1YJLA

Reduced peptidylglycine alpha-hydroxylating monooxygenase in a new crystal form
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
306
structure length
285
Chain Sequence
TIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTICNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-glycine alpha-amidating monooxygenase
publication title The catalytic copper of Peptidylglycine alpha-Hydroxylating Monooxygenase also plays a critical structural role.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 54
structure length 285
sequence length 306
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yjlA02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 1yjlA01
1YJKA 1YIPA 1SDWA 3KS7A 1YI9A 3MIDA 4R4ZA 3MLJA 1PHMA 3MIBA 4R4XA 1YJLA 1PGSA 3MIHA 3PHMA 3MIFA 3MIGA 4QHBA 1OPMA 4E4ZA 3PMSA 1PNGA 1PNFA 3MLLA 3MICA 3MLKA 3MIEA
chains in the Genus database with same CATH superfamily
1DGWA 2Y6GA 4CDUA 5FZ8A 3HAGA 2PLV3 4Q4W3 1OFSA 1RC6A 3DEMA 5FY8A 1HQNA 4QX2A 1SACA 2YPJA 2WABA 1MQTC 1MQTA 5GZFA 4PIZA 1AYN1 1IS4A 4Q4X1 2GDFA 5FCCA 1VBB2 3A21A 3B5LB 5JVVA 5J48A 1PZ7A 4META 1IG3A 4NIIA 1IG0A 2WSUA 4S2GA 1OKOA 5A3OA 5G04L 4Q4X3 1AYN3 4PDWC 1F31A 4PDWA 1WCQA 1TZOA 3FWEA 5FZLA 2XXZA 4AI0A 3HN3A 4LBOA 1NOVA 1S0IA 1WW6A 2EXKA 2H0VA 2BNOA 2RHPA 2VECA 2X05A 3WV6A 5IYYA 3PVBB 3M4FA 4CRQA 3VKNA 1YFYA 2E7TA 2W87A 4AQ6A 1RUE2 4IXLA 4E8CA 3ZOIA 2HWF1 1SPPB 3O1UA 5T5OA 3VZMA 4JVAA 4Y20B 3PL0A 4BXFA 2G9GA 3VDCA 2VR4A 3CNAA 1I5ZA 3GBFA 4FOYA 4KQ7A 2HWF3 2VCAA 5GLWA 4JGYB 4A7KA 2CYFA 5FJHA 1RUH1 2QDNA 2VNRA 2WSVA 4COWA 4MSVA 2DDUA 1GUIA 4JHTA 1E5HA 3TWIA 3RZGA 3ATGA 4YG6A 3VBRB 1RUH3 4UW3A 2PAMA 3A0KA 2VQAA 1SLCA 3K77A 5DAWA 5FKCA 4XDPA 5DAQA 2FCUA 2WFF1 2NN8A 5FZKA 2WA3A 1ONAA 1Q8PA 3AP9A 3GZUC 3WW1A 5FZMA 5JXJA 5GLVA 5KBFA 3MLLA 2FDHA 3GZAA 3IIAA 3WQ7A 4CYDA 1XU1A 1OMIA 1KXGA 4NIDA 2ZEZA 2WFF3 4B7EA 1DF0A 4FOVA 1V6LA 4GWMA 4NHMA 2DYCA 1ZZ9A 3WLUA 1E5RA 3C7EA 2JG8B 4XC9A 3O14A 5SV5A 2D93A 2W47A 1V6KA 5FYBA 1PZ9A 2JG9C 3EMRA 2JG9A 1R092 2XG3A 5JZGC 4XUQA 4H14A 2GC3A 2ILMA 3SEEA 5EV7A 4LBQD 1QNYA 1XNTA 3NSTA 4XJZA 2ZAAA 2ZEXA 2FCVA 1RVF1 1C1FA 1W8UA 1S0CA 4K20A 5I93A 2PFWA 5LA2A 3DYPA 4XUNA 1RVF3 1WA6X 4EWEA 5D8AC 5CKNA 5D8AA 1D0GA 4GIQA 2WT2A 1ZZ7A 3IMMA 4LT5A 3AFGA 1W9SA 1LCLA 4EWDA 4HG6B 2J1VA 2A5ZA 3ACHA 4XXPA 4RFT0 4ZXEA 3UGFA 3J7NA 3WZ1A 4AGGA 3BI3A 4DO0A 3HWJA 1G9BA 3GNEA 4HFSA 3F95A 5FPAA 3KQRA 3T0DA 2BNMA 2WZEA 1RYYA 3LIHA 3RYRA 1JYNA 5CU1A 1WCDJ 3BN6A 2VXRA 1W6OA 4BM8A 1O8PA 3WEZA 1O3RA 1C5IA 1K42A 1DZQA 4HVOA 5CKQA 3MLKA 3ZPOA 3BODA 3ZXJA 3AFKA 1RUI1 1O7FA 5A6XA 4WVMA 3LQCA 4XTMA 5BY5A 1S0BA 1CAUB 1NY71 4FTSA 2A70A 3OF1A 4ARXA 2XWJB 1RUI3 3V0BB 3GHMA 2Z42A 3GHNA 3HT1A 2ZGOA 3N3HA 4B7KA 5H9SA 1UMHA 2D6PA 2VY0A 5FAXA 2HWC1 4OHZA 5DZGA 3JU9A 5JPMB 3HNMA 4Y26A 5FZ9A 3BU7A 2RDRA 3WF3A 3VV1A 1WCSA 5B2GB 2HWC3 2Y0OA 4JQRA 2BGPA 1YQ8A 4QGMA 1H8TB 1IKPA 3VBFB 2Z5WA 4P08A 4QB1A 4HL0A 2R16A 4XF1A 5A7NA 1WW4A 2A71A 4Y22A 4GMP0 5CA6A 2Y6HA 3B94A 4LBJA 1G7YA 2HYXA 5FK7A 2XWBB 4GMP3 5FZOA 1EAH1 3U75A 4LTAA 3C3VA 2PA7A 4UYBA 5A32A 5JI9A 2JJ6A 5IVVA 2OUJA 2NP0A 1VBD1 4IGPA 2XPJA 1H2NA 1AUYA 2XBO2 3UETA 4B4QA 2JDHA 1EAH3 2Q1FA 4R9BA 5IVCA 4K8FA 1PVXA 3POGA 1DQ6A 1QJX1 1CIWA 1Y9GA 3AM2A 1EPWA 1VBD3 5FYZA 5ACA1 5DUWA 4A44A 2WO1A 3X29B 4UW6A 3MW4A 4WVWA 2XJRA 3KT7A 4KGQA 3HBKA 1QJX3 1RINA 1PK6B 4E8DA 2EALA 3RPQA 5CFDA 4CCNA 4FAGA 5ACA3 1ENSA 5CFDC 3D0SA 1QHDA 3IN9A 3FUQA 4FPHA 4BZ4A 4LHSA 4Q1PA 5LRRA 3D4KA 2DVDA 2RR11 1R1A1 4NRMA 1LAJA 2R1DA 1WMDA 1Q5OA 5LY1A 3WF0A 4INDA 2RR13 5T50A 1R1A3 3FL7A 3MEPA 2ATFA 4QPGC 1WMFA 4IEVA 3AMMA 3U07A 3ZYJB 3ZSJA 5K0UB 3B7MA 3ST7A 2NQYA 1GWMA 3MF9A 2RS12 5FZEA 1LNSA 2KD7A 3I3EA 2C1FA 5KHKA 3H7JA 1V00A 3RJRA 3CEWA 4KGGA 4FAHA 2E33A 3JQWA 2ARXA 1UKRA 5EJZB 3U37A 3FFQA 4KG8A 2XVKA 3GGLA 2P37A 4Q4V1 5C3SA 2FZ2A 4EV0A 2DUOA 4DY5A 3K4AA 4QX7A 4RA0A 5C71A 1O4YA 3CQOA 3KLSA 3AZVA 3H3ZA 1VRBA 4XFHA 5A7SA 5KC5A 3Q9OA 3PUSA 2EIDA 4Q4V3 5IW0A 3S7EA 1WW7A 3OYWB 4ISQA 3UNPA 3OUIA 1JUIA 1YQCA 4MHUA 1IZ3A 1UN1A 1W04A 2DUPA 2XJPA 3ME2A 3RWNA 4DS0A 2Z79A 4NIGA 4A4AA 4OCTA 1AZDA 4Q0VA 3A22A 1HW5A 4YW6A 3MW2A 2X5IB 5EWSA 5FMDA 3L9JT 2Q5TA 3O0XA 4NRPA 2VE1A 4XHXA 1FOD2 3OPTA 1ZA4A 2P3JA 1PGL1 1WKYA 1GOFA 3ROUA 1OQ1A 2VMCA 4XHBA 4CP2A 5JUVA 1VRH1 2PQQA 4YWAA 3TOJA 4E9KA 4P5YA 2VUAA 2P34A 3WW3A 5HV0A 1IOAA 4V2VA 3LSEA 1MEC2 1W03A 5A3NA 1VRH3 3AYDA 3TNPB 3W58A 4N7UA 1ZVFA 1DHKB 2ZOEB 1VJ2A 4MGKE 4YW3A 2VMIA 1VR3A 2JDPA 3I4IA 5FBJA 2R32A 3RDIA 1A34A 1R082 1J84A 3VZKA 4Y1XA 5LY2A 1IQAA 3VD7A 1D2QA 2JDAA 1UU4A 4HXCA 4COYA 4P9YA 2B9UA 3I7DA 1XOYA 3E5UA 3WF1A 5JSPA 1CPMA 4AFMA 2QQJA 1JODA 3Q8AA 3FZ3A 4J6GA 2GZWA 1GP6A 2WC2A 5CYYA 1XNBA 1KFXL 3JQXA 5FZDA 3K3NA 4EZ4A 4YZ2A 3FLRA 2DCTA 2KM2A 4BMEA 1AJKA 3QCWA 1F4HA 2IVJA 2PN5A 3WINE 2VCMA 4DINB 1W8TA 1QDOA 2GH8A 1MVEA 2VVDA 5AVPA 1ND2C 5LB6A 2DFCA 2VMFA 4XFCA 1RITA 4AFBA 5IFTA 4FQ4A 3U4SA 2PHUA 3L2YA 2P6CA 2LUWA 3LZZA 4GJYA 4M3CF 4RFRB 2WR9A 3MDPA 5FYVA 2VTXJ 4DXSA 4A3XA 3KGLA 1OLQA 5F2SA 2VZOA 1J83A 4Y1ZA 1BQPA 5C4WB 