4A44A

Cpgh89cbm32-5, from clostridium perfringens, in complex with the tn antigen
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
140
structure length
140
Chain Sequence
ASALPQGNMKATATSEHPDVGNEGLAKFAIDGKENTIWHTKYNPVEELPQSITLELGGSYEINKFTYLPRSGAKNGNITKYELHVSEDGNNFRKISEGNWDDSGSLKTLKFNSTKATHVKLVALEGVGGFASAAELNVFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-N-ACETYLGLUCOSAMINIDASE FAMILY PROTEIN
publication title Carbohydrate Recognition by an Architecturally Complex Alpha-N-Acetylglucosaminidase from Clostridium Perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
total genus 30
structure length 140
sequence length 140
ec nomenclature ec 3.2.1.50: Alpha-N-acetylglucosaminidase.
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4a44A00
3I97A 2W94A 3C7GA 3NJXA 5IJRA 1RYYA 5JXHA 2J1UA 1UXZA 3GDBA 1JU3A 3J7HA 3OGRA 4XUOA 3K4ZA 4W8JA 5DMYA 2CDPA 1UY3A 3A21A 1JYVA 2VC9A 4DXSA 5EJ1B 4DXRA 4KWUA 2WQ8A 1I5PA 4DUWA 3GXUA 1UY1A 4BDVB 4FI9A 2WO2A 2YG0A 3K77A 3PUIA 1R64A 4JKMA 2PQSA 3I2GA 2E32A 5IFPA 2ZEZA 1UWWA 2WBKA 3T08A 4CU9A 2RVAA 3E1F1 4BJ0A 2BGOA 5FUIA 4JKKA 2YB7A 5DQ0A 3ACFA 2ZEYA 3WNLA 3DECA 3OBAA 4ARXA 1XNTA 2VZ1A 2JE8A 2E26A 3EB7A 1GNYA 2WYSA 3WF1A 2E31A 4ZZ5A 1UY4A 4QX2A 2VR4A 4XVHA 3OG2A 4D0QA 3K4AA 2BERA 2J1AA 2W95A 3ZM8A 5F7UA 1L7QA 2J1RA 2B4KA 3OEAA 3LEKA 4GWJA 1JZ4A 3K4DA 2W91A 3W5NA 1J84A 4PF1A 2DDUA 3FHAA 4MO3M 3SKVA 2BGPA 4MADA 1UY2A 2W92A 4RYDA 1H6YA 3VD7A 4HG6B 1SHWB 3T2OA 1JI6A 1XNAA 1DYOA 3ECQA 3I2IA 4QX0A 1XC6A 5EIYB 1UMHA 1JHJA 2W46A 2VZSA 1UYZA 2JDAA 4Z2AA 4CUAA 3UESA 3PUHA 3T0AA 3I2JA 3LPGA 1CX1A 4PT6A 2C4XA 2VZVA 4E8DA 1GOFA 2X09A 5J1XA 4XURA 3SKJE 3A22A 3WQBA 4JX0A 2WN2A 1JZ3A 3WNMA 2JD9A 3HNMA 3UETA 1JZ2A 2CDOA 2BZDA 2VMCA 4CU6A 1GOGA 1PMJX 3ETPA 2ZEXA 2Y6GA 3W5MA 3CDZB 4OMDA 3WNOA 2B9VA 1EUTA 1UX7A 3IB3A 5JXIA 5JXJA 4QDQA 3CIHA 1JZ5A 3OB8A 5LCWL 2VZQA 2XQXA 5LA1A 3T09A 1GUIA 2VL4A 4XUNA 5LA0A 4QPWA 3I2HA 2WUHA 1O59A 3LEIA 4ARYA 3CZJA 3K75B 3BGAA 4LQRA 1UYYA 2QQMA 4ET7A 4XUPA 1DLCA 2VMEA 2X10A 1SG3A 1DP0A 3A23A 2QQLA 4P08A 2XOMA 4CVUA 5C7GA 1PMHX 2ZEWA 2ORZA 2E33A 2WABA 3C7FA 1HN1A 3IIIA 2YC2A 2YFZA 2WAAA 3DYMA 4QAWA 4QB2A 1W9SA 1OD3A 4QDSA 3THCA 1XPWA 3HOBA 2XONA 4UI9L 1J83A 3UNPA 2WZEA 4CUCA 5C70A 3LPFA 3IAQA 2WAOA 3T0BA 1H6XA 2W1UA 4A42A 4PQQA 2RV9A 2VZOA 5I0DA 4QX3A 3NJVA 1W8OA 2L9LA 4ZXEA 2LW8A 3K46A 1YQ2A 4CU7A 4IUGA 4YPJA 1OF3A 2J1EA 5LA2A 1BHGA 2QQNA 1W9WA 3HN3A 4RN5A 1K12A 2R7EB 4CUBA 2WN3A 2W1WA 2QQOA 5JR2A 2Y6JA 2EICA 2WO1A 1K42A 3I2FA 3ACHA 3OGSA 4P02B 3SEPA 1UMIA 1L7RA 2Y6HA 2VQUA 2VM9A 1K3IA 3WNPA 1F4AA 2VTFA 2OKXA 3LE0A 2VCBA 3WEZA 4JKLA 4TXWA 3WSOA 2RJ2A 4OMCA 1UYXA 2QQKA 3MV11 1KEXA 2V72A 2YC4A 4P00B 1IQDC 3VDAA 2QQIA 1GMMA 5JMOA 3NQHA 2QQJA 1OF4A 4BXSV 1ULOA 3FL7A 2W9XA 2V4VA 4DEQA 4DEVA 1K45A 2VO5A 1CIYA 3VD5A 3I3EA 4DXTA 3HEIA 1TG7A 3WF3A 3DYOA 1O8SA 3WF4A 3IAPA 5B4XA 3NNGA 3BN6A 1D7PM 4QX1A 2Y64A 3MUZ1 3HNBM 1F4HA 1MPXA 1O8PA 5A1AA 2W1QA 1KGYA 4ZZ8A 4JHZA 1W8NA 1JZ7A 3LEGA 3HNYM 2VZPA 3U37A 2VCAA 3FHQA 1JYXA 1JZ8A 2EIBA 5B4NA 1NX9A 2Y6KA 4D8MA 4AG4A 4GWIA 3LQCA 1OT5A 2VMFA 4A3ZA 3T2PA 2W5FA 2QBXA 3A7QA 3DYPA 3OGVA 2ZXQA 3WF0A 3C7EA 2YFUA 3P1IA 4QDRA 4A44A 3ACGA 4LPLA 2VOTA 5JUVA 5HPOA 4M4PA 1NAEA 1JZ6A 3MO4A 4A41A 1CZTA 1UZ0A 1TVGA 1CZSA 1P8JA 5CZKA 3NRUA 4BK4A 4DUVA 1GU3A 2VZ3A 2WO3A 5DPNA 3MUY1 1W0NA 1JYWA 3OEBA 2J1VA 3CZUA 3T0DA 1W99A 3THDA 3IDAA 3F2ZA 2WDBA 4AAXA 3WNKA 2DCJA 4XZUG 1JYNA 3HPNA 3CQOA 4MGSA 4LHSA 1OH4A 1PX4A 4CU8A 2X05A 2W87A 1UXXX 5HXMA 2VMDA 2W47A 2BBAA 4P5YA 5JXGA 2VZTA 2W1SA 1US3A 1JU4A 4XUQA 5G04L 2DCKA 2ID4A 4L0PA 4GZ9A 3EYPA 2J22A 4LKSA 4W50A 3GGLA 1GOHA 3D3AA 4OZOA 3SEEA 4A45A 3JXSA 3WNNA 3HJRA 2C26A 3C7HA 2VZUA 2JKXA 2VQTA 4OUEA 3VD4A 3CMGA 5EJZB 2J1SA 1SDDB 1WKYA 1NUKA 4BK5A 3CKHA 3T2QA 1W9TA 3AC0A 5IFTA 3ABZA 3VDBA 3VD9A 2V5DA 4W4ZA 4MGQA 3FN9A 2KD7A 2EIEA 5DN2A 3P6BA 1NKGA 5G05L 2VJXA 4M4RA 4XUTA 2XHNA 4QB6A 2HYXA 3WF2A 3MV01 5C71A 2Y8KA 4DUXA 5IYYA 4OYUA 5CYYA 4A6OA 4KI5M 2Y6LA 1GQPA 3I2KA 5IHRA 2LS6A 1US2A 3C8XA 3VDCA 4QB1A 2J7MA 3C7OA 2VCCA 3VD3A 1UY0A 2EIDA 4UAPA 1ULPA 2Z4FA 2C9KA 1EUUA 1LNSA 2WZ8A 2ORXA 3I3DA 4ZY9A 2VZRA 3ACIA 2W3JA 1PX3A 2J1TA 3GM8A 4MOAA 1T2XA 1CZVA 3I3BA 4KMQA 4E8CA 2HLEA 4TTGA 1WCQA 4UOJA 3MBWA 4A4AA
chains in the Genus database with same CATH superfamily
2XUEA 4YARA 1O3TA 3POJA 2W94A 1YIPA 5FY9A 4BQWA 5BNPC 3NJXA 5DZFA 2CGNA 4OHWA 3WUCA 5JXHA 5EHDA 4I09A 5BNOA 3J8F2 1LEDA 1ZYBA 4W8JA 5FPAA 5DMYA 4CDWB 4HN1A 4RQPB 3H7JA 1J3PA 5FIXA 4YW2A 5J37A 1AR73 3H3LA 1G9CA 4HT1T 1UD1A 2ENRA 3S7EA 4DXSA 4KWUA 2FHRA 3D0SA 2RMU3 1I5PA 2K46A 3H8RA 2D3PA 3BYWA 2ZGUA 1ZBE1 4XYXA 2BV4A 2WO2A 3K77A 3PUIA 2FZ2A 1R64A 2CAVA 4KG0A 3KVAA 4XJ8A 5FYCA 5JSPA 2PQSA 3I2GA 5JAXA 2R072 5C9AA 4GB33 4GMP0 4IE4A 1DDLA 2RS32 2RVAA 1NZCA 2P1BA 4CXWA 5FUIA 1XYOA 3AMHA 4JKKA 2YB7A 1VBB3 1E5HA 1U5ZA 2XBO3 2CL2A 4I0WB 3WNLA 2ZEYA 1F35A 4QPGB 4OHYA 4XDOA 4HFSA 4Z07A 2K0GA 5KC5A 3Q8CA 4B29A 3DECA 4Z1VA 3B7MA 1HB1A 5FZOB 1I6XA 2JE8A 2D6KA 1AL23 1HRI2 1ND2B 3WF1A 2OQ6A 5A7SA 3ZR5A 3IMMA 2ZMLA 4MSVA 3LEMA 4DXZA 2H6CA 1PGL2 3GBGA 1JH5A 1EPWA 2VR4A 3EHKA 3FE5A 4XF9A 3E97A 4XFGA 1W2OA 3OG2A 5DZGA 1OLRA 2F6BA 3K3OA 3KSCA 3OJBA 3VV1A 2OUHA 2PLV1 3OTFA 1O6UA 3PL0A 3R4SA 4B4PA 4OI4A 3LF7A 1B35A 2DYCA 4HZFA 2PYTA 1SLLA 2BERA 4Q29A 1QWRA 1EY2A 1KQRA 1R1A1 2ZABA 2ZGSA 1I5ZA 4XHXA 1L7QA 1XSQA 1CAVB 4XJZA 1V9U2 2VUJA 4HPKB 3VZJA 3ZIWA 3ILRA 3I59B 3TWIA 4FAGA 1DBNA 3LEKA 1SLTA 5FZDA 2ZBJA 4ZONA 1UZZA 3RG0A 1ZRDA 1J84A 1RUF2 5F3CA 1PVC3 1Q8PA 2DDUA 3FHAA 5JI7A 4CP1A 1AUYA 2RG4A 3SKVA 4MADA 3J8F1 1FV2A 3NAPC 1H6YA 1X36A 3RVHA 5CAZA 5FO7B 4H14A 1YCIA 1POV1 3GYDA 3QH6A 4HG6B 2XJUA 1TME3 1JI6A 1YWKA 1YLLA 3VBUA 2A7AA 3ASIA 5AC92 3NNMA 4SLIA 1V6JA 4BHPA 1LENA 3AZYA 4AI0A 1DYOA 4M3CA 2PFWA 2R041 2D40A 2EXKA 2A3YA 1GZ9A 4XFAA 2VY0A 1RUJ2 2EXHA 4XXPA 1BEV3 2O8QA 4LIUA 4L9BA 1W0OA 4MH0E 1UMHA 4I02A 1JHJA 2JIGA 1UYZA 3EQEA 3LWCA 3VLBB 4Z2AA 3O1MA 2R071 4HN0A 4OULA 2RS31 4MGYE 2GSYA 2WQ4A 2C4XA 3OSDA 4LLOA 2VZVA 1MEC3 4E8DA 5FXVA 3SMHA 3IDEA 4EWDA 4FOVA 1C4RA 1CJDA 4BOWA 5D8AA 2ZS6B 4QWNA 3WY6A 3AJYA 3PIGA 2ZTNA 1JZ3A 3WNMA 2O14A 4COWA 1WW5A 4BWOA 1HRI1 2CDOA 2WA3A 3U0ZA 3Q8AA 2LUWA 4QXKA 1PGL1 1WCUA 3W5MA 4OMDA 4GMP3 1RMU3 1QJY3 4Y24A 2B9VA 2GNTA 1KITA 1UX7A 1PO23 1ZZBA 2XVGA 3IB3A 4RQPA 4LBJA 5AVAA 2DVBA 1WLCA 3V65A 3POBA 1S0EA 2VNVA 5ACA2 1N47A 4CDQB 3M70A 1RHI2 2VZQA 5IVBA 4IE7A 4LA3A 2JDUA 4Y4RA 2IVIB 3C2UA 2VL4A 1V9U1 3MLLA 2D6LX 2HWF2 3TN93 3NNFA 5FFOC 3CJIC 4IEQA 3LEIA 3VBSC 3W58A 3CZJA 1H8TC 3K75B 3DXTA 4LKFA 2EXIA 2XDVA 1UYYA 4LQRA 3JBG3 5FXXA 4ET7A 4QQ2A 4CEWB 1RUF1 4QGMA 3WVJA 2X10A 4K20A 4LUMA 2YDEA 5FZHA 2XHKA 3KV4A 4XBNA 3SLIA 2JG8B 1BLZA 3K51A 4E4DX 4NRQA 1DP0A 3UKNA 1RVF2 2QQLA 3M4FA 1C1FA 3O7OA 1NOVA 1K5MC 3UJQA 5D1IA 1D2SA 2PAEA 4P08A 4Q0PA 5AC91 4QU1A 1Q43A 2ORZA 4QM8A 5FZOA 3AKSA 3AVSA 2WABA 4GWNA 4WM8C 4Y5SA 2FCVA 1DQ4A 1ND2A 2XB6C 4N53B 3ZPOA 4QAWA 4FOQA 1RUJ1 4W6XA 3WCSA 3B9IA 1RINA 1VBD2 1XPWA 1XU1A 1U5YA 1J83A 5FYTA 2HJIA 2TBVA 4LBQD 4JQRA 4XZPA 1H9WA 4AEKA 2EXJA 3RZKA 4DRVA 1RUG2 1H6XA 1MZEA 1VIWB 1RXGA 2W1UA 4HKWA 4IL7A 5ANQA 1KXGA 1W9FA 5ABJA 1KS4A 3N36A 2BVVA 4FTEA 1MQTC 2VZOA 4FOYA 1UOGA 5T5OA 4Z92B 4AF9A 1CAVA 3ZPYA 3O0VA 4UW5A 5K0UC 5F3IA 1HV1A 1N3QA 2DTYA 1W8OA 2MNGA 3CL1A 2Y33A 3P3NA 4HPKA 5FP7A 3I59A 1G6NA 1HB4A 4XFIA 4YPJA 3CU7A 4X6RB 2J1EA 3ZN6B 1C1LA 1MS1A 1KJRA 4KH9A 1Z7S2 4FTBA 2YU1A 4PIYA 4AGRA 5DAVA 5FZ1A 1WLWA 1OQEA 3LIGA 2JDNA 2NN8A 5AVPA 4COYA 1QNYA 2Y6JA 3TEWA 2QDNA 5ACA1 1SCSA 2ARAA 2DVDA 5E88A 4EJRA 4JGZC 4QU2A 4B3NA 4MV2A 1AXZA 2IC1A 2PA7A 3SISA 5A3UA 1PK6C 4P02B 4TWTA 1HJFA 4K3UA 2VMHA 1UMIA 2CSGA 2HWF1 2Y6HA 3DL3A 4D3WA 2VQUA 3I7DA 1T6GC 1YJLA 1K3IA 2BGCA 2TUNA 3KS7A 5CU1A 4BM8A 1JXNA 2G4IA 3WNPA 2I45A 2VTFA 4RHV3 3H42B 3WEZA 1RUH2 2VCBA 1LRHA 5DG1A 4LT5A 3K48A 2PAMA 1A3KA 4OMCA 3WG1A 4YYOA 2W2IA 4QGLA 1OKQA 2FBEA 2PAKA 4QHBA 3RMXA 2BFUS 4LULA 3SCHA 3JZVA 1VJ2A 2JICA 2C1FA 3FHIB 4PI0A 1VBC3 4S2HA 1RVF1 3MFCA 3TEXA 1VBE3 4XJWA 3PTYA 3N9LA 2A6VA 2BQPA 2Q5TA 5BNNC 4JDOA 4EWEA 1V6NA 4BXSV 1JN2P 3FL7A 4O65A 1AX1A 2WQZC 3UGHA 3IMNA 2V4VA 3DPRC 3AM2A 4DPNA 3V0BB 5IVEA 4Q5OA 2V73A 3MHZA 4AL9A 2Q8CA 1ASJ3 1VBD1 2VO5A 2MEV3 5HCBA 1NLSA 2JDMA 4OQ8A 1W03A 4Q4Y3 4DXTA 2XPJA 4OUSA 3VDDB 2ZACA 4XCAA 3LSEA 4XACA 4P5HA 3FWEA 1LESA 1RUG1 3R05A 4Q2FA 1C5IA 5KXEA 2KA3A 4CDQA 3RMYA 3WW1A 3NV4A 1IS5A 2JEMA 4XE9A 3WQ1A 3J7NA 4NPMA 5CA6A 1DGWA 4FFFA 3ZKUA 1HW5A 2Y64A 4QX1A 3MUZ1 3J9SA 4CDXC 2HWC2 2WIIB 4FQZA 4EE2A 2W1QA 3MIDA 1DYKA 4YVWB 4CEWA 1KDMA 5FP8A 5IUQA 2P3JA 1CESA 1GNHA 4JHZA 4CRQA 3VB9A 5IAVA 1Z7S1 2Y26A 4RL7A 4ZS2A 5GLZA 1LHWA 3HNYM 4NUBA 4BQXA 1XYNA 2QQPA 4IE5A 4QXHA 3FLPA 2ZHNA 4LHNA 2BP6A 4LBOA 5FZBA 4EYUA 3RZHA 3POIA 3NNJA 2ZAAA 4D6SA 5HCHA 2Y6KA 5BY5A 1HQWA 4LBQB 3VKMA 4Z8BA 1X50A 4AG4A 5JSOA 2ZMKA 4PF5A 3X29B 4N53A 1G7YA 4AEJA 1YI7A 3LQCA 4WM7A 5DAQA 5T54A 1FMD2 2O8OA 1RUH1 1LOGA 2QBXA 3DYPA 1DFQA 3RZMA 1WCDJ 2BOIA 5T5LA 5KC6A 1AJOA 3C7EA 2HWB2 4M0HA 3LB9A 5H9SA 3ACGA 5FCCA 3ZX7A 1LEMA 3DKWA 4BE3A 2LROA 2W0XA 4YW6A 4LR4A 4B7KA 4I3GA 2JKBA 3W21A 4EZ4A 1X82A 2DCTA 5JUVA 2DVAA 2RDNA 4M4PA 1UQXA 4TLGA 4A41A 3NWKA 3AP6A 5FK7A 4FPEA 3WP5A 3ZLIA 3WQ7A 4IGPA 3ZN6A 2XJSA 3POGA 5CFCA 1KFUL 1JS9A 2WO3A 4J25A 4U2AA 5DPNA 3ZSKA 4GH4B 4Y1ZA 3AYEA 4XIKA 1MZ6A 3PVBB 2HBTA 2I2SA 1W2NA 3T0DA 5H9PA 1W99A 3THDA 3IDAA 1NG0A 1PNFA 3F2ZA 3N3HA 4I01A 3HIFA 4AW7A 5FKBA 4Y33A 4I30A 3HPNA 1Q3EA 3ZFGB 4Q4W2 1HDKA 4Y4YA 2HWC1 5KHJA 1DCSA 3KV6A 4U36A 4FO9A 2X05A 2W87A 1UXXX 2NPIA 3WNXA 5HXMA 4UFKA 2WZR3 1F9KA 3RRDA 2DVFA 2HWD2 3AVRA 4P9XA 2R32A 2NMOA 2BBAA 4Q1PA 3BODA 5JXGA 1NLRA 4BXFA 1QKQA 3AP9A 2B45X 2DCKA 4CP9B 4L0PA 2QZ3A 1AYN3 1G9FA 1BBT1 1VRH2 4W50A 4O9GA 4OZOA 3UKTA 4QD2A 3HQXA 3JXSA 2XJVA 1M06G 5C8CB 2QKDA 5HCFA 2D6MA 2VZUA 2VVEA 4DQAA 1ULFA 4OUEA 4AHWA 3RFRA 3O12A 5CG9A 4LA2A 4S2FA 2D3SA 2W52A 1BK1A 1L7LA 1A6CA 3H8UA 4BH9A 1FMD1 4DNYA 4BK5A 1AR62 1HXS2 3N9MA 4JTNA 2ET1A 3T2QA 4CP2A 4NRPA 5IFTA 2YPDA 3ABZA 1PMIA 4FFGA 3VD9A 3VDBA 3VUOA 1DZQA 1QJX2 3JD72 3VDDA 3I3QA 2N7GA 4CCCA 3UGGA 3AKTA 3RJ2X 1V6IA 2HWB1 2RS12 3UV9A 5I8YA 1LU2A 4YVSC 1EAH2 1GANA 4XIOA 4OI1A 3UT0A 4P9WA 4UWDA 1SQ4A 5FXZA 4DUXA 1UMZA 4A7ZA 5JI9A 2VUCA 4L2NA 4OYUA 4DINB 4HVRA 3PUAA 1NE4A 4IV3B 3JU9A 2ZKLA 4S2GA 4XMIA 5DAXA 1W6OB 2AR6A 2Y6LA 3AL6A 4QMAA 4AR2A 1GQPA 2FCUA 4YVWA 5IHRA 1VE0A 3ZOIA 2W39A 1OQ1A 2BNMA 2J7MA 4CDUB 3C7OA 4XQWA 5KHHA 