4W3 5ACA1 2FZ2A 1W39A 1NCQB 1RUI1 5D8AC 5D8AB 4GH4C 1BMV1 1HRI2 1POV3 1AR62 3J8F3 5BNOA 4FSJA 1DDLA 3TN93 2HWB3 1VRH1 1BEV3 2R073 4CEWB 4CEWC 2ZZQA 5A32A 1PGW2 3JD73 1POV1 1R1A2 4EJRA 3JB8A 1NCRC 1NCRB 2RS52 1AR83 1EAH2 2PLV2 1RUC2 2R062 2HWB1 4Q4V1 1BEV1 1ASJ2 4WM8A 1AL23 4CDQA 4YVSA 3VBSC 2FZ1A 1EV11 1RUF3 1AYM2 1K5MB 1RUD3 2HWC1 2HWF3 1VBC2 4CDWB 1ND2C 5AC93 1TMF3 5JZGB 5GKAC 1RUE2 1FMD3 1RUF1 4WM7B 2RM23 1TME3 1RUD1 1RUI2 4LLFA 3IDEA 1BMV2 2HWF1 5AC91 4CEYB 1TMF1 1HXS3 1B35A 2ZAHA 4QPGA 1VRH2 1TME1 2X5IB 5BNPA 1R081 5C8CC 3ZFFB 5C8CB 1HXS1 1NA1A 1RUG1 2WZR3 3S6PA 1NOVA 3ZFGA 1VBE2 1FOD3 1QJY1 5CFCC 5FOJB 3VBOB 1Z7S1 1NY71 4Q4V2 1V9U3 2RR13 2WS93 2HWE1 1HRV1 1EV12 4IV3A 5A33B 2HWC2 3VBHB 2XPJA 1ND3C 1FOD1 1R093 5CFDC 2RR11 1POV0 4CDXA 2R041 1PO21 2WFF3 1PGL1 4FTEA 3VBUA 3NAPC 3NAPB 1QJX3 1R091 2RMU2 5C4WA 3VBFC 3VBFB 4YVWA 4IV1B 4RHV2 1PIV3 1PVC3 4BCUA 2BUKA 1F2NA 1QQP3 1RVF1 1H8TA 2HWD1 1ND3A 1R082 1RHI2 2GH8A 3VDDC 3VDDB 5BNOB 1RUG2 4AEDA 1NCQC 1RMU3 4RQPA 2RS13 1QJY2 1FPN3 1Z7S2 2ZTNA 5J96B 1NY72 5ABJA 4GMP3 1D4M3 1COV2 1OOPC 1OOPB 1PO11 2HWE2 4RFT0 1AYN3 1HRV2 4Q4W1 4QPIB 4QPIC 5BNNA 1NG0A 4Q4X2 1FPN1 2DF7A 4N43C 4N43B 4WM8B 4GB33 1D4M1 3J8F1 4Q4Y3 2R042 1BBT3 1PO22 1VBA3 1AR93 3FBMA 3VBRB 3VBRC 1VBB3 3TN91 2BBVA 1ZBE3 2R071 5LK7B 2MEV3 5D8AA 3JD71 4GH4A 1RUJ3 1AR73 1AR81 1K5MC 4PDWC 4PDWB 1BBT1 1C8M3 3JB4C 4CDWC 5JZGC 1QJU3 4CDUC 1AL21 2XBO3 1MQTC 1MQTB 1RVF2 4CDUB 4FTSA 2HWD2 1ZBA3 4CEWA 4Y5Z0 5ACA2 1VBD3 4WM7C 1OHFA 1NCRA 4QPGB 4CEYC 1X33A 1PO12 3M8LA 1RUH3 1FMD1 4NWWA 4Q4W2 1MEC3 3JBG3 3VBSA 1VBD1 2RM21 2X5IC 2RS33 4RS5B 1HQNA 4N53B 4N53C 5DDJ3 3ZFFC 5K0UC 5K0UB 4JGYC 4JGYB 1C8NA 1ND2A 3J8F2 3CJIC 3CJIB 1A6CA 1E57A 1MEC1 4IV3B 3VBOC 3TN92 2HWB2 1BEV2 2R072 2RS31 4RR3B 4RR3C 5DDJ1 5C9AB 3HAGA 5C9AC 3JD72 1HRI3 1AR63 1AR82 2WZR1 3VBHC 3DPRB 3DPRC 1X36A 1V9U1 2WS91 3ZFEB 1AL22 1RUF2 4JGZB 4JGZC 5L7OC 5L7OB 1R1A3 1AR61 2RS53 1RUD2 3ZFFA 5C8CA 1RB8G 1EAH3 2HWF2 2PLV3 1RUC3 2R063 5AC92 5CFCA 1TMF2 1H8TB 4SBVA 4IV1C 1ASJ3 1FMD2 2WFF1 1PGW1 4RQPB 2RM22 1TME2 1VB4A 1AYM3 2TBVA 5A33A 2R061 3VBHA 1QJX1 1VBC3 1HXS2 2WWSA 5BNOC 2QQPA 5CFDA 2VQ0A 1GFF2 1RUE3 1PIV1 4Z92B 1PVC1 3LOBA 5A32B 1QQP1 1RUI3 3NAPA 2WZR2 1RMU1 2RS11 3VBFA 1FOD2 1WCDJ 1AUYA 4WM8C 4GMP1 4CDQC 4YVSB 4YVSC 1V9U2 1VRH3 2RR12 2WS92 4CDQB 1AYN1 4GH4B 1PGL2 3VDDA 1HX6A 1VBE3 2BPA2 1NCQA 1R092 2WLPA 5FMOL 4NWVA 4GB31 4Q4V3 4Q4Y1 1OOPA 2WFF2 1CD3G 1VBA1 1AR91 1EV13 1VBB1 1ZBE1 4QPIA 2BFUL 2HWC3 1VBE1 2MEV1 1QJX2
chains in the Genus database with same CATH superfamily
3FBYA 3TNQA 1O8SA 1AR71 3E97A 2DFCA 3MF6A 2H6CA 4M4PA 4C1XA 4FO9A 3NWKA 4E8DA 4K3UA 3D6EA 2GH2A 3K51A 3ZN5A 2AEZA 4UOJA 5FDBA 5JXIA 3WW4A 2LROA 2YV8A 4FPHA 3VD3A 1LHNA 3DYPA 5BNPB 5BNPC 2VUJA 4YNIA 1ZBA1 4E9KA 2J1UA 1NA1B 1NA1C 1ZZBA 1PGSA 3AYCA 4LOSA 5J48A 5L36A 4OZOA 4HL0A 1EPZA 1ULDA 5T50A 5HXMA 3EB7A 2VTXJ 4D3WA 4H7MA 5G05L 3WF0A 1FPN2 3AYDA 4PDWA 1XPWA 1CVNA 1XNBA 2J1RA 5DZFA 4M0NA 1KGYA 3SXWA 2XWBB 5FYUA 3O1VA 4RYDA 5FZDA 4ZS3A 4OHVA 4B4RA 3LZZA 2V5DA 2LM3A 2PAEA 1QGLA 1UW8A 2ZGPA 4SLIA 4UW6A 3K77A 4F8AA 4WM7A 1GNYA 1J3PA 2Y64A 2FBEA 4LTAA 3ZLIA 4A6SA 1NLRA 3I54A 1L3JA 1XU2A 1OT5A 4GB32 1D2QA 3LKJA 1W9SA 4PJYA 1H4HA 4LKFA 3VD5A 3RWNA 3CEWA 1COV3 2C1FA 2WNVA 1YO8A 2HWE3 4Q4Y2 4Y22A 3AJZA 3O0WA 3H1MA 3S7IA 2ZGKA 3NJZA 1JZ5A 3RZJA 1W8TA 4DRVA 1U5IA 1LULA 4XOGA 5FLJA 2Q5TA 3PLQA 1UY0A 1DGRA 1GZWA 1O4TA 2MHFA 3MIBA 2J1VA 1D0HA 4ZXEA 2BNMA 5EQUA 5C4WB 5FO7B 5C4WC 5F1RA 2X5IA 1WCQA 4P9JA 5I91A 2WFPA 4Q0SA 5FFOC 1AR72 2R7EB 1HDKA 3SHRA 2ZA9A 5I0TA 2FCTA 1MZ5A 3GCXA 4JGYA 4MYEA 4RN5A 1PO23 3B69A 5FP3A 4COUA 2Y34A 1U12A 1GQPA 5EJ3A 4A6OA 1YUDA 3RJRA 1WD4A 3BI3A 5IWFA 3N9PA 4XYXA 4JRLA 1ND3B 5EPAA 1SQ4A 1ZBA2 2UURA 1M06G 2PELA 3IPVA 2YBSA 4OVEA 1R1A1 5BNQA 3TWIA 1QJEA 4WZFA 3FE5A 3RZZA 3AVSA 4TZDA 5FMDA 2WT2A 3M4FA 5FZOB 1N1TA 2Z42A 1ZM1A 5FKCA 1VB2A 3AMMA 3ETQA 1W9FA 3V0AA 2PHTA 2WIIB 2Y6JA 4XFHA 1PHMA 1I9RA 1RVF3 1TZOA 3LGRA 3OF1A 4FPYA 5HCFA 5C8WA 5FOBB 3LE0A 1ZZ6A 3AM2A 4QM8A 2Q1FA 5ACA3 4W8JA 2J42A 5CIRA 1AYM1 5FMOS 3QCWA 2PHWA 4QPWA 2Z5WA 1AX1A 4HK8A 4KBZA 4NRMA 1W05A 4QT6A 4BMEA 1H1AA 2XJTA 1W6PB 4QGMA 3GBGA 3UJQA 1L7QA 1O7FA 2R16A 3DKWA 1CR7A 2FDIA 1PMIA 1G6NA 2HYKA 3AZXA 3U14A 2CGOA 1BMV1 3T2TA 2VNOA 4LKSA 2GDFA 1CN1A 2IWGB 5FZ3A 2J7MA 1JXNA 2PHXA 2FDGA 3AZZA 3F2ZA 4L92A 1W8NA 3J8F3 4FQZA 2R32A 1I3HA 1UOBA 2DCJA 2YHJA 3H42B 1H6XA 1F4AA 3IAPA 1XQNA 4XXPA 3WCSA 1F9KA 4RD7A 2VZOA 1CZTA 2FHRA 2WABA 2WBKA 2Z79A 2ZZQA 2R49A 3OBZA 1PGW2 1POV1 1R1A2 2E31A 1W03A 3JB8A 1DYPA 2QKDA 5C3SA 3MV11 4TTGA 3C7HA 4FFIA 4A2UA 4XF3A 1JYTA 3MLKA 2DUOA 1MPXA 4L0PA 2HWB1 4I0AA 4LO6B 1X9PA 4AXOA 1BEV1 2WWUA 2ZGTA 4PF5A 5F2WA 4WM8A 1SBEA 2DVFA 2JG8C 2JG8B 2VMEA 3VBSC 4UI9L 4EROA 4AQ6A 1RUF3 1OI6A 3J9SA 2P3IA 2ZOEB 3KLSA 4L97A 1AYM2 4LO5B 3U1XA 1N3OA 1JHNA 1RUD3 