1H2MA 3E5QA 5DXDA 3HR9A 3Q8EA 4FPKA 1HIXA 3AKTA 3FE5A 2D3PA 2VCBA 1RUG2 3KHBA 3ZYFA 2UWCA 4LHLA 2G4IA 3IAQA 4KU8A 3MICA 1DGWX 1XRUA 1W39A 1AR92 5F32A 1Z7S2 2WWUA 1OUSA 2GAUA 1GZCA 5FO8B 3ENRA 1GNHA 1XQNA 3SCGA 2VOWA 2ZTNA 2OZJA 1V6JA 2Q30A 1NX9A 5HXMA 4JC1A 2ID4A 3MO4A 3ZN6B 1KD7A 2PHTA 3LIGA 2JE9A 3ZXDA 1UWWA 1K12A 5GZGA 4FPYA 2W1WA 3IPVB 4Y4YA 3C7HA 4FFGA 3WG1A 1VBC2 1EYBA 5T3NA 1JZ5A 3PU8A 4CCKA 1LOEA 1QXRA 1XBFA 2FDGA 2GN3A 1GNYA 2V73A 4B1MA 5DABA 4S2HA 3UKTA 5DAVA 1RUD1 4L8QA 4CPBD 3WY6A 3HQXA 2QZ2A 1CN1A 5H9PA 4LJHA 4ZY9A 1TE1B 1YLLA 5FP8A 2VQ0A 5KXBA 3W9AA 3DL3A 3AP6A 1GQGA 5FMBA 1RUD3 3RYKA 1CAWB 1O4TA 4CEWB 2GN7A 2QQMA 3HT2A 2ZX0A 4AFDA 4XUTA 1FI2A 1NLSA 4IEZA 4YSFA 2JD9A 5J96B 2ZAHA 1K5JA 1OH4A 4CEYC 4E2QA 4CEYA 1GNZA 4XDOA 4WZFA 3HVDA 5A7WA 1DG6A 4HK8A 4QMAA 2XB6C 3WXPA 4TSVA 3IM0A 4AAXA 4XACA 4KMQA 2TBVA 1PMIA 5IK4A 5DG2A 1XYPA 4P9JA 4QXHA 4WM8B 3OD0A 4IE0A 4HOOA 3SKJE 4OI0A 4QKFA 5FY1A 3JUUA 2JX9A 3T4VA 2A3WA 5JI7A 3OG2A 1BBT2 3SKVA 2VZPA 3AJYA 1PHMA 2QQUA 5J1XA 4YZ1A 1HN0A 1JBCA 2QBXA 5I0RA 1AR71 1PIV1 2GC2A 2DU0A 1QNWA 2QQLA 3JBG1 4E27A 2VNVA 3B9IA 1JOJA 3T4HB 1XE8A 3N35A 4RSUA 5FYUA 1UY4A 2RM21 3ACGA 4WBBA 1AR73 1PIV3 5D2AA 3RZLA 3LOBA 4N53C 2D6MA 4N53A 3JBG3 4XUOA 2WDBA 2HWD2 3RYPA 2J1TA 3O12A 2WQZC 2NMOA 1URXA 2RM23 2UYAA 4EE2A 1CZVA 4XYXA 2UWBA 2VU9A 4YYOA 2BV4A 4PIYA 3UL2A 3UESA 4HPKB 3LKJA 4LOSA 4D6SA 5T54A 4JHZA 1GV9A 4M0NA 4BQ2A 3OSDA 4AE2A 4M4RA 1EV11 2VXJA 3N9QA 5DDJ2 4PF1A 3I3DA 4NHYA 4EYUA 1PMHX 5IVEA 2BFUL 2X10A 4XBNA 2I07B 4FFIA 2F17A 2EVXA 1OLMA 1ULCA 1EV13 2AEYA 2RDNA 5E88A 4CDUB 2Y0IA 3AXDA 1LOBA 1EUUA 1AL23 1K3IA 3NV4A 2ENRA 4C0BA 3LFMA 2ZEYA 3LFIA 3QOPA 4AI2A 4JRAA 4CZSA 3USUA 4G3YC 3TEZA 1NLQA 3MHZA 4LO4B 1DYOA 4QXKA 3FC0A 4Q8KA 1QOSA 3VBUB 2E7AA 3C7OA 1BCXA 1OKQA 1W9TA 5BNPA 1LB2A 1ZRFA 1AR82 2DVGA 3FHAA 1UMIA 3OGRA 4UAPA 2BEOA 3ZVXA 4CCMA 3ZFFC 2RMU2 4E4HA 3ZFFA 1F5FA 1W2OA 4ZPIA 4RR3B 4NJ4A 1ZBA1 1LENA 2VMEA 1GQHA 5B4NA 3R0RA 2W46A 2XHNA 3KM5A 4KL1A 5T55A 3KV6A 3W5MA 4W6XA 4YRDA 1ZBA3 1BHGA 1HDKA 3K48A 2WLPA 3DV8A 2VZVA 3AP5A 3HBZA 2R061 1RUJ3 4ORFA 4XEZA 3VD9A 4NPRA 1HQWA 2Y8KA 4FP2A 1G9AA 3E6CC 1COV1 1JZ3A 4D6RA 5GLTA 3RNSA 3ZYPA 2VZTA 3I3QA 2GC0A 2R063 4IERA 2E9QA 2UY9A 5F6LB 1COV3 2EIGA 3NL1A 4Y4RA 4M4PA 1V9U2 1WZXA 5ABJA 1Z0HA 3WNOA 3L2HA 4XF9A 2Q8DA 2MHFA 1Y9QA 1XC6A 4RGAA 1T6GC 3FHQA 3WG4A 1LKNA 1C5HA 2XUMA 1TMF1 1VBE1 4TZDA 4UFMA 1C8M1 1Y3TA 1PO22 1BXHA 1TMF3 1VBE3 3B9CA 3LEMA 3OPZA 4QXBA 1C8M3 5KC6A 2OPKA 1IPSA 3ETPA 2Y6JA 3K3OA 5IJRA 5DUVA 4J25A 1WD3A 4AEJA 2WL1A 1BMV1 4D8MA 3P3NA 3THCA 2WWJA 5BNOB 1HN1A 1WA4A 4GAZA 1AR62 4D7SA 4ZZ5A 3ZPYA 1NA1B 4IEQA 3O5SA 4LIVA 1LESA 1AXZA 2JDMA 3OD4A 4R4ZA 4V2WA 3VDDB 1ZYBA 2LS6A 3POSA 1BK1A 4HONA 1NT0A 2ZACA 2ZCWA 3V64A 1N1VA 1OLRA 2ORZA 2YC4A 2NM1A 2FDJA 4RQPC 4RQPA 5FMOS 5J36A 1H4GA 5FOJB 5LBEA 3MIGA 1JZ4A 4O61A 1W6MA 2W3JA 1QJY2 4TTGA 4MX3A 1DGLA 2A6VA 1DZRA 4MXVA 4SBVA 3WQBA 1FAYA 4GA9A 4CDQC 2BVVA 4CDQA 5HCAA 1GKBA 1OFNA 3AMNA 2TEPA 5A3LA 2DFBA 5FO7B 1DBNA 3CL1A 4XF3A 1LGCA 2QKDA 3FX3A 1KDMA 1M4WA 3JB8A 2W1UA 5J7MA 2HBUA 5FYMA 4QPIA 4QDSA 4W65A 1AXYA 4BISA 1UOFA 2GC1A 1SLIA 1NCRC 4U36A 1NCRA 1Q3EA 3ABZA 3LA2A 4QX5A 5FZAA 4B8EA 1NKGA 3AZZA 3BYWA 1VBB1 3CJIC 3CJIA 4IEPA 5FLHA 5FYIA 2LM3A 2P3IA 3ZKYA 4CDWB 1QQP3 2B5HA 4MGYE 3JD72 1E5IA 5C6CA 4CU9A 5FDBA 2Q1ZB 3R4UA 3ZFGB 1VBB3 1DU3D 5ISLA 3SEPA 4FOWA 1PGW1 4Q8LA 1UOJA 1ND3B 1AX2A 4F8AA 2XMLA 3WP5A 4YPJA 5DMYA 1QY4A 1RUE1 4Q0UA 4HZFA 3RMYA 1YJKA 3ZO0B 4WM7C 2VOXA 3H1WA 4WM7A 5LASA 4AEDC 4AEDA 1JYTA 1RUE3 4CXXA 2IXJA 3UV9A 3ZMOA 1CPNA 1HV0A 3I2OA 2WJSA 5ERLA 1LECA 5FOBB 1G86A 1NE6A 1POV1 2ERFA 5K9YA 4N8MA 3T30A 2YUEA 2MEV2 2PHWA 1JYIA 3WCRA 5FZ4A 1N1YA 2DVFA 1U5YA 4DMIA 3AMPA 3RZJA 2AEZA 5LATA 4UFHA 2QNKA 3RJ2X 1A8MA 2B7YA 4NMIA 4GH4C 1JZ6A 1XYOA 2ZZQA 3G6JB 4N43C 1MZ6A 4N43A 3AKQA 5A3PA 5LWBA 3ZSLA 1RUC2 1UQXA 4XE9A 3SHRA 1UAIA 3QH7A 5I8SA 1YEWA 4AFAA 4MADA 1TME2 1GQPA 3GZEA 5C8CC 5C8CA 3FLTA 2Y38A 1LHNA 2X09A 4KWLA 1CAXB 3GDBA 3J7LA 4YLZA 2WS92 1W3XA 5FY5A 2VW2A 4NO4A 4BYYA 5JMOA 4C1XA 3BUCA 2HEVF 2SLIA 3LOIA 1XYNA 4QHBA 3VUOA 1YHFA 3WQ0A 1HLCA 1U5XA 1D7PM 1UL9A 1KEXA 3IDEA 4I0BA 1W6PA 4RS5C 1ULOA 4RS5A 2JKXA 3CIHA 5EIYB 2BNNA 4FXKB 4LKFA 3W21A 1CJPA 3N7KA 5I8YA 2QQPA 1W3VA 1ZZCA 2QTWB 3NNGA 5KHHA 2HYKA 1DQ1A 1SEFA 2VD7A 2WO7A 3N7JA 4KI5M 5GKAC 4AEKA 4BDVB 3TEWA 5CNAA 3DYOA 3AP4A 4ATFA 5EYYA 4COZA 3VKFC 4FPEA 3VD3A 4I02A 2ZGRA 4TXWA 1C8NA 3B01A 3NNFA 1W8OA 4UBGA 4EN9B 1GP5A 4DOUA 1UW8A 2VG9A 1KGYA 2DCJA 1F8VA 3N4MA 5AVAA 4XF0A 1ZNPA 2YB7A 4IEUA 4DZGA 1S0FA 4Z1VA 1F15A 1MACA 2Y6KA 1GOHA 4EN0A 1CIYA 2PHDA 2OXBA 1SFYA 1DFQA 3ZYGA 4PLNA 1MS0A 2A3YA 1DGRA 4ARYA 4IEXA 1HKDA 4FPLA 1OA2A 4OMCA 2AR6A 4MHRA 4OLLA 2KR2A 4PHZA 3RVHA 4Q0SA 2CHHA 2ET7A 2BJSA 3EHKA 3FFZA 3AL6A 2FZ1A 4IESA 4YGEA 2I45A 5ANQA 1RTVA 1FPN2 3KV9A 3RWKX 3UYJA 1UYZA 3IWZA 1V6NA 2J1SA 1K45A 1OOPC 5APAA 3TAYA 1XSRA 2WNEA 4CA9A 3LPFA 4MGZE 3D8CA 1OLME 4P00B 2WNVB 3T1LA 4LA2A 3HD8B 3D0JA 4WV8A 5TSWA 1SDWA 4P02B 1JYWA 1H6XA 5T5JA 5FR3A 3ZXEA 1UU6A 1CZSA 