1C1LA

Lactose-liganded congerin i
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
135
Chain Sequence
GGLQVKNFDFTVGKFLTVGGFINNSPQRFSVNVGESMNSLSLHLDHRFNYGADQNTIVMNSTLKGDNGWETEQRSTNFTLSAGQYFEITLSYDINKFYIDILDGPNLEFPNRYSKEFLPFLSLAGDARLTLVKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure of the conger eel galectin, congerin I, in lactose-liganded and ligand-free forms: emergence of a new structure class by accelerated evolution.
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords PROTEIN (CONGERIN I)
total genus 32
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 1999-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c1lA00
3RG0A 2GNDA 2W52A 4FPKA 1WW7A 3O0WA 1GZWB 4JRAA 1G8WA 3B9CA 3IN9A 1Q8SA 4R9DA 1HQLA 2CWMA 3V65A 4LBQA 1V6KA 3BIWE 5DXDA 1UAIA 2D3RA 5FREA 1CIWA 2CTVA 2AH2A 4GXLA 1C1LA 3ILFA 5HCFA 3WDYA 2UWCA 3M1HA 4YZ5A 2P34A 4GKXA 2H0BA 1MS5A 4LBLA 4I30A 2CYFA 4BLIA 1ULGA 2B7YA 1CESA 1R1ZA 3R4SA 2AUYA 3AZWA 1LEMA 4XJWA 2EXIA 2DUOA 1BYHA 3A0NA 1IOAA 5T5JA 1JHNA 5JMCA 4DFSA 1YXWA 2YV8A 1W6OB 4Y1UA 3WG1A 1WW5A 2D3PA 1WD4A 1Q8QA 2OVUA 3OYWA 3RRDA 3ZXKA 4ASMB 4ATFA 1HQWA 1QGLA 2YZ4A 4L8QA 3NV1A 3ZYPA 1KRIA 3UJOA 1A8DA 2E7TA 4Y26A 3KQRA 3WNXA 3FFZA 1LHVA 4TYSA 1FYUA 4GALA 2DUPA 2A6XA 4YGBA 1WLDA 1KQRA 1JYIA 4FP2A 1DHKB 1TEIA 1LOAA 3QCWA 3GNEA 2TEPA 3ZYRA 5HCBA 2VUAA 3WVJA 4DPNA 2A3XA 3I4IA 4LBQB 3AP7A 4YG3A 3TAYA 4Z8BA 1VAVA 1C57A 3N7KA 1LOGA 2YROA 1WUVA 4XIOA 4XOGA 2YXSA 5IK4A 3CNAA 3ZSKA 5GLWA 3FLPA 4P14A 1N1YA 3POYA 2ZMLA 4YW1A 3T2TA 2D3SA 1URXA 2DU1A 4GKYA 4YW4A 1QOOA 2A3YA 2WJSA 3GALA 4BQ1A 1DYPA 2ARXA 4YGCA 4BOWA 3O0XA 1LGCA 4WVWA 2BQPA 4Q2FA 2OUHA 3WG2A 1IS5A 1LOFA 5DZFA 2R0FA 1UZZA 4PQ9A 4FOVA 4LBOA 3ZPYA 3V0AA 1W6QA 4K1ZA 2GMEA 5T52A 4FPFA 5KXDA 1Y7BA 2E7QA 3V0BB 3AYDA 4ZKTB 1YI7A 1GZ9A 2P2KA 3ASIA 3OY8A 1H9WA 2A6ZA 5JVVA 5DUWA 3D4KA 1LOCA 2ENRA 2NZ9A 3ATGA 1WW6A 1MS0A 3APBA 2RHPA 1Q8VA 1ULCA 3I8TA 2ZZJA 4GWMA 4AGVA 5JDBA 5CNAA 1QF3A 2GNMA 4NO4A 4BLJA 1AF9A 2GNBA 4H55A 3A0KA 1LENA 1MZ6A 2UWAA 1UX6A 3PJQA 1GNZA 4XHXA 3AXDA 1G9DA 4UW4A 4AWDA 1VLNA 3N7LA 1NXD1 4FPCA 1FV2A 1BQPA 1LOBA 4AGRA 2GALA 3MW3A 1QDOA 3WCRA 1OQ1A 1WBLA 3SH5A 2OW4A 1W6PA 4Y20B 3WDUA 1DQ2A 2W39A 1PZ9A 4Y22B 2DU0A 3WUDA 3D5OA 4U36A 5EXOA 3R05A 3USUB 5E8AA 2JD4A 2D7FA 5GLVA 3WHUA 5DG2A 4ATEA 1S0BA 3M3QA 1MS8A 4M3CB 5H9QA 1W6PB 2UURA 5IK5A 1GV9A 5DUUA 1SLIA 1CN1A 1V6LA 2WQZC 4M3CF 4XTPA 5KXCA 3WDXA 2DYCA 1JYCA 4RL7A 1V00A 4CTEA 1HDKA 5JOWA 4ISQA 3WOGA 4DRRA 1XQNA 3AK0A 3ZSMA 2SLIA 2D6PA 2ZGOA 1LEDA 3JU9A 4GWNA 2D6LX 4ZXKA 2GNTA 4BM8A 1SLLA 1GZWA 1SFYA 2D43A 2ZGSA 4YW5A 2SBAA 2YMZA 2VW0A 4WVVA 1LHNA 2D6MA 2V5YA 2WT0A 1S0GA 1N1VA 2JDZA 1UMZA 4M01A 5JOZA 3IPVA 3PVEA 3QLQA 1DQ5A 3M3OA 2DVFA 2DURA 2FMDA 1AXKA 1S0CA 4YFZA 4JCKA 1KJRA 1APNA 2W08A 4FPHA 5GJ6A 3NWKA 3ZXFA 4TZDA 1WCSA 3SH3A 3WV6A 4XE9A 1V6NA 1SCRA 1BKZA 3MW4A 1H9PA 2WLQA 3H0OA 2UWBA 4YW2A 4UW6A 1SBFA 1QMJA 1AX1A 3AXEA 1AJOA 1GLHA 1N3PA 1QOTA 3B01A 3AX4A 4Q1PA 1LECA 2A6VA 1GICA 3NV2A 3FBYA 5H9SA 5T55A 3O5SA 2DVGA 4XDQA 4BMEA 2DV9A 2ZGRA 3OYWB 1RIRA 4WZFA 3HR9A 4UW3A 5EYXA 1MS1A 4YLZA 1AXZA 1Z0HA 4XHBA 5T5OA 3WG4A 1C4RA 1DQ1A 2ZGKA 2AYHA 2GDFA 3N7MA 3RMXA 3MPPG 2R1BA 1CPNA 2NM1A 2PHFA 2ZGTA 1QU0A 4XJUA 5GZFA 4YG0A 2ZGQA 3AYEA 1MS4A 2ZABA 2EIGA 2EAKA 5GLTA 5GZCA 1O4YA 2GN3A 3AFKA 4R9BA 1G9CA 4KBBA 3ZXJA 1AVBA 3VKNA 2KM2A 4R9AA 2ZHKA 3OJBA 1W6MA 1LESA 1FAYA 3VKOA 2NMOA 4YZ3A 1KJLA 3L2YA 2EXKA 3OBRA 4Q1RA 3SLIA 3HN1A 1IKPA 2G4IA 1UKGA 2A5ZA 3OPZA 2JE7A 3PVNA 1BJQA 1QNWA 1FX5A 2C5DA 3AP9A 3FLRA 1ENQA 3W59A 3UJQA 4C1WA 2NP0A 1SACA 4BMBA 3A4UA 1Q56A 2DTWA 3RMYA 3R4UA 5JOXA 3IM0A 5DUVA 4AVSA 1JW6A 2PHUA 3WG3A 1GSLA 4FOQA 1W6MB 3O12A 4XJ9A 4XJ8A 2E51A 3ZSLA 1W6NB 2YY1A 4Y1ZA 2ERFA 4ITCA 2PHXA 4K20A 5GLUA 2JECA 3SISA 3AZZA 3V64A 1LOEA 1CONA 1ZM1A 1G7YA 4LBNA 4YGEA 5CBLA 5LK5A 3Q9OA 1S0DA 3WZ1A 1DLLA 1DYKA 2NYYA 2D6NA 4YZ4A 2DVDA 4SLIA 3AYCA 1UPSA 2EALA 4LBMA 3SNMA 1CJPA 3WUCA 4U2AA 1SCSA 2XG3A 4LBJA 5IT6A 2DUQA 5IK8A 4W65A 1S1AA 3PVOA 5HCAA 1MR5A 3N36A 3T1MA 5AVAA 3FUQA 4M3CE 3VKLA 4CZSA 1X50A 2ZAAA 4P9XA 4Y22A 3WCSA 3WLUA 1DBNA 3M3EA 2A71A 1F31A 3AJYA 1U0AA 1DQ6A 5E88A 3POSA 1S0JA 3TB0A 2GN7A 2EXJA 2E6VA 4YM2A 4LBQD 1AZDA 2AGSA 3WDTA 1AJKA 4FOWA 5KXBA 3POWA 3OGGA 4MYEA 4FPLA 1HLCA 1W0PA 3V0BA 1LOFC 1LGNA 5L73A 2VXRA 4PBPA 1DIWA 1JN2P 2C9AA 1LHWA 4FPYA 2W68A 2A7AA 2WSVA 1ULFA 2V73A 4HL0A 4P9YA 2WT2A 1GYKA 4YM3A 2D44A 1N3OA 2E53A 4FOYA 2LALA 5DG1A 1D0HA 5E89A 2JJ6A 5H9PA 3INAA 1QOSA 3IPVB 4Y1VA 1DQ4A 3IMNA 2ZMKA 4WV8A 5GZDA 4C1XA 4NOTA 2EF6A 1I3HA 1FV3A 4FPEA 3AYAA 2EXHA 1Z78A 3N3HA 4LBKA 1DFQA 4XMAA 1A78A 1OKQA 1O4ZA 5DUXA 4FVVA 3BTAA 4XBNA 4FP3A 1EPWA 4K21A 4M00A 3PMEA 5T5LA 3RQ0A 2P3KA 4DRVA 4JC1A 1GBGA 4F83A 2ZGUA 3RSJA 1DQ0A 4BPZA 1MS3A 4XYXA 5JOYA 1KDKA 2CNAA 3OY8B 1VAMA 3AJZA 4XTMA 1V6JA 3FLTA 5EWSA 5F5QA 2LTNA 3O0VA 4YGDA 1JOJA 3JUUA 1SBEA 1IS4A 2ZMNA 2UU8A 1LU2A 3UL2A 1SLBA 5GLZA 2JKBA 2DWRA 4OZXA 1H30A 4FQZA 4Y24A 1V6OA 2A3WA 4AGGA 4XXAA 4Y20A 1ULDA 1VIWB 3LSDA 4FPOB 5DZEA 1F5FA 4XJAA 5T54A 1A3KA 3M3CA 