1YJLA

Reduced peptidylglycine alpha-hydroxylating monooxygenase in a new crystal form
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
306
structure length
285
Chain Sequence
b'TIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTICNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-glycine alpha-amidating monooxygenase
publication title The catalytic copper of Peptidylglycine alpha-Hydroxylating Monooxygenase also plays a critical structural role.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 54
structure length 285
sequence length 306
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yjlA02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 1yjlA01
3MIFA 1YI9A 3MIGA 1YJKA 4QHBA 1PGSA 3MIDA 3MIEA 3KS7A 1PNGA 4R4ZA 3MIBA 3MIHA 1PHMA 3MLJA 1OPMA 1PNFA 3MLLA 1SDWA 4R4XA 4E4ZA 1YIPA 3MLKA 3PMSA 1YJLA 3PHMA 3MICA
chains in the Genus database with same CATH superfamily
1WMDA 4AEMA 4M01A 4LXLA 4Q2FA 2UWAA 5IK7A 4YW1A 4XF9A 1IG0A 3UESA 5DXDA 5JI7A 2NLRA 3T2TA 2QQKA 3ALQA 3WW4A 3W9AA 5EIYB 5KC5A 3N9OA 1CONA 4YFZA 5K0UB 5IUQA 2VU9A 3VBOA 3VKOA 3WQ7A 1OOPB 1F15A 1I9RA 3M3IA 4WZCA 2Y60A 4GH4B 3THPA 5C8CC 1W28A 2LS6A 1W9WA 1DDLA 1ACCA 1PO13 2R061 5CIRA 4XF0A 4F8AA 5BNPB 4QDSA 3C7GA 5C4WC 1LHWA 2G9ZA 2XLAA 1XSRA 5F3EA 1AL21 1W39A 3RGBA 2B45X 5BYNA 1CJDA 1XQNA 5HCBA 2RMU2 3S57A 4AFCA 1IS6A 2XL7A 3HWJA 4JCKA 3VDAA 3EB7A 1T6BX 2Z5WA 1RVF3 4LIUA 3WOGA 4YNIA 4HK8A 1U0AA 3ZVXA 1RITA 1TEIA 3I2GA 5ABJB 3IWZA 1M4WA 5M0TA 4LBMA 3QCWA 3W5MA 1K3IA 3AVSA 4XF3A 5A6YA 3VBFB 2DBNA 3H42B 1Y9QA 2Q1MA 4P00B 3VKMA 2BJSA 5BNNC 2R062 4IEPA 4JGYA 2WT1A 3U37A 4PLMA 3CBNA 1AL22 5A7WB 2V5DA 2XJPA 1SDWA 1V9U3 4PIYA 4TN7A 1ZA4A 5CFCC 5FYZA 3RZKA 3KQRA 2VECA 3FHQA 1HB2A 4OHZA 4LBQB 3URFA 4OHWA 2AH2A 1Q43A 4QXCA 1LESA 1XNKA 3AYCA 4AEDB 5JPMB 1ENXA 2I74A 2WFPA 5DAQA 5FQ0B 1HB3A 4PT6A 2CGNA 5FZMA 2LM3A 3IDBB 4Y1UA 2VGDA 3U78A 2FDGA 1RVF1 4R4ZA 2VVFA 5J09A 4IQPA 4CDWC 3VBUB 5CKQA 3RZHA 2Y64A 2D5HA 2VZTA 4FPLA 3O7OA 4AF9A 1H9WA 2WUHA 2GP5A 3AMHA 1LU1A 2GH2A 3NWKA 1KXGA 1X7NA 5DUUA 4FSJA 4RS5C 1W9SA 2JDZA 4JV4A 4LE3A 3ZYPA 2GMEA 1PX3A 5CBLA 1K42A 1QNWA 3IIAA 4YW6A 4DB5A 3MI8A 4PBPA 2W95A 3CZJA 2WFF3 4QB6A 3VKFC 4BIFA 1V9U1 4FTSA 2BBAA 2WNUA 1DQ0A 3NKGA 5IVYA 2D6LX 3LEKA 4CP2A 4JZRA 1OVPA 2DCJA 3V0AB 5LK7B 1RVF2 3P1IA 3ZSLA 4B7KA 3POIA 4CUBA 1O6UA 1X33A 3GBWA 5A7QA 4EN8B 1UQXA 1BKZA 3LFMA 3UKVA 4Y24A 4YG6A 5DUVA 2PYTA 1W2NA 2EXKA 1V6LA 2DUQA 4IEXA 4AFAA 1JYWA 1BLZA 2ZEYA 3NO8A 4A3ZA 3ZFEC 2LALA 1JYCA 3MPBA 3WHTA 4Y1ZA 1FXZA 1VE0A 3HEIA 2IVJA 5FPLA 3T30A 3CDZB 4NMIA 1OUXA 1AUYA 1S2KA 3M70A 5ACA3 1K5MC 1JXNA 1V9U2 1VMJA 3HBZA 4LK6A 4WV8A 5J7MA 2VMHA 3RZJA 4AL9A 2Z4FA 3L2YA 3WUCA 2ZZJA 1H8TC 1EUTA 3HIFA 4Y3OA 4IEVA 2RJKA 4GWJA 4DUWA 1F2NA 2ZGQA 3W20A 4A7ZA 4IUGA 4G9SB 1AJKA 4LKDA 3O1MA 4Y5Z0 1NQJA 4COVA 1FMD3 2WFF1 5EP9A 5FUIA 5GM0A 3ES1A 4R8HA 3MLLA 3PMEA 2Q0AA 5F5CA 3ZIXA 4IGPA 4PQ9A 1BZWA 1GICA 1KQRA 3DPRB 2ZGRA 2VY0A 3OF1A 2GMMA 1E57A 1BBT3 3OPZA 4HG6B 3FN9A 4I30A 2WZR3 5FYYA 3VZKA 3IMNA 4CDQB 4DY5A 4OHYA 4YRDA 1PVC1 1LGNA 2UYAA 1SCRA 3ZYHA 3AC0A 2EA7A 3AFGA 2XLFA 4O9EA 3UKTA 1RGSA 1DP0A 2BGCA 4AQ6A 3ORJA 3I8TA 3VKNA 3POEA 4BDVB 5FZOA 2WFF2 3VBRC 3FLTA 5HV4A 4QDRA 2BWAA 1S0IA 1W8WA 4WBBA 5L9VA 1POV0 2W91A 2ZX0A 3CEWA 4P5YA 4UFJA 5GLZA 3TEWA 2RS53 2DU0A 3GBFA 3NJZA 4PLOA 4XFAA 3WNOA 1YJLA 2ORZA 4DEQA 3FLPA 1WBFA 4XJUA 3RYPA 3DKQA 3LA2A 4YVSB 5FKBA 1CZTA 4N8MA 4QX2A 2ZOEB 1PVC2 4AAXA 3J7MA 3I3BA 4MUVA 2XLGA 4A6OA 2Y6KA 4EZ4A 4QAWA 4Y22A 3WT3A 2B39A 3C2UA 1XNBA 3KV9A 5JCTA 5JVVA 3AX4A 5LASA 2WZR1 1QJFA 3TB0A 1G9FA 5DUXA 2JE8A 1YFXA 4I0BA 4XILA 2VVEA 1D2QA 1LCLA 1RMU1 3J4UH 1PZ8A 2W87A 4QD2A 4ES8A 3BU0A 4D7YA 1HLCA 4JGYC 3N9QA 1WA6X 3MFCA 5DDJ2 3H8RA 4H3WA 2XJTA 1HQLA 4UXAA 2RS13 2Y6HA 1KGYA 4TWTA 1ULDA 1YJKA 2Z2SB 4Q4Y3 1Z0HA 1JZ5A 3WF4A 2QQOA 1V6JA 2RS51 2YU1A 3B01A 2JDKA 3GZUC 5FJKA 2Q8DA 4CUGA 1KJRA 1O4TA 2Q30A 2PLV3 4YW7A 1GOHA 1VAMA 3NNLA 2WZR2 4EN9B 3J8F3 4UYBA 5EYYA 2VZUA 2J1VA 1VBD3 4UF0B 3B69A 3POJA 1C1LA 4C8DA 4M3CB 2XOMA 1RMU2 3I54A 4R52A 3AKPA 3D82A 4UFKA 3N9NA 2YBKA 4P9IA 4XCAA 3ZIWA 3RFRA 3BCWA 3OBTA 2XMLA 4KQ7A 1W6PB 1JZ3A 5IFTA 2D98A 3Q9OA 4MGYE 5LA2A 2R6QA 4ZU7A 2WO2A 4FTBA 2RS52 3H3UA 4ZS3A 3LIGA 2QUOA 2PN5A 4LTAA 1VB4A 4H2AA 4AI8A 1DQ5A 2A70A 2VD7A 4AQSA 4DOUA 1ENRA 1ZZ7A 3RI8A 4NHLA 3L2HA 4ZXEA 2RS11 1BMV1 1DYKA 4MGQA 1PGL1 1AR72 1UZWA 2UWCA 2WNUC 4XCBA 4CEYA 4Q4Y1 4Y26A 2VW1A 2B5HA 4LA2A 4AI3A 4UFLA 1X50A 3WDUA 3JBG3 2PLV1 4NIIA 2RS33 2ZKNA 4P9YA 4LBQD 5FYUA 4IGOA 2J1SA 2ARXA 1VBD1 4HSLA 3LEMA 3T4HB 4Q4W3 4CEWC 1ZRFA 3JD71 3USUA 2VE1A 3CJIB 3EYPA 2VMCA 3I2FA 2WO7A 1UXZA 5JIAA 3VL9A 3THTA 2J1EA 5JSPA 2JG8A 3LA3A 1UKGA 3I7DA 1PO21 2ZMLA 3R05A 2ZGKA 1NG0A 2BZDA 2OQ7A 5LCWL 1PGL2 1JYIA 2EAKA 2WR9A 3D6EA 4Q4Y2 4W50A 4BQ5A 4RR3C 1GP6A 5BPXA 3S5QA 3ZSKA 4NJ4A 4KWJA 2GNTA 2PLV2 2WL1A 4L97A 4A41A 1OH4A 5FP7A 1CAVB 3GALA 1PGW1 4OI2A 1AZDA 4DXTA 1QF3A 2BW8A 1VBD2 1C57A 1RUC3 1DQ1A 3JD72 3OUHA 3NV4A 1U5XA 3QH7A 1WWYA 3GJAA 3POYA 2A6XA 4HVRA 1TZOA 3UNPA 1OF3A 1WMFA 