4A44A

Cpgh89cbm32-5, from clostridium perfringens, in complex with the tn antigen
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
140
structure length
140
Chain Sequence
ASALPQGNMKATATSEHPDVGNEGLAKFAIDGKENTIWHTKYNPVEELPQSITLELGGSYEINKFTYLPRSGAKNGNITKYELHVSEDGNNFRKISEGNWDDSGSLKTLKFNSTKATHVKLVALEGVGGFASAAELNVFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Carbohydrate Recognition by an Architecturally Complex Alpha-N-Acetylglucosaminidase from Clostridium Perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
molecule keywords ALPHA-N-ACETYLGLUCOSAMINIDASE FAMILY PROTEIN
total genus 30
structure length 140
sequence length 140
ec nomenclature ec 3.2.1.50: Alpha-N-acetylglucosaminidase.
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4a44A00
1O8PA 2QBXA 2VZPA 5IJRA 2JD9A 4LPLA 2W87A 2VM9A 4QB1A 2ORZA 3ETPA 3I2IA 3T2PA 1BHGA 1JU3A 4CVUA 2VZVA 1ULPA 5JXJA 4ZXEA 1GQPA 5IYYA 3CKHA 3NNGA 1K3IA 3MO4A 1XNAA 2QQNA 2W1WA 3VD5A 3WEZA 3T0BA 2VZQA 2JKXA 2QQLA 3ZM8A 1PX4A 3I3BA 4CUCA 4CU8A 1K42A 4A42A 3NJXA 1GOGA 3IIIA 3T08A 1NX9A 1O8SA 2VQUA 1OH4A 4AAXA 4A6OA 3I2GA 4QB6A 2WUHA 1R64A 2C26A 3K75B 4XVHA 4DEVA 4UAPA 3T0AA 3MV01 2C4XA 3IDAA 1NAEA 5C71A 2VOTA 5CYYA 2Z4FA 4DXRA 4PT6A 4OUEA 1YQ2A 3LPFA 2W1QA 5IFTA 4QX2A 4QX0A 3EYPA 4PQQA 3K4DA 5JMOA 5IHRA 3U37A 3IAPA 3DYOA 2VZOA 4E8DA 2VCAA 4JKLA 1F4HA 1UY1A 2DCKA 5C7GA 1KGYA 4P00B 2BERA 2VCCA 3I2HA 3WF1A 1UXXX 3W5NA 3VDAA 3A22A 4UI9L 1K12A 4M4RA 3CQOA 2QQIA 1JYWA 4KMQA 1GOHA 1DYOA 2J1EA 3WSOA 2Y6GA 3GDBA 3A21A 5EIYB 2WN3A 2WQ8A 4YPJA 2EIBA 2W94A 4ZY9A 3PUIA 2Y6LA 2LW8A 1UMHA 1WCQA 1W8OA 4CUAA 4TTGA 4AG4A 3UNPA 3HJRA 5HXMA 1CZSA 3T09A 2RVAA 3THDA 1JZ8A 3HN3A 3JXSA 5A1AA 3OBAA 1JZ5A 4LHSA 5JXIA 5J1XA 4CUBA 2YC4A 3IB3A 4E8CA 4L0PA 5B4NA 3W5MA 4Z2AA 3LEIA 4FI9A 3CZJA 3E1F1 2WABA 3K4AA 2B9VA 3WF0A 5IFPA 1OT5A 1W9TA 3VD9A 4A41A 2J22A 3WNNA 1UY2A 1PMHX 4MOAA 5JR2A 3MBWA 4QDRA 2BZDA 4DXSA 1UMIA 4QAWA 1W0NA 1GMMA 2YG0A 1TG7A 2WYSA 4XUOA 2J7MA 2BGPA 4UOJA 1JZ3A 4W8JA 2WBKA 2X09A 4LQRA 2KD7A 1GNYA 2VR4A 3OG2A 4RN5A 1T2XA 3C7FA 1TVGA 4QX1A 1DP0A 3ECQA 2Y6JA 3LEGA 5LA2A 2PQSA 2VMCA 4RYDA 3C7EA 3NRUA 3C8XA 3CMGA 5LA1A 2ZEXA 4BXSV 1F4AA 2E31A 4P02B 1GUIA 4BK4A 3SKJE 3UESA 2J1TA 1OD3A 3J7HA 3OGVA 5DQ0A 3MUZ1 5DMYA 5DPNA 2YFUA 4XURA 2VZ3A 4A3ZA 1W9SA 5CZKA 2YFZA 1O59A 5LA0A 2W95A 2WO2A 4OZOA 1PMJX 1JYVA 2WAAA 2ORXA 4ARXA 2WO3A 2LS6A 3I2JA 2VC9A 3UETA 3OEAA 2ZXQA 4QB2A 2QQKA 4QDSA 5LCWL 2WZEA 2V72A 5EJ1B 1UX7A 3ACIA 4XUNA 2RJ2A 2ZEWA 2VMFA 3LE0A 4A44A 4XUQA 1JZ7A 3WNMA 1DLCA 3MUY1 2Y8KA 1W9WA 1SDDB 2E26A 2R7EB 4XUPA 3I2KA 3ACFA 4P5YA 3LQCA 3HOBA 1ULOA 4JX0A 4JKMA 4XUTA 4ET7A 1OF4A 3SEEA 2WO1A 3P1IA 2Y6HA 1EUUA 3K46A 4DXTA 2QQOA 3HNYM 2XONA 2WDBA 3I3EA 2J1VA 2VZSA 2W91A 2W47A 2HLEA 1XC6A 4MADA 5F7UA 1CZTA 1UWWA 3DECA 4ARYA 4ZZ8A 1PX3A 2W5FA 4KI5M 3WF3A 2X05A 1I5PA 4M4PA 1US3A 4DUXA 3WNOA 1W99A 3DYPA 3CZUA 3F2ZA 2E33A 2VTFA 2BGOA 4LKSA 2W46A 3C7OA 3HNBM 2J1AA 3GGLA 2JDAA 3VDBA 4OMDA 2W3JA 3VDCA 4MGQA 3OB8A 2YC2A 3GM8A 3EB7A 2Y64A 1JZ6A 1P8JA 2XOMA 4P08A 2HYXA 4XZUG 4BDVB 2VZUA 3BGAA 3SEPA 2CDOA 4TXWA 1US2A 2VQTA 2VJXA 2QQJA 3HPNA 4DUVA 5I0DA 3AC0A 3LPGA 2W9XA 4D8MA 3C7GA 3FN9A 4MGSA 4DEQA 5G05L 3D3AA 3FHQA 3SKVA 3NQHA 2WN2A 4GWJA 2B4KA 5HPOA 1JYXA 1UY3A 3WNPA 1OF3A 5C70A 3VD4A 1JYNA 2V5DA 3GXUA 1HN1A 4A4AA 4MO3M 2RV9A 3I3DA 4PF1A 2DCJA 4BK5A 2X10A 3I2FA 3FL7A 3OGRA 3VD7A 2Y6KA 5G04L 3NJVA 2L9LA 4DUWA 3ACHA 1UYYA 3PUHA 2VO5A 3WNKA 4JKKA 3OEBA 1UY0A 1UXZA 4W50A 2VZ1A 1NUKA 2ZEYA 2C9KA 1MPXA 3K77A 1H6XA 5DN2A 3WQBA 2EICA 2DDUA 3CIHA 1L7RA 3C7HA 3P6BA 2JE8A 3T0DA 1JI6A 2XQXA 2J1UA 4KWUA 4IUGA 3T2QA 5EJZB 4CU9A 5JUVA 2EIDA 2ID4A 1NKGA 1SG3A 2VZRA 3WF4A 1UY4A 2W92A 2VMDA 1SHWB 1K45A 3FHAA 3VD3A 1LNSA 2QQMA 4GZ9A 4HG6B 3A7QA 4QPWA 3WNLA 1J84A 4JHZA 1H6YA 4D0QA 4OMCA 1IQDC 5JXGA 3HEIA 2E32A 2W1SA 3T2OA 4CU6A 4GWIA 4BJ0A 3HNMA 2YB7A 2J1SA 2V4VA 1KEXA 2ZEZA 4QDQA 2OKXA 2BBAA 3LEKA 3MV11 1GU3A 2VMEA 3IAQA 5B4XA 1GOFA 4A45A 2VL4A 1RYYA 2VCBA 1CZVA 1J83A 1CIYA 1W8NA 2CDPA 4ZZ5A 1UYXA 3THCA 3I97A 3WF2A 3K4ZA 4CU7A 3DYMA 1L7QA 2J1RA 2VZTA 1XNTA 1JZ4A 2W1UA 1JU4A 5JXHA 1JHJA 4OYUA 2XHNA 1CX1A 4W4ZA 3ABZA 1WKYA 3BN6A 4QX3A 3ACGA 5FUIA 1JZ2A 2WZ8A 1XPWA 1D7PM 2WAOA 3CDZB 3OGSA 1UYZA 1EUTA 2EIEA 1UZ0A 3A23A
chains in the Genus database with same CATH superfamily
2LM3A 2HEYF 2ZGMA 3AMQA 4HN1A 2Y0IA 2GDFA 3ILFA 2YDEA 2QBXA 2VZPA 4Q0SA 3TN92 3U78A 2W87A 3WD5A 2B7YA 2JIJA 4IEVA 3FLTA 4OCTA 3ZVXA 4K7JA 1OD5A 1DZRA 1POQA 2A6YA 1JU3A 1U0AA 5T52A 1ULPA 5I0SA 1PGL1 5JXJA 1GZ9A 2A70A 3JQWA 4RGGA 1COV3 4ZXEA 3SC7X 4AEMA 5JIUA 1CAWA 2WSVA 5SV5A 1TME2 1FMD3 3USUB 4DFSA 5BNPB 4B4PA 3NNGA 2GP5A 3CNAA 3NNJA 1ZZCA 1XNAA 4ZS3A 2W1WA 4DPNA 1LOEA 5A6XA 4XF1A 5FKCA 2A6WA 5KWRA 5DXDA 1QIQA 4KWJA 3H8OA 4NRQA 5F1RA 1TEIA 4QHOA 4JQTA 4CP2A 5HBAA 2AREA 3SCHA 2D3RA 1X7NA 4WM7C 1UMZA 1O8SA 1OH4A 3B9IA 2C9AA 1EV12 1QJX1 1K5MB 3B00A 4LBQD 3J4UH 3OBZA 4YVSA 4DINB 4UAPA 2QQPA 1Q8PA 3T0AA 2A6XA 5AC92 1BLZA 2CTVA 3LDBA 4F83A 5DDJ3 5CFDA 5FZKA 2Q8DA 4AHWA 1EPWA 1UZWA 1AR93 1EAH1 1N3QA 1F5JA 1NZCA 1FV2A 1WW5A 5EZWA 1O6UA 2FCVA 2Z4FA 4PT6A 2WO7A 1YQ2A 4FTSA 3M3EA 1JUHA 4LKDA 3D0JA 3FFZA 1V6LA 5FUNA 1RJ8A 3EYPA 3BALA 4H2AA 4YZ3A 5FK8A 3IMMA 2A1XA 2QQVA 4L92A 5LEKA 1RUNA 4LK6A 5JMOA 2G9GA 1ZA4A 5IHRA 1NLRA 1GNHA 3IAPA 3U37A 1JW6A 3O14A 1OLME 5FYVA 4UFKA 5A80A 1M06G 4EWAA 4MG2A 3AMHA 1E5RA 1BVP1 4XETA 1FPN2 1H2NA 4Y1YA 3K3NA 5EV7A 2PAKA 2XJTA 3PHMA 4FPJA 4GH4B 5C7GA 2JDHA 4QGLA 1KGYA 4WV8A 2VCCA 4FTEA 1D0GA 3AZWA 4AGRA 4QQOA 5JZGB 4XIOA 2ENRA 1C8M3 5IUQA 4FAHA 4UI9L 1W06A 1SMVA 5AVPA 1VIWB 3RS6A 1D0HA 1LR5A 5FZEA 2C5DA 2O14A 3RG0A 4BIFA 2ILMA 3CQOA 4Q27A 5FWJA 2R041 3AP9A 1GOHA 4MGZE 2VUDA 4E4HA 5CA6A 4AHXA 2WNOA 5H9RA 4B1LA 1RITA 5EIYB 3OY8A 4Q5OA 2GNMA 2WQ8A 2ET7A 4N43C 4YPJA 1YI7A 4M3CE 1DFQA 2VG9A 3FUOA 4FOYA 4N9IA 4FTBA 1OQDA 1ALYA 3EXUA 4H3WA 4AGVA 3PUIA 2Y6LA 5C3RA 1GP4A 1WCQA 4AG4A 4KBZA 2VE1A 1QH7A 2EALA 3KCYA 5HXMA 1CZSA 2PHLA 2WSUA 5BV6A 3FUQA 4RS5B 4LHLA 4CCJA 1UU6A 4URAA 3JXSA 4NHXA 3OBAA 1W8HA 2E6VA 5FZ3A 1TNFA 4FOWA 2P5BA 1AL23 4WVMA 1FOD2 5FP8A 4AK3A 2F4PA 3VN4A 5J1XA 1W2TA 5KBFA 3W9AA 1J1TA 3H0OA 1POV1 1W2UA 3RQ0A 4LTAA 1JUIA 2WLQA 4Y5TA 3THTA 3TWIA 2A5ZA 3AFGA 4B4RA 4D7TA 4EQVA 3BUCA 1DYKA 3WDVA 4E8CA 2WA3A 4OI2A 2BPA2 1UF2C 2VXRA 3ZN6B 3TBDA 1L3JA 3B3QE 1D4VB 2RR12 1EPZA 3LEIA 5IAVA 3ZOIA 3SQOA 4FI9A 1AYM1 4QWNA 1R093 1H4HA 3Q8CA 5JI9A 1CESA 2WWJA 3KCCA 3GZTB 2FDIA 3AP5A 5FXZA 1A6CA 4CDXA 3VD9A 3C2UA 3WQ0A 2J22A 4PBOA 1DQ0A 1RHI1 3WX5A 3D4KA 2CY6A 3N9QA 1PMHX 1C8M2 1O3TA 4MOAA 4LE4A 1UAIA 2W2IA 3NV4A 3E6DA 1XXNA 2CV6A 1X9TA 3HWJA 3BODA 3Q9OA 4XFCA 4DOUA 1AR91 3U1XA 1AX0A 3N7KA 5LATA 1XYOA 1AF9A 5FZ7A 4FPCA 5FBJA 1JTZX 1GZCA 1OKQA 3N3HA 4KGQA 4FAGA 2HWF2 1R1ZA 1MQTB 1Z7S1 5I8YA 1BK0A 2EVXA 2VQ0A 1ZZBA 2HWE3 4X6RB 2JDNA 1LGNA 2X09A 1W8WA 2KD7A 3OG2A 2VR4A 5LBEA 4X8NA 3C7FA 1TVGA 4QX1A 1TMF1 1PO22 5FZAA 3VKOA 2WWSA 4LK7A 5A7QA 1WBFA 3MFAA 3ECQA 1IPJA 4MHUA 2DYCA 3M1HA 1ZRIA 4AEDC 1VBD3 4YM0A 5LA2A 5JPNB 4Y1UA 3KGLA 2ZHLA 3R4DB 4P9GA 4CDWA 4Z92B 2OW4A 3C7EA 1RUE2 3IDBB 4G4FA 2GNDA 3C8XA 1GLHA 3ES1A 2JJ6A 2XBO1 1F4AA 2DVDA 2E31A 2IZWA 3CEWA 4P02B 3GZEA 3KQ4B 1FATA 1AL22 3O1SA 4YM2A 5FY8A 1WLDA 1YYNA 1H1MA 1OD3A 2J1TA 4K6BA 3RWNA 4GXLA 5LK7B 1ZRRA 5FZMA 2QDRA 4MUVA 2HWF3 1V0AA 2XBO2 4QQHA 4UXAA 2GSYA 1LOFA 2O1QA 4B4QA 4UF0B 3QCWA 3RI8A 3AZYA 2PHUA 4YGEA 4UW6A 4Q26A 1W9SA 2HWD2 4Q4W3 5CZKA 2YFZA 5DZGA 3ELNA 5FYYA 5JAXA 3R4SA 4LO7A 5JSRA 3JD73 3WDTA 4RQPC 1GV9A 1QH6A 3AXEA 4PDWB 2WINB 4XFFA 4TYSA 3VBFA 2ORXA 3AZVA 4L8QA 5A3UA 3J8F2 4UFMA 5A3PA 3RI9A 4ARXA 1ULGA 2RJLA 2XLGA 3LOIA 2PAEA 1IS6A 4GKYA 3GHNA 4XJ8A 3UETA 4AEJA 4QU1A 1H8TC 2ZXQA 4QB2A 2WL1A 3AXDA 3AKRA 4NWVA 1I3HA 2WZEA 4R4XA 5EJ1B 3U07A 3BTYA 2ZHNA 2R0FA 4Y24A 4LEJA 2KXLA 1R082 1XU1A 1KDMA 3AZZA 3BPZA 3KVAA 3ZFEC 4RSUA 2VMHA 4LLFA 4CDQC 5IVCA 4YGCA 1FX5A 4IDZA 1Y9GA 4A44A 1JZ7A 3B01A 5KXBA 2OQ6A 1AX1A 3MUY1 4HKWA 4E2SA 3BU0A 3UKTA 4YM1A 4X6QB 2Q8CA 1PO12 4BCUA 5C8CA 2PHWA 1GNZA 4XUTA 4QPIB 4XHXA 4C0BA 1PNFA 4ET7A 4CCKA 2A3WA 5FYUA 4BH9A 3ZFGB 4AFDA 2JXAA 4Q8KA 1YI9A 5C4WA 4NPMA 4LO8A 5T55A 2JB8A 3AVRA 3HNYM 2P3KA 2WDBA 3I3EA 1QOSA 1W6NB 4OHYA 5JOWA 4EE2A 4MADA 3S7IA 4D6RA 4AI8A 5F7UA 4DO0A 1ZZ8A 3DECA 5K7PA 2W5FA 4P9LA 1EV13 4WM7B 4BM8A 5FZFA 3U0ZA 4FFGA 4B1MA 4IQPA 5BY5A 2OPKA 3ZKUA 1HRI1 1W8ZA 2VGDA 2WLPA 3N9OA 2D6NA 4JV4A 4RD7A 3PU3A 4META 1W99A 3F2ZA 1YJKA 3O7OA 4UW3A 2E33A 1ZBA2 2MEV2 2VTFA 1HQNA 1WW7A 2BGOA 5GJ6A 3VLBB 1E5SA 2I07B 2Q30A 4LKSA 4XMIA 5GLVA 5KC6A 2MEV3 2VVFA 3ROUA 5HCBA 2UURA 4XFHA 4XFIA 3ZFFA 3GGLA 3N36A 1C4RA 3L2HA 4UYBA 4F3JA 1JYIA 1YFUA 4BQ2A 4W6XA 3VDBA 3EO6A 4OMDA 1L7LA 1SCRA 4K3UA 2ARCA 1YLLA 1UZVA 5FP9A 3O1OA 3LF7A 2Z42A 3VBRB 4WM7A 5F3GA 4P08A 4AVCA 5A7NA 3MDPA 1COV1 2GALA 3BGAA 4LHNA 5CKMA 4TXWA 5JSOA 3TEXA 4CDUA 1S0GA 4BB3A 5F3CA 5FPLA 3HPNA 4PF5A 4IEZA 4LULA 1XB9A 2C24A 3ZYBA 3C7GA 4QXCA 4AVSA 4MGSA 2XB6C 1ZRCA 4DEQA 1ND2B 5B2GB 1UO9A 1Q3EA 3FHQA 4YW5A 5A3OA 5DDJ2 4ZU4A 5J36A 4XHBA 3O1TA 4NHLA 1JYXA 5HCFA 1UY3A 1OF3A 3CF6E 4QPIA 2IXJA 5J7MA 2R1BA 2WR9A 1RVF2 4QQ2A 4CEYB 4XFBA 4Q8LA 2IXHA 3IIAA 4KQ7A 1F15A 3JD71 4PF1A 5FZ1A 1ZBA1 2DCJA 3VBHA 5A7SA 2FCTA 5GZEA 5T50A 1FNZA 2RMU1 1H2MA 3S30A 4IEPA 1ULDA 2OUJA 5KHKA 5IVJA 2GC1A 4I09A 4IGPA 4IE7A 2OZJA 1YCIA 2YGMA 3B9CA 3PUHA 4LKFA 2VO5A 2YBSA 2E7AA 5FYCA 3RPQA 3OEBA 1UY0A 4ISRA 4RS5C 4ATEA 2NMOA 2QZ2A 1F8VA 2RDQA 3AJZA 3WP5A 5FY0A 2C9KA 5A70A 1H6XA 3GCXA 1ZYBA 1QY4A 2EICA 2XL7A 2JDPA 3AVSA 4OHWA 3LCPA 4R9DA 2IXKA 3RSJA 2PHTA 4AFBA 1MZEA 3T0DA 1QJU3 2A75A 5E89A 4OULA 5FMDA 4CUGA 1LHVA 2W08A 5L36A 2RS31 4N53B 2PYTA 3DUIA 1WMEA 3T2QA 5EJZB 3VGIA 1IOAA 4CCNA 1PGSA 5JUVA 4QT6A 1SG3A 1MVEA 2GC0A 4OI4A 2NQYA 5T5PA 5CFCC 2P34A 2QKDA 1AYM2 2VMDA 3WG3A 3I54A 4XCAA 2VVEA 2Q8OA 5FMCA 2MNGA 2DFBA 1Z78A 2NZ9A 4C1XA 1HN0A 5IWFA 1W8FA 4GZ9A 4HK9A 3VHOA 3HBKA 2D5FA 3VDDB 2RS51 4IW3A 5FKBA 1HXS3 4EN0A 2NYYA 3U4XA 4XQ4A 1RL3A 3RZJA 4JQRA 1J84A 3NV2A 4KBBA 4JHZA 3WUDA 1IZ3A 4XIKA 1XQNA 2ZTNA 1SFYA 2NM1A 3X29B 1FMD1 1IQDC 1QNWA 1WW4A 4LITA 1FOD1 4LIUA 4UBHA 3ZIXA 4LLOA 2HWD1 4PLNA 4V2VA 4BQXA 2BFUS 2YROA 4AF9A 3DL3A 1KEXA 4LA3A 2CSGA 1VBE1 4J1WA 3M3CA 2ZGQA 3MV11 2VTXJ 3PVBB 5FPUA 5FUPA 2Y60A 5JOXA 1GOFA 2SLIA 1HB2A 3APBA 4PBPA 4A45A 4IEOA 2CGPA 4M0NA 2DFCA 1J83A 4CXXA 1UX6A 5LY2A 2CDPA 3ZO0B 4XJ9A 4ZZ5A 2RM22 4UW5A 1WLWA 4Y5SA 1J58A 3WF2A 4AQSA 1UOBA 3ZFFC 4CDQB 1S2EA 2PQQA 1O7FA 