1YJLA

Reduced peptidylglycine alpha-hydroxylating monooxygenase in a new crystal form
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
306
structure length
285
Chain Sequence
TIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTICNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peptidyl-glycine alpha-amidating monooxygenase
publication title The catalytic copper of Peptidylglycine alpha-Hydroxylating Monooxygenase also plays a critical structural role.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 54
structure length 285
sequence length 306
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yjlA02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 1yjlA01
3MIHA 1YJKA 1PNGA 4R4XA 1OPMA 3MIEA 3PHMA 1SDWA 3MIGA 3KS7A 4R4ZA 4E4ZA 1PGSA 1YIPA 3MLJA 1YJLA 3MLKA 3MIFA 3MIBA 3MICA 1PNFA 1YI9A 3PMSA 1PHMA 4QHBA 3MIDA 3MLLA
chains in the Genus database with same CATH superfamily
1BBT2 3PLQA 2EIEA 1EP0A 2HKXA 5C9AC 1V00A 3FX3A 1W9FA 1DYOA 1KGYA 2WNVB 3VDDC 2JB4A 1TG7A 3KGZA 4MOAA 4XUQA 3ZXGA 5T5PA 1YNAA 1SPPA 5I8SA 5C4WC 2OUHA 2BU9A 3CJXA 4Y22A 3S30A 1VMHA 5BUVA 2WWJA 1IKQA 2JB8A 5CG8A 4N43A 4PF1A 3TOJA 4AOCA 1AR82 2RR13 4J6GA 4BMEA 3N9PA 4M01A 1FPN2 1ASJ1 3HWJA 3KHCA 3GGLA 1AR93 1NUKA 2D3SA 4YYOA 3W58A 1RMU1 3VGIA 2VCAA 1RIRA 3CNAA 4P08A 3RZLA 1FATA 1RUD1 4QMAA 5T55A 3RPQA 5DZGA 4AW7A 1K12A 5F6LB 1QJEA 1J84A 2YU2A 1EV13 4LJHA 2NN8A 2C26A 5LRSA 1EY2A 1OA4A 4CEWA 1QNYA 1WCSA 3K2OA 3P3NA 2PQQA 1ZBE3 3VDAA 1NQJA 1REFA 3EHKA 4GMP1 3Q8BA 2H0BA 4CA9A 2GSYA 2E9QA 2EVXA 4X6RB 1DU3D 4ZU7A 2B45X 1ZRFA 3CKHA 3LEIA 3VZKA 5FP9A 3O1PA 4XXPA 1QJY2 5F37A 1POV3 4XW3A 3RWKX 5JI7A 1UU4A 4QHZA 4YW2A 4EYUA 4Z2WA 4OI2A 1REDA 1W9TA 3WR0A 4YARA 4A6OA 3NO8A 3R4DB 4LKSA 1HRI2 3BUCA 3ZYJB 5HV0A 4RSUA 4IEQA 2VZPA 3LEMA 3U10A 1ND2C 4FTSA 1XE0A 5IJRA 2ZPXA 2W46A 2YZ4A 1LRHA 3T0DA 4XC9A 1AYN3 3OG2A 5F3IA 2F6BA 4HVOA 4OZXA 1W04A 1S0FA 1VE0A 4BQ4A 4IETA 5C71A 3KV9A 1VR3A 4OI4A 2GNMA 3UETA 1Z0HA 1AX0A 1PGSA 2WS93 3MFAA 5IVEA 4HONA 3L2YA 5KBFA 1RUG1 5DDJ3 1PGL1 3M3IA 4LBQD 4QPYA 4YVWA 3C8XA 1V9U3 3DEMA 1XE8A 1GNHA 3ZXLA 1ZRCA 1UY4A 2RS11 4OLLA 1SBFA 3C7OA 1ZBA2 2E7TA 4Y20A 5FZEA 3MW4A 5GLWA 4OHZA 4DFSA 1N3QA 4Q1RA 3LD8A 2RS32 2PTMA 3GF6A 1W8WA 2HWF3 4MGSA 4XJAA 5AFBA 2VMCA 5BNNA 3KQRA 2PHFA 4PF5A 1CD3G 1D0GA 1VJ2A 5DQ0A 4Q4V2 1U0AA 1X7NA 1Y3TA 5LBBA 4CXYA 1W6OB 1DGLA 4OMDA 4K7JA 2GNTA 4LKEA 4RS5C 3JCIA 2NYYA 2VBPA 2QQWA 2TBVA 3POGA 1W0PA 2HLEA 4KL1A 4LK6A 2PFWA 3ZN4A 4BQ1A 3HMYA 1H2LA 5IK8A 3K4ZA 3BU0A 3UYJA 4ASKA 3PTRB 1RUJ2 4NIHA 3RYPA 2Q8CA 1RUF1 3MPBA 4K1ZA 4YM3A 4E2GA 1BQPA 4Q26A 2DVAA 3ZYBA 1J1LA 1QY4A 3VDBA 5CKQA 4W8JA 5FY9A 3RZJA 1COV2 4GD4A 4XEZA 2WLPA 1OFSA 4B4QA 2ZGRA 3V0AA 2XWJB 4OZOA 5JXHA 2JWPA 1PX3A 2RMU2 3FL7A 4DZGA 1GNZA 1UOFA 3M8LA 1UF2C 4Q4Y2 1OLMA 4QPIC 1V6IA 5EJ1B 2XG3A 1I9RA 3OOXA 4MGTA 2AGSA 4TN7A 2DBNA 4RQPA 1C5HA 4LE3A 4PLNA 4A6SA 4JDMA 1T6GC 3LGRA 5FLHA 3WNLA 5GLTA 4YM1A 2ZX1A 3F95A 2ADEA 5HI0A 4Y24A 4GB31 4J1WA 1AR73 4CDQB 3JB4C 5CVRA 4LBMA 1H4GA 4WVVA 4HN0A 1S2BA 5T52A 3PL0A 2XONA 1AR61 1G8WA 1MS8A 1PGW1 1QF3A 2DVFA 3BOPA 3GBWA 4QXKA 2NPIA 2W1WA 1PIV2 5LZ6A 2Y0OA 1DGRN 3BALA 3U1XA 2B46X 3QD6A 4D8MA 5AC93 1PX4A 3VKFC 1QQP3 2IXJA 2D43A 3HPNA 3ZYHA 1ND3A 5A3UA 3V0BA 5FV3A 2RE9A 2D44A 1HJGA 2WO1A 4LBJA 1VB4A 5FZAA 4MGYE 3VBHC 1RUC2 2XH6A 4OHWA 1OA3A 1N1TA 3WV6A 4AFDA 3BODA 3MGUA 1LAJA 2DVDA 1G9CA 1NT0A 5JMCA 2X29A 1LB2A 3E5UA 3IBMA 3KCCA 3H8RA 3BVCA 2OKXA 1OH3A 1JZ4A 3I2DA 4IE7A 1CIWA 5JDBA 4PDWC 3VD4A 1HQWA 4PHZA 5IAXA 4HG6B 1JZ3A 1GBGA 2JICA 2D6KA 3M3CA 4QXBA 1W8UA 2OUJA 4MGIE 5L73A 4A41A 2X53S 2DUQA 2G1MA 4IW3A 1O3TA 1H4HA 1ASJ2 1NCRB 2ZKLA 4JCKA 4YVSC 5H9SA 1RUE3 2VOVA 3QBQA 1RMU2 4HZFA 3S6PA 1OOPA 2ZTNA 1F9KA 2G9ZA 2XBO3 2H6BA 4Q4X3 3IKWA 3VDDA 2B5HA 2RDQA 2YG0A 2A3XA 3BU7A 3GM8A 3KMHA 3RDIA 4MX3A 5C4WA 3D6EA 1NLRA 2HWC3 4AYUA 1VMJA 2OA2A 4IQPA 4LIVA 4D0QA 5AVPA 1BXHA 3I59B 2VMDA 3USSA 5FPLA 3SITA 4QKDA 5HCBA 3ATGA 4YFWA 1C8NA 1F31A 1B09A 1MZ5A 1VRH1 4NHYA 2QQOA 1I5ZA 1Z7S3 2ZX2A 2PAEA 1H9WA 4W6XA 4UOJA 4YGEA 5GJ6A 1PM4A 2C1FA 1J3RA 1UX6A 3MFCA 4CU7A 2EXJA 3LWCA 3KD4A 2HWE3 3ZXDA 1XSRA 1EYBA 1YQ5A 1RUNA 2CSGA 1C8M3 3JBG3 5JLVA 2XL9A 1N3PA 4Y1VA 3ZYIB 3E6DA 3WINE 1MZFA 5IHRA 4XOGA 2XLAA 3ON7A 3S57A 2E26A 3MIEA 3V65A 1IG3A 2A6XA 5A7QA 4HVQA 2JG8B 3KV6A 3AP7A 4GJZA 3T3YA 4UFJA 1HXS3 2AH2A 4OYUA 2GP5A 3ZLIA 3WP5A 4COZA 2CL2A 4GWJA 4A3ZA 1H2KA 5FPXA 4TTGA 2VVDA 1JN2P 4XTPA 1OQ1A 3PMSA 4XFGA 4Q0SA 5EJ3A 4QHBA 5FZ8A 1RUG2 1D0HA 1STMA 3NNJA 3VHOA 4GJYA 5FO7B 4DEVA 3BTYA 2RS12 1WWYA 3ALQA 4XJWA 2R071 1XNTA 3PVEA 2HYKA 5FUPA 3Q8EA 1YQ2A 3I3QA 4L92A 1OD5A 2ZHLA 4CYDA 1DZQA 1I6XA 4M4RA 2DWRA 3VD3A 4QX3A 2EALA 5LBEA 3ZPYA 4Q4X1 3HN3A 2GU9A 4I3GA 5KC6A 4LO7A 5K0UB 2VG9A 2WAOA 3LB9A 4XF3A 3MDPA 5D1IA 3IN9A 4PIZA 4IE4A 4ITCA 1MPXA 2ZGLA 2CYFA 3UKVA 3RS6A 4URAA 5JIAA 1QWRA 1JOPA 2W0XA 1LOAA 2RVAA 1RJ7A 5CU1A 5H9PA 1DBNA 3VD5A 1RUF2 2HBUA 2ET7A 3IIAA 2J22A 3AYCA 3JBG1 4DO0A 3W5MA 2B42B 3D0JA 2CGPA 3RG0A 2E7AA 2OQ7A 3NNLA 4G9SB 5F8PA 3VBRC 2NP0A 4NJ4A 2YPJA 