4A44A

Cpgh89cbm32-5, from clostridium perfringens, in complex with the tn antigen
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
140
structure length
140
Chain Sequence
ASALPQGNMKATATSEHPDVGNEGLAKFAIDGKENTIWHTKYNPVEELPQSITLELGGSYEINKFTYLPRSGAKNGNITKYELHVSEDGNNFRKISEGNWDDSGSLKTLKFNSTKATHVKLVALEGVGGFASAAELNVFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ALPHA-N-ACETYLGLUCOSAMINIDASE FAMILY PROTEIN
publication title Carbohydrate Recognition by an Architecturally Complex Alpha-N-Acetylglucosaminidase from Clostridium Perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
total genus 30
structure length 140
sequence length 140
ec nomenclature ec 3.2.1.50: Alpha-N-acetylglucosaminidase.
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4a44A00
2J1VA 2BGPA 2WZEA 3A22A 4XUTA 2VMFA 2XOMA 3LQCA 3ACIA 2W46A 1UY3A 1PMHX 2VCBA 1WKYA 1OH4A 2VZTA 3ACGA 1US2A 3OBAA 3E1F1 5LA1A 4LQRA 4PT6A 2VMCA 2J1EA 4CUCA 3HPNA 4RYDA 4BJ0A 2VR4A 3I3EA 2BBAA 3WNLA 3NNGA 3OGRA 4CU7A 5JXJA 1GMMA 2KD7A 3C7OA 2C26A 3THCA 2Y64A 3W5NA 4QDSA 4DUVA 4ZXEA 4TXWA 3UETA 4QB2A 5IFPA 1XNAA 1JZ6A 3I2JA 3ETPA 3T2QA 1JZ8A 4TTGA 4UAPA 3D3AA 3LEIA 3K75B 2B4KA 5C7GA 3GXUA 2ZEYA 1NX9A 3WF0A 2EIEA 1K3IA 4BXSV 1W8OA 4GWIA 3MV11 1KGYA 3K46A 4YPJA 4QB6A 3THDA 3WF3A 5G04L 1L7RA 2W9XA 1CZVA 3P6BA 2J1AA 1W9WA 2LW8A 2WN2A 3A21A 1UY0A 2W94A 3WNNA 5JUVA 5DPNA 1DLCA 3ABZA 3GM8A 3CMGA 1TG7A 2DCJA 1PX3A 5EIYB 1JZ3A 2YC4A 1YQ2A 4P5YA 4XUOA 3MBWA 2E26A 4KI5M 4A44A 1SG3A 2WAAA 5JXGA 5JR2A 2JE8A 1JYVA 3P1IA 5JMOA 3FHQA 1W99A 3T0BA 2J1RA 1OF3A 4CUAA 5JXIA 2VQTA 4QX0A 2QBXA 3I3DA 4ET7A 5C70A 4M4PA 2WUHA 4ZZ8A 3WF2A 4BDVB 4QPWA 5J1XA 2C9KA 2QQJA 2W91A 1W8NA 4M4RA 4A45A 2YB7A 2PQSA 2V4VA 1NAEA 4MOAA 3LEGA 2WO2A 5IFTA 3CKHA 3IB3A 4A6OA 1GOGA 4JHZA 4JKMA 4GWJA 3CDZB 1UXXX 3OGVA 4QAWA 2QQIA 4BK4A 5A1AA 5I0DA 4XZUG 3WF1A 2V5DA 2J1UA 3MO4A 3LPGA 4DUXA 2VZQA 3PUIA 2VO5A 2VM9A 2ORXA 5B4XA 1K45A 1PMJX 2CDOA 4ZZ5A 5G05L 3VDBA 2DCKA 3I2IA 3EB7A 4L0PA 1K12A 4QDRA 3BN6A 3OGSA 3HNYM 4A3ZA 2YG0A 3I2FA 4P00B 3GGLA 4DUWA 3C7EA 2VL4A 5EJ1B 2BZDA 1CZSA 2X05A 3I97A 2VCCA 3DYMA 3T2OA 2QQOA 3HNMA 3UESA 1XNTA 2VZUA 1JZ2A 5DN2A 2HLEA 1UWWA 5C71A 3SEEA 5F7UA 1UY4A 3CQOA 3HNBM 1K42A 1JYXA 3HN3A 5LA0A 2V72A 1EUTA 4P08A 2RVAA 1RYYA 2VJXA 4KMQA 3WNMA 3T0DA 2ZEXA 4A42A 1UYXA 4P02B 4MGQA 1F4HA 2VMDA 2C4XA 1GNYA 4AG4A 3C7HA 2Y6HA 3OEBA 2WDBA 3CZUA 2WO1A 3GDBA 1L7QA 2ZXQA 3OEAA 3K4ZA 3IIIA 1JZ7A 4DXSA 1UYYA 4PQQA 4RN5A 3SKVA 4E8CA 3CZJA 1O8SA 5IJRA 5B4NA 3VD5A 2YC2A 3C7GA 2VZOA 3LPFA 2W5FA 2W3JA 3ZM8A 2WABA 1WCQA 3HJRA 2ZEWA 4QX1A 4FI9A 3SKJE 1XPWA 2E33A 3K4AA 2VQUA 5DMYA 2CDPA 3ACFA 1UXZA 3WQBA 2QQLA 4CU9A 1UZ0A 1UY1A 3OB8A 1CZTA 2VZ3A 3NQHA 1OD3A 4DXRA 1DP0A 3SEPA 1SHWB 4D8MA 3K77A 3JXSA 1LNSA 3FHAA 3ECQA 4A4AA 4LKSA 1JZ5A 1GOFA 1O59A 1OF4A 1PX4A 1JYWA 2VZPA 2WAOA 4MGSA 1ULPA 2RV9A 3UNPA 2WQ8A 2VZSA 1UMHA 2QQNA 2W47A 3HEIA 4OMCA 1GQPA 4KWUA 2XONA 1T2XA 2W1SA 2LS6A 4W4ZA 2VZ1A 1ULOA 4QB1A 4OMDA 4LPLA 3VD4A 2W1QA 4OZOA 3F2ZA 3FN9A 2JD9A 3PUHA 2Y6KA 4JX0A 5IYYA 3MV01 3A23A 3W5MA 1UX7A 2VZVA 3NRUA 5HPOA 5HXMA 1HN1A 4W50A 4XUNA 1IQDC 4DXTA 4XUQA 4CU6A 2W95A 3HOBA 4OUEA 3A7QA 3NJVA 2ORZA 3T0AA 3IAQA 1GOHA 2E32A 3C8XA 4BK5A 4CVUA 4UOJA 3WNOA 4JKKA 3NJXA 4LHSA 1P8JA 2BGOA 2X09A 1UY2A 2W87A 5LA2A 1O8PA 1DYOA 1EUUA 2YFZA 1US3A 4DEVA 3FL7A 2VOTA 3I3BA 2Y6GA 5CZKA 3BGAA 3I2KA 5DQ0A 2J1TA 2J1SA 4MADA 1NKGA 1W0NA 5EJZB 4ARXA 3WF4A 1JHJA 1OT5A 4DEQA 1NUKA 4AAXA 2VC9A 2WYSA 2WBKA 3DYOA 3VD9A 4HG6B 2X10A 4W8JA 1UYZA 3WSOA 2ZEZA 1CX1A 2WN3A 4XURA 1F4AA 2DDUA 3VD7A 5LCWL 3AC0A 3LE0A 3WNKA 4ZY9A 2VCAA 3EYPA 4UI9L 2YFUA 4MO3M 2JKXA 2B9VA 1KEXA 1MPXA 1JI6A 1XC6A 2Y6JA 4D0QA 3DYPA 2J7MA 1CIYA 3DECA 2XQXA 3LEKA 4XVHA 2E31A 4E8DA 3T2PA 2VTFA 1SDDB 3MUZ1 3I2HA 3J7HA 3T08A 2J22A 4CUBA 3VDAA 1H6XA 1R64A 2EIDA 3IDAA 1JU3A 3CIHA 3T09A 3VD3A 4IUGA 1J83A 3ACHA 2EICA 2W1UA 2QQKA 2BERA 2WZ8A 5JXHA 1GU3A 1J84A 2WO3A 4QX2A 5IHRA 1BHGA 1W9TA 4GZ9A 5FUIA 2Y8KA 1JZ4A 1I5PA 4OYUA 2VMEA 4ARYA 1GUIA 2VZRA 3I2GA 4JKLA 2HYXA 4Z2AA 3IAPA 4A41A 2QQMA 2XHNA 4QDQA 2L9LA 3MUY1 4QX3A 1D7PM 2W1WA 3K4DA 1H6YA 2ID4A 3WNPA 3OG2A 2W92A 3WEZA 5CYYA 2JDAA 2EIBA 4CU8A 1TVGA 1W9SA 2OKXA 1UMIA 3C7FA 2Z4FA 4XUPA 2RJ2A 1JYNA 2R7EB 3U37A 1JU4A 2Y6LA 3VDCA 4PF1A
chains in the Genus database with same CATH superfamily
2PHLA 2PAEA 3INAA 1AYN3 3AKTA 4DFSA 5M0TA 2GC1A 5H9RA 2GU9A 3AMQA 1V6MA 3A22A 4KL1A 2PHDA 4Y5TA 4A3XA 5A3PA 5JOXA 1W9YA 2D7FA 4OI0A 3UYJA 1W8HA 2QTWB 1SMVA 1XNKA 1W6QB 1FOD3 2VCBA 4GXLA 1Q8PA 5HV0A 2VZTA 1O4YA 3ZIXA 2ZGTA 3AZWA 3E1F1 5LA1A 4X6RB 2VGDA 2E53A 2VMCA 1TMF2 3JBG3 4JGZB 1UZZA 2W68A 3O0XA 3ILRA 3L2HA 2VY0A 3AKPA 3ZOIA 4XMAA 3LSDA 4XIOA 4CU7A 5IVEA 1BEV2 1EV11 4LUMA 5ABJC 4CCEA 1GMMA 3PHMA 3GZEA 2EXKA 4Y24A 1NLRA 4META 4QDSA 5LATA 2O8OA 2ZACA 3C3VA 3PIJA 4AZZA 1W05A 1XNAA 3V0BA 1OUSA 2VVDA 2XLAA 4GMP3 2DU1A 4WM7A 2D44A 1VBE1 5CB7A 3S0MA 3NV4A 2CGPA 1AXYA 5H9PA 3LEIA 4RQPA 2F4PA 5C7GA 5LEJA 4JC1A 4B1LA 1GZWA 5HV4A 3WF0A 1DGLA 3NAPC 3UKTA 3PTYA 1W8OA 2DCZA 2YROA 4BXSV 4ORFA 1ZBA3 2GNMA 3ZXAC 4Y4RA 4A6SA 4D3WA 1KFXL 2DCYA 5LW9A 5F9TA 1KD7A 1O5UA 2BV4A 3OYWA 4QB6A 4SBVA 2RDNA 4UBHA 1NA1B 2QKDA 2ZBJA 5FZFA 3ST7A 3P6BA 1HB3A 1QY4A 4Y20B 2J1AA 3USUB 1W9WA 2LW8A 2XVKA 3DXUA 1UMZA 3Q8FA 3PJYA 4PDWC 5GZGA 4QT6A 2K9ZA 4YW2A 5HCHA 1S1AA 2W94A 3E97A 3MIHA 2WSUA 3WNNA 3TEWA 2G9GA 5FP8A 4QM8A 3H1YA 1X50A 3ZKYA 1X9PA 1DLCA 2XBO1 1JOJA 3ABZA 4L11A 3TN91 1DYPA 1VBD3 3AMHA 1KFUL 3FWEA 3GM8A 4GKYA 1VMJA 4GH4C 2Y6FA 3BI3A 2BYVE 3PTRB 1NY72 1OLQA 1JZ3A 1W04A 2YC4A 4P5YA 4QMAA 4XUOA 5FYSA 2ATFA 3MBWA 3BU7A 1B35A 4COUA 5F32A 5FUNA 