1C1LA

Lactose-liganded congerin i
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
135
Chain Sequence
GGLQVKNFDFTVGKFLTVGGFINNSPQRFSVNVGESMNSLSLHLDHRFNYGADQNTIVMNSTLKGDNGWETEQRSTNFTLSAGQYFEITLSYDINKFYIDILDGPNLEFPNRYSKEFLPFLSLAGDARLTLVKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CONGERIN I)
publication title High-resolution structure of the conger eel galectin, congerin I, in lactose-liganded and ligand-free forms: emergence of a new structure class by accelerated evolution.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 32
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 1999-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c1lA00
2GMMA 1AZDA 1Q8PA 3AP6A 1DQ5A 5T50A 3FBYA 3ZSJA 3V0BA 1DQ0A 4SLIA 1JYIA 4XJ9A 3TB0A 5T5PA 3FFZA 4U2AA 1MZ5A 1VIWB 2D6KA 4TZDA 1VAVA 1W6NA 2VW1A 4XBNA 1V00A 3FLRA 4JCKA 5DUUA 2EXHA 2P2KA 1JW6A 3LSEA 2R16A 1N1VA 4XMAA 1LEDA 2VH9A 2OW4A 1DQ6A 4YGBA 3N7LA 3FUQA 3ILNA 5CNAA 4XBQA 3UL2A 2YXSA 4PQ9A 3NV2A 5EYXA 5E89A 3IPVA 3WNXA 1S0DA 5EXOA 2PHRA 3USUB 1FNYA 1V6MA 1VALA 3VKOA 1N1TA 5F5QA 1TEIA 2W08A 3BODA 5F9TA 3VKFC 1FATA 2A6YA 3V65A 1W0OA 4RA0A 4NOTA 4YFZA 2D6MA 5DUVA 2D6LX 3O0VA 4FPCA 2P34A 4BPZA 1EPWA 1N47A 2WNEA 3W59A 1QOOA 2XG3A 3WG2A 1CN1A 3MW4A 4AVSA 3NV4A 2R0HA 1G7YA 2DTWA 3WDUA 2WT0A 4YM1A 1AF9A 2WKKA 1YYNA 2A6ZA 3AZXA 3KM5A 3INAA 1V6IA 1BJQA 1DBNA 1SFYA 1ZM1A 4FVVA 5JLVA 5JOYA 2D6OX 5GALA 1GKBA 1ULEA 4Q8LA 3AX4A 5GJ6A 4M3CF 4GALA 1SLTA 1DGLA 2ZMLA 2DU1A 3U4XA 3VKLA 2GN3A 1HLCA 1SCSA 2B7YA 4FPGA 4XBLA 2ZKNA 1RINA 1JBCA 2ZGRA 1AXKA 1Z78A 2GMEA 1IOAA 3AP5A 1C1FA 3AP4A 4IQPA 1GZWA 1A78A 4MYEA 1LU2A 2ZGTA 2OUJA 4C1XA 3JUUA 4P9YA 4XZPA 1SLBA 2CYFA 3AYAA 4XYXA 3FUOA 4FOYA 4Q1RA 5GLWA 5T5LA 2DV9A 3AZYA 1F31A 4XXAA 4OZXA 1HQWA 1ULDA 3AYDA 2NMNA 1DQ2A 2I2SA 3ZXEA 3ZXLA 4FPLA 2ZGQA 2D44A 1H9PA 1UZZA 5CB7A 3SITA 3WDTA 3WUCA 4FPEA 3T1MA 2D6PA 3AYEA 1CQ9A 4GXLA 3QLQA 3B9CA 3A4UA 4RL7A 1UX6A 5DXDA 4YW3A 3SH4A 2JDZA 3OY8A 4Y24A 2A6XA 2GNTA 2LTNA 1KRIA 1S1AA 1XQNA 1IKQA 3MW2A 4DQAA 3PJQA 1UL9A 3B69A 4YG0A 1SLLA 1PZ9A 3NV3A 3WVJA 1W6QB 1DQ1A 1GNZA 4WZFA 1MZ6A 2BQPA 2A5ZA 2LALA 2ZGSA 3LCPA 3PVNA 4Q26A 4YM2A 1G9DA 1SBFA 2EIGA 1C57A 4GWMA 4Y1XA 1D0HA 3M2MA 4LBJA 1LULA 3AP9A 4ATFA 5DZGA 1URXA 1OQ1A 4Q1PA 1APNA 4BMEA 4FOQA 1W6OB 1LGCA 1WUVA 2DWRA 5GLUA 5AVAA 5HCBA 3AK0A 2XB6C 1Q56A 1LOFA 1MS8A 2DUPA 2GDFA 3W58A 3APBA 5FREA 1QKQA 1ULFA 3MW3A 1AXYA 3WHUA 1G9CA 3V0AA 2D7FA 4WVVA 2ES3A 4BLJA 2ZGUA 3AP7A 2YV8A 1S0GA 1MS4A 2DU0A 2DURA 5JOXA 3POSA 3WCSA 1CR7A 2R49A 5T5OA 1GZ9A 3WZ1A 3D4KA 1YO8A 1WLDA 2DVFA 5SV8A 2D6NA 4LBQD 4GKXA 1FX5A 1IS5A 2ENRA 2NZ9A 4K1ZA 4K1YA 4R9AA 4Y1VA 1CPNA 1KDMA 1SLCA 1QGLA 3N3HA 2ZBJA 4P9XA 1LENA 1IKPA 5HCFA 4PF5A 3H0OA 1LU1A 3WLUA 1MVQA 2VU9A 1LGNA 3ZSKA 3WDYA 1SBEA 1UAIA 1MR5A 2E51A 1ULCA 2NM1A 4LBNA 3RG0A 1UMZA 3OGGA 2PHXA 4D69A 2CY6A 1QNYA 3USUA 1LESA 1V6NA 1YIFA 1JXNA 4XHBA 5GZEA 2CL2A 1IS3A 3GNEA 4YM3A 1JUIA 4Y22B 1PZ8A 4F83A 2D3PA 4ISQA 4CRQA 1V6LA 3M3QA 1W6MB 1HDKA 3O0XA 3BTAA 5T5JA 3DUIA 3WG4A 1D2SA 2AREA 4UW3A 1GZCA 4WV8A 4R9BA 3SH5A 3NWKA 1BYHA 2WLQA 4M01A 1DLLA 3IN9A 1CESA 2PHFA 3RSJA 4BOWA 1C1LA 3N35A 1LHOA 1CJPA 4M3CB 2WT1A 3R4SA 2DYCA 4YZ4A 2GNDA 4XJZA 3RMYA 3ZSLA 1YXWA 1U0AA 1GBGA 4YW5A 3VUOA 3Q9OA 4Y1YA 4AVVA 4ISRA 4M00A 3UJQA 1DZQA 1FV2A 5KXBA 1AJOA 1KQRA 4Z8BA 1QMJA 3POWA 4LBQB 4XHXA 2PHUA 4LBMA 2A3WA 3ZVXA 1OFSA 1ZA4A 2DUQA 4XTPA 4Y1ZA 2VY0A 2NP0A 5H9SA 1QU0A 2OUHA 1IS6A 1WLWA 2SBAA 4I30A 4YGEA 3WDXA 1CPMA 4CTEA 1LECA 1SBDA 3WG1A 4DRVA 2WQZC 3ENRA 1WW4A 1MS1A 4P9WA 2GNBA 1VAMA 3WV6A 3R05A 4NO4A 4XJ8A 2JE9A 1MS3A 1LOFC 1W0PA 4R9DA 5EYYA 2GMPA 5DG2A 5GZDA 3B3QE 4ZXKA 2JECA 2VUAA 3CNAA 3OPZA 5DUWA 4YG3A 3POYA 4P14A 3AFKA 3OBRA 1I3HA 5GM0A 2OVUA 3N7MA 4UW4A 1AX2A 3WHTA 4AGGA 1QF3A 3AZZA 3C2UA 2A71A 2KM2A 4YGDA 3KQRA 2P37A 4FPJA 2C9AA 5T52A 1Z0HA 1DIWA 4ZKTB 2RHPA 2EXIA 1G9AA 3T1LA 4FOVA 3ZYPA 4Y1UA 4Q27A 3ATGA 1S0FA 2YY1A 2NYYA 1PZ7A 4GA9A 1W6QA 1S0EA 3I4IA 1BXHA 3ZXJA 3LSDA 1LOAA 1GNHA 5HCAA 1LOBA 2P3IA 2UWAA 2JD4A 3O0WA 3ZXKA 4AGVA 4U36A 1S0IA 3AZVA 5KXCA 2E7QA 1UN1A 1G9BA 1W6OA 1V6OA 3UJOA 1W6PA 2ZGLA 1Q8SA 4FP3A 5L73A 3RRDA 1BZWA 1WW7A 1KDKA 4FPYA 2W39A 5H9QA 5IT6A 1N1YA 1MS9A 2D3RA 1Y7BA 3M3CA 2UWBA 4ATEA 1LOCA 2JJ6A 2WSVA 3B00A 4WVWA 5DZFA 4FPOB 1JYCA 3QCWA 5GZCA 3HN1A 4XJAA 1KJLA 1S0CA 3ZXFA 1LOGA 4XTMA 3IMNA 1S0BA 3OYWB 3V64A 1SACA 2ZHMA 4YW4A 3PVOA 1KITA 1UZYA 5IK4A 4YG6A 1RITA 2ZHKA 4YM0A 3WOGA 1WD4A 1V6KA 1H9WA 1WW6A 5H9RA 2ZGOA 1MS5A 2NN8A 3M3OA 4Y26A 1FNZA 2CWMA 1SCRA 1G8WA 2FHRA 5GZFA 2D3SA 2UWCA 3TAYA 2YMZA 1O4YA 4DS0A 3DGTA 3WDWA 4DPNA 2ZGKA 4K20A 2ZACA 4KBBA 1AX1A 1ENSA 4XXPA 5E88A 2ZHNA 4YW1A 2GNMA 4JC1A 4YZ1A 1Q8VA 5CA6A 5GLVA 3D5OA 3AJZA 1A3KA 4AYUA 1QDCA 1QOTA 4XMIA 1N3PA 2DVAA 3FLPA 1Q8QA 3V0BB 1RIRA 1GICA 1AJKA 2ZA9A 2ZAAA 2EXJA 1YI7A 2H0BA 2V73A 4FPKA 5EWSA 4AWDA 4XE9A 2CTVA 1GLHA 1NXD1 4JRAA 3MEPA 1GYKA 4ASMB 4CZSA 1W6NB 1WD3A 3ILRA 2A3XA 4TYSA 3RMXA 2ARBA 2C5DA 4PBOA 1R1ZA 1QOSA 5IUQA 1G86A 5KXDA 2ZGPA 3ASIA 4Y22A 1LTEA 1FV3A 2NMOA 1W6MA 1ENRA 1BKZA 1WBFA 