3EHKA 2MPFA 2VQ0A 3KV5A 3JBG1 4LBLA 3WNPA 2RS31 4XBQA 1MZ6A 1PO22 2ILMA 4GXLA 4KI5M 4LITA 2ZACA 3PIGA 4V2WA 1G9BA 1SCSA 2HEYF 4Q4W1 4W6WA 5IHRA 2K2SA 4OLLA 5LZ6A 2EVXA 2Q8EA 3ZXAC 2DF7A 4Y33A 1AYN3 4OFGA 1N47A 4ASLA 1REEA 4KNCA 3I4IA 1PGW2 4MXWB 4GJZA 1UX7A 5FAXA 4FFGA 5FXVA 2JICA 1HQNA 5FY7A 5LEKA 2CY6A 1GBGA 1QNYA 3ZPOA 2XQXA 4FQZA 5LB6A 2GP3A 2WIIB 3JBG2 4LHKA 1CAUA 1R082 3B00A 2Y6FA 2BFUL 2L9LA 3DYPA 5FDBA 2RE9A 2D7FA 1UYPA 1KFXL 1VBC3 2P3JA 4NPMA 4Q4W2 4IL7A 1AXYA 3EBRA 5FJHA 4JKKA 4MADA 1RXGA 2NN8A 2A6VA 4OULA 2RDNA 2PELA 1CZSA 2D5FA 4RGAA 4I2OA 3W21A 1UU6A 3WNKA 1DZRA 5FREA 1XE0A 2NP0A 1JOBA 2H6CA 2YFUA 3RPQA 3LOBA 4H14A 1UU4A 1AX0A 1ND2B 2JDHA 4Q1PA 1AYN1 5BNOC 1JHJA 1LHVA 1G7YA 4N53B 5EJZB 2FDJA 3WP3A 4J1XA 5F1RA 2NM1A 5D8AA 2CAVA 2QVSB 4CUCA 1FNZA 4KMQA 4UWDA 3U10A 1JUHA 3KV6A 5JOZA 1RHI2 2TBVA 3I3DA 1LOFC 5L7OB 1IZ3A 4XJ8A 4CDXB 4A2UA 3MLJA 1YIFA 4LNVA 3I2JA 1CAWA 4LO6B 5DAWA 1BEV3 3PL0A 3S7IA 1RUE3 1JYXA 1F5JA 2WJSA 4G4FA 1VBC1 4P9XA 1GP5A 2WA3A 1MPXA 2ZGTA 3WSOA 2OVUA 4N7IA 2GC2A 1OFNA 1AYN2 2VXRA 3ACLA 2YGMA 2P6CA 2VQUA 4Q5OA 3ACGA 4JRLA 4NROA 4QQ2A 4TSVA 4BWOA 4AVCA 2DUPA 3CIHA 5T52A 1RINA 1RIRA 4NO4A 1PMJX 4WVWA 3WNNA 1UOGA 1PGSA 3AYDA 1NYWA 3NVCA 1GFF2 1CJPA 1G9AA 3HR9A 1SBFA 3FE5A 4UFMA 5K0UA 3O1VA 2A3WA 4P08A 4Q29A 4RSUA 4X6RB 3MIHA 1POV3 2IFRA 1OOPA 3J26N 1J83A 4CP0A 1NCRB 3F2ZA 4EWDA 2N7GA 3E5XA 3ROUA 4DRRA 2JKXA 4LHSA 1VBC2 2A6YA 1OQDA 4CXYA 3ECQA 5F7UA 2ZTNA 3PMSA 4P9LA 3ZXFA 3ZYRA 1RB8G 5LRSA 2YUEA 2P1BA 3NNJA 4AWDA 1O4ZA 2H6BA 4GD4A 1N1VA 4CCJA 1XNTA 1RUE1 3ZSEA 4HPKB 3HN1A 3H8UA 1RXFA 4IV1B 1NZIA 4L8QA 4QT6A 4UW6A 4AFMA 1SG3A 3KT4A 4A7KA 3OBAA 3ELNA 3O12A 1OMIA 1OURA 1NT0A 4QPIB 5HBAA 2FDFA 2HJIA 1C8M3 1ND3B 4INDA 4K1YA 1VRH3 2R16A 1P8JA 1RUNA 3VBFA 4UBHA 1HB4A 5DAVA 3VBHC 1ZA7A 1V6NA 5FPAA 1YFYA 2JG8C 4IW3A 1MQTB 4CU7A 4JHZA 1JU3A 1GOFA 2Y6LA 3BPZA 3D0SA 3B7MA 4Y1YA 5FPBA 1UZVA 2Z79A 3C8XA 3LB9A 1R092 5A7WA 3TRSB 3RG0A 2E63A 2ZJCA 3GBGA 1POV1 1QJX3 3P3PA 2DVDA 4LBQA 1RUE2 3CF6E 3VDBA 2ZX1A 1EYBA 5F3GA 2VJXA 2YC0A 5FYIA 3AP7A 4AEDA 4COZA 2JDMA 1Q8OA 1E5SA 1OSGA 3NRUA 3GM8A 5CYYA 3H3LA 4CCKA 4DPNA 5FQ0A 2IFWA 3FFQA 1IOAA 3E97A 4P14A 2IZWA 2VXJA 4Y1VA 4CP1A 1U5YA 2GALA 3FC0A 2WZPP 1YO8A 4EE2A 1W90A 4PI0A 2YG0A 2V72A 2YFZA 4ASMB 2W1QA 1H6XA 1OLMA 1EP0A 3THDA 1N1YA 4GB33 1QJEA 1C8M1 2WWJA 2VH9A 1ZBA2 2J7MA 1UOJA 1ZRRA 2Y34A 3TYJA 4XFBA 2JD9A 1COV2 3ZDSA 2WAAA 3U11A 2HYXA 3T4VA 1DG6A 2XPJA 2XGXA 4Y20B 1CESA 1MR5A 2YBPA 3ZFGC 4MGIE 4FTEA 3PTYA 1FT9A 2PMWB 4KWUA 1K5JA 3BKZA 4CXXA 3RQ0A 3BVCA 5GJ6A 1Z78A 4LHLA 5AVPA 5H9QA 5CB7A 3V0AA 3MUY1 3W5NA 1DGWA 2WN3A 3I97A 4XJ9A 2WQ8A 1I3HA 1SHWB 2ET7A 1W8HA 1OQ1A 3WP5A 3RNSA 3SCGA 5FZ6A 1C8M2 4KG0A 3LDRA 1NQDA 3NNGA 5E88A 3WG2A 2PAKA 4QWNA 4D3WA 3WF2A 4GULA 4A3XA 2J1RA 5FPZA 5FY4A 5JUVA 1E5RA 1NCQC 1B35C 4IE6A 3NQHA 4XDOA 1UMIA 4TLFA 3KCXA 3WNXA 5I8YA 2ATFA 3ZR6A 4PLNA 1O5UA 4FPFA 2VO5A 4XFIA 5DAPA 3BTZA 3R0RA 1QOOA 1WCDJ 2VTFA 3AKSA 4NHMA 2P37A 1UMZA 3GNEA 2B8MA 3V56A 1MZEA 4MGZE 5FPXA 2D93A 3ZFFA 4X6QB 4LO5B 3AMQA 1OKQA 4R4XA 5F32A 5CU1A 2OUHA 5IK5A 1H9PA 4F3JA 3HNMA 2VR4A 2XJQA 1GU3A 4DS0A 4NWVA 2VW0A 4FPOB 2WN2A 2QKDA 4XABA 2ADDA 3JU9A 4K7JA 5JZGB 4FQ4A 3MW3A 4Z8BA 1IHMA 1YFUA 5IVFA 4CDQA 3O1PA 4Q0VA 1WGPA 2P2KA 2C24A 4ZU5A 2BU9A 5C3QA 2QQUA 5GZFA 4PIXA 3MW4A 2VUDA 4UI9L 1NE4A 4BYYA 1WD3A 3ZO0B 5C9AA 2ZGSA 4WVMB 3TN93 1SMVA 4DXZA 4QQOA 3I3EA 5F37A 2JG9C 4BISA 3ZLIA 3WNLA 1S0CA 4ZKTB 5IATA 2J1UA 1LEMA 4FPCA 4A42A 1C8NA 1HB1A 3SEEA 5JOXA 3FJSA 4IEOA 4IESA 1OKOA 4KWKA 3SH3A 2E31A 4YFWA 1S2BA 5IJRA 1E5HA 4YVSA 2RM21 3AJYA 1B09A 2BP6A 1FATA 1KJLA 1EPZA 3H8XA 2VCAA 3SCHA 2R041 3MUZ1 4A6SA 3WV6A 2A5ZA 1G6NA 4FOWA 4CU8A 2BBVA 1DYOA 1D0HA 2G1MA 2PAMA 4Q0QA 3DKWA 5KHGA 3ZSJA 1LULA 2D44A 4E2GA 3F95A 4C1WA 1ULEA 1C3HA 2JE9A 3ITQA 2Z69A 5A7SA 1DQ6A 3A22A 3Q8BA 1VP6A 4YVWB 5DMYA 3N35A 1ULPA 4EV0A 2DFBA 1BCXA 2CWSA 2B9UA 2X5IC 2YROA 4UFHA 2J22A 3WW2A 1ZYBA 3E1F1 3JXSA 5AFEA 5IK8A 3TN91 4JGZC 3WF1A 1RUI3 5C7GA 1JYVA 3PJYA 1JYNA 2RM22 4HVOA 3NJXA 4XJWA 2XH6A 1IPJA 4HKLA 2UU8A 2R042 4KGGA 2YC2A 1HIXA 5L19A 1HW5A 1KEXA 1UF2C 4W65A 3O1RA 2PHTA 2FCTA 2A73B 4BH9A 2ZAHA 3JCIA 1IPKA 1OUSA 4AGRA 1J58A 1Q8QA 1N1TA 3ACFA 2Y33A 4UF0A 3KF5A 4ZY9A 2CV6A 4OMCA 4BA6A 2V09A 2QFEA 4M3CA 2C0ZA 2OPKA 4E4HA 4NIDA 2FDKA 1ZVFA 3C7HA 4NRMA 1W6PA 1VB2A 3ZYFA 1YEWA 4YW5A 1XSQA 1VPHA 4MSVA 5I93A 5F9TA 4MHUA 3RJ2X 4NRQA 2O14A 3KGLA 1J3QA 1F4AA 2WBKA 4RYDA 4WVZA 5L9BA 3SITA 2K0GA 3I2OA 1HJGA 1HN0A 1W0OA 4Y4RA 2R073 3AMPA 2HWD3 5IVJA 1RUI1 1ULFA 1O91A 4RQPB 4WM7B 3OOXA 1CAXB 4I3PA 2HWE3 4JHTA 4OYUA 5A3WA 1LOAA 4HN0A 3TAYA 4BHPA 1NE6A 4CCCA 5JMCA 3ZN6A 2RR13 4QPGB 1QHDA 1OLQA 1SLIA 4PF5A 4S2FA 2XVLA 4KU8A 4MX3A 1QJZA 1GZWB 3MICA 4D69A 3MZHA 5GALA 3CQOA 1VLNA 1O8SA 2ETEA 1F5FA 1W05A 5EXOA 1DGRA 3R4UA 4XHXA 3FWEA 1JZ8A 5LW9A 2DU1A 2ZABA 3CJIA 4QXBA 4WM8A 4DUVA 4BPZA 5GLWA 1XE8A 5T5OA 5A80A 1Q56A 1S0FA 1APNA 2LUWA 1PNGA 4UAPA 5IT6A 4LBOA 1RUI2 5B2GB 4CDUB 1OFSA 1GKBA 1OPMA 1J3PA 2ZX4A 4OUEA 1FOD3 3SXWA 4E4ZA 1ZZ9A 5E8AA 1V70A 4GAZA 