4Q4Y2

Crystal structure of coxsackievirus a24v soaked with disialyllacto-n-tetraose (dslnt)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
264
structure length
264
Chain Sequence
GYSDRVRQITLGNSTITTQEAANAVVAYGEWPSYLDDKEANPIDAPTEPDVSSNRFYTLDSVQWKSTSRGWWWKLPDALKDMGMFGQNMYYHYLGRSGYTVHVQCNASKFHQGALGVFAIPEYVMACNTEAKTSYVSYVNANPGEKGGVFDNAYNPSAEASEGRKFAALDYLLGCGVLAGNAFVYPHQIINLRTNNSATLVLPYVNSLAIDCMAKHNNWGLVILPLCKLDYAPNSSTEIPITVTIAPMFTEFNGLRNITVPATQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coxsackievirus capsid protein VP1
publication title A sialic Acid binding site in a human picornavirus.
pubmed doi rcsb
molecule tags Virus
total genus 64
structure length 264
sequence length 264
ec nomenclature
pdb deposition date 2014-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4q4y200
1BBT1 1RUJ1 4CDUB 1AL23 1ND2B 4WM8A 5AC92 2WFF3 1RHI2 3VBRB 1C8M1 1VBA2 2RS53 1V9U2 4CEWC 3DPRA 1NOVA 2IZWA 1PVC2 5L7OC 1PGW2 2RR13 1PGL2 1AR83 2FZ2A 1FMD3 1QJX1 1RUF1 1AYM2 1FOD1 1ASJ1 2HWB2 1FPN3 1POV1 1CJDA 2RM23 2R061 1R081 4QPIC 2X5IA 1RUC1 5BNNC 3TN92 1HX6A 1R1A3 4PDWB 1B35A 1RB8G 1RMU3 1RUI1 4CEYA 4Q4V1 1AR72 1X36A 4JGZB 4RS5B 2R072 2R041 4GH4C 2XPJA 4QPGB 1RHI3 1ZBA1 4JGYA 1F8VA 4N43A 4Q4Y2 4AEDB 2WLPA 5C4WB 5JZGC 1V9U3 1TMF3 5A33B 3NAPC 4SBVA 4RR3A 1ND3B 5ABJB 2HWC2 1K5MA 1NCQC 2HWE2 5K0UA 5ACA2 1AL21 3CJIB 1VBB2 2RS51 1BEV2 2GSYA 3IDEA 1OPOA 2PLV2 2RR11 4Y4YA 1TME1 4YVWA 4CDUA 1X33A 1FMD1 1VRH3 1M06G 1MQTB 5CFDC 3TN93 1RUG2 5J98B 1HXS2 1FPN1 1RUD2 1EV12 2RM21 1AR73 4GB31 3VBFB 1QJY2 1NA1C 2WZR3 1PO12 2FZ1A 1EAH3 1VBC2 4Q4Y3 1VBD3 5LK7B 3J8F1 2RS32 1VAKA 1PIV3 1OHFA 5ACA3 2HWE3 1VBB3 5D8AB 1HRI3 5BNOC 4FTEA 4PDWA 1RUE3 1NY72 4JGYB 1TMF1 2PLV3 1ZBE1 4Y5Z0 1HRV2 2XBO3 4CDWB 4RR3B 4CDQC 5FMOL 1Z7S2 4Q4X1 4AEDA 4CDXB 1COV2 3ZFGA 4YVSC 1ND3A 3VBOC 5ABJA 1RUD3 1EV13 1AL0G 1NCRB 3CJIA 1QJY3 4YVWB 1VRH1 1QJU2 3ZFEC 1PO13 1AR92 3ZFFB 1OOPC 4WM7C 5C9AC 1PO23 5C8CA 1C8NA 1NG0A 4CEWB 4EJRA 1AR62 2WZR1 2RS13 1MQTA 5DDJ2 5CFCA 1EAH1 2RMU3 1VBD1 1ND2C 3JB4C 4LLFA 1R093 5A32A 1RVF3 1PIV1 3VBFA 5ACA1 3JD72 1Z7S3 1MEC2 1D4M2 3VBUA 1HRI1 1RUE1 4QPIB 3JBG2 2HWD3 2XBO1 1VBE2 1RUH2 2WS92 5D8AA 1BMV2 1A6CA 3VDDC 5AC93 2Y26A 4N53C 1VBA3 1BBT2 1RUJ2 5BNPC 1QQP1 1EV11 1RUD1 1POV0 1PVC3 4CDWA 3ZFGB 1QJY1 1C8M2 3NAPB 4RQPA 4RS5C 1AUYA 4JGZC 4Q4W2 5DDJ3 2WFF1 4CDXA 4FSJA 1NCQB 1PO21 4QPGC 1GFF2 1AYM3 2HWB3 5C4WC 1NCRA 5C8CB 4RHV2 3VBOA 1H8TC 2RS11 1QJX2 1RUF2 3ZFFA 1AR81 2RMU1 1FOD2 1ASJ2 1D4M3 5CFCB 1QJZA 3S6PA 3ZXAC 2R062 1R091 4WM8C 5CFDB 1RVF1 4CEWA 1R082 5A32B 1RUC2 2MEV2 3DPRC 5L7OA 1AYN2 2R073 2WS93 2DF7A 1NA1B 1RUI2 1R1A1 4Q4V2 3VBSC 3VBUB 1BBT3 2GH8A 2HWD1 1RMU1 5J96B 1E57A 1ZBA2 2HWC3 4Q4W3 5GKAC 5AC91 1RHI1 2ZTNA 4QPIA 4IV3C 1VBA1 1BEV3 1V9U1 5BNNA 2X5IC 1AL22 1PVC1 1PGW1 5BNOB 4RHV3 1VB4A 1DDLA 1PGL1 2RS52 1B35C 1RUF3 4GH4A 4CEYC 4RQPB 1ASJ3 2RR12 1TME2 1AYM1 1POV3 2HWB1 4N53A 1RUG3 1HXS3 2BFUL 5JZGA 3JB8A 1FMD2 4JGYC 4N43C 5BNPA 3NAPA 2MEV3 4GMP0 1AYN3 3VBOB 4IV1C 2WWSA 1NCQA 1D4M1 1FPN2 3VBHC 1K5MC 4NWVA 3TN91 1RUI3 5FMOS 5K0UC 1VBC3 4Q4V3 2RM22 3ZFEB 4GB32 2RS33 1OOPB 2BFUS 1AR71 2R071 3J8F2 5L7OB 3M8LA 1HQNA 4FTSA 4CDUC 4Q4Y1 5CFDA 3VBRC 3FBMA 1HRV3 2HWC1 2HWE1 4Q4W1 1VBB1 1TMF2 1NA1A 1ZBE2 1BEV1 1TME3 2ZZQA 2PLV1 3VBSA 1COV3 3LOBA 5BNNB 4RHV1 4FTBA 4Q4X2 2HWF2 1QJU3 2QQPA 1AR93 4GH4B 1RUG1 4IV3A 1HXS1 4GB33 3VDDB 5BNOA 2VQ0A 2ZAHA 1VRH2 4N53B 4PDWC 2MEV1 4BCUA 5JZGB 1AYN1 1AR63 5BNPB 1PO11 3J8F3 4CDQA 2BUKA 1VBC1 2RS31 2WZR2 4AEDC 4GMP3 1EAH2 4YVSA 1VBD2 3ZFGC 1ND3C 5ABJC 1CD3G 1H8TB 1ZBE3 3JD73 4IV1A 1MEC3 3CJIC 3ZFEA 1PIV2 3VBHA 1OOPA 1NY71 4WM7A 2BBVA 5C9AA 3HAGA 3JBG3 1HRV1 4Q4X3 4WM8B 1HRI2 5C8CC 2HWF3 1RUE2 1VBE3 1RUH3 1Z7S1 3DPRB 2XBO2 1MQTC 5CFCC 1COV1 1ND2A 2R042 1RUJ3 3VBRA 3VBSB 2BPA2 4Z92B 5FOJB 1C8M3 1QJU1 3VBFC 1AR91 1QQP2 2TBVA 3VBUC 4IV3B 2WFF2 4NWWA 1AR61 1SMVA 2X5IB 1PO22 1QJX3 5DDJ1 1F2NA 1FOD3 1B35B 4CDQB 3VDDA 4CEYB 2RS12 5D8AC 2R063 1W39A 1AR82 4GMP1 2RMU2 1R083 1RUC3 4YVSB 4N43B 3JD71 4CDWC 1IHMA 1R092 1MEC1 4RR3C 1RVF2 4RS5A 4JGZA 4IV1B 4RQPC 3JBG1 4CDXC 2R043 3VBHB 1K5MB 4QPGA 4WM7B 4RFT0 5C9AB 5K0UB 1WCDJ 5C4WA 2HWF1 1VBE1 1RUH1 1ZBA3 1R1A2 2WS91 5A33A 1H8TA 1NCRC 1BMV1 2HWD2 1VB2A 4YVWC 1RMU2 1QQP3 3ZFFC
chains in the Genus database with same CATH superfamily