3AJYA 4YW2A 3OBTA 3A0NA 1N3QA 1N3OA 4YGCA 1V6JA 1B09A 2CNAA 5JOZA 2EALA 4LBOA 1OKQA 5T54A 4HANA 3IPVB 4AGRA 1LGBA 2A7AA 4M3CA 2YROA 1HKDA 1FAYA 3BIWE 1DQ4A 4UW6A 1LEMA 2AENA 2UURA 5FRAA 3AXDA 5CAZA 1F9KA 5E8AA 2WJSA 1ONAA 3O12A 1AXZA 4BLIA 3WCRA 4M3CE 3I8TA 1CVNA 2ERFA 2GALA 4FQZA 2A75A 4PBPA 2Z42A 2ZMNA 2DVBA 2ZHLA 4LBQA 2R1BA 3B01A 1LHUA 2TEPA 5IK8A 3WDVA 2JE7A 4XOGA 4YZ5A 3HMYA 4ITCA 3SLIA 1SLIA 3ILFA 3OJBA 3VKMA 2EXKA 1N1SA 1GV9A 4HL0A 4C1WA 5IK5A 1DFQA 2DVDA 2GN7A 4BQ1A 2E6VA 3N7JA 4YZ3A 4DRRA 1C4RA 2DTYA 1WCSA 4LBKA 5CBLA 2WT2A 2DVGA 2PHWA 2Q5TA 1G9FA 4PCRA 4Y20B 2W52A 4H55A 4FPFA 1GZWB 3T2TA 3ZSMA 1IS4A 2AGSA 4K21A 3VV1A 3HR9A 4XIOA 2E7TA 2YZ4A 3O5SA 4AVTA 4BM8A 2V5YA 3SNMA 3RS6A 3IKWA 2DUOA 3RQ0A 1YRZA 2VXRA 2PELA 4BMBA 1H30A 1UPSA 1AVBA 1Q8OA 3PMEA 3ZYRA 1LJ7A 1VLNA 4UW5A 4Y20A 4YZ2A 5IK7A 3WUDA 1BQPA 1MVEA 5DG1A 2AUYA 5JOWA 3VKNA 2R1DA 4R9CA 1JHNA 5H9PA 1ULGA 2A6VA 3N36A 3AXEA 2E53A 2W68A 2ZGNA 3M1HA 1QDOA 4XJUA 2AH2A 2VW2A 1QNWA 1DYKA 3D6EA 3FLTA 3OY8B 4XIKA 1JOJA 4L8QA 1DHKB 2PHTA 3L2YA 5T55A 3AZWA 2D43A 3WG3A 3NV1A 3SISA 1LHVA 1ENQA 3JU9A 5BYNA 1LHNA 1CIWA 2A70A 2G4IA 1UKGA 1A8DA 1WBLA 2SLIA 3BOPA 4GKYA 5DUXA 4Q2FA 2ARXA 1LCLA 5DZEA 3ZPYA 3GALA 3PVEA 1SLAA 4FQ4A 1WLCA 2VW0A 1O4ZA 1NLSA 3OYWA 3M3EA 1AX0A 1JN2P 3AYCA 4XILA 4FOWA 1LHWA 4GWNA 4YLZA 1LODA 3SH3A 3UK9A 3MPPG 3R4UA 2A3YA 1W6PB 1J1TA 5JVVA 1WW5A 2ZABA 2AR6A 2ZGMA 4DFSA 4LBLA 1GANA 4Q8KA 2AYHA 1S0JA 1KJRA 2EAKA 2R0FA 3IM0A 1FYUA 3N7KA 2ZMKA 3V0AB 2ZZJA 1HQLA 3A0KA 5LK5A 1F5FA 2EF6A 5JDBA 5JMCA 1X50A 5KXEA 4FP2A 2P3KA 4YFWA 1MACA 5GLTA 1LOEA 5GZGA 1I1EA 5GLZA 2A6WA 4W65A 1MS0A 1GSLA 1DYPA 4XJWA 2HYKA 2WSUA 4XDQA 2FMDA 2JKBA 4FPHA 2P3JA 2UU8A 1CONA 2CWSA
chains in the Genus database with same CATH superfamily
2GMMA 3AP6A 3EHKA 4RHV2 4E27A 5CKQA 1W3VA 1RUF1 3VD9A 4F7ZA 4OHZA 4WM8C 4LO7A 5A7QA 5T5PA 1VJ2A 1WCKA 1QWRA 2JDYA 4R4XA 4TZDA 1CAWA 2RJ2A 2BVBA 1VAVA 1PO12 3HBZA 1PGL2 4UF0A 1QJU1 2P4EA 5FP3A 2ARCA 2R16A 3VBHC 3VHOA 2LW8A 1IPKA 1Q5OA 3VBSC 1RUE3 2OW4A 5JSOA 1ND2A 2XHNA 2AACA 5LBBA 1W8UA 3ETPA 3NQHA 1YHFA 3NRUA 2J1AA 3S7EA 4RR3C 4DY5A 2RV9A 2OS2A 2VBBA 3FUQA 5JPMB 5A6XA 1IG3A 3NV2A 1QHDA 2VTFA 4FXGB 2VVEA 5EYXA 1E5SA 4AEDC 5GKAC 3UGGA 4V1PA 5FYZA 2QQPA 3BIEA 2VZOA 1ULPA 1N1TA 3VKOA 4B7KA 3UKNA 3EB7A 4HKOA 4DEVA 1XU2A 3VKFC 5F9TA 2A6YA 1DZTA 3HQRA 4JDMA 4RA0A 1YQ8A 4UT5A 4NOTA 3VBUA 5JXGA 5DUVA 3MIBA 2R041 2VTXA 1GZTA 2D6LX 3ZFEB 3VZLA 2P34A 3PHMA 4BPZA 3I3BA 2Q4SA 1AR93 1EYBA 2JDKA 5C5UA 4IEVA 3NSTA 2C0ZA 2R0HA 2VTXJ 4IGPA 3WDUA 4OMDA 1TME3 4S2DA 3VBOA 5LRSA 4LE3A 4NHKA 1NCQC 3KMHA 4MGQA 4FFFA 1GWLA 2A1XA 5K8SA 2PMWB 5FZGA 1V6IA 3MBWA 5EIYB 5GJ6A 1GOFA 1UYXA 1ULEA 1QY4A 3WQ7A 1SLTA 1ZBE1 3OF1A 2ZMLA 4B7EA 5CFCA 1W2TA 3MIGA 4D7YA 2B7YA 1NCRC 4XBLA 1UY0A 1JBCA 1CAUB 2GMEA 3AP5A 1IOAA 3ACGA 4IQPA 2K0GA 4NR1A 5C4WA 3VBFC 1GQGA 2VMCA 4P9YA 4DUVA 3NJZA 4KG0A 2XONA 5FYVA 5F2WA 3FUOA 3R0RA 2RM21 2YC4A 4Q1RA 4NIAA 1HN1A 1SPPA 3AZYA 4LORA 4OZXA 1HQWA 1ULDA 2HWC3 4RQPB 1OT5A 3ZXLA 2JEMA 4Z82A 3PNAA 1I5PA 5FYSA 5C8CA 5IVVA 4K40A 5IATA 2D6PA 4COUA 4FCAA 4IEQA 3P3PA 3OB8A 1Q43A 2G19A 5DXDA 5CFDB 4BDVB 3AL5A 1OFNA 4YW3A 5FZ0A 3OY8A 4ZPIA 3WQ1A 2A6XA 2GNTA 2VNOA 4I01A 3CQOA 1JZ5A 1RUJ1 1IKQA 2GZWA 2R073 2Q1MA 1SFPA 1YQ6A 3U78A 4R52A 3J8F3 1MZ6A 4BQ2A 3NW4A 1AL21 4CEYA 5IVCA 4XPVA 2A5ZA 5C70A 2X05A 2Y60A 3GCWA 3PVNA 4FAHA 1SBFA 2XBO2 1G9DA 2JD9A 5FV3A 2JIGA 1LULA 4ATFA 2WZPP 1RJ8A 3LFMA 4NPMA 4ZZ8A 1URXA 5KBFA 1APNA 4XF0A 1H2NA 4FXKB 4D7SA 2RDQA 1LGCA 1FPN1 2JENA 2YG0A 5AVAA 5GLUA 1R093 2GC3A 5LBCA 2XB6C 1Q56A 2GDFA 2W5FA 5A7WA 3W58A 3D0SA 5B4NA 1GUIA 1GFF2 2VOTA 2IC1A 4UFLA 2RS13 3DPRA 5C3OA 1NAEA 4WVVA 4BB3A 1OUSA 5JI7A 5AVPA 3ZIWA 4AFCA 2IXIA 3GXUA 1MS4A 2WN3A 2DU0A 2OA2A 3D82A 3B9IA 1CR7A 1GZ9A 1QJY3 2HWE2 3I59A 1YO8A 4XDOA 1XB9A 3JZVA 4Y3OA 4WVZA 2DVFA 2H0VA 1FX5A 5BNPB 1IS5A 1K5MB 1YJKA 1W2UA 1O3SA 2NZ9A 1R081 4Q4X2 4R9AA 5K4LA 2JKXA 1UYPA 5DDJ3 3ZDVA 3IDBB 5I91A 2ZBJA 1L7RA 1VMHA 3ZFGC 2B9UA 1HRI3 3JBG1 3H0OA 1LU1A 3KB5A 4L99A 3WLUA 4C91A 1C3HA 1LGNA 3WF3A 3ZSKA 2VQ0A 3WDYA 5C3RA 4CEWC 2VOWA 2E51A 4I3PA 2Y6FA 3H8XA 2WS93 1UW8A 4K8FA 1VBC1 3ZOIA 4LUKA 3WP3A 3MIDA 4FBFA 2CY6A 4RS5B 4LUMA 4O9EA 5LEKA 3PIGA 2GC1A 1CAWB 1MEC2 1V6NA 1R1A3 5A7SA 4UF0B 3EMRA 3I2KA 2CL2A 2XJVA 3GDBA 3GNEA 4Y22B 1RUC2 1UZ0A 1QJEA 4QKDA 4F3JA 2RDNA 1V6LA 1XNBA 1W6MB 5A33B 3PUSA 3BTAA 3POJA 4QPIA 5J36A 3I7DA 1PK6C 2AREA 2DCJA 4MX3A 4SBVA 3SH5A 3NWKA 1BYHA 2JG9C 2OXBA 4M01A 4UXAA 1DLLA 4X6QB 2WWUA 4Q0VA 2PHFA 3RI9A 3RSJA 3T3YA 4XQDA 3B7MA 5A3PA 3MICA 2PFWA 5AC92 4AFMA 3BGAA 1V0AA 4XJZA 2WA4A 3AVSA 4ORFA 5FMOL 2Q8EA 2YHJA 2IXHA 1DU3D 2WNVB 1GBGA 1VMJA 4JGZB 3F2ZA 5F5AA 4YW5A 3UNPA 5BNNB 4Y1YA 4CDUB 3H1MA 4NRQA 1UYYA 4BK5A 4GB32 1H1MA 3LD8A 1KQRA 3POWA 4XHXA 5FZ3A 3GBGA 4BISA 1FT9A 4MOAA 3S0MA 1OFSA 2BZDA 5HBAA 2WFF2 1NYWA 2WZR1 2NP0A 2VY0A 2Q1FA 5FY0A 5D8AC 4CCEA 2DDUA 2CU5A 5F7UA 1PHMA 2AZ5A 4BXSV 3DL3A 1YFWA 1CPMA 4LULA 5A80A 1LECA 1RUG2 1YNAA 2RS51 1PVXA 2WQZC 1WW4A 4QQOA 2R7EB 2FDGA 4CDXA 4NO4A 4URAA 1W0PA 4JX0A 4ES9A 