1UPSA 3ITQA 2Y26A 4CUCA 3VBUC 4MLOA 3V0AA 1RJ8A 2XBO1 4LBQB 4AWDA 4PBPA 3OTFA 1VBA1 1GSLA 1WMEA 1X8MA 5A1AA 4A7ZA 1VE0A 2IXKA 1AF9A 3P5BA 3DN7A 2AGSA 2XBO3 5GLZA 1CGPA 4XAEA 3WDTA 4E4ZA 5DAXA 5A7OA 1VBA3 3RI8A 3ASIA 4O9EA 5FY9A 3OGSA 3AZWA 2OUHA 2W39A 2XL7A 5A6QA 1RUOA 4IV3C 4AF9A 4IV3A 4NIAA 2K2SA 2E53A 3U78A 3KZ4C 2VZQA 2WUHA 4LLFA 1U12A 1IPKA 1X33A 3PMEA 4XFBA 1HB2A 3T0AA 4BOWA 2OPWA 1O59A 2VAUA 3UT0A 1C57A 4DUXA 4N90A 2B9VA 5DUUA 5A70A 1XPWA 2JDZA 1GZTA 2VULA 2Q8CA 2HEYF 2CWSA 4JGZC 2RS11 3ZLIA 3U14A 4JGZA 3M8LA 3MFCA 2WNUC 5JZGA 2WNUA 2G9ZA 3I2JA 2ZGQA 1WLTA 3S30A 2JE8A 2RS13 3ELNA 4OI4A 2VJXA 4PJYA 5FQ0B 2BYVE 4CDXB 5FLJA 1N1SA 5E1RA 3H0OA 3J26N 3WF4A 1H4HA 4DXTA 2ORXA 4OFGA 4RGGA 4QHOA 3K2OA 3TN91 1FATA 2H6BA 1FMD2 2W94A 3N36A 2XKPA 3MPBA 3PUQA 4BQYA 4L11A 4NIHA 1GU3A 1W2AX 3TN93 1W6QA 3BALA 4GWIA 4YVWC 1QMJA 1PX4A 4YVWA 1H1IA 1UCXA 5F5CA 1CZTA 1KS4A 3BB6A 1LGNA 3SQOA 1UZWA 5EJ1B 4LUKA 2QJVA 3BGAA 5IT6A 4QGLA 2YC0A 4QDQA 5KXEA 1N1TA 1VPHA 3BTAA 1Q8VA 1S1AA 2YU2A 5CFCC 3VDAA 4P9XA 5CFCA 3EJKA 4K7JA 4YW2A 1G9DA 2JXAA 5C9AC 4QKNA 1UX7A 2R041 2HWB2 1QKQA 3MIEA 1MEC1 3VL8A 1XNKA 3MF6A 3T3YA 1DZTA 2YFZA 4CCLA 4NHLA 1PVC2 4E2GA 5JIAA 4A2UA 2VNGA 4QQPA 4PQQA 1YO8A 2R043 3T2QA 1MEC3 2F4PA 2H6CA 4GB32 1GWLA 2A3XA 4CVUA 1W90A 3MI8A 2VCCA 4D94A 3LDRA 4OHYA 1UY0A 2P17A 4C1WA 2BGOA 2IZWA 4IE4A 1H0BA 3JZVA 2PLV2 2AENA 3M3CA 1IKQA 4B4PA 5KXDA 3WP3A 5L9BA 5FZ0A 2DF7A 5JPNB 1LHWA 3AYCA 4Y5Z0 3UKNA 5FY0A 4WVZA 5C7GA 2VOTA 4QKBA 1UO9A 4Z92B 4HSLA 1B35C 3KCYA 1JMUB 4K9SA 1B35A 3O7OA 5DUXA 4RD7A 1JHNA 1K5MB 3ZYIB 2OQ7A 3IB3A 5JXGA 1GZWA 4AHYA 4Q4X2 1AYN2 1S4CA 4D7TA 5JOYA 4DFSA 1NCQB 1EY2A 1LODA 3I8TA 4J1XA 5JSRA 3CO2A 3LSDA 1UIKA 1YCIA 3GCXA 4UFJA 4C91A 4PT6A 2ZXQA 1SFPA 3WNMA 1ACCA 1I5PA 3I59A 5I0DA 5BNNB 3B00A 2R0HA 4LE3A 5FPUA 3ZM8A 1LTEA 2ZGKA 4MOAA 3R4DB 4GD4A 1EPZA 1QJZA 4AOCA 4Z2WA 2K9ZA 1W0NA 1HRI2 2C6SA 1RUH2 2OZ6A 4OYUA 3USUB 4D7YA 3I3MA 3A7QA 3WF2A 3GJBA 2WYSA 4QPGA 1JU4A 2PHLA 1SQ4A 2JE7A 2Q4SA 4M0HA 2NYYA 5BNPB 3PVOA 5F3EA 4HSJA 4KNCA 1OSGA 3CJXA 2WZR1 3OY8B 4Y5SA 2Z2SB 2WFF2 2C24A 3DPRB 4UT5A 4YNIA 3WDUA 4CSWA 5AFEA 2D6NA 2RE9A 4R9CA 3BIWE 2WZR3 1OVPA 2WLQA 3ZXGA 3DXTA 4Y1VA 2NZ9A 2VC9A 1JW6A 1W9WA 5F3GA 2HLEA 3RFRA 1XB9A 2GH2A 4DXZA 1MPXA 1BEV1 2FDIA 4Z82A 1JOPA 1LOCA 3ILNA 1Y7BA 2G9FA 3KD4A 4P9LA 4Y1UA 5FZ6A 1JYXA 1BEV3 4Z07A 4LLOA 4FPCA 1W28A 1F2NA 3USSA 2VVEA 2TUNA 1TNFA 3MYXA 2SBAA 3NV3A 3PUIA 3J7MA 5ABJB 3JB4C 3SC7X 3CZJA 5L9VA 3KV4A 1H2KA 1GLHA 2H0BA 3VBSB 3DCQA 5F1RA 3U4XA 4BQXA 5CIRA 1CVNA 3FBYA 4A7YA 5C5UA 3RZKA 4M3CE 1T6BX 2YU1A 3INAA 4Q0PA 3KVBA 1ULGA 2GNMA 4FI9A 3KQ4B 3RI9A 2BOIA 1BBT1 5IAVA 4EN8B 3OGGA 1V6MA 2VH9A 3K4ZA 4CP9B 4FTBA 3AC0A 2VTFA 4MGIE 2D5FA 2WN3A 3P1IA 4URAA 4CXWA 2OX0A 1V70A 4ISRA 4YVSC 3IAPA 3M3OA 1KDKA 1W9FA 1WUVA 3ZN4A 1QU0A 5IAXA 1I1EA 4OQ8A 2D6OX 4BU2A 2RS51 1L7RA 3WD5A 5M0TA 5DAPA 3U11A 2BUKA 2JICA 1RMU2 4EJRA 4W8JA 2XOMA 1CAVB 4GKXA 5FZ7A 5JR2A 3TBDA 4N9HA 2RS53 4S2FA 5FIXA 2VUDA 1VAKA 3M3IA 4IV1B 4HLTA 1SDDB 1UNBA 4LULA 2WIIB 4O65A 3NVCA 3IIIA 1S2KA 5DZEA 4FP3A 5IWFA 3ZX7A 2GMMA 2GNBA 1NYWA 3EYPA 4IQPA 4QB2A 1CESA 5L7OB 5LCWL 2D7FA 3ZSEA 1Q8QA 2CAUA 3WG3A 2P3YA 1ND2A 4FFHA 5LA0A 1E57A 3WNKA 3CMGA 3J4UH 1S2BA 3MPPG 3PU3A 1Q8OA 1SPPA 2HWC2 2VVFA 4Y20A 2XJQA 2XJUA 3LEIA 2ZA9A 3GXUA 4QPIB 1NXD1 4GALA 2O8QA 4BIFA 1PZ8A 5BYNA 4JGYC 3RZHA 3LB9A 4JGYA 1ODMA 4O9GA 3M2MA 5IVBA 3KT1A 3PIGA 1RGSA 2I2SA 4YGDA 3PJQA 4YW5A 5CAZA 2RVAA 3O1OA 2JD4A 3VBRC 2VBPA 3PDQA 3VBRA 1CWPA 2JIJA 4BA6A 1DQ4A 5FBZA 1IS5A 1FX5A 1EAH2 5F5QA 3OUHA 4DRVA 2RMU1 5FP9A 3URFA 4KBZA 1VBD2 1X50A 2D40A 1RUF1 3OUJA 5FYYA 2QE3A 3V56A 4XABA 1TNRA 4LPLA 1LJ7A 2RMU3 1H1AA 2DCKA 3NWKA 2ZS6B 5ACA2 3O0VA 5FWJA 1PO12 1RUF3 3ACFA 4UXAA 1W0PA 2JG8C 1UXZA 2JG8A 4UW5A 1JZ8A 5LEKA 2HWE2 5CB7A 1DYKA 1S0JA 4EN6B 4FCAA 3RZMA 3JXSA 5HI0A 3VBOB 4W4ZA 4I3GA 4GULA 5LA9A 2OKXA 4LORA 1XNCA 5CISA 2YPDA 2E32A 1RHI1 4O7XA 1V9U1 3LA3A 2J1AA 2ZGNA 1QGLA 5E8AA 3KB5A 1KQRA 4Q4Y1 3QACA 1RHI3 1O5LA 4HANA 1V9U3 3NAPB 5J37A 3H42B 4NOTA 3T09A 2IXCA 1QOTA 4ZS3A 2RV9A 5A80A 4Q4Y3 4GXLA 2ZGUA 3K4DA 4MXWB 4CP1A 5F9TA 3MZHA 5C70A 4K1ZA 1ENQA 2CWMA 4CP0A 4F83A 1OD5A 4S2DA 4A41A 2A6XA 1W6NB 4Q0QA 4B3NA 1DYPA 2C4XA 1GMMA 3SNMA 4KH9A 1ZRIA 2B46X 2WRAA 4UF0B 3HNYM 4UW4A 3S5AA 5KXCA 1KFUL 2WQ8A 1RJ7A 1S2EA 2IUWA 4Z8BA 4XJ9A 2EXIA 3ZIXA 3C7FA 1J3QA 4FO9A 2VBBA 1AR61 5FPXA 4MO3M 1U5IA 4AVVA 3VBHB 3ES1A 1O5UA 4JDNA 4OI2A 5I0TA 1REFA 1T2XA 4LBMA 5IK8A 4G9SB 1AR63 4DPNA 2W08A 2NMNA 5LRSA 1XE7A 1XSQA 1Y9MA 3NV2A 2VL4A 3OCPA 2JB4A 2QDRA 1CAUA 2R072 1L7QA 3F2ZA 4IDZA 4NWWA 5JMCA 3H8RA 2XJVA 2Q1MA 3PVNA 1VRH2 1W8FA 5FFOC 1GFF2 3VLBB 3E97A 1OUXA 2VZRA 1MS3A 1L3JA 4FVVA 4M3CB 4CCOA 2DURA 2YHJA 3EQEA 2B39A 5A33B 2QUOA 4XJ8A 2VOVA 4AG4A 2XJTA 3E6DA 3EBRA 1ST8A 3POWA 1DQ2A 3NW4A 2VUCA 4AHWA 2PELA 4MGTA 5A6YA 3ZFEB 3PTYA 1H8TC 3OOXA 3VBFC 1H8TA 4QM9A 5IFPA 1GICA 4V1PA 3ORJA 5FMCA 2A6ZA 1W8HA 2BTVC 4HETA 2D3SA 1NQJA 5CKMA 5DG1A 1IQDC 1PNFA 1SLLA 2HKXA 1MQTB 2D43A 2AYHA 3AZXA 3ZIWA 2BZDA 4ZU7A 2CSGA 2CTVA 1ULPA 