4A44A

Cpgh89cbm32-5, from clostridium perfringens, in complex with the tn antigen
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
140
structure length
140
Chain Sequence
ASALPQGNMKATATSEHPDVGNEGLAKFAIDGKENTIWHTKYNPVEELPQSITLELGGSYEINKFTYLPRSGAKNGNITKYELHVSEDGNNFRKISEGNWDDSGSLKTLKFNSTKATHVKLVALEGVGGFASAAELNVFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Carbohydrate Recognition by an Architecturally Complex Alpha-N-Acetylglucosaminidase from Clostridium Perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
molecule keywords ALPHA-N-ACETYLGLUCOSAMINIDASE FAMILY PROTEIN
total genus 30
structure length 140
sequence length 140
ec nomenclature ec 3.2.1.50: Alpha-N-acetylglucosaminidase.
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4a44A00
1OF4A 5FUIA 3P1IA 5DMYA 3WF2A 2YFUA 3WEZA 3WNPA 3C7EA 1CIYA 2Y6HA 5IJRA 1JZ3A 1UMIA 2VZQA 3PUHA 3OEAA 2BBAA 2W92A 1UY2A 3HJRA 4MO3M 5B4XA 4AG4A 2WZ8A 4A44A 5EIYB 3WF4A 3T0BA 3IDAA 2VMEA 4GWJA 4KMQA 1UYZA 4DUWA 2WQ8A 2VZTA 1JZ5A 5IHRA 3SEEA 5B4NA 2WN2A 1GQPA 3LE0A 3VDBA 1JZ4A 3A7QA 4JKKA 4CUBA 1GMMA 4A42A 2VOTA 4TXWA 1UY1A 2B9VA 2X10A 3HNBM 4JX0A 5C70A 3WQBA 3FN9A 1UY3A 4OUEA 2X05A 4Z2AA 3SKJE 1K12A 2J1UA 2RV9A 5C71A 3W5NA 2VZ3A 5IFTA 4A45A 2VR4A 4JKLA 1MPXA 4CU6A 1DLCA 2YC4A 1O59A 3BGAA 4P08A 1CZSA 3DYMA 4W50A 3HPNA 5CYYA 4JKMA 4P02B 3F2ZA 2E31A 3HNMA 1HN1A 2W3JA 1CZTA 3T0DA 3I3BA 2LS6A 2W47A 4KI5M 2W5FA 4OMDA 3W5MA 2EIBA 3MV01 2WAOA 5A1AA 4QB2A 4YPJA 1WKYA 3I3DA 4XVHA 4IUGA 4D0QA 2KD7A 3I2FA 1CX1A 1O8SA 2QQIA 2YFZA 3WNKA 1H6YA 3OG2A 2VMDA 4AAXA 1I5PA 3GGLA 2C26A 2L9LA 1R64A 5DN2A 3C7FA 1OT5A 1J84A 1UMHA 1YQ2A 3C8XA 4A4AA 1WCQA 3ACFA 2VZ1A 4LHSA 2OKXA 1TVGA 4MADA 3NJVA 4CU7A 2XHNA 3LEKA 2QBXA 1RYYA 3A23A 5LA2A 4QAWA 1JYWA 4HG6B 3WSOA 2W1UA 5JMOA 2QQLA 1GOGA 3K4AA 3DYOA 1UY0A 2Y6JA 3LPGA 3OBAA 3MUY1 3I2IA 3CZJA 4XURA 5I0DA 2J1RA 1JU3A 1EUUA 2WN3A 1OD3A 4XUOA 3T2PA 3A22A 3FHAA 3OGRA 1P8JA 2ID4A 2Y8KA 2QQNA 2VMCA 2YB7A 3WF1A 4BJ0A 1JZ2A 3FHQA 3T09A 4P5YA 3UNPA 4ZXEA 4M4PA 3C7OA 2VC9A 3CQOA 2WDBA 3ETPA 2W1WA 4RYDA 2VJXA 4OYUA 1EUTA 2Z4FA 3HEIA 2YC2A 2BGPA 2RVAA 1JYNA 1GUIA 1PX3A 3NRUA 3DECA 3MBWA 3IAQA 4TTGA 4QX3A 5C7GA 2ZEWA 4QX1A 2W95A 3D3AA 4MGQA 4DEVA 1IQDC 1JYXA 4PQQA 5JR2A 1F4HA 2W46A 3IB3A 3UESA 3CKHA 2Y6LA 3UETA 1KEXA 5JXIA 1XPWA 2BZDA 3NJXA 1L7RA 3ECQA 1JHJA 3I2KA 3AC0A 4D8MA 3SKVA 3OB8A 2WO3A 2J1TA 2JE8A 4PT6A 2B4KA 3VD9A 1D7PM 2XQXA 3I2HA 2VZOA 4XUNA 1K42A 3WNLA 1CZVA 1UYXA 3OGSA 1UX7A 5JXJA 3I2GA 2VTFA 1GOFA 2HLEA 4A6OA 2VCBA 2WABA 2QQJA 4ET7A 4LPLA 3THDA 2VL4A 3WNMA 3HN3A 1K3IA 5JUVA 1W9TA 2CDPA 1UXXX 1JZ6A 2JDAA 5DQ0A 1W0NA 2QQMA 4E8DA 1OF3A 4GWIA 3K77A 5IFPA 5CZKA 3CDZB 4QX2A 4UAPA 2JKXA 2VZSA 5HPOA 1H6XA 3ACGA 3LEIA 2W1SA 3I97A 1XNAA 5G05L 1UZ0A 3OEBA 4P00B 3ACIA 4OMCA 1JI6A 2J22A 2WBKA 1GOHA 3E1F1 2J1AA 4W4ZA 2ORZA 3GDBA 3LQCA 2VCCA 1OH4A 1BHGA 2BGOA 4ZZ8A 3T08A 2DCJA 4UI9L 2WAAA 3K4DA 4BDVB 5LA0A 1UXZA 4XUQA 2J1VA 4M4RA 4RN5A 2X09A 2E26A 2VO5A 4KWUA 3MV11 4A41A 1UYYA 3WF3A 2EIEA 1F4AA 2J1SA 1US2A 3J7HA 1ULOA 1W9WA 3ACHA 1US3A 3MO4A 4CU8A 3VD3A 4QDQA 2E32A 2Y6KA 2XOMA 5HXMA 4CVUA 3JXSA 1PMHX 3FL7A 3VD4A 2DCKA 3HNYM 4BXSV 2XONA 4QX0A 3NQHA 4L0PA 3CMGA 1W8OA 4DUXA 3I2JA 2WYSA 5EJZB 4DXRA 2W91A 3VDCA 4QPWA 5LCWL 5F7UA 2CDOA 3CZUA 4XZUG 1JYVA 4CUAA 3CIHA 4QDSA 3C7HA 4QB6A 3DYPA 2HYXA 1NX9A 4ARYA 2VCAA 1TG7A 2PQSA 1K45A 3C7GA 2W87A 4JHZA 3VD7A 2ZEZA 2QQOA 2WZEA 2VZVA 3VDAA 2ZEXA 4LQRA 2WO2A 3HOBA 2Y6GA 3T2OA 3ABZA 2J1EA 2V4VA 1PX4A 3LPFA 4ARXA 2RJ2A 3A21A 4QB1A 1ULPA 4XUTA 2EIDA 1GNYA 1NKGA 5JXHA 2VQUA 2W1QA 2YG0A 3EYPA 2BERA 4DUVA 3BN6A 4MOAA 4ZY9A 2ZXQA 3LEGA 1J83A 1W8NA 3IIIA 1O8PA 3T2QA 4PF1A 2VZRA 3I3EA 1UY4A 5G04L 4FI9A 1T2XA 2LW8A 2V72A 1SHWB 2WO1A 3T0AA 2VQTA 1KGYA 2Y64A 2V5DA 1W99A 3K4ZA 1DP0A 2W9XA 4BK4A 4DEQA 2ZEYA 3MUZ1 4ZZ5A 2DDUA 4GZ9A 4QDRA 2R7EB 3THCA 1XC6A 3U37A 3VD5A 4MGSA 2JD9A 3P6BA 3EB7A 1UWWA 4DXTA 3K75B 4OZOA 2VMFA 2ORXA 1DYOA 3GM8A 4E8CA 2WUHA 3IAPA 1JU4A 5IYYA 2C9KA 2EICA 4XUPA 4BK5A 2C4XA 4DXSA 3OGVA 4CU9A 3ZM8A 1L7QA 4CUCA 5EJ1B 3PUIA 1XNTA 4A3ZA 2QQKA 5LA1A 4UOJA 5JXGA 1LNSA 1PMJX 1GU3A 5J1XA 2VM9A 4LKSA 1JZ8A 2J7MA 1NAEA 2W94A 2VZUA 3WF0A 3SEPA 3WNNA 2VZPA 3WNOA 1JZ7A 3GXUA 1NUKA 2E33A 5DPNA 1SG3A 3NNGA 4W8JA 1W9SA 1SDDB 3K46A
chains in the Genus database with same CATH superfamily
4C90A 2EAAA 4XF0A 1XSRA 2ZX0A 3FFQA 3P1IA 4BLIA 3BIEA 2CGPA 1UCXA 4L99A 1UZZA 3NAPB 5DMYA 1G6NA 4XIKA 1R083 1PO23 1NLQA 3HR9A 3C7EA 1CIYA 4H55A 1VMHA 4XYXA 5FP9A 4CEWA 3J8F2 4K8RB 3MZHA 1AR93 2VZQA 3PUHA 4DPNA 3GZEA 2ZZQA 4MXWA 5C8CA 3BTYA 3N35A 3VN4A 5FZLA 2VULA 3O1RA 2TUNA 5JWPA 3UJOA 4PDWA 2Q30A 4CTEA 3USUA 5FY7A 5F3IA 2ZGLA 4A44A 1LR5A 3WF4A 1XE8A 1LULA 2RS31 2NPIA 3GCWA 2VMEA 4UFLA 3H8OA 2DVFA 3IZOA 4YZ5A 1Z7S2 2NZ9A 4PBOA 1H30A 3HQUA 2WZR1 1XB9A 5K9YA 2WQ8A 2VZTA 1SLTA 3PHMA 4GAZA 2CHHA 5FYUA 5GJ6A 5CFDA 3WG2A 4LIVA 3WVJA 5IHRA 1JZ5A 2WN2A 1ENXA 1GQPA 3LE0A 2WZR2 1PMIA 4I0AA 4QXCA 4CDWA 1AX1A 1LU2A 1YJLA 2QZ3A 1H2LA 4SBVA 1UPIA 4TXWA 1C28A 5F37A 1STMA 2B9VA 1COV1 3KSCA 3HNBM 3UJQA 4R52A 4JX0A 2XBO2 4I0BA 5C70A 5F3CA 1UY3A 5D8AB 5FZFA 2DUOA 3LDRA 2UY8A 2RV9A 2JDZA 3QH6A 1VBC2 3OJBA 1DDLA 5IFTA 2Z42A 4A45A 5LK7B 3SHRA 2VR4A 1AL23 5T55A 1YI7A 4XXAA 2XJQA 4LBQB 1UZVA 1VBC1 2QTWB 2DVDA 1WMXA 1F15A 3ZFEA 1GQHA 3HPNA 3T4HB 2ZGKA 1WW7A 4DO0A 2VMGA 2WFF1 4LO8A 1YIPA 4P02B 3H0OA 3WDWA 4CDUA 2F4PA 1PGL2 2Q5TA 1WLWA 1RVF2 1IHMA 3UV9A 5FUNA 5EYXA 3ZFGC 4CDUB 3THTA 1OQDA 5DDJ3 4AGRA 5JOYA 2XKOA 1PGL1 1UOBA 1YNAA 5AVPA 4A7ZA 4R8HA 3W58A 1RVF1 1ULFA 2LS6A 5FWJA 4KI5M 5JZGA 2IXIA 1ST8A 3HBKA 4ZU5A 5KHIA 3B3QE 3MV01 3TN93 1QOOA 5FO8B 4QB2A 2XUMA 1WKYA 1Y4WA 5FZGA 5LWBA 2BP6A 2KD7A 3IDBB 5CIRA 1CX1A 1QNYA 4Y20A 4BQWA 4LBLA 5JMCA 1VRH3 1GZ9A 3BI3A 2QQIA 1S0FA 2YFZA 1H2MA 4X8NA 4GMP0 1AYM2 1HB3A 4H7LA 1H6YA 1AL21 4NOTA 2VMDA 5T54A 1BLZA 3I8TA 2R072 1H8TC 1BK0A 1NE4A 4DXZA 3GGLA 4X8PA 2XR4A 4GD4A 2C26A 3LA3A 3MIEA 1CAUB 4YGEA 5E8AA 2BVBA 4YVWB 5FZMA 4D3WA 4E4ZA 5DN2A 3J4UH 4ZU7A 4QGNA 1S2KA 3OTFA 1OT5A 4YVWA 2UYBA 5A70A 2VCMA 3C2UA 5JPNB 2CV6A 4JQRA 4Q8KA 4PIXA 4QPIA 2C9AA 4KWLA 1R1A1 5DAPA 1RITA 1SEFA 5H9PA 4A4AA 3RFRA 3ACFA 4FPLA 2O8QA 4JTOA 4LHSA 4W65A 4XOGA 5CKNA 4XQWA 4FTBA 3WW1A 3Q8AA 3V0AB 3HVDA 2E7AA 4GA9A 2XHNA 4URAA 2WS93 4XILA 2QBXA 1RGSA 4NAMA 3VZNA 4Q4W1 2A7AA 4QAWA 4HG6B 1D0GA 2W1UA 3WCRA 3I54A 1EAH3 1GOGA 3NL1A 3OY8A 2HEWF 3DYOA 3WOGA 1OOPA 4Q0VA 2B9UA 4N53C 1WCSA 4TSVA 3VKFC 4CP2A 3RZJA 5AC91 4B4RA 4MGTA 3OBAA 3I2IA 4XURA 5I0DA 2J1RA 4FOVA 1JU3A 1DGRN 5AC92 1JH5A 3U75A 3HQXA 5JDBA 4BCUA 1CVNA 1PK6A 3POBA 3DPRB 3KF3A 1F35A 3PU8A 1W3VA 1WA6X 2E63A 1CONA 3M70A 1P8JA 1NYWA 2XJVA 2OX0A 5FYTA 5IATA 1RUH1 2QQNA 1RL3A 1R082 3WZ1A 2ZHLA 1V6MA 4S2GA 4EYUA 4XQ4A 3FHQA 5DAQA 3B9IA 1RUD2 5FP3A 1HB4A 4MVTA 1RUH2 2NYYA 4ZXEA 1O5LA 4TYSA 1RUF3 3C7OA 3ETPA 2RMU3 3KB5A 4GB32 3WUDA 4NMIA 2Q1FA 1BBT2 1QXRA 3HEIA 4CCDA 3KHCA 1F5FA 1ZBA2 2A3XA 2RVAA 4FPCA 4UBGA 1D4VB 4ZONA 4YGCA 4XFGA 4XDQA 5FLJA 2X5IB 3ACLA 1Y3TA 4LNVA 3RMXA 1DQ1A 3IAQA 4OHXA 3OOXA 4XHBA 5EXOA 4NIAA 2ZEWA 4QX1A 4N43A 2DCTA 1W2AX 1GP6A 2OPWA 3WR0A 5A32A 2BOJA 4MGQA 3N4MA 1IQDC 2LRPA 4BZ4A 4OQ8A 2B46X 3IB3A 3QACA 2ZS6B 2QFEA 3CKHA 1RUC1 4NIIA 2P3YA 1Q8PA 2RM21 2D98A 5FBJA 1MS9A 4R9BA 2X5IC 4LOTA 1WCDJ 3NJXA 5F2SA 3FZ3A 1JHJA 3S6PA 1F2NA 1WMDA 3DPRA 2GSYA 3VHOA 3D0SA 1BEV2 2R16A 3AC0A 3D5OA 4D8MA 2B8MA 3OB8A 1ASJ1 3M3EA 2ES3A 2IXCA 3VD9A 2ZGQA 2IVIB 2XQXA 2BQPA 1OXCA 1BEV1 3AMPA 2VZOA 2HWE3 4HSJA 5FZ4A 3NSTA 4LBNA 3ILNA 5A3WA 3GNEA 2RS51 2OUHA 1UYXA 2NM1A 1SPPB 1UX7A 3M7AA 3QCWA 4L97A 5FPVA 1W3XA 3UL2A 5CNAA 5FPZA 4NIDA 1DZTA 1S2BA 1QJX3 4IE0A 4HK9A 4LK7A 4P9WA 5FP4A 3UT0A 2E53A 1LGBA 2PMWB 4MXWB 5K0UA 5IVJA 4FCAA 1ZA7A 1RUG1 4ASKA 3THDA 1MS3A 2I2SA 4HL0A 4G4FA 3WNMA 4NN0A 1K3IA 2VG9A 3CJIB 2UWAA 2B7YA 3RWNA 3ES1A 4JAAA 5GLVA 3VHPA 4G9SB 1VIWB 3IM0A 1LOAA 4ZU4A 1PVC3 4HOOA 3USSA 2WFPA 2H0BA 3MW3A 4AZZA 1OF3A 1MS1A 3AFKA 1NOVA 2A75A 4TWTA 4DRRA 5IFPA 4LO7A 5L36A 1UO9A 2K9ZA 1D0HA 3CDZB 4Q1RA 3OGGA 1CJDA 2GAUA 4JCKA 4D7SA 1VB4A 2G19A 2WZR3 2YU2A 1LB2A 5C9AA 4Q4V1 4LBOA 3T30A 4Q27A 4XMAA 3WDTA 4AW7A 5FZ8A 1DLLA 3PJYA 3PUAA 4XF3A 1SACA 3KLSA 3P3NA 2BFUL 1NY71 4INDA 1AUYA 1VBA2 1T6BX 4P00B 3IN9A 3RJRA 2WS92 5CEHA 4LKEA 1XQNA 5A3UA 1ZZCA 1JI6A 4LBQD 2J22A 3SNMA 1AVBA 3SQOA 1ND2B 1UKRA 1LTEA 4Y24A 1EY2A 4W4ZA 2ORZA 1MZFA 1ND2A 3TRSB 1V0AA 2P37A 4M00A 3VDDB 5F8PA 4ZZ8A 2C1FA 4Z2WA 3IT8A 4UI9L 5DAXA 4CPBA 1CD3G 1KS5A 5LA0A 1UXZA 2VAUA 3CEWA 4ITCA 3IDCB 4XUQA 4C8DA 3ZYJB 3KT7A 5CFCC 5IK4A 2DYCA 5FYIA 5J98B 1CESA 1IGOA 1AX0A 1H9PA 4HPKA 3ZPOA 4EQVA 4KWUA 1QQP3 2C0ZA 3MV11 2WLPA 3TN92 4LXLA 3WF3A 5BNPC 1OUSA 1RHI1 2J1SA 2D3SA 4XBQA 4AEJA 3F95A 1W9WA 5FY9A 3VHRA 5F5QA 1BEV3 4IEVA 4QDQA 1OOPC 1V9U1 1XE0A 2PA7A 4XQDA 5IW0A 4JDNA 3ZMNA 3AP6A 4B8EA 4EROA 1YCIA 2FDFA 1DFQA 5HXMA 2XJRA 3ME2A 2CTVA 4XJUA 1VALA 1UIKA 1N1TA 5KXDA 1PMHX 2KM2A 3VD4A 5KHHA 1HRV2 5FYYA 1N1SA 3VHNA 1REEA 1VMJA 2WQ4A 1PM4A 5A7WA 1UPSA 3M3CA 1C5IA 4CCJA 1HRV1 4N53B 1AXYA 1XYPA 2AUYA 4TLFA 1LOFA 1YYNA 4P9IA 3TEZA 1LEDA 4XFHA 2P3JA 3IDEA 4ZPIA 1YQ5A 1C8M2 4N7UA 4QPWA 4BQXA 1U5YA 3W20A 5J7MA 2QQPA 1Y9QA 1W6QA 3OD0A 1PVXA 1JYVA 2R0HA 4AHXA 1FMD1 4QDSA 1LODA 4XFAA 1UNBA 4YZ2A 2HWB1 1LCLA 1ND3B 3LDBA 2I74A 4QB6A 5EJ3A 3ZSEA 4IQPA 2YBSA 1LECA 4C0BA 1TG7A 1B35A 2QZ2A 1WA4A 5LBBA 2XVKA 2FCVA 3PTYA 2QNKA 2W87A 4HETA 1S0BA 2QQOA 1ZRCA 2VZVA 2PHDA 3VDAA 3M4FA 1SCRA 2Q1ZB 2E51A 4YWAA 5T52A 3HOBA 3WP4A 2I07B 1ONAA 2ZGTA 3TEXA 5C33A 5GLWA 5JZGC 4LUMA 4XCAA 3THPA 4MGKE 1PX4A 5FO7B 3LPFA 1S1AA 5LB6A 1LENA 2RJ2A 3NW4A 3A21A 4QB1A 2EIDA 1GNYA 1G8WA 4Q4W3 1QU0A 5JXHA 1AL22 2ZCWA 4SLIA 1H8TB 3O1OA 1O3TA 2YG0A 4GH4B 4XCBA 2XLAA 4ZY9A 1RUF2 2R063 3O7OA 3INAA 1PZ9A 3IIIA 4KQ7A 4ATEA 5A3TA 2SBAA 2GC2A 5HCBA 5A7WB 4CP9B 4IV1A 4LITA 5K4LA 3L9JT 1RVF3 3U14A 4RQPB 2OVUA 5E89A 1T2XA 2WO1A 1HKDA 1WWYA 4BB3A 3KHBA 3LZZA 2EA7A 3K4ZA 4N43B 4COWA 3JUUA 3U4XA 5FLHA 4BK4A 2XH6A 2DDUA 2JENA 4GZ9A 4QDRA 1IS3A 1RMU1 2B39A 4FAHA 3V0AA 4CDQC 2IXHA 2XVGA 3OYWA 3BU7A 3DKWA 3RI9A 4CXXA 3EB7A 4KH9A 2YPJA 3O1VA 4LJHA 4MSVA 1I9RA 2VMFA 1DYOA 1QY4A 4CDQA 1Z78A 1R093 4XZPA 5A3NA 3KQRA 3I59A 1COV3 3ZYHA 3NNJA 2WUHA 3V64A 5B2GB 2VUCA 4XTPA 5J3UA 2VW0A 2DFCA 1SFNA 3MYXA 3ZYBA 2HWC1 3AFGA 3IMNA 1L7QA 2HWE1 2EAKA 1O3SA 4AVSA 5AFBA 1IKPA 2FCUA 1OURA 2HWE2 4IV1C 1LGNA 3EXUA 4FPJA 1OSGA 4Q0PA 3E5QA 1LNSA 1V70A 3PNAA 4GH4A 4BIFA 3I49A 3VGIA 3POFA 4HSLA 4M3CA 2LALA 1GNZA 