4OI0A 3B3QE 3I2IA 2VUAA 4MO3M 5FOJB 4CYDA 4XFGA 4CXYA 4G3YC 2JG8C 1JZ6A 3PUQA 1XPWA 1X9TA 3TWIA 1WZXA 2OVUA 2JDUA 4A7KA 3NJYA 3N7MA 4IEYA 5A3TA 3K51A 3S5AA 5BY5A 1QF3A 2JICA 3N9OA 4FTEA 1W8NA 2KM2A 4FPJA 3TRSB 3UETA 2RMU3 1FMD1 4V2VA 4CCMA 3T1LA 4Q27A 1UYZA 1SPPB 1ZBA3 4A6SA 3ATGA 5FXVA 4ASKA 1S0FA 1NA1B 1TQ5A 4JHZA 5J48A 3PL0A 4MLOA 4NAOA 5C8CB 3WF4A 2QZ3A 3VZKA 2VZ3A 5BNOA 1LOAA 1OD5A 1UIKA 5D1IA 4EYUA 1W8OA 4ASLA 2P3IA 5HCAA 5JZGB 3LDBA 5I0SA 4G4FA 1BBT2 2BGCA 4NWWA 3ZXKA 5FYIA 1HB4A 4K8RB 3MIHA 5FWEA 5C9AB 4L2NA 3CEWA 3MLKA 5JSRA 1W6OA 4QPGA 1C5HA 1W6PA 1Q8SA 4FP3A 1W04A 1BZWA 1KDKA 1MS9A 1ZX5A 1Y7BA 2D3RA 4XUQA 5FJHA 4I2OA 2WSVA 2GP5A 5DZFA 2VL4A 2UY8A 4XJAA 1KJLA 4MV2A 1ODMA 3IMNA 3I3MA 3GZAA 5FWJA 2BERA 1UZVA 2BVVA 1RUI3 4NIIA 1W8TA 4YG6A 1RITA 1GQPA 4Z92B 1EAH2 1JMUB 4XEZA 5B4XA 4KWLA 3HQUA 5KR7A 1V6KA 2YUEA 5H9RA 2ZGOA 1QH7A 4QWNA 3M3OA 3OPTA 1K12A 1FNZA 2C1FA 1IZ3A 3SMHA 1NZCA 4N53A 3HNYM 2CHHA 4DS0A 1GP4A 4LK6A 1WA6X 1RHI1 1K3IA 2ZGKA 1D7PM 3LEGA 5BNQA 5FYMA 3AMMA 1OLME 1RUD1 2H6CA 3SEPA 2GNMA 2VCCA 3HWJA 2XOMA 2QBXA 3D5OA 4AYUA 5FZ1A 5LW9A 4JRLA 4W6WA 4QX2A 1Q8QA 1GICA 4CP0A 2QE3A 4QQ2A 2V73A 5FIXA 3JQWA 4XE9A 2VNRA 4P5YA 1RGSA 4JRAA 4NAMA 3HAGA 4CZSA 1W6NB 2W94A 2WIIB 3RJRA 3WNOA 4E4ZA 1VBA3 2C5DA 1R1ZA 5IUQA 2R063 2CV6A 2RDRA 5KXDA 2ARAA 2ZX3A 3ASIA 1D0GA 4XF4A 2LROA 3ZM8A 1BKZA 4HONA 2RS33 4XC9A 2W47A 3A0NA 4HK8A 4OYUA 5EV7A 1BMV2 5FYYA 1OLRA 5I8SA 2OPWA 2GH2A 2CNAA 1PO21 2EALA 5F32A 4HANA 4A7ZA 5EQUA 3THCA 2PTMA 3VD5A 2X53S 1DG6A 1AL0G 1T6BX 2YROA 3BIWE 4KGQA 1DQ4A 2VMGA 5ANQA 4QKFA 3SEEA 3WQ0A 1U5YA 2IFWA 2XQXA 3CJIC 3DXTA 2WNUB 4QB2A 4K6BA 1YFYA 2Y33A 3BCWA 1ZZCA 2QQUA 2WYSA 5CIRA 3I2DA 4M3CE 3L2HA 4CUAA 2EA7A 1RMU3 3GGLA 2RJLA 4FQZA 4J1WA 4ES8A 2ZMNA 2DVBA 4YWAA 2JDHA 3VHRA 3WDVA 1CD3G 2JE7A 2JXAA 4YZ5A 1YWKA 1SLIA 3ILFA 2HWF2 4Q4Y2 3OJBA 1YQ2A 2VZTA 2Q8OA 5KC5A 1GWKA 5FXZA 3VBHA 5IK5A 1DFQA 3VBSA 2JE8A 1EY2A 4XFCA 3WW3A 2HBTA 4BQ1A 2E6VA 4A45A 4RR3A 1WA4A 3QD6A 2DTYA 1FOD1 1WCSA 3NKGA 4IERA 2P3YA 1H8TB 3ACHA 3ALQA 4Y20B 4AEDA 2O8OA 3C7EA 4RGKA 2W52A 1GZWB 1YEWA 1IS4A 4K21A 2BP6A 4ZS2A 3VV1A 2E7TA 4BM8A 3K3NA 5IVBA 2V5YA 3I2OA 2W1WA 5FY5A 2VXRA 1OLQA 1RUE2 2QTWB 3B94A 4WVMB 1ASJ3 4UW5A 5L9BA 4YZ2A 5IK7A 5C7GA 1BQPA 3UESA 4COVA 4Q0PA 1UOBA 2Y6JA 1JUHA 2YU1A 2AUYA 4HMZA 3VDDC 5H9PA 3VKNA 4BXFA 1UY2A 5A32A 3A23A 3RDIA 3TN91 2BYVE 2E32A 2EAAA 1KXGA 1Z7S3 2GSYA 1S2BA 3ZMNA 1ZRCA 1X8MA 1RVF1 2VZSA 2YC0A 1AR83 1BEV1 1NCQA 4EZHA 1HXS3 2OQ6A 3FMGA 5LBFA 3CDZB 4IEPA 1VMFA 3WY6A 5IYYA 4BIOA 4OQ8A 1WCQA 3ZN6A 4D8MA 3SISA 4RHV1 5ACA3 1PVC1 1UMHA 2RR11 4IV1B 5FZEA 4ZHNA 4OI1A 4GKYA 1OF3A 4DMIA 1VBE1 3K3OA 2WFPA 1PO11 3ZPYA 3RZKA 1TME2 1XJAA 2BNOA 3BOWA 4FQ4A 4OHYA 2VW0A 4PJYA 3VBFA 3OUIA 1I5ZA 3N9QA 1AX0A 3C7OA 4H7MA 4WZCA 4AZZA 1LHWA 3UK9A 3S57A 4LHLA 3R4UA 1YUDA 3ZYBA 1ZZ6A 1W6PB 3RI8A 5FZDA 4HPKA 2AR6A 2ZGMA 1OA4A 4FFHA 4N43A 4DNYA 1QJX2 3IB3A 3O7OA 1H4GA 1S0JA 4HKLA 1KJRA 2R0FA 1RUF3 1FYUA 3ES4A 3IM0A 1HQLA 1H2LA 5CKNA 4KBZA 1MACA 2VCMA 1QJU3 2IXLA 3POGA 3LWCA 1DZRA 1MS0A 4P9IA 1DYPA 1POV1 4AVAA 1RUNA 3W21A 4XJWA 1QJZA 2VZPA 3IAPA 4PI2A 2WSUA 1WMDA 3AKPA 2UU8A 4U2AA 2EIBA 2HWC2 2C24A 1Q8PA 5T50A 2YDEA 3T2OA 4SLIA 2VMFA 5C3SA 4XJ9A 1JOBA 1HQNA 5IWFA 2Y38A 1XC6A 4Y5SA 5DUUA 2GP3A 2VZQA 4Q4W1 3VBRC 4B29A 2J7MA 1RUH1 4LPLA 2R072 4UFKA 5FMBA 5IAVA 1DQ6A 2R043 3OUJA 5FUIA 1QQP3 3ILNA 5CNAA 4XBQA 1NQJA 3W20A 4DXZA 4PQ9A 1ZZBA 3AM2A 3WNXA 4NROA 1JI6A 1VALA 4BA6A 2FMYA 2ORXA 4Q0QA 1MQTC 1UWWA 4CP9B 1XRUA 4KG8A 1FATA 1CAVB 2QDRA 2WC2A 5ABJB 2Q0AA 3PDQA 3EXUA 4OCTA 2FCUA 4KWUA 1J58A 2Y0OA 4TSVA 3MHZA 2QZ2A 1WMEA 4H3WA 2WNEA 3W59A 2E63A 2BUKA 1Y9QA 1QXPA 3ZR6A 2XG3A 2CSGA 4CDWB 1CN1A 3FE5A 4AVSA 2RS12 3NV4A 2YFZA 5FY9A 4AK3A 1US2A 2DTWA 5F8PA 3BUCA 4AVCA 4LO8A 1OOPA 1X9PA 2IXJA 2WKKA 4XFHA 3ZFGA 2DBNA 4XFIA 5FKCA 2A6ZA 5IFPA 3KM5A 2AC1A 5L36A 1DBNA 1ZM1A 2TUNA 1QJY2 2XKOA 4D0QA 2W95A 5JOYA 5GALA 1GKBA 2IXCA 4M3CF 1UU6A 4GALA 5E1RA 3M4FA 1DGLA 2VXJA 3RPQA 3VKLA 5F37A 4WM8B 1SCSA 3D0JA 1PX4A 1UZWA 5A7OA 2ZKNA 3H50A 2BNMA 1XXNA 1Z78A 4MYEA 4AAPA 1A78A 4IE4A 4PDWC 3THTA 2OUJA 3JUUA 2ZXQA 4IL7A 3PTRB 1HRI2 2CYFA 1HB2A 3WW1A 1RUJ3 3LDRA 4XXAA 5FMCA 3C7FA 1IQDC 4CU7A 1SG3A 3ZXEA 2I2SA 5A1FA 4XETA 2ZGQA 2C6SA 3AL6A 5CB7A 4ET7A 5CISA 1AL23 5F3IA 3CL1A 2FDKA 2G9GA 5FUPA 3SQOA 3A4UA 4RL7A 1UX6A 1R1A2 4OUMA 4BWOA 1XOYA 4UFIA 1LNSA 2JDZA 2DFCA 2YBSA 4EJRA 2R32A 1FPN3 1CZSA 1XNTA 1TMF2 3WVJA 1W6QB 1L3JA 1GNZA 4D3WA 4WZFA 4A3XA 5B2GB 3MIEA 1OH4A 2BQPA 4Q4X1 4P9JA 4Q26A 1C57A 1BLZA 1FI2A 2WO2A 4GWMA 4Y1XA 5D8AA 4M4PA 1ZRDA 4UAPA 3URFA 1ZRRA 1OQ1A 1XSQA 2ZX1A 5DAXA 3NJXA 5FK7A 3ECQA 3WXPA 5A3UA 4FOQA 3WP5A 4UOJA 1WUVA 1ZVFA 3FBMA 1C5IA 3WEZA 3KCCA 1MS8A 4LKSA 5LBEA 1QKQA 2ETEA 2YU2A 1ULFA 4RGAA 3AFGA 3WHUA 2MEV2 2IXKA 2JG8A 4C0HA 3DKQA 4ZZ5A 1R083 3U0ZA 1NCRB 1MEC1 4BQYA 1KS5A 2ES3A 3O1OA 3AP7A 1TNRA 2YV8A 3GCXA 1O6UA 1W2OA 3IAQA 3HEIA 4MZUA 1POV0 1RUC1 3POSA 3KV6A 3JBG3 3U11A 1V9U1 2AEZA 1VRH1 3WZ1A 2VOXA 3N9PA 5FLJA 4UFHA 3K48A 1O5LA 1WLDA 1OMIA 4JTOA 4RYDA 3IBMA 3HOBA 