1NCRB 4UAPA 3ZSEA 5KWRA 2CHHA 3V56A 1YNAA 2RR13 5JR7B 3I2DA 2AUYA 2GN3A 5L9BA 2ORXA 2GMPA 5A7NA 5GZCA 1CAWB 5FP4A 5HCAA 3E5XA 3ACIA 4Y20B 2EVXA 4MYEA 3H8OA 5CKQA 1NA1C 5EP9A 5FK8A 4Q4W1 3GM8A 2E6VA 3GF6A 3B69A 2VBDA 4MOAA 1NCQB 4AHZA 3MZHA 1QJU2 2E51A 4QPYA 5TSWA 5A33B 2HWD1 3ZYBA 4CYDA 3O5SA 1AXYA 3NJZA 4AI8A 1HIXA 1RJ8A 5EFUA 3HWJA 2HKXA 1YXWA 3WG2A 1QMJA 1OA2A 5DUXA 4KQ7A 5FPZA 1HB2A 5I0TA 4L8QA 5F8PA 3TNQA 3VZOA 4P14A 4XBLA 1RUD3 4K1YA 4I2OA 1REFA 2UYAA 1GLHA 3LSDA 1VRH1 3C7GA 3ORJA 1A8DA 3MDPA 4GWMA 5JZGB 5C5UA 1MS8A 4N43C 2ZX0A 3KQ4B 5FZ7A 3WW3A 4LKDA 5I0UA 3GDBA 4JDNA 2ERFA 3K4ZA 3SH3A 4O61A 3ZN4A 2CDPA 1UY3A 1R093 4XILA 1YQCA 1DQ6A 3I54A 2ZGOA 4BLIA 1HXS1 1ULDA 2UWBA 3IPVA 2O1QA 1JYVA 2VC9A 5FTTC 4GH4A 3OPZA 4NWVA 4DXRA 1QJX1 3JD71 4YG0A 2NZ9A 3H0OA 5FZLA 2OYZA 4DUWA 2RS11 1WW7A 3ZVXA 4X8PA 1UY1A 1EAH1 3SXWA 2YC0A 4MG2A 3MIFA 1MR5A 1WCKA 2VOKA 3MLJA 1NQJA 2DWRA 1DLLA 3KLSA 4NROA 1YO8A 4QX7A 4WVMA 1LAJA 5IFPA 4RFRB 5L73A 2QZ2A 2LTNA 3ZFGA 2PHTA 3NV2A 4J1WA 5DUUA 1PNGA 4MLOA 2ZZJA 4PLMA 3LA2A 5DXDA 5IVYA 1CGPA 1ZRIA 1UW8A 5DQ0A 3ACFA 1LOFC 1Z0HA 4Q4V2 3ZSLA 1ZREA 2VTXA 4AVBA 3WV6A 4CP9A 2P3YA 5A3OA 1YQ5A 5C9AB 3AYCA 3NKGA 2VZ1A 2XVKA 4OFGA 3VZKA 3EB7A 3T2TA 1TNRA 2WYSA 1QU0A 1BQPA 5FYMA 4EN8B 2R30A 3IDBB 5JMCA 3U4XA 4QX2A 2B42B 5FYUA 1C8NA 1GWKA 5C8CA 4XVHA 4NAOA 4E2QA 2NMNA 1GV9A 2PHUA 2P5BA 3FX3A 4AHXA 4XFCA 2WNUB 2HBUA 2RJKA 1QJU1 4Y1YA 3EMRA 5C4WB 1MZ5A 2VOVA 3D5OA 3PDQA 5T52A 1H9PA 2OPWA 5F7UA 1EV12 1H4GA 2ZHMA 5DDJ3 2BPA2 3E6DA 5F9TA 4RS5B 2J1RA 3MEPA 2CWSA 1J3RA 1WD3A 1VAVA 4YLZA 2VBPA 1UX6A 1JUIA 2VE1A 3LOIA 2AREA 3WW4A 1C3HA 4JGYB 2W91A 4GAZA 3WDVA 4AXOA 3U07A 4BLJA 5JVVA 2BJSA 2NYYA 4IV3A 3J26N 4IE6A 3TNPB 5FZEA 4WVVA 1UY2A 1W6OA 4RYDA 5EZWA 2PQQA 3KV9A 4FPYA 3AFGA 4JV4A 1LGBA 2P2KA 2Y60A 1QOTA 4AFBA 1LU1A 5KBFA 4CDUA 2Q8OA 2IVJA 4IEZA 5FKCA 3ZN5A 4RR3C 3ZXLA 1NCRA 1CX4A 4LLFA 1F5JA 3RS6A 1CAUB 2EF6A 4CA9A 1QXJA 5B2GB 1HV0A 4HLTA 1CAWA 3WOGA 3RJRA 2AENA 4Y20A 2OVUA 4CCMA 3UESA 1R1ZA 5FLJA 1GSLA 1J59A 3I2JA 3LPGA 4CCEA 4LBMA 1NCQA 3GALA 4PT6A 1SFPA 1QJEA 1E5SA 1W39A 3HAGA 3OGJA 4YNIA 5F3EA 4P9IA 5A80A 2Q8DA 3ZXAC 1MS5A 1PZ8A 1ZA4A 2GAUA 2X09A 1ZM1A 4XDQA 4YW1A 5EYXA 5A33A 3S7IA 4XURA 3PURA 1LB2A 3SKJE 3BVCA 4Q4V1 3WQBA 3ZFEB 4NOTA 2E9QA 1W90A 2XJRA 5DG2A 3VBFB 4CEYC 4JX0A 1DYPA 4FP3A 4OHZA 3QACA 2P34A 5JCTA 1F31A 1FXZA 1VBA3 1LULA 2VULA 3PIJA 4FFHA 4XCBA 3SC7X 4B1MA 1KS5A 5E8AA 1ND3B 4D69A 5FZ8A 1GOGA 1AR72 1RUI3 1WWYA 4TZDA 3ETPA 5FLIA 5D8AB 2ZGRA 3ZIXA 3WNOA 4EWAA 2RMU2 2WL1A 3KV5A 5HI0A 4BIOA 1YFUA 2GC0A 1KD7A 2IXCA 2JWPA 3O1VA 2FDGA 3OB8A 2ZZQA 5HV4A 5LA1A 1LOEA 4XXAA 5IATA 1CVNA 1EV11 4XUNA 2R063 4CZSA 4JQTA 3BIWE 5F37A 1O59A 3H1WA 3WXPA 4ARYA 4YW4A 2WA4A 3FFQA 4HXCA 3BGAA 1IKQA 1IQAA 1VBB2 2XBO2 5I8TA 4KU8A 4XUPA 3PUSA 4J1XA 3ENRA 1TNFA 4AEMA 4E4HA 2AZ5A 2P4EA 4UFLA 1H2KA 5A7QA 4QX8A 1AX2A 4BDVB 3A23A 4B4RA 4GKYA 1AL22 2HWE3 5EWSA 2F4PA 4BPZA 3VBOC 1VR3A 2XOMA 3WD5A 3LZZA 4PLOA 2WNVC 4RFT0 2WNEA 4LEJA 2WYFA 5FLHA 1Y4WA 3AJZA 2E33A 4AQ2A 4Q8KA 5FOBB 4C1XA 2DF7A 1F15A 3THTA 3Q8EA 4PBPA 2YFZA 2WAAA 3MPPG 5FY4A 5BPXA 4QB2A 3TYJA 3HOBA 4UI9L 3HVDA 1N1YA 1Y9MA 2X5IB 3UNPA 2XH6A 3H8XA 4UBGA 4YSFA 4OHXA 5FREA 5C70A 3LPFA 3AX4A 4SBVA 4LJHA 2YMZA 3IAQA 3TAYA 4CCJA 2WNUA 3S5AA 1EP0A 1H2MA 3NVCA 3GJAA 1SMVA 3PNAA 5C4WA 5A7OA 3CEWA 4XQ4A 3AKQA 4N8MA 1UIKA 2HEWF 1C8M1 1H8TA 1PVC2 3MYXA 4RGAA 4UFMA 3ZYFA 4RS5A 3KM5A 4Y22B 5C3RA 4ZXEA 2CU5A 2LW8A 1PHMA 1I3HA 4R52A 4IUGA 3ES4A 4JGYA 1OF3A 1TME2 1X8MA 5LA2A 1BHGA 1H1IA 5DABA 2GMMA 2PMWB 1REDA 2OUJA 5FZ9A 3B5LB 3V64A 3ZYIB 1E5IA 5FXWA 2R043 4CUBA 4IGQA 5I91A 5JSRA 2WN3A 4I3PA 2RMU1 4S2DA 5FMOS 4COZA 3G7DA 5DAWA 1D4M1 4QKBA 2OXBA 2FZ1A 4YGDA 3WG3A 2EICA 1BEV2 2IFWA 1LOCA 1SACA 4WM8A 3LDBA 1RUE3 2CY6A 1K42A 3BOPA 2CYFA 4LTAA 4PQ9A 3I2FA 5LA9A 5LBFA 5C3SA 3U10A 1MS0A 1ZRRA 1Q8SA 2Z79A 5CBLA 3E5UA 4AEDC 1L7RA 4R9AA 2ZOEB 1CAUA 4F7ZA 3FC0A 1MEC2 1X7NA 2EIGA 2OKXA 4F83A 1VBB1 2XBO1 4JKLA 4OQ9A 3WSOA 1ZVFA 4MHRA 4BMEA 2YZ4A 2NM1A 1APNA 2H0BA 3FBMA 3OD0A 1UYXA 5FJKA 5FMBA 2DU1A 1VP6A 1MS3A 3W9AA 1VMJA 5F5AA 5I8SA 2QQUA 1FPN3 4AI2A 1AL21 3IT8A 1WA4A 4G3YC 4P00B 4HL0A 1IQDC 4GJYA 3VDAA 2QQIA 2W08A 3ZFEA 3NQHA 4UXAA 3VBFA 4G4FA 1VB4A 3HN1A 1OF4A 1RMU2 1QJY2 2JX9A 2BW8A 1PO22 1W2TA 4R9BA 1ND3A 4IW3A 4LO4B 4DEVA 1AL0G 1STMA 4QPIC 2B46X 1K45A 3VBRC 1CIYA 3VD5A 3DXUA 4FFIA 5A1LA 3CNAA 1CR7A 2GP3A 4UYBA 1AXKA 3TN92 1UKRA 4ZPIA 5FO8B 1BVP1 4A7YA 1Y3TA 1O8SA 3ZYJB 5IVVA 1FX5A 3PMSA 1OLME 1WMXA 3AL5A 3IAPA 3R0RA 5F5IA 5KXCA 5B4XA 3NNGA 1PVC1 1RIRA 1WD4A 4XF3A 5M0TA 4Y3OA 5F6LB 3J4UH 3J7LA 1G9AA 3HNBM 3PVOA 4LBNA 4IEPA 5LBCA 1F4HA 5A1AA 2XQRA 1KGYA 4JC1A 1TME1 4XFFA 4AQSA 1YFXA 3ON7A 4AI1A 1QJFA 3BPZA 2XWJB 1JZ7A 5I0SA 3LEGA 1GICA 2AC1A 1DQ1A 4NPLA 4AVVA 2JG9B 3EBRA 1BYHA 1IPSA 2Z5WA 4FXGB 3VZNA 3OBRA 2YGMA 3U37A 2VCMA 1YQ6A 3FHQA 3RZGA 1BEV1 2QUOA 1TEIA 3DPRA 5F32A 2EIBA 5B4NA 1S0IA 2NP0A 5IVFA 5IK7A 1NZIA 4CP0A 3TBDA 2VW2A 5T3NA 1SPPB 5A70A 1V6KA 3T2PA 4TN7A 4D7SA 1MEC1 1PVXA 1W8TA 3IWZA 2X5IA 1ZZCA 3KCXA 3ZYRA 5BXXA 1J3QA 4YFZA 2YFUA 3G6JB 4URTA 3BCWA 4A7KA 5FQ0B 2BFUL 4FPJA 4XHBA 4LHLA 2WO7A 5C3PA 4WM7B 4XABA 4CDXA 4JDMA 3KQRA 5LEJA 1JYTA 4CPBA 4KL1A 4NHMA 2B7YA 3M3QA 1R083 4LUKA 5FAXA 3LOBA 3VBHB 4HANA 4Y22A 2BWAA 1B35C 4G9SB 4GMP1 1QJY1 4QXCA 5IK4A 3MO4A 3ZFFB 2Q1MA 1UZ0A 4YGEA 1PO21 3SNMA 1S0GA 1TVGA 1LOBA 1GP6A 5CZKA 3VKOA 5L9RA 2A1XA 4CE8A 4CCOA 2FDFA 5L7OB 1UKGA 2PTMA 2WSUA 3MUY1 1OVPA 3FLRA 3HMYA 4E27A 1WUVA 3N7JA 3TN91 5AFEA 4OI0A 4XAAA 2J1VA 3I49A 4NHLA 4JZRA 4P9YA 1V6OA 1GQHA 4ZS3A 1UO9A 4RHV2 1PGSA 3AZVA 4ISRA 2IXKA 1AR83 5APAA 4MXVA 4DY5A 2DCJA 3RI9A 5CFCB 1JYNA 3BTXA 1UZVA 5C6CA 2NLRA 4MGSA 1PX4A 3VBUC 1A34A 1OLQA 2DU0A 1RVF3 4HK8A 5H9QA 3S57A 1JYIA 2QQVA 1VBC2 1GWMA 2W47A 1COV3 1VBE2 4P5YA 1RHI1 2BOJA 2VXRA 2ZGMA 1FT9A 2VOWA 4FP2A 5FZ6A 3ILFA 1H1MA 5J98B 5FDBA 4MGKE 1JU4A 1OA3A 3RSJA 4GZ9A 1ENXA 5HXVA 4N43B 3LD8A 3GHNA 1IS3A 1VPHA 1J1LA 1KFXL 2AYHA 3D3AA 1ASJ2 1PM4A 2MEV2 2J42A 2JDZA 4Q4Y2 4XF1A 2GP5A 3WNNA 3HJRA 1L3JA 1ZBA3 1GQGA 1RUG3 4KU7A 4Z2WA 2Q1FA 3B93A 1WKYA 3RYKA 3FBYA 5DUWA 4YWAA 1IOAA 4E4SA 2WWSA 2KXLA 1W9TA 3AC0A 1YRZA 2GMEA 2WZPP 3VZMA 1ZZ6A 4MGQA 5FMCA 1LOAA 2V5YA 4OUMA 4XUTA 2Q1ZB 4FOWA 5EPAA 1AVBA 1QH6A 2CGPA 4AI3A 2B39A 4R4ZA 4CDWC 4RQPC 3ZXJA 1AF9A 2A3XA 4AYUA 1PZ7A 4DZGA 4FCAA 2A5ZA 1ULEA 1RGSA 4A6OA 4PDWB 3H9AA 5FZIA 3HQUA 4AK3A 3PMEA 3PUQA 3QH7A 4BQ2A 1QQP3 1US2A 4AAPA 4YFWA 3RGBA 2BWCA 1F5FA 3ZDVA 3C8XA 3MIHA 4QB1A 3VDCA 5J09A 1ZZ7A 1WMFA 2JG9A 3BALA 3VD3A 5BUVA 3M3OA 1WBLA 3BKZA 2C9KA 1EUUA 1LNSA 3LGRA 3DN7A 3O14A 4FPFA 3I3MA 5E6HA 5T5JA 2XXZA 1XRUA 4RHV1 4D6RA 1MS4A 3POFA 1UCXA 3NW4A 2W3JA 2ZPXA 2J1TA 1SPPA 3U1XA 4QPGC 4RGGA 2JXAA 4EROA 2C9AA 2RM23 1CZVA 2QE3A 4KWLA 3M8LA 2ZGQA 3SH5A 1VBC1 5GZEA 2A6WA 4L97A 4E8CA 4Z82A 3INAA 4NWWA 1VBE1 1ND2C 1QGLA 1X33A 3WR0A 5J96B 4IV1C 2BRTA 4LIVA 1X9PA 5CFDB 5FQ0A 4QKNA 3VHOA 4JTOA 4Q4X3 3V0AA 3O1OA 2QTWB 4P9JA 3H7YA 4X8NA 3VKLA 4FVVA 1ASJ1 1E57A 3N9NA 1RYYA 3NV3A 4GULA 2MEV1 4META 3VHRA 3VBHA 2R0HA 2SLIA 1REEA 2XLAA 2H6BA 5JLVA 1JU3A 4FPGA 4LHKA 3KT7A 3LFMA 3OGRA 4R8HA 1GR3A 5FWEA 3ZFFA 2C0ZA 4Y26A 4UF0B 5LATA 4MXWB 1HN0A 4LK6A 2ZX2A 4NPRA 1V6MA 2XJQA 4E9KA 2ZGKA 5L7OA 2ZAHA 3AZXA 4XEZA 5EJ1B 5IK5A 1WW4A 2WQ8A 3RZZA 1SBFA 3B00A 1JODA 1SLBA 2VUDA 4YG6A 5FP9A 3D6EA 4MHUA 4MZUA 2B5HA 2IXHA 1NA1A 1T6BX 2GNMA 2YG0A 1VB2A 2WZR2 4FI9A 2OZ6A 5FYHA 4NIGA 5C33A 3MFAA 1HX6A 1KRIA 3B02A 3IPVB 3UYJA 1XBFA 2E32A 2WRAA 4TYSA 4A2UA 1DG6A 4AOCA 1EPZA 3T08A 3WCRA 4H55A 2WR9A 3APBA 3E1F1 3URFA 4BJ0A 1BBT3 2BGOA 2WWUA 3GZAA 2DFCA 4GKXA 1AYN2 1QHDA 2RHPA 1ENSA 2Z69A 1JOBA 1BCXA 4RA0A 5CKNA 1UPIA 4XJ9A 4WVMB 4Y1UA 2WFF3 3FMGA 3KCCA 1LHOA 2BNOA 4Y5TA 4NHKA 2OS2A 3OBAA 4ARXA 4N43A 5FPUA 4INDA 2YBSA 3L9JT 2E26A 1DGRN 1GNYA 1LHNA 2Y38A 4ZZ5A 5FZMA 3BU7A 4DB5A 3RYRA 4FXKB 4IV1B 3VL8A 4D7YA 4UFJA 1CPNA 4AGGA 3E6BA 3KVBA 5BNPB 2WS93 4AHYA 1ALYA 3OY8B 1S55A 2R0FA 2FMDA 2WT0A 2W95A 3GHMA 4Q0QA 4YGBA 3ZM8A 4BMBA 3DUIA 1TMF3 4YZ3A 1RXFA 2QNKA 3IIAA 4OLLA 5ABJC 2YUEA 1ZA7A 4DOUA 2ZJCA 1S2EA 3RQ0A 5FOJB 5LEKA 3RPQA 3T1MA 4L99A 1W8FA 1XSRA 3AYAA 4B4QA 1JZ4A 5LW9A 1F8VA 1SZBA 1OURA 3UJOA 2PHFA 3NV1A 2Q8EA 1PO13 1UZYA 2BUKA 5EJ3A 5A3LA 5KXDA 3MIBA 5GALA 4CDQC 4PDWA 2BGPA 3VBOB 2W92A 5KR7A 1IS4A 2RR12 4GALA 1ULGA 5H9RA 1FOD3 5GLWA 3T2OA 3Q9OA 3NMBA 3SITA 1H0BA 2XWBB 5JDBA 5F2SA 5BNQA 1XB9A 1QY4A 5CEHA 5FYSA 5LRSA 3I2IA 4CEWC 4NIHA 1JMUB 1LGNA 2BEOA 1S2KA 1M4WA 2WNOA 4C91A 2JG8C 1RUNA 2WZR1 5AFBA 1YYNA 5EIYB 1O91A 2VZSA 1W3VA 2JDAA 2UY9A 5FYBA 1SFYA 4OCTA 5HBAA 3BUCA 2RDSA 3PUHA 2ET7A 4XOGA 3T0AA 3P3PA 1GNZA 2VECA 5CISA 1CX1A 1N3OA 1RUD2 1S0CA 1AYN1 1QOSA 1ST8A 1GOFA 1RUC3 2G1MA 2AGSA 4Q27A 4QGNA 5T50A 3U11A 5J1XA 2JJ6A 3M3EA 4AVAA 3ZYGA 1HRV3 4R9DA 2XLGA 1QEXA 1Q8OA 2ATFA 2PHXA 5CFDA 2QDRA 3JUUA 2JD9A 3HNMA 3N9QA 3UETA 1JZ2A 1R092 2BZDA 3LCPA 3L2YA 4CU6A 5F5QA 2JDKA 2LALA 3LFIA 2ZEXA 1QJX3 3KD4A 1AJKA 3GCXA 3VN4A 2VW0A 5FY0A 1N3PA 3JB8A 5JXIA 3KMHA 3CHXA 4UF0A 4QDQA 3CIHA 2C24A 5FPXA 4K8RB 4MXWA 3B9CA 5JXJA 1W6MA 1JZ5A 1N1TA 2XLFA 3OYWB 2WSVA 3GJBA 1HLCA 1ZNPA 3NAPB 3M3CA 5LB6A 4K40A 5FZFA 1AYM3 1GUIA 3KGLA 5A3PA 4FQ4A 3BTYA 5FY8A 5F5CA 2QJVA 5F6KA 2WUHA 3MPBA 1FAYA 4ZHNA 1QF3A 2DBIA 4FPKA 4IDZA 4K8FA 1AR61 4A6SA 2BBVA 2DVGA 2AEZA 1GWLA 3SH4A 1W2UA 2OQ7A 5DUVA 1Q5OA 4ATFA 4Q0VA 4JRLA 2RR11 1GKBA 1TZOA 1S0DA 4N90A 1QXRA 2WJSA 5KHIA 2PHLA 5FPBA 1CQ9A 1W06A 3ZSJA 4CVUA 5C7GA 1PMHX 1ODNA 5DZEA 2ZEWA 3MF9A 4I0AA 2Y6FA 3IIIA 1UIJA 4HBNA 3MF6A 2YC2A 1XE8A 2BVBA 4XC9A 3LA3A 1C5HA 3DYMA 3PJYA 4QHOA 2OX0A 1W9SA 1OD3A 4MGIE 4QDSA 3NO8A 3MLKA 2FDIA 1Y7BA 4IV1A 3GBWA 2A71A 1VMFA 5FZ0A 4PBOA 2WZEA 2JIJA 4FPCA 5DDJ2 4B8EA 3AKRA 3Q8BA 1RITA 5BNPA 5A1FA 1D4VB 5ERLA 3T0BA 3OY8A 4D7TA 4EZHA 5LASA 3O1PA 4K21A 4HOOA 4NN0A 1RUD1 4CTEA 5IK8A 3I2OA 4YZ1A 3ZYPA 5I0DA 1V70A 3NJVA 1ODMA 1BKZA 4XETA 2RS53 2L9LA 1QDCA 5EYYA 2XKOA 3NSTA 3NJYA 2VW1A 4W6YA 4EQVA 1C28A 1YQ2A 4CU7A 3VDDC 1R091 3ZDSA 1KJLA 4H2AA 1U0AA 4Q0SA 3H1YA 1HQLA 5LZ6A 2GNBA 3D0JA 3CJIB 1W9WA 2IUWA 3HN3A 4RN5A 1K12A 3VBSB 4BIFA 1H8TB 5JIAA 3VBOA 5FZKA 5A3MA 2B8MA 2W1WA 2QQOA 2WNVA 2YY1A 2G9FA 5JR2A 4JRAA 1AR93 1HQNA 2BNNA 3N7LA 4CPBD 2RE9A 2IXJA 4R9CA 1O5LA 2WO1A 5FY7A 2D6OX 5LK5A 3RDIA 4X6QB 1NQDA 3MIEA 3IN9A 4KG8A 4PIZA 3OGSA 5ABJB 5FR3A 4YVWC 4WZCA 1JUHA 1K5MB 4YRDA 2VM9A 2ARCA 4I0BA 3I8TA 4LK7A 3RWKX 1PIV3 5HV0A 4M3CF 4XJUA 1JOJA 3LE0A 2ZX3A 5FYZA 1W2AX 1YFWA 