1C1LA

Lactose-liganded congerin i
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
135
Chain Sequence
b'GGLQVKNFDFTVGKFLTVGGFINNSPQRFSVNVGESMNSLSLHLDHRFNYGADQNTIVMNSTLKGDNGWETEQRSTNFTLSAGQYFEITLSYDINKFYIDILDGPNLEFPNRYSKEFLPFLSLAGDARLTLVKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CONGERIN I)
publication title High-resolution structure of the conger eel galectin, congerin I, in lactose-liganded and ligand-free forms: emergence of a new structure class by accelerated evolution.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 32
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 1999-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c1lA00
2Z42A 3FLPA 3B69A 5IT6A 3R05A 4YM0A 3B9CA 1MACA 4AVSA 2PHWA 3ZXFA 4GKXA 3AZVA 4P9XA 1Q8SA 1S0IA 4AGRA 1JXNA 1KJLA 4M3CB 1FATA 1SLAA 4C1XA 2EXKA 3M1HA 1AX0A 1W6OA 3VKFC 5SV8A 4Y24A 2H0BA 4NO4A 1N3QA 3TB0A 1ZA4A 2DTWA 4FP2A 3NV4A 1ENSA 1N3OA 2R1DA 3WDUA 3AYEA 4K1ZA 3AP4A 1ULGA 1KJRA 3D5OA 1AX1A 2AREA 2EIGA 2NMNA 3ZSJA 3RMYA 2OUJA 2TEPA 4FOYA 5DG1A 1V6KA 4YZ4A 3M3CA 2D3RA 2A3WA 4XJ9A 3W59A 1FV2A 3RMXA 4UW3A 1DQ5A 4HANA 1G9AA 3OJBA 4PBOA 4FPJA 1MVQA 1MS4A 2R16A 4Y1ZA 4XIOA 3WG2A 3VKLA 3WG1A 4L8QA 3ZXEA 5DZFA 4FPYA 3POWA 1S0GA 2NZ9A 1URXA 2ZGKA 2ZAAA 4XHXA 3FLRA 2CY6A 2GNDA 1G9DA 3L2YA 4AVTA 1FNYA 1A8DA 4GWNA 1S0DA 1U0AA 1UKGA 1QOSA 1JN2P 4K1YA 4LBQD 3IN9A 1DFQA 1QKQA 1KDMA 1LGBA 3ATGA 5DG2A 3WDXA 3INAA 3LCPA 1FNZA 3I4IA 4M01A 2W39A 4YG6A 5GZFA 3D4KA 4RL7A 1HDKA 3NV1A 5GZEA 3QCWA 2XG3A 5T52A 1LHUA 4YM2A 1QOTA 1MVEA 2A6VA 4ISRA 1N1SA 1GBGA 1GZCA 2DUOA 5T55A 1G8WA 3ZYRA 5CNAA 2DWRA 1W6MB 3OBRA 4FOQA 3N7LA 1MZ5A 4K20A 4XE9A 3UL2A 1AXZA 1QU0A 2ZMKA 3OGGA 2CWSA 5GALA 3V0BA 2A3XA 4YLZA 2ZGRA 2DV9A 3N3HA 1ENQA 2ZGQA 4YW4A 4YGCA 3SITA 4ITCA 1Q8VA 2WSVA 5DUWA 4YW3A 4YGBA 1WW6A 3V64A 2UWAA 4Q26A 5E89A 5T5JA 1Q56A 2G4IA 4YW1A 5GZGA 5T5PA 3M3OA 3BOPA 3ENRA 3HR9A 3ILRA 5HCBA 1RITA 4WZFA 3V65A 2ZKNA 1C57A 4XJWA 2BQPA 3AYCA 4M00A 2P3KA 2ARBA 2VW2A 3LSDA 1IKQA 5FRAA 3C2UA 1AVBA 5JLVA 2CWMA 1SLCA 3MPPG 3O0XA 4LBLA 5CB7A 4R9BA 1SFYA 2EALA 1DQ2A 1PZ8A 1LULA 2D6PA 1KQRA 1W6OB 2Q5TA 3B01A 5DZGA 2HYKA 3O0VA 4JCKA 4P14A 3LSEA 3WLUA 3POYA 2P3JA 5BYNA 2D7FA 3A0NA 3WUCA 2ZA9A 1ONAA 2DU0A 1TEIA 2A7AA 1LGCA 1F5FA 2DTYA 1S0CA 2FMDA 3D6EA 4M3CE 4LBOA 1QDOA 4XBLA 2JDZA 4XMIA 2A70A 2VXRA 5HCFA 1O4YA 1Q8PA 3R4UA 3WZ1A 1LHVA 3IMNA 4BOWA 1MS1A 1GSLA 2UWBA 1S0FA 3SLIA 1ULFA 4FQ4A 2A6XA 2ZACA 2GNTA 4UW6A 4F83A 2GN3A 1PZ9A 1D2SA 2E53A 4ZXKA 1W0OA 4FP3A 1DLLA 1DBNA 1JUIA 2YROA 3IPVA 2UWCA 3OY8A 1UZZA 3WCRA 4P9YA 2JD4A 3PMEA 3R4SA 4YFWA 1GANA 1CJPA 1UAIA 3V0AA 4U2AA 4Y22A 4UW4A 1LTEA 4I30A 3ZYPA 2DUPA 4XXAA 5DUVA 4MYEA 4PCRA 4YGEA 1N1YA 1OKQA 1YRZA 1BZWA 2A71A 3AYAA 4TYSA 2A6YA 5IK5A 3HN1A 4U36A 1N47A 2GDFA 3OYWA 4Q8KA 3APBA 2RHPA 3JUUA 4DFSA 4BMEA 4XHBA 3W58A 3WV6A 1NLSA 2ZHKA 5T54A 2YY1A 1SCSA 5DUXA 3AK0A 1F9KA 4YZ5A 4XJ8A 5CBLA 2C9AA 3MW4A 1SLIA 1IS4A 3M3QA 4YW5A 2D3SA 2D44A 4FPKA 3FUOA 5L73A 4YZ2A 1GNHA 4YZ3A 2FHRA 4FPFA 5T50A 5DZEA 3WNXA 1ULCA 3MW2A 5EXOA 5CA6A 1YIFA 4ASMB 1KRIA 1AXKA 4YZ1A 1Q8QA 1DZQA 1QF3A 1WCSA 2A6WA 1I3HA 4XJAA 4AYUA 1WUVA 3HMYA 4LBQB 2C5DA 3AP7A 2DYCA 1W6NA 4XDQA 1DYPA 3AZYA 1IOAA 3O12A 4XXPA 4Q1PA 4Q8LA 1SLTA 5H9RA 1X50A 1SLLA 1MR5A 5JOZA 4WVVA 1VALA 2R0FA 4YM1A 5JMCA 3ZPYA 3IKWA 1LOGA 2ZGOA 5DUUA 1SCRA 4XJZA 1QNWA 3USUA 1F31A 5T5LA 1LHNA 1LU2A 2WNEA 3AZWA 1LEMA 2OVUA 4FPLA 3KM5A 2ARXA 2AYHA 2I2SA 4LBKA 5AVAA 2GMEA 1O4ZA 1C1FA 1LHOA 3AFKA 3SH3A 1QGLA 1D0HA 3PVOA 1DIWA 3M3EA 3TAYA 3FUQA 4JRAA 4RA0A 3WDTA 4ZKTB 2DU1A 1W6QA 2PHUA 1G9BA 3UJQA 2VU9A 4H55A 2YV8A 5GZCA 5JDBA 4XILA 4Y1XA 1Z78A 4LBNA 2ES3A 4AVVA 2VW1A 1VLNA 1UN1A 2ZGSA 3NV3A 1LGNA 5F5QA 4AGGA 3AJYA 2A6ZA 1HQLA 2CNAA 1ULDA 4D69A 1S0JA 1SLBA 4NOTA 4P9WA 1KDKA 4PF5A 3IPVB 1CQ9A 4M3CF 2ZGPA 3PJQA 2DUQA 1CESA 2E6VA 1V6MA 3CNAA 1WLWA 3PVEA 4Y22B 3V0AB 1IS3A 2WKKA 2W68A 2EAKA 1BKZA 1WBFA 3FLTA 3ZSMA 3ILNA 4FPHA 1N3PA 1GLHA 3BODA 3GALA 4FPCA 1XQNA 3UJOA 1UX6A 4DRVA 2WLQA 4XZPA 1R1ZA 2V73A 3FBYA 1WD3A 3AZXA 3T1MA 1LECA 4KBBA 4OZXA 1UMZA 3ZXJA 1OQ1A 1IKPA 5JOYA 5KXEA 3OYWB 5JVVA 2ERFA 3Q9OA 5GLUA 2A3YA 2GNBA 2ZHLA 1LESA 4ATFA 3U4XA 1SBFA 4CTEA 1YXWA 4HL0A 1ULEA 2PHRA 1HKDA 1H9WA 4FOVA 1AX2A 1YYNA 5HCAA 4FPGA 2DURA 2WJSA 1G9CA 3B00A 3POSA 1GZ9A 3N35A 2D6MA 2A75A 1G86A 3ASIA 1RINA 3PVNA 1GZWA 5E88A 2EF6A 5EWSA 3VV1A 3OBTA 3B3QE 1MS8A 1HQWA 2E51A 3JU9A 5IK4A 1ZM1A 5GLVA 2GN7A 4FOWA 3ILFA 1W0PA 2ZGTA 1I1EA 1G9FA 1V6NA 3O5SA 2AGSA 3ZXKA 1CVNA 3QLQA 3VUOA 1GNZA 1W6NB 4BMBA 5KXDA 4Z8BA 1JHNA 2EXHA 2YXSA 4BQ1A 4DRRA 1A78A 2V5YA 1UL9A 4XYXA 2R0HA 2VY0A 1AZDA 2WQZC 1WLDA 1LHWA 2CTVA 2KM2A 2XB6C 4PQ9A 5H9PA 2PHFA 1YO8A 1CN1A 1S0EA 3WDVA 2D43A 3DUIA 5H9SA 3WDYA 3USUB 1DQ1A 4R9CA 1IS5A 2ZGLA 2ZHNA 2CYFA 4Y20A 5FREA 2EXIA 3AYDA 4JC1A 4AGVA 3NWKA 4BPZA 1LCLA 1JYIA 1SBEA 1W6PA 1JW6A 4CRQA 1GKBA 1CR7A 1G7YA 2DVAA 1CIWA 3AX4A 4LBMA 3WDWA 3V0BB 3AXDA 5JOXA 1V00A 4TZDA 1DQ4A 1NXD1 4W65A 5KXBA 2WT0A 5KXCA 1LENA 1SBDA 2ZABA 3SNMA 4YW2A 4UW5A 4CZSA 1W6QB 5T5OA 1BJQA 1APNA 3T2TA 4YGDA 3VKMA 