1MVEA 4Q8KA 4IQPA 1N1TA 1PZ7A 1RINA 2D6KA 2VW2A 2ZGLA 3B3QE 5GZEA 1W6OA 1OFSA 1PZ8A 4Y1XA 1UL9A 2R49A 1GZCA 1LULA 3DGTA 1LU1A 2DTYA 4XBLA 1LHOA 1YRZA 2WT1A 3FUOA 3RS6A 1S0IA 1YYNA 2HYKA 2AR6A 1YIFA 2ARBA 4D69A 1WBFA 3D6EA 1S0EA 4CRQA 1N47A 1KITA 1QKQA 3N7JA 4HANA 4PCRA 1V6IA 1WLCA 1GNHA 2AREA 1MS9A 1ENRA 3OBTA 3SITA 5GZGA 1KDMA 1LCLA 2PHWA 1LHUA 1GANA 1Q8PA 4R9CA 5GALA 1CVNA 2VY0A 3BODA 1G86A 1VALA 3NV4A 3LCPA 2CY6A 2ZGMA 4FPGA 1D2SA 2A75A 1S0FA 2Z42A 1JXNA 1WLWA 2ZACA 2FHRA 1WD3A 3C2UA 3ZXLA 2GMPA 3MEPA 4Q27A 1ENSA 5IK7A 3AP6A 1V6MA 1FNYA 2Q5TA 1QNYA 3N35A 5DZGA 2DVBA 4RA0A 3UK9A 1G9BA 2VH9A 4K1YA 2CWSA 2GMMA 3HMYA 2P37A 5SV8A 3B69A 3VKMA 1HKDA 5T5PA 2PHTA 4AVTA 1JBCA 2P3IA 1F9KA 4XBQA 5CAZA 3AZXA 4XJZA 3WHTA 4XZPA 1MVQA 2AENA 2ZHNA 1IS3A 3VV1A 5KXEA 1ZA4A 1IS6A 3LSEA 3V0AB 3ILRA 2WNEA 2VW1A 1CQ9A 3ILNA 4YW3A 2P3JA 1YO8A 1FATA 1J1TA 1N1SA 1UZYA 4Y1YA 1IKQA 1AXYA 5FRAA 5F9TA 2XB6C 2VU9A 2ZGPA 1SLCA 1LODA 3AP5A 3AZVA 5CA6A 1N3QA 2WSUA 4AVVA 1W6QB 3W58A 3M2MA 1DZQA 3KM5A 1Q8OA 4ISRA 2ES3A 1BXHA 1GKBA 1CR7A 1JUIA 1MZ5A 1SBDA 1FNZA 3ENRA 3AZYA 4XIKA 2PHRA 5EYYA 5GM0A 2ZHLA 3IKWA 4XMIA 4YFWA 4M3CA 1DGLA 4FPJA 5CB7A 1UN1A 3T1LA 5H9RA 3U4XA 2I2SA 1LGBA 1G9AA 3ZXEA 2R0HA 4YG6A 1C1FA 4YZ2A 4DS0A 4YZ1A 1LJ7A 1BZWA 1RITA 1QDCA 2ZBJA 1B09A 3MW2A 2R1DA 4YM0A 3ZSJA 1AX0A 5T50A 3B00A 1G9FA 4FQ4A 5JLVA 1W0OA 2JE9A 3DUIA 3AP4A 3BOPA 4DQAA 3WDVA 2PELA 2D6OX 2CL2A 4PF5A 1ULEA 4Q26A 4GA9A 4AYUA 1I1EA 1W6NA 1SLTA 1CPMA 2WKKA 2ZA9A 2A6WA 2R16A 4XILA 4YM1A 3VUOA 5IUQA 2ZGNA 3NV3A 2ZKNA 2NMNA 2A6YA 1SLAA 1MACA 4UW5A 1ONAA 3SH4A 3VKFC 4XXPA 4PBOA 3WDWA 1AX2A 2ZHMA 4Q8LA 3ZVXA 2DVAA 1WW4A 2OUJA 2NN8A 4P9WA 1LTEA 2A70A 1NLSA 5BYNA 3USUA
chains in the Genus database with same CATH superfamily
3FL7A 3RG0A 1WW7A 2O1QA 4QX1A 4MLOA 1TME3 2ILMA 3NKTA 1QQP1 1Q8SA 3NQHA 4LIVA 4I02A 4R9DA 2Y26A 4WM8C 1CAXA 1VRH3 5FZAA 2B45X 2CTVA 3MV01 3T4HB 3WNNA 4UAPA 4ASKA 1SZBA 3ILFA 4QQ2A 3GCXA 5HCFA 3M1HA 4CDQC 4DXZA 1I9RA 1SQ4A 2PMWB 4GKXA 3W20A 1MS5A 4RN5A 2Q8OA 1H2NA 4I30A 1GOHA 5HCHA 4XFFA 2B7YA 4IE5A 3GCWA 3I49A 2VC9A 4XJWA 4QQLA 2G1MA 2C6SA 1IPSA 4E4DX 5JMCA 3UKVA 1JTZX 2YV8A 2E9QA 2DBNA 1XE8A 2AEYA 4OMCA 1WD4A 3OYWA 1OLQA 1W8WA 4Q0UA 5FYZA 2YUEA 3RRDA 3DPRB 3J7MA 3J7HA 2QDNA 5LWBA 1TE1B 1V9U3 4L8QA 4N43A 1DGWA 4QPIB 5BNPA 3KD4A 3B02A 1NCQC 1TZOA 3WNXA 4CDWC 2N7GA 1LHVA 4EWDA 2A6XA 3LQCA 1KQRA 3AM2A 1UIJA 4CU9A 1NA1C 4Z07A 4A45A 2PQQA 3IDAA 2VUAA 3I2FA 3WVJA 2A3XA 3I4IA 4Z8BA 3OD0A 5F5AA 1LOGA 2YROA 1WUVA 1YNAA 4ZU5A 2J1RA 2JDUA 1RUC1 2OZ6A 1YC61 1HB4A 2YXSA 3B7MA 5ERLA 5BXXA 3WXPA 4IV3C 1Y9GA 3UGHA 2XWBB 5DDJ3 5FDBA 5F37A 4YW1A 2D3SA 4CSWA 2ZCWA 1PVC3 2XBO1 4YW4A 1QOOA 1GUIA 3GALA 1RHI3 1KGYA 4LEJA 4COVA 4BQ1A 4CDWB 1BVVA 3HWJA 4XPVA 1K5MB 1LGCA 3EBRA 4Q2FA 4QX7A 1IS5A 1H1AA 2IVIB 3HQUA 3B5LB 2R0FA 4CUCA 2P6HA 3HT2A 3ZPYA 1W6QA 5KR7A 3MI8A 4OULA 2RR13 2ORZA 3AVSA 3LGRA 2QQVA 5FZ6A 3DPRA 3ZFFB 2UY8A 4LE3A 1W8TA 1GZ9A 4AVAA 3E5XA 3GHNA 5EV7A 3JQWA 4IERA 1UCXA 2A6ZA 1SG3A 2D98A 2NZ9A 4RGGA 1MS0A 1R092 3D0SA 2ZZJA 2EVXA 5EFUA 4R4ZA 5FMBA 1UX7A 2OS2A 2V5DA 2W1UA 4NO4A 2JG9C 1AF9A 5KBFA 2GNBA 3A0KA 3LEMA 2IFWA 1TQ5A 4OI4A 4Q0PA 4XUPA 4XHXA 1GNZA 3AXDA 4AXOA 4JHTA 2FCVA 2ZXQA 3D82A 5E6HA 1BBT1 1CZVA 4AGRA 1HRV3 1HRI3 4CVUA 3W5NA 5F2SA 1O5UA 4Y22B 3WNKA 3A21A 2WFPA 2PA7A 5A6YA 4URAA 5A7PA 1OBNA 2WNUA 5E8AA 2CAVA 2JD4A 2HWC2 3J8F3 3OG2A 4MO3M 5C70A 2TBVA 3M3QA 1WA4A 4M3CB 5LBFA 5IK5A 1CN1A 4XTPA 2C24A 4KWUA 4LITA 2YFZA 2DYCA 4BQXA 1NY72 2E26A 3H8UA 4TLFA 3U4SA 4CTEA 1HDKA 4Q4V2 3QH6A 4CE8A 4J6GA 1W9FA 4QWNA 2XJQA 3IIIA 4IGPA 1JS9A 4GWNA 4XF0A 3ZIWA 4LKDA 1GZWA 1FPN1 1SFYA 2D43A 2DCYA 4YW5A 4D0QA 4QAWA 1HQNA 4WVVA 1LHNA 5BNPC 4Q4W1 1OF4A 5FCCA 2WYFA 3I3DA 1UMZA 4M01A 3FN9A 2VZTA 1NCRC 1GWLA 1UY2A 2Z2SB 4OUEA 3VHNA 4GQ7A 4N8MA 3ZOIA 4J1XA 3TN91 1AYN3 1QWRA 4CA9A 2J7MA 3MLJA 3MF9A 3NWKA 1QJU1 1J59A 1S4CA 1SCRA 4JKKA 2VBPA 2WA4A 1VRH2 3AKSA 1H9PA 3FFQA 2YC0A 3PTYA 3J26N 4LQRA 3SCFA 4YPJA 4PIYA 4EYUA 1E5SA 2VZQA 3B01A 1QOTA 3ZFEA 4A42A 3VBSB 4CEYB 4QPGB 2VTXA 3BB6A 1ASJ3 3E97A 4QKDA 3NV2A 4DUWA 2GP3A 5H9SA 4MVTA 4COYA 2V4AA 4UT5A 4A4AA 1RIRA 5CEHA 5EYXA 4AF9A 2RJ2A 3VHRA 1AXZA 2XMLA 2RG4A 1C4RA 2ZGKA 4ONUA 3T08A 3RMXA 1V9U2 1RUE2 1RUH2 1HRI2 1Y4WA 2VZ1A 2VOTA 3LWCA 3PIGA 3VL8A 4C0HA 5C33A 1JYXA 3AYEA 1MS4A 5JZGB 2ZJCA 4IEQA 3AMMA 5LA9A 2EIGA 4K7JA 3L9JT 4RHV1 5GLTA 5JIUA 5GZCA 1O4YA 1RUD3 3AFKA 4R9BA 3NNGA 1QJU2 3UV9A 1PIV1 2GC0A 1G9CA 4A7ZA 4BU2A 1W8FA 2JDHA 4MZUA 5LY2A 2BOIA 3EYPA 3H9AA 1K5MA 4YZ3A 3SC7X 1UU4A 3L2YA 4LPLA 4NPLA 5FK7A 4QX8A 3SLIA 3HN1A 1VBD3 4COZA 1UKGA 2W0XA 3OPZA 4AE2A 4HVQA 3ELNA 3PVNA 3ZPOA 3BGAA 3LFMA 3M8LA 1XNCA 4CCDA 3FLRA 5C9AC 5HXMA 3UJQA 1ASJ1 3KVAA 1NAEA 4HK9A 1BVP1 1OLRA 3ZMOA 4CXXA 1KD7A 3RFRA 5FP4A 1XB9A 5AC92 4MGZE 1JU4A 1P8JA 5C9AA 1W8HA 2R043 3M70A 3U0ZA 4AVSA 3CBNA 2PHUA 3WG3A 4TLGA 4AAPA 1CAVB 4UOJA 2WUHA 4HONA 2OT7A 1RTVA 2Z69A 1JOPA 4ITCA 2PHXA 4XF1A 2JG8C 4LO4B 5GLUA 5FZIA 3LA7A 3BYWA 4LBNA 1ZM1A 2AC1A 2FDKA 1ZVFA 1GOGA 5L9BA 5K9YA 1GR3A 3WZ1A 4DEQA 1NA1B 4FBFA 1S2EA 