1ZBE1 2OT7A 4XBQA 3UJQA 2UYBA 4BQ3A 1O3QA 3ZYRA 1ZX5A 4OQ9A 2XUEA 3HEIA 2FDFA 4PDWB 3VL9A 5C3QA 2OA2A 1S55A 2QQKA 1ZBE3 1PK6C 2RS31 1RXGA 3K46A 1PK6A 3V65A 4BPZA 5KHGA 1FT9A 4AQSA 5FPVA 3WDYA 5JR7B 5FZ1A 1HB4A 2RS33 2WNOA 3I3BA 4LOTA 1WCKA 3D3AA 4CUAA 1D4M2 1AHSA 5DN2A 4FPJA 2I74A 2VTXA 2JECA 2C0ZA 4JKKA 4MV2A 4XFAA 5H9RA 5K0UC 1QJEA 2JB8A 2XLFA 3CF6E 4KWKA 5K0UA 3ZDSA 1FV2A 3NJZA 2BDRA 2XKOA 1CX4A 4UFIA 1RUC1 3VHPA 2QQIA 3LDBA 4XQWA 5L9RA 3ILRA 3J7HA 3KF3A 1J1LA 1TME1 3WNNA 3ZYHA 1RUC3 3VZJA 4DNYA 1SLBA 3FHIB 3BOWA 1YC61 1OI6A 2PXJA 3MBWA 1VAVA 5BNQA 3O1VA 2E6VA 4M01A 1QJU2 2GSYA 3LA7A 1ASJ2 1C28A 1TME3 2WS91 4BQ5A 4QQOA 4A6SA 3OYWA 2GP3A 2NPIA 4MUVA 1ULEA 1ULDA 5K8SA 1ZREA 2ZMNA 2D3RA 2J7MA 3UK9A 1C1LA 2WS93 2JDUA 1WLCA 1F9KA 1W8NA 2UU8A 4LKSA 3GZTB 2OS2A 3WNPA 2X5IC 3DKQA 3N9LA 2JG9B 2DBNA 2X5IA 2ZPXA 2DCYA 3IT8A 2CNAA 3AKSA 4AYUA 5JXIA 2ZX4A 5IUQA 2P5BA 3APBA 1OBNA 4AI9A 1N47A 5FUIA 1PGSA 2O0OA 1IHMA 3PTRB 2ARCA 2K0GA 1L7LA 2AREA 5AC91 2CL2A 1MS4A 5D8AB 1O8SA 5A3MA 3VDBA 1ZZ8A 4X6QB 1Q56A 2K46A 5AC93 1HRV2 2J1UA 1W6QB 3ZXLA 2FHRA 3N9OA 3OBRA 4JDMA 3SCFA 1X7NA 1W99A 1SFNA 1QDCA 1UY1A 2VZ1A 3AB0A 4NROA 4HBNA 1S0DA 5DQ0A 2Q8OA 1NQDA 3WW2A 4BHPA 4WVVA 1GBGA 3D5OA 5C3RA 5FYTA 1W6OB 5EJ3A 4YW1A 4HT1T 4JCKA 1AR72 1PIV2 2GP5A 3WW4A 3GYDA 3AMQA 4D69A 3S7IA 3JBG2 4LBKA 3H8XA 1LULA 4BIOA 3ZN5A 3J8F2 3PJYA 2V5DA 5FYSA 4WVMB 4DEQA 5LA1A 2FDKA 1I9RA 1BYHA 1FPN1 1W8WA 2EAAA 3NNJA 4IEWA 4XJWA 4YM2A 1BK0A 1VMFA 1TVGA 2IFRA 2CGNA 4FXGB 4IE7A 4LO8A 1FPN3 4EZHA 1OA3A 4BK4A 1UX6A 2W0XA 5C4WC 2EAKA 3H1YA 5C4WA 3BKZA 4JKMA 4MGQA 4Q29A 1EV12 4RHV2 1I3HA 2W52A 5GALA 2KXLA 3WDVA 1AL22 4LNVA 4GJZA 2D98A 4I09A 2IVIB 5FY4A 4OZXA 1XU2A 3QLQA 4ZS2A 1GWKA 1YQ5A 3M3EA 1POV0 4GZ9A 4Y22B 5EQUA 3ZXFA 2C5DA 4DRRA 1POV3 3EO6A 1CX1A 1POQA 5FZOB 1JOBA 1GZWB 4RL7A 4YM3A 5F7UA 2PAKA 3ZN6A 5A32B 2XVGA 4GH4A 2WZPP 4QB6A 5H9QA 4HK9A 1QXPA 5J98B 3IPVA 5DPNA 5C3OA 2W5FA 2E51A 5K4LA 5FTTC 3ZMNA 3T1MA 3KS7A 4OI1A 1M06G 4KWUA 1YYNA 1YFWA 1YQ2A 5C3PA 3JCIA 4NRQA 4ZXKA 1OA4A 4AVCA 2W1SA 2XONA 1RUJ2 2RJLA 1J3PA 2ZGSA 3GBWA 2A1XA 1W8ZA 5CFDB 2YBSA 2YXSA 1R091 5L36A 3BU0A 1DLCA 1LOFC 2BU9A 1LOFA 5BV6A 1PMJX 2JIGA 1H30A 2GU9A 4CEWC 1CAWA 1QXJA 3POFA 4CEWA 4OHXA 4COVA 1R093 1ZZ6A 4FBFA 3WP4A 2AZ5A 2Y33A 4QPGB 2B42B 3DECA 2OW4A 4BQ1A 1AVBA 1OF4A 4IE6A 4QX8A 2ZMLA 2DU1A 1UPIA 1ULFA 5E6HA 4NPMA 2HJIA 1EP0A 2C26A 2TNFA 4K40A 4WM8C 3T08A 4A3ZA 4WM8A 5EFUA 5F2WA 3KHCA 4MH0E 2X8KA 2ZKLA 2BGCA 1H6YA 3H8UA 4OMDA 4Y3OA 2VW1A 5LZ6A 2A6WA 5JCTA 3A23A 5E89A 2XHKA 3M3QA 5KWRA 4RYDA 5LW9A 2PHRA 3IBMA 4FTEA 5A3UA 1OD3A 4B1LA 4MG2A 4QD2A 1JI6A 2V4VA 5A6ZA 3S57A 1YNAA 3T2OA 4QQ2A 4H7MA 5J3UA 3NKTA 2XDVA 4OUEA 3LEKA 1G9CA 2XH6A 5A7PA 4E4DX 2GMEA 1PVC1 3PURA 1NUKA 2YMZA 1DP0A 3OEBA 4L99A 3M7AA 2Y64A 2XGXA 3BOPA 5FYHA 1FNYA 1FYUA 4RN5A 5A7QA 5GZCA 2YDEA 3ES4A 1UF2C 1DCSA 2IXLA 3KSCA 1ZM1A 2V72A 2DTWA 4XFFA 2W1QA 3UJOA 2UWAA 4HPKA 3VZNA 2ZABA 3AXEA 1UZ0A 4R9AA 3AYAA 2EXHA 5EP9A 3LAGA 2EA7A 1GP4A 1WGPA 4IETA 1O3TA 1UZYA 1KRIA 2WWSA 2BW8A 5LEJA 2RDQA 3DKWA 4QQHA 1OOPA 1P8JA 1VB4A 1OXCA 5FUPA 3TB0A 4CTEA 3ZR5A 1AX0A 5F5IA 4CDUC 3KGZA 3W20A 4K6BA 3Q8FA 2VQTA 4XQDA 1VLNA 3IDAA 3PIJA 4Y5TA 4IGOA 5CBLA 1RB8G 1QQP2 2EICA 4BWOA 3WHTA 4AVTA 2IXIA 4AVAA 1H2LA 1LHOA 1F35A 3WUCA 5FYCA 1Z78A 2XJSA 1FXZA 2DBIA 1B09A 3AKRA 4I0AA 3VBUA 1LU1A 1J1TA 3D82A 5IK7A 1U0AA 2XL9A 4OUMA 3FN9A 5F3IA 3MV11 3PHMA 1HXS2 2PHFA 4YGCA 5T52A 3WUDA 1JH5A 4EQVA 1PGW2 1SCSA 4ONUA 1JHJA 4RR3C 4W6WA 4RR3A 1F4AA 2G1MA 1ND2B 3DF0A 2X53S 1PM4A 4I01A 2ZGPA 3RQ0A 4JV4A 3VGIA 4A45A 2F6BA 4LBNA 4SLIA 3M1HA 2VGDA 2FBEA 1VAMA 1OT5A 1OVSA 3FBMA 3RS6A 1HRI1 1MS9A 3RG0A 4P14A 2ARBA 1J59A 5FP7A 5LK5A 5ANNA 3AZYA 2OQ6A 2W91A 5LBBA 5SV8A 1HRI3 1IGOA 4JKLA 1ENXA 1SCRA 1MZ5A 4P9GA 3N9MA 4ET7A 4ITCA 4AAPA 3DXUA 2ETEA 4BQ4A 5KR7A 1WBFA 4H7LA 4Q5OA 1UZVA 1PNGA 3B93A 4YGBA 4LXLA 3ILFA 1G9FA 2D97A 1US2A 3NQHA 1AJOA 1RIRA 4TYSA 3R6SA 3AJZA 5FUNA 3WCSA 1HV1A 5FPBA 3ZSKA 2HH9A 1VP6A 2YROA 3EXUA 2GNTA 3O1RA 2Y6LA 1WD4A 3ACIA 4I2OA 4UFLA 4UI9L 4YG0A 3HMYA 5CZKA 1NE4A 4LBLA 3WOGA 3VZLA 3VN4A 4AQTA 5BNOC 4BLIA 1S0EA 5BNOA 4JX0A 1NA1C 5C8WA 5JAXA 1NA1A 3VDDC 1QEXA 3VDDA 1O3SA 1FOD1 5CG9A 1SBEA 1JN2P 1UMZA 3POYA 4JDOA 4XFIA 1H9PA 1QH7A 3GF6A 2CDOA 3O1SA 1ZZBA 3NNMA 1FOD3 4I0WB 3GBGA 3T0BA 4ASKA 4CEYB 5C33A 5C9AA 5A7WB 1LRHA 1Y43B 5FLIA 5FZBA 5KHIA 5FZFA 1SZBA 2P1BA 1LOAA 4M00A 5GZEA 4GWNA 2QZ3A 2WQ4A 2DUQA 4XETA 1W9YA 4LHNA 5CEHA 3BTYA 4R4XA 4PLOA 1R081 1AYM2 1PX3A 3IDBB 4Y24A 3MIHA 3AP7A 1W2NA 1RUNA 1XNDA 1FV3A 2WYFA 3THTA 1YI7A 2WO2A 1RMU1 2BVBA 3HJRA 3TNQA 1R083 2CDPA 4LUMA 3RSJA 2WA4A 4CDWC 4Q4W2 2QQOA 4CDWA 5HV4A 3KV5A 1R1ZA 1RMU3 1VB2A 5FWEA 2J42A 1V6IA 2R49A 4MVTA 4BQWA 2BQPA 5HPOA 4XPVA 4XILA 2W92A 4XMIA 3ZFGC 3ZFGA 3U1XA 1WWYA 2VMHA 4MGSA 5FY7A 4NE9A 1ND3C 3A0NA 1ND3A 2W95A 2X29A 3SXWA 3U10A 3D6EA 3E6BA 4N53B 3UGGA 4K3UA 5A1LA 3VHRA 1W2TA 3O1PA 2WKKA 3NJXA 2BBAA 1CQ9A 3HPNA 4R52A 4D3WA 4XJUA 1E5SA 3H9AA 2QVSB 2EIEA 4K8RB 3FUOA 1R64A 4L97A 1QOOA 4QX3A 4BLJA 1IS6A 1N3OA 4KG0A 3ZXAC 