1UX6A 5C3SA 4IEVA 1DQ1A 3N9LA 4CTEA 4BISA 3LGRA 1IPKA 2ZX0A 4WVWA 4Q8LA 5DUXA 1RUH3 1ZM1A 4X8NA 2YGMA 5JMOA 4ES8A 5JXIA 1OF3A 5AFBA 2GMEA 1RUD1 4QX0A 5FYVA 5C8CC 1PO23 4Y22B 4CEYC 4XETA 4M4PA 1APNA 5KXDA 2B9UA 4QPIB 4YW4A 4N53B 2CWMA 3ZYIB 2VCMA 4XZPA 5K7PA 5F3EA 4E9KA 3B7MA 1PK6A 1RUG1 5L9RA 2XXZA 3ZFGC 1V6OA 4COWA 5I91A 4CCJA 2RDSA 2EAAA 2QZ3A 1YQ8A 1OLME 2V4VA 1NAEA 1REDA 2WIIB 1VJ2A 4YRDA 1WMEA 1YFXA 4YM3A 1OVSA 4NAMA 1GOGA 3MLKA 1LU1A 1R091 2D40A 2R32A 4O9GA 2YUEA 1IPSA 3AK0A 1HXS2 4Y1YA 5L7OB 1AR61 1J1TA 1S0IA 1LHOA 4QAWA 1W8FA 2HBTA 2Q0AA 2SBAA 3RZKA 3HWJA 4OZXA 3KS7A 4ZS2A 1NZCA 1DQ6A 4LE3A 1GNZA 4NPLA 5E1RA 4AI1A 5JPMB 5A7PA 4FOVA 4FQ4A 2CU5A 4DUXA 1ZX5A 2ZGRA 2VZQA 1W6PB 2ZGOA 1QKQA 3PIGA 3JUUA 1H4HA 5B4XA 2UWBA 1K45A 5C4WC 2G9FA 2UY9A 2HWC1 4LBMA 4CPBD 5G05L 3ZIWA 1QNYA 1OPMA 1SFYA 1VB4A 2ZMNA 5FFOC 3EB7A 4CE8A 3OCPA 1K12A 2YPJA 1R1ZA 5GLWA 3WINE 2IZWA 4Q4Y2 1Q8OA 4LBKA 1WW7A 3UKNA 3J7LA 5KHGA 3KHCA 1RB8G 5JLVA 3ETQA 5HBAA 4LITA 1R1A1 3I2FA 1SFPA 3ZSJA 3LKJA 5AFEA 4LTAA 2WS92 5FPBA 3H0OA 5FPAA 1ZRCA 1OSGA 1FMD3 5GLZA 1YUDA 3A0NA 1JYIA 3O7OA 3LF7A 3K48A 1TNFA 2WKKA 4FPEA 2VPVA 1OH3A 2VCCA 1S0BA 3R4SA 2D43A 4MHRA 2P3JA 4RR3C 2WINB 1ZBE1 4DZGA 3AB0A 2K0GA 1JZ2A 2YHJA 3U14A 2RMU2 5JWPA 2ZHNA 1GP6A 4FT8A 4FAGA 4DMIA 2ARXA 3DV8A 2HLEA 4L2NA 1QJY1 4BMBA 2JKBA 4FPOB 1XYNA 2JICA 3CQOA 2QCSB 5F5AA 1HN0A 4LEJA 4CDUC 1JYXA 3HN3A 3ZFEC 5LA0A 5C8WA 3QCWA 3DCQA 2PAMA 5C5TA 1EUTA 4N43B 3QH6A 1AR82 3ZN6B 4AEDA 3K51A 5GZCA 1RUJ2 4A42A 4V1PA 2XHKA 1VBA3 4XYXA 5BNNA 2XGXA 3U75A 2C4XA 4UFJA 3UT0A 1G9BA 2V4AA 2AEZA 4COZA 2WDBA 4YW3A 1OURA 3ZO0B 4EROA 5E6HA 1VRH3 1BBT2 2ZXQA 5DG1A 3VZKA 4XOGA 5DAPA 3I2OA 3IIIA 2WJSA 2DVDA 4K20A 2Z5WA 3RVHA 4AHXA 3VBSA 4Y1UA 5DAVA 2OZJA 4RN5A 1AR91 4AFDA 4E8CA 5A3LA 4ZONA 1K5MB 3O1RA 1H2LA 4Q4W2 1EP0A 3CZJA 4LBQD 4XMIA 2JG8B 2Y34A 2WNEA 3BTXA 5A1LA 1OOPC 4FOQA 4AVTA 3Q8AA 4PF5A 1UF2C 4BOWA 1NCQB 3AMNA 3I7DA 2HWB3 4WVZA 1AZDA 2RG4A 4MXWA 4YLZA 4BQYA 4GQ7A 1WCQA 5C3OA 4CEWB 1Q5OA 4CDWB 3PU3A 1UU5A 2VTXJ 2E33A 4NIHA 1V0AA 4Y1VA 4EYUA 4QPGC 5LZ6A 1XSRA 2BFUS 4LO4B 3IPVA 4NWVA 1HKDA 3AYEA 3GCXA 4O7XA 4QQPA 4FBFA 5J37A 2BBVA 1O4TA 4QWNA 1AYM2 4LXLA 1ULEA 3ZSEA 4UW3A 1E57A 1VBC1 4QKNA 3SEPA 1RUE3 3T3YA 3K77A 1F5JA 1Z7S2 4HPKA 3ECQA 4JGZC 3W58A 2YXSA 4L92A 3ZYFA 3V0AB 5A3UA 1VIWB 2YBSA 1FT9A 1AHSA 1D0GA 1POQA 2GP5A 3QH7A 4LE4A 4HKOA 2ZOEB 5FP3A 2E7TA 2RDRA 3PVEA 3VLBB 4CXXA 5A6QA 1CWPA 1LENA 4FPJA 2NLRA 1AYN2 2RV9A 1AL23 3GBWA 5E8AA 3M1HA 4BQXA 2PHTA 4HN1A 2RR11 5CFDB 3UNPA 5JMCA 4SLIA 2O0OA 5IK8A 4BIOA 1VAKA 1QQP1 1U5ZA 4HSLA 4JQTA 1GQPA 2NMNA 4M0HA 4QPYA 3ZXEA 2WWJA 4RD7A 2XONA 5CFCB 1FOD2 4GB33 2LS6A 4XXAA 4YZ4A 4IV1A 4C90A 1S0CA 4QB1A 4XFAA 1ND2B 3LDBA 4JV4A 1OQ1A 1PVXA 2D6KA 4U36A 3JBG2 2BUKA 4FPFA 4Q4X1 4M3CF 1QH7A 2FCVA 3ZDSA 1HJFA 2W1QA 4YW6A 3F2ZA 2VUCA 5FY1A 3VZOA 1LCLA 1CJPA 2Y6KA 4JX0A 2LRPA 3A23A 3VGIA 1WLCA 5IVFA 1QXPA 4XF0A 3K2OA 1NA1C 4LUKA 5DZFA 3U11A 1REFA 5C9AA 2HWF1 4DXTA 1ULDA 1GQHA 5C3RA 4K9SA 4CU6A 1ZRDA 3HOBA 2ET7A 1JTZX 3URFA 2DVFA 3VBFA 1XE7A 1M06G 2XJVA 2RS13 2BW8A 5HCFA 4EJRA 4MLOA 4CVUA 1E5SA 2BU9A 1S0JA 2OX0A 5CKNA 4HT1T 2FDFA 1FNZA 4JKKA 3LOBA 1X33A 3VKOA 4AVSA 3H8RA 4YG0A 3ES1A 1UKRA 4COYA 3VDDA 1GNHA 4IE6A 1C8M3 1ZBA2 1DYOA 2YFZA 2JDKA 1XE8A 2WWUA 3VBUA 1W2NA 3MYXA 2NYYA 1DZQA 4OHYA 4IE0A 1RUOA 1HRI1 4UBGA 2RHPA 3PUSA 3SH4A 3I2KA 1ZZ6A 3E5UA 1FI2A 5FZ6A 3H3ZA 2VULA 4ISRA 4JQRA 4DNYA 1XNDA 1WMXA 1IS3A 2ZAAA 3LDKA 3QOPA 5DZGA 1POV3 4JRAA 2ZHKA 3MIBA 2F6BA 4J1WA 1Y3TA 2V73A 1DLLA 5LBFA 1OT5A 5JAXA 4H55A 4AAXA 1E5RA 2WYSA 2GNBA 1W06A 4QKDA 2GMPA 3VD9A 1UQXA 1RGSA 1VBD2 5HXVA 4KBBA 1DBNA 3DKQA 1G86A 2Q1FA 3IMMA 3WSOA 4QXCA 4QPIC 2FDKA 4N53C 5FK7A 1F4AA 1LESA 4QGNA 2P4EA 1RUI1 5LCWL 1UOBA 3GZUC 4K40A 4IV3B 2IFRA 1PO11 2VAUA 2EA7A 3LE0A 3RGBA 4MGTA 1CAXA 2P3KA 5FP4A 1RUH2 4LIVA 1NE4A 3H7YA 1W6OA 2VQAA 5IATA 4Z82A 5BPXA 3KT4A 2B9VA 4LMFA 3KQ4B 1OD5A 2XWJB 1PO22 5CNAA 3ZMOA 3ZPOA 4D0QA 1ZRFA 3DYPA 2ILMA 5L7OC 1CAVA 2DVAA 1IHMA 2FZ1A 4I09A 1HB1A 4E8DA 4NMIA 5GALA 2D93A 4H7LA 3V65A 1MQTB 4L97A 4EZ4A 1QHDA 2VTFA 1HX6A 3B3QE 5FZEA 3MUZ1 5DUVA 3J7HA 4LR4A 5FYBA 4CUBA 1HV0A 4OVEA 4QX5A 4DRVA 1U12A 2TEPA 3ACLA 2EIGA 5J09A 1JU3A 3SMHA 2A6YA 4IL7A 1RC6A 3M3OA 3SQOA 5FPZA 1YQ6A 1GV9A 3ACHA 4NIDA 2OIIA 1E5HA 4EN6B 2XDVA 3BVCA 3AYAA 4B3NA 2VUAA 2D6PA 4H7MA 3MW3A 3S57A 2VVEA 5JXHA 2PLV1 4K3UA 1CAWB 1J84A 3RS6A 2WA3A 1YNAA 4GWNA 3SCGA 1KS4A 5E16A 5D8AB 1F8VA 5A33A 5FUIA 5FAXA 1HRV1 1F35A 2JDUA 4JGYA 4WZCA 1G9AA 2VZRA 4HANA 3C2UA 1MEC1 4W6XA 4UW6A 3F95A 2PN5A 1C5HA 1MACA 4EWEA 1Y9QA 2OYZA 2VNVA 1DZTA 3ZYJB 5FMBA 5IK7A 5F6LB 1R083 3LCPA 1H6YA 5A7WA 3SC7X 3OG2A 1JXNA 1VR3A 5CYYA 5FXWA 3NJZA 1ZRIA 2OPKA 3J8F1 4YVWA 1PZ9A 4XUPA 2RJ2A 2B45X 3U37A 4N7UA 4ZS3A 3I4IA 4CP1A 1JU4A 1WZXA 2P1BA 2YGLA 3VZNA 2GNDA 5BXXA 1CAWA 1AR71 1QWRA 5FYYA 5FXZA 5L9BA 1FMD2 2VW0A 4B4RA 1LAJA 3KV9A 4RS5B 3T1LA 1IG0A 2JIGA 1J3RA 4UXAA 5C6CA 4R4XA 3WP4A 1ZZCA 3ACIA 2EXHA 1UY3A 4RA0A 1B09A 2HH9A 4GMP0 4KH9A 3AL6A 2ES3A 4FPGA 2IWGB 3ACGA 3O0VA 3S5QA 4D94A 3FBMA 4NE9A 3TNQA 3W20A 3KT1A 2P17A 3O12A 2DFCA 3DKWA 2P3IA 3KSCA 5FZOA 5BNOB 2D3SA 4Q29A 1XNCA 4CUCA 4RYDA 1SLAA 2IXLA 2K46A 2VR4A 1QJX3 3FHIB 1V70A 3VKNA 4A7YA 1RXGA 3BALA 4KNCA 5FY9A 3WNLA 1OXCA 2WQZC 4FVVA 3RRDA 4DPNA 2KD7A 2JG8C 4RSUA 3THCA 4NWWA 3ZYGA 1H9PA 1VB2A 2Q4SA 3WDUA 3EXUA 1NXD1 2AEYA 4BE3A 2WT1A 3NVCA 2NP0A 1VBA2 5IFPA 1NCQC 4QXKA 4P9LA 4TTGA 3OSDA 4YNIA 4DB5A 5A6XA 1ZYBA 4CEWC 4CDWC 2TNFA 4MV2A 3D3AA 2IVIB 1Z0HA 2C1FA 3GXUA 5FMOS 3WVJA 2ZEYA 1NX9A 2AR6A 3OY8B 2EIEA 4CCCA 1K3IA 2PHWA 4YW5A 4XACA 2XR4A 3B94A 2G19A 2R041 4IGOA 