2CGPA 4GALA 5FPZA 5K8SA 5JIUA 2UURA 3M2MA 5FZDA 4CDUB 5KXBA 5LA1A 5LEKA 3IMMA 1KS4A 1AL23 4Q1RA 4WM8A 1APNA 5JMOA 2DBNA 2FCVA 2VW2A 4HK9A 1C8M1 2FD8A 1RJ8A 1V9U2 1C28A 1QOSA 4BWOA 5C70A 1CAUA 1PVC2 4R9AA 5L7OC 2L9LA 2QQKA 2VCCA 5GZCA 1UQXA 3FL7A 2A73B 4N9IA 1N1SA 4COWA 2FZ2A 1TNFA 2J22A 1RGSA 2D40A 2DWRA 2XKPA 3ETPA 4PJYA 4XCAA 1QJX1 5FYUA 1DQ0A 2QKDA 4IE5A 5ERLA 3OYWA 4XEZA 4L92A 5T5LA 2ORZA 1WBLA 1J84A 3DF0A 2K46A 4RFRB 1DQ6A 2RM23 2R061 2UYBA 2P6HA 2VW1A 4R4XA 4UW4A 3R6SA 2XLAA 4M3CB 2BP6A 4FPKA 1NXMA 1J3PA 1S0JA 1R1A3 1UD1A 3Q8AA 1SLLA 4K20A 1WMXA 3PUIA 4OI0A 3CZUA 1RMU3 1XPWA 4HG6B 4CEYA 3MF6A 1AR72 1X36A 4RS5B 5A7PA 1GZ9A 4MXWA 2R072 4GH4C 4MSVA 5F2WA 3U07A 4EQVA 3LDBA 1VMJA 2PHDA 2ZX1A 3IWZA 3B00A 4QPGB 2QCSB 4NJ4A 3RFRA 1ZBA1 4LLOA 4Q4Y2 2WLPA 2D5HA 4W8JA 1SLIA 1V9U3 3ASIA 3ZPOA 1ZVFA 5IFPA 3H3LA 1REFA 5FZOB 3V65A 3JCIA 2J1EA 3PVOA 1WLCA 2X05A 3NW4A 4RR3A 1ND3B 4MXVA 4NPRA 2AH2A 2Q5TA 2VQUA 2WZEA 3ENRA 1OXCA 2XJVA 4FOWA 5K0UA 1GICA 1MS3A 2LROA 1VBB2 5T5OA 4FOYA 1EY2A 1WMEA 2ZBJA 4CCMA 5HI0A 2RS51 3IDEA 2VW0A 4NO4A 4XBQA 3HQRA 3VV1A 3WF3A 4XF1A 3ZIXA 4XF3A 3ZSEA 4UFJA 4XURA 1AHSA 2YPJA 2IXCA 1X8EA 2WT2A 1PZ7A 5FZBA 1X33A 1GQPA 1NYWA 5FZ6A 2LS6A 2ZX4A 3KMHA 4UBGA 3RZZA 4W6WA 1CIYA 4B29A 3ROUA 4BB3A 1F9KA 3WDVA 4D6QA 4CVUA 2JDAA 2W5FA 1F35A 3PU8A 1SLCA 1AXKA 1RUG2 4XMIA 1URXA 1AX2A 1DLLA 2W3JA 5KXDA 2XJRA 2GMPA 1OLMA 1AR73 2GC3A 1NA1C 3CL1A 3K3OA 2C9AA 2OS2A 3WLUA 5B2GB 3ZYFA 1EAH3 2OQ6A 2IXIA 1A3KA 1OBNA 1W8HA 4Q4Y3 5FQ0A 1LRHA 3SMHA 1YFYA 1PIV3 3ME2A 3WP3A 3NMBA 1XSRA 3GM8A 2XXZA 1YIFA 4KG0A 3NV4A 5FPVA 5FP7A 1VBB3 4AHWA 4QKDA 2PXJA 1CZTA 2CAUA 1FATA 4P9LA 3TEZA 4PCRA 4P5YA 4CP9B 1TMF1 4BLJA 1ZBE1 4KWJA 1VMHA 2Q30A 2XBO3 4I0WB 4Q0PA 3I59B 3GNEA 5I0RA 2CYFA 3H42B 4CDQC 1BCXA 1PHMA 2I07B 5DZGA 1SEFA 1Z7S2 1L3JA 3P5BA 2TNFA 1W0PA 3INAA 1W8FA 2DDUA 4AEDA 4E8CA 3LAGA 3GXUA 1CX1A 4OZXA 1XE0A 2OZJA 3ZFGA 3VBOC 3I2KA 4QB2A 4JDNA 2PQQA 4K7JA 1OLRA 4Y5TA 4Z1VA 1CPMA 1OURA 4GWMA 3DXTA 4AQ2A 1VRH1 1JMUB 1O4YA 1OD3A 1R64A 4R4ZA 1C1LA 5FXZA 3ZFEC 3RZKA 1OOPC 1U5ZA 2JDKA 4MG2A 1PMIA 2CDPA 1GP5A 5F6KA 4Y1XA 5LK5A 4EJRA 3PMEA 1Q5OA 3AXEA 4JTOA 2RS13 2AENA 2CTVA 5DDJ2 5CFCA 2PHWA 2BQPA 3K46A 4AI8A 3R4SA 4P00B 1UYYA 3FX3A 1ND2C 1VE0A 1W03A 3JB4C 4IEXA 4A7ZA 3HQUA 3OB8A 4LLFA 5A3UA 3OGGA 1RVF3 3AP5A 1LGBA 1N3QA 1PK6A 2EAAA 1XNCA 3IDCB 5IVEA 3E6CC 1H1MA 3J7HA 5E16A 4ASMB 3WNMA 3ZIWA 1A78A 2W68A 3C7HA 1Y7BA 4LUKA 3JD72 4FXGB 1Z7S3 4N9HA 3WCSA 1MEC2 5F6LB 1UMHA 4BJ0A 4UXAA 1ZZ6A 1HV0A 2IVIB 4AQ6A 2EICA 4TTGA 1I5PA 1ULGA 1GZWB 3D3AA 3EJKA 2AZ5A 2W1WA 3KHBA 5IK7A 3LDKA 1W3VA 2LW8A 4AVCA 3O1VA 3OSDA 1YQ6A 2WNOA 5DXDA 2GH2A 1H0BA 2QDNA 1AVBA 5AC93 4NAMA 1B09A 2JG8A 4Z2WA 3POIA 2W9XA 1MVEA 5CA6A 1RUJ2 5JI7A 3PDQA 2XGXA 1UY3A 1XRUA 2VZRA 3AJYA 5F5CA 1QJY1 2O1QA 2VU9A 3WR0A 4YW7A 2E7AA 4CPBA 5JXGA 2CWSA 4IEVA 1F5FA 2XB6C 5DDJ3 4FSJA 3NJXA 2VE1A 4L2NA 5I8YA 3HBZA 2YBPA 2B42B 4LA3A 2ZGSA 4XFBA 1WCSA 1DQ1A 3KVBA 2GNMA 3PUSA 1AYM3 5FZ7A 5CEHA 2W1QA 5FY0A 2AUYA 3R4DB 3WP4A 5JDBA 4BM8A 4RHV2 4PBPA 4LHLA 4Q0QA 3CBNA 1KDKA 1LHWA 1RUF2 1YQCA 2YC2A 1NLQA 2GC1A 4JKKA 3ZFFA 4BQ2A 3T2TA 2C4XA 2ADEA 4IEOA 1J59A 3UV9A 1MZFA 3S6PA 1ULEA 2C6SA 4N7UA 2FDKA 1UOJA 4WM8C 3ETQA 3NNLA 3IDAA 5APAA 3WHTA 4FPLA 3ZYIB 1R082 3ZO0B 2GDFA 1RUC2 1MVQA 1V6NA 1AYN2 3X29B 5IVFA 1AF9A 1OF3A 3KV5A 1NA1B 2N7GA 1RUI2 1PVXA 1VIWB 1OMIA 1R1A1 3AMMA 3KLSA 4Q4V2 4QQPA 4XFIA 1W04A 4W4ZA 3LWCA 4BQWA 2BNOA 3KV6A 2GH8A 4YGBA 2Y6KA 5BUVA 1V00A 4ATFA 1RMU1 2DVBA 1NE4A 2W95A 1C5HA 1E57A 4GJZA 2CGNA 3NJZA 1HN1A 1H30A 2HWC3 1S0GA 3ZLIA 2A6ZA 4HVQA 2WNEA 1OH4A 3ABZA 3SNMA 2W1UA 3FHIB 5DUWA 1W2TA 4XDOA 4QPIA 5CVRA 1ULDA 3IN9A 1BEV3 1V9U1 3AKRA 2ZGQA 4DXRA 2UWCA 5H9QA 3WQBA 1W2AX 3ZYJB 1G9FA 3ECQA 1PVC1 4BHPA 1FT9A 4YW1A 5C3RA 4H55A 1OFNA 5A6XA 4RHV3 1DDLA 3GJAA 4N8MA 3VDAA 3EHKA 1RUF3 1WW5A 1UO9A 4D0QA 4CEYC 1PGSA 1RXGA 3UT0A 4P08A 4ISRA 2X29A 1GNHA 1HXS3 1HJGA 1XU2A 4F83A 1CN1A 4LHKA 4LKFA 5AFEA 5F32A 1ALYA 5FK8A 1CAWB 5FFOC 5D2AA 4JDOA 3VB9A 2J1UA 1AYN3 1DIWA 1W6QB 3VBOB 1RITA 5JOYA 2WWSA 2V5YA 3CKHA 3UESA 1ZRIA 4YPJA 1FPN2 3VBHC 4UF0B 5DZFA 1Z0HA 2ID4A 1RUI3 4OVEA 4QHBA 5K0UC 1VBC3 4Q4V3 1ZX5A 3ZFEB 4D6RA 3C8XA 4YW3A 4CCCA 1OOPB 1OI6A 1PMHX 1SHWB 4I2OA 1LKNA 1O4ZA 3TRSB 1UW8A 1AR71 3R0RA 1W9SA 2R071 3EYPA 4TYSA 2WLQA 1XYNA 1I3HA 4IUGA 3VZNA 2QNKA 4S2HA 2ARCA 1G8WA 4Q4Y1 5CFDA 4OQ9A 4GZ9A 2IUWA 1ZM1A 2Y38A 3RMYA 3LCPA 3H8XA 1QOOA 1W9YA 3WQ1A 3HNMA 1UZ0A 2EIGA 2DVGA 1VBB1 2BZDA 2ZGMA 3DXUA 3HNYM 4AVSA 1F4HA 1ODNA 3I2GA 5T50A 2Y60A 3LSDA 3S5QA 5FR3A 4ONUA 1U5YA 4OHVA 2ZZQA 2VL4A 3VBSA 1O3QA 2WWJA 1LOAA 5FPUA 4YW2A 5BNNB 1UF2C 3I2JA 2XQXA 5LA2A 3I2IA 2C5DA 2C9KA 2P1BA 4LE3A 1GNYA 5T54A 2DUOA 2YGLA 5F37A 1QJU3 4YARA 1KJLA 1YFXA 3E97A 1HN0A 5FPAA 5FY8A 1DYKA 4ITCA 4HKWA 1RUG1 3A0NA 3ZSMA 4EV0A 1QOTA 2VQ0A 3AYEA 1FI2A 2Y0IA 2J1AA 3OF1A 1D2SA 4BCUA 1T2XA 5JZGB 1AR63 2ARAA 4A41A 1W2NA 5EJ1B 3D0SA 3M3OA 3KF5A 2ERFA 3ZXKA 5IK5A 5LRSA 1UY1A 2H6BA 3BU7A 4QXKA 2WZR2 4XJ9A 1A8MA 1GANA 1RIRA 2LALA 2VBPA 2XJQA 5K4LA 4AEDC 1YFUA 3IM0A 1GMMA 2OIIA 4DQAA 3JXSA 2EIEA 4XF4A 3ZFGC 3BIWE 3H3UA 4RYDA 1RUNA 2I45A 1SFYA 1UYZA 2RJLA 4IV1A 1ZZCA 4DXSA 4BQ3A 1JU3A 1WD3A 4WM7A 4JRAA 3OD4A 3TBDA 4AK3A 3H1MA 4HPKB 2RDSA 4WM8B 5J48A 4XUOA 2GMMA 1UCXA 3QBQA 2GNTA 2V72A 4Y1YA 2CL2A 1Z7S1 3FN9A 4W65A 3DECA 4YGDA 3Q9OA 4META 5FAXA 1G9BA 4JKMA 1UYXA 1HB3A 1CAUB 4ORFA 1N3OA 4E4ZA 1DCSA 1O3SA 5CFCC 1JZ5A 1IG3A 4COYA 3OPWA 1OUXA 5FZ4A 4TSVA 1X82A 3OD0A 4IEQA 3KT7A 2XMLA 2BYVE 4M3CF 1JYIA 2JG9B 3M3IA 1C8M3 3POJA 5FV3A 2A71A 4JZRA 4QHOA 3SHRA 5A7WA 4Y26A 1SBEA 1PK6C 3S5AA 1H9PA 1MZ5A 1QQP2 3OYWB 4MGZE 3WNPA 2DU0A 4QQHA 3GCXA 3OPTA 5E6HA 4L0PA 3IDBB 3ZKYA 4CXYA 5LRRA 1HJFA 1CPNA 3UYJA 2BDRA 1PMJX 1T6GC 4EROA 2WFF2 5G04L 4NWWA 1SMVA 4H7MA 1CAXA 1W28A 4E4DX 1PO22 1QJX3 1UL9A 4K3UA 4KG8A 