1GR3A 4LKSA 3S0MA 3OF1A 5K0UB 4KG0A 2W94A 3IMMA 1QQP2 3H8XA 1Y9MA 4L2NA 1DG6A 1CWPA 4AL9A 1DU3D 3GXUA 3SH5A 1ZRRA 1ZBA1 3DGTA 2DURA 4FT8A 2DBIA 4B7EA 2JE9A 4HK8A 2G4IA 2E33A 3AMQA 3AL5A 1AR63 3FJSA 3O12A 5BPXA 4Y26A 4CCLA 4W8JA 1W9SA 2R30A 4Z07A 3T3YA 2K2SA 1AR72 1BVP1 3EBRA 4JHTA 5KXBA 3OYWB 4FPHA 2HWB3 5FAXA 2OZ6A 3ZXEA 3IWZA 3MHZA 1QJX1 2YBKA 3AP4A 3H1WA 3H9AA 3ZYFA 2YFUA 5IJRA 1TE1B 4BLJA 5FPBA 2GMMA 1A8MA 1FYUA 3OEAA 2FDGA 2ZGOA 1Q3EA 4CDWB 1RUC3 5L9RA 3LCPA 3HJRA 4V2VA 1C4RA 1YLLA 2HWC3 2R062 2WR9A 3AYEA 3ZDSA 4AR2A 2BVVA 5CG8A 4GB33 5B4XA 5LBEA 5EYYA 1H1IA 4PCRA 4LO6B 1ASJ3 5C3OA 3I2OA 4OI1A 5ABJA 1QJY1 2WZ8A 2R061 1VBB3 2RS12 4B1LA 4QHOA 1TEIA 1W8FA 4GWJA 1UYZA 2ZGPA 1QJY2 1HRI3 3POWA 1LOGA 4QD2A 4RR3A 1DIWA 4GKYA 4D69A 1V9U3 3SEEA 4CCKA 5B4NA 3SC7X 4Q26A 1NT0A 4EN8B 3VDBA 4JVAA 1V00A 2YXSA 5T5OA 1EV13 4CUBA 1GMMA 4CXWA 1ZBE3 5EWSA 4A42A 2DVBA 3VKLA 5FDBA 3S57A 1UZWA 2VUAA 3SCHA 4Q2FA 4R9AA 1RUG2 4G3YC 5I8SA 3WQBA 2CWMA 2VD7A 3FN9A 2X05A 4WM8C 2VXJA 1RINA 4OHVA 4PQ9A 1K12A 2J1UA 3BCWA 3QD6A 4CDUC 5C71A 1VBE2 3W5NA 2LM3A 2G9GA 1WW6A 1ZVFA 1ZZ9A 4CU6A 1MEC1 2XGXA 4KWKA 3ORJA 5F5CA 1VBE1 1CZSA 1X9PA 1XYOA 4Y1ZA 5IVFA 5FTTC 4XFBA 2FDHA 4WM8B 5L9VA 1AYN2 3WXPA 4GKXA 4K9SA 1MZEA 4AHWA 5I8TA 3QBQA 4Y1YA 1JBCA 1HN1A 4IGQA 4N7IA 3PUSA 3WD5A 2PHXA 1VLNA 2JG9A 1CZTA 4QX7A 2VUDA 3FBMA 4N53A 4Z82A 2W5FA 4AI0A 1LHOA 1JTZX 3FUOA 3TAYA 4Y5Z0 2NMOA 3AL6A 1UN1A 4IUGA 1IPKA 3I2FA 4OUSA 3KMHA 2ZHNA 4WBBA 3H3LA 2BGCA 2DBNA 3GF6A 2RR13 2HWD3 3H3UA 3KV9A 4CYDA 2VOVA 1MVEA 1ND3A 2FZ1A 5F6KA 4Y4RA 2HWF3 4AAXA 4PDWC 2F4LA 4QKFA 1AX2A 1YFWA 3I2DA 1B35B 1JYIA 1VPHA 2VNVA 1GLHA 3R05A 1SMVA 2WNVC 5FZOB 3VUOA 2HKXA 5FOBB 3KM5A 1UMHA 1NCQA 4IEQA 2ZKNA 1NA1B 5FK7A 4O65A 2GN7A 3RDIA 2F6BA 4W6WA 3X29B 1XSQA 5FMBA 4CCMA 2JDNA 2VZ1A 1I3HA 4D6SA 5F5IA 1IG0A 1C3HA 1NXMA 1O4TA 4BHPA 3POEA 3NJVA 4QGMA 4MH0E 2PHLA 3BPZA 2PHTA 4HVQA 1HDKA 4TLGA 4YLZA 2QQWA 1W6PA 2HJIA 2RS32 3A0KA 4Y1XA 3A23A 1N3PA 5LA2A 1QDOA 3B93A 4QU1A 5IVYA 3LSDA 3WSOA 2EXHA 2QQLA 3GBFA 1Z7S1 2V5YA 5GLTA 3ZLIA 1W05A 3AP5A 5GALA 3N9PA 3WINE 3UKNA 5J48A 5BNNA 2Y6JA 5FKBA 4UW4A 4RR3C 2GP5A 1RTVA 4DIQA 4NRMA 3RG0A 1ENRA 1VR3A 2WFF3 4QT6A 3FHIB 2XUEA 4BQ2A 3BKZA 4I01A 3T2PA 4JGYC 5D8AA 5AVAA 1YO8A 2OIIA 3OBRA 5CU1A 2H6CA 3DF0A 3APBA 5FYHA 1N1VA 3M3QA 2BFUS 4YG6A 2Y8KA 2A6VA 3VL8A 5AFEA 3GZAA 2WL1A 3B7MA 1HQWA 1YQ6A 1WBFA 4YVWC 3WF1A 2D6KA 3JQXA 3MFCA 2Y60A 4W6YA 3VKOA 1AR61 1KXGA 4JDOA 4P5YA 3UNPA 2AGSA 3H42B 4Q0SA 5CFCA 2A6YA 2WDBA 1H2KA 2YDEA 4J6GA 1QH6A 4ORFA 1G9CA 3N7JA 3LFIA 4OYUA 4IE7A 4UF0B 4FSJA 1JOBA 3K46A 4OLLA 1IQAA 2ZGSA 1PX3A 5K0UC 1OBNA 3MLLA 4Q4X2 3WQ0A 3NRUA 1Q8OA 3MBWA 3O1PA 2EVXA 5C7GA 2QQVA 1YEWA 4Q4X1 1UX6A 1H4HA 2W95A 2GNBA 5FZ1A 2EXKA 4CCEA 1Z0HA 1W06A 1CJPA 3BU0A 4PQQA 1J58A 1W9YA 2JDYA 3MW2A 3M3IA 1AJKA 3UETA 1KEXA 4LEJA 4PLNA 1MQTA 2QE3A 2BZDA 3WV6A 1FV2A 3O14A 1X7NA 4AQTA 2ZX3A 4ZKTB 5FZ9A 1JYWA 5J09A 2VBDA 5FXVA 4B7KA 4JC1A 5ACA1 4QHBA 1UIJA 4CZSA 4LE4A 2WO3A 3AZYA 1AZDA 2J1TA 1VAVA 1JW6A 2B4KA 2IC1A 2SLIA 1HV0A 1G9FA 1D7PM 2CL2A 3N7KA 4EV0A 4FTSA 3R0RA 4PI0A 3ILRA 4QU2A 4AOCA 3LIHA 3ITQA 3KGZA 3D0JA 3HD8B 3DV8A 2DTWA 1RMU2 4FVVA 4O61A 2UWCA 5EHDA 3RJ2X 3S7IA 3TYJA 3WNLA 3H7JA 1OPOA 4BQ4A 5FZBA 3D4KA 1NE6A 3CJIA 4D7YA 3I2GA 3TNPB 1SFPA 3LFMA 1GZWB 2GDFA 1WLCA 1BQPA 4Q4W2 2PN5A 1QJEA 2RS53 2WJSA 1K5JA 1TNRA 2XKPA 4XF4A 4O9GA 5K7PA 4NHYA 3JBG1 3K3NA 2OQ7A 2MEV1 4LPLA 3VLBB 2HWC2 2PELA 3WLUA 1WMFA 1A78A 2OPKA 3NVCA 1GICA 3HN3A 5JUVA 4LLOA 4W6XA 2JDAA 2O14A 3CBNA 5DQ0A 1W0NA 2EIGA 4IEXA 3KT1A 4AFAA 1N3QA 1GFF2 2FDIA 4Y5TA 1KJLA 5HXVA 2Q8EA 3DXUA 1XNBA 5LY2A 1IS4A 3HIFA 3VBFA 3VBSA 1U5XA 4QX2A 5JVVA 1QOSA 5HPOA 4JRLA 1H4GA 1QQP1 3GBGA 5BV6A 3R4DB 2VW2A 1NCRB 3J26N 1DHKB 2TNFA 4HZFA 5A3OA 1NA1C 2D93A 1PGW1 5G05L 4IEWA 1UZ0A 3S5AA 2VMHA 4GB31 1A6CA 2C5DA 2VUJA 3H7YA 3PTRB 4FOWA 3WDUA 1BBT1 2XHKA 3OUIA 1SDWA 5FZKA 2C24A 3CHXA 3RYKA 3ZN5A 4BQ1A 3PL0A 5DZGA 1D2QA 2VGDA 3SMHA 3WDVA 4JV4A 3RZKA 1I5ZA 1UL9A 1EAH1 1WLTA 2E9QA 2WBKA 4OHWA 2GU9A 2LTNA 4C0HA 5HV0A 3FLTA 3KV6A 5J96B 1AF9A 1M4WA 4DS0A 4L8QA 4Q4X3 4FQ4A 3CJXA 4CSWA 3LQCA 5F1RA 4C1WA 3QLQA 1RJ8A 5GLZA 4YGBA 2BGOA 4AE2A 2DCJA 2AEZA 1ALYA 1B35C 4AVBA 3G7DA 3ZKYA 3QH7A 4YG3A 4XE9A 5LA9A 4BDVB 4EZHA 5L7OC 1QMJA 2BNMA 1C57A 5ANNA 4RN5A 4B4PA 4CUGA 1X33A 1AR82 2X8KA 2IXKA 3B01A 3MFAA 4J1WA 4FFIA 4YW4A 1OOPB 1I6XA 2E26A 5ACA3 4RGKA 2BU9A 5FFOC 4A41A 1AR81 4I30A 1UYYA 3J8F3 1VJ2A 2RG4A 5D1IA 2K46A 4GMP3 1FI2A 1H8VA 2A1XA 1US2A 2UY9A 1UAIA 5SV8A 3J7HA 1W03A 2QDNA 2N7GA 1HLCA 2Q8DA 4AWDA 4BMBA 4LBJA 4UFJA 2ATFA 1HW5A 2BJSA 2CGNA 3V0BA 3ZN4A 1WCKA 1W39A 2VBBA 2WC2A 2XOMA 4UFMA 1F9KA 4DINB 1W8HA 3MIGA 3LWCA 4XFIA 4NPLA 3JXSA 4CP0A 3M3OA 4DQAA 4FBFA 1W6MB 2R1BA 4LORA 1N47A 2CAUA 4OI2A 4CCNA 4XHXA 1OLQA 5FP7A 2NN8A 3NQHA 4FPFA 3ZN6A 4BISA 2QUOA 4EN0A 2ZX2A 4AQ2A 4DUXA 2UU8A 3I2JA 4DXRA 1RXFA 3VDCA 1W6PB 5FP8A 4BM8A 5LCWL 1GBGA 5A6QA 2C6SA 4MUVA 4IETA 4R4XA 5JZGB 4CEWC 1A34A 4DOUA 4KL1A 2RS13 1OKQA 2R49A 3CIHA 5H9QA 1O7FA 1OH3A 1PIV3 3DYPA 2HYXA 3MIHA 4K8FA 2EXIA 2WINB 4HVOA 2VCAA 4IE4A 2PQSA 5FYBA 4AEKA 1PK6C 5DUXA 4DZGA 4BQ5A 3B02A 5FMOL 3UGHA 1XNKA 5BYNA 5H9RA 1VRBA 2QKDA 3WG4A 3ZIWA 2ZEXA 2VY0A 4LQRA 2WO2A 2PLV2 2Y6GA 1OLMA 1RUI1 3T2OA 5DDJ2 5IK8A 1XE7A 2EALA 3CJIC 2V4VA 4RQPA 2R042 4DY5A 2AH2A 1O91A 2D6LX 5DDJ1 3VV1A 3O0WA 4QHZA 4S2FA 1NKGA 3KF5A 1J1LA 4MYEA 2W08A 4Q29A 3W9AA 4AEDB 1Q8SA 4XJWA 5HCFA 1OVSA 3NMBA 4C91A 3BN6A 4JGZC 5EP9A 4GQ7A 1UU5A 2ZXQA 5FZHA 3WCSA 5DXDA 1J83A 4MGZE 1D2SA 5CISA 3Q8BA 1AYN3 4PF1A 4WVMA 3TB0A 3ZR5A 5T3NA 4QPYA 2VOXA 4CXYA 2DCYA 1FV3A 4WVVA 2LW8A 4FQZA 1QIQA 1NCQB 1SHWB 3L2HA 5F5AA 1TME2 4NHLA 5T5PA 3ZKUA 2WYFA 3KVBA 4BMEA 3O1TA 5J36A 2RMU1 2Y64A 3ES4A 2D5FA 1OMIA 1D4M2 1UMZA 1W99A 2W68A 5FZAA 2ZMKA 1SBDA 4AAPA 3JB4C 1QOTA 3MUZ1 2JJ6A 1GP5A 4I0WB 4ZXKA 2Z79A 2WZPP 1CPNA 3VBUC 4CCCA 2OA2A 2V73A 2TEPA 3THCA 1AHSA 5KBFA 3I4IA 2GALA 2P4EA 3SH3A 2R6QA 4MGSA 2JD9A 2JKBA 4JZRA 3K75B 3ELNA 2ARAA 3RPQA 4XDOA 2ORXA 4OQ9A 2JG8A 3VB9A 2P5BA 2WT2A 3OUHA 4D6RA 1LOEA 2VNOA 3IKWA 5LW9A 4LHNA 2E7QA 5FJHA 3OD4A 5FIXA 1GSLA 3SH4A 2EICA 2D6MA 5IYYA 3BOPA 2JWPA 2C4XA 3PU3A 3OSDA 2RM23 4AI9A 4BK5A 2R32A 2WNUC 4YRDA 3UGGA 1HRV3 1SCSA 2XG3A 3AKRA 2D6OX 5T50A 2DCZA 1KRIA 4YW1A 3HBZA 1XNTA 4M0NA 2ZX1A 3KT4A 2QQKA 4QXKA 3VZOA 5A6XA 3FFZA 3PVNA 2BEOA 3N9OA 1WMEA 2YC0A 2HBUA 1PMJX 4RS5B 1GU3A 4M01A 2JB4A 5GZDA 5J1XA 4JGYA 2X5IA 3NNLA 1RUE3 4YVSC 3JBG3 2W39A 1VBA3 3KCCA 1NAEA 2AYHA 2UYAA 5EQUA 2BRTA 3POJA 2WWUA 3VBOC 4YM3A 2WA3A 3SEPA 5FO9B 4RHV3 3WNNA 4CDQB 4Y22B 1YFXA 2VZPA 3WNOA 3ZIXA 1JZ7A 1GZWA 3HT1A 5C3PA 3GALA 1LJ7A 3I7DA 5GKAC 2JIJA 2H0VA 3LEMA 4YGDA 5I8YA 2P3KA 4CDWC 2XLGA 1FX5A 4JQTA 3D6EA 2HEYF 4XTMA 5DPNA 3UGFA 4HKOA 4BOWA 1OLRA 3N3HA 4IEUA 1NCRC 2YU1A 4H3WA 4P9XA 3BTZA 3LOIA 3LGRA 1OF4A 4ASLA 3NNMA 5FUIA 4A7KA 1PIV1 4A3XA 5JIAA 1CX4A 2VW1A 1C8NA 4NVPA 2NQYA 2VOKA 3WEZA 2ERFA 4DY3A 4AFBA 1ZRFA 3WNPA 1JZ3A 5E16A 3PUQA 1UMIA 3DEMA 4DFSA 3MW4A 4ZS3A 2WNVA 2J42A 2R071 2W92A 1ACCA 1U5IA 2WNEA 5FYMA 3RZMA 2WNVB 1AXZA 5IVBA 5F3GA 3MLJA 1MQTB 3WDYA 3MIFA 2GNDA 4PIYA 5LY1A 5LBFA 2VPVA 1VRH1 3TEYA 3K51A 1TMF1 1PZ8A 3T0BA 3BTXA 1QHDA 1BMV2 4NHKA 4HKLA 4Q4V3 1TMF2 3MDPA 4AVVA 2YMZA 4DUWA 1GV9A 5FY1A 3E6CC 1DQ0A 4EE2A 2W2IA 5LASA 3H3ZA 3A7QA 5DG2A 3ZYRA 1SZBA 4FO9A 4JKKA 1SLCA 1SLBA 1LKNA 2D6PA 2R1DA 1ZYBA 1SFYA 2VOTA 3AVSA 4E2SA 3S7EA 2DUPA 4FOYA 1C8M3 2X10A 2XVLA 1XU2A 1AR83 2E6VA 3AB0A 5FJKA 4ES8A 3VZKA 2D5HA 4AFCA 2OT7A 2PYTA 1HXS1 3WW3A 3S30A 1YJKA 3N9MA 3M8LA 2VZ3A 5FZCA 3H1YA 4JRAA 4JKLA 3NV3A 1RJ7A 1MPXA 2AREA 1J1TA 4PLOA 4UBHA 1DLCA 4OHYA 2YC4A 1O59A 4XIOA 4LO4B 3O1MA 1IPJA 3I59B 2GC0A 3NV4A 3DYMA 4W50A 1I1EA 3GJBA 5L7OA 1DGWA 5D8AC 5F32A 4IESA 2ZACA 5CYYA 1GZCA 3U1XA 1UYPA 3PIJA 1QJU2 3F2ZA 4XJ9A 5A7SA 2E31A 3HNMA 2Z2SB 3HWJA 2DF7A 3AK0A 3LA2A 4NROA 4QWNA 5DUUA 1SPPA 5T5JA 5FR3A 3ZYIB 4YW2A 4E2GA 1TME3 1QJU1 4PI2A 1H8TA 2ZHMA 2FQPA 3B00A 2XJPA 3I3BA 3WNXA 4OMDA 3WP5A 3W5MA 1V6LA 3RS6A 2P17A 2EIBA 2WAOA 4Y1VA 5A1AA 4E2QA 1V6NA 4D0QA 3I3DA 4XVHA 5LEKA 2BBVA 2HH9A 2XB6C 1S0DA 3H50A 2YROA 1FPN1 3NAPA 5F39A 4R4ZA 2WQZC 5DUWA 3VDDC 3PJQA 3RYPA 3VBUB 1YC61 1E5RA 1FPN2 2BWCA 3Q9OA 3WNKA 4BA6A 3VBUA 5CFCB 1AR71 3T1LA 2ADDA 2KXLA 1I5PA 3POIA 2WSVA 5IUQA 5DZFA 1VAMA 1Y43B 3AMHA 2L9LA 4S2HA 2VNGA 3WG3A 1O3QA 2VECA 2A5ZA 4Q1PA 3D82A 2PHRA 1MS0A 3JZVA 1HB2A 2A6XA 3BODA 4KWJA 4WM7B 3ZFEC 1YQ2A 4BYYA 5BNNB 5C9AB 1H1MA 2WRAA 3C8XA 4JGZB 4FPKA 1WCQA 2MEV3 1QGLA 4OI0A 2PLV3 4Q4Y1 1ND3C 4CE8A 1Y7BA 3SCFA 4EWDA 2YY1A 4AQSA 1RUE1 1GANA 2IXJA 3FLRA 4JGZA 5EPAA 2OKXA 1G9BA 1TVGA 4MADA 2R043 4HN0A 2PTMA 1FNYA 3LEKA 1FXZA 1RUE2 1O4ZA 2AZ5A 1ASJ2 1COV2 4A7YA 4YZ3A 4AHYA 3LOBA 3RVHA 5BNNC 5FZ3A 4UXAA 4WM7C 1UY0A 1BK1A 2HBTA 4V1PA 2VH9A 3AKSA 1VP6A 2P6HA 1ENQA 4YW3A 5FMDA 2DWRA 1FATA 4B29A 4BU2A 3CZJA 5CFDC 3RZLA 1M06G 4WV8A 2ZA9A 4FP3A 2OYZA 1DGRA 1EUUA 4UWDA 5C4WA 1OD3A 1J3RA 1PNFA 3LF7A 1GNHA 4YNIA 4UYBA 4YM0A 3LD8A 4XDPA 1HN0A 5M0TA 1Q8VA 3FHAA 2PFWA 1WZXA 1EYBA 1W8TA 4CEWB 4P9GA 4QQHA 4QKDA 3QOPA 4YZ4A 3VBSC 5LK5A 5FZ6A 2VMCA 3W59A 5FZ7A 3AP9A 3E97A 1CAXB 5DAWA 2K0GA 3RI8A 4OI4A 3N9NA 4DNYA 4UFKA 5J37A 2DFBA 4HFSA 4WM8A 4XEZA 4YM2A 3ZXKA 2VU9A 4YG0A 2FDKA 1LHVA 1POV3 2EF6A 1PNGA 2W1WA 3FX3A 3KCXA 2IFWA 2OUJA 2VJXA 3FWEA 2V4AA 2HWF1 3FBYA 1S0IA 1KQRA 2BGPA 2XJUA 3AJZA 1GUIA 5I0RA 2PLV1 4Q4Y3 1F31A 3B94A 4YVSB 4Q4V2 1S0EA 4QMAA 5IVEA 1W0OA 4TTGA 3O1SA 2Q0AA 2CU5A 1LOCA 3WY6A 4CDXB 1OUXA 3HN1A 1URXA 2QQUA 1NY72 5ABJC 3NJZA 3D3AA 4OZXA 4AI2A 1L7LA 4D7TA 4DEVA 1DQ5A 1ZBE1 4KBBA 3ZXFA 3WHUA 3UESA 3ZSMA 4YZ1A 5CADA 2Y6LA 1ULDA 2XDVA 3FMGA 4ISRA 1XPWA 1PO11 2A6ZA 3LIGA 2ETEA 1UW8A 3VBHA 4CEYB 3BTAA 4WVMB 3TOJA 1L7RA 1X9TA 4JGYB 3KWVA 1PO12 3OPWA 2RJLA 1ZZ6A 4LT5A 1E5SA 4M3CE 5BNQA 1QJY3 3OPTA 5HI0A 2ENRA 2ET1A 1BJQA 2JE8A 1MQTC 1JOJA 2KA3A 2OZJA 2Y26A 2YHJA 4PT6A 4XAEA 4YW5A 4E27A 2XWJB 1SLLA 2G1MA 3I2HA 3R4SA 2RHPA 1ZREA 3AYDA 1GWKA 1QJU3 1PVC1 1U5ZA 2IXLA 1JUHA 3OGSA 1YQ8A 5GZCA 3D8CA 1PZ7A 4NWVA 2VTFA 2HLEA 2D3RA 2VVEA 5A80A 2XBO3 2BUKA 2W0XA 1JOPA 4P14A 1RUJ3 5FPXA 1PK6B 4NPMA 1Y9GA 1VBC3 4YW7A 1LRHA 4QM9A 1E5HA 2Y34A 1ZZ8A 2ZHKA 2JB8A 2GMEA 4ET7A 4NHMA 3NJYA 2V09A 3TNQA 4Y20B 5FMOS 3KD4A 1U0AA 1R092 2TBVA 2VXRA 3LB9A 4K1YA 1UQXA 4FFFA 1UU6A 3ZOIA 1W9TA 2NLRA 4AXOA 3RZGA 4AEMA 4FTEA 1UXXX 5FWEA 5FBZA 1KS4A 3H1MA 4COYA 1JZ6A 2A73B 5CBLA 4Z1VA 1Q5OA 2JDPA 2DVAA 5FK8A 2YYOA 1KDMA 3IBMA 2MPFA 4NAOA 3WP6A 