1HLCA 5GJ6A 4Y1YA 1JBCA 3ZXLA 4Q1RA 5IK8A 3MW3A 2ZGUA 5F9TA 5GLZA 1UPSA 2GMMA 2DVGA 4BLJA 2JE9A 3OPZA 3VKNA 1LU1A 1FYUA 4BM8A 2UU8A 1MS9A 3AP6A 1AXYA 2GALA 3I8TA 1DYKA 1LOEA 1AF9A 5E8AA 3WG4A 1QOOA 1A3KA 1WW4A 1N1VA 2JECA 3A4UA 1UZYA 1AJOA 2E7QA 2DVDA 1YI7A 3M2MA 1C4RA 1LODA 3SH5A 3WUDA 1Y7BA 3FFZA 2AENA 2ZZJA 2W52A 3SISA 1FV3A 2JJ6A 3N7KA 4R9AA 2WSUA 4WVWA 4XIKA 2GNMA 3IM0A 3RQ0A 2R49A 1S1AA 2ZGNA 1WLCA 3N7MA 3NV2A 4R9DA 4M3CA 1DHKB 1DQ6A 3SH4A 4DPNA 4FPOB 2VH9A 2SLIA 3WVJA 4DQAA 4FQZA 4XOGA 1KITA 3O0WA 1V6LA 1MS0A 2UURA 4IQPA 1VAVA 4Y1VA 4SLIA 2R1BA 1VIWB 3ZSLA 1LOCA 1Z0HA 2A5ZA 5JOWA 1FX5A 2AH2A 2ZHMA 1MS3A 3KQRA 2PHXA 4GXLA 4PBPA 3RG0A 1GZWB 2YMZA 1WBLA 2VUAA 1V6JA 1WW7A 2LTNA 2OUHA 3AP9A 3AZZA 1MS5A 3T1LA 4DS0A 5EYXA 1Q8OA 2P34A 4WV8A 1H9PA 1V6IA 4YG3A 2D3PA 2VW0A 3OY8B 4BLIA 1RIRA 2SBAA 2D6LX 1B09A 2D6NA 2ZMLA 4GKYA 2ZBJA 4XJUA 1EPWA 4YM3A 5GZDA 3A0KA 3AP5A 2PHTA 1GV9A 5H9QA 1GICA 5LK5A 3AJZA 1QDCA 2B7YA 2E7TA 3DGTA 3N36A 5CAZA 1FAYA 1LOAA 1WD4A 4K21A 1JOJA 1H30A 2OW4A 2D6OX 1S0BA 4AWDA 1OFSA 2DVFA 3BIWE 4XMAA 4XTMA 3UK9A 3GNEA 4LBQA 1V6OA 4GA9A 4Y20B 2ZMNA 1DGLA 3WHUA 2YZ4A 1LJ7A 3RSJA 1LOFA 1QMJA 1WW5A 2CL2A 3WCSA 4GWMA 1MZ6A 1LOBA 3H0OA 5IUQA 1W6PB 1SACA 2EXJA 2GMPA 3N7JA 3ZSKA 4C1WA 1N1TA 3ZVXA 1CPNA 2P3IA 3RRDA 4YFZA 2NYYA 3AXEA 3VKOA 3WHTA 1BQPA 4XBQA 2PELA 1LOFC 1ENRA 1BYHA 4FPEA 1AJKA 2JKBA 2NMOA 2NP0A 2WT2A 2LALA 1VAMA 4Q2FA 2JE7A 1J1TA 2NN8A 1CPMA 4GALA 4YG0A 2AR6A 2NM1A 4Y26A 1W6MA 1GYKA 5DXDA 2ZGMA 3RS6A 4LBJA 1LEDA 2D6KA 2P2KA 1BXHA 2W08A 4Q27A 1IS6A 4ISQA 1C1LA 1JYCA 4XTPA 5GLTA 2P37A 5GM0A 4Y1UA 5IK7A 1QNYA 4XBNA 3WG3A 3MEPA 4ATEA 3BTAA 2AUYA 5GLWA 3WOGA 4FVVA 2DVBA 2ENRA 1PZ7A 5EYYA 1DQ0A 2WT1A 1CONA
chains in the Genus database with same CATH superfamily
5C7GA 3FLPA 1ASJ2 2GAUA 2R072 1PIV1 3UGHA 5FXVA 4YM0A 4B7KA 2WLPA 2PHWA 4MV2A 1EAH3 3VBOA 2Z2SB 3AZVA 4P9XA 4OHVA 5SV5A 1X8MA 2ZX0A 4CXYA 1SLAA 4XAEA 5BNOC 4JDOA 3M1HA 5ACA1 1W6OA 4EYUA 4YVWC 3RFRA 4HVQA 3C7GA 5DAVA 4Y24A 3T2PA 2H0BA 1N3QA 2BU9A 2VAUA 2DTWA 3IZOA 4O61A 1T6GC 3RWKX 1ENSA 2RS51 3ZXDA 3ZFEB 4K1ZA 1T2XA 1ULGA 3GBFA 4K6BA 2O14A 3D5OA 2VZPA 1AX1A 2AREA 3ZR5A 4Z1VA 1POV0 3RMYA 3ZSJA 4XQWA 5FZFA 2OUJA 1YJLA 1AR93 4YZ4A 4QDRA 1ST8A 2D3RA 2A3WA 3W59A 5FZ0A 4CP0A 3RMXA 2DF7A 2WFPA 1DQ5A 2XWBB 5BNPB 3DL3A 1MVQA 1MS4A 2LW8A 4DZGA 5G04L 4BHPA 4ZS3A 3T09A 2W5FA 3OUJA 3H8UA 3WNPA 3G6JB 3POWA 2HWC1 1CD3G 2PMWB 4XHXA 2ZAAA 3FLRA 2GNDA 1AUYA 1FNYA 2E7AA 3KCCA 2VBPA 1YIPA 4HVRA 1U0AA 1OVPA 1UKGA 1QOSA 4YVSA 1JN2P 5LBFA 1DDLA 4KH9A 1CX1A 1ACCA 1BMV1 1QKQA 1LGBA 3LZZA 1ALYA 3WDXA 3INAA 4M01A 3Q8CA 4AFAA 2W39A 1FOD2 3KGZA 4RGKA 5TSWA 3O1UA 1W9YA 3WQ0A 3MI8A 2D93A 3O14A 1W03A 1XXNA 1RUC3 2KD7A 2XG3A 4XUQA 2VQTA 4YM2A 4URAA 1UY0A 3WX5A 3ZN4A 4CA9A 3QBQA 4QPIC 1N1SA 4AEDC 1GBGA 3FX3A 4UOJA 4LA2A 2DUOA 3KV4A 2P4EA 4QKFA 1NLQA 1MZ5A 3OGGA 3H7JA 1QJU3 4YLZA 1BBT2 2ZGRA 3LPFA 3EYPA 3OEBA 3C7OA 2LS6A 3WF3A 1HRI2 4QPGB 1JH5A 1ZRDA 3TRSB 4ITCA 4I3GA 1RUJ3 4OUEA 2WAOA 1Q8VA 5DUWA 3JD73 1F35A 1CAWB 1HXS1 1OA2A 1W3VA 4Q26A 1Q56A 3THCA 4YW1A 5T5PA 3CJIB 3LAGA 4QQHA 5JXIA 2ET7A 1CJDA 1EV13 1YQ8A 1ODNA 2MEV1 2ZKNA 4GZ9A 4LORA 4DMIA 2P3KA 5JXJA 1X36A 1UZVA 2QQNA 5FRAA 4IXLA 1EUTA 5JLVA 1GOGA 2CWMA 3MPPG 3OUIA 4IV3C 3TBDA 4AR2A 1BEV1 1SFYA 4XFAA 4Y5SA 4IEWA 3POJA 2Q5TA 1KQRA 1TMF2 1W90A 3DYPA 3B01A 4RR3B 3GHNA 1FPN1 2O1QA 2W92A 4Q4X2 2HYKA 3H3LA 4WZCA 4AAPA 5IVYA 1Q43A 4QD2A 1WCUA 2XXZA 2Y26A 5JSRA 2P3JA 4V1PA 5C9AC 2A7AA 4M3CE 1S0CA 5C71A 4URTA 3NNJA 4EJRA 2JDZA 2R7EB 1AR73 5FYYA 5KHHA 1XOYA 1O4YA 1Q8PA 1R1A1 3PNAA 3R4UA 4OYUA 1RC6A 1MS1A 1YFUA 3BYWA 4IUGA 1GSLA 2LUWA 4FO9A 1OH4A 2RVAA 4JHTA 5DMYA 1V9U2 3RZKA 3SLIA 3GCXA 4FQ4A 1OPMA 2PHLA 3BPSA 3NAPC 2FZ2A 2GN3A 1UMHA 2WRAA 3VBHB 1W0OA 4MXWA 1DBNA 4WM7B 2YROA 1K5MC 1DG6A 2HWB2 1O4TA 1KEXA 3OY8A 5F5IA 3WCRA 2L9LA 2JD4A 2WNUA 3PMEA 4QB2A 3I2DA 1RGSA 1RHI3 5LCWL 1PM4A 2AEZA 3W9AA 2DUPA 2P6CA 4AEKA 3AKSA 1AR83 3VZOA 5A6ZA 1VB4A 4X6QB 5FCCA 5A33A 2EIEA 4TYSA 1POV1 1CONA 3K4DA 3RZGA 4A2UA 5IK5A 3FC0A 3WW4A 5JIUA 1N47A 3T0AA 1VRH1 3OYWA 4Q8KA 1J3PA 4Z82A 5FZIA 1UIJA 1SPPA 1RVF2 1VBB2 2GSYA 3APBA 3JUUA 5A6QA 4LA3A 4CCNA 4RGGA 1VMFA 1GQHA 3W58A 3WV6A 3OB8A 2YY1A 1SCSA 3PMSA 3SCFA 4AI1A 2VZVA 1VBA3 1XNTA 3MW4A 4GMP3 4LKDA 3BPZA 1IS4A 3M3QA 4YW5A 4Q4Y3 2D3SA 2OZ6A 1D4M1 4YZ3A 1S2BA 4FPFA 1XYOA 3JQWA 3KCXA 4TN7A 1ULCA 4KWUA 2ZPXA 3J4UH 5CA6A 1VBE1 4CDWC 1O3TA 1Z7S1 2A6WA 1O91A 3LA7A 1O3QA 5FMDA 3NKTA 2XJVA 4LHNA 4LKSA 1YQ5A 3S7IA 3E1F1 3MYXA 1W6NA 3ZN6A 4AAXA 1H4HA 2FCTA 5I8SA 5LEJA 1YFWA 3SC7X 4Q8LA 4AQTA 5C8CA 1O5UA 1X50A 3U0ZA 1NY71 1VALA 3J7HA 2BDRA 4A45A 2CAUA 4RQPA 4YM1A 5JZGA 4D6SA 2VPVA 2ZGOA 5DUUA 1Y3TA 5JPMB 2PLV1 2R073 1F31A 5T5LA 1LHNA 2WNEA 3AZWA 2OVUA 4FPLA 1WA4A 3K4AA 4B4PA 2WWJA 5LY1A 5AVAA 5A7WB 1YQCA 4JGZC 4P9GA 3DYOA 3LKJA 3VDDC 3M3EA 3FUQA 4HXCA 3NJYA 4IEYA 2WFF3 1UWWA 5FK8A 1XYNA 2DU1A 2XJQA 4HK8A 2GU9A 2YV8A 5GZCA 3VBFA 1DCSA 1NCQC 2VO5A 4PI0A 5HPOA 1H2LA 4AVVA 5C3QA 1UN1A 2ZGSA 5C3RA 1QHDA 3DF0A 1ULDA 1RUG1 2KR2A 2GP5A 3GZAA 5BNOB 2AC1A 2IVJA 