1KDKA 4NRMA 4WM8B 3DEMA 4ORFA 4XFHA 3DGTA 3CF6E 4IETA 5CIRA 3AMPA 2QQKA 4UW4A 5FZGA 3A0KA 3CLPA 2YV8A 5ANNA 5FZ3A 1VBA2 3E5QA 4AVSA 1KEXA 3N9PA 4QHZA 1POV0 1I1EA 3D8CA 5EQUA 1RUI2 5D21A 1CD3G 3RYPA 2YPJA 3WZ1A 4URAA 4W6WA 5JMOA 2QQJA 3WX5A 4HVQA 3RZLA 5L19A 1VAKA 5T55A 1GYKA 2W9XA 1MQTB 3AMMA 3USSA 4CXYA 4DEQA 5K0UB 4COUA 3USUB 3VKFC 2D97A 3ZXKA 1ULCA 1CONA 4N9IA 2KR2A 3WUDA 1O3QA 3HT2A 3I3EA 3LDKA 5FPVA 4EN9B 3RI8A 1D2QA 4BU2A 3HEIA 1BXHA 1ENQA 5DDJ1 1TG7A 2R062 4XFBA 4XF4A 1XNDA 1V00A 1DGRA 2JDHA 2ADEA 1UU5A 1ACCA 3OYWA 4NHYA 4UT5A 2YU2A 1ZZ8A 5FY5A 4AEDA 4E2SA 3N7KA 3NAPA 5KHKA 2YXSA 1DHKB 3BN6A 3NNLA 3FLTA 3MIGA 1D7PM 1DIWA 1W0PA 4XAEA 3TEYA 2GN7A 4Q0UA 4JGZB 1UOJA 1MPXA 1O4TA 1ZBE3 3HQRA 4GH4C 1UL9A 2HWE2 1O7FA 3ACLA 4Y1XA 1OH3A 1PK6B 2QCSB 2ZGLA 3DF0A 4LBKA 4ZZ8A 5JWPA 2Q30A 1XQNA 5DAPA 3ST7A 3F95A 5CKMA 2ZHKA 4WVWA 3UK9A 1QXPA 1LKNA 4GB32 3DCQA 1BVVA 4NHXA 4FPLA 4LXLA 3WG4A 4L11A 2VZPA 1JYCA 4LKEA 5FMOL 5J36A 2VCAA 3B94A 1GP5A 3ZFGC 2XJPA 1MACA 4M01A 1JZ8A 1A78A 3VZLA 2JENA 1NX9A 1SBEA 1YUDA 4FPOB 2GZWA 4IERA 2IXLA 4GWIA 5JOYA 1OT5A 4A3ZA 5BNNB 2CAUA 5LRRA 1S1AA 1C8M3 3PLQA 3A7QA 2F4LA 4LE3A 2CTVA 2GH8A 2R16A 3AXDA 3DPRB 1GZWB 1XOYA 4AFCA 1PZ9A 4LOSA 1O4ZA 5CNAA 1VRBA 2AACA 5GLUA 3WF0A 2PLV3 3P1IA 4BQ5A 4CSWA 4UFIA 4QDRA 4A44A 1VBA1 2K2SA 3GZEA 5C8CC 3AKPA 3OBTA 4LPLA 4LE4A 4PCRA 5SV8A 1FNYA 1IZ3A 1WGPA 1R1A3 1W8UA 4IESA 2LRPA 2VOTA 1RUI1 3ZXGA 5BV6A 4E2GA 5HPOA 3T3YA 1MS9A 2R042 4HONA 1JZ6A 2A6YA 3AK0A 1O3RA 1D4M3 1UN1A 1D0HA 5CADA 1CZSA 4CCDA 2WLPA 5F39A 3HT1A 1P8JA 1W6NB 5K9YA 4FPHA 4CDXB 2Q0AA 3NRUA 3CJIA 1RUE2 4XDPA 3VBSA 4DUVA 1GU3A 5C3QA 1WA6X 3OOXA 2WINB 4UW6A 2R061 3J8F3 4QX5A 3OEBA 3U75A 5C5TA 3CZUA 1A8MA 1POV3 1GP4A 4IV3C 1O4YA 4P9LA 4XJAA 3ZYHA 4COVA 2F17A 5GZGA 1AR71 3GCWA 4M3CE 4BQYA 2DFBA 3OD4A 3HD8B 4BQ1A 4MVTA 1K5MA 5KXBA 4LHSA 4NIIA 3ZXDA 4CU8A 2NQYA 4CDUC 1DQ0A 2B9UA 3AMNA 3CBNA 2VVFA 1FPN2 2HWE1 3R4UA 5JOWA 1NCRC 2VXJA 5E16A 2A6XA 2BTVC 3GZTB 3ZXEA 3K2OA 1IPKA 2VZTA 2R073 3N35A 2WT1A 2W1SA 2RS33 2ID4A 3OGGA 4GB31 1XYPA 4WZFA 4QQOA 3WP4A 2J22A 4LKSA 4IGOA 1OOPC 3GGLA 3WT3A 1GOHA 1F2NA 4KGQA 3SEEA 5F1RA 4Q26A 4A45A 3OBZA 4ZU5A 1NCQC 3SQOA 4BCUA 4XW3A 3T30A 1Z78A 2V4AA 3W59A 3C7HA 1W9YA 3QLQA 2JKXA 1MQTA 2VQTA 3VD4A 2R1BA 5ISLA 1OD5A 2FDJA 4ASLA 5FWJA 1TE1B 1HRI3 2ADDA 2E7QA 3PJQA 4IE0A 4QT6A 1V6LA 3JB4C 5K0UA 5FY1A 3CKHA 3USUA 3WINE 2DBNA 3AFKA 5A3TA 1XNCA 2V5DA 2ZKNA 3BTAA 4W4ZA 4AE2A 4AVTA 1BJQA 1XXNA 2KD7A 4NR1A 4O7XA 3WP6A 2EIEA 2P17A 5JZGC 2UY8A 3CJXA 1NKGA 3P6BA 2VJXA 4M4RA 1NE6A 4IQPA 2HYXA 1GZCA 1Y43B 2YROA 2DCYA 5IAXA 3MV01 5F3GA 2Y8KA 5C71A 1QH7A 4GIQA 1XE7A 2C5DA 1V9U3 2A73B 5E1RA 5CYYA 3D82A 4YW7A 4JGZA 2Z42A 2Z2SB 4KI5M 4NE9A 4AFDA 2D44A 4ZXKA 1VAMA 4D94A 4F3JA 1PK6A 5A7PA 1HKDA 2LS6A 1NY72 1URXA 1RUF3 1FYUA 3JBG2 5BNOC 5I0RA 1RUE1 4CXXA 2VNRA 2VCCA 1UU4A 1UY0A 2QQWA 3IM0A 4PI2A 1ULPA 2VNGA 2YBPA 4B7EA 1G9DA 1NXD1 4LO7A 2KM2A 2VBBA 4LITA 3FZ3A 1TQ5A 3AMQA 1AZDA 3ZSMA 1SLIA 1U12A 5AC93 1S0BA 2MPFA 2VZRA 3CO2A 1CAXB 3O1RA 4AFMA 3ME2A 3HR9A 4K1ZA 1UOFA 4FBFA 1UAIA 4JCKA 1MZFA 1Q56A 1T2XA 3N9OA 1OQDA 3GZUC 1H4HA 5BNNA 1RUJ3 2WKKA 3I3BA 2H0VA 1FPN1 3KCYA 5C9AC 3A4UA 1XJAA 1WCQA 1YJKA 4TTGA 2Y34A 4UOJA 1GZWA 1R082 3BB6A 5J48A 1JBCA 3O1TA 1W04A 3BTZA 4CDWA 4A4AA 2SBAA 4CCKA 3DV8A 3I97A 1MVEA 5LY2A 4IEVA 3UGFA 2X53S 3PVEA 2A75A 5IJRA 1WLTA 2WNUC 2PELA 2DUQA 2R1DA 4XMAA 1WMEA 2J1UA 4YVSB 1UXZA 5C4WC 4OI2A 3J7HA 4XUOA 1OMIA 4HETA 4KWKA 4LO6B 1G86A 1GFF2 5I93A 3AP7A 1W6NA 1W6QB 1YI9A 3H3ZA 4RS5C 3V0AB 4BA6A 1FNZA 3A21A 1W8HA 2GALA 1C57A 1IKPA 1AR82 4LMFA 1YIFA 1OLMA 3OPWA 5A6YA 4JGYC 4EN7B 1G9BA 1RMU1 2I74A 3ELNA 5GM0A 3GXUA 5LK7B 5A3NA 2D5HA 1YQ8A 2ZGTA 2JD4A 5ACA3 4QPGA 4BQ4A 2FDKA 1RHI3 2D93A 1COV2 5IVCA 1X9TA 2OZJA 4IEXA 4JKMA 5FMDA 2X29A 5K8SA 1CWPA 4MUVA 2OIIA 2ZEZA 4AQTA 1UWWA 2HWF3 2IXIA 2WBKA 3AYDA 3LDRA 1J58A 4HMZA 4LORA 2D6NA 3ZMNA 1CJPA 2JB4A 3O0WA 3BPSA 3ZMOA 2EAAA 2OT7A 3MW4A 4UBHA 1OHFA 1BMV2 3RWNA 2IWGB 1NA1B 5T5PA 2E53A 1NY71 2CNAA 1SLCA 3JBG1 4ISQA 1N1SA 4KNCA 5LY1A 4C90A 4HK9A 1ZBA2 4DRRA 3I4IA 4OHVA 1XNTA 3QD6A 4YG3A 2WFPA 1W8ZA 5A6ZA 1UOBA 2QFEA 3VHPA 4C1WA 5L9VA 1SFNA 2E31A 3T4HB 2ZMNA 4ONUA 2OPKA 1UY4A 4NAMA 3WDWA 1YFYA 1CN1A 2VMIA 5FYIA 3KB5A 3N4MA 2ETEA 3EJKA 1Y9GA 3U4SA 4K9SA 2E7TA 4XBQA 3ZFEC 2A3WA 3VBFC 4ZKTB 1DQ2A 3KT1A 4D0QA 2OW4A 2VGDA 4A3XA 1PGW2 2A70A 2V09A 1OXCA 3K4AA 1VBD3 3MW2A 3ZO0B 5GLVA 2DUOA 2P6HA 2J1AA 2JE7A 4PJYA 3THPA 1Q8QA 5GLTA 4ES9A 1R081 1ND3C 1RL3A 1XNKA 2EALA 2CV6A 1QDOA 1WZXA 3QOPA 5FJHA 1LR5A 2FMYA 2B4KA 2Y0IA 3OEAA 4NIDA 2GC2A 5D8AC 4GWJA 1QNWA 3JQWA 3K4DA 5FO9B 3AXEA 1Q8VA 1QQP2 3W5NA 2WWJA 2HYKA 5BYNA 4PF1A 1OC1A 1OFNA 2GNDA 4MO3M 2MHFA 5A3WA 1DZRA 5IW0A 4UFHA 5A7WB 5A6XA 5FZCA 2FD8A 3T4VA 3H1MA 3VD7A 1O5UA 4D6QA 1H2LA 1W8WA 2XUMA 1SHWB 4DFSA 1ZRFA 5FUPA 3IBMA 2XVLA 2O0OA 3OUHA 3S30A 1IG3A 3OUJA 3KF5A 5LBEA 1AR81 2DUPA 4AZZA 1XNAA 1Z7S3 3LA7A 4QQHA 5FUNA 3ECQA 4QX0A 5FYYA 5GZFA 4AI9A 4K7JA 2RM22 3KWVA 2VG9A 2FQPA 2R49A 4H7MA 2D3RA 4CU9A 1XC6A 4YW3A 2E7AA 1COV1 3VHNA 1OUXA 2UU8A 2W46A 1CAXA 4ITCA 3PU8A 3MW3A 4CUAA 1I9RA 1LECA 1XNBA 3W20A 2VTXJ 3O1SA 4Q4X2 3M1HA 1FI2A 1CPMA 1RUH3 2XG3A 4AVCA 1BMV1 3SCGA 3ZKYA 3A22A 5L36A 1S4CA 1HJGA 4LNVA 2WN2A 4YM2A 1ZBA1 3OF1A 2X5IC 3GBFA 4IEWA 1LHVA 3TOJA 3KZ4C 4M00A 4XF0A 5FZ4A 2UWAA 1U5IA 2VMCA 4GA9A 4J6GA 1PMJX 4AFAA 1J1TA 2P37A 5GZDA 1EYBA 3EO6A 3FUQA 2Y6GA 1S0FA 4YVSA 3CDZB 3POSA 2ES3A 4KBZA 1EUTA 1DGLA 4LO8A 3WHUA 1W6QA 4ASKA 1PGW1 5LCWL 1V0AA 2XQXA 3VGIA 3ZR6A 3AP5A 3T09A 4Q4Y1 2JG8A 1ENRA 1LODA 1W6PB 3WW2A 5LA0A 4QPWA 3I2HA 1VLNA 1JW6A 3FFZA 5FBJA 4JVAA 1DZTA 1BBT2 2TNFA 4IEUA 1VMHA 2WT2A 4RR3B 2QQMA 1W6MB 3L2HA 1E5RA 1QQP1 4NVPA 1DLCA 1IGOA 2VMEA 2WFF2 2DV9A 5JIUA 4L92A 2VMGA 2VU9A 3BU0A 1XU2A 2RDQA 2HWC3 1O3SA 3M3IA 1SG3A 1H30A 4N7UA 1XE0A 3U78A 4WBBA 5K7PA 2EA7A 2HEVF 1NLQA 2GC1A 3AZWA 2DCZA 1UZWA 4HSLA 4W65A 1RJ7A 3ILNA 3PTRB 1IHMA 1DF0A 3TB0A 3EXUA 2JDYA 3K3NA 4IXLA 3BI3A 3C7FA 1HN1A 2WS92 2GU9A 3U14A 4H7LA 2RM21 1AHSA 2OA2A 4CEYB 1BZWA 3THCA 1UYPA 4WV8A 1N1VA 2XONA 1GZTA 3TRSB 4HKLA 1JTZX 2ILMA 3UKVA 1TMF2 5J7MA 4CUCA 2DTWA 4HKOA 1LCLA 4M0NA 5A32B 2WAOA 3R4DB 2VPVA 4A42A 1FMD3 1QJZA 3UL2A 4PQQA 4Q4X1 2RV9A 4XPVA 1MVQA 3KGZA 3DKQA 4QX3A 3RZJA 4YM3A 1PO12 4R4XA 4MGTA 2HWB3 3K46A 3FUOA 3POEA 3WDTA 2D6PA 2VOXA 1FOD2 1VALA 4BQ3A 4P9GA 2QQNA 2D43A 1AX0A 4C0BA 1H8VA 2R7EB 1LJ7A 4QM9A 4QQLA 1IG0A 3PHMA 5A7WA 3LIHA 4V2VA 1OA4A 2PXJA 3S6PA 1NYWA 5EV7A 2XL9A 3A0NA 5FV3A 4QXBA 4YM0A 1RC6A 3IDCB 3VL9A 4YZ2A 1UF2C 1ZRCA 3S5QA 2IZWA 5FRAA 3ACHA 3M7AA 4MGZE 3SEPA 1B09A 4QKFA 1D0GA 1HB3A 1UPSA 2TEPA 1LOFA 3BOWA 4EN0A 1G8WA 4RD7A 2WNVB 1F4AA 4V2WA 2E63A 2JG9C 2BDRA 1RUC2 2VNOA 2YHJA 4BZ4A 5C3OA 4TXWA 1OPMA 4DMIA 2RJ2A 3C3VA 2ZCWA 3NKTA 1HRV2 2WFF1 1CIWA 1OKOA 4Q4W3 3WHTA 2EAKA 3MV11 1NXMA 3TEZA 1SLAA 5FP3A 3V0BA 2V72A 1JOPA 3LKJA 3AZZA 3FJSA 2YC4A 1PM7A 2HWD3 4N7IA 2YBKA 1GMMA 4WVZA 3POWA 1LHUA 2PN5A 3T1LA 1ULOA 4PHZA 1YC61 4AQ6A 1JHNA 2WS91 3O1UA 1VRH3 4O9EA 4LBLA 1DU3D 1SCRA 2X8KA 2FDHA 2ZX1A 3P5BA 4YGCA 5FPLA 2GH2A 4N53C 3S0MA 4WM7C 1TMF1 1AYM2 3D4KA 4ASMB 1X8EA 2W68A 2XGXA 1OBNA 3WF3A 4NO4A 3DYOA 3VBHC 1W05A 1AR63 1OFSA 1HXS3 4Y5Z0 4KWJA 2FCTA 3ZFFC 3WF4A 3JD73 1DGWX 1PO11 1W6PA 2K9ZA 2D98A 3LAGA 4UW3A 2RS13 2ARXA 4IEOA 1O8PA 4JAAA 1EAH3 1OUSA 3ZXFA 4RR3A 4BYYA 4DIQA 5L7OC 1ZX5A 1FOD1 1Y9QA 1H2NA 4BISA 2GC3A 1DQ5A 2DURA 4KBBA 4AEDB 3IKWA 3H3UA 5FZAA 1W8NA 3H50A 3ETQA 4LBQA 2QVSB 5IWFA 1OOPB 1YHFA 1OPOA 4ATEA 4KGGA 2CWMA 4F8AA 2P6CA 2PHWA 5CFCC 1WBFA 2D7FA 4OZXA 1LGCA 4CUGA 3KF3A 5GJ6A 2BU9A 2VAUA 5GKAC 4IEYA 1JYXA 2ZX4A 2ARBA 4ZU7A 4FTSA 3MI8A 3E6CC 1IS6A 4D8MA 1BK0A 1ONAA 4DY3A 5SV5A 3ES1A 5LWBA 1ZZ9A 2VMFA 2P3KA 4CEYA 1POQA 1RUC1 1OI6A 2W5FA 2ZGPA 5E89A 3OGVA 5JOXA 2ZXQA 3IZOA 2XL7A 1HRV1 3WDUA 2RS52 4QPIB 5A32A 3N7MA 3OPTA 2CGOA 3VBRB 1QJU3 2G9ZA 5K4LA 3Q8FA 1YEWA 4CCLA 1QOOA 3SHRA 3R6SA 1WMDA 1IPJA 3VKNA 4GD4A 2R6QA 5J3UA 1NAEA 3O0XA 1CZTA 5BNOB 4FT8A 1AR92 2JB8A 4JHTA 2ZHLA 2VQ0A 4BK4A 4RGKA 2UURA 2VVDA 4E4ZA 2VZ3A 2PHDA 3OCPA 3KHBA 1AYM1 2XMLA 2ZA9A 2YGLA 3ALQA 1W0NA 3MGUA 3PVNA 4C0HA 1JYWA 3BIEA 4CCNA 5CG8A 1GBGA 1PIV2 5EXOA 4DS0A 4Q8LA 5JPNB 2WC2A 4PDWC 2WDBA 4AAXA 3WQ0A 3WNKA 4K6BA 4XTMA 4QQPA 4XZUG 4YZ4A 1LTEA 4YW5A 3CQOA 3JQXA 3M2MA 2VUAA 1OH4A 3WDYA 2IFRA 3B01A 3PU3A 2AEYA 1SDWA 3ITQA 3POYA 3WLUA 4B1LA 4HVOA 2VMDA 1WLDA 3KHCA 3HBZA 1SBDA 4EV0A 4PLNA 2UWCA 1US3A 3QCWA 2JECA 4XUQA 2GDFA 4Y1VA 5G04L 3EYPA 4AWDA 2VQAA 2JE9A 2G9GA 1OVSA 4FAHA 1NT0A 4GXLA 2HH9A 2PHRA 2VD7A 2VH9A 4Q1RA 4Q4V3 4QKDA 5CVRA 4NMIA 2Y0OA 2C26A 2C6SA 4NJ4A 5IT6A 4OVEA 3CMGA 5EJZB 4ZU4A 1FV3A 4YZ5A 2J1SA 1SDDB 4EN6B 1NUKA 1W3XA 1RTVA 4TLFA 2XKPA 4AGVA 5FYVA 2HEYF 4HSJA 1B35B 3SCFA 5CFDC 4ES8A 1OSGA 2G19A 5IVJA 4GJZA 3FN9A 3J7MA 3NL1A 5LBBA 2RS51 5DN2A 5G05L 5F2WA 2XHNA 4QB6A 1ZBE2 3WP3A 1QIQA 3WF2A 5C8WA 5FBZA 4H3WA 2XR4A 2D5FA 5IYYA 4V1PA 4BB3A 1EV13 3B3QE 3MICA 3AB0A 2RJLA 2A6ZA 1UU6A 4LOTA 4FSJA 4XTPA 1AR91 4GQ7A 1K5JA 3GNEA 3I2KA 2WLQA 5D2AA 4XQDA 3VBUB 2JDPA 4PIXA 2P3IA 3AP4A 5CB7A 1RB8G 4C8DA 1OOPA 4DO0A 5JPMB 2EIDA 1W28A 4M3CB 2BYVE 2Z4FA 5KHGA 2XJTA 2WZ8A 4MX3A 1PIV1 2UYBA 1H1AA 3ROUA 1C8M2 3I3DA 3KT4A 4ZY9A 3JCIA 3RNSA 2YYOA 2LM3A 1PX3A 1WCSA 4TSVA 1UNBA 2AH2A 2I07B 2PLV2 1SEFA 2ZGNA 3WDXA 5JOZA 3HBKA 3QBQA 4KMQA 4N9HA 1S0JA 2HLEA 5JZGA 1RUOA 1R1A2 2Q4SA 1WW6A 3OUIA 1FATA 4RSUA 5A6QA 4QPIA 2RDRA 4LO5B 1S2BA 3ATGA 1U5XA 3VBRA 3MBWA 4YM1A 4NIAA 1D4M2
chains in the Genus database with same CATH topology