4LMFA 2DTWA 3SC7X 2AR6A 1PK6B 2R071 1U5ZA 2JWPA 2ID4A 1PNFA 2HWD1 1LTEA 2D6MA 2BWCA 2JB4A 2WLPA 4XFGA 5F6LB 1AVBA 3ZFFC 1YQ8A 1PO11 3AZXA 3WG3A 4V2VA 5IAXA 1NLQA 1LOCA 3Q8FA 4AI9A 3VHNA 2J42A 1PMIA 4X8NA 2YV8A 1GLHA 3THCA 4AHYA 4EN0A 3ILFA 3N4MA 1XPWA 5DABA 2CWMA 4BQ2A 5A6XA 1W2AX 2VZVA 3J7NA 2AENA 2HWC3 5FXXA 2UWBA 5FP4A 1XNCA 1SLAA 1OF4A 2XKOA 1WKYA 3EMRA 1CX1A 2R072 4QX5A 2HWD2 2X05A 5C9AC 1JODA 2XG3A 3NAPB 3P3NA 4MXWA 4BK4A 2E7QA 1PO12 2QCSB 3HOBA 5JSRA 3HAGA 2ORXA 3P5BA 5FZEA 4BJ0A 4XF4A 3VBSA 2MNGA 5HCAA 3VDDB 2PQQA 4QM9A 3KCYA 3OUIA 1DZTA 4Q8KA 3I49A 4ATFA 4FPGA 2XBO3 1QXPA 3NNMA 5LK5A 1QGLA 3DECA 4YVSC 5FFOC 3H1MA 1NA1B 5C8WA 2OPWA 5FZKA 1JN2P 4PF1A 2VULA 4MGSA 3ZXDA 3OBRA 4LT5A 2WNOA 2RVAA 2PHLA 1BHGA 2Y0IA 2HYKA 5KXDA 3AM2A 4AVVA 1OLRA 5C8CB 1SLCA 3A0KA 5A6QA 3USSA 4YW2A 5C4WB 1S0JA 2HWC1 1TME3 1ND2A 1UOFA 2ZGNA 5FMDA 1W99A 1OQEA 2JEMA 2W1SA 2ZMNA 3CU7A 4NE9A 5EYXA 1JZ7A 2WNVA 5FP9A 1MACA 1XBFA 1XXNA 3PUIA 1TQ5A 4E4DX 4KG8A 4NUBA 5L7OA 4GZ9A 2VQTA 4CDXA 1UIJA 3T0BA 3FL7A 2VMEA 3H7JA 3TNQA 1RC6A 4AYUA 3NV2A 2VC9A 2ES3A 4QM8A 5LEJA 2RJ2A 3WEZA 3WQ0A 3WZ1A 3FBYA 1MS1A 2WLQA 4ET7A 2Y6JA 4LIVA 4LKFA 3RDIA 5BNNB 1QKQA 2JJ6A 2HWC2 1STMA 2EXHA 3ZM8A 5DZFA 5GZCA 5FMCA 5DPNA 2ZGMA 1D4M3 4SLIA 3LOIA 1VBE3 3K3OA 1O59A 1W6MA 5CFCB 1QJY3 4MGTA 4HZFA 5FYVA 2WZ8A 3OSDA 3SISA 2QDNA 5IWFA 3S6PA 2GNBA 1QXRA 4O65A 4FPKA 3B5LB 3S7EA 1DQ2A 2BDRA 3OB8A 1TME1 5ACA1 4D0QA 5BV6A 1NOVA 4QMAA 1HXS3 4YWAA 5GLUA 1AF9A 3AFKA 1NCRA 2BERA 3VBOC 4K9SA 4C0HA 2WWSA 1FPN3 1LENA 4IE5A 1G8WA 4UW4A 1I1EA 5FZ3A 4D6SA 1XNDA 4CDWB 1W6OA 1W6QA 1XU1A 3VUOA 2EIGA 1MEC3 2HEWF 4FPYA 1FMD1 3POBA 2XJVA 4FOVA 4IEYA 1GV9A 4URTA 3VD3A 4QHBA 5H9SA 5LA1A 1O3RA 2E32A 2VTXA 1GUIA 3VLBB 5CG9A 5FK8A 4HPKA 1JYTA 1PIV3 4RS5B 3C7OA 4WVVA 3V65A 3M8LA 2XXZA 5FTTC 1TME2 1BBT1 2JDUA 5ACA2 4WM8C 4QPIA 4ES9A 1C1FA 2JX9A 5F2WA 1ND3A 1RUH3 1VBE1 4YYOA 3TWIA 2GC0A 4BLIA 3ETPA 1WA4A 4QX0A 1W8TA 1QJY1 2G9FA 2C4XA 4RFT0 5FYCA 3UYJA 4AXOA 2EXJA 2QQWA 3FUQA 3IPVB 3VHRA 1ENSA 2Y26A 2ZGUA 1FMD2 3BN6A 3GF6A 1HXS1 1W8UA 3U0ZA 3AL6A 5HXMA 1AR93 4ASKA 2FHRA 2E6VA 3EO6A 3M3QA 5FRAA 4AGGA 3K2OA 4DFSA 1FPN1 1X9TA 1PZ9A 1KS4A 3AZVA 3ZFEB 1YQCA 2D43A 4CP9B 4XPVA 1QJU3 3J9SA 1Y43B 2A3YA 3RWNA 3VKLA 5A33B 1BBT2 4FXKB 2XDVA 3WINE 1GNZA 3AYEA 1K5MB 2BTVC 2WDBA 2X8KA 3KZ4C 1QJY2 4AVSA 5FCCA 2OW4A 4BQ3A 4NIHA 1H8TB 1PIV1 1UW8A 4GMP0 4YM3A 1F31A 4XTMA 1RYYA 4QHZA 1PX4A 3WF0A 5EZWA 2OKXA 4DUXA 1RUH1 1UZYA 2BUKA 4GALA 1NKGA 1SFYA 1FPN2 1GQPA 5B4XA 5T55A 5ERLA 4UW5A 3WHUA 5A70A 3WD5A 1IPSA 4XUOA 2A7AA 4FXGB 1SLBA 2P3KA 1UMHA 2EIEA 2W9XA 1LHUA 3I2DA 1RTVA 2YU2A 2VM9A 4ZPIA 5FLJA 3VBSC 1Q5OA 1FV3A 1NX9A 1SLLA 2W46A 4OZXA 4QXHA 2E53A 3HMYA 4FFHA 1AR91 4AZZA 2CU5A 4L0PA 3CHXA 5FYBA 4BXSV 5I0DA 5BXXA 2VOVA 2ZAAA 3FUOA 2VNGA 1PIV2 3HNBM 4RD7A 5JOWA 1SPPB 1WW7A 1QJU1 4PBOA 1UYYA 4EN6B 3LAGA 2JXAA 1LR5A 5JXHA 3VD9A 3J8F1 3UV9A 3VBRB 1RUH2 1LHNA 3ETQA 5EHDA 2VW2A 1W3VA 2VG9A 3R4DB 3KQ4B 4QQHA 2XONA 5FUPA 3WG1A 1S1AA 4B4PA 2QJVA 3UKNA 1QIQA 4E8DA 4MLOA 1OT5A 1CVNA 3OD0A 3BALA 4B3NA 4N43A 2YC4A 2G4IA 3VHOA 4LOTA 4FP3A 2RS12 1BMV2 2ZHKA 1AR92 1H4GA 1XE7A 1GOGA 4FCAA 1W3XA 1C28A 1WW5A 4FP2A 4QX1A 5H9RA 3UT0A 3JZVA 4LQRA 4Q27A 4META 2R0FA 1ZRCA 4AVBA 4AAPA 2WNVC 1SBEA 4JDMA 3HT1A 1Y9GA 3J8F2 5HXVA 4YARA 1QY4A 1TNRA 1HRV3 5FY8A 1BK0A 5E6HA 4AE2A 1RL3A 4M0HA 2PHDA 3VD4A 1YI9A 4B8EA 1A78A 3WQ1A 4XUQA 4ZS2A 2DVFA 5JZGA 1T2XA 3OYWB 3A4UA 4Z1VA 4JGYB 4JC1A 4MH0E 3GHNA 3PUHA 1JOPA 2QTWB 3NNFA 4YG3A 3ABZA 1C4RA 3PVEA 3PUAA 4U2AA 4GJYA 5JWPA 4QQLA 4WVMA 4AG4A 3J7HA 2ARBA 3AP6A 5FO9B 4XF1A 2V5YA 3GZAA 3VZNA 2RDQA 2DWRA 3AP9A 3KB5A 4C91A 2IXIA 1ULGA 3PU8A 5KXEA 3PLQA 4P02B 2VBBA 1N3OA 4OUMA 3CMGA 2WYFA 4Z07A 1IKPA 1R64A 2RS32 2W68A 5JR7B 4XTPA 4YPJA 3BIEA 2B9VA 2ARCA 1UPSA 4AHXA 1AXZA 3OUJA 5AC93 4IE7A 1RUC1 3WR0A 3KVAA 2CL2A 2AREA 1VIWB 4RGKA 1I5PA 1QQP3 2XUMA 3MBWA 2PHXA 3OG2A 5LATA 2FMDA 1UN1A 5FMOS 1MS9A 4CCEA 2WNEA 4CVUA 4XOGA 1L3JA 1BVVA 1X8EA 1GWKA 1VBB3 2ZCWA 5K4LA 1WLTA 1YWKA 1YRZA 2A1XA 4YVWA 5GKAC 3R4SA 1FV2A 1MS5A 1OH3A 4KL1A 1YQ6A 5A32B 2CDPA 4YZ2A 3A23A 3DN7A 4LORA 1MS0A 5HI0A 2ZPXA 5D21A 4FOYA 4PQQA 1W8OA 3HQUA 3T1LA 1RUC2 2XJUA 3TNPB 3ZR5A 3K46A 4COUA 5J36A 4CEWB 4IE0A 1S2EA 4Y5TA 3KT1A 3EQEA 3CLPA 2ZGOA 5I0UA 5HPOA 3VZOA 3ST7A 1TMF3 2Y0OA 1W6NB 2FZ1A 3O0XA 3PVBB 4JTNA 4XUNA 4AHZA 5FUNA 2C9KA 1RUD3 4HLTA 5AC91 3APBA 1VR3A 2C26A 3N7KA 1OD3A 5JPNB 2CSGA 2XQRA 2A6ZA 5JAXA 1KRIA 4GWNA 5LY2A 3RI9A 4RR3B 5F39A 2ZGLA 3IDEA 4C1XA 4IDZA 4GKYA 4DO0A 5C5TA 5A7NA 1UPIA 1W8ZA 2TUNA 3OGVA 3FFZA 1YI7A 3VL8A 4DY3A 2VNVA 3KGZA 4QGLA 1JZ4A 5A1FA 2WO3A 3MGUA 4XMAA 1QMJA 4L9BA 1SEFA 1WLWA 4LKEA 4BMEA 3RZZA 3DEMA 1OI6A 4GH4A 4RQPA 5AC92 1CAXA 1UY2A 5FXZA 2X53S 4GWIA 2XHNA 5BNPA 1WLCA 1GWMA 5T50A 3WDWA 1V0AA 3LD8A 4QPGA 3AP5A 4XEZA 1CN1A 4CEYC 5GZGA 1YUDA 4OQ9A 3POWA 1CPNA 1GZWA 1TMF1 1YQ2A 2WWUA 3O5SA 2W47A 1ASJ3 4DQAA 4ZXKA 1BEV1 2UY9A 1RUD1 5T5PA 1CD3G 1XYOA 2OYZA 4XVHA 3LWCA 3WUDA 3K4DA 3JQWA 4WZFA 5CFDB 3INAA 5ABJA 3QLQA 2PFWA 4AI0A 4YZ5A 4FBFA 2D3PA 2YMZA 