1HRV3 2ATFA 4EN7B 1LHVA 2J1AA 2RDSA 2VZUA 4LORA 5JOWA 2YC4A 4FFGA 2YGMA 1BK0A 4JGYB 2WZR2 4AQTA 1GZCA 5GZCA 2WAAA 1S55A 1WBFA 2BUKA 4MV2A 5AVAA 5LY2A 2VE1A 1PHMA 3SKVA 4EN8B 5B4NA 5L7OC 3VBOC 5I0UA 4QPGB 4DRVA 1PMJX 1UYYA 3ECQA 2K46A 4I2OA 1US3A 4WZFA 5KC5A 3CBNA 4QU1A 5T5LA 2WBKA 3FHQA 2FMDA 1RB8G 4I02A 4KU8A 2CGNA 4GB32 4B1LA 2I74A 4COVA 3AP4A 2XKOA 5GKAC 3Q8CA 2K2SA 3A7QA 4Q5OA 2VD7A 5FYHA 4AZZA 3WSOA 4B3NA 1PGW2 3IDBB 3VZLA 1AR62 1GWMA 1KDKA 4XDQA 5D8AB 3OTFA 4CPBA 5F7UA 4LKDA 3S5QA 1DGRA 4FQ4A 1VLNA 4XF1A 3KF5A 5J48A 1IG0A 1K5MB 1K5JA 4QKNA 1PMIA 4Y1XA 4ZS2A 2DVBA 4EJRA 4LLFA 4AVTA 1AXYA 1NA1C 1PO23 1W8NA 5DXDA 5EXOA 1AZDA 4OCTA 3E1F1 3GNEA 3RI8A 2XPJA 4JKKA 1UPSA 1HW5A 1W2OA 2VMEA 5EZWA 3ZYFA 4DQAA 5ABJA 2Y0IA 1JUHA 4ONUA 4GULA 2PHRA 2WNOA 2Z42A 1BBT3 1ULOA 5BNPC 1F35A 1SLTA 4LO4B 4PI0A 3VDCA 4TLGA 3V64A 3ZXKA 4CUGA 5L9VA 1A34A 1YWKA 4I0AA 5A7SA 4KI5M 1JZ5A 1IS6A 3IPVA 5A1LA 4UFKA 2BGCA 2R32A 1JYNA 3R6SA 3B7MA 4WVMA 2V72A 1G7YA 2EF6A 5FCCA 4PBPA 4V1PA 1SFPA 3C2UA 1AR83 4Y4YA 2X8KA 3VBHA 1U12A 2BVVA 1JH5A 2RM21 2WLQA 3LOIA 4FPLA 3N9LA 4BQWA 3AKRA 3MBWA 3O14A 5FZOB 3UK9A 1FPN3 1F15A 4URTA 3KT1A 3O1SA 3SH5A 4L0PA 1F4HA 2VUDA 4XURA 3RYKA 4BQYA 5JMOA 3P6BA 1MS5A 2P17A 2E63A 2R041 4YM0A 1LODA 3LIGA 4Y26A 1FXZA 1X8EA 2HEYF 3AMPA 4FPFA 4RGGA 1R1A1 1W6PB 2PN5A 2VZQA 5B2GB 2OPWA 4LT5A 3TEWA 4IERA 3D3AA 4XE9A 1DQ4A 4JKLA 4DIQA 1A8DA 1YI9A 2RJ2A 2ID4A 3PURA 2ZBJA 2ORZA 3ZSLA 4BQXA 1VRH2 1YC61 2C0ZA 2ARAA 2WL1A 2ZA9A 1RJ8A 4YVSA 1PK6B 1ULGA 3ZDSA 3BN6A 1EUUA 1QJY3 4JTOA 4HFSA 2UU8A 4WM8B 4NRQA 2PAKA 1GR3A 5DMYA 4L9BA 2GALA 2WFPA 4XIOA 4ATEA 2W92A 4XFFA 3GALA 4R8HA 5FP3A 4A44A 3GZTB 3AMNA 5E1RA 1BEV1 1HRI3 3IMMA 2VZTA 3MIBA 2WZ8A 2IXKA 1Y7BA 1L3JA 2WC2A 2WO2A 3K3OA 4H7LA 3U75A 1IPKA 1JTZX 5FBZA 4O61A 2XVGA 1I1EA 5FK8A 4AFAA 2ZS6B 5KHKA 4K20A 4BA6A 4RN5A 5FXWA 5LB6A 4TYSA 4H7MA 2Z79A 5BXXA 3ZX7A 2BPA2 1B35B 1GOGA 1YRZA 3QACA 3AJYA 5A6YA 2WFF2 2ARCA 3V56A 1FOD1 1LOEA 1QXPA 3TWIA 3KV4A 5EYYA 4L8QA 1FT9A 5DG2A 3PU3A 3H1YA 5FPBA 1AR81 3HBZA 2Z5WA 3CMGA 4E2SA 3RZHA 4GKYA 1DGWX 2YYOA 4P00B 3FUOA 5GALA 2C9AA 3N35A 2R072 2VZSA 1ZBA3 4NWVA 1UYZA 1UZZA 2BGPA 2VO5A 3RYRA 4ARXA 1AXZA 5FTTC 1YUDA 3RWNA 2Z69A 2VZRA 2RS33 1YQ6A 2GH8A 3G7DA 1VBC2 1OLME 4COWA 1KRIA 5SV5A 1JHJA 3VBUB 1VBA1 2BTVC 4UT5A 1DZRA 1GWKA 3AM2A 5KHHA 4CDUC 4O9GA 1Q56A 1J58A 2P4EA 3HT2A 2PMWB 4KWLA 4Q4V3 3H8OA 1ZRIA 3HR9A 3LEGA 4N90A 4CCMA 1V0AA 2X5IB 4LXLA 1X9TA 4HL0A 3T0BA 3VZJA 1J59A 2FCTA 4KWUA 2XVKA 4BMBA 1W6QA 1X50A 3J7HA 4ZZ5A 2CU5A 3MEPA 5HCFA 1PK6A 2VBBA 5FJHA 4C1XA 1RUJ3 4Y33A 3O1VA 4LMFA 3O1RA 4IXLA 5FZ9A 3WT3A 4QX5A 3WDTA 5FOJB 3VBFC 1OVPA 3AZVA 2VUAA 1A3KA 4P14A 5C3OA 1GICA 5FMOL 3OUHA 4M4PA 4YGDA 4PT6A 5F2SA 1COV3 1CN1A 3PUSA 1XBFA 1EPWA 3OGVA 3POYA 3ZSMA 2YROA 4DXTA 4EQVA 3S5AA 3I54A 1CPMA 5EFUA 1UPIA 2DUPA 4TSVA 2J1EA 2RMU3 1SCSA 1Q43A 1UZWA 5I0TA 4A42A 1RGSA 4Q4Y3 1CAXB 4IV3C 4BWOA 4LEJA 4HSLA 4YPJA 5LA1A 1BMV1 4DPNA 4IESA 4DXSA 2CAUA 5JZGB 4Q0PA 4BB3A 1ZZCA 3OPWA 2ZX0A 1FNYA 1KFXL 1UY1A 2FDFA 4B7KA 4FPOB 1TME1 3WF4A 3ZOIA 1UD1A 3U4SA 5A3LA 5A3TA 1W2UA 4KWKA 2RG4A 1A6CA 2EXIA 3VBUA 3RSJA 3RZKA 2ZCWA 2D6PA 2RS31 4XMIA 2B9VA 4S2GA 1LGCA 4FO9A 5GLZA 1A78A 5L7OA 4S2FA 2BDRA 1F5FA 1LTEA 1PIV3 1UMIA 3VBOA 3WW2A 1YJKA 2CHHA 3DF0A 3WY6A 5C7GA 4UW4A 1R092 4C1WA 4XACA 1OA2A 3ZDVA 5DAWA 1LHNA 2HWB1 1CAVB 1H9PA 1HB3A 2ZHMA 5FUNA 4UI9L 2OX0A 4N53C 1H6XA 4QT6A 3ZFGC 4AF9A 4AI9A 1O3RA 2JJ6A 3AKQA 2WJSA 1NZIA 3NW4A 3P5BA 4K21A 4PLMA 3CJIB 4W50A 2CAVA 5IATA 5J96B 3MLJA 2KD7A 4TXWA 5FK7A 4DUXA 5LK7B 1RUC3 2DCZA 3I2JA 4KG0A 3WG4A 4CCNA 3H50A 1UNBA 2ZEWA 1RINA 2OS2A 1U5XA 2Y38A 3ILFA 2E7QA 1NKGA 4YWAA 4ZS3A 5IK7A 4LO8A 2VULA 4FOWA 3OUIA 1NA1A 3QH6A 4P9XA 4AFMA 1F2NA 1O91A 4D94A 1LHUA 4Q0UA 5FPVA 2BNOA 3LDRA 4GH4B 1H8TC 1RUH1 1IZ3A 2DDUA 4UBGA 5C6CA 1Q5OA 1GFF2 3DXTA 3AP6A 3PTYA 3NQHA 3RJRA 4CP0A 2RM22 5FWJA 1MQTA 2ARXA 2ZGPA 4N43B 5CG9A 4XQDA 5LA9A 1ASJ3 4Q4W1 4V2VA 5F5IA 4CP2A 4FPGA 4JDNA 5BNPA 2IXCA 3H1MA 5I8YA 2IXHA 4Q0QA 3N7JA 2QUOA 2R042 1UW8A 5A3PA 1XYPA 3RGBA 1UIJA 3VD9A 4KBBA 5E6HA 3O1OA 2YV8A 1Y4WA 3KWVA 2W2IA 2AR6A 1R1A2 3BB6A 1CAUA 3DKQA 2YFUA 3W21A 1GP6A 1CZVA 2XUEA 2IVJA 3D8CA 1BVVA 4DUWA 3IDAA 2Y34A 3KQ4B 1JOJA 3PDQA 5A80A 5BY5A 4K1YA 3PIGA 5G04L 4GMP3 4CEWB 2FZ2A 5JOXA 2PHWA 3VN4A 1IS4A 1UQXA 2FMYA 3WOGA 4AQSA 5IVJA 4JQTA 2ENRA 2JDNA 4MADA 3MV11 1QJX2 5CIRA 1DQ0A 3A0NA 2DCTA 1ULCA 2V4VA 1PVC1 4LQRA 5FPUA 1NE6A 1SLIA 4WBBA 2VQTA 3T1MA 2ZGKA 3S7IA 1ONAA 4IEWA 4JDOA 1H2NA 4TLFA 1BEV2 3CO2A 3IB3A 3VLBB 1FX5A 1WLCA 2CTVA 4UWDA 2JE9A 1WD3A 3JQXA 3BI3A 4AI1A 3MUY1 2RJKA 1S0CA 2FDJA 4YSFA 1HB1A 3WNOA 1XSQA 3DN7A 2I2SA 4YW3A 4E27A 3K51A 3LAGA 4GWNA 4YW4A 2KXLA 4GH4A 3FLTA 1FNZA 4NIDA 3NRUA 2BWCA 1VB2A 1PO11 2JDZA 3B5LB 1JYCA 4AEJA 1FOD2 2PHLA 3CU7A 4AVVA 5KXEA 1ACCA 3IT8A 1JZ8A 1RUG3 2Z4FA 4LO5B 3C7GA 4NRMA 2VOXA 2RS13 2WSVA 4MHUA 3B9CA 4YVWB 1UO9A 2V5DA 2AREA 4LUKA 3BTAA 2QTWB 3INAA 4JHTA 4HKWA 2Y60A 2D3PA 2D40A 4NPLA 4Y20B 4XZPA 5FYIA 5FJKA 4CDQC 1VBA2 3ACLA 4P02B 5KR7A 3AVSA 4XCBA 1PZ8A 2JDAA 