5FKCA 5ERLA 1VMHA 5FREA 3JB8A 4B7KA 4YZ5A 4RFT0 3AXEA 3THDA 2ZABA 5F5IA 3WF3A 3SITA 1UPIA 3AKSA 3MDPA 3O1PA 4Q0SA 4A2UA 4O9EA 4UWDA 1YI7A 4XTPA 1BKZA 2WN2A 3O1OA 5JOYA 5FZ1A 2Z69A 1UY0A 1W3VA 3BUCA 4XDQA 3BTZA 4NUBA 5FRAA 5JUVA 2FMDA 2JE9A 3CBNA 1AUYA 5CFDC 3JZVA 1NCRB 3ZFFA 1DCSA 1TME1 1RVF1 2ADDA 2LTNA 3IMNA 4LORA 1TG7A 4IEZA 5JDBA 2BQPA 3H3LA 4EV0A 5CFCC 2C9AA 3ELNA 1YRZA 4V2WA 1COV3 1QJFA 1W6MA 2E26A 2DF7A 1SG3A 2IXCA 1ND2C 2R30A 2VXRA 4S2HA 4YG6A 3KB5A 5FYCA 3LFIA 1N3QA 3RDIA 5JR2A 1EAH1 1F2NA 2BRTA 4QX8A 3P1IA 3AP4A 5BV6A 3FHQA 4RHV1 1SLBA 3D4KA 4QHZA 5FYZA 5H9SA 4OUSA 3DL3A 4U2AA 1C8NA 1ND3A 1RHI3 2A6WA 2P2KA 1JN2P 1V6NA 3LD8A 2AENA 2HWE1 2ZCWA 2JB8A 5JZGA 4I0WB 3WLUA 2WUHA 2N7GA 4AVCA 1IZ3A 1Q8SA 4QPWA 3QBQA 2PQQA 1MVEA 4IEYA 4LT5A 2QQJA 3GF6A 4YVSA 2R6QA 5F8PA 4KG8A 5IAXA 2PELA 4B7EA 4F3JA 4HK9A 4CSWA 1U0AA 5JIAA 2ZGLA 3POIA 4GALA 3SCFA 1PGW1 2PQSA 4MOAA 4FPKA 3VL9A 2WO2A 5IFTA 2OUHA 3AMPA 3IB3A 5BNPA 2WNVB 4JKMA 1LOEA 3AMMA 5IAVA 3E5QA 2HWB1 1MVQA 3U4SA 1A78A 3GNEA 4QU2A 2OQ7A 1HQLA 5L36A 1A8MA 2AH2A 3GZAA 3QD6A 1QJU1 3IZOA 4LBOA 4N9IA 4Y33A 3ROUA 2RM23 5T5LA 4CP2A 2RS12 3V0BB 4NRQA 2J1UA 1WW6A 4WM7B 3MO4A 2XUMA 1N1SA 4EN8B 2R063 3AKRA 1F31A 3WT3A 3PUIA 2WO7A 3HQXA 1D4M1 4RQPB 5DZEA 4IEOA 2ORXA 1QNWA 2JG9A 5IWFA 4OUMA 1C8M2 1GZWB 1PMJX 1PZ7A 1RUF1 1RUE1 1GWLA 4LK7A 3VDBA 1PVC1 1OQEA 4J1XA 4CDUA 5IK4A 3I2IA 2XWBB 1PMIA 3ZFEA 5EP9A 4QDRA 3BN6A 3NWKA 2XKPA 3OYWB 1HB4A 4IV3C 1QXRA 2QQUA 1C57A 1MS9A 1W8TA 2V5YA 2XUEA 1D4VB 4CDQA 2YG0A 4H3WA 4XDPA 1AL21 2WNVA 4D7SA 3BYWA 3GBFA 5EXOA 4DUWA 2A5ZA 4OI1A 5FK8A 2BZDA 1MS0A 1Q3EA 3FLTA 5JSOA 3I54A 1PNGA 1UZVA 2X05A 1W28A 4XQ4A 5C33A 3PMSA 4B29A 4B4PA 1AX0A 2XJQA 2WZR3 1MQTC 4P9YA 2VMIA 3R4DB 5DABA 3MZHA 2D97A 2G4IA 2QQOA 1N3PA 4QQOA 1XNTA 2CTVA 5D1IA 1B35B 5CU1A 1UIKA 5FPXA 3IT8A 5LK7B 1UL9A 1VMFA 2I45A 3KLSA 1OOPA 1UN1A 2DBIA 3MGUA 3NW4A 5DN2A 4TLGA 4TZDA 1UY4A 3HNBM 2K2SA 4Y4YA 5FJKA 4IXLA 4UW5A 3BTAA 3U07A 4P08A 4CZSA 1UZYA 2RVAA 1RYYA 4IE4A 2X8KA 1QIQA 4W65A 4QPGA 1X8MA 5D8AC 3O5SA 1H4GA 1W0OA 1WGPA 4PLMA 4WVMA 1CQ9A 4XJUA 1WLTA 4MGQA 3WW3A 1CGPA 2VMDA 1WD3A 3LFMA 5LBBA 4BH9A 2RE9A 1RMU3 1GNYA 1RIRA 2Y6HA 2R1BA 1DF0A 3C7HA 3HN1A 4FO9A 4XHXA 4Z07A 3N9NA 1PGL1 4ASMB 2VBDA 1L7QA 3M7AA 4XQWA 1PK6B 3OBTA 4MYEA 4XFFA 2SLIA 2WSVA 4BXFA 5AC93 1JZ7A 3WR0A 4NJ4A 4FFFA 4OI2A 1FXZA 2XJRA 3H50A 4JDOA 2DURA 4CYDA 4XEZA 3I3MA 2ZGKA 1TMF1 1MZ5A 4IE7A 5FZ7A 3SKVA 1SZBA 4QD2A 1C1LA 1YQCA 1O8SA 2Q5TA 4UFKA 3ZSLA 3OD4A 4BQ2A 2DBNA 1XRUA 2XLFA 3ITQA 4N9HA 1BEV1 5IJRA 4FTEA 4HETA 4YM0A 1ZRRA 1V6IA 3U1XA 3VD5A 5L9VA 4HMZA 3VZMA 1Y9MA 2DCTA 2W3JA 3P5BA 1I9RA 3N9PA 5EYYA 1KJRA 3KM5A 4LLFA 4QX1A 2RS33 4AOCA 4Y5Z0 5IW0A 1LU2A 1QH6A 5T5JA 2PHXA 3K4AA 3WQ0A 4URAA 4RS5C 1PIV3 2VE1A 1BXHA 1YJKA 2CDPA 5DMYA 1UXZA 1R082 3WQBA 2NZ9A 1OC1A 3CLPA 3RSJA 4BWOA 5CADA 3LAGA 4IDZA 5LA9A 3SLIA 2BP6A 1UZ0A 2BVVA 4R52A 3OB8A 2VZ3A 1DIWA 1H2MA 4P5HA 1OD3A 4NO4A 4UFLA 5FZ8A 3CJIA 1SHWB 4OHWA 1C28A 1LNSA 4MGIE 4AL9A 4NAOA 3NNJA 5BNOC 2H0VA 3PL0A 3KHBA 4CA9A 2R073 4XTMA 4PCRA 1PX4A 1H30A 4K21A 5FZ3A 3RYRA 3UGHA 4TWTA 5IVVA 5SV5A 3M2MA 1UOJA 1SBFA 4Q8KA 2QZ2A 2NQYA 4EN7B 1UMHA 2PMWB 2BNMA 3WUDA 2MEV3 4OMCA 3E6DA 2CNAA 3RJ2X 3LB9A 4KWUA 5LBEA 1I3HA 4TLFA 5A3OA 1JODA 1T2XA 2W1SA 3O1TA 1ASJ3 1JW6A 2GC0A 4XJAA 4AQTA 5I0RA 3RZHA 1ULOA 2HJIA 1ZZBA 2WNOA 4BYYA 1MS8A 3TRSB 1N3OA 4OMDA 1NY71 4XFBA 5FLHA 2JECA 1ZVFA 2PA7A 2R0FA 3MIGA 3Q8CA 5KHJA 4OZOA 1QJX2 3FN9A 3WDXA 2JD9A 3POEA 1CR7A 3J7NA 5B2GB 3WZ1A 1GZTA 4I0BA 2VZVA 2IXJA 2A3YA 1LTEA 2ZMLA 4K7JA 4Q5OA 4Z2WA 3RZMA 1HN1A 4AI9A 1I5ZA 5HCAA 4UFHA 1BJQA 1MZFA 4BCUA 3BIEA 3GBGA 2CWSA 1XB9A 4UF0A 1DYKA 4AEDB 4EN0A 2RS53 1OKQA 1Q8QA 5DDJ3 4CDXA 1GFF2 3EHKA 3NJVA 2ORZA 3DEMA 4LA3A 2V09A 1GOHA 5JOZA 4JAAA 2W0XA 4LKDA 5BNNB 2ZGMA 4BIFA 1X7NA 2BFUL 4UOJA 4IERA 3NNMA 2QDRA 1NCRC 2HWD3 3MFCA 1UO9A 2E7AA 3NJXA 5IUQA 3VBOC 2WNUA 3K3OA 3MHZA 3RMYA 4FSJA 1UY2A 2DVBA 3D8CA 2GALA 3M4FA 5F39A 1SFNA 2FZ2A 5FZ0A 4DEVA 3GJBA 3VBSB 3O0WA 3OBZA 3ZXFA 1LULA 4NR1A 1LOFA 3LA3A 5LRRA 2W2IA 1LGBA 1KITA 4MADA 1OUXA 3BGAA 5DQ0A 4Q1PA 1GICA 3OOXA 1SBEA 2J1SA 5CBLA 1RUC1 1GYKA 1LEDA 3VN4A 1W0NA 3WF4A 1HXS1 3JD73 4AGRA 2OXBA 4QU1A 1FPN3 4MXWB 1L3JA 4PHZA 3EO6A 5EHDA 1NUKA 1LHUA 2VC9A 3VBRA 5A80A 1BVVA 1TEIA 1OHFA 2GAUA 3POGA 4RL7A 2X10A 4AWDA 4W8JA 4B4QA 4AGGA 4GULA 1UYZA 1NXMA 4CCMA 4IE5A 3IPVB 3M3EA 4I01A 4IEUA 4NIIA 1COV2 4D7TA 3VBHB 3POFA 4XURA 2VTXA 1CX1A 4HL0A 5GLVA 5CG8A 4XJ9A 2ZX2A 1LOCA 2ADEA 3FFZA 2XLGA 3IDEA 2CL2A 2CY6A 2ZHMA 3FJSA 4MGYE 2UWAA 4HPKB 2ZPXA 3Q9OA 4NHYA 4P9XA 4ZY9A 4Q4Y1 1LOAA 2A7AA 5DXDA 5KC6A 2YFUA 3O1UA 2ZX4A 3TYJA 1MPXA 2NM1A 2O1QA 4KWLA 1RHI2 5JPNB 2QQWA 4NRMA 4BQ4A 3O1VA 5FDBA 2WS91 4P14A 2GH2A 4OHZA 1FNYA 1T6BX 2E31A 4NOTA 5EZWA 1MZ6A 3WD5A 4CPBA 4AFMA 1QDOA 3T2TA 1SDDB 3DXTA 2BOIA 1CD3G 1U5IA 2PTMA 3GZTB 2JDMA 3NV2A 3WX5A 2BJSA 1HQWA 4IV1B 4RQPC 1R64A 2EIDA 3WDVA 4CRQA 3VBHA 1WWYA 1WMDA 2YYOA 4XF1A 1IPJA 4XABA 1A6CA 2Q30A 3OD0A 4Q0QA 4C91A 4LBNA 5EYXA 2RMU1 1UD1A 2GMMA 3IM0A 1PM4A 1S2KA 4AEMA 1JOPA 2BOJA 3OPTA 4Q4V3 3RMXA 4HLTA 4BA6A 5F3IA 2QQKA 3WUCA 2ZZJA 1AXKA 4YGDA 5H9QA 4IESA 2XL7A 4TN7A 2WO3A 4R9AA 5C9AB 2OVUA 1LEMA 1VBB3 1V9U2 1PNFA 2Y8KA 5ANNA 5EFUA 3U10A 2D6LX 5BY5A 1AR81 4OFGA 1I5PA 2RM22 4GWMA 4OYUA 3I2GA 1RUJ1 2X53S 1C4RA 5JOWA 1GLHA 1W6NA 1XXNA 2KM2A 2R062 2Y33A 3VBFB 5CEHA 1ENRA 3VUOA 1HW5A 2YY1A 3DGTA 4BQ3A 1LODA 4IEWA 2A1XA 2C5DA 4K6BA 4A7ZA 1W8ZA 2A6XA 2L9LA 3EBRA 2W1WA 1BBT1 3K4DA 4GA9A 4QX3A 3VDDB 5TSWA 5DAXA 4D6SA 3NMBA 5FR3A 4CU8A 1TVGA 1W9SA 1UMIA 3C7FA 3VBUB 1B35C 3QACA 2BWCA 2HEYF 2PAKA 1JYNA 4NHMA 1XBFA 2R7EB 