1YJLA

Reduced peptidylglycine alpha-hydroxylating monooxygenase in a new crystal form
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
306
structure length
285
Chain Sequence
b'TIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTICNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-glycine alpha-amidating monooxygenase
molecule tags Oxidoreductase
source organism Rattus norvegicus
publication title The catalytic copper of Peptidylglycine alpha-Hydroxylating Monooxygenase also plays a critical structural role.
pubmed doi rcsb
total genus 54
structure length 285
sequence length 306
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1yjlA02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 1yjlA01
4QHBA 3MLLA 3PMSA 3MIGA 3MLJA 3MIBA 3MIEA 3MICA 1SDWA 1PGSA 1YJKA 1PHMA 1PNGA 3MIDA 3MIFA 1PNFA 1YIPA 1OPMA 4R4XA 4R4ZA 3PHMA 1YI9A 4E4ZA 1YJLA 3MLKA 3MIHA 3KS7A
chains in the Genus database with same CATH superfamily
1RITA 1W8OA 2XJRA 4YVSB 1XE8A 4WZFA 1Z78A 2K2SA 5EJ1B 1PIV1 2E7TA 5DZFA 3RYKA 4I0WB 3WP3A 4AVVA 4A7ZA 4PLNA 1K45A 2DURA 4MGZE 1OOPB 4HLTA 4YG6A 5K0UA 4AVCA 4S2HA 2GN3A 2D98A 3HAGA 3MIFA 1QJFA 2NN8A 3OJBA 3JB8A 1YQ2A 5BNOB 1JUIA 2PHWA 1GZWB 4ET7A 4FPLA 2WNVC 4EE2A 5ABJA 3G6JB 1LOCA 2WZEA 4UT5A 5CB7A 2QQIA 4R52A 3W20A 4AGGA 1PO11 1RUF2 1ZBA3 1EV12 2IC1A 4Q0UA 2ZX0A 4E27A 5FP7A 4YVSA 5L9BA 3M1HA 2JECA 3D4KA 2FDKA 1XB9A 1RJ7A 2A70A 5IK4A 1TMF1 1VBD2 1QU0A 1GANA 1PK6C 4QXHA 4N43A 2HYXA 4AI3A 2HBUA 3KCXA 3NAPB 2ZEZA 5FYTA 2UY9A 1MS8A 1MS4A 1U12A 5GZEA 3LA7A 4JDOA 5HCBA 1QEXA 5FZDA 1V9U1 3QOPA 4BE3A 2DCYA 4QX2A 4ISQA 1OKQA 3O1TA 4Y22A 1VBA3 3GZTB 1SBFA 5H9RA 2BZDA 2BWAA 1DYPA 2ARCA 4NPMA 4RSUA 1VB2A 4YRDA 4FCAA 3O1MA 5A7PA 5E8AA 3HQXA 4V2WA 4J6GA 5H9SA 1SACA 5CAZA 1FV2A 4CE8A 1LHOA 3SEPA 1RL3A 4HETA 4D7SA 5T55A 1ZA7A 2F4LA 1J1LA 2D6PA 2MEV2 3UKNA 1XRUA 4ARXA 1UXXX 2VMIA 1OF4A 4IEYA 5DAXA 5FYYA 1AR92 1YQ8A 4XTPA 4YFWA 4PIZA 1VLNA 4EQVA 1Y4WA 1UMIA 2XBO3 4LHKA 1L7RA 5DUWA 5FV3A 4FFGA 3VBFA 4LE4A 1JS9A 3FLTA 4BM8A 2FMYA 3GJAA 3MZHA 5I0TA 2ET1A 1CAWA 4KH9A 4YZ3A 2HWE1 3B5LB 3DGTA 4CPBA 3POSA 1POV1 4BZ4A 4CDXA 1POV0 1JBCA 2KD7A 4RYDA 1C5HA 5LEKA 2FDIA 1NZCA 4UW4A 4MH0E 5FPUA 4YM0A 2RS32 2BVBA 2XJSA 4U36A 2AEYA 2WNUB 4QKNA 3RMXA 3U1XA 2BWCA 1LHNA 2CNAA 1ALYA 4AEDC 1AX1A 1X8EA 1S0GA 3TOJA 1HLCA 5J3UA 4OFGA 3D6EA 1MS0A 3M3OA 1W8FA 4Z1VA 5EFUA 3OUHA 3RMYA 5C8CC 1CAWB 1SFNA 1LU2A 1QJEA 3R4DB 3IIAA 4MGTA 3H8UA 4Q1PA 4GAZA 3LFMA 1W2AX 5F2WA 5LA0A 3P1IA 3KMHA 4IEVA 1CAXB 1QJX1 4CDUA 3AVSA 4QGNA 5CFCC 1W2NA 1IPSA 1IS5A 4D7TA 4C1XA 1YO8A 2XB6C 3WDVA 2HJIA 2DYCA 1YLLA 2V73A 4AR2A 4AI8A 4AAPA 1XC6A 1OOPA 5LA2A 2RS52 3THDA 2E9QA 4MSVA 5A3PA 1NAEA 4UFIA 1NCRC 4XAEA 4P02B 1XSRA 1QMJA 4AHXA 4CYDA 2W92A 5I0RA 4XQDA 4JRLA 1G7YA 5EP9A 2ZMLA 1UOGA 2EXJA 3HD8B 3N9LA 3M7AA 1Z7S2 1AR63 4M00A 1WD4A 4O61A 2HWF3 1F35A 2YB7A 1PMHX 3DPRC 4JVAA 1VBE3 1LEMA 4CPBD 2UWAA 4FTEA 5IHRA 1UQXA 4JGZA 3KV4A 1XSQA 1CR7A 5FOBB 5G04L 1VBA2 5CISA 3ACGA 3K75B 4K7JA 4AHZA 4HVQA 5ABJC 4NJ4A 4XUTA 5BNPB 2P3YA 2IUWA 3AZZA 3FUQA 1S0EA 4N43B 4XXPA 1VAKA 4X6QB 5A7WA 2W08A 5CBLA 1EV13 5FBZA 4XFAA 2D3SA 4XFHA 4K6BA 4PQQA 1W06A 3E1F1 3WINE 4B4RA 5T52A 1RXGA 1UF2C 2A6XA 2ORXA 3WOGA 5FQ0A 4XACA 4FPYA 1W2OA 2XHNA 4A2UA 4AI0A 3ZPOA 5LK7B 5T5OA 3T08A 2YROA 2XWBB 1PM7A 3DCQA 5F7UA 3VBRA 3LDKA 3VBHA 3OYWA 5CKNA 2JKXA 4QX0A 4LR4A 3NL1A 1F31A 1MACA 2IFRA 5GM0A 3J8F1 3IBMA 1ULEA 2GNTA 3IMNA 4P5HA 1O8PA 3IPVB 1LOAA 5JOWA 1XBFA 3DECA 5IVJA 3PU3A 3LPFA 1MZ5A 4CEYC 2Y34A 2WBKA 5FYBA 2XG3A 4KU8A 3I2KA 4NHMA 5BNNA 3MF9A 1JZ5A 4H55A 2QZ2A 3I3DA 1W0OA 1YXWA 2FDJA 1CX1A 2UURA 4RN5A 3EMRA 1OD3A 3JCIA 3U78A 1HIXA 3SLIA 3O0XA 3AL6A 4FXGB 5FY4A 4JHZA 5A3MA 4CDWC 3B02A 2OVUA 4UFKA 2RR12 2D44A 3W58A 1PZ9A 2LM3A 3U11A 2RMU3 1QJX3 4CEWA 4CP9B 4BQWA 4U2AA 4Q26A 3VL9A 5C3OA 2ZAAA 3H0OA 2P17A 4IGPA 3OSDA 2WZR3 5FMCA 2J1TA 3I49A 4LA2A 5AFBA 4OMCA 4QMAA 4MXWA 5CNAA 3ZYFA 4TZDA 1GMMA 2YYOA 4W6WA 3RDIA 3ES1A 2EXHA 2FCUA 5EWSA 3OGVA 1ULPA 4XUPA 1QXJA 5FZ8A 1HJGA 3ZN4A 2XQXA 1NY72 1PGSA 2ORZA 2YZ4A 4WBBA 5IJRA 3GCXA 3PUHA 3WV6A 3ZYPA 3TEZA 3LOBA 2BNOA 1W6NB 4IEPA 1O59A 5LW9A 1TVGA 1GNYA 3FC0A 4QB6A 5FO7B 3VZKA 2BV4A 3IT8A 5C9AB 1MR5A 4UFLA 5ACA3 1JZ4A 1CAVB 4QPIC 1US2A 2VZ3A 1VE0A 2ZGOA 1WMDA 2A75A 2YDEA 2HH9A 4Q4X2 1GV9A 3C2UA 4P9IA 4EV0A 4BB3A 1M06G 2WQ8A 4META 1I6XA 3LDBA 4TLFA 4XILA 5HV4A 5EYYA 3A0KA 4XJAA 3NV2A 3OTFA 1ND2A 1ENSA 2RG4A 4LE3A 5KBFA 1JYTA 1RUOA 1S2EA 1N1SA 5LBCA 4ASLA 3T30A 2WA3A 2E33A 2W94A 4L0PA 5FZ0A 4LKDA 2YBPA 1YJKA 4AOCA 4XF0A 1S2BA 1TME3 3FLRA 3VN4A 4CEYB 1O5UA 4XJWA 1ODNA 4CEWC 3WDUA 5GZGA 2Q1ZB 4PBPA 4BXSV 2VVDA 1D2SA 3GHMA 4I01A 5E88A 1MPXA 5T3NA 1LOEA 4LK7A 1HV0A 2E32A 1JOBA 2A3YA 2ZX2A 2JDKA 4PLMA 5FZLA 2Y6JA 3C7FA 4Z82A 1S0JA 4RR3B 4WM8A 3EB7A 2D6NA 4CCLA 1GSLA 3OGRA 3I7DA 1GP4A 3AYEA 4UI9L 1FPN2 4WVVA 4BIFA 1C8M1 3T2QA 1HV1A 1D4M2 4ZS2A 5EJZB 4D0QA 3WW2A 4QPIA 4CCDA 1N1YA 4ZY9A 3ETQA 5FZ3A 4BCUA 1GUIA 3MF6A 5JSPA 5KXCA 2XL7A 5HCHA 4CCCA 4A42A 4YGCA 3FE5A 4ATFA 3NNMA 4K40A 1UU5A 3SCFA 3WG3A 1IS4A 