1HW5A 3ZOIA 5FIXA 3B3QE 3M1HA 2VMHA 1ND2C 3P1IA 3EMRA 3PIJA 4FPKA 1TMF3 4I0WB 1GKBA 4LEJA 4LT5A 3UNPA 3FLPA 1QXRA 3WW1A 2Y6KA 4GJZA 4UW5A 1HJGA 4QDSA 2D3RA 1JYVA 3RVHA 2RM23 4P9LA 2DU0A 2B7YA 2IVIB 1HKDA 1ENXA 3UT0A 1PZ7A 1V6KA 1VP6A 1BMV2 2HWF1 2P17A 3CDZB 2RJLA 1K12A 1C57A 2H6BA 2PA7A 4OI2A 5LK5A 5AC91 1RUOA 1UU6A 2J1EA 1DQ6A 2VMCA 3JU9A 3K46A 4D6QA 2CNAA 4Q29A 3OPTA 3UK9A 3N36A 2VW1A 4X8NA 4QX0A 5FUPA 3AMHA 4OMDA 2BNOA 1TME1 1DQ5A 4QGLA 4MUVA 3RZLA 4FOWA 2X05A 3WNPA 2HH9A 3F95A 4TLFA 2ZACA 3ABZA 4L2NA 3ZYHA 1AXYA 2UY8A 3ZXLA 5FLHA 3I2JA 4LUKA 3M70A 1W8UA 3BOWA 4KI5M 1IS5A 4CZSA 2GZWA 2VMIA 2Q0AA 2QUOA 3LEGA 5FOJB 4E8CA 2H0VA 3VBOB 4JX0A 4YG0A 4CP9A 3NNLA 2JJ6A 4Y20A 4F3JA 5LASA 2HWE1 4AZZA 2ZABA 4KBBA 4NIDA 2VBPA 2ZX4A 2X53S 2QDNA 5AFEA 3I2HA 4KWKA 4XZUG 5IAVA 4QAWA 5JXHA 1O91A 5FPAA 3OPZA 2W95A 4LHKA 4CCCA 3BGAA 5A33B 1OQDA 2OPWA 2XPJA 1O3QA 4UBHA 4LUMA 1LGCA 2WAOA 3J7LA 2XJPA 3ILNA 1WUVA 4AEKA 2OXBA 4NIIA 2A6ZA 3SNMA 1Y3TA 1W6MB 3RSJA 2FCVA 5T5PA 1PO21 5IHRA 1W6NA 4FTEA 4AVAA 1HV0A 2VZSA 3NW4A 2FMYA 4LBQB 2A71A 1MZ6A 2XL7A 1QJX3 1R091 2VM9A 1SDWA 1TNRA 3LOIA 3OPWA 4IE6A 5IVFA 5T5JA 1IPSA 2JE7A 4DUXA 3LEIA 4YVWA 5B2GB 4IEQA 4JKLA 2G4IA 4NJ4A 4Z2AA 4UT5A 4DS0A 1CPMA 1PVC3 4BCUA 2ZGLA 1SBFA 1QH7A 3WT3A 2VULA 4FXKB 2HEWF 1SLCA 3NV3A 1RVF1 4YG6A 1LENA 4HXCA 3VDDC 3VDDB 4O9EA 2VZ3A 4M3CE 1NCQC 4E4HA 2RS13 1QWRA 2PTMA 4B8EA 5T5OA 2FMDA 3Q8CA 4CUCA 1UYXA 4AI3A 1PK6A 5K4LA 1HB4A 5J96B 3ZXKA 4BWOA 4GMP3 1X8MA 2W5FA 1D4M3 1COV2 5GLVA 5ANNA 3P3PA 2HWE2 2QVSB 3KWVA 3AXEA 1OXCA 2ZX3A 4GA9A 4RFT0 5DG2A 2E7QA 2VR4A 3IIAA 4I09A 3LFMA 3AX4A 4NN0A 2WQZC 4N7UA 4OQ9A 1LRHA 3M3IA 1REDA 4KWLA 3JZVA 3MHZA 4QXHA 4BLJA 3ZXDA 3M3CA 3POIA 2W9XA 5DZGA 2ZGUA 1UY2A 3ZXFA 5TSWA 4BA6A 4XBNA 3CJXA 5C5UA 1BZWA 1HIXA 3J8F1 4LXLA 3BVCA 3ST7A 1PO22 2WWJA 3M7AA 1NAEA 1CIYA 1YCIA 1Z0HA 3FBMA 5FR3A 1VBB3 2BBVA 1QNYA 1ZBE3 1SLBA 4MHUA 4ZONA 4ASKA 1VIWB 2GAUA 5IK4A 5FYMA 5LK7B 1YI7A 1NLSA 3B93A 3BIWE 3W9AA 3ES4A 4GH4A 1RUJ3 1YQ8A 4FOYA 3AZVA 3U37A 4PDWC 4PDWB 4NOTA 1LOGA 3LFIA 2JIGA 4HZFA 1KRIA 5F2SA 4ZZ8A 2IUWA 2D40A 3AP7A 2W1QA 4UWDA 5JIUA 4CUAA 2WNEA 2EICA 1ODMA 2E6VA 3ON7A 3OGSA 4WBBA 4D7SA 2XBO3 4D8MA 1RVF2 4FTSA 1R64A 4FPJA 1ZRDA 4CEWA 1VRBA 2VXJA 2W87A 5ACA2 4CYDA 4WM7C 5AFBA 2P34A 3Q8EA 5JAXA 1RYYA 5CVRA 2P6HA 2IVJA 3RRDA 5LA0A 3SQOA 4QPGB 5DAXA 1DZQA 1O4ZA 4L11A 1NT0A 5A6YA 2GNMA 1UQXA 5GLZA 2UWAA 2WNVC 2WNVB 3O7OA 4UFMA 4CXXA 3IMNA 4AHXA 2VZVA 5IJRA 4GKXA 1W8OA 1UPSA 1RUH3 4UFKA 5A3WA 4NWWA 2Y6LA 1MZFA 1OKOA 1PZ9A 1QIQA 1GZWB 2ZX2A 4EN8B 4EQVA 3TAYA 1ENSA 4GXLA 2RM21 5A3UA 5F5CA 3RGBA 2YFUA 2VCAA 4ARYA 2X5IC 2RS33 4EZHA 1QDOA 3Q8FA 1HQNA 3UGGA 3IMMA 4P5HA 5A7PA 1W6QA 5FTTC 3RMXA 5KXEA 2GN7A 4FFFA 1QHDA 3IT8A 3MBWA 4JGYC 4JGYB 4ARXA 1C8NA 1NQJA 2YDEA 3J8F2 2C9AA 3KGLA 3MFAA 4Y5SA 1ULOA 1RXFA 1UWWA 3LIHA 3OYWA 2G9ZA 3AVRA 2EA7A 5FY5A 2VG9A 5A6ZA 3J4UH 3OUIA 1AXKA 5DMYA 3IPVB 3K48A 3GHMA 5DDJ1 3T2OA 1H2NA 2VPVA 3WD5A 5CKMA 1AR63 1ULCA 4ISQA 5DUUA 5FYIA 1YRZA 3OCPA 3SEEA 3VL8A 1YFYA 4LO8A 3WY6A 4YZ1A 1X36A 3L9JT 3MFCA 4YW1A 3CBNA 3KMHA 2OQ6A 2ZX0A 2I74A 5FZEA 4CSWA 1Q8VA 1U0AA 5EIYB 1V6OA 3A23A 1WLCA 3GNEA 4AAXA 4AFCA 1RUF2 1Q5OA 3D3AA 1QXJA 3J7NA 1OSGA 4K8RB 4O61A 2FDFA 2RS53 1RUD2 3I59A 5C8CA 1YEWA 2JB4A 1Y4WA 1BK0A 2EIBA 4K20A 3KQRA 2HBUA 3WG3A 4A7YA 2GMPA 3WDVA 1TMF2 2WO3A 1GQGA 1H8TB 4HN1A 4XIKA 1ASJ3 3H3ZA 3O5SA 4KU8A 4AQSA 1GMMA 3AP4A 2CHHA 3KT7A 3ZXEA 1OVSA 1UD1A 3TEXA 2A5ZA 1C1FA 1H9PA 2I07B 4RQPB 4CU8A 2RM22 2P4EA 3AKQA 4QQPA 4DZGA 2UYAA 1H2LA 1YJLA 1GQHA 2R061 1QJX1 2VZTA 1HB3A 1VBC3 1Z78A 1UAIA 1RJ7A 3K4ZA 4COVA 1MS1A 2RJ2A 2VQ0A 1CPNA 2VUDA 4S2FA 5FY9A 3IKWA 1OQ1A 4B7EA 1QNWA 3LDRA 5DXDA 3EHKA 5C3PA 1QMJA 1PVC1 3M3EA 4ZHNA 3VD9A 3NV4A 3E6DA 4IEZA 3QOPA 4WVWA 3WLUA 3ZYRA 3DF0A 3LOBA 2ZJCA 5JMOA 4QQLA 1YFWA 3CU7A 3WG4A 4GIQA 5F6KA 3ZMNA 3C7FA 3WX5A 2EALA 1BK1A 3Q8AA 3S57A 1A78A 1EUUA 2SLIA 3PUAA 1O6UA 2RS11 3VBFA 2OIIA 1MS4A 1EPWA 5I0DA 3CMGA 5FXWA 4CPBD 2A6WA 3TEZA 2D6MA 1VJ2A 4WM8C 2VOWA 2AH2A 3HMYA 2DVBA 4GMP1 4IEVA 4QQHA 2BVVA 2XUMA 4DRRA 4CCKA 4XUQA 5DUWA 4ZZ5A 1OA2A 5C3QA 2JXAA 3WG2A 1SG3A 4CU7A 3ZXJA 4MGSA 5BV6A 5SV5A 4G4FA 5IAXA 3NV1A 1LOFA 1OVPA 1WW5A 4NHLA 4RGKA 4Z8BA 4ZU7A 3DEMA 2Y0OA 4LBOA 5HCHA 2ORXA 3GALA 3H8XA 3E5XA 1H9WA 5H9PA 1Y9GA 2D43A 4LMFA 3GJAA 1PNFA 2CU5A 4NR1A 1EY2A 1V6NA 4AQ2A 5IW0A 1VBB1 3CNAA 4GWJA 1W0NA 1ZBE1 3B9IA 2BFUL 4XHBA 1H1IA 1JYXA 2VMGA 2P5BA 1QJX2 3PIGA 3POYA 1I5PA 5FYBA 3KHBA 1XYOA 3USUA 1IG0A 1RUJ1 1H8VA 1UO9A 4YFWA 5APAA 5FZ1A 5FYYA 2IXLA 4JQTA 1JTZX 2E63A 5FZIA 4BQ3A 4DFSA 4YSFA 2EIDA 1QOSA 4Q26A 4B4QA 5A3LA 1PVC2 2X10A 2YYOA 1X82A 1IQDC 1RIRA 4CU9A 2XBO1 4E4ZA 1FATA 5CU1A 3MICA 1XRUA 3KT1A 3K3OA 3MW3A 2BNNA 2X09A 1CJDA 2ZGRA 3IIIA 4E2SA 5A1AA 2NP0A 1UF2C 3WVJA 5CBLA 1SEFA 1Y7BA 2RS12 2WINB 3FUOA 1JUIA 4RS5C 4CP9B 2XONA 3RYRA 1LR5A 2XGXA 4Y1ZA 