1O5LA 3AK0A 2BGCA 2HWC2 4CU7A 2HWC3 1RGSA 2VZTA 1JZ4A 1JU4A 3FZ3A 2Q4SA 1JHJA 1K5MC 1AR73 1I6XA 4NR1A 4OYUA 2XHNA 1B35B 4HVOA 3ZSKA 3N9LA 1NG0A 4K8FA 3JBG1 3POIA 5I91A 5M0TA 3LFIA 3S57A 3AP4A 1X33A 1Y3TA 3E6BA 1VBD2 2ZBJA 3OPZA 4D6SA 2GH8A 3M3OA 3DEMA 3DXUA 1Q43A 2VOWA 1NA1B 1VPHA 1DYPA 3U10A 2WZ8A 4PDWC 4AI1A 4P9XA 2JIGA 2ZHMA 3CJIB 4HSJA 3W20A 1CAXA 3D82A 4DXZA 3AKPA 3OGGA 2VUAA 3J7MA 2UWAA 2EIEA 5F5AA 4N8MA 5FAXA 4NRMA 2VW2A 3AMMA 1CGPA 1SDWA 2GMMA 2P6HA 3O5SA 2GP3A 1W0PA 5DABA 4EN7B 2IUWA 4O61A 1N1YA 1D4M2 1QJY3 3ACLA 1SBFA 1QOTA 2D6OX 1D2SA 1SFNA 2HWB1 3AYAA 1MS3A 3NW4A 4LPLA 4MYEA 4RHV2 3B94A 3NKTA 2ZHKA 3ZYHA 2VCMA 2D44A 3WG4A 2G9ZA 3T2PA 1BHGA 4CVUA 2VZVA 1ZREA 1RUJ3 2VOKA 2RG4A 1IKQA 3DPRA 4ZU7A 4W65A 4NIAA 3CKHA 4QM8A 4XF9A 3RRDA 5FYIA 1K3IA 1ZRFA 4IV3C 4WVVA 3NAPC 3VD5A 1S0FA 3TNQA 2VZQA 4NAMA 2GNTA 1ZZ7A 5FLIA 4PI2A 3WOGA 3ZM8A 2RS11 4ZXKA 1PX4A 5KC5A 4D6QA 1QHDA 3H1WA 5F5CA 1H8TA 4FO9A 5CG8A 5CB7A 2E63A 5FDBA 1KJRA 1C57A 3ZDVA 2GMPA 4A6OA 2EIGA 2XJRA 2JE7A 3I2GA 4QB6A 4H14A 4E27A 1RMU2 2R062 4PLOA 3ZXJA 1OQ1A 2DV9A 1BBT1 1H1IA 2Q1FA 5CFDC 2C4XA 3TOJA 1PIV3 2PHRA 3VBFB 4QX7A 5DG2A 1XYPA 1MZ6A 1TQ5A 2OYZA 4DY3A 1QXPA 4QPYA 4YW4A 2OS2A 3HT1A 1UOFA 1X8EA 1VBC1 4Q4V1 1DGRN 3ME2A 3OYWA 4OUEA 3MYXA 3ALQA 3LPFA 2UWCA 1BKZA 3AP7A 4CDXB 4GQ7A 5CISA 3K4DA 1W90A 1MR5A 3HMYA 4BOWA 1OUSA 5CFCB 3DYOA 2XKOA 3V65A 2OA2A 4BPZA 3SCGA 2VCAA 3NAPA 4RFT0 3H9AA 4JKLA 3MI8A 1VBE2 3PTRB 1UY1A 1VALA 3BU7A 2IFRA 2AC1A 1LHOA 4UW4A 1LOGA 3KT7A 4YW1A 1ENSA 1RHI3 4FPOB 1YFWA 2R32A 5IVEA 1EAH3 2DCYA 3OOXA 3WF1A 2HWE2 4AE2A 1ENXA 1O4TA 1V00A 2OIIA 4DS0A 3W5NA 4CXYA 1QEXA 3A22A 4HVRA 2VW1A 4RS5A 4FPKA 1YC61 1LOAA 1GZTA 4M4RA 5A1LA 5ISLA 2UY8A 2VD7A 3DN7A 4Q4X3 2DUPA 2QQIA 2ZS6B 5SV8A 3RZKA 1JYWA 1CIWA 4KMQA 1ZZ6A 1DBNA 2FCUA 1DGWA 3ZXGA 5BYNA 4K8RB 5D8AB 4YVSB 5FZ6A 3VZLA 1NCQC 3LWCA 3GDBA 4YW2A 5JIAA 1RXFA 1LGBA 1UD1A 3H7JA 1R1A2 3UGGA 1H2LA 3WT3A 4AQTA 4MH0E 1LEDA 2EXIA 2JEMA 2EIBA 3KD4A 4MXVA 2W94A 1F31A 1DQ2A 5LEJA 3NL1A 5ACA2 3IZOA 5LZ6A 4EZHA 1KQRA 1W8OA 4CUAA 1XSQA 4CCLA 2EXHA 4D69A 1J3QA 2VMGA 3K48A 4LO5B 4A2UA 4K1YA 2HWB2 3PIGA 2RVAA 2CL2A 4CEYC 4Q0VA 1SLTA 1H8VA 1JXNA 2KA3A 3HN3A 1WCUA 1JZ8A 4JRAA 4XACA 3HD8B 2XLFA 3AZXA 1Q5OA 3UV9A 4X8PA 3VBOA 2R071 1UIKA 2AYHA 2NLRA 5AVAA 3FWEA 1CAWB 2D43A 4NPRA 2FMYA 3N4MA 1ZRDA 4XFAA 3WCSA 4O65A 4CDUC 4CUBA 3POBA 1LHUA 3W21A 3IB3A 1X8MA 2CNAA 1G6NA 5IVFA 1QXJA 3BVCA 3CLPA 3GJAA 1S0CA 5B4NA 2ZOEB 4Z2AA 3UKVA 1ASJ3 3MLKA 4YARA 4AI3A 2YXSA 2XVLA 1SACA 4AR2A 4JC1A 1RIRA 2WABA 3U14A 4YVWA 3DPRB 4LBNA 5EJ3A 2FDGA 2ZGSA 4CEYA 3O1MA 1W9TA 3BYWA 4JGZA 4YZ4A 4A41A 3AP6A 5A32A 5BNQA 5ANQA 2X5IA 2PXJA 3M3QA 3VV1A 1ND2A 2XVKA 5H9SA 2Z5WA 5DUVA 3MBWA 1ZBE1 3V64A 5C6CA 4QDRA 5FREA 2BZDA 1ODMA 1UMIA 4COUA 3AL6A 4AAPA 4OHVA 1ACCA 2GU9A 1HDKA 1GMMA 3VL8A 2XXZA 4C0HA 1VBE3 1DQ6A 4TLGA 2PLV3 2YYOA 2DBNA 1NOVA 2WYSA 4FP2A 4LO4B 4NHMA 4NOTA 2YY1A 4XUOA 3ZSLA 3FJSA 5C3OA 5F3IA 2WBKA 3ETQA 3WG2A 2C0ZA 1HRV1 4IE6A 4R9AA 1AUYA 1PGW1 1IHMA 1HJFA 3GCWA 1IS5A 2LRPA 4OUSA 3SCFA 3WP3A 5IATA 1CVNA 4JDMA 3GBFA 5J37A 3CJIA 5FO7B 1GZWB 1NY72 1UOJA 2BUKA 1TMF2 2MEV1 2DUOA 2PN5A 1ZBA3 2WZR2 2PQSA 2VMCA 2XJVA 3POEA 4FPEA 2VOVA 4RYDA 1MS4A 3IKWA 3OUHA 2AZ5A 5KHHA 3NRUA 2BP6A 3ZFEA 3RZZA 2ZEXA 5F39A 3MFCA 4Y5Z0 5FYHA 4C90A 4FSJA 1PM4A 4BK4A 3POGA 1N3OA 1AXYA 2IXIA 2X5IC 3SKJE 1OUXA 1W2OA 2MHFA 1TME3 4Q4W1 3OGVA 1MEC3 1F35A 4IGOA 2TEPA 5DQ0A 1UU4A 4YWAA 4P9YA 2WKKA 1DZTA 2UYAA 5DMYA 1DG6A 2YFUA 1ULCA 4JTNA 3RYRA 3RZMA 5FXXA 4QPIC 2IXCA 3IPVB 4S2DA 5JZGC 4A3ZA 2FMDA 4MV2A 4QGMA 1UOGA 3UGFA 4YG0A 2XJSA 4YVSC 2AEZA 3WUCA 4BQ5A 1R092 2W95A 2WO2A 1HLCA 3SH3A 1CAVA 1YQ5A 1E57A 1S2KA 4FP3A 4D3WA 1KXGA 2WAAA 4E4ZA 3AKTA 4WM8B 1VAMA 1GKBA 5JI7A 3ZFGC 3MIBA 3M3IA 3O12A 1OH3A 1AR63 1VAKA 1G9DA 3MPBA 4CDUB 5BNOC 4IV1C 1LOCA 2AEYA 3N9PA 1QU0A 1Z0HA 2DU1A 2QQKA 2BNNA 1R083 4GALA 4QDSA 1LODA 4Q4Y3 1QJX3 2R49A 1W28A 1UX7A 2ATFA 3VBRA 1OPOA 5HV0A 1RC6A 1MVQA 3ACIA 5FR3A 4ASMB 1PZ9A 1XNDA 2RJ2A 4IL7A 3WDXA 5FPZA 1CJDA 3ZYPA 3ZR6A 3RMYA 1HB4A 2RJKA 1LGCA 2XUMA 2X53S 4RGKA 1JBCA 1J3RA 1RUH2 3ZR5A 1DLCA 2W68A 2JDKA 4QPGA 4Q4Y1 1SDDB 3UT0A 2RE9A 2VUJA 3I2KA 4XUPA 3ACFA 4IE4A 3KV9A 1V9U2 4CEWA 5AFEA 1S2BA 1R091 2UYBA 3H8XA 3MW2A 1SBEA 4XFGA 1OMIA 4XJAA 1PIV1 3HOBA 1ULOA 4OLLA 4XE9A 3L9JT 2XLAA 2ZACA 2IVIB 2WYFA 2RS32 2HYKA 5F2SA 2WO1A 2Y6HA 1B35C 4UFHA 1ONAA 4DXTA 2A6VA 1WBLA 3H8UA 1ODNA 1DGLA 3JBG2 2XONA 3QH6A 3BIWE 2W91A 4OUMA 2W47A 5D8AC 3TB0A 1XC6A 4TSVA 1YIFA 1CZTA 1OURA 2OT7A 1NA1C 1FAYA 1JOPA 1RUC2 3SNMA 5FOJB 2BTVC 4FOQA 3SH5A 4NO4A 1S0BA 1PX3A 1YXWA 3NJZA 1ST8A 2LALA 4I30A 5GZFA 3L2YA 3CHXA 3WF3A 2Z79A 4UBGA 4Y1VA 1US3A 4GIQA 3KVBA 4OQ9A 2XWJB 5A32B 2BWCA 3VBHB 1AYN3 5A33B 5C3PA 5K0UC 4ASLA 1VMHA 1OOPB 5IK8A 5LRSA 2UWBA 4KNCA 5L9RA 3QOPA 5L19A 3RNSA 3VZMA 1FPN1 2P3IA 3ZXFA 4IXLA 4OI1A 3TAYA 3WDYA 5BNNB 3WXPA 3EQEA 3N7JA 4RFRB 2JDAA 4YG6A 5JDBA 1W6PB 2N7GA 1RUG1 3VBUC 1NY71 1WMFA 2A3YA 2YC2A 4OQ8A 4FPHA 3GM8A 4G9SB 2Y64A 5FP3A 3PVNA 4HPKB 4HBNA 1POV0 2WS93 1SLBA 1P8JA 1UPSA 4SBVA 3T30A 4LOSA 1OFNA 1AR72 3SEPA 2CDOA 1JOJA 3OPWA 4HLTA 3UJQA 1V70A 2VQTA 5KXDA 2DVBA 5GLUA 2VJXA 4E9KA 1IPKA 1V6NA 1W05A 2D3PA 5F6LB 4CYDA 5C5TA 4HKOA 3LPGA 1FPN3 2GH2A 4PIZA 3VHPA 2BVVA 4XILA 5H9QA 4ORFA 5ACA1 2ZKLA 3A0KA 1HB3A 2PTMA 3SKVA 1QMJA 3KS7A 2HBTA 2H0BA 1PIV2 2PHFA 4ZONA 3ZFFB 4NIDA 1J59A 1C8NA 5HPOA 4BQWA 4Y26A 2WZPP 4N43A 5C70A 1JYNA 2V5DA 3VL9A 3VD4A 3GXUA 1HN1A 2BQPA 4N7UA 2WT0A 2VW0A 3GJBA 4BMBA 5DUUA 3P3NA 3WP4A 3WNXA 4GMP3 3VD7A 1BEV2 2C6SA 2Y6KA 5G04L 4A3XA 2L9LA 5CAZA 4MSVA 1R081 5A7WA 1NQJA 4HL0A 1PZ7A 5FCCA 1URXA 3WNKA 1ASJ1 3Q8AA 1VBB3 1VBB2 3AB0A 3G7DA 3TRSB 4W50A 4FXGB 4D94A 5FPBA 1OA4A 1QKQA 1CR7A 1NUKA 1WA6X 2RMU3 4O9GA 5D8AA 2F4LA 3K77A 1W9FA 1XRUA 5DN2A 3WQBA 4O7XA 2P3JA 2RS53 3OTFA 1N3PA 1SCSA 4Y4RA 2XH6A 4QM9A 4CDWB 1L7RA 2WZR3 3C7HA 5T5LA 3GNEA 2D93A 2ZX2A 4Q29A 5L9BA 4KWUA 4O9EA 4IEUA 4ZHNA 4J1XA 4IUGA 4AEKA 4NRPA 5BPXA 2Y34A 1AJOA 1N1TA 4OHZA 1Y43B 4CCOA 4DY5A 4IEXA 2ID4A 2EXJA 4LE3A 3AMPA 3WINE 2VZRA 4M00A 4ZU5A 4GH4C 3WF4A 1H1AA 3E5UA 3UL2A 2Q1MA 3VB9A 1K45A 3FHAA 3QH7A 3O1RA 5GZGA 2RR11 4YFZA 3FBMA 1HX6A 4FVVA 5F9TA 2WFF1 1LNSA 2QQMA 2JG8C 4Q4W2 4YW6A 4MHRA 4N7IA 1GWKA 5HCHA 4WZFA 4KH9A 3WY6A 1H9PA 2ZZJA 5FY5A 4IETA 1GR3A 1RJ7A 4I3PA 1AL0G 2IVJA 1V6IA 5J96B 5C3SA 3LD8A 4MGIE 3V0AB 3VBOC 5AC93 3AMNA 3HNMA 1CX4A 5BUVA 4HETA 2ADEA 1LEMA 4QDQA 2D5HA 4LBLA 4OFGA 1S4CA 1JYCA 5J09A 3KM5A 3ZPYA 2HH9A 2OX0A 1VBA3 3ST7A 2WIIB 3ZMOA 4NIHA 1OA2A 2YU1A 3RVHA 4CCDA 1CIYA 1HJGA 5JOZA 1MEC2 2ZGTA 1AYN2 5K4LA 2D98A 5CNAA 5FLHA 3LSDA 2VH9A 3KCXA 4JHTA 1L7QA 1FI2A 1QQP2 3NNLA 2GAUA 4AI2A 1XNTA 4XJUA 2VNOA 1AR61 2I74A 5ABJC 1AR92 1GBGA 1CX1A 1RUF3 3TNPB 1PZ8A 1HW5A 4W4ZA 3ABZA 2JG8B 1WKYA 3H7YA 1JODA 3BN6A 2FBEA 3K3OA 5F37A 3ITQA 1YRZA 3O0XA 4KG0A 4E2GA 1XPWA 1D7PM 1X36A 2YPDA 2J42A 5FXVA 5EHDA 3AJYA 4CCEA 2XVGA 1OKOA 4XAEA 4ZPIA 1O4YA 2XUEA 3OGSA 4AOCA 5C4WC 3S5AA 1UYZA 1EUTA 5CFCA 3WHTA 1LJ7A 5A3NA 2Z2SB 1Y7BA 4QKBA 1UZ0A 5CIRA 2PA7A 3A23A 3Q8BA 3R4UA 2JG9A 3LDRA 1G7YA 2ZGKA 3ES4A 2BOJA 3Q8EA 4XAAA 5CU1A 5DAQA 3S6PA 2O8OA 4AI9A 3SMHA 4BU2A 1BQPA 1QDOA 1T6GC 2VM9A 2XGXA 4QB1A 2ORZA 3ETPA 3I2IA 3AKQA 4ES9A 4LBMA 5AFBA 1ZNPA 5APAA 3A0NA 1B09A 4HFSA 5LBBA 2A7AA 2EF6A 2CGNA 1GQPA 4DQAA 3E97A 4CDQA 1IKPA 2RM21 4CSWA 1VMFA 2HWB3 2ZGOA 3J8F1 5FZ8A 2WNVC 3MO4A 1F2NA 1GSLA 2QQNA 3LB9A 2CAVA 1A34A 1MS1A 3WQ7A 1V6MA 3I49A 3PTYA 2JKXA 2W0XA 2JB4A 2V5YA 5FZGA 1H8TB 1KS4A 4HPKA 2BJSA 2G9FA 4FPYA 1BCXA 2VU9A 4XJZA 3U4SA 3WHUA 5C9AB 4A42A 1AYN1 4BISA 3IIIA 4YYOA 1NX9A 1S0DA 3MIGA 3MIHA 3V56A 2R30A 1DLLA 3RWKX 4AAXA 5KXEA 3IN9A 3LGRA 5CKQA 1H2KA 1R64A 2BOIA 5GALA 4AQ2A 5FQ0A 1YJLA 4XVHA 4DEVA 3FFQA 1DDLA 1IS3A 3MV01 3KB5A 1FXZA 1WUVA 3ZYJB 1OVSA 2XHKA 4NWWA 4E4SA 2RDRA 2VOTA 1ENQA 1COV2 3KV4A 1RMU1 2R061 5E6HA 3DPRC 4DXRA 4XDOA 4GULA 1PNGA 3H1MA 2XR4A 3ZSMA 3O0WA 4QX2A 4TWTA 3VBSC 2FDJA 4QX0A 3W58A 1LU2A 4UFLA 4FT8A 5FYTA 3POJA 4KU8A 3HQUA 4HVQA 2HEVF 5A6ZA 1KJLA 1FYUA 4MVTA 4HMZA 3WDWA 2VZOA 3AFKA 1PO21 3DCQA 1H4GA 4GB32 5FZCA 5CEHA 2BRTA 1PGW2 2TNFA 1F4HA 3LFMA 2I2SA 5FY1A 3MGUA 5FZOA 1HXS2 1NA1A 3KHCA 2BERA 1O5UA 3M8LA 3TYJA 4FBFA 2YBKA 1YFXA 1UXXX 3MLLA 5EYYA 3VDAA 3BI3A 1MS8A 1B35A 4Q0QA 4CPBD 1HXS1 1WMDA 4QQPA 1A78A 3BIEA 3OBRA 2BU9A 3KSCA 4LUMA 3O0VA 3J8F3 1DYOA 2ZX0A 2JDUA 2ZABA 2Y6GA 4LJHA 3RDIA 3A21A 2V4AA 3MIFA 4ISQA 1CAUA 2EAAA 1XNBA 3ZDSA 2GMEA 5FJKA 4JRLA 5L9VA 2LW8A 1UMHA 1W6PA 1S0IA 2ZGPA 2QTWB 4Q1RA 5EFUA 4HKLA 4BLIA 3T3YA 1GWLA 3VHRA 3LOBA 1AJKA 2DCZA 3B02A 4QX8A 4Y22A 4MGYE 3D5OA 3DKWA 3V0BB 1PGL2 5HXVA 4YRDA 3VBFC 2B42B 3PU8A 5K9YA 3VDDA 4RQPA 1RVF3 4Q0UA 5A7OA 4AZZA 1MEC1 4DMIA 4AFMA 4EWEA 2R1DA 4URTA 5L73A 4Z2WA 4CCMA 2KM2A 3WZ1A 4L0PA 4YLZA 3ZN5A 4AHYA 4NIGA 4OHXA 1Q8VA 3W5MA 1VBB1 1LOFC 5FTTC 2O0OA 5IFPA 1N47A 1BXHA 4Z82A 3BTXA 4U2AA 2GC3A 4WVZA 3VKLA 2CWMA 3FBYA 4FQZA 1UY2A 2YPJA 1W3XA 4XQWA 1BJQA 4ZKTB 5T5JA 2H6CA 1VRBA 1GZWA 2ZKNA 4LKEA 3HAGA 4COZA 5JR2A 5FXWA 1ULFA 4YW3A 2RS52 3PJQA 4XEZA 4DXSA 3ZLIA 1BBT2 1BBT3 4XOGA 4AFAA 1W0NA 5FO8B 2YG0A 5JXHA 1PVXA 1W6NA 3UGHA 3RZGA 1EYBA 1RUC3 4XPVA 5E16A 2J7MA 4EN9B 4XF4A 4UOJA 1XYNA 3D6EA 4MGKE 5L7OA 1OQEA 1A8DA 4W8JA 1C3HA 5FRAA 3TN91 3MW3A 2ZAHA 3V0BA 1S0JA 5BNNA 1VMJA 1T2XA 1XU2A 2JICA 2AACA 4Q0PA 1W2NA 4GKXA 3OUIA 1OOPA 4H7MA 4LIVA 4SLIA 4P9WA 2RR13 2Y6JA 2IC1A 1YQCA 3ILRA 4BIOA 3VKMA 1GFF2 1AR71 4IE0A 1Q8QA 3JCIA 3E5XA 2Y6FA 1V6JA 1F9KA 3SH4A 3CMGA 1NLSA 2JDMA 1W6QB 1VLNA 1ND2C 5LA1A 3RYPA 4BXSV 4GWMA 4A6SA 3JZVA 3UYJA 4B7EA 3IPVA 3VHNA 4DRRA 1GUIA 5I0TA 1FOD3 2DWRA 4K20A 1W04A 2LTNA 3UESA 4CA9A 1NXMA 1NE4A 2JWPA 5LBFA 3S5QA 5E8AA 1EV11 1QJX2 4HOOA 5FP7A 3ZXAC 2QJVA 5IW0A 2WQZC 2ZMNA 4XYXA 5GLTA 4NHKA 4RHV3 3FX3A 3KV5A 1PK6C 2XG3A 2VZ3A 2V73A 4JGYA 4XURA 3LA7A 1C5IA 2RS33 3LA3A 1SLCA 5I0UA 2RS12 4OVEA 5FWEA 3RJ2X 1YQ6A 3T2TA 3H3UA 1EP0A 3MEPA 4PIYA 5LASA 1KFXL 1PMJX 2ZX1A 2ZMKA 1JYVA 2AGSA 3OJBA 3QLQA 1LULA 1FV3A 3CJXA 2LS6A 3I2JA 5FV3A 4LBOA 3J7NA 4MGTA 2XJPA 2VECA 2V72A 5FFOC 5FJHA 1W6MB 3PURA 2W52A 4IV1B 3JUUA 1OBNA 2LUWA 4YG3A 1OLQA 4RHV1 5D2AA 2DVGA 1RUD2 4XUNA 5KXCA 4PHZA 2ARAA 2JECA 2HWD3 2RMU2 1W8TA 4WM8A 1AXKA 3ZYIB 1D4M3 1QJY2 1LCLA 4R4ZA 4EJRA 1LHNA 2Y8KA 3NNMA 2JD4A 2E26A 1OOPC 4U36A 4NAOA 4P5YA 5I8SA 1WGPA 2MPFA 3LQCA 3AYCA 3UK9A 1AHSA 3H1YA 2D97A 4CP9B 1JH5A 1RUF2 5DDJ1 1NQDA 4JKMA 5DG1A 1QJEA 3BTZA 1OF4A 4JDOA 1IGOA 3LIGA 2YZ4A 3SEEA 2FHRA 