1RUG1 1JUHA 2PYTA 4GMP1 4NHXA 3I2DA 2BBVA 2JDYA 4CU7A 5KHJA 1LU2A 1AR91 2HWF2 4YG3A 1Z7S1 2DTYA 3N7MA 2BWCA 1RUG3 3BTXA 1U5ZA 1IS3A 1MR5A 1CONA 2RG4A 3I2GA 3ECQA 4LEJA 5DZFA 1DDLA 1AR93 1H9WA 1W2UA 1KS5A 3ACLA 1Z7S3 3POEA 1YFXA 2XQRA 2HBTA 4QU2A 4E2SA 1US3A 1STMA 2ZMKA 4XCAA 1VBA2 3LPGA 2B8MA 1PO11 4LK6A 1V6OA 5FXXA 3RGBA 3N7LA 4AGRA 2UY8A 4CCEA 1VBC1 2HWE1 3ZFFB 4CXYA 2RJ2A 1PO13 4AFCA 5F8PA 2P4EA 1CAXA 4EROA 5FO9B 1VBC3 3E1F1 3AVSA 1W06A 5FK8A 2HWE3 3K51A 1OPOA 4H55A 1O4ZA 3VD5A 4AVBA 3KMHA 3AL5A 2AC1A 3S0MA 1WW5A 2VZSA 4CCCA 2O14A 3LCPA 3PUAA 4WZCA 2WAAA 3LGRA 3AVRA 2YY1A 1NLRA 2ZX2A 3I2IA 4P9WA 3SH5A 1QWRA 3A4UA 3ZYBA 5IHRA 4R9DA 3CKHA 5CADA 1AX1A 1EUTA 3TEYA 2V4AA 4R8HA 2A7AA 3EB7A 4AL9A 4ZU4A 2ZHNA 2J1RA 2ZJCA 1ALYA 3KCCA 2B4KA 3OEAA 2WINB 4MZUA 4FSJA 2YZ4A 1RVF2 1APNA 3B3QE 4FPFA 4XW3A 1I6XA 3VD4A 2FD8A 5FZ3A 5LBFA 1F5JA 2AH2A 4K21A 3I2FA 3SISA 3I97A 4DUVA 3TN92 4W50A 2Q8EA 4NHKA 4NN0A 2CU5A 4QQLA 4IGQA 1SBFA 4QWNA 1O91A 1UY3A 1SG3A 3IMNA 2YBKA 2ZZJA 1Q8SA 4IEYA 4LITA 4B29A 2WT1A 1MZEA 1MZFA 4YFZA 5K7PA 1YJLA 2G19A 1BBT3 4QPWA 2FMDA 3CLPA 3MUZ1 4URTA 4YVSA 2BPA2 4LO5B 2BERA 4XTPA 4KWJA 4DIQA 5I91A 3SH4A 1HQLA 2R071 4A6OA 2R7EB 5FREA 2HEWF 5B4XA 4B4RA 3ON7A 5JXHA 3HQRA 2Q0AA 2Y34A 1UXXX 3WQ1A 3LF7A 2R073 4BK5A 3FJSA 2CGOA 2HWD1 1VALA 2R042 3QD6A 4AHXA 2W68A 1RUI2 2FQPA 4OULA 3MGUA 4RQPB 2FMYA 4ES9A 5F37A 5JIUA 1UOBA 3G7DA 1NY72 2HWD3 2WFPA 4AXOA 4AZZA 1G6NA 5FP4A 1W6MB 2PAEA 4LO6B 4CU6A 3MV01 5DDJ1 3M70A 4CDQB 4QGNA 4AVSA 4BE3A 1MS1A 2DCZA 2WNVC 1TEIA 2GMPA 2WNVA 5EYXA 3VHOA 1W0OA 1OC1A 4LKEA 1KJLA 3B69A 4X6RB 2VMGA 1LGBA 2Y6FA 5DDJ3 2WAOA 4AI8A 3NMBA 3LEGA 3WVJA 3WHUA 2ZHLA 3DUIA 4LA3A 1QF3A 1QH6A 1X82A 1NCRB 2XR4A 3OGVA 2VW0A 4JRLA 4AK3A 4LBQA 5FPZA 1QJFA 4PCRA 1DLLA 3CJIB 5FJKA 3C2UA 1SLTA 2P2KA 2OIIA 3N9NA 5FXZA 1WLDA 2YG0A 4L9BA 4N7IA 3IDCB 3POIA 3SLIA 1AR81 4HMZA 3VKMA 3H1MA 2CY6A 4JTNA 4BH9A 3NO8A 1TQ5A 4DY3A 5J09A 1AR83 2FCTA 2QFEA 2VBDA 4CE8A 4JZRA 3P3PA 4XCBA 4JTOA 4BCUA 4E4SA 1LEMA 4D6QA 5BUVA 1QJX2 3RZZA 1D4M1 5FRAA 1NZCA 1LHUA 2VO5A 3C7GA 5JWPA 5LK7B 4WM7B 1C4RA 2WZ8A 4AEDB 4XJAA 4NAMA 4LQRA 4YARA 1D4M3 4TWTA 1ZRRA 4QT6A 4DUWA 2D6KA 2MPFA 2ZKNA 4XAAA 4K1YA 3ZR6A 4ZHNA 2R6QA 1UKGA 2D6LX 2RR12 3DGTA 1R1A2 4LR4A 4XFGA 4EWAA 4Q27A 2CV6A 4YZ3A 3MIDA 3O1TA 1JZ7A 5FQ0A 3I49A 3TEXA 4GH4B 2R1BA 4CDXC 1SHWB 3GCWA 4CDXA 2ZEWA 1PM7A 4N43B 3SITA 2VZUA 2ADEA 1QJU1 3IZOA 4X8PA 2AACA 1ASJ1 5D1IA 5IATA 1DQ5A 2WZR2 3CHXA 5JOZA 5C5TA 5E16A 3I54A 1BVVA 1GR3A 1MVQA 1PO21 1QJU3 3LWCA 3PMSA 1ASJ3 4XF4A 3T2PA 3WX5A 4Q4V2 4UWDA 1JYCA 5HBAA 5C8CB 1UYPA 5GZDA 1HJGA 1PO23 4JQTA 3SCHA 2Z69A 1ZRCA 2ARAA 4IUGA 3SH3A 4BXSV 3LE0A 2C9AA 1BEV2 2CAVA 2IXHA 4AR2A 5AFBA 1KITA 4Z2AA 2PMWB 1W6PB 1A78A 3KT4A 4RS5B 4ZONA 1DIWA 4NVPA 4QAWA 5FXWA 3RRDA 3UGHA 2J1EA 4P5HA 2VNOA 5BPXA 1PGL2 1ZA7A 3MFAA 2F4LA 2XLGA 2YC2A 3BCWA 5GJ6A 3IKWA 5HXVA 1DQ0A 3V0BA 1QJY1 2GNDA 1REEA 1HRV1 3PNAA 2YGLA 4UBHA 3BIEA 3I2HA 2VPVA 2D44A 3Q8BA 1QJY3 3QBQA 4QU1A 1HRV3 3HIFA 3THDA 2BFUS 4AHZA 4F7ZA 4L0PA 4QDRA 5EPAA 4CCJA 2PTMA 1Q43A 5G05L 1AXKA 1J3RA 4HKLA 2ADDA 3P6BA 4L92A 2WT0A 3VBFA 2JEMA 2GALA 1UY2A 2RDSA 2RS52 2YYOA 2VZ3A 3PUHA 3W59A 3E5XA 3WP6A 1JU3A 3J8F1 1K5MC 1K5MA 2UURA 4KBBA 3JD71 1UYYA 2QQWA 2RJKA 3CBNA 1OPMA 2QQNA 3WR0A 1OURA 3J8F3 5JOWA 3MUY1 4XUPA 4HKOA 3JD73 1NCQC 1NCQA 4LE4A 4OUSA 4FPGA 4FFFA 4Y1YA 1UYXA 3B02A 1X9PA 4COUA 4PLMA 3WT3A 1H1MA 1YI9A 4P9IA 2E7QA 4ASLA 2IFWA 2YBPA 4RHV1 4XIKA 3THPA 1UZZA 4BMBA 5I0SA 3WSOA 1JZ2A 3S5QA 5BNNC 3H3UA 5BNNA 1AL21 1SMVA 1OOPB 1Y4WA 2W2IA 4RHV3 5JSOA 3ZXKA 2MEV1 4I30A 4UOJA 2LW8A 4OZOA 2AUYA 4LIUA 4QPYA 4QKDA 2Y60A 1UD1A 3AK0A 1DGRN 1NG0A 1BZWA 2MEV3 3KCXA 1UOGA 4MYEA 2KA3A 1XNAA 4HKWA 5T5LA 1YWKA 3FLPA 2C9KA 3BPSA 1JS9A 3OGJA 3V0AB 1X8EA 3WDWA 1ENRA 5BNPC 1JYVA 1RXFA 4PBOA 4ES8A 1BKZA 1JTZX 3NV1A 3OY8A 3NJVA 3DPRC 4LKDA 1BJQA 3DPRA 1WBLA 3ZSMA 1ODNA 2YV8A 1RUF2 3PVEA 4NR1A 2R0FA 4Q26A 4JAAA 2JKBA 4AI1A 3Q8CA 1RUJ1 3AKPA 3VHNA 3AYEA 4XURA 4C90A 3W5NA 2N7GA 5L73A 2ZGMA 4XBLA 5A3WA 4IV3B 4I3PA 1O6UA 1XXNA 1A8DA 4XMAA 4RGKA 2BOJA 2E63A 3KF5A 4XOGA 5FPLA 5FXVA 2O8OA 3WNXA 5HCFA 1YQ6A 1D2SA 3BPZA 4FQZA 4AEMA 1SBDA 5A3TA 4TLFA 5JDBA 3LDKA 3K75B 1YUDA 4BJ0A 1RUD2 5GLUA 1LEDA 3ETQA 1RHI2 5ABJC 2DVAA 4JGZB 5JZGB 2WNUB 3O0WA 1WMXA 4N9IA 1NXMA 4OVEA 4Q4Y2 1CR7A 3VBSC 3VBSA 2E26A 3CU7A 3MLJA 2VUJA 3WDXA 2XLAA 3HN1A 4CU8A 4L2NA 3VZOA 4A42A 4IEOA 5FZGA 5HCBA 3ZDVA 1IPJA 4U2AA 5EXOA 2E31A 4GWJA 3MIFA 2D5HA 1VMHA 3R4SA 3OBAA 4G4FA 3UKVA 1CJDA 2ZHMA 1G8WA 3HOBA 2IWGB 3LD8A 1C3HA 2JENA 4Y33A 5FZIA 4CP9A 2PQSA 4W6YA 3PLQA 1OH3A 1FNZA 2V09A 4YM1A 1X36A 3O1MA 1OQEA 3HNBM 3VB9A 1H8VA 3AMHA 4FOQA 4QHZA 4AQ2A 4YZ5A 3OPWA 4YVWB 1HJFA 3KWVA 4Q1RA 1LHVA 1ZRDA 4HVRA 2V5YA 1CAVA 3GALA 1OHFA 1OQDA 4DEVA 4IW3A 4IV1C 4IV1A 2L9LA 4YM0A 5CFCB 2ZGLA 2LRPA 2VM9A 3NNLA 5C9AB 1VIWB 1YRZA 5F6KA 5L7OC 1TG7A 5L7OA 2RM22 5F39A 2VMDA 1WLWA 4AW7A 1YXWA 3N9PA 4QX1A 1D4VB 5FMOL 1MS8A 3I2KA 5JOXA 2LALA 1S0GA 2WN2A 3CZUA 4J1WA 2J22A 2ET1A 2DVBA 2WBKA 4QXCA 5L19A 4H2AA 4QPIC 4HVQA 2YFUA 