5C4WC 1JZ8A 5FMBA 3BUCA 1KDKA 3L2HA 2FDHA 3LB9A 4BK5A 2J7MA 2RS31 4YVWB 2PAMA 4LNVA 3S7EA 3UYJA 1ZZBA 3N9PA 4ZHNA 4LK6A 4LXLA 2ZEXA 4Y22B 5JR2A 1IS3A 1LAJA 2GP3A 5F3IA 1JYVA 3ZR6A 3HOBA 5LW9A 2J1UA 3MF6A 2BJSA 4FPHA 3GALA 4Z8BA 1WGPA 3UJOA 1XNCA 3CQOA 5FPXA 2JICA 2WLQA 1UOFA 4XFHA 2CAVA 1R081 2KA3A 4JX0A 3SEPA 4AHWA 4NVPA 3I3QA 2TUNA 1XE7A 4IERA 3WNLA 3KF3A 5JVVA 4ATFA 2ERFA 4XQDA 4JGYA 1SBFA 4W50A 4CP9B 4CTEA 1AYN1 1ULEA 4E8CA 1COV1 1GZTA 3NMBA 1ZZ9A 1Y9QA 1GOHA 2Y0IA 1YYNA 4XF9A 2Q30A 2ZJCA 1OMIA 5FPLA 4A7KA 4FPGA 1ZRCA 4YARA 3HNMA 1R64A 5CKQA 3N35A 3S57A 1O5LA 1NCRC 1W06A 5JSPA 3DKWA 2Q4SA 2A75A 3MIBA 3ASIA 3PVNA 3VV1A 1GZWA 4FAHA 1XBFA 5C3OA 5L19A 5K0UC 5JPNB 2E51A 5KHJA 3KLSA 4AW7A 1ZM1A 1UXZA 1AYM3 2VJXA 1J1LA 2YBKA 3TN92 2XLFA 1BBT3 1V6NA 3O5SA 2AGSA 4PDWB 5ISLA 4BQXA 3ZXKA 1CVNA 1HRI3 3QLQA 2WO2A 2NLRA 1S4CA 2GC1A 1JHNA 2BBAA 4QPIB 4LK7A 2EXHA 4RS5C 4AEDB 4QHOA 4BQ1A 3BU0A 2HWE1 4CEYC 4HSLA 4Q4V2 1W8NA 2RMU1 4UBHA 5BNNC 1RUD2 4Q5OA 2XB6C 3H1WA 4IEQA 5L7OA 1YO8A 1CN1A 1S0EA 1UY4A 4XFGA 4AI0A 2VZTA 5H9SA 3WDYA 4WM8C 5FREA 4MHRA 4NRMA 1DP0A 2XJUA 4I09A 2WYSA 1SBEA 4I01A 1SFPA 4CRQA 1GKBA 2ZAHA 4FTEA 1G7YA 1CIWA 3V0BB 5E16A 3AXDA 1W2TA 1DQ4A 3DV8A 2YBSA 2WT0A 5FMCA 1TMF3 1LENA 1OI6A 1SBDA 5LBCA 2WA4A 4IL7A 4AQ6A 4C91A 5KR7A 4N9IA 2ZOEB 3SNMA 4Q4X3 5ACA2 2X10A 1H1IA 1W05A 2W95A 3IDEA 3I49A 1W6QB 1PX3A 4IV1C 4GWJA 2BBVA 1UKRA 3T2TA 4A6SA 1GQGA 4YGDA 5FYBA 5EZWA 2RS52 4K7JA 4Q1RA 2Z69A 5F9TA 4OI0A 4IV3B 4BLJA 5JIAA 3A23A 1FYUA 4EE2A 5FPAA 3PTRB 4Z92B 1MS9A 4E4HA 1AXYA 1U5YA 2GALA 3I8TA 1UMIA 2Y6GA 3I2GA 1LOEA 2ZX3A 1CAVA 1V9U3 1F8VA 1YWKA 3EQEA 4UBGA 3MPBA 2JECA 3VD5A 3J7MA 3NW4A 3IMMA 3P3PA 4AVBA 1L7QA 3WW1A 1DF0A 2PAEA 5C9AB 2ZZJA 4TLGA 3POBA 2JJ6A 4YRDA 2BYVE 1QH6A 2IFWA 4G9SB 2WSUA 2HWC2 5DQ0A 4NIDA 4IW3A 3F95A 1WLCA 2OPKA 3N7MA 4LKEA 1RXFA 4NN0A 3NV2A 5HXVA 4CP1A 4Z2WA 1DHKB 1QEXA 1ZYBA 5APAA 3SH4A 5C6CA 1RUNA 2VH9A 3WVJA 1XE8A 1ZBE3 3NAPB 4DQAA 1KD7A 3B9IA 1HJGA 4EZ4A 3VD4A 1UD1A 1HB2A 1MS0A 2YFUA 1HX6A 4IQPA 5FYSA 3MLLA 3TYJA 1HN1A 4OHXA 4B3NA 2A5ZA 1W9TA 1XPWA 1FX5A 1GUIA 1K5MB 2AH2A 2CU5A 2OPWA 4GXLA 4R8HA 3RG0A 2YMZA 4XQ4A 1WW7A 1VBC3 2LTNA 3LOIA 3WF2A 1H8TA 5AC93 5FO7B 1WCQA 2WIIB 1XYPA 3WQ7A 3PU3A 4AFMA 1PK6C 2VW0A 3ZFFA 5FZAA 4ZONA 2SBAA 2WWUA 4JDNA 2D6NA 3MV11 4COVA 1STMA 4R52A 3R0RA 4FTBA 2VNRA 3M7AA 2WYFA 3PJYA 4J6GA 3O1TA 5K7PA 3OBAA 4PT6A 2V72A 2XVGA 5C8WA 1QWRA 4K21A 4AXOA 2OW4A 5BNPC 3BCWA 2Y34A 3BIWE 4MADA 5FO9B 1HXS2 1VR3A 4LLOA 4XTMA 3ES4A 1H8VA 5CADA 1V6OA 4Y20B 2ZMNA 2XOMA 4LO6B 2WS92 2WZEA 2YZ4A 3MLJA 4DXZA 2X05A 1LOFA 4HN0A 1DGRA 4GWMA 2JDMA 4Q0SA 1XU2A 1W6PB 1QJZA 1SACA 2ILMA 2J1VA 2MEV2 3MIEA 3NKGA 1RUI1 4C1WA 1OA3A 4CUCA 1CPNA 2P3IA 3VL9A 4MGKE 3ON7A 2UY9A 1NA1C 3EBRA 4CDWB 4DXSA 3RYKA 3HQRA 3AMPA 1ENRA 1BEV2 2QQLA 3DEMA 3TEWA 3LIHA 4HG6B 2XPJA 5FZOA 3PUQA 4HMZA 1ENXA 3RZZA 4CDXC 3USSA 4IEXA 1CPMA 2BNNA 1RUOA 1FPN2 2BTVC 1RL3A 4Y26A 1IHMA 1YC61 2VR4A 2YYOA 4N43B 4XFCA 5DXDA 1UYPA 1OOPC 5BV6A 3SKVA 1W3XA 5FZMA 5FYMA 3CZJA 4META 4B8EA 1JYCA 2K0GA 5GLTA 5C3PA 1RUF1 1R1A2 4CYDA 3A22A 1QNYA 2PQSA 1SFNA 3CHXA 3AMMA 3BTAA 4ATEA 2CGOA 2QZ3A 3K3OA 4P9JA 2VM9A 3CKHA 5EYYA 4QM9A 3O1VA 3ZO0B 2Z42A 2P6HA 4JGZB 2E26A 4DNYA 5BNOA 3R05A 2BEOA 3VDDB 1L3JA 2VOXA 4BIFA 5IJRA 4QX0A 2GH2A 4CDQA 4YWAA 1JXNA 2DCJA 2WO3A 1KJLA 2F4LA 3IAPA 3CMGA 4WBBA 3RVHA 3WP5A 5F7UA 1JYXA 2IZWA 3E5XA 3CJIC 2X09A 2EXKA 5DDJ1 4BIOA 1AX0A 3U10A 3VKFC 1P8JA 2VOVA 2WNVB 4NO4A 1ZA4A 3J8F1 2BNMA 3NV4A 1N3OA 3SMHA 3WDUA 1PNFA 1JYTA 3AP4A 1W9WA 5LZ6A 1BVVA 3OOXA 4L92A 2H6CA 5HXMA 4RR3C 1YFXA 2OZJA 4CP9A 3I3MA 5BNNB 1QJY1 1W9FA 5FV3A 2TEPA 2Q8DA 2DFCA 2XHKA 3M3CA 4QWNA 5A1AA 1FV2A 3RDIA 4UW3A 1NE4A 4HANA 2RR11 2VMHA 4XF1A 4FPJA 1RUE3 4XIOA 2QDNA 3AVRA 3WG1A 3NVCA 4L8QA 3ZSEA 5E1RA 4NIIA 1B35C 2W91A 3P6BA 1H4GA 4MGQA 1S0GA 5FY4A 4AHXA 1VBE2 4IE7A 4ASLA 4P5YA 1Z7S2 4GB31 1GWLA 2BNOA 4K1YA 5J48A 4NWWA 1DFQA 4WVZA 3VBHC 2RV9A 3DXTA 3ATGA 3GZEA 5K8SA 1NCRB 2FDFA 3LCPA 2QDRA 1Y9GA 3I4IA 4WM7C 3HNBM 4EV0A 5A80A 4AK3A 3NV1A 4A44A 4LIUA 2ZX1A 4HETA 5GZEA 1AL21 3I3EA 5K0UB 2Y6JA 4BJ0A 2VXJA 5FMOS 1LHUA 5FBZA 1NY72 2IXJA 2A6VA 5F39A 2BFUS 4CU9A 4FAGA 2PLV2 3O1RA 2XBO3 3B02A 5T55A 1O8SA 1W6MB 3WP3A 4MXVA 4RS5B 5FYIA 4PIYA 2ZMKA 1QJX1 4CEYB 2RE9A 5GALA 3V0BA 4KI5M 4UXAA 2ZEZA 3LFMA 4RD7A 3ACIA 4AQ2A 2DV9A 4YPJA 2JXAA 4CUAA 4DO0A 4CVUA 4EWEA 3GYDA 3TNPB 5ACA3 1OPOA 3KHBA 4NWVA 3SITA 1GQPA 4WM8B 1RJ8A 3I2JA 5EQUA 1UOJA 1JOBA 3VBUB 4CCJA 3DCQA 1WW6A 1QXPA 2UWAA 2WA3A 3IBMA 4QU1A 4E9KA 5T5JA 2G4IA 5GZGA 3N9NA 2FMYA 1YLLA 2WZR1 3KT4A 3M3OA 2W1QA 3ACLA 3ENRA 4ZY9A 1JZ5A 4FFGA 1RUG2 5A32A 2W46A 4XJWA 5F37A 2BQPA 3AYCA 4X8NA 2VW2A 2X5IC 3LSDA 2RS32 3WP6A 2YC0A 2V5DA 1O8PA 2PTMA 1SLCA 4CDUA 4K8FA 4R9BA 1SZBA 5IFTA 2EALA 1DQ2A 1LULA 1QJFA 1QH7A 1IPJA 3C7EA 3I2IA 4D6RA 2PAKA 3OUHA 4QM8A 4BB3A 1LKNA 4L0PA 2HWC3 1L7LA 4P14A 4Y4YA 1RUH1 2OIIA 1R082 4UFHA 2CGPA 2D7FA 3WUCA 4Y3OA 2ZA9A 1K5JA 1LGCA 1F5FA 2JG9B 1QDOA 4XMIA 3NAPA 1AYN2 1COV2 3I2OA 1OFNA 1PM7A 4GD4A 3SEEA 3WZ1A 4BOWA 3WNKA 3MHZA 5C3SA 