2O14A 4YLZA 1W3XA 5DDJ1 3JU9A 5FLJA 1QXPA 4O7XA 4H2AA 4MV2A 4IEWA 2FCUA 4LIVA 4AFBA 2VY0A 4CEYB 5C6CA 4NIAA 2DUPA 5GZDA 1QXRA 2R063 4OI4A 3WNNA 4BQYA 3FLPA 5FWEA 3H50A 2RMU2 3CEWA 2JG8C 4CXWA 3LDRA 3NV2A 1UMIA 3P1IA 2IXJA 3JD71 1MEC1 2EVXA 5GZFA 4OFGA 1N1YA 4LBQD 4R8HA 5JR2A 3VKFC 3Q8BA 2XLFA 3WDTA 3GGLA 2E53A 3VBHB 3ZXFA 1DZRA 2Z42A 3CJXA 4XFHA 5C9AB 1IPJA 5K0UB 2WUHA 1NQJA 5C4WA 3WW2A 2HWF1 5CNAA 2V09A 3OEBA 5ANQA 1ZBA3 5FRAA 1O8SA 1H8TA 2BGPA 4QM8A 4A44A 1WA4A 3JQWA 4PIZA 5FYVA 2HWD2 1WKYA 3ZR6A 1QMJA 2CWMA 4YVWC 1K12A 1QQP3 2G9FA 3ZFFC 1JYWA 1RUJ1 3LE0A 1TE1B 5DABA 1UKRA 4YZ1A 1YQ8A 3BALA 4BMEA 4NRQA 4AEKA 2WFF3 3VHOA 1RHI2 4L11A 2F6BA 3W9AA 1GQHA 2CNAA 1VBA2 3HD8B 2RS53 3WQ7A 1NOVA 2ZEZA 1ZYBA 5EV7A 4IEZA 1PGW2 1ULOA 3V0BA 1Y43B 2RG4A 4K6BA 4A42A 3RJRA 3AFKA 3LPFA 3WEZA 3WP5A 5B4NA 5SV8A 4K8RB 4OLLA 5CISA 3I49A 3T3YA 3ILRA 1C1FA 4GWJA 1RUF1 4PF1A 1L7RA 2P37A 2JKBA 5FQ0B 2HWB2 2JB8A 1OH3A 2Z4FA 4O61A 5FZCA 3A21A 4YFWA 4LEJA 4XDQA 3SCFA 1Q8OA 1JS9A 1LAJA 3P3PA 2IXHA 5FZ9A 4TWTA 1O3TA 1NQDA 4LITA 4QX8A 2WAAA 1R081 4QPIC 4UFIA 2VZTA 3N9OA 1JTZX 2A6XA 4X8PA 4E2QA 1RUC1 5FZLA 2WFPA 1YYNA 1HX6A 2P3IA 1KFXL 2VOXA 1GYKA 1W8TA 2D6NA 3MLKA 1Q8PA 1XSQA 2D3RA 3N9LA 4JRLA 1LECA 1RUI1 4V2VA 2O8OA 4IEPA 4Q4V1 4O9EA 2DVFA 3LA3A 4JGZB 3P3NA 3M70A 5KHHA 4A6OA 1OVPA 2KA3A 1RHI3 1YNAA 4JGYA 2GALA 5FKBA 4N43A 5LBEA 2Q4SA 4AEDB 1F8VA 4FQ4A 4Y4RA 3PL0A 3BGAA 4MLOA 4KWUA 2ETEA 4UBHA 1TMF3 5L73A 2BWAA 3E5QA 5C5UA 3LZZA 1YCIA 1K5MA 2HWE2 2D97A 2W08A 4NE9A 4FFHA 3WW4A 4Z8BA 5JWPA 5FYYA 3VD4A 2VMIA 3B69A 5A80A 3ZXGA 4OHWA 1BK1A 1OPOA 3OEAA 2PLV2 3HPNA 1V6JA 2VVDA 4C90A 1YLLA 3CZJA 1TNRA 2J7MA 2WT1A 4UW3A 3WNOA 1SDWA 5IAXA 2QQLA 1VRH3 2Y6JA 4Y3OA 5FZ0A 4Z2AA 5JI9A 2ZX2A 5CFDC 3DEMA 4XFCA 2WN2A 4QU2A 3BTXA 1S55A 3IMNA 3QLQA 2WQ8A 2PQSA 5JVVA 4P14A 3ZR5A 1FPN1 1NZCA 4Y1VA 4LBQA 2Q8EA 3AL6A 4GKXA 1QJY2 3W21A 5CZKA 5F39A 1RXFA 2DVAA 4GJYA 2JWPA 4PT6A 2NZ9A 4YZ5A 3WG2A 1QY4A 5FYSA 4AI2A 2WBKA 5FZKA 3MF9A 2VMEA 3NV3A 1YO8A 2RS32 4IE0A 3ITQA 5E1RA 1VAKA 1DQ4A 4ZU4A 4YM1A 1JI6A 3FUOA 4P9JA 1UZZA 4NIDA 4FCAA 4NRPA 2HWE3 4HONA 2OVUA 3D4KA 4BPZA 1LODA 3ATGA 4XF0A 2W46A 5GZGA 1WLWA 1UIJA 3KT4A 2RE9A 4FTEA 4QAWA 3UL2A 1IPKA 1NY72 2HKXA 2JG8B 2PLV3 3B9IA 4I3GA 4NHMA 1ENSA 2Q8OA 4BZ4A 1UPSA 1H2LA 5J3UA 4Y5Z0 1HRV2 3MEPA 1YRZA 2DBIA 1JW6A 3B5LB 1H1IA 3K48A 3CMGA 2XVKA 2BNNA 1NLSA 5DN2A 1UY0A 1JZ6A 2ZHKA 3LB9A 2BOJA 1GWMA 1SPPB 2FBEA 1YWKA 1C3HA 3QH7A 1VMFA 5ABJA 1H8VA 2R6QA 1XC6A 4H14A 4PIXA 5DZEA 2VUAA 3CJIA 1QJY3 1DZQA 4X6RB 4A4AA 3VZLA 4YVWB 3THTA 5FXWA 1AR92 2XDVA 3K75B 3ZFFB 4D7YA 4G9SB 3AP9A 4WM7C 2WO7A 3WG3A 1QJEA 5FBZA 2BWCA 1STMA 4YFZA 3OPZA 3AVRA 2K0GA 5C8CA 1J3RA 4KNCA 1EPZA 4M4RA 1JZ3A 4TLGA 5EPAA 3QD6A 4YGEA 3NJVA 3GBFA 2WZR1 4YG3A 3BB6A 2VMFA 4YGCA 2YV8A 1IQAA 2JDHA 1CONA 3MIGA 3DYPA 4MGIE 3NO8A 4LO7A 2OUJA 3RWKX 2EIBA 2Y6HA 4ES8A 3LEGA 3WUDA 5A3MA 3M3QA 1ZZ8A 3TOJA 5A32A 2KXLA 2JJ6A 1DP0A 3WG4A 5ACA1 1IQDC 1L7QA 3SCGA 2JKXA 1DYOA 1SFPA 2HH9A 4QHZA 3UNPA 2K2SA 1WMDA 4EN9B 5I0SA 1F4AA 1KXGA 1PZ9A 2ZA9A 3OY8A 1IG0A 4QPIB 5LATA 4AG4A 1UOBA 2QQWA 3TNPB 2XLGA 5CKNA 3V0AB 1G9CA 2JDMA 2IVJA 4L9BA 4B7KA 3O1OA 3S7EA 3SH4A 2WS92 4W50A 3I2FA 3PURA 5D8AA 2B8MA 2FDIA 4DXTA 1KJRA 4XHBA 2ZMLA 3T30A 3ZKUA 2Y26A 2FMDA 4N53C 5KHKA 3AKQA 3LKJA 4ZXKA 2YY1A 2QQJA 4BQ4A 2DV9A 1QQP1 1EV11 5F1RA 5JAXA 1PVC3 3DGTA 3JUUA 4CDWA 1ULPA 4A45A 4Y20B 4YM2A 3PUQA 2CY6A 2YUEA 4AOCA 3U75A 3N7MA 4OHZA 1AUYA 3ACIA 2JDPA 2W39A 2WFF1 4LO4B 4MADA 4CDXA 4E4SA 1EUUA 1TG7A 4WV8A 5CG9A 1PO21 4FPYA 3NVCA 5F7UA 1GKBA 5C4WC 2IFWA 1G6NA 1FAYA 1H8TC 2C0ZA 4IL7A 4HKLA 1OSGA 2VBBA 3A23A 1V70A 2RMU1 3HVDA 3AVSA 4KL1A 1BQPA 4MGSA 1QJZA 1UYPA 5A7NA 2CAVA 4LA2A 4IE4A 1NE6A 4BH9A 5CFDB 1ACCA 3L2YA 2HYKA 4WVZA 4CEWA 1Q8SA 4K9SA 3MPPG 1MZEA 3H0OA 1NT0A 2R073 2WS93 4CU7A 2DF7A 4QDQA 4DUXA 1YJKA 1DGLA 1ZRRA 3GBWA 5IK8A 5LASA 5FO7B 3IT8A 2QVSB 3DCQA 3AM2A 5HV0A 2HLEA 1N47A 1YEWA 3VBUB 3MLJA 4MYEA 2HWD1 4AEJA 4BK5A 3S0MA 2CV6A 2E31A 2VULA 2R7EB 3JQXA 2BGCA 1J83A 4D6SA 3O5SA 4LR4A 5GKAC 1RHI1 4UOJA 2ZTNA 2YU1A 3IPVB 3SEPA 1VBA1 3THCA 5F9TA 3HEIA 2HEYF 1XYPA 4AZZA 2AEZA 1PGW1 2RVAA 1VB4A 2WSUA 1TQ5A 3VHRA 4HZFA 1GZTA 1US2A 5F5QA 2R49A 4RQPB 1KEXA 2WT0A 3ZX7A 1AJOA 1WW6A 2RR12 1TME2 2WNVA 4MHUA 1JHNA 5FXVA 3V56A 1Y9QA 4Y5SA 5FZ1A 5SV5A 4EWDA 4MGKE 2HWB1 3GZAA 5IHRA 1RUG3 4I0BA 2QQIA 4E4HA 5FY9A 4XACA 1FMD2 3ACHA 4JGYC 4N43C 1Z78A 4UFHA 5GALA 4PF5A 3I97A 3NAPA 4P5HA 4Q0SA 5BNPA 3AJZA 5CBLA 2XJSA 1YHFA 3NNGA 4FFFA 2E33A 1NCQA 1W6OA 2CU5A 4D7TA 2NP0A 1K5MC 4NWVA 4OUMA 4GB32 2WRAA 3H1YA 2XH6A 1UWWA 2ZHNA 2E63A 2ZPXA 4WVMA 2SLIA 4HN1A 1MACA 2A75A 2P34A 5A3NA 3MLLA 4KBZA 4YYOA 1ZNPA 1YI9A 4IXLA 1MS0A 1W6PB 5TSWA 5C7GA 1BXHA 1W99A 3L9JT 3N9QA 4HOOA 4NROA 3H1WA 5DUUA 4XQDA 4CA9A 3HT2A 1UY4A 4XAAA 3VBRC 2KM2A 5T5JA 2FDFA 1NLRA 2WNUC 3MW3A 4L8QA 2YBKA 4Q0VA 4C91A 4QPWA 1W90A 3CHXA 5L9VA 2Z79A 2HWE1 4JAAA 4A3ZA 5DAQA 5FUNA 1GOHA 2AGSA 4Q4W1 1YFWA 2QBXA 2F17A 2DFBA 4YZ3A 5FZGA 5FZIA 3GZTB 1TME3 3TWIA 2PLV1 2DFCA 4FT8A 2CSGA 4CUCA 5FP9A 3J7MA 3FHAA 4KGGA 1NX9A 4M01A 4EZHA 