3DYMA 4IL7A 4LMFA 3MW3A 3POBA 5A1FA 1QQP1 5I8TA 4CPBA 1YIFA 4Q2FA 5FP3A 4ZKTB 5IVJA 5I0UA 2P3KA 4NUBA 3H8OA 1W05A 3TRSB 4QX0A 2P6HA 4PIXA 1LR5A 1HXS1 4NAOA 2NLRA 2QCSB 1HB3A 1B35B 2EF6A 4C0HA 2JDKA 4LHKA 5HCHA 1N3PA 4NWVA 5FZCA 2BRTA 5IK5A 3S6PA 1HXS3 4CUBA 4CUGA 4XZPA 4ZZ8A 1NZIA 1J58A 1BLZA 1ZBE2 1HX6A 2ZX3A 3GJAA 3QH6A 4UFKA 3BVCA 5F3CA 4F3JA 3T2TA 3HQUA 1KJRA 1GOGA 1D0HA 2A75A 4TN7A 2ZX1A 3U0ZA 3OBTA 2RS32 1SLAA 4FT8A 4HN1A 3SMHA 4YZ4A 1UIJA 3OBZA 1XJAA 3OJBA 4XZUG 2MNGA 1ZBA2 5LBCA 4IE5A 3VBOC 3VBOA 3I59B 2VQUA 5F5AA 1GYKA 1NAEA 2WO3A 4DQAA 1A6CA 5D21A 1REDA 1QIQA 4XVHA 2YGMA 3TYJA 2QQVA 1MS5A 2R062 4XQ4A 2B45X 5BXXA 4DXRA 1COV2 3NAPC 5FKBA 2BP6A 3NAPA 5JLVA 4ATEA 4YFWA 3CDZB 4YW4A 3H50A 4MXWA 3POJA 4OHVA 4XXAA 4EN7B 2LROA 1WCUA 1YIPA 2EXJA 3NRUA 2EIBA 4XDQA 3OB8A 1W6NA 1FMD1 2LTNA 4PQ9A 4QM8A 5T5PA 1V0AA 4UF0A 1N3QA 1JXNA 4H3WA 3WG2A 1LOGA 3MIBA 4PF5A 3R05A 2O1QA 4LO7A 2XQXA 5GM0A 1TMF2 1OF3A 1VBE2 2DV9A 2OVUA 1FMD3 4PI0A 5IVYA 4D0QA 1C8M2 4DB5A 3VKLA 2ES3A 5CG8A 4NPLA 4C8DA 2CGPA 3KVAA 3VBHC 1BVP1 3RMXA 3VBHA 1X9TA 3H3LA 2ZGTA 3ALQA 3ZKUA 1HB1A 5EHDA 4LK7A 1GZ9A 2JWPA 2XVLA 2VOKA 5EZWA 1BMV2 4FPOB 4ASMB 1AL0G 2HWB1 2ZHKA 4XIOA 1A3KA 1UU5A 2Z4FA 3WNLA 4TLGA 2R30A 1CD3G 1RL3A 2DWRA 5FV3A 2OYZA 4YW7A 2HWB3 2BWAA 3H7YA 4GB31 5IVFA 4ZU5A 4M3CA 2A73B 3AX4A 4AI3A 1VMJA 1PVC3 5A33A 2A6YA 2PHXA 1YFUA 1AYM1 4X8NA 4PI2A 3C8XA 5AC92 4GKYA 4OHWA 4GB33 5FZHA 3FMGA 2W9XA 4KU7A 3VKOA 5CVRA 4AGVA 3GM8A 4BB3A 1XE0A 2IC1A 3ZFEC 1GANA 2ZBJA 3ZFEA 1AYM3 3BTZA 4CCDA 2PLV1 3NKGA 4Q4W1 4GQ7A 4HN0A 2JDNA 3NJYA 3J9SA 4YVSB
chains in the Genus database with same CATH topology
1DGWA 4CDUA 3HAGA 2PLV3 4Q4W3 1OFSA 1RC6A 1HQNA 1SACA 2YPJA 1MQTC 1MQTA 5GZFA 4PIZA 1AYN1 1IS4A 4Q4X1 2GDFA 5FCCA 1VBB2 3B5LB 5JVVA 5J48A 1PZ7A 4META 2WSUA 4S2GA 4Q4X3 1AYN3 4PDWC 1F31A 4PDWA 3FWEA 4AI0A 4LBOA 1NOVA 1S0IA 1WW6A 2VECA 2RHPA 2BNOA 2EXKA 2H0VA 3WV6A 3PVBB 3M4FA 4CRQA 3VKNA 1YFYA 2E7TA 4AQ6A 1RUE2 4IXLA 2HWF1 5T5OA 3VZMA 4JVAA 4Y20B 2G9GA 3CNAA 1I5ZA 3GBFA 4FOYA 4KQ7A 2HWF3 5GLWA 4JGYB 4A7KA 2CYFA 1RUH1 2QDNA 2VNRA 2WSVA 4COWA 4MSVA 3TWIA 3ATGA 4YG6A 3VBRB 1RUH3 4UW3A 2PAMA 3A0KA 2VQAA 1SLCA 2WFF1 2NN8A 3WW1A 2WA3A 1ONAA 1Q8PA 3AP9A 3GZUC 5GLVA 5KBFA 3MLLA 3GZAA 3IIAA 3WQ7A 4CYDA 1XU1A 1OMIA 1KXGA 2WFF3 4B7EA 1DF0A 4FOVA 1V6LA 4GWMA 4NHMA 2DYCA 1ZZ9A 3WLUA 2JG8B 3O14A 5SV5A 2D93A 1V6KA 1PZ9A 2JG9C 2JG9A 1R092 2XG3A 5JZGC 4H14A 2GC3A 2ILMA 5EV7A 4LBQD 1QNYA 3NSTA 4XJZA 2ZAAA 1RVF1 1C1FA 1S0CA 4K20A 5I93A 2PFWA 1RVF3 4EWEA 5D8AC 5D8AA 1D0GA 4GIQA 2WT2A 1ZZ7A 4LT5A 3AFGA 1LCLA 4EWDA 2A5ZA 4XXPA 4RFT0 4AGGA 3WZ1A 1G9BA 3HWJA 3GNEA 4HFSA 3KQRA 2BNMA 3RYRA 5CU1A 1WCDJ 2VXRA 1W6OA 4BM8A 1O3RA 1C5IA 1DZQA 4HVOA 3MLKA 3BODA 3ZXJA 3AFKA 1RUI1 1O7FA 4WVMA 4XTMA 5BY5A 1S0BA 1CAUB 1NY71 4FTSA 2A70A 3OF1A 2XWJB 1RUI3 3V0BB 3GHMA 2Z42A 3GHNA 3HT1A 2ZGOA 3N3HA 4B7KA 5H9SA 2D6PA 5FAXA 2VY0A 2HWC1 4OHZA 5DZGA 3JU9A 5JPMB 4Y26A 3BU7A 3VV1A 1WCSA 5B2GB 2HWC3 2Y0OA 4JQRA 4QGMA 1H8TB 1IKPA 3VBFB 2Z5WA 4HL0A 2R16A 4XF1A 1WW4A 2A71A 4Y22A 4GMP0 5CA6A 3B94A 4LBJA 1G7YA 2XWBB 4GMP3 1EAH1 4LTAA 3C3VA 2PA7A 5A32A 5JI9A 2JJ6A 2OUJA 2NP0A 1VBD1 2XPJA 1H2NA 1AUYA 2XBO2 4B4QA 1EAH3 4R9BA 4K8FA 1PVXA 1DQ6A 1QJX1 1CIWA 3AM2A 1EPWA 1VBD3 5ACA1 5DUWA 3X29B 4UW6A 3MW4A 4WVWA 2XJRA 3KT7A 4KGQA 4FAGA 1QJX3 1RINA 1PK6B 5CFDC 2EALA 3RPQA 5CFDA 5ACA3 1ENSA 3D0SA 1QHDA 3IN9A 3FUQA 4FPHA 4BZ4A 4Q1PA 5LRRA 3D4KA 2DVDA 2RR11 1R1A1 2R1DA 1WMDA 1Q5OA 4INDA 2RR13 5T50A 1R1A3 3MEPA 2ATFA 4QPGC 1WMFA 4IEVA 3AMMA 3U07A 3ZYJB 3ZSJA 5K0UB 3B7MA 3ST7A 2NQYA 3MF9A 2RS12 5KHKA 2C1FA 3H7JA 1V00A 3RJRA 3CEWA 4KGGA 4FAHA 3JQWA 2ARXA 1UKRA 3FFQA 4KG8A 2XVKA 2P37A 4Q4V1 2FZ2A 4EV0A 2DUOA 4DY5A 4RA0A 1O4YA 3KLSA 3AZVA 3H3ZA 5KC5A 4XFHA 3Q9OA 3S7EA 4Q4V3 1WW7A 3OYWB 4ISQA 1JUIA 1IZ3A 1UN1A 2DUPA 3ME2A 2XJPA 3RWNA 4DS0A 2Z79A 1AZDA 4Q0VA 1HW5A 3MW2A 2X5IB 5EWSA 3L9JT 2Q5TA 3O0XA 4XHXA 1FOD2 1ZA4A 2P3JA 1PGL1 3ROUA 1OQ1A 4XHBA 4CP2A 1VRH1 2PQQA 3TOJA 4E9KA 2VUAA 2P34A 3WW3A 1IOAA 3LSEA 1MEC2 1VRH3 3AYDA 3TNPB 3W58A 4N7UA 1ZVFA 1DHKB 2ZOEB 1VJ2A 4MGKE 4YW3A 2VMIA 1VR3A 3I4IA 2R32A 3RDIA 1R082 3VZKA 4Y1XA 1IQAA 1D2QA 1UU4A 4COYA 4P9YA 2B9UA 3I7DA 3E5UA 5JSPA 1CPMA 4AFMA 3FZ3A 4J6GA 2GZWA 2WC2A 1XNBA 1KFXL 3JQXA 4YZ2A 3FLRA 2DCTA 2KM2A 4BMEA 1AJKA 3QCWA 2PN5A 3WINE 4DINB 1ZRFA 2GH8A 1QDOA 2VVDA 1MVEA 5AVPA 1ND2C 2DFCA 4XFCA 4AFBA 1RITA 4FQ4A 2PHUA 3L2YA 4M3CF 2LUWA 3LZZA 3MDPA 4A3XA 3KGLA 1OLQA 4Y1ZA 1BQPA 5C4WB 1H2MA 3E5QA 5DXDA 3HR9A 4FPKA 1HIXA 3AKTA 3FE5A 2D3PA 1RUG2 2UWCA 4LHLA 2G4IA 4KU8A 3MICA 1DGWX 1XRUA 1W39A 1AR92 1Z7S2 2GAUA 1GZCA 5FO8B 3ENRA 1GNHA 1XQNA 3SCGA 2VOWA 2ZTNA 2OZJA 1V6JA 2Q30A 4JC1A 3ZN6B 1KD7A 2PHTA 2JE9A 3ZXDA 5GZGA 4FPYA 3IPVB 4Y4YA 3WG1A 1VBC2 1EYBA 5T3NA 1LOEA 1QXRA 2GN3A 2V73A 4S2HA 3UKTA 1RUD1 4L8QA 3WY6A 3HQXA 2QZ2A 1CN1A 5H9PA 1TE1B 1YLLA 5KXBA 2VQ0A 3W9AA 3DL3A 3AP6A 1GQGA 1RUD3 3RYKA 1CAWB 1O4TA 4CEWB 2GN7A 3HT2A 4AFDA 2ZX0A 1FI2A 1NLSA 4IEZA 4YSFA 5J96B 2ZAHA 4CEYC 4E2QA 4CEYA 1GNZA 4WZFA 1DG6A 4HK8A 4QMAA 2XB6C 3WXPA 