2ENRA 2GN3A 4ISQA 4Q26A 3RYKA 1GNHA 2UY8A 3LDBA 1YQ5A 4CDUA 4N43C 1NZCA 5FY5A 5A3PA 3V0BB 3KMHA 1KD7A 1QOTA 4P9JA 4YM1A 3ZKUA 4A7YA 1WCUA 5L73A 1ALYA 1UY3A 2YYOA 2W0XA 3IT8A 3PU3A 5FV3A 1BEV2 4CE8A 1SFNA 1W2TA 3NJYA 2GNDA 3LPGA 3P6BA 5DAXA 3MIDA 2Y38A 4CCLA 2GC3A 2GAUA 1S0EA 1H1MA 3H0OA 4NN0A 5C5UA 5BNOB 1V6IA 2YDEA 3EXUA 2W08A 4NVPA 4BE3A 5CKNA 2RV9A 5IVCA 1BJQA 1JI6A 2JDYA 4TZDA 2QQNA 3NV1A 2R7EB 2B46X 1AXKA 4GMP3 3E5UA 1DQ4A 1H4HA 2BYVE 2R49A 3MHZA 3NMBA 3VBUA 4D94A 2K9ZA 4HBNA 4HL0A 3GYDA 1HDKA 2HKXA 1VRH1 3CNAA 4DMIA 5KBFA 3BI3A 3S0MA 3NAPA 2WQ4A 3U4SA 3LEGA 3B3QE 2D6KA 5IVEA 4ONUA 1RUF3 4D8MA 3VDDA 3MDPA 4BB3A 1HJFA 3FMGA 4AFBA 4CA9A 1DGWX 5FP8A 3BTXA 1W9TA 1QJX1 4OI1A 3SNMA 5KXCA 1F9KA 3UL2A 1U12A 1NLRA 4AGVA 2V73A 4CCMA 1NA1A 1YIPA 1WBLA 2GN7A 2JKBA 1KFUL 3A21A 4JVAA 3VHPA 4XMIA 4AK3A 1VRH2 4K21A 4TTGA 5DQ0A 4K40A 4N90A 2WZEA 1W03A 4J1WA 4FPJA 4AVAA 5C8CA 2EICA 2AGSA 4GMP1 2P3YA 4S2HA 3VB9A 1O5LA 3HN3A 5C4WA 4LJHA 1PMHX 4YW3A 1XRUA 3IAPA 5DN2A 2LTNA 3UJQA 3NV3A 2ZKLA 4GB31 1VBA3 4FAGA 1CGPA 4LBNA 3K51A 1QJX2 4N7UA 2NPIA 2W92A 3H50A 5CZKA 5JSOA 2CGOA 3OPTA 2VBPA 5JMOA 3IDAA 5LA9A 1AYM3 5D8AC 5FXWA 1L7QA 3WP4A 5A3NA 2WA4A 1JZ2A 1DU3D 1RUF1 1H1IA 2MEV3 4A44A 5C33A 3DV8A 2W5FA 2H0BA 5C3OA 1H30A 5C3SA 3ZX7A 3OEAA 3Q8CA 2GH8A 1DLLA 4ZU4A 3I3MA 4BQ4A 2TNFA 3RZLA 3VBHB 3HQRA 3NW4A 3DPRA 1EV13 1C5IA 2H0VA 5BNNA 5I91A 2VOWA 4M4PA 4I02A 3AMMA 4GB32 2YPDA 1J3RA 2EALA 2OT7A 3BOPA 3C3VA 4XBLA 4EROA 5CFCA 5GZEA 4QPWA 5JXGA 1UOBA 2YGLA 4R9CA 3O0VA 4K1ZA 3TOJA 3ZYIB 4Y1XA 4LLOA 3NSTA 4NR1A 2RHPA 1Y3TA 4E2SA 1NUKA 2BNNA 3VGIA 5JR2A 1VBA1 5EJ3A 5F8PA 5K0UC 1GR3A 1WZXA 2ZEWA 4QKFA 3VD7A 4BMBA 4CCNA 1HRI3 3UK9A 4ZHNA 1OOPC 5GZDA 1QEXA 1V6OA 3BUCA 1H0BA 1R1A3 1V00A 4GH4C 4K8FA 4AHWA 1Z7S3 3N9MA 4CDWA 2VCCA 4QB2A 5BNPC 2EIDA 2ZX2A 1UKRA 3SMHA 5EWSA 3DXTA 2AEYA 2D3SA 4L92A 2OZJA 1MS8A 3AB0A 4KU7A 5EQUA 1UY1A 1XYNA 2W52A 1BVP1 3ASIA 5FY9A 1ULOA 1TNFA 2PA7A 5FZ4A 2WS93 4Q4X3 4UW3A 2WKKA 5ABJC 1VBA2 4EZHA 2Q4SA 1QU0A 2W1UA 2YHJA 3LA7A 3ZFGB 4I3GA 1EPWA 3AK0A 3LFIA 1ZZ6A 1LEDA 2QQMA 3M2MA 3JUUA 4XQDA 2BV4A 3VBFC 2NMOA 3QD6A 4QU1A 3M4FA 4YM0A 4Z82A 4BCUA 4CRQA 2FD8A 2GZWA 2HH9A 3IPVA 4S2GA 2ZHMA 4PDWB 3MIGA 2JIJA 4E2QA 4XUTA 4S2DA 3LEIA 3L9JT 5EFUA 2WSUA 1PZ7A 2PHFA 3D5OA 5FOBB 1QOSA 2GDFA 4CXWA 1TG7A 3BTYA 4Y5SA 4OI0A 4XJAA 3PTRB 3B94A 4CP9A 3ZFEA 2E9QA 1NCQB 1Z7S1 1B35B 2AUYA 2SLIA 4XBNA 3ZMOA 2IXCA 1LB2A 3ILNA 5A33A 1A6CA 3WY6A 1SQ4A 2F6BA 5FWJA 3MV11 5A1AA 3ACHA 4AEDC 4LO8A 3ZXEA 2GNMA 4LK7A 1K5MA 3IN9A 1UY0A 3R6SA 2EIBA 2Q1ZB 3KV4A 1ZZBA 1HQWA 3WLUA 1XNAA 2Z42A 1VJ2A 2BOIA 3E6DA 1H8TA 2QBXA 4PI2A 3TN92 3T09A 2DCYA 5FZFA 2QZ2A 2PHWA 4B4QA 4YSFA 2WS91 3AJZA 4Q4X1 3VBUC 1AL23 5CADA 3VDCA 2Q5TA 2VPVA 4DNYA 2IUWA 2VUAA 1CAWB 5L9RA 1YHFA 1Z7S2 3FLRA 1WCKA 3CL1A 5A3LA 1DBNA 3OY8B 3GJBA 1DIWA 3BYWA 4FPHA 4LULA 4GA9A 1VAVA 5FZCA 1JW6A 2P3IA 4AI2A 1N3PA 3VD5A 1OA3A 1SPPA 2C9AA 3KHCA 4I0WB 5HCFA 5BNQA 5FOJB 4CU6A 1YCIA 4D6RA 1H2NA 5DUWA 2A3XA 2GSYA 2WS92 1OA2A 3LDKA 4LO7A 4M4RA 4Q4X2 3ZYJB 5FZGA 1NA1C 3VBRA 4B7EA 4LO4B 4IEWA 2WINB 2IXLA 2JG9B 1LOEA 1NY71 1VAKA 2I45A 2BNOA 1JOJA 1IKQA 1OD5A 3AZZA 3HT2A 3HD8B 5LBFA 1PVXA 5CEHA 5I8TA 3MF6A 2B7YA 3W59A 4EJRA 3G6JB 3PDQA 2VMFA 2O0OA 1HKDA 4YZ3A 1AR63 2J1AA 4Y4YA 4QHOA 3D0JA 4IE4A 2VZ3A 2R1DA 2ET1A 3RJRA 3FX3A 4B1MA 2FBEA 1F35A 2VZPA 1UO9A 3SKVA 1CAVA 3PNAA 5F3CA 3T2OA 1POQA 3MFAA 2HWE1 4MHRA 2CGPA 1JHNA 4XQWA 4BU2A 2XJSA 5ISLA 1JMUB 1NY72 5ANNA 1XB9A 3U1XA 4MG2A 1AR83 1H2LA 1RJ8A 1UZ0A 2RR11 3BOWA 4DRVA 5BY5A 1LAJA 5CNAA 1GZTA 2DVGA 1MVEA 2X5IB 3DPRC 5CA6A 1JUIA 1GP4A 3OYWA 5FLIA 1YC61 1GSLA 5FR3A 4JGZB 4JDNA 3WW1A 2XWJB 3I59B 4JAAA 2EAAA 4CDQC 4BQWA 5A3OA 2DFCA 1MVQA 3PURA 3B9CA 4MZUA 4K3UA 1D0GA 5EPAA 4TLGA 5K7PA 2WT2A 4ITCA 5CISA 1JH5A 2CYFA 2AC1A 3MIFA 3BPSA 1AR61 1WW6A 2HWE2 2X09A 3PJQA 1ZZCA 2DVAA 3ON7A 5FKCA 1FOD1 2RR12 4CPBD 4IV3B 4NHKA 5TSWA 1UU5A 5IAVA 1W06A 1YFWA 2QNKA 5LRRA 3LE0A 4ZZ8A 1G86A 4HKWA 2OA2A 4XACA 4E8CA 5J37A 4JX0A 1W8NA 2VAUA 2RJLA 2E51A 3AZWA 4V1PA 1ZZ8A 5AVAA 1F8VA 1QDCA 1AR81 2D6PA 1KDMA 1T6GC 5L36A 2D3RA 1HV0A 2PXJA 4YM2A 1AR62 1NXMA 5CG8A 1S0DA 3RYRA 4QGMA 4L99A 1X8MA 1FOD2 4P5HA 2IXKA 2G19A 2OUJA 2VCBA 4UBGA 2E7TA 2C5DA 3KLSA 5A32A 4IEZA 4N53A 5FPVA 5FK7A 1F4HA 3O0WA 4RN5A 1LNSA 2IC1A 5FO7B 1OPOA 2XL9A 2BNMA 2I2SA 2IWGB 5J98B 1YLLA 1UYXA 1DHKB 3NJVA 4B4RA 4CEWA 5DG2A 1AX1A 1AR82 2IXHA 3RSJA 3SHRA 1PVC3 1J84A 5T54A 2PHUA 3M3OA 2PTMA 5FZ7A 5FZHA 3WDXA 1W6NA 2XBO1 4J6GA 2WYSA 3SH4A 3TEXA 3CJXA 5FYMA 4Q0SA 1UNBA 4XFFA 1QDOA 5EJ1B 3ZN5A 3U07A 5G04L 4MVTA 2VQAA 1LODA 2R32A 5D2AA 5EV7A 5FZ8A 2BEOA 4YGDA 3RWKX 1UCXA 1VMHA 1J1LA 5C3PA 1UY4A 5HCHA 3AMNA 3WCRA 2O8QA 2CDOA 1JZ6A 4RR3A 3ACIA 3KSCA 5G05L 4XIKA 3AYAA 5FP3A 5FBZA 2IXJA 1SACA 5DDJ3 4QX7A 4HKOA 3ZFFB 3K3NA 4CZSA 1X36A 5AFBA 1DF0A 1WMXA 5FMOL 3SH5A 1XC6A 2XBO2 3OD4A 1NXD1 1JTZX 3HNYM 4NOTA 2NQYA 3K4AA 2G9GA 2YY1A 3DYOA 4RFRB 3UGGA 4XJZA 2P34A 3M3EA 3O1UA 1W04A 1AL0G 1S0BA 1WW4A 2UYBA 5A7OA 3RS6A 1UYZA 1RMU3 4K6BA 2P6HA 3WDYA 4IERA 5C9AB 3RZGA 1A3KA 