3ZPYA 4I02A 2WT1A 3K77A 3MI8A 1IS6A 5CZKA 3VBHB 2AENA 4OULA 4DB5A 2JKXA 2VZSA 2RR11 2JECA 4A2UA 1ZRIA 3NKTA 3UKTA 5GM0A 3WT3A 3LEIA 3HT2A 1VBD3 5ANQA 5FOJB 3OBZA 3ZFEB 2RR12 2VE1A 4LLFA 3I97A 4IEOA 4MGIE 4AF9A 5GLUA 1HQLA 1RUG3 5A32B 2WNUB 1OQ1A 5F6LB 2R073 1DYPA 4MX3A 1OA2A 4K7JA 4I3PA 2AR6A 1V6JA 2BWAA 2RM22 1AR91 5E6HA 3EJKA 1Z7S3 3OY8B 5FYCA 1CGPA 1GOHA 1ULEA 4BH9A 4D94A 1NLSA 4CDXC 2J1AA 4O9EA 2P2KA 1UD1A 2D97A 4K40A 2ZTNA 1ODMA 2VCCA 2FZ2A 4UFIA 2B42B 4AFMA 5DG1A 1DQ2A 1FT9A 4XJZA 1FOD2 4RFT0 5LZ6A 1W6NA 2WAAA 3K4DA 4P5HA 2J1VA 3NWKA 4M4RA 1W6NB 1FOD1 1W8ZA 3OBTA 3ZXAC 5KHJA 4XAAA 2A71A 3O0VA 3JCIA 4JTNA 1W2UA 4XBNA 3WW4A 4META 2VO5A 5A33A 4IV3A 2WA4A 2GZWA 3OCPA 2ARBA 1W6MA 1VE0A 4FPEA 4H2AA 2MHFA 1GKBA 4IV1B 2ZOEB 4Z92B 5K8SA 1PO13 1X8MA 4CRQA 1ULOA 2QDRA 3BYWA 3ACHA 3N7LA 2O8OA 4N90A 1BMV1 2CNAA 4EN7B 5JLVA 1XJAA 2HWD2 1XBFA 4MGYE 4Y1UA 2VTXJ 2GC1A 2BYVE 4AVCA 2Y6KA 5EFUA 4H7MA 4CA9A 1HRI1 1CN1A 1VBB2 3ILFA 1H0BA 2D7FA 3AXEA 4IL7A 4BPZA 2PAEA 3VBRC 4QKNA 4MHRA 5LBCA 2ZMLA 1J3QA 1HRI2 1VBB1 1HQNA 3HNYM 1X50A 3CF6E 3ZFFA 2XONA 3H8UA 5JOWA 4AI3A 2Y0IA 1A8DA 1DCSA 4QX0A 3ZFFB 1JYTA 1ZX5A 4L0PA 4AVAA 3POGA 2MEV2 1W2NA 2YZ4A 1W8OA 3ETQA 2WYSA 5SV5A 4LTAA 3HMYA 1S0CA 5EJZB 5FREA 2W52A 4EWAA 1ZRDA 3KV5A 4PLMA 2B5HA 2FCTA 3RSJA 2GP3A 1N1YA 5F7UA 2CDOA 1WGPA 1NZCA 3OGJA 4Q0QA 3AXDA 5A7PA 1LOBA 3HQRA 4M0HA 1GP4A 5BNOB 4QQOA 2DU0A 5A1FA 3GHNA 5CG9A 1BBT3 3C7HA 5BNOA 4I09A 1WW4A 2GNTA 1VBA1 5A1LA 4Y3OA 1K45A 1XXNA 5FYZA 1G86A 4GULA 4Q8LA 4K21A 4P9JA 3VD7A 1RXGA 1W2TA 5FXZA 3VZMA 2WZEA 3MPPG 3ZXGA 4LBQA 3GBWA 1OFSA 4IGOA 4IXLA 4KNCA 3T1MA 1GYKA 2WNOA 3GYDA 4K20A 1PGW2 3ABZA 4XABA 2EXJA 1DZRA 2J1EA 2QJVA 3JB8A 3ZYPA 2XQRA 4HKWA 4GALA 4IEYA 4P9YA 3MGUA 4HBNA 4XUTA 3ZFGA 2VNRA 1OQEA 3GJAA 3DXTA 2F17A 2VQUA 5IAXA 1EAH2 5KXCA 3EYPA 4QX5A 1OKOA 5CVRA 4DUVA 4HVRA 1S4CA 1H9WA 4MOAA 5FYSA 5C5TA 2NMNA 4GJZA 1W8NA 5A7NA 3TN91 3T2QA 1NQDA 2PQQA 2VZRA 3MPBA 3I3EA 1MEC3 2DV9A 2BV4A 4KG8A 1UOJA 1UY4A 2YPDA 4NHXA 4XJAA 5KC5A 5G04L 3CNAA 5AC93 3TEWA 5FXWA 4IE6A 4QQPA 2NP0A 4Y4YA 2ZGMA 2V72A 3KQ4B 5HBAA 2VQTA 3AVRA 1GWLA 1OVPA 4QX8A 4CEYC 4FXGB 4Q4Y2 2V5DA 2Q8OA 5E88A 2XLFA 3WW2A 1LOFC 4YM1A 5LEJA 4ZZ5A 4DEQA 2ZEYA 1JYCA 3ZX7A 4DMIA 2LROA 1SBFA 2R7EB 3PIGA 4YSFA 2FHRA 3SCGA 3PVEA 5I0UA 3ATGA 1HV1A 4XFFA 3U37A 3VBRB 3VD5A 4MG2A 1KD7A 2ZPXA 3ZMOA 3VBRA 3P6BA 1LHNA 3MF9A 4DXTA 2RS11 1ULGA 1YHFA 3L2YA 1FPN3 4OZOA 1IZ3A 2XBO1 3G6JB 5JCTA 3AZXA 3RNSA 3GM8A 1C8M1 5D2AA 4E8CA 3IAPA 4RD7A 3ST7A 5JR7B 1ZBA3 1JU4A 3IIAA 3VBFB 4YFZA 4QM8A 4XUPA 2JG9C 4RGGA 3OGVA 5JAXA 2RE9A 2GC3A 4CU9A 3S5QA 3ZM8A 1WBLA 1WUVA 3EMRA 3ZN6B 5EJ1B 2E7TA 2JD4A 4LKFA 1RUI3 4RSUA 5F3EA 2OXBA 3ZDVA 4OVEA 3V56A 5A6ZA 4J25A 4CP1A 4K3UA 5JXGA 2WFF2 3A4UA 1VMFA 1MS4A 4GH4C 5FPLA 5HCHA 5FPAA 2H6BA 4HPKB 2ET7A 1UOGA 3U4SA 3MLKA 5APAA 3AKPA 2JIGA 4L92A 3ROUA 4U36A 1JZ8A 2XPJA 3B9CA 5DAVA 5C4WC 2I45A 2VZUA 5FQ0A 1ND2C 1WD4A 4OCTA 1SQ4A 5HV4A 2ZJCA 1WCUA 4GMP1 2RDQA 1HJGA 3ZSJA 1DQ6A 1NUKA 3WQ7A 4ZHNA 1CAUA 4BIOA 1SG3A 2FD8A 1ZZBA 5KHGA 4K1ZA 1ZA4A 1SDDB 3I3QA 4FPGA 1BKZA 2YGLA 2A6WA 4UW3A 1IOAA 2JXAA 1W8UA 4LR4A 2XL9A 4RFRB 5FKCA 2D43A 4EWEA 4LE3A 5DUVA 2WO7A 4RS5A 2CY6A 4AI1A 3ZSLA 2VBPA 1CR7A 3WF2A 3EO6A 2Y33A 5A3LA 2RDNA 2Y6HA 2ZBJA 2MNGA 3RMYA 1AJOA 5C5UA 4CEYA 1R1A2 4XMIA 4YYOA 4NWWA 3VBHC 2JDUA 2BNOA 2BBAA 5C6CA 1NLRA 1UY2A 2WNUA 4MO3M 4L9BA 5IWFA 1Q43A 5FY4A 3PURA 3P3PA 1UZYA 4BWOA 4UF0A 4AG4A 3H8RA 4RS5C 2YBPA 4DRVA 5EIYB 3B69A 3PMSA 2BDRA 3OPZA 4LBMA 3IDAA 5EV7A 3ZFFC 3NKGA 1PVC2 2XMLA 4KMQA 3K2OA 5JSRA 1K5MC 3NAPC 1BZWA 2ARXA 5FZEA 1YQCA 1QKQA 1S2EA 2DVGA 3KV4A 3VKMA 1UU4A 3O5SA 1RIRA 2IUWA 3LA7A 1G9DA 2FMYA 2HEVF 1JZ4A 2ADEA 1RMU3 5KC6A 4JDMA 3JU9A 5HCAA 2GN3A 1UY1A 4AYUA 4BE3A 4IE5A 2ARCA 4Y33A 4COUA 1N3OA 4OUEA 3PLQA 3VKNA 3BUCA 5JOZA 1RC6A 3W21A 1EV11 4LMFA 3RZZA 3POSA 3E6DA 4LOSA 3SKJE 1POV0 4B4QA 4Z2AA 2PAMA 2XJSA 4PF5A 5KXEA 1CQ9A 1K42A 4BXFA 3RZHA 1TNFA 4HONA 4X6QB 1RUD1 2B45X 3BGAA 3NO8A 2G9ZA 4P08A 1W2OA 1OC1A 2VQ0A 2JE7A 2Z69A 4ASMB 5I0SA 3DCQA 3Q8CA 4JKMA 1GWMA 1OD5A 3BOWA 1C1FA 3FC0A 1HIXA 1ZM1A 2W3JA 1QJFA 1Q56A 5FZDA 1YFUA 4KU8A 4NO4A 3TBDA 3U07A 5FXXA 4FOQA 4K6BA 2VMIA 1QWRA 5ERLA 4XC9A 3T0DA 2W47A 1W6QB 1JUIA 3WHTA 2JDKA 2OQ6A 1K5MB 4HXCA 5LATA 3VZJA 4YPJA 5LRSA 2XXZA 4RHV2 1CAWA 5I0TA 1OI6A 5I91A 4NIGA 5KHKA 4E4SA 3CL1A 4H14A 5IVCA 1O8SA 5C3QA 3LSEA 3ZXLA 5L9BA 1BVVA 4B1MA 1OA3A 3OG2A 2YGMA 5L7OB 1JS9A 5EZWA 1FMD3 5I93A 4R9DA 1W04A 3NV2A 3GCXA 4QPIC 4QXHA 1PIV2 2ZX4A 1JHNA 5T5LA 3FE5A 4Q0UA 1RHI3 5FRAA 3BPSA 3RYRA 5CAZA 3PVBB 1R64A 1POV1 4AFDA 5A3MA 3KS7A 5BNPA 3C7FA 1AXKA 2GH2A 3PVOA 3J7NA 4QKBA 4UT5A 1WW5A 3HAGA 4XW3A 4MXVA 3MIDA 1J84A 1S0JA 4NE9A 1NZIA 1OFNA 1DZQA 3PDQA 3ZYGA 1Q8QA 4RGAA 2XWBB 5GZGA 1VBD2 2VOWA 1MS8A 3CLPA 1MVQA 3J9SA 4N9IA 4A6SA 3M2MA 5TSWA 4M3CB 4CU7A 5ISLA 1VBD1 1XRUA 1RUJ1 4ATFA 5ACA2 1UF2C 1S55A 1NCRA 1YFYA 2DTYA 2BOIA 5FMCA 3SISA 4Z8BA 4BQ3A 1RYYA 1ZZ7A 2JDMA 3IPVB 2CYFA 2AC1A 2IVJA 5JMOA 1NXD1 2P3IA 1CIWA 3K4AA 3Q8EA 5KR7A 4XF9A 4FPOB 5C3RA 4XACA 2D3PA 3LPGA 4XF1A 5C8CB 2CSGA 3BB6A 3AZWA 3MUY1 1B09A 1MEC2 4NR1A 1LEMA 1POQA 1XOYA 1UKGA 2WN3A 1K5MA 1HX6A 2Q8CA 4PDWB 1DBNA 3J7LA 2VVFA 4XUOA 3A22A 3OGRA 4WZCA 1LU1A 1D4M3 3NV1A 4MV2A 4EZ4A 5BNOC 1DYKA 2ID4A 2JDHA 4IEPA 1X82A 3AZVA 3JBG2 4TN7A 3UKVA 4COVA 2JX9A 5IK5A 2YB7A 3VL9A 3KCYA 3RGBA 2JG9B 4BJ0A 4F3JA 3T09A 2RDRA 1JZ2A 4M4PA 1S0GA 3GHMA 1SLAA 2VC9A 3BVCA 3CQOA 3K48A 4WVWA 4LBKA 4EJRA 1AL0G 3WP3A 5FLIA 3N9LA 4LUKA 3AP7A 4RYDA 1J3PA 4HT1T 1G7YA 5CKMA 1EUTA 2Z4FA 1IS5A 1QNWA 5ABJB 2YC2A 3CO2A 1XYNA 3JD71 4AQ6A 1OLME 1JYNA 1W28A 4FXKB 4J1XA 5GZFA 5JI9A 1O5UA 1W0PA 1YIFA 4P9LA 1TZOA 3DECA 4IV3B 3SXWA 3FLPA 5JPMB 2P34A 4QX3A 1RUNA 4Y5SA 2RJKA 4XETA 3PMEA 2FMDA 4IEZA 3WUCA 1BXHA 1G9AA 3AM2A 2D44A 4QXBA 3ZFGB 3AZZA 3VBFC 1JYXA 3P5BA 4LA2A 5JR2A 1F4HA 2WWSA 2W46A 4LIUA 4NRQA 1TQ5A 3EQEA 4XPVA 5JXIA 4LA3A 3AJYA 1YRZA 4FP2A 2O0OA 1YWKA 4IV3C 1XU1A 2ZMNA 1NG0A 3J8F1 4B3NA 5A7QA 2RDSA 5FZ0A 1IG3A 4GJYA 1X8EA 2AACA 3DPRC 3ECQA 3I3MA 2PXJA 1MACA 4WZFA 1QXPA 2WLQA 1RHI2 4FFGA 3I2KA 4AGGA 1TMF3 4RL7A 5FQ0B 3SKVA 3USUB 3ZSKA 2WKKA 1UOFA 5GZEA 3URFA 1V9U2 3GZUC 4FPYA 4MLOA 1XNDA 4XUNA 4AEDC 4XBLA 4CDXA 4IDZA 1CZVA 5A7OA 4RQPC 1SLIA 3ZR6A 5IT6A 2BW8A 5JXJA 3N7MA 1GOFA 1PM7A 4PIZA 1F5JA 4F7ZA 4A6OA 4LKDA 3LKJA 5C3SA 4R9CA 4AEDA 2VCBA 2WABA 1VBE3 4IERA 1KITA 2QQJA 1U12A 4UFHA 3U0ZA 1AR62 2VL4A 4GXLA 4LK6A 4MHUA 5BUVA 1AYM3 4LHLA 2ZGNA 2ZZJA 1PHMA 2CDPA 3N36A 5FZOA 2D6NA 4YW6A 4FAGA 4EN6B 2BPA2 1FMD2 2VQAA 1W9FA 2PAKA 2HWB2 4HANA 4KGQA 2QCSB 1DF0A 2QQMA 4I3GA 5CB7A 5C4WB 3ENRA 4E8DA 3SITA 4E9KA 5JSOA 4GWIA 4YARA 1X36A 1PO22 2Q4SA 2YV8A 2R0FA 4UAPA 1LHWA 2WWJA 4QGLA 3FUQA 1H6XA 3ACGA 1PO21 4AHZA 2W1SA 4OFGA 2GH8A 1XNCA 3MEPA 1CAXA 1XNAA 1LESA 3OUJA 4U2AA 1F8VA 3AMMA 3OEBA 2JG8B 3LAGA 4M3CF 4URTA 4XFCA 2HWF2 3ACIA 4OMCA 2ZGUA 4X6RB 4WM7A 1PGSA 1YI9A 1W8WA 4CP9A 1RUOA 1QH7A 2Z5WA 3KGLA 4O7XA 3VBOB 2A3WA 2KR2A 3E1F1 1ZNPA 3E5XA 1AYM1 1RUF1 1RUI2 3VBOA 3GDBA 3AYCA 5FCCA 5FPUA 4GWMA 1OH4A 1BHGA 4PBPA 3VZLA 2A70A 2R041 4HN1A 4XJ8A 4YVSA 2WT0A 3BIWE 4QPIB 3T08A 1AR73 2A3YA 2WIIB 3ZXJA 1ZBE2 2Q1MA 3WG1A 1KJRA 1KDKA 1FNZA 2X29A 1E57A 1O4YA 1WD3A 3DL3A 3MF6A 5DZEA 2X09A 2CAVA 4AI8A 2FBEA 1QJZA 1CAVB 1GQGA 2ILMA 2EIEA 5D21A 3R6SA 3U10A 1RB8G 1F4AA 1HB1A 4L11A 5C8WA 5FY0A 1L3JA 4MZUA 1US3A 3MO4A 4NJ4A 5FZIA 3WQ1A 4CU8A 1BCXA 2XL7A 3AKTA 3VD3A 1TME1 1LHUA 1APNA 3GZTB 3E5UA 3O0XA 1BYHA 2E32A 2RMU2 3DKQA 5LRRA 1D4M1 4COZA 5H9SA 5BNPB 5F9TA 4CVUA 2JICA 2AEYA 4IW3A 4PJYA 3UK9A 4KGGA 3U11A 1V6KA 3FL7A 4WVZA 1KFUL 2Y38A 2Y6FA 3ALQA 5JOXA 2DCKA 4AGVA 4AK3A 4BXSV 5FYVA 2D40A 5FV3A 5FY5A 2O1QA 2DU1A 2X53S 3RQ0A 1R1A3 1EV12 4QQLA 5A33B 1HXS3 1MS5A 3CMGA 1NCQC 2PHFA 4GIQA 4QQ2A 3ON7A 4RR3B 3U78A 2W91A 1EP0A 5C8CC 3A0NA 3AX4A 3E6BA 1R091 2PHWA 3DUIA 1VAKA 1R081 1JXNA 3CZUA 1A3KA 4XZUG 5FUPA 4E4DX 1H2NA 4LULA 4CUAA 3LDKA 2P6CA 2HYKA 1W90A 2QVSB 1DQ4A 1DGLA 1NX9A 4NUBA 3JD73 4QPGC 5F2WA 2P1BA 4FFHA 5IAVA 4NIHA 4ARYA 3BALA 3ZVXA 5A3PA 5IK7A 3IPVA 2OS2A 3C7GA 4NPRA 3CU7A 4N9HA 4JHZA 2ZEZA 3MICA 3K3OA 2BTVC 2VTXA 2CGOA 3ASIA 3UYJA 3RWKX 1CAVA 1ODNA 2ZKLA 3POYA 1DGWX 3AMNA 3NNFA 4OUMA 4ZS2A 3C3VA 1JMUB 1QF3A 4RHV1 4Y22A 1J59A 4UW6A 1EPZA 3B5LB 3V65A 4ARXA 5BY5A 1CAWB 1R1ZA 2ZABA 4S2DA 1ULPA 4GWNA 4KBZA 1QJX2 3WDXA 4EN9B 1OA4A 1AR92 4QPGB 2YUEA 1NQJA 1EPWA 2W1QA 1LGCA 2BERA 2UWBA 5JI7A 4ISQA 1E5IA 1C1LA 1RUC2 2PHUA 3Q8FA 4QPGA 3LEGA 1REDA 4UW5A 1OPMA 1O6UA 4RA0A 5C9AC 1O8PA 2DUQA 5DABA 3ZO0B 3RRDA 1JODA 2VVDA 3AYAA 2JEMA 4FI9A 4F8AA 3M1HA 1ENSA 4KU7A 3T0AA 2ZAAA 1KGYA 1H1AA 2BNNA 2FDJA 5FY8A 4HMZA 3V0BB 1DP0A 1OHFA 4YFWA 5JIUA 2W9XA 1RUJ2 2RS52 4IGPA 1SBEA 4LHKA 3VDDA 1RUD3 4HLTA 1RUH3 2Y0OA 4ES9A 4Q5OA 2IFRA 3KZ4C 3T2TA 1VRH2 3JQWA 2CWSA 2HWD1 4LO5B 3DN7A 5JSPA 1UWWA 1NA1A 1LAJA 2IWGB 2ZAHA 3EHKA 1QEXA 3T4VA 4D6QA 5E1RA 2RS33 5A6YA 5CKQA 1MZ5A 2C9KA 1IKQA 4PHZA 4DXSA 3O1UA 2WSUA 1V6OA 4C1XA 3WX5A 4CUCA 2ZGRA 1IPSA 4V2WA 1W6OB 2OW4A 1AYN1 3PUIA 4N8MA 4BQYA 4A3ZA 5LA1A 4UOJA 1W6OA 2GNMA 3KVAA 2GMPA 4E4HA 2UURA 1HXS2 4CPBD 5L73A 1FAYA 4ONUA 5CA6A 2VM9A 1ULCA 5CFDB 4XXPA 2J7MA 1CPMA 3TWIA 1GZTA 2IZWA 3R4UA 4I2OA 3WF0A 1KFXL 1YUDA 1YXWA 3AKQA 3MIBA 5BXXA 1C5HA 1JN2P 5KWRA 1T6GC 3J7MA 4CCOA 4TZDA 3ZXDA 1MZ6A 4OHZA 5IVVA 1VB2A 1REFA 1WLDA 3JD72 2G9FA 3N9QA 5L19A 4N43C 2XJTA 1MR5A 2JG8C 1O3RA 1QDCA 4NRPA 3VBSB 2WS91 3SLIA 4AVTA 3NNGA 1HJFA 4F83A 1QXJA 1FOD3 1V6IA 2LUWA 1XC6A
chains in the Genus database with same CATH topology