1LHNA 1MS5A 1NOVA 4Q4W1 4LO7A 1RITA 2WA4A 3RFRA 1EV13 4Y5SA 4RGGA 5JSPA 1PHMA 1WCKA 4PF1A 3S7EA 3BTYA 4AHZA 2UYAA 1Y7BA 4RGKA 2A6ZA 3WNXA 5ANQA 2ZX1A 2WLQA 4YM2A 1H2NA 1QMJA 2KXLA 5C3QA 4BB3A 1UPSA 3WY6A 2BGPA 1HB2A 3DPRA 1XOYA 1VBE3 4HK8A 4XUTA 5FYIA 5FYHA 2VOWA 2XOMA 3LQCA 3VHNA 2JDPA 2WZR2 2W46A 3FUQA 3LDRA 4FXGB 3B01A 4N90A 1AXZA 1WKYA 3RZGA 1OH4A 4PI0A 1US2A 1NG0A 5FY0A 3ZR5A 1CN1A 5F5CA 4ZXKA 4LBQA 1L7LA 1PK6C 3AP6A 1AYM1 1UNBA 4PT6A 2DTWA 1XSQA 5BYNA 2J1EA 3H7JA 3HPNA 1Q8VA 5A32A 5FQ0A 2VNRA 3B9CA 1CAXB 1Z7S1 1DG6A 1H8TA 3TNPB 1W6OB 2BBAA 5FYMA 2VECA 3B00A 1KJLA 2QQVA 3DF0A 5JXJA 1H1MA 2C26A 1QDCA 1WLWA 2Y64A 4WM8A 3W5NA 2YZ4A 1J3PA 4DUVA 3IDCB 5CVRA 4KBZA 1AYN1 4LO8A 1PZ8A 1CAVB 2E6VA 1JZ6A 3ORJA 1W2TA 1YIFA 5A7QA 3MIFA 1S0GA 1RMU2 3N36A 3W9AA 1JZ8A 3JU9A 4UAPA 5FY4A 2XBO3 1T6GC 3GYDA 3MFAA 1WBLA 4NHKA 4PIYA 4QXBA 2FHRA 3TN93 2B4KA 2BNNA 1FOD1 2ZGNA 3POYA 5JVVA 1LB2A 4HBNA 4CCLA 1H0BA 4COVA 5AC92 4BM8A 1MS1A 3ZXKA 5CG9A 5D2AA 3ZDVA 2DUPA 5FZLA 2B8MA 4FAHA 3JBG1 1YC61 4ZPIA 4IQPA 5IVBA 2Z2SB 4YPJA 4D7YA 2QE3A 1IG3A 1L7RA 3VV1A 4XAEA 5FPLA 1BYHA 3SH5A 5JCTA 4NIGA 1ULCA 3AVRA 4ZHNA 4HVOA 4J6GA 5K0UA 2ZMKA 3UV9A 1JUIA 3A21A 1RUD3 3AX4A 5A33B 1O3TA 4URTA 5FIXA 4JGYB 3ZYRA 4I02A 5FZDA 2RS32 3NNLA 4GMP1 3RYKA 3TEXA 4LO6B 5JIUA 5DPNA 1BCXA 4ITCA 5FZIA 4OHVA 1PIV2 4W6YA 3CMGA 2DCJA 5HCBA 2ZGQA 4O65A 5K4LA 1RUG3 1QU0A 5A7SA 4Z1VA 5I8YA 2AUYA 1YQ2A 4MH0E 1BK1A 5A7WB 3B9IA 4KI5M 3S5AA 5K9YA 1ZBA1 3S6PA 4LIUA 5IVCA 1BVP1 2PFWA 2DFBA 2HEVF 4YVWB 3WG1A 1ZA4A 2JE8A 3ZSKA 1JYVA 2X5IA 2WLPA 2R072 1X82A 1R093 5I8TA 2E7QA 3PLQA 2EF6A 5KXBA 4AHWA 2R49A 4ATFA 3OJBA 4XF3A 1DQ5A 3T0BA 4C1WA 4CUAA 1AR63 5A70A 4NROA 2VQTA 4OULA 4UT5A 2CYFA 3I3DA 1LR5A 2MEV2 1ENXA 3PVOA 4AEDC 4ES9A 5A6ZA 4DO0A 5FWJA 2ARAA 1QOSA 1ASJ2 4ZZ8A 1DGRN 4AXOA 1VAVA 1VBD1 3LWCA 4FP2A 2KR2A 5FMOL 1OLRA 3WF2A 2WYFA 4NRPA 4BDVB 5BNNC 4A7KA 1KDMA 2D5HA 1ODNA 1W8NA 2HWC3 2XH6A 4S2DA 3AXDA 5FZOB 4BLIA 2YB7A 4NVPA 3ASIA 5A3MA 3KVAA 3OGJA 3NL1A 4HKLA 3LEGA 2QNKA 5F6KA 3WCRA 1D2QA 1G6NA 4M3CA 2I2SA 4XFIA 3VBSC 4MVTA 4PDWB 3UGGA 1RUH1 1SPPA 5ABJA 4JHZA 1LRHA 3CDZB 3OGVA 5T5PA 3LSEA 4XE9A 1R1A3 1JH5A 2MPFA 2RS52 3POSA 2QQIA 4XFGA 5DDJ2 4AQSA 4BK4A 3HT2A 4QQHA 1PO21 1TZOA 1A8DA 2P6CA 5FO7B 5T55A 2LROA 3AYCA 4JHTA 5KHHA 4D69A 4BQ1A 2V5DA 4JDNA 4N43C 1DGWA 4BMEA 4DRRA 4AFCA 1C3HA 2HWD2 1VRBA 1O4ZA 3JQXA 1OI6A 1TQ5A 2VM9A 5EV7A 3NAPA 5FYTA 2AYHA 1ZBE3 1RXFA 4XQDA 4MSVA 1BMV2 1JOBA 2IVJA 1DU3D 1A3KA 5FV3A 1YO8A 2DU0A 2VG9A 1RTVA 5CA6A 1QJY3 1Y9GA 3HNYM 4BLJA 3IWZA 4XBQA 3ZR6A 2C6SA 3AZXA 3H1WA 5F1RA 3W59A 4PDWA 4KQ7A 2VUDA 3JD72 1HV1A 2WRAA 1K5MC 3V64A 1ALYA 1FPN2 3R0RA 4Y1ZA 1ZA7A 1GKBA 3C7EA 1IGOA 1JBCA 3PURA 1JYTA 1U5XA 4YYOA 4JRLA 5GLTA 1FV3A 2QJVA 3M70A 3OTFA 5KC5A 1CZSA 1Y43B 1N1VA 1SLCA 1F5FA 2O8QA 3IN9A 3ZFFB 4GH4A 1NLQA 1KS5A 3I97A 3NV3A 4XPVA 3DYMA 4R8HA 3T2OA 2VD7A 5ACA3 1YHFA 5F37A 3D6EA 3BIWE 3ES4A 1O7FA 1S2EA 4K1ZA 4E4DX 3UESA 3E6CC 1W6MB 4IV1C 2Q8EA 4GAZA 5FOJB 5A3TA 1AR93 3OF1A 1O3QA 2H6CA 1YYNA 4QHBA 5FXXA 5C71A 2AC1A 3AYDA 3AL5A 4RGAA 3FBYA 3N4MA 1K42A 5APAA 2V72A 5GLUA 5C8CA 3SH3A 1QJEA 2CAVA 2R1DA 3MPPG 3HAGA 4E2SA 3WXPA 2VJXA 1VE0A 4CEYA 4KMQA 3OUHA 3KVBA 3AP9A 4PIXA 3T0DA 1ND3B 2A3XA 1FMD1 1GZ9A 1W2AX 2WFF2 3AZYA 1UYXA 3E6BA 3WQ1A 4CP9A 5JZGB 1G7YA 1F4HA 2VOKA 2YU1A 1OFNA 5LB6A 5ACA2 3VBFC 3OEBA 3H9AA 3POWA 1XU2A 3CZUA 3ZFGA 3GDBA 4G3YC 2DYCA 5FY7A 2OA2A 3RYPA 2BWAA 3RQ0A 3K4ZA 4OHXA 4YVSB 4B1MA 2FDGA 1EPWA 2BGCA 3HBKA 2CSGA 3PVBB 4DQAA 4DXSA 1AX2A 1VBC3 3VDDC 4Q4V2 4WBBA 5J48A 4PQQA 3LEMA 2CGNA 2HEWF 3HBZA 3J7MA 3KCCA 4KGQA 4O61A 5T5OA 4JTNA 3VBUC 4EZHA 5BNPB 3MLJA 2WL1A 4NHLA 5J3UA 3ON7A 3BU0A 3WHUA 2NN8A 1VBB2 5B4NA 1LHWA 2B46X 1YJLA 3C7GA 2VZOA 3LPFA 2W5FA 2PHRA 3TBDA 3R05A 1SLIA 3RI9A 2RR13 1ENSA 1XQNA 4E4SA 4IEPA 2P34A 1VBA1 2ZEWA 3ILFA 1WLDA 1QEXA 3HVDA 3BODA 4XCBA 4CCDA 2GN3A 4AAPA 2XMLA 5C4WA 3VKFC 3ACFA 5KBFA 1VRH1 2PHFA 2YMZA 3LIGA 3TWIA 1H1IA 2ENRA 4GD4A 3TB0A 2JG9B 2QFEA 4QGMA 4Y26A 4CU9A 2X29A 1UCXA 1W0PA 3PDQA 2BVBA 1UY1A 2QVSB 3AFGA 4QQ2A 5JR7B 5KHKA 2GSYA 1CAUA 1DP0A 1MZEA 4CDUB 1MS3A 5FP9A 5FMCA 3ZFEB 2HKXA 2R16A 4P9WA 1UYPA 3AVSA 3M3IA 5FZKA 1OLMA 3SCHA 1JS9A 3RWNA 1EV12 4HONA 4CDQB 4E4ZA 3LA7A 5FZ9A 2E51A 1J58A 2HWF3 1TNRA 1ULPA 4E2GA 3N3HA 5EJ3A 2W39A 2WQ8A 4LBLA 4Y3OA 4E27A 1S0EA 4AEKA 1VBE2 1V9U3 1XYOA 1ZNPA 2QQNA 3VBOA 5F3CA 5D21A 4IEQA 1OVPA 4D6RA 1NLSA 4RR3A 5EQUA 1DDLA 4QXHA 5CAZA 1NQJA 4W4ZA 2VZ1A 5DG2A 4AVVA 4MUVA 2JXAA 2ZTNA 4NN0A 3WQ7A 1V00A 1UU6A 1HLCA 3JCIA 5A3WA 1SACA 3WW1A 3VZLA 1OOPB 5AVAA 1HRI3 3PUHA 4BQ5A 1GP5A 2NPIA 3MV01 3W5MA 1UX7A 3D5OA 4CXWA 2YV8A 4W50A 2P5BA 2C0ZA 3D0JA 2A73B 1D2SA 4GJYA 1QF3A 2Y0OA 4LULA 3SHRA 1URXA 4XUQA 3MICA 2PYTA 1I1EA 4GIQA 1C1FA 2R0HA 4QPGB 2B5HA 4LA2A 3FLRA 4WVMB 4XIKA 3IAQA 3T0AA 3ME2A 4JGYC 2XBO2 3C8XA 2IUWA 2MNGA 3TN92 1PGL2 2ERFA 2OPWA 4BK5A 4GB31 2JDZA 3ZKUA 2A71A 1A34A 4LHSA 2A6VA 3VHRA 3R4UA 4XAAA 1SLLA 2X09A 3V56A 2W87A 1TE1B 1RUI3 5LA2A 1M4WA 4ZU5A 1US3A 2UWCA 2XVLA 3FMGA 4NPRA 1LJ7A 3FL7A 1PO13 3CJXA 2EVXA 1DZRA 3I3BA 5KHIA 5CZKA 3A0KA 4DOUA 4YVWC 3ZSMA 4FTSA 2J1TA 1ODMA 3I59A 1KXGA 1S55A 2JENA 1V6KA 1NKGA 2JX9A 1FATA 1RUD2 3M8LA 3NSTA 4I3PA 1JUHA 5EJZB 4DY3A 5J7MA 1JHJA 4Y1XA 4FXKB 4PBOA 1IKQA 1S0FA 4K8RB 4FFIA 4DEQA 1W8WA 2VQ0A 2P6HA 2FCTA 1IS5A 3FUOA 4K8FA 4AGVA 3OGGA 1E5IA 2H6BA 2RS11 2WBKA 5CKQA 4XF4A 3WDYA 4ZKTB 1WD4A 4HG6B 3QLQA 5FY5A 5J98B 1W6QA 3KF3A 1RUG2 1WCUA 3VB9A 3H1MA 4H2AA 3HQRA 1PM7A 3AM2A 2DDUA 3ZYHA 3N9MA 3VD7A 1C8M1 3SXWA 1V6LA 3AKQA 3PU8A 1LGNA 3AC0A 1H9WA 4FQZA 4I30A 4JGZA 3CJIB 2F4LA 5FPUA 5FZCA 1SQ4A 3BOWA 3WNKA 4AQ6A 