3I97A 2W94A 3C7GA 3NJXA 5IJRA 1RYYA 5JXHA 2J1UA 1UXZA 3GDBA 1JU3A 3J7HA 3OGRA 4XUOA 3K4ZA 4W8JA 5DMYA 2CDPA 1UY3A 3A21A 1JYVA 2VC9A 4DXSA 5EJ1B 4DXRA 4KWUA 2WQ8A 1I5PA 4DUWA 3GXUA 1UY1A 4BDVB 4FI9A 2WO2A 2YG0A 3K77A 3PUIA 1R64A 4JKMA 2PQSA 3I2GA 2E32A 5IFPA 2ZEZA 1UWWA 2WBKA 3T08A 4CU9A 2RVAA 3E1F1 4BJ0A 2BGOA 5FUIA 4JKKA 2YB7A 5DQ0A 3ACFA 2ZEYA 3WNLA 3DECA 3OBAA 4ARXA 1XNTA 2VZ1A 2JE8A 2E26A 3EB7A 1GNYA 2WYSA 3WF1A 2E31A 4ZZ5A 1UY4A 4QX2A 2VR4A 4XVHA 3OG2A 4D0QA 3K4AA 2BERA 2J1AA 2W95A 3ZM8A 5F7UA 1L7QA 2J1RA 2B4KA 3OEAA 3LEKA 4GWJA 1JZ4A 3K4DA 2W91A 3W5NA 1J84A 4PF1A 2DDUA 3FHAA 4MO3M 3SKVA 2BGPA 4MADA 1UY2A 2W92A 4RYDA 1H6YA 3VD7A 4HG6B 1SHWB 3T2OA 1JI6A 1XNAA 1DYOA 3ECQA 3I2IA 4QX0A 1XC6A 5EIYB 1UMHA 1JHJA 2W46A 2VZSA 1UYZA 2JDAA 4Z2AA 4CUAA 3UESA 3PUHA 3T0AA 3I2JA 3LPGA 1CX1A 4PT6A 2C4XA 2VZVA 4E8DA 1GOFA 2X09A 5J1XA 4XURA 3SKJE 3A22A 3WQBA 4JX0A 2WN2A 1JZ3A 3WNMA 2JD9A 3HNMA 3UETA 1JZ2A 2CDOA 2BZDA 2VMCA 4CU6A 1GOGA 1PMJX 3ETPA 2ZEXA 2Y6GA 3W5MA 3CDZB 4OMDA 3WNOA 2B9VA 1EUTA 1UX7A 3IB3A 5JXIA 5JXJA 4QDQA 3CIHA 1JZ5A 3OB8A 5LCWL 2VZQA 2XQXA 5LA1A 3T09A 1GUIA 2VL4A 4XUNA 5LA0A 4QPWA 3I2HA 2WUHA 1O59A 3LEIA 4ARYA 3CZJA 3K75B 3BGAA 4LQRA 1UYYA 2QQMA 4ET7A 4XUPA 1DLCA 2VMEA 2X10A 1SG3A 1DP0A 3A23A 2QQLA 4P08A 2XOMA 4CVUA 5C7GA 1PMHX 2ZEWA 2ORZA 2E33A 2WABA 3C7FA 1HN1A 3IIIA 2YC2A 2YFZA 2WAAA 3DYMA 4QAWA 4QB2A 1W9SA 1OD3A 4QDSA 3THCA 1XPWA 3HOBA 2XONA 4UI9L 1J83A 3UNPA 2WZEA 4CUCA 5C70A 3LPFA 3IAQA 2WAOA 3T0BA 1H6XA 2W1UA 4A42A 4PQQA 2RV9A 2VZOA 5I0DA 4QX3A 3NJVA 1W8OA 2L9LA 4ZXEA 2LW8A 3K46A 1YQ2A 4CU7A 4IUGA 4YPJA 1OF3A 2J1EA 5LA2A 1BHGA 2QQNA 1W9WA 3HN3A 4RN5A 1K12A 2R7EB 4CUBA 2WN3A 2W1WA 2QQOA 5JR2A 2Y6JA 2EICA 2WO1A 1K42A 3I2FA 3ACHA 3OGSA 4P02B 3SEPA 1UMIA 1L7RA 2Y6HA 2VQUA 2VM9A 1K3IA 3WNPA 1F4AA 2VTFA 2OKXA 3LE0A 2VCBA 3WEZA 4JKLA 4TXWA 3WSOA 2RJ2A 4OMCA 1UYXA 2QQKA 3MV11 1KEXA 2V72A 2YC4A 4P00B 1IQDC 3VDAA 2QQIA 1GMMA 5JMOA 3NQHA 2QQJA 1OF4A 4BXSV 1ULOA 3FL7A 2W9XA 2V4VA 4DEQA 4DEVA 1K45A 2VO5A 1CIYA 3VD5A 3I3EA 4DXTA 3HEIA 1TG7A 3WF3A 3DYOA 1O8SA 3WF4A 3IAPA 5B4XA 3NNGA 3BN6A 1D7PM 4QX1A 2Y64A 3MUZ1 3HNBM 1F4HA 1MPXA 1O8PA 5A1AA 2W1QA 1KGYA 4ZZ8A 4JHZA 1W8NA 1JZ7A 3LEGA 3HNYM 2VZPA 3U37A 2VCAA 3FHQA 1JYXA 1JZ8A 2EIBA 5B4NA 1NX9A 2Y6KA 4D8MA 4AG4A 4GWIA 3LQCA 1OT5A 2VMFA 4A3ZA 3T2PA 2W5FA 2QBXA 3A7QA 3DYPA 3OGVA 2ZXQA 3WF0A 3C7EA 2YFUA 3P1IA 4QDRA 4A44A 3ACGA 4LPLA 2VOTA 5JUVA 5HPOA 4M4PA 1NAEA 1JZ6A 3MO4A 4A41A 1CZTA 1UZ0A 1TVGA 1CZSA 1P8JA 5CZKA 3NRUA 4BK4A 4DUVA 1GU3A 2VZ3A 2WO3A 5DPNA 3MUY1 1W0NA 1JYWA 3OEBA 2J1VA 3CZUA 3T0DA 1W99A 3THDA 3IDAA 3F2ZA 2WDBA 4AAXA 3WNKA 2DCJA 4XZUG 1JYNA 3HPNA 3CQOA 4MGSA 4LHSA 1OH4A 1PX4A 4CU8A 2X05A 2W87A 1UXXX 5HXMA 2VMDA 2W47A 2BBAA 4P5YA 5JXGA 2VZTA 2W1SA 1US3A 1JU4A 4XUQA 5G04L 2DCKA 2ID4A 4L0PA 4GZ9A 3EYPA 2J22A 4LKSA 4W50A 3GGLA 1GOHA 3D3AA 4OZOA 3SEEA 4A45A 3JXSA 3WNNA 3HJRA 2C26A 3C7HA 2VZUA 2JKXA 2VQTA 4OUEA 3VD4A 3CMGA 5EJZB 2J1SA 1SDDB 1WKYA 1NUKA 4BK5A 3CKHA 3T2QA 1W9TA 3AC0A 5IFTA 3ABZA 3VDBA 3VD9A 2V5DA 4W4ZA 4MGQA 3FN9A 2KD7A 2EIEA 5DN2A 3P6BA 1NKGA 5G05L 2VJXA 4M4RA 4XUTA 2XHNA 4QB6A 2HYXA 3WF2A 3MV01 5C71A 2Y8KA 4DUXA 5IYYA 4OYUA 5CYYA 4A6OA 4KI5M 2Y6LA 1GQPA 3I2KA 5IHRA 2LS6A 1US2A 3C8XA 3VDCA 4QB1A 2J7MA 3C7OA 2VCCA 3VD3A 1UY0A 2EIDA 4UAPA 1ULPA 2Z4FA 2C9KA 1EUUA 1LNSA 2WZ8A 2ORXA 3I3DA 4ZY9A 2VZRA 3ACIA 2W3JA 1PX3A 2J1TA 3GM8A 4MOAA 1T2XA 1CZVA 3I3BA 4KMQA 4E8CA 2HLEA 4TTGA 1WCQA 4UOJA 3MBWA 4A4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I97 A;  2W94 A;  3C7G A;  3NJX A;  5IJR A;  1RYY A;  5JXH A;  2J1U A;  1UXZ A;  3GDB A;  1JU3 A;  3J7H A;  3OGR A;  4XUO A;  3K4Z A;  4W8J A;  5DMY A;  2CDP A;  1UY3 A;  3A21 A;  1JYV A;  2VC9 A;  4DXS A;  5EJ1 B;  4DXR A;  4KWU A;  2WQ8 A;  1I5P A;  4DUW A;  3GXU A;  1UY1 A;  4BDV B;  4FI9 A;  2WO2 A;  2YG0 A;  3K77 A;  3PUI A;  1R64 A;  4JKM A;  2PQS A;  3I2G A;  2E32 A;  5IFP A;  2ZEZ A;  1UWW A;  2WBK A;  3T08 A;  4CU9 A;  2RVA A;  3E1F 1;  4BJ0 A;  2BGO A;  5FUI A;  4JKK A;  2YB7 A;  5DQ0 A;  3ACF A;  2ZEY A;  3WNL A;  3DEC A;  3OBA A;  4ARX A;  1XNT A;  2VZ1 A;  2JE8 A;  2E26 A;  3EB7 A;  1GNY A;  2WYS A;  3WF1 A;  2E31 A;  4ZZ5 A;  1UY4 A;  4QX2 A;  2VR4 A;  4XVH A;  3OG2 A;  4D0Q A;  3K4A A;  2BER A;  2J1A A;  2W95 A;  3ZM8 A;  5F7U A;  1L7Q A;  2J1R A;  2B4K A;  3OEA A;  3LEK A;  4GWJ A;  1JZ4 A;  3K4D A;  2W91 A;  3W5N A;  1J84 A;  4PF1 A;  2DDU A;  3FHA A;  4MO3 M;  3SKV A;  2BGP A;  4MAD A;  1UY2 A;  2W92 A;  4RYD A;  1H6Y A;  3VD7 A;  4HG6 B;  1SHW B;  3T2O A;  1JI6 A;  1XNA A;  1DYO A;  3ECQ A;  3I2I A;  4QX0 A;  1XC6 A;  5EIY B;  1UMH A;  1JHJ A;  2W46 A;  2VZS A;  1UYZ A;  2JDA A;  4Z2A A;  4CUA A;  3UES A;  3PUH A;  3T0A A;  3I2J A;  3LPG A;  1CX1 A;  4PT6 A;  2C4X A;  2VZV A;  4E8D A;  1GOF A;  2X09 A;  5J1X A;  4XUR A;  3SKJ E;  3A22 A;  3WQB A;  4JX0 A;  2WN2 A;  1JZ3 A;  3WNM A;  2JD9 A;  3HNM A;  3UET A;  1JZ2 A;  2CDO A;  2BZD A;  2VMC A;  4CU6 A;  1GOG A;  1PMJ X;  3ETP A;  2ZEX A;  2Y6G A;  3W5M A;  3CDZ B;  4OMD A;  3WNO A;  2B9V A;  1EUT A;  1UX7 A;  3IB3 A;  5JXI A;  5JXJ A;  4QDQ A;  3CIH A;  1JZ5 A;  3OB8 A;  5LCW L;  2VZQ A;  2XQX A;  5LA1 A;  3T09 A;  1GUI A;  2VL4 A;  4XUN A;  5LA0 A;  4QPW A;  3I2H A;  2WUH A;  1O59 A;  3LEI A;  4ARY A;  3CZJ A;  3K75 B;  3BGA A;  4LQR A;  1UYY A;  2QQM A;  4ET7 A;  4XUP A;  1DLC A;  2VME A;  2X10 A;  1SG3 A;  1DP0 A;  3A23 A;  2QQL A;  4P08 A;  2XOM A;  4CVU A;  5C7G A;  1PMH X;  2ZEW A;  2ORZ A;  2E33 A;  2WAB A;  3C7F A;  1HN1 A;  3III A;  2YC2 A;  2YFZ A;  2WAA A;  3DYM A;  4QAW A;  4QB2 A;  1W9S A;  1OD3 A;  4QDS A;  3THC A;  1XPW A;  3HOB A;  2XON A;  4UI9 L;  1J83 A;  3UNP A;  2WZE A;  4CUC A;  5C70 A;  3LPF A;  3IAQ A;  2WAO A;  3T0B A;  1H6X A;  2W1U A;  4A42 A;  4PQQ A;  2RV9 A;  2VZO A;  5I0D A;  4QX3 A;  3NJV A;  1W8O A;  2L9L A;  4ZXE A;  2LW8 A;  3K46 A;  1YQ2 A;  4CU7 A;  4IUG A;  4YPJ A;  1OF3 A;  2J1E A;  5LA2 A;  1BHG A;  2QQN A;  1W9W A;  3HN3 A;  4RN5 A;  1K12 A;  2R7E B;  4CUB A;  2WN3 A;  2W1W A;  2QQO A;  5JR2 A;  2Y6J A;  2EIC A;  2WO1 A;  1K42 A;  3I2F A;  3ACH A;  3OGS A;  4P02 B;  3SEP A;  1UMI A;  1L7R A;  2Y6H A;  2VQU A;  2VM9 A;  1K3I A;  3WNP A;  1F4A A;  2VTF A;  2OKX A;  3LE0 A;  2VCB A;  3WEZ A;  4JKL A;  4TXW A;  3WSO A;  2RJ2 A;  4OMC A;  1UYX A;  2QQK A;  3MV1 1;  1KEX A;  2V72 A;  2YC4 A;  4P00 B;  1IQD C;  3VDA A;  2QQI A;  1GMM A;  5JMO A;  3NQH A;  2QQJ A;  1OF4 A;  4BXS V;  1ULO A;  3FL7 A;  2W9X A;  2V4V A;  4DEQ A;  4DEV A;  1K45 A;  2VO5 A;  1CIY A;  3VD5 A;  3I3E A;  4DXT A;  3HEI A;  1TG7 A;  3WF3 A;  3DYO A;  1O8S A;  3WF4 A;  3IAP A;  5B4X A;  3NNG A;  3BN6 A;  1D7P M;  4QX1 A;  2Y64 A;  3MUZ 1;  3HNB M;  1F4H A;  1MPX A;  1O8P A;  5A1A A;  2W1Q A;  1KGY A;  4ZZ8 A;  4JHZ A;  1W8N A;  1JZ7 A;  3LEG A;  3HNY M;  2VZP A;  3U37 A;  2VCA A;  3FHQ A;  1JYX A;  1JZ8 A;  2EIB A;  5B4N A;  1NX9 A;  2Y6K A;  4D8M A;  4AG4 A;  4GWI A;  3LQC A;  1OT5 A;  2VMF A;  4A3Z A;  3T2P A;  2W5F A;  2QBX A;  3A7Q A;  3DYP A;  3OGV A;  2ZXQ A;  3WF0 A;  3C7E A;  2YFU A;  3P1I A;  4QDR A;  4A44 A;  3ACG A;  4LPL A;  2VOT A;  5JUV A;  5HPO A;  4M4P A;  1NAE A;  1JZ6 A;  3MO4 A;  4A41 A;  1CZT A;  1UZ0 A;  1TVG A;  1CZS A;  1P8J A;  5CZK A;  3NRU A;  4BK4 A;  4DUV A;  1GU3 A;  2VZ3 A;  2WO3 A;  5DPN A;  3MUY 1;  1W0N A;  1JYW A;  3OEB A;  2J1V A;  3CZU A;  3T0D A;  1W99 A;  3THD A;  3IDA A;  3F2Z A;  2WDB A;  4AAX A;  3WNK A;  2DCJ A;  4XZU G;  1JYN A;  3HPN A;  3CQO A;  4MGS A;  4LHS A;  1OH4 A;  1PX4 A;  4CU8 A;  2X05 A;  2W87 A;  1UXX X;  5HXM A;  2VMD A;  2W47 A;  2BBA A;  4P5Y A;  5JXG A;  2VZT A;  2W1S A;  1US3 A;  1JU4 A;  4XUQ A;  5G04 L;  2DCK A;  2ID4 A;  4L0P A;  4GZ9 A;  3EYP A;  2J22 A;  4LKS A;  4W50 A;  3GGL A;  1GOH A;  3D3A A;  4OZO A;  3SEE A;  4A45 A;  3JXS A;  3WNN A;  3HJR A;  2C26 A;  3C7H A;  2VZU A;  2JKX A;  2VQT A;  4OUE A;  3VD4 A;  3CMG A;  5EJZ B;  2J1S A;  1SDD B;  1WKY A;  1NUK A;  4BK5 A;  3CKH A;  3T2Q A;  1W9T A;  3AC0 A;  5IFT A;  3ABZ A;  3VDB A;  3VD9 A;  2V5D A;  4W4Z A;  4MGQ A;  3FN9 A;  2KD7 A;  2EIE A;  5DN2 A;  3P6B A;  1NKG A;  5G05 L;  2VJX A;  4M4R A;  4XUT A;  2XHN A;  4QB6 A;  2HYX A;  3WF2 A;  3MV0 1;  5C71 A;  2Y8K A;  4DUX A;  5IYY A;  4OYU A;  5CYY A;  4A6O A;  4KI5 M;  2Y6L A;  1GQP A;  3I2K A;  5IHR A;  2LS6 A;  1US2 A;  3C8X A;  3VDC A;  4QB1 A;  2J7M A;  3C7O A;  2VCC A;  3VD3 A;  1UY0 A;  2EID A;  4UAP A;  1ULP A;  2Z4F A;  2C9K A;  1EUU A;  1LNS A;  2WZ8 A;  2ORX A;  3I3D A;  4ZY9 A;  2VZR A;  3ACI A;  2W3J A;  1PX3 A;  2J1T A;  3GM8 A;  4MOA A;  1T2X A;  1CZV A;  3I3B A;  4KMQ A;  4E8C A;  2HLE A;  4TTG A;  1WCQ A;  4UOJ A;  3MBW A;  4A4A A; 
#chains in the Genus database with same CATH topology
 2XUE A;  4YAR A;  1O3T A;  3POJ A;  2W94 A;  1YIP A;  5FY9 A;  4BQW A;  5BNP C;  3NJX A;  5DZF A;  2CGN A;  4OHW A;  3WUC A;  5JXH A;  5EHD A;  4I09 A;  5BNO A;  3J8F 2;  1LED A;  1ZYB A;  4W8J A;  5FPA A;  5DMY A;  4CDW B;  4HN1 A;  4RQP B;  3H7J A;  1J3P A;  5FIX A;  4YW2 A;  5J37 A;  1AR7 3;  3H3L A;  1G9C A;  4HT1 T;  1UD1 A;  2ENR A;  3S7E A;  4DXS A;  4KWU A;  2FHR A;  3D0S A;  2RMU 3;  1I5P A;  2K46 A;  3H8R A;  2D3P A;  3BYW A;  2ZGU A;  1ZBE 1;  4XYX A;  2BV4 A;  2WO2 A;  3K77 A;  3PUI A;  2FZ2 A;  1R64 A;  2CAV A;  4KG0 A;  3KVA A;  4XJ8 A;  5FYC A;  5JSP A;  2PQS A;  3I2G A;  5JAX A;  2R07 2;  5C9A A;  4GB3 3;  4GMP 0;  4IE4 A;  1DDL A;  2RS3 2;  2RVA A;  1NZC A;  2P1B A;  4CXW A;  5FUI A;  1XYO A;  3AMH A;  4JKK A;  2YB7 A;  1VBB 3;  1E5H A;  1U5Z A;  2XBO 3;  2CL2 A;  4I0W B;  3WNL A;  2ZEY A;  1F35 A;  4QPG B;  4OHY A;  4XDO A;  4HFS A;  4Z07 A;  2K0G A;  5KC5 A;  3Q8C A;  4B29 A;  3DEC A;  4Z1V A;  3B7M A;  1HB1 A;  5FZO B;  1I6X A;  2JE8 A;  2D6K A;  1AL2 3;  1HRI 2;  1ND2 B;  3WF1 A;  2OQ6 A;  5A7S A;  3ZR5 A;  3IMM A;  2ZML A;  4MSV A;  3LEM A;  4DXZ A;  2H6C A;  1PGL 2;  3GBG A;  1JH5 A;  1EPW A;  2VR4 A;  3EHK A;  3FE5 A;  4XF9 A;  3E97 A;  4XFG A;  1W2O A;  3OG2 A;  5DZG A;  1OLR A;  2F6B A;  3K3O A;  3KSC A;  3OJB A;  3VV1 A;  2OUH A;  2PLV 1;  3OTF A;  1O6U A;  3PL0 A;  3R4S A;  4B4P A;  4OI4 A;  3LF7 A;  1B35 A;  2DYC A;  4HZF A;  2PYT A;  1SLL A;  2BER A;  4Q29 A;  1QWR A;  1EY2 A;  1KQR A;  1R1A 1;  2ZAB A;  2ZGS A;  1I5Z A;  4XHX A;  1L7Q A;  1XSQ A;  1CAV B;  4XJZ A;  1V9U 2;  2VUJ A;  4HPK B;  3VZJ A;  3ZIW A;  3ILR A;  3I59 B;  3TWI A;  4FAG A;  1DBN A;  3LEK A;  1SLT A;  5FZD A;  2ZBJ A;  4ZON A;  1UZZ A;  3RG0 A;  1ZRD A;  1J84 A;  1RUF 2;  5F3C A;  1PVC 3;  1Q8P A;  2DDU A;  3FHA A;  5JI7 A;  4CP1 A;  1AUY A;  2RG4 A;  3SKV A;  4MAD A;  3J8F 1;  1FV2 A;  3NAP C;  1H6Y A;  1X36 A;  3RVH A;  5CAZ A;  5FO7 B;  4H14 A;  1YCI A;  1POV 1;  3GYD A;  3QH6 A;  4HG6 B;  2XJU A;  1TME 3;  1JI6 A;  1YWK A;  1YLL A;  3VBU A;  2A7A A;  3ASI A;  5AC9 2;  3NNM A;  4SLI A;  1V6J A;  4BHP A;  1LEN A;  3AZY A;  4AI0 A;  1DYO A;  4M3C A;  2PFW A;  2R04 1;  2D40 A;  2EXK A;  2A3Y A;  1GZ9 A;  4XFA A;  2VY0 A;  1RUJ 2;  2EXH A;  4XXP A;  1BEV 3;  2O8Q A;  4LIU A;  4L9B A;  1W0O A;  4MH0 E;  1UMH A;  4I02 A;  1JHJ A;  2JIG A;  1UYZ A;  3EQE A;  3LWC A;  3VLB B;  4Z2A A;  3O1M A;  2R07 1;  4HN0 A;  4OUL A;  2RS3 1;  4MGY E;  2GSY A;  2WQ4 A;  2C4X A;  3OSD A;  4LLO A;  2VZV A;  1MEC 3;  4E8D