4HMZA 4HOOA 4OMCA 4MG2A 4QB1A 3FBYA 5DZEA 2JDUA 4XF0A 5BNNB 2VH9A 2RDNA 4FPJA 3WLUA 3OBAA 1BHGA 1JYVA 3AZXA 3U0ZA 2WO3A 1DZTA 3J9SA 4BXSV 3IAPA 4R4ZA 1F4AA 1RUI1 2C9KA 4QXCA 3ZSJA 1HB4A 1YFWA 3WD5A 2ZEXA 4BU2A 2D6OX 3HQRA 2W1QA 3NJZA 2JE7A 3I3BA 4Y4RA 1N1SA 3BIWE 2MEV2 5T5JA 1UKRA 4P9GA 1RUF3 2DF7A 1KQRA 4IGPA 5IVVA 2VZOA 4CDUA 3O1UA 5JSRA 4D7YA 4NIAA 4KQ7A 5A3OA 5F32A 2OIIA 1ODNA 1KDMA 4F8AA 3HT1A 4LBQA 4ZU4A 4ORFA 3SNMA 3BTZA 1J1TA 2F4LA 3JU9A 2VCBA 4UYBA 2ZGSA 1BK1A 1HIXA 1E5HA 1WW6A 2TUNA 2WRAA 4R4XA 1SFNA 4FP3A 4IE0A 5A7OA 5CFDA 2WZR3 4A7KA 4E9KA 3V0AB 1DYPA 4YZ1A 1OF3A 1OT5A 4XFAA 1BMV2 1UMZA 2ZMNA 5EV7A 3W5NA 3N9MA 2FQPA 3K75B 3O0VA 4XAAA 3X29B 1RUOA 3VBFA 4AI2A 5C8CB 3EO6A 1KXGA 3VB9A 2E31A 1XU2A 2X05A 3EYPA 1TME2 2WNUC 3OBRA 4YZ4A 1ZYBA 3ETPA 3VKMA 4RQPB 4NO4A 2BW8A 3GYDA 4LITA 1LOFC 4JHZA 2GMMA 4ZXKA 3TEXA 1ZVFA 2JG9A 3UT0A 4GB33 4BQ3A 5A1FA 4BISA 3LSDA 2FD8A 2EICA 2EXHA 3ZKUA 3T09A 3AFKA 2Q0AA 4IV3A 1ULPA 2A6ZA 1AR63 3ZR6A 3ZN5A 1SCRA 2QQJA 4BM8A 5LCWL 3N9NA 3SCFA 1XU1A 1U5ZA 2VY0A 1N47A 2E53A 5D21A 4D6QA 3CEWA 3ZXAC 3DV8A 3A23A 4BDVB 5DAVA 2HWB2 1DFQA 1W6MA 2ZACA 3N7MA 3T2TA 3IZOA 5FR3A 3LEKA 2OXBA 1WCQA 4LBKA 3OGGA 3V0BB 3AYAA 1O3QA 1ND3B 2P2KA 5I91A 4O7XA 1DP0A 3LDKA 1O5UA 1ULEA 5FYBA 4XUTA 4CSWA 4BLJA 3CL1A 2UURA 2D5FA 4P9IA 1S0EA 3GCXA 5JR7B 1L7QA 1ENQA 2JG8C 2H0VA 2VM9A 5F3GA 4WM7C 4CXXA 1L7LA 4N53A 2ETEA 3ZFGA 4B4PA 2GP3A 2ES3A 3ZYPA 1YHFA 2BFUS 2WZR1 3HNMA 1RUH2 4GQ7A 1UXZA 1LKNA 5GLVA 4XETA 4OHYA 1JU3A 5C8CA 3ST7A 3AMMA 4NHXA 5E88A 3KF3A 3MI8A 1QXRA 3LE0A 4K8RB 5I0DA 3AX4A 4GMP0 2ARBA 3WDWA 4F7ZA 1WA4A 3H8UA 2MNGA 4Q4W2 3P3PA 4NR1A 2AEZA 1KS4A 1ULDA 5A33A 3WUDA 5IK5A 2XXZA 1D2QA 4XFHA 3LSEA 4HSJA 1AJKA 4GWMA 2Q30A 2VMGA 2VZVA 1OOPB 5C9AB 1TEIA 1W8HA 1H8TA 3VDDB 3VHRA 5FBJA 5ANQA 5FYTA 4CCOA 5C4WB 2BJSA 3ACHA 2FZ1A 2LRPA 2DTYA 4GA9A 4YW5A 2VXJA 1VBD2 4LBNA 1VRH3 3POJA 1XNCA 3EB7A 1GP4A 3J8F1 4P9LA 3WW1A 4BQ5A 4UFLA 2BOJA 1W3VA 3E5QA 4INDA 2J1VA 4HVRA 2VUJA 4NIIA 5I0RA 3DKWA 1EPZA 1PVC2 2ZX3A 3N4MA 5LEJA 3DXUA 5BNOC 3JD71 4UFMA 2Y6GA 2L9LA 1YFXA 2DU0A 1SBEA 4RYDA 2QQPA 4KMQA 1ZA7A 5JXJA 2VXRA 5FP7A 1I5PA 4QX0A 4BK5A 2ZEYA 4QB6A 1YFUA 4D6RA 3AMHA 4P5YA 1YIPA 4JGYC 1KITA 4O9EA 3LPGA 1PO12 2WFF3 3NV4A 3UJQA 2FCVA 5E16A 4BPZA 4LKFA 1YQ8A 1O5LA 4LOSA 1CPNA 3B94A 4JGZC 4LBOA 4MHRA 4QPGC 2P3YA 3LPFA 1UOJA 2R073 2Y33A 4AI3A 1F8VA 3PJQA 4E4DX 2XMLA 3AYEA 3PVNA 3D5OA 2WZPP 3J7MA 2R061 1DHKB 3FWEA 4I0BA 5CADA 1UMHA 1VBC3 5LATA 3SHRA 4C0BA 5C9AA 2GC1A 3THTA 1POV0 1H2MA 4AI8A 4J25A 1R1ZA 2LUWA 4FTEA 4FSJA 2ORXA 2VZ1A 2O8QA 1HB2A 1NCQC 3HBKA 1QJU1 4DUVA 4QAWA 3N3HA 5D8AC 4LOTA 2W87A 3LKJA 3O12A 3I2KA 1AHSA 1FYUA 1YYNA 4PCRA 3HQUA 4GWIA 4M0HA 3LDBA 1RUI2 4KGGA 1QIQA 2P3JA 2TNFA 3DPRC 1SLLA 4XQ4A 4CUAA 5CEHA 1HLCA 5FXVA 2UWBA 3BIEA 2FDIA 2QQUA 3B3QE 5CFCC 5A6ZA 3WG2A 2NZ9A 4AVBA 3O1MA 1GUIA 5GM0A 4CUBA 4G4FA 5IVBA 4MYEA 5JSOA 3ES1A 3ZFFC 4ASLA 5LA0A 2OPKA 2QVSB 1LOBA 4H14A 1OSGA 2JENA 2YDEA 4RS5B 1W0NA 1HDKA 1RHI1 1QJFA 5IYYA 4R52A 4XFIA 2VR4A 1OF4A 3ZKYA 3PUHA 1DIWA 5EPAA 3UESA 1X36A 3J7NA 4N7IA 2VUCA 1ZREA 3P1IA 2ZXQA 3QLQA 4Z82A 2VMIA 1LGNA 1MS9A 3NAPC 1AF9A 3J7LA 2WFF1 1CESA 4UAPA 4LUMA 5C3RA 1XOYA 3RNSA 4PIXA 5DPNA 2LROA 4FFHA 4PI2A 1OKQA 5LY1A 4W6WA 3WQ7A 1UX7A 3OF1A 1D7PM 1FAYA 1ND2A 3O0WA 4AK3A 1SG3A 2XQRA 1V6LA 1CWPA 3WVJA 4R9DA 5A7PA 2WA3A 1P8JA 1R081 1ZZBA 1VBC1 3MF6A 3B00A 5F5CA 4EWDA 3AFGA 1GSLA 3RZGA 3VZMA 4Q0VA 4WVWA 3K4AA 4QPIB 2BBVA 2YBSA 3TRSB 2D6MA 1R093 2V4AA 3AVRA 1CONA 3N7LA 5EP9A 3WCRA 3ZYRA 5C3PA 4XIKA 2AUYA 1AJOA 2WNUA 2ZGMA 4BZ4A 4ISQA 1JMUB 4Q29A 4HPKA 2Z2SB 1LOFA 3K48A 5FMBA 1CZSA 1WD4A 5HXMA 2WN2A 3LA7A 1PNGA 2ERFA 2VMFA 2XJPA 4F83A 1SEFA 4XMAA 3LIHA 2PELA 4FFFA 2ZABA 2PHDA 5ISLA 1QH7A 2CGOA 1WMXA 2Q1MA 2GN3A 1QMJA 5GZGA 1LJ7A 5ABJB 4RS5A 5FZ3A 5FXXA 3AP5A 1TNFA 1W8FA 3I2IA 2A75A 3H1WA 4IV1C 3NJXA 4ZZ8A 3KZ4C 4PJYA 3ME2A 1QGLA 1GQHA 2OYZA 2E51A 1HQLA 3VBSC 5IVYA 3ZSKA 5A7NA 1SLAA 4EROA 3IPVB 4ES8A 1URXA 1GNYA 4NWWA 4XPVA 3RQ0A 2RM23 1XJAA 2VVFA 4WVMB 4NHKA 5JXIA 2B9UA 2I07B 2BBAA 5A3WA 3VBHB 2QQNA 5LA2A 1U5YA 2RS51 4IEYA 1BCXA 3MO4A 4XQWA 3SLIA 2R043 3VD7A 1FMD3 3BYWA 4AVSA 1LHWA 5D2AA 2VCMA 3OJBA 4QGLA 5DAPA 1JUIA 4AEDC 2WO7A 2KA3A 1R1A3 2Y6HA 3NV3A 3OGRA 1K42A 1JODA 3G6JB 4OVEA 4QPIA 4UF0B 2H6CA 3WDXA 1LECA 4COUA 3BPZA 4TWTA 3JQWA 4X6QB 2C24A 5FZLA 2XKPA 4AHXA 1UOGA 1R091 1LGBA 4XJ9A 5ANNA 1OLQA 3CIHA 3J8F2 2QQIA 4FQZA 4C91A 3T4VA 1UZ0A 4U2AA 3SEEA 4Q8KA 1QJX3 4YW1A 4QGNA 4AAXA 4YVSB 3M70A 4MXWA 3ACGA 3WF0A 1VP6A 2QQKA 1S4CA 2W3JA 3OYWB 4X8NA 5FZ1A 4Q1PA 2JE8A 3OGJA 3JD72 4NPRA 1BEV3 4YNIA 4A7ZA 2YB7A 4RD7A 2PQSA 1SACA 4DXRA 3MW2A 2NLRA 5A7WA 1H6YA 3CF6E 3I3DA 1SLCA 1QU0A 2VQ0A 2DU1A 5JCTA 4QQHA 3ELNA 3ZXFA 3I2FA 5K8SA 1CR7A 4M3CB 1FOD3 1VAVA 2WIIB 2XGXA 3DL3A 4LPLA 5FWEA 5FZ7A 4ES9A 4XABA 5LBFA 4M00A 5J36A 3PIJA 1TZOA 2ZMKA 5DAXA 5BNOA 1XE7A 2P6CA 4AAPA 2XLFA 2XJRA 3AXDA 3FFZA 4BJ0A 1PVXA 1XNDA 3D4KA 4B4RA 2R062 2IWGB 2VCCA 4XBNA 5FZCA 2ZGNA 1SQ4A 1VALA 3I3MA 5SV8A 1FMD1 2OW4A 3PVOA 3CQOA 4HKOA 1VBA3 3W59A 4RR3C 1V6NA 