4LBQD 3GBFA 4JAAA 4AVBA 3MPBA 3BB6A 5FP7A 4OHXA 1JYNA 5DAVA 3JD71 1VBC3 2WBKA 4BZ4A 1VBD2 4MHRA 1KDMA 4QXBA 1QGLA 3KT1A 4YVSB 1UKRA 4RGGA 1OI6A 2BJSA 4P9XA 4C0BA 1IKPA 1OVSA 2RMU2 3QACA 3P3NA 2WRAA 3UYJA 3HD8B 4YVWC 4YARA 4GB31 1MR5A 1ULCA 4OULA 2AEYA 1ND3A 5FY1A 5L7OC 4EE2A 3E6DA 4FSJA 2WFF1 3W5MA 4AW7A 4LO6B 4XUNA 2OZJA 3USUA 1YIFA 2CGOA 2XJTA 5GZEA 4JHTA 4PIYA 4A44A 1NOVA 2BOJA 4YM3A 4F83A 3WNMA 1AUYA 3POFA 2WO3A 3LFIA 3OGSA 4CRQA 1H8VA 1HDKA 1OPOA 3O0XA 4HT1T 3DUIA 3WG4A 2PLV1 4HBNA 1D2SA 2WR9A 1WMFA 4UW3A 1GZCA 4CDQA 1TE1B 2WLQA 1UX7A 4Z2AA 1CESA 2FQPA 4EZ4A 4BOWA 3H7JA 2QDNA 1C1LA 1CX4A 4MXWB 3ZFFC 3NNGA 3KS7A 3RYKA 2W1SA 2WZR3 2IUWA 2WT1A 5FZ4A 1O3TA 2GNDA 4WM7B 1X36A 2WZEA 4IV3B 3RFRA 1RUI2 4QX7A 2RS53 3VUOA 2VM9A 4NRMA 4AVVA 4ISRA 5FMDA 3WF2A 2VGDA 2Q30A 3HBKA 1AR72 1IPJA 1QMJA 2W9XA 4NRPA 4Z8BA 2PHUA 1TZOA 2VG9A 3ZVXA 1B35B 2DUQA 1BBT1 2OUHA 4A2UA 1H2KA 1WLWA 2SBAA 3I2JA 4I30A 4ZU4A 3WR0A 4BQ5A 4DINB 3WDXA 4RFRB 2WDBA 3OEBA 3IMMA 3ENRA 3RZMA 1MS1A 2GNBA 3MDPA 3R05A 4CEWB 4MH0E 1DYOA 2JE9A 2J42A 4N43C 4OI4A 4HFSA 3NO8A 4XABA 5LY2A 4UWDA 3CNAA 5F3GA 4HKWA 1HW5A 2GAUA 3F95A 5GM0A 2XPJA 3Q8BA 2UYAA 4UW4A 4DXRA 3OOXA 3WUCA 5FZBA 2H6BA 2BBVA 3AZZA 1VBA2 3WNPA 3CJIA 4YGDA 3UKVA 2C26A 5T52A 4YRDA 1Z0HA 4E4SA 2OZ6A 4ZKTB 3ZXAC 5K0UC 4XQWA 3K4DA 4FOVA 4NUBA 3VD4A 1J84A 1PK6B 3OD4A 2YY1A 2XJRA 1GOGA 1OPMA 2WQ8A 3POEA 4I0WB 3E6CC 1S0EA 1BXHA 1UU5A 2JG9B 1U5XA 4KU7A 3ZXJA 4D6QA 5L9VA 1LOBA 3I3DA 3O0WA 4XAEA 3ZKYA 2QQVA 4CCDA 1GOHA 1PX3A 4AGVA 4NPRA 1S0IA 1AYM1 3MF9A 4I09A 1YQCA 3K4AA 5KXCA 2Z4FA 2E7QA 4B1MA 1UN1A 4K3UA 4L9BA 5I0RA 3DYMA 3MUY1 3O14A 2ZGLA 5L73A 3LPGA 1F2NA 2BW8A 4FPYA 4TXWA 4Y5Z0 5FYHA 4BE3A 3NVCA 3ZMOA 2UWBA 2XJPA 1LOCA 3G6JB 2W91A 3B00A 3CHXA 3HT1A 4NHLA 2WZ8A 4ZS3A 4CVUA 1JYCA 3QCWA 3HN1A 1RXFA 3U1XA 2B45X 1S0CA 2YPDA 3A22A 3OYWB 5FZ7A 1SACA 2ADEA 2B5HA 1RHI3 2ZHMA 1DGRA 1V70A 4RFT0 2ET7A 3USSA 5IK4A 1RUD3 3ZN5A 2ZHKA 1BMV1 3ACLA 3H7YA 4YM0A 4I02A 2IVIB 1XE8A 3OBZA 5M0TA 4LEJA 3VDDA 3VDCA 2NN8A 2JB4A 4IEXA 1A6CA 2VUCA 2FHRA 2Y0IA 3PU3A 4Q4V1 2UWCA 3E97A 1VE0A 2YMZA 3ACFA 5GZFA 3WP4A 1Q3EA 4KWJA 1OOPC 5FYBA 5E88A 1AX1A 4Q0SA 4XXPA 2PAKA 1UY4A 1ZZ7A 3MGUA 2ZHNA 4YZ1A 4JC1A 1XNDA 5CA6A 3GJAA 4CSWA 1A3KA 2YGMA 1EUUA 2V5DA 4XMIA 3H8OA 2LS6A 5LB6A 1N3PA 3FLPA 1J3QA 3EJKA 4XURA 3LOIA 4LITA 3ZO0B 2EXJA 1RL3A 1YI7A 2H0BA 4FPKA 5EWSA 4AE2A 1K45A 1PO23 1PM7A 3ZDSA 4FI9A 4J6GA 4AI8A 4LLOA 2RE9A 1KS4A 3ILRA 4GIQA 2A3XA 4TYSA 1ACCA 3SC7X 1HXS2 1OHFA 2NMOA 4H2AA 4FFIA 1ENRA 1UNBA 1WBFA 3AJYA 1ND2B 1JH5A 1N3QA 3AMQA 3VB9A 1S2EA 1N3OA 4RQPC 3OUHA 4YGCA 1B09A 5FZKA 4LBOA 2QUOA 2FDJA 3QOPA 1VBB2 3BTXA 4QGNA 4QKBA 1JODA 2A7AA 2VMEA 3WNNA 4E4HA 4AHYA 4M3CA 1HKDA 1FAYA 4C8DA 1BVVA 5CFDC 2UURA 2V4AA 3I3EA 4JGYC 3T2PA 1O5UA 1OBNA 1US3A 3VBUB 4EN7B 2BV4A 3H3ZA 4E8CA 1AYN1 3WCRA 3NNLA 2W2IA 1CVNA 3DKWA 2HWD2 2GALA 2HWB2 3ORJA 4E4DX 2VECA 2Z42A 4LBQA 2ZHLA 2R1BA 2WNOA 1FOD3 1BVP1 1GP6A 3OTFA 1GU3A 5A7PA 5J96B 5IK8A 4AEJA 3AVRA 2IVJA 4XOGA 2X10A 4GMP1 4LXLA 3VBOB 4BQ4A 4CU8A 4LE4A 3VKMA 2P5BA 2EXKA 2JDNA 1GV9A 2VD7A 3GYDA 4YW6A 2XWBB 3VBRA 1W9WA 1ODNA 4DY3A 3ZSEA 5F39A 2B39A 4MGYE 4IUGA 2DVDA 3THDA 3JCIA 1HRV1 4KH9A 1XYNA 5CZKA 5I93A 3N7JA 4JQTA 4DRRA 1CAXA 2V09A 1C4RA 5CFCB 5CBLA 1RXGA 1W06A 1D4M1 2FZ1A 4W6XA 2DVGA 4Z2WA 3TN93 1G9FA 1NE6A 5JCTA 2XVKA 1RVF3 1UD1A 2E9QA 3FN9A 1MQTA 3V56A 5C4WB 1BEV3 3HR9A 2J22A 2BBAA 2YZ4A 1ZNPA 4XIOA 1R64A 3SNMA 4AVTA 3RS6A 4JKKA 1J59A 3J7MA 1JS9A 1YRZA 3RQ0A 3NJVA 2PELA 1FXZA 1H30A 5E6HA 1AVBA 3VZJA 2ZPXA 3ZKUA 2R042 4EQVA 1PIV1 1MVEA 1QJX1 1AR61 4INDA 1QQP2 4RHV3 5DG1A 1PVC3 4AQSA 2RR13 2WABA 2R1DA 3ON7A 1JHNA 1K5MC 5APAA 2A6VA 3M3IA 2G9FA 5CVRA 5BNPC 3MYXA 1VBE3 3LA3A 2W68A 5LA2A 1PO13 1QDOA 4XW3A 4LO5B 3KV4A 5HV4A 1JU4A 4QQHA 3OY8B 3KV9A 4HZFA 4AFDA 1J1LA 4L8QA 4AHXA 2JDAA 1COV2 1DP0A 2N7GA 1K42A 3NV1A 3ZYGA 1LHVA 5BYNA 2OQ7A 3JU9A 4N7IA 5FQ0A 1ND3C 1T2XA 4CEYB 2A70A 4AI2A 1C8M2 4MGZE 4Q2FA 4RS5C 4UI9L 2ARXA 1LCLA 2QQIA 3AKQA 4LIUA 1DGWX 2KD7A 4PDWA 3OEAA 2OPKA 1O4ZA 1NLSA 2MHFA 1JN2P 1POV3 5FY8A 4YLZA 3LOBA 3H8UA 4NIDA 2VZ1A 2JDMA 3FC0A 4QX1A 1WW5A 4CDQC 1OSGA 4DFSA 2VZUA 5A7WB 4ARXA 1GANA 2ZEZA 3DECA 3N7KA 4E2QA 4DUWA 2ZMKA 3DPRB 2ZZJA 3A0KA 3ST7A 5LK5A 5KXEA 1Y9GA 4XF3A 4XFFA 2CDPA 4FP2A 4YFWA 5GZGA 3CZUA 4CCKA 4W65A 2J1SA 4LTAA 4Q4W3 2HYKA 2XXZA 1XYPA 3LEKA 4JGZC 4QHZA 4Q5OA 4X6RB 1RUH3 3I59B 4ZU5A 2FBEA 4D6RA 4CA9A 4IE5A 4AI0A 1WLTA 4AQ6A 3GZTB 4OMCA 5FZOA 3V0BA 3WNKA 4Q0UA 1OQDA 1JYIA 1D2QA 1HV0A 5F5IA 3TB0A 3FFZA 1MZ5A 2GC2A 2D6KA 1Y43B 4OUSA 2VW1A 1J83A 1YIPA 3R6SA 4W50A 3CIHA 3RGBA 1E5IA 1V00A 3FLRA 1LR5A 4OVEA 2EXHA 2FCVA 1JW6A 2P2KA 3LSEA 3NAPA 2F4PA 4XMAA 4BHPA 3TEXA 1QJY1 1DDLA 1OURA 1FPN2 3Q8FA 4EROA 3N7LA 5DAQA 1EV12 1IGOA 1EP0A 1QH6A 2YXSA 1U12A 3FL7A 3IPVA 4L0PA 2QQJA 1O59A 5F5QA 1TEIA 1HRI1 2W08A 3M7AA 1PNGA 3V65A 1NLRA 2Q1ZB 2QKDA 5A6ZA 2D6MA 4QPIB 1W2NA 4PLMA 1XE7A 5FCCA 5JAXA 5BV6A 1NA1C 3SKVA 1N47A 4TLFA 3ME2A 1QOOA 3WG2A 3MW4A 5FOBB 2QNKA 4L11A 1R082 4YVWA 5JZGC 4GMP0 1UXXX 2DCTA 5LEJA 4YM1A 1NUKA 1AF9A 