5FFOC 1BXHA 4ISRA 4YG3A 2VTFA 5A3OA 4N9IA 4BPZA 4Y1YA 4QDRA 3MLKA 4RR3A 4WM8B 3AX4A 4OQ9A 1PIV3 3URFA 4CEYA 2RMU1 5KC6A 5DAVA 2LS6A 1ULDA 1H8TA 1OMIA 3ETPA 1GNHA 2PHTA 3VBFC 1UX7A 2P2KA 3AZYA 4XBQA 4BK4A 1NOVA 4Z07A 1OLQA 1H1MA 2A1XA 3L2YA 1UAIA 5JSRA 1AZDA 1AJKA 1VAMA 1D2QA 2OQ6A 2VNOA 3ACHA 1W6OA 5FKBA 1G9DA 3W59A 1WCSA 3Q8EA 2Y6LA 3U37A 2WUHA 1OBNA 2YXSA 2ZGLA 2B42B 3OBTA 4R9BA 5FY0A 2NMOA 5LBFA 1FX5A 4AI9A 2R7EB 2QDRA 5IATA 2VXRA 2J42A 3I4IA 4WM8C 2OW4A 3NJVA 4CP0A 5FYHA 3QD6A 1Y9QA 1KITA 4N53A 3H7YA 1RMU2 1OFNA 5DXDA 4UBGA 4UW5A 4YW7A 3USSA 5B4NA 1COV2 2PHFA 3FJSA 3POYA 3ZXEA 4E8CA 3ACFA 1YQ6A 2VMDA 3H9AA 1RJ8A 3DUIA 5JI7A 3LSDA 4AFDA 1K12A 3FN9A 2A3XA 2W3JA 4XEZA 3V65A 4BXFA 5GZCA 5J09A 2G19A 2LW8A 3N9PA 2JKBA 4QQOA 5FPVA 4FPCA 4GWMA 1UXZA 3GHNA 3N7JA 3F95A 5FYSA 5IFPA 2PTMA 2KR2A 3GBGA 5J37A 2W5FA 1VJ2A 4IESA 2W9XA 3ZPYA 2QJVA 4FFIA 4XFCA 1S4CA 2IFWA 1FPN3 1YI7A 1JODA 3ZYGA 5F6LB 4Q5OA 1NCRA 2IXCA 2MEV3 1DU3D 1QF3A 1R092 4AFCA 4OUSA 1HRV3 5JUVA 4CXWA 1BEV2 2O1QA 2VW1A 2WIIB 1UO9A 4A45A 4CCOA 3LAGA 2VQ0A 3SH3A 1H4GA 1CD3G 3EQEA 1BKZA 4CP2A 5DZGA 2C9KA 1RUH1 3AZVA 2HWB3 2QE3A 5CU1A 2XBO1 1ND2C 2JEMA 1HW5A 4J25A 5A1AA 2YHJA 1RUJ2 4MHUA 1NQDA 3UV9A 4LQRA 1AR93 4K8FA 4N9HA 2O0OA 3AZWA 1AR82 1YIPA 4Y33A 1D4M3 3VBUC 2PHLA 3CQOA 3JQXA 1LTEA 2PAMA 3V64A 4CA9A 1QJY1 1I3HA 1DHKB 3ABZA 4Q4V2 1GOHA 3VBFB 2C0ZA 5FPLA 4DQAA 3VKFC 1JZ3A 1ZRDA 4YVWA 4NPLA 4XF3A 3UESA 2B7YA 2ETEA 5GLZA 1SZBA 1ST8A 3AMHA 3H3LA 3N7LA 5E1RA 4Q4W3 4JRAA 4CCMA 2NPIA 2WRAA 3J7HA 4HBNA 5IFTA 4QPIB 4YLZA 4GMP0 4NAMA 4E2QA 1AR71 5E6HA 5APAA 3WZ1A 5H9QA 1OD5A 4URTA 1FI2A 3FLPA 5FZOA 1EP0A 1N3PA 3CJIB 1LHWA 4A7YA 2X10A 2ZACA 1PNFA 3SITA 5DAQA 1MEC1 2QQNA 4B7KA 1WCDJ 1WKYA 3VBHB 4JZRA 1W0NA 3GCWA 3PUQA 3OD0A 5LASA 4L97A 5EIYB 5LY1A 4B4QA 1W8HA 1IQDC 1U0AA 4KGGA 3VV1A 4DO0A 3KS7A 3IMMA 3ZO0B 5A6ZA 3C8XA 1UMHA 1WLCA 4P5YA 3J7NA 4GIQA 2A6WA 3T09A 3SH4A 5JPMB 2E26A 2BP6A 3ZR6A 1W39A 3NO8A 4ZHNA 2HEYF 2EIGA 2R1DA 1W9YA 2PXJA 1S0IA 4XCBA 2BOJA 3M8LA 3ECQA 3QACA 5GLVA 1YQCA 2A7AA 1ENRA 2X29A 4JGYC 1UU6A 1MZ6A 3OGGA 2QQWA 1CWPA 4JGZB 1H9WA 1KDMA 5A33B 3VDDA 1RIRA 1ZZCA 2G9ZA 5C5UA 1LODA 1Y9MA 1UPSA 4AK3A 1O91A 1XNBA 4IE4A 3I3QA 2B4KA 4XTMA 5FLJA 3RNSA 1YFWA 2CHHA 4AEJA 1C57A 2XLAA 5JXHA 3UT0A 5LCWL 1REFA 3IDBB 1PVC2 1NYWA 4KWUA 5FAXA 3IB3A 2J1VA 2YC2A 2FCTA 4UFMA 4ZPIA 2R071 5I93A 4OI0A 2ZTNA 4LBQD 1KFXL 4NRQA 4O9EA 3ZXGA 1MZFA 4Z2AA 5A3TA 5KXDA 3KCCA 5GZFA 4LO6B 3K48A 1T2XA 3CU7A 3PLQA 4GH4B 4TTGA 1G9AA 1DF0A 1R083 2XHKA 3E5UA 1QXRA 1RUG1 5AVAA 3PVEA 1RGSA 2ZS6B 4BQ2A 5BNNC 4UAPA 3H3ZA 5KXEA 3V0BB 1NUKA 5C33A 2Z69A 4PF5A 1O8SA 2WT2A 5F5CA 1AYM2 4D69A 2HBTA 2W1WA 2XLFA 1IZ3A 1QXPA 4FQZA 3HR9A 4DRVA 3C7EA 2Q0AA 1D4M1 1HB1A 1QOSA 2OZ6A 4Y5SA 1O3QA 3Q8CA 1HB2A 5CEHA 3HMYA 3HN3A 2Z42A 1DQ5A 5A7OA 3H7JA 3BPZA 1UN1A 1WCQA 1XNTA 1UZZA 1HRI2 1LGNA 4LNVA 4H7LA 5FR3A 3LEMA 4X8PA 1N1TA 3F2ZA 2BEOA 4HVRA 3TN91 3VBSB 3MV11 1ZA4A 4LA3A 1S0DA 4Q4Y1 5FDBA 4XYXA 5JAXA 1OQ1A 4GWJA 1DYOA 2NZ9A 4LIVA 4OI1A 5EV7A 1LKNA 4QDSA 5IVVA 3KV5A 2OX0A 2ZKNA 3MYXA 2G9FA 3R0RA 3U14A 1H8VA 3NSTA 3O7OA 2PHUA 4FO9A 3VBUA 2EXIA 1CZVA 3WF0A 4EN0A 1JHNA 4YARA 4HONA 1ASJ1 1QGLA 4KG0A 4YW5A 5FUNA 3INAA 1ZRCA 3MEPA 1W99A 3LIGA 3UGFA 1GFF2 3VKOA 4MXWB 2AR6A 3E5QA 4FPGA 4XJZA 4WM7A 4NOTA 3W5MA 3ST7A 4A3XA 2ENRA 1JYWA 1S0FA 4AHYA 2WAOA 1SPPA 5DZEA 5CADA 4DUXA 1TQ5A 4NWVA 2VC9A 1W9SA 3OG2A 4FOQA 2VJXA 1OHFA 2AH2A 1WLWA 1ZRFA 2WS92 2VZSA 3RYPA 1IS3A 1TZOA 4MUVA 5FY7A 4FOYA 4EJRA 1WW7A 3TAYA 2LALA 2RS12 3NWKA 1CESA 1R1A1 3KD4A 3BIEA 1W6MA 2JG9C 2PMWB 3TEYA 4QPGC 4R9CA 5A7WB 2XKOA 2C5DA 4SLIA 5EHDA 2ARXA 1ACCA 1NY71 4EN7B 1G9CA 2ID4A 3BGAA 5FRAA 3A0NA 4XHBA 2CGNA 4AAXA 3MI8A 3DXTA 4JAAA 3ZXFA 1DIWA 3I2HA 4UOJA 4NIIA 2VOXA 2XJVA 1ZZBA 2QQPA 2JXAA 4FQ4A 4XJUA 1XYPA 1G86A 2JIJA 4FPKA 3AKTA 5BNNB 3I2IA 5FO9B 5JXJA 1KGYA 5IK8A 4RGAA 4BOWA 4CDQB 4DXZA 1PGW1 5FUPA 4YPJA 4ZZ5A 5ACA1 4GKYA 4IEXA 4B8EA 1ZZ9A 3IPVA 4NIHA 1OVSA 5C4WA 2DVAA 3GZAA 3USUA 3CMGA 2QZ3A 2WO7A 5DG2A 2OZJA 2DDUA 1HB3A 1W03A 1YYNA 1YEWA 2RR11 2WFF3 2R16A 3RWNA 3ILRA 1PHMA 4MVTA 2D6MA 3JD71 4QKDA 5CFDA 2WKKA 4WM7C 3ASIA 1RB8G 5DMYA 2IWGB 2V4AA 1N1VA 5KC5A 5FK7A 3IWZA 2V09A 3HPNA 3AMPA 4QM8A 2DBNA 5FZOB 3VDCA 4FVVA 4IE7A 2ZGUA 5FMOL 1UY3A 1YC61 3ES4A 1O3TA 2ZEYA 3A23A 4KWJA 3VD7A 4DIQA 5L9RA 2DU1A 2YG0A 1AYN1 3KT4A 3KWVA 1GQHA 5F3GA 2WNVA 4IQPA 1KDKA 1O7FA 4ZU7A 3O12A 4RGGA 5K7PA 1UU4A 1O3SA 3A22A 2KXLA 3DKWA 2VOVA 1SFYA 4OUMA 1B35A 5FTTC 4B1MA 1X8MA 2DVBA 2ZEXA 3NJXA 4JGZC 3VKLA 2EIDA 1A6CA 3J7MA 3M2MA 3THPA 5CG9A 5FYIA 2ZZJA 3UKTA 3SHRA 3JD72 4XUQA 2JDHA 1UNBA 2WZR2 2VNGA 5C3QA 2RM22 3N7KA 1MS9A 3KVAA 4MXVA 4PDWA 5L7OB 1K5JA 4WVMA 3UYJA 1SEFA 1YNAA 4LK6A 4HOOA 1RC6A 4ORFA 4XC9A 5FY8A 1GQPA 2A5ZA 2EALA 1QJZA 3MHZA 2WNVB 2WFPA 4Z2WA 2EVXA 4NAOA 2ZHNA 3UNPA 5FO8B 1PGW2 4GH4A 5JDBA 4IV1B 3I54A 1CAXA 3NMBA 1VBA1 2ARBA 4GXLA 2RJ2A 3ZYIB 2BNNA 1WLDA 1IPJA 4FOVA 3VBHC 1VBB3 1W6QB 4SBVA 3H8RA 3ZFEB 3VZJA 5A6XA 4HT1T 2R042 4NO4A 1JXNA 2WO3A 3QCWA 4Y5TA 2D5HA 5F9TA 1XNAA 2XQRA 2YV8A 4ZONA 1D0GA 