4LBKA 2VOVA 1SDDB 2EXKA 1CVNA 2VVFA 4Q4X2 1Q8VA 4XYXA 2W2IA 5EJ3A 3TEYA 4HMZA 2HWF2 2WWUA 3K4AA 1XNAA 3CIHA 3LSEA 3M4FA 4QQLA 2G1MA 2VNRA 1MS4A 4CRQA 5A6YA 2QQPA 1LTEA 5DMYA 2EXHA 2W47A 4GH4B 1XE7A 2Q1FA 3NNMA 4LO5B 4IV3A 4XDPA 3Q8CA 4FPHA 4GB33 4QQ2A 4XVHA 5FYIA 4AGGA 5A70A 2ZAHA 3EBRA 4YG6A 5A1FA 3RI8A 4N53B 3A4UA 5IAVA 3VZKA 4Q1PA 1US3A 3CF6E 2MEV1 3O7OA 3OBTA 4JDMA 3B7MA 5HPOA 4HT1T 5IATA 5EFUA 4GWNA 5FO8B 1JBCA 3AMNA 2HEWF 4XQWA 4PLOA 2OKXA 5FZFA 2JDZA 2BUKA 1K5JA 3H3ZA 4CUBA 3GJBA 2RS31 3QCWA 3K4DA 3S7IA 3VD5A 1OPMA 2Y8KA 3RZGA 2YPDA 2XG3A 5DUVA 4YVSA 5LBFA 1SCSA 4AI0A 4F8AA 1VBD2 1UIKA 5T5PA 5LY1A 4LKSA 1KGYA 5ABJC 3VL9A 1PX3A 1H8TB 3JD73 2DCTA 1FXZA 1MEC3 2BNMA 3CJIC 2GP5A 4PLMA 1DF0A 3SEEA 3VKLA 1VPHA 4HFSA 1NY71 3WUCA 1UAIA 3HQXA 5L9RA 2BBVA 4JHZA 4ISQA 3UKNA 2W0XA 2PHXA 1W6MA 3BCWA 1HRV1 3APBA 4RD7A 4Q4X3 5F5AA 4C8DA 3NSTA 1HRI2 5FZHA 5C8CC 3AZWA 2HWF3 1RUE2 2JXAA 1CWPA 2WA3A 2ZEXA 5A7SA 4HXCA 1CZVA 5F3GA 5GM0A 1TEIA 4YWAA 1QWRA 2OZ6A 1UMZA 5HXMA 3V0BB 3C2UA 3W5MA 1K42A 2V4VA 4Q29A 1RUJ3 4Y22B 2E9QA 3WG1A 1LOCA 3LFIA 2D5FA 2BPA2 5JSOA 5KHGA 4OI2A 1OA2A 4IQPA 3RSJA 1C4RA 4JKLA 4KGQA 1AR91 1MZ6A 3B9CA 4JTNA 5T52A 5KHJA 1BVVA 5I93A 3CLPA 3FJSA 4QQOA 1QEXA 2BW8A 1LEMA 2XUEA 3I54A 4HETA 3O0XA 5FYCA 1ONAA 3KCYA 1IOAA 3PU3A 3QACA 4QPYA 1W6NB 4H3WA 4XFGA 1XNBA 3LA2A 2WQ4A 5FCCA 1C5IA 3BUCA 3FFQA 4OCTA 2JEMA 2BJSA 1ZREA 4B3NA 5A6QA 1HLCA 4P9YA 4ATEA 1DGWA 2ZXQA 3FUQA 4AR2A 4CDQB 5D8AC 5JUVA 3OGRA 3EB7A 3RPQA 1W8NA 1W39A 4P9GA 1R083 3LOIA 4QXHA 4XMAA 4CCDA 1RUC3 4IETA 2LUWA 3POYA 1VR3A 4N43B 4CDWC 1R092 3OUJA 4RR3C 1AXZA 4AQTA 4XJZA 4RL7A 5FYTA 2CHHA 4RS5A 4A2UA 4AF9A 4DMIA 2CDOA 1IGOA 3KQ4B 3NKGA 4AI1A 2E26A 1JOBA 4CDXC 2HBTA 3MUY1 1K5MB 1WUVA 4QPGA 5FYMA 2VR4A 3LEMA 3M7AA 5CKMA 1POQA 4XCBA 4OI1A 5HCHA 4YW6A 2WS91 2F4LA 4JCKA 4YW4A 2PTMA 2ADDA 2D6OX 3SITA 2XWJB 3USUB 4JQTA 3K3NA 1VB2A 3FHQA 3KB5A 2JIJA 3KS7A 2AACA 4AEMA 2UY9A 1OQDA 3ON7A 1UN1A 1A8DA 4GIQA 4LO8A 1JU4A 4LXLA 5IVVA 3SISA 4ZZ5A 4XILA 4R9CA 2ZGUA 5FY5A 3KM5A 5IVYA 3WY6A 1ND2B 4XABA 4GA9A 5C33A 3J9SA 1AZDA 3VBRB 2WNUB 4CEWC 3FMGA 3DKQA 4NHYA 3U14A 2HYXA 1PGL2 4BQ5A 5K7PA 3RG0A 1ZA7A 5LY2A 3B01A 2J1VA 4S2DA 4XPVA 5A3PA 3B02A 5JOXA 2VOKA 3POBA 3URFA 4XTPA 3MZHA 4DS0A 4M0NA 3AZVA 1AX1A 2JDNA 1W2UA 4P9XA 2Y6GA 2ZGPA 3PMSA 3KV9A 3TB0A 4PI0A 1FPN3 4XIOA 3W59A 3WT3A 3ZYRA 4BQ1A 1OUSA 3RMXA 2JE9A 2AEYA 4EYUA 3C7EA 4ZS2A 3O1SA 2PMWB 4URTA 3ES4A 4AVAA 4LK7A 5FYBA 2WO2A 2ARXA 3RGBA 4A6SA 5LBBA 4XZPA 3T09A 4CZSA 1B35A 2VMGA 2VM9A 3TYJA 3T2QA 1OD5A 1KFUL 4W6XA 5CAZA 2MHFA 2R041 4A7KA 4MGTA 2PHFA 4FAHA 2WNVC 1YI7A 4IEUA 1I1EA 5EYXA 4KI5M 2VTXA 3R4UA 4CP9A 4D69A 2OX0A 4QXBA 4NIHA 2D6MA 3WSOA 2R30A 3DUIA 5A33B 2QE3A 3NAPC 1L7LA 3VD7A 4QDSA 2GNBA 5FZ3A 4PHZA 5ABJB 4HVRA 4XF9A 3BTYA 1NCQC 2D7FA 2XL9A 5ACA2 3CJIB 1QDOA 5IJRA 1QIQA 2YZ4A 3ES1A 1A34A 3MUZ1 4URAA 5DG1A 2NQYA 2GSYA 3RVHA 2C1FA 2VZQA 1GQGA 1V6OA 2FDHA 2RR11 1TME1 4U36A 3DN7A 4K1ZA 1CIWA 4INDA 5IT6A 1DLCA 1FMD1 1M06G 1KDMA 2XJTA 2P3JA 2PFWA 2DCJA 4P9IA 5IFTA 5FZEA 5FY4A 2VOWA 4KH9A 2GNDA 2NLRA 1NUKA 4KQ7A 3BKZA 1E5SA 1O5LA 2E51A 2W52A 3N3HA 1EV12 4KBBA 3M1HA 4A3XA 3G7DA 4GB31 5T55A 2WZR3 1C57A 4R9DA 4MOAA 2NN8A 3AX4A 3IAQA 4KU8A 2VCAA 2OXBA 3MIDA 5EWSA 4LULA 4XZUG 5DAVA 5C3QA 1DU3D 5LK7B 2OA2A 3OY8B 2W1SA 3AP7A 2OPWA 4JVAA 1J3QA 2BBAA 3VN4A 1QXJA 3MFCA 4KWLA 4CCNA 4YW5A 5FO9B 1LENA 1OHFA 2WO3A 2YXSA 3OBRA 3B3QE 4CCKA 5ACA3 4MXWB 4E2SA 1X9PA 4NR1A 1UZVA 2R0HA 5D8AB 5L9BA 2BV4A 4XTMA 3PVEA 4PDWA 4WVVA 4C1WA 2EIDA 1GZWA 3JZVA 1GSLA 1DFQA 4TLFA 4WZCA 1QH7A 4QGMA 1HDKA 3ZPYA 1FYUA 3UETA 4DEQA 4ZONA 3BOWA 2EALA 3KGZA 4CDWB 4RR3B 3BTZA 1RINA 2G19A 2Y6LA 5FMOL 1UZYA 3D6EA 2X10A 2KD7A 4Q4X1 5BPXA 4CDXB 2E32A 3UKVA 2W94A 2J1RA 2JD4A 2BU9A 3UKTA 1COV2 3PVNA 3ZN6A 2EXJA 4YVSC 3RQ0A 1RUOA 1FV3A 1EV13 1UKGA 1FNZA 1S2KA 5F3EA 4YM3A 1WW4A 3OG2A 3POEA 2VUDA 1X50A 3RJ2X 1BK0A 1AX0A 3ZYHA 5A3LA 1JHJA 1WA6X 2JX9A 3AFGA 3WOGA 1WCQA 4V2WA 1PO23 3GZEA 2E7TA 4AYUA 5JOZA 3W5NA 4GQ7A 4NHLA 3ACGA 2VD7A 5KR7A 1F31A 4XQ4A 1NG0A 1ENXA 4XJUA 2JENA 5FZMA 3ZYBA 1DGRN 1H9WA 1W9FA 3PTRB 5GLWA 4CEWB 2Y64A 1MQTA 4MHRA 2PAMA 5FTTC 4AFCA 4I0AA 2Q8CA 4Y1ZA 1G86A 2RMU3 4OQ8A 4M3CE 3HOBA 2P4EA 1Q3EA 1VBD1 3KCCA 1U5IA 3AZZA 4LBNA 5HV4A 4AFMA 3Q8EA 3E5UA 4Z92B 2YGMA 3WDUA 3T0DA 4Q8KA 5JPMB 5GLZA 3VBFA 2DTWA 1E5RA 1BKZA 3C3VA 3IBMA 2PA7A 5FJKA 1REEA 3PNAA 2BTVC 3ELNA 1H2MA 4AQSA 4G4FA 2WABA 4RSUA 1WWYA 3OOXA 3FLRA 3GHNA 4EWEA 1HRI1 5J36A 1RUE1 2GC0A 3AYAA 4HSLA 2QUOA 3S57A 4FP2A 2J42A 3AMQA 3JBG2 2HWD3 2VOTA 4FVVA 2VNVA 4YZ4A 4F7ZA 4LO6B 1VBE2 1DGWX 4LUMA 1RUH2 1FX5A 1O91A 2PYTA 2D3SA 4UYBA 1JZ2A 3NV1A 4QGLA 1RTVA 2PHLA 1BMV2 1A6CA 1FV2A 3TEXA 2QQOA 1X9TA 3NQHA 3QH6A 4OUSA 2WIIB 1VBA3 2ATFA 2BRTA 2UWAA 1BBT2 3K2OA 5DAXA 1JYVA 3PIJA 4LJHA 5FZ8A 1RUD1 3MYXA 1POV0 3ZFGB 1DQ2A 2ZMNA 4NOTA 3WF4A 3HIFA 4CU6A 3NAPB 1QGLA 1QU0A 4QB1A 4RS5C 1O4TA 1TZOA 4PI2A 4Q4W2 4BIOA 2A6WA 3C7FA 5L19A 2H6CA 4AFAA 3WHUA 1GNZA 1NCQB 1S0FA 2OT7A 3MV01 4D8MA 1OLQA 4QPGC 1GFF2 2WZ8A 3PUHA 3T2PA 1QHDA 1SBDA 2HWB3 1CAWA 2ZGOA 3GBGA 1NKGA 