1YYNA 1OBNA 4IV1A 1CZVA 5CFDA 2VCMA 4CYDA 3CJIC 2ZS6B 1D4M1 2QDRA 1H8VA 1ZBE3 2ZXQA 4ARYA 5FY0A 4UFIA 4QB1A 1RUOA 5LBEA 5DZEA 3GHMA 3ZYBA 3N9LA 3FBMA 1S4CA 1MQTA 3SKJE 4AFDA 4EWEA 3V0BA 5DDJ1 4H55A 4ATEA 5J48A 4NIAA 3DCQA 1W0NA 1GNYA 3LIHA 1ONAA 1AR73 3QACA 5KWRA 3KT7A 4IEQA 2Q8CA 3IIIA 3ENRA 5JI9A 5KHHA 5F2SA 1TVGA 1H2MA 2P4EA 3AXEA 2W3JA 1W2UA 4SBVA 1CWPA 4OCTA 4DINB 1RUG3 1RJ7A 4X8PA 3RVHA 1MEC1 4C0BA 3KF3A 1D4M2 1ST8A 5T3NA 5BNOA 1VBE2 1XJAA 1XYPA 4LEJA 1PM4A 1J1TA 2BRTA 2V4VA 3M1HA 1IG3A 1PM7A 1OHFA 1Q8SA 4UOJA 3H3ZA 5I8SA 3AZYA 5JXIA 3PHMA 4LHNA 3T3YA 2A75A 4NAMA 3O1TA 1HXS2 1LOFA 1ZBE1 4BQXA 3M3CA 2ZHLA 2ZMKA 2DCZA 3ZN4A 3HPNA 1O4YA 5F5QA 4AI1A 4FO9A 4HMZA 3BU7A 1JBCA 1AJOA 4HSJA 2WSVA 4Y20A 1DGLA 1MEC2 2O1QA 1UIKA 2JDNA 3JD73 1AR71 4QU2A 2PQSA 4XZPA 4RHV3 4PCRA 4FFFA 2QQIA 5FZAA 3N36A 4AEKA 2AZ5A 4H7MA 2ZGPA 5J1XA 2W1WA 3IM0A 4MYEA 4AVTA 3OEBA 4OZOA 1HX6A 1RUG1 1MS3A 1PO23 1MZFA 2GMPA 3KWVA 4LR4A 1I5ZA 3ME2A 4N9HA 4D7TA 3E6CC 1ZBE2 2CHHA 3NL1A 3O14A 5D1IA 3BGAA 1IGOA 2DCTA 3J7LA 4XE9A 1H2KA 4HT1T 2ZX3A 3VBOB 4B1LA 4EYUA 4JKMA 4QKNA 2YBSA 1CQ9A 2BOJA 4YG0A 5FYTA 3D8CA 3PVOA 4CPBA 3T0AA 4HXCA 3I3QA 4KGQA 4RGGA 4F7ZA 3K75B 1PHMA 1ND2C 4QGNA 5HV0A 3OBZA 3ZN6B 2ADEA 5K8SA 2YZ4A 2HWF3 4N53C 1JS9A 2LW8A 3SEPA 4I09A 3MPPG 4XFCA 4XAAA 1WD4A 3LQCA 4Z2WA 4Q4V3 3GCXA 3T2PA 1R083 1RUG2 1QJU2 2VNRA 4H7LA 4JTOA 5CAZA 2JIGA 2QQLA 4J25A 4CUAA 4OHVA 2KR2A 1GQHA 4FFIA 2FZ2A 5L7OC 1NLSA 5ANQA 4WM8B 1SZBA 2JECA 5GLTA 4CDXC 4RHV1 1LRHA 5C71A 3LSDA 3GZTB 3MF9A 1EY2A 3D3AA 4YZ4A 3LCPA 3T1MA 2CTVA 2GC1A 3Q8EA 2BQPA 3VBHA 4BK5A 4NIGA 2R1BA 2YXSA 2PHRA 4BXFA 3MW2A 4DIQA 3DGTA 1N1SA 2VVDA 1ZX5A 5H9PA 2FDHA 1EAH3 1OA4A 1MZ5A 3AKQA 4O7XA 4NPRA 5A1LA 5IFPA 2V4AA 2HBUA 1FX5A 2VOTA 5LBCA 4CSWA 2VTXJ 1RUJ3 5A6ZA 5KHIA 3ZMNA 4YW4A 2FCVA 3DF0A 4W8JA 1O8PA 3SLIA 2PAEA 3QH6A 3A0NA 1FI2A 1RHI3 3LZZA 4RHV2 1ENQA 2Q8OA 4B29A 4PJYA 2HWF1 5E1RA 3WXPA 2AYHA 4QKDA 1NCRC 2AEZA 4IGQA 4Q4V1 4LLFA 2VNOA 4JRAA 3TBDA 5F3IA 1R081 5KHKA 4K8RB 1ODMA 5JLVA 2XVKA 1Y9MA 3ZSMA 1OC1A 1HRV1 1W8FA 4GWMA 2C1FA 4ISRA 4LKSA 3OJBA 3HJRA 4AR2A 3POSA 1DCSA 2JE7A 1FNYA 1H1AA 1V6KA 1YNAA 4JQRA 1G9DA 1FAYA 3CO2A 4RL7A 3KM5A 4HVQA 3DUIA 4KBBA 4P9WA 1UAIA 2QQJA 3IBMA 4IV1C 5FZLA 5CFDC 1W2OA 4QPYA 3C7EA 4W4ZA 1EAH1 2R30A 4QXKA 3VBSB 3ZFGA 3ZKYA 4QPIC 4CCOA 5K9YA 2HWF2 1WMEA 1ND3C 3KHBA 5C6CA 2XKPA 2WNUB 1CX4A 2CNAA 2RDSA 1RUJ1 4Q4V2 1GYKA 3WF3A 2YB7A 3AP4A 5GLVA 1W9FA 4PHZA 5B4NA 1MQTC 3KVBA 4PDWA 5DZGA 1LKNA 4BZ4A 1I6XA 2DDUA 2F4LA 3GDBA 4QX3A 4TYSA 4W6XA 4FOQA 1W0PA 1BYHA 1UL9A 2HLEA 1GMMA 2Q1FA 4N9IA 1HRV2 4Q1RA 4XXAA 2Y8KA 1R1ZA 1RHI1 5J3UA 4XURA 3OGSA 4XUPA 2A6WA 1EUUA 2WO1A 4M0NA 5E89A 1BXHA 1NCQA 1XOYA 4MXVA 1B35A 1Y4WA 2ARAA 5F5IA 1ODNA 3RRDA 4NHYA 1SLTA 1REFA 4XC9A 1IQAA 1UZZA 1EAH2 5FZ0A 2JDAA 5KXBA 2BPA2 1O3QA 3WDTA 4HFSA 1CR7A 4DXRA 3BTAA 4FVVA 1QQP1 4W6YA 3SCFA 1RUJ2 2VZOA 1FYUA 2QQVA 1E5IA 4E4SA 3OCPA 2W94A 4NAOA 2DUOA 3VV1A 3ZYGA 2WNVB 2F4PA 4Q0PA 3UGHA 3ZXLA 2OX0A 1L7LA 4GKXA 3IDCB 4QX8A 3JB4C 4DXSA 3B93A 3JB8A 1VBB1 1R093 3BB6A 5A3TA 4C90A 4AQTA 4G3YC 1IS4A 3AXDA 5FY1A 3H1WA 1J59A 5IK4A 2ZBJA 1LHOA 3DYMA 1A8DA 3KD4A 3OY8A 3WDVA 1D7PM 2ZZQA 3E6BA 4WM7A 3PVNA 4CU9A 2X29A 4AQ2A 3OGRA 1Q8VA 3W58A 4BM8A 2VBDA 5I0RA 3O1OA 1K45A 4XYXA 1US3A 1QQP2 2VZQA 1VALA 4XW3A 5F5AA 1Y7BA 3GGLA 4EN7B 1W6MB 1US2A 2OZ6A 1HV1A 5A3UA 1C5HA 5DG1A 1LECA 3A7QA 4HONA 4XXPA 4IETA 3U75A 3MV01 3H8OA 2HWB3 1VBB2 3RZMA 5FZOB 2JG9A 3AVRA 4HN1A 3ILRA 5FZIA 5IW0A 3VZJA 1O3TA 2WT0A 2YPJA 3N7JA 4R9BA 4LBKA 5LBBA 1ZBA3 4OUSA 2BVBA 3U14A 4ARXA 2JDPA 2SBAA 1KDKA 2KA3A 1COV3 2FQPA 2VMGA 2OQ6A 2W39A 3IKWA 1D2SA 5LY1A 1GZ9A 1BK1A 1W6OB 1W6QB 2B42B 2DVBA 1R091 4A4AA 1DLCA 3N9PA 3ZOIA 1UD1A 1A8MA 4R9AA 5FPUA 3VZLA 1TMF2 1PK6A 1WUVA 2X10A 2LROA 4Y22B 3G7DA 1HN1A 1QH7A 4OVEA 1RUD2 2VL4A 4XZUG 5IVBA 3LKJA 3RMYA 4ORFA 3UETA 5KR7A 1DYPA 2D6OX 2DTYA 2RDRA 4BIOA 4I01A 4LE4A 4LOSA 1GWLA 2D40A 4DEVA 4CCDA 2DYCA 4LA3A 1AX2A 3O1SA 2FDIA 1ZREA 2F17A 2X5IA 4YGCA 5LWBA 2QQPA 1OLME 2C6SA 4HETA 1ASJ1 3OGJA 3X29B 4JGZA 3TEYA 5JZGC 3I59A 2HWB1 4CTEA 4XDPA 3MLKA 3FZ3A 2HEVF 3V64A 5I0TA 1D4VB 4QKBA 1QXJA 2E26A 1ZBA1 2XJRA 4FI9A 3FHIB 1S0GA 3I2HA 4YZ1A 2NZ9A 1L7RA 1COV1 2IVIB 5FZBA 3ZPYA 5FIXA 1YXWA 3HVDA 2P17A 2Y6GA 1REDA 5FZ1A 3DL3A 2E7AA 5IYYA 4MOAA 1URXA 2D97A 2TEPA 3HBKA 4IV3A 4XQ4A 3B9IA 1CIYA 3IB3A 4XDQA 2FMYA 4FPEA 3T2QA 2VZRA 3BODA 1H6YA 1ASJ2 3S30A 3I2KA 2ZA9A 3H9AA 4JDOA 3UGFA 3PIJA 2HWB2 1NAEA 2VOKA 5C3RA 4ZONA 1SFPA 1TE1B 1AHSA 2WQZC 5FZ9A 3ZDVA 4P9GA 1LU2A 3OTFA 4AOCA 1IQDC 1S55A 2B4KA 2J1TA 3PUQA 2OXBA 4IEUA 2JB8A 3MYXA 3UJOA 4O61A 3ZXKA 4XIOA 3U4XA 1LGCA 4KBZA 4XETA 1CIWA 1UWWA 3D4KA 2QZ3A 5JOYA 2UURA 4NPLA 4YVWC 3SQOA 3KS7A 2JENA 3MO4A 3QBQA 4CEYB 4COYA 4A45A 3MIBA 4LPLA 1UXXX 1SDDB 2JD4A 4HK9A 4PDWC 1CPMA 2WRAA 3N7LA 2GU9A 2NMNA 4OHXA 4LUMA 3WG4A 4JKLA 4KWLA 3T0DA 3I2IA 4O9GA 4UT5A 3ES4A 4ZZ5A 4YGBA 2P5BA 4PIZA 2RG4A 5C70A 1Q8PA 3USUB 1O7FA 4D7SA 1BQPA 5E16A 2DURA 5JIUA 3H1YA 4XFHA 3IZOA 3K77A 4XHBA 5SV5A 2VMIA 1N3QA 1MS4A 3FHAA 4TXWA 2JG8B 