4XDPA 3WQBA 1JODA 4XAAA 2JX9A 1SCSA 2XG3A 1BK1A 3RYPA 2ZEWA 3VBHB 4JTNA 4QPIC 4CU6A 1S1AA 5C3RA 4AEKA 5IK8A 4XACA 4W6WA 4ZPIA 5HBAA 5FJKA 2ETEA 4S2GA 5FZLA 3VKLA 4L97A 4Q4V1 2V4VA 1W2AX 4IL7A 5JXIA 1TVGA 3IDEA 1REFA 1OA3A 3W9AA 1F31A 2KD7A 3J8F2 5JXHA 2ORXA 2G9FA 4MHUA 2GN7A 2EXJA 2WLPA 3I3EA 2IZWA 5FK8A 1AZDA 3I59A 2AGSA 4HZFA 4DZGA 5IVBA 3OGGA 1VPHA 2ZX3A 3TEYA 1W0PA 3V0BA 1LOFC 4NIIA 4QHOA 4PBPA 1JN2P 1PK6A 2BZDA 1LHWA 3LFIA 2Q30A 5J98B 4COWA 4CUAA 2VOWA 3VBFB 1RVF2 3HNBM 3LEGA 4WBBA 1ZZ6A 1PO23 2E7AA 1N3OA 2HBTA 2B46X 4MH0E 3JZVA 1IQDC 3VBOA 2JJ6A 2QCSB 5F2WA 3QH7A 5KHJA 2R071 1GWMA 4Y1VA 1DQ4A 3IMNA 3POBA 5FYHA 4INDA 2XKPA 3ALQA 5A33B 4H7MA 5A6XA 3KMHA 2ZOEB 5AC93 5AFEA 5HI0A 4FPEA 4CXYA 1AYN2 3S30A 4UF0A 1OFNA 3VD3A 1A78A 4HG6B 1TG7A 2YGMA 1AL23 2WQ4A 3GF6A 2JIJA 2VBDA 4M00A 1LNSA 2P3KA 3S0MA 4I09A 4UFKA 1W2NA 1EP0A 4E8DA 2RDSA 1VMJA 4IEVA 2Y0OA 1YHFA 3P1IA 5F3CA 2XWJB 1H8TC 4P08A 2CNAA 3TYJA 3BN6A 4ARXA 3OY8B 1GOFA 5FZEA 2B8MA 3OBZA 4SBVA 1WCUA 5EWSA 3T0DA 4DY3A 5IVJA 1EUUA 3VBUC 1JOJA 4NHYA 1IS4A 2UU8A 4FT8A 5GLZA 3PTRB 3WW3A 2JKBA 2BWAA 5IWFA 5D8AA 3HNMA 2A3WA 5HPOA 3J9SA 1XNAA 5IW0A 4Y20A 1K3IA 4QM9A 3WW4A 4Y4RA 3CJIC 4K8RB 3VBSC 3OSDA 3M3CA 4ZU4A 1PGL2 5B4XA 2VW2A 3B3QE 5DMYA 1O3SA 3SCHA 1TMF2 3X29B 1XOYA 3HBKA 4AFAA 1PMHX 4XFBA 4Z1VA 4AFBA 1AL21 1LHOA 3O1UA 1EAH2 3RS6A 3BTYA 1S0IA 2PXJA 2HYKA 2ARBA 1EY2A 2WO7A 2Q8DA 4GB33 5FXWA 1QKQA 5L7OC 4HANA 1V6IA 1H8TB 5E1RA 3UYJA 3ZFEC 1MS9A 2QUOA 3T2OA 2PHWA 4ASLA 3LDKA 2VY0A 1NQJA 1CX1A 3LCPA 2Z79A 1S0FA 1WLWA 2FHRA 3C2UA 1C8M1 3UGFA 1WGPA 1ENSA 3OB8A 2R062 2XKOA 5DZGA 2XDVA 2ZX1A 5D21A 3TRSB 1RUG3 2HYXA 3LAGA 3DYPA 3NAPB 1C5IA 3C8XA 4Q4X2 2NLRA 2W87A 5KC6A 1IPJA 5T5PA 1W2UA 4AVTA 1JBCA 2VVFA 1XU1A 2QKDA 1F9KA 1PIV2 2VMDA 5K0UB 1E57A 5CAZA 3WHTA 4D8MA 2FZ2A 2RV9A 4QHBA 2AENA 3VV1A 2X5IA 1ZA4A 5J7MA 4E8CA 3C3VA 1VBA1 2JDPA 3ROUA 2HWE2 1AR71 4AQ2A 4IE4A 2DDUA 3E6BA 1NA1A 1O91A 4YW3A 1YCIA 4B4QA 3FC0A 4Y1YA 5F9TA 2VQUA 1AXYA 3GZAA 1PHMA 2XHNA 3QBQA 2XB6C 2VU9A 2PTMA 2VMHA 4CDWA 3R4DB 1LODA 3MIHA 3AP5A 4HN1A 3LDRA 5EJZB 3GZTB 2VZPA 5FAXA 1CAUB 4XQWA 2ZZQA 2WNOA 3M2MA 4BJ0A 4AEDA 3GZEA 2ES3A 4IW3A 3WF2A 1GKBA 4E4HA 4I2OA 1MZ5A 2P5BA 1Y3TA 5FYMA 2HWD3 4JTOA 4PIXA 2PHRA 1L3JA 5EYYA 5GM0A 3T09A 3WX5A 2ZHLA 4UI9L 5JSPA 1VRH1 3I7DA 4YFWA 4M3CA 4PI2A 3RYRA 2MEV1 1W28A 2XXZA 1G9AA 5FYTA 4CDQA 4E27A 2CGPA 3AL5A 3PUSA 4MGSA 2VCMA 4IEOA 4QGLA 3ZN4A 4IEXA 1C1FA 4YG6A 3MUZ1 2J1EA 1W3XA 1W90A 4LLOA 4AVBA 3K77A 5FPLA 5FZGA 2ZBJA 1B09A 4KU7A 2R1DA 3ZSJA 1AX0A 4NRQA 2WS92 1DZRA 1RMU2 1OD3A 2PLV2 3K75B 3KV6A 5ACA3 1W0OA 2JE9A 1AYM3 1J3RA 3VN4A 5BNNB 5JLVA 1JZ6A 4P00B 4HVOA 1AR82 1DLCA 2CL2A 5FZDA 3U1XA 1EV11 2XVKA 5K0UC 2WKKA 3OEBA 1KFUL 1PVC2 1OC1A 4JDMA 4XILA 3WP4A 2ZTNA 4WM7A 5IUQA 2VUCA 5FQ0A 3VD4A 1FMD1 2HWD1 3IB3A 2NMNA 5LEKA 5L36A 3VDBA 3K4DA 1AR61 5IVVA 4XZUG 4IESA 3VKFC 5A1LA 3IDCB 1WW4A 3RZJA 1REEA 3T2PA 5LRSA 1VBB3 3E5QA 3USUA 2GNDA 4HPKA 2W52A 4FPKA 1M4WA 4GJZA 2VNGA 4QXKA 1GZWB 3H42B 1G8WA 1E5HA 4MGQA 3B93A 5FOJB 1JZ2A 3CZJA 5IVYA 3VD7A 3BIWE 1UAIA 2CV6A 3OUHA 3IT8A 3DXTA 1NKGA 5BNOC 5LCWL 5FREA 1OH4A 1PVXA 2GH8A 2RR11 1X9PA 4IE0A 1W9YA 3WDYA 2XONA 2UWCA 2P34A 1XNBA 3JB8A 2CYFA 2BOJA 3H3LA 2XBO2 3R4SA 5ANNA 4X6QB 4S2DA 2AUYA 4I3GA 4H3WA 5JIAA 1W8ZA 2DUOA 3I2KA 4LMFA 1BYHA 4GD4A 4E9KA 1RJ7A 4Y1UA 1WW5A 2JDNA 3ZFGA 1HN0A 2PN5A 3HAGA 3ZXKA 1V0AA 1OOPA 4CCEA 2G9ZA 4KMQA 4ASMB 4MSVA 4C91A 4AZZA 4WM8B 1YFYA 2B9UA 5DAWA 3LB9A 5FZKA 3LIHA 3BTXA 2JDAA 2Y38A 3UJOA 1D2QA 4QPGA 4Y26A 3KQRA 3SMHA 4AEMA 3H8OA 1W05A 1YQ8A 1WLDA 1JYIA 4C90A 3GNEA 1XYNA 3VZOA 1YQCA 1QH6A 2L9LA 4LBQB 1UY4A 3AP7A 4YG3A 5GKAC 3TAYA 1VAVA 2AEZA 4XOGA 3E1F1 3HN3A 2VNRA 3CNAA 1YFUA 2BNMA 4P14A 4LULA 3I97A 5KHKA 2R063 4JZRA 1OUXA 3VBRC 2HBUA 5FYYA 4GKYA 5FKBA 3RJ2X 4CCOA 4N7IA 1OQDA 1JMUB 4IXLA 2BP6A 4BISA 2ARXA 4QPYA 4YGCA 2ZKLA 3C7OA 3H1MA 2HWC1 1J58A 5FZ4A 2BQPA 5JPMB 5FZFA 1SDDB 2QVSB 4NPMA 4PQ9A 4FOVA 1HB2A 3V0AA 4LO5B 4I0AA 3WNPA 3VBFC 2VCAA 2GMEA 1SDWA 3ZMNA 1C8NA 4EJRA 1K42A 4ZKTB 2RS12 1PX4A 5DUWA 5K4LA 1LOCA 2DBIA 1GP5A 3ATGA 4AFMA 4A7YA 1ULCA 3I8TA 4CXWA 2WAOA 1L7LA 5CNAA 4QXHA 4BLJA 2W94A 3O1OA 5C4WA 4FTSA 1LENA 1MZ6A 4JV4A 2WZPP 4IEPA 3THCA 2Y34A 1ZBE1 2PLV1 2QQOA 1G9DA 4QXBA 4AWDA 2QQIA 3I59B 2EIDA 1FOD3 1NXD1 1STMA 2VVDA 3N7LA 4LK7A 5FXXA 1PM4A 1W9SA 1QDOA 3WCRA 1OQ1A 1ZZ8A 1WBLA 2A1XA 5I8TA 4Q0SA 2HWC3 4FTBA 4Y20B 3KHBA 1DQ2A 1PZ9A 3PUQA 2YU1A 2JG8A 2WZR2 4R52A 1J84A 2RDQA 1TME1 3USUB 5L9RA 5F6KA 3HJRA 4D6QA 2D7FA 5GLVA 5K7PA 5DG2A 2IVJA 3ME2A 3RGBA 1ZBA3 5CKQA 2IXIA 3PVBB 4LJHA 1RUJ1 1SLIA 1V6LA 3KF5A 1VBC3 3O1RA 4AEDC 2F4LA 4Z2WA 1SEFA 3L2HA 3V56A 1HX6A 4PF1A 2W92A 4WM7B 3WOGA 3ZLIA 1RUD2 3O1TA 3EMRA 4LUKA 2SLIA 1UQXA 1F35A 1LEDA 3JU9A 1DGRA 4HSLA 2EA7A 2GNTA 4QQOA 1SLLA 2X8KA 5JR7B 3ZYIB 4AG4A 2ZGSA 3KT4A 2SBAA 1EYBA 2YMZA 2VW0A 4KH9A 5F5IA 2D6MA 1F8VA 3KV5A 1S0GA 2KR2A 1US2A 1UZWA 2JDZA 3O1SA 3HIFA 2OPWA 3IPVA 1V9U1 3KS7A 3PVEA 3QLQA 5LBCA 4HVRA 1Q5OA 5C9AB 3FHIB 3BOWA 2DVFA 2DURA 2FMDA 4YFZA 1VMHA 2YBKA 3KVBA 4JCKA 5LATA 5FPUA 