3ZYPA 1NCRA 2ZX3A 4MGYE 2DVDA 1QDCA 4J6GA 2DCYA 4UW5A 1W6QA 3VBOA 1G9AA 3BTAA 2VC9A 3GF6A 2J1SA 2WZPP 3WNKA 1UXZA 4CCJA 1J58A 3K51A 4IGQA 1FOD2 1ASJ2 1N1VA 3I3BA 1OA3A 4LBOA 4UF0A 4W6YA 3U1XA 2Q1ZB 3AZYA 5CFCB 3OGSA 1JYXA 1O7FA 2IXLA 4GXLA 3O1UA 1R091 5A1LA 2WSVA 3O1PA 4MH0E 2BOIA 4XBNA 4D3WA 2MEV2 2XWBB 4CCEA 1PK6B 3DV8A 3MHZA 2QDRA 1SCRA 3PJQA 4Q8LA 3MIFA 2VJXA 2VQTA 2JIGA 4OHYA 3ORJA 3WX5A 3CNAA 4QX1A 3ILNA 1Y9MA 5KC6A 3UGHA 5E88A 3VBSC 2VTFA 1GR3A 1GUIA 2HJIA 4BLIA 4BQXA 3ZXEA 1BBT3 5CKQA 4Q5OA 3NKTA 3RWNA 4I09A 1OQ1A 1EUTA 3ZSJA 5C3PA 3HR9A 3NJYA 1H1AA 3HNBM 1NZIA 3SKVA 5I8TA 1V0AA 3J4UH 2V4AA 4P9WA 4Q4W3 4P02B 5F2SA 1DHKB 4EN8B 3TNQA 4JHTA 1IS6A 1WW7A 2XUMA 2ZGKA 3IB3A 3RYPA 4O65A 5BNNA 1MR5A 2DTYA 1W9WA 2GN7A 1AL22 4FQZA 3THPA 4MX3A 1CGPA 4LOTA 3BYWA 2GC2A 1I5ZA 1PGL1 5J09A 1B35C 2VZOA 2VNOA 1YC61 3N35A 3O0WA 2X09A 4ZY9A 1ASJ3 1UX6A 4AAXA 5JPNB 4YSFA 4RA0A 2B7YA 5IK4A 2G9ZA 1FNYA 1POV3 3DYMA 3VKMA 2DU1A 4CTEA 2RDRA 3H9AA 3JB8A 4FPFA 1JXNA 5JZGA 5FLIA 3SH5A 1ULFA 4ZU5A 2MEV3 4GD4A 4IV1C 1LESA 4AE2A 3AC0A 3L2HA 1D4M1 1KITA 1LHOA 2R1DA 3VLBB 2LRPA 2BVBA 2RM22 2RS33 3IKWA 5C71A 1OQEA 3RZMA 1D7PM 4Z82A 1JZ4A 1LULA 4TXWA 3CQOA 3J8F2 1HB1A 2CGOA 3LQCA 1PZ8A 1O5UA 3M8LA 4ET7A 4ZZ8A 3D82A 2RDQA 5FREA 3ZOIA 2KR2A 2PAKA 4IERA 3ZMNA 4DXZA 1OA4A 1RJ7A 3WDYA 1WLDA 3SLIA 4F3JA 1SLTA 5CIRA 1V6MA 3O12A 1D2QA 1GBGA 4MUVA 4HPKA 2VVEA 2RJ2A 3FBMA 3T0AA 1HRV3 1LOGA 2FDJA 2Q0AA 2VG9A 3AKTA 4K21A 4XBLA 4DEVA 5FDBA 3KZ4C 4FXKB 3WDWA 1IKQA 1S0EA 2NYYA 4NMIA 3WP6A 5IVJA 1WZXA 2ZOEB 4Y33A 1LU1A 2YC4A 5IVCA 5JR7B 2P6CA 2W92A 2Y0OA 2NM1A 3BVCA 3LOBA 4AVVA 4FTBA 3I2HA 3OTFA 1PX4A 2JG9A 4ASKA 4QKNA 4UW6A 2Q8DA 4HK8A 3SKJE 4L97A 4BXSV 4YNIA 2ENRA 1QH6A 1CR7A 3AZXA 1BZWA 2XR4A 3D0JA 4TN7A 1XOYA 1LOFA 1AR93 2PHRA 4XUTA 2YFZA 4NIGA 4ARXA 1CAVA 2ZEYA 2ZS6B 3POWA 3RZLA 5BNOA 3MPBA 5DG2A 3O1TA 4PDWC 1VRBA 5AVPA 4LOSA 4XOGA 2BERA 2QQNA 3J26N 3F95A 3MW2A 3J8F3 3WNLA 4PIYA 5FIXA 4AI3A 1NXD1 3RNSA 4NPLA 4OULA 4N90A 4FOVA 4OUEA 4AHYA 4N7IA 2EAKA 1V6IA 2MPFA 1EAH2 1SLBA 3QOPA 4QB6A 3K4ZA 4J1WA 4C1XA 1XXNA 4PQ9A 2ZKLA 4XC9A 5CADA 2JD9A 1ODMA 2WDBA 4HVOA 4M0HA 3T0BA 4FI9A 2QTWB 4Q2FA 3OBZA 4QWNA 1PIV2 5G05L 3VGIA 5C8WA 2DUQA 3AP4A 3VBHA 1HQLA 4XJAA 5FPXA 2E7QA 1UNBA 2Y33A 3A7QA 3VD3A 2FCTA 1U0AA 3AMPA 3EXUA 5C9AA 1LR5A 2JICA 1I9RA 2ET1A 1OKOA 4LIUA 5GLVA 5KXEA 5J37A 3A22A 4NN0A 4LKEA 4GAZA 5GLUA 2ZHMA 4AWDA 3Q8FA 2B45X 2AYHA 2XBO2 3SXWA 1MQTC 1IS4A 2ZMKA 3IIAA 5IUQA 4NIIA 4CCOA 1COV1 4JC1A 2R042 5EJZB 4DUWA 2IWGB 4DRVA 2AREA 2D44A 1CX4A 4CP2A 3VBSB 1H6YA 3VUOA 4FO9A 5CYYA 2OPKA 1SACA 1W0OA 3H7JA 2YC0A 3BPZA 4Q0UA 5JSPA 5KBFA 4GWIA 3VBFC 2WQZC 3RRDA 3LIHA 1F15A 4XUNA 1GU3A 3ZMOA 2GMEA 4CXXA 4I30A 5I0DA 4CYDA 3BIEA 1O8PA 1U12A 3KVAA 3VZOA 5A3WA 4BYYA 4CPBD 4EN6B 2TBVA 4I02A 5JCTA 4Z07A 5A1AA 4IGOA 2WA4A 1Y3TA 2WL1A 3AYDA 4E8DA 3UGGA 2E6VA 4XHXA 5A3OA 1AJKA 4BDVB 4UFKA 2A3XA 2R32A 3VKOA 4ZHNA 3AYCA 3WINE 3VL8A 1O59A 4FFGA 2JDUA 3RZJA 3D8CA 1B35B 2VXRA 3ILFA 4LE4A 1S2BA 5I8SA 2ZGTA 4XFAA 5GZEA 2A5ZA 2RS12 3VDDA 3WV6A 4FAGA 2VAUA 2OUHA 1QJFA 1AR82 4GMP1 1TVGA 2O8QA 5E89A 5A7QA 2F4PA 4ZU7A 4C0HA 2GP3A 3I2OA 1P8JA 4LBLA 5JMCA 4COZA 5JXHA 1IHMA 3GYDA 3OCPA 4XIKA 1ULCA 1RVF2 4JGZA 3N7KA 3OGVA 4IV1B 5FBJA 4DINB 1HKDA 1JZ8A 1W8WA 1MS5A 1N3PA 1R1ZA 3PTYA 3JBG1 4UI9L 5JOWA 2R043 4WM7B 4RFT0 4QX3A 3C7OA 3SC7X 1WCDJ 2HBUA 1VBE1 2UY8A 1RUH1 3ST7A 1ZZBA 3G6JB 1NCRC 1BMV1 2RDNA 1N1TA 2ZKNA 4IEYA 3SH3A 2Q1MA 2C26A 3I3DA 1LEDA 4AHZA 1ZZ7A 4RN5A 1BBT1 1RC6A 1X8MA 2TUNA 4HSJA 3U4XA 2VH9A 4X6QB 1ZRCA 4L99A 3MICA 3BOPA 3LGRA 5EP9A 4E2GA 5AC92 3AK0A 3HBKA 5BY5A 3MGUA 5HCFA 1UXXX 3MW4A 3F2ZA 4B8EA 1W2OA 3VHPA 3IAPA 3DPRA 4K40A 4X8NA 3ZDVA 3KD4A 4EWAA 2IZWA 5DPNA 4ZXEA 2JDYA 5JIAA 5A7WB 2RR13 2R1BA 1IKPA 2WR9A 2XOMA 3AMHA 4JX0A 4MO3M 1QF3A 3N9MA 3WCRA 1AR83 2NPIA 3IZOA 1FMD3 3RZHA 2X8KA 3MFAA 3PVBB 4QD2A 3LPGA 1AYM2 4LPLA 1CAXB 4B7EA 1FOD1 1ASJ1 5EZWA 3VHNA 3VKNA 1W9TA 3N7LA 2A3YA 5FK7A 4FBFA 5KWRA 1HB4A 3ZSKA 1POV1 1CJDA 1S0DA 3OUIA 1PM7A 3ZXDA 1F5JA 4FPJA 1S1AA 1LHNA 1MPXA 2X5IA 5JSRA 4AGVA 3FFZA 1GZCA 1KQRA 1Q43A 3TN92 5BNNC 3UGFA 5FJHA 3POSA 4RGAA 3W20A 2I74A 2VCBA 4PDWB 4COUA 4DIQA 1RB8G 5BNQA 3MBWA 4ASLA 2VCMA 4KWKA 5F3IA 1KS5A 2XPJA 5L36A 4EZ4A 2YYOA 5IYYA 2AC1A 1UZWA 3KQRA 4DY3A 4PQQA 5FUPA 3HMYA 4NPMA 3W58A 3N7JA 2I2SA 5C4WB 5JZGC 1EP0A 2DURA 3N9NA 1SQ4A 3IIIA 5C3SA 1S0BA 3BN6A 3ZN6B 4SBVA 1HIXA 1BYHA 3E6DA 2VO5A 2HWC2 1QKQA 2YMZA 2A7AA 3ACFA 1AL21 1LHVA 1PNFA 2XHKA 2A1XA 1JUIA 3LIGA 1YXWA 4HKOA 5IVBA 5FPBA 4IDZA 4XFFA 3ZXJA 5LZ6A 4CE8A 1BEV2 2QFEA 2VMHA 2XVGA 1SPPA 2VUCA 3LA7A 3B93A 1GV9A 3KT1A 1XE8A 4Y4YA 1S4CA 2AR6A 4BXFA 4TZDA 4YVWA 4CDUA 3T1MA 4CU8A 2ZJCA 4MZUA 5FP4A 2YDEA 4XJWA 1MQTB 2VQAA 5FKCA 5FYHA 2RV9A 1LGNA 3TN93 5I0UA 2XJPA 1J1TA 1HXS2 5J98B 2A6VA 4DB5A 1W8OA 1RUD2 4EE2A 2RM21 3AB0A 3VBFB 4AL9A 4HBNA 4COVA 2XVLA 1PO12 4XETA 2FZ1A 2ZACA 3S30A 2VZPA 3DKWA 3FZ3A 3MV11 1VBC2 3POGA 5AFBA 5A3TA 1SZBA 1VBD3 2IC1A 1JOJA 3J8F1 3ZVXA 2JG9C 2K9ZA 3AKSA 1D4VB 1XNKA 4HLTA 2WJSA 1GP6A 3MIEA 4ZPIA 1W8ZA 2JE7A 2VXJA 4M3CA 1BJQA 