A;  5FXV A;  3SMH A;  3IDE A;  4EWD A;  4FOV A;  1C4R A;  1CJD A;  4BOW A;  5D8A A;  2ZS6 B;  4QWN A;  3WY6 A;  3AJY A;  3PIG A;  2ZTN A;  1JZ3 A;  3WNM A;  2O14 A;  4COW A;  1WW5 A;  4BWO A;  1HRI 1;  2CDO A;  2WA3 A;  3U0Z A;  3Q8A A;  2LUW A;  4QXK A;  1PGL 1;  1WCU A;  3W5M A;  4OMD A;  4GMP 3;  1RMU 3;  1QJY 3;  4Y24 A;  2B9V A;  2GNT A;  1KIT A;  1UX7 A;  1PO2 3;  1ZZB A;  2XVG A;  3IB3 A;  4RQP A;  4LBJ A;  5AVA A;  2DVB A;  1WLC A;  3V65 A;  3POB A;  1S0E A;  2VNV A;  5ACA 2;  1N47 A;  4CDQ B;  3M70 A;  1RHI 2;  2VZQ A;  5IVB A;  4IE7 A;  4LA3 A;  2JDU A;  4Y4R A;  2IVI B;  3C2U A;  2VL4 A;  1V9U 1;  3MLL A;  2D6L X;  2HWF 2;  3TN9 3;  3NNF A;  5FFO C;  3CJI C;  4IEQ A;  3LEI A;  3VBS C;  3W58 A;  3CZJ A;  1H8T C;  3K75 B;  3DXT A;  4LKF A;  2EXI A;  2XDV A;  1UYY A;  4LQR A;  3JBG 3;  5FXX A;  4ET7 A;  4QQ2 A;  4CEW B;  1RUF 1;  4QGM A;  3WVJ A;  2X10 A;  4K20 A;  4LUM A;  2YDE A;  5FZH A;  2XHK A;  3KV4 A;  4XBN A;  3SLI A;  2JG8 B;  1BLZ A;  3K51 A;  4E4D X;  4NRQ A;  1DP0 A;  3UKN A;  1RVF 2;  2QQL A;  3M4F A;  1C1F A;  3O7O A;  1NOV A;  1K5M C;  3UJQ A;  5D1I A;  1D2S A;  2PAE A;  4P08 A;  4Q0P A;  5AC9 1;  4QU1 A;  1Q43 A;  2ORZ A;  4QM8 A;  5FZO A;  3AKS A;  3AVS A;  2WAB A;  4GWN A;  4WM8 C;  4Y5S A;  2FCV A;  1DQ4 A;  1ND2 A;  2XB6 C;  4N53 B;  3ZPO A;  4QAW A;  4FOQ A;  1RUJ 1;  4W6X A;  3WCS A;  3B9I A;  1RIN A;  1VBD 2;  1XPW A;  1XU1 A;  1U5Y A;  1J83 A;  5FYT A;  2HJI A;  2TBV A;  4LBQ D;  4JQR A;  4XZP A;  1H9W A;  4AEK A;  2EXJ A;  3RZK A;  4DRV A;  1RUG 2;  1H6X A;  1MZE A;  1VIW B;  1RXG A;  2W1U A;  4HKW A;  4IL7 A;  5ANQ A;  1KXG A;  1W9F A;  5ABJ A;  1KS4 A;  3N36 A;  2BVV A;  4FTE A;  1MQT C;  2VZO A;  4FOY A;  1UOG A;  5T5O A;  4Z92 B;  4AF9 A;  1CAV A;  3ZPY A;  3O0V A;  4UW5 A;  5K0U C;  5F3I A;  1HV1 A;  1N3Q A;  2DTY A;  1W8O A;  2MNG A;  3CL1 A;  2Y33 A;  3P3N A;  4HPK A;  5FP7 A;  3I59 A;  1G6N A;  1HB4 A;  4XFI A;  4YPJ A;  3CU7 A;  4X6R B;  2J1E A;  3ZN6 B;  1C1L A;  1MS1 A;  1KJR A;  4KH9 A;  1Z7S 2;  4FTB A;  2YU1 A;  4PIY A;  4AGR A;  5DAV A;  5FZ1 A;  1WLW A;  1OQE A;  3LIG A;  2JDN A;  2NN8 A;  5AVP A;  4COY A;  1QNY A;  2Y6J A;  3TEW A;  2QDN A;  5ACA 1;  1SCS A;  2ARA A;  2DVD A;  5E88 A;  4EJR A;  4JGZ C;  4QU2 A;  4B3N A;  4MV2 A;  1AXZ A;  2IC1 A;  2PA7 A;  3SIS A;  5A3U A;  1PK6 C;  4P02 B;  4TWT A;  1HJF A;  4K3U A;  2VMH A;  1UMI A;  2CSG A;  2HWF 1;  2Y6H A;  3DL3 A;  4D3W A;  2VQU A;  3I7D A;  1T6G C;  1YJL A;  1K3I A;  2BGC A;  2TUN A;  3KS7 A;  5CU1 A;  4BM8 A;  1JXN A;  2G4I A;  3WNP A;  2I45 A;  2VTF A;  4RHV 3;  3H42 B;  3WEZ A;  1RUH 2;  2VCB A;  1LRH A;  5DG1 A;  4LT5 A;  3K48 A;  2PAM A;  1A3K A;  4OMC A;  3WG1 A;  4YYO A;  2W2I A;  4QGL A;  1OKQ A;  2FBE A;  2PAK A;  4QHB A;  3RMX A;  2BFU S;  4LUL A;  3SCH A;  3JZV A;  1VJ2 A;  2JIC A;  2C1F A;  3FHI B;  4PI0 A;  1VBC 3;  4S2H A;  1RVF 1;  3MFC A;  3TEX A;  1VBE 3;  4XJW A;  3PTY A;  3N9L A;  2A6V A;  2BQP A;  2Q5T A;  5BNN C;  4JDO A;  4EWE A;  1V6N A;  4BXS V;  1JN2 P;  3FL7 A;  4O65 A;  1AX1 A;  2WQZ C;  3UGH A;  3IMN A;  2V4V A;  3DPR C;  3AM2 A;  4DPN A;  3V0B B;  5IVE A;  4Q5O A;  2V73 A;  3MHZ A;  4AL9 A;  2Q8C A;  1ASJ 3;  1VBD 1;  2VO5 A;  2MEV 3;  5HCB A;  1NLS A;  2JDM A;  4OQ8 A;  1W03 A;  4Q4Y 3;  4DXT A;  2XPJ A;  4OUS A;  3VDD B;  2ZAC A;  4XCA A;  3LSE A;  4XAC A;  4P5H A;  3FWE A;  1LES A;  1RUG 1;  3R05 A;  4Q2F A;  1C5I A;  5KXE A;  2KA3 A;  4CDQ A;  3RMY A;  3WW1 A;  3NV4 A;  1IS5 A;  2JEM A;  4XE9 A;  3WQ1 A;  3J7N A;  4NPM A;  5CA6 A;  1DGW A;  4FFF A;  3ZKU A;  1HW5 A;  2Y64 A;  4QX1 A;  3MUZ 1;  3J9S A;  4CDX C;  2HWC 2;  2WII B;  4FQZ A;  4EE2 A;  2W1Q A;  3MID A;  1DYK A;  4YVW B;  4CEW A;  1KDM A;  5FP8 A;  5IUQ A;  2P3J A;  1CES A;  1GNH A;  4JHZ A;  4CRQ A;  3VB9 A;  5IAV A;  1Z7S 1;  2Y26 A;  4RL7 A;  4ZS2 A;  5GLZ A;  1LHW A;  3HNY M;  4NUB A;  4BQX A;  1XYN A;  2QQP A;  4IE5 A;  4QXH A;  3FLP A;  2ZHN A;  4LHN A;  2BP6 A;  4LBO A;  5FZB A;  4EYU A;  3RZH A;  3POI A;  3NNJ A;  2ZAA A;  4D6S A;  5HCH A;  2Y6K A;  5BY5 A;  1HQW A;  4LBQ B;  3VKM A;  4Z8B A;  1X50 A;  4AG4 A;  5JSO A;  2ZMK A;  4PF5 A;  3X29 B;  4N53 A;  1G7Y A;  4AEJ A;  1YI7 A;  3LQC A;  4WM7 A;  5DAQ A;  5T54 A;  1FMD 2;  2O8O A;  1RUH 1;  1LOG A;  2QBX A;  3DYP A;  1DFQ A;  3RZM A;  1WCD J;  2BOI A;  5T5L A;  5KC6 A;  1AJO A;  3C7E A;  2HWB 2;  4M0H A;  3LB9 A;  5H9S A;  3ACG A;  5FCC A;  3ZX7 A;  1LEM A;  3DKW A;  4BE3 A;  2LRO A;  2W0X A;  4YW6 A;  4LR4 A;  4B7K A;  4I3G A;  2JKB A;  3W21 A;  4EZ4 A;  1X82 A;  2DCT A;  5JUV A;  2DVA A;  2RDN A;  4M4P A;  1UQX A;  4TLG A;  4A41 A;  3NWK A;  3AP6 A;  5FK7 A;  4FPE A;  3WP5 A;  3ZLI A;  3WQ7 A;  4IGP A;  3ZN6 A;  2XJS A;  3POG A;  5CFC A;  1KFU L;  1JS9 A;  2WO3 A;  4J25 A;  4U2A A;  5DPN A;  3ZSK A;  4GH4 B;  4Y1Z A;  3AYE A;  4XIK A;  1MZ6 A;  3PVB B;  2HBT A;  2I2S A;  1W2N A;  3T0D A;  5H9P A;  1W99 A;  3THD A;  3IDA A;  1NG0 A;  1PNF A;  3F2Z A;  3N3H A;  4I01 A;  3HIF A;  4AW7 A;  5FKB A;  4Y33 A;  4I30 A;  3HPN A;  1Q3E A;  3ZFG B;  4Q4W 2;  1HDK A;  4Y4Y A;  2HWC 1;  5KHJ A;  1DCS A;  3KV6 A;  4U36 A;  4FO9 A;  2X05 A;  2W87 A;  1UXX X;  2NPI A;  3WNX A;  5HXM A;  4UFK A;  2WZR 3;  1F9K A;  3RRD A;  2DVF A;  2HWD 2;  3AVR A;  4P9X A;  2R32 A;  2NMO A;  2BBA A;  4Q1P A;  3BOD A;  5JXG A;  1NLR A;  4BXF A;  1QKQ A;  3AP9 A;  2B45 X;  2DCK A;  4CP9 B;  4L0P A;  2QZ3 A;  1AYN 3;  1G9F A;  1BBT 1;  1VRH 2;  4W50 A;  4O9G A;  4OZO A;  3UKT A;  4QD2 A;  3HQX A;  3JXS A;  2XJV A;  1M06 G;  5C8C B;  2QKD A;  5HCF A;  2D6M A;  2VZU A;  2VVE A;  4DQA A;  1ULF A;  4OUE A;  4AHW A;  3RFR A;  3O12 A;  5CG9 A;  4LA2 A;  4S2F A;  2D3S A;  2W52 A;  1BK1 A;  1L7L A;  1A6C A;  3H8U A;  4BH9 A;  1FMD 1;  4DNY A;  4BK5 A;  1AR6 2;  1HXS 2;  3N9M A;  4JTN A;  2ET1 A;  3T2Q A;  4CP2 A;  4NRP A;  5IFT A;  2YPD A;  3ABZ A;  1PMI A;  4FFG A;  3VD9 A;  3VDB A;  3VUO A;  1DZQ A;  1QJX 2;  3JD7 2;  3VDD A;  3I3Q A;  2N7G A;  4CCC A;  3UGG A;  3AKT A;  3RJ2 X;  1V6I A;  2HWB 1;  2RS1 2;  3UV9 A;  5I8Y A;  1LU2 A;  4YVS C;  1EAH 2;  1GAN A;  4XIO A;  4OI1 A;  3UT0 A;  4P9W A;  4UWD A;  1SQ4 A;  5FXZ A;  4DUX A;  1UMZ A;  4A7Z A;  5JI9 A;  2VUC A;  4L2N A;  4OYU A;  4DIN B;  4HVR A;  3PUA A;  1NE4 A;  4IV3 B;  3JU9 A;  2ZKL A;  4S2G A;  4XMI A;  5DAX A;  1W6O B;  2AR6 A;  2Y6L A;  3AL6 A;  4QMA A;  4AR2 A;  1GQP A;  2FCU A;  4YVW A;  5IHR A;  1VE0 A;  3ZOI A;  2W39 A;  1OQ1 A;  2BNM A;  2J7M A;  4CDU B;  3C7O A;  4XQW A;  5KHH A;  1NCR B;  4UAP A;  3ZSE A;  5KWR A;  2CHH A;  3V56 A;  1YNA A;  2RR1 3;  5JR7 B;  3I2D A;  2AUY A;  2GN3 A;  5L9B A;  2ORX A;  2GMP A;  5A7N A;  5GZC A;  1CAW B;  5FP4 A;  5HCA A;  3E5X A;  3ACI A;  4Y20 B;  2EVX A;  4MYE A;  3H8O A;  5CKQ A;  1NA1 C;  5EP9 A;  5FK8 A;  4Q4W 1;  3GM8 A;  2E6V A;  3GF6 A;  3B69 A;  2VBD A;  4MOA A;  1NCQ B;  4AHZ A;  3MZH A;  1QJU 2;  2E51 A;  4QPY A;  5TSW A;  5A33 B;  2HWD 1;  3ZYB A;  4CYD A;  3O5S A;  1AXY A;  3NJZ A;  4AI8 A;  1HIX A;  1RJ8 A;  5EFU A;  3HWJ A;  2HKX A;  1YXW A;  3WG2 A;  1QMJ A;  1OA2 A;  5DUX A;  4KQ7 A;  5FPZ A;  1HB2 A;  5I0T A;  4L8Q A;  5F8P A;  3TNQ A;  3VZO A;  4P14 A;  4XBL A;  1RUD 3;  4K1Y A;  4I2O A;  1REF A;  2UYA A;  1GLH A;  3LSD A;  1VRH 1;  3C7G A;  3ORJ A;  1A8D A;  3MDP A;  4GWM A;  5JZG B;  5C5U A;  1MS8 A;  4N43 C;  2ZX0 A;  3KQ4 B;  5FZ7 A;  3WW3 A;  4LKD A;  5I0U A;  3GDB A;  4JDN A;  2ERF A;  3K4Z A;  3SH3 A;  4O61 A;  3ZN4 A;  2CDP A;  1UY3 A;  1R09 3;  4XIL A;  1YQC A;  1DQ6 A;  3I54 A;  2ZGO A;  4BLI A;  1HXS 1;  1ULD A;  2UWB A;  3IPV A;  2O1Q A;  1JYV A;  2VC9 A;  5FTT C;  4GH4 A;  3OPZ A;  4NWV A;  4DXR A;  1QJX 1;  3JD7 1;  4YG0 A;  2NZ9 A;  3H0O A;  5FZL A;  2OYZ A;  4DUW A;  2RS1 1;  1WW7 A;  3ZVX A;  4X8P A;  1UY1 A;  1EAH 1;  3SXW A;  2YC0 A;  4MG2 A;  3MIF A;  1MR5 A;  1WCK A;  2VOK A;  3MLJ A;  1NQJ A;  2DWR A;  1DLL A;  3KLS A;  4NRO A;  1YO8 A;  4QX7 A;  4WVM A;  1LAJ A;  5IFP A;  4RFR B;  5L73 A;  2QZ2 A;  2LTN A;  3ZFG A;  2PHT A;  3NV2 A;  4J1W A;  5DUU A;  1PNG A;  4MLO A;  2ZZJ A;  4PLM A;  3LA2 A;  5DXD A;  5IVY A;  1CGP A;  1ZRI A;  1UW8 A;  5DQ0 A;  3ACF A;  1LOF C;  1Z0H A;  4Q4V 2;  3ZSL A;  1ZRE A;  2VTX A;  4AVB A;  3WV6 A;  4CP9 A;  2P3Y A;  5A3O A;  1YQ5 A;  5C9A B;  3AYC A;  3NKG A;  2VZ1 A;  2XVK A;  4OFG A;  3VZK A;  3EB7 A;  3T2T A;  1TNR A;  2WYS A;  1QU0 A;  1BQP A;  5FYM A;  4EN8 B;  2R30 A;  3IDB B;  5JMC A;  3U4X A;  4QX2 A;  2B42 B;  5FYU A;  1C8N A;  1GWK A;  5C8C A;  4XVH A;  4NAO A;  4E2Q A;  2NMN A;  1GV9 A;  2PHU A;  2P5B A;  3FX3 A;  4AHX A;  4XFC A;  2WNU B;  2HBU A;  2RJK A;  1QJU 1;  4Y1Y A;  3EMR A;  5C4W B;  1MZ5 A;  2VOV A;  3D5O A;  3PDQ A;  5T52 A;  1H9P A;  2OPW A;  5F7U A;  1EV1 2;  1H4G A;  2ZHM A;  5DDJ 3;  2BPA 2;  3E6D A;  5F9T A;  4RS5 B;  2J1R A;  3MEP A;  2CWS A;  1J3R A;  1WD3 A;  1VAV A;  4YLZ A;  2VBP A;  1UX6 A;  1JUI A;  2VE1 A;  3LOI A;  2ARE A;  3WW4 A;  1C3H A;  4JGY B;  2W91 A;  4GAZ A;  3WDV A;  4AXO A;  3U07 A;  4BLJ A;  5JVV A;  2BJS A;  2NYY A;  4IV3 A;  3J26 N;  4IE6 A;  3TNP B;  5FZE A;  4WVV A;  1UY2 A;  1W6O A;  4RYD A;  5EZW A;  2PQQ A;  3KV9 A;  4FPY A;  3AFG A;  4JV4 A;  1LGB A;  2P2K A;  2Y60 A;  1QOT A;  4AFB A;  1LU1 A;  5KBF A;  4CDU A;  2Q8O A;  2IVJ A;  4IEZ A;  5FKC A;  3ZN5 A;  4RR3 C;  3ZXL A;  1NCR A;  1CX4 A;  4LLF A;  1F5J A;  3RS6 A;  1CAU B;  2EF6 A;  4CA9 A;  1QXJ A;  5B2G B;  1HV0 A;  4HLT A;  1CAW A;  3WOG A;  3RJR A;  2AEN A;  4Y20 A;  2OVU A;  4CCM A;  3UES A;  1R1Z A;  5FLJ A;  1GSL A;  1J59 A;  3I2J A;  3LPG A;  4CCE A;  4LBM A;  1NCQ A;  3GAL A;  4PT6 A;  1SFP A;  1QJE A;  1E5S A;  1W39 A;  3HAG A;  3OGJ A;  4YNI A;  5F3E A;  4P9I A;  5A80 A;  2Q8D A;  3ZXA C;  1MS5 A;  1PZ8 A;  1ZA4 A;  2GAU A;  2X09 A;  1ZM1 A;  4XDQ A;  4YW1 A;  5EYX A;  5A33 A;  3S7I A;  4XUR A;  3PUR A;  1LB2 A;  3SKJ E;  3BVC A;  4Q4V 1;  3WQB A;  3ZFE B;  4NOT A;  2E9Q A;  1W90 A;  2XJR A;  5DG2 A;  3VBF B;  4CEY C;  4JX0 A;  1DYP A;  4FP3 A;  4OHZ A;  3QAC A;  2P34 A;  5JCT A;  1F31 A;  1FXZ A;  1VBA 3;  1LUL A;  2VUL A;  3PIJ A;  4FFH A;  4XCB A;  3SC7 X;  4B1M A;  1KS5 A;  5E8A A;  1ND3 B;  4D69 A;  5FZ8 A;  1GOG A;  1AR7 2;  1RUI 3;  1WWY A;  4TZD A;  3ETP A;  5FLI A;  5D8A B;  2ZGR A;  3ZIX A;  3WNO A;  4EWA A;  2RMU 2;  2WL1 A;  3KV5 A;  5HI0 A;  4BIO