1C28A 3KF3A 4JCKA 4PIXA 4RR3C 4W6WA 4IEQA 5L7OC 5C9AC 3K46A 4XF0A 5DAVA 4BYYA 1O3SA 4IERA 1W6OB 2WFF3 2QQOA 2WC2A 3H42B 4YVWB 5FYZA 2J1VA 1BYHA 3PUSA 4M3CB 3GZUC 1W9YA 3NAPB 1QWRA 1AR82 2HBUA 4AI0A 3PMEA 1BK1A 3N9MA 1HRV2 4NJ4A 4QXBA 3KMHA 1WD3A 4ZZ8A 5A6QA 2I45A 4W6YA 4P9IA 3GBGA 1OA3A 2SBAA 5EWSA 3NV3A 4KI5M 1RHI2 1SLIA 2X05A 1I5PA 1JHNA 2Y38A 3GZAA 1RUC1 1RUE1 2KR2A 1PMIA 4Q4X1 4DUXA 4LHKA 4XQDA 2P37A 3WNOA 5LK5A 3BCWA 3CZUA 4QKFA 4EWDA 5JSPA 5DUWA 3BOWA 2F17A 3C7OA 3IMNA 4B8EA 5FZLA 2BFUL 3PL0A 2NP0A 2J1AA 2ETEA 1MQTC 4Y20B 1ZZ9A 1NCQB 2A71A 1AX2A 3RMXA 4LUKA 1UZZA 2W3JA 1J3PA 3VDCA 1I1EA 3OB8A 2VAUA 4M3CF 1ASJ2 2IXLA 1JZ6A 1TNRA 5D1IA 3HQXA 2EXKA 1DF0A 3P3PA 4Z8BA 1RUG2 3I2OA 4Z07A 5FZ0A 4AGGA 2R16A 1EAH2 4JZRA 4H7LA 3S7EA 3NMBA 3VKNA 2FQPA 2DTYA 2QQJA 5ABJB 1PVC3 4DUVA 2X5IB 3AC0A 2W9XA 4D8MA 3FN9A 2A3XA 5I0RA 1YWKA 1Z7S2 5A6YA 2WNVA 4UT5A 1MZ5A 2VNVA 3D3AA 3KGZA 3PUAA 4HANA 2FD8A 3FHIB 3NQHA 4NPLA 3VUOA 1LHWA 2OPWA 4GWJA 4JGYC 2B4KA 4NVPA 1Q8SA 4I3GA 5FMOL 3RZLA 2PMWB 1X50A 3GF6A 4F8AA 1ULEA 2JG8A 3WQ1A 1BZWA 1LOBA 4V2WA 5FZDA 5GLZA 4A4AA 4XABA 4CP1A 3I3DA 2YHJA 4COYA 1YO8A 4IESA 1AR81 3FL7A 4PCRA 4AWDA 1R1A3 3CU7A 4RL7A 1ZBE2 3GBWA 5CVRA 4DUWA 3I3MA 2A73B 1G9AA 4K40A 3I3QA 3BB6A 4B3NA 3M7AA 3V0AA 3NSTA 2PLV2 2JKBA 4N9HA 4Y20A 3RJRA 2FDFA 4GMP0 5H9PA 2ZAAA 1GWMA 1HRI3 3LKJA 1V9U1 4UFJA 1IS4A 3CIHA 4I0AA 2R073 4QKNA 1ND3A 2JE8A 3DKQA 4M0HA 1JI6A 5BNOB 2XQXA 4QU2A 3J26N 1VBA2 1YNAA 2J1UA 2ZX3A 2D3SA 5T54A 1UCXA 2HKXA 1HQWA 4IEWA 4IE5A 1UN1A 4TZDA 1DCSA 1CJPA 4CU9A 1RUD1 1YEWA 2EIDA 3RYKA 1NKGA 1ZA7A 2WZR1 2YV8A 4JGZC 1UY4A 1I5ZA 4MXWA 5T3NA 1F5FA 1SHWB 4XDPA 5GZCA 1PM7A 1QJY1 4HXCA 2R6QA 4OZXA 4Y33A 5C8WA 1VE0A 3VD3A 1RB8G 3SXWA 1LB2A 2GC2A 1ZM1A 1WLTA 1MS0A 3I59A 4QPWA 4R8HA 2YC0A 2X29A 3HR9A 1H6YA 4KWKA 2F6BA 4LR4A 3EMRA 5F2WA 2QVSB 3QD6A 1RUE3 4IV3B 5JXGA 2XL9A 1UQXA 2WFPA 3HEIA 4MLOA 4CTEA 4C8DA 4Y1XA 3HN1A 5T5OA 4GWIA 1BMV2 2YB7A 4M01A 2J1SA 1NXD1 2E7TA 1EY2A 2ZEZA 2ZGLA 3EBRA 4Y4YA 4BXFA 4CRQA 4DB5A 1WZXA 2UY9A 5CFDB 1GU3A 1A3KA 2GZWA 2VMEA 5B4XA 4COVA 3SISA 3GYDA 1SQ4A 1TZOA 3IT8A 3WR0A 2HWE1 1VR3A 4J6GA 5IAXA 1CZVA 1W8NA 3MW4A 3POSA 3OUJA 2B9UA 1WCDJ 3EHKA 3FC0A 1YQ8A 1LESA 1MQTA 1UYXA 2E53A 3K4ZA 1AXZA 4QX5A 1NCQA 3Q8FA 3DYMA 1RTVA 2J1RA 1U5XA 3NV1A 5DZEA 4JTOA 4OI0A 3F95A 1UPIA 5BXXA 4I2OA 2W1UA 5FK7A 2JDZA 3CO2A 4EROA 3E6CC 2K9ZA 4AQ6A 5FPXA 1YFYA 3I4IA 1GQHA 1NLQA 1YUDA 2K46A 1O3QA 1WMXA 4XF3A 3ZXDA 4QHBA 2NMNA 4TN7A 4AVVA 5BNPA 1SBDA 2Y26A 4ZS2A 3LZZA 3ACGA 4XW3A 4CDWC 5F6KA 5FUIA 4AVTA 1U5YA 1W8UA 4NE9A 5FZ9A 2XKPA 2ZGUA 3MPPG 1DU3D 3NWKA 4CPBA 3QBQA 1UIJA 4J25A 2WT2A 1G9CA 4CXWA 4RR3A 2OXBA 2ZGNA 1X82A 2K2SA 4XTMA 1RXGA 4I02A 3JQXA 1APNA 5GKAC 2RS13 3POYA 3ZSEA 2DUQA 3NJYA 2AUYA 1O8PA 3OPTA 2XJUA 1W6OA 4CZSA 1DGWX 5IJRA 2JD9A 1WCKA 5A3WA 5F32A 5I93A 4CP0A 4LOTA 2VBBA 1UKGA 5DZFA 4AEDB 3GHMA 3T1LA 1VJ2A 5K0UB 4JVAA 1OI6A 5LY1A 5GLWA 2DF7A 4QGNA 4WVMB 3URFA 5FBZA 4XZPA 4LXLA 4TLFA 1VP6A 4L2NA 4FFHA 4WM8C 4JAAA 3KF5A 3SITA 4FCAA 3ZSJA 5IYYA 3C3VA 1JN2P 5FY7A 3ZXLA 4QXHA 2BYVE 3WEZA 4YW7A 5LWBA 3ZIWA 1UNBA 3B7MA 3T0BA 5F5IA 1MACA 5J98B 3AYDA 1UW8A 5A33A 4QD2A 3U75A 4C91A 2QQLA 1CAXB 2RDNA 3RFRA 2P3YA 4RR3B 2G4IA 3I3BA 4S2GA 4CUCA 1BEV3 4HT1T 4CU8A 5A3LA 1K42A 1HV0A 3IDEA 3NJXA 1C5HA 1GOGA 1I9RA 3T08A 2DURA 2VQUA 2FZ1A 1K5JA 4XCBA 1OXCA 4S2HA 5F5QA 1G9FA 4L99A 1PVC2 1W03A 1PO23 3OCPA 4P5HA 2WUHA 2C26A 1HB1A 1RUI2 3VBUA 3K75B 3WW3A 1NE6A 1YHFA 4XBQA 1Q8OA 2FDHA 2D6KA 3IDAA 4PLMA 1LRHA 4QPGB 1NAEA 5FPVA 2JX9A 3USUA 4EYUA 1VRH2 1GP5A 5C33A 5C71A 1RUJ2 4GB31 1OVPA 5FZHA 1X9PA 1Y9MA 3JBG3 3THPA 2XPJA 5CYYA 5CG9A 1PK6A 3TEYA 1SEFA 2H0VA 1UYPA 2PLV1 4MX3A 2Q1ZB 2W1QA 4XMAA 1LU1A 4BQYA 3WP6A 5IFTA 3N7LA 1HKDA 2QQUA 4PQQA 4NIIA 4CEWB 2ET1A 4BHPA 4XBNA 3B69A 4PI0A 3WV6A 4GB33 1KD7A 1CPNA 1AYM3 4E8DA 2LROA 1OHFA 4AVBA 2Q8EA 1VAVA 4ONUA 4HN0A 1QDCA 2DBIA 3EJKA 3PMSA 3M4FA 1XBFA 5C4WB 1C1FA 1W0OA 2DCKA 2QNKA 4KWLA 5A1FA 5LB6A 4P00B 1VB2A 4QMAA 3ZPOA 3INAA 1WLCA 3I2HA 3ZYGA 4DZGA 4QHZA 2HWC1 4FPGA 3RGBA 5C8CB 2R072 1DGRA 1K12A 2P6CA 3KWVA 4GD4A 2V09A 1QF3A 1VRH1 2JG9C 2P17A 3D8CA 3POFA 4RGAA 5BNNC 1AR62 3M70A 4YZ1A 4I0WB 1K5MA 3MZHA 1XNKA 4QPGC 2J1EA 2FDKA 5FIXA 3WSOA 4LT5A 2D7FA 2DTWA 5HI0A 5JPMB 3AKSA 1CAUB 2ZA9A 1RVF1 1JS9A 2WN3A 3ILNA 3PNAA 4MXWB 1XSRA 3HVDA 4A7ZA 5L7OB 2OUHA 1R1A1 3ENRA 3WVJA 1O3RA 3NNFA 1BEV1 1PK6B 1H0BA 2AENA 3H3LA 4ZY9A 2GN7A 3VBRC 1RUI3 1HQLA 1QOOA 3AL5A 4TTGA 3UNPA 4LORA 4HONA 3O1UA 3KV6A 4UFIA 4ATFA 5KHGA 3HJRA 2VNGA 3WW1A 3T09A 5BNOA 3VZNA 3W59A 4BQ1A 1YIPA 1CPMA 3THDA 3R6SA 2VBDA 5A1AA 4NROA 1JZ5A 2ZJCA 2VNRA 4LHSA 2B5HA 4N53C 3ZFEB 3WDUA 2VOXA 4DIQA 1LENA 2YMZA 3VZKA 1OLRA 1MS9A 4ES8A 2YC4A 3KLSA 5FOBB 3G6JB 3MF9A 3WG1A 3I59B 2G1MA 4I01A 1DZQA 4GWNA 1RUI1 2CAUA 1S0EA 2JG9B 3VBSB 5J48A 4QKDA 3CZJA 3E1F1 3WF0A 3K4AA 1DQ1A 2B9VA 4CCCA 5IK5A 2ES3A 3ATGA 3I7DA 4RQPB 1OT5A 4FFFA 5ANNA 1UZYA 4MZUA 3H8RA 3TEWA 1UU5A 4AXOA 5DUXA 4BWOA 3ZN4A 1XE0A 3WNNA 2P2KA 1QQP1 4KU7A 3J9SA 4HSLA 1ZVFA 4QQLA 5K0UA 1FMD2 2NN8A 2XDVA 4HK8A 1LAJA 1VBA1 2BW8A 2XMLA 4H55A 1S1AA 1Z7S3 4IV3A 4Y22B 3ZXEA 1NCRA 1IG3A 2R042 3AM2A 5LA9A 3T4HB 2VTXA 3T4VA 4QAWA 4YGBA 1SPPB 3AX4A 5AC91 2B45X 2WA4A 1WA4A 1SLLA 1JYTA 4KGGA 2Q0AA 1TG7A 4AEDA 4AL9A 1MZFA 2GN3A 4AFCA 1SLAA 4F7ZA 1VBC3 3PJYA 4JGZB 4Q4V3 2BGPA 4YM3A 2YGLA 5C9AA 1ZBE3 1HIXA 4IEYA 1JZ3A 5LBCA 1KS5A 2B39A 1GNYA 2W39A 2WWUA 4LQRA 4RN5A 1QXRA 1DQ5A 4B29A 3IBMA 2WFF2 4D7SA 2QDNA 3VBHC 3ZYRA 3ZXKA 1DP0A 2ZZQA 1ND3C 3KZ4C 4A7KA 4CEWC 3KT4A 4K9SA 4BQ4A 1OC1A 3LA2A 3M2MA 4S2FA 2O8QA 3LEGA 4PDWA 1IQAA 1ND3B 3ZMNA 1OFSA 4Z1VA 4BLJA 1TME1 1OSGA 5GZDA 3TEZA 2ARBA 1AVBA 1LECA 5KHIA 3IDCB 3VBOB 1QGLA 2EAKA 2QZ3A 1NCRC 3J7LA 5JOYA 2BWAA 4Y1ZA 3K2OA 5HV4A 1NYWA 5KR7A 4GJYA 2WS91 3I8TA 3J7HA 1HRV3 4YVWC 5JMCA 2QFEA 3ZN6A 3MUZ1 2FZ2A 5D21A 4CDXC 2TUNA 1V9U3 3LIHA 4FPFA 4LBKA 4LBQB 4R9BA 5EXOA 3ZFGA 1UL9A 5DPNA 1DIWA 3K51A 3KHBA 4P14A 1ZX5A 5KHJA 3B93A 2E51A 1RUH3 3BKZA 2JE9A 3IWZA 1CN1A 1C1LA 1KDKA 1O59A 3HQRA 2VUCA 3NKGA 5A3TA 3N7MA 5LA0A 2CHHA 1KRIA 4OZOA 3PVOA 2BV4A 1AZDA 3JD72 5FZ4A 1KFUL 2BBVA 3WW2A 5TSWA 2WNVB 5FYMA 2P1BA 2Q5TA 3JU9A 1V6KA 2WO3A 1BMV1 1XNCA 3PIJA 2BEOA 5FQ0B 3JB4C 2VC9A 4NMIA 4Q4X2 2PHDA 1E5IA 2TBVA 3OEAA 5EP9A 2P4EA 3R0RA 1PO11 2B46X 4XTPA 1N1VA 3T1MA 5LCWL 2QCSB 2DVFA 1QJZA 2BNOA 4GAZA 1PHMA 1OLMA 4E2QA 1VB4A 2C1FA 4K1ZA 3OYWB 4LMFA 1G9BA 2ZEWA 3P5BA 4C1WA 2E7QA 2VMFA 4L97A 3TN93 1FT9A 1CD3G 3LE0A 1U12A 4XUQA 5E88A 1RMU3 2R063 3WNMA 1QNYA 3FLRA 3BTAA 5FZBA 2QE3A 5F8PA 5JLVA 1W9WA 1W39A 3CJIC 2VQAA 2R7EB 4LO6B 5FY9A 4R52A 1XE8A 5LRRA 3H50A 1H30A 2ZCWA 3I2DA 2X8KA 4YFWA 2CGOA 3UKNA 1IG0A 4I0BA 4JX0A 1NT0A 4UF0A 5C8CC 3DGTA 3A4UA 1SFPA 2ERFA 2DVAA 3P1IA 4JGYB 1EUUA 2VXJA 5FZIA 3FLPA 1M4WA 1RINA 2EA7A 2VZSA 3PUQA 5EQUA 2HLEA 2RM23 5J3UA 3MICA 4CE8A 2A6ZA 1JOBA 4XC9A 2WS92 1UWWA 1ENRA 2OQ7A 5FYSA 4ARYA 1IPSA 1E5HA 3H3ZA 3HT2A 5BNPC 2XJQA 3LAGA 2Z69A 1C8M1 2IFWA 2Y33A 4XBLA 2DCTA 2HWF1 3FMGA 2K0GA 1GYKA 1CONA 3CBNA 2WNEA 1W6QA 4GA9A 4M4PA 4XXPA 1GANA 2AH2A 3WCRA 4PQ9A 2OZ6A 5CADA 1QJU1 3DYPA 5ABJA 1A8MA 4CP9A 5FYBA 4FOVA 4IGQA 2PFWA 2W46A 3BOPA 1Y4WA 3MIDA 3MLJA 3HNBM 5IVYA 3ASIA 5EPAA 1W2AX 3OD0A 2BDRA 4NN0A 5FP4A 1J1LA 2PAMA 1LKNA 3MHZA 2QUOA 4MGQA 3O1PA 3ZKYA 2BNMA 2XBO3 2D6LX 4LBQA 4AW7A 3VDDC 2CYFA 3EB7A 3HIFA 3OD4A 4EZ4A 1Q56A 4DRVA 4Q4Y2 5F3EA 1W6MA 2D40A 3OY8B 4IV1A 2ZMLA 5FMBA 2XOMA 4P9JA 4A7YA 5IVVA 2HYXA 3UJOA 1GICA 1RUF1 4ITCA 4XZUG 1RUJ1 2JENA 2VZUA 4BDVB 4QXKA 2DU0A 2WJSA 4K21A 2E9QA 3GALA 1US2A 4YZ5A 3KQRA 5I0DA 4R9CA 3KT1A 3ORJA 1RUH1 1U5ZA 2VPVA 4FPLA 5G05L 1VRH3 1WCSA 2BVBA 3LEMA 2WN2A 1HRI2 3DXTA 4YGDA 5JZGA 5LW9A 3WNPA 5I8TA 2RDSA 3R05A 3VZOA 4AHZA 4JDNA 4GH4A 1NZIA 3BPSA 3OBTA 4MO3M 2RV9A 2VMIA 4ASKA 3DF0A 4BK5A 4M3CA 2X10A 3LSEA 2WQ4A 5IT6A 3USSA 3I2FA 3OSDA 3OGRA 5FMOS 5K8SA 4BQ3A 2NPIA 4Q1PA 1T6BX 3NJVA 2ZGRA 4HZFA 3ACHA 5EYXA 3VZJA 1PO13 4N90A 3CL1A 1UYYA 1S55A 1XJAA 4COWA 4D7YA 1O91A 1XOYA 4JKKA 3DV8A 4FQ4A 5JR7B 1REEA 1UXZA 1W3VA 2VZ1A 1SPPA 1SZBA 4KL1A 2ZEYA 5ACA3 3AYEA 5FLJA 1MPXA 1CWPA 4FXKB 4GMP1 3MIEA 5IK7A 4BZ4A 1GP6A 2DDUA 3POWA 2WNUA 4XJWA 5C3QA 1AL21 1HV1A 2R0HA 3P6BA 2OVUA 5FO9B 2WT1A 1POV3 2AR6A 1G86A 5DAWA 5ERLA 1JMUB 2CU5A 1FNYA 3PDQA 3E5QA 5HCAA 1DHKB 2QQWA 1WD4A 4AVAA 3NO8A 4EN8B 4PJYA 2G19A 1RUG3 5A7WB 2D6PA 3D0SA 5DAPA 3VBSA 2W92A 3S0MA 2ARXA 2B8MA 5JCTA 5JWPA 2YBPA 3MF6A 2ADDA 3N9NA 3JB8A 4BMEA 2D6MA 2WRAA 3OGJA 3A7QA 4HG6B 4WZCA 2XWBB 1QQP3 4N43B 4XDQA 3WNLA 4Y3OA 5A3MA 2PHXA 2R043 4LNVA 2XQRA 4D0QA 3PVEA 3VBUB 4EV0A 4OMCA 2YU2A 5IK4A 2GNBA 2E32A 2W1SA 4YSFA 4N53A 2JDYA 3T2OA 1WW6A 2PELA 4CU6A 4GJZA 4UWDA 4BJ0A 2V4VA 1TE1B 4XXAA 1D2QA 4RA0A 3QACA 2OKXA 1XE7A 1OPMA 5FZOB 1G8WA 2BBAA 3B5LB 2IWGB 3LEKA 3WW4A 3SLIA 1RUOA 2H6BA 3IAQA 4EN6B 1QJU2 2VL4A 1Y9QA 3ZYFA 4L9BA 1RYYA 2VCBA 2VULA 4E4DX 1AR83 2YUEA 2HEWF 4NHYA 5FPAA 3THCA 3I97A 4G3YC 1STMA 1DQ4A 5E1RA 2HJIA 1O4ZA 3HBZA 4NUBA 5GM0A 3SHRA 5FY4A 5JXIA 4INDA 3U11A 3ON7A 1REDA 1VBD1 2CWSA 4DNYA 2VY0A 2ZPXA 4L11A 1KITA 3ZX7A 4BE3A 3IM0A 1NCRB 2VBPA 3FE5A 3VKFC 2WNUB 1CAVB 2Y0OA 1CQ9A 1TMF3 3LDKA 3NVCA 4YNIA 2UU8A 4B7KA 5CBLA 1BVVA 1LTEA 4KG8A 5DAXA 5CKNA 1GQGA 4WBBA 3WLUA 4QX3A 1PVC1 4BA6A 2WNUC 4V1PA 1JZ2A 5A7PA 5IVBA 2RHPA 2WAOA 3N35A 1N1SA 4WVWA 3CDZB 3O1VA 3RZHA 2ZX4A 1U5IA 1D4M1 1RUD3 2VVDA 1QJFA 1H9WA 1MS5A 4LA2A 3PLQA 5C5UA 5JVVA 4LBJA 3OF1A 4Q2FA 1WWYA 1VBC2 4Q4V2 4AYUA 1REFA 4YZ2A 1V6OA 1UKRA 4FFIA
chains in the Genus database with same CATH topology