1OF4A 5FUIA 3P1IA 5DMYA 3WF2A 2YFUA 3WEZA 3WNPA 3C7EA 1CIYA 2Y6HA 5IJRA 1JZ3A 1UMIA 2VZQA 3PUHA 3OEAA 2BBAA 2W92A 1UY2A 3HJRA 4MO3M 5B4XA 4AG4A 2WZ8A 4A44A 5EIYB 3WF4A 3T0BA 3IDAA 2VMEA 4GWJA 4KMQA 1UYZA 4DUWA 2WQ8A 2VZTA 1JZ5A 5IHRA 3SEEA 5B4NA 2WN2A 1GQPA 3LE0A 3VDBA 1JZ4A 3A7QA 4JKKA 4CUBA 1GMMA 4A42A 2VOTA 4TXWA 1UY1A 2B9VA 2X10A 3HNBM 4JX0A 5C70A 3WQBA 3FN9A 1UY3A 4OUEA 2X05A 4Z2AA 3SKJE 1K12A 2J1UA 2RV9A 5C71A 3W5NA 2VZ3A 5IFTA 4A45A 2VR4A 4JKLA 1MPXA 4CU6A 1DLCA 2YC4A 1O59A 3BGAA 4P08A 1CZSA 3DYMA 4W50A 3HPNA 5CYYA 4JKMA 4P02B 3F2ZA 2E31A 3HNMA 1HN1A 2W3JA 1CZTA 3T0DA 3I3BA 2LS6A 2W47A 4KI5M 2W5FA 4OMDA 3W5MA 2EIBA 3MV01 2WAOA 5A1AA 4QB2A 4YPJA 1WKYA 3I3DA 4XVHA 4IUGA 4D0QA 2KD7A 3I2FA 1CX1A 1O8SA 2QQIA 2YFZA 3WNKA 1H6YA 3OG2A 2VMDA 4AAXA 1I5PA 3GGLA 2C26A 2L9LA 1R64A 5DN2A 3C7FA 1OT5A 1J84A 1UMHA 1YQ2A 3C8XA 4A4AA 1WCQA 3ACFA 2VZ1A 4LHSA 2OKXA 1TVGA 4MADA 3NJVA 4CU7A 2XHNA 3LEKA 2QBXA 1RYYA 3A23A 5LA2A 4QAWA 1JYWA 4HG6B 3WSOA 2W1UA 5JMOA 2QQLA 1GOGA 3K4AA 3DYOA 1UY0A 2Y6JA 3LPGA 3OBAA 3MUY1 3I2IA 3CZJA 4XURA 5I0DA 2J1RA 1JU3A 1EUUA 2WN3A 1OD3A 4XUOA 3T2PA 3A22A 3FHAA 3OGRA 1P8JA 2ID4A 2Y8KA 2QQNA 2VMCA 2YB7A 3WF1A 4BJ0A 1JZ2A 3FHQA 3T09A 4P5YA 3UNPA 4ZXEA 4M4PA 3C7OA 2VC9A 3CQOA 2WDBA 3ETPA 2W1WA 4RYDA 2VJXA 4OYUA 1EUTA 2Z4FA 3HEIA 2YC2A 2BGPA 2RVAA 1JYNA 1GUIA 1PX3A 3NRUA 3DECA 3MBWA 3IAQA 4TTGA 4QX3A 5C7GA 2ZEWA 4QX1A 2W95A 3D3AA 4MGQA 4DEVA 1IQDC 1JYXA 4PQQA 5JR2A 1F4HA 2W46A 3IB3A 3UESA 3CKHA 2Y6LA 3UETA 1KEXA 5JXIA 1XPWA 2BZDA 3NJXA 1L7RA 3ECQA 1JHJA 3I2KA 3AC0A 4D8MA 3SKVA 3OB8A 2WO3A 2J1TA 2JE8A 4PT6A 2B4KA 3VD9A 1D7PM 2XQXA 3I2HA 2VZOA 4XUNA 1K42A 3WNLA 1CZVA 1UYXA 3OGSA 1UX7A 5JXJA 3I2GA 2VTFA 1GOFA 2HLEA 4A6OA 2VCBA 2WABA 2QQJA 4ET7A 4LPLA 3THDA 2VL4A 3WNMA 3HN3A 1K3IA 5JUVA 1W9TA 2CDPA 1UXXX 1JZ6A 2JDAA 5DQ0A 1W0NA 2QQMA 4E8DA 1OF3A 4GWIA 3K77A 5IFPA 5CZKA 3CDZB 4QX2A 4UAPA 2JKXA 2VZSA 5HPOA 1H6XA 3ACGA 3LEIA 2W1SA 3I97A 1XNAA 5G05L 1UZ0A 3OEBA 4P00B 3ACIA 4OMCA 1JI6A 2J22A 2WBKA 1GOHA 3E1F1 2J1AA 4W4ZA 2ORZA 3GDBA 3LQCA 2VCCA 1OH4A 1BHGA 2BGOA 4ZZ8A 3T08A 2DCJA 4UI9L 2WAAA 3K4DA 4BDVB 5LA0A 1UXZA 4XUQA 2J1VA 4M4RA 4RN5A 2X09A 2E26A 2VO5A 4KWUA 3MV11 4A41A 1UYYA 3WF3A 2EIEA 1F4AA 2J1SA 1US2A 3J7HA 1ULOA 1W9WA 3ACHA 1US3A 3MO4A 4CU8A 3VD3A 4QDQA 2E32A 2Y6KA 2XOMA 5HXMA 4CVUA 3JXSA 1PMHX 3FL7A 3VD4A 2DCKA 3HNYM 4BXSV 2XONA 4QX0A 3NQHA 4L0PA 3CMGA 1W8OA 4DUXA 3I2JA 2WYSA 5EJZB 4DXRA 2W91A 3VDCA 4QPWA 5LCWL 5F7UA 2CDOA 3CZUA 4XZUG 1JYVA 4CUAA 3CIHA 4QDSA 3C7HA 4QB6A 3DYPA 2HYXA 1NX9A 4ARYA 2VCAA 1TG7A 2PQSA 1K45A 3C7GA 2W87A 4JHZA 3VD7A 2ZEZA 2QQOA 2WZEA 2VZVA 3VDAA 2ZEXA 4LQRA 2WO2A 3HOBA 2Y6GA 3T2OA 3ABZA 2J1EA 2V4VA 1PX4A 3LPFA 4ARXA 2RJ2A 3A21A 4QB1A 1ULPA 4XUTA 2EIDA 1GNYA 1NKGA 5JXHA 2VQUA 2W1QA 2YG0A 3EYPA 2BERA 4DUVA 3BN6A 4MOAA 4ZY9A 2ZXQA 3LEGA 1J83A 1W8NA 3IIIA 1O8PA 3T2QA 4PF1A 2VZRA 3I3EA 1UY4A 5G04L 4FI9A 1T2XA 2LW8A 2V72A 1SHWB 2WO1A 3T0AA 2VQTA 1KGYA 2Y64A 2V5DA 1W99A 3K4ZA 1DP0A 2W9XA 4BK4A 4DEQA 2ZEYA 3MUZ1 4ZZ5A 2DDUA 4GZ9A 4QDRA 2R7EB 3THCA 1XC6A 3U37A 3VD5A 4MGSA 2JD9A 3P6BA 3EB7A 1UWWA 4DXTA 3K75B 4OZOA 2VMFA 2ORXA 1DYOA 3GM8A 4E8CA 2WUHA 3IAPA 1JU4A 5IYYA 2C9KA 2EICA 4XUPA 4BK5A 2C4XA 4DXSA 3OGVA 4CU9A 3ZM8A 1L7QA 4CUCA 5EJ1B 3PUIA 1XNTA 4A3ZA 2QQKA 5LA1A 4UOJA 5JXGA 1LNSA 1PMJX 1GU3A 5J1XA 2VM9A 4LKSA 1JZ8A 2J7MA 1NAEA 2W94A 2VZUA 3WF0A 3SEPA 3WNNA 2VZPA 3WNOA 1JZ7A 3GXUA 1NUKA 2E33A 5DPNA 1SG3A 3NNGA 4W8JA 1W9SA 1SDDB 3K46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OF4 A;  5FUI A;  3P1I A;  5DMY A;  3WF2 A;  2YFU A;  3WEZ A;  3WNP A;  3C7E A;  1CIY A;  2Y6H A;  5IJR A;  1JZ3 A;  1UMI A;  2VZQ A;  3PUH A;  3OEA A;  2BBA A;  2W92 A;  1UY2 A;  3HJR A;  4MO3 M;  5B4X A;  4AG4 A;  2WZ8 A;  4A44 A;  5EIY B;  3WF4 A;  3T0B A;  3IDA A;  2VME A;  4GWJ A;  4KMQ A;  1UYZ A;  4DUW A;  2WQ8 A;  2VZT A;  1JZ5 A;  5IHR A;  3SEE A;  5B4N A;  2WN2 A;  1GQP A;  3LE0 A;  3VDB A;  1JZ4 A;  3A7Q A;  4JKK A;  4CUB A;  1GMM A;  4A42 A;  2VOT A;  4TXW A;  1UY1 A;  2B9V A;  2X10 A;  3HNB M;  4JX0 A;  5C70 A;  3WQB A;  3FN9 A;  1UY3 A;  4OUE A;  2X05 A;  4Z2A A;  3SKJ E;  1K12 A;  2J1U A;  2RV9 A;  5C71 A;  3W5N A;  2VZ3 A;  5IFT A;  4A45 A;  2VR4 A;  4JKL A;  1MPX A;  4CU6 A;  1DLC A;  2YC4 A;  1O59 A;  3BGA A;  4P08 A;  1CZS A;  3DYM A;  4W50 A;  3HPN A;  5CYY A;  4JKM A;  4P02 B;  3F2Z A;  2E31 A;  3HNM A;  1HN1 A;  2W3J A;  1CZT A;  3T0D A;  3I3B A;  2LS6 A;  2W47 A;  4KI5 M;  2W5F A;  4OMD A;  3W5M A;  2EIB A;  3MV0 1;  2WAO A;  5A1A A;  4QB2 A;  4YPJ A;  1WKY A;  3I3D A;  4XVH A;  4IUG A;  4D0Q A;  2KD7 A;  3I2F A;  1CX1 A;  1O8S A;  2QQI A;  2YFZ A;  3WNK A;  1H6Y A;  3OG2 A;  2VMD A;  4AAX A;  1I5P A;  3GGL A;  2C26 A;  2L9L A;  1R64 A;  5DN2 A;  3C7F A;  1OT5 A;  1J84 A;  1UMH A;  1YQ2 A;  3C8X A;  4A4A A;  1WCQ A;  3ACF A;  2VZ1 A;  4LHS A;  2OKX A;  1TVG A;  4MAD A;  3NJV A;  4CU7 A;  2XHN A;  3LEK A;  2QBX A;  1RYY A;  3A23 A;  5LA2 A;  4QAW A;  1JYW A;  4HG6 B;  3WSO A;  2W1U A;  5JMO A;  2QQL A;  1GOG A;  3K4A A;  3DYO A;  1UY0 A;  2Y6J A;  3LPG A;  3OBA A;  3MUY 1;  3I2I A;  3CZJ A;  4XUR A;  5I0D A;  2J1R A;  1JU3 A;  1EUU A;  2WN3 A;  1OD3 A;  4XUO A;  3T2P A;  3A22 A;  3FHA A;  3OGR A;  1P8J A;  2ID4 A;  2Y8K A;  2QQN A;  2VMC A;  2YB7 A;  3WF1 A;  4BJ0 A;  1JZ2 A;  3FHQ A;  3T09 A;  4P5Y A;  3UNP A;  4ZXE A;  4M4P A;  3C7O A;  2VC9 A;  3CQO A;  2WDB A;  3ETP A;  2W1W A;  4RYD A;  2VJX A;  4OYU A;  1EUT A;  2Z4F A;  3HEI A;  2YC2 A;  2BGP A;  2RVA A;  1JYN A;  1GUI A;  1PX3 A;  3NRU A;  3DEC A;  3MBW A;  3IAQ A;  4TTG A;  4QX3 A;  5C7G A;  2ZEW A;  4QX1 A;  2W95 A;  3D3A A;  4MGQ A;  4DEV A;  1IQD C;  1JYX A;  4PQQ A;  5JR2 A;  1F4H A;  2W46 A;  3IB3 A;  3UES A;  3CKH A;  2Y6L A;  3UET A;  1KEX A;  5JXI A;  1XPW A;  2BZD A;  3NJX A;  1L7R A;  3ECQ A;  1JHJ A;  3I2K A;  3AC0 A;  4D8M A;  3SKV A;  3OB8 A;  2WO3 A;  2J1T A;  2JE8 A;  4PT6 A;  2B4K A;  3VD9 A;  1D7P M;  2XQX A;  3I2H A;  2VZO A;  4XUN A;  1K42 A;  3WNL A;  1CZV A;  1UYX A;  3OGS A;  1UX7 A;  5JXJ A;  3I2G A;  2VTF A;  1GOF A;  2HLE A;  4A6O A;  2VCB A;  2WAB A;  2QQJ A;  4ET7 A;  4LPL A;  3THD A;  2VL4 A;  3WNM A;  3HN3 A;  1K3I A;  5JUV A;  1W9T A;  2CDP A;  1UXX X;  1JZ6 A;  2JDA A;  5DQ0 A;  1W0N A;  2QQM A;  4E8D A;  1OF3 A;  4GWI A;  3K77 A;  5IFP A;  5CZK A;  3CDZ B;  4QX2 A;  4UAP A;  2JKX A;  2VZS A;  5HPO A;  1H6X A;  3ACG A;  3LEI A;  2W1S A;  3I97 A;  1XNA A;  5G05 L;  1UZ0 A;  3OEB A;  4P00 B;  3ACI A;  4OMC A;  1JI6 A;  2J22 A;  2WBK A;  1GOH A;  3E1F 1;  2J1A A;  4W4Z A;  2ORZ A;  3GDB A;  3LQC A;  2VCC A;  1OH4 A;  1BHG A;  2BGO A;  4ZZ8 A;  3T08 A;  2DCJ A;  4UI9 L;  2WAA A;  3K4D A;  4BDV B;  5LA0 A;  1UXZ A;  4XUQ A;  2J1V A;  4M4R A;  4RN5 A;  2X09 A;  2E26 A;  2VO5 A;  4KWU A;  3MV1 1;  4A41 A;  1UYY A;  3WF3 A;  2EIE A;  1F4A A;  2J1S A;  1US2 A;  3J7H A;  1ULO A;  1W9W A;  3ACH A;  1US3 A;  3MO4 A;  4CU8 A;  3VD3 A;  4QDQ A;  2E32 A;  2Y6K A;  2XOM A;  5HXM A;  4CVU A;  3JXS A;  1PMH X;  3FL7 A;  3VD4 A;  2DCK A;  3HNY M;  4BXS V;  2XON A;  4QX0 A;  3NQH A;  4L0P A;  3CMG A;  1W8O A;  4DUX A;  3I2J A;  2WYS A;  5EJZ B;  4DXR A;  2W91 A;  3VDC A;  4QPW A;  5LCW L;  5F7U A;  2CDO A;  3CZU A;  4XZU G;  1JYV A;  4CUA A;  3CIH A;  4QDS A;  3C7H A;  4QB6 A;  3DYP A;  2HYX A;  1NX9 A;  4ARY A;  2VCA A;  1TG7 A;  2PQS A;  1K45 A;  3C7G A;  2W87 A;  4JHZ A;  3VD7 A;  2ZEZ A;  2QQO A;  2WZE A;  2VZV A;  3VDA A;  2ZEX A;  4LQR A;  2WO2 A;  3HOB A;  2Y6G A;  3T2O A;  3ABZ A;  2J1E A;  2V4V A;  1PX4 A;  3LPF A;  4ARX A;  2RJ2 A;  3A21 A;  4QB1 A;  1ULP A;  4XUT A;  2EID A;  1GNY A;  1NKG A;  5JXH A;  2VQU A;  2W1Q A;  2YG0 A;  3EYP A;  2BER A;  4DUV A;  3BN6 A;  4MOA A;  4ZY9 A;  2ZXQ A;  3LEG A;  1J83 A;  1W8N A;  3III A;  1O8P A;  3T2Q A;  4PF1 A;  2VZR A;  3I3E A;  1UY4 A;  5G04 L;  4FI9 A;  1T2X A;  2LW8 A;  2V72 A;  1SHW B;  2WO1 A;  3T0A A;  2VQT A;  1KGY A;  2Y64 A;  2V5D A;  1W99 A;  3K4Z A;  1DP0 A;  2W9X A;  4BK4 A;  4DEQ A;  2ZEY A;  3MUZ 1;  4ZZ5 A;  2DDU A;  4GZ9 A;  4QDR A;  2R7E B;  3THC A;  1XC6 A;  3U37 A;  3VD5 A;  4MGS A;  2JD9 A;  3P6B A;  3EB7 A;  1UWW A;  4DXT A;  3K75 B;  4OZO A;  2VMF A;  2ORX A;  1DYO A;  3GM8 A;  4E8C A;  2WUH A;  3IAP A;  1JU4 A;  5IYY A;  2C9K A;  2EIC A;  4XUP A;  4BK5 A;  2C4X A;  4DXS A;  3OGV A;  4CU9 A;  3ZM8 A;  1L7Q A;  4CUC A;  5EJ1 B;  3PUI A;  1XNT A;  4A3Z A;  2QQK A;  5LA1 A;  4UOJ A;  5JXG A;  1LNS A;  1PMJ X;  1GU3 A;  5J1X A;  2VM9 A;  4LKS A;  1JZ8 A;  2J7M A;  1NAE A;  2W94 A;  2VZU A;  3WF0 A;  3SEP A;  3WNN A;  2VZP A;  3WNO A;  1JZ7 A;  3GXU A;  1NUK A;  2E33 A;  5DPN A;  1SG3 A;  3NNG A;  4W8J A;  1W9S A;  1SDD B;  3K46 A; 
#chains in the Genus database with same CATH topology
 4C90 A;  2EAA A;  4XF0 A;  1XSR A;  2ZX0 A;  3FFQ A;  3P1I A;  4BLI A;  3BIE A;  2CGP A;  1UCX A;  4L99 A;  1UZZ A;  3NAP B;  5DMY A;  1G6N A;  4XIK A;  1R08 3;  1PO2 3;  1NLQ A;  3HR9 A;  3C7E A;  1CIY A;  4H55 A;  1VMH A;  4XYX A;  5FP9 A;  4CEW A;  3J8F 2;  4K8R B;  3MZH A;  1AR9 3;  2VZQ A;  3PUH A;  4DPN A;  3GZE A;  2ZZQ A;  4MXW A;  5C8C A;  3BTY A;  3N35 A;  3VN4 A;  5FZL A;  2VUL A;  3O1R A;  2TUN A;  5JWP A;  3UJO A;  4PDW A;  2Q30 A;  4CTE A;  3USU A;  5FY7 A;  5F3I A;  2ZGL A;  4A44 A;  1LR5 A;  3WF4 A;  1XE8 A;  1LUL A;  2RS3 1;  2NPI A;  3GCW A;  2VME A;  4UFL A;  3H8O A;  2DVF A;  3IZO A;  4YZ5 A;  1Z7S 2;  2NZ9 A;  4PBO A;  1H30 A;  3HQU A;  2WZR 1;  1XB9 A;  5K9Y A;  2WQ8 A;  2VZT A;  1SLT A;  3PHM A;  4GAZ A;  2CHH A;  5FYU A;  5GJ6 A;  5CFD A;  3WG2 A;  4LIV A;  3WVJ A;  5IHR A;  1JZ5 A;  2WN2 A;  1ENX A;  1GQP A;  3LE0 A;  2WZR 2;  1PMI A;  4I0A A;  4QXC A;  4CDW A;  1AX1 A;  1LU2 A;  1YJL A;  2QZ3 A;  1H2L A;  4SBV A;  1UPI A;  4TXW A;  1C28 A;  5F37 A;  1STM A;  2B9V A;  1COV 1;  3KSC A;  3HNB M;  3UJQ A;  4R52 A;  4JX0 A;  2XBO 2;  4I0B A;  5C70 A;  5F3C A;  1UY3 A;  5D8A B;  5FZF A;  2DUO A;  3LDR A;  2UY8 A;  2RV9 A;  2JDZ A;  3QH6 A;  1VBC 2;  3OJB A;  1DDL A;  5IFT A;  2Z42 A;  4A45 A;  5LK7 B;  3SHR A;  2VR4 A;  1AL2 3;  5T55 A;  1YI7 A;  4XXA A;  2XJQ A;  4LBQ B;  1UZV A;  1VBC 1;  2QTW B;  2DVD A;  1WMX A;  1F15 A;  3ZFE A;  1GQH A;  3HPN A;  3T4H B;  2ZGK A;  1WW7 A;  4DO0 A;  2VMG A;  2WFF 1;  4LO8 A;  1YIP A;  4P02 B;  3H0O A;  3WDW A;  4CDU A;  2F4P A;  1PGL 2;  2Q5T A;  1WLW A;  1RVF 2;  1IHM A;  3UV9 A;  5FUN A;  5EYX A;  3ZFG C;  4CDU B;  3THT A;  1OQD A;  5DDJ 3;  4AGR A;  5JOY A;  2XKO A;  1PGL 1;  1UOB A;  1YNA A;  5AVP A;  4A7Z A;  4R8H A;  3W58 A;  1RVF 1;  1ULF A;  2LS6 A;  5FWJ A;  4KI5 M;  5JZG A;  2IXI A;  1ST8 A;  3HBK A;  4ZU5 A;  5KHI A;  3B3Q E;  3MV0 1;  3TN9 3;  1QOO A;  5FO8 B;  4QB2 A;  2XUM A;  1WKY A;  1Y4W A;  5FZG A;  5LWB A;  2BP6 A;  2KD7 A;  3IDB B;  5CIR A;  1CX1 A;  1QNY A;  4Y20 A;  4BQW A;  4LBL A;  5JMC A;  1VRH 3;  1GZ9 A;  3BI3 A;  2QQI A;  1S0F A;  2YFZ A;  1H2M A;  4X8N A;  4GMP 0;  1AYM 2;  1HB3 A;  4H7L A;  1H6Y A;  1AL2 1;  4NOT A;  2VMD A;  5T54 A;  1BLZ A;  3I8T A;  2R07 2;  1H8T C;  1BK0 A;  1NE4 A;  4DXZ A;  3GGL A;  4X8P A;  2XR4 A;  4GD4 A;  2C26 A;  3LA3 A;  3MIE A;  1CAU B;  4YGE A;  5E8A A;  2BVB A;  4YVW B;  5FZM A;  4D3W A;  4E4Z A;  5DN2 A;  3J4U H;  4ZU7 A;  4QGN A;  1S2K A;  3OTF A;  1OT5 A;  4YVW A;  2UYB A;  