3ZYHA 1S0FA 3SCHA 4LHSA 4XEZA 4XC9A 3NJXA 3JQXA 4O65A 4EROA 1PO11 4EQVA 5B2GB 1HB1A 2A6XA 2GNTA 4UW6A 4CPBD 2XDVA 2XLAA 1ZVFA 4LE3A 4MLOA 1ZRIA 1UCXA 1DLLA 5J37A 1F5JA 3U4SA 2VVDA 4Q4W1 1YI9A 1PVC3 2E63A 5KHKA 3Q8FA 4N8MA 4BQ4A 5JI9A 1VP6A 1QQP1 2OA2A 1I5PA 3ECQA 3V0AA 2WZ8A 1F15A 2DCYA 5EJ1B 1Q3EA 4XXAA 4CEWC 1RJ7A 2RM21 3OGRA 3EB7A 4NUBA 3ME2A 4MYEA 2HWE2 3PIJA 4XETA 2JDNA 1PK6B 2RMU2 3AC0A 2D5FA 4BQ3A 1JODA 5IWFA 2A6YA 5FP3A 3LQCA 5DAPA 4LE4A 1PO21 2WS93 4MG2A 2RDSA 2GDFA 3DXUA 3FBMA 2HBUA 3VHRA 5FXZA 2XR4A 4CU6A 5FBJA 2QVSB 4S2GA 3CU7A 5LBEA 1W2OA 1KGYA 5F6KA 2VVFA 1NLSA 3KMHA 2ZHKA 1R091 2JDKA 3AK0A 4QQ2A 1RMU1 2WL1A 5CBLA 2WDBA 5EJ3A 1GOFA 1SLIA 2JKXA 4XFFA 2WZPP 5FLIA 3C3VA 1XNBA 4FPKA 3N9LA 5FK7A 1FPN3 3U78A 4YZ2A 2FHRA 4P5HA 5T50A 2YDEA 4IEUA 4ASMB 1AXKA 2W1SA 4YZ1A 1WCSA 1JZ6A 4XJAA 1ZBA2 2EIBA 1WUVA 3HMYA 3LIGA 1NA1B 1NLRA 2DYCA 4NHXA 4K3UA 3AZYA 3ZYJB 2OQ6A 4CDXB 5H9RA 3OCPA 1SLTA 1MR5A 1JS9A 4LR4A 4PDWC 3J9SA 5FR3A 4H7MA 4KGGA 5FO8B 5JMCA 1LOGA 1OOPB 2Q8EA 2VQUA 3J7NA 3AB0A 2IUWA 4KWKA 5FY5A 5CYYA 3POEA 1LU2A 1LEMA 3ELNA 3S6PA 3VDDA 3VZLA 2V4AA 3NL1A 4KGQA 3U14A 3CF6E 5AVPA 4AVCA 4LOTA 2GMEA 1O4ZA 1OURA 5FZHA 4EN7B 4E4ZA 2WNOA 1ND2C 3PTYA 5FJHA 3SH3A 5I0SA 1QGLA 2FCUA 4MSVA 1C8M3 2HEVF 5LB6A 1NCQA 4PLNA 3HQUA 3MIGA 4AOCA 1S2EA 3PIGA 3QD6A 3GCWA 3PUAA 1W8HA 2B45X 3V56A 3NSTA 3WDTA 4CUGA 1HRV1 4Q0VA 4ZKTB 2PHUA 4MGIE 1OQDA 3OD4A 5C4WA 3S30A 3UJQA 4AI9A 1POV3 4BQ2A 5JDBA 1U12A 1SDWA 2J1TA 1Z78A 3I59B 2HWF3 2ES3A 4LBNA 4Y1XA 5T3NA 3VBRC 2V09A 4DIQA 3NV3A 1MQTA 4AGGA 4E2GA 3IIAA 3ZKYA 1HQLA 2CNAA 4D69A 4CCOA 3LDKA 4DUXA 4QHZA 4P9WA 1EAH1 1JI6A 3IPVB 1QJEA 3VN4A 3PJQA 5FUPA 3D8CA 2E6VA 3KV9A 5FP9A 2VZQA 1NG0A 1REFA 5J36A 3UGFA 3H3UA 5BUVA 4GQ7A 1BKZA 1WBFA 2VBBA 4UFJA 3ZSMA 3ILNA 5FQ0A 1GLHA 3CBNA 1O3RA 1R1ZA 3FBYA 1VBE3 2VD7A 1WD3A 3AZXA 4LQRA 2R32A 4KBBA 3MF9A 4XABA 1Z7S3 2YU1A 3T1MA 2HH9A 1HV0A 4NR1A 4Q0QA 4DUVA 3WF1A 4XDOA 3MBWA 1NCRA 1WWYA 4CXXA 4DY5A 4L97A 1HKDA 1AR91 4DUWA 1H9WA 1AX2A 3D3AA 4I3PA 1NZIA 1RUI2 4HPKB 1B35B 2W47A 2Y64A 2NQYA 3ITQA 2DURA 2VVEA 2WJSA 4IDZA 3B00A 3THTA 4D7YA 1GZ9A 1MEC3 2XH6A 1RTVA 1G86A 3HVDA 4DEQA 4BDVB 1ZZ8A 2YG0A 1J59A 4TSVA 2EIDA 2W2IA 4GMP0 2WO1A 3OPTA 4RHV2 5FYVA 3FN9A 2QQOA 1VRBA 4RS5A 4FOWA 5FUIA 5CVRA 1US3A 4JVAA 2ZGTA 4CEYA 1G9FA 1JU3A 4OMCA 4OVEA 1S2KA 1E5RA 5L9RA 4AHYA 2Y6FA 3LOBA 2HEWF 5J3UA 2BERA 2YPDA 5KXDA 3LFIA 3MV01 3PU8A 1J3RA 1VB2A 5FYHA 1UL9A 2B5HA 2VY0A 1REDA 1RUF2 1RUC1 4FFHA 5FOJB 3C7HA 3N4MA 1IG0A 1WLDA 1LHWA 2KM2A 2WO7A 4PQ9A 5H9PA 2PHFA 2PXJA 3BOWA 1NUKA 2WABA 2D43A 3B5LB 1CZVA 2ZX2A 3USUB 3LD8A 4R9CA 4BXSV 2ZGLA 2CYFA 1RUG3 4Y5Z0 2EXIA 4AHZA 3AYDA 3HT2A 4AGVA 4UF0B 1UZ0A 4M4PA 3E5QA 3U07A 4D3WA 4D7TA 5KBFA 1OVSA 3NNFA 3AMQA 2RS33 1JW6A 4WVMB 3AX4A 1IPKA 2VMFA 4QXCA 4IV1A 2HLEA 2R063 1V00A 5D2AA 1OHFA 4LKFA 2VGDA 4YNIA 3WP4A 3CL1A 1S55A 5KXBA 4BQ5A 5KXCA 1PMJX 2IVIB 4W6XA 4NIGA 2R042 5DDJ2 2ZABA 5FKBA 1W28A 1POQA 4UW5A 2YPJA 3WNMA 2VZ3A 4IGOA 4H7LA 3BTYA 4NPMA 5FPVA 5T5OA 1TZOA 3JD71 1I6XA 3J8F2 3NQHA 1R083 3VKMA 3RWNA 1TNRA 5FZDA 2X5IB 4IE4A 5CFDA 5CG8A 5IK8A 4CCLA 2ZGUA 1UPSA 2OS2A 2BGPA 5F32A 2DVGA 1MPXA 1EV11 5CISA 2BV4A 4BM8A 3U1XA 2UU8A 1W2AX 4HKLA 1NQJA 2VZOA 4HN1A 4QXKA 4BISA 4N43C 3PLQA 1GWKA 1DYKA 4NIAA 5E8AA 2RR12 4AVAA 1WLTA 1AJOA 2E7QA 1TNFA 2DVDA 3SXWA 3KZ4C 3I2HA 4XUPA 4LMFA 1LODA 1ASJ3 1BK1A 3ZXGA 1T6BX 1Y7BA 3FFZA 2AENA 4IEPA 1FV3A 5FOBB 3GGLA 4WVWA 2ZKLA 4XIKA 3RQ0A 2R49A 1S1AA 3LA2A 4GB32 4R9DA 4OI2A 4AFBA 3GZUC 4DPNA 4PF1A 1TME2 1AR71 1TE1B 2QUOA 3OGVA 3OGJA 1KITA 1WMEA 1UPIA 2RMU3 4YVSC 3VLBB 1ZZ7A 2VUCA 3AKRA 3POIA 4JTNA 1AL22 2Y6LA 2YC4A 1W8TA 4SLIA 4EN9B 2VNVA 3ZFEA 4QAWA 3M3IA 1MS3A 2XQRA 3KQRA 4H3WA 4JZRA 4EN0A 2ATFA 1H2NA 4PIZA 2XHNA 1KS5A 3HD8B 3P3NA 2VNGA 5EYXA 1Q8OA 1W8ZA 4W6YA 1H9PA 1V6IA 2WNVC 1IG3A 4WV8A 3WW3A 5BY5A 4CEWB 3K46A 2EICA 3KCYA 4BLIA 1RIRA 5ABJC 2D6LX 1RHI1 3N9QA 4GKYA 3RZMA 2ZBJA 1EPWA 4XUNA 5FWEA 4ZU7A 5GZDA 5BNPA 5EFUA 3H8OA 3LPGA 4I02A 4A3ZA 1GICA 1EYBA 2WN2A 4BH9A 5JXHA 1AR81 1QDCA 3URFA 3ZIXA 3N36A 4XW3A 4XVHA 4IE5A 2HJIA 1ZBA3 1E57A 3GBWA 2JEMA 1ODMA 2J1RA 3I7DA 4IEOA 2YGLA 3CO2A 4AL9A 1NA1A 3W5MA 4ZS2A 4MH0E 1LJ7A 1WW5A 1QMJA 2WZR2 2CL2A 4S2HA 2VMCA 3H0OA 1FOD3 5IUQA 3ZSKA 2EXJA 1A6CA 4CDXA 2DCKA 4NMIA 3H8RA 3RRDA 4YFZA 5A6XA 3WHTA 3D82A 4GMP1 4UI9L 3VHOA 3DPRB 1C8NA 1OOPA 3W20A 3QH6A 2JKBA 2W3JA 2NMOA 3UKTA 1L7RA 2WT2A 2NN8A 2WBKA 5IVFA 1SDDB 4YG0A 2XLGA 4GALA 4BA6A 1CAUB 4ZZ5A 2YFZA 4A42A 1X9PA 1GYKA 4IESA 2ZGMA 4P08A 2QNKA 1VE0A 4I0AA 2FDJA 1BXHA 4Q27A 1IS6A 1HV1A 3WNOA 4QPGA 3WQ1A 1C1LA 3TNQA 5C5TA 2EA7A 1AR61 1ZZCA 2AACA 1UY3A 2P1BA 3ALQA 5FP4A 3S0MA 1M06G 4Y1UA 2JD9A 3MEPA 4JQTA 4FVVA 1JUHA 3JBG2 2DVBA 2ENRA 3I59A 1CAWA 1DGWA 5JUVA 5B4NA 5JSOA 1PO12 1ND2B 5FZ8A 3WXPA 5FZ4A 1Y43B 3B69A 3CJIA 3FZ3A 5JR7B 1SG3A 3VBUC 5IT6A 3B9CA 4MVTA 4AVSA 2J22A 3ZXFA 1PIV2 2JG8B 5LATA 3RYRA 2BPA2 4CCMA 4AGRA 1OT5A 1S0IA 3BN6A 2QQVA 4INDA 5LEKA 4OI4A 1CIYA 4AF9A 1ZZ6A 1QQP2 4M3CB 4NHYA 3THDA 3FFQA 3AMHA 3VBRB 2WFF1 5SV8A 1NKGA 4RR3A 1EPZA 2WNUC 