1O8PA 2QBXA 2VZPA 5IJRA 2JD9A 4LPLA 2W87A 2VM9A 4QB1A 2ORZA 3ETPA 3I2IA 3T2PA 1BHGA 1JU3A 4CVUA 2VZVA 1ULPA 5JXJA 4ZXEA 1GQPA 5IYYA 3CKHA 3NNGA 1K3IA 3MO4A 1XNAA 2QQNA 2W1WA 3VD5A 3WEZA 3T0BA 2VZQA 2JKXA 2QQLA 3ZM8A 1PX4A 3I3BA 4CUCA 4CU8A 1K42A 4A42A 3NJXA 1GOGA 3IIIA 3T08A 1NX9A 1O8SA 2VQUA 1OH4A 4AAXA 4A6OA 3I2GA 4QB6A 2WUHA 1R64A 2C26A 3K75B 4XVHA 4DEVA 4UAPA 3T0AA 3MV01 2C4XA 3IDAA 1NAEA 5C71A 2VOTA 5CYYA 2Z4FA 4DXRA 4PT6A 4OUEA 1YQ2A 3LPFA 2W1QA 5IFTA 4QX2A 4QX0A 3EYPA 4PQQA 3K4DA 5JMOA 5IHRA 3U37A 3IAPA 3DYOA 2VZOA 4E8DA 2VCAA 4JKLA 1F4HA 1UY1A 2DCKA 5C7GA 1KGYA 4P00B 2BERA 2VCCA 3I2HA 3WF1A 1UXXX 3W5NA 3VDAA 3A22A 4UI9L 1K12A 4M4RA 3CQOA 2QQIA 1JYWA 4KMQA 1GOHA 1DYOA 2J1EA 3WSOA 2Y6GA 3GDBA 3A21A 5EIYB 2WN3A 2WQ8A 4YPJA 2EIBA 2W94A 4ZY9A 3PUIA 2Y6LA 2LW8A 1UMHA 1WCQA 1W8OA 4CUAA 4TTGA 4AG4A 3UNPA 3HJRA 5HXMA 1CZSA 3T09A 2RVAA 3THDA 1JZ8A 3HN3A 3JXSA 5A1AA 3OBAA 1JZ5A 4LHSA 5JXIA 5J1XA 4CUBA 2YC4A 3IB3A 4E8CA 4L0PA 5B4NA 3W5MA 4Z2AA 3LEIA 4FI9A 3CZJA 3E1F1 2WABA 3K4AA 2B9VA 3WF0A 5IFPA 1OT5A 1W9TA 3VD9A 4A41A 2J22A 3WNNA 1UY2A 1PMHX 4MOAA 5JR2A 3MBWA 4QDRA 2BZDA 4DXSA 1UMIA 4QAWA 1W0NA 1GMMA 2YG0A 1TG7A 2WYSA 4XUOA 2J7MA 2BGPA 4UOJA 1JZ3A 4W8JA 2WBKA 2X09A 4LQRA 2KD7A 1GNYA 2VR4A 3OG2A 4RN5A 1T2XA 3C7FA 1TVGA 4QX1A 1DP0A 3ECQA 2Y6JA 3LEGA 5LA2A 2PQSA 2VMCA 4RYDA 3C7EA 3NRUA 3C8XA 3CMGA 5LA1A 2ZEXA 4BXSV 1F4AA 2E31A 4P02B 1GUIA 4BK4A 3SKJE 3UESA 2J1TA 1OD3A 3J7HA 3OGVA 5DQ0A 3MUZ1 5DMYA 5DPNA 2YFUA 4XURA 2VZ3A 4A3ZA 1W9SA 5CZKA 2YFZA 1O59A 5LA0A 2W95A 2WO2A 4OZOA 1PMJX 1JYVA 2WAAA 2ORXA 4ARXA 2WO3A 2LS6A 3I2JA 2VC9A 3UETA 3OEAA 2ZXQA 4QB2A 2QQKA 4QDSA 5LCWL 2WZEA 2V72A 5EJ1B 1UX7A 3ACIA 4XUNA 2RJ2A 2ZEWA 2VMFA 3LE0A 4A44A 4XUQA 1JZ7A 3WNMA 1DLCA 3MUY1 2Y8KA 1W9WA 1SDDB 2E26A 2R7EB 4XUPA 3I2KA 3ACFA 4P5YA 3LQCA 3HOBA 1ULOA 4JX0A 4JKMA 4XUTA 4ET7A 1OF4A 3SEEA 2WO1A 3P1IA 2Y6HA 1EUUA 3K46A 4DXTA 2QQOA 3HNYM 2XONA 2WDBA 3I3EA 2J1VA 2VZSA 2W91A 2W47A 2HLEA 1XC6A 4MADA 5F7UA 1CZTA 1UWWA 3DECA 4ARYA 4ZZ8A 1PX3A 2W5FA 4KI5M 3WF3A 2X05A 1I5PA 4M4PA 1US3A 4DUXA 3WNOA 1W99A 3DYPA 3CZUA 3F2ZA 2E33A 2VTFA 2BGOA 4LKSA 2W46A 3C7OA 3HNBM 2J1AA 3GGLA 2JDAA 3VDBA 4OMDA 2W3JA 3VDCA 4MGQA 3OB8A 2YC2A 3GM8A 3EB7A 2Y64A 1JZ6A 1P8JA 2XOMA 4P08A 2HYXA 4XZUG 4BDVB 2VZUA 3BGAA 3SEPA 2CDOA 4TXWA 1US2A 2VQTA 2VJXA 2QQJA 3HPNA 4DUVA 5I0DA 3AC0A 3LPGA 2W9XA 4D8MA 3C7GA 3FN9A 4MGSA 4DEQA 5G05L 3D3AA 3FHQA 3SKVA 3NQHA 2WN2A 4GWJA 2B4KA 5HPOA 1JYXA 1UY3A 3WNPA 1OF3A 5C70A 3VD4A 1JYNA 2V5DA 3GXUA 1HN1A 4A4AA 4MO3M 2RV9A 3I3DA 4PF1A 2DCJA 4BK5A 2X10A 3I2FA 3FL7A 3OGRA 3VD7A 2Y6KA 5G04L 3NJVA 2L9LA 4DUWA 3ACHA 1UYYA 3PUHA 2VO5A 3WNKA 4JKKA 3OEBA 1UY0A 1UXZA 4W50A 2VZ1A 1NUKA 2ZEYA 2C9KA 1MPXA 3K77A 1H6XA 5DN2A 3WQBA 2EICA 2DDUA 3CIHA 1L7RA 3C7HA 3P6BA 2JE8A 3T0DA 1JI6A 2XQXA 2J1UA 4KWUA 4IUGA 3T2QA 5EJZB 4CU9A 5JUVA 2EIDA 2ID4A 1NKGA 1SG3A 2VZRA 3WF4A 1UY4A 2W92A 2VMDA 1SHWB 1K45A 3FHAA 3VD3A 1LNSA 2QQMA 4GZ9A 4HG6B 3A7QA 4QPWA 3WNLA 1J84A 4JHZA 1H6YA 4D0QA 4OMCA 1IQDC 5JXGA 3HEIA 2E32A 2W1SA 3T2OA 4CU6A 4GWIA 4BJ0A 3HNMA 2YB7A 2J1SA 2V4VA 1KEXA 2ZEZA 4QDQA 2OKXA 2BBAA 3LEKA 3MV11 1GU3A 2VMEA 3IAQA 5B4XA 1GOFA 4A45A 2VL4A 1RYYA 2VCBA 1CZVA 1J83A 1CIYA 1W8NA 2CDPA 4ZZ5A 1UYXA 3THCA 3I97A 3WF2A 3K4ZA 4CU7A 3DYMA 1L7QA 2J1RA 2VZTA 1XNTA 1JZ4A 2W1UA 1JU4A 5JXHA 1JHJA 4OYUA 2XHNA 1CX1A 4W4ZA 3ABZA 1WKYA 3BN6A 4QX3A 3ACGA 5FUIA 1JZ2A 2WZ8A 1XPWA 1D7PM 2WAOA 3CDZB 3OGSA 1UYZA 1EUTA 2EIEA 1UZ0A 3A23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8P A;  2QBX A;  2VZP A;  5IJR A;  2JD9 A;  4LPL A;  2W87 A;  2VM9 A;  4QB1 A;  2ORZ A;  3ETP A;  3I2I A;  3T2P A;  1BHG A;  1JU3 A;  4CVU A;  2VZV A;  1ULP A;  5JXJ A;  4ZXE A;  1GQP A;  5IYY A;  3CKH A;  3NNG A;  1K3I A;  3MO4 A;  1XNA A;  2QQN A;  2W1W A;  3VD5 A;  3WEZ A;  3T0B A;  2VZQ A;  2JKX A;  2QQL A;  3ZM8 A;  1PX4 A;  3I3B A;  4CUC A;  4CU8 A;  1K42 A;  4A42 A;  3NJX A;  1GOG A;  3III A;  3T08 A;  1NX9 A;  1O8S A;  2VQU A;  1OH4 A;  4AAX A;  4A6O A;  3I2G A;  4QB6 A;  2WUH A;  1R64 A;  2C26 A;  3K75 B;  4XVH A;  4DEV A;  4UAP A;  3T0A A;  3MV0 1;  2C4X A;  3IDA A;  1NAE A;  5C71 A;  2VOT A;  5CYY A;  2Z4F A;  4DXR A;  4PT6 A;  4OUE A;  1YQ2 A;  3LPF A;  2W1Q A;  5IFT A;  4QX2 A;  4QX0 A;  3EYP A;  4PQQ A;  3K4D A;  5JMO A;  5IHR A;  3U37 A;  3IAP A;  3DYO A;  2VZO A;  4E8D A;  2VCA A;  4JKL A;  1F4H A;  1UY1 A;  2DCK A;  5C7G A;  1KGY A;  4P00 B;  2BER A;  2VCC A;  3I2H A;  3WF1 A;  1UXX X;  3W5N A;  3VDA A;  3A22 A;  4UI9 L;  1K12 A;  4M4R A;  3CQO A;  2QQI A;  1JYW A;  4KMQ A;  1GOH A;  1DYO A;  2J1E A;  3WSO A;  2Y6G A;  3GDB A;  3A21 A;  5EIY B;  2WN3 A;  2WQ8 A;  4YPJ A;  2EIB A;  2W94 A;  4ZY9 A;  3PUI A;  2Y6L A;  2LW8 A;  1UMH A;  1WCQ A;  1W8O A;  4CUA A;  4TTG A;  4AG4 A;  3UNP A;  3HJR A;  5HXM A;  1CZS A;  3T09 A;  2RVA A;  3THD A;  1JZ8 A;  3HN3 A;  3JXS A;  5A1A A;  3OBA A;  1JZ5 A;  4LHS A;  5JXI A;  5J1X A;  4CUB A;  2YC4 A;  3IB3 A;  4E8C A;  4L0P A;  5B4N A;  3W5M A;  4Z2A A;  3LEI A;  4FI9 A;  3CZJ A;  3E1F 1;  2WAB A;  3K4A A;  2B9V A;  3WF0 A;  5IFP A;  1OT5 A;  1W9T A;  3VD9 A;  4A41 A;  2J22 A;  3WNN A;  1UY2 A;  1PMH X;  4MOA A;  5JR2 A;  3MBW A;  4QDR A;  2BZD A;  4DXS A;  1UMI A;  4QAW A;  1W0N A;  1GMM A;  2YG0 A;  1TG7 A;  2WYS A;  4XUO A;  2J7M A;  2BGP A;  4UOJ A;  1JZ3 A;  4W8J A;  2WBK A;  2X09 A;  4LQR A;  2KD7 A;  1GNY A;  2VR4 A;  3OG2 A;  4RN5 A;  1T2X A;  3C7F A;  1TVG A;  4QX1 A;  1DP0 A;  3ECQ A;  2Y6J A;  3LEG A;  5LA2 A;  2PQS A;  2VMC A;  4RYD A;  3C7E A;  3NRU A;  3C8X A;  3CMG A;  5LA1 A;  2ZEX A;  4BXS V;  1F4A A;  2E31 A;  4P02 B;  1GUI A;  4BK4 A;  3SKJ E;  3UES A;  2J1T A;  1OD3 A;  3J7H A;  3OGV A;  5DQ0 A;  3MUZ 1;  5DMY A;  5DPN A;  2YFU A;  4XUR A;  2VZ3 A;  4A3Z A;  1W9S A;  5CZK A;  2YFZ A;  1O59 A;  5LA0 A;  2W95 A;  2WO2 A;  4OZO A;  1PMJ X;  1JYV A;  2WAA A;  2ORX A;  4ARX A;  2WO3 A;  2LS6 A;  3I2J A;  2VC9 A;  3UET A;  3OEA A;  2ZXQ A;  4QB2 A;  2QQK A;  4QDS A;  5LCW L;  2WZE A;  2V72 A;  5EJ1 B;  1UX7 A;  3ACI A;  4XUN A;  2RJ2 A;  2ZEW A;  2VMF A;  3LE0 A;  4A44 A;  4XUQ A;  1JZ7 A;  3WNM A;  1DLC A;  3MUY 1;  2Y8K A;  1W9W A;  1SDD B;  2E26 A;  2R7E B;  4XUP A;  3I2K A;  3ACF A;  4P5Y A;  3LQC A;  3HOB A;  1ULO A;  4JX0 A;  4JKM A;  4XUT A;  4ET7 A;  1OF4 A;  3SEE A;  2WO1 A;  3P1I A;  2Y6H A;  1EUU A;  3K46 A;  4DXT A;  2QQO A;  3HNY M;  2XON A;  2WDB A;  3I3E A;  2J1V A;  2VZS A;  2W91 A;  2W47 A;  2HLE A;  1XC6 A;  4MAD A;  5F7U A;  1CZT A;  1UWW A;  3DEC A;  4ARY A;  4ZZ8 A;  1PX3 A;  2W5F A;  4KI5 M;  3WF3 A;  2X05 A;  1I5P A;  4M4P A;  1US3 A;  4DUX A;  3WNO A;  1W99 A;  3DYP A;  3CZU A;  3F2Z A;  2E33 A;  2VTF A;  2BGO A;  4LKS A;  2W46 A;  3C7O A;  3HNB M;  2J1A A;  3GGL A;  2JDA A;  3VDB A;  4OMD A;  2W3J A;  3VDC A;  4MGQ A;  3OB8 A;  2YC2 A;  3GM8 A;  3EB7 A;  2Y64 A;  1JZ6 A;  1P8J A;  2XOM A;  4P08 A;  2HYX A;  4XZU G;  4BDV B;  2VZU A;  3BGA A;  3SEP A;  2CDO A;  4TXW A;  1US2 A;  2VQT A;  2VJX A;  2QQJ A;  3HPN A;  4DUV A;  5I0D A;  3AC0 A;  3LPG A;  2W9X A;  4D8M A;  3C7G A;  3FN9 A;  4MGS A;  4DEQ A;  5G05 L;  3D3A A;  3FHQ A;  3SKV A;  3NQH A;  2WN2 A;  4GWJ A;  2B4K A;  5HPO A;  1JYX A;  1UY3 A;  3WNP A;  1OF3 A;  5C70 A;  3VD4 A;  1JYN A;  2V5D A;  3GXU A;  1HN1 A;  4A4A A;  4MO3 M;  2RV9 A;  3I3D A;  4PF1 A;  2DCJ A;  4BK5 A;  2X10 A;  3I2F A;  3FL7 A;  3OGR A;  3VD7 A;  2Y6K A;  5G04 L;  3NJV A;  2L9L A;  4DUW A;  3ACH A;  1UYY A;  3PUH A;  2VO5 A;  3WNK A;  4JKK A;  3OEB A;  1UY0 A;  1UXZ A;  4W50 A;  2VZ1 A;  1NUK A;  2ZEY A;  2C9K A;  1MPX A;  3K77 A;  1H6X A;  5DN2 A;  3WQB A;  2EIC A;  2DDU A;  3CIH A;  1L7R A;  3C7H A;  3P6B A;  2JE8 A;  3T0D A;  1JI6 A;  2XQX A;  2J1U A;  4KWU A;  4IUG A;  3T2Q A;  5EJZ B;  4CU9 A;  5JUV A;  2EID A;  2ID4 A;  1NKG A;  1SG3 A;  2VZR A;  3WF4 A;  1UY4 A;  2W92 A;  2VMD A;  1SHW B;  1K45 A;  3FHA A;  3VD3 A;  1LNS A;  2QQM A;  4GZ9 A;  4HG6 B;  3A7Q A;  4QPW A;  3WNL A;  1J84 A;  4JHZ A;  1H6Y A;  4D0Q A;  4OMC A;  1IQD C;  5JXG A;  3HEI A;  2E32 A;  2W1S A;  3T2O A;  4CU6 A;  4GWI A;  4BJ0 A;  3HNM A;  2YB7 A;  2J1S A;  2V4V A;  1KEX A;  2ZEZ A;  4QDQ A;  2OKX A;  2BBA A;  3LEK A;  3MV1 1;  1GU3 A;  2VME A;  3IAQ A;  5B4X A;  1GOF A;  4A45 A;  2VL4 A;  1RYY A;  2VCB A;  1CZV A;  1J83 A;  1CIY A;  1W8N A;  2CDP A;  4ZZ5 A;  1UYX A;  3THC A;  3I97 A;  3WF2 A;  3K4Z A;  4CU7 A;  3DYM A;  1L7Q A;  2J1R A;  2VZT A;  1XNT A;  1JZ4 A;  2W1U A;  1JU4 A;  5JXH A;  1JHJ A;  4OYU A;  2XHN A;  1CX1 A;  4W4Z A;  3ABZ A;  1WKY A;  3BN6 A;  4QX3 A;  3ACG A;  5FUI A;  1JZ2 A;  2WZ8 A;  1XPW A;  1D7P M;  2WAO A;  3CDZ B;  3OGS A;  1UYZ A;  1EUT A;  2EIE A;  1UZ0 A;  3A23 A; 
#chains in the Genus database with same CATH topology
 2LM3 A;  2HEY F;  2ZGM A;  3AMQ A;  4HN1 A;  2Y0I A;  2GDF A;  3ILF A;  2YDE A;  2QBX A;  2VZP A;  4Q0S A;  3TN9 2;  3U78 A;  2W87 A;  3WD5 A;  2B7Y A;  2JIJ A;  4IEV A;  3FLT A;  4OCT A;  3ZVX A;  4K7J A;  1OD5 A;  1DZR A;  1POQ A;  2A6Y A;  1JU3 A;  1U0A A;  5T52 A;  1ULP A;  5I0S A;  1PGL 1;  5JXJ A;  1GZ9 A;  2A70 A;  3JQW A;  4RGG A;  1COV 3;  4ZXE A;  3SC7 X;  4AEM A;  5JIU A;  1CAW A;  2WSV A;  5SV5 A;  1TME 2;  1FMD 3;  3USU B;  4DFS A;  5BNP B;  4B4P A;  3NNG A;  2GP5 A;  3CNA A;  3NNJ A;  1ZZC A;  1XNA A;  4ZS3 A;  2W1W A;  4DPN A;  1LOE A;  5A6X A;  4XF1 A;  5FKC A;  2A6W A;  5KWR A;  5DXD A;  1QIQ A;  4KWJ A;  3H8O A;  4NRQ A;  5F1R A;  1TEI A;  4QHO A;  4JQT A;  4CP2 A;  5HBA A;  2ARE A;  3SCH A;  2D3R A;  1X7N A;  4WM7 C;  1UMZ A;  1O8S A;  1OH4 A;  3B9I A;  2C9A A;  1EV1 2;  1QJX 1;  1K5M B;  3B00 A;  4LBQ D;  3J4U H;  3OBZ A;  4YVS A;  4DIN B;  4UAP A;  2QQP A;  1Q8P A;  3T0A A;  2A6X A;  5AC9 2;  1BLZ A;  2CTV A;  3LDB A;  4F83 A;  5DDJ 3;  5CFD A;  5FZK A;  2Q8D A;  4AHW A;  1EPW A;  1UZW A;  1AR9 3;  1EAH 1;  1N3Q A;  1F5J A;  1NZC A;  1FV2 A;  1WW5 A;  5EZW A;  1O6U A;  2FCV A;  2Z4F A;  4PT6 A;  2WO7 A;  1YQ2 A;  4FTS A;  3M3E A;  1JUH A;  4LKD A;  3D0J A;  3FFZ A;  1V6L A;  5FUN A;  1RJ8 A;  3EYP A;  3BAL A;  4H2A A;  4YZ3 A;  5FK8 A;  3IMM A;  2A1X A;  2QQV A;  4L92 A;  5LEK A;  1RUN A;  4LK6 A;  5JMO A;  2G9G A;  1ZA4 A;  5IHR A;  1NLR A;  1GNH A;  3IAP A;  3U37 A;  1JW6 A;  3O14 A;  1OLM E;  5FYV A;  4UFK A;  5A80 A;  1M06 G;  4EWA A;  4MG2 A;  3AMH A;  1E5R A;  1BVP 1;  4XET A;  1FPN 2;  1H2N A;  4Y1Y A;  3K3N A;  5EV7 A;  2PAK A;  2XJT A;  3PHM A;  4FPJ A;  4GH4 B;  5C7G A;  2JDH A;  4QGL A;  1KGY A;  4WV8 A;  2VCC A;  4FTE A;  1D0G A;  3AZW A;  4AGR A;  4QQO A;  5JZG B;  4XIO A;  2ENR A;  1C8M 3;  5IUQ A;  4FAH A;  4UI9 L;  1W06 A;  1SMV A;  5AVP A;  1VIW B;  3RS6 A;  1D0H A;  1LR5 A;  5FZE A;  2C5D A;  2O14 A;  3RG0 A;  4BIF A;  2ILM A;  3CQO A;  4Q27 A;  5FWJ A;  2R04 1;  3AP9 A;  1GOH A;  4MGZ E;  2VUD A;  4E4H A;  5CA6 A;  4AHX A;  2WNO A;  5H9R A;  4B1L A;  1RIT A;  5EIY B;  3OY8 A;  4Q5O A;  2GNM A;  2WQ8 A;  2ET7 A;  4N43 C;  4YPJ A;  1YI7 A;  4M3C E;  1DFQ A;  2VG9 A;  3FUO A;  4FOY A;  4N9I A;  4FTB A;  1OQD A;  1ALY A;  3EXU A;  4H3W A;  4AGV A;  3PUI A;  2Y6L A;  5C3R A;  1GP4 A;  1WCQ A;  4AG4 A;  4KBZ A;  2VE1 A;  1QH7 A;  2EAL A;  3KCY A;  5HXM A;  1CZS A;  2PHL A;  2WSU A;  5BV6 A;  3FUQ A;  4RS5 B;  4LHL A;  4CCJ A;  1UU6 A;  4URA A;  3JXS A;  4NHX A;  