3N7LA 1R092 2PLV3 1W90A 4UI9L 5ISLA 4MO3M 1AR62 2DVGA 4I0AA 1RL3A 4Q0VA 1KEXA 5FP7A 3UJOA 1JI6A 1POV1 1XC6A 2MHFA 2Y6JA 5I0SA 1HRV3 2WFPA 1WCDJ 2J7MA 1CIYA 2XJTA 3HIFA 5FZBA 2B39A 2TBVA 5DUWA 2BEOA 4XW3A 5C5UA 3DECA 2UY8A 2ZGSA 1N47A 4XVHA 1MEC3 2ZJCA 4W6WA 4L9BA 4IGQA 1SDWA 4IGPA 3D82A 1AVBA 1UZWA 1FV2A 4IW3A 1PGSA 3KGLA 1G8WA 2AGSA 5A6YA 5FZHA 2HWC2 1HIXA 1H6XA 3IDAA 2Q1MA 3KZ4C 4G4FA 5DUUA 4D6QA 4XXPA 3NO8A 1O6UA 2P3YA 4G9SB 3J8F3 5SV8A 2LUWA 2QQPA 1BK0A 1NA1A 4JDMA 2WZ8A 2VW2A 1GU3A 2XJUA 1BZWA 2ZKNA 4K1YA 5IVJA 1HJGA 4Y20A 1R1A2 3EJKA 4XBNA 5DAQA 1F9KA 3USUA 1JHNA 1BHGA 1W9TA 1AR73 4UF0B 3KCXA 1JZ4A 1FX5A 1O5LA 1YFWA 2Z42A 2ZX3A 1OMIA 4AFAA 4CDXB 4UFIA 4HSJA 4ARYA 3D0SA 5BNQA 2EALA 4DIQA 4XILA 2HYXA 3CU7A 1X9TA 2HBUA 4C8DA 2E63A 2IXKA 3AP5A 3MEPA 2A3WA 1GWMA 2JB4A 3HR9A 1FYUA 3ZFFC 1ZBE2 2DUOA 4A41A 1OQDA 2XJPA 2QQMA 1WBFA 2XHNA 2WNUB 4INDA 4QDQA 5GZEA 2Y0IA 3RZZA 3T30A 4RFRB 1D7PM 3WNPA 2UYBA 2ID4A 1H1AA 4EQVA 2G1MA 2W92A 3FE5A 3WEZA 1K5JA 2FCUA 4Q1RA 3JB4C 3VKMA 1QJY2 5JI7A 1RUC2 4PLNA 1DGRA 3LOIA 1SCSA 3JQWA 3VDCA 2RJLA 4EWAA 1ULGA 1YCIA 2GC3A 2ZKLA 1REEA 1GR3A 3WOGA 4XJZA 1MR5A 3GALA 2B42B 1AJKA 2D3PA 3J26N 4ASLA 3M3CA 3VHOA 1CPMA 1ZZ9A 2J1VA 4Y22A 3WDWA 3MW2A 5F2SA 4YW7A 4CP0A 4WV8A 2WZEA 5FOBB 3L9JT 1ND3C 2FDJA 2Q1ZB 3VBRB 1YFUA 2VMFA 5T52A 1XE0A 1BLZA 4PQ9A 2Q8DA 1V6JA 1W9FA 4QPIA 2VVFA 4N53A 5JZGC 1POV0 1UOFA 3MPBA 2OZ6A 5L19A 1D0HA 1PMHX 1RINA 5FJHA 5IT6A 4CXYA 2D5FA 3LA2A 2FBEA 4DXZA 1R081 2GDFA 3OBAA 3J4UH 4YWAA 4LJHA 3THPA 4LQRA 4YVSC 1DQ2A 3E5XA 3ZXLA 5I8SA 1AR92 2R043 2VOXA 4CCKA 1GP4A 3UJQA 4BJ0A 2DV9A 4OQ9A 2I74A 4JCKA 5LRSA 2ARCA 2VW1A 3I3EA 3NNGA 3OGRA 3ALQA 4EE2A 4XFHA 3SISA 2A70A 5BNPC 1OA4A 3ILNA 3POJA 3C7OA 4QKBA 5L7OA 4LBJA 5LWBA 2RJKA 3MW4A 3PUQA 4ZXEA 4TXWA 3UETA 4QB2A 2OS2A 2WZPP 5FZAA 1N1YA 4V2VA 2G9ZA 3I2JA 3ETPA 3T2QA 4TYSA 1W6PA 3AJYA 1TME3 1RVF3 3RNSA 4AE2A 3K75B 3PVNA 5GKAC 1Q56A 4HZFA 4XBLA 2J42A 1UU4A 4YFZA 4XFCA 1VBC2 4GWIA 3MV11 5T3NA 1RJ7A 2JG9C 5HI0A 1KGYA 4AI8A 2EXJA 5FMDA 2Q8OA 3K46A 2BDRA 3N35A 1QJX1 1WMFA 3FC0A 4X8PA 1EAH3 2IFWA 3DUIA 1UW8A 5G04L 4AQ2A 2W9XA 1CZVA 4AHYA 4UFMA 1LOBA 3CNAA 4RHV3 3B5LB 4CUGA 4F7ZA 2YBKA 3WCSA 4IETA 4CDQC 2QUOA 2RR12 4UYBA 2WNVC 5FO8B 5F2WA 4Q0PA 1XJAA 3POBA 1QQP2 1KDKA 2HWE3 1W6NB 3P3PA 3NKGA 2DWRA 3NV1A 3VZJA 2WFF3 1YFYA 2YBPA 4M01A 4CCNA 3U78A 1PX3A 1XYPA 2AREA 3IDBB 4WM7C 5EIYB 1CESA 1ONAA 4Q4X2 1Q43A 3RJRA 3T1MA 4A44A 3WG2A 2WAAA 2UU8A 5JXGA 2IC1A 5FPVA 4N8MA 1UOGA 1LHVA 4ONUA 5IK5A 4R4ZA 2XL9A 4YG3A 5GZDA 4YSFA 2ZGPA 3IBMA 4OI4A 3TAYA 1W99A 3L2YA 2HWF2 2D6NA 2J1RA 1RJ8A 3NNFA 4N43A 4QQLA 4UW4A 3ZN6A 3WHTA 1GQGA 4PJYA 4FPYA 2XPJA 2QBXA 3WW2A 4ET7A 4PLOA 1QJU3 4L99A 1AJOA 2VXJA 3N7KA 5C70A 5A7OA 3ZLIA 3DPRB 1ULFA 1LECA 1KQRA 4YW1A 4MX3A 4XJ8A 2CGOA 1D4M3 5J1XA 3APBA 2C9KA 3I8TA 4Z92B 2W91A 4DS0A 5JSRA 3B69A 1COV1 1MS4A 1RUF3 4M4RA 4FP3A 5E88A 4P9JA 3H3UA 4OLLA 5I0UA 4LBQB 2FDIA 1PVC3 2DTYA 1W8UA 2VBPA 4A45A 1QXJA 5A32B 1HRI2 5FQ0B 2ZZQA 1K5MA 5I93A 5FXVA 3CKHA 3OBRA 1H8TB 3OUJA 4FOWA 3RI8A 4A6OA 2JG8A 4GWJA 4LKEA 1WW5A 1UXXX 3O1SA 4WM8B 1BQPA 1NCQA 2JDNA 3AFKA 3WV6A 5A1AA 3M3QA 5C3PA 4AVAA 3KT7A 3H42B 1RHI1 5I0DA 2A75A 3GCWA 4Q26A 4XZUG 2Z79A 3A4UA 4CEWA 4CDWA 3WF1A 2RDQA 5FO9B 3LPGA 2OQ6A 1J1LA 4FCAA 3HT1A 4JVAA 4LOTA 3ZXGA 3VL8A 5LY1A 3H8OA 2VO5A 5GZFA 3I2DA 5I0TA 1CPNA 2GC2A 2XG3A 2W52A 4AF9A 2PXJA 3KV5A 4L8QA 2FMYA 1ZZ7A 1RUI2 4PI2A 3IKWA 2JJ6A 3AJZA 2CDOA 4ZZ5A 1F15A 2DCKA 1PO12 2WT2A 2F17A 4F83A 4AEJA 4L0PA 1YI9A 1EYBA 2PHUA 3OGSA 4FPLA 3CJIC 4LHLA 5FZ4A 5T54A 4A3ZA 2VH9A 3V0AA 3PJQA 4HFSA 2VBBA 5GJ6A 3AZZA 3O1MA 1HDKA 2ZGUA 3GHMA 2YPDA 4BU2A 1OA3A 4FPHA 5K0UB 3BPSA 5FCCA 4N7IA 4P00B 4MGKE 5FLJA 4NIAA 3GGLA 3FFQA 2JWPA 2BNOA 1V9U1 3K3NA 5CFDA 2VL4A 2Y26A 5EWSA 3N9OA 4YGCA 5EJ1B 2RM21 4QM9A 2UURA 3MF6A 5CISA 4BQWA 4OQ8A 2D3RA 1S4CA 3KGZA 2R061 3OUIA 5FLIA 3MLLA 5CFCA 4LO5B 4X6QB 2D6OX 5BUVA 5L73A 4DINB 1ZZ8A 1ND2A 2JIJA 5IVYA 3HNMA 3HQUA 4MHUA 2VZUA 5GM0A 3ZPYA 1XNBA 1DGWX 2XQRA 3FLPA 3FX3A 3KWVA 1KRIA 1JYCA 3J9SA 1TMF3 1YLLA 1Z78A 1UWWA 2Q8CA 3UL2A 3SEEA 3GHNA 5F7UA 2PLV2 2X5IB 3WW4A 4YARA 1YXWA 4QGLA 4AYUA 3ENRA 3ZMNA 2NMOA 1DQ4A 2VMHA 3RZJA 1BEV3 4FPCA 3WP6A 1HRV2 4BHPA 5FYUA 2Y38A 1UIJA 5T50A 1IS4A 1S0DA 1G9FA 3WNMA 4AI2A 3VHPA 3WP5A 2CAUA 2IXHA 2ZEXA 4HN0A 1MEC2 2FD8A 1VP6A 3CHXA 1XU1A 3G6JB 3KV4A 4P02B 2Y60A 3VKLA 4LNVA 4CDXC 3TOJA 3UKVA 4AG4A 3H8XA 2ET1A 4BPZA 2WO1A 2WZR1 1OA2A 1SCRA 3OEAA 1YWKA 3CEWA 2BTVC 1J3QA 1EPZA 2WNUC 5LASA 3S7IA 1G9CA 3J8F2 2E9QA 1UYYA 2FQPA 4PBPA 2JEMA 3TEZA 4LKFA 3N9QA 4IEXA 1OKOA 1GZCA 4M3CB 5FY8A 5ABJB 5CKMA 1SPPB 3DN7A 1LOFC 1OFSA 1QOTA 4NPMA 5DAWA 1GBGA 3AP7A 1AR72 1YQ5A 3B93A 5JI9A 3U0ZA 1CIWA 2WQ4A 1OPOA 2YC2A 4FOYA 3W21A 4AVBA 3ZM8A 1IQAA 3MIDA 3P3NA 4J25A 2WABA 5F3GA 2YDEA 3HJRA 1WA6X 3AZVA 3KV6A 4FI9A 1O91A 4MZUA 3SKJE 1XPWA 4I3GA 1RMU1 3Q8BA 5LY2A 4QHOA 4YM1A 1QOOA 1VPHA 2VQUA 2YU2A 3VBRC 4E4HA 1X36A 3NAPB 4MGZE 3RPQA 1WCSA 2QQLA 4P9IA 4KG0A 1FAYA 3B02A 4GJZA 1CZTA 4ATEA 3NQHA 3KQRA 1IKPA 4DXRA 5AC91 4FTBA 1J59A 4IV3A 4D8MA 3LZZA 3BPZA 3JXSA 2ZAHA 1AX1A 3FHAA 4A4AA 4AI3A 4LKSA 5FWEA 1GOFA 2ZA9A 1JZ5A 3MF9A 3MI8A 1O59A 1OF4A 1JYWA 2BPA2 2VZPA 4YGEA 2YC0A 2WAOA 3KMHA 5LBCA 1CONA 1IS6A 5AVPA 4MGSA 1NQDA 3H8UA 2WR9A 4FFHA 1WW4A 4QKFA 3WP3A 5FTTC 2IXIA 4Q2FA 2VZSA 2XKOA 2TUNA 2WWSA 2ZS6B 2RS31 2W47A 1NZIA 3HEIA 2ETEA 2OW4A 4LHNA 5KWRA 1MQTA 2O14A 4GH4B 1PIV1 4AR2A 1G9DA 3R6SA 4C0HA 2HYKA 2LM3A 3KD4A 3IIAA 3PUAA 4E2QA 2XB6C 3SNMA 2DUQA 2VOVA 1N1TA 3UK9A 4OCTA 1YEWA 4KGGA 2R042 4LPLA 3T4HB 3VD4A 2VNGA 5CIRA 4YZ2A 4XF9A 1LKNA 3I3QA 1QGLA 4YGBA 3VBHC 3TEYA 1X8EA 