4P9IA 2MNGA 3VBSB 4YSFA 2WQ4A 4FP2A 4NPLA 3IAQA 4X8PA 5FJKA 3UGGA 2R1DA 3AYEA 3NRUA 5FAXA 3EXUA 3ZM8A 4IGQA 4RN5A 1GP4A 4MX3A 4ORFA 2CGNA 4COYA 3BIEA 4FOYA 4N7UA 5DG1A 1V6KA 4YW7A 3ZFGC 1RUI3 3KWVA 4PI2A 3MFAA 5FY9A 3SCGA 1B35A 4SBVA 1CAXB 4GJYA 3ROUA 1R092 3OJBA 3ZMOA 2Q1ZB 2R16A 1RMU2 2JG9C 1C5IA 2C0ZA 3WG2A 3PUHA 3ABZA 4RHV3 1GU3A 3CDZB 4QX3A 2Q1FA 5DZFA 1YUDA 4FPYA 5A7OA 3VBHA 3FJSA 2NZ9A 3VHPA 4JKKA 1URXA 4E4SA 2HWB3 3GM8A 4WM7A 1G9DA 2CY6A 2CDPA 3L2YA 4AVTA 4GWNA 1S0DA 5D8AB 4OHZA 2JB4A 2VZRA 2XUEA 2VBDA 1CZTA 5GKAC 3OD0A 2RS11 1KDMA 2X29A 5DAWA 1BMV2 1FNZA 4YG6A 2JB8A 1RUF3 1HDKA 3TEYA 3QCWA 2I07B 1UIKA 3IIIA 5T52A 2VZSA 4BQYA 1QOTA 5FZ6A 1MVEA 1H2MA 3POGA 1I1EA 4FSJA 4ISRA 4N90A 3ST7A 5A3OA 2ARCA 3BB6A 2I74A 1GZCA 1RVF3 1VBB3 3EMRA 4DOUA 4UFKA 1VJ2A 2B4KA 2QZ2A 2YBPA 4HSJA 1OBNA 3LGRA 4RQPC 3OBRA 1AYM1 3UL2A 3ZPOA 1WMDA 1AXZA 5FYCA 1BBT1 4JAAA 4NIHA 2A3XA 5FZBA 1HRI1 2E32A 2QQMA 2BUKA 2OX0A 2R043 3TOJA 3TEZA 3IB3A 5LASA 1NAEA 2X8KA 2XVLA 5JXGA 2XMLA 2VQ0A 4YGCA 3AL5A 3W5NA 5IW0A 2Q8CA 5DAQA 1BLZA 2LROA 1HRV2 2RJ2A 4YW3A 4YGBA 3QOPA 5F2WA 5FLJA 1F4HA 1TQ5A 2JX9A 4L9BA 4P02B 2X5IA 3AVSA 3PDQA 5JI7A 2VTXA 3T4HB 3BOPA 3HR9A 4NAOA 3RI8A 2D98A 5HCBA 4L2NA 3V65A 1M4WA 1C57A 1UNBA 2JDUA 4L99A 1EAH2 3H42B 3H3ZA 3T2OA 4AFDA 4LHKA 3O0XA 4LBLA 3H1MA 1OD3A 3FL7A 4QKBA 1HIXA 1PZ8A 2D6PA 1BCXA 1SQ4A 1UXXX 1W6OB 1HQNA 1VMJA 2PHDA 2VMEA 2QJVA 5DZGA 5IVJA 3HWJA 3KS7A 1O6UA 4J1XA 3K48A 4JKLA 1WMXA 1H1AA 2DCZA 4H14A 2I45A 4YW6A 2HBTA 2C26A 5A7WA 4GB33 2A1XA 5BYNA 3WEZA 1TME3 2DU0A 4DEVA 2DTYA 3D6EA 4GULA 4DS0A 2ORZA 2YUEA 3I3DA 2A70A 4XUTA 5HCFA 3MGUA 4LUMA 1H1MA 4EN6B 4UFIA 2Y60A 1AL23 4BXFA 3B7MA 5M0TA 3Q8BA 4G3YC 4JGYC 3SHRA 5A3LA 4OULA 2VOTA 4OCTA 2ETEA 3GXUA 2ZACA 4QQPA 5FZKA 2WUHA 4F83A 2MHFA 4YYOA 2ET1A 2E53A 1GR3A 4ZXKA 4FP3A 4O9GA 1OLME 3N9OA 2FD8A 4CEWA 2VCAA 2UWCA 3K2OA 2Q1MA 1UZZA 5FZCA 4YVWA 5C5UA 1XE0A 2UY8A 3R4SA 4YVSB 3S5AA 1ZNPA 1CJPA 3ACGA 4Y22A 4XDPA 2JIJA 3HEIA 4UW4A 1WCDJ 1LTEA 4I30A 1ZBE1 1NE6A 3WY6A 5DUVA 4JTOA 3OSDA 2HWD1 2VOWA 3ETQA 3IDBB 4YGEA 3ZYIB 1JYWA 1X7NA 1D2QA 1YCIA 2A71A 1BZWA 1RUC2 3AYAA 2KXLA 4DB5A 1GP6A 4QGNA 2BZDA 1OQEA 3PUIA 3HN1A 4U36A 5D21A 5ABJB 4LIVA 5AC91 1VBC1 3V0AB 1FMD1 1NT0A 4FT8A 2WZR3 1CWPA 2W94A 4QMAA 1VRH2 2RHPA 1GWMA 2VTXJ 4DFSA 4OFGA 3ZIWA 2G9FA 5L7OC 4D94A 3BI3A 3WSOA 4B4RA 5FXXA 5DUXA 2JDYA 3RYPA 1PGSA 1F9KA 2BGOA 4AI3A 4FBFA 5F6LB 4XJ8A 4EWDA 4YZ5A 2C9AA 1KXGA 1SHWB 2YGMA 3GDBA 5A3WA 1I9RA 1E5IA 1O59A 5A7SA 1EP0A 1GMMA 1XNKA 5L73A 1YEWA 4CPBA 4A6OA 1D4M2 2IC1A 4I2OA 1H2KA 1CAUA 1GFF2 4IETA 5DZEA 3MW2A 3TN93 1KRIA 3JD72 3UKNA 2B39A 1QF3A 5A3TA 1I3HA 4I0WB 4PDWA 3OTFA 4LBQB 3T2QA 2JDPA 1FXZA 2C5DA 4LHLA 5L9VA 3AP7A 2XJTA 3VZJA 4QPIA 1EV12 3HNYM 3HBZA 1IOAA 3O12A 3Q8EA 4XXPA 5FZ1A 2QE3A 4Q1PA 1X33A 4Q4V3 4AEDA 4PJYA 4DY3A 5BXXA 3JBG3 5FPUA 1RUD3 2G9GA 2DCTA 3UT0A 1RYYA 3KB5A 1PO13 3IKWA 3ZPYA 2IXIA 4D6QA 1ND2A 4M0NA 4OMDA 1OXCA 4XJZA 1VPHA 5I8TA 5FYTA 1PIV3 3O7OA 2ZCWA 3KM5A 1OC1A 4LLFA 2QQJA 2B46X 4LBKA 3M4FA 3M70A 4N53C 3SKJE 1QQP3 3AFKA 2H6BA 2UYAA 3ZDSA 1D0HA 5EJZB 1DIWA 5FZ7A 1W8WA 5FYUA 4JRAA 3H50A 4RA0A 4F3JA 2VULA 2PFWA 1W6QA 1G9BA 4GH4C 2E31A 2VU9A 4FCAA 1UX7A 2RS53 4NRPA 5EHDA 5FZ3A 5F5QA 3O1PA 1PGW1 5FZGA 2A6ZA 2N7GA 1ZREA 1SLBA 2HEYF 3A7QA 4IV3A 1PNGA 2VCBA 1UU6A 3LA3A 4NOTA 2VL4A 4HBNA 2ZGPA 2WNUB 2DUQA 1R093 2WR9A 1H8TC 1YQ2A 3K77A 3OEAA 1RHI2 1XJAA 4QKNA 2WKKA 2XKOA 1PGL1 2F17A 2XQXA 2EAKA 5A7PA 3OPWA 1UZWA 3ZFFC 1KFUL 1N3PA 3BODA 5LRSA 4FPCA 5FYZA 4A41A 5C9AA 3MLKA 2VC9A 5A33B 2V73A 3LEMA 5A7NA 2C1FA 2OYZA 1NOVA 3EJKA 4OZXA 4QX2A 3ZFGB 5EIYB 5FXWA 1IKPA 5EP9A 4CCEA 1UYZA 5KXEA 5FPBA 3OYWB 4CUBA 2A3YA 2ZHLA 1LESA 3U4XA 4Y33A 1SPPB 5HV4A 5FIXA 1YXWA 4HL0A 5A3NA 2FQPA 1XNAA 2PHRA 4KG0A 3SQOA 5I0RA 5JCTA 1HJFA 2D40A 2QFEA 3AMNA 2IXLA 5HCAA 2Y33A 4W8JA 2WC2A 3CEWA 4M0HA 2O0OA 2D6MA 4Z2AA 1RUE1 1K5MA 2BOIA 5E88A 1OD5A 1W2UA 4CCKA 3OBTA 4QGLA 5F3EA 3B3QE 3HAGA 1HQWA 5BNQA 3CZUA 5GLVA 3T3YA 5IATA 2O8OA 1BK0A 1UY2A 4HFSA 4C90A 2BW8A 4ZXEA 3C7FA 1IGOA 5G05L 1IZ3A 1YFYA 2CDOA 3VUOA 3T30A 1W6NB 3ZN6B 4BMBA 2E33A 2TBVA 4CE8A 3B93A 2Q8OA 2YXSA 4DRRA 1A78A 2V5YA 4KU7A 2R0HA 1AR62 2WQZC 4LJHA 5FZ9A 4RQPB 2CTVA 5JZGB 1HXS3 4HVOA 4XZUG 2QQUA 3DUIA 4A4AA 2OKXA 1VBD1 2XBO1 4IEZA 4Y20A 4B7EA 4QX5A 3E5UA 4JC1A 5IYYA 3NWKA 1JTZX 2MEV3 1LCLA 1JYIA 1W6PA 2UYBA 4OI1A 3NNLA 2C6SA 2DVAA 3LEIA 3WDWA 1YQ6A 2E9QA 3VZNA 2QCSB 2VECA 1NXD1 3C8XA 4W65A 1BEV3 4CDWA 4Y5TA 3HT1A 4CP2A 4J1WA 2BVVA 4LOSA 4CDQC 1IQDC 5F8PA 2WFF2 4OUSA 4QDQA 4AFCA 1ULOA 2XWJB 4QT6A 1APNA 4XCAA 5IVBA 2VZUA 3VBFB 1HLCA 3HQXA 4N43A 5CFCC 3H1YA 4Y1YA 1JBCA 3DPRC 2W1WA 4OUMA 3ZXLA 4C0BA 4S2FA 2FDKA 1DGWX 3VKNA 3A21A 2XJRA 1W0NA 3RI9A 3AP6A 1FI2A 1R1A3 2B42B 4COWA 2XJSA 2QQIA 3WG4A 1A3KA 1WW4A 1N1VA 3KSCA 2OXBA 2WINB 1UZYA 2ARAA 1ULPA 3M2MA 1C4RA 2IXCA 3SH5A 3VDAA 5FDBA 4JGZA 2CHHA 3EHKA 5AFEA 1RXGA 3JZVA 3KHCA 5L9BA 3N7KA 2YU2A 3MUY1 3SISA 3IM0A 3BGAA 4GIQA 2ZGNA 3H7YA 4B4QA 1D7PM 1XRUA 2DDUA 4JGYB 1DQ6A 5FZEA 5E6HA 1U5ZA 2RS12 2SLIA 4MGZE 5I0UA 4HOOA 2JG8C 5FY7A 