4TSVA 3IM0A 2TBVA 1PMIA 5IK4A 5DG2A 1XYPA 4P9JA 4WM8B 3OD0A 4OI0A 3JUUA 2JX9A 2A3WA 5JI7A 1BBT2 3AJYA 1PHMA 4YZ1A 1JBCA 5I0RA 1AR71 1PIV1 2GC2A 2DU0A 1QNWA 3JBG1 3B9IA 1JOJA 1XE8A 3N35A 4RSUA 2RM21 4WBBA 1AR73 1PIV3 3LOBA 4N53C 2D6MA 4N53A 3JBG3 2HWD2 3RYPA 3O12A 2WQZC 2NMOA 1URXA 2RM23 2UYAA 4XYXA 2UWBA 2VU9A 4YYOA 4PIYA 3UL2A 4HPKB 3LKJA 5T54A 4M0NA 1GV9A 4AE2A 1EV11 5DDJ2 2BFUL 4XBNA 2I07B 2EVXA 1ULCA 1EV13 5E88A 4CDUB 2Y0IA 3AXDA 1LOBA 1AL23 3NV4A 2ENRA 4C0BA 3QOPA 4AI2A 4JRAA 4CZSA 3USUA 4G3YC 4LO4B 4QXKA 3FC0A 4Q8KA 1QOSA 3VBUB 2E7AA 1BCXA 1OKQA 5BNPA 1LB2A 1AR82 2DVGA 3ZVXA 2BEOA 3ZFFC 2RMU2 3ZFFA 1F5FA 4RR3B 1ZBA1 1LENA 1GQHA 3R0RA 3KM5A 4KL1A 5T55A 4W6XA 4YRDA 1ZBA3 1HDKA 3K48A 2WLPA 3DV8A 3AP5A 3HBZA 4ORFA 2R061 1RUJ3 4XEZA 4NPRA 1HQWA 1G9AA 4FP2A 3E6CC 1COV1 5GLTA 3RNSA 3ZYPA 2GC0A 2R063 4IERA 2E9QA 2UY9A 5F6LB 1COV3 2EIGA 3NL1A 1V9U2 5ABJA 1Z0HA 3L2HA 4XF9A 2MHFA 1Y9QA 4RGAA 1T6GC 3WG4A 1LKNA 1C5HA 2XUMA 1TMF1 1VBE1 4TZDA 1C8M1 1Y3TA 1PO22 1BXHA 1TMF3 1VBE3 3B9CA 3OPZA 1C8M3 5KC6A 2OPKA 5DUVA 1WD3A 4AEJA 2WL1A 1BMV1 3P3NA 5BNOB 1WA4A 1AR62 4D7SA 3ZPYA 1NA1B 4IEQA 3O5SA 1LESA 1AXZA 3OD4A 4R4ZA 3VDDB 1ZYBA 3POSA 1BK1A 2ZACA 2ZCWA 3V64A 1N1VA 1OLRA 4RQPC 2NM1A 4RQPA 5FMOS 5J36A 1H4GA 5FOJB 3MIGA 1W6MA 1QJY2 4MX3A 1DGLA 2A6VA 1DZRA 4MXVA 4SBVA 4CDQC 1FAYA 4GA9A 4CDQA 2BVVA 5HCAA 1GKBA 1OFNA 3AMNA 2TEPA 5A3LA 2DFBA 5FO7B 1DBNA 3CL1A 4XF3A 1LGCA 2QKDA 3FX3A 1KDMA 1M4WA 3JB8A 5J7MA 4QPIA 4W65A 1AXYA 2GC1A 1SLIA 1NCRC 4U36A 1NCRA 1Q3EA 3LA2A 4QX5A 4B8EA 4IEPA 3AZZA 3CJIC 1VBB1 5FLHA 3CJIA 4CDWB 2LM3A 2P3IA 1QQP3 2B5HA 4MGYE 3JD72 5C6CA 5FDBA 2Q1ZB 3R4UA 3ZFGB 1VBB3 1DU3D 4FOWA 1PGW1 4Q8LA 1ND3B 1AX2A 4F8AA 3WP5A 1QY4A 1RUE1 4Q0UA 4HZFA 3RMYA 1YJKA 3ZO0B 4WM7C 2VOXA 3H1WA 4WM7A 4AEDC 4AEDA 1RUE3 2IXJA 3UV9A 3ZMOA 1CPNA 1HV0A 2WJSA 1LECA 5FOBB 1G86A 1NE6A 1POV1 2ERFA 5K9YA 2YUEA 2MEV2 2PHWA 1JYIA 3WCRA 1N1YA 2DVFA 1U5YA 4DMIA 3AMPA 2QNKA 3RJ2X 1A8MA 2B7YA 4GH4C 1XYOA 2ZZQA 3G6JB 4N43C 1MZ6A 4N43A 3AKQA 3ZSLA 1RUC2 4XE9A 3SHRA 1UAIA 3QH7A 5I8SA 4AFAA 1TME2 5C8CC 5C8CA 3FLTA 2Y38A 1LHNA 4KWLA 1CAXB 4YLZA 4BYYA 2WS92 2VW2A 4NO4A 4C1XA 2HEVF 2SLIA 3LOIA 1XYNA 4QHBA 3VUOA 1YHFA 3WQ0A 1HLCA 1U5XA 1UL9A 3IDEA 4I0BA 1W6PA 4RS5C 4RS5A 2BNNA 4FXKB 1CJPA 3N7KA 5I8YA 2QQPA 1ZZCA 5KHHA 2HYKA 1DQ1A 1SEFA 3N7JA 5GKAC 4AEKA 5CNAA 3AP4A 4ATFA 5EYYA 4COZA 3VKFC 4FPEA 4I02A 2ZGRA 1C8NA 3B01A 4EN9B 4UBGA 4DOUA 1UW8A 2VG9A 2DCJA 1F8VA 3N4MA 5AVAA 4XF0A 1ZNPA 4IEUA 4DZGA 1S0FA 4Z1VA 1MACA 4EN0A 2PHDA 1SFYA 1DFQA 3ZYGA 4PLNA 1MS0A 2A3YA 1DGRA 4IEXA 1HKDA 4FPLA 1OA2A 2AR6A 4OLLA 4Q0SA 2ET7A 3EHKA 3FFZA 4IESA 2FZ1A 4YGEA 2I45A 1RTVA 1FPN2 3IWZA 1V6NA 1OOPC 3TAYA 2WNEA 4MGZE 3D8CA 2WNVB 3T1LA 4LA2A 3HD8B 3D0JA 4WV8A 5TSWA 1SDWA 5T5JA 3ZXEA 1UU6A 1UPSA 2Y26A 3VBUC 4MLOA 3V0AA 1RJ8A 2XBO1 4LBQB 4AWDA 4PBPA 3OTFA 1VBA1 1GSLA 1WMEA 1X8MA 4A7ZA 2IXKA 1AF9A 3DN7A 2AGSA 2XBO3 5GLZA 1CGPA 3WDTA 4E4ZA 1VBA3 3RI8A 3ASIA 4O9EA 3AZWA 2OUHA 2W39A 2XL7A 1RUOA 4IV3C 4AF9A 4IV3A 2K2SA 2E53A 3KZ4C 4LLFA 1U12A 1IPKA 1X33A 3PMEA 4XFBA 4BOWA 1C57A 4N90A 5DUUA 2JDZA 2VULA 2HEYF 2CWSA 4JGZC 2RS11 4JGZA 3M8LA 3MFCA 2WNUC 5JZGA 2WNUA 2ZGQA 1WLTA 3S30A 2RS13 3ELNA 4OI4A 4PJYA 5FQ0B 2BYVE 4CDXB 5FLJA 1N1SA 5E1RA 3H0OA 3J26N 1H4HA 4OFGA 4RGGA 3TN91 1FATA 2H6BA 1FMD2 3N36A 2XKPA 3MPBA 4L11A 3TN93 1W6QA 3BALA 4YVWC 1QMJA 4YVWA 1H1IA 1UCXA 1KS4A 3BB6A 1LGNA 4LUKA 2QJVA 5IT6A 4QGLA 2YC0A 5KXEA 1N1TA 3BTAA 1Q8VA 1S1AA 5CFCC 4P9XA 5CFCA 3EJKA 4K7JA 4YW2A 1G9DA 2JXAA 5C9AC 3MIEA 2R041 2HWB2 1QKQA 1MEC1 3VL8A 1XNKA 3MF6A 1DZTA 4NHLA 1PVC2 4E2GA 5JIAA 4A2UA 2VNGA 4QQPA 1YO8A 2R043 1MEC3 2F4PA 2H6CA 4GB32 2A3XA 3MI8A 4D94A 4OHYA 2P17A 4C1WA 2IZWA 1H0BA 3JZVA 2PLV2 2AENA 3M3CA 1IKQA 4B4PA 5KXDA 3WP3A 2DF7A 5JPNB 1LHWA 3AYCA 4Y5Z0 3UKNA 4WVZA 4Z92B 4HSLA 1B35C 3KCYA 5DUXA 4K9SA 1B35A 3O7OA 5F5QA 4RD7A 1JHNA 1K5MB 3ZYIB 1GZWA 4AHYA 4Q4X2 1AYN2 4D7TA 5JOYA 4DFSA 1NCQB 1EY2A 1LODA 3I8TA 4J1XA 5JSRA 3CO2A 3LSDA 1UIKA 1YCIA 4C91A 3I59A 5BNNB 3B00A 2R0HA 4LE3A 1LTEA 2ZGKA 3R4DB 1EPZA 1QJZA 4Z2WA 2K9ZA 1HRI2 1RUH2 2OZ6A 3USUB 4D7YA 4QPGA 2PHLA 1SQ4A 2JE7A 2Q4SA 4M0HA 2NYYA 5BNPB 3PVOA 4HSJA 4KNCA 1OSGA 3CJXA 2WZR1 3OY8B 2Z2SB 2WFF2 3DPRB 3WDUA 4YNIA 5AFEA 2D6NA 2RE9A 4R9CA 3BIWE 2WZR3 2WLQA 3ZXGA 4Y1VA 2NZ9A 1JW6A 2GH2A 4DXZA 1BEV1 4Z82A 1LOCA 3ILNA 1Y7BA 2G9FA 3KD4A 4P9LA 4Y1UA 1BEV3 4Z07A 4LLOA 4FPCA 1F2NA 3USSA 2VVEA 2TUNA 1TNFA 3MYXA 2SBAA 3NV3A 5ABJB 3JB4C 1H2KA 1GLHA 2H0BA 3VBSB 5F1RA 3U4XA 5CIRA 1CVNA 3FBYA 4A7YA 4M3CE 4Q0PA 3INAA 1ULGA 2GNMA 3RI9A 1BBT1 4EN8B 3OGGA 1V6MA 2VH9A 4FTBA 4MGIE 2D5FA 1V70A 4ISRA 4YVSC 3M3OA 1KDKA 3ZN4A 1WUVA 1QU0A 1I1EA 2D6OX 2RS51 3WD5A 3U11A 2BUKA 2JICA 1RMU2 4EJRA 1CAVB 4GKXA 3TBDA 4N9HA 2RS53 4S2FA 1VAKA 3M3IA 4IV1B 4HLTA 4LULA 2WIIB 3NVCA 5DZEA 1S2KA 3ZX7A 4FP3A 2GMMA 2GNBA 1NYWA 4IQPA 1CESA 5L7OB 2D7FA 3ZSEA 1Q8QA 2CAUA 3WG3A 1ND2A 1E57A 3J4UH 1S2BA 3MPPG 1Q8OA 2HWC2 2VVFA 4Y20A 2XJQA 2XJUA 4BIFA 2ZA9A 4QPIB 1NXD1 4GALA 2O8QA 1PZ8A 5BYNA 4JGYC 3LB9A 4JGYA 4O9GA 3M2MA 3KT1A 