5FXWA 2WINB 1SBEA 2BJSA 5T5LA 1WMEA 3AFGA 3WP5A 1XU1A 2EA7A 2RS11 4FXKB 4OHWA 4DXRA 3BU0A 1LOGA 2MNGA 3N7MA 4AEMA 3O14A 3HOBA 1NA1C 4LPLA 2GNBA 1HDKA 1VB4A 4RS5A 1REDA 4Y20A 1V6OA 1W6MB 3ZXLA 5F5QA 1VR3A 5FZHA 1K42A 5K0UC 3WT3A 3VB9A 1FNYA 5H9PA 3TBDA 4N7IA 2JE9A 1LR5A 2VOTA 3WQ0A 4KWLA 3SQOA 4A41A 1VIWB 5LBEA 3ZSKA 5ACA2 1GOGA 3CDZB 3FZ3A 3APBA 3POJA 1LAJA 5IK5A 3PJYA 4PF1A 2Z2SB 1YJLA 2MHFA 5FMBA 4COVA 2W1UA 3AK0A 2W68A 1RUJ3 2ZHLA 5HCFA 5J7MA 1LULA 3FMGA 1RUI1 2JE8A 3BYWA 3EHKA 2AZ5A 1US3A 3M3QA 5DUUA 3WW4A 3MIEA 4FPEA 2RS31 1V6KA 1FMD1 1PK6A 1H2NA 2D6LX 3NV4A 1AXKA 3MW4A 4QX1A 4XZPA 3UGGA 3RJ2X 3R05A 3ZFGC 4YFZA 3AZXA 1IS6A 4LHLA 3K46A 4YZ1A 2YGMA 4YSFA 2BU9A 3BTZA 5C4WC 1V70A 3LFIA 4NPRA 1SLCA 1QJY3 2WS91 1HRI1 5DQ0A 3OEAA 4PQ9A 3I97A 1L7LA 3THTA 3N9MA 1YQ5A 5A7QA 1IQAA 1Q8OA 1DYKA 1RUH3 4HPKA 4QDQA 1OA3A 3V56A 2CYFA 3S5AA 3BODA 4Q29A 4Y4YA 3C7OA 3SEEA 1AR91 4QGLA 5A7SA 1UMZA 1NCQB 3FWEA 3BUCA 2GAUA 4QX3A 5AC92 3P6BA 3WDTA 1D7PM 4KGQA 2Z4FA 5HXMA 3O1UA 1B35B 2CDOA 1ASJ2 3IM0A 4DEVA 1NX9A 4MLOA 5D21A 3PIGA 1A34A 1VBE1 3KCYA 5C6CA 4QX7A 2JWPA 4I30A 1GYKA 1W3VA 4IEWA 4TYSA 1UYYA 4HSJA 4K1ZA 3K51A 1EPWA 3WQBA 2LUWA 3GZUC 1DGRA 3FX3A 3I3MA 4Q4Y2 1C1FA 5I8TA 2R1BA 2Y0IA 2VH9A 3H1WA 3ITQA 4RL7A 1Y43B 2QUOA 3VL8A 2BGPA 5JMCA 2X5IB 1EAH3 3PUIA 5FZCA 4LO4B 1AR61 1UL9A 2PQSA 3KV9A 4OI2A 3H8OA 5F6KA 2E51A 4GJYA 3M4FA 3OY8A 4HANA 2WA4A 1F9KA 3M3EA 4XXAA 1JMUB 2CGOA 2QCSB 3LWCA 3ZIWA 5C5TA 2FDGA 2C26A 4AEDA 4B7EA 2JD4A 2NYYA 5FZGA 1VMJA 2J22A 4CP1A 1AYM1 2DCTA 1ZZ6A 5JSOA 1A8DA 4ONUA 4BQYA 3TNPB 3USUB 3SH5A 1SQ4A 1YIFA 3PTRB 4CRQA 3DYMA 2I2SA 2X8KA 4P9LA 1RUG2 2QKDA 2Y64A 4GB33 3ATGA 2RDNA 3DEMA 4QHZA 2R063 2ATFA 4QXCA 1ND3B 2WLPA 4ES8A 2VBPA 2F4PA 2XOMA 1LU1A 3MLJA 3T4HB 4MZUA 4OULA 1PMIA 5B4XA 1V6LA 4K9SA 1PVC1 4LTAA 4MGKE 4QB1A 1DZQA 3M3IA 1MEC2 5FLIA 1DGWA 3H1MA 4YGDA 4PDWB 3OUIA 1BBT1 4CDWA 2W52A 2W2IA 3ZSMA 4JHTA 4Q8LA 4L92A 4V2VA 1OA2A 2GP3A 2VZVA 4RD7A 4OHZA 3LIHA 4EN6B 2WQ4A 4E4DX 2GC2A 4OCTA 1GZCA 1GP5A 2R073 1ZZ7A 3POIA 4HFSA 4E4ZA 1C4RA 1N47A 3SMHA 3VUOA 1LHUA 4NMIA 4IETA 2YGLA 4KMQA 1VBC1 3BALA 4LBJA 4V1PA 4IGQA 3V0BA 1QIQA 1JW6A 2WS93 3QLQA 3AJZA 2E7QA 3KHBA 4IV1A 2EIEA 4Q4V1 1TG7A 3VZOA 1RUG3 2H0BA 3WHTA 1NE6A 2OXBA 3OD4A 2VPVA 3GZEA 4A3ZA 4IEQA 2VW2A 4DFSA 2HEWF 5AFEA 5G05L 1W8TA 4Y3OA 3WDYA 1RUC2 4M01A 2ZGPA 4DXSA 2H0VA 3LF7A 1AHSA 4LBKA 2KA3A 3ILFA 4Y4RA 1FOD3 1O4ZA 5FWEA 2XBO2 3O1SA 5A33A 1LESA 4I02A 4XCAA 2E7AA 4Q4X3 4XW3A 2BFUL 4LBOA 2W1QA 1LB2A 1O3RA 2DTWA 5FP4A 1DGLA 5EPAA 3VBRC 1BEV1 5FZ9A 3VHPA 2XLGA 3VD3A 3T1LA 1FT9A 2VZUA 5D1IA 1UZWA 3O1RA 4Q4Y3 4M4PA 2L9LA 4FFHA 2TEPA 4NHLA 5CYYA 2AENA 4XIKA 3I2DA 4P9WA 4PIXA 1H1AA 2VZQA 4XPVA 1OFSA 1PO13 4DNYA 4IV3B 1RUC1 2CAVA 3KT1A 3RSJA 5CKQA 1VP6A 4PJYA 2DV9A 1H2LA 1KS4A 3NKGA 4QQ2A 1W6OB 1JH5A 3PVOA 4CCEA 1IG3A 1ND2B 2Y60A 1ND3C 1F2NA 1OQEA 2BW8A 2JG8A 1NXMA 1RINA 4NWWA 3LCPA 1CAUB 2BBAA 3WF1A 2RJLA 4K21A 4YZ2A 4Q0SA 4QQHA 5FJKA 2WR9A 3CJIC 3RYRA 1LOFC 3T0BA 4LKEA 4D3WA 2CL2A 2VVEA 5J1XA 4DB5A 4DMIA 1UKGA 1OF3A 4N53B 2PLV1 1WW4A 3KSCA 4RFT0 4YVWC 5LBBA 4IXLA 2VQTA 1MZEA 1R091 1BBT2 1PK6B 5EXOA 1JU3A 2VR4A 1G8WA 1O5LA 2I45A 4XURA 5HBAA 2P6HA 5AVPA 1JOJA 2NLRA 1F15A 1PGL1 2BNMA 5DG1A 4RQPC 2JENA 1W8NA 1CAUA 2R6QA 2XXZA 1YFUA 1RHI1 3O0WA 3NV1A 3WCRA 1E5RA 1OPOA 2WC2A 1WLTA 5J96B 1AXYA 2GNMA 3JD73 3D0SA 5FP3A 3FHQA 1ZM1A 4JV4A 5A32B 1JI6A 2XR4A 3L2HA 5DUVA 1E5SA 1HJFA 1IHMA 4PLOA 3THCA 3U4XA 4CP9A 2GN7A 3VD5A 1FNZA 4IE0A 5F32A 1X36A 5FXXA 5A3WA 1COV1 2YFZA 3MW3A 4RS5C 1VMHA 2W95A 4TLGA 1RMU1 4RGKA 4QX8A 3MFAA 1JZ7A 2DVGA 2VY0A 4YM2A 2QDNA 2B46X 2IZWA 4XFFA 2ZGSA 4MV2A 5CKMA 2Q8OA 5I0SA 1Z0HA 1D4VB 1H6XA 3ZXKA 1I5ZA 3HQRA 4X8NA 5IAXA 1CIWA 4AQ6A 2IXJA 2XDVA 1I9RA 1QWRA 4QPGB 5F3IA 5HXVA 3RQ0A 1AR62 1FYUA 4KBBA 2R043 5FYCA 3PVNA 4C90A 2K0GA 2PHXA 3UJQA 3PURA 4YYOA 4UW6A 5LY2A 3TEWA 4UFJA 3CO2A 4I09A 2XVLA 3WDWA 2E31A 5LK5A 2FCVA 4CDUB 5J48A 2VBBA 3RGBA 1SLAA 5HV0A 2Q1FA 3KB5A 3IAPA 5M0TA 1VBE2 3NAPC 4FI9A 2BDRA 2G1MA 4ES9A 1OLMA 2JDPA 5L9VA 5LA9A 3WP4A 3GM8A 1PX3A 4LIUA 3KF3A 5GZDA 3VHOA 3RZLA 1Q8SA 4D6RA 5AC91 3VDBA 1FXZA 3MIHA 3N9OA 4WVMB 1DP0A 4I3GA 1RUC3 4P9XA 4RHV2 2PELA 4UW3A 5F8PA 2OUJA 1Q56A 5EQUA 1XPWA 3T2OA 1AR73 1KQRA 4XF9A 3N3HA 4DPNA 5C3SA 1Q43A 3WF2A 3SC7X 4URAA 2UYBA 1XE7A 2B39A 1ONAA 3MO4A 4MG2A 1UKRA 1W90A 3OEBA 1FPN1 5ERLA 1MEC3 2R30A 3D82A 1DZTA 2JIGA 1OT5A 3FHAA 3S0MA 1JZ8A 3DN7A 5IWFA 3TNQA 2J1EA 3H42B 4CEWB 3H1YA 2HWD3 5GLWA 2QQUA 4ARYA 5K9YA 1FMD2 1EUUA 4QU1A 3CNAA 2XJTA 3AKPA 3Q8AA 4C0BA 4FTBA 3WNXA 5A3LA 5EZWA 2EICA 1RUI2 1H2KA 3LPGA 2CWMA 2XMLA 3LOIA 5FPAA 4F8AA 1QH7A 2D97A 2R0FA 3WR0A 1WBFA 4FPJA 4X6RB 2K46A 2GH2A 2IXHA 4KQ7A 1J3RA 4KWKA 4XIOA 4CSWA 4NIDA 3WNOA 2X5IA 2UY8A 2QQLA 4DS0A 4IGOA 4BQ4A 4CUAA 1DCSA 1W8UA 4LULA 5ABJB 2WN3A 2VUAA 1V6MA 1WCKA 3A21A 2WNUC 1QQP1 4H7MA 1PMJX 1X50A 2TUNA 4XABA 2JJ6A 4IE5A 4AEKA 2OPWA 1W2UA 1CAVA 1HQLA 4FOWA 3VBRB 5C9AA 1YRZA 3J8F3 5FBJA 4A44A 1PO23 3WP6A 4NHKA 4DY3A 4EN9B 2RS53 1X9PA 4XFGA 3AXDA 1QNWA 2C1FA 1RMU3 4HSLA 4IEOA 5KWRA 5FPBA 