3VHNA 4UF0A 1AYM1 2LW8A 4PDWA 1QJU2 1ZX5A 5IWFA 4CEYC 1OLRA 4XZUG 4FPKA 3WG3A 5C3SA 1E5RA 5FKBA 1ZA4A 1RL3A 3TYJA 2VVEA 4GALA 4A3XA 2XR4A 1T6BX 3ZFEC 2W68A 4FXGB 5FRAA 5T5OA 4CDWC 1BVP1 3B01A 4XFCA 3I4IA 1W6QB 1CZTA 2ZZJA 3QOPA 2MEV3 4NVPA 1QJX1 3OYWA 4CP9A 5FLIA 3U4XA 5JI9A 3CJIC 5CNAA 5FZFA 1E57A 4K9SA 5GZFA 2QQLA 2B8MA 4BOWA 4JVAA 2C5DA 5FQ0A 1IQDC 3VKLA 1NCQA 2VNVA 5LK5A 1LU2A 1FI2A 2DYCA 2LM3A 4FPHA 5CYYA 4XILA 4QM8A 2YMZA 2YBPA 5FDBA 5IW0A 4Y1ZA 1ST8A 4EN6B 1MS4A 1RHI2 4NUBA 3UKNA 3OD4A 3ZO0B 1VMFA 3DPRA 1V6KA 1R64A 1W8TA 2DURA 4M3CA 1G6NA 3U37A 5CFCA 1AUYA 3M3EA 2JD9A 3VZOA 3A22A 4ISRA 3URFA 3TEYA 3B02A 2P34A 4MGQA 4XDPA 3WQ1A 3WQ0A 3NNMA 3HNYM 1TME3 3ZFFA 2HWD2 3SH3A 1DLLA 2E33A 5FZMA 4CDXC 3MV01 4QKFA 4ET7A 2VOTA 4E4ZA 4HXCA 1NG0A 1I3HA 1UOBA 4S2HA 1UWWA 5FYYA 2GC3A 5LASA 1G9FA 3VBRB 2XWBB 3KLSA 3CZUA 1R082 4UBHA 3MZHA 4FCAA 4AHZA 2K9ZA 2WQZC 3WP6A 2R16A 2W47A 2VTXA 2WYFA 1OBNA 3NAPA 4HKLA 2D3RA 1ALYA 2JD4A 3CHXA 4CCJA 5L7OB 2A1XA 1S1AA 2QCSB 3VBOB 1W05A 3AJZA 5C33A 2VQUA 1MS1A 2HWB3 2XL7A 1IPSA 2D5HA 2GC2A 4V2WA 4WZCA 1DQ2A 3AL5A 3J26N 2O8OA 4YZ3A 2J1UA 4IGOA 2ILMA 2JKBA 2YPDA 2JEMA 4DINB 2MEV1 1VIWB 5FYUA 1UIKA 2W52A 1W9YA 3WP3A 4AEKA 5LEKA 1SHWB 4AFCA 1JHNA 5JXGA 1PMHX 3I3EA 1AL0G 5FY5A 3SC7X 2QKDA 4D7TA 4MZUA 5JSPA 1YCIA 2X10A 2ZMLA 3OD0A 1S0IA 4MH0E 1C1LA 3UKTA 4AGRA 1TMF1 3J4UH 2WQ4A 2WABA 5FP4A 5GLUA 3ETQA 4W4ZA 2WNVC 1RUH3 1NA1B 2UY9A 2FDGA 3M3OA 2IXLA 1GOFA 4OULA 5LWBA 2JIJA 4EWAA 2VQAA 2V73A 3THCA 5ERLA 1Q3EA 3POIA 5F5QA 4LA2A 3H8XA 4EV0A 4FVVA 4ARYA 5ACA1 2RS52 4FFIA 4Q4W3 1LOGA 3C7EA 1YXWA 4TZDA 3OB8A 1OC1A 1ZZ6A 1MQTB 4YVWC 3VBRA 4KG8A 3WNXA 1GANA 2VW1A 4NN0A 4IV1A 2BFUL 5BNPB 2W1SA 4DS0A 1OD3A 2SLIA 2ZJCA 4EZHA 3VBSA 2G9GA 3IDCB 4LR4A 3AZZA 4XJUA 1CAWA 4Q27A 2JDKA 4XHBA 4FP2A 1HN0A 4Q8LA 4NHMA 3WF2A 1HN1A 1G86A 3Q9OA 5H9RA 1SFYA 4YG0A 1CAUB 3OY8A 4RA0A 3BKZA 2E32A 3FUQA 4IEXA 5KXCA 4FAGA 1JYWA 1VBD3 3VUOA 2AYHA 4QU2A 4A7YA 4GZ9A 4NE9A 5F2WA 5IUQA 1IOAA 2JDMA 1JBCA 1W6NA 2SBAA 2AZ5A 1OURA 1HV1A 4XBLA 4BE3A 3KT4A 4LE4A 5A3NA 4ZKTB 4AEDA 1GV9A 1UU5A 1PVC3 3PMEA 2CWSA 4ZPIA 2WT0A 5I8TA 1WZXA 4N9IA 1NYWA 4Y5Z0 5APAA 5G05L 4QX1A 3NMBA 3ZR5A 1XC6A 1YIFA 4I09A 4C90A 5LBCA 3BGAA 3THPA 2V09A 2F17A 4HK9A 4C8DA 1WLTA 1XRUA 5FY1A 1CGPA 4ZXEA 2PHUA 2VW2A 2NQYA 3WZ1A 2KR2A 3PU8A 4Z2AA 1XNBA 3JXSA 5LRRA 1PO13 3KV5A 2W08A 4LO6B 2DUOA 1EAH3 1NY71 3FHAA 3QCWA 4BLIA 3N36A 1M06G 3I97A 5IVCA 2FDKA 3B69A 3K46A 4XUPA 2WNEA 3WDYA 4RQPC 1X9PA 4LNVA 4JAAA 2A7AA 4LLOA 3W9AA 1K45A 4DOUA 4CU6A 1FMD2 4H3WA 4PBOA 3HIFA 5DABA 3RFRA 4UXAA 4KWJA 1AYM2 1NAEA 2Y6KA 3KVBA 4OHXA 4N8MA 1S2EA 5I0SA 2RV9A 3WF3A 4CCKA 2A3WA 4QKBA 1RUI3 1VBD1 4IEVA 2XHNA 3AK0A 5KHIA 2VPVA 4XUNA 3ZPOA 4HLTA 1XNKA 3W20A 5DUXA 1CJPA 3O1TA 1V6JA 3KVAA 4GKXA 1D4M1 1VAMA 1GLHA 1WW5A 1GZWA 4I30A 4L99A 4MGZE 2RHPA 4RR3A 5FYCA 3ZYGA 5FY8A 1MZEA 2VTFA 4CDUB 5FZIA 3WCSA 4RHV1 4CEYA 3BPSA 4EN0A 1WLDA 1KJRA 3L2HA 1C1FA 1OH4A 1WKYA 3I7DA 5DAQA 4KU7A 4IEZA 2WT2A 2VW0A 4LBQB 5HXVA 3UJOA 4CDWA 5I93A 2PAMA 4A45A 3SKJE 4AEMA 2W9XA 4YW6A 3FE5A 1Y9QA 3KB5A 4AG4A 5CFDB 2XB6C 5EJZB 1NE4A 2P6HA 2XVLA 5HCAA 3FZ3A 3R4SA 2R1BA 1EAH1 4L97A 3RZZA 4XVHA 3C3VA 4Y1UA 3VBFB 1W99A 4PLOA 3I2HA 4XYXA 2J1TA 4HT1T 1KD7A 1XXNA 1TNRA 3WQBA 3THDA 3NKTA 4BHPA 4YRDA 2R6QA 2QNKA 2ZGUA 1HV0A 2E6VA 3I2GA 2JG9B 3PVBB 1UYXA 1Y9GA 1OOPC 3TNQA 4IEPA 3T08A 3BTXA 4IV3B 4HK8A 1LEMA 2EA7A 1N1VA 4XHXA 3ZIXA 4AVAA 5FZGA 1AL21 2XJUA 2DFCA 4X8PA 4HBNA 2WR9A 4CDXA 4YZ2A 2R30A 1U5IA 2O14A 3Q8AA 1JZ6A 1W6MB 4XDOA 3ENRA 1Q8SA 3KCYA 4D3WA 3L9JT 5JOZA 4AGGA 2A71A 1K3IA 4SLIA 1VBE1 3GJAA 3AXEA 3POEA 3ZXEA 5C8WA 4FPCA 1VBB1 2NM1A 2FBEA 2HJIA 4XJ8A 4JX0A 1UU6A 1LCLA 1OPOA 1POQA 1DDLA 4BXFA 1JOBA 5IVFA 3ZSEA 2XJVA 4I3PA 5FYVA 3NVCA 1TMF2 2HH9A 1N3OA 1MEC1 3SMHA 4I01A 1NXD1 2Y6LA 4UW3A 4JZRA 1IPJA 1UXXX 2FHRA 4N53B 3ZFGB 1DGWA 2A6WA 4MSVA 2PLV3 4E4SA 5FFOC 5GZDA 1GQPA 2BERA 2D93A 3HEIA 4CTEA 5ACA2 2ADDA 2P3IA 4B29A 3F2ZA 1ODMA 3ZXJA 1XNAA 2KM2A 2LTNA 3AZYA 1NZCA 4QDSA 1X33A 1NCRC 3WX5A 2CY6A 5A33B 2JECA 3MHZA 2P1BA 4AGVA 1LU1A 1A8MA 4FOVA 2WNVA 3OCPA 3VV1A 3EQEA 3H9AA 4FOQA 4FPEA 1UCXA 2RJLA 4GXLA 4BK4A 4FT8A 3S0MA 1US2A 3RJ2X 1H8TB 3A0KA 4BYYA 4ZONA 3U78A 1BJQA 2YBKA 1W90A 3SCGA 2DVGA 4Z8BA 2VNGA 3NJYA 3J8F3 2EXKA 1O59A 3LQCA 4LHSA 4MLOA 5EYXA 3WDVA 2RR11 5CKMA 4WV8A 4RFRB 3ILRA 3M4FA 2K0GA 2GH2A 2GZWA 1PNFA 2G4IA 5C5UA 3GBFA 1AR91 1ZZ8A 2JDPA 4XJZA 1O4YA 2IFWA 4NROA 3ROUA 5F39A 3JD73 1KS5A 1REEA 2ZAHA 4FTBA 4MGKE 1JW6A 5J3UA 4SBVA 2A70A 4XF9A 2VGDA 1C57A 3FLPA 1JU4A 1G9BA 1Y9MA 3GCWA 1IKPA 1EV11 2JXAA 4J1XA 1AVBA 2AC1A 3EXUA 3POWA 4L11A 2BZDA 4NPMA 4QX2A 3KS7A 4MUVA 2Q4SA 5FMOS 3D0SA 2Q8EA 5JUVA 1ZBE1 5A70A 3SH4A 4AQ6A 4KGQA 4QX7A 2OVUA 3LFIA 1H8VA 4ATFA 3IDEA 1NY72 3M2MA 2B4KA 2JKXA 2PLV1 1W03A 1YFYA 1C5IA 1RXFA 3TN92 5FIXA 3WG1A 3T1LA 1POV1 2FCUA 2ZZQA 3VL8A 1OFNA 3OPZA 4GAZA 4BCUA 2R063 3MIHA 2V5YA 4M3CE 3ACIA 3WHTA 2BP6A 5F6KA 1Q8VA 5BNQA 1MS3A 2DCJA 3K4DA 1UKGA 1WUVA 4NAOA 3WNNA 1AYN1 4Y5SA 1QJU3 5FAXA 5CZKA 3WW4A 2YXSA 5F3CA 4DB5A 4DNYA 2OZ6A 