4I2OA 5IYYA 4C0BA 1W39A 3OPZA 4YZ3A 5HPOA 3NRUA 2R071 5HXMA 1RUC3 5C8CB 4S2GA 4M00A 3Q8EA 1IQDC 4XUNA 4KU7A 5E89A 5D8AA 5J36A 2VMGA 1HXS3 1ST8A 1NE6A 2WC2A 4CEYB 5LEKA 2W95A 4OUEA 4LOSA 3A7QA 4ASKA 2XVGA 2MEV1 4Q0UA 4CP9B 2AACA 3ZYBA 2E32A 2ZHLA 2GNTA 1TME2 1RVF2 1UKGA 5A7NA 3WNOA 3THTA 3EQEA 5J96B 1ASJ1 1H8VA 1W3XA 2CV6A 3ZFGB 3RZLA 4DY5A 3I49A 1P8JA 3HD8B 2BGOA 4JZRA 4KU8A 4EN9B 2AZ5A 3EMRA 1ACCA 4YZ1A 3NKTA 4YFWA 2C24A 2WT0A 1O8PA 3WG3A 1EUUA 2D6MA 4S2FA 5FKBA 3WG4A 1U5YA 1DHKB 4AI0A 1EAH2 2GZWA 2VOTA 3OPWA 1ENQA 4LK6A 2D98A 2Y6GA 4MXVA 3FZ3A 1H2KA 4Q4Y3 3KCYA 4RHV2 5FZMA 4XJWA 1QJZA 4ARXA 3MIEA 3BB6A 1VAMA 4CCOA 2RS51 1RUNA 5DDJ1 1W2UA 2CHHA 2P37A 3ZYPA 3BKZA 2JDHA 2WS93 2HWE2 4TSVA 3X29B 1SBDA 5C9AC 1O3SA 4RS5A 1VRH2 3O14A 4AW7A 3DYOA 3DPRC 4HVRA 2HWD1 3CF6E 2OUJA 5C4WB 4R9CA 2XJSA 2ZEZA 4AK3A 3CO2A 1ZREA 2WN3A 1CVNA 5A1FA 4B8EA 4R9DA 1HQNA 2QDNA 4ISQA 3ZVXA 3NJYA 1BMV1 4XDOA 1PGW2 1CAUB 4Z8BA 5A3NA 5BNOA 1OBNA 3T4VA 5KR7A 2RMU3 1JMUB 2OT7A 3PMEA 3RWKX 1AL0G 1IOAA 5EPAA 3USSA 4H14A 1SEFA 1S2BA 4FFGA 4LLOA 2VCAA 4C1XA 2EXIA 2GH8A 3EYPA 2HWB2 4BZ4A 2JKXA 3RG0A 4MG2A 1H8TC 2GP3A 5FBJA 1W03A 3UGFA 1VLNA 3JD71 1QJU2 1FPN1 1AR83 1YIPA 1C5IA 3N7MA 4WM8C 1RUJ3 1SLTA 2XQXA 3LEKA 3VBOB 3U4XA 5LK5A 2FDHA 1WUVA 3T2PA 2W08A 3HMYA 1CJDA 1CX4A 1D4M2 2GN7A 2VUJA 4RR3B 1QQP3 3ZN5A 1VALA 1GSLA 1W2OA 3G7DA 3I2HA 4PIZA 3T08A 2J22A 1RUF2 3LIHA 4KWJA 1RUE2 3OY8A 3VDAA 4F8AA 4M0NA 5FUPA 3GJAA 1BBT3 1PVC2 2EAKA 3CIHA 3T09A 3KF5A 3VD3A 2KA3A 4IUGA 2LALA 4HKWA 4R9BA 1J83A 2I07B 4Q4X3 4WZFA 1STMA 4AFBA 1WA4A 1LGCA 2EICA 2W1UA 2BERA 4Q4W3 1AL22 4Q27A 4HVQA 4QX2A 5K8SA 4XC9A 4NHXA 5IHRA 5KXCA 1Y4WA 5F5QA 4GZ9A 4KWKA 3WDTA 1AF9A 4XHBA 5K0UC 3BOPA 2JD4A 2VMEA 1GANA 3ATGA 1GUIA 1I6XA 5KXEA 4GB32 2WFF1 4JKLA 3CL1A 1NCRA 2JDYA 4P9GA 4Z2AA 1GWKA 2VNOA 1EY2A 1LOGA 3IAPA 2VU9A 5ACA1 3S30A 4XCAA 1DQ0A 4QX7A 3ZXJA 3MUY1 1DFQA 1NT0A 3ZX7A 3ZN4A 4JTOA 2JDAA 2ARBA 2EIBA 1AYM3 3N7JA 4WVVA 2H0BA 4M3CE 4ZU4A 2OKXA 3BCWA 2B7YA 3ZXDA 4GKXA 2Z4FA 4Q4V1 4LHKA 1Z7S3 4HXCA 1UAIA 1O3RA 2Y6LA 5FBZA 4HOOA 2JE7A 3PNAA 3I59B 2X5IC 5FZGA 4EWDA 1VBB1 4ZU7A 1NYWA
chains in the Genus database with same CATH topology
2J1VA 2BGPA 2WZEA 3A22A 4XUTA 2VMFA 2XOMA 3LQCA 3ACIA 2W46A 1UY3A 1PMHX 2VCBA 1WKYA 1OH4A 2VZTA 3ACGA 1US2A 3OBAA 3E1F1 5LA1A 4LQRA 4PT6A 2VMCA 2J1EA 4CUCA 3HPNA 4RYDA 4BJ0A 2VR4A 3I3EA 2BBAA 3WNLA 3NNGA 3OGRA 4CU7A 5JXJA 1GMMA 2KD7A 3C7OA 2C26A 3THCA 2Y64A 3W5NA 4QDSA 4DUVA 4ZXEA 4TXWA 3UETA 4QB2A 5IFPA 1XNAA 1JZ6A 3I2JA 3ETPA 3T2QA 1JZ8A 4TTGA 4UAPA 3D3AA 3LEIA 3K75B 2B4KA 5C7GA 3GXUA 2ZEYA 1NX9A 3WF0A 2EIEA 1K3IA 4BXSV 1W8OA 4GWIA 3MV11 1KGYA 3K46A 4YPJA 4QB6A 3THDA 3WF3A 5G04L 1L7RA 2W9XA 1CZVA 3P6BA 2J1AA 1W9WA 2LW8A 2WN2A 3A21A 1UY0A 2W94A 3WNNA 5JUVA 5DPNA 1DLCA 3ABZA 3GM8A 3CMGA 1TG7A 2DCJA 1PX3A 5EIYB 1JZ3A 2YC4A 1YQ2A 4P5YA 4XUOA 3MBWA 2E26A 4KI5M 4A44A 1SG3A 2WAAA 5JXGA 5JR2A 2JE8A 1JYVA 3P1IA 5JMOA 3FHQA 1W99A 3T0BA 2J1RA 1OF3A 4CUAA 5JXIA 2VQTA 4QX0A 2QBXA 3I3DA 4ET7A 5C70A 4M4PA 2WUHA 4ZZ8A 3WF2A 4BDVB 4QPWA 5J1XA 2C9KA 2QQJA 2W91A 1W8NA 4M4RA 4A45A 2YB7A 2PQSA 2V4VA 1NAEA 4MOAA 3LEGA 2WO2A 5IFTA 3CKHA 3IB3A 4A6OA 1GOGA 4JHZA 4JKMA 4GWJA 3CDZB 1UXXX 3OGVA 4QAWA 2QQIA 4BK4A 5A1AA 5I0DA 4XZUG 3WF1A 2V5DA 2J1UA 3MO4A 3LPGA 4DUXA 2VZQA 3PUIA 2VO5A 2VM9A 2ORXA 5B4XA 1K45A 1PMJX 2CDOA 4ZZ5A 5G05L 3VDBA 2DCKA 3I2IA 3EB7A 4L0PA 1K12A 4QDRA 3BN6A 3OGSA 3HNYM 4A3ZA 2YG0A 3I2FA 4P00B 3GGLA 4DUWA 3C7EA 2VL4A 5EJ1B 2BZDA 1CZSA 2X05A 3I97A 2VCCA 3DYMA 3T2OA 2QQOA 3HNMA 3UESA 1XNTA 2VZUA 1JZ2A 5DN2A 2HLEA 1UWWA 5C71A 3SEEA 5F7UA 1UY4A 3CQOA 3HNBM 1K42A 1JYXA 3HN3A 5LA0A 2V72A 1EUTA 4P08A 2RVAA 1RYYA 2VJXA 4KMQA 3WNMA 3T0DA 2ZEXA 4A42A 1UYXA 4P02B 4MGQA 1F4HA 2VMDA 2C4XA 1GNYA 4AG4A 3C7HA 2Y6HA 3OEBA 2WDBA 3CZUA 2WO1A 3GDBA 1L7QA 2ZXQA 3OEAA 3K4ZA 3IIIA 1JZ7A 4DXSA 1UYYA 4PQQA 4RN5A 3SKVA 4E8CA 3CZJA 1O8SA 5IJRA 5B4NA 3VD5A 2YC2A 3C7GA 2VZOA 3LPFA 2W5FA 2W3JA 3ZM8A 2WABA 1WCQA 3HJRA 2ZEWA 4QX1A 4FI9A 3SKJE 1XPWA 2E33A 3K4AA 2VQUA 5DMYA 2CDPA 3ACFA 1UXZA 3WQBA 2QQLA 4CU9A 1UZ0A 1UY1A 3OB8A 1CZTA 2VZ3A 3NQHA 1OD3A 4DXRA 1DP0A 3SEPA 1SHWB 4D8MA 3K77A 3JXSA 1LNSA 3FHAA 3ECQA 4A4AA 4LKSA 1JZ5A 1GOFA 1O59A 1OF4A 1PX4A 1JYWA 2VZPA 2WAOA 4MGSA 1ULPA 2RV9A 3UNPA 2WQ8A 2VZSA 1UMHA 2QQNA 2W47A 3HEIA 4OMCA 1GQPA 4KWUA 2XONA 1T2XA 2W1SA 2LS6A 4W4ZA 2VZ1A 1ULOA 4QB1A 4OMDA 4LPLA 3VD4A 2W1QA 4OZOA 3F2ZA 3FN9A 2JD9A 3PUHA 2Y6KA 4JX0A 5IYYA 3MV01 3A23A 3W5MA 1UX7A 2VZVA 3NRUA 5HPOA 5HXMA 1HN1A 4W50A 4XUNA 1IQDC 4DXTA 4XUQA 4CU6A 2W95A 3HOBA 4OUEA 3A7QA 3NJVA 2ORZA 3T0AA 3IAQA 1GOHA 2E32A 3C8XA 4BK5A 4CVUA 4UOJA 3WNOA 4JKKA 3NJXA 4LHSA 1P8JA 2BGOA 2X09A 1UY2A 2W87A 5LA2A 1O8PA 1DYOA 1EUUA 2YFZA 1US3A 4DEVA 3FL7A 2VOTA 3I3BA 2Y6GA 5CZKA 3BGAA 3I2KA 5DQ0A 2J1TA 2J1SA 4MADA 1NKGA 1W0NA 5EJZB 4ARXA 3WF4A 1JHJA 1OT5A 4DEQA 1NUKA 4AAXA 2VC9A 2WYSA 2WBKA 3DYOA 3VD9A 4HG6B 2X10A 4W8JA 1UYZA 3WSOA 2ZEZA 1CX1A 2WN3A 4XURA 1F4AA 2DDUA 3VD7A 5LCWL 3AC0A 3LE0A 3WNKA 4ZY9A 2VCAA 3EYPA 4UI9L 2YFUA 4MO3M 2JKXA 2B9VA 1KEXA 1MPXA 1JI6A 1XC6A 2Y6JA 4D0QA 3DYPA 2J7MA 1CIYA 3DECA 2XQXA 3LEKA 4XVHA 2E31A 4E8DA 3T2PA 2VTFA 1SDDB 3MUZ1 3I2HA 3J7HA 3T08A 2J22A 4CUBA 3VDAA 1H6XA 1R64A 2EIDA 3IDAA 1JU3A 3CIHA 3T09A 3VD3A 4IUGA 1J83A 3ACHA 2EICA 2W1UA 2QQKA 2BERA 2WZ8A 5JXHA 1GU3A 1J84A 2WO3A 4QX2A 5IHRA 1BHGA 1W9TA 4GZ9A 5FUIA 2Y8KA 1JZ4A 1I5PA 4OYUA 2VMEA 4ARYA 1GUIA 2VZRA 3I2GA 4JKLA 2HYXA 4Z2AA 3IAPA 4A41A 2QQMA 2XHNA 4QDQA 2L9LA 3MUY1 4QX3A 1D7PM 2W1WA 3K4DA 1H6YA 2ID4A 3WNPA 3OG2A 2W92A 3WEZA 5CYYA 2JDAA 2EIBA 4CU8A 1TVGA 1W9SA 2OKXA 1UMIA 3C7FA 2Z4FA 4XUPA 2RJ2A 