1LOFC 2XKOA 1DQ5A 4DUVA 4B4RA 1SLAA 2QZ3A 3OGJA 1XJAA 3NNFA 5HCAA 4LTAA 4LNVA 1HRI3 2PHUA 1XQNA 2WAOA 5BNOC 1RUE3 4JGYB 3V0AA 3EO6A 3WVJA 4YZ2A 3GDBA 2PN5A 4V1PA 2ET7A 3R05A 1QNYA 1LB2A 2VMCA 3RYKA 1WCKA 3LEKA 2VPVA 3PJYA 5H9RA 2D6LX 1UU5A 2VZVA 2YU2A 3AP6A 1WCUA 2R0FA 3V64A 2DCKA 1SBFA 2ZX0A 2HEVF 4FFIA 1VJ2A 3BPSA 3KWVA 5FZOA 2JECA 3U11A 3NNJA 3RDIA 1DG6A 1ND3A 2B4KA 2OQ7A 3J7NA 4Y20A 5AVAA 5GLTA 1RUD3 3KV4A 1AL0G 5LBCA 1LGCA 1NCRB 4HN0A 5J1XA 5J7MA 2EA7A 2P5BA 1DGRA 1OLME 1QJU2 3U4SA 1PO13 4UWDA 4I01A 3OJBA 1ENRA 2IXKA 4AVBA 1JUHA 2D98A 4B1MA 3LD8A 4E9KA 5C9AC 3RS6A 2UU8A 4LBMA 3T2OA 3WF1A 5D21A 3CU7A 3I7DA 4QKFA 1YIPA 3VZJA 1C8NA 2V5DA 3POFA 1AR62 1AXYA 2ZZJA 3H7YA 4LBQB 1VAMA 5FMBA 4CUAA 3VDBA 4FOQA 3FLTA 4IW3A 1EAH1 5LEJA 3O1MA 3SCHA 5E8AA 5C3OA 3U37A 3WF2A 5I0TA 3KF3A 4GKYA 1GOGA 1R093 1WLTA 2P2KA 3N9PA 3WQ0A 1PIV1 3E5XA 4WBBA 4AAPA 3C7GA 1OVSA 1YQ2A 4XXPA 2YROA 5DQ0A 4OYUA 1ST8A 3I3MA 3ZN4A 2D6KA 2PAEA 5T3NA 1OKQA 1D4M2 4XW3A 3VBUA 4EN7B 2QQMA 5BXXA 1OC1A 2D6PA 4HL0A 1LHUA 1EYBA 3LFMA 4QU1A 3RYRA 2ILMA 3RI9A 1S0CA 3N4MA 2P3YA 5KXCA 2VECA 1YQ5A 2B39A 2XBO1 1KRIA 1E5IA 3O1RA 4LHNA 2A6YA 4BA6A 1M4WA 4OHXA 1YUDA 2Z69A 5KHIA 3KHCA 5GJ6A 3IPVA 5KC5A 3BODA 3VDDC 3I4IA 2VNGA 3ALQA 3WW1A 4IESA 2V73A 4NRMA 2VZ1A 4M00A 2ZABA 3UJQA 1J1LA 5BNPC 3D5OA 4J1XA 2WINB 4AI9A 4HANA 3I59A 4Y24A 2RJKA 1C8M2 2WYFA 4RQPA 4S2FA 4JGZC 1MS8A 4PBOA 4K8FA 3TEWA 3P6BA 3FE5A 5FXXA 2EF6A 1K3IA 3H8OA 4CUGA 4JV4A 2ZEWA 2WYSA 5C8CB 3LF7A 5D1IA 3N36A 2VBDA 1MS9A 2P3KA 3PHMA 1GP4A 2P17A 2RS11 2SBAA 3J7LA 1QJX2 5A6ZA 4QT6A 1AR81 3H8RA 1ZZ9A 5FLHA 4BK4A 5IW0A 1D4M3 2FQPA 4CU9A 3OUHA 2QZ2A 2VTXJ 1LOEA 1VALA 2FDGA 3ZXAC 2R062 5ANNA 3AL5A 3HN1A 5FZAA 4OZOA 1RVF1 4QX5A 4UFMA 4UAPA 2VMDA 5DAWA 4CP0A 4QXCA 1XB9A 2X53S 2PHTA 3KSCA 5A32B 1GWKA 4QX7A 1EPWA 3DPRC 1W6PA 5L7OA 1JOPA 3HT1A 4QKBA 1S0IA 4AHXA 1WD4A 5FP8A 5L7OB 1CESA 5DUXA 4BOWA 2GZWA 2YHJA 4LT5A 4DO0A 1PM4A 1KD7A 3ACLA 3VDCA 2BVVA 2H0BA 5J96B 3FC0A 1ZBA2 2QJVA 3T08A 3WXPA 1H4HA 3A0KA 2YBSA 4D94A 3T4HB 5AC91 3BU0A 2GAUA 3M3CA 4AW7A 1I6XA 3KGLA 5LCWL 4DRRA 4IV3C 5JLVA 1DZTA 2B9VA 4S2GA 1CAVB 2UYAA 2X5IC 4EN0A 3WD5A 5BNOB 3OBAA 2LTNA 2ZCWA 2DYCA 1UY2A 4LKDA 4ARYA 4DY5A 5C5TA 2RS52 4QGNA 1UU4A 1O6UA 4A7YA 5JXIA 1K45A 4GH4A 4SLIA 4QX0A 4B4PA 4XJ8A 3I3EA 5LA9A 1AYM1 2OYZA 3ZDSA 1LNSA 5FMCA 4N53A 1HV1A 1JH5A 2BFUL 2WKKA 4NHXA 1IPSA 1UU6A 1RL3A 1GOFA 4YG0A 4GMP0 3FWEA 4NAOA 1JYTA 5HCBA 2D3PA 4FP3A 3AXDA 3DYOA 4Q27A 3PIGA 2NMNA 2C24A 5FY7A 1UX7A 4BISA 5CB7A 3TN91 5FMOS 1GWLA 1H4GA 4KU7A 4R9BA 3E6BA 4DOUA 2A3WA 3I3QA 4LHSA 4J25A 5FOBB 2ORXA 3NL1A 2BFUS 3TAYA 2VZUA 1XU1A 1H2KA 4RGKA 5HBAA 3KCXA 3AKPA 4UT5A 5I91A 2ZGNA 1HQNA 4NVPA 2Z2SB 4FTSA 4CDUC 2YFUA 4GULA 3NRUA 1G9DA 2JB4A 2B5HA 1OFSA 2XL7A 2ES3A 1CZSA 1Y9GA 2D43A 2VZSA 3FBYA 3HJRA 3M3EA 1CJPA 4CSWA 5LW9A 1WBFA 2OW4A 4YM0A 4RGGA 3O0VA 2HWC1 4D7SA 4K1YA 2A70A 2XONA 1TMF2 5ISLA 1NA1A 4AXOA 1ZBE2 5EXOA 2FMYA 1U5XA 1V6KA 3I8TA 4FPGA 2BGOA 1BEV1 4IE6A 5FMDA 1G7YA 5F3CA 4Y22A 5K9YA 4MGQA 3CDZB 4C0BA 1XYOA 4XXAA 1COV3 5LA0A 2DCZA 1UOFA 4RHV1 3GHMA 1H6XA 1JZ7A 4XAEA 4LMFA 4XUQA 5H9PA 4JQRA 3GALA 1MS1A 1SFNA 3GCWA 4AGRA 3UJOA 1JN2P 1HQWA 2LM3A 1E5HA 2QQUA 3MO4A 5FPLA 3VZMA 4FPEA 2ZAAA 4E27A 5JXJA 2UWBA 3SQOA 4O9GA 1HXS1 2WNVB 1V6LA 3VDDB 4OMDA 1VRH2 1W6NA 2TEPA 4LQRA 2ZHLA 5CG8A 4DPNA 1AYN1 2ZGLA 5BNPB 2WO1A 2W91A 1PO11 3WW3A 2W87A 1DBNA 4QMAA 4CDQA 1VBC1 1W6OB 1W0NA 2XQRA 2YG0A 4I3PA 5A7OA 4DZGA 1Y4WA 3HWJA 1JYNA 2VZ3A 2G4IA 3HN3A 4GMP3 4WVMB 2GN3A 4BIFA 3MIHA 3B94A 3T4VA 4IE7A 4NHKA 1ND3C 1CD3G 2B9UA 4H7LA 4NUBA 2J1TA 1ZBE3 4B4QA 1LU2A 1GLHA 5FWJA 3ZFEA 1D0GA 1OT5A 1S2EA 3WDXA 3ZXLA 4QX2A 5DAPA 1OOPA 4CCLA 3HAGA 3JBG3 3PUAA 3U78A 4BU2A 3E1F1 5BYNA 1VLNA 3GZUC 4BE3A 3DL3A 5FY1A 1NAEA 3USUA 1VBE3 1IS5A 3I2DA 1RUH3 2FHRA 3VD9A 3O14A 1X7NA 3MIBA 4FPOB 1XNDA 2R16A 3DPRB 5IWFA 1T6BX 5EQUA 4LBJA 2JE8A 1ND2A 2NMOA 5B4XA 1ZRFA 3WF0A 1UPIA 5FYZA 1ENQA 3VBRA 3K77A 4M4PA 4QDRA 2B46X 2WNUA 5FP3A 4KMQA 5FOJB 2BEOA 1BHGA 2ZGRA 1LJ7A 1XBFA 1IZ3A 1ZA4A 3NWKA 3WZ1A 1QJU1 4ZKTB 4B1LA 5F5IA 3ZYGA 5M0TA 2WC2A 5BV6A 4OMCA 3UK9A 1WMFA 2VUJA 1LOBA 2PELA 1DYPA 4ZS3A 3U10A 2ARBA 1W06A 5LB6A 3WNXA 1VAVA 3ZN5A 4DFSA 3VBUC 2QQVA 4IGPA 4IV3B 3LEIA 4MVTA 1BVP1 5EYYA 4AFDA 5EIYB 1Q56A 4ES9A 1AR61 2X5IB 1UOGA 4BMBA 3MI8A 4G3YC 1Q8QA 1F2NA 4R52A 3ZSLA 1FOD3 5F8PA 1XNTA 2VGDA 3EQEA 2WN3A 2D93A 2G9GA 1BLZA 1IS3A 2XJUA 2XHNA 5CU1A 4YRDA 5EHDA 1LCLA 4LK6A 1QNWA 1D0HA 2O0OA 3H8UA 2Y34A 1VP6A 3PLQA 2Y6FA 4CP1A 1JODA 4XE9A 3THDA 1HB2A 4YVSB 5H9SA 3BI3A 4LORA 1OF4A 3U0ZA 5FUIA 4XUPA 1REDA 2RHPA 3MDPA 1W05A 1SG3A 5HXVA 4AVTA 3CO2A 4U2AA 4RQPC 4Y1UA 3T1LA 1ZRDA 1HW5A 4Q26A 1CQ9A 1YJLA 2H0VA 4PLNA 4WZFA 5LWBA 1PNGA 4UFLA 1RYYA 1O3RA 2MNGA 1WGPA 1W6MB 2YB7A 3ZM8A 1R1A2 5A33A 2IFRA 2EXIA 4WVWA 1W8UA 3USSA 4DNYA 1H2NA 1JYCA 1RMU2 4FPCA 3EMRA 4QM9A 2GU9A 2Z5WA
chains in the Genus database with same CATH topology