5DN2A 3VGIA 4MO3M 2JDAA 4Y1VA 2VMIA 2WNVA 4H2AA 2R1BA 1VIWB 3J26N 3MO4A 4ONUA 5CZKA 3MICA 1LOCA 3ZSLA 3DECA 5J09A 1V0AA 5LA2A 5ABJA 3VD9A 1GZWB 2P3YA 1WBLA 2VUAA 2OUHA 3D0JA 2Y8KA 1VRH3 4Z07A 4A3XA 1MS5A 3T1LA 5A3UA 5A6YA 4LUKA 2P34A 2A73B 3VBSC 3ZMNA 1PVC1 3U11A 5J1XA 3ORJA 2PA7A 1AYM2 2VCMA 3E6DA 4S2DA 5KWRA 2HKXA 2TNFA 3A0KA 3AP5A 2PHTA 3KV6A 2VZ1A 3KVAA 1DLCA 1F4AA 1REEA 2QTWB 5LK5A 1D4M3 3AJZA 4AE2A 4GAZA 1ND3C 2E7TA 4OHYA 1HW5A 5DAXA 4KG8A 5CAZA 1FAYA 1WD4A 3JB4C 1XB9A 1NXMA 2J1SA 1JOJA 1H30A 3KT7A 5FUNA 4D7SA 5L7OB 3NNGA 4LPLA 2WS91 4LBQA 2ZS6B 3WHUA 2P17A 3IWZA 1HB4A 3GZTB 2OQ7A 4V2VA 3RSJA 3WCSA 4NE9A 4QXHA 3AKQA 3W21A 1LOBA 1W99A 1UYXA 2GMPA 1XSRA 2B9UA 3BALA 3F2ZA 4OLLA 1N1TA 4FXKB 2G1MA 5K0UA 5D8AC 2NYYA 5FWJA 3VKOA 2IWGB 2VE1A 2GH8A 2Z79A 4N7IA 1BQPA 2FCVA 4QXBA 2GC2A 2BOJA 4TXWA 2PELA 3ETPA 4XBQA 4FPEA 4XURA 3ZDVA 2NP0A 2PLV3 3PVBB 4ARYA 4Q2FA 5CKNA 4JHZA 1JZ2A 4CDUC 1PVXA 1W6MA 3FHAA 5J98B 4MGYE 1WZXA 4NRQA 1O3SA 3D0SA 3BTZA 4LBJA 1LEDA 4QHBA 3ZKUA 3ZN5A 5BNNA 2W08A 4NHMA 3VB9A 2K9ZA 3BKZA 1J3QA 4WM8A 5GM0A 1OUSA 5J7MA 5IK7A 3VBUA 3WNNA 1CAVB 3WOGA 2RDNA 1GP5A 3AKPA 1JU4A 2NPIA 1ZX5A 3P1IA 5F2SA 2WT1A 4N53B 1G9AA 1OKOA 4KMQA 1MZEA 1MACA 1US2A 3DKQA 4GKXA 1JMUB 4LITA 1Q8SA 1IPSA 5LA1A 4GH4B 3GHMA 2QQWA 1QJU1 1C8M1 3WT3A 1FATA 4C1XA 3RJRA 3T4VA 1ZBE2 2BRTA 3VBOC 2AEYA 2VOKA 2XL7A 1RUJ1 2ZX4A 4RFRB 3TB0A 5A3PA 2HWD2 5CG9A 1J84A 3PUSA 2HWF1 3ZFGA 1C28A 2PN5A 3GBGA 4HKWA 1KJRA 4COUA 4Q0PA 1GNYA 3K51A 2EIGA 1H8TB 1QXJA 2CSGA 2JIGA 1VBC2 2NMNA 4NAMA 1FMD2 4O9EA 2JG9A 4XFBA 2RJLA 3KVBA 1AYN3 1OUXA 2ADEA 1COV3 1PMIA 2J42A 3RJ2X 4K8RB 3ZFFB 1QJY2 3E97A 2ORXA 4XJ9A 4Q0UA 1UO9A 2VUDA 1SEFA 5IVEA 3U75A 3T0BA 2B8MA 4PBOA 4QX1A 4UWDA 4Y1ZA 1Y4WA 2Y38A 1VMHA 3I3BA 2XJPA 4UFLA 3VKLA 4J25A 3L9JT 2D5HA 4V2WA 3ZXEA 5FY1A 3G7DA 3ZXAC 2W87A 2JDHA 3HN3A 2ZGKA 3H9AA 2YC2A 1A8DA 3WF4A 4JDMA 3FMGA 4LBQD 4PQQA 5JMOA 5FTTC 3IN9A 4TLFA 5FP7A 5DG2A 2K2SA 1BVP1 1AR63 4CU8A 2FDGA 1KFXL 5GZFA 4K40A 3D4KA 4RL7A 3THPA 1ZRFA 2HWE3 4MGTA 4B1MA 3ZYFA 3R4DB 1PK6A 4A7YA 4W6WA 1MEC1 3UV9A 1U5IA 1G6NA 4HKOA 5FZOB 2BP6A 3ES1A 1X8EA 1H6YA 2JENA 1G8WA 4RFT0 2Y0OA 3ZYRA 5A1FA 1OLMA 5CNAA 2DWRA 5JWPA 3MDPA 4FOQA 4N9HA 3N7LA 4XE9A 4K20A 1QU0A 1D4VB 2CWSA 4XCBA 5DABA 2OT7A 5K9YA 4MOAA 2WAAA 3VZKA 3B94A 1QJX2 4ES9A 1Q5OA 1X82A 2WQ8A 2XVKA 3N3HA 1ENQA 1K12A 2JWPA 2ZGQA 4FI9A 3FWEA 3QACA 2QKDA 4YW4A 5A70A 4TTGA 4FTSA 4CXWA 3O1OA 2VNOA 1LR5A 4BE3A 3RZJA 3MFCA 3AM2A 4LULA 4QPYA 2WSVA 5D1IA 4ZPIA 3V64A 3X29B 4NJ4A 4TWTA 5E89A 4I0BA 1W39A 3LEGA 1C5HA 3RPQA 2GC3A 1PGW2 4AZZA 5LA0A 4CCDA 3ILRA 1RITA 2BWAA 4WZFA 4GWIA 4MZUA 2R30A 4M00A 1K45A 4ASKA 5F5CA 4CDQB 1MQTC 2ARBA 4LTAA 5I91A 1IKQA 2R061 3C2UA 1AVBA 4QU2A 2XONA 4QPWA 5CB7A 2IXKA 1E5SA 1EUUA 4BYYA 5CFCB 5L36A 1VBA1 4W4ZA 3HJRA 1PHMA 1PGL2 4JRLA 1UOBA 4Q4Y1 3MIHA 2RG4A 5LRRA 2K46A 4EZHA 4XFIA 4B29A 5IHRA 4GJZA 3O0VA 1W8FA 3ZLIA 4AEJA 2J1AA 4JCKA 3LSEA 4ES8A 5C70A 4M4RA 3WINE 3WLUA 1UW8A 3POYA 1RUH2 1H0BA 3NJVA 3H8XA 2BVBA 3A0NA 1JOPA 4AEMA 1ONAA 3P5BA 4F7ZA 2W0XA 1TEIA 2H0VA 2RS13 2FMDA 2HYXA 4LBOA 4XBLA 5ANNA 2VXRA 3E6CC 1LHVA 1DGRN 3IMNA 4DINB 4E27A 2UWBA 4DXRA 3LWCA 4LO7A 4AG4A 3LF7A 2F4PA 4XF0A 3ZYBA 2ZEWA 1ULFA 4HZFA 1PMHX 1OF4A 1RUE2 1K3IA 1TG7A 1ASJ1 3LDRA 5EPAA 4JQRA 2R071 3OBZA 1PZ9A 1YJKA 1DU3D 1D2SA 4FXGB 3VHNA 3UESA 2DFBA 2O8QA 3MIFA 2BGCA 4PHZA 1JUIA 3CLPA 2ZXQA 3IPVA 3K4ZA 1H6XA 3UKVA 3MZHA 3OGSA 4Q4W2 2QQKA 4DXTA 4P9YA 4YFWA 1GANA 1UAIA 3UNPA 4U2AA 1E5HA 3ZYPA 3IT8A 3QH7A 4QDSA 1NX9A 2RM22 4PCRA 2VG9A 1N1YA 1OKQA 1YRZA 3RZHA 1UQXA 1UY1A 2YB7A 4X6RB 3KQ4B 2R6QA 1KS4A 1YHFA 1A8MA 2W1UA 1PO22 3WW2A 1VBD2 2XBO2 1AHSA 4BMEA 4XHBA 4EWAA 1OA4A 1ND3B 5T54A 1LRHA 3EO6A 4HPKA 2G9ZA 5LA9A 5J96B 5FFOC 5AC92 2D44A 3FUOA 5IAVA 4LT5A 1GNHA 1QIQA 3R6SA 3ACFA 4CCCA 4ET7A 3WNXA 5A3MA 3DN7A 5EXOA 2EVXA 3Q8AA 1YIFA 1ZBA1 1JZ4A 4E8DA 1Q8QA 1DZQA 4AYUA 3JCIA 4D0QA 5IVCA 1UYYA 3DYMA 5HBAA 4AQSA 1W8OA 1UF2C 1D0GA 1WCKA 5A32B 2VUJA 4G4FA 4YM3A 1FOD1 4XDQA 1DYPA 3FHIB 2VCCA 3NO8A 3KV5A 3T0DA 5CFDC 1SLLA 2AZ5A 5JOZA 3FE5A 4WVVA 2R0FA 4CDUB 2V4VA 1WKYA 2ZEYA 3WR0A 4N53A 4K9SA 2IFRA 3WD5A 1SCRA 3RZLA 1QNWA 3USUA 2C9KA 1NQDA 2RDRA 5C8CC 4BZ4A 1CZSA 4C0HA 2C4XA 4F8AA 1HB3A 4UF0A 1W9SA 3JXSA 4KWJA 2ARXA 3ZYGA 2AYHA 5JZGC 2I2SA 3KGLA 4WVMA 1C1FA 1LHOA 3POFA 5F1RA 4GH4A 4QGMA 5KC6A 5JAXA 3PVOA 1A34A 5DDJ3 2DBIA 3TAYA 2GZWA 2XL9A 1YNAA 2HWD3 2FBEA 2GC0A 4IEVA 5C33A 5FMOL 4H55A 3J8F3 5KHIA 2VQAA 5A7QA 5FLHA 4XILA 3HBKA 5KC5A 2DBNA 1PX4A 2VW1A 1VLNA 2BFUL 1LGNA 3J7LA 3IDAA 1FMD3 3WF0A 2EAAA 2BWCA 3AJYA 3GJAA 2LM3A 1S0JA 5I0TA 1BHGA 3RNSA 1QJY3 3OG2A 4PF5A 2VMGA 3ZFEC 3VBFC 1CQ9A 4M3CF 3VBOB 1PVC2 2MPFA 2QQPA 3RGBA 4Y4RA 1CESA 5CKMA 1V6MA 2XGXA 1WLWA 2RR13 3CNAA 3PVEA 3AFGA 4PLOA 4R4XA 4E4DX 5IVVA 4OQ8A 2W68A 1JZ7A 2Z5WA 5B4XA 1TMF1 4P9LA 2XKPA 1O7FA 3FLTA 4RYDA 5AFBA 1WA6X 4IE0A 4Q4X1 1XQNA 2WWSA 1UX6A 2P5BA 4DRVA 3NJZA 4XZPA 3ZX7A 3BTXA 4MGSA 1NZCA 2RJKA 5CIRA 1LECA 5DPNA 1SMVA 1UMZA 4HT1T 3ZXJA 1OQ1A 3N9MA 4XAAA 1OSGA 5JOYA 3K3NA 3Q9OA 5GLUA 2GNBA 4ZU5A 4B1LA 