3PMSA 3KLSA 3HNBM 4CXXA 1W6PB 4G4FA 4XQ4A 4AXOA 4BMBA 3ZDVA 5BNPC 1PVXA 1Y3TA 4EWEA 4Y24A 1SLIA 1GLHA 5F2SA 5F5IA 1XQNA 2R041 2A71A 5T5JA 4KU7A 4FBFA 1U5IA 3A7QA 2P3JA 3C7HA 3VD9A 1CGPA 1BVP1 4LITA 1JTZX 2VOWA 4XMIA 2RS33 3MDPA 5A7NA 1PZ7A 4IE6A 3UETA 4A6OA 4D94A 4FPFA 4WVZA 1UW8A 1NCQA 3DYPA 4C91A 3BKZA 1UY4A 3ZXDA 3I2FA 4LOTA 3WNKA 1VPHA 1ZX5A 4CUGA 4YM3A 5I91A 3POEA 5K0UB 1AUYA 2QNKA 2ZGNA 4MGSA 1IOAA 1FAYA 1Q8PA 1OLME 4HL0A 2YPJA 2PAEA 1AL23 1H9PA 4BQ5A 1MS3A 4E2SA 3L9JT 3MFCA 2WSUA 1NLSA 2ADEA 2RM21 3K3OA 3RPQA 2P1BA 2JX9A 2WZR1 1XXNA 2GC1A 2DTYA 1XNCA 5JOZA 1WW6A 4W8JA 2ADDA 1FV3A 2IVIB 3ZMOA 3LB9A 1EUTA 1NLRA 2FDFA 2VU9A 3FBMA 4AQTA 1REEA 2IVJA 5F3EA 4EROA 1HQNA 2OT7A 4W65A 2PFWA 2RE9A 1KJLA 5JIAA 4LBQA 1BYHA 4TXWA 2BERA 1DQ1A 1X7NA 3OUJA 4HN1A 4N90A 3KT7A 5FZMA 2QVSB 3S7IA 1S2KA 3O5SA 3POWA 1AYN2 1EPZA 2ZABA 2K9ZA 2GU9A 3NJYA 5SV5A 5A70A 1HQWA 2VE1A 1DGWX 1L3JA 2WO1A 5FY9A 2WYFA 3BOWA 2WNEA 3AVRA 1Y7BA 3AYAA 1TE1B 4RS5B 1WCUA 2WO2A 1QJU3 3AB0A 2WZPP 5I0DA 1UD1A 1NQJA 1YCIA 2HEVF 3FBYA 2JDMA 2Q5TA 2FHRA 3NNFA 3NW4A 1NT0A 2W91A 2R061 3J26N 4L99A 5JIUA 4N8MA 3T4VA 5A32A 1NCQC 2TBVA 2A3WA 3AMNA 3WNPA 2Z79A 3GJBA 2BGCA 4GKXA 3LSEA 4YZ4A 4QKBA 3WXPA 1J83A 1QJX2 3ON7A 2V72A 5FXVA 4QHBA 1W9WA 4LO8A 4MOAA 4PT6A 2OS2A 1V6NA 2W87A 2AACA 4PDWC 1ND3A 2YBSA 1A8MA 1ZRIA 2BUKA 2Q4SA 2QQKA 3HT1A 3EBRA 5FLHA 5E16A 2WYSA 2Y26A 3MIDA 1OA4A 3LA3A 4KBZA 3ZN6A 2VMHA 4JGYA 3JBG3 1CPMA 2JDUA 5F1RA 4HZFA 3JUUA 2NP0A 1CVNA 1V6IA 2RDQA 3MPBA 2XJPA 4R4ZA 1IKQA 2I07B 4Q27A 2JE7A 4M3CE 5CFDB 2A6YA 1UZVA 4O7XA 4GULA 1A3KA 1R1A2 1RUE2 5DAWA 2C9AA 5GLUA 2WNUA 1HKDA 2RR13 2WFF1 4CU8A 5JOXA 4AF9A 4OQ8A 2HWE2 3DPRB 3GGLA 4DINB 5A6YA 1RUF3 1X82A 2VTXA 3VDDB 3WNNA 3MGUA 4P9JA 4GMP1 3OGSA 1LNSA 3KGZA 4IUGA 3VZMA 1ZRRA 4ZZ8A 4QPYA 1H8TB 1DLLA 4XOGA 3K3NA 1JN2P 3HQUA 1S0CA 1NA1A 1GBGA 1S0BA 3KM5A 4P00B 4P08A 2XONA 5C70A 2YFUA 1DQ6A 2DCJA 3D5OA 3PUSA 4Q4V3 5BY5A 1WW5A 3KV6A 4A4AA 3VHNA 4Y20B 2DU0A 2O14A 4AQSA 1YI9A 2RM23 5KHJA 3DPRA 3ZIXA 1GU3A 1DQ4A 1V6JA 4M0NA 4LLFA 3MW2A 3TRSB 5LRSA 1F5JA 2JG8C 4PI0A 4AFAA 4PIYA 4RA0A 3CEWA 4QXBA 3ENRA 3BIWE 3MUZ1 1OSGA 2CY6A 3WQ7A 2DF7A 3ZKYA 4AFBA 1VALA 5BYNA 2VZ1A 3HEIA 4B4PA 3X29B 1A78A 3CJIA 4H3WA 1W6QA 1LOFA 1SDDB 4QB2A 1QH6A 1V9U2 1VAVA 3HBZA 4L11A 3TN92 3D8CA 1IKPA 5LWBA 2VBDA 1VBB2 4I3PA 2P3IA 1CJDA 4ZXKA 4CDQA 4UF0B 3SCHA 1O4TA 1GZ9A 1OXCA 1VBD1 3ZFGA 4AVSA 5LA1A 5FZ1A 4B29A 2HWC1 3NNGA 2ES3A 4K8RB 1XNDA 2JG8B 4QM9A 3ZXJA 2FQPA 5F37A 1RYYA 2GC3A 4XVHA 2AGSA 1YFYA 1EV11 1WUVA 2FD8A 1DQ0A 1STMA 2UYAA 2VECA 3ZMNA 1W05A 5C3RA 1C5IA 3BPSA 3ZSJA 3CJXA 4JQRA 3HWJA 2XWJB 2BPA2 2H6BA 1POQA 4NRMA 5D8AA 5DN2A 4CDWB 3KQRA 3WNMA 1DZRA 1WA6X 5BUVA 2Y0OA 3S5QA 3I2JA 4JCKA 2TNFA 4JDMA 1F4HA 4RQPB 1AYN3 4BH9A 1HRV1 4JX0A 1DQ2A 2GALA 3AYCA 3MBWA 5FZKA 2R072 2ZEWA 3C3VA 3LZZA 1Z7S3 1VRH3 4XJ8A 5L36A 1ZREA 1KRIA 3JXSA 5CA6A 2C4XA 2QQJA 4RFRB 3M70A 4M4RA 1E5HA 2QTWB 5FJHA 2W0XA 3WCSA 4FAGA 4BQ1A 5BXXA 5KR7A 1K5MA 1W28A 1SPPB 3U75A 4LHSA 2J1UA 4QHOA 3T2PA 2DFCA 3W5NA 2IXKA 1UYXA 3AKQA 1VRBA 3CZJA 4ZS3A 2VMFA 1KJRA 4MX3A 2GP5A 4Q0VA 5DPNA 4XMAA 4I0AA 3WG2A 1N3OA 1RUF1 2D43A 4LXLA 4IW3A 2JD9A 1I5PA 2RVAA 4DOUA 1JUHA 5CVRA 4XAAA 3RS6A 2J1RA 4K1YA 1VMFA 1SCRA 4EN8B 4Z8BA 1KEXA 3AM2A 1CPNA 1BQPA 1TNFA 2NM1A 5CIRA 3BU7A 5FY5A 4Y22B 1W9TA 1MQTB 4DZGA 2ZKLA 3RZJA 1ZZ8A 2BYVE 4M3CA 4MADA 3LQCA 1OC1A 1SDWA 1QOTA 4XHXA 3BCWA 1AXZA 5ANNA 3WQ1A 1PIV2 4XDOA 2MPFA 1HRI3 1LEDA 3PVBB 4ZU5A 2YU1A 4E4SA 3WW3A 4HKOA 2PYTA 1K3IA 2VTXJ 3KF5A 5FQ0B 5FYUA 2ZGQA 1LGBA 2YMZA 4O9GA 4CCKA 1AR72 1OPMA 1DFQA 2Q8CA 2P6CA 4A7KA 3ZYHA 4QD2A 2XUMA 1HXS1 4NHXA 2Y38A 3ZFEC 4AGVA 1UY1A 3AMQA 3IDAA 4M3CF 1GWLA 2WDBA 5GLTA 3BVCA 1L7QA 4QAWA 3EO6A 4YZ5A 3Q8FA 3KZ4C 5IT6A 3BOPA 2AC1A 1QJY2 3NNJA 3T0AA 2FZ2A 3B00A 5J36A 3LKJA 2DCZA 2IXIA 3B9IA 2BOIA 4FSJA 3ZKUA 4BLIA 4Q0PA 1AR81 1NKGA 3SISA 3OY8B 4YW4A 1BJQA 1H0BA 1PX4A 3WHUA 1RUJ1 2Q8EA 5HPOA 3AFKA 4DY5A 3B3QE 4MYEA 3MPPG 4R4XA 4J1XA 1RUH2 1ULCA 4YVSC 1TMF3 5LB6A 4JGYB 2C24A 4C0HA 4C1WA 4UBHA 1GKBA 1GWKA 1T6GC 3I59B 4COWA 3VDDC 3B69A 1KFUL 2WAAA 1F4AA 2ZCWA 3GBFA 1W3XA 3B7MA 4IV3C 2RV9A 1XJAA 4MHRA 4GB32 3ZX7A 3FFZA 4BMEA 2LROA 3VDAA 3NRUA 1ZBE1 1BLZA 2UWBA 2SLIA 1V00A 4COYA 4XZUG 3RZMA 1R082 3OPTA 5LZ6A 3WW1A 1MS5A 3WLUA 4OZXA 3CKHA 2JICA 2OPKA 3P5BA 4QGMA 5FMOS 4I2OA 4XETA 4DUVA 1G9BA 1EAH2 1QQP3 3OPWA 1I1EA 2CSGA 2OUHA 3BN6A 1U5YA 2Y6HA 5FIXA 2W39A 2HLEA 3VBOC 5AC93 1MVQA 4QWNA 5FWJA 4TN7A 4BU2A 5B2GB 1PO21 2XH6A 2ZHKA 1UX6A 2ZOEB 5L19A 2VOKA 3ZN6B 5JCTA 2HWE3 4Y5Z0 3VKMA 4R9AA 2VMCA 2B9VA 3ACIA 5FZEA 1EYBA 5FZ4A 4Q4W2 3VLBB 3VZNA 5FZAA 2VD7A 3VBUB 4WM7B 4I0BA 1BHGA 2EF6A 1RVF2 3B93A 4YVWB 5KXBA 1X9TA 4JTOA 3VBSC 2GMEA 5A1FA 5A1LA 2SBAA 2EAKA 4AVAA 4CU6A 1OLRA 2D6OX 1AJOA 2RMU2 4AVTA 2R32A 2WQZC 2XUEA 1ULFA 1APNA 1KS5A 3DKQA 3GNEA 4M3CB 2P3KA 5FZFA 3DV8A 4RQPA 3PUAA 3WDXA 4NIGA 1CQ9A 3NNLA 1FOD1 2VXJA 3GALA 5JVVA 3RWKX 3ZYBA 1CX4A 5KHIA 2CU5A 1UIJA 3LDRA 1TME2 3WNLA 4BHPA 1E5IA 4NR1A 4BA6A 2GMMA 2ZBJA 1HX6A 5T5PA 2VULA 1HXS2 2W47A 3PHMA 1C8M2 4UFHA 