2CGPA 4GALA 5FPZA 5K8SA 5JIUA 2UURA 3M2MA 5KXBA 4CDUB 5LEKA 1KS4A 1AL23 4Q1RA 4WM8A 1APNA 2VW2A 4HK9A 1C8M1 1RJ8A 1V9U2 1C28A 1QOSA 4BWOA 1CAUA 1PVC2 4R9AA 5L7OC 5GZCA 2A73B 4N9IA 1N1SA 4COWA 2FZ2A 1TNFA 1RGSA 2D40A 2DWRA 2XKPA 4PJYA 1QJX1 1DQ0A 2QKDA 3OYWA 4XEZA 4L92A 5T5LA 1WBLA 3DF0A 4UW4A 1DQ6A 2RM23 2R061 2UYBA 2VW1A 4R4XA 3R6SA 2XLAA 4M3CB 4FPKA 1NXMA 1J3PA 1S0JA 1R1A3 1UD1A 1SLLA 4K20A 4OI0A 1RMU3 4CEYA 3MF6A 1AR72 1X36A 4RS5B 3U07A 1GZ9A 4MXWA 2R072 4GH4C 4MSVA 2PHDA 2ZX1A 3IWZA 3B00A 4QPGB 2QCSB 1ZBA1 4LLOA 4Q4Y2 2WLPA 2D5HA 1SLIA 1V9U3 3ASIA 1ZVFA 1REFA 3V65A 3JCIA 3PVOA 1WLCA 3NW4A 4RR3A 1ND3B 4MXVA 4NPRA 2AH2A 2Q5TA 3ENRA 2XJVA 4FOWA 5K0UA 1GICA 1MS3A 1VBB2 5T5OA 4FOYA 1EY2A 1WMEA 2ZBJA 5HI0A 2RS51 3IDEA 2VW0A 4NO4A 4XBQA 3VV1A 4XF1A 3ZIXA 4XF3A 3ZSEA 1AHSA 2YPJA 2IXCA 1X8EA 2WT2A 1PZ7A 1X33A 1NYWA 2ZX4A 3KMHA 3RZZA 4UBGA 4B29A 4W6WA 3ROUA 1F9KA 3WDVA 1SLCA 1AXKA 1RUG2 4XMIA 1URXA 1AX2A 1DLLA 5KXDA 2XJRA 2GMPA 1AR73 2GC3A 1NA1C 3CL1A 2C9AA 3WLUA 5B2GB 1EAH3 2IXIA 1A3KA 4Q4Y3 5FQ0A 1LRHA 3SMHA 1YFYA 1PIV3 3ME2A 3WP3A 1YIFA 4KG0A 3NV4A 1VBB3 4AHWA 2CAUA 1FATA 4P9LA 4PCRA 1TMF1 4BLJA 1ZBE1 4KWJA 2Q30A 2XBO3 4I0WB 4Q0PA 3I59B 3GNEA 2CYFA 4CDQC 1BCXA 1PHMA 2I07B 5DZGA 1SEFA 1Z7S2 1L3JA 2TNFA 1W0PA 3INAA 4AEDA 3LAGA 4OZXA 2OZJA 3ZFGA 3VBOC 4JDNA 2PQQA 4K7JA 1OLRA 4Z1VA 1CPMA 4GWMA 4AQ2A 1VRH1 3ZFEC 1O4YA 4R4ZA 1C1LA 1OOPC 1U5ZA 1PMIA 5F6KA 4Y1XA 5LK5A 4EJRA 3PMEA 1Q5OA 3AXEA 4JTOA 2RS13 2AENA 2CTVA 5DDJ2 5CFCA 2PHWA 2BQPA 4AI8A 3R4SA 3FX3A 3JB4C 1ND2C 4IEXA 4A7ZA 4LLFA 3OGGA 1RVF3 3AP5A 1LGBA 1N3QA 1PK6A 2EAAA 1XNCA 3IDCB 3E6CC 1H1MA 5E16A 4ASMB 3ZIWA 1A78A 2W68A 4N9HA 1Y7BA 4LUKA 3JD72 4FXGB 1Z7S3 3WCSA 1MEC2 5F6LB 4UXAA 1ZZ6A 1HV0A 4AQ6A 1ULGA 1GZWB 3EJKA 2AZ5A 5IK7A 4AVCA 5DXDA 2GH2A 1H0BA 2QDNA 1AVBA 5AC93 1B09A 2JG8A 4Z2WA 1MVEA 5CA6A 1RUJ2 5JI7A 2XGXA 1XRUA 3AJYA 1QJY1 2O1QA 2VU9A 3WR0A 2E7AA 2CWSA 4IEVA 1F5FA 2XB6C 5DDJ3 4FSJA 4L2NA 5I8YA 3HBZA 2B42B 4LA3A 2ZGSA 4XFBA 1WCSA 1DQ1A 2GNMA 1AYM3 2AUYA 3R4DB 3WP4A 5JDBA 4BM8A 4RHV2 4PBPA 4LHLA 4Q0QA 1KDKA 1LHWA 1RUF2 3ZFFA 2GC1A 3T2TA 4IEOA 1J59A 3UV9A 1MZFA 3S6PA 1ULEA 4N7UA 4WM8C 3WHTA 3ETQA 4FPLA 3ZYIB 1R082 3ZO0B 2GDFA 1RUC2 1MVQA 1V6NA 1AYN2 3X29B 1AF9A 1NA1B 2N7GA 1RUI2 1PVXA 1VIWB 1OMIA 1R1A1 3AMMA 3KLSA 4Q4V2 4QQPA 4XFIA 3LWCA 2BNOA 2GH8A 4YGBA 5BUVA 1V00A 4ATFA 1RMU1 2DVBA 1NE4A 1C5HA 1E57A 2CGNA 3NJZA 1H30A 2HWC3 1S0GA 4HVQA 2A6ZA 2WNEA 3SNMA 3FHIB 5DUWA 4QPIA 5CVRA 1ULDA 3IN9A 1BEV3 1V9U1 3AKRA 2ZGQA 2UWCA 5H9QA 3ZYJB 4BHPA 1G9FA 3ECQA 1PVC1 5JLVA 1FT9A 4YW1A 4H55A 1OFNA 4RHV3 1DDLA 3EHKA 1RUF3 1WW5A 4CEYC 1PGSA 4ISRA 2X29A 1GNHA 1HXS3 1XU2A 4F83A 1CN1A 4LHKA 5AFEA 1ALYA 1CAWB 5FFOC 4JDOA 1AYN3 1DIWA 1W6QB 3VBOB 1RITA 5JOYA 2WWSA 2V5YA 1FPN2 3VBHC 5DZFA 1Z0HA 1RUI3 4OVEA 4QHBA 5K0UC 1VBC3 4Q4V3 1ZX5A 3ZFEB 4YW3A 1OOPB 1OI6A 4I2OA 1LKNA 1O4ZA 3TRSB 1UW8A 1AR71 3R0RA 2R071 4TYSA 2WLQA 1XYNA 1I3HA 3VZNA 2QNKA 4S2HA 1G8WA 4Q4Y1 5CFDA 1ZM1A 2Y38A 3RMYA 3LCPA 1QOOA 3WQ1A 2EIGA 2DVGA 1VBB1 2ZGMA 4AVSA 5T50A 3LSDA 4ONUA 1U5YA 4OHVA 2ZZQA 3VBSA 1O3QA 1LOAA 4YW2A 5BNNB 1UF2C 2C5DA 4LE3A 5T54A 2DUOA 2YGLA 1QJU3 4YARA 1KJLA 1YFXA 3E97A 1DYKA 4ITCA 4HKWA 1RUG1 3A0NA 3ZSMA 4EV0A 1QOTA 2VQ0A 3AYEA 1FI2A 2Y0IA 3OF1A 1D2SA 4BCUA 5JZGB 1AR63 3D0SA 3M3OA 2ERFA 3ZXKA 5IK5A 5LRSA 2H6BA 3BU7A 4QXKA 2WZR2 4XJ9A 1A8MA 1GANA 1RIRA 2LALA 2XJQA 4AEDC 1YFUA 3IM0A 2OIIA 4DQAA 4XF4A 3ZFGC 3BIWE 3H3UA 1RUNA 2I45A 1SFYA 2RJLA 4IV1A 1ZZCA 1WD3A 4WM7A 4JRAA 3OD4A 3TBDA 4AK3A 3H1MA 4HPKB 4WM8B 5J48A 2GMMA 1UCXA 3QBQA 2GNTA 4Y1YA 2CL2A 1Z7S1 4W65A 4YGDA 3Q9OA 4META 5FAXA 1G9BA 4E4ZA 4ORFA 1CAUB 1N3OA 5CFCC 4COYA 4TSVA 1X82A 3OD0A 4IEQA 3KT7A 4M3CF 2BYVE 1JYIA 2JG9B 3M3IA 1C8M3 3SHRA 2A71A 4Y26A 1SBEA 1PK6C 1H9PA 1MZ5A 1QQP2 3OYWB 4MGZE 2DU0A 4QQHA 3IDBB 5LRRA 1CPNA 1T6GC 4EROA 2WFF2 4NWWA 1SMVA 4H7MA 1CAXA 4E4DX 1PO22 1QJX3 1UL9A 4K3UA 4KG8A 5DDJ1 4YLZA 3JU9A 5FLJA 1QXPA 4MV2A 4IEWA 4AFBA 2VY0A 4CEYB 5C6CA 2DUPA 5GZDA 1QXRA 2R063 4OI4A 3FLPA 3H50A 2RMU2 3CEWA 2JG8C 3NV2A 2IXJA 3JD71 1MEC1 2EVXA 5GZFA 4OFGA 1N1YA 4LBQD 4R8HA 3VKFC 2XLFA 3WDTA 3VBHB 2E53A 3ZXFA 1DZRA 2Z42A 3CJXA 4XFHA 5C9AB 1IPJA 5K0UB 1NQJA 5C4WA 3WW2A 2HWF1 5CNAA 2V09A 5FRAA 1ZBA3 1H8TA 4QM8A 1WA4A 3JQWA 4PIZA 2HWD2 1QMJA 2CWMA 4YVWC 1QQP3 2G9FA 3ZFFC 1RUJ1 1TE1B 1UKRA 4YZ1A 3BALA 4BMEA 4AEKA 2WFF3 3VHOA 1RHI2 4L11A 2F6BA 3W9AA 1GQHA 2CNAA 1VBA2 3HD8B 2RS53 3WQ7A 1NOVA 5EV7A 1ZYBA 4IEZA 1PGW2 3V0BA 1Y43B 4K6BA 3RJRA 3AFKA 3WP5A 5SV8A 4OLLA 3ILRA 1C1FA 1RUF1 2P37A 2JKBA 5FQ0B 2HWB2 4YFWA 4LEJA 4XDQA 3SCFA 1Q8OA 3P3PA 2IXHA 4TWTA 1O3TA 1NQDA 4E2QA 1R081 4QPIC 4X8PA 1JTZX 2A6XA 1RUC1 2WFPA 1YYNA 1HX6A 2P3IA 1KFXL 2VOXA 1GYKA 2D6NA 3MLKA 1Q8PA 2D3RA 4JRLA 1LECA 1RUI1 2O8OA 4IEPA 4Q4V1 4O9EA 2DVFA 3LA3A 4JGZB 3P3NA 3M70A 5KHHA 2KA3A 1RHI3 1YNAA 4JGYA 2GALA 1F8VA 4N43A 2Q4SA 4AEDB 4FQ4A 4MLOA 4UBHA 2ETEA 1TMF3 5L73A 2BWAA 3E5QA 3LZZA 1YCIA 1K5MA 2HWE2 2D97A 2W08A 4Z8BA 3WW4A 5JWPA 2VMIA 3B69A 3ZXGA 4OHWA 1BK1A 1OPOA 2PLV2 1V6JA 2VVDA 4C90A 1YLLA 1TNRA 2WT1A 4UW3A 1SDWA 1VRH3 5JI9A 2ZX2A 5CFDC 4XFCA 4QU2A 1S55A 3IMNA 3QLQA 5JVVA 4P14A 1FPN1 1NZCA 4Y1VA 4LBQA 4GKXA 1QJY2 2DVAA 2NZ9A 4YZ5A 3WG2A 1QY4A 4AI2A 3MF9A 3NV3A 1YO8A 