5C33A 2VGDA 1DGWX 3A0KA 3ZIWA 4M3CA 3NV2A 1D4M2 3NKGA 4O9GA 5CEHA 5IK8A 3RS6A 4CDWA 1WMXA 4AHWA 1RUH1 4BMBA 1SMVA 2GALA 3HJRA 2RMU1 4CCDA 5JWPA 1R083 5J09A 2XUEA 2Y0IA 2YC4A 1RUG3 4M4RA 2CWMA 5GLWA 3NL1A 1Q8SA 3PDQA 4U2AA 2Y26A 1W2OA 3O0XA 1N47A 2OQ7A 3K4AA 2PHUA 5FBZA 4BQ4A 3FFZA 2NYYA 2UU8A 4YM2A 2JKBA 4UXAA 4A41A 2AACA 2YPJA 4EV0A 1CZVA 3PJYA 2ARBA 3FJSA 4ET7A 2VTXA 1A3KA 1F35A 1ACCA 1KJRA 2DTYA 4YZ3A 1Q8PA 2NMOA 5DAVA 1ZZ9A 4HLTA 1H4GA 1W6NB 1HRV3 1A8MA 4KL1A 3DKQA 1VBB2 3WDXA 1ZBE2 3INAA 4E4DX 3O1PA 4FPGA 4XF1A 4KWUA 3ZFEC 2PQQA 4YZ5A 2WLQA 1OUSA 1W9TA 5CFCB 2J1TA 2E33A 3ACIA 4YVWB 4YVWC 1RUJ2 2DFBA 3LEKA 1REFA 4QKNA 1AL0G 1DF0A 4P9YA 4NHXA 3AKRA 1V6MA 4XFBA 4YW7A 2WAAA 5A1FA 4M3CF 1OBNA 4Q4X1 3VBOA 2XBO2 4K7JA 5A7OA 5KXBA 3AB0A 1US2A 4Z07A 2GC2A 4XTPA 2RVAA 4RR3A 5F8PA 3THDA 4LJHA 5A6XA 5FPXA 5C9AA 3N9LA 2Q8EA 3WNMA 5DAPA 5ANQA 1Y43B 2RS51 2K0GA 4CCMA 1C28A 1IG3A 1PK6C 1PK6B 1VAMA 1VMJA 3S5AA 4XTMA 5EYXA 5J1XA 2ILMA 1GOHA 4DXZA 1H1MA 2E32A 1ASJ1 1WW7A 4LNVA 1YQ6A 1RUH2 2W0XA 3LSDA 4FVVA 1OPOA 4MXVA 2VNGA 2RS32 5EZWA 3ZYPA 5FK7A 5F5AA 3SCHA 4MGYE 2BWAA 4K40A 1VBC1 4QDQA 4LBQA 4OHWA 1OF4A 4R9AA 2WSVA 5KC6A 3D8CA 4I01A 2F6BA 4M0HA 1UYYA 5IATA 2FZ2A 4LKEA 1JUHA 4QHZA 2XXZA 2VNRA 1ONAA 3CHXA 5A3TA 4IGOA 1W9WA 2AEYA 4BE3A 3GF6A 4GH4C 4AGRA 2WSUA 2IXKA 2YPDA 3MDPA 1POV3 1AR62 2D5FA 3ZDVA 3G6JB 5F5QA 3HPNA 2Z69A 4DPNA 3AJYA 3I3QA 1W2UA 4A45A 3C7OA 4Q8LA 1DDLA 1SDDB 2A6XA 3D0JA 4BXSV 3H3LA 1T6BX 4YYOA 1X8EA 3TN93 2HWB3 3IBMA 3I49A 1BEV3 1OD3A 4CEWB 4CEWC 1AX0A 1ZA7A 5A1LA 4PT6A 1K42A 3VZJA 2F4PA 4XDQA 4PLMA 4HT1T 4EJRA 4DQAA 4OYUA 4Y3OA 2RS52 1CAXB 1AR83 2BGPA 4PIYA 2AYHA 2L9LA 3MYXA 4IEUA 4JRAA 2GMMA 4UF0A 1UZWA 1PM7A 2A6VA 2Y6HA 3D5OA 3IM0A 1W3VA 1ASJ2 3GCWA 3ZSMA 5C5TA 4CDQA 3A0NA 1DQ0A 4DB5A 2A3XA 4OFGA 3U10A 4HKOA 3ZKUA 1LHUA 3ILFA 3O1UA 2FZ1A 3DGTA 1C5HA 2NZ9A 3WSOA 2CTVA 1S0IA 4FAHA 1W6QB 4V1PA 4KNCA 1FV3A 3VKLA 5DN2A 2HWF3 5DABA 2VUCA 1VBC2 4J25A 4XF4A 2VZUA 5AC93 2P3KA 1L7RA 2IFWA 4F83A 3OYWB 1IS4A 4URTA 5GKAC 4AGVA 2Q8OA 4CCEA 4B7KA 1HB1A 3K4DA 1JW6A 4R4XA 3N7LA 5JOYA 5FZ6A 1QY4A 1TME3 1ENRA 1UZYA 3WZ1A 4HKWA 3ACHA 1M4WA 3IDEA 2ZXQA 3M3OA 3DYMA 3RG0A 3I3BA 3WHTA 4XDPA 4YM1A 4DMIA 3DECA 1CZSA 2O1QA 1E5RA 2CL2A 1LODA 3IDBB 1UZZA 2Z2SB 4P9XA 2XKOA 1WW6A 4QPGA 5EJZB 5FAXA 4O65A 1WWYA 4XDOA 4AFDA 5FZBA 4LBMA 2BEOA 3NJXA 4X8PA 5FRAA 5LZ6A 1R081 2D6NA 3I59B 2ZBJA 1SPPA 4JHZA 4FPCA 5C8CC 5C8CB 1RUG1 3N4MA 2WZR3 3AMQA 3S6PA 4EE2A 1WCUA 2DUPA 3ZFGA 3RZMA 1JMUB 1SFPA 3ZSKA 4WVVA 3WXPA 5F3IA 1RUNA 3KQ4B 4QDRA 2HBTA 1XJAA 4TWTA 3KM5A 2RJKA 2VC9A 4V2WA 3U07A 1ULGA 2A6YA 1S0JA 1XB9A 2DVDA 3NSTA 4G9SB 5GZCA 1IPJA 1BKZA 4IEYA 1HRV1 4JHTA 1HV1A 3C8XA 5EXOA 2AENA 2BW8A 3VL9A 3SKJE 4IXLA 1ND3C 5FREA 5I8TA 1R093 3TRSB 3RQ0A 2WA3A 2W3JA 5FZ7A 2RDQA 5FY7A 1LAJA 2V73A 4D7YA 5T3NA 4XACA 5DUVA 1YFXA 5IVJA 1WMEA 4KG0A 3SC7X 3SH5A 4URAA 4QWNA 3MIGA 4W65A 4BB3A 1V6LA 5E1RA 1ZRFA 1IKQA 4BIOA 3O1RA 2ZGSA 2FDKA 1Q3EA 4DUVA 1NXD1 5CADA 2DV9A 4JV4A 4BQYA 4K9SA 4COYA 2BGCA 4IEXA 2RHPA 3ORJA 3VBFC 3VBFB 3BTYA 3T0DA 4IV1B 4OHXA 5EWSA 4AOCA 2RDSA 2A3WA 3ZVXA 3RJ2X 5FO8B 3AFKA 2WZPP 4XIOA 4MO3M 1NZIA 2BUKA 4YGEA 4ONUA 2VO5A 3FL7A 1QQP3 1H8TA 1RINA 4NUBA 1DZRA 1W9YA 1KS5A 4QX2A 1R082 1UIJA 2B45X 1RUG2 3KGZA 1LOFC 3MIHA 5FZCA 4RQPA 3THTA 3T4HB 4FAGA 4LKDA 1O5UA 2ZTNA 3M3QA 1Q8OA 2EIEA 5BXXA 5A3PA 5G04L 5JSOA 3H8OA 5AVPA 1G9BA 3JQWA 2UWCA 3EQEA 2QQVA 2WT1A 4EN6B 1XYNA 1HRV2 4N7IA 2AC1A 2ZEXA 1GUIA 3PVOA 4QXCA 1SFYA 1SBDA 4R9CA 4Q0UA 3H1YA 3FWEA 2BQPA 1U5ZA 3USUB 1ALYA 1LGNA 4INDA 2E26A 3NRUA 4CCLA 2Y8KA 1AJKA 3W20A 1SACA 3N9OA 4D94A 4K21A 1LHOA 2JDHA 2YROA 2Q4SA 2P6CA 3LPFA 3EXUA 5F3GA 4U36A 4YZ2A 1VBA3 4CPBA 2X8KA 1E5HA 2XJVA 3BU0A 4NMIA 3OEAA 3R4UA 3TN91 3LQCA 5F32A 2ERFA 5CA6A 2VOXA 1IQAA 2VY0A 1LGBA 3NJYA 4AI9A 3PVEA 2AR6A 5C7GA 5D8AA 1OFSA 3W59A 3A22A 3IN9A 1KDMA 2OVUA 3T1MA 3VZOA 3O14A 1AR81 1BBT1 1LKNA 4DEVA 4M3CB 5JXGA 1BVP1 3JB4C 4CDWC 4E4SA 3I3MA 1QJU3 4AVCA 4DNYA 1J1LA 3NNMA 3OD0A 1VALA 2NQYA 5IVBA 1US3A 3CLPA 4RGGA 1UYZA 1T2XA 4GWNA 1IKPA 1W04A 3MUY1 3IB3A 5BPXA 2XQXA 1ZA4A 2JICA 5C3OA 3USSA 5JOWA 2RV9A 2V72A 3HT2A 3I8TA 2ENRA 2W1WA 5GLTA 5I0UA 4BQWA 2J22A 1ZYBA 4HSJA 3M8LA 3KF5A 4QPYA 5FZ0A 3WNOA 3JBG3 1VBD1 4ZKTB 4C90A 4QU1A 4GWMA 3I2GA 4XUPA 2Y38A 5C3RA 4X6QB 1OQEA 4FBFA 5DDJ3 1WW4A 4LOTA 5A6QA 4XE9A 4XUTA 1BXHA 1SCSA 4RGAA 2SBAA 3AC0A 4PI0A 2WO7A 2UYBA 5DZEA 4CA9A 3RYKA 3H1WA 3PVBB 1UMHA 1A6CA 3UGFA 5J3UA 1MEC1 4IV3B 1JZ2A 5GJ6A 1DQ4A 5H9QA 5LBBA 3VBOC 3TN92 2HWB2 1JOPA 5FP4A 3U11A 3RFRA 3ZYJB 1BEV2 2D6KA 4AI2A 1TVGA 2W1UA 4RR3B 1DCSA 2JD4A 4RR3C 3VN4A 2WNUB 3OUJA 5C9AB 5C9AC 3IAQA 5FY0A 1AJOA 2IXIA 4AAPA 4BZ4A 1AR82 2WZR1 1JU4A 5K8SA 3GBWA 2N7GA 1PX4A 4UW4A 3T4VA 5B4NA 3LAGA 1HB2A 1DZTA 2NLRA 1NYWA 4MX3A 2XHNA 2XJQA 1YIFA 2ES3A 3WP3A 3WQ0A 1LU1A 1YJKA 4ZXKA 5JXJA 1FNYA 1YQCA 2I2SA 