2OS2A 4N43B 4HOOA 5APAA 2CAUA 5FO8B 1LOBA 2BFUS 5FMBA 3OPWA 1A34A 4D6QA 3CKHA 2BVVA 2DV9A 2VUJA 2OIIA 4GIQA 3E5QA 4OMDA 4AW7A 3WVJA 4F83A 1GQGA 1ZNPA 2I07B 4IXLA 3Q8AA 2E33A 4KH9A 5KC6A 1DZQA 3VN4A 1RUF2 2RM23 2K46A 2XB6C 1O3SA 4LBJA 2D6NA 3AKTA 4E9KA 3GCWA 2WAOA 4MO3M 4QDQA 4E27A 3BIWE 2DCKA 1UX6A 2EXIA 2R043 3WNMA 4MGKE 5LA0A 4NRPA 5F6KA 2ZEXA 1ZRIA 3LPFA 1AYM1 5FLHA 3WQBA 5T5JA 4RQPC 4WM7C 3TEZA 5SV8A 2MEV1 3ZXGA 2XWBB 2VUCA 3C7FA 5FBJA 2A71A 2ZEZA 4U36A 4COWA 4QPGC 1ZM1A 2QE3A 3DXUA 3PUSA 2ERFA 5CVRA 1EV11 3GXUA 4RS5A 4L2NA 3HQXA 1DFQA 1OXCA 1WCSA 2FCUA 4Z2AA 5BUVA 3QOPA 1LJ7A 2KM2A 2ZHNA 4EQVA 5CKMA 2EF6A 2BGOA 5IVVA 3GZEA 3K4ZA 4L11A 5JXJA 1AYM2 1IS5A 3H7YA 4EWAA 4CDUC 1CAUB 4GQ7A 2O8OA 5FYHA 2MEV2 3S5AA 2BGPA 2W2IA 3B02A 3JQXA 4K20A 1GZCA 4FAHA 1JU4A 4R9DA 5JDBA 1QWRA 1LOGA 3WP6A 1G9CA 5A7PA 1X82A 2XR4A 2WABA 1LGBA 4NWWA 1HRI1 2RMU3 3AKRA 2WC2A 3KCCA 1PK6C 5A3MA 4HANA 1KS5A 4BLJA 1EV12 1R1A1 1V6MA 3WX5A 5I0SA 2LRPA 3RMXA 4YGEA 2AACA 1ZRDA 4M3CE 3POGA 3OGGA 5T5LA 4YLZA 2XUEA 3WCSA 2DBIA 1X9PA 2HBTA 3AL5A 4Q8LA 1VRBA 4Z92B 4BQ1A 3IAQA 1XU2A 3N3HA 4Q0UA 2VZSA 2KXLA 3K48A 4DZGA 1WLDA 1OVSA 3T08A 5J96B 4RA0A 3LF7A 4M3CF 5FYSA 4AEJA 3VZMA 1U5IA 1Q3EA 5D8AB 5FZDA 1GANA 2XVGA 4QQPA 3M7AA 3POFA 1VMFA 2R063 2VZ1A 3N7MA 5KHJA 2R0HA 1M06G 1K12A 4FT8A 2VMDA 1HRI2 3MEPA 3MIEA 3EJKA 2XHKA 4M00A 4OQ8A 1R1A2 3LGRA 2NYYA 3NAPC 5FWEA 3LSEA 4XAEA 2VOXA 1WCQA 1ULCA 1IS3A 3ZXJA 4MV2A 1QH6A 2KD7A 4NHXA 4BOWA 1KITA 4I0AA 4JQTA 3VDDC 1SBDA 3IMMA 4LUKA 4IV3C 4BQYA 4URAA 1DGRN 3WW3A 4OI4A 2RMU1 1W9YA 3CZUA 2MHFA 3NKTA 3ATGA
chains in the Genus database with same CATH topology
1WMDA 4AEMA 4M01A 4Q2FA 2UWAA 5IK7A 4YW1A 4XF9A 5DXDA 5JI7A 2NLRA 3T2TA 3ALQA 3WW4A 3W9AA 5KC5A 1CONA 4YFZA 5K0UB 5IUQA 2VU9A 3VBOA 3VKOA 3WQ7A 1OOPB 1I9RA 3M3IA 4WZCA 4GH4B 3THPA 5C8CC 1DDLA 1PO13 2R061 5CIRA 4XF0A 4F8AA 5BNPB 5C4WC 1LHWA 2XLAA 1AL21 1W39A 5BYNA 2B45X 1CJDA 1XQNA 5HCBA 2RMU2 4AFCA 1IS6A 2XL7A 3HWJA 4JCKA 2Z5WA 1RVF3 3WOGA 4YNIA 4HK8A 1U0AA 3ZVXA 1RITA 1TEIA 5ABJB 3IWZA 1M4WA 4LBMA 3QCWA 4XF3A 3VBFB 3VKMA 1Y9QA 2Q1MA 5BNNC 2R062 4IEPA 4JGYA 2WT1A 4PLMA 1AL22 2XJPA 1SDWA 1V9U3 4PIYA 1ZA4A 5CFCC 3KQRA 2VECA 4OHZA 4LBQB 3URFA 4OHWA 2AH2A 1Q43A 1LESA 1XNKA 3AYCA 4AEDB 5JPMB 1ENXA 2I74A 2WFPA 5FQ0B 2CGNA 2LM3A 3IDBB 4Y1UA 2VGDA 1RVF1 4R4ZA 2VVFA 5J09A 4IQPA 4CDWC 3VBUB 4FPLA 2D5HA 3O7OA 4AF9A 1H9WA 3AMHA 1LU1A 2GH2A 3NWKA 1KXGA 1X7NA 5DUUA 4FSJA 4RS5C 2JDZA 4JV4A 4LE3A 3ZYPA 5CBLA 2GMEA 1QNWA 3IIAA 4DB5A 3MI8A 4PBPA 3VKFC 4BIFA 2WFF3 1V9U1 4FTSA 2WNUA 1DQ0A 3NKGA 2D6LX 4CP2A 2DCJA 3V0AB 5LK7B 1RVF2 3ZSLA 4B7KA 1X33A 3GBWA 4EN8B 1BKZA 3UKVA 4Y24A 4YG6A 5DUVA 2PYTA 2EXKA 1V6LA 2DUQA 4IEXA 4AFAA 3NO8A 3ZFEC 2LALA 1JYCA 3MPBA 3WHTA 4Y1ZA 1FXZA 1AUYA 1S2KA 3M70A 5ACA3 1K5MC 1JXNA 1V9U2 3HBZA 4WV8A 5J7MA 2VMHA 3L2YA 3WUCA 2ZZJA 1H8TC 3HIFA 4IEVA 2RJKA 1F2NA 2ZGQA 4A7ZA 4G9SB 1AJKA 4Y5Z0 1NQJA 4COVA 1FMD3 2WFF1 5GM0A 3ES1A 4R8HA 3MLLA 3PMEA 2Q0AA 3ZIXA 4PQ9A 1BZWA 1GICA 1KQRA 3DPRB 2ZGRA 2VY0A 3OF1A 2GMMA 1E57A 1BBT3 3OPZA 3VZKA 4I30A 2WZR3 4CDQB 4DY5A 3IMNA 4OHYA 4YRDA 1PVC1 1LGNA 2UYAA 1SCRA 2EA7A 3AFGA 2XLFA 4O9EA 3UKTA 1RGSA 2BGCA 4AQ6A 3I8TA 3VKNA 2WFF2 3VBRC 3FLTA 2BWAA 1S0IA 4WBBA 1POV0 2ZX0A 3CEWA 5GLZA 2RS53 2DU0A 3GBFA 3NJZA 4PLOA 4XFAA 1YJLA 3FLPA 1WBFA 4XJUA 3RYPA 3LA2A 4YVSB 2ZOEB 1PVC2 4MUVA 2XLGA 4Y22A 3WT3A 2B39A 3C2UA 1XNBA 5JCTA 5JVVA 3AX4A 2WZR1 3TB0A 1G9FA 5DUXA 1YFXA 4I0BA 4XILA 2VVEA 1D2QA 1LCLA 1RMU1 3J4UH 1PZ8A 4ES8A 4QD2A 4D7YA 1HLCA 4JGYC 3MFCA 5DDJ2 4H3WA 2XJTA 1HQLA 4UXAA 2RS13 4TWTA 1ULDA 1YJKA 2Z2SB 4Q4Y3 1Z0HA 2RS51 1V6JA 3B01A 3GZUC 1KJRA 1O4TA 2Q30A 2PLV3 1VAMA 4EN9B 2WZR2 3J8F3 5EYYA 1VBD3 3B69A 1C1LA 4M3CB 3I54A 1RMU2 4R52A 3AKPA 3D82A 4P9IA 3ZIWA 3BCWA 3OBTA 4KQ7A 1W6PB 2D98A 3Q9OA 4MGYE 2R6QA 4ZU7A 4FTBA 2RS52 3H3UA 2QUOA 2PN5A 4LTAA 1VB4A 4AI8A 1DQ5A 2A70A 4AQSA 4DOUA 1ENRA 1ZZ7A 3RI8A 4NHLA 3L2HA 2RS11 1BMV1 1DYKA 1PGL1 1AR72 2UWCA 2WNUC 4CEYA 4Q4Y1 4Y26A 2VW1A 2B5HA 4LA2A 4AI3A 1X50A 3WDUA 3JBG3 2PLV1 2RS33 2ZKNA 4P9YA 4LBQD 2ARXA 1VBD1 4HSLA 4CEWC 4Q4W3 1ZRFA 3JD71 3USUA 3CJIB 5JIAA 3VL9A 3THTA 5JSPA 2JG8A 3LA3A 1UKGA 3I7DA 1PO21 2ZMLA 3R05A 2ZGKA 1NG0A 1PGL2 1JYIA 2EAKA 3D6EA 4Q4Y2 4RR3C 5BPXA 3ZSKA 4KWJA 2GNTA 2PLV2 2WL1A 4L97A 1CAVB 3GALA 1PGW1 4OI2A 1AZDA 1QF3A 2BW8A 1VBD2 1C57A 1RUC3 1DQ1A 3JD72 3NV4A 1U5XA 3QH7A 3POYA 2A6XA 4HVRA 1WMFA 3EHKA 2MPFA 2VQ0A 3JBG1 4LBLA 2RS31 4XBQA 1MZ6A 1PO22 2ILMA 4GXLA 2ZACA 1G9BA 1SCSA 2HEYF 4Q4W1 4W6WA 2K2SA 4OLLA 2EVXA 3ZXAC 2DF7A 1AYN3 4OFGA 1N47A 4ASLA 1REEA 4KNCA 3I4IA 1PGW2 4MXWB 5FAXA 2JICA 1HQNA 5LEKA 2CY6A 1GBGA 1QNYA 4FQZA 2WIIB 3JBG2 4LHKA 1CAUA 1R082 3B00A 2BFUL 5FDBA 2RE9A 2D7FA 1KFXL 1VBC3 2P3JA 4Q4W2 4IL7A 1AXYA 3EBRA 2NN8A 2A6VA 4OULA 2PELA 2D5FA 4RGAA 4I2OA 1UU6A 1DZRA 5FREA 2NP0A 2H6CA 3RPQA 3LOBA 4H14A 1UU4A 1AX0A 1ND2B 4Q1PA 5BNOC 1AYN1 1LHVA 1G7YA 4N53B 3WP3A 4J1XA 5F1RA 2NM1A 5D8AA 2CAVA 2QVSB 1FNZA 3U10A 1JUHA 5JOZA 1RHI2 2TBVA 5L7OB 1LOFC 1IZ3A 4XJ8A 4CDXB 4A2UA 3MLJA 1YIFA 4LNVA 1CAWA 4LO6B 