2RS32 5E1RA 1VAKA 1DQ4A 4ZU4A 4YM1A 3FUOA 4P9JA 1UZZA 4FCAA 2HWE3 4BPZA 2OVUA 3D4KA 1LODA 3ATGA 4XF0A 5GZGA 1WLWA 1UIJA 3KT4A 2RE9A 4FTEA 3UL2A 1IPKA 1NY72 2HKXA 2JG8B 2PLV3 3B9IA 4I3GA 4NHMA 1ENSA 2Q8OA 4BZ4A 1UPSA 1H2LA 5J3UA 4Y5Z0 1HRV2 3MEPA 1YRZA 3K48A 1JW6A 3B5LB 1H1IA 2XVKA 2BNNA 1NLSA 2ZHKA 3LB9A 2FBEA 1YWKA 1C3HA 3QH7A 5ABJA 1H8VA 2R6QA 4H14A 4PIXA 5DZEA 2VUAA 3CJIA 1QJY3 1DZQA 4X6RB 3VZLA 4YVWB 3THTA 1AR92 3ZFFB 4D7YA 4G9SB 3AP9A 4WM7C 3WG3A 5FBZA 2BWCA 4YFZA 3OPZA 2K0GA 5C8CA 1J3RA 4KNCA 1EPZA 3QD6A 4YGEA 3GBFA 2WZR1 4YG3A 3BB6A 4YGCA 2YV8A 1IQAA 4MGIE 1CONA 3MIGA 3NO8A 4LO7A 2OUJA 4ES8A 3WUDA 5A3MA 3M3QA 1ZZ8A 3TOJA 5A32A 2KXLA 2JJ6A 3WG4A 5ACA1 3SCGA 2K2SA 1WMDA 4EN9B 5I0SA 1KXGA 1PZ9A 2ZA9A 3OY8A 4QPIB 4AG4A 3TNPB 2XLGA 3V0AB 1G9CA 4L9BA 4B7KA 3S7EA 3SH4A 2WS92 5D8AA 2B8MA 1KJRA 4XHBA 2ZMLA 2Y26A 2FMDA 4N53C 5KHKA 3AKQA 3LKJA 4ZXKA 2YY1A 2DV9A 1QQP1 1EV11 5F1RA 5JAXA 1PVC3 3DGTA 3JUUA 4CDWA 4Y20B 4YM2A 2CY6A 2YUEA 3N7MA 4OHZA 1AUYA 4LO4B 1O3SA 2W39A 2WFF1 4CDXA 4E4SA 4WV8A 5CG9A 1PO21 4FPYA 3NVCA 1GKBA 5C4WC 2IFWA 1G6NA 1FAYA 1H8TC 2C0ZA 4IL7A 4HKLA 1OSGA 1V70A 2RMU1 4KL1A 1BQPA 1QJZA 2CAVA 4LA2A 4BH9A 1NE6A 5CFDB 3L2YA 2HYKA 4WVZA 4CEWA 1Q8SA 4K9SA 3MPPG 1MZEA 3H0OA 2R073 2WS93 2DF7A 1YJKA 1DGLA 1ZRRA 3GBWA 5IK8A 5FO7B 3IT8A 2QVSB 3AM2A 1N47A 3VBUB 3MLJA 4MYEA 2HWD1 4AEJA 3S0MA 2CV6A 2VULA 3JQXA 2BGCA 3O5SA 4LR4A 5GKAC 1RHI1 2ZTNA 3IPVB 5F9TA 1VBA1 2HEYF 1XYPA 1PGW1 1VB4A 2WSUA 1TQ5A 3VHRA 4HZFA 5F5QA 2R49A 4RQPB 2WT0A 3ZX7A 2RR12 1WW6A 2WNVA 1TME2 1AJOA 3V56A 1JHNA 4EWDA 1Y9QA 5SV5A 4MGKE 2HWB1 3GZAA 1RUG3 4I0BA 5GALA 1FMD2 4JGYC 4N43C 1Z78A 5BNPA 4PF5A 3NAPA 4P5HA 4Q0SA 3AJZA 5CBLA 2XJSA 1YHFA 2NP0A 1NCQA 1W6OA 4D7TA 1K5MC 4NWVA 4OUMA 4GB32 3H1YA 2XH6A 2ZHNA 4WVMA 2E63A 2ZPXA 2SLIA 4HN1A 1MACA 2A75A 2P34A 3MLLA 4YYOA 1ZNPA 1YI9A 4IXLA 1MS0A 1W6PB 5TSWA 5L7OB 1BXHA 3L9JT 5DUUA 3H1WA 4XQDA 3HT2A 3VBRC 2KM2A 5T5JA 1NLRA 2WNUC 3MW3A 4L8QA 4Q0VA 4C91A 2Z79A 2HWE1 4JAAA 2AGSA 4Q4W1 1YFWA 2DFBA 4YZ3A 3GZTB 1TME3 3TWIA 2PLV1 2DFCA 4FT8A 4M01A 4KGGA 4LBKA 2VOVA 2EXKA 1CVNA 2VVFA 4Q4X2 1Q8VA 4XYXA 5EJ3A 4HMZA 2HWF2 3LSEA 3M4FA 4QQLA 4CRQA 2VNRA 1MS4A 2QQPA 1LTEA 2EXHA 4GH4B 1XE7A 4LO5B 3WDWA 4IV3A 4AGGA 4GB33 4FPHA 4QQ2A 2ZAHA 3EBRA 4YG6A 3RI8A 4N53B 3A4UA 3VZKA 4Q1PA 3CF6E 3OBTA 2MEV1 3O7OA 4JDMA 3B7MA 4HT1T 5EFUA 4GWNA 5FO8B 1JBCA 3AMNA 2HEWF 4XQWA 4PLOA 2JDZA 2BUKA 3H3ZA 2RS31 3QCWA 3S7IA 1OPMA 5DUVA 2XG3A 4YVSA 4F8AA 4AI0A 1SCSA 1VBD2 1UIKA 5T5PA 5ABJC 3VL9A 1H8TB 3JD73 2DCTA 1FXZA 1MEC3 2BNMA 3CJIC 4PLMA 1DF0A 3VKLA 4HFSA 1NY71 3WUCA 1UAIA 3HQXA 2BBVA 4ISQA 3UKNA 2W0XA 2PHXA 1W6MA 3BCWA 1HRV1 3APBA 4RD7A 4Q4X3 3NSTA 1HRI2 5C8CC 3AZWA 2HWF3 1RUE2 2JXAA 2WA3A 5GM0A 1TEIA 1QWRA 2OZ6A 1UMZA 3V0BB 3C2UA 4Q29A 1RUJ3 4Y22B 2E9QA 3WG1A 1LOCA 2D5FA 2BPA2 5JSOA 5KHGA 4OI2A 1OA2A 4IQPA 3RSJA 1C4RA 4KGQA 1AR91 1MZ6A 3B9CA 4JTNA 5T52A 5KHJA 1BVVA 5I93A 3CLPA 3FJSA 4QQOA 2BW8A 1LEMA 3I54A 4HETA 3O0XA 1ONAA 3KCYA 1IOAA 4QPYA 3QACA 1W6NB 4H3WA 4XFGA 1XNBA 3LA2A 2WQ4A 5FCCA 1C5IA 3FFQA 2JEMA 1ZREA 4B3NA 1HLCA 4P9YA 4ATEA 1DGWA 3FUQA 4CDQB 5D8AC 3RPQA 1W39A 4P9GA 1R083 3LOIA 4XMAA 1RUC3 4IETA 2LUWA 3POYA 1VR3A 4N43B 4CDWC 1R092 4RR3C 1AXZA 4AQTA 4XJZA 4RL7A 4A2UA 4RS5A 4DMIA 4AF9A 1IGOA 3NKGA 4AI1A 4CDXC 1K5MB 1WUVA 4QPGA 3M7AA 4OI1A 2WS91 4JCKA 4YW4A 2PTMA 2D6OX 3SITA 2XWJB 3USUB 1VB2A 3KB5A 4AEMA 3KS7A 5I0RA 2UY9A 1OQDA 4GIQA 1UN1A 1A8DA 4LO8A 3SISA 4XILA 4R9CA 2ZGUA 3KM5A 3WY6A 1ND2B 4GA9A 5C33A 3J9SA 1AZDA 3VBRB 2WNUB 4CEWC 3FMGA 1PGL2 5K7PA 3RG0A 3B01A 4XPVA 4S2DA 3B02A 5JOXA 2VOKA 3URFA 4XTPA 3MZHA 4DS0A 4M0NA 3AZVA 1AX1A 1W2UA 4P9XA 2ZGPA 3PMSA 3TB0A 1FPN3 4XIOA 3W59A 3WT3A 3ZYRA 4BQ1A 3RMXA 2JE9A 4URTA 3ES4A 4AVAA 2ARXA 4XZPA 4CZSA 1B35A 2VMGA 3TYJA 1OD5A 1KFUL 4W6XA 5CAZA 2MHFA 2R041 4A7KA 2PHFA 4FAHA 2WNVC 1YI7A 4IEUA 1I1EA 5EYXA 3R4UA 4D69A 2D6MA 2R30A 3DUIA 5A33B 2QE3A 3NAPC 2GNBA 5ABJB 4HVRA 4XF9A 1NCQC 2D7FA 2XL9A 5ACA2 3CJIB 1QDOA 2YZ4A 3ES1A 5DG1A 2NQYA 2GSYA 2C1FA 1GQGA 1V6OA 2RR11 1TME1 4U36A 3DN7A 4K1ZA 1CIWA 4INDA 5IT6A 1FMD1 1M06G 1KDMA 2XJTA 2P3JA 2PFWA 2DCJA 4P9IA 2VOWA 4KH9A 2GNDA 2NLRA 4KQ7A 1O5LA 2E51A 2W52A 3N3HA 1EV12 4KBBA 3M1HA 4A3XA 3G7DA 4GB31 5T55A 2WZR3 1C57A 4R9DA 2NN8A 3AX4A 4KU8A 3MIDA 5EWSA 4LULA 1DU3D 5LK7B 2OA2A 3OY8B 3AP7A 4JVAA 1J3QA 3VN4A 1QXJA 3MFCA 4KWLA 4YW5A 5FO9B 1LENA 1OHFA 2YXSA 3OBRA 5ACA3 3B3QE 4MXWB 4E2SA 4NR1A 2R0HA 5D8AB 4XTMA 3PVEA 4PDWA 4WVVA 4C1WA 1GZWA 3JZVA 1GSLA 1DFQA 4TLFA 4WZCA 1QH7A 4QGMA 1HDKA 3ZPYA 1FYUA 3BOWA 2EALA 3KGZA 4CDWB 4RR3B 1RINA 5FMOL 1UZYA 3D6EA 5BPXA 4Q4X1 4CDXB 3UKVA 2JD4A 3UKTA 1COV2 3PVNA 3ZN6A 2EXJA 4YVSC 3RQ0A 1RUOA 1FV3A 1EV13 1UKGA 1FNZA 1S2KA 4YM3A 1WW4A 3RJ2X 1X50A 1AX0A 5A3LA 2JX9A 3AFGA 3WOGA 1PO23 2E7TA 4AYUA 5JOZA 4GQ7A 4NHLA 1F31A 4XQ4A 1NG0A 1ENXA 4XJUA 2JENA 4CEWB 1DGRN 1H9WA 5GLWA 1MQTA 5FTTC 2PAMA 4AFCA 4I0AA 4Y1ZA 1G86A 2RMU3 4M3CE 1Q3EA 1VBD1 3KCCA 1U5IA 3AZZA 4LBNA 4AFMA 3E5UA 2YGMA 3WDUA 4Q8KA 5JPMB 5GLZA 3VBFA 2DTWA 3C3VA 1BKZA 3IBMA 2PA7A 1REEA 3PNAA 2BTVC 3ELNA 1H2MA 4AQSA