5A70 A;  2VCM A;  3C2U A;  5JPN B;  2CV6 A;  4JQR A;  4Q8K A;  4PIX A;  4QPI A;  2C9A A;  4KWL A;  1R1A 1;  5DAP A;  1RIT A;  1SEF A;  5H9P A;  4A4A A;  3RFR A;  3ACF A;  4FPL A;  2O8Q A;  4JTO A;  4LHS A;  4W65 A;  4XOG A;  5CKN A;  4XQW A;  4FTB A;  3WW1 A;  3Q8A A;  3V0A B;  3HVD A;  2E7A A;  4GA9 A;  2XHN A;  4URA A;  2WS9 3;  4XIL A;  2QBX A;  1RGS A;  4NAM A;  3VZN A;  4Q4W 1;  2A7A A;  4QAW A;  4HG6 B;  1D0G A;  2W1U A;  3WCR A;  3I54 A;  1EAH 3;  1GOG A;  3NL1 A;  3OY8 A;  2HEW F;  3DYO A;  3WOG A;  1OOP A;  4Q0V A;  2B9U A;  4N53 C;  1WCS A;  4TSV A;  3VKF C;  4CP2 A;  3RZJ A;  5AC9 1;  4B4R A;  4MGT A;  3OBA A;  3I2I A;  4XUR A;  5I0D A;  2J1R A;  4FOV A;  1JU3 A;  1DGR N;  5AC9 2;  1JH5 A;  3U75 A;  3HQX A;  5JDB A;  4BCU A;  1CVN A;  1PK6 A;  3POB A;  3DPR B;  3KF3 A;  1F35 A;  3PU8 A;  1W3V A;  1WA6 X;  2E63 A;  1CON A;  3M70 A;  1P8J A;  1NYW A;  2XJV A;  2OX0 A;  5FYT A;  5IAT A;  1RUH 1;  2QQN A;  1RL3 A;  1R08 2;  3WZ1 A;  2ZHL A;  1V6M A;  4S2G A;  4EYU A;  4XQ4 A;  3FHQ A;  5DAQ A;  3B9I A;  1RUD 2;  5FP3 A;  1HB4 A;  4MVT A;  1RUH 2;  2NYY A;  4ZXE A;  1O5L A;  4TYS A;  1RUF 3;  3C7O A;  3ETP A;  2RMU 3;  3KB5 A;  4GB3 2;  3WUD A;  4NMI A;  2Q1F A;  1BBT 2;  1QXR A;  3HEI A;  4CCD A;  3KHC A;  1F5F A;  1ZBA 2;  2A3X A;  2RVA A;  4FPC A;  4UBG A;  1D4V B;  4ZON A;  4YGC A;  4XFG A;  4XDQ A;  5FLJ A;  2X5I B;  3ACL A;  1Y3T A;  4LNV A;  3RMX A;  1DQ1 A;  3IAQ A;  4OHX A;  3OOX A;  4XHB A;  5EXO A;  4NIA A;  2ZEW A;  4QX1 A;  4N43 A;  2DCT A;  1W2A X;  1GP6 A;  2OPW A;  3WR0 A;  5A32 A;  2BOJ A;  4MGQ A;  3N4M A;  1IQD C;  2LRP A;  4BZ4 A;  4OQ8 A;  2B46 X;  3IB3 A;  3QAC A;  2ZS6 B;  2QFE A;  3CKH A;  1RUC 1;  4NII A;  2P3Y A;  1Q8P A;  2RM2 1;  2D98 A;  5FBJ A;  1MS9 A;  4R9B A;  2X5I C;  4LOT A;  1WCD J;  3NJX A;  5F2S A;  3FZ3 A;  1JHJ A;  3S6P A;  1F2N A;  1WMD A;  3DPR A;  2GSY A;  3VHO A;  3D0S A;  1BEV 2;  2R16 A;  3AC0 A;  3D5O A;  4D8M A;  2B8M A;  3OB8 A;  1ASJ 1;  3M3E A;  2ES3 A;  2IXC A;  3VD9 A;  2ZGQ A;  2IVI B;  2XQX A;  2BQP A;  1OXC A;  1BEV 1;  3AMP A;  2VZO A;  2HWE 3;  4HSJ A;  5FZ4 A;  3NST A;  4LBN A;  3ILN A;  5A3W A;  3GNE A;  2RS5 1;  2OUH A;  1UYX A;  2NM1 A;  1SPP B;  1UX7 A;  3M7A A;  3QCW A;  4L97 A;  5FPV A;  1W3X A;  3UL2 A;  5CNA A;  5FPZ A;  4NID A;  1DZT A;  1S2B A;  1QJX 3;  4IE0 A;  4HK9 A;  4LK7 A;  4P9W A;  5FP4 A;  3UT0 A;  2E53 A;  1LGB A;  2PMW B;  4MXW B;  5K0U A;  5IVJ A;  4FCA A;  1ZA7 A;  1RUG 1;  4ASK A;  3THD A;  1MS3 A;  2I2S A;  4HL0 A;  4G4F A;  3WNM A;  4NN0 A;  1K3I A;  2VG9 A;  3CJI B;  2UWA A;  2B7Y A;  3RWN A;  3ES1 A;  4JAA A;  5GLV A;  3VHP A;  4G9S B;  1VIW B;  3IM0 A;  1LOA A;  4ZU4 A;  1PVC 3;  4HOO A;  3USS A;  2WFP A;  2H0B A;  3MW3 A;  4AZZ A;  1OF3 A;  1MS1 A;  3AFK A;  1NOV A;  2A75 A;  4TWT A;  4DRR A;  5IFP A;  4LO7 A;  5L36 A;  1UO9 A;  2K9Z A;  1D0H A;  3CDZ B;  4Q1R A;  3OGG A;  1CJD A;  2GAU A;  4JCK A;  4D7S A;  1VB4 A;  2G19 A;  2WZR 3;  2YU2 A;  1LB2 A;  5C9A A;  4Q4V 1;  4LBO A;  3T30 A;  4Q27 A;  4XMA A;  3WDT A;  4AW7 A;  5FZ8 A;  1DLL A;  3PJY A;  3PUA A;  4XF3 A;  1SAC A;  3KLS A;  3P3N A;  2BFU L;  1NY7 1;  4IND A;  1AUY A;  1VBA 2;  1T6B X;  4P00 B;  3IN9 A;  3RJR A;  2WS9 2;  5CEH A;  4LKE A;  1XQN A;  5A3U A;  1ZZC A;  1JI6 A;  4LBQ D;  2J22 A;  3SNM A;  1AVB A;  3SQO A;  1ND2 B;  1UKR A;  1LTE A;  4Y24 A;  1EY2 A;  4W4Z A;  2ORZ A;  1MZF A;  1ND2 A;  3TRS B;  1V0A A;  2P37 A;  4M00 A;  3VDD B;  5F8P A;  4ZZ8 A;  2C1F A;  4Z2W A;  3IT8 A;  4UI9 L;  5DAX A;  4CPB A;  1CD3 G;  1KS5 A;  5LA0 A;  1UXZ A;  2VAU A;  3CEW A;  4ITC A;  3IDC B;  4XUQ A;  4C8D A;  3ZYJ B;  3KT7 A;  5CFC C;  5IK4 A;  2DYC A;  5FYI A;  5J98 B;  1CES A;  1IGO A;  1AX0 A;  1H9P A;  4HPK A;  3ZPO A;  4EQV A;  4KWU A;  1QQP 3;  2C0Z A;  3MV1 1;  2WLP A;  3TN9 2;  4LXL A;  3WF3 A;  5BNP C;  1OUS A;  1RHI 1;  2J1S A;  2D3S A;  4XBQ A;  4AEJ A;  3F95 A;  1W9W A;  5FY9 A;  3VHR A;  5F5Q A;  1BEV 3;  4IEV A;  4QDQ A;  1OOP C;  1V9U 1;  1XE0 A;  2PA7 A;  4XQD A;  5IW0 A;  4JDN A;  3ZMN A;  3AP6 A;  4B8E A;  4ERO A;  1YCI A;  2FDF A;  1DFQ A;  5HXM A;  2XJR A;  3ME2 A;  2CTV A;  4XJU A;  1VAL A;  1UIK A;  1N1T A;  5KXD A;  1PMH X;  2KM2 A;  3VD4 A;  5KHH A;  1HRV 2;  5FYY A;  1N1S A;  3VHN A;  1REE A;  1VMJ A;  2WQ4 A;  1PM4 A;  5A7W A;  1UPS A;  3M3C A;  1C5I A;  4CCJ A;  1HRV 1;  4N53 B;  1AXY A;  1XYP A;  2AUY A;  4TLF A;  1LOF A;  1YYN A;  4P9I A;  3TEZ A;  1LED A;  4XFH A;  2P3J A;  3IDE A;  4ZPI A;  1YQ5 A;  1C8M 2;  4N7U A;  4QPW A;  4BQX A;  1U5Y A;  3W20 A;  5J7M A;  2QQP A;  1Y9Q A;  1W6Q A;  3OD0 A;  1PVX A;  1JYV A;  2R0H A;  4AHX A;  1FMD 1;  4QDS A;  1LOD A;  4XFA A;  1UNB A;  4YZ2 A;  2HWB 1;  1LCL A;  1ND3 B;  3LDB A;  2I74 A;  4QB6 A;  5EJ3 A;  3ZSE A;  4IQP A;  2YBS A;  1LEC A;  4C0B A;  1TG7 A;  1B35 A;  2QZ2 A;  1WA4 A;  5LBB A;  2XVK A;  2FCV A;  3PTY A;  2QNK A;  2W87 A;  4HET A;  1S0B A;  2QQO A;  1ZRC A;  2VZV A;  2PHD A;  3VDA A;  3M4F A;  1SCR A;  2Q1Z B;  2E51 A;  4YWA A;  5T52 A;  3HOB A;  3WP4 A;  2I07 B;  1ONA A;  2ZGT A;  3TEX A;  5C33 A;  5GLW A;  5JZG C;  4LUM A;  4XCA A;  3THP A;  4MGK E;  1PX4 A;  5FO7 B;  3LPF A;  1S1A A;  5LB6 A;  1LEN A;  2RJ2 A;  3NW4 A;  3A21 A;  4QB1 A;  2EID A;  1GNY A;  1G8W A;  4Q4W 3;  1QU0 A;  5JXH A;  1AL2 2;  2ZCW A;  4SLI A;  1H8T B;  3O1O A;  1O3T A;  2YG0 A;  4GH4 B;  4XCB A;  2XLA A;  4ZY9 A;  1RUF 2;  2R06 3;  3O7O A;  3INA A;  1PZ9 A;  3III A;  4KQ7 A;  4ATE A;  5A3T A;  2SBA A;  2GC2 A;  5HCB A;  5A7W B;  4CP9 B;  4IV1 A;  4LIT A;  5K4L A;  3L9J T;  1RVF 3;  3U14 A;  4RQP B;  2OVU A;  5E89 A;  1T2X A;  2WO1 A;  1HKD A;  1WWY A;  4BB3 A;  3KHB A;  3LZZ A;  2EA7 A;  3K4Z A;  4N43 B;  4COW A;  3JUU A;  3U4X A;  5FLH A;  4BK4 A;  2XH6 A;  2DDU A;  2JEN A;  4GZ9 A;  4QDR A;  1IS3 A;  1RMU 1;  2B39 A;  4FAH A;  3V0A A;  4CDQ C;  2IXH A;  2XVG A;  3OYW A;  3BU7 A;  3DKW A;  3RI9 A;  4CXX A;  3EB7 A;  4KH9 A;  2YPJ A;  3O1V A;  4LJH A;  4MSV A;  1I9R A;  2VMF A;  1DYO A;  1QY4 A;  4CDQ A;  1Z78 A;  1R09 3;  4XZP A;  5A3N A;  3KQR A;  3I59 A;  1COV 3;  3ZYH A;  3NNJ A;  2WUH A;  3V64 A;  5B2G B;  2VUC A;  4XTP A;  5J3U A;  2VW0 A;  2DFC A;  1SFN A;  3MYX A;  3ZYB A;  2HWC 1;  3AFG A;  3IMN A;  1L7Q A;  2HWE 1;  2EAK A;  1O3S A;  4AVS A;  5AFB A;  1IKP A;  2FCU A;  1OUR A;  2HWE 2;  4IV1 C;  1LGN A;  3EXU A;  4FPJ A;  1OSG A;  4Q0P A;  3E5Q A;  1LNS A;  1V70 A;  3PNA A;  4GH4 A;  4BIF A;  3I49 A;  3VGI A;  3POF A;  4HSL A;  4M3C A;  2LAL A;  1GNZ A;  1GR3 A;  4LKS A;  3S0M A;  3OF1 A;  5K0U B;  4KG0 A;  2W94 A;  3IMM A;  1QQP 2;  3H8X A;  1Y9M A;  4L2N A;  1DG6 A;  1CWP A;  4AL9 A;  1DU3 D;  3GXU A;  3SH5 A;  1ZRR A;  1ZBA 1;  3DGT A;  2DUR A;  4FT8 A;  2DBI A;  4B7E A;  2JE9 A;  4HK8 A;  2G4I A;  2E33 A;  3AMQ A;  3AL5 A;  1AR6 3;  3FJS A;  3O12 A;  5BPX A;  4Y26 A;  4CCL A;  4W8J A;  1W9S A;  2R30 A;  4Z07 A;  3T3Y A;  2K2S A;  1AR7 2;  1BVP 1;  3EBR A;  4JHT A;  5KXB A;  3OYW B;  4FPH A;  2HWB 3;  5FAX A;  2OZ6 A;  3ZXE A;  3IWZ A;  3MHZ A;  1QJX 1;  2YBK A;  3AP4 A;  3H1W A;  3H9A A;  3ZYF A;  2YFU A;  5IJR A;  1TE1 B;  4BLJ A;  5FPB A;  2GMM A;  1A8M A;  1FYU A;  3OEA A;  2FDG A;  2ZGO A;  1Q3E A;  4CDW B;  1RUC 3;  5L9R A;  3LCP A;  3HJR A;  4V2V A;  1C4R A;  1YLL A;  2HWC 3;  2R06 2;  2WR9 A;  3AYE A;  3ZDS A;  4AR2 A;  2BVV A;  5CG8 A;  4GB3 3;  5B4X A;  5LBE A;  5EYY A;  1H1I A;  4PCR A;  4LO6 B;  1ASJ 3;  5C3O A;  3I2O A;  4OI1 A;  5ABJ A;  1QJY 1;  2WZ8 A;  2R06 1;  1VBB 3;  2RS1 2;  4B1L A;  4QHO A;  1TEI A;  1W8F A;  4GWJ A;  1UYZ A;  2ZGP A;  1QJY 2;  1HRI 3;  3POW A;  1LOG A;  4QD2 A;  4RR3 A;  1DIW A;  4GKY A;  4D69 A;  1V9U 3;  3SEE A;  4CCK A;  5B4N A;  3SC7 X;  4Q26 A;  1NT0 A;  4EN8 B;  3VDB A;  4JVA A;  1V00 A;  2YXS A;  5T5O A;  1EV1 3;  4CUB A;  1GMM A;  4CXW A;  1ZBE 3;  5EWS A;  4A42 A;  2DVB A;  3VKL A;  5FDB A;  3S57 A;  1UZW A;  2VUA A;  3SCH A;  4Q2F A;  4R9A A;  1RUG 2;  4G3Y C;  5I8S A;  3WQB A;  2CWM A;  2VD7 A;  3FN9 A;  2X05 A;  4WM8 C;  2VXJ A;  1RIN A;  4OHV A;  4PQ9 A;  1K12 A;  2J1U A;  3BCW A;  3QD6 A;  4CDU C;  5C71 A;  1VBE 2;  3W5N A;  2LM3 A;  2G9G A;  1WW6 A;  1ZVF A;  1ZZ9 A;  4CU6 A;  1MEC 1;  2XGX A;  4KWK A;  3ORJ A;  5F5C A;  1VBE 1;  1CZS A;  1X9P A;  1XYO A;  4Y1Z A;  5IVF A;  5FTT C;  4XFB A;  2FDH A;  4WM8 B;  5L9V A;  1AYN 2;  3WXP A;  4GKX A;  4K9S A;  1MZE A;  4AHW A;  5I8T A;  3QBQ A;  4Y1Y A;  1JBC A;  1HN1 A;  4IGQ A;  4N7I A;  3PUS A;  3WD5 A;  2PHX A;  1VLN A;  2JG9 A;  1CZT A;  4QX7 A;  2VUD A;  3FBM A;  4N53 A;  4Z82 A;  2W5F A;  4AI0 A;  1LHO A;  1JTZ X;  3FUO A;  3TAY A;  4Y5Z 0;  2NMO A;  3AL6 A;  1UN1 A;  4IUG A;  1IPK A;  3I2F A;  4OUS A;  3KMH A;  2ZHN A;  4WBB A;  3H3L A;  2BGC A;  2DBN A;  3GF6 A;  2RR1 3;  2HWD 3;  3H3U A;  3KV9 A;  4CYD A;  2VOV A;  1MVE A;  1ND3 A;  2FZ1 A;  5F6K A;  4Y4R A;  2HWF 3;  4AAX A;  4PDW C;  2F4L A;  4QKF A;  1AX2 A;  1YFW A;  3I2D A;  1B35 B;  1JYI A;  1VPH A;  2VNV A;  1GLH A;  3R05 A;  1SMV A;  2WNV C;  5FZO B;  3VUO A;  2HKX A;  5FOB B;  3KM5 A;  1UMH A;  1NCQ A;  4IEQ A;  2ZKN A;  1NA1 B;  5FK7 A;  4O65 A;  2GN7 A;  3RDI A;  2F6B A;  4W6W A;  3X29 B;  1XSQ A;  5FMB A;  4CCM A;  2JDN A;  2VZ1 A;  1I3H A;  4D6S A;  5F5I A;  1IG0 A;  1C3H A;  1NXM A;  1O4T A;  4BHP A;  3POE A;  3NJV A;  4QGM A;  4MH0 E;  2PHL A;  3BPZ A;  2PHT A;  4HVQ A;  1HDK A;  4TLG A;  4YLZ A;  2QQW A;  1W6P A;  2HJI A;  2RS3 2;  3A0K A;  4Y1X A;  3A23 A;  1N3P A;  5LA2 A;  1QDO A;  3B93 A;  4QU1 A;  5IVY A;  3LSD A;  3WSO A;  2EXH A;  2QQL A;  3GBF A;  1Z7S 1;  2V5Y A;  5GLT A;  3ZLI A;  1W05 A;  3AP5 A;  5GAL A;  3N9P A;  3WIN E;  3UKN A;  5J48 A;  5BNN A;  2Y6J A;  5FKB A;  4UW4 A;  4RR3 C;  2GP5 A;  1RTV A;  4DIQ A;  4NRM A;  3RG0 A;  1ENR A;  1VR3 A;  2WFF 3;  4QT6 A;  3FHI B;  2XUE A;  4BQ2 A;  3BKZ A;  4I01 A;  3T2P A;  4JGY C;  5D8A A;  5AVA A;  1YO8 A;  2OII A;  3OBR A;  5CU1 A;  2H6C A;  3DF0 A;  3APB A;  5FYH A;  1N1V A;  3M3Q A;  2BFU S;  4YG6 A;  2Y8K A;  2A6V A;  3VL8 A;  5AFE A;  3GZA A;  2WL1 A;  3B7M A;  1HQW A;  1YQ6 A;  1WBF A;  4YVW C;  3WF1 A;  2D6K A;  3JQX A;  3MFC A;  2Y60 A;  4W6Y A;  3VKO A;  1AR6 1;  1KXG A;  4JDO A;  4P5Y A;  3UNP A;  2AGS A;  3H42 B;  4Q0S A;  5CFC A;  2A6Y A;  2WDB A;  1H2K A;  2YDE A;  4J6G A;  1QH6 A;  4ORF A;  1G9C A;  3N7J A;  3LFI