3HD8B 5BY5A 1WMDA 4HMZA 2E9QA 1EP0A 1V6IA 3T2PA 3WNNA 4CXYA 1O3SA 3BPSA 1T6GC 1SLIA 3ZFFA 5JI7A 1EAH3 4XFAA 2HWF2 4K6BA 1RUC3 2R063 3QLQA 5AC92 5JOXA 5CFCA 4LLOA 5KHHA 4COWA 2ZGNA 4XCBA 4NROA 1VLNA 2GNBA 3GBFA 5JIAA 5GLUA 1GV9A 2EVXA 1PMHX 2CSGA 2QCSB 2XLFA 2JB8A 2YU1A 3HR9A 5D1IA 1BQPA 3WDWA 1TME2 1VB4A 5F37A 1DU3D 2YY1A 1GOGA 5LB6A 1G9AA 5GZFA 1N1SA 3PU8A 4ATEA 1ZX5A 2TBVA 4QX8A 3VBHA 5FK8A 4RFRB 2WUHA 1IZ3A 2VQUA 3OJBA 3I2OA 3J7MA 1GFF2 2HEYF 4FP2A 1W2AX 1RUE3 2BOJA 4Z92B 3HNYM 3PUHA 4KH9A 4BISA 1A8DA 2UY9A 2RE9A 2LRPA 3NO8A 4W50A 2GP3A 4QMAA 1QQP1 1RUI3 3ME2A 4PLNA 4B29A 2ID4A 3AL5A 3NAPA 3ZMOA 3G7DA 2WZR2 5LBEA 1QOOA 1W8FA 1Q43A 5IVCA 5FBJA 1JI6A 4UF0B 2Q8CA 4AEJA 5A3NA 4Y1UA 3BOPA 4Y26A 1J59A 4CDQC 4CDQB 2NN8A 3MW2A 1VRH3 2Y6FA 3VD7A 5HV4A 1Q56A 2JECA 5JR7B 4ASMB 3W5MA 2K46A 3E6BA 2VW0A 2EXKA 3VDCA 1DP0A 2R0HA 5JLVA 4JTNA 3KVAA 1OFNA 3N9MA 1JZ3A 2PHRA 2BPA2 3APBA 1VMHA 2J1SA 1R092 1JN2P 3DXTA 5FMOL 3SEPA 4AVSA 4C0BA 5JMCA 2Y60A 3FLTA 4Y1VA 3H7YA 4Q4V3 5FJKA 4HVOA 1URXA 1CD3G 1LTEA 1UY4A 1VBA1 2QDRA 5KXCA 2A1XA 2ETEA 1UYPA 2VQTA 3ELNA 2ADEA 4CP2A 3B9CA 2JE8A 3A4UA 1VBE1 4MGKE 4DXTA 5I93A 2ORZA 4MVTA 1UOJA 1ZRIA 3MPBA 1WLTA 4QD2A 5FPBA 4N43A 2BRTA 3BTAA 1S4CA 1CAXA 1ZRCA 4QPGC 1W2TA 3WUDA 4LIUA 1CAVB 3VKMA 5B4XA 5JPMB 4OCTA 4QB6A 1QJU1 3A7QA 4H2AA 4XQWA 1QQP2 2OA2A 1JODA 1LOEA 4NE9A 3WP5A 4HANA 3WW3A 4B1LA 2ZMLA 1SPPB 2YC2A 3JUUA 2RMU3 1V6JA 4MSVA 5FY8A 1XBFA 3ZFGC 3ZDSA 3ZFGB 4L9BA 1X9TA 4QM9A 4XF9A 1UL9A 5J98B 1GWLA 3I2KA 2QQWA 1XSRA 1OMIA 4AI8A 3JXSA 4P5YA 3B94A 3AYEA 1IHMA 2LW8A 2QTWB 4BJ0A 1C1LA 2D44A 3OGVA 4XJ8A 1XC6A 3CF6E 1MQTA 1JH5A 1HN1A 1VR3A 3JBG1 4K1ZA 4X6RB 3L2YA 4DOUA 1S55A 5JUVA 5CISA 2FDJA 1N1VA 4RHV1 2RDNA 1J58A 4IGPA 1QJY3 3ZYGA 4C8DA 5FWJA 1OLMA 1DGLA 1Z7S3 5LA9A 3URFA 3LEMA 3HOBA 1ZREA 1G7YA 3D0SA 5DG1A 4H3WA 5FQ0A 2PHDA 1VBA2 3N7KA 3K2OA 4EN0A 5F9TA 1IS6A 1QF3A 1RHI1 4PHZA 1KD7A 3R05A 1JU3A 4Q4X3 2EXHA 2IZWA 4YWAA 4D7TA 3D4KA 2DUQA 1GICA 1H2MA 4BXFA 2YMZA 3DV8A 1UU4A 5I8SA 4YARA 5JVVA 3LDKA 3DL3A 4XHXA 2QFEA 4I30A 2R043 4IUGA 2D6PA 4QX7A 4N9HA 3CJIA 1OA4A 4HFSA 3WW2A 2VVEA 2JG9A 3ZM8A 1QJU2 1H8TC 1UOGA 1AHSA 3BODA 3LA7A 4GKYA 4HBNA 3ZN4A 3MIFA 3N9QA 1WA4A 3GZEA 1S2EA 4KG8A 4LBJA 5CFDB 2VMFA 4AGGA 1G9DA 4RQPC 3MW4A 3SCFA 1DGWA 4ZU4A 5J36A 1JYCA 1EAH1 4PBPA 4XAAA 5JPNB 5IFTA 1RUC1 3ITQA 1WCSA 2XJRA 3MIDA 5FXVA 3MZHA 1BHGA 2CV6A 3HVDA 2BV4A 2CWSA 1NXMA 2LS6A 1GP6A 4YGCA 3LB9A 3E5QA 5EP9A 4HPKA 1EUTA 2DCKA 4Q1RA 1YLLA 2ZZJA 3JBG2 2VW2A 2ZGQA 3KZ4C 4IE5A 1UNBA 3SKVA 4AW7A 4XETA 3UESA 5DDJ2 1W8WA 3QH6A 2E7AA 2R0FA 3ZR6A 4R4ZA 2XHKA 1PO13 3VHRA 1B09A 4IV1A 1RUE1 2XB6C 4Q4W3 1RTVA 3V56A 1MVQA 5FYZA 5FXZA 4NAMA 5CNAA 2HJIA 1RUI1 4TXWA 5D8AC 5D8AB 3CL1A 4PQ9A 3ZYBA 3OBRA 2B5HA 3ZR5A 3VKOA 2ZGOA 3OSDA 2BZDA 2WRAA 1C4RA 1BJQA 1H2KA 3PU3A 5DQ0A 3DCQA 1FV2A 1WZXA 3WDUA 2QE3A 3WDTA 4OLLA 4IGQA 3BN6A 4CDWB 1NUKA 1O4YA 2GMEA 4Y33A 4L99A 5DUXA 3WEZA 2OT7A 3EBRA 2D5HA 1HQWA 4AHYA 3UL2A 1ODNA 1VRH1 2G1MA 2PHLA 3ZSEA 3VGIA 5IT6A 3IDCB 3HT1A 4HK9A 5LRRA 2OZJA 1GR3A 1I1EA 5A32A 4LBLA 2UWBA 1POQA 2JEMA 3JD73 1XOYA 2VVFA 5FZKA 2ZKLA 5FPUA 1EAH2 2B8MA 3ZX7A 3T3YA 1CX4A 1RUC2 2R062 4BK4A 4QX5A 1A34A 4Q0QA 2PHFA 1XNDA 4UFIA 5T55A 2BBAA 1UXXX 4Q8KA 4Q4V1 3B01A 2C24A 3KCXA 4JDMA 2C0ZA 3NNJA 4YPJA 3VKNA 3WNKA 4WVZA 1K5MB 3JCIA 1KFXL 1CAUA 1PMJX 2QQNA 5A7WA 4AF9A 4QGNA 3U4SA 1S0DA 1UOFA 2GU9A 3LPGA 5FMCA 5LA1A 5JZGB 1J3QA 3VB9A 2WN3A 1RUE2 2WR9A 3PMEA 1WD3A 1WLDA 1O3RA 2JDMA 2DCZA 2QQMA 2WJSA 4QQOA 1RUI2 2O8QA 4LLFA 3THPA 4FQ4A 2A3YA 2Y6GA 2P1BA 1IGOA 4CEYB 3KF3A 2ZHKA 5FO9B 5IYYA 2JENA 4BOWA 1B35A 3AXDA 4IW3A 1LESA 1DLCA 1LCLA 3C7GA 4XJAA 3ZSLA 4BU2A 4YM3A 3UKTA 3VZLA 5FZAA 2A73B 4LE4A 1W28A 1VRH2 5LEKA 3WUCA 1NE6A 4CP0A 4XVHA 5BYNA 4XMAA 1G8WA 1GZCA 4G3YC 5LBFA 2W92A 2JDAA 5A3OA 5CG9A 3ZFFB 4OUEA 5A70A 1HXS1 2CGPA 3RPQA 3LD8A 4H14A 2DWRA 2PN5A 2VZRA 3WNLA 1QJY1 5CFCC 5FV3A 3LA3A 1Z7S1 3V0BA 3FHQA 1NY71 2VCBA 4Q4V2 1K3IA 3KD4A 3WQ7A 1V9U3 2WS93 3MPPG 3PMSA 4OHZA 4A42A 1BVVA 1KFUL 4XXAA 3VDAA 4MGZE 4AFMA 4YW2A 5I8YA 3NJVA 3WP4A 4XBLA 4Q0PA 3AYAA 3Q9OA 4IV3A 3BB6A 4QKBA 2EF6A 2OX0A 3VBHB 2ARCA 2JD9A 1FOD1 4RA0A 1RXGA 4DY5A 4EN7B 1NQDA 1FI2A 3POGA 2WNUA 4CTEA 3I4IA 1CESA 2W94A 1RGSA 2VBBA 2RR11 4BM8A 4EZ4A 5FZ8A 1POV0 4NO4A 2OYZA 3WF3A 2R041 2W39A 4CDXA 4XQ4A 4Q2FA 1PGL1 4QQ2A 3VHPA 3AP6A 2FCUA 1Y9MA 4AR2A 5FCCA 3VBUA 1S1AA 3NAPC 3NAPB 1DBNA 2RMU2 1N1YA 3MLJA 3P5BA 1LEMA 1LOAA 1CWPA 3AFGA 4N8MA 3VLBB 4YW6A 4J1XA 2AUYA 1F5FA 5LBCA 3C7EA 3O1OA 4OULA 2DBIA 5AVAA 5GZDA 1PIV3 2TNFA 2JDYA 5FYCA 5FZ9A 4QB1A 4TN7A 3MLLA 1F2NA 2VAUA 1D0GA 2WDBA 3Q8BA 3GGLA 4KMQA 5JSRA 2XLGA 3PURA 4DUWA 2GH8A 3VHNA 2A70A 2VMDA 2VBDA 1QDCA 5BNOB 2HYXA 4YRDA 4AEDA 5FXXA 1RMU3 4LPLA 4NRPA 1MZEA 1W90A 1DQ2A 3WR0A 1QJY2 2ZEYA 2YXSA 4A44A 1Z7S2 2D6OX 4NHYA 1NY72 4OUMA 1WBLA 2HKXA 5FUIA 4C1WA 5ABJA 4LO4B 