3OBA A;  1W8H A;  2E6V A;  5FZ3 A;  1TNF A;  4FOW A;  2P5B A;  1AL2 3;  4WVM A;  1FOD 2;  5FP8 A;  4AK3 A;  2F4P A;  3VN4 A;  5J1X A;  1W2T A;  5KBF A;  3W9A A;  1J1T A;  3H0O A;  1POV 1;  1W2U A;  3RQ0 A;  4LTA A;  1JUI A;  2WLQ A;  4Y5T A;  3THT A;  3TWI A;  2A5Z A;  3AFG A;  4B4R A;  4D7T A;  4EQV A;  3BUC A;  1DYK A;  3WDV A;  4E8C A;  2WA3 A;  4OI2 A;  2BPA 2;  1UF2 C;  2VXR A;  3ZN6 B;  3TBD A;  1L3J A;  3B3Q E;  1D4V B;  2RR1 2;  1EPZ A;  3LEI A;  5IAV A;  3ZOI A;  3SQO A;  4FI9 A;  1AYM 1;  4QWN A;  1R09 3;  1H4H A;  3Q8C A;  5JI9 A;  1CES A;  2WWJ A;  3KCC A;  3GZT B;  2FDI A;  3AP5 A;  5FXZ A;  1A6C A;  4CDX A;  3VD9 A;  3C2U A;  3WQ0 A;  2J22 A;  4PBO A;  1DQ0 A;  1RHI 1;  3WX5 A;  3D4K A;  2CY6 A;  3N9Q A;  1PMH X;  1C8M 2;  1O3T A;  4MOA A;  4LE4 A;  1UAI A;  2W2I A;  3NV4 A;  3E6D A;  1XXN A;  2CV6 A;  1X9T A;  3HWJ A;  3BOD A;  3Q9O A;  4XFC A;  4DOU A;  1AR9 1;  3U1X A;  1AX0 A;  3N7K A;  5LAT A;  1XYO A;  1AF9 A;  5FZ7 A;  4FPC A;  5FBJ A;  1JTZ X;  1GZC A;  1OKQ A;  3N3H A;  4KGQ A;  4FAG A;  2HWF 2;  1R1Z A;  1MQT B;  1Z7S 1;  5I8Y A;  1BK0 A;  2EVX A;  2VQ0 A;  1ZZB A;  2HWE 3;  4X6R B;  2JDN A;  1LGN A;  2X09 A;  1W8W A;  2KD7 A;  3OG2 A;  2VR4 A;  5LBE A;  4X8N A;  3C7F A;  1TVG A;  4QX1 A;  1TMF 1;  1PO2 2;  5FZA A;  3VKO A;  2WWS A;  4LK7 A;  5A7Q A;  1WBF A;  3MFA A;  3ECQ A;  1IPJ A;  4MHU A;  2DYC A;  3M1H A;  1ZRI A;  4AED C;  1VBD 3;  4YM0 A;  5LA2 A;  5JPN B;  4Y1U A;  3KGL A;  2ZHL A;  3R4D B;  4P9G A;  4CDW A;  4Z92 B;  2OW4 A;  3C7E A;  1RUE 2;  3IDB B;  4G4F A;  2GND A;  3C8X A;  1GLH A;  3ES1 A;  2JJ6 A;  2XBO 1;  1F4A A;  2DVD A;  2E31 A;  2IZW A;  3CEW A;  4P02 B;  3GZE A;  3KQ4 B;  1FAT A;  1AL2 2;  3O1S A;  4YM2 A;  5FY8 A;  1WLD A;  1YYN A;  1H1M A;  1OD3 A;  2J1T A;  4K6B A;  3RWN A;  4GXL A;  5LK7 B;  1ZRR A;  5FZM A;  2QDR A;  4MUV A;  2HWF 3;  1V0A A;  2XBO 2;  4QQH A;  4UXA A;  2GSY A;  1LOF A;  2O1Q A;  4B4Q A;  4UF0 B;  3QCW A;  3RI8 A;  3AZY A;  2PHU A;  4YGE A;  4UW6 A;  4Q26 A;  1W9S A;  2HWD 2;  4Q4W 3;  5CZK A;  2YFZ A;  5DZG A;  3ELN A;  5FYY A;  5JAX A;  3R4S A;  4LO7 A;  5JSR A;  3JD7 3;  3WDT A;  4RQP C;  1GV9 A;  1QH6 A;  3AXE A;  4PDW B;  2WIN B;  4XFF A;  4TYS A;  3VBF A;  2ORX A;  3AZV A;  4L8Q A;  5A3U A;  3J8F 2;  4UFM A;  5A3P A;  3RI9 A;  4ARX A;  1ULG A;  2RJL A;  2XLG A;  3LOI A;  2PAE A;  1IS6 A;  4GKY A;  3GHN A;  4XJ8 A;  3UET A;  4AEJ A;  4QU1 A;  1H8T C;  2ZXQ A;  4QB2 A;  2WL1 A;  3AXD A;  3AKR A;  4NWV A;  1I3H A;  2WZE A;  4R4X A;  5EJ1 B;  3U07 A;  3BTY A;  2ZHN A;  2R0F A;  4Y24 A;  4LEJ A;  2KXL A;  1R08 2;  1XU1 A;  1KDM A;  3AZZ A;  3BPZ A;  3KVA A;  3ZFE C;  4RSU A;  2VMH A;  4LLF A;  4CDQ C;  5IVC A;  4YGC A;  1FX5 A;  4IDZ A;  1Y9G A;  4A44 A;  1JZ7 A;  3B01 A;  5KXB A;  2OQ6 A;  1AX1 A;  3MUY 1;  4HKW A;  4E2S A;  3BU0 A;  3UKT A;  4YM1 A;  4X6Q B;  2Q8C A;  1PO1 2;  4BCU A;  5C8C A;  2PHW A;  1GNZ A;  4XUT A;  4QPI B;  4XHX A;  4C0B A;  1PNF A;  4ET7 A;  4CCK A;  2A3W A;  5FYU A;  4BH9 A;  3ZFG B;  4AFD A;  2JXA A;  4Q8K A;  1YI9 A;  5C4W A;  4NPM A;  4LO8 A;  5T55 A;  2JB8 A;  3AVR A;  3HNY M;  2P3K A;  2WDB A;  3I3E A;  1QOS A;  1W6N B;  4OHY A;  5JOW A;  4EE2 A;  4MAD A;  3S7I A;  4D6R A;  4AI8 A;  5F7U A;  4DO0 A;  1ZZ8 A;  3DEC A;  5K7P A;  2W5F A;  4P9L A;  1EV1 3;  4WM7 B;  4BM8 A;  5FZF A;  3U0Z A;  4FFG A;  4B1M A;  4IQP A;  5BY5 A;  2OPK A;  3ZKU A;  1HRI 1;  1W8Z A;  2VGD A;  2WLP A;  3N9O A;  2D6N A;  4JV4 A;  4RD7 A;  3PU3 A;  4MET A;  1W99 A;  3F2Z A;  1YJK A;  3O7O A;  4UW3 A;  2E33 A;  1ZBA 2;  2MEV 2;  2VTF A;  1HQN A;  1WW7 A;  2BGO A;  5GJ6 A;  3VLB B;  1E5S A;  2I07 B;  2Q30 A;  4LKS A;  4XMI A;  5GLV A;  5KC6 A;  2MEV 3;  2VVF A;  3ROU A;  5HCB A;  2UUR A;  4XFH A;  4XFI A;  3ZFF A;  3GGL A;  3N36 A;  1C4R A;  3L2H A;  4UYB A;  4F3J A;  1JYI A;  1YFU A;  4BQ2 A;  4W6X A;  3VDB A;  3EO6 A;  4OMD A;  1L7L A;  1SCR A;  4K3U A;  2ARC A;  1YLL A;  1UZV A;  5FP9 A;  3O1O A;  3LF7 A;  2Z42 A;  3VBR B;  4WM7 A;  5F3G A;  4P08 A;  4AVC A;  5A7N A;  3MDP A;  1COV 1;  2GAL A;  3BGA A;  4LHN A;  5CKM A;  4TXW A;  5JSO A;  3TEX A;  4CDU A;  1S0G A;  4BB3 A;  5F3C A;  5FPL A;  3HPN A;  4PF5 A;  4IEZ A;  4LUL A;  1XB9 A;  2C24 A;  3ZYB A;  3C7G A;  4QXC A;  4AVS A;  4MGS A;  2XB6 C;  1ZRC A;  4DEQ A;  1ND2 B;  5B2G B;  1UO9 A;  1Q3E A;  3FHQ A;  4YW5 A;  5A3O A;  5DDJ 2;  4ZU4 A;  5J36 A;  4XHB A;  3O1T A;  4NHL A;  1JYX A;  5HCF A;  1UY3 A;  1OF3 A;  3CF6 E;  4QPI A;  2IXJ A;  5J7M A;  2R1B A;  2WR9 A;  1RVF 2;  4QQ2 A;  4CEY B;  4XFB A;  4Q8L A;  2IXH A;  3IIA A;  4KQ7 A;  1F15 A;  3JD7 1;  4PF1 A;  5FZ1 A;  1ZBA 1;  2DCJ A;  3VBH A;  5A7S A;  2FCT A;  5GZE A;  5T50 A;  1FNZ A;  2RMU 1;  1H2M A;  3S30 A;  4IEP A;  1ULD A;  2OUJ A;  5KHK A;  5IVJ A;  2GC1 A;  4I09 A;  4IGP A;  4IE7 A;  2OZJ A;  1YCI A;  2YGM A;  3B9C A;  3PUH A;  4LKF A;  2VO5 A;  2YBS A;  2E7A A;  5FYC A;  3RPQ A;  3OEB A;  1UY0 A;  4ISR A;  4RS5 C;  4ATE A;  2NMO A;  2QZ2 A;  1F8V A;  2RDQ A;  3AJZ A;  3WP5 A;  5FY0 A;  2C9K A;  5A70 A;  1H6X A;  3GCX A;  1ZYB A;  1QY4 A;  2EIC A;  2XL7 A;  2JDP A;  3AVS A;  4OHW A;  3LCP A;  4R9D A;  2IXK A;  3RSJ A;  2PHT A;  4AFB A;  1MZE A;  3T0D A;  1QJU 3;  2A75 A;  5E89 A;  4OUL A;  5FMD A;  4CUG A;  1LHV A;  2W08 A;  5L36 A;  2RS3 1;  4N53 B;  2PYT A;  3DUI A;  1WME A;  3T2Q A;  5EJZ B;  3VGI A;  1IOA A;  4CCN A;  1PGS A;  5JUV A;  4QT6 A;  1SG3 A;  1MVE A;  2GC0 A;  4OI4 A;  2NQY A;  5T5P A;  5CFC C;  2P34 A;  2QKD A;  1AYM 2;  2VMD A;  3WG3 A;  3I54 A;  4XCA A;  2VVE A;  2Q8O A;  5FMC A;  2MNG A;  2DFB A;  1Z78 A;  2NZ9 A;  4C1X A;  1HN0 A;  5IWF A;  1W8F A;  4GZ9 A;  4HK9 A;  3VHO A;  3HBK A;  2D5F A;  3VDD B;  2RS5 1;  4IW3 A;  5FKB A;  1HXS 3;  4EN0 A;  2NYY A;  3U4X A;  4XQ4 A;  1RL3 A;  3RZJ A;  4JQR A;  1J84 A;  3NV2 A;  4KBB A;  4JHZ A;  3WUD A;  1IZ3 A;  4XIK A;  1XQN A;  2ZTN A;  1SFY A;  2NM1 A;  3X29 B;  1FMD 1;  1IQD C;  1QNW A;  1WW4 A;  4LIT A;  1FOD 1;  4LIU A;  4UBH A;  3ZIX A;  4LLO A;  2HWD 1;  4PLN A;  4V2V A;  4BQX A;  2BFU S;  2YRO A;  4AF9 A;  3DL3 A;  1KEX A;  4LA3 A;  2CSG A;  1VBE 1;  4J1W A;  3M3C A;  2ZGQ A;  3MV1 1;  2VTX J;  3PVB B;  5FPU A;  5FUP A;  2Y60 A;  5JOX A;  1GOF A;  2SLI A;  1HB2 A;  3APB A;  4PBP A;  4A45 A;  4IEO A;  2CGP A;  4M0N A;  2DFC A;  1J83 A;  4CXX A;  1UX6 A;  5LY2 A;  2CDP A;  3ZO0 B;  4XJ9 A;  4ZZ5 A;  2RM2 2;  4UW5 A;  1WLW A;  4Y5S A;  1J58 A;  3WF2 A;  4AQS A;  1UOB A;  3ZFF C;  4CDQ B;  1S2E A;  2PQQ A;  1O7F A;  1O5L A;  3AK0 A;  2BGC A;  2HWC 2;  4CU7 A;  2HWC 3;  1RGS A;  2VZT A;  1JZ4 A;  1JU4 A;  3FZ3 A;  2Q4S A;  1JHJ A;  1K5M C;  1AR7 3;  1I6X A;  4NR1 A;  4OYU A;  2XHN A;  1B35 B;  4HVO A;  3ZSK A;  3N9L A;  1NG0 A;  4K8F A;  3JBG 1;  3POI A;  5I91 A;  5M0T A;  3LFI A;  3S57 A;  3AP4 A;  1X33 A;  1Y3T A;  3E6B A;  1VBD 2;  2ZBJ A;  3OPZ A;  4D6S A;  2GH8 A;  3M3O A;  3DEM A;  3DXU A;  1Q43 A;  2VOW A;  1NA1 B;  1VPH A;  1DYP A;  3U10 A;  2WZ8 A;  4PDW C;  4AI1 A;  4P9X A;  2JIG A;  2ZHM A;  3CJI B;  4HSJ A;  3W20 A;  1CAX A;  3D82 A;  4DXZ A;  3AKP A;  3OGG A;  2VUA A;  3J7M A;  2UWA A;  2EIE A;  5F5A A;  4N8M A;  5FAX A;  4NRM A;  2VW2 A;  3AMM A;  1CGP A;  1SDW A;  2GMM A;  2P6H A;  3O5S A;  2GP3 A;  1W0P A;  5DAB A;  4EN7 B;  2IUW A;  4O61 A;  1N1Y A;  1D4M 2;  1QJY 3;  3ACL A;  1SBF A;  1QOT A;  2D6O X;  1D2S A;  1SFN A;  2HWB 1;  3AYA A;  1MS3 A;  3NW4 A;  4LPL A;  4MYE A;  4RHV 2;  3B94 A;  3NKT A;  2ZHK A;  3ZYH A;  2VCM A;  2D44 A;  3WG4 A;  2G9Z A;  3T2P A;  1BHG A;  4CVU A;  2VZV A;  1ZRE A;  1RUJ 3;  2VOK A;  2RG4 A;  1IKQ A;  3DPR A;  4ZU7 A;  4W65 A;  4NIA A;  3CKH A;  4QM8 A;  4XF9 A;  3RRD A;  5FYI A;  1K3I A;  1ZRF A;  4IV3 C;  4WVV A;  3NAP C;  3VD5 A;  1S0F A;  3TNQ A;  2VZQ A;  4NAM A;  2GNT A;  1ZZ7 A;  5FLI A;  4PI2 A;  3WOG A;  3ZM8 A;  2RS1 1;  4ZXK A;  1PX4 A;  5KC5 A;  4D6Q A;  1QHD A;  3H1W A;  5F5C A;  1H8T A;  4FO9 A;  5CG8 A;  5CB7 A;  2E63 A;  5FDB A;  1KJR A;  1C57 A;  3ZDV A;  2GMP A;  4A6O A;  2EIG A;  2XJR A;  2JE7 A;  3I2G A;  4QB6 A;  4H14 A;  4E27 A;  1RMU 2;  2R06 2;  4PLO A;  3ZXJ A;  1OQ1 A;  2DV9 A;  1BBT 1;  1H1I A;  2Q1F A;  5CFD C;  2C4X A;  3TOJ A;  1PIV 3;  2PHR A;  3VBF B;  4QX7 A;  5DG2 A;  1XYP A;  1MZ6 A;  1TQ5 A;  2OYZ A;  4DY3 A;  1QXP A;  4QPY A;  4YW4 A;  2OS2 A;  3HT1 A;  1UOF A;  1X8E A;  1VBC 1;  4Q4V 1;  1DGR N;  3ME2 A;  3OYW A;  4OUE A;  3MYX A;  3ALQ A;  3LPF A;  2UWC A;  1BKZ A;  3AP7 A;  4CDX B;  4GQ7 A;  5CIS A;  3K4D A;  1W90 A;  1MR5 A;  3HMY A;  4BOW A;  1OUS A;  5CFC B;  3DYO A;  2XKO A;  3V65 A;  2OA2 A;  4BPZ A;  3SCG A;  2VCA A;  3NAP A;  4RFT 0;  3H9A A;  4JKL A;  3MI8 A;  1VBE 2;  3PTR B;  1UY1 A;  1VAL A;  3BU7 A;  2IFR A;  2AC1 A;  1LHO A;  4UW4 A;  1LOG A;  3KT7 A;  4YW1 A;  1ENS A;  1RHI 3;  4FPO B;  1YFW A;  2R32 A;  5IVE A;  1EAH 3;  2DCY A;  3OOX A;  3WF1 A;  2HWE 2;  4AE2 A;  1ENX A;  1O4T A;  1V00 A;  2OII A;  4DS0 A;  3W5N A;  4CXY A;  1QEX A;  3A22 A;  4HVR A;  2VW1 A;  4RS5 A;  4FPK A;  1YC6 1;  1LOA A;  1GZT A;  4M4R A;  5A1L A;  5ISL A;  2UY8 A;  2VD7 A;  3DN7 A;  4Q4X 3;  2DUP A;  2QQI A;  2ZS6 B;  5SV8 A;  3RZK A;  1JYW A;  1CIW A;  4KMQ A;  1ZZ6 A;  1DBN A;  2FCU A;  1DGW A;  3ZXG A;  5BYN A;  4K8R B;  5D8A B;  4YVS B;  5FZ6 A;  3VZL A;  1NCQ C;  3LWC A;  3GDB A;  4YW2 A;  5JIA A;  1RXF A;  1LGB A;  1UD1 A;  3H7J A;  1R1A 2;  3UGG A;  1H2L A;  3WT3 A;  4AQT A;  4MH0 E;  1LED A;  2EXI A;  2JEM A;  2EIB A;  3KD4 A;  4MXV A;  2W94 A;  1F31 A;  1DQ2 A;  5LEJ A;  3NL1 A;  5ACA 2;  3IZO A;  5LZ6 A;  4EZH A;  1KQR A;  1W8O A;  4CUA A;  1XSQ A;  4CCL A;  2EXH A;  4D69 A;  1J3Q A;  2VMG A;  3K48 A;  4LO5 B;  4A2U A;  4K1Y A;  2HWB 2;  3PIG A;  2RVA A;  2CL2 A;  4CEY C;  4Q0V A;  1SLT A;  1H8V A;  1JXN A;  2KA3 A;  3HN3 A;  1WCU A;  1JZ8 A;  4JRA A;  4XAC A;  3HD8 B;  2XLF A;  3AZX A;  1Q5O A;  3UV9 A;  4X8P A;  3VBO A;  2R07 1;  1UIK A;  2AYH A;  2NLR A;  5AVA A;  3FWE A;  1CAW B;  2D43 A;  4NPR A;  2FMY A;  3N4M A;  1ZRD A;  4XFA A;  3WCS A;  4O65 A;  4CDU C;  4CUB A;  3POB A;  1LHU A;  3W21 A;  3IB3 A;  1X8M A;  2CNA A;  1G6N A;  5IVF A;  1QXJ A;  3BVC A;  3CLP A;  3GJA A;  1S0C A;  5B4N A;  2ZOE B;  4Z2A A;  3UKV A;  1ASJ 3;  3MLK A;  4YAR A;  4AI3 A;  2YXS A;  2XVL A;  1SAC A;  4AR2 A;  4JC1 A;  1RIR A;  2WAB A;  3U14 A;  4YVW