4FAHA 4XFBA 3U11A 1PZ7A 3FFQA 1GZTA 4CCEA 4Y3OA 5K0UC 3MLKA 2LS6A 3C7FA 2WS91 3MICA 4CE8A 4H55A 1KEXA 1J3PA 5DDJ1 1UY3A 1V9U1 3KT7A 4QQ2A 2BV4A 4M3CF 3U14A 3ABZA 3T2PA 4IDZA 1D4M2 3GBGA 3A21A 1ENXA 5F5AA 2QE3A 2YY1A 1QOSA 1GKBA 5CKNA 5CB7A 4RHV2 5T54A 2A6VA 2HWF1 1JYIA 2N7GA 1W6OA 2O1QA 3VZNA 3MPPG 5ABJC 1XYOA 3PHMA 1H1MA 2DCKA 1RHI3 1AX1A 4YZ5A 1RXGA 1OVSA 4IE5A 2J7MA 1RVF2 5FOBB 4JC1A 1IGOA 3ITQA 4MXVA 4XAEA 3T30A 4BH9A 1V6OA 2Y6JA 2WWSA 3OSDA 5FYSA 4QM9A 4CCDA 5AFEA 5JPMB 1OUSA 5FZDA 2HBTA 1SMVA 1UYPA 5A6QA 4HANA 3IIIA 1EAH2 3IWZA 4RGKA 4Q2FA 3SQOA 2HWD3 1O6UA 4OI0A 2YUEA 1BKZA 5EHDA 1LESA 4LHNA 3UL2A 5A3MA 4E2QA 3AMQA 1CJDA 1R083 1ND2B 1QNWA 2WWUA 2WDBA 1MVQA 1X8MA 3HQXA 5BYNA 2BNMA 4XCAA 4R9BA 5L9BA 1QDOA 2WSUA 5HV4A 1BLZA 3T4HB 1EUTA 3FMGA 2XJSA 1GP5A 5FO9B 1TE1B 3DECA 2OT7A 1AL22 5FZ6A 2R0FA 3IMNA 3TBDA 4IUGA 5JVVA 1OXCA 5J37A 1K5MC 3WEZA 2BOIA 4OFGA 4JRAA 1V70A 2WNUB 1FV3A 2PHXA 2ET1A 4ASMB 1HKDA 3ASIA 4HPKB 4QQLA 2W1UA 1AX2A 1S0GA 4PIYA 2VOWA 4YGCA 2GN7A 2Y8KA 1DQ1A 1WMDA 2QZ2A 4CDQA 1IS3A 1VBE2 2ZEZA 3PUQA 4IEUA 1G9AA 2PA7A 1RUD2 4LHLA 4CZSA 1VBB2 1O4TA 1AR71 5FUIA 5HCHA 3LCPA 2P5BA 3WDUA 4PQQA 1YEWA 5IFPA 4QQOA 4DXZA 2BRTA 1ZM1A 1YO8A 2D97A 1MEC2 2J1SA 3OUJA 1OMIA 1C4RA 2D98A 2XJTA 2EAAA 3GZAA 4R9AA 4YM2A 5J1XA 4AWDA 1Q8QA 3GZEA 4AQ2A 3LA3A 4CCLA 2GNBA 1IHMA 5AC91 1IS5A 2IZWA 1QQP1 4DMIA 5HBAA 4YW7A 1LEDA 3NSTA 2RS53 1OHFA 3H0OA 4XXAA 2B39A 4XTMA 2HWD1 4COYA 5CBLA 1UZYA 4NHLA 3FC0A 3CZJA 2WYSA 5EQUA 2EIGA 5T50A 1LR5A 5JOYA 2HYXA 1N1YA 3EMRA 2GMPA 4LA3A 4IL7A 4AHYA 4CU9A 5C3QA 5FY0A 1O3SA 4WM7B 3RZMA 1WCKA 1BYHA 5CAZA 5IAVA 5J09A 3NJVA 5KWRA 2QDNA 3FBMA 4LULA 1YQCA 2IC1A 4NOTA 3I8TA 3H3UA 4XF4A 4Y5TA 4DY5A 1OQEA 1MACA 3K77A 3PNAA 4IE6A 3SCHA 4QB2A 2R1DA 4FBFA 1UY0A 2DBIA 4OQ8A 1PGL2 4JTNA 2QQVA 3EJKA 1W8OA 2RR12 3JUUA 3OEBA 3T2QA 1NCRA 1WCDJ 3R0RA 2IXIA 2NMOA 2ZGOA 3U07A 1PK6C 3HJRA 4AVCA 4JRLA 1AR92 1SZBA 1YI7A 2W94A 4WM8C 1RUE1 4MXWB 5LW9A 4P9JA 4MVTA 3AP9A 2XBO1 4YG3A 5J98B 4DRRA 4QWNA 3I59A 2GMEA 4R9CA 4EWEA 1QJZA 5FPAA 2HWC1 2JDHA 1EV12 2WINB 3HAGA 1W3XA 4OUEA 3KSCA 3JB8A 4NRPA 4Y1YA 5A7WB 3AZWA 2PXJA 5BPXA 3GJBA 4CVUA 4JV4A 4IGQA 3PJYA 1F5JA 1XPWA 1ZBE2 2MHFA 2QJVA 1J3QA 1B35C 1Z7S1 3KGLA 1GMMA 2B7YA 3MIDA 5KXBA 3UNPA 2PLV2 1VRBA 2VECA 4U36A 2HWE1 2ZOEB 1WCUA 2WQ8A 4D6SA 1C8M1 1CIYA 5BNOB 3VL9A 4O65A 2CDOA 1OPMA 1QXJA 4E4HA 1OUXA 4META 3E6BA 2JG8A 3HVDA 1ENRA 4WM7A 1DYKA 2IFRA 4UFHA 1ZZ9A 1QH6A 3TAYA 1O8SA 1AYM3 1JI6A 2XJQA 3HNBM 4LTAA 4RGAA 3VBUC 3ZN6B 4AR2A 1AYN2 3RMXA 3FJSA 1MR5A 2CDPA 5J7MA 5FYMA 1HXS1 1UY2A 2XLGA 5FXZA 3SXWA 3UGHA 3N7KA 4PDWB 4YG6A 1GOHA 3ES4A 3DYMA 1S0DA 3H3LA 5FMDA 1D2SA 2UY8A 1PM7A 2QZ3A 2X5IC 2VC9A 4M0NA 1OKOA 1JYXA 2AEYA 2WS92 4JGZB 3POFA 5T3NA 3ZMNA 1CQ9A 3LF7A 3OBTA 2VAUA 5DDJ2 3ACFA 1Q8PA 2A5ZA 5DZFA 1GQGA 1V9U2 3KCXA 2WN3A 4KNCA 4QQPA 1NOVA 4CP9B 1XYNA 1Z78A 1JS9A 1JXNA 1UL9A 2C6SA 4EE2A 4FPYA 5FQ0B 1WLWA 2O0OA 2PHTA 4QX8A 2HWF2 3B9IA 1GYKA 1NCQB 2Y64A 2A73B 2EIBA 2Q1FA 3HN1A 4ZU5A 5B4XA 5K0UA 1NXMA 2BWAA 2EIDA 2R0HA 3DUIA 2RDRA 1IQAA 3RMYA 2ZGQA 4HN1A 1DQ5A 2R49A 4HETA 4OHVA 5FZ4A 3DPRB 1GWLA 3R05A 2QFEA 1CX4A 5GZEA 5FREA 1HQNA 3LZZA 4D69A 5E89A 5CFCB 2BEOA 2OZJA 2W39A 5JZGC 5JPNB 2VMHA 1M4WA 3D82A 4L2NA 4P5HA 3VKNA 4LK7A 5K9YA 2VZ3A 2ZX4A 2XQXA 5IFTA 4CPBD 4JQRA 5FYZA 3ZFFB 3BCWA 2IVIB 3MIGA 1MQTC 1DG6A 4W65A 3GZUC 2VNOA 2XHKA 1QOOA 3OPTA 3SISA 1XB9A 2UWCA 5FKCA 2G19A 4BIFA 4CCCA 1VPHA 4CRQA 3ZN6A 3B93A 1HRV1 4QXHA 3MIFA 1YLLA 1S2KA 4OUSA 4JGYA 3H7YA 4NMIA 5KHGA 1UAIA 4XUOA 4AHWA 4UW5A 1GZ9A 4UFIA 3UGFA 1S0BA 2Y6FA 1GU3A 3NAPB 5FLJA 2I45A 4K8FA 2PYTA 4QPGA 5H9QA 2OQ6A 2WT1A 4G3YC 4JGZA 2Q8OA 4EZ4A 1O7FA 3POBA 2QQMA 5EWSA 5FO8B 1J83A 3AKTA 4P9YA 3AB0A 3OEAA 3M1HA 5FZ0A 1XQNA 1JZ2A 1O8PA 1QOTA 3NV1A 4C0HA 1V6MA 1LNSA 3CDZB 2QDRA 4K3UA 4NAMA 2IUWA 2JDYA 4RFT0 1AR72 1YJLA 2BNNA 4OUMA 3NWKA 5D8AA 2FDHA 1DCSA 3O7OA 4QD2A 1W39A 3DYOA 5FY7A 1X82A 1K5MA 1TMF3 5A1AA 1H1IA 3GDBA 1W9WA 2P37A 4QGMA 4BQ2A 3NV2A 2YU1A 3QH7A 2P3KA 4GH4C 3WP4A 1PO21 4F3JA 5AC92 3GXUA 1QQP2 3MYXA 4P9WA 2VOKA 3E6CC 3KHBA 3NL1A 4B7EA 5ACA3 3WF1A 1OI6A 3LFMA 1SDWA 1C3HA 2WZEA 5FZBA 2JX9A 4N43C 5IT6A 5JR2A 3WNPA 1CVNA 3CLPA 5FPZA 5FP8A 5CA6A 1BBT1 4IV1B 2GAUA 1SBDA 2D6NA 2YFZA 2ZHKA 3OGSA 3LA2A 1WBLA 3VBSB 1LOCA 3HOBA 3TNPB 1S0JA 4B8EA 1W9SA 1CAWB 2W95A 5C5TA 2BYVE 5DUWA 4A4AA 2X09A 2J42A 3M3QA 1WMFA 1UZVA 1WW4A 3OY8B 5EIYB 5M0TA 4K40A 4Z1VA 1ULFA 5A32B 5FZOA 4N7UA 4AXOA 4CEWC 2QBXA 3OBZA 2YGLA 1FPN1 1W6NB 3E5XA 3NNGA 1W2TA 3H3ZA 4DY3A 3I49A 3R4UA 1KJLA 3WW3A 2A6YA 1QEXA 1RUE2 4AEDB 4AE2A 3DYPA 4YGBA 1MVEA 1LHOA 3ZIWA 1W6PA 2XBO2 4Q4X2 4XBQA 3TB0A 2VJXA 4WVZA 1DQ6A 2A3YA 4E8DA 2G9FA 2HWC2 3H42B 5L19A 3MUZ1 1RTVA 2ZHNA 4K6BA 1C28A 5KHJA 3FN9A 3AKSA 1FV2A 1ZZ7A 3MLLA 2CV6A 4N9HA 5DN2A 5F9TA 1SLBA 3NKGA 5DG1A 3RRDA 3GHNA 5CFDC 4LIUA 4D7SA 1Z7S2 3C7HA 4WM8A 2HEWF 3TN93 3VHPA 1ENSA 1DF0A 5JWPA 2HWE2 1QJY1 2D6LX 3POSA 2J1RA 4QDQA 1C8M2 3JBG2 1G9DA 3WUCA 1NLQA 2NMNA 3PUIA 2F4PA 3GHMA 3ZVXA 4Z07A 1HRI1 2ZAAA 1NQDA 5HPOA 5FMCA 1KFUL 2JG9C 1WMEA 