3GXUA 3ZYFA 1PO11 3S0MA 4MOAA 1AYN3 2HLEA 5A7SA 1ZVFA 5FY1A 4A3ZA 5LY1A 4Q4W1 4BK5A 5BNNA 3PUIA 2C5DA 3E6CC 1J83A 1NG0A 4Q4X2 1FX5A 2B9VA 3FLRA 4UAPA 1FPN1 5LEJA 4N43C 1F15A 4N43B 4TSVA 4XQDA 1WCKA 1RC6A 3ILRA 2WZEA 4Q0VA 2R042 4W6WA 1BBT3 2CY6A 5EJ1B 4FP3A 2XOMA 1AR93 4EWDA 3WDYA 3OOXA 4GZ9A 3DYOA 2DCTA 4JC1A 5LRSA 4D69A 1KS4A 2MEV3 5L9RA 3JD71 5F6LB 2KM2A 3CQOA 3O1MA 1GZTA 3OUHA 4PCRA 5L9VA 4AE2A 4E27A 1RJ8A 3EO6A 2BJSA 2ZMKA 4IEWA 5LCWL 1C8M3 1UMIA 2DYCA 5FZHA 4M01A 2PFWA 1MQTC 1MQTB 2NMNA 2WA4A 2WZ8A 4LK7A 2CDPA 1FYUA 3ACLA 5FZLA 2J1AA 4AFBA 2VOKA 3IDAA 1VBD3 2ET7A 4GD4A 4MHRA 3UKVA 2VTFA 4Y24A 1KEXA 1MS8A 2I45A 1NCRA 2VD7A 4D6RA 3ZSJA 4R9DA 1JBCA 4DEQA 1F5JA 2G9GA 3E1F1 4R9BA 4K1YA 5FQ0B 1PO12 3WHUA 4ORFA 5FZGA 5E89A 3GZUC 4CXWA 2ZHLA 5KHKA 2WN2A 1QKQA 4Q4W2 4CRQA 1MEC3 4FFHA 4PIXA 1XNCA 3QD6A 1CAVA 1JZ4A 2YFZA 4YW5A 2Z4FA 3WNXA 1FT9A 3C2UA 3U0ZA 5F5IA 1GBGA 1S0GA 4UFLA 2DVGA 3UV9A 2QNKA 2XKPA 4XJZA 5C71A 2AREA 4PQQA 3RI9A 3I7DA 2CYFA 1GU3A 1X50A 3CJIC 3CJIB 1UZ0A 5FPLA 3T1LA 4XFFA 2JG9C 2JG9B 2YU2A 1I5ZA 3ECQA 4META 4DY3A 3POBA 3WCRA 1W0PA 3UETA 1YC61 1CONA 2O8OA 5FYVA 4HOOA 1LJ7A 4Y1XA 1J1TA 3JD72 1HRI3 1SCRA 1XNTA 1ZZCA 3OY8A 4I3PA 4P9GA 4XJ9A 3ZPYA 4NIGA 4UFJA 2C6SA 2GC3A 2JE9A 1PX3A 3BIEA 1H30A 2ZMNA 5JR2A 3H8RA 1D4VB 2QQLA 4S2DA 3LF7A 5E16A 4H7LA 4NHMA 1C5IA 1FXZA 1V9U1 2WS91 1UU5A 4HPKB 4V2VA 3POSA 3LWCA 2QZ2A 3OB8A 4EN9B 4BQXA 5CZKA 1GWMA 2BP6A 3PVNA 2Q8DA 3NVCA 5L7OB 4LHSA 1PZ8A 3WF2A 2W46A 3AP9A 1WKYA 4MXWA 1EYBA 2DVAA 4QX3A 3ROUA 1RB8G 3UKNA 2D93A 1H0BA 2Y33A 2PLV3 5FUNA 1LB2A 5H9SA 4LORA 2XVKA 4SBVA 1TE1B 3ACFA 3POWA 4IV1C 4R8HA 1QU0A 4CCNA 4DXRA 2HEVF 1PGW1 1CAWA 2QJVA 4J1WA 1HLCA 1U5XA 4FI9A 2VZPA 4XABA 1W8ZA 2OW4A 3I2DA 4J6GA 2WWSA 3I97A 4UYBA 4E2QA 1QOTA 5CFDA 2QQPA 2QQJA 1DYOA 1UZVA 3OGRA 3WQ1A 3T0AA 1PIV1 1NKGA 3HQUA 4PIZA 4XILA 5JI9A 1S0EA 4FPOB 1CX1A 4N90A 4ISRA 3QACA 5A32B 4BH9A 3IZOA 2GNDA 1YFUA 2CAUA 2WO2A 3E5UA 1SHWB 3VZKA 3ACGA 1OLME 4RSUA 5HCBA 1XE8A 4C0HA 3H50A 1GP5A 3SMHA 1RMU1 4JDOA 4BYYA 1CGPA 2K2SA 3AL6A 1SZBA 1WCDJ 3FC0A 5KR7A 3OGJA 4WZCA 3VD4A 3GHNA 4ZPIA 5IVVA 3RZHA 1V9U2 2D3SA 2WS92 1UKGA 3PUSA 2W52A 3ZN6A 4IETA 4KU7A 1AYN1 1JOBA 2YBKA 3DUIA 4CP1A 1G9CA 3ZPOA 2LTNA 1NX9A 1CAUB 1SLTA 5A7WB 2XLAA 3O1SA 1VBE3 2X29A 2ZPXA 3KCCA 5CYYA 3T08A 3MIEA 3PTRB 2P2KA 2WL1A 3VKFC 3I3EA 1NZCA 3O12A 2DTWA 3WG1A 2XVGA 4JVAA 1SLAA 5FZ4A 5I0RA 3RI8A 1OOPA 2QZ3A 1ZZ8A 2WKKA 5CG8A 1AR91 1E5SA 1KITA 1EV13 1MR5A 2PXJA 2RDRA 4HN0A 3WV6A 3MV01 4QPIA 2ARAA 2IXHA 3B00A 1RL3A 5C6CA 2HWC3 2V09A 4GJYA 1VPHA 3P6BA 2MEV1 2VOTA 2EXIA 3BCWA 4JZRA 4Y1YA 2O14A 3BTZA 2VZ1A 4JCKA 4NVPA 4XC9A 2ARXA 4HETA 1B35B 1B35C 3HWJA 3VBSB 4IDZA 4LIVA 5GZGA 1PIV2 4Y4YA 5F39A 5FWEA 3AZYA 1W99A 1C8M1 4Q5OA 3I3DA 4EWAA 2ZS6B 5HBAA 4D6SA 3VBRA 3OBAA 2TEPA 1VMFA 3ENRA 3GDBA 5JCTA 3LA2A 2F4LA 4XFCA 1GSLA 2XH6A 1ND2B 2EXJA 5T54A 4BPZA 5L9BA 1RMU2 2ZHMA 3I2IA 4YG3A 5IUQA 3GM8A 4RHV3 2DCYA 2WYSA 4IESA 1LHVA 1K5MA 1NLQA 3V0BB 2ZX1A 3C3VA 1ST8A 5DAQA 4IE0A 5LY2A 3GZTB 1OD5A 3W21A 4CUBA 1AYN2 2VH9A 4FFGA 5JZGA 1QXPA 4DXSA 4CDUA 1PVXA 3H8UA 1RHI3 1FAYA 4IV3C 4RL7A 1QJFA 1YQ2A 4XFIA 4ES8A 1P8JA 1PNGA 3TB0A 3HN3A 3CIHA 4IEOA 2JDPA 1LOCA 3R0RA 4AYUA 2XDVA 4W4ZA 2WNUC 1K5JA 3H0OA 4XMIA 3SH4A 3TEYA 4CDXC 4CDXB 2VU9A 4LA2A 1OKQA 4CEYA 1U5YA 1BBT2 4XURA 5IK7A 4R52A 2A75A 1AR92 3N3HA 3PNAA 4QKDA 2VL4A 3VBUB 3VBUC 4EWEA 1OA3A 3DXUA 4FPLA 1DIWA 2V4AA 2VVDA 5GALA 1OC1A 3AZWA 3AMNA 4GMP0 3U78A 2MEV2 1V00A 1ULPA 5EV7A 4XW3A 1HRI1 4RS5A 1QJZA 4N53A 3EJKA 4BHPA 4HONA 1COV1 2EIGA 5D21A 3ZXAC 3S7EA 2PAMA 2KXLA 2VXRA 2VJXA 5K0UA 1IOAA 3R6SA 3T0BA 3ZXGA 1UY1A 1C8M2 5JSPA 1JZ8A 2O0OA 3FX3A 5H9RA 5I0SA 5IK5A 3CZJA 3WF4A 2GSYA 5KWRA 5D2AA 1VAKA 4WVMA 4AEDB 1AX2A 4AEDC 1VBD2 3OD4A 4AFAA 3K3NA 5F3CA 4FTBA 1F8VA 1TNFA 5FPZA 1WLWA 1FNZA 1OPMA 4LO7A 4NHKA 1UMZA 5ABJC 1J84A 2PLV1 5ABJB 1MS0A 3LIGA 3SCGA 1JOJA 4F7ZA 2XJUA 3DPRA 3NNFA 4NPLA 2JDNA 2ZEZA 2B42B 3UJOA 2IXCA 3ZFEA 5BNNC 5BNNB 2HWD3 2R30A 2W47A 1MEC2 4Y5TA 4LBQD 4P9IA 2XQRA 1LEDA 4ZY9A 5SV8A 3WOGA 1XU1A 4JGZA 5L7OA 4XUNA 1ENQA 3TOJA 2VE1A 4PF1A 2KA3A 1DYKA 4CVUA 4A3XA 2P3JA 3NNGA 3MUZ1 4NPRA 4NRQA 2DU1A 2OUJA 4P14A 4TLGA 5JOZA 5HCAA 3KHCA 3ES1A 1ZRRA 1SFNA 3KCYA 3SLIA 4D0QA 2GP5A 1W2NA 1W6OA 2BFUS 2ZKNA 2D98A 5ACA1 3AMPA 1RITA 1W39A 2VCMA 2W1SA 5FLIA 3RZKA 1NCQB 2Q30A 1J3RA 1OURA 5LA2A 1GOFA 3MI8A 2VCCA 4P9WA 4B1MA 2GNTA 2QBXA 3M2MA 1HRI2 4YM0A 4BQ2A 3POFA 2YBPA 3RDIA 1GWKA 2RG4A 5A7QA 3OGGA 1XNAA 2CDOA 2VECA 5BNOA 4FSJA 4IERA 3HQXA 4JAAA 3VZNA 1S0CA 5FZMA 2R073 2R6QA 4P08A 3WINE 3OG2A 4ASLA 4NPMA 1JYWA 1UY3A 1NCRC 1NCRB 3HEIA 3A21A 3RNSA 1HN0A 1H6YA 1IS3A 1ULFA 2LALA 2PLV2 3K75B 4PLOA 3FFQA 1KQRA 2FDHA 4FCAA 5A3MA 3VDBA 1D2SA 1L7LA 4Q1PA 1AL23 2JDKA 4YVSA 2W68A 5FKBA 5HV0A 1EV11 4S2HA 5EFUA 1VAVA 4IE7A 1V70A 4LBNA 2HWC1 3BU7A 4AWDA 5KBFA 1CQ9A 4ES9A 4CUGA 