A;  3DPR B;  4LBN A;  5EJ3 A;  2FDG A;  2ZGS A;  4CEY A;  3O1M A;  1W9T A;  3BYW A;  4JGZ A;  4YZ4 A;  4A41 A;  3AP6 A;  5A32 A;  5BNQ A;  5ANQ A;  2X5I A;  2PXJ A;  3M3Q A;  3VV1 A;  1ND2 A;  2XVK A;  5H9S A;  2Z5W A;  5DUV A;  3MBW A;  1ZBE 1;  3V64 A;  5C6C A;  4QDR A;  5FRE A;  2BZD A;  1ODM A;  1UMI A;  4COU A;  3AL6 A;  4AAP A;  4OHV A;  1ACC A;  2GU9 A;  1HDK A;  1GMM A;  3VL8 A;  2XXZ A;  4C0H A;  1VBE 3;  1DQ6 A;  4TLG A;  2PLV 3;  2YYO A;  2DBN A;  1NOV A;  2WYS A;  4FP2 A;  4LO4 B;  4NHM A;  4NOT A;  2YY1 A;  4XUO A;  3ZSL A;  3FJS A;  5C3O A;  5F3I A;  2WBK A;  3ETQ A;  3WG2 A;  2C0Z A;  1HRV 1;  4IE6 A;  4R9A A;  1AUY A;  1PGW 1;  1IHM A;  1HJF A;  3GCW A;  1IS5 A;  2LRP A;  4OUS A;  3SCF A;  3WP3 A;  5IAT A;  1CVN A;  4JDM A;  3GBF A;  5J37 A;  3CJI A;  5FO7 B;  1GZW B;  1NY7 2;  1UOJ A;  2BUK A;  1TMF 2;  2MEV 1;  2DUO A;  2PN5 A;  1ZBA 3;  2WZR 2;  2PQS A;  2VMC A;  2XJV A;  3POE A;  4FPE A;  2VOV A;  4RYD A;  1MS4 A;  3IKW A;  3OUH A;  2AZ5 A;  5KHH A;  3NRU A;  2BP6 A;  3ZFE A;  3RZZ A;  2ZEX A;  5F39 A;  3MFC A;  4Y5Z 0;  5FYH A;  4C90 A;  4FSJ A;  1PM4 A;  4BK4 A;  3POG A;  1N3O A;  1AXY A;  2IXI A;  2X5I C;  3SKJ E;  1OUX A;  1W2O A;  2MHF A;  1TME 3;  4Q4W 1;  3OGV A;  1MEC 3;  1F35 A;  4IGO A;  2TEP A;  5DQ0 A;  1UU4 A;  4YWA A;  4P9Y A;  2WKK A;  1DZT A;  2UYA A;  5DMY A;  1DG6 A;  2YFU A;  1ULC A;  4JTN A;  3RYR A;  3RZM A;  5FXX A;  4QPI C;  2IXC A;  3IPV B;  4S2D A;  5JZG C;  4A3Z A;  2FMD A;  4MV2 A;  4QGM A;  1UOG A;  3UGF A;  4YG0 A;  2XJS A;  4YVS C;  2AEZ A;  3WUC A;  4BQ5 A;  1R09 2;  2W95 A;  2WO2 A;  1HLC A;  3SH3 A;  1CAV A;  1YQ5 A;  1E57 A;  1S2K A;  4FP3 A;  4D3W A;  1KXG A;  2WAA A;  4E4Z A;  3AKT A;  4WM8 B;  1VAM A;  1GKB A;  5JI7 A;  3ZFG C;  3MIB A;  3M3I A;  3O12 A;  1OH3 A;  1AR6 3;  1VAK A;  1G9D A;  3MPB A;  4CDU B;  5BNO C;  4IV1 C;  1LOC A;  2AEY A;  3N9P A;  1QU0 A;  1Z0H A;  2DU1 A;  2QQK A;  2BNN A;  1R08 3;  4GAL A;  4QDS A;  1LOD A;  4Q4Y 3;  1QJX 3;  2R49 A;  1W28 A;  1UX7 A;  2ATF A;  3VBR A;  1OPO A;  5HV0 A;  1RC6 A;  1MVQ A;  3ACI A;  5FR3 A;  4ASM B;  1PZ9 A;  1XND A;  2RJ2 A;  4IL7 A;  3WDX A;  5FPZ A;  1CJD A;  3ZYP A;  3ZR6 A;  3RMY A;  1HB4 A;  2RJK A;  1LGC A;  2XUM A;  2X53 S;  4RGK A;  1JBC A;  1J3R A;  1RUH 2;  3ZR5 A;  1DLC A;  2W68 A;  2JDK A;  4QPG A;  4Q4Y 1;  1SDD B;  3UT0 A;  2RE9 A;  2VUJ A;  3I2K A;  4XUP A;  3ACF A;  4IE4 A;  3KV9 A;  1V9U 2;  4CEW A;  5AFE A;  1S2B A;  1R09 1;  2UYB A;  3H8X A;  3MW2 A;  1SBE A;  4XFG A;  1OMI A;  4XJA A;  1PIV 1;  3HOB A;  1ULO A;  4OLL A;  4XE9 A;  3L9J T;  2XLA A;  2ZAC A;  2IVI B;  2WYF A;  2RS3 2;  2HYK A;  5F2S A;  2WO1 A;  2Y6H A;  1B35 C;  4UFH A;  1ONA A;  4DXT A;  2A6V A;  1WBL A;  3H8U A;  1ODN A;  1DGL A;  3JBG 2;  2XON A;  3QH6 A;  3BIW E;  2W91 A;  4OUM A;  2W47 A;  5D8A C;  3TB0 A;  1XC6 A;  4TSV A;  1YIF A;  1CZT A;  1OUR A;  2OT7 A;  1NA1 C;  1FAY A;  1JOP A;  1RUC 2;  3SNM A;  5FOJ B;  2BTV C;  4FOQ A;  3SH5 A;  4NO4 A;  1S0B A;  1PX3 A;  1YXW A;  3NJZ A;  1ST8 A;  2LAL A;  4I30 A;  5GZF A;  3L2Y A;  3CHX A;  3WF3 A;  2Z79 A;  4UBG A;  4Y1V A;  1US3 A;  4GIQ A;  3KVB A;  4OQ9 A;  2XWJ B;  5A32 B;  2BWC A;  3VBH B;  1AYN 3;  5A33 B;  5C3P A;  5K0U C;  4ASL A;  1VMH A;  1OOP B;  5IK8 A;  5LRS A;  2UWB A;  4KNC A;  5L9R A;  3QOP A;  5L19 A;  3RNS A;  3VZM A;  1FPN 1;  2P3I A;  3ZXF A;  4IXL A;  4OI1 A;  3TAY A;  3WDY A;  5BNN B;  3WXP A;  3EQE A;  3N7J A;  4RFR B;  2JDA A;  4YG6 A;  5JDB A;  1W6P B;  2N7G A;  1RUG 1;  3VBU C;  1NY7 1;  1WMF A;  2A3Y A;  2YC2 A;  4OQ8 A;  4FPH A;  3GM8 A;  4G9S B;  2Y64 A;  5FP3 A;  3PVN A;  4HPK B;  4HBN A;  1POV 0;  2WS9 3;  1SLB A;  1P8J A;  1UPS A;  4SBV A;  3T30 A;  4LOS A;  1OFN A;  1AR7 2;  3SEP A;  2CDO A;  1JOJ A;  3OPW A;  4HLT A;  3UJQ A;  1V70 A;  2VQT A;  5KXD A;  2DVB A;  5GLU A;  2VJX A;  4E9K A;  1IPK A;  1V6N A;  1W05 A;  2D3P A;  5F6L B;  4CYD A;  5C5T A;  4HKO A;  3LPG A;  1FPN 3;  2GH2 A;  4PIZ A;  3VHP A;  2BVV A;  4XIL A;  5H9Q A;  4ORF A;  5ACA 1;  2ZKL A;  3A0K A;  1HB3 A;  2PTM A;  3SKV A;  1QMJ A;  3KS7 A;  2HBT A;  2H0B A;  1PIV 2;  2PHF A;  4ZON A;  3ZFF B;  4NID A;  1J59 A;  1C8N A;  5HPO A;  4BQW A;  4Y26 A;  2WZP P;  4N43 A;  5C70 A;  1JYN A;  2V5D A;  3VL9 A;  3VD4 A;  3GXU A;  1HN1 A;  2BQP A;  4N7U A;  2WT0 A;  2VW0 A;  3GJB A;  4BMB A;  5DUU A;  3P3N A;  3WP4 A;  3WNX A;  4GMP 3;  3VD7 A;  1BEV 2;  2C6S A;  2Y6K A;  5G04 L;  4A3X A;  2L9L A;  5CAZ A;  4MSV A;  1R08 1;  5A7W A;  1NQJ A;  4HL0 A;  1PZ7 A;  5FCC A;  1URX A;  3WNK A;  1ASJ 1;  3Q8A A;  1VBB 3;  1VBB 2;  3AB0 A;  3G7D A;  3TRS B;  4W50 A;  4FXG B;  4D94 A;  5FPB A;  1OA4 A;  1QKQ A;  1CR7 A;  1NUK A;  1WA6 X;  2RMU 3;  4O9G A;  5D8A A;  2F4L A;  3K77 A;  1W9F A;  1XRU A;  5DN2 A;  3WQB A;  4O7X A;  2P3J A;  2RS5 3;  3OTF A;  1N3P A;  1SCS A;  4Y4R A;  2XH6 A;  4QM9 A;  4CDW B;  1L7R A;  2WZR 3;  3C7H A;  5T5L A;  3GNE A;  2D93 A;  2ZX2 A;  4Q29 A;  5L9B A;  4KWU A;  4O9E A;  4IEU A;  4ZHN A;  4J1X A;  4IUG A;  4AEK A;  4NRP A;  5BPX A;  2Y34 A;  1AJO A;  1N1T A;  4OHZ A;  1Y43 B;  4CCO A;  4DY5 A;  4IEX A;  2ID4 A;  2EXJ A;  4LE3 A;  3AMP A;  3WIN E;  2VZR A;  4M00 A;  4ZU5 A;  4GH4 C;  3WF4 A;  1H1A A;  3E5U A;  3UL2 A;  2Q1M A;  3VB9 A;  1K45 A;  3FHA A;  3QH7 A;  3O1R A;  5GZG A;  2RR1 1;  4YFZ A;  3FBM A;  1HX6 A;  4FVV A;  5F9T A;  2WFF 1;  1LNS A;  2QQM A;  2JG8 C;  4Q4W 2;  4YW6 A;  4MHR A;  4N7I A;  1GWK A;  5HCH A;  4WZF A;  4KH9 A;  3WY6 A;  1H9P A;  2ZZJ A;  5FY5 A;  4IET A;  1GR3 A;  1RJ7 A;  4I3P A;  1AL0 G;  2IVJ A;  1V6I A;  5J96 B;  5C3S A;  3LD8 A;  4MGI E;  3V0A B;  3VBO C;  5AC9 3;  3AMN A;  3HNM A;  1CX4 A;  5BUV A;  4HET A;  2ADE A;  1LEM A;  4QDQ A;  2D5H A;  4LBL A;  4OFG A;  1S4C A;  1JYC A;  5J09 A;  3KM5 A;  3ZPY A;  2HH9 A;  2OX0 A;  1VBA 3;  3ST7 A;  2WII B;  3ZMO A;  4NIH A;  1OA2 A;  2YU1 A;  3RVH A;  4CCD A;  1CIY A;  1HJG A;  5JOZ A;  1MEC 2;  2ZGT A;  1AYN 2;  5K4L A;  2D98 A;  5CNA A;  5FLH A;  3LSD A;  2VH9 A;  3KCX A;  4JHT A;  1L7Q A;  1FI2 A;  1QQP 2;  3NNL A;  2GAU A;  4AI2 A;  1XNT A;  4XJU A;  2VNO A;  1AR6 1;  2I74 A;  5ABJ C;  1AR9 2;  1GBG A;  1CX1 A;  1RUF 3;  3TNP B;  1PZ8 A;  1HW5 A;  4W4Z A;  3ABZ A;  2JG8 B;  1WKY A;  3H7Y A;  1JOD A;  3BN6 A;  2FBE A;  3K3O A;  5F37 A;  3ITQ A;  1YRZ A;  3O0X A;  4KG0 A;  4E2G A;  1XPW A;  1D7P M;  1X36 A;  2YPD A;  2J42 A;  5FXV A;  5EHD A;  3AJY A;  4CCE A;  2XVG A;  1OKO A;  4XAE A;  4ZPI A;  1O4Y A;  2XUE A;  3OGS A;  4AOC A;  5C4W C;  3S5A A;  1UYZ A;  1EUT A;  5CFC A;  3WHT A;  1LJ7 A;  5A3N A;  2Z2S B;  1Y7B A;  4QKB A;  1UZ0 A;  5CIR A;  2PA7 A;  3A23 A;  3Q8B A;  3R4U A;  2JG9 A;  3LDR A;  1G7Y A;  2ZGK A;  3ES4 A;  2BOJ A;  3Q8E A;  4XAA A;  5CU1 A;  5DAQ A;  3S6P A;  2O8O A;  4AI9 A;  3SMH A;  4BU2 A;  1BQP A;  1QDO A;  1T6G C;  2VM9 A;  2XGX A;  4QB1 A;  2ORZ A;  3ETP A;  3I2I A;  3AKQ A;  4ES9 A;  4LBM A;  5AFB A;  1ZNP A;  5APA A;  3A0N A;  1B09 A;  4HFS A;  5LBB A;  2A7A A;  2EF6 A;  2CGN A;  1GQP A;  4DQA A;  3E97 A;  4CDQ A;  1IKP A;  2RM2 1;  4CSW A;  1VMF A;  2HWB 3;  2ZGO A;  3J8F 1;  5FZ8 A;  2WNV C;  3MO4 A;  1F2N A;  1GSL A;  2QQN A;  3LB9 A;  2CAV A;  1A34 A;  1MS1 A;  3WQ7 A;  1V6M A;  3I49 A;  3PTY A;  2JKX A;  2W0X A;  2JB4 A;  2V5Y A;  5FZG A;  1H8T B;  1KS4 A;  4HPK A;  2BJS A;  2G9F A;  4FPY A;  1BCX A;  2VU9 A;  4XJZ A;  3U4S A;  3WHU A;  5C9A B;  4A42 A;  1AYN 1;  4BIS A;  3III A;  4YYO A;  1NX9 A;  1S0D A;  3MIG A;  3MIH A;  3V56 A;  2R30 A;  1DLL A;  3RWK X;  4AAX A;  5KXE A;  3IN9 A;  3LGR A;  5CKQ A;  1H2K A;  1R64 A;  2BOI A;  5GAL A;  4AQ2 A;  5FQ0 A;  1YJL A;  4XVH A;  4DEV A;  3FFQ A;  1DDL A;  1IS3 A;  3MV0 1;  3KB5 A;  1FXZ A;  1WUV A;  3ZYJ B;  1OVS A;  2XHK A;  4NWW A;  4E4S A;  2RDR A;  2VOT A;  1ENQ A;  1COV 2;  3KV4 A;  1RMU 1;  2R06 1;  5E6H A;  3DPR C;  4DXR A;  4XDO A;  4GUL A;  1PNG A;  3H1M A;  2XR4 A;  3ZSM A;  3O0W A;  4QX2 A;  4TWT A;  3VBS C;  2FDJ A;  4QX0 A;  3W58 A;  1LU2 A;  4UFL A;  4FT8 A;  5FYT A;  3POJ A;  4KU8 A;  3HQU A;  4HVQ A;  2HEV F;  5A6Z A;  1KJL A;  1FYU A;  4MVT A;  4HMZ A;  3WDW A;  2VZO A;  3AFK A;  1PO2 1;  3DCQ A;  1H4G A;  4GB3 2;  5FZC A;  5CEH A;  2BRT A;  1PGW 2;  2TNF A;  1F4H A;  3LFM A;  2I2S A;  5FY1 A;  3MGU A;  5FZO A;  1HXS 2;  1NA1 A;  3KHC A;  2BER A;  1O5U A;  3M8L A;  3TYJ A;  4FBF A;  2YBK A;  1YFX A;  1UXX X;  3MLL A;  5EYY A;  3VDA A;  3BI3 A;  1MS8 A;  1B35 A;  4Q0Q A;  4CPB D;  1HXS 1;  1WMD A;  4QQP A;  1A78 A;  3BIE A;  3OBR A;  2BU9 A;  3KSC A;  4LUM A;  3O0V A;  3J8F 3;  1DYO A;  2ZX0 A;  2JDU A;  2ZAB A;  2Y6G A;  4LJH A;  3RDI A;  3A21 A;  2V4A A;  3MIF A;  4ISQ A;  1CAU A;  2EAA A;  1XNB A;  3ZDS A;  2GME A;  5FJK A;  4JRL A;  5L9V A;  2LW8 A;  1UMH A;  1W6P A;  1S0I A;  2ZGP A;  2QTW B;  4Q1R A;  5EFU A;  4HKL A;  4BLI A;  3T3Y A;  1GWL A;  3VHR A;  3LOB A;  1AJK A;  2DCZ A;  3B02 A;  4QX8 A;  4Y22 A;  4MGY E;  3D5O A;  3DKW A;  3V0B B;  1PGL 2;  5HXV A;  4YRD A;  3VBF C;  2B42 B;  3PU8 A;  5K9Y A;  3VDD A;  4RQP A;  1RVF 3;  4Q0U A;  5A7O A;  4AZZ A;  1MEC 1;  4DMI A;  4AFM A;  4EWE A;  2R1D A;  4URT A;  5L73 A;  4Z2W A;  4CCM A;  2KM2 A;  3WZ1 A;  4L0P A;  4YLZ A;  3ZN5 A;  4AHY A;  4NIG A;  4OHX A;  1Q8V A;  3W5M A;  1VBB 1;  1LOF C;  5FTT C;  2O0O A;  5IFP A;  1N47 A;  1BXH A;  4Z82 A;  3BTX A;  4U2A A;  2GC3 A;  4WVZ A;  3VKL A;  2CWM A;  3FBY A;  4FQZ A;  1UY2 A;  2YPJ A;  1W3X A;  4XQW A;  1BJQ A;  4ZKT B;  5T5J A;  2H6C A;  1VRB A;  1GZW A;  2ZKN A;  4LKE A;  3HAG A;  4COZ A;  5JR2 A;  5FXW A;  1ULF A;  4YW3 A;  2RS5 2;  3PJQ A;  4XEZ A;  4DXS A;  3ZLI A;  1BBT 2;  1BBT 3;  4XOG A;  4AFA A;  1W0N A;  5FO8 B;  2YG0 A;  5JXH A;  1PVX A;  1W6N A;  3UGH A;  3RZG A;  1EYB A;  1RUC 3;  4XPV A;  5E16 A;  2J7M A;  4EN9 B;  4XF4 A;  4UOJ A;  1XYN A;  3D6E A;  4MGK E;  5L7O A;  1OQE A;  1A8D A;  4W8J A;  1C3H A;  5FRA A;  3TN9 1;  3MW3 A;  2ZAH A;  3V0B A;  1S0J A;  5BNN A;  1VMJ A;  1T2X A;  1XU2 A;  2JIC A;  2AAC A;  4Q0P A;  1W2N A;  4GKX A;  3OUI A;  1OOP A;  4H7M A;  4LIV A;  4SLI A;  4P9W A;  2RR1 3;  2Y6J A;  2IC1 A;  1YQC A;  3ILR A;  4BIO A;  3VKM A;  1GFF 2;  1AR7 1;  4IE0 A;  1Q8Q A;  3JCI A;  3E5X A;  2Y6F A;  1V6J A;  1F9K A;  3SH4 A;  3CMG A;  1NLS A;  2JDM A;  1W6Q B;  1VLN A;  1ND2 C;  5LA1 A;  3RYP A;  4BXS V;  4GWM A;  