1BEV3 3S7IA 1RUE3 1F5JA 2WJSA 4G4FA 1VBC1 4P9XA 2WA3A 2ZGTA 2OVUA 4N7IA 2GC2A 1OFNA 1AYN2 2VXRA 3ACLA 2YGMA 4QQ2A 4TSVA 5FLJA 4JRLA 4BWOA 4AVCA 2DUPA 5T52A 1RINA 1RIRA 4NO4A 4WVWA 1PGSA 3AYDA 1NYWA 3NVCA 1GFF2 1CJPA 1G9AA 3HR9A 1SBFA 3FE5A 5K0UA 2A3WA 4Q29A 4RSUA 4X6RB 3MIHA 1POV3 2IFRA 1OOPA 3J26N 4CP0A 4EWDA 1NCRB 2N7GA 3E5XA 3ROUA 4DRRA 1VBC2 2A6YA 1OQDA 3ECQA 2ZTNA 3PMSA 4P9LA 3ZXFA 3ZYRA 1RB8G 5LRSA 2YUEA 4AWDA 1O4ZA 2H6BA 1N1VA 1RUE1 3ZSEA 4HPKB 3HN1A 3H8UA 4IV1B 4UW6A 4L8QA 4QT6A 4AFMA 4A7KA 3KT4A 3ELNA 3O12A 1OMIA 4QPIB 5HBAA 2HJIA 1C8M3 1ND3B 4INDA 4K1YA 1VRH3 2R16A 1RUNA 3VBFA 4UBHA 3VBHC 1V6NA 1YFYA 2JG8C 1MQTB 3BPZA 3D0SA 3B7MA 4Y1YA 2Z79A 3LB9A 1R092 3TRSB 3RG0A 2E63A 2ZJCA 3GBGA 1POV1 1QJX3 3P3PA 2DVDA 4LBQA 1RUE2 3CF6E 2ZX1A 1EYBA 2YC0A 3AP7A 4AEDA 4COZA 1Q8OA 1OSGA 5FQ0A 4DPNA 2IFWA 3FFQA 1IOAA 3E97A 4P14A 2IZWA 4Y1VA 4CP1A 1U5YA 2GALA 3FC0A 2WZPP 1YO8A 4ASMB 1EP0A 1N1YA 4GB33 1C8M1 2VH9A 1ZBA2 1ZRRA 3TYJA 4XFBA 1COV2 3ZDSA 3U11A 1DG6A 2XPJA 2XGXA 4Y20B 1CESA 1MR5A 3ZFGC 4MGIE 4FTEA 3PTYA 1FT9A 3RQ0A 5GJ6A 1Z78A 4LHLA 5AVPA 5H9QA 5CB7A 3V0AA 1DGWA 4XJ9A 1I3HA 2ET7A 1OQ1A 3WP5A 3RNSA 3SCGA 1C8M2 4KG0A 3WG2A 1NQDA 5E88A 4D3WA 5I93A 2PAKA 4A3XA 4GULA 5FPZA 1NCQC 1B35C 3WNXA 4TLFA 3KCXA 5I8YA 2ATFA 4PLNA 1O5UA 4FPFA 4XFIA 3R0RA 1QOOA 1WCDJ 3AKSA 4NHMA 2P37A 1UMZA 3GNEA 2B8MA 3V56A 1MZEA 4MGZE 5FPXA 2D93A 3ZFFA 4X6QB 4LO5B 3AMQA 1OKQA 4R4XA 5CU1A 2OUHA 5IK5A 1H9PA 4F3JA 2XJQA 4DS0A 4NWVA 2VW0A 4FPOB 2QKDA 3JU9A 4K7JA 5JZGB 4FQ4A 3MW3A 4Z8BA 1IHMA 1YFUA 4CDQA 4Q0VA 1WGPA 2P2KA 4ZU5A 5GZFA 4PIXA 3MW4A 1NE4A 4BYYA 1WD3A 3ZO0B 5C9AA 2ZGSA 4WVMB 3TN93 1SMVA 4DXZA 4QQOA 2JG9C 1S0CA 4ZKTB 4FPCA 1LEMA 1C8NA 5JOXA 3FJSA 4IEOA 4IESA 4KWKA 3SH3A 4YFWA 1S2BA 4YVSA 2RM21 3AJYA 1B09A 1FATA 1KJLA 1EPZA 3SCHA 2R041 3WV6A 2A5ZA 1G6NA 4FOWA 2BBVA 1D0HA 2PAMA 4Q0QA 3DKWA 5KHGA 3ZSJA 1LULA 2D44A 4E2GA 4C1WA 1ULEA 1C3HA 2JE9A 2Z69A 1DQ6A 4YVWB 1VP6A 3N35A 4EV0A 2DFBA 1BCXA 2CWSA 2B9UA 2X5IC 2YROA 3WW2A 5IK8A 1ZYBA 5AFEA 3TN91 4JGZC 1RUI3 3PJYA 2RM22 4HVOA 4XJWA 2XH6A 1IPJA 4HKLA 2UU8A 2R042 4KGGA 1HIXA 5L19A 1HW5A 1UF2C 4W65A 2PHTA 2A73B 4BH9A 2ZAHA 3JCIA 1IPKA 4AGRA 1J58A 1Q8QA 1N1TA 2CV6A 4BA6A 2V09A 2QFEA 4M3CA 2C0ZA 2OPKA 1ZVFA 1W6PA 1VB2A 4YW5A 4MSVA 5F9TA 3RJ2X 3KGLA 1J3QA 4WVZA 3SITA 2K0GA 1W0OA 2R073 3AMPA 2HWD3 1RUI1 1ULFA 1O91A 4RQPB 4WM7B 1CAXB 4I3PA 2HWE3 4BHPA 3TAYA 1LOAA 4HN0A 1NE6A 5JMCA 3ZN6A 2RR13 4QPGB 1QHDA 1OLQA 1SLIA 4PF5A 4S2FA 2XVLA 4KU8A 4MX3A 1QJZA 1GZWB 3MICA 4D69A 3MZHA 5GALA 1VLNA 2ETEA 5EXOA 1F5FA 1DGRA 3R4UA 4XHXA 3FWEA 2DU1A 2ZABA 3CJIA 4WM8A 4BPZA 5GLWA 1XE8A 5T5OA 1Q56A 1S0FA 1APNA 2LUWA 1PNGA 5IT6A 4LBOA 1RUI2 5B2GB 4CDUB 1OFSA 1GKBA 1OPMA 1J3PA 2ZX4A 1FOD3 3SXWA 4E4ZA 1ZZ9A 5E8AA 1V70A 2DTWA 2AR6A 1PK6B 2R071 1U5ZA 4XFGA 1PNFA 2HWD1 1LTEA 2D6MA 2BWCA 2WLPA 5F6LB 1AVBA 3ZFFC 3AZXA 1PO11 3WG3A 1LOCA 3VHNA 1PMIA 4X8NA 2YV8A 1GLHA 4AHYA 4EN0A 3ILFA 3N4MA 2CWMA 2AENA 2HWC3 2UWBA 1XNCA 1SLAA 2XKOA 2R072 4QX5A 2HWD2 5C9AC 2XG3A 3NAPB 3P3NA 4MXWA 2E7QA 1PO12 2QCSB 5JSRA 3HAGA 4XF4A 3VBSA 2MNGA 5HCAA 3VDDB 2PQQA 4QM9A 3KCYA 1DZTA 4Q8KA 4ATFA 4FPGA 2XBO3 1QXPA 5LK5A 1QGLA 4YVSC 5FFOC 3H1MA 1NA1B 5C8WA 1JN2P 2VULA 3ZXDA 3OBRA 4LT5A 2PHLA 2Y0IA 5KXDA 2HYKA 3AM2A 4AVVA 1OLRA 5C8CB 1SLCA 3A0KA 3USSA 4YW2A 5C4WB 1S0JA 2HWC1 1TME3 1ND2A 2ZGNA 2JEMA 1OQEA 2ZMNA 3CU7A 5EYXA 2WNVA 1MACA 1XXNA 1TQ5A 4E4DX 4KG8A 5L7OA 4CDXA 1UIJA 3H7JA 3TNQA 4AYUA 1RC6A 3NV2A 2ES3A 4QM8A 5LEJA 3WQ0A 3WZ1A 3FBYA 1MS1A 2WLQA 3RDIA 5BNNB 1QKQA 2JJ6A 2HWC2 2EXHA 5DZFA 5GZCA 2ZGMA 1D4M3 4SLIA 3LOIA 1VBE3 1W6MA 5CFCB 1QJY3 4HZFA 3SISA 2QDNA 3S6PA 2GNBA 1QXRA 4FPKA 3B5LB 3S7EA 1DQ2A 5BV6A 1TME1 5ACA1 1NOVA 4QMAA 1HXS3 5GLUA 1AF9A 3AFKA 1NCRA 3VBOC 4C0HA 4K9SA 2WWSA 1FPN3 1LENA 1G8WA 4UW4A 1I1EA 1XNDA 4CDWB 1W6OA 1W6QA 1XU1A 3VUOA 2EIGA 1MEC3 2HEWF 4FPYA 1FMD1 2XJVA 4FOVA 4IEYA 1GV9A 4URTA 4QHBA 5H9SA 1O3RA 3VLBB 5CG9A 4HPKA 1PIV3 4RS5B 4WVVA 3V65A 3M8LA 5FTTC 1TME2 1BBT1 5ACA2 4WM8C 4QPIA 4ES9A 1C1FA 2JX9A 1ND3A 1RUH3 1VBE1 4YYOA 3TWIA 2GC0A 4BLIA 1WA4A 1QJY1 2G9FA 4RFT0 4AXOA 2EXJA 3FUQA 3IPVB 3VHRA 1ENSA 2Y26A 2ZGUA 1FMD2 3GF6A 1HXS1 3U0ZA 1AR93 2FHRA 2E6VA 3EO6A 3M3QA 5FRAA 4AGGA 4DFSA 1FPN1 1PZ9A 1KS4A 3AZVA 3ZFEB 2D43A 4XPVA 1QJU3 3J9SA 1Y43B 2A3YA 3RWNA 3VKLA 5A33B 1BBT2 4FXKB 3WINE 1GNZA 3AYEA 1K5MB 2BTVC 2X8KA 3KZ4C 1QJY2 4AVSA 5FCCA 2OW4A 1H8TB 1PIV1 1UW8A 4GMP0 4YM3A 1F31A 4XTMA 5EZWA 1RUH1 1UZYA 2BUKA 4GALA 1SFYA 1FPN2 5T55A 4UW5A 3WHUA 3WD5A 2A7AA 4FXGB 1SLBA 2P3KA 3UV9A 1LHUA 3I2DA 1RTVA 3VBSC 1Q5OA 1FV3A 4OZXA 1SLLA 2E53A 3HMYA 1AR91 5BXXA 2VOVA 2ZAAA 3FUOA 2VNGA 1PIV2 4RD7A 5JOWA 1WW7A 1QJU1 4PBOA 4EN6B 3LAGA 2JXAA 1LR5A 3J8F1 3VBRB 1RUH2 1LHNA 3ETQA 2VW2A 2VG9A 3R4DB 4QQHA 3WG1A 4B4PA 1S1AA 2QJVA 3UKNA 4MLOA 1CVNA 3OD0A 3BALA 4B3NA 4N43A 2G4IA 3VHOA 4FP3A 2RS12 1BMV2 2ZHKA 1AR92 1H4GA 1XE7A 4FCAA 1C28A 1WW5A 4FP2A 5H9RA 3JZVA 4Q27A 4META 2R0FA 1ZRCA 4AVBA 2WNVC 1SBEA 4JDMA 3HT1A 5HXVA 3J8F2 4YARA 1QY4A 1TNRA 1HRV3 4AE2A 1RL3A 4M0HA 2PHDA 1YI9A 4B8EA 