1OH3A 3VUOA 2K9ZA 2FQPA 1AZDA 1LOBA 3WP6A 4Z1VA 3BKZA 4LHNA 3OBTA 1FMD3 1AVBA 3LSEA 1HQLA 1NE4A 1RUF1 1WA6X 3NKTA 4MH0E 4QB2A 4QU2A 4WM7B 2BVBA 5HI0A 4AG4A 1RUD1 4BDVB 2WNOA 4I0BA 4QXBA 1ZNPA 3OY8B 4NIAA 2GC1A 1TQ5A 1YQ5A 4QHOA 4FPFA 3SITA 1TMF1 1HXS3 2W2IA 5ERLA 5EYYA 4Y22B 2DBNA 5E88A 3AK0A 4W6YA 2ZAHA 4DO0A 4JDNA 4GQ7A 3ZKYA 1WMFA 4Z82A 2BGOA 4YFZA 2X5IB 3ASIA 1Q8QA 4AK3A 4C91A 4LQRA 4ITCA 4MXWB 5BNPA 5F7UA 3PUQA 1NA1A 4XUOA 4Z2WA 2WQ8A 1NOVA 4UFHA 4P02B 1VBE2 3EYPA 4QHBA 2PMWB 1MACA 1FOD3 3HBZA 4LHLA 1GZ9A 2YUEA 3ATGA 3B5LB 4GULA 1HJFA 4BQ1A 2RR13 2XR4A 4LITA 4XPVA 4OI4A 5FMBA 3W58A 4JTOA 5J7MA 1CAWB 1XNKA 1O8PA 4MG2A 4JQRA 3SISA 1EV12 3THCA 4XJUA 1G86A 2EAKA 3BTXA 2HWC2 3HQRA 3OEBA 1QEXA 2D3PA 2WO1A 3GJBA 3L2HA 5DPNA 1W06A 5CFDC 3V0AB 3POJA 2ATFA 5FP9A 1Y9QA 1GYKA 2IXJA 2TUNA 5FP7A 4AEMA 3MO4A 4OMCA 5LW9A 4FT8A 2WFF3 4IEPA 5T5LA 1LECA 2KR2A 1N3QA 1DLLA 2VUAA 2WYFA 3KV4A 3J26N 3JQXA 3QH7A 4Y4RA 3VHOA 4HVQA 1LNSA 5IVEA 2FD8A 3RWKX 5C4WA 4NAOA 1JYNA 1GLHA 4HSLA 3MF9A 5HPOA 5HXVA 1S0BA 1OLQA 2ZHNA 3N35A 4RHV2 4FPEA 2JDUA 2QQKA 3R4DB 3S30A 1GNZA 4YGDA 5DAWA 4AVBA 5KC5A 1JZ6A 4I3GA 3ZN6B 4OZXA 3ZIXA 1W3XA 3CO2A 2PYTA 3V64A 5A7NA 5J37A 2ZAAA 5KXDA 4OQ8A 3T09A 4KQ7A 4MLOA 2HWD1 2JDZA 1ND3A 1RHI2 2XVLA 3DN7A 4CE8A 2MNGA 1WBFA 3KV6A 1UN1A 2BOIA 2BWCA 4LA3A 5FYTA 1KDKA 1FPN3 1UXZA 2D7FA 5FZOA 5FP8A 1ULEA 4MV2A 5FYHA 2XL9A 4XCAA 1OOPC 1OOPB 3PTYA 3T2QA 1F31A 3H3UA 3AKTA 1S2KA 1JZ7A 1K45A 4XBQA 4QPIB 3I2FA 4GALA 4QPIC 4XFGA 4OI0A 3H9AA 3RMYA 3B7MA 2R1BA 3BYWA 1KJLA 4L8QA 4YZ4A 2QQUA 1BLZA 3MGUA 2JWPA 2DF7A 3NQHA 4HKLA 5FY4A 3P3NA 4AI1A 4WM8B 1XSQA 1STMA 4GB33 1D4M1 2A7AA 3KT4A 4LBKA 2GN3A 4TYSA 4ZU5A 3H7JA 4EYUA 4Q4Y3 5L19A 3FHAA 2IC1A 4I2OA 4LE3A 4QXKA 1W8HA 4XAEA 4MADA 1W6PA 4AL9A 3VBRB 3VBRC 3GYDA 3SH3A 3X29B 1UPIA 2R071 4AI0A 2YGMA 4BLIA 2P3YA 3WQBA 5L73A 2OUHA 4H55A 1OF3A 4COZA 5BUVA 2B9UA 3HIFA 1YWKA 2B4KA 1YXWA 1DQ1A 2H0BA 2C26A 1AR73 3TBDA 1K5MC 5FJHA 4NIHA 4BIFA 1DG6A 2OKXA 5C70A 2G19A 5CB7A 3S5QA 5CKNA 5LWBA 5JZGC 4BQ5A 5KHIA 2AZ5A 1V0AA 1AL21 1BYHA 4QKFA 4CDUC 4MZUA 4CDUB 2HWD2 1ZBA3 3O0VA 2D6LX 5IFPA 4Y5Z0 3HBKA 4OUSA 2IFRA 2D97A 3TYJA 2YZ4A 3BUCA 3D82A 2W91A 4A4AA 1OHFA 2ZEWA 5KHGA 3HNBM 3T30A 4ATFA 2G9FA 3POEA 4CEYC 1X33A 2C4XA 2E7TA 5FZFA 3FZ3A 2YC0A 4XEZA 4W6XA 1S2BA 1FMD1 1UX6A 2JG8A 2JIJA 1GP4A 3N7JA 3ETPA 3VBSA 4AVVA 4LULA 2OS2A 3TEWA 2YGLA 2DDUA 4RS5B 2MPFA 3FN9A 5EHDA 4N53B 4N53C 4A7KA 4MGTA 4Y20B 3CKHA 1DGRN 2BTVC 4YGBA 3ZFFC 5K0UC 5K0UB 1ND2A 3CZUA 1YI9A 2PQSA 1OLRA 2BERA 5JDBA 3VV1A 3PL0A 1E57A 1UIKA 4UBGA 2ET1A 2ZCWA 1O3TA 2NPIA 4MGQA 2BYVE 1KXGA 3KB5A 4FOVA 2R072 2RS31 4KWJA 4AQTA 1GANA 5ISLA 4WVMB 1O5LA 3HAGA 2B39A 2JX9A 2VZQA 1CJPA 4UW3A 5FPVA 2BU9A 5FYSA 3V65A 4JKMA 1AXZA 4KGGA 2VNVA 3VBHC 1MS3A 3BALA 3DPRB 3DPRC 3ALQA 1QH6A 5GZEA 4OI1A 1JHJA 1R1ZA 1W0OA 1G9FA 3AP5A 3VZMA 4CCJA 3ZYIB 4WV8A 3ZFEB 1AL22 1E5IA 5KHJA 2OPKA 1N3PA 2XG3A 3FMGA 3GZAA 4O7XA 1XYPA 4JGZB 2BDRA 3KV9A 1X7NA 1D7PM 1R1A3 1AR61 1YHFA 4JGZC 5CKQA 2OZ6A 4GWIA 5F3EA 4I02A 2EAAA 3J7HA 1BCXA 4FOQA 5IVYA 1C3HA 4N9IA 1CIWA 5A80A 1MVEA 2XMLA 4LR4A 1UX7A 1MS9A 2XWJB 3PJQA 5K7PA 1MS5A 4DINB 4IE4A 4E2GA 2YG0A 1W6OB 4HG6B 1SLLA 2F17A 3HNMA 1FMD2 2WFF1 1F4HA 3MEPA 4MGIE 3PHMA 2ADDA 3FHIB 1AYM3 1YYNA 2CAVA 2DURA 5E8AA 5CAZA 3O1TA 5A33A 3BPZA 4XJWA 4KGQA 5K9YA 2E51A 3W5NA 4HVRA 2VQAA 1HXS2 2V5YA 5BNOC 1IPKA 1LU2A 1XE7A 2QQOA 3B02A 4LK6A 4A7ZA 2JKXA 3AKPA 4S2GA 4IQPA 1XE0A 4M00A 3NMBA 2P37A 1TG7A 1I6XA 1OH4A 1W6MA 3ZO0B 2AGSA 4PI2A 2PAKA 4YLZA 3UYJA 4ZS2A 1O59A 2W08A 2WT0A 3IWZA 4OHYA 1AF9A 4Q27A 2V4VA 4FXGB 3LDBA 1YNAA 2CGNA 5E6HA 3N7MA 5GM0A 1YIPA 2Q1ZB 4IL7A 1UCXA 1FOD2 2VOVA 2WC2A 3KVBA 1WGPA 4P00B 1OUXA 1AUYA 3WF1A 4CU6A 3U4XA 5T52A 1APNA 4XZPA 4YVSB 2B46X 2RR12 1VE0A 4YVSC 2XJSA 3RYPA 3TNPB 2LUWA 3U75A 3KS7A 1LHWA 3OTFA 1UKRA 4GH4B 2QQIA 5L7OC 3N9NA 1PGL2 2WQ4A 1ZZ7A 3KSCA 5LATA 2YB7A 1JYIA 4K8FA 3VDDA 4AHZA 1HX6A 2R1DA 1NCQA 2E53A 2WLPA 1XXNA 2KD7A 4XF0A 4YW3A 4NWVA 4B3NA 4B4PA 4GB31 2NM1A 3HN1A 5M0TA 4Q4Y1 4DIQA 1JS9A 3KV5A 1PM4A 2GC0A 2WFF2 3R4SA 3RZGA 4QX1A 3FUQA 4JKKA 1S0FA 4CCOA 4GAZA 3LCPA 1TEIA 3UGHA 2C9KA 1REEA 1DFQA 1GNHA 3AKSA 4AVTA 2Q1MA 1DHKB 4PBOA 4YW4A 2ZGMA 3QBQA
chains in the Genus database with same CATH topology