A;  1YFU A;  2GC0 A;  1KD7 A;  2IXC A;  2JWP A;  3O1V A;  2FDG A;  3OB8 A;  2ZZQ A;  5HV4 A;  5LA1 A;  1LOE A;  4XXA A;  5IAT A;  1CVN A;  1EV1 1;  4XUN A;  2R06 3;  4CZS A;  4JQT A;  3BIW E;  5F37 A;  1O59 A;  3H1W A;  3WXP A;  4ARY A;  4YW4 A;  2WA4 A;  3FFQ A;  4HXC A;  3BGA A;  1IKQ A;  1IQA A;  1VBB 2;  2XBO 2;  5I8T A;  4KU8 A;  4XUP A;  3PUS A;  4J1X A;  3ENR A;  1TNF A;  4AEM A;  4E4H A;  2AZ5 A;  2P4E A;  4UFL A;  1H2K A;  5A7Q A;  4QX8 A;  1AX2 A;  4BDV B;  3A23 A;  4B4R A;  4GKY A;  1AL2 2;  2HWE 3;  5EWS A;  2F4P A;  4BPZ A;  3VBO C;  1VR3 A;  2XOM A;  3WD5 A;  3LZZ A;  4PLO A;  2WNV C;  4RFT 0;  2WNE A;  4LEJ A;  2WYF A;  5FLH A;  1Y4W A;  3AJZ A;  2E33 A;  4AQ2 A;  4Q8K A;  5FOB B;  4C1X A;  2DF7 A;  1F15 A;  3THT A;  3Q8E A;  4PBP A;  2YFZ A;  2WAA A;  3MPP G;  5FY4 A;  5BPX A;  4QB2 A;  3TYJ A;  3HOB A;  4UI9 L;  3HVD A;  1N1Y A;  1Y9M A;  2X5I B;  3UNP A;  2XH6 A;  3H8X A;  4UBG A;  4YSF A;  4OHX A;  5FRE A;  5C70 A;  3LPF A;  3AX4 A;  4SBV A;  4LJH A;  2YMZ A;  3IAQ A;  3TAY A;  4CCJ A;  2WNU A;  3S5A A;  1EP0 A;  1H2M A;  3NVC A;  3GJA A;  1SMV A;  3PNA A;  5C4W A;  5A7O A;  3CEW A;  4XQ4 A;  3AKQ A;  4N8M A;  1UIK A;  2HEW F;  1C8M 1;  1H8T A;  1PVC 2;  3MYX A;  4RGA A;  4UFM A;  3ZYF A;  4RS5 A;  3KM5 A;  4Y22 B;  5C3R A;  4ZXE A;  2CU5 A;  2LW8 A;  1PHM A;  1I3H A;  4R52 A;  4IUG A;  3ES4 A;  4JGY A;  1OF3 A;  1TME 2;  1X8M A;  5LA2 A;  1BHG A;  1H1I A;  5DAB A;  2GMM A;  2PMW B;  1RED A;  2OUJ A;  5FZ9 A;  3B5L B;  3V64 A;  3ZYI B;  1E5I A;  5FXW A;  2R04 3;  4CUB A;  4IGQ A;  5I91 A;  5JSR A;  2WN3 A;  4I3P A;  2RMU 1;  4S2D A;  5FMO S;  4COZ A;  3G7D A;  5DAW A;  1D4M 1;  4QKB A;  2OXB A;  2FZ1 A;  4YGD A;  3WG3 A;  2EIC A;  1BEV 2;  2IFW A;  1LOC A;  1SAC A;  4WM8 A;  3LDB A;  1RUE 3;  2CY6 A;  1K42 A;  3BOP A;  2CYF A;  4LTA A;  4PQ9 A;  3I2F A;  5LA9 A;  5LBF A;  5C3S A;  3U10 A;  1MS0 A;  1ZRR A;  1Q8S A;  2Z79 A;  5CBL A;  3E5U A;  4AED C;  1L7R A;  4R9A A;  2ZOE B;  1CAU A;  4F7Z A;  3FC0 A;  1MEC 2;  1X7N A;  2EIG A;  2OKX A;  4F83 A;  1VBB 1;  2XBO 1;  4JKL A;  4OQ9 A;  3WSO A;  1ZVF A;  4MHR A;  4BME A;  2YZ4 A;  2NM1 A;  1APN A;  2H0B A;  3FBM A;  3OD0 A;  1UYX A;  5FJK A;  5FMB A;  2DU1 A;  1VP6 A;  1MS3 A;  3W9A A;  1VMJ A;  5F5A A;  5I8S A;  2QQU A;  1FPN 3;  4AI2 A;  1AL2 1;  3IT8 A;  1WA4 A;  4G3Y C;  4P00 B;  4HL0 A;  1IQD C;  4GJY A;  3VDA A;  2QQI A;  2W08 A;  3ZFE A;  3NQH A;  4UXA A;  3VBF A;  4G4F A;  1VB4 A;  3HN1 A;  1OF4 A;  1RMU 2;  1QJY 2;  2JX9 A;  2BW8 A;  1PO2 2;  1W2T A;  4R9B A;  1ND3 A;  4IW3 A;  4LO4 B;  4DEV A;  1AL0 G;  1STM A;  4QPI C;  2B46 X;  1K45 A;  3VBR C;  1CIY A;  3VD5 A;  3DXU A;  4FFI A;  5A1L A;  3CNA A;  1CR7 A;  2GP3 A;  4UYB A;  1AXK A;  3TN9 2;  1UKR A;  4ZPI A;  5FO8 B;  1BVP 1;  4A7Y A;  1Y3T A;  1O8S A;  3ZYJ B;  5IVV A;  1FX5 A;  3PMS A;  1OLM E;  1WMX A;  3AL5 A;  3IAP A;  3R0R A;  5F5I A;  5KXC A;  5B4X A;  3NNG A;  1PVC 1;  1RIR A;  1WD4 A;  4XF3 A;  5M0T A;  4Y3O A;  5F6L B;  3J4U H;  3J7L A;  1G9A A;  3HNB M;  3PVO A;  4LBN A;  4IEP A;  5LBC A;  1F4H A;  5A1A A;  2XQR A;  1KGY A;  4JC1 A;  1TME 1;  4XFF A;  4AQS A;  1YFX A;  3ON7 A;  4AI1 A;  1QJF A;  3BPZ A;  2XWJ B;  1JZ7 A;  5I0S A;  3LEG A;  1GIC A;  2AC1 A;  1DQ1 A;  4NPL A;  4AVV A;  2JG9 B;  3EBR A;  1BYH A;  1IPS A;  2Z5W A;  4FXG B;  3VZN A;  3OBR A;  2YGM A;  3U37 A;  2VCM A;  1YQ6 A;  3FHQ A;  3RZG A;  1BEV 1;  2QUO A;  1TEI A;  3DPR A;  5F32 A;  2EIB A;  5B4N A;  1S0I A;  2NP0 A;  5IVF A;  5IK7 A;  1NZI A;  4CP0 A;  3TBD A;  2VW2 A;  5T3N A;  1SPP B;  5A70 A;  1V6K A;  3T2P A;  4TN7 A;  4D7S A;  1MEC 1;  1PVX A;  1W8T A;  3IWZ A;  2X5I A;  1ZZC A;  3KCX A;  3ZYR A;  5BXX A;  1J3Q A;  4YFZ A;  2YFU A;  3G6J B;  4URT A;  3BCW A;  4A7K A;  5FQ0 B;  2BFU L;  4FPJ A;  4XHB A;  4LHL A;  2WO7 A;  5C3P A;  4WM7 B;  4XAB A;  4CDX A;  4JDM A;  3KQR A;  5LEJ A;  1JYT A;  4CPB A;  4KL1 A;  4NHM A;  2B7Y A;  3M3Q A;  1R08 3;  4LUK A;  5FAX A;  3LOB A;  3VBH B;  4HAN A;  4Y22 A;  2BWA A;  1B35 C;  4G9S B;  4GMP 1;  1QJY 1;  4QXC A;  5IK4 A;  3MO4 A;  3ZFF B;  2Q1M A;  1UZ0 A;  4YGE A;  1PO2 1;  3SNM A;  1S0G A;  1TVG A;  1LOB A;  1GP6 A;  5CZK A;  3VKO A;  5L9R A;  2A1X A;  4CE8 A;  4CCO A;  2FDF A;  5L7O B;  1UKG A;  2PTM A;  2WSU A;  3MUY 1;  1OVP A;  3FLR A;  3HMY A;  4E27 A;  1WUV A;  3N7J A;  3TN9 1;  5AFE A;  4OI0 A;  4XAA A;  2J1V A;  3I49 A;  4NHL A;  4JZR A;  4P9Y A;  1V6O A;  1GQH A;  4ZS3 A;  1UO9 A;  4RHV 2;  1PGS A;  3AZV A;  4ISR A;  2IXK A;  1AR8 3;  5APA A;  4MXV A;  4DY5 A;  2DCJ A;  3RI9 A;  5CFC B;  1JYN A;  3BTX A;  1UZV A;  5C6C A;  2NLR A;  4MGS A;  1PX4 A;  3VBU C;  1A34 A;  1OLQ A;  2DU0 A;  1RVF 3;  4HK8 A;  5H9Q A;  3S57 A;  1JYI A;  2QQV A;  1VBC 2;  1GWM A;  2W47 A;  1COV 3;  1VBE 2;  4P5Y A;  1RHI 1;  2BOJ A;  2VXR A;  2ZGM A;  1FT9 A;  2VOW A;  4FP2 A;  5FZ6 A;  3ILF A;  1H1M A;  5J98 B;  5FDB A;  4MGK E;  1JU4 A;  1OA3 A;  3RSJ A;  4GZ9 A;  1ENX A;  5HXV A;  4N43 B;  3LD8 A;  3GHN A;  1IS3 A;  1VPH A;  1J1L A;  1KFX L;  2AYH A;  3D3A A;  1ASJ 2;  1PM4 A;  2MEV 2;  2J42 A;  2JDZ A;  4Q4Y 2;  4XF1 A;  2GP5 A;  3WNN A;  3HJR A;  1L3J A;  1ZBA 3;  1GQG A;  1RUG 3;  4KU7 A;  4Z2W A;  2Q1F A;  3B93 A;  1WKY A;  3RYK A;  3FBY A;  5DUW A;  4YWA A;  1IOA A;  4E4S A;  2WWS A;  2KXL A;  1W9T A;  3AC0 A;  1YRZ A;  2GME A;  2WZP P;  3VZM A;  1ZZ6 A;  4MGQ A;  5FMC A;  1LOA A;  2V5Y A;  4OUM A;  4XUT A;  2Q1Z B;  4FOW A;  5EPA A;  1AVB A;  1QH6 A;  2CGP A;  4AI3 A;  2B39 A;  4R4Z A;  4CDW C;  4RQP C;  3ZXJ A;  1AF9 A;  2A3X A;  4AYU A;  1PZ7 A;  4DZG A;  4FCA A;  2A5Z A;  1ULE A;  1RGS A;  4A6O A;  4PDW B;  3H9A A;  5FZI A;  3HQU A;  4AK3 A;  3PME A;  3PUQ A;  3QH7 A;  4BQ2 A;  1QQP 3;  1US2 A;  4AAP A;  4YFW A;  3RGB A;  2BWC A;  1F5F A;  3ZDV A;  3C8X A;  3MIH A;  4QB1 A;  3VDC A;  5J09 A;  1ZZ7 A;  1WMF A;  2JG9 A;  3BAL A;  3VD3 A;  5BUV A;  3M3O A;  1WBL A;  3BKZ A;  2C9K A;  1EUU A;  1LNS A;  3LGR A;  3DN7 A;  3O14 A;  4FPF A;  3I3M A;  5E6H A;  5T5J A;  2XXZ A;  1XRU A;  4RHV 1;  4D6R A;  1MS4 A;  3POF A;  1UCX A;  3NW4 A;  2W3J A;  2ZPX A;  2J1T A;  1SPP A;  3U1X A;  4QPG C;  4RGG A;  2JXA A;  4ERO A;  2C9A A;  2RM2 3;  1CZV A;  2QE3 A;  4KWL A;  3M8L A;  2ZGQ A;  3SH5 A;  1VBC 1;  5GZE A;  2A6W A;  4L97 A;  4E8C A;  4Z82 A;  3INA A;  4NWW A;  1VBE 1;  1ND2 C;  1QGL A;  1X33 A;  3WR0 A;  5J96 B;  4IV1 C;  2BRT A;  4LIV A;  1X9P A;  5CFD B;  5FQ0 A;  4QKN A;  3VHO A;  4JTO A;  4Q4X 3;  3V0A A;  3O1O A;  2QTW B;  4P9J A;  3H7Y A;  4X8N A;  3VKL A;  4FVV A;  1ASJ 1;  1E57 A;  3N9N A;  1RYY A;  3NV3 A;  4GUL A;  2MEV 1;  4MET A;  3VHR A;  3VBH A;  2R0H A;  2SLI A;  1REE A;  2XLA A;  2H6B A;  5JLV A;  1JU3 A;  4FPG A;  4LHK A;  3KT7 A;  3LFM A;  3OGR A;  4R8H A;  1GR3 A;  5FWE A;  3ZFF A;  2C0Z A;  4Y26 A;  4UF0 B;  5LAT A;  4MXW B;  1HN0 A;  4LK6 A;  2ZX2 A;  4NPR A;  1V6M A;  2XJQ A;  4E9K A;  2ZGK A;  5L7O A;  2ZAH A;  3AZX A;  4XEZ A;  5EJ1 B;  5IK5 A;  1WW4 A;  2WQ8 A;  3RZZ A;  1SBF A;  3B00 A;  1JOD A;  1SLB A;  2VUD A;  4YG6 A;  5FP9 A;  3D6E A;  4MHU A;  4MZU A;  2B5H A;  2IXH A;  1NA1 A;  1T6B X;  2GNM A;  2YG0 A;  1VB2 A;  2WZR 2;  4FI9 A;  2OZ6 A;  5FYH A;  4NIG A;  5C33 A;  3MFA A;  1HX6 A;  1KRI A;  3B02 A;  3IPV B;  3UYJ A;  1XBF A;  2E32 A;  2WRA A;  4TYS A;  4A2U A;  1DG6 A;  4AOC A;  1EPZ A;  3T08 A;  3WCR A;  4H55 A;  2WR9 A;  3APB A;  3E1F 1;  3URF A;  4BJ0 A;  1BBT 3;  2BGO A;  2WWU A;  3GZA A;  2DFC A;  4GKX A;  1AYN 2;  1QHD A;  2RHP A;  1ENS A;  2Z69 A;  1JOB A;  1BCX A;  4RA0 A;  5CKN A;  1UPI A;  4XJ9 A;  4WVM B;  4Y1U A;  2WFF 3;  3FMG A;  3KCC A;  1LHO A;  2BNO A;  4Y5T A;  4NHK A;  2OS2 A;  3OBA A;  4ARX A;  4N43 A;  5FPU A;  4IND A;  2YBS A;  3L9J T;  2E26 A;  1DGR N;  1GNY A;  1LHN A;  2Y38 A;  4ZZ5 A;  5FZM A;  3BU7 A;  4DB5 A;  3RYR A;  4FXK B;  4IV1 B;  3VL8 A;  4D7Y A;  4UFJ A;  1CPN A;  4AGG A;  3E6B A;  3KVB A;  5BNP B;  2WS9 3;  4AHY A;  1ALY A;  3OY8 B;  1S55 A;  2R0F A;  2FMD A;  2WT0 A;  2W95 A;  3GHM A;  4Q0Q A;  4YGB A;  3ZM8 A;  4BMB A;  3DUI A;  1TMF 3;  4YZ3 A;  1RXF A;  2QNK A;  3IIA A;  4OLL A;  5ABJ C;  2YUE A;  1ZA7 A;  4DOU A;  2ZJC A;  1S2E A;  3RQ0 A;  5FOJ B;  5LEK A;  3RPQ A;  3T1M A;  4L99 A;  1W8F A;  1XSR A;  3AYA A;  4B4Q A;  1JZ4 A;  5LW9 A;  1F8V A;  1SZB A;  1OUR A;  3UJO A;  2PHF A;  3NV1 A;  2Q8E A;  1PO1 3;  1UZY A;  2BUK A;  5EJ3 A;  5A3L A;  5KXD A;  3MIB A;  5GAL A;  4CDQ C;  4PDW A;  2BGP A;  3VBO B;  2W92 A;  5KR7 A;  1IS4 A;  2RR1 2;  4GAL A;  1ULG A;  5H9R A;  1FOD 3;  5GLW A;  3T2O A;  3Q9O A;  3NMB A;  3SIT A;  1H0B A;  2XWB B;  5JDB A;  5F2S A;  5BNQ A;  1XB9 A;  1QY4 A;  5CEH A;  5FYS A;  5LRS A;  3I2I A;  4CEW C;  4NIH A;  1JMU B;  1LGN A;  2BEO A;  1S2K A;  1M4W A;  2WNO A;  4C91 A;  2JG8 C;  1RUN A;  2WZR 1;  5AFB A;  1YYN A;  5EIY B;  1O91 A;  2VZS A;  1W3V A;  2JDA A;  2UY9 A;  5FYB A;  1SFY A;  4OCT A;  5HBA A;  3BUC A;  2RDS A;  3PUH A;  2ET7 A;  4XOG A;  3T0A A;  3P3P A;  1GNZ A;  2VEC A;  5CIS A;  1CX1 A;  1N3O A;  1RUD 2;  1S0C A;  1AYN 1;  1QOS A;  1ST8 A;  1GOF A;  1RUC 3;  2G1M A;  2AGS A;  4Q27 A;  4QGN A;  5T50 A;  3U11 A;  5J1X A;  2JJ6 A;  3M3E A;  4AVA A;  3ZYG A;  1HRV 3;  4R9D A;  2XLG A;  1QEX A;  1Q8O A;  2ATF A;  2PHX A;  5CFD A;  2QDR A;  3JUU A;  2JD9 A;  3HNM A;  3N9Q A;  3UET A;  1JZ2 A;  1R09 2;  2BZD A;  3LCP A;  3L2Y A;  4CU6 A;  5F5Q A;  2JDK A;  2LAL A;  3LFI A;  2ZEX A;  1QJX 3;  3KD4 A;  1AJK A;  3GCX A;  3VN4 A;  2VW0 A;  5FY0 A;  1N3P A;  3JB8 A;  5JXI A;  3KMH A;  3CHX A;  4UF0 A;  4QDQ A;  3CIH A;  2C24 A;  5FPX A;  4K8R B;  4MXW A;  3B9C A;  5JXJ A;  1W6M A;  1JZ5 A;  1N1T A;  2XLF A;  3OYW B;  2WSV A;  3GJB A;  1HLC A;  1ZNP A;  3NAP B;  3M3C A;  5LB6 A;  4K40 A;  5FZF A;  1AYM 3;  1GUI A;  3KGL A;  5A3P A;  4FQ4 A;  3BTY A;  5FY8 A;  5F5C A;  2QJV A;  5F6K A;  2WUH A;  3MPB A;  1FAY A;  4ZHN A;  1QF3 A;  2DBI A;  4FPK A;  4IDZ A;  4K8F A;  1AR6 1;  4A6S A;  2BBV A;  2DVG A;  2AEZ A;  1GWL A;  3SH4 A;  1W2U A;  2OQ7 A;  5DUV A;  1Q5O A;  4ATF A;  4Q0V A;  4JRL A;  2RR1 1;  1GKB A;  1TZO A;  1S0D A;  4N90 A;  1QXR A;  2WJS A;  5KHI A;  2PHL A;  5FPB A;  1CQ9 A;  1W06 A;  3ZSJ A;  4CVU A;  5C7G A;  1PMH X;  1ODN A;  5DZE A;  2ZEW A;  3MF9 A;  4I0A A;  2Y6F A;  3III A;  1UIJ A;  4HBN A;  3MF6 A;  2YC2 A;  1XE8 A;  