1A78A 3WQ1A 2DVFA 5JZGA 3OYWB 3A4UA 4Z1VA 4JGYB 4JC1A 4MH0E 3GHNA 4YG3A 1C4RA 3PVEA 4U2AA 5JWPA 4QQLA 4WVMA 4AG4A 2ARBA 3AP6A 5FO9B 4XF1A 2V5YA 3GZAA 3VZNA 2DWRA 3AP9A 3KB5A 4C91A 2IXIA 1ULGA 5KXEA 3PLQA 1N3OA 4OUMA 4Z07A 1IKPA 2RS32 2W68A 5JR7B 4XTPA 5AC93 1UPSA 4AHXA 1AXZA 1RUC1 3WR0A 2CL2A 2AREA 1VIWB 1QQP3 2XUMA 2PHXA 2FMDA 1UN1A 5FMOS 1MS9A 2WNEA 4XOGA 1L3JA 1BVVA 1X8EA 1VBB3 2ZCWA 1WLTA 1YWKA 1YRZA 4YVWA 5GKAC 3R4SA 1FV2A 1MS5A 4KL1A 5A32B 4YZ2A 3DN7A 1MS0A 5HI0A 2ZPXA 4FOYA 3TNPB 3T1LA 1RUC2 2XJUA 4COUA 5J36A 4CEWB 3KT1A 3EQEA 3CLPA 2ZGOA 5I0UA 3VZOA 3ST7A 1TMF3 2Y0OA 1W6NB 2FZ1A 3O0XA 3PVBB 4JTNA 4AHZA 4HLTA 1RUD3 5AC91 3APBA 1VR3A 3N7KA 5JPNB 2A6ZA 5JAXA 1KRIA 4GWNA 3RI9A 4RR3B 2ZGLA 3IDEA 4C1XA 4GKYA 1UPIA 2TUNA 3FFZA 1YI7A 3VL8A 4DY3A 3KGZA 4QGLA 3MGUA 4XMAA 1QMJA 4L9BA 1SEFA 1WLWA 4BMEA 3RZZA 1OI6A 4GH4A 4RQPA 5AC92 1CAXA 2X53S 5BNPA 1WLCA 5T50A 3WDWA 4QPGA 4XEZA 4CEYC 3AP5A 1CN1A 5GZGA 1YUDA 3POWA 1CPNA 1GZWA 1TMF1 3O5SA 4DQAA 1ASJ3 4ZXKA 1BEV1 2UY9A 1RUD1 5T5PA 1CD3G 1XYOA 2OYZA 3LWCA 3WUDA 3JQWA 4WZFA 5CFDB 3INAA 5ABJA 3QLQA 2PFWA 4AI0A 4YZ5A 4FBFA 2D3PA 2YMZA 2ENRA 2GN3A 4ISQA 4Q26A 3RYKA 1GNHA 2UY8A 4CDUA 4N43C 1NZCA 3V0BB 3KMHA 1KD7A 1QOTA 4P9JA 4YM1A 4A7YA 5L73A 1ALYA 2YYOA 2W0XA 3IT8A 1BEV2 1SFNA 2GNDA 3MIDA 2Y38A 2GC3A 2GAUA 1S0EA 1H1MA 3H0OA 4NN0A 5BNOB 1V6IA 2YDEA 3EXUA 2W08A 4NVPA 4BE3A 1BJQA 4TZDA 3NV1A 2B46X 1AXKA 4GMP3 3E5UA 1DQ4A 1H4HA 2BYVE 2R49A 3VBUA 4D94A 2K9ZA 4HBNA 4HL0A 3GYDA 1HDKA 2HKXA 1VRH1 3CNAA 4DMIA 5KBFA 3S0MA 3NAPA 2WQ4A 3B3QE 2D6KA 4ONUA 1RUF3 3VDDA 3MDPA 3FMGA 4AFBA 1DGWX 1QJX1 4OI1A 3SNMA 5KXCA 1F9KA 3UL2A 1U12A 1NLRA 4AGVA 2V73A 1NA1A 1YIPA 1WBLA 2GN7A 2JKBA 1KFUL 4JVAA 3VHPA 4AK3A 4XMIA 1VRH2 4K21A 4K40A 4N90A 4J1WA 4FPJA 4AVAA 5C8CA 2AGSA 4GMP1 4S2HA 1O5LA 5C4WA 4YW3A 1XRUA 3UJQA 2LTNA 3NV3A 2ZKLA 4GB31 1VBA3 4FAGA 1CGPA 4LBNA 3K51A 1QJX2 4N7UA 2NPIA 3H50A 5JSOA 2CGOA 1AYM3 5D8AC 3WP4A 2WA4A 1DU3D 1RUF1 1H1IA 2MEV3 5C33A 3DV8A 2H0BA 1H30A 3ZX7A 2GH8A 1DLLA 4ZU4A 2TNFA 3VBHB 3NW4A 3DPRA 1EV13 1C5IA 2H0VA 5BNNA 5I91A 2VOWA 4I02A 3AMMA 4GB32 1J3RA 2EALA 3BOPA 3C3VA 4XBLA 4EROA 5CFCA 5GZEA 2YGLA 4R9CA 3O0VA 4K1ZA 3TOJA 3ZYIB 4Y1XA 4LLOA 3NSTA 4NR1A 2RHPA 1Y3TA 4E2SA 2BNNA 3VGIA 1VBA1 5EJ3A 5K0UC 1GR3A 4BMBA 1HRI3 3UK9A 1OOPC 5GZDA 1V6OA 1H0BA 1R1A3 1V00A 4GH4C 4K8FA 4AHWA 1Z7S3 4CDWA 5BNPC 2ZX2A 1UKRA 3SMHA 5EWSA 2D3SA 4L92A 2OZJA 1MS8A 3AB0A 4KU7A 1XYNA 2W52A 1BVP1 3ASIA 1TNFA 2PA7A 2WS93 4Q4X3 4UW3A 2WKKA 5ABJC 1VBA2 2Q4SA 1QU0A 2YHJA 3LA7A 3ZFGB 4I3GA 1EPWA 3AK0A 1ZZ6A 1LEDA 3M2MA 3JUUA 4XQDA 3VBFC 2NMOA 3QD6A 4BCUA 3M4FA 4YM0A 4Z82A 4CRQA 2GZWA 3IPVA 4S2GA 2ZHMA 4PDWB 3MIGA 4E2QA 4S2DA 3L9JT 5EFUA 2WSUA 1PZ7A 2PHFA 3D5OA 5FOBB 1QOSA 2GDFA 4OI0A 4XJAA 3B94A 3ZFEA 2E9QA 1NCQB 1Z7S1 1B35B 2AUYA 2SLIA 4XBNA 3ZMOA 2IXCA 1LB2A 3ILNA 5A33A 1A6CA 3WY6A 1SQ4A 2F6BA 4AEDC 4LO8A 3ZXEA 2GNMA 1K5MA 3IN9A 3R6SA 2Q1ZB 1ZZBA 1HQWA 3WLUA 2Z42A 1VJ2A 3E6DA 1H8TA 3TN92 2DCYA 4B4QA 2QZ2A 2PHWA 4YSFA 2WS91 3AJZA 4Q4X1 3VBUC 1AL23 5CADA 2Q5TA 2VPVA 4DNYA 2VUAA 1CAWB 1YHFA 1Z7S2 3FLRA 1WCKA 3CL1A 5A3LA 1DBNA 3OY8B 1DIWA 4FPHA 4LULA 4GA9A 1VAVA 1JW6A 2P3IA 4AI2A 1N3PA 1OA3A 2C9AA 4I0WB 5HCFA 5BNQA 5FOJB 1YCIA 1H2NA 5DUWA 2A3XA 2GSYA 2WS92 1OA2A 4LO7A 4Q4X2 3ZYJB 1NA1C 3VBRA 4B7EA 4LO4B 4IEWA 2WINB 2IXLA 2JG9B 1LOEA 1NY71 1VAKA 2I45A 2BNOA 1JOJA 1IKQA 1OD5A 3AZZA 3HT2A 3HD8B 5I8TA 1PVXA 3MF6A 2B7YA 3W59A 4EJRA 3G6JB 2O0OA 1HKDA 4YZ3A 1AR63 4Y4YA 3D0JA 2R1DA 2ET1A 3RJRA 3FX3A 2FBEA 1CAVA 3PNAA 2CGPA 3MFAA 2HWE1 1JHNA 4XQWA 2XJSA 1NY72 1AR83 1H2LA 1RJ8A 2RR11 3BOWA 5BY5A 4DRVA 5CNAA 2DVGA 1MVEA 2X5IB 3DPRC 5CA6A 1JUIA 3OYWA 5FLIA 1GSLA 4JGZB 4JDNA 3WW1A 2XWJB 3I59B 4JAAA 2EAAA 4CDQC 2DFCA 1MVQA 3B9CA 4MZUA 4K3UA 1D0GA 5K7PA 2WT2A 4ITCA 1JH5A 2CYFA 3MIFA 1AR61 1WW6A 2HWE2 3PJQA 1ZZCA 2DVAA 1FOD1 2RR12 4IV3B 4NHKA 5TSWA 1UU5A 1YFWA 2QNKA 5LRRA 1G86A 4HKWA 2OA2A 5J37A 2RJLA 2E51A 3AZWA 4V1PA 1ZZ8A 5AVAA 1F8VA 1QDCA 1AR81 2D6PA 1KDMA 1T6GC 5L36A 2D3RA 1HV0A 4YM2A 1AR62 1NXMA 5CG8A 1S0DA 3RYRA 4QGMA 4L99A 1X8MA 1FOD2 4P5HA 2IXKA 2OUJA 4UBGA 2E7TA 2C5DA 3KLSA 5A32A 4IEZA 4N53A 3O0WA 2IC1A 5FO7B 1OPOA 2XL9A 2BNMA 2I2SA 2IWGB 5J98B 1YLLA 1DHKB 4B4RA 4CEWA 5DG2A 1AX1A 1AR82 2IXHA 3RSJA 3SHRA 1PVC3 5T54A 2PHUA 3M3OA 2PTMA 3WDXA 1W6NA 2XBO1 4J6GA 3SH4A 3CJXA 4Q0SA 4XFFA 1QDOA 3ZN5A 3U07A 4MVTA 2VQAA 1LODA 2R32A 5EV7A 2BEOA 4YGDA 1UCXA 1J1LA 3AMNA 3WCRA 2O8QA 4RR3A 3KSCA 4XIKA 3AYAA 5FBZA 2IXJA 1SACA 5DDJ3 4HKOA 3ZFFB 4CZSA 1X36A 5AFBA 1DF0A 5FMOL 3SH5A 3OD4A 2XBO2 1NXD1 1JTZX 4NOTA 2NQYA 2G9GA 2YY1A 4XJZA 2P34A 3M3EA 1S0BA 1AL0G 1WW4A 2UYBA 3RS6A 1RMU3 4K6BA 3WDYA 5C9AB 4IERA 1A3KA 1YYNA 4IV1A 5CFDA 4CYDA 3CJIC 2ZS6B 1D4M1 2QDRA 1H8VA 1ZBE3 1RUOA 5DZEA 3GHMA 3FBMA 4EWEA 1MQTA 4AFDA 3V0BA 5DDJ1 4H55A 4ATEA 5J48A 1ONAA 1AR73 3QACA 5KWRA 3KT7A 4IEQA 3ENRA 5JI9A 5KHHA 1H2MA 3AXEA 1W2UA 4SBVA 4DINB 1RUG3 1RJ7A 4X8PA 1MEC1 4C0BA 1D4M2 5BNOA 5T3NA 1VBE2 1XYPA 4LEJA 1J1TA 3M1HA 1PM7A 1OHFA 1Q8SA 3H3ZA 5I8SA 3AZYA 3PHMA 4LHNA 2A75A 1HXS2 1LOFA