3FBYA 3TNQA 1AR71 3E97A 2DFCA 3MF6A 2H6CA 4C1XA 4FO9A 3NWKA 4K3UA 3D6EA 2GH2A 3K51A 3ZN5A 5FDBA 3WW4A 2YV8A 4FPHA 1LHNA 5BNPB 5BNPC 2VUJA 4YNIA 1ZBA1 4E9KA 3AYCA 1NA1B 1NA1C 1ZZBA 1PGSA 5J48A 5L36A 4HL0A 1EPZA 1ULDA 5T50A 4D3WA 4H7MA 1FPN2 3AYDA 4PDWA 1CVNA 1XNBA 5DZFA 4M0NA 3SXWA 2XWBB 4OHVA 4B4RA 3LZZA 2LM3A 2PAEA 1QGLA 1UW8A 2ZGPA 4SLIA 4UW6A 4F8AA 4WM7A 1J3PA 2FBEA 4LTAA 1NLRA 3I54A 1L3JA 1XU2A 4GB32 1D2QA 3LKJA 4PJYA 1H4HA 3RWNA 3CEWA 1COV3 2C1FA 2WNVA 1YO8A 2HWE3 4Q4Y2 4Y22A 3AJZA 3O0WA 3H1MA 3S7IA 2ZGKA 3NJZA 4DRVA 1U5IA 1LULA 4XOGA 5FLJA 2Q5TA 3PLQA 1DGRA 1GZWA 1O4TA 2MHFA 3MIBA 1D0HA 5C4WB 2BNMA 5C4WC 5F1RA 5FO7B 2X5IA 4P9JA 5I91A 2WFPA 4Q0SA 5FFOC 1AR72 1HDKA 3SHRA 2ZA9A 5I0TA 1MZ5A 4JGYA 4MYEA 1PO23 3B69A 4COUA 1U12A 5EJ3A 1YUDA 3RJRA 1WD4A 4XYXA 4JRLA 1ND3B 1SQ4A 1ZBA2 2UURA 1M06G 2PELA 3IPVA 4OVEA 1R1A1 5BNQA 3TWIA 4WZFA 3FE5A 3RZZA 4TZDA 2WT2A 3M4FA 1N1TA 2Z42A 1ZM1A 1VB2A 3AMMA 3ETQA 3V0AA 2PHTA 2WIIB 4XFHA 5HCFA 1PHMA 1I9RA 1RVF3 3LGRA 3OF1A 4FPYA 5C8WA 5FOBB 1ZZ6A 3AM2A 4QM8A 5ACA3 5CIRA 5FMOS 1AYM1 3QCWA 2PHWA 2Z5WA 1AX1A 4HK8A 4QT6A 4BMEA 1H1AA 2XJTA 1W6PB 4QGMA 3GBGA 3UJQA 1O7FA 2R16A 3DKWA 1CR7A 1PMIA 1G6NA 2HYKA 3AZXA 2CGOA 1BMV1 3T2TA 2VNOA 2GDFA 1CN1A 2IWGB 2PHXA 1JXNA 3AZZA 4L92A 3J8F3 4FQZA 2R32A 1I3HA 2DCJA 2YHJA 1XQNA 4XXPA 3WCSA 1F9KA 4RD7A 2Z79A 2FHRA 2ZZQA 2R49A 1PGW2 1POV1 1R1A2 3JB8A 1DYPA 2QKDA 4A2UA 4XF3A 3MLKA 2DUOA 2HWB1 4I0AA 4LO6B 4AXOA 1BEV1 2ZGTA 4PF5A 4WM8A 1SBEA 2DVFA 2JG8C 2JG8B 3VBSC 4EROA 4AQ6A 1RUF3 1OI6A 3J9SA 2P3IA 2ZOEB 3KLSA 4L97A 1AYM2 4LO5B 1N3OA 1JHNA 1RUD3 1HW5A 3B3QE 3M1HA 2VMHA 1ND2C 4CDWB 4FPKA 1TMF3 4I0WB 1GKBA 4LEJA 4LT5A 3FLPA 1QXRA 3WW1A 4UW5A 2D3RA 2RM23 4P9LA 2DU0A 2B7YA 1HKDA 1ENXA 1PZ7A 1V6KA 1VP6A 1BMV2 2HWF1 2P17A 2RJLA 1C57A 2H6BA 2PA7A 4OI2A 5LK5A 5AC91 1RUOA 1UU6A 1DQ6A 3JU9A 2CNAA 4Q29A 3UK9A 3N36A 2VW1A 4X8NA 3AMHA 2BNOA 1TME1 1DQ5A 4QGLA 4MUVA 4FOWA 4TLFA 2ZACA 4L2NA 1AXYA 2UY8A 3ZXLA 5FLHA 4LUKA 3M70A 3BOWA 1IS5A 4CZSA 2GZWA 2VMIA 2Q0AA 2QUOA 5FOJB 2H0VA 3VBOB 4YG0A 2JJ6A 4Y20A 4F3JA 2HWE1 2ZABA 4KBBA 2ZX4A 2X53S 2QDNA 5AFEA 4KWKA 1O91A 3OPZA 5A33B 4LHKA 1O3QA 1OQDA 2XPJA 4UBHA 4LUMA 1LGCA 2XJPA 3ILNA 1WUVA 4AEKA 2A6ZA 3SNMA 1Y3TA 1W6MB 3RSJA 5T5PA 1PO21 1W6NA 4FTEA 4AVAA 1HV0A 3NW4A 2FMYA 4LBQB 2A71A 1MZ6A 2XL7A 1QJX3 1R091 1SDWA 1TNRA 3LOIA 5T5JA 2JE7A 4YVWA 5B2GB 4IEQA 2G4IA 4DS0A 1CPMA 1PVC3 4BCUA 2ZGLA 1SBFA 1QH7A 3WT3A 2VULA 4FXKB 2HEWF 1SLCA 3NV3A 1RVF1 4YG6A 1LENA 3VDDC 3VDDB 4O9EA 4M3CE 1NCQC 2RS13 1QWRA 2PTMA 4B8EA 5T5OA 2FMDA 4AI3A 1PK6A 5J96B 3ZXKA 4BWOA 4GMP3 1X8MA 1D4M3 1COV2 5GLVA 3P3PA 2HWE2 2QVSB 4GA9A 3AXEA 4RFT0 2ZX3A 5DG2A 2E7QA 3IIAA 4I09A 3AX4A 4NN0A 2WQZC 4N7UA 1LRHA 3M3IA 1REDA 4KWLA 3JZVA 4BLJA 3ZXDA 3M3CA 5DZGA 2ZGUA 3ZXFA 5TSWA 4BA6A 4XBNA 3CJXA 1BZWA 1HIXA 3J8F1 3ST7A 1PO22 3M7AA 1YCIA 1Z0HA 3FBMA 1VBB3 2BBVA 1QNYA 1ZBE3 1SLBA 1VIWB 2GAUA 5IK4A 5LK7B 1YI7A 1NLSA 3B93A 3BIWE 3W9AA 3ES4A 4GH4A 1RUJ3 4FOYA 3AZVA 4PDWC 4PDWB 4NOTA 1LOGA 1KRIA 4HZFA 3AP7A 2D40A 5JIUA 2WNEA 2E6VA 4WBBA 4D7SA 4FTSA 2XBO3 1RVF2 4FPJA 1ZRDA 4CEWA 5ACA2 4CYDA 4WM7C 5AFBA 2P34A 5JAXA 5CVRA 3RRDA 4QPGB 1DZQA 1O4ZA 4L11A 2GNMA 5GLZA 2UWAA 2WNVC 2WNVB 3O7OA 3IMNA 4AHXA 4GKXA 1UPSA 1RUH3 4NWWA 1MZFA 1PZ9A 4EN8B 1GZWB 2ZX2A 3TAYA 1ENSA 4GXLA 2RM21 2X5IC 2RS33 1QDOA 1HQNA 4P5HA 1W6QA 5FTTC 3RMXA 5KXEA 2GN7A 1QHDA 3IT8A 4JGYC 4JGYB 4YFZA 1C8NA 1NQJA 2YDEA 3J8F2 2C9AA 3KGLA 3MFAA 3OYWA 2EA7A 2VG9A 3J4UH 1AXKA 3IPVB 3K48A 3GHMA 5DDJ1 1H2NA 2VPVA 3WD5A 1AR63 1ULCA 4ISQA 5DUUA 1YRZA 3OCPA 3VL8A 1YFYA 4LO8A 3WY6A 4YZ1A 1X36A 3L9JT 3MFCA 4YW1A 3KMHA 2ZX0A 2I74A 1Q8VA 1U0AA 1V6OA 1WLCA 3GNEA 4AFCA 1RUF2 1Q5OA 1QXJA 1OSGA 2RS53 1RUD2 3I59A 5C8CA 4K20A 3KQRA 3WG3A 4A7YA 2GMPA 3WDVA 1TMF2 1GQGA 1H8TB 4HN1A 4XIKA 1ASJ3 3H3ZA 3O5SA 4KU8A 4AQSA 3AP4A 3KT7A 3ZXEA 1UD1A 2A5ZA 1C1FA 1H9PA 2I07B 4RQPB 2RM22 3AKQA 4QQPA 4DZGA 2UYAA 1H2LA 1YJLA 1GQHA 2R061 1QJX1 1VBC3 1Z78A 1UAIA 1RJ7A 4COVA 1MS1A 2VQ0A 4S2FA 1CPNA 3IKWA 1OQ1A 4B7EA 1QNWA 5DXDA 3EHKA 1QMJA 1PVC1 3M3EA 3NV4A 3E6DA 4IEZA 3QOPA 4WVWA 3WLUA 3ZYRA 3DF0A 3LOBA 2ZJCA 4QQLA 1YFWA 3CU7A 3WG4A 4GIQA 5F6KA 3ZMNA 3WX5A 2EALA 1BK1A 1A78A 2SLIA 2RS11 3VBFA 2OIIA 1MS4A 1EPWA 2A6WA 2D6MA 1VJ2A 4WM8C 2VOWA 2AH2A 3HMYA 2DVBA 4GMP1 4IEVA 4QQHA 2BVVA 2XUMA 4DRRA 5DUWA 1OA2A 2JXAA 3WG2A 3ZXJA 5BV6A 5SV5A 4G4FA 3NV1A 1LOFA 4Z8BA 1WW5A 4NHLA 4ZU7A 2Y0OA 4LBOA 3GALA 3E5XA 1H9WA 5H9PA 2D43A 1PNFA 4NR1A 1EY2A 1V6NA 4AQ2A 1VBB1 3CNAA 1ZBE1 3B9IA 2BFUL 4XHBA 1H1IA 2VMGA 1QJX2 3POYA 1XYOA 3USUA 4YFWA 1RUJ1 1H8VA 2IXLA 1JTZX 2E63A 4DFSA 4YSFA 1QOSA 4Q26A 4B4QA 5A3LA 1PVC2 2YYOA 1X82A 1RIRA 2XBO1 4E4ZA 1FATA 5CU1A 3MICA 1XRUA 3KT1A 3MW3A 2BNNA 2NP0A 1CJDA 2ZGRA 4E2SA 1UF2C 3WVJA 5CBLA 1SEFA 1Y7BA 2RS12 2WINB 3FUOA 1JUIA 4RS5C 3RYRA 1LR5A 2XGXA 4Y1ZA 5C33A 2VGDA 1DGWX 3A0KA 3ZIWA 4M3CA 3NV2A 1D4M2 3NKGA 4O9GA 5IK8A 3RS6A 4CDWA 4AHWA 1RUH1 4BMBA 1SMVA 2GALA 2RMU1 5JWPA 1R083 5J09A 2Y0IA 1RUG3 5GLWA 2CWMA 3NL1A 1Q8SA 4U2AA 2Y26A 3O0XA 1N47A 2PHUA 5FBZA 3FFZA 2NYYA 2UU8A 4YM2A 2JKBA 4UXAA 4EV0A 2YPJA 3PJYA 2ARBA 3FJSA 1A3KA 1KJRA 2DTYA 4YZ3A 1Q8PA 2NMOA 1ZZ9A 4HLTA 1H4GA 1W6NB 1HRV3 1A8MA 4KL1A 1VBB2 3WDXA 1ZBE2 3INAA 4E4DX 4FPGA 4XF1A 3ZFEC 2PQQA 4YZ5A 2WLQA 5CFCB 4YVWB 4YVWC 1RUJ2 2DFBA 1REFA 1AL0G 1DF0A 4P9YA 3AKRA 1V6MA 4XFBA 4M3CF 4Q4X1 3VBOA 2XBO2 4K7JA 5KXBA 3AB0A 4Z07A 2GC2A 4XTPA 4RR3A 5FPXA 5C9AA 1Y43B 2RS51 2K0GA 1C28A 1PK6C 1PK6B 