A;  4OYU A;  4IE7 A;  4UF0 B;  4FSJ A;  1JOB A;  3K46 A;  4OLL A;  1IQA A;  2ZGS A;  1PX3 A;  5K0U C;  1OBN A;  3MLL A;  4Q4X 2;  3WQ0 A;  3NRU A;  1Q8O A;  3MBW A;  3O1P A;  2EVX A;  5C7G A;  2QQV A;  1YEW A;  4Q4X 1;  1UX6 A;  1H4H A;  2W95 A;  2GNB A;  5FZ1 A;  2EXK A;  4CCE A;  1Z0H A;  1W06 A;  1CJP A;  3BU0 A;  4PQQ A;  1J58 A;  1W9Y A;  2JDY A;  3MW2 A;  3M3I A;  1AJK A;  3UET A;  1KEX A;  4LEJ A;  4PLN A;  1MQT A;  2QE3 A;  2BZD A;  3WV6 A;  1FV2 A;  3O14 A;  1X7N A;  4AQT A;  2ZX3 A;  4ZKT B;  5FZ9 A;  1JYW A;  5J09 A;  2VBD A;  5FXV A;  4B7K A;  4JC1 A;  5ACA 1;  4QHB A;  1UIJ A;  4CZS A;  4LE4 A;  2WO3 A;  3AZY A;  1AZD A;  2J1T A;  1VAV A;  1JW6 A;  2B4K A;  2IC1 A;  2SLI A;  1HV0 A;  1G9F A;  1D7P M;  2CL2 A;  3N7K A;  4EV0 A;  4FTS A;  3R0R A;  4PI0 A;  3ILR A;  4QU2 A;  4AOC A;  3LIH A;  3ITQ A;  3KGZ A;  3D0J A;  3HD8 B;  3DV8 A;  2DTW A;  1RMU 2;  4FVV A;  4O61 A;  2UWC A;  5EHD A;  3RJ2 X;  3S7I A;  3TYJ A;  3WNL A;  3H7J A;  1OPO A;  4BQ4 A;  5FZB A;  3D4K A;  1NE6 A;  3CJI A;  4D7Y A;  3I2G A;  3TNP B;  1SFP A;  3LFM A;  1GZW B;  2GDF A;  1WLC A;  1BQP A;  4Q4W 2;  2PN5 A;  1QJE A;  2RS5 3;  2WJS A;  1K5J A;  1TNR A;  2XKP A;  4XF4 A;  4O9G A;  5K7P A;  4NHY A;  3JBG 1;  3K3N A;  2OQ7 A;  2MEV 1;  4LPL A;  3VLB B;  2HWC 2;  2PEL A;  3WLU A;  1WMF A;  1A78 A;  2OPK A;  3NVC A;  1GIC A;  3HN3 A;  5JUV A;  4LLO A;  4W6X A;  2JDA A;  2O14 A;  3CBN A;  5DQ0 A;  1W0N A;  2EIG A;  4IEX A;  3KT1 A;  4AFA A;  1N3Q A;  1GFF 2;  2FDI A;  4Y5T A;  1KJL A;  5HXV A;  2Q8E A;  3DXU A;  1XNB A;  5LY2 A;  1IS4 A;  3HIF A;  3VBF A;  3VBS A;  1U5X A;  4QX2 A;  5JVV A;  1QOS A;  5HPO A;  4JRL A;  1H4G A;  1QQP 1;  3GBG A;  5BV6 A;  3R4D B;  2VW2 A;  1NCR B;  3J26 N;  1DHK B;  2TNF A;  4HZF A;  5A3O A;  1NA1 C;  2D93 A;  1PGW 1;  5G05 L;  4IEW A;  1UZ0 A;  3S5A A;  2VMH A;  4GB3 1;  1A6C A;  2C5D A;  2VUJ A;  3H7Y A;  3PTR B;  4FOW A;  3WDU A;  1BBT 1;  2XHK A;  3OUI A;  1SDW A;  5FZK A;  2C24 A;  3CHX A;  3RYK A;  3ZN5 A;  4BQ1 A;  3PL0 A;  5DZG A;  1D2Q A;  2VGD A;  3SMH A;  3WDV A;  4JV4 A;  3RZK A;  1I5Z A;  1UL9 A;  1EAH 1;  1WLT A;  2E9Q A;  2WBK A;  4OHW A;  2GU9 A;  2LTN A;  4C0H A;  5HV0 A;  3FLT A;  3KV6 A;  5J96 B;  1AF9 A;  1M4W A;  4DS0 A;  4L8Q A;  4Q4X 3;  4FQ4 A;  3CJX A;  4CSW A;  3LQC A;  5F1R A;  4C1W A;  3QLQ A;  1RJ8 A;  5GLZ A;  4YGB A;  2BGO A;  4AE2 A;  2DCJ A;  2AEZ A;  1ALY A;  1B35 C;  4AVB A;  3G7D A;  3ZKY A;  3QH7 A;  4YG3 A;  4XE9 A;  5LA9 A;  4BDV B;  4EZH A;  5L7O C;  1QMJ A;  2BNM A;  1C57 A;  5ANN A;  4RN5 A;  4B4P A;  4CUG A;  1X33 A;  1AR8 2;  2X8K A;  2IXK A;  3B01 A;  3MFA A;  4J1W A;  4FFI A;  4YW4 A;  1OOP B;  1I6X A;  2E26 A;  5ACA 3;  4RGK A;  2BU9 A;  5FFO C;  4A41 A;  1AR8 1;  4I30 A;  1UYY A;  3J8F 3;  1VJ2 A;  2RG4 A;  5D1I A;  2K46 A;  4GMP 3;  1FI2 A;  1H8V A;  2A1X A;  1US2 A;  2UY9 A;  1UAI A;  5SV8 A;  3J7H A;  1W03 A;  2QDN A;  2N7G A;  1HLC A;  2Q8D A;  4AWD A;  4BMB A;  4LBJ A;  4UFJ A;  2ATF A;  1HW5 A;  2BJS A;  2CGN A;  3V0B A;  3ZN4 A;  1WCK A;  1W39 A;  2VBB A;  2WC2 A;  2XOM A;  4UFM A;  1F9K A;  4DIN B;  1W8H A;  3MIG A;  3LWC A;  4XFI A;  4NPL A;  3JXS A;  4CP0 A;  3M3O A;  4DQA A;  4FBF A;  1W6M B;  2R1B A;  4LOR A;  1N47 A;  2CAU A;  4OI2 A;  4CCN A;  4XHX A;  1OLQ A;  5FP7 A;  2NN8 A;  3NQH A;  4FPF A;  3ZN6 A;  4BIS A;  2QUO A;  4EN0 A;  2ZX2 A;  4AQ2 A;  4DUX A;  2UU8 A;  3I2J A;  4DXR A;  1RXF A;  3VDC A;  1W6P B;  5FP8 A;  4BM8 A;  5LCW L;  1GBG A;  5A6Q A;  2C6S A;  4MUV A;  4IET A;  4R4X A;  5JZG B;  4CEW C;  1A34 A;  4DOU A;  4KL1 A;  2RS1 3;  1OKQ A;  2R49 A;  3CIH A;  5H9Q A;  1O7F A;  1OH3 A;  1PIV 3;  3DYP A;  2HYX A;  3MIH A;  4K8F A;  2EXI A;  2WIN B;  4HVO A;  2VCA A;  4IE4 A;  2PQS A;  5FYB A;  4AEK A;  1PK6 C;  5DUX A;  4DZG A;  4BQ5 A;  3B02 A;  5FMO L;  3UGH A;  1XNK A;  5BYN A;  5H9R A;  1VRB A;  2QKD A;  3WG4 A;  3ZIW A;  2ZEX A;  2VY0 A;  4LQR A;  2WO2 A;  2PLV 2;  2Y6G A;  1OLM A;  1RUI 1;  3T2O A;  5DDJ 2;  5IK8 A;  1XE7 A;  2EAL A;  3CJI C;  2V4V A;  4RQP A;  2R04 2;  4DY5 A;  2AH2 A;  1O91 A;  2D6L X;  5DDJ 1;  3VV1 A;  3O0W A;  4QHZ A;  4S2F A;  1NKG A;  3KF5 A;  1J1L A;  4MYE A;  2W08 A;  4Q29 A;  3W9A A;  4AED B;  1Q8S A;  4XJW A;  5HCF A;  1OVS A;  3NMB A;  4C91 A;  3BN6 A;  4JGZ C;  5EP9 A;  4GQ7 A;  1UU5 A;  2ZXQ A;  5FZH A;  3WCS A;  5DXD A;  1J83 A;  4MGZ E;  1D2S A;  5CIS A;  3Q8B A;  1AYN 3;  4PF1 A;  4WVM A;  3TB0 A;  3ZR5 A;  5T3N A;  4QPY A;  2VOX A;  4CXY A;  2DCY A;  1FV3 A;  4WVV A;  2LW8 A;  4FQZ A;  1QIQ A;  1NCQ B;  1SHW B;  3L2H A;  5F5A A;  1TME 2;  4NHL A;  5T5P A;  3ZKU A;  2WYF A;  3KVB A;  4BME A;  3O1T A;  5J36 A;  2RMU 1;  2Y64 A;  3ES4 A;  2D5F A;  1OMI A;  1D4M 2;  1UMZ A;  1W99 A;  2W68 A;  5FZA A;  2ZMK A;  1SBD A;  4AAP A;  3JB4 C;  1QOT A;  3MUZ 1;  2JJ6 A;  1GP5 A;  4I0W B;  4ZXK A;  2Z79 A;  2WZP P;  1CPN A;  3VBU C;  4CCC A;  2OA2 A;  2V73 A;  2TEP A;  3THC A;  1AHS A;  5KBF A;  3I4I A;  2GAL A;  2P4E A;  3SH3 A;  2R6Q A;  4MGS A;  2JD9 A;  2JKB A;  4JZR A;  3K75 B;  3ELN A;  2ARA A;  3RPQ A;  4XDO A;  2ORX A;  4OQ9 A;  2JG8 A;  3VB9 A;  2P5B A;  2WT2 A;  3OUH A;  4D6R A;  1LOE A;  2VNO A;  3IKW A;  5LW9 A;  4LHN A;  2E7Q A;  5FJH A;  3OD4 A;  5FIX A;  1GSL A;  3SH4 A;  2EIC A;  2D6M A;  5IYY A;  3BOP A;  2JWP A;  2C4X A;  3PU3 A;  3OSD A;  2RM2 3;  4AI9 A;  4BK5 A;  2R32 A;  2WNU C;  4YRD A;  3UGG A;  1HRV 3;  1SCS A;  2XG3 A;  3AKR A;  2D6O X;  5T50 A;  2DCZ A;  1KRI A;  4YW1 A;  3HBZ A;  1XNT A;  4M0N A;  2ZX1 A;  3KT4 A;  2QQK A;  4QXK A;  3VZO A;  5A6X A;  3FFZ A;  3PVN A;  2BEO A;  3N9O A;  1WME A;  2YC0 A;  2HBU A;  1PMJ X;  4RS5 B;  1GU3 A;  4M01 A;  2JB4 A;  5GZD A;  5J1X A;  4JGY A;  2X5I A;  3NNL A;  1RUE 3;  4YVS C;  3JBG 3;  2W39 A;  1VBA 3;  3KCC A;  1NAE A;  2AYH A;  2UYA A;  5EQU A;  2BRT A;  3POJ A;  2WWU A;  3VBO C;  4YM3 A;  2WA3 A;  3SEP A;  5FO9 B;  4RHV 3;  3WNN A;  4CDQ B;  4Y22 B;  1YFX A;  2VZP A;  3WNO A;  3ZIX A;  1JZ7 A;  1GZW A;  3HT1 A;  5C3P A;  3GAL A;  1LJ7 A;  3I7D A;  5GKA C;  2JIJ A;  2H0V A;  3LEM A;  4YGD A;  5I8Y A;  2P3K A;  4CDW C;  2XLG A;  1FX5 A;  4JQT A;  3D6E A;  2HEY F;  4XTM A;  5DPN A;  3UGF A;  4HKO A;  4BOW A;  1OLR A;  3N3H A;  4IEU A;  1NCR C;  2YU1 A;  4H3W A;  4P9X A;  3BTZ A;  3LOI A;  3LGR A;  1OF4 A;  4ASL A;  3NNM A;  5FUI A;  4A7K A;  1PIV 1;  4A3X A;  5JIA A;  1CX4 A;  2VW1 A;  1C8N A;  4NVP A;  2NQY A;  2VOK A;  3WEZ A;  2ERF A;  4DY3 A;  4AFB A;  1ZRF A;  3WNP A;  1JZ3 A;  5E16 A;  3PUQ A;  1UMI A;  3DEM A;  4DFS A;  3MW4 A;  4ZS3 A;  2WNV A;  2J42 A;  2R07 1;  2W92 A;  1ACC A;  1U5I A;  2WNE A;  5FYM A;  3RZM A;  2WNV B;  1AXZ A;  5IVB A;  5F3G A;  3MLJ A;  1MQT B;  3WDY A;  3MIF A;  2GND A;  4PIY A;  5LY1 A;  5LBF A;  2VPV A;  1VRH 1;  3TEY A;  3K51 A;  1TMF 1;  1PZ8 A;  3T0B A;  3BTX A;  1QHD A;  1BMV 2;  4NHK A;  4HKL A;  4Q4V 3;  1TMF 2;  3MDP A;  4AVV A;  2YMZ A;  4DUW A;  1GV9 A;  5FY1 A;  3E6C C;  1DQ0 A;  4EE2 A;  2W2I A;  5LAS A;  3H3Z A;  3A7Q A;  5DG2 A;  3ZYR A;  1SZB A;  4FO9 A;  4JKK A;  1SLC A;  1SLB A;  1LKN A;  2D6P A;  2R1D A;  1ZYB A;  1SFY A;  2VOT A;  3AVS A;  4E2S A;  3S7E A;  2DUP A;  4FOY A;  1C8M 3;  2X10 A;  2XVL A;  1XU2 A;  1AR8 3;  2E6V A;  3AB0 A;  5FJK A;  4ES8 A;  3VZK A;  2D5H A;  4AFC A;  2OT7 A;  2PYT A;  1HXS 1;  3WW3 A;  3S30 A;  1YJK A;  3N9M A;  3M8L A;  2VZ3 A;  5FZC A;  3H1Y A;  4JRA A;  4JKL A;  3NV3 A;  1RJ7 A;  1MPX A;  2ARE A;  1J1T A;  4PLO A;  4UBH A;  1DLC A;  4OHY A;  2YC4 A;  1O59 A;  4XIO A;  4LO4 B;  3O1M A;  1IPJ A;  3I59 B;  2GC0 A;  3NV4 A;  3DYM A;  4W50 A;  1I1E A;  3GJB A;  5L7O A;  1DGW A;  5D8A C;  5F32 A;  4IES A;  2ZAC A;  5CYY A;  1GZC A;  3U1X A;  1UYP A;  3PIJ A;  1QJU 2;  3F2Z A;  4XJ9 A;  5A7S A;  2E31 A;  3HNM A;  2Z2S B;  3HWJ A;  2DF7 A;  3AK0 A;  3LA2 A;  4NRO A;  4QWN A;  5DUU A;  1SPP A;  5T5J A;  5FR3 A;  3ZYI B;  4YW2 A;  4E2G A;  1TME 3;  1QJU 1;  4PI2 A;  1H8T A;  2ZHM A;  2FQP A;  3B00 A;  2XJP A;  3I3B A;  3WNX A;  4OMD A;  3WP5 A;  3W5M A;  1V6L A;  3RS6 A;  2P17 A;  2EIB A;  2WAO A;  4Y1V A;  5A1A A;  4E2Q A;  1V6N A;  4D0Q A;  3I3D A;  4XVH A;  5LEK A;  2BBV A;  2HH9 A;  2XB6 C;  1S0D A;  3H50 A;  2YRO A;  1FPN 1;  3NAP A;  5F39 A;  4R4Z A;  2WQZ C;  5DUW A;  3VDD C;  3PJQ A;  3RYP A;  3VBU B;  1YC6 1;  1E5R A;  1FPN 2;  2BWC A;  3Q9O A;  3WNK A;  4BA6 A;  3VBU A;  5CFC B;  1AR7 1;  3T1L A;  2ADD A;  2KXL A;  1I5P A;  3POI A;  2WSV A;  5IUQ A;  5DZF A;  1VAM A;  1Y43 B;  3AMH A;  2L9L A;  4S2H A;  2VNG A;  3WG3 A;  1O3Q A;  2VEC A;  2A5Z A;  4Q1P A;  3D82 A;  2PHR A;  1MS0 A;  3JZV A;  1HB2 A;  2A6X A;  3BOD A;  4KWJ A;  4WM7 B;  3ZFE C;  1YQ2 A;  4BYY A;  5BNN B;  5C9A B;  1H1M A;  2WRA A;  3C8X A;  4JGZ B;  4FPK A;  1WCQ A;  2MEV 3;  1QGL A;  4OI0 A;  2PLV 3;  4Q4Y 1;  1ND3 C;  4CE8 A;  1Y7B A;  3SCF A;  4EWD A;  2YY1 A;  4AQS A;  1RUE 1;  1GAN A;  2IXJ A;  3FLR A;  4JGZ A;  5EPA A;  2OKX A;  1G9B A;  1TVG A;  4MAD A;  2R04 3;  4HN0 A;  2PTM A;  1FNY A;  3LEK A;  1FXZ A;  1RUE 2;  1O4Z A;  2AZ5 A;  1ASJ 2;  1COV 2;  4A7Y A;  4YZ3 A;  4AHY A;  3LOB A;  3RVH A;  5BNN C;  5FZ3 A;  4UXA A;  4WM7 C;  1UY0 A;  1BK1 A;  2HBT A;  4V1P A;  2VH9 A;  3AKS A;  1VP6 A;  2P6H A;  1ENQ A;  4YW3 A;  5FMD A;  2DWR A;  1FAT A;  4B29 A;  4BU2 A;  3CZJ A;  5CFD C;  3RZL A;  1M06 G;  4WV8 A;  2ZA9 A;  4FP3 A;  2OYZ A;  1DGR A;  1EUU A;  4UWD A;  5C4W A;  1OD3 A;  1J3R A;  1PNF A;  3LF7 A;  1GNH A;  4YNI A;  4UYB A;  4YM0 A;  3LD8 A;  4XDP A;  1HN0 A;  5M0T A;  1Q8V A;  3FHA A;  2PFW A;  1WZX A;  1EYB A;  1W8T A;  4CEW B;  4P9G A;  4QQH A;  4QKD A;  3QOP A;  4YZ4 A;  3VBS C;  5LK5 A;  5FZ6 A;  2VMC A;  3W59 A;  5FZ7 A;  3AP9 A;  3E97 A;  1CAX B;  5DAW A;  2K0G A;  3RI8 A;  4OI4 A;  3N9N A;  4DNY A;  4UFK A;  5J37 A;  2DFB A;  4HFS A;  4WM8 A;  4XEZ A;  4YM2 A;  3ZXK A;  2VU9 A;  4YG0 A;  2FDK A;  1LHV A;  1POV 3;  2EF6 A;  1PNG A;  2W1W A;  3FX3 A;  3KCX A;  2IFW A;  2OUJ A;  2VJX A;  3FWE A;  2V4A A;  2HWF 1;  3FBY A;  1S0I A;  1KQR A;  2BGP A;  2XJU A;  3AJZ A;  1GUI A;  5I0R A;  2PLV 1;  4Q4Y 3;  1F31 A;  3B94 A;  4YVS B;  4Q4V 2;  1S0E A;  4QMA A;  5IVE A;  1W0O A;  4TTG A;  3O1S A;  2Q0A A;  2CU5 A;  1LOC A;  3WY6 A;  4CDX B;  1OUX A;  3HN1 A;  1URX A;  2QQU A;  1NY7 2;  5ABJ C;  3NJZ A;  3D3A A;  4OZX A;  4AI2 A;  1L7L A;  