2IXKA 5GJ6A 1OQEA 3ZXFA 2VMIA 5FYUA 3U11A 4GH4B 2JG8B 4TZDA 1WA6X 3WV6A 4XE9A 3K48A 3KZ4C 3MW4A 1MQTA 3KGZA 3OEAA 2B4KA 1V70A 3C7HA 2UWBA 4YYOA 4YW2A 3GZUC 3RWNA 1OURA 2ET7A 3WQ1A 3DF0A 1F4HA 1U5IA 1AJOA 1COV3 3AXEA 4LO7A 4QGMA 1PVC1 2XBO3 4JRLA 4Q1PA 5LBEA 1LAJA 2A6VA 4RQPA 3N9LA 3ZN5A 3FBYA 5DDJ1 5T55A 2MPFA 3KWVA 4XDQA 2HWF3 1ZZBA 1FOD2 3HR9A 2R6QA 1MS1A 2DFCA 3WG4A 2VAUA 3DECA 4XHBA 4Z2AA 2AYHA 3N7MA 2WIIB 4LO6B 4M4PA 4WVZA 1O3QA 2TUNA 2ZGTA 4DO0A 4XJUA 1NZCA 3LDBA 1UZVA 2RS32 3LA2A 5J48A 2ZGQA 4YARA 5FLHA 2BFUS 5FY1A 2B9VA 1CD3G 2GN3A 4Y5SA 1NCRA 1AVBA 3VKNA 2KM2A 1CWPA 2ZHKA 3OJBA 3NJXA 1UU6A 3VLBB 4FFHA 3TEXA 1HRV1 3K51A 3AKQA 1RVF3 2FD8A 1KFXL 1JU3A 3PLQA 4F3JA 2BRTA 5IHRA 1QNWA 4UFLA 2C5DA 1YFWA 3NRUA 1ENQA 4KQ7A 3WR0A 3H7JA 4AHYA 3PIJA 5C3PA 4Y5TA 2JB8A 2NP0A 2QQMA 1QJZA 4W6XA 1CAXB 2QTWB 4OI1A 2HEVF 3A4UA 1Q56A 5JOXA 1NLRA 3R4UA 3Q8AA 1BBT3 4BQYA 5AVPA 1GNYA 4IE7A 5JI9A 1PMIA 5DUVA 3OUJA 1NYWA 4EN7B 1JW6A 1U12A 3CQOA 1GSLA 1W6MB 3WF0A 2WA3A 5IAXA 4OCTA 4QX0A 5C4WB 3VBOC 1OOPC 1W6NB 4Y1ZA 3WQ0A 5AC91 4OHXA 4XABA 1R093 1LOEA 2G19A 1ZNPA 1G7YA 2WL1A 3MO4A 3N9QA 4YGEA 5CBLA 2WZR1 2JEMA 3WINE 2DCZA 5A3WA 2BGPA 3MV11 4A44A 2IFRA 1MZEA 2DVDA 2UYAA 4SLIA 4TSVA 1IG3A 3FX3A 3OD4A 4LBMA 3BPSA 4LUMA 4U2AA 5C5UA 1ZZ7A 4LBJA 2W47A 3A22A 3IWZA 1F4AA 2DUQA 2JWPA 4QDSA 3PVOA 3CKHA 5EJ1B 3WEZA 5HCAA 2P1BA 3N36A 4JQTA 4X8PA 4RR3A 5F39A 5AVAA 3T1MA 1WMDA 4MOAA 4XUTA 1XYPA 3NNJA 1ULOA 3IAPA 5LEJA 4NUBA 4OQ9A 4Y22A 3WCSA 3WLUA 5JI7A 1CAWB 3RZKA 4WZCA 5FKCA 1IG0A 4AI3A 3VBOB 3MFCA 4GAZA 5A7QA 2RS33 5JSRA 1K5JA 3OOXA 4YM2A 1YI9A 2K9ZA 3WDTA 1AJKA 4FOWA 3POWA 1VBC2 3TN93 3PUIA 4MYEA 1UF2C 1DF0A 4LHNA 1HLCA 4PLMA 3OPTA 4QPIA 5FO7B 3RI9A 4JGZB 5F3IA 1AL0G 1DIWA 5BPXA 2WAAA 2RMU3 3C7GA 4FPYA 3AMNA 4QMAA 2H6BA 2BBAA 3IDBB 2WSVA 1ULFA 1HB3A 4HL0A 4MXVA 2Y8KA 4P9YA 5FY7A 5FZHA 4DXRA 4AI8A 1OXCA 5BY5A 2RE9A 1GP4A 5A7WA 3O1MA 1MEC3 1QJEA 5ABJC 2FDIA 4CUBA 5A6ZA 5E89A 5LB6A 2DCTA 2QQKA 1GFF2 1QOSA 3GBGA 4GMP1 4NOTA 3FHQA 3GJBA 3NO8A 3N3HA 4GH4A 4IV3B 3NL1A 3POJA 4LBKA 4OI2A 4RHV3 4UWDA 4XMAA 1OKQA 4A7KA 4LTAA 2X09A 4NIHA 4FVVA 3BTAA 2HWE3 1YWKA 4YVWA 4CPBD 4K21A 4N43C 2F17A 3RQ0A 1UOBA 1A34A 4LXLA 2PFWA 2VL4A 1AUYA 1PIV3 3NSTA 5FZ7A 3RZMA 1DQ0A 1VBD1 2WABA 1MS3A 1WCDJ 4XYXA 1GP6A 5JOYA 1BHGA 1ND2A 3ES4A 1VB4A 4XQ4A 3VD9A 1IGOA 5F5QA 2LTNA 5I8YA 3O0VA 1K5MC 1SBEA 2ZMNA 2QQPA 1ENXA 3BVCA 4HPKB 2VCCA 3UL2A 1YJKA 4AI2A 4BQWA 2BV4A 4OZXA 1L7QA 4FFFA 4AGGA 4MGYE 4NAMA 1ULDA 1H4HA 1UXXX 4JDNA 4RSUA 1RUE3 4N53C 4HSJA 5DZEA 5CYYA 1F5FA 2BJSA 5T54A 3THDA 4BQ2A 3OGRA 2WO1A 1UOFA 5CKMA 4IQPA 1PZ7A 2YBPA 4KWKA 5GZEA 3SKVA 4TN7A 5JWPA 1JZ8A 4LT5A 4RQPB 4GB32 1UL9A 2R49A 1GZCA 2OZJA 4E2QA 4FAGA 2W2IA 5HV4A 2DTYA 4XBLA 4MUVA 1JOBA 2Y6GA 1YRZA 2X29A 3FUOA 4YW7A 5A7OA 1YYNA 2DFBA 4D69A 4L2NA 3T4VA 1UOGA 1N47A 1KITA 4QD2A 4BH9A 4AQSA 1ODMA 3K4ZA 4MX3A 4Z92B 5A3NA 4L99A 3HPNA 4PIZA 4Q4Y1 1O7FA 2JIGA 2LROA 2LS6A 3ZSEA 1NQDA 1S2KA 3OBTA 1OPMA 2K0GA 1LCLA 3PNAA 1LHUA 1GANA 1OHFA 1Q8PA 3PL0A 1CVNA 5GALA 5A32A 2RDNA 1JYVA 3J7LA 3VBHC 3ZM8A 1D2SA 2Z42A 1JXNA 3IAQA 1JI6A 1PNFA 1WD3A 3JD72 4JAAA 3USSA 2GMPA 2WC2A 4Q27A 3VBHA 2RJLA 3AP6A 3ZXLA 4ES9A 1FNYA 4EWAA 4Y4YA 2Q5TA 3KSCA 4N9IA 4RA0A 2CDPA 3MIDA 4P9LA 4ARYA 4O9GA 3HMYA 2P37A 1UZ0A 2VM9A 3B69A 4RQPC 2BW8A 5IAVA 5L7OA 1Z7S1 1WLTA 2VMEA 4B7EA 1HRI1 4OUMA 4CP9A 4V1PA 3AZXA 5FZ1A 1VAKA 4XZPA 1W39A 2ZHNA 4RHV2 3IZOA 3Q8FA 4PJYA 2P17A 2IXCA 2VZSA 1GWKA 2YYOA 4QDQA 5T3NA 2WNEA 2VW1A 2C1FA 2NPIA 4RGAA 1ZRRA 2RS52 3DEMA 2K46A 4N53A 4AL9A 1XE0A 2QNKA 5D8AC 5CA6A 2WFF1 2OKXA 4A3ZA 1CAWA 2WINB 3ACGA 4EZHA 5JZGA 5LZ6A 5A3OA 2HWD2 3EB7A 3W58A 3T0BA 4NROA 4IETA 4ISRA 4X6RB 1BXHA 3NMBA 4XUOA 5L19A 4V2WA 1JUIA 4XW3A 4CU8A 1SBDA 1PO21 3AZYA 2VUJA 4JQRA 1TNRA 4XIKA 3H8XA 1SHWB 2I45A 2WNUC 1J3PA 4UFJA 3OF1A 2RM23 1DGLA 2VUDA 3T1LA 1KEXA 4NRMA 3D0JA 4AOCA 1T6GC 4TXWA 2QZ3A 3NJZA 1UKRA 2R0HA 5EZWA 5FP7A 5FPZA 4DS0A 3QOPA 1OT5A 5D1IA 1QDCA 4HETA 2BGCA 4HKLA 1JZ3A 3MW2A 2Y6LA 1OUSA 5FZCA 1AR72 4NWWA 2ZEZA 4EN6B 2GC2A 2J22A 1POV1 3B00A 3WP5A 2GP5A 1G9FA 2HKXA 2W1WA 1C3HA 4NHLA 2A73B 3AP4A 5JXJA 1D7PM 4Q4W3 2HWB3 3BOPA 4PT6A 4XFAA 5A70A 2D6OX 5BNPB 5L9VA 4Q26A 4GA9A 1M06G 2FDJA 1YLLA 1SLTA 2JD9A 1CPMA 5FFOC 5TSWA 3WY6A 2VECA 5J09A 1I5PA 5F3EA 4BDVB 2XJVA 4DB5A 4NHMA 5CFDC 2GC3A 3LF7A 4XEZA 5M0TA 3H3ZA 3J4UH 2VGDA 2A6YA 4I0BA 1MQTC 1MACA 3EJKA 5FY9A 2RM21 3ACFA 4PBOA 1AX2A 4ZXEA 3WDWA 2HEWF 5EP9A 5I0UA 2Q8CA 3F2ZA 1RUF2 4D6RA 4C0BA 3F95A 4PDWC 3LEIA 1VE0A 4BQ4A 4JKMA 5I0TA 4RGKA 5A3UA 5B2GB 3O0WA 4GULA 2PQSA 2WWUA 1D4M3 5JSOA 5FZOB 2QJVA 3B9CA 2XH6A 2GC1A 1HQLA 4LBQA 1POV3 4EROA 1H0BA 1V6KA 1AR62 1OD5A 4IV3A 2G9GA 3U14A 3U75A 5FUIA 1CIWA 4RR3C 2AH2A 2XL9A 4GXLA 5FTTC 1C8M3 1C1LA 3MDPA 5FP3A 3S7IA 4HN0A 3MLLA 3N9PA 2B39A 4LBLA 2H0BA 4BLIA 1HV1A 1R1ZA 3JXSA 1OOPB 1RC6A 1O59A 3R0RA 4CCKA 3AZWA 4XUNA 1RUD1 2D5FA 3A0NA 1IOAA 5J36A 5FMCA 4EWEA 4DFSA 4NE9A 4RFT0 1NZIA 5FYIA 1Q8QA 2OVUA 1BK0A 2RDRA 2W91A 2VVEA 4K6BA 1W99A 1AHSA 1QGLA 3NV1A 2J42A 1R1A3 1SPPB 5FO8B 1KRIA 5DN2A 1A8DA 