2ZX4A 3VL9A 5KHIA 3MZHA 4LKFA 5C9AC 4P00B 4NN0A 5JR7B 4JDNA 3JBG2 4S2HA 2NPIA 3WD5A 3O1SA 1BJQA 4LHNA 2ILMA 5JLVA 3CO2A 2X29A 2PHLA 3BU0A 1TMF1 2D6OX 2XGXA 2L9LA 3AB0A 4O9GA 1D4VB 1O4TA 1NT0A 4Q8LA 5FP9A 3DXUA 5FUNA 2XJUA 1PGW2 5L7OA 1OF4A 5CADA 2GN3A 1HLCA 1VBC2 4FPGA 2WQ4A 1RINA 2ZGRA 3W9AA 1AXKA 5A3MA 5DMYA 2W1UA 3ZYHA 2YGLA 3E5XA 2ZGTA 2YC2A 4P9GA 4C1XA 3FZ3A 4GULA 4XZPA 3SCFA 3AYAA 3PLQA 4XYXA 2DCZA 2XMLA 4CDXB 2DV9A 1F31A 1OVPA 2EICA 4H14A 4CCJA 3AYDA 4AQTA 1DQ2A 5JPNB 1GNYA 3IDAA 3N9MA 4FPLA 4YSFA 2D44A 1H9PA 1MZFA 3SITA 3WDTA 2MEV1 1E57A 4FPEA 4QGLA 2VMDA 3AYEA 1SHWB 4LOTA 4N9IA 2PN5A 3T0BA 3ZFFA 4GH4C 2J1VA 3OGVA 3GM8A 2TNFA 3KCYA 2IZWA 5CU1A 1H2MA 5IVFA 3FHIB 3U37A 3MFAA 1NXMA 5I0UA 5A7NA 2KR2A 2VVFA 1S1AA 1XQNA 1H0BA 3P6BA 3KF3A 2XVGA 3PJQA 4DQAA 4LA3A 3M70A 4NMIA 4YG0A 3MI8A 1PZ9A 3NV3A 5LATA 4BU2A 5C5TA 3BVCA 1DQ1A 3K4ZA 1GR3A 3RWNA 3LGRA 3VHPA 4MGTA 2WYFA 5BNOB 1AR92 4S2GA 2OT7A 1VBD1 1W8HA 2LALA 2ZGSA 4YM2A 1PGL1 1W8FA 2J1EA 4QU1A 2X5IC 1NY72 1D0HA 2WZR2 3SXWA 2XHKA 3AP9A 4LBJA 3ETQA 5FDBA 2WO1A 3GHNA 5DZGA 3FJSA 2G1MA 1VB2A 2RMU1 4BMEA 3AMNA 2WN2A 2P1BA 4HSJA 1W6OB 3BPZA 4QPGB 4XFAA 3T2QA 1V9U3 2RS52 2XQRA 1VRH3 5HCBA 3AK0A 4QX0A 3MFCA 4OUEA 2ZCWA 3APBA 3AMPA 4CP2A 3OSDA 3MW3A 1AXYA 4J25A 3V0AA 2D7FA 4UBGA 3JD73 5C33A 2WAOA 4XACA 4PDWB 3MLLA 3WF1A 2DURA 2D40A 5K0UA 1NX9A 1OQEA 2R49A 2WNUC 5T5OA 2BOIA 4Y4YA 4O61A 3GZEA 3ELNA 4YYOA 2VBDA 4LKEA 4GB33 5SV8A 3JB4C 3VZNA 2VCBA 3AKSA 4HVOA 4COZA 4XDPA 4PIXA 1F4AA 5SV5A 2WFF3 2YPJA 4IEZA 4Y1VA 4AQ2A 4N53B 3KCXA 4AOCA 4OFGA 3RVHA 3S6PA 2ZX0A 1LENA 4IE7A 2BFUS 4XUPA 4D94A 4PIZA 1XNKA 3J9SA 4M0NA 5LA9A 1MVQA 2IWGB 4V2WA 4QB1A 2E31A 4FTSA 5A6QA 2ORZA 1F5JA 3VD7A 1UAIA 3LZZA 2PLV3 4JDOA 5FTTC 2FZ2A 3J8F2 4JTNA 1AR71 3P1IA 2NM1A 1UOGA 3RG0A 1UMZA 5FP4A 2BGPA 4KQ7A 2PHXA 2I74A 2FD8A 1QNYA 1H8TC 2UY9A 2W1QA 2WLPA 4QAWA 1LESA 1W39A 4FTBA 1HJFA 1REEA 2Z79A 4XCBA 3CLPA 4IGOA 4C90A 1JUIA 1M4WA 4AI9A 3I2GA 2WA3A 2XUMA 4AF9A 3M3QA 5EHDA 4EV0A 5T5JA 1R092 3CJXA 2XDVA 3QBQA 2RVAA 4R9BA 5J7MA 4Y5TA 4IE0A 3TYJA 1ZBE3 5LK7B 1TG7A 4BJ0A 5HCHA 3J7LA 3T30A 2E26A 1PNFA 4PT6A 5BXXA 3WW4A 1K5JA 1ZZ8A 1CJPA 1IG0A 1CGPA 1BBT3 2WINB 3H1YA 3R4SA 1VBA1 1W9SA 4YZ4A 4A41A 4AHZA 4QQLA 3KGZA 3EBRA 3ZSLA 1RHI2 1YXWA 1LRHA 3B93A 1ST8A 4CCOA 1GMMA 1GQHA 2RM23 1O7FA 2J1RA 4O7XA 1VP6A 4M00A 3O1PA 5KXBA 1DZQA 1FV2A 1HX6A 2F4LA 4W4ZA 3VZOA 4QHOA 4IV1C 1UPIA 5ISLA 2XBO1 5DDJ2 2PHDA 4ZU7A 5IVJA 3BTZA 4XTPA 4L92A 2BNNA 1QU0A 4PF1A 2XLGA 1IS6A 5F6KA 1JYWA 4YGEA 1UXZA 3H3UA 4LO4B 4NHXA 3VBHB 3ZYJB 3RZHA 1SBDA 3WG1A 3OD0A 3VBSB 1L7QA 1VAMA 4NWVA 3WV6A 4CCLA 1C8NA 4XJ8A 5CG9A 1MS3A 1LOFC 3POIA 4R9DA 4RQPA 3I97A 2GMPA 4URTA 4YVWB 4RR3B 4IEOA 5EYYA 3OPZA 5DUWA 2WS92 4YG3A 2QQKA 2XR4A 5I0TA 4P14A 5KHKA 3AFKA 3OBRA 5L7OB 1I3HA 1MZEA 1PO22 2ZTNA 5FZ6A 3TEZA 4AEDB 1WCUA 3WX5A 1YQ5A 1AX2A 2Y34A 3KLSA 5FXXA 5CFDA 3C2UA 4MGSA 2A71A 4JGYA 3MIFA 2P37A 1AYM3 2C9AA 2HBUA 4A3ZA 5FAXA 2HWE1 1G9AA 3ZR5A 1RB8G 4Y1UA 1REFA 2NYYA 1PZ7A 1JHJA 3E1F1 4GA9A 5A32B 4BQXA 1UCXA 4EN8B 3LSDA 4UBHA 2B46X 1GNHA 4AL9A 1REDA 2UWAA 4KL1A 1PM4A 3GBWA 5FLIA 4UYBA 5FY7A 2EIEA 1NCQB 2DFBA 2C4XA 3L9JT 3NAPC 3GJBA 1VAKA 5FKBA 4Z07A 3LB9A 3C8XA 3T08A 2K9ZA 1V6OA 1WWYA 4F8AA 3RZGA 3ZN6B 3RRDA 2BEOA 1Y3TA 5H9QA 1T6GC 3I2FA 1SQ4A 2GH8A 1N1YA 3HNMA 3M3CA 1UF2C 2HYXA 3KD4A 2VAUA 2JJ6A 4K7JA 4LIVA 4QDQA 2TBVA 2XL7A 1FOD2 4HXCA 2VNVA 4HN1A 2PYTA 1IHMA 4Y4RA 3TNPB 2MPFA 4Q4V3 5F5CA 5FZ8A 1LOGA 1OXCA 2ZEXA 3VBFB 1XBFA 3ZXFA 5A3OA 4DO0A 1I9RA 4YW4A 3PVOA 3M8LA 3ZXGA 1JZ3A 1UZYA 5FO9B 3VD3A 4LJHA 4IEUA 2RJKA 1UMIA 5IVEA 4CPBD 4TN7A 3N4MA 4HPKB 3IWZA 1XNCA 4QPYA 1H1IA 4N43B 1H9WA 1WW6A 2CAUA 3MF6A 2VE1A 4KGGA 1MS5A 1NE4A 3VGIA 1K5MA 1SZBA 1TNFA 1P8JA 1VBB1 1UQXA 4CDWC 2CWMA 3MV11 5J3UA 3H8RA 1G8WA 2CDOA 2I45A 2D3SA 3TN92 3TAYA 3ACIA 5AC91 2JWPA 2VUJA 3G7DA 5JOWA 2QFEA 4O65A 1RVF2 3J26N 3WDWA 5JR2A 4KMQA 1ZREA 1J3RA 2PAMA 2ZACA 4K20A 1F8VA 4YW1A 2OYZA 3CF6E 4Z1VA 5FPVA 1Q8VA 1WGPA 1ZBA2 3AJZA 1JU3A 1QDCA 1QOTA 4QU2A 5DN2A 5FZ9A 4HG6B 2HWD1 3ZN4A 2HWB1 4AEKA 1RIRA 4W8JA 1AJKA 5EPAA 2B8MA 3X29B 1PVC2 5K9YA 2RR12 2VUDA 2ZAHA 2D97A 3UGHA 4A7YA 4RS5A 1VBE2 2PQQA 4ASMB 4R4ZA 4H7LA 3E5UA 1XE0A 2ARBA 3RMXA 1QOSA 1G86A 1RUG1 4Y22A 1LTEA 5I8TA 5KC6A 4JKMA 1W6MA 5ANNA 5A33A 3S30A 4QX5A 1SDWA 4YW2A 4UFJA 3OBTA 5L9RA 1AYN3 2B9VA 5JIAA 4A42A 2ADDA 5FPBA 1V6JA 2DCKA 4LK7A 4AFBA 1ZRFA 2LRPA 3SCGA 2I07B 5CG8A 1W8ZA 4X8PA 2CGPA 5AFBA 4JV4A 3T09A 4AEMA 4BQ3A 4XCAA 5F3EA 4GMP3 3WQBA 1MPXA 4ARYA 3WP6A 2BPA2 4NHMA 4P08A 2AENA 3O1RA 1Y4WA 3OGRA 5CAZA 3OG2A 1KEXA 1F9KA 5FZLA 2WNVA 4JGZA 1ONAA 3VDAA 1F15A 4QDRA 3O12A 5BNNA 4CDUA 4DUXA 1HIXA 1HRV3 1QQP1 4GQ7A 5KWRA 1OKOA 2WWJA 4PBPA 5EFUA 5JXIA 3B01A 3KWVA 1DF0A 1D4M3 2TEPA 5CEHA 5I8YA 2D5HA 4ITCA 4WBBA 2ZEYA 4CU9A 1HN0A 1N1SA 1OOPB 3IT8A 3ZFGB 2O1QA 4HL0A 4C1WA 3LEMA 3LA7A 3WNLA 1FMD3 1BK1A 4Q4W2 2W92A 1COV1 3CU7A 4XAAA 4OQ9A 1RUH2 4N8MA 4QX8A 4LT5A 4ONUA 1HJGA 3VHNA 2BWCA 5A70A 2QJVA 1PIV3 4YZ3A 1QJX3 3I3QA 1AR63 4MGIE 1QIQA 4LBKA 4MXVA 4B3NA 1C8M1 5FPUA 1NG0A 2PHWA 2Q5TA 