5ANQA 1JYNA 3FHQA 5LY2A 1OF3A 1AL0G 4FOVA 4O7XA 3LE0A 3O1MA 4MUVA 1AR92 4XF3A 4NHKA 4Q29A 1X9TA 1V9U1 1G9CA 1EY2A 3POSA 4CSWA 2C24A 4UT5A 5BPXA 1RINA 4QB1A 5EWSA 2EF6A 4XF4A 4XUOA 4RHV1 2WN3A 3GJBA 3PURA 5A1LA 3ACHA 1MS8A 3JU9A 5IK4A 5K4LA 2B9VA 2HWB1 2GN7A 2ZZQA 3PHMA 4LO5B 3ILFA 2XUMA 1W0PA 1QJX3 4E2QA 4L11A 4COZA 4JKMA 3GF6A 1CGPA 3VL8A 1J83A 1GNZA 4HONA 5F5AA 4HK9A 3U37A 4XYXA 1AZDA 1I5ZA 4BCUA 3E6BA 4QPGC 4QQLA 2VMDA 1DZTA 3WDVA 4KQ7A 1DQ1A 1IS5A 1U5XA 2ZHNA 1VBB1 1RVF1 1ZA7A 3VDBA 1W8UA 4BPZA 4OQ9A 4AI2A 4BU2A 1CR7A 1MZFA 4LBMA 3VD3A 5JOXA 4EN8B 4TZDA 2R041 1NCQB 1W2NA 4C8DA 5CFCA 1QJU2 1C8M2 1F2NA 2ZTNA 3DPRA 3KF5A 2IXHA 4YW2A 1LNSA 3T08A 4CZSA 1VAKA 1BJQA 5C4WB 1RUJ2 1Y9MA 1K42A 4NROA 5GJ6A 1RUH3 2HWF2 1MQTB 4PIXA 4NHLA 1DZRA 3MW3A 4FFIA 4JV4A 5GLZA 2GMMA 1JHJA 5I0DA 2JE9A 2LRPA 3OPZA 1LU1A 4HLTA 4ARXA 3I97A 5LBBA 2ADDA 3KT1A 4KL1A 4QX7A 3S5QA 1AF9A 1QOOA 1RB8G 4P00B 2ID4A 3A4UA 4AI8A 4RSUA 1YI7A 3LEKA 5FQ0B 3VD7A 3I2FA 5I93A 3CIHA 3IDCB 1FT9A 3WUDA 2D97A 3M8LA 2W52A 4UAPA 5FY8A 4PLMA 4Q4W3 4R9AA 3MIDA 2JG8A 1TVGA 2GNMA 4NPRA 1OLRA 2YHJA 4KBZA 4KWLA 1DYOA 1TME1 3HPNA 4LO8A 2F6BA 4M3CA 3KD4A 3HIFA 3TWIA 4FPOB 2PQQA 4QKDA 3VBRA 4UFMA 1CX4A 3PL0A 4FQZA 2RM23 4XOGA 5CU1A 1AR72 2Y6HA 1ZRRA 3O0WA 4R4ZA 5HI0A 1V6LA 3CJXA 3VBSA 2UURA 1VAVA 1OLQA 5JOWA 2Y6KA 1Z0HA 4ZU4A 2ZHMA 1MEC2 2PHXA 3LDBA 4PBPA 1UU4A 3AKTA 3AP9A 3AZZA 1PO23 1V6JA 1VBD3 4XACA 5IAXA 2J1EA 5HCHA 1UOGA 4MXWB 4YG3A 2D3PA 5LK7B 3ZOIA 1XU1A 1ND3A 3OY8B 3VDCA 5KHGA 1W04A 4IE6A 1B09A 2FZ1A 2ZMLA 4XJUA 4KU8A 3TEXA 4BK4A 1CAXA 1RMU3 4LO4B 4BWOA 5FKCA 1GV9A 5F3GA 5H9QA 3UETA 2B7YA 3DGTA 5FY0A 4QQOA 1AR82 4UYBA 1LOAA 3NNMA 1XC6A 2D6OX 1S0BA 2G19A 1OFSA 2DVFA 4AWDA 4OHWA 4QB6A 2JE8A 4XMAA 5D8AA 3UK9A 3GNEA 4GA9A 1DGLA 2X53S 1XNDA 2CV6A 1JZ3A 2Z4FA 1MZ6A 4OZOA 3N7JA 4ZZ8A 2QBXA 3ZVXA 4CU7A 4IV1B 3VZMA 4A7ZA 3AL6A 3AXEA 4IGPA 1V70A 2R062 2W9XA 5FP8A 5HV0A 5IFPA 1NYWA 4FFFA 3O1SA 1LOFC 4MHUA 1BYHA 1VBA2 1AJKA 2Q0AA 3MUZ1 5I8YA 1LB2A 4Q4Y2 2LALA 1HN0A 1VAMA 4LEJA 2JE7A 1J1TA 2RDQA 3JB8A 2AR6A 2FDIA 1OH3A 2NM1A 5FPZA 3TN91 1XSQA 1J58A 5F3CA 2PYTA 3RS6A 5CFDB 4E2SA 2D6KA 2P2KA 3I54A 4RGAA 5ERLA 4ISQA 4XPVA 5CEHA 1IQAA 3BU7A 3OF1A 4XTPA 4QX8A 5EV7A 1QY4A 4Q4V1 5LWBA 4KNCA 2P37A 3BVCA 5C8CB 1HRV3 1UU5A 1WMFA 1RUD1 3I2KA 3JBG1 4XBNA 5FZLA 2AUYA 5GLWA 3WG3A 4BQWA 4D8MA 2VTFA 3K75B 1PZ7A 1DQ0A 1QXRA 1C3HA 3WQBA
chains in the Genus database with same CATH topology
3FLPA 1ASJ2 2GAUA 2R072 1PIV1 4YM0A 4B7KA 2WLPA 2PHWA 4MV2A 1EAH3 3VBOA 2Z2SB 3AZVA 4P9XA 4OHVA 5SV5A 1X8MA 2ZX0A 1SLAA 5BNOC 4JDOA 3M1HA 5ACA1 1W6OA 4YVWC 4HVQA 4Y24A 2H0BA 1N3QA 2DTWA 1T6GC 1ENSA 2RS51 3ZXDA 3ZFEB 4K1ZA 1ULGA 3GBFA 4K6BA 3D5OA 1AX1A 2AREA 4Z1VA 1POV0 3RMYA 3ZSJA 4XQWA 2OUJA 1YJLA 1AR93 4YZ4A 2D3RA 2A3WA 3W59A 4CP0A 3RMXA 2DF7A 2WFPA 1DQ5A 2XWBB 5BNPB 3DL3A 1MVQA 1MS4A 4DZGA 4BHPA 3H8UA 3G6JB 3POWA 2HWC1 1CD3G 4XHXA 2ZAAA 3FLRA 2GNDA 1AUYA 1FNYA 2E7AA 3KCCA 4HVRA 1YIPA 1U0AA 1UKGA 1QOSA 4YVSA 1JN2P 1DDLA 4KH9A 1BMV1 1QKQA 1LGBA 3LZZA 1ALYA 3WDXA 3INAA 4M01A 4AFAA 2W39A 1FOD2 3KGZA 5TSWA 3WQ0A 3MI8A 2D93A 3O14A 1XXNA 1RUC3 2XG3A 4YM2A 3WX5A 3ZN4A 3QBQA 4QPIC 1N1SA 4AEDC 1GBGA 3FX3A 4LA2A 2DUOA 1MZ5A 3OGGA 3H7JA 1QJU3 4YLZA 1BBT2 2ZGRA 1HRI2 4QPGB 1JH5A 1ZRDA 3TRSB 4ITCA 4I3GA 1RUJ3 1Q8VA 5DUWA 3JD73 1CAWB 1HXS1 1OA2A 4Q26A 1Q56A 4YW1A 5T5PA 3CJIB 3LAGA 4QQHA 2ET7A 1CJDA 1EV13 2MEV1 2ZKNA 4DMIA 2P3KA 1X36A 5FRAA 4IXLA 5JLVA 2CWMA 3MPPG 4IV3C 3TBDA 1BEV1 1SFYA 4XFAA 4IEWA 2Q5TA 1KQRA 1TMF2 3B01A 4RR3B 3GHNA 1FPN1 2O1QA 4Q4X2 2HYKA 4WZCA 1Q43A 4QD2A 2Y26A 5JSRA 2P3JA 4V1PA 5C9AC 2A7AA 4M3CE 1S0CA 4URTA 4EJRA 2JDZA 1AR73 5KHHA 1O4YA 1Q8PA 1R1A1 3PNAA 3R4UA 1RC6A 1MS1A 1YFUA 1GSLA 2LUWA 4FO9A 1V9U2 3SLIA 4FQ4A 1OPMA 2PHLA 3NAPC 2FZ2A 2GN3A 3VBHB 1W0OA 4MXWA 1DBNA 4WM7B 2YROA 1K5MC 1DG6A 2HWB2 1O4TA 3OY8A 3WCRA 2JD4A 2WNUA 3PMEA 3I2DA 1RGSA 1RHI3 3W9AA 2DUPA 4AEKA 3AKSA 1AR83 3VZOA 1VB4A 4X6QB 5A33A 4TYSA 1POV1 1CONA 4A2UA 5IK5A 3FC0A 3WW4A 5JIUA 1N47A 1VRH1 3OYWA 4Q8KA 1J3PA 4Z82A 1UIJA 1VBB2 1RVF2 2GSYA 3APBA 3JUUA 4LA3A 4RGGA 1GQHA 3W58A 3WV6A 2YY1A 1SCSA 3PMSA 3SCFA 4AI1A 1VBA3 4GMP3 3MW4A 3BPZA 1IS4A 3M3QA 4YW5A 4Q4Y3 2D3SA 2OZ6A 1D4M1 4YZ3A 1S2BA 4FPFA 1XYOA 3JQWA 3KCXA 1ULCA 5CA6A 2ZPXA 3J4UH 1VBE1 4CDWC 1O3TA 1Z7S1 2A6WA 1O91A 3LA7A 1O3QA 3NKTA 2XJVA 4LHNA 3S7IA 3MYXA 1W6NA 3ZN6A 1H4HA 5I8SA 5LEJA 1YFWA 4AQTA 4Q8LA 5C8CA 1O5UA 1X50A 3U0ZA 1NY71 1VALA 2CAUA 4RQPA 4YM1A 5JZGA 2VPVA 2ZGOA 5DUUA 1Y3TA 5JPMB 2PLV1 2R073 1F31A 5T5LA 1LHNA 2WNEA 3AZWA 2OVUA 4FPLA 1WA4A 4B4PA 5AVAA 4JGZC 4P9GA 3LKJA 3VDDC 3M3EA 3FUQA 4IEYA 2WFF3 1XYNA 2DU1A 2XJQA 4HK8A 2GU9A 2YV8A 5GZCA 3VBFA 1NCQC 1H2LA 4AVVA 1UN1A 2ZGSA 1QHDA 3DF0A 1ULDA 1RUG1 3GZAA 5BNOB 5C4WC 1KDKA 3L2HA 3LB9A 2RS31 4YVWB 2PAMA 4LNVA 3S7EA 1ZZBA 4Y22B 1IS3A 3MF6A 4FPHA 3GALA 1WGPA 3UJOA 1XNCA 5FPXA 2JICA 2WLQA 4XFHA 2CAVA 1R081 2KA3A 4AHWA 4NVPA 2TUNA 1XE7A 4IERA 5JVVA 4ATFA 2ERFA 4XQDA 4JGYA 1SBFA 4CTEA 1AYN1 1ULEA 1COV1 1ZZ9A 1Y9QA 2Y0IA 1YYNA 4XF9A 2Q30A 2ZJCA 1OMIA 4A7KA 4FPGA 