4CZSA 4HKLA 2ARAA 3ZLIA 1PVC3 1OURA 3POGA 4EWAA 3H8XA 3POBA 3GF6A 3RJRA 3CF6E 4W4ZA 1OUSA 1OOPC 1W6PA 1QY4A 2V5DA 2WSVA 3I2OA 1NE4A 3ZFEA 5JZGB 1NLQA 3VBOB 1PNGA 1K5MB 4BDVB 3OGJA 2R49A 3GXUA 4CCNA 4FP3A 5BNOC 2VNVA 4IV1C 1JYXA 1VBC3 3V0AA 4GWNA 4O65A 3CBNA 3CHXA 4IEZA 3S57A 1RUD1 5IVBA 1UPIA 4CU9A 4DUWA 4OMDA 3VBSA 4HMZA 5C4WB 4D7YA 1NXD1 2EAAA 5L73A 1C28A 2PHRA 3R4SA 1UOBA 3NAPA 4CDQC 2WNOA 2VQAA 4INDA 2ZX1A 4S2GA 4JDNA 5CZKA 1W9FA 2HKXA 3NV3A 2EXKA 2ZZQA 3QH6A 5ISLA 1PM4A 2PLV3 3KGLA 3VHRA 2VZOA 3I3BA 1T6BX 3JBG1 5A6QA 3RZKA 5HI0A 4Q4X1 4WZCA 1W04A 3BTAA 4HVOA 3E6DA 3I3EA 2UWCA 3PDQA 3T2TA 2DUPA 4C8DA 2WZ8A 3S30A 4MGYE 4AE2A 1Q8VA 4XBNA 4COUA 5CFDC 4LUMA 2JB4A 4NHYA 4AYUA 2DVDA 1RHI3 4H14A 4COZA 5A3UA 4Q1RA 2WL1A 1UYPA 2VW0A 2G4IA 3FFQA 1GR3A 3LA2A 5FOJB 5IVEA 2YU2A 1RXFA 3WEZA 1HRV2 2ZHMA 5LRRA 3IZOA 4XFIA 4CUCA 3R4UA 1KXGA 1RVF3 3WX5A 1SMVA 2VVFA 4R9DA 3WF4A 2EIBA 1COV3 1W8WA 5JPNB 4CTEA 4OHXA 1ULOA 2CTVA 3ZYJB 3HN1A 4G9SB 4AQ2A 1OH4A 2BQPA 2N7GA 3AP7A 3OBAA 5C3PA 3KHCA 2ILMA 4P9GA 4BJ0A 1K5MC 5FXZA 5IVYA 2HWF2 2WABA 2XJQA 3SXWA 4BQ3A 3UJOA 2XPJA 3OB8A 3UGHA 3PIJA 4QQLA 2R0HA 3AC0A 2DUOA 1QJU1 1WZXA 3PU8A 3VZLA 4MGIE 2VCMA 4CDXC 4OHVA 2B8MA 1UZ0A 2HWC2 4JC1A 3HT2A 4HG6B 4OLLA 4YW3A 4AG4A 4GZ9A 4P9YA 5K8SA 3ZFFA 2E6VA 3HBKA 4ATEA 1JZ2A 3BB6A 1VBB1 4ASKA 2ZPXA 3OCPA 4UYBA 1R093 5F3CA 2BBVA 2VNRA 5IVCA 3RI8A 4WV8A 5C9AC 4AFMA 1AL22 4GWIA 4KG8A 4E8DA 1O4YA 1UOJA 4FPOB 2VCCA 4GA9A 4XDPA 1WMFA 2XVKA 2GDFA 4L9BA 3ALQA 3EXUA 5D8AC 5C8CB 3CLPA 3CZUA 1F5FA 4GH4C 1VBD3 5EYXA 2HWB2 2RS13 3AKRA 4UXAA 3TWIA 2YY1A 5CFCA 3AL5A 1QDOA 2A73B 3NQHA 1BK1A 4W6XA 1RUNA 3K4ZA 1P8JA 4AI2A 3DF0A 4CDUC 2HWD2 3J8F2 4QQPA 1J58A 1OUXA 4NUBA 4XQWA 3ZFFB 3B94A 2CDPA 1WGPA 1AL0G 4UWDA 5FYZA 1S55A 1J84A 2JDNA 4GALA 4NN0A 2DWRA 2ZGKA 3GYDA 2O8QA 2D5FA 3MIBA 4KI5M 3RG0A 4F7ZA 1UWWA 2PQQA 4W6YA 4K3UA 5IUQA 2CWSA 2HYKA 4LBQB 4BK5A 1V9U3 3T3YA 2NMNA 4R8HA 1AX2A 1W0PA 5I0UA 4BLJA 4D6SA 3IKWA 3WY6A 4E9KA 5DABA 3IIIA 5I8YA 3E97A 2WFF2 4LEJA 2WT0A 1W2TA 1RUE1 2FZ1A 1XYOA 2CV6A 1E57A 5FCCA 3VGIA 1SLBA 3ZFFC 2E53A 4AI1A 4D8MA 2J7MA 1OKOA 4HN0A 1URXA 2XGXA 5KHGA 5FZBA 3AP9A 5FZIA 4DXTA 1JZ6A 4Z92B 3AP4A 2XL9A 1Z7S1 1Q8QA 2YC0A 1ZNPA 3N36A 5FYVA 2F17A 2AUYA 4ASMB 5IVFA 3ZYRA 1O6UA 2ERFA 3Q8BA 2QBXA 1J1TA 3E5XA 3ME2A 2OYZA 1X33A 4LBMA 1GNZA 4NIAA 1ZBA1 1WWYA 2VZTA 3K4AA 3ZDSA 2RJKA 4BIOA 2RS51 1JOPA 2C6SA 4W50A 5FKCA 4CU7A 3GBWA 2GSYA 4CXYA 3C7GA 3J9SA 1C8M3 3LGRA 4HXCA 1MQTC 1DGRN 2PHDA 4TWTA 4J1WA 1XYNA 4HK8A 5GJ6A 1EY2A 4EZ4A 5JI9A 3SKVA 2R062 1ZBA2 3IDEA 2JG9B 5JXGA 1DDLA 2HWC3 2Q30A 2QFEA 4OYUA 2Y8KA 4UF0A 1QDCA 4WVWA 5FUIA 2D3PA 2BFUS 4YGEA 1B09A 1LOBA 3AYDA 4B1LA 4QT6A 4JKLA 2W46A 2HWD1 1DBNA 3VD4A 5HCAA 1TNRA 3B9CA 5LEJA 4LO5B 4OZOA 3R6SA 1IPKA 5A80A 2D6KA 3DYOA 3VBOA 4RR3C 4XF1A 4ZU4A 4FP2A 2Y6FA 5JZGA 1ENXA 2FDHA 4FTSA 1CZSA 3WUCA 3S7EA 2F6BA 5FMDA 5L7OC 4XUNA 4S2FA 4B3NA 4DRRA 2VCBA 1F8VA 4XJ9A 1AL21 1ODMA 1R1ZA 1GQGA 1XE0A 3RVHA 4BWOA 2ZJCA 2G9GA 3WD5A 1AYM3 2BVVA 2WLQA 3NKTA 2YBKA 3HIFA 4NVPA 1GZTA 1UY0A 1G6NA 2OIIA 5IAVA 3TEXA 4G3YC 2BTVC 4IV3A 4YG0A 1QNYA 4YNIA 2VM9A 2D3RA 2VO5A 3KQ4B 4LBNA 2J1AA 3PMEA 3I2GA 3EJKA 5BNPA 1J3QA 2HWF1 1NG0A 3RZHA 2MEV1 3B01A 2ZGTA 3H50A 1H1IA 4Q0QA 3AKSA 4XBLA 3LD8A 3CIHA 3D3AA 2GH8A 4ZXEA 4PCRA 4AHWA 1NCRB 2JDZA 1UY2A 5JMOA 3LEIA 1CN1A 3W21A 4AW7A 2D7FA 2OQ7A 2HWB1 2BRTA 2DFBA 5E89A 3RFRA 5C71A 4AWDA 1ENQA 2DUQA 2ZXQA 2JDYA 5IW0A 2PAKA 3P3NA 1JYIA 3OF1A 2VGDA 4LBLA 4MGQA 3NVCA 1B35C 4Y1XA 4YW2A 3M3CA 3E6CC 3ELNA 1W6NA 1UOFA 2PN5A 3E6BA 4JTNA 3FL7A 4LOSA 2WT1A 5GKAC 2O8OA 3ZVXA 4P14A 1CZTA 4LLOA 4TSVA 3N9NA 1AF9A 3PJQA 4QKFA 2VMGA 1TMF2 5SV8A 3W9AA 3IAQA 4AEDB 3UK9A 1MS1A 1UCXA 1U5ZA 5JLVA 1QJU2 4YW6A 2YUEA 1DLCA 2AYHA 1QQP2 1PO12 3LE0A 1HXS3 2VAUA 3JZVA 2AREA 4Q2FA 1AX0A 4GQ7A 2DVFA 2X5IC 3JU9A 4GD4A 3ILNA 5DAPA 1GICA 4FPHA 4Y1UA 4L8QA 3RZZA 3IN9A 3P3PA 3D0JA 4LUKA 4HK9A 1R64A 1RUD2 5FREA 4AVBA 1XOYA 2VQUA 1BEV3 1NZIA 5F5AA 3AXEA 3FHIB 1SCSA 3G7DA 3HNMA 1U5XA 1ULGA 3LEGA 4LKFA 1YUDA 1H2MA 3H3UA 4PBOA 4LJHA 1AR83 2GNDA 1CIYA 1HN1A 1OI6A 2NQYA 2WJSA 2Y6KA 3K77A 3IDCB 3RZGA 2QQVA 4OUEA 2XJUA 4GMP3 1OQDA 5A3NA 4EWDA 1C1LA 1HB4A 1N3QA 3VKNA 1J3PA 3ROUA 2X53S 5JWPA 4XF4A 4OHYA 4FT8A 4HKWA 3I8TA 4YWAA 3MICA 3RI9A 4QPWA 3WUDA 5TSWA 3J4UH 3JBG2 3FUOA 2P4EA 4HPKB 3A4UA 1JU4A 1PZ8A 5BNOA 2GC0A 1LJ7A 5KHKA 1SLTA 4RHV1 3ZOIA 2JDAA 2ZX3A 3HNYM 1LCLA 3POFA 4IDZA 4L2NA 2RHPA 1H8TC 5FYMA 1H6YA 4JKKA 1ZBE3 1GOFA 4BYYA 2Z5WA 3PL0A 3BI3A 1JYNA 5D2AA 4KL1A 4QXKA 1ZVFA 2FBEA 2Y33A 4Y26A 1TEIA 1GWMA 4YGBA 5FPXA 5JZGC 2RDRA 2CAUA 3K2OA 3U07A 2QQMA 3MLLA 3OYWB 3MIGA 5D8AB 3SKJE 4DEQA 1SHWB 2ET7A 2GMPA 2VUDA 2XVGA 4M0HA 4CUBA 4GJZA 4EYUA 4QU2A 1JHJA 2W1SA 2X09A 4FFFA 4IEUA 2D93A 5DDJ3 5DDJ2 1J59A 4NRPA 2V4VA 1LHVA 5C8CA 3HVDA 3J7LA 1JYVA 4Q4W1 1WD3A 2B5HA 3KVBA 1RUI3 2VZRA 3EYPA 3OBRA 4N53C 4Y1VA 5I8SA 1WBLA 4ITCA 2ZA9A 1G9FA 4BQXA 1FMD3 3AMMA 3QH7A 1VRH2 3BTXA 1H4HA 1YWKA 3OPZA 3RRDA 3WG1A 1BK0A 3ZXAC 2ZMNA 3WSOA 1OVPA 3O1OA 3U4SA 2P5BA 3ACLA 4A6SA 1LRHA 2VUCA 5FZ7A 4AZZA 