4PCRA 4QQPA 3AC0A 4H55A 4FPFA 1HB3A 2R30A 4OLLA 1A34A 2AGSA 1RC6A 2R062 3RJ2X 5IHRA 3IKWA 3FHAA 3TBDA 4BMBA 3KT4A 2RS32 1EAH1 3EQEA 3PMEA 4IE6A 5IW0A 1O3RA 1UOFA 1NA1A 4MHUA 5A6YA 3THPA 5LZ6A 3N36A 1KFUL 2VBPA 5JZGA 3AXEA 2E53A 3E5QA 5HPOA 2ZGNA 2NLRA 4YVSC 3HQXA 4FO9A 4LQRA 4XJUA 1CWPA 3ABZA 5FXWA 4IW3A 5C3PA 4JGYB 1OC1A 4BYYA 1DYKA 3FLTA 4OHVA 4LOSA 5C9AA 1VR3A 1JOJA 1JZ7A 4B4RA 3BTYA 4NVPA 2X09A 2D43A 4GWIA 1ENQA 1RMU2 3T4HB 5HI0A 3KGLA 5FP8A 1LHNA 3POBA 1CIWA 2G4IA 1WBLA 1A8DA 1XYOA 3BOPA 5F1RA 5FMOS 5DUXA 3WW2A 1UIJA 1GP5A 3C7GA 3LAGA 5D8AB 3GALA 1UY1A 2B42B 3PVEA 3ZYFA 2FDFA 4PLOA 4NPLA 1WLCA 3AMHA 2HKXA 2WL1A 2P6CA 3AYCA 3K77A 4FOWA 4GWNA 4XILA 3SH3A 4UFMA 1O3QA 3ITQA 2VQUA 2A3YA 3BU7A 3ZFEC 4OZOA 4ZXEA 4LBLA 4Q8KA 1H4HA 2AYHA 4AHWA 1OLMA 5JWPA 1EV11 2EAKA 1QXRA 3LKJA 4IGQA 2JG8B 4L97A 3IDEA 4GH4A 1SMVA 5JMCA 5JDBA 1X50A 3FWEA 1XNAA 4MGKE 5GLTA 4EN6B 1LOEA 3K75B 1NQDA 4WM7C 1F35A 4FT8A 5HXMA 1ZYBA 4AAXA 4IV3C 4ZONA 2VQAA 4DIQA 2FMDA 2JKBA 4FPHA 1ASJ2 5IFTA 1CONA 2CWSA 1C28A 5I0DA 3NMBA 1ZRIA 1AZDA 2XWJB 3ZSJA 1DQ5A 1NLQA 2Y8KA 3FBYA 1DQ0A 2Z5WA 3LIHA 4DEQA 3RYRA 4QB6A 3UT0A 1VIWB 1Z7S2 1B35C 4Q4Y1 2HWF1 3TNQA 4XZUG 1OA3A 1W6NA 2X5IA 3U75A 5DAWA 1AR82 2WAAA 4HOOA 4XBNA 4JCKA 1X33A 3RWKX 1BHGA 2FCTA 4LA2A 4I3GA 1N1VA 1LEDA 2VH9A 1X8EA 4R8HA 2VCAA 4B4QA 2HLEA 4JQRA 5ACA2 4YGBA 3KV5A 1PGW1 4HLTA 4CUCA 5FBZA 1ND3B 3N9NA 3UL2A 3S7IA 2LM3A 2K46A 5LA1A 5LCWL 2XVLA 5E89A 1S0DA 5EXOA 2PHRA 2V4VA 3USUB 2JDPA 1FNYA 1V6MA 2Y64A 3UKTA 5J37A 1HV1A 1SEFA 4GJYA 1W03A 1RYYA 3BODA 4YNIA 5IJRA 3KZ4C 4A6OA 4AG4A 2WNUA 3PUAA 1W0OA 1RUE1 4COYA 5FR3A 3OPWA 4YFZA 4BH9A 1V9U2 1VRH2 3O0VA 3KF5A 1OD3A 4TLGA 4IXLA 4CDQB 4FPCA 4CPBA 1TMF3 5LY1A 4EN9B 3PURA 1EPWA 2V72A 4EWAA 1RUF2 4CXXA 4DOUA 2VOVA 2JIJA 1G7YA 3JD72 2R6QA 5A3WA 5A3NA 1LB2A 2WT0A 5D2AA 4DXTA 1QJU2 4CXWA 1RJ7A 1CX1A 1YYNA 4CU6A 1HB1A 3BN6A 3AZXA 5JSPA 3INAA 1EUTA 3UV9A 4FVVA 1SFYA 3DCQA 2BWAA 3AX4A 5D21A 5FBJA 3BKZA 2FDHA 4NIHA 2HEYF 1AR91 4CE8A 2X8KA 2DU1A 3U4XA 1H6XA 2MEV3 2PA7A 1H8TA 1TME1 2WO7A 4Y20A 1NY71 3WUDA 3ZXDA 1C1FA 3AP4A 1GZWA 1BK0A 2K2SA 1LU2A 1QXJA 5J1XA 1SLBA 4LLFA 1W8WA 4IESA 1RTVA 2UYBA 4FOYA 5GLWA 5T5LA 1O8PA 4WVMA 5IVYA 5HV0A 5JXJA 2PLV2 2NMNA 1DLCA 3HPNA 2GC0A 1UZZA 4HK9A 4YW7A 3T1MA 3DN7A 1CQ9A 4GXLA 3QLQA 3B9CA 1VBD3 4IEWA 3U14A 3T0DA 4Y33A 4KI5M 1W90A 1Y9MA 3B5LB 3O1VA 3CJIB 4KNCA 3SH4A 2VVDA 1ZZ9A 4Y24A 2LTNA 1KRIA 3KHBA 2Y6GA 3MW2A 1UL9A 2YBKA 3B69A 5FYTA 2HWC1 5J98B 3LF7A 4JZRA 1SLLA 4XF1A 4D6SA 5JIUA 2BRTA 1JYXA 1JZ2A 4IV1A 3Q8CA 1ZBE2 4OHWA 4IETA 1W0NA 1A8MA 2JB8A 3IDCB 2OIIA 3RZZA 2WWSA 3LCPA 3PJYA 2EIGA 2QQMA 3M2MA 4DZGA 2QQLA 4E2GA 2LUWA 4BK4A 4Q1PA 4P02B 2R071 4BIFA 2DWRA 1KD7A 2RM22 1ND2C 2KA3A 2VNGA 1LOFA 3J8F1 1O8SA 2DUPA 3DF0A 2D98A 5FREA 1KFXL 5C3QA 2GU9A 2RDSA 3CBNA 1G9CA 3KSCA 5EJ1B 3ZX7A 2OX0A 4MG2A 5BUVA 3HNBM 2ZGUA 4BLJA 2BU9A 1S0GA 3ROUA 5JOXA 4MUVA 3WCSA 4JVAA 2WNVC 3VBUC 1TVGA 2XJQA 1CJDA 5FYUA 5AFEA 1R091 1RUJ2 3OCPA 4M0HA 5BNNC 4CDUC 3D4KA 3PVBB 1O91A 5LASA 2D6NA 3VDDB 1AR73 3NL1A 4GKXA 1AL22 2ENRA 2RS11 3K46A 2YYOA 4K1ZA 3MLJA 4K1YA 3SKJE 5C6CA 1CPNA 3I2HA 4PLNA 1SLCA 4GH4B 5G05L 1ALYA 3N3HA 3VBOC 3LPFA 5FZIA 1U5ZA 1STMA 1YJLA 4RSUA 4XUTA 3WSOA 5HCFA 1AYM2 4PF5A 2VU9A 4HVRA 4COWA 4CUBA 3WINE 4GZ9A 3LQCA 1SBEA 1M06G 1W05A 1ENXA 3U10A 1JZ8A 1DGRN 4AI1A 4LBNA 3PMSA 4NJ4A 2ID4A 4KU8A 3OGGA 5DDJ1 4CCNA 5DAPA 4MSVA 4D69A 2OKXA 5CFCC 5KHGA 1POQA 3NKTA 3R4DB 2VZVA 4XHBA 1JXNA 2X5IB 1I6XA 1XU1A 2PQSA 5C4WC 2ZEWA 1IS3A 1YI9A 4IDZA 4CP9A 3GF6A 1PZ8A 3NNMA 2D3PA 4ISQA 4Q29A 1CAVA 2XL9A 4I0BA 5ABJA 4HSLA 2P17A 3NNJA 3IIAA 1CIYA 4QD2A 5DABA 5L19A 4WV8A 5C8CC 5K7PA 2QQNA 2WS91 1YC61 3IN9A 4CDWA 3PIJA 3KQ4B 4A4AA 3N35A 1LHOA 2XBO3 3O1MA 1R1A1 1ZA7A 4LNVA 4M3CB 4XUOA 5BNPA 4Q4V2 4QX3A 2DYCA 3RMYA 1W9TA 1S2KA 2A73B 1U0AA 3DV8A 2ZKLA 2W0XA 4B8EA 2NQYA 2XLFA 5KHHA 3Q9OA 4XF9A 3BI3A 3PUIA 3WT3A 1W99A 2E33A 5FPLA 3UJQA 1AJOA 3OBAA 5EP9A 5ERLA 3RZJA 4LBQB 5G04L 2QCSB 4CEYC 4LBMA 2A3WA 5E16A 3IIIA 4DXSA 1ZA4A 3LEIA 2VJXA 4WM8A 4GAZA 5DPNA 5FFOC 3BYWA 4HVQA 4LHKA 4Y1ZA 2O8QA 5H9SA 3EO6A 4XVHA 1OH3A 3QH7A 3VBRB 4CTEA 4S2FA 4QXCA 2PAEA 3ES1A 4DRVA 4P9WA 2HWE3 1E5RA 4MVTA 4GD4A 3ZYIB 5C71A 3JQXA 4ZXKA 5DG2A 5GZDA 1X82A 1NKGA 2JECA 2Z69A 3VL8A 2VZRA 1CAXB 2ZOEB 4CCCA 3POYA 3O1TA 4Q4X3 1JYVA 3DPRC 1JZ4A 1JYTA 5FLHA 2ZZQA 3HT2A 5FYCA 4D7TA 2DBIA 2XKPA 2YFUA 3WHTA 4AGGA 1MQTB 1YCIA 4GWJA 3UGFA 4QDSA 1IPSA 3KQRA 3U07A 3O1UA 1S55A 1DIWA 2RHPA 1VPHA 2EXIA 4LKDA 4N9HA 3CMGA 3ZYPA 4B4PA 3EYPA 4QGMA 1AYN2 1JTZX 1UO9A 3MO4A 3RZLA 1DGWA 1W6QA 5FO8B 2WUHA 3I4IA 5J09A 1KGYA 5FO7B 5FPZA 2JD4A 2ZX2A 3E6BA 3A7QA 1MEC3 4LHSA 2MNGA 3TEWA 1H6YA 5IAXA 2BDRA 4QT6A 4U36A 3VN4A 1W9YA 1RUC3 2EIDA 3AZVA 4LMFA 4BCUA 3TEYA 4AR2A 5C8WA 3H42B 1G9BA 3J4UH 4AXOA 1AHSA 3UJOA 1ZBA1 3CZJA 1WW7A 2XUEA 1UY3A 2W39A 2XH6A 3OGJA 5FQ0B 5IT6A 1HRV2 3MUZ1 2VPVA 4ATEA 1PMHX 2PXJA 2YB7A 2W3JA 4WVWA 1VBB3 4QHBA 4FPOB 1D4M2 1NCRA 4AI3A 5GZCA 5AC93 4J1XA 4N7UA 5JMOA 3C3VA 5FZHA 5TSWA 1BCXA 4FAGA 4XTMA 4W6YA 1S0BA 3SHRA 3V64A 1KITA 3Q8EA 