1ZRCA 4YARA 3N35A 1O5LA 1NCRC 5JSPA 3DKWA 2Q4SA 2A75A 3MIBA 3ASIA 3PVNA 3VV1A 1GZWA 4FAHA 5L19A 5K0UC 5JPNB 2E51A 5KHJA 3KLSA 4AW7A 1ZM1A 1AYM3 3TN92 1J1LA 2XLFA 1BBT3 1V6NA 3O5SA 2AGSA 4PDWB 3ZXKA 1CVNA 1HRI3 3QLQA 2NLRA 2GC1A 1JHNA 4QPIB 4Z8BA 2EXHA 4RS5C 4AEDB 4BQ1A 2HWE1 4CEYC 4HSLA 4Q4V2 2RMU1 4UBHA 5BNNC 1RUD2 2XB6C 3H1WA 4IEQA 5L7OA 1YO8A 1CN1A 1S0EA 4AI0A 4XFGA 5H9SA 3WDYA 4WM8C 5FREA 2XJUA 4I09A 1SBEA 4I01A 4CRQA 1GKBA 2ZAHA 1G7YA 1CIWA 3V0BB 5E16A 3AXDA 1DQ4A 3DV8A 2WT0A 1TMF3 1LENA 1OI6A 1SBDA 2WA4A 4IL7A 4AQ6A 4C91A 4N9IA 2ZOEB 3SNMA 4Q4X3 5ACA2 3IDEA 1H1IA 1W6QB 4IV1C 2BBVA 1UKRA 3T2TA 1GQGA 4YGDA 5EZWA 2RS52 4K7JA 4Q1RA 2Z69A 5F9TA 4OI0A 4IV3B 4BLJA 5JIAA 1FYUA 4Z92B 1MS9A 1AXYA 1U5YA 2GALA 3I8TA 1LOEA 2ZX3A 1CAVA 1V9U3 1F8VA 1YWKA 3EQEA 4UBGA 3MPBA 2JECA 3NW4A 3P3PA 4AVBA 3WW1A 1DF0A 2PAEA 5C9AB 2ZZJA 2JJ6A 4YRDA 2BYVE 1QH6A 2IFWA 4G9SB 2WSUA 2HWC2 1WLCA 2OPKA 3N7MA 4NN0A 5HXVA 4CP1A 3NV2A 4Z2WA 1DHKB 1ZYBA 3SH4A 5C6CA 1RUNA 2VH9A 3WVJA 1XE8A 1ZBE3 3NAPB 4DQAA 1KD7A 3B9IA 1UD1A 1MS0A 4IQPA 1HX6A 3MLLA 3TYJA 4OHXA 4B3NA 2A5ZA 1FX5A 1K5MB 2AH2A 4R8HA 4GXLA 3RG0A 2YMZA 4XQ4A 1WW7A 1VBC3 2LTNA 3LOIA 5AC93 1H8TA 5FO7B 2WIIB 1XYPA 3WQ7A 4AFMA 1PK6C 2VW0A 3ZFFA 2SBAA 4JDNA 2D6NA 4COVA 4R52A 3R0RA 4FTBA 2VNRA 3M7AA 3PJYA 4J6GA 5K7PA 2XVGA 5C8WA 1QWRA 4K21A 4AXOA 2OW4A 5BNPC 3BCWA 3BIWE 5FO9B 1HXS2 1VR3A 4LLOA 4XTMA 3ES4A 1H8VA 5CADA 1V6OA 4Y20B 2ZMNA 4LO6B 2WS92 2YZ4A 3MLJA 4DXZA 1LOFA 4HN0A 1DGRA 4GWMA 4Q0SA 1XU2A 1W6PB 1QJZA 2MEV2 1SACA 2ILMA 3NKGA 3MIEA 4C1WA 1RUI1 5J7MA 1OA3A 1CPNA 2P3IA 3VL9A 4MGKE 2UY9A 1NA1C 3EBRA 4CDWB 3RYKA 3AMPA 1ENRA 1BEV2 2XPJA 4HMZA 1ENXA 3RZZA 4CDXC 3USSA 4IEXA 1CPMA 2BNNA 1RUOA 1FPN2 2BTVC 1RL3A 4Y26A 1IHMA 2YYOA 4N43B 4XFCA 5DXDA 1OOPC 5BV6A 4META 4B8EA 1JYCA 2K0GA 5GLTA 1RUF1 1R1A2 4CYDA 1QNYA 1SFNA 3BTAA 3AMMA 4ATEA 2CGOA 2QZ3A 4P9JA 5EYYA 4QM9A 3ZO0B 2Z42A 4JGZB 4DNYA 5BNOA 3R05A 2BEOA 3VDDB 1L3JA 2VOXA 4BIFA 4CDQA 2GH2A 1JXNA 2DCJA 1KJLA 3WP5A 4WBBA 2IZWA 3E5XA 3CJIC 2EXKA 5DDJ1 4BIOA 1AX0A 3U10A 3VKFC 2VOVA 2WNVB 4NO4A 1ZA4A 3J8F1 2BNMA 3NV4A 1N3OA 3SMHA 3WDUA 1PNFA 3AP4A 1BVVA 4L92A 2H6CA 4RR3C 1YFXA 2OZJA 1QJY1 2TEPA 2DFCA 2XHKA 3M3CA 1FV2A 3RDIA 4UW3A 1NE4A 4HANA 2RR11 2VMHA 4XF1A 4FPJA 1RUE3 4XIOA 2QDNA 3WG1A 3NVCA 4L8QA 3ZSEA 5E1RA 1B35C 1H4GA 1S0GA 4AHXA 1VBE2 4ASLA 1Z7S2 4GB31 2BNOA 4K1YA 5J48A 4NWWA 1DFQA 4WVZA 3VBHC 3ATGA 5K8SA 1NCRB 3LCPA 2QDRA 3I4IA 4EV0A 4WM7C 4AK3A 3NV1A 5K0UB 2ZX1A 4HETA 5GZEA 1AL21 5FMOS 1LHUA 5FBZA 1NY72 2IXJA 2A6VA 2BFUS 4FAGA 2PLV2 2XBO3 3B02A 5T55A 1W6MB 3WP3A 4MXVA 4RS5B 4PIYA 2ZMKA 1QJX1 4CEYB 2RE9A 5GALA 3V0BA 4UXAA 4RD7A 5BNNB 4AQ2A 2DV9A 2JXAA 4EWEA 3GYDA 3TNPB 5ACA3 1OPOA 4NWVA 3SITA 4WM8B 1RJ8A 3VBUB 1WW6A 1QXPA 2UWAA 2WA3A 3IBMA 4E9KA 5T5JA 2G4IA 5GZGA 2FMYA 1YLLA 2WZR1 3KT4A 3M3OA 3ENRA 3ACLA 1RUG2 5A32A 4XJWA 2BQPA 3AYCA 4X8NA 2VW2A 2X5IC 3LSDA 2RS32 3WP6A 2YC0A 2PTMA 1SLCA 4CDUA 4K8FA 4R9BA 2EALA 1DQ2A 1LULA 1QH7A 1IPJA 2PAKA 4QM8A 1LKNA 2HWC3 4P14A 4Y4YA 1RUH1 2OIIA 1R082 2CGPA 2D7FA 3WUCA 2ZA9A 1LGCA 1F5FA 2JG9B 1QDOA 4XMIA 3NAPA 1AYN2 1COV2 1OFNA 1PM7A 3WZ1A 4BOWA 1S0FA 3SCHA 4XEZA 3JQXA 5B2GB 4EROA 1PO11 2A6XA 2GNTA 4UW6A 2XLAA 1ZVFA 4LE3A 4MLOA 1UCXA 1DLLA 5J37A 1F5JA 2VVDA 4Q4W1 1YI9A 1PVC3 2E63A 5KHKA 5JI9A 1VP6A 1QQP1 2OA2A 3V0AA 3ECQA 2DCYA 1Q3EA 4XXAA 4CEWC 1RJ7A 2RM21 3ME2A 4MYEA 2HWE2 4XETA 1PK6B 2RMU2 2D5FA 2A6YA 4LE4A 1PO21 2WS93 2GDFA 3FBMA 3VHRA 2QVSB 4S2GA 3CU7A 5F6KA 2VVFA 1NLSA 3KMHA 2ZHKA 1R091 4QQ2A 3AK0A 1RMU1 2WL1A 5CBLA 5EJ3A 1SLIA 4XFFA 2WZPP 5FLIA 3C3VA 1XNBA 4FPKA 1FPN3 4YZ2A 2FHRA 4P5HA 5T50A 2YDEA 4IEUA 4ASMB 1AXKA 4YZ1A 1WCSA 4XJAA 1ZBA2 1WUVA 3HMYA 1NA1B 1NLRA 2DYCA 4K3UA 3AZYA 3ZYJB 4CDXB 5H9RA 3OCPA 1SLTA 1MR5A 4LR4A 4PDWC 3J9SA 4H7MA 4KGGA 5FO8B 5JMCA 1LOGA 1OOPB 3AB0A 4KWKA 1LU2A 1LEMA 3ELNA 3S6PA 3VDDA 3VZLA 3NL1A 4KGQA 3CF6E 5AVPA 4AVCA 2GMEA 1O4ZA 4EN7B 4E4ZA 1ND2C 3PTYA 3SH3A 5I0SA 1QGLA 4MSVA 1C8M3 2HEVF 1NCQA 4PLNA 3MIGA 3QD6A 3V56A 3WDTA 2B45X 3NSTA 4ZKTB 1HRV1 4Q0VA 2PHUA 4MGIE 1OQDA 3OD4A 5C4WA 3S30A 3UJQA 1POV3 5JDBA 1U12A 1SDWA 4Y1XA 1Z78A 3I59B 2HWF3 2ES3A 4LBNA 5T3NA 3VBRC 2V09A 3NV3A 1MQTA 4AGGA 4E2GA 3IIAA 1HQLA 2CNAA 4D69A 4P9WA 1EAH1 3IPVB 3VN4A 3PJQA 3D8CA 2E6VA 1NG0A 1REFA 5J36A 3H3UA 5BUVA 4GQ7A 1BKZA 1WBFA 3ZSMA 3ILNA 5FQ0A 1GLHA 1O3RA 1R1ZA 3FBYA 1VBE3 1WD3A 3AZXA 3T1MA 2R32A 4KBBA 3MF9A 1Z7S3 1HV0A 4NR1A 4Q0QA 1NCRA 4DY5A 4L97A 1HKDA 1AR91 1H9WA 1AX2A 4I3PA 1RUI2 4HPKB 1B35B 2NQYA 2DURA 2VVEA 2WJSA 3THTA 3B00A 4D7YA 1GZ9A 1MEC3 2XH6A 1RTVA 1G86A 1ZZ8A 1J59A 4TSVA 4GMP0 4RHV2 4RS5A 4FOWA 5CVRA 4JVAA 4CEYA 2ZGTA 1I1EA 1G9FA 4OVEA 3LOBA 1S2KA 4AHYA 2HEWF 5J3UA 5KXDA 1J3RA 1VB2A 1UL9A 2B5HA 2VY0A 1REDA 1RUF2 1RUC1 5FOJB 3N4MA 1WLDA 1LHWA 2KM2A 5H9PA 4PQ9A 2PHFA 3BOWA 2D43A 3B5LB 2ZX2A 3USUB 4R9CA 2ZGLA 2CYFA 1RUG3 4Y5Z0 2EXIA 4AHZA 3AYDA 3HT2A 4AGVA 3U07A 4D3WA 3E5QA 4D7TA 5KBFA 3AMQA 2RS33 1JW6A 4WVMB 3AX4A 1IPKA 4IV1A 2R063 1V00A 1OHFA 2VGDA 4YNIA 3WP4A 3CL1A 1S55A 5KXBA 5KXCA 4W6XA 2R042 5DDJ2 2ZABA 4UW5A 2YPJA