1RGSA 2I2SA 4YGDA 3PJQA 4YW5A 5CAZA 2JD4A 3VBRC 3VBRA 4BA6A 1DQ4A 5FBZA 1IS5A 1FX5A 1EAH2 4DRVA 2RMU1 3URFA 1VBD2 1X50A 2D40A 1RUF1 2QE3A 3V56A 1TNRA 1LJ7A 2RMU3 1H1AA 2DCKA 3NWKA 2ZS6B 5ACA2 3O0VA 1PO12 1RUF3 4UXAA 1W0PA 2JG8C 2JG8A 4UW5A 5LEKA 2HWE2 5CB7A 1DYKA 1S0JA 4EN6B 4FCAA 5HI0A 3VBOB 4I3GA 4GULA 1XNCA 1RHI1 1V9U1 3LA3A 2ZGNA 1QGLA 5E8AA 3KB5A 1KQRA 4Q4Y1 3QACA 1RHI3 1O5LA 4HANA 1V9U3 3NAPB 5J37A 4NOTA 2IXCA 1QOTA 4Q4Y3 4GXLA 2ZGUA 4MXWB 4CP1A 5F9TA 3MZHA 4K1ZA 1ENQA 2CWMA 4CP0A 4F83A 1OD5A 4S2DA 2A6XA 1W6NB 4Q0QA 4B3NA 1DYPA 3SNMA 4KH9A 2B46X 4UW4A 5KXCA 1KFUL 1RJ7A 4Z8BA 4XJ9A 2EXIA 3ZIXA 1J3QA 4FO9A 1AR61 5FPXA 1U5IA 4AVVA 3VBHB 3ES1A 1O5UA 4JDNA 4OI2A 5I0TA 1REFA 4LBMA 5IK8A 4G9SB 1AR63 4DPNA 2W08A 2NMNA 5LRSA 1XE7A 3NV2A 3OCPA 2QDRA 1CAUA 2R072 5JMCA 4NWWA 2XJVA 2Q1MA 3PVNA 1VRH2 5FFOC 1GFF2 3VLBB 3E97A 1MS3A 1L3JA 4FVVA 4M3CB 2DURA 2YHJA 3EQEA 2B39A 5A33B 2QUOA 4XJ8A 2VOVA 4AG4A 2XJTA 3E6DA 3EBRA 3POWA 1DQ2A 3NW4A 4AHWA 2PELA 3ZFEB 3PTYA 1H8TC 3VBFC 1H8TA 4QM9A 1GICA 4V1PA 2A6ZA 2BTVC 4HETA 2D3SA 1NQJA 5DG1A 1PNFA 1SLLA 2HKXA 1MQTB 2D43A 2AYHA 3AZXA 3ZIWA 4ZU7A 2CTVA 1ZBE1 4XBQA 3UJQA 2UYBA 1O3QA 3ZYRA 1ZX5A 4PDWB 3VL9A 2OA2A 1S55A 2RS31 1ZBE3 1PK6C 4BPZA 5KHGA 3V65A 1PK6A 1FT9A 4AQSA 3WDYA 5JR7B 2RS33 1WCKA 1D4M2 1AHSA 4FPJA 2I74A 2JECA 2C0ZA 4MV2A 4XFAA 5H9RA 5K0UC 5K0UA 2XLFA 3CF6E 4KWKA 3ZDSA 1FV2A 3NJZA 2XKOA 1CX4A 1RUC1 3VHPA 4XQWA 3ILRA 1J1LA 1TME1 1RUC3 3VZJA 4DNYA 1SLBA 3FHIB 3BOWA 1OI6A 5BNQA 1VAVA 2E6VA 4M01A 1QJU2 2GSYA 3LA7A 1ASJ2 1C28A 1TME3 2WS91 4QQOA 1ZREA 3OYWA 2NPIA 4MUVA 1ULEA 1ULDA 5K8SA 2ZMNA 2D3RA 3UK9A 1C1LA 2WS93 1WLCA 1F9KA 2UU8A 3GZTB 2X5IC 2JG9B 2X5IA 2ZPXA 2DCYA 3IT8A 2CNAA 3AKSA 4AYUA 2ZX4A 5IUQA 3APBA 1N47A 1PGSA 2O0OA 1IHMA 2K0GA 2AREA 5AC91 2CL2A 1MS4A 5D8AB 5A3MA 1ZZ8A 4X6QB 1Q56A 5AC93 1HRV2 1W6QB 3ZXLA 2FHRA 3OBRA 4JDMA 3SCFA 1X7NA 1SFNA 1QDCA 3AB0A 4HBNA 1S0DA 2Q8OA 3WW2A 1NQDA 4BHPA 4WVVA 1GBGA 3D5OA 1W6OB 5EJ3A 4YW1A 4HT1T 4JCKA 1AR72 1PIV2 3WW4A 3GYDA 3AMQA 4D69A 3S7IA 3JBG2 4LBKA 1LULA 4BIOA 3ZN5A 3J8F2 3PJYA 4WVMB 1I9RA 1BYHA 1FPN1 2EAAA 4IEWA 4YM2A 4XJWA 2IFRA 2CGNA 4FXGB 4LO8A 1FPN3 1OA3A 1UX6A 2W0XA 5C4WC 2EAKA 3H1YA 5C4WA 4Q29A 1EV12 4RHV2 1I3HA 2W52A 5GALA 2KXLA 3WDVA 1AL22 4LNVA 2D98A 4I09A 4OZXA 1XU2A 3QLQA 3M3EA 3ZXFA 1POV0 4Y22B 2C5DA 4DRRA 1POV3 3EO6A 1GZWB 4RL7A 4YM3A 2PAKA 3ZN6A 5A32B 2XVGA 4GH4A 2WZPP 5H9QA 4HK9A 1QXPA 5J98B 3IPVA 2E51A 3ZMNA 5FTTC 3T1MA 3KS7A 4OI1A 1M06G 1YYNA 1YFWA 3JCIA 4ZXKA 4AVCA 1OA4A 3GBWA 1RUJ2 2RJLA 1J3PA 2ZGSA 5CFDB 2YXSA 1R091 5L36A 1LOFC 1LOFA 5BV6A 1H30A 2GU9A 4CEWC 1CAWA 1QXJA 4CEWA 4OHXA 4COVA 1R093 1ZZ6A 4FBFA 3WP4A 2AZ5A 4QPGB 2B42B 2OW4A 4BQ1A 1AVBA 2ZMLA 2DU1A 1UPIA 1ULFA 2HJIA 1EP0A 2TNFA 4K40A 4WM8C 4WM8A 5EFUA 4MH0E 2X8KA 2ZKLA 2BGCA 3H8UA 2VW1A 2A6WA 5JCTA 5E89A 2XHKA 3M3QA 5KWRA 2PHRA 3IBMA 4FTEA 4QD2A 1YNAA 4QQ2A 4H7MA 5J3UA 3NKTA 1G9CA 2XH6A 4E4DX 2GMEA 1PVC1 2YMZA 4L99A 3M7AA 2XGXA 3BOPA 1FNYA 1FYUA 5GZCA 2YDEA 3ES4A 1UF2C 2IXLA 3KSCA 1ZM1A 4XFFA 2DTWA 3UJOA 2UWAA 4HPKA 3VZNA 2ZABA 3AXEA 4R9AA 3AYAA 2EXHA 3LAGA 2EA7A 1KRIA 1WGPA 4IETA 1O3TA 1UZYA 2WWSA 2BW8A 5LEJA 3DKWA 4QQHA 1OOPA 4CTEA 1VB4A 3TB0A 1AX0A 4CDUC 3KGZA 4K6BA 4XQDA 1VLNA 5CBLA 1RB8G 1QQP2 4BWOA 3WHTA 4AVTA 2IXIA 4AVAA 1H2LA 1LHOA 3WUCA 1Z78A 2XJSA 1FXZA 3AKRA 1B09A 4I0AA 3VBUA 1LU1A 1J1TA 3D82A 5IK7A 1U0AA 2XL9A 4OUMA 3PHMA 1HXS2 2PHFA 4YGCA 5T52A 3WUDA 1JH5A 1PGW2 1SCSA 4ONUA 4RR3C 4W6WA 4RR3A 1ND2B 3DF0A 2X53S 4I01A 2ZGPA 3RQ0A 4JV4A 3VGIA 2F6BA 4LBNA 4SLIA 3M1HA 2VGDA 2FBEA 1VAMA 3FBMA 3RS6A 1HRI1 1MS9A 3RG0A 4P14A 2ARBA 1J59A 5LK5A 3AZYA 5SV8A 1HRI3 1IGOA 1ENXA 1SCRA 1MZ5A 4P9GA 4ITCA 2ETEA 1WBFA 4H7LA 1PNGA 3B93A 4YGBA 3ILFA 1G9FA 2D97A 1AJOA 1RIRA 4TYSA 3R6SA 3AJZA 3WCSA 1HV1A 3ZSKA 1VP6A 2YROA 3EXUA 2GNTA 1WD4A 4I2OA 4YG0A 3HMYA 1NE4A 4LBLA 3WOGA 3VZLA 3VN4A 4AQTA 5BNOC 4BLIA 1S0EA 5BNOA 1NA1C 5C8WA 5JAXA 1NA1A 3VDDC 3VDDA 1O3SA 1FOD1 5CG9A 1SBEA 1JN2P 1UMZA 3POYA 4JDOA 4XFIA 1H9PA 1QH7A 3GF6A 1ZZBA 1FOD3 4I0WB 3GBGA 4CEYB 5C33A 5C9AA 1LRHA 1Y43B 5FLIA 5KHIA 4M00A 1LOAA 5GZEA 4GWNA 2QZ3A 2WQ4A 2DUQA 4XETA 4LHNA 4R4XA 4PLOA 1R081 1AYM2 3IDBB 4Y24A 3MIHA 3AP7A 1RUNA 1XNDA 1FV3A 3THTA 1YI7A 1RMU1 2BVBA 3TNQA 1R083 4LUMA 3RSJA 2WA4A 4CDWC 4Q4W2 4CDWA 1R1ZA 1RMU3 1VB2A 1V6IA 2R49A 4MVTA 2BQPA 4XPVA 4XILA 4XMIA 3ZFGC 3ZFGA 2VMHA 1ND3C 3A0NA 1ND3A 3SXWA 2X29A 3U10A 3D6EA 3E6BA 4N53B 4K3UA 3VHRA 2WKKA 1CQ9A 4R52A 4D3WA 4XJUA 3H9AA 2QVSB 3FUOA 4L97A 1QOOA 4BLJA 1IS6A 1N3OA 4KG0A 3ZXAC 1RUG1 1JUHA 2PYTA 4GMP1 3I2DA 2BBVA 5KHJA 1LU2A 1AR91 2HWF2 4YG3A 1Z7S1 2DTYA 3N7MA 2BWCA 1RUG3 1U5ZA 1IS3A 1MR5A 1CONA 3ECQA 5DZFA 4LEJA 1DDLA 1AR93 1H9WA 1W2UA 1KS5A 3ACLA 1Z7S3 1YFXA 4QU2A 4E2SA 2ZMKA 1VBA2 2B8MA 1PO11 1V6OA 4AGRA 3N7LA 2UY8A 1VBC1 2HWE1 3ZFFB 1PO13 4AFCA 1CAXA 4EROA 5FO9B 1VBC3 2HWE3 3K51A 1OPOA 4H55A 1O4ZA 4AVBA 3KMHA 3S0MA 1WW5A 3LCPA 4WZCA 3LGRA 2YY1A 1NLRA 2ZX2A 4P9WA 3SH5A 1QWRA 3A4UA 4R9DA 5CADA 1AX1A 4R8HA 2A7AA 4ZU4A 2ZHNA 2ZJCA 1ALYA 3KCCA 2WINB 4MZUA 4FSJA 2YZ4A