1JYTA 2E7TA 1TNFA 2J1UA 2E63A 4EN8B 4GALA 2CGNA 3KCCA 4YGBA 3RPQA 3JBG2 2BNNA 3NJYA 4FP2A 4N7UA 1AR73 1DHKB 1TEIA 1LOAA 3QCWA 4K9SA 4BXFA 2TEPA 1BCXA 3ABZA 3G6JB 1WCQA 1Z7S3 5HCBA 4AI0A 1H8VA 2ATFA 1CZTA 1ZYBA 1H2KA 2MEV3 2BBVA 2VNOA 3ZSKA 3FLPA 5FZ8A 3RJRA 1N1YA 5FBJA 3RWKX 4IEWA 3POYA 2ZMLA 5J3UA 1NE6A 3T2TA 1RUG2 3LPFA 1VBC1 1QJFA 2ID4A 4XFHA 3LE0A 3HEIA 4CDXC 2A3YA 2WJSA 2JDMA 2X10A 3WP6A 4CP9B 3WF1A 2WNVA 4COUA 1DYPA 1E5IA 2YC2A 4XCBA 4BOWA 3O0XA 1LOFA 3DKQA 3OUIA 2VZOA 1RHI2 3AKRA 1UZZA 4LBOA 4H7LA 4NN0A 4HMZA 3VBFA 4AFCA 5FZBA 4FPFA 4GZ9A 3N4MA 5IFPA 4LOTA 2VOKA 5I8SA 5CKNA 3AYDA 3VZNA 3ASIA 1UNBA 3S7EA 5G05L 3VDCA 1UO9A 1YEWA 2WQ8A 4UBGA 5JVVA 1OLMA 3HNYM 5KHGA 2ENRA 1PNGA 3VHOA 1WW6A 4AGVA 5FOBB 2RHPA 2HH9A 2W1SA 2ZEXA 5JDBA 2ET1A 1XBFA 1R082 2GNMA 2Y6HA 1C8M2 1WMXA 1PGW1 1ND2B 1FT9A 2UWAA 3PU3A 1C28A 1VB2A 3G7DA 5FPAA 2HWF2 4UW4A 3MYXA 5LY1A 3ZN6A 3LZZA 3BI3A 2RS11 4FPCA 1FV2A 2W46A 1XPWA 2GALA 3MW3A 1C5HA 2JB4A 5FO9B 3SH5A 1XYOA 2VE1A 2XOMA 5A80A 1GQGA 4LKEA 1RUNA 1ASJ2 3ON7A 5C8WA 3WUDA 4CP2A 5A1FA 2EIEA 4EZ4A 3K4AA 1CX4A 2W95A 3SEEA 3MGUA 3Q8CA 2HWF1 4CCNA 5CFCC 3BALA 3U37A 1MS8A 1HJGA 4P02B 1W6PB 2W5FA 3MIFA 1GV9A 3SCGA 5DUUA 3U07A 3ZFGC 5ACA2 1YQ5A 5KWRA 4M3CF 4TTGA 1HJFA 5KXCA 3WDXA 2VO5A 2YGLA 4JGZC 1Z7S2 2R073 1S2BA 3MUY1 3PDQA 3I3QA 4OLLA 3I3MA 5JOWA 4ISQA 4DRRA 3H3UA 3ZSMA 4IV1B 4UFIA 3THPA 1UU5A 2Q0AA 1GQPA 3UETA 5FZ9A 2D6LX 4ZXKA 4BM8A 2H6CA 3NNFA 4ES8A 3POFA 5LK7B 4YVSC 2V5YA 1UY3A 1XJAA 2XJSA 5FY8A 1UMHA 1HXS1 1O3RA 5JOZA 2VQ0A 4XURA 1DQ5A 3M3OA 4MGIE 1Q43A 5FZOA 1MQTB 3FZ3A 4LHKA 4PDWA 2LUWA 3OGJA 4OZOA 4E2GA 1KJRA 5FUPA 4FPHA 4EQVA 3I2JA 2YG0A 1UMIA 4MADA 1WCSA 2QBXA 4EN9B 4GB31 1V6NA 2WDBA 4XF9A 3H0OA 1DZTA 5FYBA 2R7EB 1SBFA 3H1YA 1RUH1 3LA3A 3WSOA 1QMJA 1AX1A 4OHVA 1KXGA 2J1TA 4MG2A 1GLHA 1N3PA 2KA3A 2F6BA 4LORA 3VBUB 2JG9A 1AR91 4YNIA 3BTZA 5FUNA 1WWYA 3SXWA 2R061 3MFAA 5FXZA 3O5SA 5FIXA 5I93A 3DKWA 4BMEA 2ZGRA 3ORJA 3H50A 1F15A 2XLGA 4UW3A 4BB3A 1W8OA 3DYMA 2R32A 4Q5OA 3B9IA 3O7OA 3NVCA 2WYSA 3P6BA 2V09A 2NM1A 2PHFA 3LOIA 1QU0A 2Y64A 5GZFA 2BGOA 4NAOA 3ZXDA 1VP6A 4G3YC 4JGYB 5FY0A 1EUTA 3KV9A 2EAKA 3Q8BA 4DXSA 1JZ7A 4IEYA 1VRBA 5J1XA 4CCMA 4OVEA 5DQ0A 3AC0A 4R9AA 5JPNB 4ET7A 2FDFA 1FMD2 1LESA 2NMOA 2OPKA 1KJLA 1QIQA 2D93A 3BKZA 1YFXA 2JE7A 3J7NA 2P6CA 1RYYA 1BJQA 4LO8A 2FQPA 4DUVA 3KV4A 3AB0A 4A6OA 2DF7A 2ADDA 2XR4A 1XNKA 3PUHA 5FP9A 4LA3A 1QJY3 3TWIA 3W59A 3EXUA 5EQUA 4B3NA 1UWWA 1VBD2 2BERA 2C9KA 2XLFA 3LPGA 3T3YA 2R042 4ZZ5A 1VBA3 1WKYA 5CU1A 2RMU2 1UYZA 3U78A 4BMBA 4D7YA 3SHRA 2DTWA 3RMYA 1VMFA 4QDRA 4TWTA 2Q1ZB 3IM0A 3BUCA 1F5JA 4V2VA 1D4VB 1NCQA 1SFPA 4FOQA 1MEC2 1ZA7A 4GWJA 3O1VA 4JVAA 2XUEA 1W3VA 4CDUB 1CGPA 3ZSLA 2YY1A 2FMYA 2ERFA 3VL9A 4KG0A 4HT1T 1JYNA 4K20A 5SV5A 3SISA 4DUXA 1CONA 3MHZA 1JH5A 5F5CA 1R083 1RUJ3 5EHDA 1DP0A 1MZFA 1S0DA 3Q9OA 1DLLA 2E33A 4G9SB 2NYYA 5FWJA 3I2GA 4XFGA 1U5XA 3WUCA 3MPBA 3UESA 5IT6A 1NT0A 5FLIA 2ZAHA 1MR5A 3FUQA 2OYZA 3PMSA 4RYDA 5BV6A 2OXBA 2ZAAA 4IEUA 3Q8EA 2Z5WA 1DBNA 4B4PA 4BWOA 4A3XA 1T6BX 2J1VA 3AFGA 1XRUA 1U0AA 3MBWA 1DQ6A 5LA0A 4HBNA 5E88A 5A1AA 1S0JA 5CIRA 3TB0A 3ZDSA 2E6VA 4NWVA 4NVPA 1UYXA 1J1LA 1CAVA 1Y43B 4GJYA 1LRHA 2IXLA 2LRPA 4O61A 4Q4X1 2QQLA 4FPLA 4HFSA 3PHMA 2ZEYA 1HIXA 2R072 1LGNA 3AKTA 1FMD3 2VXRA 3O1PA 2C9AA 1BEV1 4QT6A 5F8PA 4B7KA 2W68A 5BNNC 4M4RA 2VQTA 2V73A 1QJX3 3ETPA 3KT1A 3MLKA 4C8DA 2IXHA 2RS51 3VBUA 1HW5A 5A3MA 4BA6A 4E4SA 2E53A 5C6CA 4N43B 4CEYC 1VBB1 4FOYA 2LALA 4YVSA 1TMF1 4XFIA 5H9PA 3INAA 1PO13 2FCUA 2BWCA 3IPVB 4MGTA 1ZRCA 2UYBA 1REDA 4WV8A 4C1XA 3TNPB 1B35B 1I3HA 1RUI1 3ETQA 1WCKA 5AFBA 1DG6A 4NR1A 4W6YA 1O4ZA 2Y60A 3J8F1 4XBNA 5DUXA 3VZJA 1EPWA 2V72A 3LIGA 4P9IA 3NAPC 3E5UA 2JDKA 2Q1MA 5T5LA 3E6CC 4OI0A 1W9TA 4Q4X3 3AVRA 4XETA 4DRVA 4GMP0 4FAHA 3K3NA 5JXGA 2AZ5A 4JGYC 3NKGA 5CFCA 1RUI2 2XHKA 4MXWA 5FP8A 1KDKA 1VBE1 3AJZA 5FXVA 1V6JA 5A3PA 2VZRA 1QXPA 2CDOA 3FLTA 4QKBA 3ZR6A 4A2UA 1RGSA 1RVF1 1W8UA 4JGYA 4IE6A 1EPZA 1LU2A 1SLBA 5EPAA 5F32A 2CAUA 2DWRA 4FQZA 3NAPA 3GBWA 4XXAA 3ZXGA 4AVCA 1TMF3 4IUGA 4KBZA 4UYBA 4AR2A 4B1MA 3RZGA 4CU7A 4KU8A 4JGZA 4XUQA 4Q8KA 4FSJA 2ZGLA 1W6OA 1PZ8A 1T2XA 2IWGB 4Y1XA 1AYN1 2BPA2 1LULA 3DGTA 1LU1A 3VBRB 4M0HA 2X5IC 1NCRB 2MNGA 1YIFA 3GXUA 1WBFA 2B5HA 1S0EA 3D6EA 4P5YA 4E2SA 5KC5A 3I2IA 3N7JA 2C4XA 4DY5A 1EAH3 1GNHA 1RUF1 2AREA 5FYSA 3SQOA 3TNQA 5CG8A 2W1QA 4Q4W2 1ENRA 3SITA 1ZRFA 1GU3A 1KDMA 2VPVA 3HOBA 4R9CA 2D97A 5J96B 2PHDA 3BODA 2CY6A 1R64A 2ZGMA 3OCPA 4N90A 4AI9A 3AMPA 2F4PA 1VJ2A 2BTVC 1GZTA 3KLSA 3UGGA 5IK7A 1ZBE3 1QNYA 2PLV3 3N35A 2DVBA 3QACA 3QD6A 3UK9A 1G9BA 3TBDA 1PGSA 5FLJA 1UD1A 2CWSA 5SV8A 3SKJE 4CEWB 1QXJA 4RS5A 5A33A 1AR83 4ZONA 2VXJA 1HKDA 1YQ6A 2GAUA 3VKMA 4LIUA 1WMEA 3ACLA 4QB2A 1H4GA 2I07B 3GYDA 4F8AA 5JR2A 1ND3C 1GQHA 5KXEA 5G04L 3HQRA 3WW1A 5C7GA 1IS6A 3LSEA 4S2HA 3ILRA 1PM7A 3POGA 1CQ9A 1OLME 1MEC1 2YDEA 1ZBA1 2VULA 3T30A 3VZKA 3TEWA 3CLPA 1UZYA 1FI2A 2VOVA 1IKQA 3POEA 3S5QA 5C8CC 1JYWA 3C7EA 1FOD1 1RUC3 1EAH1 1RUF3 4Q4Y2 4O9EA 2BYVE 3AZVA 3VDAA 2ADEA 4KI5M 1N3QA 2WSUA 4KGGA 1DGWX 2RMU1 1DZQA 