4A6S A;  3JZV A;  3UYJ A;  4B7E A;  3IPV A;  3VHN A;  4DRR A;  1GUI A;  5I0T A;  1FOD 3;  2DWR A;  4K20 A;  1W04 A;  2LTN A;  3UES A;  4CA9 A;  1NXM A;  1NE4 A;  2JWP A;  5LBF A;  3S5Q A;  5E8A A;  1EV1 1;  1QJX 2;  4HOO A;  5FP7 A;  3ZXA C;  2QJV A;  5IW0 A;  2WQZ C;  2ZMN A;  4XYX A;  5GLT A;  4NHK A;  4RHV 3;  3FX3 A;  3KV5 A;  1PK6 C;  2XG3 A;  2VZ3 A;  2V73 A;  4JGY A;  4XUR A;  3LA7 A;  1C5I A;  2RS3 3;  3LA3 A;  1SLC A;  5I0U A;  2RS1 2;  4OVE A;  5FWE A;  3RJ2 X;  1YQ6 A;  3T2T A;  3H3U A;  1EP0 A;  3MEP A;  4PIY A;  5LAS A;  1KFX L;  1PMJ X;  2ZX1 A;  2ZMK A;  1JYV A;  2AGS A;  3OJB A;  3QLQ A;  1LUL A;  1FV3 A;  3CJX A;  2LS6 A;  3I2J A;  5FV3 A;  4LBO A;  3J7N A;  4MGT A;  2XJP A;  2VEC A;  2V72 A;  5FFO C;  5FJH A;  1W6M B;  3PUR A;  2W52 A;  4IV1 B;  3JUU A;  1OBN A;  2LUW A;  4YG3 A;  1OLQ A;  4RHV 1;  5D2A A;  2DVG A;  1RUD 2;  4XUN A;  5KXC A;  4PHZ A;  2ARA A;  2JEC A;  2HWD 3;  2RMU 2;  1W8T A;  4WM8 A;  1AXK A;  3ZYI B;  1D4M 3;  1QJY 2;  1LCL A;  4R4Z A;  4EJR A;  1LHN A;  2Y8K A;  3NNM A;  2JD4 A;  2E26 A;  1OOP C;  4U36 A;  4NAO A;  4P5Y A;  5I8S A;  1WGP A;  2MPF A;  3LQC A;  3AYC A;  3UK9 A;  1AHS A;  3H1Y A;  2D97 A;  4CP9 B;  1JH5 A;  1RUF 2;  5DDJ 1;  1NQD A;  4JKM A;  5DG1 A;  1QJE A;  3BTZ A;  1OF4 A;  4JDO A;  1IGO A;  3LIG A;  2YZ4 A;  3SEE A;  2FHR A;  1C28 A;  3KF3 A;  4JCK A;  4PIX A;  4RR3 C;  4W6W A;  4IEQ A;  5L7O C;  5C9A C;  3K46 A;  4XF0 A;  5DAV A;  4BYY A;  1O3S A;  4IER A;  1W6O B;  2WFF 3;  2QQO A;  2WC2 A;  3H42 B;  4YVW B;  5FYZ A;  2J1V A;  1BYH A;  3PUS A;  4M3C B;  3GZU C;  1W9Y A;  3NAP B;  1QWR A;  1AR8 2;  2HBU A;  4AI0 A;  3PME A;  1BK1 A;  3N9M A;  1HRV 2;  4NJ4 A;  4QXB A;  3KMH A;  1WD3 A;  4ZZ8 A;  5A6Q A;  2I45 A;  4W6Y A;  4P9I A;  3GBG A;  1OA3 A;  2SBA A;  5EWS A;  3NV3 A;  4KI5 M;  1RHI 2;  1SLI A;  2X05 A;  1I5P A;  1JHN A;  2Y38 A;  3GZA A;  1RUC 1;  1RUE 1;  2KR2 A;  1PMI A;  4Q4X 1;  4DUX A;  4LHK A;  4XQD A;  2P37 A;  3WNO A;  5LK5 A;  3BCW A;  3CZU A;  4QKF A;  4EWD A;  5JSP A;  5DUW A;  3BOW A;  2F17 A;  3C7O A;  3IMN A;  4B8E A;  5FZL A;  2BFU L;  3PL0 A;  2NP0 A;  2J1A A;  2ETE A;  1MQT C;  4Y20 B;  1ZZ9 A;  1NCQ B;  2A71 A;  1AX2 A;  3RMX A;  4LUK A;  1UZZ A;  2W3J A;  1J3P A;  3VDC A;  1I1E A;  3OB8 A;  2VAU A;  4M3C F;  1ASJ 2;  2IXL A;  1JZ6 A;  1TNR A;  5D1I A;  3HQX A;  2EXK A;  1DF0 A;  3P3P A;  4Z8B A;  1RUG 2;  3I2O A;  4Z07 A;  5FZ0 A;  4AGG A;  2R16 A;  1EAH 2;  4JZR A;  4H7L A;  3S7E A;  3NMB A;  3VKN A;  2FQP A;  2DTY A;  2QQJ A;  5ABJ B;  1PVC 3;  4DUV A;  2X5I B;  3AC0 A;  2W9X A;  4D8M A;  3FN9 A;  2A3X A;  5I0R A;  1YWK A;  1Z7S 2;  5A6Y A;  2WNV A;  4UT5 A;  1MZ5 A;  2VNV A;  3D3A A;  3KGZ A;  3PUA A;  4HAN A;  2FD8 A;  3FHI B;  3NQH A;  4NPL A;  3VUO A;  1LHW A;  2OPW A;  4GWJ A;  4JGY C;  2B4K A;  4NVP A;  1Q8S A;  4I3G A;  5FMO L;  3RZL A;  2PMW B;  1X50 A;  3GF6 A;  4F8A A;  1ULE A;  2JG8 A;  3WQ1 A;  1BZW A;  1LOB A;  4V2W A;  5FZD A;  5GLZ A;  4A4A A;  4XAB A;  4CP1 A;  3I3D A;  2YHJ A;  4COY A;  1YO8 A;  4IES A;  1AR8 1;  3FL7 A;  4PCR A;  4AWD A;  1R1A 3;  3CU7 A;  4RL7 A;  1ZBE 2;  3GBW A;  5CVR A;  4DUW A;  3I3M A;  2A73 B;  1G9A A;  4K40 A;  3I3Q A;  3BB6 A;  4B3N A;  3M7A A;  3V0A A;  3NST A;  2PLV 2;  2JKB A;  4N9H A;  4Y20 A;  3RJR A;  2FDF A;  4GMP 0;  5H9P A;  2ZAA A;  1GWM A;  1HRI 3;  3LKJ A;  1V9U 1;  4UFJ A;  1IS4 A;  3CIH A;  4I0A A;  2R07 3;  4QKN A;  1ND3 A;  2JE8 A;  3DKQ A;  4M0H A;  1JI6 A;  5BNO B;  2XQX A;  4QU2 A;  3J26 N;  1VBA 2;  1YNA A;  2J1U A;  2ZX3 A;  2D3S A;  5T54 A;  1UCX A;  2HKX A;  1HQW A;  4IEW A;  4IE5 A;  1UN1 A;  4TZD A;  1DCS A;  1CJP A;  4CU9 A;  1RUD 1;  1YEW A;  2EID A;  3RYK A;  1NKG A;  1ZA7 A;  2WZR 1;  2YV8 A;  4JGZ C;  1UY4 A;  1I5Z A;  4MXW A;  5T3N A;  1F5F A;  1SHW B;  4XDP A;  5GZC A;  1PM7 A;  1QJY 1;  4HXC A;  2R6Q A;  4OZX A;  4Y33 A;  5C8W A;  1VE0 A;  3VD3 A;  1RB8 G;  3SXW A;  1LB2 A;  2GC2 A;  1ZM1 A;  1WLT A;  1MS0 A;  3I59 A;  4QPW A;  4R8H A;  2YC0 A;  2X29 A;  3HR9 A;  1H6Y A;  4KWK A;  2F6B A;  4LR4 A;  3EMR A;  5F2W A;  2QVS B;  3QD6 A;  1RUE 3;  4IV3 B;  5JXG A;  2XL9 A;  1UQX A;  2WFP A;  3HEI A;  4MLO A;  4CTE A;  4C8D A;  4Y1X A;  3HN1 A;  5T5O A;  4GWI A;  1BMV 2;  2YB7 A;  4M01 A;  2J1S A;  1NXD 1;  2E7T A;  1EY2 A;  2ZEZ A;  2ZGL A;  3EBR A;  4Y4Y A;  4BXF A;  4CRQ A;  4DB5 A;  1WZX A;  2UY9 A;  5CFD B;  1GU3 A;  1A3K A;  2GZW A;  2VME A;  5B4X A;  4COV A;  3SIS A;  3GYD A;  1SQ4 A;  1TZO A;  3IT8 A;  3WR0 A;  2HWE 1;  1VR3 A;  4J6G A;  5IAX A;  1CZV A;  1W8N A;  3MW4 A;  3POS A;  3OUJ A;  2B9U A;  1WCD J;  3EHK A;  3FC0 A;  1YQ8 A;  1LES A;  1MQT A;  1UYX A;  2E53 A;  3K4Z A;  1AXZ A;  4QX5 A;  1NCQ A;  3Q8F A;  3DYM A;  1RTV A;  2J1R A;  1U5X A;  3NV1 A;  5DZE A;  4JTO A;  4OI0 A;  3F95 A;  1UPI A;  5BXX A;  4I2O A;  2W1U A;  5FK7 A;  2JDZ A;  3CO2 A;  4ERO A;  3E6C C;  2K9Z A;  4AQ6 A;  5FPX A;  1YFY A;  3I4I A;  1GQH A;  1NLQ A;  1YUD A;  2K46 A;  1O3Q A;  1WMX A;  4XF3 A;  3ZXD A;  4QHB A;  2NMN A;  4TN7 A;  4AVV A;  5BNP A;  1SBD A;  2Y26 A;  4ZS2 A;  3LZZ A;  3ACG A;  4XW3 A;  4CDW C;  5F6K A;  5FUI A;  4AVT A;  1U5Y A;  1W8U A;  4NE9 A;  5FZ9 A;  2XKP A;  2ZGU A;  3MPP G;  1DU3 D;  3NWK A;  4CPB A;  3QBQ A;  1UIJ A;  4J25 A;  2WT2 A;  1G9C A;  4CXW A;  4RR3 A;  2OXB A;  2ZGN A;  1X82 A;  2K2S A;  4XTM A;  1RXG A;  4I02 A;  3JQX A;  1APN A;  5GKA C;  2RS1 3;  3POY A;  3ZSE A;  2DUQ A;  3NJY A;  2AUY A;  1O8P A;  3OPT A;  2XJU A;  1W6O A;  4CZS A;  1DGW X;  5IJR A;  2JD9 A;  1WCK A;  5A3W A;  5F32 A;  5I93 A;  4CP0 A;  4LOT A;  2VBB A;  1UKG A;  5DZF A;  4AED B;  3GHM A;  3T1L A;  1VJ2 A;  5K0U B;  4JVA A;  1OI6 A;  5LY1 A;  5GLW A;  2DF7 A;  4QGN A;  4WVM B;  3URF A;  5FBZ A;  4XZP A;  4LXL A;  4TLF A;  1VP6 A;  4L2N A;  4FFH A;  4WM8 C;  4JAA A;  3KF5 A;  3SIT A;  4FCA A;  3ZSJ A;  5IYY A;  3C3V A;  1JN2 P;  5FY7 A;  3ZXL A;  4QXH A;  2BYV E;  3WEZ A;  4YW7 A;  5LWB A;  3ZIW A;  1UNB A;  3B7M A;  3T0B A;  5F5I A;  1MAC A;  5J98 B;  3AYD A;  1UW8 A;  5A33 A;  4QD2 A;  3U75 A;  4C91 A;  2QQL A;  1CAX B;  2RDN A;  3RFR A;  2P3Y A;  4RR3 B;  2G4I A;  3I3B A;  4S2G A;  4CUC A;  1BEV 3;  4HT1 T;  4CU8 A;  5A3L A;  1K42 A;  1HV0 A;  3IDE A;  3NJX A;  1C5H A;  1GOG A;  1I9R A;  3T08 A;  2DUR A;  2VQU A;  2FZ1 A;  1K5J A;  4XCB A;  1OXC A;  4S2H A;  5F5Q A;  1G9F A;  4L99 A;  1PVC 2;  1W03 A;  1PO2 3;  3OCP A;  4P5H A;  2WUH A;  2C26 A;  1HB1 A;  1RUI 2;  3VBU A;  3K75 B;  3WW3 A;  1NE6 A;  1YHF A;  4XBQ A;  1Q8O A;  2FDH A;  2D6K A;  3IDA A;  4PLM A;  1LRH A;  4QPG B;  1NAE A;  5FPV A;  2JX9 A;  3USU A;  4EYU A;  1VRH 2;  1GP5 A;  5C33 A;  5C71 A;  1RUJ 2;  4GB3 1;  1OVP A;  5FZH A;  1X9P A;  1Y9M A;  3JBG 3;  3THP A;  2XPJ A;  5CYY A;  5CG9 A;  1PK6 A;  3TEY A;  1SEF A;  2H0V A;  1UYP A;  2PLV 1;  4MX3 A;  2Q1Z B;  2W1Q A;  4XMA A;  1LU1 A;  4BQY A;  3WP6 A;  5IFT A;  3N7L A;  1HKD A;  2QQU A;  4PQQ A;  4NII A;  4CEW B;  2ET1 A;  4BHP A;  4XBN A;  3B69 A;  4PI0 A;  3WV6 A;  4GB3 3;  1KD7 A;  1CPN A;  1AYM 3;  4E8D A;  2LRO A;  1OHF A;  4AVB A;  2Q8E A;  1VAV A;  4ONU A;  4HN0 A;  1QDC A;  2DBI A;  3EJK A;  3PMS A;  3M4F A;  1XBF A;  5C4W B;  1C1F A;  1W0O A;  2DCK A;  2QNK A;  4KWL A;  5A1F A;  5LB6 A;  4P00 B;  1VB2 A;  4QMA A;  3ZPO A;  3INA A;  1WLC A;  3I2H A;  3ZYG A;  4DZG A;  4QHZ A;  2HWC 1;  4FPG A;  3RGB A;  5C8C B;  2R07 2;  1DGR A;  1K12 A;  2P6C A;  3KWV A;  4GD4 A;  2V09 A;  1QF3 A;  1VRH 1;  2JG9 C;  2P17 A;  3D8C A;  3POF A;  4RGA A;  5BNN C;  1AR6 2;  3M70 A;  4YZ1 A;  4I0W B;  1K5M A;  3MZH A;  1XNK A;  4QPG C;  2J1E A;  2FDK A;  5FIX A;  3WSO A;  4LT5 A;  2D7F A;  2DTW A;  5HI0 A;  5JPM B;  3AKS A;  1CAU B;  2ZA9 A;  1RVF 1;  1JS9 A;  2WN3 A;  3ILN A;  3PNA A;  4MXW B;  1XSR A;  3HVD A;  4A7Z A;  5L7O B;  2OUH A;  1R1A 1;  3ENR A;  3WVJ A;  1O3R A;  3NNF A;  1BEV 1;  1PK6 B;  1H0B A;  2AEN A;  3H3L A;  4ZY9 A;  2GN7 A;  3VBR C;  1RUI 3;  1HQL A;  1QOO A;  3AL5 A;  4TTG A;  3UNP A;  4LOR A;  4HON A;  3O1U A;  3KV6 A;  4UFI A;  4ATF A;  5KHG A;  3HJR A;  2VNG A;  3WW1 A;  3T09 A;  5BNO A;  3VZN A;  3W59 A;  4BQ1 A;  1YIP A;  1CPM A;  3THD A;  3R6S A;  2VBD A;  5A1A A;  4NRO A;  1JZ5 A;  2ZJC A;  2VNR A;  4LHS A;  2B5H A;  4N53 C;  3ZFE B;  3WDU A;  2VOX A;  4DIQ A;  1LEN A;  2YMZ A;  3VZK A;  1OLR A;  1MS9 A;  4ES8 A;  2YC4 A;  3KLS A;  5FOB B;  3G6J B;  3MF9 A;  3WG1 A;  3I59 B;  2G1M A;  4I01 A;  1DZQ A;  4GWN A;  1RUI 1;  2CAU A;  1S0E A;  2JG9 B;  3VBS B;  5J48 A;  4QKD A;  3CZJ A;  3E1F 1;  3WF0 A;  3K4A A;  1DQ1 A;  2B9V A;  4CCC A;  5IK5 A;  2ES3 A;  3ATG A;  3I7D A;  4RQP B;  1OT5 A;  4FFF A;  5ANN A;  1UZY A;  4MZU A;  3H8R A;  3TEW A;  1UU5 A;  4AXO A;  5DUX A;  4BWO A;  3ZN4 A;  1XE0 A;  3WNN A;  2P2K A;  1QQP 1;  4KU7 A;  3J9S A;  4HSL A;  1ZVF A;  4QQL A;  5K0U A;  1FMD 2;  2NN8 A;  2XDV A;  4HK8 A;  1LAJ A;  1VBA 1;  2BW8 A;  2XML A;  4H55 A;  1S1A A;  1Z7S 3;  4IV3 A;  4Y22 B;  3ZXE A;  1NCR A;  1IG3 A;  2R04 2;  3AM2 A;  5LA9 A;  3T4H B;  2VTX A;  3T4V A;  4QAW A;  4YGB A;  1SPP B;  3AX4 A;  5AC9 1;  2B45 X;  2WA4 A;  1WA4 A;  1SLL A;  1JYT A;  4KGG A;  2Q0A A;  1TG7 A;  4AED A;  4AL9 A;  1MZF A;  2GN3 A;  4AFC A;  1SLA A;  4F7Z A;  1VBC 3;  3PJY A;  4JGZ B;  4Q4V 3;  2BGP A;  4YM3 A;  2YGL A;  5C9A A;  1ZBE 3;  1HIX A;  4IEY A;  1JZ3 A;  5LBC A;  1KS5 A;  2B39 A;  1GNY A;  2W39 A;  2WWU A;  4LQR A;  4RN5 A;  1QXR A;  1DQ5 A;  4B29 A;  3IBM A;  2WFF 2;  4D7S A;  2QDN A;  3VBH C;  3ZYR A;  3ZXK A;  1DP0 A;  2ZZQ A;  1ND3 C;  3KZ4 C;  4A7K A;  4CEW C;  3KT4 A;  4K9S A;  4BQ4 A;  1OC1 A;  3LA2 A;  3M2M A;  4S2F A;  2O8Q A;  3LEG A;  4PDW A;  1IQA A;  1ND3 B;  3ZMN A;  1OFS A;  4Z1V A;  4BLJ A;  1TME 1;  1OSG A;  5GZD A;  3TEZ A;  2ARB A;  1AVB A;  1LEC A;  5KHI A;  3IDC B;  3VBO B;  1QGL A;  2EAK A;  2QZ3 A;  1NCR C;  3J7L A;  5JOY A;  2BWA A;  4Y1Z A;  3K2O A;  5HV4 A;  1NYW A;  5KR7 A;  4GJY A;  2WS9 1;  3I8T A;  3J7H A;  1HRV 3;  4YVW C;  5JMC A;  2QFE A;  3ZN6 A;  3MUZ 1;  2FZ2 A;  5D21 A;  4CDX C;  2TUN A;  1V9U 3;  3LIH A;  4FPF A;  4LBK A;  4LBQ B;  4R9B A;  5EXO A;  3ZFG A;  1UL9 A;  5DPN A;  1DIW A;  3K51 A;  3KHB A;  4P14 A;  1ZX5 A;  5KHJ A;  3B93 A;  2E51 A;  1RUH 3;  3BKZ A;  2JE9 A;  3IWZ A;  1CN1 A;  1C1L A;  1KDK A;  1O59 A;  3HQR A;  2VUC A;  3NKG A;  5A3T A;  3N7M