1DLCA 1QDCA 1LULA 4YFZA 1B35A 1HXS2 3AC0A 4FI9A 1WW7A 3IAQA 2GNDA 1TVGA 2UYAA 5BNNC 3DGTA 4QHOA 2Q5TA 3M7AA 3O5SA 5A32A 1L7RA 2Y26A 1LENA 5TSWA 3ZMOA 1RC6A 1W8ZA 5FY4A 3AYDA 3H7JA 1ZNPA 4LHKA 4FXKB 4NIGA 2CWMA 3HD8B 1D4M3 1OQDA 2ZKNA 1ZRRA 1ZBA1 3APBA 1JYTA 3T0AA 4IEOA 3RVHA 3UGGA 3E97A 2JIGA 1GZWB 4RR3B 5F3EA 4RHV3 2DTWA 5F1RA 2DFBA 3WXPA 2VTXJ 5E8AA 2UWAA 2MPFA 4OQ9A 4CXWA 3TEZA 4CUCA 1Q8OA 3IM0A 3ZM8A 4CEYB 1W28A 4AFBA 2X5IA 4Q4V1 4EN9B 1RITA 4Z92B 2CNAA 1RVF3 3WNKA 5L9RA 2YHJA 3S7EA 3AKPA 2VBDA 2VU9A 4ZY9A 3ZFEB 4CDWB 1WGPA 1W2AX 3USUB 4B1MA 5JAXA 1APNA 2AACA 4I0WB 4FOYA 3WHUA 1RUJ1 4KBZA 5L36A 2GDFA 1QKQA 5A6XA 3TN91 5C8CC 3MW3A 4UW6A 1W0OA 2DV9A 3MF9A 1D4VB 3ILNA 5BV6A 2W5FA 3JZVA 1E5IA 4PQ9A 3I2OA 1QHDA 1COV1 5K7PA 2XDVA 5DUUA 1CX1A 1HRV2 4H2AA 1AXKA 1BZWA 4DEQA 3A4UA 3N9OA 1CAXA 2DCYA 4YLZA 1NLSA 2RMU1 2BVBA 3EBRA 5JZGA 1AL23 3FLRA 4Q4Y1 1NX9A 2WKKA 5JIUA 1SPPB 5K4LA 2ZGTA 3KM5A 4Y22B 2D7FA 3LOBA 4RL7A 4AL9A 4CP1A 1SDDB 2EAKA 2WA4A 2YC2A 1E5SA 3VKOA 4QDRA 2Q8DA 4CDXB 2VNRA 4OI1A 1T2XA 1PZ9A 1Y43B 1RMU3 5DUVA 5FZKA 1VBE3 1TQ5A 3FHIB 4A2UA 3WNMA 1ND3C 1VAKA 1MS0A 1RUD3 2YC0A 4S2DA 2R7EB 2TEPA 2XOMA 1VBB3 1ZRDA 3K3NA 4ZHNA 4KH9A 4CU8A 1H30A 2HEVF 3AL6A 2Q1ZB 4JKMA 1PIV1 1MEC3 3ZFEA 5KXDA 1CAVA 2UYBA 1RVF1 1RYYA 2XUMA 4GIQA 3RI9A 2LALA 4QPWA 3USUA 2WUHA 3O0XA 5CISA 1HJFA 3DCQA 3SEPA 2AENA 2BGOA 1PO22 1UN1A 3T2OA 3BOWA 3NNFA 3CJIA 1W2NA 2GC0A 5C70A 3Q8FA 1MZ6A 2W91A 4BIOA 1HX6A 2C4XA 1O4ZA 1JZ7A 1RUC1 5FZHA 4LBLA 1H1AA 1WA6X 2VL4A 4E8CA 5IK4A 3N9QA 4W6YA 3PUAA 1W06A 4MO3M 3UV9A 4AI0A 1H0BA 2BQPA 3ORJA
chains in the Genus database with same CATH topology
1BBT2 3PLQA 1EP0A 2HKXA 5C9AC 1V00A 3FX3A 2WNVB 3VDDC 3ZXGA 3KGZA 5T5PA 1YNAA 5I8SA 5C4WC 2OUHA 3CJXA 4Y22A 3S30A 5BUVA 1IKQA 5CG8A 4N43A 3TOJA 1AR82 2RR13 4J6GA 4BMEA 4M01A 1FPN2 1ASJ1 3HWJA 1AR93 4YYOA 2D3SA 3W58A 1RMU1 3VGIA 1RIRA 3CNAA 1FATA 1RUD1 4QMAA 5T55A 3RPQA 5DZGA 4AW7A 5F6LB 1EV13 2NN8A 5LRSA 1EY2A 1OA4A 4CEWA 1QNYA 1WCSA 3P3NA 2PQQA 1ZBE3 1NQJA 1REFA 3EHKA 4GMP1 2H0BA 2GSYA 2E9QA 2EVXA 4X6RB 1DU3D 4ZU7A 2B45X 1ZRFA 3VZKA 4XXPA 1QJY2 1POV3 4XW3A 5JI7A 1UU4A 4YW2A 4Z2WA 4OI2A 1REDA 3WR0A 4YARA 3NO8A 3R4DB 1HRI2 3ZYJB 4RSUA 4IEQA 3U10A 4FTSA 1ND2C 2ZPXA 2YZ4A 1LRHA 1AYN3 2F6BA 4HVOA 4OZXA 1S0FA 4IETA 1VR3A 4OI4A 2GNMA 1Z0HA 1AX0A 1PGSA 2WS93 3MFAA 3L2YA 5KBFA 1RUG1 5DDJ3 1PGL1 3M3IA 4LBQD 4QPYA 4YVWA 3ZXLA 1V9U3 1ZRCA 1XE8A 1GNHA 2RS11 4OLLA 1SBFA 1ZBA2 2E7TA 4Y20A 3MW4A 5GLWA 4OHZA 4DFSA 1N3QA 4Q1RA 2RS32 2PTMA 3GF6A 2HWF3 4XJAA 5AFBA 5BNNA 3KQRA 2PHFA 4PF5A 1CD3G 1D0GA 1VJ2A 4Q4V2 1U0AA 1X7NA 1Y3TA 1W6OB 1DGLA 4K7JA 2GNTA 4RS5C 3JCIA 2NYYA 2TBVA 1W0PA 4KL1A 3ZN4A 2PFWA 4BQ1A 3HMYA 1H2LA 5IK8A 1RUJ2 3RYPA 1RUF1 3MPBA 4K1ZA 4YM3A 4E2GA 1BQPA 4Q26A 2DVAA 1J1LA 1QY4A 1COV2 4XEZA 2WLPA 1OFSA 4B4QA 2ZGRA 3V0AA 2XWJB 2RMU2 4DZGA 1GNZA 3M8LA 1UF2C 4Q4Y2 4QPIC 1V6IA 2XG3A 1I9RA 2AGSA 4RQPA 1C5HA 4LE3A 4PLNA 4JDMA 1T6GC 3LGRA 5FLHA 5GLTA 4YM1A 2ZX1A 5HI0A 4Y24A 4GB31 4J1WA 1AR73 4CDQB 3JB4C 5CVRA 4LBMA 1H4GA 4WVVA 4HN0A 1S2BA 5T52A 1AR61 1G8WA 1MS8A 1PGW1 1QF3A 2DVFA 3BOPA 3GBWA 4QXKA 2NPIA 1PIV2 2Y0OA 1DGRN 3BALA 2B46X 3QD6A 5AC93 3VKFC 1QQP3 2IXJA 2D43A 3V0BA 1ND3A 2RE9A 2D44A 4LBJA 1VB4A 3VBHC 4MGYE 1RUC2 2XH6A 4OHWA 1OA3A 1N1TA 3WV6A 4AFDA 3BODA 3MGUA 2DVDA 1G9CA 5JMCA 2X29A 3E5UA 3IBMA 3KCCA 3I2DA 1CIWA 5JDBA 4PDWC 1HQWA 1GBGA 2JICA 2D6KA 3M3CA 2OUJA 4MGIE 5L73A 2X53S 2DUQA 1O3TA 1H4HA 1ASJ2 1NCRB 2ZKLA 4JCKA 4YVSC 5H9SA 1RUE3 2VOVA 3QBQA 1RMU2 4HZFA 3S6PA 1OOPA 2ZTNA 1F9KA 2XBO3 2H6BA 4Q4X3 3IKWA 3VDDA 2B5HA 3BU7A 3KMHA 2A3XA 3RDIA 4MX3A 5C4WA 3D6EA 1NLRA 2HWC3 4AYUA 2OA2A 4IQPA 5AVPA 1BXHA 3I59B 3USSA 3SITA 5HCBA 3ATGA 4YFWA 1C8NA 1F31A 1B09A 1MZ5A 1VRH1 4YGEA 2ZX2A 1I5ZA 1Z7S3 4W6XA 2PAEA 1H9WA 5GJ6A 2C1FA 1J3RA 1UX6A 3MFCA 2EXJA 3LWCA 3KD4A 2HWE3 3ZXDA 1EYBA 1C8M3 3JBG3 5JLVA 2XL9A 1N3PA 4Y1VA 3ZYIB 3E6DA 3WINE 1MZFA 4XOGA 2XLAA 3MIEA 3V65A 2A6XA 4HVQA 2JG8B 3AP7A 1HXS3 2AH2A 3WP5A 4COZA 2CL2A 1H2KA 5FPXA 2VVDA 1JN2P 4XTPA 1OQ1A 3PMSA 4XFGA 4Q0SA 5EJ3A 4QHBA 1RUG2 1D0HA 3VHOA 5FO7B 2RS12 3ALQA 4XJWA 2R071 3PVEA 2HYKA 4L92A 1OD5A 2ZHLA 4CYDA 1DZQA 1I6XA 2DWRA 2EALA 3ZPYA 4Q4X1 2GU9A 4I3GA 5KC6A 4LO7A 5K0UB 2VG9A 3LB9A 4XF3A 3MDPA 5D1IA 3IN9A 4PIZA 4ITCA 2ZGLA 2CYFA 3UKVA 3RS6A 5JIAA 1QWRA 2W0XA 1LOAA 1RJ7A 5CU1A 5H9PA 1DBNA 1RUF2 2ET7A 3IIAA 3AYCA 3JBG1 2B42B 3D0JA 2CGPA 3RG0A 2E7AA 4G9SB 3VBRC 2NP0A 2YPJA 1HRV3 2ATFA 4EN7B 1LHVA 5JOWA 2YGMA 4JGYB 2WZR2 4AQTA 1GZCA 5GZCA 1S55A 1WBFA 2BUKA 4MV2A 5AVAA 4EN8B 5L7OC 1PHMA 3VBOC 5I0UA 4QPGB 4DRVA 3ECQA 4I2OA 4WZFA 5KC5A 5T5LA 2FMDA 1RB8G 4I02A 4KU8A 2CGNA 4GB32 2I74A 4COVA 3AP4A 2XKOA 5GKAC 2K2SA 4B3NA 1PGW2 3IDBB 3VZLA 1AR62 4XDQA 1KDKA 5D8AB 3OTFA 1DGRA 4FQ4A 1VLNA 4XF1A 5J48A 1K5MB 1PMIA 4Y1XA 4EJRA 2DVBA 4LLFA 4AVTA 1AXYA 1NA1C 1PO23 5EXOA 5DXDA 1AZDA 3GNEA 3RI8A 2XPJA 1UPSA 1HW5A 5EZWA 4DQAA 5ABJA 2Y0IA 1JUHA 4ONUA 4GULA 2PHRA 2Z42A 1BBT3 5BNPC 1SLTA 4LO4B 3ZXKA 3V64A 1YWKA 4I0AA 1IS6A 3IPVA 2BGCA 2R32A 3R6SA 3B7MA 4WVMA 1G7YA 2EF6A 