1BMV2 3SCGA 4LKSA 5FP9A 1TME1 1H30A 5BNQA 2Q1MA 2FMDA 2WN2A 1AVBA 1SLLA 1RTVA 2GZWA 2J1SA 3GDBA 1FOD2 2VG9A 1SG3A 5FP8A 4KNCA 5CFCB 3N4MA 3T1MA 2ZX4A 1LGCA 2JG9A 1OH3A 3TN93 5C7GA 2IXLA 1CONA 4MO3M 1Y9GA 2VCAA 4IERA 5FPZA 5EJ3A 1SFPA 1UIKA 3JQWA 3K4DA 3TYJA 1RHI2 4LO7A 4LMFA 3MV01 5JXIA 3HJRA 5F39A 1PGL2 1RVF1 4EZHA 1FATA 1WMXA 2OA2A 1NA1B 2B45X 4CVUA 2AEZA 1XNKA 1GP6A 4QX5A 1HN0A 3U10A 2PLV2 2H6CA 4K20A 5IK7A 1W8ZA 2YC4A 3AP6A 5IYYA 4LHNA 1PO22 4Y1ZA 1WA4A 2OKXA 3Q9OA 3ZN5A 4D6QA 4S2DA 2ZMKA 3MUY1 3U0ZA 4Q8KA 5JOYA 5FK8A 1SBDA 3ORJA 2E63A 5T50A 3TB0A 4BISA 4XE9A 1EAH1 5CG8A 1XU2A 4OI4A 1QHDA 5T54A 4YW1A 4AL9A 5BPXA 3O0VA 3ZSEA 4OVEA 1ASJ3 5LATA 4E4HA 3OOXA 2WWSA 2PA7A 4CCJA 2ZAHA 2P37A 1LENA 1R1A3 2XKPA 5FZ6A 2Q8DA 1R081 2BGOA 1RUD3 1YHFA 5JR7B 3WG4A 2JB8A 3N9QA 1BZWA 4RHV3 2V5YA 1KD7A 2Y6GA 2QQOA 5FY1A 4NE9A 1BMV1 1ZBE2 4XFBA 2KM2A 1MQTA 4E2GA 3DXUA 1MVEA 2YPDA 2A6ZA 4PHZA 4F3JA 3V0AB 4PI2A 4GB31 1VRH1 2D40A 2A6VA 2LTNA 1ZYBA 1UZYA 4FAHA 3PTYA 3LEKA 5ANQA 1LECA 4AGRA 5KHHA 4F83A 3SNMA 1CJPA 2UU8A 1C3HA 2VZPA 4JQTA 2WWUA 3O1VA 1IG0A 2DCKA 2P34A 4H2AA 5DDJ1 4ZKTB 3PNAA 5GALA 3ZM8A 2B9UA 4QPGA 3UKVA 2VUJA 1BBT3 5JR2A 1C8NA 1QKQA 3OBZA 3N35A 5L7OA 4XDQA 3S6PA 3NJZA 3WVJA 1BCXA 3WF3A 3AP5A 4NROA 3UL2A 2VMEA 3T0DA 3AJYA 1Q3EA 3ZR5A 2I74A 1Q5OA 1S1AA 4CDXB 3O1PA 1YFXA 4N7UA 2WWJA 1RUE3 1V0AA 2X05A 5C8WA 4XUOA 2LRPA 4LT5A 3JB4C 5BV6A 1UYZA 4N43C 3BTYA 2ZGMA 4JKMA 1VBC2 2VL4A 1POV3 1M4WA 2ZGRA 5DUXA 2RDSA 1QOOA 1IGOA 2DBIA 4LORA 3ZSLA 3QBQA 3CL1A 4IL7A 2CGPA 3DL3A 1JYCA 5K4LA 1DG6A 1BVVA 3I59A 5J98B 4YM1A 1GZWA 1D0HA 3ZFGB
chains in the Genus database with same CATH topology
1RITA 2XJRA 4YVSB 1XE8A 4WZFA 1Z78A 2K2SA 1PIV1 2E7TA 5DZFA 3RYKA 4I0WB 3WP3A 4AVVA 4A7ZA 4PLNA 2DURA 4MGZE 1OOPB 4HLTA 4YG6A 5K0UA 4AVCA 4S2HA 2GN3A 2D98A 3HAGA 3MIFA 2NN8A 3OJBA 3JB8A 5BNOB 1JUIA 2PHWA 1GZWB 4FPLA 2WNVC 5ABJA 3G6JB 1LOCA 5CB7A 4R52A 4AGGA 1PO11 1RUF2 1ZBA3 1EV12 2IC1A 4Q0UA 2ZX0A 4E27A 4YVSA 3M1HA 2JECA 3D4KA 1RJ7A 2A70A 5IK4A 1TMF1 1VBD2 1QU0A 1GANA 1PK6C 4AI3A 4N43A 4DY3A 3KCXA 3NAPB 2UY9A 1MS8A 1MS4A 1U12A 5GZEA 3LA7A 4JDOA 5HCBA 1V9U1 3QOPA 4BE3A 2DCYA 4ISQA 1OKQA 4Y22A 1VBA3 3GZTB 1SBFA 5H9RA 4RSUA 2BWAA 1DYPA 4YRDA 1VB2A 4FCAA 5E8AA 3HQXA 4J6GA 5H9SA 1SACA 5CAZA 1FV2A 1LHOA 1RL3A 4HETA 4D7SA 5T55A 3UKNA 1J1LA 2D6PA 2MEV2 1XRUA 2VMIA 4IEYA 1AR92 4YFWA 4XTPA 4PIZA 1VLNA 4LHKA 2XBO3 5DUWA 3VBFA 4LE4A 3FLTA 4BM8A 2FMYA 3MZHA 5I0TA 2ET1A 1CAWA 4KH9A 4YZ3A 2HWE1 3B5LB 3DGTA 3POSA 1POV1 4BZ4A 4CDXA 1POV0 1JBCA 1C5HA 5LEKA 1NZCA 4UW4A 4MH0E 4YM0A 2RS32 2BVBA 2XJSA 4U36A 2WNUB 3RMXA 2BWCA 1LHNA 2CNAA 1ALYA 4AEDC 1AX1A 1X8EA 1S0GA 3TOJA 1HLCA 5J3UA 4OFGA 3D6EA 1MS0A 3M3OA 4Z1VA 5EFUA 3RMYA 5C8CC 1CAWB 1SFNA 1LU2A 3R4DB 3IIAA 3H8UA 4Q1PA 3KMHA 4IEVA 1CAXB 1QJX1 4CDUA 4QGNA 5CFCC 1IS5A 4D7TA 4C1XA 1YO8A 2XB6C 3WDVA 2HJIA 2DYCA 1YLLA 2V73A 4AI8A 1OOPA 2RS52 2E9QA 4MSVA 1NCRC 1QMJA 4AHXA 4CYDA 5I0RA 4XQDA 4JRLA 1G7YA 2ZMLA 2EXJA 3HD8B 3M7AA 1Z7S2 1AR63 4M00A 1WD4A 2HWF3 3DPRC 4JVAA 1VBE3 1LEMA 2UWAA 4FTEA 4JGZA 5FOBB 1CR7A 1VBA2 5ABJC 4K7JA 4AHZA 4HVQA 5BNPB 3FUQA 3AZZA 4N43B 1S0EA 4XXPA 1VAKA 4X6QB 2W08A 5CBLA 1EV13 5FBZA 4XFAA 2D3SA 4XFHA 4K6BA 3WINE 4B4RA 5T52A 2A6XA 1UF2C 5FQ0A 3WOGA 4FPYA 4A2UA 4AI0A 5LK7B 5T5OA 2YROA 2XWBB 1PM7A 3VBRA 3VBHA 3OYWA 4LR4A 3NL1A 1F31A 1MACA 2IFRA 5GM0A 3J8F1 3IBMA 1ULEA 2GNTA 3IMNA 4P5HA 3IPVB 1LOAA 5JOWA 1MZ5A 4CEYC 2XG3A 4KU8A 4NHMA 5BNNA 3MF9A 4H55A 2QZ2A 1W0OA 1YXWA 2UURA 3JCIA 1HIXA 3SLIA 3O0XA 4FXGB 5A3MA 4CDWC 3B02A 2OVUA 2RR12 2D44A 3W58A 1PZ9A 2LM3A 3U11A 2RMU3 1QJX3 4CEWA 4U2AA 4Q26A 3VL9A 2ZAAA 3H0OA 2P17A 2WZR3 4LA2A 5AFBA 4QMAA 4MXWA 5CNAA 4TZDA 2YYOA 4W6WA 3RDIA 3ES1A 2EXHA 5EWSA 1QXJA 3ZN4A 4WBBA 2YZ4A 1NY72 1PGSA 4AXOA 3ZYPA 3LOBA 3WV6A 2BNOA 1W6NB 4IEPA 3FC0A 5FO7B 3VZKA 3IT8A 5C9AB 1MR5A 5ACA3 1CAVB 4QPIC 2ZGOA 1WMDA 2A75A 2YDEA 4Q4X2 1GV9A 3C2UA 4P9IA 4EV0A 1M06G 4META 1I6XA 4TLFA 4XILA 5EYYA 3A0KA 4XJAA 3NV2A 3OTFA 1ND2A 1ENSA 4LE3A 5KBFA 1RUOA 1N1SA 4ASLA 2WA3A 1YJKA 4XF0A 1S2BA 1TME3 3FLRA 3VN4A 4CEYB 1O5UA 4XJWA 4CEWC 3WDUA 5GZGA 2Q1ZB 4PBPA 2VVDA 1D2SA 3GHMA 4I01A 5E88A 5T3NA 1LOEA 1HV0A 2A3YA 2ZX2A 4PLMA 4Z82A 1S0JA 4RR3B 4WM8A 2D6NA 1GSLA 3I7DA 3AYEA 1FPN2 4WVVA 4BIFA 1C8M1 1HV1A 1D4M2 3WW2A 4QPIA 5JSPA 1N1YA 5KXCA 3ETQA 4BCUA 3MF6A 2XL7A 4YGCA 3FE5A 4ATFA 4K40A 1UU5A 3SCFA 3WG3A 1IS4A 5FFOC 1BXHA 4ISRA 4YG3A 4N9IA 4BPZA 4Y1YA 3MLKA 4RR3A 4WM8B 3AX4A 3URFA 1PIV3 4CEYA 2RMU1 5KC6A 1ULDA 1H8TA 1OMIA 1GNHA 2PHTA 3VBFC 2P2KA 4XBQA 3AZYA 1NOVA 4Z07A 1OLQA 1H1MA 3L2YA 1UAIA 5JSRA 1AZDA 1AJKA 1VAMA 1D2QA 2VNOA 1W6OA 1G9DA 3W59A 1WCSA 2YXSA 2ZGLA 3OBTA 2B42B 4R9BA 2NMOA 1FX5A 2QDRA 2VXRA 3I4IA 4WM8C 2OW4A 4CP0A 3QD6A 1Y9QA 1KITA 4N53A 3H7YA 1RMU2 1OFNA 5DXDA 4UBGA 4UW5A 3USSA 1COV2 2PHFA 3FJSA 3POYA 3ZXEA 3H9AA 1RJ8A 3DUIA 5JI7A 3LSDA 4AFDA 4XEZA 2A3XA 3V65A 5GZCA 5J09A 4QQOA 2JKBA 4FPCA 4GWMA 3GHNA 3N7JA 2PTMA 3GBGA 5J37A 3ZPYA 1VJ2A 4IESA 2QJVA 4XFCA 1YI7A 1FPN3 2IFWA 3ZYGA 5F6LB 1NCRA 2IXCA 2MEV3 1DU3D 1QF3A 1R092 4AFCA 