3B02A 1UU4A 4PI0A 1FMD2 1JOPA 2D5FA 2KXLA 3AKRA 3ZLIA 2HJIA 4QPIC 4X8NA 3TOJA 3LIGA 3WOGA 4E9KA 1WD4A 2ATFA 3DEMA 3DYOA 4MADA 1PIV2 1ULOA 2HWD3 2HWB3 1AR62 4Y26A 5FK8A 2VMHA 1OA2A 1SCRA 5BPXA 1U5IA 4QM8A 4YVSA 1O4YA 2ZJCA 4DB5A 4ZY9A 3DGTA 1NZIA 2Y6HA 4PQQA 5LRRA 2Q8CA 5T3NA 4DPNA 5FY4A 2VOKA 4KBBA 1ENSA 3LDKA 1RUI1 3T0AA 1RUG3 4QM9A 4EWEA 3MV01 4EN0A 3VDBA 5GLVA 3SCHA 2VC9A 1QEXA 4EWDA 2DVAA 2D93A 2BGOA 5FZOB 2W87A 2ZA9A 4RD7A 3V0BB 1PGSA 2ZAAA 4QXKA 4AWDA 4GJZA 4P9LA 2CTVA 1GLHA 2B4KA 1NXD1 3MEPA 1GYKA 1WD3A 4TWTA 4NHYA 1YLLA 4PBOA 1GWMA 3BALA 4I0AA 3D8CA 2FDIA 3NAPB 2ZGPA 2HEWF 3I49A 1FV3A 2DCYA 5FZCA 2CAVA 4CDXC 3ZFEA 4TTGA 3I54A 3U4SA 2ZS6B 1YFXA 2Z2SB 5JOZA 3S5QA 1EPZA 1OKQA 4KWKA 5T54A 3H3LA 3IPVB 2E7AA 4MXWA 4AGRA 1G6NA 4XFBA 1LGBA 4PHZA 2R061 1SDDB 2IFRA 3A21A 4UW6A 1LEMA 4QMAA 4WM7A 4NE9A 5EJ3A 5FRAA 3AXDA 5KHJA 2Q8DA 1QJFA 1DCSA 3GHMA 5E8AA 1RUD2 2WJSA 4IV3A 3CKHA 2RS31 1WCDJ 2W46A 4HN0A 3KHCA 1W9FA 3AKTA 1COV3 1AXZA 3N9LA 4BLIA 3I8TA 2ERFA 4OI2A 3HIFA 2A75A 3Q8AA 5BNOC 1W2AX 1LHUA 3NNFA 1C8M3 1B35A 5FPAA 1CAUA 4LR4A 3ZIXA 5A1AA 5CYYA 3HMYA 2BTVC 3BPSA 3DYPA 3PTYA 3SLIA 2C9KA 4CP1A 5F6LB 2J1TA 4NIGA 2JX9A 1PMJX 4QPGC 4XQ4A 1SFNA 3ZPOA 4M4RA 4CEWA 1E5HA 1EAH3 3LE0A 4CUGA 2GN7A 5FZAA 1PMIA 1RMU1 5EJZB 3JB8A 2Y26A 2WT2A 3LA2A 2VR4A 3RYPA 5FZFA 2HEVF 2XJSA 3IZOA 3T2TA 3ZSMA 1WKYA 1OUXA 5LA0A 3FX3A 3O5SA 2O14A 4G9SB 3T4VA 2DUOA 3VZMA 3FHQA 3KVAA 4HETA 1UPSA 1Q8OA 3K2OA 2F6BA 1LJ7A 1VLNA 3ZYRA 2QVSB 1PK6A 4BQWA 2BFUL 2EVXA 3JXSA 3D3AA 3H1WA 4RN5A 2JG9A 1H1AA 1X7NA 2XLAA 4N90A 2CGNA 3C7HA 1ULGA 3J7NA 4QKNA 4R9CA 5FJKA 3KT7A 4YPJA 3ZFFB 4B1LA 1S4CA 2O0OA 3M1HA 4K9SA 4N53C 2ET1A 1VB4A 2AH2A 2P6HA 3FFQA 3WF0A 2VW2A 1QNWA 3P5BA 3D6EA 2QQWA 4XIKA 1CZVA 1CZTA 1F4HA 3GZUC 5FPXA 1DHKB 2PHTA 3HJRA 1ASJ1 3L2YA 1RUOA 5T55A 3AZWA 3HVDA 3WG3A 2RG4A 3W5NA 2VULA 4QPWA 3QH6A 1EV13 1UKGA 2SLIA 3HN3A 1Z7S1 2HH9A 2Y6LA 1IQAA 5DQ0A 3PU8A 5DZEA 5F2SA 3VLBB 1AR81 1SLAA 5FZMA 1J3PA 3KVBA 5A1LA 1HXS1 1UOJA 3OYWA 1XSRA 3M3EA 2G9ZA 1LODA 5ABJC 3MPPG 1J1TA 4JKLA 4QXHA 5EZWA 5JVVA 2ZABA 4FFGA 3RNSA 5ACA1 1W3XA 4META 1VRBA 1LKNA 3V0AB 1W28A 5LWBA 2Y6KA 2QQOA 2F17A 4P5HA 5A3LA 4E2SA 5JUVA 1F5FA 2EF6A 4Q4Y3 2VO5A 2HWF3 2P3KA 2VMIA 2DF7A 5CKMA 5HXVA 2YBPA 5GLZA 1BEV2 1L7LA 2A6WA 3J7HA 1I1EA 1LAJA 1GSLA 5F3CA 4E8DA 1WMXA 5K0UB 4XDQA 4AFAA 1YFUA 2VQTA 3H9AA 3PUHA 2J1UA 2P3JA 5JXHA 5JI9A
chains in the Genus database with same CATH topology
2GMMA 3AP6A 3EHKA 4RHV2 4E27A 1RUF1 4F7ZA 4OHZA 4WM8C 4LO7A 5T5PA 1VJ2A 1WCKA 1QWRA 4R4XA 4TZDA 1CAWA 2BVBA 1VAVA 1PO12 3HBZA 1PGL2 1QJU1 2R16A 3VBHC 3VHOA 1IPKA 1Q5OA 3VBSC 1RUE3 2OW4A 5JSOA 1ND2A 1YHFA 3S7EA 4RR3C 4DY5A 3FUQA 5JPMB 3NV2A 1QHDA 4FXGB 5EYXA 2VVEA 4AEDC 5GKAC 4V1PA 2QQPA 3VKOA 1N1TA 4B7KA 3UKNA 4HKOA 5F9TA 1XU2A 3VKFC 2A6YA 1DZTA 4JDMA 3VBUA 4RA0A 4NOTA 5DUVA 3MIBA 2R041 2D6LX 3ZFEB 3VZLA 2P34A 3PHMA 4BPZA 2Q4SA 1AR93 1EYBA 4IEVA 3NSTA 2C0ZA 2R0HA 3WDUA 1TME3 4S2DA 3VBOA 5LRSA 4LE3A 4NHKA 1NCQC 3KMHA 1V6IA 5GJ6A 1ULEA 1QY4A 3WQ7A 1SLTA 1ZBE1 3OF1A 2ZMLA 4B7EA 5CFCA 4D7YA 3MIGA 2B7YA 1NCRC 4XBLA 1JBCA 1CAUB 2GMEA 3AP5A 1IOAA 4IQPA 2K0GA 4NR1A 5C4WA 3VBFC 1GQGA 4P9YA 3NJZA 4KG0A 3FUOA 3R0RA 2RM21 4Q1RA 3AZYA 4OZXA 1HQWA 1ULDA 2HWC3 4RQPB 5C8CA 3ZXLA 2JEMA 4Z82A 3PNAA 4K40A 2D6PA 4COUA 4FCAA 4IEQA 3P3PA 1Q43A 5DXDA 5CFDB 1OFNA 4YW3A 3OY8A 3WQ1A 2A6XA 2GNTA 2VNOA 4I01A 1RUJ1 1IKQA 2GZWA 2R073 2Q1MA 4R52A 3J8F3 1MZ6A 3NW4A 1AL21 4CEYA 4XPVA 2A5ZA 3PVNA 4FAHA 1G9DA 1SBFA 2XBO2 1LULA 4ATFA 2WZPP 1RJ8A 1URXA 5KBFA 1APNA 4XF0A 1H2NA 4FXKB 4D7SA 1LGCA 1FPN1 2JENA 5GLUA 5AVAA 1R093 2GC3A 2XB6C 1Q56A 2GDFA 3W58A 3D0SA 1GFF2 2IC1A 2RS13 3DPRA 4WVVA 5JI7A 5AVPA 3ZIWA 4AFCA 2IXIA 1MS4A 2DU0A 2OA2A 3D82A 3B9IA 1CR7A 1GZ9A 1QJY3 2HWE2 3I59A 1YO8A 3JZVA 4WVZA 2DVFA 2H0VA 1FX5A 5BNPB 1IS5A 1K5MB 1YJKA 1W2UA 1O3SA 2NZ9A 1R081 4Q4X2 4R9AA 5DDJ3 3IDBB 5I91A 2ZBJA 3ZFGC 2B9UA 1HRI3 3JBG1 3H0OA 1LU1A 3KB5A 4L99A 3WLUA 4C91A 1C3HA 1LGNA 4CEWC 3ZSKA 2VQ0A 3WDYA 2VOWA 2E51A 4I3PA 2WS93 1UW8A 4K8FA 1VBC1 4LUKA 3WP3A 3MIDA 4FBFA 2CY6A 4RS5B 4LUMA 4O9EA 5LEKA 2GC1A 1CAWB 1MEC2 1V6NA 1R1A3 2CL2A 2XJVA 3GNEA 4Y22B 1RUC2 1V6LA 1XNBA 1W6MB 5A33B 3BTAA 4QPIA 5J36A 3I7DA 1PK6C 2AREA 2DCJA 4MX3A 4SBVA 3SH5A 3NWKA 1BYHA 2JG9C 4M01A 4UXAA 4X6QB 1DLLA 4Q0VA 2PHFA 3RI9A 3RSJA 4XQDA 3B7MA 3MICA 2PFWA 5AC92 4AFMA 4XJZA 2WA4A 5FMOL 4ORFA 2YHJA 2IXHA 1DU3D 2WNVB 1GBGA 4JGZB 4YW5A 5BNNB 4Y1YA 4CDUB 3H1MA 4GB32 1H1MA 1KQRA 3POWA 4XHXA 3GBGA 1FT9A 3S0MA 1OFSA 5HBAA 2WFF2 1NYWA 2WZR1 2NP0A 2VY0A 5D8AC 1PHMA 2AZ5A 3DL3A 1YFWA 1CPMA 4LULA 1LECA 1RUG2 1YNAA 2RS51 1PVXA 2WQZC 1WW4A 4QQOA 4CDXA 4NO4A 1W0PA 4ES9A 4OI0A 3B3QE 2VUAA 5FOJB 4CYDA 4XFGA 4G3YC 2JG8C 3TWIA 4A7KA 2OVUA 3N7MA 4IEYA 3K51A 5BY5A 1QF3A 2JICA 4FTEA 2KM2A 4FPJA 3TRSB 2RMU3 1FMD1 3T1LA 4Q27A 1ZBA3 3ATGA 1S0FA 1NA1B 1TQ5A 5J48A 4MLOA 5C8CB 2QZ3A 3VZKA 5BNOA 1LOAA 1OD5A 1UIKA 5D1IA 5HCAA 4ASLA 5JZGB 2P3IA 5I0SA 4G4FA 1BBT2 2BGCA 4NWWA 3ZXKA 3MIHA 5C9AB 4L2NA 3CEWA 3MLKA 5JSRA 1W6OA 4QPGA 1C5HA 1W6PA 1Q8SA 4FP3A 1BZWA 1KDKA 