5FCCA 4PBPA 4V1PA 3VBHA 3C2UA 1AR83 4Y4YA 2X8KA 1U12A 2BVVA 1JH5A 2RM21 2WLQA 3LOIA 4FPLA 3AKRA 3O14A 3UK9A 1FPN3 4URTA 3KT1A 3SH5A 3RYKA 1MS5A 2P17A 2E63A 2R041 4YM0A 1LODA 4Y26A 1FXZA 1X8EA 2HEYF 3AMPA 4FPFA 4RGGA 1R1A1 1W6PB 2PN5A 5B2GB 4LT5A 4IERA 4XE9A 1DQ4A 1A8DA 1YI9A 2ZBJA 3ZSLA 1VRH2 2C0ZA 2WL1A 2ZA9A 1RJ8A 4YVSA 1PK6B 1ULGA 3ZDSA 1QJY3 4JTOA 4HFSA 2UU8A 4WM8B 2PAKA 1GR3A 4L9BA 2GALA 2WFPA 4XIOA 4ATEA 4XFFA 3GALA 4R8HA 3GZTB 3AMNA 5E1RA 1BEV1 1HRI3 4H7LA 3MIBA 1KRIA 2IXKA 1Y7BA 1L3JA 2WC2A 1IPKA 1JTZX 5FBZA 2XVGA 1I1EA 4AFAA 2ZS6B 5KHKA 4K20A 4BA6A 4TYSA 4H7MA 2Z79A 5BXXA 3ZX7A 2BPA2 1B35B 1YRZA 3QACA 3AJYA 2WFF2 3V56A 1FOD1 1LOEA 1QXPA 3TWIA 5EYYA 4L8QA 1FT9A 5DG2A 3H1YA 1AR81 3HBZA 2Z5WA 4E2SA 4GKYA 1DGWX 2YYOA 5GALA 3FUOA 2C9AA 3N35A 2R072 1ZBA3 4NWVA 1UZZA 3RYRA 1AXZA 5FTTC 1YUDA 3RWNA 2Z69A 2RS33 2GH8A 3G7DA 1VBC2 4COWA 5SV5A 3VBUB 1VBA1 2BTVC 4CDUC 1DZRA 3AM2A 5KHHA 5BYNA 4O9GA 1Q56A 1J58A 3HT2A 4Q4V3 4KWLA 3HR9A 4N90A 2X5IB 4HL0A 1J59A 3VZJA 4BMBA 2XVKA 1W6QA 1X50A 5HCFA 3MEPA 1PK6A 4C1XA 1RUJ3 4IXLA 3WT3A 4QX5A 3WDTA 5FOJB 3VBFC 3AZVA 2VUAA 1A3KA 4P14A 1GICA 5FMOL 4YGDA 1COV3 1CN1A 3POYA 3ZSMA 1EPWA 1LB2A 2YROA 3I54A 1CPMA 5EFUA 1UPIA 2DUPA 4TSVA 2RMU3 1SCSA 1Q43A 5I0TA 1RGSA 4Q4Y3 1CAXB 4IV3C 4BWOA 4LEJA 4HSLA 1BMV1 4DPNA 4IESA 5JZGB 2CAUA 4Q0PA 1ZZCA 2ZX0A 1FNYA 1KFXL 4B7KA 4FPOB 1TME1 1UD1A 5A3LA 1W2UA 4KWKA 1A6CA 2EXIA 3VBUA 3RSJA 2ZCWA 2D6PA 2RS31 4XMIA 4S2GA 1LGCA 4FO9A 5GLZA 1A78A 5L7OA 4S2FA 3VBOA 1F5FA 1LTEA 1PIV3 3WW2A 3WY6A 1YJKA 3DF0A 4UW4A 1R092 4C1WA 1OA2A 1LHNA 2HWB1 1CAVB 1H9PA 2ZHMA 4N53C 4QT6A 3ZFGC 4AF9A 1O3RA 2JJ6A 3AKQA 2WJSA 3NW4A 4K21A 4PLMA 3CJIB 5J96B 2CAVA 3MLJA 5LK7B 1RUC3 2DCZA 4KG0A 3WG4A 3H50A 1RINA 1U5XA 2Y38A 3ILFA 2E7QA 5IK7A 4LO8A 2VULA 4FOWA 3QH6A 1NA1A 4P9XA 4AFMA 4D94A 1F2NA 1O91A 1LHUA 4Q0UA 2BNOA 4GH4B 1H8TC 1RUH1 1IZ3A 4UBGA 5C6CA 1Q5OA 1GFF2 3AP6A 3PTYA 3RJRA 4CP0A 2RM22 1MQTA 2ARXA 2ZGPA 4N43B 5CG9A 4XQDA 1ASJ3 4Q4W1 4CP2A 4FPGA 4JDNA 5BNPA 2IXCA 3H1MA 5I8YA 2IXHA 4Q0QA 3N7JA 2QUOA 2R042 1UW8A 1XYPA 1UIJA 4KBBA 2YV8A 2AR6A 1R1A2 3BB6A 1CAUA 3D8CA 1BVVA 1JOJA 5BY5A 4K1YA 4CEWB 4GMP3 2FZ2A 5JOXA 2PHWA 3VN4A 1IS4A 3WOGA 2FMYA 4AQSA 2ENRA 1QJX2 5CIRA 1DQ0A 3A0NA 2DCTA 1ULCA 1PVC1 1NE6A 1SLIA 4WBBA 3T1MA 2ZGKA 3S7IA 1ONAA 4IEWA 4JDOA 1H2NA 4TLFA 1BEV2 3CO2A 3VLBB 1FX5A 1WLCA 2CTVA 2JE9A 1WD3A 3JQXA 4AI1A 2RJKA 1S0CA 4YSFA 3DN7A 2I2SA 4YW3A 4E27A 3K51A 3LAGA 4GWNA 4YW4A 2KXLA 4GH4A 3FLTA 1FNZA 2BWCA 1VB2A 1PO11 2JDZA 3B5LB 1JYCA 4AEJA 2PHLA 1FOD2 3CU7A 4AVVA 5KXEA 3IT8A 1RUG3 4LO5B 2VOXA 2RS13 2WSVA 3B9CA 4YVWB 2AREA 4LUKA 3BTAA 3INAA 4HKWA 2D3PA 2D40A 4Y20B 4XZPA 4CDQC 1VBA2 3ACLA 1PZ8A 4HMZA 3FBYA 5DZEA 4XF0A 5BNNB 2VH9A 4FPJA 3WLUA 3U0ZA 3AZXA 1DZTA 3J9SA 4R4ZA 1RUI1 3ZSJA 1YFWA 3WD5A 2D6OX 3NJZA 2JE7A 1N1SA 3BIWE 2MEV2 5T5JA 1UKRA 4P9GA 1RUF3 2DF7A 1KQRA 4CDUA 5JSRA 4D7YA 4KQ7A 2OIIA 1KDMA 4F8AA 3HT1A 4LBQA 4ZU4A 4ORFA 3SNMA 1J1TA 3JU9A 2ZGSA 1BK1A 1HIXA 1WW6A 2TUNA 4R4XA 4A7KA 1SFNA 4FP3A 5CFDA 4E9KA 3V0AB 2WZR3 1DYPA 4YZ1A 4XFAA 1BMV2 1UMZA 2ZMNA 5EV7A 1RUOA 2FQPA 3O0VA 3X29B 3VBFA 4AI2A 5C8CB 3EO6A 1KXGA 1XU2A 1TME2 2WNUC 3OBRA 4YZ4A 1ZYBA 3VKMA 4RQPB 4NO4A 2BW8A 3GYDA 1LOFC 2GMMA 4ZXKA 1ZVFA 2JG9A 4GB33 3LSDA 2EXHA 3AFKA 2Q0AA 4IV3A 2A6ZA 1AR63 3ZN5A 1SCRA 4BM8A 3SCFA 1XU1A 1U5ZA 2VY0A 1N47A 2E53A 3CEWA 3ZXAC 3DV8A 2HWB2 1DFQA 1W6MA 2ZACA 3N7MA 3T2TA 4LBKA 3OGGA 3V0BB 3AYAA 1O3QA 1ND3B 2P2KA 5I91A 1O5UA 1ULEA 4BLJA 3CL1A 2UURA 2D5FA 4P9IA 1S0EA 5JR7B 1ENQA 2JG8C 2H0VA 4WM7C 4N53A 2ETEA 3ZFGA 4B4PA 2ES3A 3ZYPA 1YHFA 2BFUS 2WZR1 4OHYA 1RUH2 4GQ7A 5GLVA 1LKNA 4XETA 5C8CA 3ST7A 3AMMA 5E88A 3MI8A 1QXRA 3AX4A 4GMP0 2ARBA 3WDWA 4F7ZA 1WA4A 3H8UA 2MNGA 4Q4W2 3P3PA 4NR1A 5A33A 1KS4A 1ULDA 3WUDA 5IK5A 1D2QA 4XFHA 3LSEA 4HSJA 1AJKA 4GWMA 2Q30A 2VMGA 1OOPB 5C9AB 1TEIA 1H8TA 3VDDB 3VHRA 5C4WB 2FZ1A 2DTYA 4GA9A 4YW5A 1VBD2 4LBNA 1VRH3 1XNCA 3J8F1 3WW1A 4P9LA 3E5QA 4INDA 4HVRA 2VUJA 5I0RA 3DKWA 1EPZA 1PVC2 2ZX3A 3N4MA 5LEJA 5BNOC 3JD71 1YFXA 2DU0A 1SBEA 2QQPA 2VXRA 1YFUA 3AMHA 1YIPA 4JGYC 1KITA 4O9EA 1PO12 2WFF3 3NV4A 3UJQA 5E16A 4BPZA 4QPGC 1O5LA 1CPNA 3B94A 4JGZC 4LBOA 2R073 4AI3A 1F8VA 3PJQA 4E4DX 3AYEA 3PVNA 3D5OA 2WZPP 2R061 1DHKB 3FWEA 4I0BA 5CADA 1VBC3 3SHRA 4C0BA 5C9AA 2GC1A 3THTA 1POV0 1H2MA 4AI8A 1R1ZA 2LUWA 4FTEA 4FSJA 2O8QA 1NCQC 1QJU1 3N3HA 5D8AC 3LKJA 3O12A 1AHSA 1FYUA 1YYNA 4PCRA 4M0HA 1RUI2 4KGGA 3DPRC 2P3JA 2TNFA 4XQ4A 1SLLA 1HLCA 2UWBA 3B3QE 5CFCC 3WG2A 2NZ9A 4AVBA 5GM0A 4G4FA 4MYEA 5JSOA 3ES1A 3ZFFC 4ASLA 2OPKA 2QVSB 1LOBA 4H14A 1OSGA 2JENA 2YDEA 4RS5B 1HDKA 1RHI1 4R52A 4XFIA 1DIWA 1X36A 4N7IA 1ZREA 3QLQA 4Z82A 2VMIA 1LGNA 1MS9A 3NAPC 1AF9A 2WFF1 1CESA 4LUMA 3RNSA 4PIXA 1OKQA 4W6WA 3WQ7A 3OF1A 1FAYA 1ND2A 3O0WA 4AK3A 1V6LA 3WVJA 4R9DA 2WA3A 1R081 1ZZBA 1VBC1 3MF6A 3B00A 4EWDA 3AFGA 1GSLA 3VZMA 4Q0VA 4WVWA 4QPIB 2BBVA 3TRSB 2D6MA 1R093 1CONA 3N7LA 3WCRA 3ZYRA 4XIKA 2AUYA 1AJOA 2WNUA 2ZGMA 4BZ4A 4ISQA 4Q29A 4HPKA 2Z2SB 1LOFA 3K48A 1WD4A 3LA7A 1PNGA 2ERFA 2XJPA 4F83A 1SEFA 4XMAA 2PELA 2ZABA 