4OUSA 1HRV3 1BEV2 2O1QA 2VW1A 2WIIB 3LAGA 2VQ0A 3SH3A 1H4GA 1CD3G 3EQEA 1BKZA 4CP2A 1RUH1 3AZVA 2HWB3 2QE3A 5CU1A 2XBO1 1ND2C 2JEMA 1HW5A 2YHJA 1RUJ2 1NQDA 3UV9A 1AR93 4K8FA 4N9HA 2O0OA 3AZWA 1AR82 1YIPA 1D4M3 3VBUC 2PHLA 3JQXA 1LTEA 2PAMA 1QJY1 1I3HA 1DHKB 4Q4V2 3VBFB 2C0ZA 4DQAA 1ZRDA 3VKFC 4YVWA 4XF3A 2B7YA 2ETEA 5GLZA 3AMHA 5E1RA 3N7LA 4Q4W3 4JRAA 2NPIA 4HBNA 4QPIB 4YLZA 4GMP0 4E2QA 1AR71 3WZ1A 5H9QA 1OD5A 4URTA 1FI2A 3FLPA 1EP0A 1N3PA 3CJIB 1LHWA 4A7YA 2ZACA 1PNFA 3SITA 1MEC1 4B7KA 1WCDJ 3VBHB 3OD0A 4L97A 4B4QA 1U0AA 4KGGA 3VV1A 3KS7A 3ZO0B 1WLCA 4GIQA 2A6WA 3SH4A 5JPMB 1W39A 3NO8A 2HEYF 2EIGA 2R1DA 1S0IA 3M8LA 3ECQA 3QACA 5GLVA 2A7AA 1ENRA 2X29A 4JGYC 1UU6A 1MZ6A 3OGGA 4JGZB 1KDMA 1H9WA 5A33B 3VDDA 1RIRA 1ZZCA 1LODA 4AK3A 1UPSA 1O91A 1XNBA 4XTMA 3RNSA 5FLJA 4AEJA 1YFWA 1C57A 2XLAA 1REFA 3IDBB 1PVC2 1NYWA 5FAXA 5I93A 2R071 4OI0A 2ZTNA 4LBQD 1KFXL 4O9EA 3ZXGA 1MZFA 5KXDA 3KCCA 5GZFA 4LO6B 3K48A 4GH4B 3CU7A 3PLQA 1G9AA 1DF0A 1R083 2XHKA 3E5UA 1QXRA 1RUG1 5AVAA 3PVEA 1RGSA 2ZS6B 5BNNC 5KXEA 3V0BB 3H3ZA 5C33A 2Z69A 4PF5A 2WT2A 1AYM2 4D69A 2XLFA 1IZ3A 1QXPA 4FQZA 3HR9A 4DRVA 2Q0AA 1D4M1 1QOSA 2OZ6A 1O3QA 3HMYA 2Z42A 1DQ5A 3H7JA 3BPZA 1UN1A 1UZZA 1HRI2 1LGNA 4LNVA 4H7LA 4X8PA 1N1TA 2BEOA 4HVRA 3TN91 3VBSB 1ZA4A 4LA3A 1S0DA 4Q4Y1 5FDBA 4XYXA 1OQ1A 2NZ9A 4OI1A 5EV7A 1LKNA 2ZKNA 3MYXA 3R0RA 2G9FA 1H8VA 3NSTA 3O7OA 2PHUA 4FO9A 3VBUA 2EXIA 4EN0A 1JHNA 4YARA 1ASJ1 1QGLA 4KG0A 4YW5A 3INAA 3MEPA 1GFF2 3VKOA 4MXWB 2AR6A 3E5QA 4FPGA 4XJZA 4WM7A 4NOTA 3ST7A 4A3XA 2ENRA 1S0FA 4AHYA 5CADA 5DZEA 1TQ5A 4NWVA 4FOQA 1OHFA 2AH2A 1WLWA 1ZRFA 2WS92 3RYPA 1IS3A 4MUVA 4FOYA 4EJRA 1WW7A 3TAYA 2LALA 2RS12 3NWKA 1CESA 1R1A1 3KD4A 1W6MA 2JG9C 4QPGC 4R9CA 2XKOA 2C5DA 4SLIA 2ARXA 1NY71 4EN7B 1G9CA 5FRAA 3A0NA 4XHBA 2CGNA 3MI8A 4JAAA 3ZXFA 1DIWA 2VOXA 2XJVA 1ZZBA 2QQPA 2JXAA 4FQ4A 4XJUA 1XYPA 1G86A 4FPKA 5BNNB 3AKTA 5FO9B 5IK8A 4RGAA 4BOWA 4CDQB 4DXZA 1PGW1 5ACA1 4GKYA 4IEXA 4B8EA 1ZZ9A 3IPVA 5C4WA 2DVAA 3GZAA 3USUA 2QZ3A 5DG2A 2OZJA 1YYNA 2RR11 2WFF3 2R16A 3RWNA 3ILRA 1PHMA 4MVTA 2D6MA 3JD71 5CFDA 2WKKA 4WM7C 3ASIA 1RB8G 2IWGB 1N1VA 5KC5A 3IWZA 2V09A 3AMPA 4QM8A 4FVVA 2ZGUA 5FMOL 3ES4A 1O3TA 4KWJA 2DU1A 1AYN1 3KT4A 1GQHA 2WNVA 4IQPA 1KDKA 1O7FA 4ZU7A 3O12A 4RGGA 5K7PA 1UU4A 1O3SA 2KXLA 3DKWA 2VOVA 1SFYA 4OUMA 1B35A 5FTTC 1X8MA 2DVBA 4JGZC 3VKLA 3M2MA 1A6CA 3THPA 5CG9A 2ZZJA 3UKTA 3SHRA 3JD72 2WZR2 2VNGA 2RM22 3N7KA 1MS9A 4PDWA 4MXVA 5L7OB 4WVMA 1SEFA 1YNAA 1RC6A 4ORFA 2A5ZA 2EALA 1QJZA 2WNVB 2WFPA 4Z2WA 2EVXA 2ZHNA 5FO8B 1PGW2 4GH4A 5JDBA 4IV1B 3I54A 1CAXA 1VBA1 2ARBA 4GXLA 3ZYIB 2BNNA 1WLDA 1IPJA 4FOVA 3VBHC 1VBB3 1W6QB 4SBVA 3ZFEB 3VZJA 4HT1T 2R042 4NO4A 1JXNA 3QCWA 2D5HA 5F9TA 2YV8A 1D0GA 2WINB 1SBEA 5T5LA 1WMEA 3AFGA 3WP5A 1XU1A 2EA7A 2RS11 4FXKB 4OHWA 1LOGA 2MNGA 3N7MA 4AEMA 3O14A 1NA1C 2GNBA 1HDKA 1VB4A 4RS5A 1REDA 4Y20A 1V6OA 1W6MB 3ZXLA 5F5QA 1VR3A 5K0UC 3WT3A 1FNYA 5H9PA 3TBDA 4N7IA 2JE9A 1LR5A 3WQ0A 4KWLA 1VIWB 3ZSKA 5ACA2 3FZ3A 3APBA 5IK5A 3PJYA 2Z2SB 1YJLA 2MHFA 4COVA 3AK0A 2W68A 1RUJ3 2ZHLA 5HCFA 5J7MA 1LULA 3FMGA 1RUI1 3EHKA 3M3QA 2AZ5A 3WW4A 5DUUA 3MIEA 4FPEA 2RS31 1V6KA 1FMD1 1PK6A 1H2NA 2D6LX 3NV4A 1AXKA 3MW4A 4XZPA 3ZFGC 4YFZA 3RJ2X 3R05A 3AZXA 1IS6A 4LHLA 4YZ1A 2YGMA 4YSFA 5C4WC 1V70A 4NPRA 1SLCA 1QJY3 2WS91 1HRI1 4PQ9A 3THTA 1IQAA 1Q8OA 1DYKA 1RUH3 4HPKA 1OA3A 3V56A 2CYFA 3BODA 4Q29A 4Y4YA 1AR91 4QGLA 1UMZA 1NCQB 3FWEA 2GAUA 5AC92 3WDTA 4KGQA 1B35B 1ASJ2 3IM0A 4MLOA 1VBE1 3KCYA 5C6CA 4I30A 1GYKA 4IEWA 4TYSA 4HSJA 4K1ZA 3K51A 1EPWA 2LUWA 3GZUC 1DGRA 3FX3A 4Q4Y2 1C1FA 5I8TA 2R1BA 2Y0IA 2VH9A 3H1WA 4RL7A 1Y43B 2QUOA 3VL8A 5JMCA 2X5IB 1EAH3 4LO4B 1AR61 1UL9A 5F6KA 2E51A 3M4FA 3OY8A 4HANA 2WA4A 1F9KA 3M3EA 4XXAA 2CGOA 2QCSB 3ZIWA 3LWCA 4AEDA 4B7EA 2JD4A 2NYYA 4CP1A 1AYM1 2DCTA 1ZZ6A 5JSOA 1A8DA 4ONUA 3TNPB 3USUB 3SH5A 1SQ4A 1YIFA 4CRQA 2I2SA 2X8KA 4P9LA 1RUG2 2QKDA 4GB33 3ATGA 2R063 2ATFA 1ND3B 2WLPA 4ES8A 2F4PA 1LU1A 3MLJA 4MZUA 4OULA 1PMIA 1V6LA 4K9SA 1PVC1 4LTAA 4MGKE 1DZQA 3M3IA 1MEC2 5FLIA 1DGWA 3H1MA 4YGDA 4PDWB 1BBT1 4CDWA 2W52A 3ZSMA 4Q8LA 4L92A 4EN6B 1OA2A 4RD7A 4OHZA 2WQ4A 4E4DX 2GC2A 1GZCA 2R073 4HFSA 1ZZ7A 4E4ZA 1C4RA 1N47A 3SMHA 3VUOA 1LHUA 4IETA 2YGLA 1VBC1 3BALA 4LBJA 4V1PA 3V0BA 1JW6A 2WS93 3QLQA 3AJZA 2E7QA 4IV1A 4Q4V1 3VZOA 1RUG3 2H0BA 3WHTA 1NE6A 3OD4A 2VPVA 4IEQA 2VW2A 4DFSA 2HEWF 5AFEA 3WDYA 1RUC2 4M01A 2ZGPA 2H0VA 4LBKA 1AHSA 2KA3A 3ILFA 1FOD3 1O4ZA 2XBO2 5A33A 1LESA 4I02A 2E7AA 4Q4X3 4XW3A 2BFUL 4LBOA 1LB2A 1O3RA 2DTWA 3VBRC 1DGLA 1BEV1 3VHPA 2XLGA 3T1LA 1FT9A 5D1IA 4Q4Y3 2TEPA 4NHLA 2AENA 4XIKA 3I2DA 4P9WA 4PIXA 1H1AA 4XPVA 1OFSA 1PO13 4DNYA 4IV3B 1RUC1 2CAVA 3KT1A 3RSJA 1VP6A 4PJYA 2DV9A 1H2LA 1KS4A 3NKGA 4QQ2A 1W6OB 1JH5A 3PVOA 1ND2B 1ND3C 1F2NA 1OQEA 2BW8A 2JG8A 1NXMA 1RINA 4NWWA 3LCPA 1CAUB 2RJLA 4K21A 4YZ2A 4Q0SA 4QQHA 3CJIC 3RYRA 1LOFC 4D3WA 2CL2A 2VVEA 4DB5A 4DMIA 1UKGA 4N53B 2PLV1 1WW4A 3KSCA 4RFT0 4YVWC 4IXLA 1MZEA 1R091 1BBT2 1PK6B 5EXOA 1G8WA 1O5LA 2I45A 5HBAA 5AVPA 1JOJA 2NLRA 1PGL1 2BNMA 5DG1A 4RQPC 2JENA 2R6QA 1CAUA 1YFUA 1RHI1 