2BVB A;  4XC9 A;  3LA3 A;  1C5H A;  3DYM A;  3PJY A;  4QHO A;  2OX0 A;  1W9S A;  1OD3 A;  4MGI E;  4QDS A;  3NO8 A;  3MLK A;  2FDI A;  1Y7B A;  4IV1 A;  3GBW A;  2A71 A;  1VMF A;  5FZ0 A;  4PBO A;  2WZE A;  2JIJ A;  4FPC A;  5DDJ 2;  4B8E A;  3AKR A;  3Q8B A;  1RIT A;  5BNP A;  5A1F A;  1D4V B;  5ERL A;  3T0B A;  3OY8 A;  4D7T A;  4EZH A;  5LAS A;  3O1P A;  4K21 A;  4HOO A;  4NN0 A;  1RUD 1;  4CTE A;  5IK8 A;  3I2O A;  4YZ1 A;  3ZYP A;  5I0D A;  1V70 A;  3NJV A;  1ODM A;  1BKZ A;  4XET A;  2RS5 3;  2L9L A;  1QDC A;  5EYY A;  2XKO A;  3NST A;  3NJY A;  2VW1 A;  4W6Y A;  4EQV A;  1C28 A;  1YQ2 A;  4CU7 A;  3VDD C;  1R09 1;  3ZDS A;  1KJL A;  4H2A A;  1U0A A;  4Q0S A;  3H1Y A;  1HQL A;  5LZ6 A;  2GNB A;  3D0J A;  3CJI B;  1W9W A;  2IUW A;  3HN3 A;  4RN5 A;  1K12 A;  3VBS B;  4BIF A;  1H8T B;  5JIA A;  3VBO A;  5FZK A;  5A3M A;  2B8M A;  2W1W A;  2QQO A;  2WNV A;  2YY1 A;  2G9F A;  5JR2 A;  4JRA A;  1AR9 3;  1HQN A;  2BNN A;  3N7L A;  4CPB D;  2RE9 A;  2IXJ A;  4R9C A;  1O5L A;  2WO1 A;  5FY7 A;  2D6O X;  5LK5 A;  3RDI A;  4X6Q B;  1NQD A;  3MIE A;  3IN9 A;  4KG8 A;  4PIZ A;  3OGS A;  5ABJ B;  5FR3 A;  4YVW C;  4WZC A;  1JUH A;  1K5M B;  4YRD A;  2VM9 A;  2ARC A;  4I0B A;  3I8T A;  4LK7 A;  3RWK X;  1PIV 3;  5HV0 A;  4M3C F;  4XJU A;  1JOJ A;  3LE0 A;  2ZX3 A;  5FYZ A;  1W2A X;  1YFW A;  1KDK A;  4NRM A;  4WM8 B;  3DEM A;  4ORF A;  4XFH A;  3DGT A;  3CF6 E;  4IET A;  5CIR A;  3AMP A;  2QQK A;  4UW4 A;  5FZG A;  3A0K A;  3CLP A;  2YV8 A;  5ANN A;  5FZ3 A;  1VBA 2;  3E5Q A;  4AVS A;  1KEX A;  3N9P A;  4QHZ A;  1POV 0;  1I1E A;  3D8C A;  5EQU A;  1RUI 2;  5D21 A;  1CD3 G;  3RYP A;  2YPJ A;  3WZ1 A;  4URA A;  4W6W A;  5JMO A;  2QQJ A;  3WX5 A;  4HVQ A;  3RZL A;  5L19 A;  1VAK A;  5T55 A;  1GYK A;  2W9X A;  1MQT B;  3AMM A;  3USS A;  4CXY A;  4DEQ A;  5K0U B;  4COU A;  3USU B;  3VKF C;  2D97 A;  3ZXK A;  1ULC A;  1CON A;  4N9I A;  2KR2 A;  3WUD A;  1O3Q A;  3HT2 A;  3I3E A;  3LDK A;  5FPV A;  4EN9 B;  3RI8 A;  1D2Q A;  4BU2 A;  3HEI A;  1BXH A;  1ENQ A;  5DDJ 1;  1TG7 A;  2R06 2;  4XFB A;  4XF4 A;  1XND A;  1V00 A;  1DGR A;  2JDH A;  2ADE A;  1UU5 A;  1ACC A;  3OYW A;  4NHY A;  4UT5 A;  2YU2 A;  1ZZ8 A;  5FY5 A;  4AED A;  4E2S A;  3N7K A;  3NAP A;  5KHK A;  2YXS A;  1DHK B;  3BN6 A;  3NNL A;  3FLT A;  3MIG A;  1D7P M;  1DIW A;  1W0P A;  4XAE A;  3TEY A;  2GN7 A;  4Q0U A;  4JGZ B;  1UOJ A;  1MPX A;  1O4T A;  1ZBE 3;  3HQR A;  4GH4 C;  1UL9 A;  2HWE 2;  1O7F A;  3ACL A;  4Y1X A;  1OH3 A;  1PK6 B;  2QCS B;  2ZGL A;  3DF0 A;  4LBK A;  4ZZ8 A;  5JWP A;  2Q30 A;  1XQN A;  5DAP A;  3ST7 A;  3F95 A;  5CKM A;  2ZHK A;  4WVW A;  3UK9 A;  1QXP A;  1LKN A;  4GB3 2;  3DCQ A;  1BVV A;  4NHX A;  4FPL A;  4LXL A;  3WG4 A;  4L11 A;  2VZP A;  1JYC A;  4LKE A;  5FMO L;  5J36 A;  2VCA A;  3B94 A;  1GP5 A;  3ZFG C;  2XJP A;  1MAC A;  4M01 A;  1JZ8 A;  1A78 A;  3VZL A;  2JEN A;  1NX9 A;  1SBE A;  1YUD A;  4FPO B;  2GZW A;  4IER A;  2IXL A;  4GWI A;  5JOY A;  1OT5 A;  4A3Z A;  5BNN B;  2CAU A;  5LRR A;  1S1A A;  1C8M 3;  3PLQ A;  3A7Q A;  2F4L A;  4LE3 A;  2CTV A;  2GH8 A;  2R16 A;  3AXD A;  3DPR B;  1GZW B;  1XOY A;  4AFC A;  1PZ9 A;  4LOS A;  1O4Z A;  5CNA A;  1VRB A;  2AAC A;  5GLU A;  3WF0 A;  2PLV 3;  3P1I A;  4BQ5 A;  4CSW A;  4UFI A;  4QDR A;  4A44 A;  1VBA 1;  2K2S A;  3GZE A;  5C8C C;  3AKP A;  3OBT A;  4LPL A;  4LE4 A;  4PCR A;  5SV8 A;  1FNY A;  1IZ3 A;  1WGP A;  1R1A 3;  1W8U A;  4IES A;  2LRP A;  2VOT A;  1RUI 1;  3ZXG A;  5BV6 A;  4E2G A;  5HPO A;  3T3Y A;  1MS9 A;  2R04 2;  4HON A;  1JZ6 A;  2A6Y A;  3AK0 A;  1O3R A;  1D4M 3;  1UN1 A;  1D0H A;  5CAD A;  1CZS A;  4CCD A;  2WLP A;  5F39 A;  3HT1 A;  1P8J A;  1W6N B;  5K9Y A;  4FPH A;  4CDX B;  2Q0A A;  3NRU A;  3CJI A;  1RUE 2;  4XDP A;  3VBS A;  4DUV A;  1GU3 A;  5C3Q A;  1WA6 X;  3OOX A;  2WIN B;  4UW6 A;  2R06 1;  3J8F 3;  4QX5 A;  3OEB A;  3U75 A;  5C5T A;  3CZU A;  1A8M A;  1POV 3;  1GP4 A;  4IV3 C;  1O4Y A;  4P9L A;  4XJA A;  3ZYH A;  4COV A;  2F17 A;  5GZG A;  1AR7 1;  3GCW A;  4M3C E;  4BQY A;  2DFB A;  3OD4 A;  3HD8 B;  4BQ1 A;  4MVT A;  1K5M A;  5KXB A;  4LHS A;  4NII A;  3ZXD A;  4CU8 A;  2NQY A;  4CDU C;  1DQ0 A;  2B9U A;  3AMN A;  3CBN A;  2VVF A;  1FPN 2;  2HWE 1;  3R4U A;  5JOW A;  1NCR C;  2VXJ A;  5E16 A;  2A6X A;  2BTV C;  3GZT B;  3ZXE A;  3K2O A;  1IPK A;  2VZT A;  2R07 3;  3N35 A;  2WT1 A;  2W1S A;  2RS3 3;  2ID4 A;  3OGG A;  4GB3 1;  1XYP A;  4WZF A;  4QQO A;  3WP4 A;  2J22 A;  4LKS A;  4IGO A;  1OOP C;  3GGL A;  3WT3 A;  1GOH A;  1F2N A;  4KGQ A;  3SEE A;  5F1R A;  4Q26 A;  4A45 A;  3OBZ A;  4ZU5 A;  1NCQ C;  3SQO A;  4BCU A;  4XW3 A;  3T30 A;  1Z78 A;  2V4A A;  3W59 A;  3C7H A;  1W9Y A;  3QLQ A;  2JKX A;  1MQT A;  2VQT A;  3VD4 A;  2R1B A;  5ISL A;  1OD5 A;  2FDJ A;  4ASL A;  5FWJ A;  1TE1 B;  1HRI 3;  2ADD A;  2E7Q A;  3PJQ A;  4IE0 A;  4QT6 A;  1V6L A;  3JB4 C;  5K0U A;  5FY1 A;  3CKH A;  3USU A;  3WIN E;  2DBN A;  3AFK A;  5A3T A;  1XNC A;  2V5D A;  2ZKN A;  3BTA A;  4W4Z A;  4AE2 A;  4AVT A;  1BJQ A;  1XXN A;  2KD7 A;  4NR1 A;  4O7X A;  3WP6 A;  2EIE A;  2P17 A;  5JZG C;  2UY8 A;  3CJX A;  1NKG A;  3P6B A;  2VJX A;  4M4R A;  1NE6 A;  4IQP A;  2HYX A;  1GZC A;  1Y43 B;  2YRO A;  2DCY A;  5IAX A;  3MV0 1;  5F3G A;  2Y8K A;  5C71 A;  1QH7 A;  4GIQ A;  1XE7 A;  2C5D A;  1V9U 3;  2A73 B;  5E1R A;  5CYY A;  3D82 A;  4YW7 A;  4JGZ A;  2Z42 A;  2Z2S B;  4KI5 M;  4NE9 A;  4AFD A;  2D44 A;  4ZXK A;  1VAM A;  4D94 A;  4F3J A;  1PK6 A;  5A7P A;  1HKD A;  2LS6 A;  1NY7 2;  1URX A;  1RUF 3;  1FYU A;  3JBG 2;  5BNO C;  5I0R A;  1RUE 1;  4CXX A;  2VNR A;  2VCC A;  1UU4 A;  1UY0 A;  2QQW A;  3IM0 A;  4PI2 A;  1ULP A;  2VNG A;  2YBP A;  4B7E A;  1G9D A;  1NXD 1;  4LO7 A;  2KM2 A;  2VBB A;  4LIT A;  3FZ3 A;  1TQ5 A;  3AMQ A;  1AZD A;  3ZSM A;  1SLI A;  1U12 A;  5AC9 3;  1S0B A;  2MPF A;  2VZR A;  3CO2 A;  1CAX B;  3O1R A;  4AFM A;  3ME2 A;  3HR9 A;  4K1Z A;  1UOF A;  4FBF A;  1UAI A;  4JCK A;  1MZF A;  1Q56 A;  1T2X A;  3N9O A;  1OQD A;  3GZU C;  1H4H A;  5BNN A;  1RUJ 3;  2WKK A;  3I3B A;  2H0V A;  1FPN 1;  3KCY A;  5C9A C;  3A4U A;  1XJA A;  1WCQ A;  1YJK A;  4TTG A;  2Y34 A;  4UOJ A;  1GZW A;  1R08 2;  3BB6 A;  5J48 A;  1JBC A;  3O1T A;  1W04 A;  3BTZ A;  4CDW A;  4A4A A;  2SBA A;  4CCK A;  3DV8 A;  3I97 A;  1MVE A;  5LY2 A;  4IEV A;  3UGF A;  2X53 S;  3PVE A;  2A75 A;  5IJR A;  1WLT A;  2WNU C;  2PEL A;  2DUQ A;  2R1D A;  4XMA A;  1WME A;  2J1U A;  4YVS B;  1UXZ A;  5C4W C;  4OI2 A;  3J7H A;  4XUO A;  1OMI A;  4HET A;  4KWK A;  4LO6 B;  1G86 A;  1GFF 2;  5I93 A;  3AP7 A;  1W6N A;  1W6Q B;  1YI9 A;  3H3Z A;  4RS5 C;  3V0A B;  4BA6 A;  1FNZ A;  3A21 A;  1W8H A;  2GAL A;  1C57 A;  1IKP A;  1AR8 2;  4LMF A;  1YIF A;  1OLM A;  3OPW A;  5A6Y A;  4JGY C;  4EN7 B;  1G9B A;  1RMU 1;  2I74 A;  3ELN A;  5GM0 A;  3GXU A;  5LK7 B;  5A3N A;  2D5H A;  1YQ8 A;  2ZGT A;  2JD4 A;  5ACA 3;  4QPG A;  4BQ4 A;  2FDK A;  1RHI 3;  2D93 A;  1COV 2;  5IVC A;  1X9T A;  2OZJ A;  4IEX A;  4JKM A;  5FMD A;  2X29 A;  5K8S A;  1CWP A;  4MUV A;  2OII A;  2ZEZ A;  4AQT A;  1UWW A;  2HWF 3;  2IXI A;  2WBK A;  3AYD A;  3LDR A;  1J58 A;  4HMZ A;  4LOR A;  2D6N A;  3ZMN A;  1CJP A;  2JB4 A;  3O0W A;  3BPS A;  3ZMO A;  2EAA A;  2OT7 A;  3MW4 A;  4UBH A;  1OHF A;  1BMV 2;  3RWN A;  2IWG B;  1NA1 B;  5T5P A;  2E53 A;  1NY7 1;  2CNA A;  1SLC A;  3JBG 1;  4ISQ A;  1N1S A;  4KNC A;  5LY1 A;  4C90 A;  4HK9 A;  1ZBA 2;  4DRR A;  3I4I A;  4OHV A;  1XNT A;  3QD6 A;  4YG3 A;  2WFP A;  1W8Z A;  5A6Z A;  1UOB A;  2QFE A;  3VHP A;  4C1W A;  5L9V A;  1SFN A;  2E31 A;  3T4H B;  2ZMN A;  4ONU A;  2OPK A;  1UY4 A;  4NAM A;  3WDW A;  1YFY A;  1CN1 A;  2VMI A;  5FYI A;  3KB5 A;  3N4M A;  2ETE A;  3EJK A;  1Y9G A;  3U4S A;  4K9S A;  2E7T A;  4XBQ A;  3ZFE C;  2A3W A;  3VBF C;  4ZKT B;  1DQ2 A;  3KT1 A;  4D0Q A;  2OW4 A;  2VGD A;  4A3X A;  1PGW 2;  2A70 A;  2V09 A;  1OXC A;  3K4A A;  1VBD 3;  3MW2 A;  3ZO0 B;  5GLV A;  2DUO A;  2P6H A;  2J1A A;  2JE7 A;  4PJY A;  3THP A;  1Q8Q A;  5GLT A;  4ES9 A;  1R08 1;  1ND3 C;  1RL3 A;  1XNK A;  2EAL A;  2CV6 A;  1QDO A;  1WZX A;  3QOP A;  5FJH A;  1LR5 A;  2FMY A;  2B4K A;  2Y0I A;  3OEA A;  4NID A;  2GC2 A;  5D8A C;  4GWJ A;  1QNW A;  3JQW A;  3K4D A;  5FO9 B;  3AXE A;  1Q8V A;  1QQP 2;  3W5N A;  2WWJ A;  2HYK A;  5BYN A;  4PF1 A;  1OC1 A;  1OFN A;  2GND A;  4MO3 M;  2MHF A;  5A3W A;  1DZR A;  5IW0 A;  4UFH A;  5A7W B;  5A6X A;  5FZC A;  2FD8 A;  3T4V A;  3H1M A;  3VD7 A;  1O5U A;  4D6Q A;  1H2L A;  1W8W A;  2XUM A;  1SHW B;  4DFS A;  1ZRF A;  5FUP A;  3IBM A;  2XVL A;  2O0O A;  3OUH A;  3S30 A;  1IG3 A;  3OUJ A;  3KF5 A;  5LBE A;  1AR8 1;  2DUP A;  4AZZ A;  1XNA A;  1Z7S 3;  3LA7 A;  4QQH A;  5FUN A;  3ECQ A;  4QX0 A;  5FYY A;  5GZF A;  4AI9 A;  4K7J A;  2RM2 2;  3KWV A;  2VG9 A;  2FQP A;  2R49 A;  4H7M A;  2D3R A;  4CU9 A;  1XC6 A;  4YW3 A;  2E7A A;  1COV 1;  3VHN A;  1OUX A;  2UU8 A;  2W46 A;  1CAX A;  4ITC A;  3PU8 A;  3MW3 A;  4CUA A;  1I9R A;  1LEC A;  1XNB A;  3W20 A;  2VTX J;  3O1S A;  4Q4X 2;  3M1H A;  1FI2 A;  1CPM A;  1RUH 3;  2XG3 A;  4AVC A;  1BMV 1;  3SCG A;  3ZKY A;  3A22 A;  5L36 A;  1S4C A;  1HJG A;  4LNV A;  2WN2 A;  4YM2 A;  1ZBA 1;  3OF1 A;  2X5I C;  3GBF A;  4IEW A;  1LHV A;  3TOJ A;  3KZ4 C;  4M00 A;  4XF0 A;  5FZ4 A;  2UWA A;  1U5I A;  2VMC A;  4GA9 A;  4J6G A;  1PMJ X;  4AFA A;  1J1T A;  2P37 A;  5GZD A;  1EYB A;  3EO6 A;  3FUQ A;  2Y6G A;  1S0F A;  4YVS A;  3CDZ B;  3POS A;  2ES3 A;  4KBZ A;  1EUT A;  1DGL A;  4LO8 A;  3WHU A;  1W6Q A;  4ASK A;  1PGW 1;  5LCW L;  1V0A A;  2XQX A;  3VGI A;  3ZR6 A;  3AP5 A;  3T09 A;  4Q4Y 1;  2JG8 A;  1ENR A;  1LOD A;  1W6P B;  3WW2 A;  5LA0 A;  4QPW A;  3I2H A;  1VLN A;  1JW6 A;  3FFZ A;  5FBJ A;  4JVA A;  1DZT A;  1BBT 2;  2TNF A;  4IEU A;  1VMH A;  2WT2 A;  4RR3 B;  2QQM A;  1W6M B;  3L2H A;  1E5R A;  1QQP 1;  4NVP A;  1DLC A;  1IGO A;  2VME A;  2WFF 2;  2DV9 A;  5JIU A;  4L92 A;  2VMG A;  2VU9 A;  3BU0 A;  1XU2 A;  2RDQ A;  2HWC 3;  1O3S A;  3M3I A;  1SG3 A;  1H30 A;  4N7U A;  1XE0 A;  3U78 A;  4WBB A;  5K7P A;  2EA7 A;  2HEV F;  1NLQ A;  2GC1 A;  3AZW A;  2DCZ A;  1UZW A;  4HSL A;  4W65 A;  1RJ7 A;  3ILN A;  3PTR B;  1IHM A;  1DF0 A;  3TB0 A;  3EXU A;  2JDY A;  3K3N A;  4IXL A;  3BI3 A;  3C7F A;  1HN1 A;  2WS9 2;  2GU9 A;  3U14 A;  4H7L A;  2RM2 1;  1AHS A;  2OA2 A;  4CEY B;  1BZW A;  3THC