4D7T A;  4DEV A;  1DQ5 A;  1ZBE 1;  4KBB A;  3ZXF A;  3WHU A;  3UES A;  3ZSM A;  4YZ1 A;  5CAD A;  2Y6L A;  1ULD A;  2XDV A;  3FMG A;  4ISR A;  1XPW A;  1PO1 1;  2A6Z A;  3LIG A;  2ETE A;  1UW8 A;  3VBH A;  4CEY B;  3BTA A;  4WVM B;  3TOJ A;  1L7R A;  1X9T A;  4JGY B;  3KWV A;  1PO1 2;  3OPW A;  2RJL A;  1ZZ6 A;  4LT5 A;  1E5S A;  4M3C E;  5BNQ A;  1QJY 3;  3OPT A;  5HI0 A;  2ENR A;  2ET1 A;  1BJQ A;  2JE8 A;  1MQT C;  1JOJ A;  2KA3 A;  2OZJ A;  2Y26 A;  2YHJ A;  4PT6 A;  4XAE A;  4YW5 A;  4E27 A;  2XWJ B;  1SLL A;  2G1M A;  3I2H A;  3R4S A;  2RHP A;  1ZRE A;  3AYD A;  1GWK A;  1QJU 3;  1PVC 1;  1U5Z A;  2IXL A;  1JUH A;  3OGS A;  1YQ8 A;  5GZC A;  3D8C A;  1PZ7 A;  4NWV A;  2VTF A;  2HLE A;  2D3R A;  2VVE A;  5A80 A;  2XBO 3;  2BUK A;  2W0X A;  1JOP A;  4P14 A;  1RUJ 3;  5FPX A;  1PK6 B;  4NPM A;  1Y9G A;  1VBC 3;  4YW7 A;  1LRH A;  4QM9 A;  1E5H A;  2Y34 A;  1ZZ8 A;  2ZHK A;  2JB8 A;  2GME A;  4ET7 A;  4NHM A;  3NJY A;  2V09 A;  3TNQ A;  4Y20 B;  5FMO S;  3KD4 A;  1U0A A;  1R09 2;  2TBV A;  2VXR A;  3LB9 A;  4K1Y A;  1UQX A;  4FFF A;  1UU6 A;  3ZOI A;  1W9T A;  2NLR A;  4AXO A;  3RZG A;  4AEM A;  4FTE A;  1UXX X;  5FWE A;  5FBZ A;  1KS4 A;  3H1M A;  4COY A;  1JZ6 A;  2A73 B;  5CBL A;  4Z1V A;  1Q5O A;  2JDP A;  2DVA A;  5FK8 A;  2YYO A;  1KDM A;  3IBM A;  2MPF A;  4NAO A;  3WP6 A;  3ZPY A;  4I02 A;  2WT1 A;  3K77 A;  3MI8 A;  1IS6 A;  5CZK A;  3VBH B;  2AEN A;  4OUL A;  4DB5 A;  2JKX A;  2VZS A;  2RR1 1;  2JEC A;  4A2U A;  1ZRI A;  3NKT A;  3UKT A;  5GM0 A;  3WT3 A;  3LEI A;  3HT2 A;  1VBD 3;  5ANQ A;  5FOJ B;  3OBZ A;  3ZFE B;  2RR1 2;  2VE1 A;  4LLF A;  3I97 A;  4IEO A;  4MGI E;  4AF9 A;  5GLU A;  1HQL A;  1RUG 3;  5A32 B;  2WNU B;  1OQ1 A;  5F6L B;  2R07 3;  1DYP A;  4MX3 A;  1OA2 A;  4K7J A;  4I3P A;  2AR6 A;  1V6J A;  2BWA A;  2RM2 2;  1AR9 1;  5E6H A;  3EJK A;  1Z7S 3;  3OY8 B;  5FYC A;  1CGP A;  1GOH A;  1ULE A;  4BH9 A;  4D94 A;  1NLS A;  4CDX C;  2J1A A;  4O9E A;  2P2K A;  1UD1 A;  2D97 A;  4K40 A;  2ZTN A;  1ODM A;  2VCC A;  2FZ2 A;  4UFI A;  2B42 B;  4AFM A;  5DG1 A;  1DQ2 A;  1FT9 A;  4XJZ A;  1FOD 2;  4RFT 0;  5LZ6 A;  1W6N A;  2WAA A;  3K4D A;  4P5H A;  2J1V A;  3NWK A;  4M4R A;  1W6N B;  1FOD 1;  1W8Z A;  3OBT A;  3ZXA C;  5KHJ A;  4XAA A;  2A71 A;  3O0V A;  3JCI A;  4JTN A;  1W2U A;  4XBN A;  3WW4 A;  4MET A;  2VO5 A;  5A33 A;  4IV3 A;  2WA4 A;  2GZW A;  3OCP A;  2ARB A;  1W6M A;  1VE0 A;  4FPE A;  4H2A A;  2MHF A;  1GKB A;  4IV1 B;  2ZOE B;  4Z92 B;  5K8S A;  1PO1 3;  1X8M A;  4CRQ A;  1ULO A;  2QDR A;  3BYW A;  3ACH A;  3N7L A;  2O8O A;  4N90 A;  1BMV 1;  2CNA A;  4EN7 B;  5JLV A;  1XJA A;  2HWD 2;  1XBF A;  4MGY E;  4Y1U A;  2VTX J;  2GC1 A;  2BYV E;  4AVC A;  2Y6K A;  5EFU A;  4H7M A;  4CA9 A;  1HRI 1;  1CN1 A;  1VBB 2;  3ILF A;  1H0B A;  2D7F A;  3AXE A;  4IL7 A;  4BPZ A;  2PAE A;  3VBR C;  4QKN A;  4MHR A;  5LBC A;  2ZML A;  1J3Q A;  1HRI 2;  1VBB 1;  1HQN A;  3HNY M;  1X50 A;  3CF6 E;  3ZFF A;  2XON A;  3H8U A;  5JOW A;  4AI3 A;  2Y0I A;  1A8D A;  1DCS A;  4QX0 A;  3ZFF B;  1JYT A;  1ZX5 A;  4L0P A;  4AVA A;  3POG A;  2MEV 2;  1W2N A;  2YZ4 A;  1W8O A;  3ETQ A;  2WYS A;  5SV5 A;  4LTA A;  3HMY A;  1S0C A;  5EJZ B;  5FRE A;  2W52 A;  4EWA A;  1ZRD A;  3KV5 A;  4PLM A;  2B5H A;  2FCT A;  3RSJ A;  2GP3 A;  1N1Y A;  5F7U A;  2CDO A;  1WGP A;  1NZC A;  3OGJ A;  4Q0Q A;  3AXD A;  5A7P A;  1LOB A;  3HQR A;  4M0H A;  1GP4 A;  5BNO B;  4QQO A;  2DU0 A;  5A1F A;  3GHN A;  5CG9 A;  1BBT 3;  3C7H A;  5BNO A;  4I09 A;  1WW4 A;  2GNT A;  1VBA 1;  5A1L A;  4Y3O A;  1K45 A;  1XXN A;  5FYZ A;  1G86 A;  4GUL A;  4Q8L A;  4K21 A;  4P9J A;  3VD7 A;  1RXG A;  1W2T A;  5FXZ A;  3VZM A;  2WZE A;  3MPP G;  3ZXG A;  4LBQ A;  3GBW A;  1OFS A;  4IGO A;  4IXL A;  4KNC A;  3T1M A;  1GYK A;  2WNO A;  3GYD A;  4K20 A;  1PGW 2;  3ABZ A;  4XAB A;  2EXJ A;  1DZR A;  2J1E A;  2QJV A;  3JB8 A;  3ZYP A;  2XQR A;  4HKW A;  4GAL A;  4IEY A;  4P9Y A;  3MGU A;  4HBN A;  4XUT A;  3ZFG A;  2VNR A;  1OQE A;  3GJA A;  3DXT A;  2F17 A;  2VQU A;  5IAX A;  1EAH 2;  5KXC A;  3EYP A;  4QX5 A;  1OKO A;  5CVR A;  4DUV A;  4HVR A;  1S4C A;  1H9W A;  4MOA A;  5FYS A;  5C5T A;  2NMN A;  4GJZ A;  1W8N A;  5A7N A;  3TN9 1;  3T2Q A;  1NQD A;  2PQQ A;  2VZR A;  3MPB A;  3I3E A;  1MEC 3;  2DV9 A;  2BV4 A;  4KG8 A;  1UOJ A;  1UY4 A;  2YPD A;  4NHX A;  4XJA A;  5KC5 A;  5G04 L;  3CNA A;  5AC9 3;  3TEW A;  5FXW A;  4IE6 A;  4QQP A;  2NP0 A;  4Y4Y A;  2ZGM A;  2V72 A;  3KQ4 B;  5HBA A;  2VQT A;  3AVR A;  1GWL A;  1OVP A;  4QX8 A;  4CEY C;  4FXG B;  4Q4Y 2;  2V5D A;  2Q8O A;  5E88 A;  2XLF A;  3WW2 A;  1LOF C;  4YM1 A;  5LEJ A;  4ZZ5 A;  4DEQ A;  2ZEY A;  1JYC A;  3ZX7 A;  4DMI A;  2LRO A;  1SBF A;  2R7E B;  3PIG A;  4YSF A;  2FHR A;  3SCG A;  3PVE A;  5I0U A;  3ATG A;  1HV1 A;  4XFF A;  3U37 A;  3VBR B;  3VD5 A;  4MG2 A;  1KD7 A;  2ZPX A;  3ZMO A;  3VBR A;  3P6B A;  1LHN A;  3MF9 A;  4DXT A;  2RS1 1;  1ULG A;  1YHF A;  3L2Y A;  1FPN 3;  4OZO A;  1IZ3 A;  2XBO 1;  3G6J B;  5JCT A;  3AZX A;  3RNS A;  3GM8 A;  1C8M 1;  5D2A A;  4E8C A;  3IAP A;  4RD7 A;  3ST7 A;  5JR7 B;  1ZBA 3;  1JU4 A;  3IIA A;  3VBF B;  4YFZ A;  4QM8 A;  4XUP A;  2JG9 C;  4RGG A;  3OGV A;  5JAX A;  2RE9 A;  2GC3 A;  4CU9 A;  3S5Q A;  3ZM8 A;  1WBL A;  1WUV A;  3EMR A;  3ZN6 B;  5EJ1 B;  2E7T A;  2JD4 A;  4LKF A;  1RUI 3;  4RSU A;  5F3E A;  2OXB A;  3ZDV A;  4OVE A;  3V56 A;  5A6Z A;  4J25 A;  4CP1 A;  4K3U A;  5JXG A;  2WFF 2;  3A4U A;  1VMF A;  1MS4 A;  4GH4 C;  5FPL A;  5HCH A;  5FPA A;  2H6B A;  4HPK B;  2ET7 A;  1UOG A;  3U4S A;  3MLK A;  5APA A;  3AKP A;  2JIG A;  4L92 A;  3ROU A;  4U36 A;  1JZ8 A;  2XPJ A;  3B9C A;  5DAV A;  5C4W C;  2I45 A;  2VZU A;  5FQ0 A;  1ND2 C;  1WD4 A;  4OCT A;  1SQ4 A;  5HV4 A;  2ZJC A;  1WCU A;  4GMP 1;  2RDQ A;  1HJG A;  3ZSJ A;  1DQ6 A;  1NUK A;  3WQ7 A;  4ZHN A;  1CAU A;  4BIO A;  1SG3 A;  2FD8 A;  1ZZB A;  5KHG A;  4K1Z A;  1ZA4 A;  1SDD B;  3I3Q A;  4FPG A;  1BKZ A;  2YGL A;  2A6W A;  4UW3 A;  1IOA A;  2JXA A;  1W8U A;  4LR4 A;  2XL9 A;  4RFR B;  5FKC A;  2D43 A;  4EWE A;  4LE3 A;  5DUV A;  2WO7 A;  4RS5 A;  2CY6 A;  4AI1 A;  3ZSL A;  2VBP A;  1CR7 A;  3WF2 A;  3EO6 A;  2Y33 A;  5A3L A;  2RDN A;  2Y6H A;  2ZBJ A;  2MNG A;  3RMY A;  1AJO A;  5C5U A;  4CEY A;  1R1A 2;  4XMI A;  4YYO A;  4NWW A;  3VBH C;  2JDU A;  2BNO A;  2BBA A;  5C6C A;  1NLR A;  1UY2 A;  2WNU A;  4MO3 M;  4L9B A;  5IWF A;  1Q43 A;  5FY4 A;  3PUR A;  3P3P A;  1UZY A;  4BWO A;  4UF0 A;  4AG4 A;  3H8R A;  4RS5 C;  2YBP A;  4DRV A;  5EIY B;  3B69 A;  3PMS A;  2BDR A;  3OPZ A;  4LBM A;  3IDA A;  5EV7 A;  3ZFF C;  3NKG A;  1PVC 2;  2XML A;  4KMQ A;  3K2O A;  5JSR A;  1K5M C;  3NAP C;  1BZW A;  2ARX A;  5FZE A;  1YQC A;  1QKQ A;  1S2E A;  2DVG A;  3KV4 A;  3VKM A;  1UU4 A;  3O5S A;  1RIR A;  2IUW A;  3LA7 A;  1G9D A;  2FMY A;  2HEV F;  1JZ4 A;  2ADE A;  1RMU 3;  5KC6 A;  4JDM A;  3JU9 A;  5HCA A;  2GN3 A;  1UY1 A;  4AYU A;  4BE3 A;  4IE5 A;  2ARC A;  4Y33 A;  4COU A;  1N3O A;  4OUE A;  3PLQ A;  3VKN A;  3BUC A;  5JOZ A;  1RC6 A;  3W21 A;  1EV1 1;  4LMF A;  3RZZ A;  3POS A;  3E6D A;  4LOS A;  3SKJ E;  1POV 0;  4B4Q A;  4Z2A A;  2PAM A;  2XJS A;  4PF5 A;  5KXE A;  1CQ9 A;  1K42 A;  4BXF A;  3RZH A;  1TNF A;  4HON A;  4X6Q B;  1RUD 1;  2B45 X;  3BGA A;  3NO8 A;  2G9Z A;  4P08 A;  1W2O A;  1OC1 A;  2VQ0 A;  2JE7 A;  2Z69 A;  4ASM B;  5I0S A;  3DCQ A;  3Q8C A;  4JKM A;  1GWM A;  1OD5 A;  3BOW A;  1C1F A;  3FC0 A;  1HIX A;  1ZM1 A;  2W3J A;  1QJF A;  1Q56 A;  5FZD A;  1YFU A;  4KU8 A;  4NO4 A;  3TBD A;  3U07 A;  5FXX A;  4FOQ A;  4K6B A;  2VMI A;  1QWR A;  5ERL A;  4XC9 A;  3T0D A;  2W47 A;  1W6Q B;  1JUI A;  3WHT A;  2JDK A;  2OQ6 A;  1K5M B;  4HXC A;  5LAT A;  3VZJ A;  4YPJ A;  5LRS A;  2XXZ A;  4RHV 2;  1CAW A;  5I0T A;  1OI6 A;  5I91 A;  4NIG A;  5KHK A;  4E4S A;  3CL1 A;  4H14 A;  5IVC A;  1O8S A;  5C3Q A;  3LSE A;  3ZXL A;  5L9B A;  1BVV A;  4B1M A;  1OA3 A;  3OG2 A;  2YGM A;  5L7O B;  1JS9 A;  5EZW A;  1FMD 3;  5I93 A;  4R9D A;  1W04 A;  3NV2 A;  3GCX A;  4QPI C;  4QXH A;  1PIV 2;  2ZX4 A;  1JHN A;  5T5L A;  3FE5 A;  4Q0U A;  1RHI 3;  5FRA A;  3BPS A;  3RYR A;  5CAZ A;  3PVB B;  1R64 A;  1POV 1;  4AFD A;  5A3M A;  3KS7 A;  5BNP A;  3C7F A;  1AXK A;  2GH2 A;  3PVO A;  3J7N A;  4QKB A;  4UT5 A;  1WW5 A;  3HAG A;  4XW3 A;  4MXV A;  3MID A;  1J84 A;  1S0J A;  4NE9 A;  1NZI A;  1OFN A;  1DZQ A;  3PDQ A;  3ZYG A;  1Q8Q A;  4RGA A;  2XWB B;  5GZG A;  1VBD 2;  2VOW A;  1MS8 A;  3CLP A;  1MVQ A;  3J9S A;  4N9I A;  4A6S A;  3M2M A;  5TSW A;  4M3C B;  4CU7 A;  5ISL A;  1VBD 1;  1XRU A;  1RUJ 1;  4ATF A;  5ACA 2;  1UF2 C;  1S55 A;  1NCR A;  1YFY A;  2DTY A;  2BOI A;  5FMC A;  3SIS A;  4Z8B A;  4BQ3 A;  1RYY A;  1ZZ7 A;  2JDM A;  3IPV B;  2CYF A;  2AC1 A;  2IVJ A;  5JMO A;  1NXD 1;  2P3I A;  1CIW A;  3K4A A;  3Q8E A;  5KR7 A;  4XF9 A;  4FPO B;  5C3R A;  4XAC A;  2D3P A;  3LPG A;  4XF1 A;  5C8C B;  2CSG A;  3BB6 A;  3AZW A;  3MUY 1;  1B09 A;  1MEC 2;  4NR1 A;  1LEM A;  1POQ A;  1XOY A;  1UKG A;  2WN3 A;  1K5M A;  1HX6 A;  2Q8C A;  4PDW B;  1DBN A;  3J7L A;  2VVF A;  4XUO A;  3A22 A;  3OGR A;  4WZC A;  1LU1 A;  1D4M 3;  3NV1 A;  4MV2 A;  4EZ4 A;  5BNO C;  1DYK A;  2ID4 A;  2JDH A;  4IEP A;  1X82 A;  3AZV A;  3JBG 2;  4TN7 A;  3UKV A;  4COV A;  2JX9 A;  5IK5 A;  2YB7 A;  3VL9 A;  3KCY A;  3RGB A;  2JG9 B;  4BJ0 A;  4F3J A;  3T09 A;  2RDR A;  1JZ2 A;  4M4P A;  1S0G A;  3GHM A;  1SLA A;  2VC9 A;  3BVC A;  3CQO A;  3K48 A;  4WVW A;  4LBK A;  4EJR A;  1AL0 G;  3WP3 A;  5FLI A;  3N9L A;  4LUK A;  3AP7 A;  4RYD A;  1J3P A;  4HT1 T;  1G7Y A;  5CKM A;  1EUT A;  2Z4F A;  1IS5 A;  1QNW A;  5ABJ B;  2YC2 A;  3CO2 A;  1XYN A;  3JD7 1;  4AQ6 A;  1OLM E;  1JYN A;  1W28 A;  4FXK B;  4J1X A;  5GZF A;  5JI9 A;  1O5U A;  1W0P A;  1YIF A;  4P9L A;  1TZO A;  3DEC A;  4IV3 B;  3SXW A;  3FLP A;  5JPM B;  2P34 A;  4QX3 A;  1RUN A;  4Y5S A;  2RJK A;  4XET A;  3PME A;  2FMD A;  4IEZ A;  3WUC A;  1BXH A;  1G9A A;  3AM2 A;  2D44 A;  4QXB A;  3ZFG B;  3AZZ A;  3VBF C;  1JYX A;  3P5B A;  4LA2 A;  5JR2 A;  1F4H A;  2WWS A;  2W46 A;  4LIU A;  4NRQ A;  1TQ5 A;  3EQE A;  4XPV A;  5JXI A;  4LA3 A;  3AJY A;  1YRZ A;  4FP2 A;  2O0O A;  1YWK A;  4IV3 C;  1XU1 A;  2ZMN A;  1NG0 A;  3J8F 1;  4B3N A;  5A7Q A;  2RDS A;  5FZ0 A;  1IG3 A;  4GJY A;  1X8E A;  2AAC A;  3DPR C;  3ECQ A;  3I3M A;  2PXJ A;  1MAC