1MS9A 1ZX5A 1Y7BA 2D3RA 4I2OA 2WSVA 5DZFA 2UY8A 4XJAA 1KJLA 4MV2A 3IMNA 3GZAA 2BVVA 1RUI3 4YG6A 1RITA 4Z92B 1EAH2 4XEZA 4KWLA 1V6KA 2YUEA 5H9RA 2ZGOA 1QH7A 3M3OA 1FNZA 2C1FA 1IZ3A 3SMHA 1NZCA 4N53A 4DS0A 2ZGKA 1RHI1 5BNQA 3AMMA 1RUD1 2H6CA 2GNMA 3HWJA 3D5OA 4AYUA 4JRLA 4W6WA 1Q8QA 1GICA 4CP0A 2QE3A 4QQ2A 2V73A 3JQWA 4XE9A 2VNRA 1RGSA 4JRAA 3HAGA 4CZSA 1W6NB 2WIIB 3RJRA 4E4ZA 1VBA3 2C5DA 1R1ZA 5IUQA 2R063 2CV6A 5KXDA 2ZX3A 3ASIA 1D0GA 4XF4A 1BKZA 2RS33 1BMV2 3A0NA 4HK8A 5EV7A 1OLRA 5I8SA 2GH2A 2CNAA 1PO21 2EALA 4HANA 4A7ZA 2PTMA 2X53S 1DG6A 1AL0G 2YROA 3BIWE 4KGQA 1DQ4A 2VMGA 3WQ0A 1U5YA 2IFWA 3CJIC 2WNUB 4K6BA 1YFYA 3BCWA 1ZZCA 5CIRA 3I2DA 4M3CE 3L2HA 2EA7A 1RMU3 2RJLA 4FQZA 4J1WA 4ES8A 2ZMNA 2DVBA 3VHRA 3WDVA 1CD3G 2JE7A 2JXAA 4YZ5A 1YWKA 1SLIA 3ILFA 2HWF2 4Q4Y2 3OJBA 2Q8OA 5KC5A 3VBHA 5IK5A 1DFQA 3VBSA 1EY2A 4XFCA 3WW3A 4BQ1A 2E6VA 4RR3A 1WA4A 3QD6A 2DTYA 1FOD1 1WCSA 3NKGA 4IERA 1H8TB 4AEDA 3ALQA 4Y20B 2O8OA 2W52A 1GZWB 1IS4A 4K21A 3VV1A 2E7TA 4BM8A 2V5YA 2VXRA 1OLQA 1RUE2 3B94A 4WVMB 1ASJ3 4UW5A 4YZ2A 5IK7A 1BQPA 4COVA 4Q0PA 1JUHA 3VDDC 2AUYA 4HMZA 3VKNA 5H9PA 5A32A 5K8SA 3RDIA 3TN91 2BYVE 2EAAA 1KXGA 1Z7S3 2GSYA 1S2BA 3ZMNA 1ZRCA 1X8MA 1RVF1 2YC0A 1AR83 1BEV1 1NCQA 1HXS3 3FMGA 4IEPA 3WY6A 4BIOA 3ZN6A 3SISA 4RHV1 5ACA3 1PVC1 2RR11 4IV1B 4OI1A 4GKYA 4DMIA 1VBE1 2WFPA 1PO11 3ZPYA 1TME2 2BNOA 3BOWA 4FQ4A 4OHYA 2VW0A 4PJYA 3VBFA 1I5ZA 4WZCA 1AX0A 4H7MA 1LHWA 3UK9A 4LHLA 3R4UA 1YUDA 1ZZ6A 1W6PB 3RI8A 4HPKA 2AR6A 2ZGMA 1OA4A 4N43A 4DNYA 1QJX2 3O7OA 1H4GA 1S0JA 4HKLA 1KJRA 2R0FA 1RUF3 1FYUA 3ES4A 3IM0A 1HQLA 1H2LA 1MACA 1QJU3 2IXLA 3LWCA 1DZRA 1MS0A 4P9IA 1DYPA 1POV1 4AVAA 1RUNA 4XJWA 1QJZA 2WSUA 1WMDA 3AKPA 2UU8A 4U2AA 2HWC2 1Q8PA 5T50A 2YDEA 4SLIA 4XJ9A 1HQNA 2Y38A 5DUUA 4Q4W1 3VBRC 4B29A 1RUH1 2R072 1DQ6A 2R043 1QQP3 3ILNA 5CNAA 4XBQA 1NQJA 4DXZA 4PQ9A 1ZZBA 3AM2A 3WNXA 1VALA 4BA6A 2FMYA 4Q0QA 1MQTC 1XRUA 4KG8A 1FATA 1CAVB 2QDRA 2WC2A 5ABJB 2Q0AA 4TSVA 3EXUA 1J58A 2Y0OA 2QZ2A 1WMEA 4H3WA 2WNEA 3W59A 2E63A 2BUKA 1Y9QA 1QXPA 4CDWB 2XG3A 1CN1A 3FE5A 4AVSA 2RS12 3NV4A 4AK3A 2DTWA 4AVCA 4LO8A 1OOPA 2WKKA 2IXJA 4XFHA 3ZFGA 4XFIA 2A6ZA 3KM5A 5L36A 1DBNA 1ZM1A 2TUNA 1QJY2 2XKOA 5JOYA 5GALA 1GKBA 2IXCA 4M3CF 1UU6A 4GALA 5E1RA 3M4FA 1DGLA 3RPQA 3VKLA 4WM8B 1SCSA 3D0JA 2ZKNA 3H50A 1XXNA 2BNMA 1Z78A 4MYEA 1A78A 4PDWC 3THTA 2OUJA 3JUUA 4IL7A 1HRI2 2CYFA 3WW1A 1RUJ3 4XXAA 3ZXEA 2I2SA 4XETA 2ZGQA 5CB7A 1AL23 3CL1A 2G9GA 3A4UA 4RL7A 1UX6A 1R1A2 4OUMA 4BWOA 2JDZA 2DFCA 4EJRA 2R32A 1FPN3 1TMF2 3WVJA 1W6QB 1L3JA 1GNZA 4D3WA 4WZFA 4A3XA 5B2GB 3MIEA 2BQPA 4Q4X1 4P9JA 4Q26A 1C57A 1FI2A 4GWMA 4Y1XA 5D8AA 1ZRDA 3URFA 1ZRRA 1OQ1A 2ZX1A 3ECQA 3WXPA 4FOQA 3WP5A 1WUVA 1ZVFA 3FBMA 1C5IA 3KCCA 1MS8A 1QKQA 2ETEA 1ULFA 4RGAA 3AFGA 3WHUA 2MEV2 2IXKA 2JG8A 4C0HA 1R083 3U0ZA 1NCRB 1MEC1 1KS5A 2ES3A 3AP7A 1TNRA 2YV8A 4MZUA 1POV0 1RUC1 3POSA 3JBG3 3U11A 1V9U1 1VRH1 3WZ1A 2VOXA 5FLJA 3K48A 1O5LA 1WLDA 1OMIA 4JTOA 3IBMA 4LBQD 3GBFA 4JAAA 4AVBA 3MPBA 3BB6A 4OHXA 3JD71 1VBC3 4BZ4A 1VBD2 1KDMA 1QGLA 3KT1A 4YVSB 1UKRA 4RGGA 1OI6A 4P9XA 4C0BA 1IKPA 2RMU2 3QACA 3P3NA 4YARA 3HD8B 4YVWC 4GB31 1MR5A 1ULCA 4OULA 1ND3A 5L7OC 3E6DA 4FSJA 2WFF1 4AW7A 4LO6B 2OZJA 3USUA 1YIFA 2CGOA 2XJTA 5GZEA 4PIYA 1NOVA 4YM3A 4F83A 1AUYA 4CRQA 1H8VA 1HDKA 1OPOA 3O0XA 4HT1T 3DUIA 3WG4A 2PLV1 4HBNA 1D2SA 1WMFA 4UW3A 1GZCA 4CDQA 1TE1B 2WLQA 1CESA 2FQPA 4BOWA 3H7JA 2QDNA 1C1LA 1CX4A 4MXWB 3ZFFC 3KS7A 3RYKA 2WZR3 2WT1A 1O3TA 2GNDA 4WM7B 1X36A 4IV3B 1RUI2 2RS53 3VUOA 4AVVA 4ISRA 2VGDA 2Q30A 1AR72 1IPJA 1QMJA 4Z8BA 2PHUA 3ZVXA 2VG9A 1B35B 2DUQA 1BBT1 2OUHA 4A2UA 1H2KA 1WLWA 2SBAA 4I30A 3WR0A 4ZU4A 4DINB 3WDXA 3ENRA 1MS1A 2GNBA 3MDPA 3R05A 4CEWB 4MH0E 2JE9A 4N43C 4OI4A 4HFSA 3NO8A 3CNAA 4HKWA 1HW5A 2GAUA 5GM0A 2XPJA 2UYAA 4UW4A 2BBVA 2H6BA 3AZZA 1VBA2 3CJIA 4YGDA 3UKVA 5T52A 4YRDA 1Z0HA 4E4SA 2OZ6A 4ZKTB 3ZXAC 5K0UC 4XQWA 4FOVA 1PK6B 3OD4A 2YY1A 2XJRA 1OPMA 4I0WB 3E6CC 1S0EA 1BXHA 1UU5A 2JG9B 1U5XA 4KU7A 3ZXJA 1LOBA 3O0WA 4AGVA 4NPRA 1S0IA 1AYM1 3MF9A 4I09A 5KXCA 2E7QA 1UN1A 4K3UA 4L9BA 5I0RA 3O14A 2ZGLA 5L73A 4Y5Z0 1F2NA 2BW8A 4FPYA 4BE3A 3NVCA 3ZMOA 2UWBA 2XJPA 1LOCA 3G6JB 3B00A 3HT1A 4NHLA 1JYCA 3QCWA 3HN1A 2B45X 1S0CA 3OYWB 1SACA 2B5HA 1RHI3 2ZHMA 1DGRA 1V70A 4RFT0 2ET7A 3USSA 5IK4A 1RUD3 3ZN5A 2ZHKA 1BMV1 3ACLA 3H7YA 4YM0A 4I02A 1XE8A 4LEJA 3VDDA 2NN8A 4IEXA 1A6CA 2FHRA 2Y0IA 5GZFA 4Q4V1 2UWCA 3E97A 2YMZA 3WP4A 1Q3EA 4KWJA 1OOPC 5E88A 1AX1A 4Q0SA 4XXPA 2PAKA 1ZZ7A 3MGUA 2ZHNA 4YZ1A 4JC1A 1XNDA 5CA6A 1A3KA 2YGMA 4XMIA 1N3PA 3FLPA 1J3QA 3EJKA 3LOIA 3ZO0B 2EXJA 1RL3A 1YI7A 2H0BA 4FPKA 5EWSA 4AE2A 1PO23 1PM7A 3ZDSA 4J6GA 4AI8A 4LLOA 2RE9A 1KS4A 3ILRA 4GIQA 2A3XA 4TYSA 1HXS2 1OHFA 2NMOA 1ENRA 1WBFA 3AJYA 1ND2B 1JH5A 1N3QA 3AMQA 1N3OA 4RQPC 4YGCA 1B09A 4LBOA 2QUOA 3QOPA 1VBB2 4QGNA 2A7AA 4AHYA 4M3CA 1HKDA 1FAYA 5CFDC 1BVVA 2UURA 4JGYC 1O5UA 3VBUB 4EN7B 3H3ZA 1AYN1 3WCRA 1CVNA 3DKWA 2HWD2 2GALA 2HWB2 4E4DX 2VECA 2Z42A 4LBQA 2ZHLA 2R1BA 5J96B 1FOD3 1BVP1 3OTFA 5IK8A 4AEJA 4XOGA 4GMP1 3VBOB 4LE4A 3VKMA 2EXKA 1GV9A 3GYDA 2XWBB 3VBRA