1JYNA 2R7EB 3U37A 1JU4A 2Y6LA 3VDCA 4PF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J1V A;  2BGP A;  2WZE A;  3A22 A;  4XUT A;  2VMF A;  2XOM A;  3LQC A;  3ACI A;  2W46 A;  1UY3 A;  1PMH X;  2VCB A;  1WKY A;  1OH4 A;  2VZT A;  3ACG A;  1US2 A;  3OBA A;  3E1F 1;  5LA1 A;  4LQR A;  4PT6 A;  2VMC A;  2J1E A;  4CUC A;  3HPN A;  4RYD A;  4BJ0 A;  2VR4 A;  3I3E A;  2BBA A;  3WNL A;  3NNG A;  3OGR A;  4CU7 A;  5JXJ A;  1GMM A;  2KD7 A;  3C7O A;  2C26 A;  3THC A;  2Y64 A;  3W5N A;  4QDS A;  4DUV A;  4ZXE A;  4TXW A;  3UET A;  4QB2 A;  5IFP A;  1XNA A;  1JZ6 A;  3I2J A;  3ETP A;  3T2Q A;  1JZ8 A;  4TTG A;  4UAP A;  3D3A A;  3LEI A;  3K75 B;  2B4K A;  5C7G A;  3GXU A;  2ZEY A;  1NX9 A;  3WF0 A;  2EIE A;  1K3I A;  4BXS V;  1W8O A;  4GWI A;  3MV1 1;  1KGY A;  3K46 A;  4YPJ A;  4QB6 A;  3THD A;  3WF3 A;  5G04 L;  1L7R A;  2W9X A;  1CZV A;  3P6B A;  2J1A A;  1W9W A;  2LW8 A;  2WN2 A;  3A21 A;  1UY0 A;  2W94 A;  3WNN A;  5JUV A;  5DPN A;  1DLC A;  3ABZ A;  3GM8 A;  3CMG A;  1TG7 A;  2DCJ A;  1PX3 A;  5EIY B;  1JZ3 A;  2YC4 A;  1YQ2 A;  4P5Y A;  4XUO A;  3MBW A;  2E26 A;  4KI5 M;  4A44 A;  1SG3 A;  2WAA A;  5JXG A;  5JR2 A;  2JE8 A;  1JYV A;  3P1I A;  5JMO A;  3FHQ A;  1W99 A;  3T0B A;  2J1R A;  1OF3 A;  4CUA A;  5JXI A;  2VQT A;  4QX0 A;  2QBX A;  3I3D A;  4ET7 A;  5C70 A;  4M4P A;  2WUH A;  4ZZ8 A;  3WF2 A;  4BDV B;  4QPW A;  5J1X A;  2C9K A;  2QQJ A;  2W91 A;  1W8N A;  4M4R A;  4A45 A;  2YB7 A;  2PQS A;  2V4V A;  1NAE A;  4MOA A;  3LEG A;  2WO2 A;  5IFT A;  3CKH A;  3IB3 A;  4A6O A;  1GOG A;  4JHZ A;  4JKM A;  4GWJ A;  3CDZ B;  1UXX X;  3OGV A;  4QAW A;  2QQI A;  4BK4 A;  5A1A A;  5I0D A;  4XZU G;  3WF1 A;  2V5D A;  2J1U A;  3MO4 A;  3LPG A;  4DUX A;  2VZQ A;  3PUI A;  2VO5 A;  2VM9 A;  2ORX A;  5B4X A;  1K45 A;  1PMJ X;  2CDO A;  4ZZ5 A;  5G05 L;  3VDB A;  2DCK A;  3I2I A;  3EB7 A;  4L0P A;  1K12 A;  4QDR A;  3BN6 A;  3OGS A;  3HNY M;  4A3Z A;  2YG0 A;  3I2F A;  4P00 B;  3GGL A;  4DUW A;  3C7E A;  2VL4 A;  5EJ1 B;  2BZD A;  1CZS A;  2X05 A;  3I97 A;  2VCC A;  3DYM A;  3T2O A;  2QQO A;  3HNM A;  3UES A;  1XNT A;  2VZU A;  1JZ2 A;  5DN2 A;  2HLE A;  1UWW A;  5C71 A;  3SEE A;  5F7U A;  1UY4 A;  3CQO A;  3HNB M;  1K42 A;  1JYX A;  3HN3 A;  5LA0 A;  2V72 A;  1EUT A;  4P08 A;  2RVA A;  1RYY A;  2VJX A;  4KMQ A;  3WNM A;  3T0D A;  2ZEX A;  4A42 A;  1UYX A;  4P02 B;  4MGQ A;  1F4H A;  2VMD A;  2C4X A;  1GNY A;  4AG4 A;  3C7H A;  2Y6H A;  3OEB A;  2WDB A;  3CZU A;  2WO1 A;  3GDB A;  1L7Q A;  2ZXQ A;  3OEA A;  3K4Z A;  3III A;  1JZ7 A;  4DXS A;  1UYY A;  4PQQ A;  4RN5 A;  3SKV A;  4E8C A;  3CZJ A;  1O8S A;  5IJR A;  5B4N A;  3VD5 A;  2YC2 A;  3C7G A;  2VZO A;  3LPF A;  2W5F A;  2W3J A;  3ZM8 A;  2WAB A;  1WCQ A;  3HJR A;  2ZEW A;  4QX1 A;  4FI9 A;  3SKJ E;  1XPW A;  2E33 A;  3K4A A;  2VQU A;  5DMY A;  2CDP A;  3ACF A;  1UXZ A;  3WQB A;  2QQL A;  4CU9 A;  1UZ0 A;  1UY1 A;  3OB8 A;  1CZT A;  2VZ3 A;  3NQH A;  1OD3 A;  4DXR A;  1DP0 A;  3SEP A;  1SHW B;  4D8M A;  3K77 A;  3JXS A;  1LNS A;  3FHA A;  3ECQ A;  4A4A A;  4LKS A;  1JZ5 A;  1GOF A;  1O59 A;  1OF4 A;  1PX4 A;  1JYW A;  2VZP A;  2WAO A;  4MGS A;  1ULP A;  2RV9 A;  3UNP A;  2WQ8 A;  2VZS A;  1UMH A;  2QQN A;  2W47 A;  3HEI A;  4OMC A;  1GQP A;  4KWU A;  2XON A;  1T2X A;  2W1S A;  2LS6 A;  4W4Z A;  2VZ1 A;  1ULO A;  4QB1 A;  4OMD A;  4LPL A;  3VD4 A;  2W1Q A;  4OZO A;  3F2Z A;  3FN9 A;  2JD9 A;  3PUH A;  2Y6K A;  4JX0 A;  5IYY A;  3MV0 1;  3A23 A;  3W5M A;  1UX7 A;  2VZV A;  3NRU A;  5HPO A;  5HXM A;  1HN1 A;  4W50 A;  4XUN A;  1IQD C;  4DXT A;  4XUQ A;  4CU6 A;  2W95 A;  3HOB A;  4OUE A;  3A7Q A;  3NJV A;  2ORZ A;  3T0A A;  3IAQ A;  1GOH A;  2E32 A;  3C8X A;  4BK5 A;  4CVU A;  4UOJ A;  3WNO A;  4JKK A;  3NJX A;  4LHS A;  1P8J A;  2BGO A;  2X09 A;  1UY2 A;  2W87 A;  5LA2 A;  1O8P A;  1DYO A;  1EUU A;  2YFZ A;  1US3 A;  4DEV A;  3FL7 A;  2VOT A;  3I3B A;  2Y6G A;  5CZK A;  3BGA A;  3I2K A;  5DQ0 A;  2J1T A;  2J1S A;  4MAD A;  1NKG A;  1W0N A;  5EJZ B;  4ARX A;  3WF4 A;  1JHJ A;  1OT5 A;  4DEQ A;  1NUK A;  4AAX A;  2VC9 A;  2WYS A;  2WBK A;  3DYO A;  3VD9 A;  4HG6 B;  2X10 A;  4W8J A;  1UYZ A;  3WSO A;  2ZEZ A;  1CX1 A;  2WN3 A;  4XUR A;  1F4A A;  2DDU A;  3VD7 A;  5LCW L;  3AC0 A;  3LE0 A;  3WNK A;  4ZY9 A;  2VCA A;  3EYP A;  4UI9 L;  2YFU A;  4MO3 M;  2JKX A;  2B9V A;  1KEX A;  1MPX A;  1JI6 A;  1XC6 A;  2Y6J A;  4D0Q A;  3DYP A;  2J7M A;  1CIY A;  3DEC A;  2XQX A;  3LEK A;  4XVH A;  2E31 A;  4E8D A;  3T2P A;  2VTF A;  1SDD B;  3MUZ 1;  3I2H A;  3J7H A;  3T08 A;  2J22 A;  4CUB A;  3VDA A;  1H6X A;  1R64 A;  2EID A;  3IDA A;  1JU3 A;  3CIH A;  3T09 A;  3VD3 A;  4IUG A;  1J83 A;  3ACH A;  2EIC A;  2W1U A;  2QQK A;  2BER A;  2WZ8 A;  5JXH A;  1GU3 A;  1J84 A;  2WO3 A;  4QX2 A;  5IHR A;  1BHG A;  1W9T A;  4GZ9 A;  5FUI A;  2Y8K A;  1JZ4 A;  1I5P A;  4OYU A;  2VME A;  4ARY A;  1GUI A;  2VZR A;  3I2G A;  4JKL A;  2HYX A;  4Z2A A;  3IAP A;  4A41 A;  2QQM A;  2XHN A;  4QDQ A;  2L9L A;  3MUY 1;  4QX3 A;  1D7P M;  2W1W A;  3K4D A;  1H6Y A;  2ID4 A;  3WNP A;  3OG2 A;  2W92 A;  3WEZ A;  5CYY A;  2JDA A;  2EIB A;  4CU8 A;  1TVG A;  1W9S A;  2OKX A;  1UMI A;  3C7F A;  2Z4F A;  4XUP A;  2RJ2 A;  1JYN A;  2R7E B;  3U37 A;  1JU4 A;  2Y6L A;  3VDC A;  4PF1 A; 
#chains in the Genus database with same CATH topology