A;  4WZF A;  1QXP A;  2WLQ A;  1RHI 2;  4FFG A;  3I2K A;  4AGG A;  1TMF 3;  4RL7 A;  5FQ0 B;  3SKV A;  3USU B;  3ZSK A;  2WKK A;  1UOF A;  5GZE A;  3URF A;  1V9U 2;  3GZU C;  4FPY A;  4MLO A;  1XND A;  4XUN A;  4AED C;  4XBL A;  4CDX A;  4IDZ A;  1CZV A;  5A7O A;  4RQP C;  1SLI A;  3ZR6 A;  5IT6 A;  2BW8 A;  5JXJ A;  3N7M A;  1GOF A;  1PM7 A;  4PIZ A;  1F5J A;  4F7Z A;  4A6O A;  4LKD A;  3LKJ A;  5C3S A;  4R9C A;  4AED A;  2VCB A;  2WAB A;  1VBE 3;  4IER A;  1KIT A;  2QQJ A;  1U12 A;  4UFH A;  3U0Z A;  1AR6 2;  2VL4 A;  4GXL A;  4LK6 A;  4MHU A;  5BUV A;  1AYM 3;  4LHL A;  2ZGN A;  2ZZJ A;  1PHM A;  2CDP A;  3N36 A;  5FZO A;  2D6N A;  4YW6 A;  4FAG A;  4EN6 B;  2BPA 2;  1FMD 2;  2VQA A;  1W9F A;  2PAK A;  2HWB 2;  4HAN A;  4KGQ A;  2QCS B;  1DF0 A;  2QQM A;  4I3G A;  5CB7 A;  5C4W B;  3ENR A;  4E8D A;  3SIT A;  4E9K A;  5JSO A;  4GWI A;  4YAR A;  1X36 A;  1PO2 2;  2Q4S A;  2YV8 A;  2R0F A;  4UAP A;  1LHW A;  2WWJ A;  4QGL A;  3FUQ A;  1H6X A;  3ACG A;  1PO2 1;  4AHZ A;  2W1S A;  4OFG A;  2GH8 A;  1XNC A;  3MEP A;  1CAX A;  1XNA A;  1LES A;  3OUJ A;  4U2A A;  1F8V A;  3AMM A;  3OEB A;  2JG8 B;  3LAG A;  4M3C F;  4URT A;  4XFC A;  2HWF 2;  3ACI A;  4OMC A;  2ZGU A;  4X6R B;  4WM7 A;  1PGS A;  1YI9 A;  1W8W A;  4CP9 A;  1RUO A;  1QH7 A;  2Z5W A;  3KGL A;  4O7X A;  3VBO B;  2A3W A;  2KR2 A;  3E1F 1;  1ZNP A;  3E5X A;  1AYM 1;  1RUF 1;  1RUI 2;  3VBO A;  3GDB A;  3AYC A;  5FCC A;  5FPU A;  4GWM A;  1OH4 A;  1BHG A;  4PBP A;  3VZL A;  2A70 A;  2R04 1;  4HN1 A;  4XJ8 A;  4YVS A;  2WT0 A;  3BIW E;  4QPI B;  3T08 A;  1AR7 3;  2A3Y A;  2WII B;  3ZXJ A;  1ZBE 2;  2Q1M A;  3WG1 A;  1KJR A;  1KDK A;  1FNZ A;  2X29 A;  1E57 A;  1O4Y A;  1WD3 A;  3DL3 A;  3MF6 A;  5DZE A;  2X09 A;  2CAV A;  4AI8 A;  2FBE A;  1QJZ A;  1CAV B;  1GQG A;  2ILM A;  2EIE A;  5D21 A;  3R6S A;  3U10 A;  1RB8 G;  1F4A A;  1HB1 A;  4L11 A;  5C8W A;  5FY0 A;  1L3J A;  4MZU A;  1US3 A;  3MO4 A;  4NJ4 A;  5FZI A;  3WQ1 A;  4CU8 A;  1BCX A;  2XL7 A;  3AKT A;  3VD3 A;  1TME 1;  1LHU A;  1APN A;  3GZT B;  3E5U A;  3O0X A;  1BYH A;  2E32 A;  2RMU 2;  3DKQ A;  5LRR A;  1D4M 1;  4COZ A;  5H9S A;  5BNP B;  5F9T A;  4CVU A;  2JIC A;  2AEY A;  4IW3 A;  4PJY A;  3UK9 A;  4KGG A;  3U11 A;  1V6K A;  3FL7 A;  4WVZ A;  1KFU L;  2Y38 A;  2Y6F A;  3ALQ A;  5JOX A;  2DCK A;  4AGV A;  4AK3 A;  4BXS V;  5FYV A;  2D40 A;  5FV3 A;  5FY5 A;  2O1Q A;  2DU1 A;  2X53 S;  3RQ0 A;  1R1A 3;  1EV1 2;  4QQL A;  5A33 B;  1HXS 3;  1MS5 A;  3CMG A;  1NCQ C;  2PHF A;  4GIQ A;  4QQ2 A;  3ON7 A;  4RR3 B;  3U78 A;  2W91 A;  1EP0 A;  5C8C C;  3A0N A;  3AX4 A;  3E6B A;  1R09 1;  2PHW A;  3DUI A;  1VAK A;  1R08 1;  1JXN A;  3CZU A;  1A3K A;  4XZU G;  5FUP A;  4E4D X;  1H2N A;  4LUL A;  4CUA A;  3LDK A;  2P6C A;  2HYK A;  1W90 A;  2QVS B;  1DQ4 A;  1DGL A;  1NX9 A;  4NUB A;  3JD7 3;  4QPG C;  5F2W A;  2P1B A;  4FFH A;  5IAV A;  4NIH A;  4ARY A;  3BAL A;  3ZVX A;  5A3P A;  5IK7 A;  3IPV A;  2OS2 A;  3C7G A;  4NPR A;  3CU7 A;  4N9H A;  4JHZ A;  2ZEZ A;  3MIC A;  3K3O A;  2BTV C;  2VTX A;  2CGO A;  3ASI A;  3UYJ A;  3RWK X;  1CAV A;  1ODN A;  2ZKL A;  3POY A;  1DGW X;  3AMN A;  3NNF A;  4OUM A;  4ZS2 A;  3C3V A;  1JMU B;  1QF3 A;  4RHV 1;  4Y22 A;  1J59 A;  4UW6 A;  1EPZ A;  3B5L B;  3V65 A;  4ARX A;  5BY5 A;  1CAW B;  1R1Z A;  2ZAB A;  4S2D A;  1ULP A;  4GWN A;  4KBZ A;  1QJX 2;  3WDX A;  4EN9 B;  1OA4 A;  1AR9 2;  4QPG B;  2YUE A;  1NQJ A;  1EPW A;  2W1Q A;  1LGC A;  2BER A;  2UWB A;  5JI7 A;  4ISQ A;  1E5I A;  1C1L A;  1RUC 2;  2PHU A;  3Q8F A;  4QPG A;  3LEG A;  1RED A;  4UW5 A;  1OPM A;  1O6U A;  4RA0 A;  5C9A C;  1O8P A;  2DUQ A;  5DAB A;  3ZO0 B;  3RRD A;  1JOD A;  2VVD A;  3AYA A;  2JEM A;  4FI9 A;  4F8A A;  3M1H A;  1ENS A;  4KU7 A;  3T0A A;  2ZAA A;  1KGY A;  1H1A A;  2BNN A;  2FDJ A;  5FY8 A;  4HMZ A;  3V0B B;  1DP0 A;  1OHF A;  4YFW A;  5JIU A;  2W9X A;  1RUJ 2;  2RS5 2;  4IGP A;  1SBE A;  4LHK A;  3VDD A;  1RUD 3;  4HLT A;  1RUH 3;  2Y0O A;  4ES9 A;  4Q5O A;  2IFR A;  3KZ4 C;  3T2T A;  1VRH 2;  3JQW A;  2CWS A;  2HWD 1;  4LO5 B;  3DN7 A;  5JSP A;  1UWW A;  1NA1 A;  1LAJ A;  2IWG B;  2ZAH A;  3EHK A;  1QEX A;  3T4V A;  4D6Q A;  5E1R A;  2RS3 3;  5A6Y A;  5CKQ A;  1MZ5 A;  2C9K A;  1IKQ A;  4PHZ A;  4DXS A;  3O1U A;  2WSU A;  1V6O A;  4C1X A;  3WX5 A;  4CUC A;  2ZGR A;  1IPS A;  4V2W A;  1W6O B;  2OW4 A;  1AYN 1;  3PUI A;  4N8M A;  4BQY A;  4A3Z A;  5LA1 A;  4UOJ A;  1W6O A;  2GNM A;  3KVA A;  2GMP A;  4E4H A;  2UUR A;  1HXS 2;  4CPB D;  5L73 A;  1FAY A;  4ONU A;  5CA6 A;  2VM9 A;  1ULC A;  5CFD B;  4XXP A;  2J7M A;  1CPM A;  3TWI A;  1GZT A;  2IZW A;  3R4U A;  4I2O A;  3WF0 A;  1KFX L;  1YUD A;  1YXW A;  3AKQ A;  3MIB A;  5BXX A;  1C5H A;  1JN2 P;  5KWR A;  1T6G C;  3J7M A;  4CCO A;  4TZD A;  3ZXD A;  1MZ6 A;  4OHZ A;  5IVV A;  1VB2 A;  1REF A;  1WLD A;  3JD7 2;  2G9F A;  3N9Q A;  5L19 A;  4N43 C;  2XJT A;  1MR5 A;  2JG8 C;  1O3R A;  1QDC A;  4NRP A;  3VBS B;  2WS9 1;  3SLI A;  4AVT A;  3NNG A;  1HJF A;  4F83 A;  1QXJ A;  1FOD 3;  1V6I A;  2LUW A;  1XC6 A; 
#chains in the Genus database with same CATH homology
 1OF4 A;  5FUI A;  3P1I A;  5DMY A;  3WF2 A;  2YFU A;  3WEZ A;  3WNP A;  3C7E A;  1CIY A;  2Y6H A;  5IJR A;  1JZ3 A;  1UMI A;  2VZQ A;  3PUH A;  3OEA A;  2BBA A;  2W92 A;  1UY2 A;  3HJR A;  4MO3 M;  5B4X A;  4AG4 A;  2WZ8 A;  4A44 A;  5EIY B;  3WF4 A;  3T0B A;  3IDA A;  2VME A;  4GWJ A;  4KMQ A;  1UYZ A;  4DUW A;  2WQ8 A;  2VZT A;  1JZ5 A;  5IHR A;  3SEE A;  5B4N A;  2WN2 A;  1GQP A;  3LE0 A;  3VDB A;  1JZ4 A;  3A7Q A;  4JKK A;  4CUB A;  1GMM A;  4A42 A;  2VOT A;  4TXW A;  1UY1 A;  2B9V A;  2X10 A;  3HNB M;  4JX0 A;  5C70 A;  3WQB A;  3FN9 A;  1UY3 A;  4OUE A;  2X05 A;  4Z2A A;  3SKJ E;  1K12 A;  2J1U A;  2RV9 A;  5C71 A;  3W5N A;  2VZ3 A;  5IFT A;  4A45 A;  2VR4 A;  4JKL A;  1MPX A;  4CU6 A;  1DLC A;  2YC4 A;  1O59 A;  3BGA A;  4P08 A;  1CZS A;  3DYM A;  4W50 A;  3HPN A;  5CYY A;  4JKM A;  4P02 B;  3F2Z A;  2E31 A;  3HNM A;  1HN1 A;  2W3J A;  1CZT A;  3T0D A;  3I3B A;  2LS6 A;  2W47 A;  4KI5 M;  2W5F A;  4OMD A;  3W5M A;  2EIB A;  3MV0 1;  2WAO A;  5A1A A;  4QB2 A;  4YPJ A;  1WKY A;  3I3D A;  4XVH A;  4IUG A;  4D0Q A;  2KD7 A;  3I2F A;  1CX1 A;  1O8S A;  2QQI A;  2YFZ A;  3WNK A;  1H6Y A;  3OG2 A;  2VMD A;  4AAX A;  1I5P A;  3GGL A;  2C26 A;  2L9L A;  1R64 A;  5DN2 A;  3C7F A;  1OT5 A;  1J84 A;  1UMH A;  1YQ2 A;  3C8X A;  4A4A A;  1WCQ A;  3ACF A;  2VZ1 A;  4LHS A;  2OKX A;  1TVG A;  4MAD A;  3NJV A;  4CU7 A;  2XHN A;  3LEK A;  2QBX A;  1RYY A;  3A23 A;  5LA2 A;  4QAW A;  1JYW A;  4HG6 B;  3WSO A;  2W1U A;  5JMO A;  2QQL A;  1GOG A;  3K4A A;  3DYO A;  1UY0 A;  2Y6J A;  3LPG A;  3OBA A;  3MUY 1;  3I2I A;  3CZJ A;  4XUR A;  5I0D A;  2J1R A;  1JU3 A;  1EUU A;  2WN3 A;  1OD3 A;  4XUO A;  3T2P A;  3A22 A;  3FHA A;  3OGR A;  1P8J A;  2ID4 A;  2Y8K A;  2QQN A;  2VMC A;  2YB7 A;  3WF1 A;  4BJ0 A;  1JZ2 A;  3FHQ A;  3T09 A;  4P5Y A;  3UNP A;  4ZXE A;  4M4P A;  3C7O A;  2VC9 A;  3CQO A;  2WDB A;  3ETP A;  2W1W A;  4RYD A;  2VJX A;  4OYU A;  1EUT A;  2Z4F A;  3HEI A;  2YC2 A;  2BGP A;  2RVA A;  1JYN A;  1GUI A;  1PX3 A;  3NRU A;  3DEC A;  3MBW A;  3IAQ A;  4TTG A;  4QX3 A;  5C7G A;  2ZEW A;  4QX1 A;  2W95 A;  3D3A A;  4MGQ A;  4DEV A;  1IQD C;  1JYX A;  4PQQ A;  5JR2 A;  1F4H A;  2W46 A;  3IB3 A;  3UES A;  3CKH A;  2Y6L A;  3UET A;  1KEX A;  5JXI A;  1XPW A;  2BZD A;  3NJX A;  1L7R A;  3ECQ A;  1JHJ A;  3I2K A;  3AC0 A;  4D8M A;  3SKV A;  3OB8 A;  2WO3 A;  2J1T A;  2JE8 A;  4PT6 A;  2B4K A;  3VD9 A;  1D7P M;  2XQX A;  3I2H A;  2VZO A;  4XUN A;  1K42 A;  3WNL A;  1CZV A;  1UYX A;  3OGS A;  1UX7 A;  5JXJ A;  3I2G A;  2VTF A;  1GOF A;  2HLE A;  4A6O A;  2VCB A;  2WAB A;  2QQJ A;  4ET7 A;  4LPL A;  3THD A;  2VL4 A;  3WNM A;  3HN3 A;  1K3I A;  5JUV A;  1W9T A;  2CDP A;  1UXX X;  1JZ6 A;  2JDA A;  5DQ0 A;  1W0N A;  2QQM A;  4E8D A;  1OF3 A;  4GWI A;  3K77 A;  5IFP A;  5CZK A;  3CDZ B;  4QX2 A;  4UAP A;  2JKX A;  2VZS A;  5HPO A;  1H6X A;  3ACG A;  3LEI A;  2W1S A;  3I97 A;  1XNA A;  5G05 L;  1UZ0 A;  3OEB A;  4P00 B;  3ACI A;  4OMC A;  1JI6 A;  2J22 A;  2WBK A;  1GOH A;  3E1F 1;  2J1A A;  4W4Z A;  2ORZ A;  3GDB A;  3LQC A;  2VCC A;  1OH4 A;  1BHG A;  2BGO A;  4ZZ8 A;  3T08 A;  2DCJ A;  4UI9 L;  2WAA A;  3K4D A;  4BDV B;  5LA0 A;  1UXZ A;  4XUQ A;  2J1V A;  4M4R A;  4RN5 A;  2X09 A;  2E26 A;  2VO5 A;  4KWU A;  3MV1 1;  4A41 A;  1UYY A;  3WF3 A;  2EIE A;  1F4A A;  2J1S A;  1US2 A;  3J7H A;  1ULO A;  1W9W A;  3ACH A;  1US3 A;  3MO4 A;  4CU8 A;  3VD3 A;  4QDQ A;  2E32 A;  2Y6K A;  2XOM A;  5HXM A;  4CVU A;  3JXS A;  1PMH X;  3FL7 A;  3VD4 A;  2DCK A;  3HNY M;  4BXS V;  2XON A;  4QX0 A;  3NQH A;  4L0P A;  3CMG A;  1W8O A;  4DUX A;  3I2J A;  2WYS A;  5EJZ B;  4DXR A;  2W91 A;  3VDC A;  4QPW A;  5LCW L;  5F7U A;  2CDO A;  3CZU A;  4XZU G;  1JYV A;  4CUA A;  3CIH A;  4QDS A;  3C7H A;  4QB6 A;  3DYP A;  2HYX A;  1NX9 A;  4ARY A;  2VCA A;  1TG7 A;  2PQS A;  1K45 A;  3C7G A;  2W87 A;  4JHZ A;  3VD7 A;  2ZEZ A;  2QQO A;  2WZE A;  2VZV A;  3VDA A;  2ZEX A;  4LQR A;  2WO2 A;  3HOB A;  2Y6G A;  3T2O A;  3ABZ A;  2J1E A;  2V4V A;  1PX4 A;  3LPF A;  4ARX A;  2RJ2 A;  3A21 A;  4QB1 A;  1ULP A;  4XUT A;  2EID A;  1GNY A;  1NKG A;  5JXH A;  2VQU A;  2W1Q A;  2YG0 A;  3EYP A;  2BER A;  4DUV A;  3BN6 A;  4MOA A;  4ZY9 A;  2ZXQ A;  3LEG A;  1J83 A;  1W8N A;  3III A;  1O8P A;  3T2Q A;  4PF1 A;  2VZR A;  3I3E A;  1UY4 A;  5G04 L;  4FI9 A;  1T2X A;  2LW8 A;  2V72 A;  1SHW B;  2WO1 A;  3T0A A;  2VQT A;  1KGY A;  2Y64 A;  2V5D A;  1W99 A;  3K4Z A;  1DP0 A;  2W9X A;  4BK4 A;  4DEQ A;  2ZEY A;  3MUZ 1;  4ZZ5 A;  2DDU A;  4GZ9 A;  4QDR A;  2R7E B;  3THC A;  1XC6 A;  3U37 A;  3VD5 A;  4MGS A;  2JD9 A;  3P6B A;  3EB7 A;  1UWW A;  4DXT A;  3K75 B;  4OZO A;  2VMF A;  2ORX A;  1DYO A;  3GM8 A;  4E8C A;  2WUH A;  3IAP A;  1JU4 A;  5IYY A;  2C9K A;  2EIC A;  4XUP A;  4BK5 A;  2C4X A;  4DXS A;  3OGV A;  4CU9 A;  3ZM8 A;  1L7Q A;  4CUC A;  5EJ1 B;  3PUI A;  1XNT A;  4A3Z A;  2QQK A;  5LA1 A;  4UOJ A;  5JXG A;  1LNS A;  1PMJ X;  1GU3 A;  5J1X A;  2VM9 A;  4LKS A;  1JZ8 A;  2J7M A;  1NAE A;  2W94 A;  2VZU A;  3WF0 A;  3SEP A;  3WNN A;  2VZP A;  3WNO A;  1JZ7 A;  3GXU A;  1NUK A;  2E33 A;  5DPN A;  1SG3 A;  3NNG A;  4W8J A;  1W9S A;  1SDD B;  3K46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...