3MF6A 4CDXA 1D4M2 1Q8OA 1YJLA 5FMDA 1CR7A 1W06A 2RM22 3ZFFA 4ORFA 1FNZA 3PURA 3ZYFA 1IQAA 3CL1A 4ZS2A 3CEWA 3A7QA 1OF3A 5H9RA 3U4XA 2I2SA 3I2OA 3ZN6B 2WFF2 5C8CA 1X8EA 5FQ0B 4I01A 5JMOA 3BIEA 2BVVA 2DCKA 1R1A2 4AW7A 2XJUA 3TN92 1LJ7A 4LHLA 5DABA 1J3QA 3GM8A 1I5ZA 1ND3A 4YM0A 1XSRA 1RHI1 3DN7A 3THTA 2HWB2 1G6NA 3M4FA 3FJSA 2E32A 1CIYA 2WZ8A 4FQ4A 4DOUA 4OHYA 1RUE1 2BEOA 1PMJX 5FZ0A 5IFTA 5FPBA 1R1A1 2PELA 1ND3B 3WDVA 4DNYA 4AQTA 3W5MA 1ULEA 4BK5A 1I1EA 2EICA 3NNLA 4IDZA 4K40A 5IVEA 3NW4A 4EE2A 3P3NA 2ZA9A 2R16A 4RD7A 3VB9A 5F7UA 2OA2A 4CDXB 3K3OA 4H2AA 4CDQB 3NV3A 3KB5A 1PK6C 3BPZA 1PGW2 1SLAA 1US3A 4FFGA 4UW5A 1VBB2 1FXZA 3SH4A 4L92A 2J1AA 4LA2A 5K0UA 4Q8LA 2WWJA 4NIAA 1LKNA 4MXWB 1OA4A 2ZX0A 3B94A 3JBG1 4P9WA 3P3PA 1LB2A 1LTEA 2X05A 2A70A 1O3TA 1NLSA 4JX0A 4B4RA 2FCTA 5C8CB 1ACCA 3KCYA 1YUDA 2VMCA 5F3GA 4JRAA 2ARCA 3IN9A 3EO6A 4FCAA 2CWMA 3V65A 3H8RA 3PJYA 2OX0A 5FBZA 5DXDA 3WQ7A 2D3RA 3ACIA 2IXJA 2Y0IA 1ZRIA 2BU9A 4Q4Y3 2PAKA 1JUHA 3WP3A 4AEDB 4YZ5A 4PI0A 4ZU7A 3VD5A 1WZXA 4I0WB 3DV8A 4G4FA 2JICA 4Z82A 1ULGA 1CESA 1OPOA 3ST7A 1X9TA 2BDRA 1JZ4A 1LEMA 2LW8A 2EXIA 3MIEA 3JB4C 5F6LB 2D40A 1NUKA 4ZHNA 5T5JA 1JHNA 4RS5B 4HK8A 1YXWA 4EN0A 1W6OB 2YBSA 3WG1A 5FMOL 5FMOS 2WS93 4PLNA 3I2DA 1ZRDA 1RMU3 2D3PA 3RZLA 2LM3A 4RR3B 4CP1A 2WFF3 5C3SA 3UKNA 2WWSA 4ATFA 5JUVA 1HQWA 4NPRA 3JBG3 2YZ4A 2VZVA 3ZYPA 3HD8B 1CZSA 3GHMA 1FPN3 1HXS2 2VMGA 2Z4FA 1Q3EA 2WO2A 4I3PA 3FFZA 2E31A 4TYSA 1FYUA 4PHZA 5DAXA 2DUPA 4P9GA 4E4ZA 5F1RA 2B42B 4K3UA 1QJU3 1XNTA 2ZS6B 3ZYRA 4DPNA 1QXRA 4QPGC 2WZR3 4BIOA 1C57A 3N7KA 4KL1A 4XIOA 5ANQA 3BU7A 2VTFA 1PX3A 3ZYHA 5IK4A 5L7OB 1I6XA 3JD73 5GLWA 5C4WC 1DU3D 1ZBE2 4CEYA 5LRRA 1RXGA 1OSGA 1URXA 4JHZA 4META 5CFDB 2DU1A 5BUVA 4XC9A 3PUAA 4R8HA 3A23A 1W2OA 4UF0B 4A6SA 2XJRA 4QX5A 1R091 4WVWA 3S6PA 2OUHA 3WG2A 2CU5A 2XL7A 5DZFA 4YSFA 3OGSA 2WS91 1RMU1 2JE8A 2HWB1 3ACHA 3S57A 4AFDA 4K1ZA 2XGXA 3H7YA 4P5HA 5T52A 5IVFA 4AQ6A 2Y33A 3RDIA 5K8SA 4WM8A 5KXDA 4IV1C 1H2LA 1UW8A 1Y7BA 4XVHA 4BYYA 2E7QA 2O0OA 2TNFA 2XJPA 1YI7A 3OY8A 2P2KA 2VBBA 4BQ3A 3MZHA 1RUOA 1H9WA 1ZX5A 2CSGA 3RNSA 5FZMA 3WF4A 4BHPA 3D4KA 3APBA 1NXMA 2OQ7A 3K46A 1Q8VA 4GWMA 2GSYA 3ZO0B 4D7TA 3P5BA 4AHXA 1QF3A 1UY0A 1S55A 3JD71 4H55A 3N9OA 3T0AA 1H6YA 1UX6A 3PJQA 5FPXA 4HOOA 2HEYF 1QHDA 1D4M1 1VLNA 2QE3A 1KS5A 1W0NA 2QDRA 1BQPA 1LOBA 4XFCA 4CP0A 2BFUL 2QFEA 3VDDA 3UNPA 1BLZA 5FJHA 2OW4A 3DXUA 1VBE2 1W6PA 3ZYBA 3WDUA 2W39A 1ZBA2 2DU0A 3D5OA 4U36A 5D8AB 3T2QA 3CIHA 5EXOA 3R05A 1ND2C 4MGKE 4KGQA 5HXVA 1J83A 2W3JA 1O8PA 2OQ6A 2HWE1 3OTFA 3WHUA 4ATEA 2X53S 2PHLA 4W50A 1OH3A 1OVPA 1S0BA 4OMDA 5H9QA 2UURA 4EV0A 3BCWA 2XLAA 1DCSA 4O7XA 2WQZC 4CCJA 5IATA 4BK4A 1JYCA 4AI1A 4RL7A 1QY4A 1V00A 4LNVA 4UBHA 2JG9B 1GMMA 2P4EA 4JDOA 5BNOB 5KHHA 3GGLA 3OBAA 1QEXA 4GH4C 1XQNA 4GMP3 3AK0A 5A3LA 2D6PA 2ZGOA 2YU2A 4R4XA 4RFRB 4Q4V3 4IGOA 1PO22 2IUWA 4N53B 4B29A 2RR12 2XQXA 5BNOA 3TOJA 4LK6A 2WT0A 1CAUA 1N1VA 3IIAA 4QXCA 2RJKA 3RYKA 2BUKA 2BVBA 3KQ4B 5B4NA 3LEKA 1QJY2 3DL3A 3ECQA 4LR4A 3WNMA 1AXKA 1S0CA 5DAQA 1APNA 2W08A 3D8CA 4AHWA 4UXAA 4NIGA 5FR3A 1AL22 4D3WA 2FBEA 3SH3A 1AR63 1RXFA 4IEZA 4CYDA 1BKZA 4AHZA 3JCIA 4CDUC 2WLQA 1PK6B 2YPJA 3U10A 2VNVA 4UW6A 3MICA 4MV2A 3URFA 4Y3OA 1HN1A 5JCTA 3AX4A 3AL6A 1UXZA 1LECA 2O14A 1GICA 2WBKA 2YPDA 2DVGA 4Q29A 1X36A 2DV9A 3OYWB 4S2FA 5FPVA 1NG0A 4QHZA 4A41A 4D6SA 5BNNA 4WZFA 4Y33A 4YLZA 5T5OA 1Z0HA 5ABJB 1HRV2 1UIKA 1DQ1A 2IC1A 2YB7A 1POV0 2GDFA 3CZUA 3D3AA 3FMGA 3MPPG 2R1BA 4CDUA 1CPNA 2OIIA 3DPRC 5A3TA 4YG0A 1OA2A 2W9XA 3EQEA 3RVHA 4KG8A 4QKFA 2ZABA 4DEVA 4IGQA 5JAXA 1D0GA 4OFGA 5CFDA 4KBBA 4WM7C 3ZXJA 1UY1A 4Y5Z0 5EIYB 1W6MA 5CZKA 1FAYA 2VQAA 2MEV2 3JQXA 1WMFA 3VKOA 2EXKA 3OBRA 4KNCA 4NHXA 4Q1RA 4K8FA 5IYYA 1IKPA 2G4IA 2QQWA 2A5ZA 4CEWC 1U5ZA 2UY9A 1K12A 2QQJA 2XUMA 1FX5A 4DMIA 3AP9A 2QZ2A 1SFNA 2XQRA 4QM8A 3VGIA 4BQ5A 3VBSA 4BE3A 4URTA 5A7SA 4C1WA 1L7RA 1NCQB 4LKSA 4XF3A 5I0SA 1BEV3 5IJRA 3IMMA 1SACA 3N9MA 4QU1A 3GBFA 3HT1A 4AAXA 4JKLA 2O8QA 2Y6JA 2R30A 2WR9A 3AMHA 2K2SA 1U5YA 3HQXA 4O65A 1NE4A 5A7WB 3ZDVA 3C7FA 4XJ9A 3O12A 4XJ8A 2XVLA 5FY5A 1BBT2 2YFUA 2E51A 3FWEA 3VZMA 1COV2 2X5IB 1O5LA 2XVGA 5C3OA 3ITQA 3FHAA 2VTXJ 4OUSA 4D7SA 2JECA 3AZZA 2DCJA 3I54A 3V64A 3W21A 3ZFGB 3UKTA 1RUI3 1W03A 4PLOA 5LK5A 5I0RA 2FDGA 5CFCB 3RZHA 1X82A 1DYKA 3VDDC 1CJDA 1O6UA 2D6NA 2CHHA 3GJAA 4YZ4A 3AYCA 1UPSA 3ZFEB 2EALA 3FE5A 3CHXA 3SNMA 1CJPA 5C71A 4UFHA 3UT0A 2H0VA 3HVDA 1EV12 5LBBA 5C3QA 4W65A 4YVSB 3MIBA 1KS4A 4M3CE 3VDDB 4ZY9A 4CZSA 4QKNA 4QX2A 5CADA 1JZ5A 5CG9A 1W8NA 1X50A 4FXGB 1VBE3 3EHKA 4P9JA 1H1IA 4P9XA 3WW2A 3NJVA 3I3BA 5FZ3A 1MPXA 3M3EA 4YWAA 2Q4SA 4KWJA 2A71A 4NIDA 3AJYA 1RUH3 1O4TA 3POSA 4GWIA 1XNDA 5LASA 4LBQD 3KT7A 1H6XA 1XSQA 4IV1A 5KXBA 3DYOA 4BXSV 1RUG1 1HB1A 3GDBA 1SPPA 1ULPA 3CDZB 1QJX2 4H14A 1QQP2 3CJIA 4YW6A 5L73A 3ZIXA 3KF3A 3OPWA 3ZKUA 1OKOA 4HXCA 4ZZ8A 1B35C 2VMFA 4NJ4A 2A7AA 4BIFA 4Q0QA 1XC6A 1OVSA 1AYM2 2R041 2VZ3A 2WT2A 5IVCA 1PO12 2QQUA 1GYKA 3LKJA 4WVMB 4YM3A 2D44A 1A8MA 2VCBA 5DAPA 4DXTA 2C0ZA 1D0HA 1K45A 1AR93 1YQ2A 2JXAA 5DG1A 1H8TA 4LKFA 3RZZA 5CISA 