3O0WA 3NV1A 3WCRA 2WC2A 1OPOA 5J96B 1WLTA 1AXYA 2GNMA 3JD73 3D0SA 1ZM1A 4JV4A 5A32B 3L2HA 5DUVA 1IHMA 4PLOA 3U4XA 2GN7A 1FNZA 1X36A 1COV1 3MW3A 4RS5C 1RMU1 3MFAA 2DVGA 2VY0A 4YM2A 2QDNA 2B46X 2IZWA 4XFFA 2ZGSA 4MV2A 2Q8OA 5I0SA 1Z0HA 1D4VB 3ZXKA 1I5ZA 4X8NA 1CIWA 4AQ6A 2IXJA 4QPGB 1I9RA 1QWRA 5HXVA 3RQ0A 1AR62 1FYUA 4KBBA 2R043 3PVNA 4C90A 2PHXA 2K0GA 3UJQA 4YYOA 4UW6A 3CO2A 4I09A 2XVLA 3WDWA 5LK5A 4CDUB 5J48A 1SLAA 3KB5A 1VBE2 3NAPC 4ES9A 3WP4A 3VHOA 5GZDA 1Q8SA 5AC91 1FXZA 3MIHA 3V64A 4WVMB 4RHV2 4I3GA 1RUC3 4P9XA 4UW3A 2PELA 2OUJA 1Q56A 1ZRCA 1AR73 1KQRA 4XF9A 3N3HA 4DPNA 1Q43A 2UYBA 1XE7A 2B39A 1ONAA 1UKRA 1FPN1 1MEC3 2R30A 3D82A 1DZTA 3S0MA 3DN7A 3TNQA 4CEWB 3H1YA 2HWD3 5GLWA 5K9YA 1FMD2 3CNAA 2XJTA 3AKPA 4C0BA 4FTBA 3WNXA 5A3LA 5EZWA 1RUI2 1H2KA 2CWMA 3LOIA 4F8AA 1QH7A 2D97A 2R0FA 3WR0A 1WBFA 4FPJA 4X6RB 2GH2A 2IXHA 4KQ7A 1J3RA 4KWKA 4XIOA 2X5IA 2UY8A 4DS0A 5ABJB 4LULA 2VUAA 1V6MA 1WCKA 4H7MA 2WNUC 1QQP1 1X50A 2TUNA 2JJ6A 4AEKA 1W2UA 1CAVA 1HQLA 4FOWA 3VBRB 5C9AA 1YRZA 3J8F3 1PO23 3WP6A 4NHKA 4EN9B 2RS53 4XFGA 3AXDA 1QNWA 2C1FA 1RMU3 4HSLA 4IEOA 5KWRA 3PMSA 3KLSA 1W6PB 4G4FA 4XQ4A 4BMBA 5BNPC 1PVXA 1Y3TA 4EWEA 4Y24A 1SLIA 1GLHA 1XQNA 2R041 2A71A 5T5JA 4KU7A 4FBFA 1U5IA 1CGPA 2P3JA 1BVP1 1JTZX 2VOWA 4XMIA 2RS33 3MDPA 1PZ7A 4D94A 4FPFA 4WVZA 1UW8A 1NCQA 4C91A 3ZXDA 4YM3A 5I91A 1ZX5A 5K0UB 1AUYA 2QNKA 2ZGNA 1IOAA 1FAYA 1Q8PA 4HL0A 2YPJA 2PAEA 1AL23 1H9PA 1MS3A 4E2SA 3L9JT 3MFCA 2WSUA 1NLSA 3RPQA 2RM21 2JX9A 2WZR1 1XXNA 2GC1A 2DTYA 1XNCA 5JOZA 1WW6A 3ZMOA 1FV3A 3LB9A 1NLRA 2VU9A 3FBMA 4AQTA 1REEA 4EROA 1HQNA 4W65A 2PFWA 2RE9A 1KJLA 5JIAA 4LBQA 1BYHA 1DQ1A 1X7NA 4HN1A 3S7IA 4N90A 3KT7A 2QVSB 1S2KA 3O5SA 3POWA 1AYN2 1EPZA 2ZABA 2K9ZA 2GU9A 5SV5A 1HQWA 1DGWX 1L3JA 3BOWA 2WNEA 1Y7BA 3AYAA 1TE1B 4RS5B 3AB0A 1QJU3 2WZPP 1UD1A 1NQJA 1YCIA 2HEVF 3FBYA 2Q5TA 2FHRA 3NW4A 2R061 3J26N 4L99A 5JIUA 5A32A 1NCQC 2TBVA 2A3WA 3AMNA 2Z79A 2BGCA 4GKXA 3LSEA 4YZ4A 3WXPA 1QJX2 4QHBA 4LO8A 1V6NA 4PDWC 1ND3A 1A8MA 2BUKA 2Q4SA 3HT1A 3EBRA 5FLHA 5E16A 2Y26A 3MIDA 1OA4A 3LA3A 3ZN6A 2VMHA 4JGYA 3JBG3 1CPMA 5F1RA 4HZFA 3JUUA 2NP0A 1CVNA 1V6IA 3MPBA 2XJPA 4R4ZA 1IKQA 2I07B 4Q27A 2JE7A 4M3CE 5CFDB 2A6YA 4GULA 1A3KA 1R1A2 1RUE2 5GLUA 2C9AA 5CFCA 2WNUA 1HKDA 2RR13 2WFF1 5JOXA 4AF9A 2HWE2 3DPRB 4DINB 1RUF3 1X82A 3VDDB 3MGUA 4P9JA 4GMP1 3KGZA 3VZMA 1ZRRA 4QPYA 1H8TB 1DLLA 4XOGA 1JN2P 1S0CA 1NA1A 1GBGA 1S0BA 3KM5A 1DQ6A 2DCJA 3D5OA 4Q4V3 5BY5A 1WW5A 3VHNA 4Y20B 2DU0A 4AQSA 1YI9A 2RM23 5KHJA 3DPRA 3ZIXA 1DQ4A 1V6JA 4M0NA 4LLFA 3MW2A 3TRSB 5LRSA 1F5JA 2JG8C 4AFAA 4PIYA 4RA0A 3CEWA 3ENRA 3BIWE 1OSGA 2CY6A 3WQ7A 2DF7A 4AFBA 1VALA 5BYNA 4B4PA 3X29B 1A78A 3CJIA 4H3WA 1LOFA 1W6QA 1QH6A 1V9U2 1VAVA 3HBZA 4L11A 3TN92 3D8CA 1IKPA 1VBB2 4I3PA 2P3IA 1CJDA 4ZXKA 4CDQA 3SCHA 1O4TA 1GZ9A 1VBD1 3ZFGA 4AVSA 4B29A 2HWC1 2ES3A 3ZXJA 1XNDA 2JG8B 4QM9A 2FQPA 2GC3A 2AGSA 1EV11 1WUVA 1YFYA 1DQ0A 2UYAA 2VECA 3ZMNA 1C5IA 3ZSJA 3CJXA 4JQRA 3HWJA 2XWJB 2BPA2 2H6BA 5D8AA 4CDWB 3KQRA 1DZRA 5BUVA 2Y0OA 4JCKA 2TNFA 4JDMA 4RQPB 1AYN3 4BH9A 1HRV1 1DQ2A 2GALA 3AYCA 2R072 3C3VA 3LZZA 1ZREA 1Z7S3 1VRH3 4XJ8A 5L36A 1KRIA 5CA6A 3M70A 3WCSA 4FAGA 2W0XA 4BQ1A 5BXXA 1K5MA 2DFCA 2IXKA 3AKQA 1KJRA 4MX3A 4Q0VA 4XMAA 4I0AA 3WG2A 1N3OA 1RUF1 2D43A 4DOUA 1JUHA 5CVRA 3RS6A 4K1YA 1SCRA 4EN8B 4Z8BA 3AM2A 1CPNA 1BQPA 1TNFA 2NM1A 5CIRA 3BU7A 4Y22B 1MQTB 4DZGA 2ZKLA 1ZZ8A 2BYVE 4M3CA 1SDWA 1QOTA 4XHXA 3BCWA 1AXZA 3WQ1A 1PIV2 4ZU5A 2MPFA 1HRI3 1LEDA 3PVBB 4E4SA 3WW3A 4HKOA 2PYTA 5FQ0B 2ZGQA 1LGBA 2YMZA 4O9GA 1AR72 1OPMA 1DFQA 4A7KA 4QD2A 2XUMA 1HXS1 3ZFEC 2Y38A 4AGVA 3AMQA 4M3CF 5GLTA 3EO6A 4YZ5A 3KZ4C 5IT6A 3BOPA 1QJY2 2FZ2A 3B00A 5J36A 3LKJA 2DCZA 2IXIA 3B9IA 4FSJA 4BLIA 4Q0PA 1AR81 3SISA 3OY8B 4YW4A 1BJQA 1H0BA 3WHUA 1RUJ1 3AFKA 4DY5A 3B3QE 4MYEA 3MPPG 4R4XA 4J1XA 1RUH2 1ULCA 4YVSC 1TMF3 4C1WA 4JGYB 4C0HA 4UBHA 1GKBA 1T6GC 3I59B 4COWA 3VDDC 3B69A 1KFUL 2ZCWA 3GBFA 3B7MA 4IV3C 4GB32 3ZX7A 3FFZA 4BMEA 1ZBE1 2SLIA 2UWBA 1V00A 4COYA 1R082 3WW1A 1MS5A 3WLUA 4OZXA 2JICA 2OPKA 4QGMA 5FMOS 4I2OA 4XETA 1G9BA 1EAH2 1QQP3 1I1EA 2OUHA 1U5YA 2W39A 3VBOC 5AC93 1MVQA 5B2GB 1PO21 2XH6A 2ZHKA 1UX6A 2ZOEB 5L19A 2VOKA 3ZN6B 5JCTA 2HWE3 4Y5Z0 3VKMA 4R9AA 5JAXA 3VLBB 3VZNA 1EYBA 4Q4W2 3VBUB 4WM7B 4I0BA 2EF6A 1RVF2 3B93A 4YVWB 5KXBA 4JTOA 3VBSC 2GMEA 2SBAA 2EAKA 4AVAA 1OLRA 2D6OX 1AJOA 2RMU2 4AVTA 2R32A 2WQZC 1ULFA 1APNA 1KS5A 3GNEA 4M3CB 2P3KA 3DV8A 4RQPA 3WDXA 1CQ9A 1FOD1 3GALA 5JVVA 1CX4A 5KHIA 1UIJA 1TME2 4BHPA 4NR1A 4BA6A 2GMMA 2ZBJA 1HX6A 5T5PA 2VULA 1HXS2 3PHMA 4CZSA 1C8M2 4HKLA 1PVC3 4EWAA 3GF6A 3RJRA 3CF6E 1OOPC 1W6PA 1QY4A 2WSVA 1NE4A 3ZFEA 5JZGB 3VBOB 1PNGA 1K5MB 3OGJA 2R49A 5BNOC 4FP3A 4IV1C 1VBC3 3V0AA 4GWNA 4IEZA 1RUD1 1UPIA 3VBSA 4HMZA 5C4WB 4D7YA 1NXD1 2EAAA 5L73A 1C28A 2PHRA 3R4SA 3NAPA 4CDQC 2VQAA 4INDA 2ZX1A 4S2GA 4JDNA 3NV3A 2HKXA 3QH6A 2EXKA 2ZZQA 2PLV3 3KGLA 3VHRA 3JBG1 5HI0A 4Q4X1 4WZCA 3BTAA 4HVOA 3E6DA 2UWCA 3T2TA 2DUPA 3S30A 4MGYE 4AE2A 1Q8VA 4XBNA 4COUA 5CFDC 4LUMA 4AYUA 2DVDA 1RHI3 4H14A 4COZA 4Q1RA 2WL1A 3FFQA 2VW0A 2G4IA 5FOJB