2PHDA 1QH7A 2CGOA 2Q1MA 2GN3A 1QMJA 5GZGA 1LJ7A 5ABJB 4RS5A 3AP5A 1TNFA 2A75A 3H1WA 4IV1C 3KZ4C 4PJYA 3ME2A 1QGLA 1GQHA 2OYZA 2E51A 1HQLA 3VBSC 3ZSKA 1SLAA 4EROA 3IPVB 4ES8A 1URXA 4NWWA 4XPVA 3RQ0A 2RM23 2VVFA 4WVMB 4NHKA 2B9UA 2I07B 3VBHB 1U5YA 2RS51 4IEYA 1BCXA 4XQWA 3SLIA 2R043 4AVSA 1FMD3 1LHWA 3OJBA 4QGLA 4AEDC 1JUIA 2KA3A 1R1A3 3NV3A 3G6JB 4OVEA 4QPIA 2H6CA 3WDXA 1LECA 4COUA 3BPZA 4TWTA 3JQWA 4X6QB 2XKPA 4AHXA 1R091 1LGBA 4XJ9A 1OLQA 3J8F2 4C91A 4FQZA 4U2AA 4Q8KA 1QJX3 4YW1A 4QGNA 4YVSB 3M70A 4MXWA 1VP6A 3OYWB 4X8NA 4Q1PA 3OGJA 3JD72 4NPRA 1BEV3 4YNIA 4A7ZA 4RD7A 1SACA 3MW2A 2NLRA 3CF6E 1SLCA 1QU0A 2VQ0A 2DU1A 5JCTA 4QQHA 3ELNA 3ZXFA 5K8SA 1CR7A 4M3CB 1FOD3 1VAVA 2WIIB 2XGXA 3DL3A 4ES9A 4M00A 5J36A 2ZMKA 5BNOA 1XE7A 2XLFA 2XJRA 3AXDA 3FFZA 1PVXA 1XNDA 3D4KA 4B4RA 2R062 2IWGB 4XBNA 2ZGNA 1SQ4A 1VALA 5SV8A 1FMD1 2OW4A 3PVOA 4HKOA 1VBA3 3W59A 4RR3C 1V6NA 3VHNA 1AYM1 4PDWA 1QJU2 1ZX5A 4CEYC 1OLRA 3WG3A 4FPKA 1ZA4A 1RL3A 3TYJA 2VVEA 4GALA 4A3XA 3ZFEC 2W68A 4FXGB 5FRAA 5T5OA 4CDWC 1BVP1 3B01A 4XFCA 3I4IA 1W6QB 2ZZJA 3QOPA 2MEV3 4NVPA 1QJX1 3OYWA 5FLIA 3U4XA 5JI9A 3CJIC 5CNAA 5GZFA 1E57A 4K9SA 4BOWA 5FQ0A 2B8MA 4JVAA 2C5DA 3VKLA 1NCQA 5LK5A 1LU2A 1FI2A 2DYCA 2LM3A 4FPHA 4XILA 4QM8A 2YMZA 5FDBA 4Y1ZA 4EN6B 1MS4A 1RHI2 3UKNA 3OD4A 3ZO0B 3DPRA 1V6KA 2DURA 4M3CA 1G6NA 5CFCA 1AUYA 3M3EA 3VZOA 4ISRA 3URFA 3B02A 2P34A 3WQ1A 3WQ0A 1TME3 3ZFFA 2HWD2 3SH3A 1DLLA 4CDXC 4E4ZA 1NG0A 1I3HA 4S2HA 3VBRB 2GC3A 1G9FA 2XWBB 3KLSA 1R082 4UBHA 3MZHA 4FCAA 4AHZA 2K9ZA 2WQZC 3WP6A 2R16A 3NAPA 4HKLA 2D3RA 1ALYA 2JD4A 5L7OB 1S1AA 2QCSB 3VBOB 3AJZA 5C33A 1MS1A 2HWB3 2XL7A 2D5HA 2GC2A 4WZCA 1DQ2A 3J26N 2O8OA 4YZ3A 2JKBA 2ILMA 2JEMA 4DINB 2MEV1 1VIWB 1UIKA 2W52A 3WP3A 4AEKA 5LEKA 4AFCA 1JHNA 1AL0G 2QKDA 4D7TA 4MZUA 5JSPA 1YCIA 2ZMLA 3OD0A 4MH0E 1S0IA 1C1LA 3UKTA 4AGRA 1TMF1 3J4UH 2WQ4A 5GLUA 3ETQA 2WNVC 1RUH3 1NA1B 2UY9A 3M3OA 2IXLA 4OULA 4EWAA 2VQAA 2V73A 1Q3EA 5F5QA 4LA2A 4EV0A 4FVVA 5ACA1 2RS52 4Q4W3 1LOGA 1YXWA 4TZDA 1ZZ6A 1MQTB 4YVWC 3VBRA 4KG8A 3WNXA 1GANA 2VW1A 4NN0A 4IV1A 2BFUL 5BNPB 4DS0A 2SLIA 2ZJCA 3VBSA 2G9GA 3IDCB 4LR4A 3AZZA 4XJUA 1CAWA 4Q27A 4XHBA 4FP2A 4Q8LA 4NHMA 1G86A 3Q9OA 5H9RA 1SFYA 4YG0A 1CAUB 3OY8A 4RA0A 3FUQA 4IEXA 5KXCA 4FAGA 1VBD3 3VUOA 2AYHA 4QU2A 4A7YA 5IUQA 1IOAA 1JBCA 1W6NA 2SBAA 2AZ5A 4XBLA 1HV1A 4BE3A 3KT4A 4LE4A 4ZKTB 4AEDA 1GV9A 1UU5A 1PVC3 3PMEA 2CWSA 2WT0A 5I8TA 4N9IA 4Y5Z0 1NYWA 1YIFA 4I09A 4C90A 3THPA 2V09A 4HK9A 1WLTA 1XRUA 1CGPA 2PHUA 2VW2A 2NQYA 3WZ1A 1XNBA 5LRRA 1PO13 2W08A 4LO6B 1EAH3 2DUOA 1NY71 3QCWA 4BLIA 3N36A 1M06G 3B69A 2WNEA 3WDYA 4RQPC 4LNVA 4JAAA 2A7AA 4LLOA 3W9AA 4DOUA 1FMD2 4H3WA 4PBOA 3HIFA 4UXAA 4KWJA 1AYM2 4OHXA 5I0SA 2A3WA 1RUI3 1VBD1 4IEVA 3AK0A 5KHIA 2VPVA 4HLTA 1XNKA 5DUXA 1CJPA 1V6JA 4GKXA 1D4M1 1VAMA 1GLHA 1WW5A 1GZWA 4I30A 4L99A 4MGZE 2RHPA 4RR3A 3ZYGA 1MZEA 4CDUB 3WCSA 4EN0A 4RHV1 4CEYA 1WLDA 1KJRA 3L2HA 1C1FA 3I7DA 4KU7A 4IEZA 2WT2A 2VW0A 4LBQB 5HXVA 3UJOA 4CDWA 5I93A 2PAMA 4AEMA 3FE5A 1Y9QA 3KB5A 4AG4A 5CFDB 2XB6C 1NE4A 2XVLA 5HCAA 3FZ3A 3R4SA 2R1BA 1EAH1 4L97A 3RZZA 4Y1UA 3C3VA 3VBFB 4PLOA 4XYXA 4HT1T 1KD7A 1XXNA 1TNRA 3NKTA 4BHPA 4YRDA 2R6QA 2QNKA 2ZGUA 1HV0A 2E6VA 3PVBB 2JG9B 1OOPC 3TNQA 4IEPA 4IV3B 4HK8A 1LEMA 2EA7A 1N1VA 4XHXA 3ZIXA 4AVAA 1AL21 2XJUA 2DFCA 4X8PA 4HBNA 4CDXA 4YZ2A 2R30A 1U5IA 1W6MB 3ENRA 1Q8SA 3KCYA 4D3WA 3L9JT 5JOZA 4AGGA 2A71A 4SLIA 1VBE1 3AXEA 3ZXEA 5C8WA 4FPCA 1VBB1 2NM1A 2FBEA 2HJIA 4XJ8A 1UU6A 1LCLA 1OPOA 1DDLA 3ZSEA 2XJVA 4I3PA 3NVCA 1TMF2 1N3OA 1MEC1 3SMHA 4I01A 1NXD1 4UW3A 1IPJA 2FHRA 4N53B 3ZFGB 1DGWA 2A6WA 4MSVA 2PLV3 4E4SA 5FFOC 5GZDA 2D93A 4CTEA 5ACA2 2P3IA 4B29A 3ZXJA 2KM2A 2LTNA 3AZYA 1NZCA 1X33A 1NCRC 3WX5A 2CY6A 5A33B 2JECA 4AGVA 1LU1A 1A8MA 4FOVA 2WNVA 3OCPA 3VV1A 3EQEA 3H9AA 4FOQA 4FPEA 1UCXA 2RJLA 4GXLA 3S0MA 4FT8A 4BYYA 3RJ2X 1H8TB 3A0KA 1BJQA 3SCGA 2DVGA 4Z8BA 2VNGA 3J8F3 2EXKA 4MLOA 3WDVA 5EYXA 2RR11 4WV8A 3ILRA 3M4FA 2K0GA 2GH2A 2GZWA 1PNFA 2G4IA 3GBFA 1AR91 1ZZ8A 4XJZA 1O4YA 2IFWA 3ROUA 3JD73 1KS5A 1REEA 2ZAHA 4FTBA 4MGKE 1JW6A 5J3UA 4SBVA 2A70A 4XF9A 2VGDA 1C57A 3FLPA 1G9BA 1IKPA 1EV11 2JXAA 4J1XA 1AVBA 3EXUA 3POWA 4L11A 3KS7A 4MUVA 2Q4SA 5FMOS 3D0SA 1ZBE1 3SH4A 4AQ6A 4KGQA 2OVUA 1H8VA 4ATFA 3IDEA 1NY72 3M2MA 2PLV1 1C5IA 1YFYA 3TN92 3WG1A 3T1LA 1POV1 2ZZQA 3VL8A 1OFNA 3OPZA 4BCUA 2R063 3MIHA 2V5YA 4M3CE 3WHTA 5F6KA 1Q8VA 5BNQA 1MS3A 2DCJA 1UKGA 1WUVA 1AYN1 3WW4A 1QJU3 5FAXA 2YXSA 4DB5A 4DNYA 2OZ6A 4FAHA 4XFBA 3U11A 1PZ7A 3FFQA 5K0UC 3MLKA 2WS91 3MICA 4H55A 1J3PA 5DDJ1 1V9U1 3KT7A 4QQ2A 4M3CF 1D4M2 3GBGA 1ENXA 2QE3A 2YY1A 1QOSA 1GKBA 5CB7A 4RHV2 5T54A 2A6VA 2HWF1 1JYIA 2N7GA 1W6OA 2O1QA 3VZNA 3MPPG 5ABJC 1XYOA 3PHMA 1H1MA 2DCKA 1RHI3 1AX1A 4YZ5A 5FOBB 1RVF2 4JC1A 1IGOA 4MXVA 4BH9A 1V6OA 2WWSA 4QM9A 5AFEA 5JPMB 1SMVA 4HANA 1EAH2 3IWZA 4Q2FA 2HWD3 4OI0A 2YUEA 1BKZA 1LESA 4LHNA 3UL2A 5A3MA 4E2QA 3AMQA 1CJDA 1R083 1ND2B 1QNWA 3HQXA 1MVQA 1X8MA 2BNMA 4R9BA 1QDOA 2WSUA 3FMGA 2XJSA 5FO9B 1TE1B 1AL22 2R0FA 3IMNA 3TBDA 5JVVA 5J37A 1K5MC 4OFGA 4JRAA 1V70A 2WNUB 1FV3A 2PHXA