1NOVA 1BEV2 4KWLA 2ZMKA 5GZDA 1DDLA 3CF6E 5A7NA 3ZYJB 4HLTA 2EF6A 4YRDA 5LA2A 1FV3A 4CUGA 3AYAA 1VR3A 2EXHA 1UOJA 1XXNA 1Z78A 3M7AA 4XF4A 5J37A 3POIA 1DFQA 4FP3A 4ZS3A 2J1SA 3AMQA 3PMEA 1QJY1 1ZZCA 1F2NA 2D5HA 1AR81 4FTEA 4JC1A 4L11A 3ZR5A 1GBGA 4F83A 2ZGUA 3RSJA 4BPZA 1IHMA 1ODNA 4FO9A 5LA1A 1E5RA 2WNVB 2CGOA 5C5TA 3OGVA 1VAMA 2PAMA 4XTMA 3ZFFC 3CU7A 1AYM1 1UYPA 1W04A 3CO2A 4XDOA 4YGDA 2QQNA 3JUUA 2I74A 2JKXA 5BNQA 5KHIA 4NMIA 1EV13 5FY4A 2P3YA 3WNOA 2YHJA 3TEZA 1NLQA 3KCXA 1H30A 4Y24A 1V6OA 2RVAA 4YVWC 1XE7A 4DINB 3FBMA 1RJ8A 2HLEA 4HKOA 1VIWB 3LSDA 4FPOB 2JENA 5ACA1 4XJAA 2VZUA 1A3KA 5FWEA 1R081 1MVEA 1COV1 3RI8A 1N1TA 1RINA 3V0BB 2D6KA 1H2MA 4B8EA 1X8MA 1OFSA 1W9WA 4CEWA 1UPIA 4OYUA 1NX9A 4Q0VA 5DAVA 2WT1A 3K2OA 4FXKB 2GZWA 2AR6A 2VG9A 5ABJA 4YVWB 4CRQA 3LOBA 4PCRA 2VOXA 4QB6A 4XAEA 3N9NA 2YC4A 1WLCA 5APAA 4QU2A 1DYOA 2Y6KA 3MIGA 4FI9A 5GZGA 2NQYA 3ZKYA 3NV4A 1G86A 1VALA 2JDYA 2ZX4A 1BMV1 2VJXA 2A75A 1QH7A 3CJXA 2ZACA 4FPGA 4LE4A 3SEPA 4F7ZA 1VBA2 5E16A 3MEPA 1X7NA 1OI6A 4OHZA 1V6MA 5DDJ2 3KHCA 1OMIA 3PU8A 2VH9A 4K1YA 1O8SA 3VZLA 2GMMA 3WT3A 4LOSA 3WNLA 2MHFA 2GU9A 5EJ3A 5LW9A 1YIPA 2PYTA 3NNMA 2PHTA 2FDHA 2P3IA 1SMVA 4XBQA 4XJZA 4AK3A 1BMV2 2EIBA 2WN3A 4CCLA 2WRAA 1ZZ9A 1MVQA 4NRPA 4AEJA 1IS3A 1DGRN 3DCQA 1JHJA 2PAEA 3HBZA 5D2AA 4OQ8A 2RS53 4XQDA 5FYCA 3O14A 1TME2 3V0AB 1PGL1 1RUC2 1ZREA 4BZ4A 3R6SA 3ILNA 5FYVA 5A6QA 2P3JA 1RUJ2 1YO8A 1FATA 2O8OA 1J1TA 1N1SA 5FRAA 2XPJA 4PDWB 1PO11 2ZGPA 4N9HA 1SLCA 2RS13 3CMGA 1XU2A 2WNVC 2VD7A 1A6CA 4AVVA 1W6QB 4OHWA 5HV0A 2ARAA 2HJIA 2VR4A 3KM5A 1X33A 4QB1A 5A32B 4WVMA 1QJX1 4QX3A 4QQPA 3VBRA 4CPBA 1NY71 1HV0A 2EAAA 2ZPXA 3ES1A 4LLFA 3S5AA 3ENRA 2FZ1A 1UYYA 5JZGC 1POQA 3IKWA 4XMIA 5CB7A 4FPJA 3CJIB 1UN1A 3VHPA 3ZX7A 3KGLA 1LGBA 4M0NA 4D94A 1Y9QA 1RB8G 5I0DA 1RL3A 1Y9MA 3WF3A 4NHKA 4PQQA 3ZXEA 2C26A 4YZ2A 4DIQA 4YZ1A 2Y6FA 1BZWA 1RITA 4X8NA 1QQP3 3ZYGA 5T50A 5I91A 5DPNA 3H1WA 4LHSA 4XCAA 2WZEA 2ZX2A 1ST8A 3AKPA 3DUIA 2XJTA 4RS5C 4UFMA 3I2HA 4FFIA 4QQHA 2Q8EA 4CCCA 3M3IA 4DQAA 1FPN2 1HXS3 2BNOA 4PF5A 4AYUA 3ZXAC 4L9BA 3IBMA 4HKWA 1W6NA 1AR92 1LR5A 2A6WA 2WNUB 4YM1A 3VUOA 2Q1FA 3E6DA 2ZGNA 4QGNA 5CVRA 1IPKA 4B1LA 4GIQA 1B35A 1H1MA 1W2TA 2WO3A 2ZKNA 3WD5A 1ALYA 2WN2A 4J1WA 2GH2A 1ONAA 3BU0A 4XXPA 2ZHMA 4L0PA 4BCUA 2AACA 3ZVXA 2DVAA 4QPWA 2OUJA 5ISLA 2NN8A 5FV3A 3LD8A 2RS31 4W4ZA 2KXLA 4J25A 4MHRA 4W8JA 5BYNA 1IZ3A
chains in the Genus database with same CATH topology
3RG0A 1WW7A 2O1QA 4MLOA 1TME3 2ILMA 3NKTA 1QQP1 1Q8SA 4R9DA 4I02A 2Y26A 4WM8C 1CAXA 1VRH3 2B45X 2CTVA 3ILFA 4QQ2A 5HCFA 4DXZA 3M1HA 4CDQC 1I9RA 1SQ4A 4GKXA 1MS5A 2Q8OA 1H2NA 4I30A 4XFFA 2B7YA 4XJWA 4QQLA 4E4DX 5JMCA 3UKVA 1JTZX 2YV8A 2E9QA 1XE8A 1WD4A 3OYWA 1OLQA 4Q0UA 3RRDA 2YUEA 3DPRB 2QDNA 1TE1B 1V9U3 4L8QA 4N43A 1DGWA 4QPIB 5BNPA 3KD4A 3B02A 1NCQC 3WNXA 4CDWC 2N7GA 1LHVA 4EWDA 2A6XA 1KQRA 3AM2A 1UIJA 1NA1C 4Z07A 2PQQA 2VUAA 3WVJA 2A3XA 3I4IA 4Z8BA 3OD0A 1LOGA 2YROA 1WUVA 1YNAA 4ZU5A 2YXSA 2OZ6A 1RUC1 3B7MA 5BXXA 3WXPA 4IV3C 2XWBB 5DDJ3 5FDBA 4YW1A 2D3SA 2ZCWA 1PVC3 2XBO1 4YW4A 1QOOA 3GALA 1RHI3 4LEJA 4COVA 4BQ1A 4CDWB 1BVVA 3HWJA 4XPVA 1K5MB 1LGCA 3EBRA 4Q2FA 1IS5A 1H1AA 3B5LB 2R0FA 3HT2A 3ZPYA 1W6QA 3MI8A 4OULA 2RR13 3LGRA 3DPRA 3ZFFB 2UY8A 4LE3A 1GZ9A 4AVAA 3E5XA 3GHNA 5EV7A 3JQWA 4IERA 1UCXA 2A6ZA 2D98A 2NZ9A 4RGGA 1MS0A 1R092 3D0SA 2ZZJA 2EVXA 5EFUA 4R4ZA 4NO4A 2JG9C 1AF9A 5KBFA 2GNBA 3A0KA 2IFWA 1TQ5A 4OI4A 4Q0PA 4XHXA 1GNZA 3AXDA 4AXOA 3D82A 1BBT1 4AGRA 1HRV3 1HRI3 1O5UA 4Y22B 2WFPA 2PA7A 2WNUA 5E8AA 2CAVA 2JD4A 2HWC2 3J8F3 2TBVA 3M3QA 1WA4A 4M3CB 5IK5A 1CN1A 4XTPA 2DYCA 1NY72 3H8UA 4TLFA 4CTEA 1HDKA 4Q4V2 3QH6A 4J6GA 2XJQA 4GWNA 4XF0A 3ZIWA 1GZWA 1FPN1 1SFYA 2D43A 2DCYA 4YW5A 1HQNA 4WVVA 1LHNA 5BNPC 4Q4W1 5FCCA 1UMZA 4M01A 1NCRC 2Z2SB 3VHNA 4GQ7A 4J1XA 3TN91 1AYN3 1QWRA 3MLJA 3MF9A 3NWKA 1QJU1 1J59A 1SCRA 2WA4A 1VRH2 3AKSA 1H9PA 3FFQA 2YC0A 3PTYA 3J26N 3SCFA 4PIYA 3B01A 3ZFEA 1QOTA 3VBSB 4CEYB 4QPGB 3BB6A 1ASJ3 3E97A 3NV2A 5H9SA 4MVTA 4COYA 1RIRA 5EYXA 4AF9A 3VHRA 1AXZA 1C4RA 2ZGKA 4ONUA 3RMXA 1V9U2 1RUE2 1RUH2 1HRI2 3LWCA 4C0HA 5C33A 3AYEA 1MS4A 5JZGB 2ZJCA 4IEQA 3AMMA 5JIUA 2EIGA 4K7JA 3L9JT 4RHV1 5GLTA 5GZCA 1O4YA 1RUD3 3AFKA 4R9BA 1G9CA 1QJU2 3UV9A 1PIV1 2GC0A 4A7ZA 4MZUA 3H9AA 1K5MA 4YZ3A 1UU4A 3L2YA 3SLIA 3HN1A 1VBD3 4COZA 1UKGA 2W0XA 3OPZA 4AE2A 4HVQA 3ELNA 3PVNA 3M8LA 1XNCA 3FLRA 5C9AC 3UJQA 1ASJ1 4HK9A 1BVP1 1OLRA 3ZMOA 1KD7A 5AC92 4MGZE 5C9AA 2R043 3M70A 3U0ZA 4AVSA 2PHUA 3WG3A 1CAVB 1RTVA 2Z69A 4ITCA 2PHXA 4XF1A 2JG8C 4LO4B 5GLUA 3LA7A 4LBNA 1ZM1A 1ZVFA 5K9YA 1GR3A 3WZ1A 1NA1B 4FBFA 2JX9A 1SCSA 2XG3A 1BK1A 3RYPA 3VBHB 4JTNA 4QPIC 5IK8A 1S1AA 1O3SA 4AEKA 4W6WA 5HBAA 2ETEA 4S2GA 3VKLA 4L97A 4Q4V1 4IL7A 3IDEA 1REFA 1OA3A 3W9AA 1F31A 3J8F2 2G9FA 2GN7A 2EXJA 2WLPA 2IZWA 1AZDA 3I59A 2AGSA 4HZFA 4DZGA 3OGGA 2ZX3A 1W0PA 3V0BA 1LOFC 4PBPA 1JN2P 1PK6A 1LHWA 2Q30A 5J98B 4COWA 2VOWA 3VBFB 1RVF2 4WBBA 1ZZ6A 1PO23 2E7AA 1N3OA 2B46X 4MH0E 3JZVA 3VBOA 2JJ6A 2QCSB 3QH7A 5KHJA 2R071 4Y1VA 1DQ4A 3IMNA 4INDA 2XKPA 3ALQA 5A33B 4H7MA 5AC93 3KMHA 2ZOEB 