A;  1UYP A;  4WV8 A;  1N1V A;  2XON A;  1GZT A;  3TRS B;  4HKL A;  1JTZ X;  2ILM A;  3UKV A;  1TMF 2;  5J7M A;  4CUC A;  2DTW A;  4HKO A;  1LCL A;  4M0N A;  5A32 B;  2WAO A;  3R4D B;  2VPV A;  4A42 A;  1FMD 3;  1QJZ A;  3UL2 A;  4PQQ A;  4Q4X 1;  2RV9 A;  4XPV A;  1MVQ A;  3KGZ A;  3DKQ A;  4QX3 A;  3RZJ A;  4YM3 A;  1PO1 2;  4R4X A;  4MGT A;  2HWB 3;  3K46 A;  3FUO A;  3POE A;  3WDT A;  2D6P A;  2VOX A;  1FOD 2;  1VAL A;  4BQ3 A;  4P9G A;  2QQN A;  2D43 A;  1AX0 A;  4C0B A;  1H8V A;  2R7E B;  1LJ7 A;  4QM9 A;  4QQL A;  1IG0 A;  3PHM A;  5A7W A;  3LIH A;  4V2V A;  1OA4 A;  2PXJ A;  3S6P A;  1NYW A;  5EV7 A;  2XL9 A;  3A0N A;  5FV3 A;  4QXB A;  4YM0 A;  1RC6 A;  3IDC B;  3VL9 A;  4YZ2 A;  1UF2 C;  1ZRC A;  3S5Q A;  2IZW A;  5FRA A;  3ACH A;  3M7A A;  4MGZ E;  3SEP A;  1B09 A;  4QKF A;  1D0G A;  1HB3 A;  1UPS A;  2TEP A;  1LOF A;  3BOW A;  4EN0 A;  1G8W A;  4RD7 A;  2WNV B;  1F4A A;  4V2W A;  2E63 A;  2JG9 C;  2BDR A;  1RUC 2;  2VNO A;  2YHJ A;  4BZ4 A;  5C3O A;  4TXW A;  1OPM A;  4DMI A;  2RJ2 A;  3C3V A;  2ZCW A;  3NKT A;  1HRV 2;  2WFF 1;  1CIW A;  1OKO A;  4Q4W 3;  3WHT A;  2EAK A;  3MV1 1;  1NXM A;  3TEZ A;  1SLA A;  5FP3 A;  3V0B A;  2V72 A;  1JOP A;  3LKJ A;  3AZZ A;  3FJS A;  2YC4 A;  1PM7 A;  2HWD 3;  4N7I A;  2YBK A;  1GMM A;  4WVZ A;  3POW A;  1LHU A;  2PN5 A;  3T1L A;  1ULO A;  4PHZ A;  1YC6 1;  4AQ6 A;  1JHN A;  2WS9 1;  3O1U A;  1VRH 3;  4O9E A;  4LBL A;  1DU3 D;  1SCR A;  2X8K A;  2FDH A;  2ZX1 A;  3P5B A;  4YGC A;  5FPL A;  2GH2 A;  4N53 C;  3S0M A;  4WM7 C;  1TMF 1;  1AYM 2;  3D4K A;  4ASM B;  1X8E A;  2W68 A;  2XGX A;  1OBN A;  3WF3 A;  4NO4 A;  3DYO A;  3VBH C;  1W05 A;  1AR6 3;  1OFS A;  1HXS 3;  4Y5Z 0;  4KWJ A;  2FCT A;  3ZFF C;  3WF4 A;  3JD7 3;  1DGW X;  1PO1 1;  1W6P A;  2K9Z A;  2D98 A;  3LAG A;  4UW3 A;  2RS1 3;  2ARX A;  4IEO A;  1O8P A;  4JAA A;  1EAH 3;  1OUS A;  3ZXF A;  4RR3 A;  4BYY A;  4DIQ A;  5L7O C;  1ZX5 A;  1FOD 1;  1Y9Q A;  1H2N A;  4BIS A;  2GC3 A;  1DQ5 A;  2DUR A;  4KBB A;  4AED B;  3IKW A;  3H3U A;  5FZA A;  1W8N A;  3H50 A;  3ETQ A;  4LBQ A;  2QVS B;  5IWF A;  1OOP B;  1YHF A;  1OPO A;  4ATE A;  4KGG A;  2CWM A;  4F8A A;  2P6C A;  2PHW A;  5CFC C;  1WBF A;  2D7F A;  4OZX A;  1LGC A;  4CUG A;  3KF3 A;  5GJ6 A;  2BU9 A;  2VAU A;  5GKA C;  4IEY A;  1JYX A;  2ZX4 A;  2ARB A;  4ZU7 A;  4FTS A;  3MI8 A;  3E6C C;  1IS6 A;  4D8M A;  1BK0 A;  1ONA A;  4DY3 A;  5SV5 A;  3ES1 A;  5LWB A;  1ZZ9 A;  2VMF A;  2P3K A;  4CEY A;  1POQ A;  1RUC 1;  1OI6 A;  2W5F A;  2ZGP A;  5E89 A;  3OGV A;  5JOX A;  2ZXQ A;  3IZO A;  2XL7 A;  1HRV 1;  3WDU A;  2RS5 2;  4QPI B;  5A32 A;  3N7M A;  3OPT A;  2CGO A;  3VBR B;  1QJU 3;  2G9Z A;  5K4L A;  3Q8F A;  1YEW A;  4CCL A;  1QOO A;  3SHR A;  3R6S A;  1WMD A;  1IPJ A;  3VKN A;  4GD4 A;  2R6Q A;  5J3U A;  1NAE A;  3O0X A;  1CZT A;  5BNO B;  4FT8 A;  1AR9 2;  2JB8 A;  4JHT A;  2ZHL A;  2VQ0 A;  4BK4 A;  4RGK A;  2UUR A;  2VVD A;  4E4Z A;  2VZ3 A;  2PHD A;  3OCP A;  3KHB A;  1AYM 1;  2XML A;  2ZA9 A;  2YGL A;  3ALQ A;  1W0N A;  3MGU A;  3PVN A;  4C0H A;  1JYW A;  3BIE A;  4CCN A;  5CG8 A;  1GBG A;  1PIV 2;  5EXO A;  4DS0 A;  4Q8L A;  5JPN B;  2WC2 A;  4PDW C;  2WDB A;  4AAX A;  3WQ0 A;  3WNK A;  4K6B A;  4XTM A;  4QQP A;  4XZU G;  4YZ4 A;  1LTE A;  4YW5 A;  3CQO A;  3JQX A;  3M2M A;  2VUA A;  1OH4 A;  3WDY A;  2IFR A;  3B01 A;  3PU3 A;  2AEY A;  1SDW A;  3ITQ A;  3POY A;  3WLU A;  4B1L A;  4HVO A;  2VMD A;  1WLD A;  3KHC A;  3HBZ A;  1SBD A;  4EV0 A;  4PLN A;  2UWC A;  1US3 A;  3QCW A;  2JEC A;  4XUQ A;  2GDF A;  4Y1V A;  5G04 L;  3EYP A;  4AWD A;  2VQA A;  2JE9 A;  2G9G A;  1OVS A;  4FAH A;  1NT0 A;  4GXL A;  2HH9 A;  2PHR A;  2VD7 A;  2VH9 A;  4Q1R A;  4Q4V 3;  4QKD A;  5CVR A;  4NMI A;  2Y0O A;  2C26 A;  2C6S A;  4NJ4 A;  5IT6 A;  4OVE A;  3CMG A;  5EJZ B;  4ZU4 A;  1FV3 A;  4YZ5 A;  2J1S A;  1SDD B;  4EN6 B;  1NUK A;  1W3X A;  1RTV A;  4TLF A;  2XKP A;  4AGV A;  5FYV A;  2HEY F;  4HSJ A;  1B35 B;  3SCF A;  5CFD C;  4ES8 A;  1OSG A;  2G19 A;  5IVJ A;  4GJZ A;  3FN9 A;  3J7M A;  3NL1 A;  5LBB A;  2RS5 1;  5DN2 A;  5G05 L;  5F2W A;  2XHN A;  4QB6 A;  1ZBE 2;  3WP3 A;  1QIQ A;  3WF2 A;  5C8W A;  5FBZ A;  4H3W A;  2XR4 A;  2D5F A;  5IYY A;  4V1P A;  4BB3 A;  1EV1 3;  3B3Q E;  3MIC A;  3AB0 A;  2RJL A;  2A6Z A;  1UU6 A;  4LOT A;  4FSJ A;  4XTP A;  1AR9 1;  4GQ7 A;  1K5J A;  3GNE A;  3I2K A;  2WLQ A;  5D2A A;  4XQD A;  3VBU B;  2JDP A;  4PIX A;  2P3I A;  3AP4 A;  5CB7 A;  1RB8 G;  4C8D A;  1OOP A;  4DO0 A;  5JPM B;  2EID A;  1W28 A;  4M3C B;  2BYV E;  2Z4F A;  5KHG A;  2XJT A;  2WZ8 A;  4MX3 A;  1PIV 1;  2UYB A;  1H1A A;  3ROU A;  1C8M 2;  3I3D A;  3KT4 A;  4ZY9 A;  3JCI A;  3RNS A;  2YYO A;  2LM3 A;  1PX3 A;  1WCS A;  4TSV A;  1UNB A;  2AH2 A;  2I07 B;  2PLV 2;  1SEF A;  2ZGN A;  3WDX A;  5JOZ A;  3HBK A;  3QBQ A;  4KMQ A;  4N9H A;  1S0J A;  2HLE A;  5JZG A;  1RUO A;  1R1A 2;  2Q4S A;  1WW6 A;  3OUI A;  1FAT A;  4RSU A;  5A6Q A;  4QPI A;  2RDR A;  4LO5 B;  1S2B A;  3ATG A;  1U5X A;  3VBR A;  3MBW A;  4YM1 A;  4NIA A;  1D4M 2; 
#chains in the Genus database with same CATH homology
 3I97 A;  2W94 A;  3C7G A;  3NJX A;  5IJR A;  1RYY A;  5JXH A;  2J1U A;  1UXZ A;  3GDB A;  1JU3 A;  3J7H A;  3OGR A;  4XUO A;  3K4Z A;  4W8J A;  5DMY A;  2CDP A;  1UY3 A;  3A21 A;  1JYV A;  2VC9 A;  4DXS A;  5EJ1 B;  4DXR A;  4KWU A;  2WQ8 A;  1I5P A;  4DUW A;  3GXU A;  1UY1 A;  4BDV B;  4FI9 A;  2WO2 A;  2YG0 A;  3K77 A;  3PUI A;  1R64 A;  4JKM A;  2PQS A;  3I2G A;  2E32 A;  5IFP A;  2ZEZ A;  1UWW A;  2WBK A;  3T08 A;  4CU9 A;  2RVA A;  3E1F 1;  4BJ0 A;  2BGO A;  5FUI A;  4JKK A;  2YB7 A;  5DQ0 A;  3ACF A;  2ZEY A;  3WNL A;  3DEC A;  3OBA A;  4ARX A;  1XNT A;  2VZ1 A;  2JE8 A;  2E26 A;  3EB7 A;  1GNY A;  2WYS A;  3WF1 A;  2E31 A;  4ZZ5 A;  1UY4 A;  4QX2 A;  2VR4 A;  4XVH A;  3OG2 A;  4D0Q A;  3K4A A;  2BER A;  2J1A A;  2W95 A;  3ZM8 A;  5F7U A;  1L7Q A;  2J1R A;  2B4K A;  3OEA A;  3LEK A;  4GWJ A;  1JZ4 A;  3K4D A;  2W91 A;  3W5N A;  1J84 A;  4PF1 A;  2DDU A;  3FHA A;  4MO3 M;  3SKV A;  2BGP A;  4MAD A;  1UY2 A;  2W92 A;  4RYD A;  1H6Y A;  3VD7 A;  4HG6 B;  1SHW B;  3T2O A;  1JI6 A;  1XNA A;  1DYO A;  3ECQ A;  3I2I A;  4QX0 A;  1XC6 A;  5EIY B;  1UMH A;  1JHJ A;  2W46 A;  2VZS A;  1UYZ A;  2JDA A;  4Z2A A;  4CUA A;  3UES A;  3PUH A;  3T0A A;  3I2J A;  3LPG A;  1CX1 A;  4PT6 A;  2C4X A;  2VZV A;  4E8D A;  1GOF A;  2X09 A;  5J1X A;  4XUR A;  3SKJ E;  3A22 A;  3WQB A;  4JX0 A;  2WN2 A;  1JZ3 A;  3WNM A;  2JD9 A;  3HNM A;  3UET A;  1JZ2 A;  2CDO A;  2BZD A;  2VMC A;  4CU6 A;  1GOG A;  1PMJ X;  3ETP A;  2ZEX A;  2Y6G A;  3W5M A;  3CDZ B;  4OMD A;  3WNO A;  2B9V A;  1EUT A;  1UX7 A;  3IB3 A;  5JXI A;  5JXJ A;  4QDQ A;  3CIH A;  1JZ5 A;  3OB8 A;  5LCW L;  2VZQ A;  2XQX A;  5LA1 A;  3T09 A;  1GUI A;  2VL4 A;  4XUN A;  5LA0 A;  4QPW A;  3I2H A;  2WUH A;  1O59 A;  3LEI A;  4ARY A;  3CZJ A;  3K75 B;  3BGA A;  4LQR A;  1UYY A;  2QQM A;  4ET7 A;  4XUP A;  1DLC A;  2VME A;  2X10 A;  1SG3 A;  1DP0 A;  3A23 A;  2QQL A;  4P08 A;  2XOM A;  4CVU A;  5C7G A;  1PMH X;  2ZEW A;  2ORZ A;  2E33 A;  2WAB A;  3C7F A;  1HN1 A;  3III A;  2YC2 A;  2YFZ A;  2WAA A;  3DYM A;  4QAW A;  4QB2 A;  1W9S A;  1OD3 A;  4QDS A;  3THC A;  1XPW A;  3HOB A;  2XON A;  4UI9 L;  1J83 A;  3UNP A;  2WZE A;  4CUC A;  5C70 A;  3LPF A;  3IAQ A;  2WAO A;  3T0B A;  1H6X A;  2W1U A;  4A42 A;  4PQQ A;  2RV9 A;  2VZO A;  5I0D A;  4QX3 A;  3NJV A;  1W8O A;  2L9L A;  4ZXE A;  2LW8 A;  3K46 A;  1YQ2 A;  4CU7 A;  4IUG A;  4YPJ A;  1OF3 A;  2J1E A;  5LA2 A;  1BHG A;  2QQN A;  1W9W A;  3HN3 A;  4RN5 A;  1K12 A;  2R7E B;  4CUB A;  2WN3 A;  2W1W A;  2QQO A;  5JR2 A;  2Y6J A;  2EIC A;  2WO1 A;  1K42 A;  3I2F A;  3ACH A;  3OGS A;  4P02 B;  3SEP A;  1UMI A;  1L7R A;  2Y6H A;  2VQU A;  2VM9 A;  1K3I A;  3WNP A;  1F4A A;  2VTF A;  2OKX A;  3LE0 A;  2VCB A;  3WEZ A;  4JKL A;  4TXW A;  3WSO A;  2RJ2 A;  4OMC A;  1UYX A;  2QQK A;  3MV1 1;  1KEX A;  2V72 A;  2YC4 A;  4P00 B;  1IQD C;  3VDA A;  2QQI A;  1GMM A;  5JMO A;  3NQH A;  2QQJ A;  1OF4 A;  4BXS V;  1ULO A;  3FL7 A;  2W9X A;  2V4V A;  4DEQ A;  4DEV A;  1K45 A;  2VO5 A;  1CIY A;  3VD5 A;  3I3E A;  4DXT A;  3HEI A;  1TG7 A;  3WF3 A;  3DYO A;  1O8S A;  3WF4 A;  3IAP A;  5B4X A;  3NNG A;  3BN6 A;  1D7P M;  4QX1 A;  2Y64 A;  3MUZ 1;  3HNB M;  1F4H A;  1MPX A;  1O8P A;  5A1A A;  2W1Q A;  1KGY A;  4ZZ8 A;  4JHZ A;  1W8N A;  1JZ7 A;  3LEG A;  3HNY M;  2VZP A;  3U37 A;  2VCA A;  3FHQ A;  1JYX A;  1JZ8 A;  2EIB A;  5B4N A;  1NX9 A;  2Y6K A;  4D8M A;  4AG4 A;  4GWI A;  3LQC A;  1OT5 A;  2VMF A;  4A3Z A;  3T2P A;  2W5F A;  2QBX A;  3A7Q A;  3DYP A;  3OGV A;  2ZXQ A;  3WF0 A;  3C7E A;  2YFU A;  3P1I A;  4QDR A;  4A44 A;  3ACG A;  4LPL A;  2VOT A;  5JUV A;  5HPO A;  4M4P A;  1NAE A;  1JZ6 A;  3MO4 A;  4A41 A;  1CZT A;  1UZ0 A;  1TVG A;  1CZS A;  1P8J A;  5CZK A;  3NRU A;  4BK4 A;  4DUV A;  1GU3 A;  2VZ3 A;  2WO3 A;  5DPN A;  3MUY 1;  1W0N A;  1JYW A;  3OEB A;  2J1V A;  3CZU A;  3T0D A;  1W99 A;  3THD A;  3IDA A;  3F2Z A;  2WDB A;  4AAX A;  3WNK A;  2DCJ A;  4XZU G;  1JYN A;  3HPN A;  3CQO A;  4MGS A;  4LHS A;  1OH4 A;  1PX4 A;  4CU8 A;  2X05 A;  2W87 A;  1UXX X;  5HXM A;  2VMD A;  2W47 A;  2BBA A;  4P5Y A;  5JXG A;  2VZT A;  2W1S A;  1US3 A;  1JU4 A;  4XUQ A;  5G04 L;  2DCK A;  2ID4 A;  4L0P A;  4GZ9 A;  3EYP A;  2J22 A;  4LKS A;  4W50 A;  3GGL A;  1GOH A;  3D3A A;  4OZO A;  3SEE A;  4A45 A;  3JXS A;  3WNN A;  3HJR A;  2C26 A;  3C7H A;  2VZU A;  2JKX A;  2VQT A;  4OUE A;  3VD4 A;  3CMG A;  5EJZ B;  2J1S A;  1SDD B;  1WKY A;  1NUK A;  4BK5 A;  3CKH A;  3T2Q A;  1W9T A;  3AC0 A;  5IFT A;  3ABZ A;  3VDB A;  3VD9 A;  2V5D A;  4W4Z A;  4MGQ A;  3FN9 A;  2KD7 A;  2EIE A;  5DN2 A;  3P6B A;  1NKG A;  5G05 L;  2VJX A;  4M4R A;  4XUT A;  2XHN A;  4QB6 A;  2HYX A;  3WF2 A;  3MV0 1;  5C71 A;  2Y8K A;  4DUX A;  5IYY A;  4OYU A;  5CYY A;  4A6O A;  4KI5 M;  2Y6L A;  1GQP A;  3I2K A;  5IHR A;  2LS6 A;  1US2 A;  3C8X A;  3VDC A;  4QB1 A;  2J7M A;  3C7O A;  2VCC A;  3VD3 A;  1UY0 A;  2EID A;  4UAP A;  1ULP A;  2Z4F A;  2C9K A;  1EUU A;  1LNS A;  2WZ8 A;  2ORX A;  3I3D A;  4ZY9 A;  2VZR A;  3ACI A;  2W3J A;  1PX3 A;  2J1T A;  3GM8 A;  4MOA A;  1T2X A;  1CZV A;  3I3B A;  4KMQ A;  4E8C A;  2HLE A;  4TTG A;  1WCQ A;  4UOJ A;  3MBW A;  4A4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...