A;  5LA0 A;  2CHH A;  1KRI A;  4OZO A;  3PVO A;  2BV4 A;  1AZD A;  3JD7 2;  5FZ4 A;  1KFU L;  2BBV A;  3WW2 A;  5TSW A;  2WNV B;  5FYM A;  2P1B A;  2Q5T A;  3JU9 A;  1V6K A;  2WO3 A;  1BMV 1;  1XNC A;  3PIJ A;  2BEO A;  5FQ0 B;  3JB4 C;  2VC9 A;  4NMI A;  4Q4X 2;  2PHD A;  1E5I A;  2TBV A;  3OEA A;  5EP9 A;  2P4E A;  3R0R A;  1PO1 1;  2B46 X;  4XTP A;  1N1V A;  3T1M A;  5LCW L;  2QCS B;  2DVF A;  1QJZ A;  2BNO A;  4GAZ A;  1PHM A;  1OLM A;  4E2Q A;  1VB4 A;  2C1F A;  4K1Z A;  3OYW B;  4LMF A;  1G9B A;  2ZEW A;  3P5B A;  4C1W A;  2E7Q A;  2VMF A;  4L97 A;  3TN9 3;  1FT9 A;  1CD3 G;  3LE0 A;  1U12 A;  4XUQ A;  5E88 A;  1RMU 3;  2R06 3;  3WNM A;  1QNY A;  3FLR A;  3BTA A;  5FZB A;  2QE3 A;  5F8P A;  5JLV A;  1W9W A;  1W39 A;  3CJI C;  2VQA A;  2R7E B;  4LO6 B;  5FY9 A;  4R52 A;  1XE8 A;  5LRR A;  3H50 A;  1H30 A;  2ZCW A;  3I2D A;  2X8K A;  4YFW A;  2CGO A;  3UKN A;  1IG0 A;  4I0B A;  4JX0 A;  1NT0 A;  4UF0 A;  5C8C C;  3DGT A;  3A4U A;  1SFP A;  2ERF A;  2DVA A;  3P1I A;  4JGY B;  1EUU A;  2VXJ A;  5FZI A;  3FLP A;  1M4W A;  1RIN A;  2EA7 A;  2VZS A;  3PUQ A;  5EQU A;  2HLE A;  2RM2 3;  5J3U A;  3MIC A;  4CE8 A;  2A6Z A;  1JOB A;  4XC9 A;  2WS9 2;  1UWW A;  1ENR A;  2OQ7 A;  5FYS A;  4ARY A;  1IPS A;  1E5H A;  3H3Z A;  3HT2 A;  5BNP C;  2XJQ A;  3LAG A;  2Z69 A;  1C8M 1;  2IFW A;  2Y33 A;  4XBL A;  2DCT A;  2HWF 1;  3FMG A;  2K0G A;  1GYK A;  1CON A;  3CBN A;  2WNE A;  1W6Q A;  4GA9 A;  4M4P A;  4XXP A;  1GAN A;  2AH2 A;  3WCR A;  4PQ9 A;  2OZ6 A;  5CAD A;  1QJU 1;  3DYP A;  5ABJ A;  1A8M A;  4CP9 A;  5FYB A;  4FOV A;  4IGQ A;  2PFW A;  2W46 A;  3BOP A;  1Y4W A;  3MID A;  3MLJ A;  3HNB M;  5IVY A;  3ASI A;  5EPA A;  1W2A X;  3OD0 A;  2BDR A;  4NN0 A;  5FP4 A;  1J1L A;  2PAM A;  1LKN A;  3MHZ A;  2QUO A;  4MGQ A;  3O1P A;  3ZKY A;  2BNM A;  2XBO 3;  2D6L X;  4LBQ A;  4AW7 A;  3VDD C;  2CYF A;  3EB7 A;  3HIF A;  3OD4 A;  4EZ4 A;  1Q56 A;  4DRV A;  4Q4Y 2;  5F3E A;  1W6M A;  2D40 A;  3OY8 B;  4IV1 A;  2ZML A;  5FMB A;  2XOM A;  4P9J A;  4A7Y A;  5IVV A;  2HYX A;  3UJO A;  1GIC A;  1RUF 1;  4ITC A;  4XZU G;  1RUJ 1;  2JEN A;  2VZU A;  4BDV B;  4QXK A;  2DU0 A;  2WJS A;  4K21 A;  2E9Q A;  3GAL A;  1US2 A;  4YZ5 A;  3KQR A;  5I0D A;  4R9C A;  3KT1 A;  3ORJ A;  1RUH 1;  1U5Z A;  2VPV A;  4FPL A;  5G05 L;  1VRH 3;  1WCS A;  2BVB A;  3LEM A;  2WN2 A;  1HRI 2;  3DXT A;  4YGD A;  5JZG A;  5LW9 A;  3WNP A;  5I8T A;  2RDS A;  3R05 A;  3VZO A;  4AHZ A;  4JDN A;  4GH4 A;  1NZI A;  3BPS A;  3OBT A;  4MO3 M;  2RV9 A;  2VMI A;  4ASK A;  3DF0 A;  4BK5 A;  4M3C A;  2X10 A;  3LSE A;  2WQ4 A;  5IT6 A;  3USS A;  3I2F A;  3OSD A;  3OGR A;  5FMO S;  5K8S A;  4BQ3 A;  2NPI A;  4Q1P A;  1T6B X;  3NJV A;  2ZGR A;  4HZF A;  3ACH A;  5EYX A;  3VZJ A;  1PO1 3;  4N90 A;  3CL1 A;  1UYY A;  1S55 A;  1XJA A;  4COW A;  4D7Y A;  1O91 A;  1XOY A;  4JKK A;  3DV8 A;  4FQ4 A;  5JR7 B;  1REE A;  1UXZ A;  1W3V A;  2VZ1 A;  1SPP A;  1SZB A;  4KL1 A;  2ZEY A;  5ACA 3;  3AYE A;  5FLJ A;  1MPX A;  1CWP A;  4FXK B;  4GMP 1;  3MIE A;  5IK7 A;  4BZ4 A;  1GP6 A;  2DDU A;  3POW A;  2WNU A;  4XJW A;  5C3Q A;  1AL2 1;  1HV1 A;  2R0H A;  3P6B A;  2OVU A;  5FO9 B;  2WT1 A;  1POV 3;  2AR6 A;  1G86 A;  5DAW A;  5ERL A;  1JMU B;  2CU5 A;  1FNY A;  3PDQ A;  3E5Q A;  5HCA A;  1DHK B;  2QQW A;  1WD4 A;  4AVA A;  3NO8 A;  4EN8 B;  4PJY A;  2G19 A;  1RUG 3;  5A7W B;  2D6P A;  3D0S A;  5DAP A;  3VBS A;  2W92 A;  3S0M A;  2ARX A;  2B8M A;  5JCT A;  5JWP A;  2YBP A;  3MF6 A;  2ADD A;  3N9N A;  3JB8 A;  4BME A;  2D6M A;  2WRA A;  3OGJ A;  3A7Q A;  4HG6 B;  4WZC A;  2XWB B;  1QQP 3;  4N43 B;  4XDQ A;  3WNL A;  4Y3O A;  5A3M A;  2PHX A;  2R04 3;  4LNV A;  2XQR A;  4D0Q A;  3PVE A;  3VBU B;  4EV0 A;  4OMC A;  2YU2 A;  5IK4 A;  2GNB A;  2E32 A;  2W1S A;  4YSF A;  4N53 A;  2JDY A;  3T2O A;  1WW6 A;  2PEL A;  4CU6 A;  4GJZ A;  4UWD A;  4BJ0 A;  2V4V A;  1TE1 B;  4XXA A;  1D2Q A;  4RA0 A;  3QAC A;  2OKX A;  1XE7 A;  1OPM A;  5FZO B;  1G8W A;  2BBA A;  3B5L B;  2IWG B;  3LEK A;  3WW4 A;  3SLI A;  1RUO A;  2H6B A;  3IAQ A;  4EN6 B;  1QJU 2;  2VL4 A;  1Y9Q A;  3ZYF A;  4L9B A;  1RYY A;  2VCB A;  2VUL A;  4E4D X;  1AR8 3;  2YUE A;  2HEW F;  4NHY A;  5FPA A;  3THC A;  3I97 A;  4G3Y C;  1STM A;  1DQ4 A;  5E1R A;  2HJI A;  1O4Z A;  3HBZ A;  4NUB A;  5GM0 A;  3SHR A;  5FY4 A;  5JXI A;  4IND A;  3U11 A;  3ON7 A;  1RED A;  1VBD 1;  2CWS A;  4DNY A;  2VY0 A;  2ZPX A;  4L11 A;  1KIT A;  3ZX7 A;  4BE3 A;  3IM0 A;  1NCR B;  2VBP A;  3FE5 A;  3VKF C;  2WNU B;  1CAV B;  2Y0O A;  1CQ9 A;  1TMF 3;  3LDK A;  3NVC A;  4YNI A;  2UU8 A;  4B7K A;  5CBL A;  1BVV A;  1LTE A;  4KG8 A;  5DAX A;  5CKN A;  1GQG A;  4WBB A;  3WLU A;  4QX3 A;  1PVC 1;  4BA6 A;  2WNU C;  4V1P A;  1JZ2 A;  5A7P A;  5IVB A;  2RHP A;  2WAO A;  3N35 A;  1N1S A;  4WVW A;  3CDZ B;  3O1V A;  3RZH A;  2ZX4 A;  1U5I A;  1D4M 1;  1RUD 3;  2VVD A;  1QJF A;  1H9W A;  1MS5 A;  4LA2 A;  3PLQ A;  5C5U A;  5JVV A;  4LBJ A;  3OF1 A;  4Q2F A;  1WWY A;  1VBC 2;  4Q4V 2;  4AYU A;  1REF A;  4YZ2 A;  1V6O A;  1UKR A;  4FFI A; 
#chains in the Genus database with same CATH homology
 1O8P A;  2QBX A;  2VZP A;  5IJR A;  2JD9 A;  4LPL A;  2W87 A;  2VM9 A;  4QB1 A;  2ORZ A;  3ETP A;  3I2I A;  3T2P A;  1BHG A;  1JU3 A;  4CVU A;  2VZV A;  1ULP A;  5JXJ A;  4ZXE A;  1GQP A;  5IYY A;  3CKH A;  3NNG A;  1K3I A;  3MO4 A;  1XNA A;  2QQN A;  2W1W A;  3VD5 A;  3WEZ A;  3T0B A;  2VZQ A;  2JKX A;  2QQL A;  3ZM8 A;  1PX4 A;  3I3B A;  4CUC A;  4CU8 A;  1K42 A;  4A42 A;  3NJX A;  1GOG A;  3III A;  3T08 A;  1NX9 A;  1O8S A;  2VQU A;  1OH4 A;  4AAX A;  4A6O A;  3I2G A;  4QB6 A;  2WUH A;  1R64 A;  2C26 A;  3K75 B;  4XVH A;  4DEV A;  4UAP A;  3T0A A;  3MV0 1;  2C4X A;  3IDA A;  1NAE A;  5C71 A;  2VOT A;  5CYY A;  2Z4F A;  4DXR A;  4PT6 A;  4OUE A;  1YQ2 A;  3LPF A;  2W1Q A;  5IFT A;  4QX2 A;  4QX0 A;  3EYP A;  4PQQ A;  3K4D A;  5JMO A;  5IHR A;  3U37 A;  3IAP A;  3DYO A;  2VZO A;  4E8D A;  2VCA A;  4JKL A;  1F4H A;  1UY1 A;  2DCK A;  5C7G A;  1KGY A;  4P00 B;  2BER A;  2VCC A;  3I2H A;  3WF1 A;  1UXX X;  3W5N A;  3VDA A;  3A22 A;  4UI9 L;  1K12 A;  4M4R A;  3CQO A;  2QQI A;  1JYW A;  4KMQ A;  1GOH A;  1DYO A;  2J1E A;  3WSO A;  2Y6G A;  3GDB A;  3A21 A;  5EIY B;  2WN3 A;  2WQ8 A;  4YPJ A;  2EIB A;  2W94 A;  4ZY9 A;  3PUI A;  2Y6L A;  2LW8 A;  1UMH A;  1WCQ A;  1W8O A;  4CUA A;  4TTG A;  4AG4 A;  3UNP A;  3HJR A;  5HXM A;  1CZS A;  3T09 A;  2RVA A;  3THD A;  1JZ8 A;  3HN3 A;  3JXS A;  5A1A A;  3OBA A;  1JZ5 A;  4LHS A;  5JXI A;  5J1X A;  4CUB A;  2YC4 A;  3IB3 A;  4E8C A;  4L0P A;  5B4N A;  3W5M A;  4Z2A A;  3LEI A;  4FI9 A;  3CZJ A;  3E1F 1;  2WAB A;  3K4A A;  2B9V A;  3WF0 A;  5IFP A;  1OT5 A;  1W9T A;  3VD9 A;  4A41 A;  2J22 A;  3WNN A;  1UY2 A;  1PMH X;  4MOA A;  5JR2 A;  3MBW A;  4QDR A;  2BZD A;  4DXS A;  1UMI A;  4QAW A;  1W0N A;  1GMM A;  2YG0 A;  1TG7 A;  2WYS A;  4XUO A;  2J7M A;  2BGP A;  4UOJ A;  1JZ3 A;  4W8J A;  2WBK A;  2X09 A;  4LQR A;  2KD7 A;  1GNY A;  2VR4 A;  3OG2 A;  4RN5 A;  1T2X A;  3C7F A;  1TVG A;  4QX1 A;  1DP0 A;  3ECQ A;  2Y6J A;  3LEG A;  5LA2 A;  2PQS A;  2VMC A;  4RYD A;  3C7E A;  3NRU A;  3C8X A;  3CMG A;  5LA1 A;  2ZEX A;  4BXS V;  1F4A A;  2E31 A;  4P02 B;  1GUI A;  4BK4 A;  3SKJ E;  3UES A;  2J1T A;  1OD3 A;  3J7H A;  3OGV A;  5DQ0 A;  3MUZ 1;  5DMY A;  5DPN A;  2YFU A;  4XUR A;  2VZ3 A;  4A3Z A;  1W9S A;  5CZK A;  2YFZ A;  1O59 A;  5LA0 A;  2W95 A;  2WO2 A;  4OZO A;  1PMJ X;  1JYV A;  2WAA A;  2ORX A;  4ARX A;  2WO3 A;  2LS6 A;  3I2J A;  2VC9 A;  3UET A;  3OEA A;  2ZXQ A;  4QB2 A;  2QQK A;  4QDS A;  5LCW L;  2WZE A;  2V72 A;  5EJ1 B;  1UX7 A;  3ACI A;  4XUN A;  2RJ2 A;  2ZEW A;  2VMF A;  3LE0 A;  4A44 A;  4XUQ A;  1JZ7 A;  3WNM A;  1DLC A;  3MUY 1;  2Y8K A;  1W9W A;  1SDD B;  2E26 A;  2R7E B;  4XUP A;  3I2K A;  3ACF A;  4P5Y A;  3LQC A;  3HOB A;  1ULO A;  4JX0 A;  4JKM A;  4XUT A;  4ET7 A;  1OF4 A;  3SEE A;  2WO1 A;  3P1I A;  2Y6H A;  1EUU A;  3K46 A;  4DXT A;  2QQO A;  3HNY M;  2XON A;  2WDB A;  3I3E A;  2J1V A;  2VZS A;  2W91 A;  2W47 A;  2HLE A;  1XC6 A;  4MAD A;  5F7U A;  1CZT A;  1UWW A;  3DEC A;  4ARY A;  4ZZ8 A;  1PX3 A;  2W5F A;  4KI5 M;  3WF3 A;  2X05 A;  1I5P A;  4M4P A;  1US3 A;  4DUX A;  3WNO A;  1W99 A;  3DYP A;  3CZU A;  3F2Z A;  2E33 A;  2VTF A;  2BGO A;  4LKS A;  2W46 A;  3C7O A;  3HNB M;  2J1A A;  3GGL A;  2JDA A;  3VDB A;  4OMD A;  2W3J A;  3VDC A;  4MGQ A;  3OB8 A;  2YC2 A;  3GM8 A;  3EB7 A;  2Y64 A;  1JZ6 A;  1P8J A;  2XOM A;  4P08 A;  2HYX A;  4XZU G;  4BDV B;  2VZU A;  3BGA A;  3SEP A;  2CDO A;  4TXW A;  1US2 A;  2VQT A;  2VJX A;  2QQJ A;  3HPN A;  4DUV A;  5I0D A;  3AC0 A;  3LPG A;  2W9X A;  4D8M A;  3C7G A;  3FN9 A;  4MGS A;  4DEQ A;  5G05 L;  3D3A A;  3FHQ A;  3SKV A;  3NQH A;  2WN2 A;  4GWJ A;  2B4K A;  5HPO A;  1JYX A;  1UY3 A;  3WNP A;  1OF3 A;  5C70 A;  3VD4 A;  1JYN A;  2V5D A;  3GXU A;  1HN1 A;  4A4A A;  4MO3 M;  2RV9 A;  3I3D A;  4PF1 A;  2DCJ A;  4BK5 A;  2X10 A;  3I2F A;  3FL7 A;  3OGR A;  3VD7 A;  2Y6K A;  5G04 L;  3NJV A;  2L9L A;  4DUW A;  3ACH A;  1UYY A;  3PUH A;  2VO5 A;  3WNK A;  4JKK A;  3OEB A;  1UY0 A;  1UXZ A;  4W50 A;  2VZ1 A;  1NUK A;  2ZEY A;  2C9K A;  1MPX A;  3K77 A;  1H6X A;  5DN2 A;  3WQB A;  2EIC A;  2DDU A;  3CIH A;  1L7R A;  3C7H A;  3P6B A;  2JE8 A;  3T0D A;  1JI6 A;  2XQX A;  2J1U A;  4KWU A;  4IUG A;  3T2Q A;  5EJZ B;  4CU9 A;  5JUV A;  2EID A;  2ID4 A;  1NKG A;  1SG3 A;  2VZR A;  3WF4 A;  1UY4 A;  2W92 A;  2VMD A;  1SHW B;  1K45 A;  3FHA A;  3VD3 A;  1LNS A;  2QQM A;  4GZ9 A;  4HG6 B;  3A7Q A;  4QPW A;  3WNL A;  1J84 A;  4JHZ A;  1H6Y A;  4D0Q A;  4OMC A;  1IQD C;  5JXG A;  3HEI A;  2E32 A;  2W1S A;  3T2O A;  4CU6 A;  4GWI A;  4BJ0 A;  3HNM A;  2YB7 A;  2J1S A;  2V4V A;  1KEX A;  2ZEZ A;  4QDQ A;  2OKX A;  2BBA A;  3LEK A;  3MV1 1;  1GU3 A;  2VME A;  3IAQ A;  5B4X A;  1GOF A;  4A45 A;  2VL4 A;  1RYY A;  2VCB A;  1CZV A;  1J83 A;  1CIY A;  1W8N A;  2CDP A;  4ZZ5 A;  1UYX A;  3THC A;  3I97 A;  3WF2 A;  3K4Z A;  4CU7 A;  3DYM A;  1L7Q A;  2J1R A;  2VZT A;  1XNT A;  1JZ4 A;  2W1U A;  1JU4 A;  5JXH A;  1JHJ A;  4OYU A;  2XHN A;  1CX1 A;  4W4Z A;  3ABZ A;  1WKY A;  3BN6 A;  4QX3 A;  3ACG A;  5FUI A;  1JZ2 A;  2WZ8 A;  1XPW A;  1D7P M;  2WAO A;  3CDZ B;  3OGS A;  1UYZ A;  1EUT A;  2EIE A;  1UZ0 A;  3A23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...