5AFEA 5HI0A 4FPEA 1AYN2 3S30A 1OFNA 1A78A 2YGMA 1AL23 2WQ4A 3GF6A 4M00A 2P3KA 3S0MA 4I09A 1EP0A 4IEVA 2Y0OA 1YHFA 2XWJB 1H8TC 3TYJA 2CNAA 3OY8B 2B8MA 4SBVA 5EWSA 4DY3A 3VBUC 1JOJA 1IS4A 2UU8A 4FT8A 5GLZA 3WW3A 2JKBA 2BWAA 5D8AA 2A3WA 3J9SA 4Y20A 4QM9A 3WW4A 3CJIC 3VBSC 3M3CA 4ZU4A 1PGL2 2VW2A 3B3QE 3SCHA 1TMF2 3X29B 4AFAA 4XFBA 4Z1VA 4AFBA 1AL21 1LHOA 1EAH2 3RS6A 1S0IA 2HYKA 2ARBA 1EY2A 4GB33 1QKQA 5L7OC 4HANA 1V6IA 1H8TB 5E1RA 3ZFEC 1MS9A 2QUOA 2PHWA 4ASLA 2VY0A 1NQJA 3LCPA 2Z79A 1S0FA 1WLWA 3C2UA 2FHRA 1C8M1 1WGPA 1ENSA 2R062 2XKOA 5DZGA 2ZX1A 3TRSB 1RUG3 3LAGA 3NAPB 1C5IA 4Q4X2 2NLRA 5KC6A 1IPJA 5T5PA 1W2UA 4AVTA 2VVFA 1JBCA 1XU1A 2QKDA 1F9KA 1PIV2 5K0UB 1E57A 5CAZA 3WHTA 2FZ2A 4QHBA 2AENA 3VV1A 2X5IA 1ZA4A 5J7MA 3C3VA 1VBA1 3ROUA 2HWE2 1AR71 4AQ2A 3E6BA 1NA1A 1O91A 4YW3A 1YCIA 4B4QA 3FC0A 4Y1YA 5F9TA 1AXYA 3GZAA 1PHMA 3QBQA 2XB6C 2VU9A 2PTMA 2VMHA 4CDWA 3R4DB 1LODA 3MIHA 3AP5A 4HN1A 3GZTB 5FAXA 1CAUB 4XQWA 2ZZQA 3M2MA 4AEDA 2ES3A 1GKBA 4I2OA 1MZ5A 1Y3TA 2HWD3 4JTOA 4PIXA 2PHRA 1L3JA 5EYYA 5GM0A 3WX5A 2ZHLA 5JSPA 1VRH1 3I7DA 4YFWA 4M3CA 3RYRA 2MEV1 1G9AA 4CDQA 4E27A 2CGPA 4IEOA 4QGLA 3ZN4A 4IEXA 1C1FA 4YG6A 4AVBA 4LLOA 2ZBJA 1B09A 4KU7A 2R1DA 3ZSJA 1AX0A 2WS92 1DZRA 1RMU2 2PLV2 5ACA3 1W0OA 2JE9A 1AYM3 1J3RA 3VN4A 5BNNB 5JLVA 4HVOA 1AR82 2CL2A 1EV11 2XVKA 5K0UC 2WKKA 4JDMA 1KFUL 1PVC2 4XILA 3WP4A 2ZTNA 4WM7A 5IUQA 5FQ0A 1FMD1 2HWD1 2NMNA 5LEKA 5L36A 1AR61 4IESA 3VKFC 3IDCB 1WW4A 1REEA 5LRSA 1VBB3 3E5QA 3USUA 2GNDA 4HPKA 2W52A 4FPKA 1M4WA 2VNGA 4QXKA 1GZWB 1G8WA 5FOJB 3B93A 3BIWE 1UAIA 2CV6A 5BNOC 3IT8A 5FREA 1PVXA 2GH8A 2RR11 3WDYA 2UWCA 2P34A 1XNBA 3JB8A 2CYFA 3R4SA 2XBO2 4X6QB 4S2DA 2AUYA 4I3GA 4H3WA 5JIAA 2DUOA 1BYHA 4E9KA 1RJ7A 4Y1UA 1WW5A 3ZFGA 2PN5A 3HAGA 3ZXKA 1OOPA 4ASMB 4MSVA 4C91A 4WM8B 1YFYA 2B9UA 3LB9A 2Y38A 3UJOA 1D2QA 4QPGA 4Y26A 3KQRA 3SMHA 4AEMA 1WLDA 1JYIA 4C90A 3GNEA 1XYNA 3VZOA 1QH6A 4YG3A 4LBQB 3AP7A 5GKAC 3TAYA 1VAVA 4XOGA 2VNRA 3CNAA 1YFUA 2BNMA 4P14A 4LULA 5KHKA 2R063 3VBRC 4GKYA 3RJ2X 4N7IA 1OQDA 4IXLA 2ARXA 4QPYA 4YGCA 2ZKLA 3H1MA 2HWC1 1J58A 2BQPA 5JPMB 2QVSB 4PQ9A 4FOVA 3V0AA 4LO5B 4I0AA 3VBFC 2GMEA 1SDWA 3ZMNA 1C8NA 4EJRA 4ZKTB 2RS12 5DUWA 1LOCA 3ATGA 4A7YA 4AFMA 1ULCA 3I8TA 5CNAA 4BLJA 5C4WA 4FTSA 1MZ6A 1LENA 4JV4A 2WZPP 4IEPA 1ZBE1 2PLV1 1G9DA 4AWDA 3I59B 3N7LA 1FOD3 1NXD1 2VVDA 1QDOA 3WCRA 1OQ1A 1ZZ8A 1WBLA 5I8TA 4Q0SA 2HWC3 4Y20B 1DQ2A 1PZ9A 2JG8A 2WZR2 4R52A 1TME1 3USUB 5F6KA 2D7FA 5GLVA 5K7PA 5DG2A 3ME2A 1ZBA3 2IXIA 3PVBB 1RUJ1 1SLIA 1V6LA 1VBC3 4AEDC 4Z2WA 1SEFA 3L2HA 3V56A 1HX6A 4WM7B 3WOGA 1RUD2 4LUKA 2SLIA 1LEDA 3JU9A 1DGRA 4HSLA 2EA7A 2GNTA 4QQOA 1SLLA 2X8KA 5JR7B 3ZYIB 4AG4A 2ZGSA 3KT4A 2SBAA 1EYBA 2YMZA 2VW0A 4KH9A 2D6MA 1F8VA 1S0GA 2JDZA 3HIFA 3IPVA 3KS7A 1V9U1 3PVEA 3QLQA 5C9AB 4HVRA 1Q5OA 3FHIB 3BOWA 2DVFA 2DURA 2FMDA 4YFZA 4JCKA 2IXKA 5GJ6A 1OQEA 3ZXFA 2VMIA 3U11A 4GH4B 2JG8B 4TZDA 3WV6A 4XE9A 3K48A 3KZ4C 3MW4A 1MQTA 3KGZA 1V70A 2UWBA 4YYOA 4YW2A 3GZUC 3RWNA 2ET7A 3WQ1A 3DF0A 1U5IA 1AJOA 1COV3 3AXEA 4LO7A 4QGMA 1PVC1 2XBO3 4JRLA 4Q1PA 2A6VA 4RQPA 3ZN5A 3FBYA 5DDJ1 5T55A 2MPFA 4XDQA 2HWF3 1ZZBA 1FOD2 3HR9A 2R6QA 1MS1A 2DFCA 3WG4A 4XHBA 2AYHA 3N7MA 2WIIB 4LO6B 4WVZA 1O3QA 2TUNA 2ZGTA 4XJUA 1NZCA 2RS32 3LA2A 5J48A 2ZGQA 4YARA 5FLHA 2BFUS 1CD3G 2GN3A 1NCRA 1AVBA 3VKNA 2KM2A 2ZHKA 3OJBA 1UU6A 3VLBB 1HRV1 3K51A 3AKQA 1RVF3 1KFXL 3PLQA 4F3JA 1QNWA 2C5DA 1YFWA 4KQ7A 1ENQA 3WR0A 3H7JA 4AHYA 2NP0A 4W6XA 1QJZA 1CAXB 4OI1A 2HEVF 3A4UA 1Q56A 5JOXA 1NLRA 3R4UA 1BBT3 5JI9A 5AVPA 1PMIA 5DUVA 1NYWA 4EN7B 1JW6A 1U12A 1GSLA 1W6MB 2WA3A 5C4WB 3VBOC 1OOPC 1W6NB 4Y1ZA 3WQ0A 5AC91 4OHXA 1R093 1LOEA 5CBLA 1ZNPA 1G7YA 2WL1A 4YGEA 2WZR1 2JEMA 3WINE 2DCZA 2IFRA 1MZEA 2DVDA 2UYAA 4SLIA 4TSVA 3FX3A 3OD4A 4LBMA 4LUMA 4U2AA 1ZZ7A 4LBJA 3IWZA 2DUQA 3PVOA 5HCAA 4X8PA 3N36A 3T1MA 4RR3A 5AVAA 1WMDA 1XYPA 5LEJA 4Y22A 3WCSA 3WLUA 5JI7A 1CAWB 4WZCA 4AI3A 3VBOB 3MFCA 2RS33 5JSRA 4YM2A 1YI9A 2K9ZA 3WDTA 1AJKA 4FOWA 3POWA 1VBC2 3TN93 4MYEA 1UF2C 1DF0A 4LHNA 1HLCA 4PLMA 4QPIA 5FO7B 3RI9A 4JGZB 1AL0G 1DIWA 5BPXA 2RMU3 4FPYA 3AMNA 4QMAA 2H6BA 3IDBB 2WSVA 1ULFA 4HL0A 4MXVA 4P9YA 4AI8A 5BY5A 2RE9A 1MEC3 5ABJC 5E89A 2DCTA 1GFF2 1QOSA 3GBGA 4GMP1 4NOTA 3NO8A 4GH4A 3N3HA 4IV3B 4LBKA 3NL1A 4OI2A 4RHV3 4XMAA 4A7KA 1OKQA 4LTAA 4FVVA 3BTAA 2HWE3 1YWKA 4YVWA 4K21A 4N43C 3RQ0A 2PFWA 1AUYA 1PIV3 3NSTA 1DQ0A 1VBD1 1MS3A 1WCDJ 4XYXA 5JOYA 1ND2A 3ES4A 1VB4A 4XQ4A 1IGOA 5F5QA 2LTNA 5I8YA 3O0VA 1K5MC 1SBEA 2ZMNA 2QQPA 1ENXA 4HPKB 3UL2A 4AI2A 1YJKA 4OZXA 4AGGA 4MGYE 1ULDA 1H4HA 4JDNA 4RSUA 1RUE3 4N53C 4HSJA 5DZEA 1F5FA 5T54A 4IQPA 1PZ7A 4KWKA 5GZEA 5JWPA 4LT5A 4RQPB 4GB32 1UL9A 2R49A 1GZCA 2OZJA 4E2QA 4FAGA 2DTYA 4XBLA 4MUVA 1YRZA 2X29A 3FUOA 1YYNA 2DFBA 4D69A 4L2NA 1N47A 1KITA 4QD2A 4BH9A 4AQSA 4MX3A 4Z92B 4L99A 4PIZA 4Q4Y1 1O7FA 3ZSEA 1NQDA 1S2KA 3OBTA 1OPMA 2K0GA 1LCLA 3PNAA 1LHUA 1GANA 1OHFA 1Q8PA 5GALA 1CVNA 5A32A 3VBHC 1D2SA 2Z42A 1JXNA 4JAAA 1PNFA 1WD3A 3JD72 3VBHA 3USSA 2GMPA 2WC2A 4Q27A 3ZXLA 2RJLA 3AP6A 4ES9A 1FNYA 4EWAA 4Y4YA 2Q5TA 3KSCA 4N9IA 4RA0A 3MIDA