1VAMA 4XTMA 5EYXA 2ILMA 4DXZA 1H1MA 1ASJ1 1WW7A 4LNVA 1RUH2 2W0XA 3LSDA 4FVVA 1OPOA 4MXVA 2VNGA 2RS32 5EZWA 3ZYPA 3SCHA 4MGYE 2BWAA 4K40A 1VBC1 4LBQA 4OHWA 4R9AA 2WSVA 5KC6A 3D8CA 4I01A 2F6BA 4M0HA 2FZ2A 1JUHA 2VNRA 1ONAA 4BE3A 3GF6A 4GH4C 4AGRA 2WSUA 2IXKA 3MDPA 1POV3 1AR62 2D5FA 3G6JB 5F5QA 2Z69A 4DPNA 3AJYA 1W2UA 4Q8LA 1DDLA 2A6XA 3D0JA 4YYOA 1X8EA 3TN93 2HWB3 3IBMA 1BEV3 4CEWB 4CEWC 1AX0A 3VZJA 2F4PA 4XDQA 4PLMA 4HT1T 4EJRA 4DQAA 2RS52 1CAXB 1AR83 4PIYA 2AYHA 3MYXA 4JRAA 4IEUA 2GMMA 1PM7A 2A6VA 3D5OA 3IM0A 3ZSMA 1ASJ2 4CDQA 3A0NA 1DQ0A 4DB5A 2A3XA 4OFGA 3U10A 4HKOA 1RUNA 1LHUA 3ILFA 2FZ1A 3DGTA 1C5HA 2NZ9A 2CTVA 1S0IA 4FAHA 1W6QB 4V1PA 4KNCA 1FV3A 3VKLA 2HWF3 1VBC2 4XF4A 5AC93 2P3KA 2IFWA 4F83A 3OYWB 1IS4A 4URTA 5GKAC 4AGVA 2Q8OA 4B7KA 1JW6A 4R4XA 3N7LA 5JOYA 1QY4A 1TME3 1ENRA 1UZYA 3WZ1A 4HKWA 3RG0A 1M4WA 3IDEA 3M3OA 3WHTA 4DMIA 4YM1A 2O1QA 2CL2A 1LODA 3IDBB 1UZZA 2Z2SB 4P9XA 2XKOA 1WW6A 4QPGA 5FAXA 4AFDA 4LBMA 2BEOA 4X8PA 5FRAA 1R081 2D6NA 3I59B 2ZBJA 5C8CC 5C8CB 4FPCA 3N4MA 1RUG1 2WZR3 3AMQA 3S6PA 2DUPA 3ZFGA 3ZSKA 4WVVA 3WXPA 4TWTA 3KM5A 2RJKA 3U07A 1ULGA 2A6YA 1S0JA 2DVDA 3NSTA 4G9SB 5GZCA 1IPJA 1BKZA 4IEYA 1HRV1 1HV1A 5EXOA 2AENA 2BW8A 3VL9A 4IXLA 1ND3C 5FREA 5I8TA 1R093 3TRSB 3RQ0A 2WA3A 2V73A 4D7YA 5T3NA 5DUVA 1YFXA 1WMEA 4KG0A 3SH5A 4W65A 3MIGA 1ZRFA 1V6LA 5E1RA 1IKQA 4BIOA 2ZGSA 1Q3EA 5CADA 1NXD1 2DV9A 4JV4A 4K9SA 4COYA 2BGCA 4IEXA 2RHPA 3VBFC 3VBFB 4IV1B 4OHXA 5EWSA 2A3WA 3ZVXA 3RJ2X 5FO8B 3AFKA 2WZPP 4XIOA 2BUKA 4YGEA 4ONUA 1QQP3 1H8TA 1RINA 1DZRA 1KS5A 1R082 1UIJA 2B45X 1RUG2 3KGZA 1LOFC 3MIHA 4FAGA 4RQPA 3THTA 1O5UA 2ZTNA 3M3QA 1Q8OA 5BXXA 5JSOA 5AVPA 1G9BA 3JQWA 2UWCA 3EQEA 2WT1A 4EN6B 1XYNA 1HRV2 4N7IA 3PVOA 1SFYA 1SBDA 4R9CA 4Q0UA 3H1YA 3FWEA 2BQPA 1U5ZA 3USUB 1ALYA 1LGNA 4INDA 1AJKA 1SACA 4D94A 4K21A 1LHOA 2YROA 2Q4SA 3EXUA 4U36A 4YZ2A 1VBA3 2X8KA 2XJVA 3TN91 3R4UA 5CA6A 2ERFA 2VOXA 1IQAA 2VY0A 1LGBA 3PVEA 2AR6A 5D8AA 1OFSA 3W59A 3IN9A 1KDMA 2OVUA 3T1MA 3VZOA 3O14A 1AR81 1BBT1 1LKNA 4M3CB 1BVP1 3JB4C 4CDWC 4E4SA 1QJU3 4AVCA 4DNYA 1J1LA 3OD0A 1VALA 2NQYA 3CLPA 4RGGA 4GWNA 1IKPA 5BPXA 1ZA4A 2JICA 3USSA 5JOWA 3HT2A 3I8TA 2ENRA 5GLTA 5I0UA 1ZYBA 4HSJA 3M8LA 4QPYA 3JBG3 1VBD1 4ZKTB 4C90A 4GWMA 2Y38A 4X6QB 1OQEA 4FBFA 5DDJ3 1WW4A 4XE9A 1BXHA 1SCSA 4RGAA 2SBAA 2UYBA 5DZEA 3RYKA 3H1WA 3PVBB 1A6CA 5J3UA 1MEC1 4IV3B 5GJ6A 1DQ4A 5H9QA 3VBOC 3TN92 2HWB2 3U11A 3ZYJB 1BEV2 2D6KA 4AI2A 4RR3B 4RR3C 3VN4A 2JD4A 2WNUB 5C9AB 5C9AC 1AJOA 2IXIA 4BZ4A 5K8SA 1AR82 2WZR1 3GBWA 2N7GA 4UW4A 3LAGA 1DZTA 2NLRA 1NYWA 4MX3A 2XJQA 1YIFA 2ES3A 3WP3A 3WQ0A 1LU1A 1YJKA 4ZXKA 1FNYA 2I2SA 3HD8B 5BY5A 1WMDA 4HMZA 2E9QA 1EP0A 1V6IA 1O3SA 1T6GC 1SLIA 3ZFFA 5JI7A 1EAH3 4XFAA 2HWF2 4K6BA 1RUC3 2R063 3QLQA 5AC92 5JOXA 5CFCA 4LLOA 5KHHA 4COWA 2ZGNA 1VLNA 2GNBA 3GBFA 5JIAA 5GLUA 1GV9A 2EVXA 2QCSB 2XLFA 3HR9A 5D1IA 1BQPA 3WDWA 1TME2 1VB4A 1DU3D 2YY1A 1G9AA 5GZFA 1N1SA 4ATEA 1ZX5A 2TBVA 3VBHA 1IZ3A 3OJBA 4FP2A 1GFF2 2HEYF 1RUE3 4Z92B 4KH9A 1A8DA 2UY9A 2RE9A 3NO8A 4QMAA 1QQP1 1RUI3 3ME2A 4PLNA 4B29A 3ZMOA 3NAPA 3G7DA 2WZR2 1QOOA 1Q43A 4AEJA 4Y1UA 3BOPA 4Y26A 1J59A 4CDQC 4CDQB 2NN8A 3MW2A 1VRH3 1Q56A 2JECA 5JR7B 4ASMB 3E6BA 2VW0A 2EXKA 5JLVA 2R0HA 4JTNA 1OFNA 2PHRA 2BPA2 3APBA 5JMCA 4C0BA 1R092 1JN2P 5FMOL 4AVSA 4Y1VA 3FLTA 3H7YA 4Q4V3 4HVOA 1URXA 1CD3G 1LTEA 1VBA1 2QDRA 5KXCA 2ETEA 3ELNA 4CP2A 3B9CA 3A4UA 4MGKE 1VBE1 5I93A 4MVTA 3MPBA 1WLTA 4QD2A 4N43A 3BTAA 1CAXA 1ZRCA 4QPGC 3WUDA 1CAVB 3VKMA 5JPMB 1QJU1 4XQWA 1QQP2 2OA2A 1LOEA 3WP5A 4HANA 3WW3A 2ZMLA 3JUUA 4MSVA 2RMU3 1V6JA 3ZFGC 3ZDSA 3ZFGB 4L9BA 4QM9A 4XF9A 1UL9A 5J98B 1OMIA 4AI8A 3B94A 3AYEA 1IHMA 1C1LA 2D44A 4XJ8A 3CF6E 1MQTA 1JH5A 1VR3A 4K1ZA 3JBG1 4X6RB 4DOUA 3L2YA 1S55A 1N1VA 4RHV1 1J58A 1QJY3 3ZYGA 1DGLA 1Z7S3 3URFA 1ZREA 1G7YA 3D0SA 5DG1A 4H3WA 5FQ0A 2PHDA 1VBA2 3N7KA 4EN0A 5F9TA 1IS6A 1QF3A 1RHI1 1KD7A 3R05A 4Q4X3 2EXHA 2IZWA 4D7TA 3D4KA 2DUQA 1GICA 1H2MA 2YMZA 3DV8A 1UU4A 5I8SA 4YARA 5JVVA 3DL3A 4XHXA 2QFEA 4I30A 2R043 2D6PA 4N9HA 3CJIA 1OA4A 4HFSA 3WW2A 2VVEA 2JG9A 1QJU2 1H8TC 1AHSA 3BODA 3LA7A 4GKYA 4HBNA 3ZN4A 3MIFA 1WA4A 4KG8A 4LBJA 5CFDB 4AGGA 4RQPC 3MW4A 3SCFA 1DGWA 4ZU4A 5J36A 1JYCA 1EAH1 4PBPA 5JPNB 1RUC1 1WCSA 2XJRA 3MIDA 3MZHA 2CV6A 2CWSA 1NXMA 4YGCA 3LB9A 3E5QA 4HPKA 2DCKA 4Q1RA 1YLLA 2ZZJA 3JBG2 2VW2A 2ZGQA 3KZ4C 4AW7A 4XETA 5DDJ2 3QH6A 2E7AA 2R0FA 4R4ZA 2XHKA 1PO13 3VHRA 1B09A 4IV1A 1RUE1 2XB6C 4Q4W3 1RTVA 3V56A 1MVQA 5CNAA 2HJIA 1RUI1 5D8AC 5D8AB 3CL1A 4PQ9A 3OBRA 2B5HA 3VKOA 2ZGOA 1C4RA 1BJQA 1H2KA 1FV2A 3WDUA 2QE3A 3WDTA 4OLLA 1O4YA 2GMEA 4L99A 5DUXA 3EBRA 2D5HA 1HQWA 4AHYA 3UL2A 1VRH1 3ZSEA 2PHLA 5IT6A 3VGIA 3IDCB 3HT1A 4HK9A 5LRRA 2OZJA 1GR3A 1I1EA 5A32A 4LBLA 2UWBA 2JEMA 3JD73 2VVFA 2ZKLA 1EAH2 2B8MA 3ZX7A 1CX4A 1RUC2 2R062 4QX5A 4Q0QA 2PHFA 1XNDA 5T55A 4Q8KA 4Q4V1 3B01A 3KCXA 4JDMA 2C0ZA 3VKNA 4WVZA 1K5MB