 2PHL A;  2PAE A;  3INA A;  1AYN 3;  3AKT A;  4DFS A;  5M0T A;  2GC1 A;  5H9R A;  2GU9 A;  3AMQ A;  1V6M A;  3A22 A;  4KL1 A;  2PHD A;  4Y5T A;  4A3X A;  5A3P A;  5JOX A;  1W9Y A;  2D7F A;  4OI0 A;  3UYJ A;  1W8H A;  2QTW B;  1SMV A;  1XNK A;  1W6Q B;  1FOD 3;  2VCB A;  4GXL A;  1Q8P A;  5HV0 A;  2VZT A;  1O4Y A;  3ZIX A;  2ZGT A;  3AZW A;  3E1F 1;  5LA1 A;  4X6R B;  2VGD A;  2E53 A;  2VMC A;  1TMF 2;  3JBG 3;  4JGZ B;  1UZZ A;  2W68 A;  3O0X A;  3ILR A;  3L2H A;  2VY0 A;  3AKP A;  3ZOI A;  4XMA A;  3LSD A;  4XIO A;  4CU7 A;  5IVE A;  1BEV 2;  1EV1 1;  4LUM A;  5ABJ C;  4CCE A;  1GMM A;  3PHM A;  3GZE A;  2EXK A;  4Y24 A;  1NLR A;  4MET A;  4QDS A;  5LAT A;  2O8O A;  2ZAC A;  3C3V A;  3PIJ A;  4AZZ A;  1W05 A;  1XNA A;  3V0B A;  1OUS A;  2VVD A;  2XLA A;  4GMP 3;  2DU1 A;  4WM7 A;  2D44 A;  1VBE 1;  5CB7 A;  3S0M A;  3NV4 A;  2CGP A;  1AXY A;  5H9P A;  3LEI A;  4RQP A;  2F4P A;  5C7G A;  5LEJ A;  4JC1 A;  4B1L A;  1GZW A;  5HV4 A;  3WF0 A;  1DGL A;  3NAP C;  3UKT A;  3PTY A;  1W8O A;  2DCZ A;  2YRO A;  4BXS V;  4ORF A;  1ZBA 3;  2GNM A;  3ZXA C;  4Y4R A;  4A6S A;  4D3W A;  1KFX L;  2DCY A;  5LW9 A;  5F9T A;  1KD7 A;  1O5U A;  2BV4 A;  3OYW A;  4QB6 A;  4SBV A;  2RDN A;  4UBH A;  1NA1 B;  2QKD A;  2ZBJ A;  5FZF A;  3ST7 A;  3P6B A;  1HB3 A;  1QY4 A;  4Y20 B;  2J1A A;  3USU B;  1W9W A;  2LW8 A;  2XVK A;  3DXU A;  1UMZ A;  3Q8F A;  3PJY A;  4PDW C;  5GZG A;  4QT6 A;  2K9Z A;  4YW2 A;  5HCH A;  1S1A A;  2W94 A;  3E97 A;  3MIH A;  2WSU A;  3WNN A;  3TEW A;  2G9G A;  5FP8 A;  4QM8 A;  3H1Y A;  1X50 A;  3ZKY A;  1X9P A;  1DLC A;  2XBO 1;  1JOJ A;  3ABZ A;  4L11 A;  3TN9 1;  1DYP A;  1VBD 3;  3AMH A;  1KFU L;  3FWE A;  3GM8 A;  4GKY A;  1VMJ A;  4GH4 C;  2Y6F A;  3BI3 A;  2BYV E;  3PTR B;  1NY7 2;  1OLQ A;  1JZ3 A;  1W04 A;  2YC4 A;  4P5Y A;  4QMA A;  4XUO A;  5FYS A;  2ATF A;  3MBW A;  3BU7 A;  1B35 A;  4COU A;  5F32 A;  5FUN A;  1UX6 A;  5C3S A;  4IEV A;  1DQ1 A;  3N9L A;  4CTE A;  4BIS A;  3LGR A;  1IPK A;  2ZX0 A;  4WVW A;  4Q8L A;  5DUX A;  1RUH 3;  1ZM1 A;  4X8N A;  2YGM A;  5JMO A;  4ES8 A;  5JXI A;  1OF3 A;  5AFB A;  2GME A;  1RUD 1;  4QX0 A;  5FYV A;  5C8C C;  1PO2 3;  4Y22 B;  4CEY C;  4XET A;  4M4P A;  1APN A;  5KXD A;  2B9U A;  4QPI B;  4YW4 A;  4N53 B;  2CWM A;  3ZYI B;  2VCM A;  4XZP A;  5K7P A;  5F3E A;  4E9K A;  3B7M A;  1PK6 A;  1RUG 1;  5L9R A;  2XXZ A;  3ZFG C;  1V6O A;  4COW A;  5I91 A;  4CCJ A;  2RDS A;  2EAA A;  2QZ3 A;  1YQ8 A;  1OLM E;  2V4V A;  1NAE A;  1RED A;  2WII B;  1VJ2 A;  4YRD A;  1WME A;  1YFX A;  4YM3 A;  1OVS A;  4NAM A;  1GOG A;  3MLK A;  1LU1 A;  1R09 1;  2D40 A;  2R32 A;  4O9G A;  2YUE A;  1IPS A;  3AK0 A;  1HXS 2;  4Y1Y A;  5L7O B;  1AR6 1;  1J1T A;  1S0I A;  1LHO A;  4QAW A;  1W8F A;  2HBT A;  2Q0A A;  2SBA A;  3RZK A;  3HWJ A;  4OZX A;  3KS7 A;  4ZS2 A;  1NZC A;  1DQ6 A;  4LE3 A;  1GNZ A;  4NPL A;  5E1R A;  4AI1 A;  5JPM B;  5A7P A;  4FOV A;  4FQ4 A;  2CU5 A;  4DUX A;  1ZX5 A;  2ZGR A;  2VZQ A;  1W6P B;  2ZGO A;  1QKQ A;  3PIG A;  3JUU A;  1H4H A;  5B4X A;  2UWB A;  1K45 A;  5C4W C;  2G9F A;  2UY9 A;  2HWC 1;  4LBM A;  4CPB D;  5G05 L;  3ZIW A;  1QNY A;  1OPM A;  1SFY A;  1VB4 A;  2ZMN A;  5FFO C;  3EB7 A;  4CE8 A;  3OCP A;  1K12 A;  2YPJ A;  1R1Z A;  5GLW A;  3WIN E;  2IZW A;  4Q4Y 2;  1Q8O A;  4LBK A;  1WW7 A;  3UKN A;  3J7L A;  5KHG A;  3KHC A;  1RB8 G;  5JLV A;  3ETQ A;  5HBA A;  4LIT A;  1R1A 1;  3I2F A;  1SFP A;  3ZSJ A;  3LKJ A;  5AFE A;  4LTA A;  2WS9 2;  5FPB A;  3H0O A;  5FPA A;  1ZRC A;  1OSG A;  1FMD 3;  5GLZ A;  1YUD A;  3A0N A;  1JYI A;  3O7O A;  3LF7 A;  3K48 A;  1TNF A;  2WKK A;  4FPE A;  2VPV A;  1OH3 A;  2VCC A;  1S0B A;  3R4S A;  2D43 A;  4MHR A;  2P3J A;  4RR3 C;  2WIN B;  1ZBE 1;  4DZG A;  3AB0 A;  2K0G A;  1JZ2 A;  2YHJ A;  3U14 A;  2RMU 2;  5JWP A;  2ZHN A;  1GP6 A;  4FT8 A;  4FAG A;  4DMI A;  2ARX A;  3DV8 A;  2HLE A;  4L2N A;  1QJY 1;  4BMB A;  2JKB A;  4FPO B;  1XYN A;  2JIC A;  3CQO A;  2QCS B;  5F5A A;  1HN0 A;  4LEJ A;  4CDU C;  1JYX A;  3HN3 A;  3ZFE C;  5LA0 A;  5C8W A;  3QCW A;  3DCQ A;  2PAM A;  5C5T A;  1EUT A;  4N43 B;  3QH6 A;  1AR8 2;  3ZN6 B;  4AED A;  3K51 A;  5GZC A;  1RUJ 2;  4A42 A;  4V1P A;  2XHK A;  1VBA 3;  4XYX A;  5BNN A;  2XGX A;  3U75 A;  2C4X A;  4UFJ A;  3UT0 A;  1G9B A;  2V4A A;  2AEZ A;  4COZ A;  2WDB A;  4YW3 A;  1OUR A;  3ZO0 B;  4ERO A;  5E6H A;  1VRH 3;  1BBT 2;  2ZXQ A;  5DG1 A;  3VZK A;  4XOG A;  5DAP A;  3I2O A;  3III A;  2WJS A;  2DVD A;  4K20 A;  2Z5W A;  3RVH A;  4AHX A;  3VBS A;  4Y1U A;  5DAV A;  2OZJ A;  4RN5 A;  1AR9 1;  4AFD A;  4E8C A;  5A3L A;  4ZON A;  1K5M B;  3O1R A;  1H2L A;  4Q4W 2;  1EP0 A;  3CZJ A;  4LBQ D;  4XMI A;  2JG8 B;  2Y34 A;  2WNE A;  3BTX A;  5A1L A;  1OOP C;  4FOQ A;  4AVT A;  3Q8A A;  4PF5 A;  1UF2 C;  4BOW A;  1NCQ B;  3AMN A;  3I7D A;  2HWB 3;  4WVZ A;  1AZD A;  2RG4 A;  4MXW A;  4YLZ A;  4BQY A;  4GQ7 A;  1WCQ A;  5C3O A;  4CEW B;  1Q5O A;  4CDW B;  3PU3 A;  1UU5 A;  2VTX J;  2E33 A;  4NIH A;  1V0A A;  4Y1V A;  4EYU A;  4QPG C;  5LZ6 A;  1XSR A;  2BFU S;  4LO4 B;  3IPV A;  4NWV A;  1HKD A;  3AYE A;  3GCX A;  4O7X A;  4QQP A;  4FBF A;  5J37 A;  2BBV A;  1O4T A;  4QWN A;  1AYM 2;  4LXL A;  1ULE A;  3ZSE A;  4UW3 A;  1E57 A;  1VBC 1;  4QKN A;  3SEP A;  1RUE 3;  3T3Y A;  3K77 A;  1F5J A;  1Z7S 2;  4HPK A;  3ECQ A;  4JGZ C;  3W58 A;  2YXS A;  4L92 A;  3ZYF A;  3V0A B;  5A3U A;  1VIW B;  2YBS A;  1FT9 A;  1AHS A;  1D0G A;  1POQ A;  2GP5 A;  3QH7 A;  4LE4 A;  4HKO A;  2ZOE B;  5FP3 A;  2E7T A;  2RDR A;  3PVE A;  3VLB B;  4CXX A;  5A6Q A;  1CWP A;  1LEN A;  4FPJ A;  2NLR A;  1AYN 2;  2RV9 A;  1AL2 3;  3GBW A;  5E8A A;  3M1H A;  4BQX A;  2PHT A;  4HN1 A;  2RR1 1;  5CFD B;  3UNP A;  5JMC A;  4SLI A;  2O0O A;  5IK8 A;  4BIO A;  1VAK A;  1QQP 1;  1U5Z A;  4HSL A;  4JQT A;  1GQP A;  2NMN A;  4M0H A;  4QPY A;  3ZXE A;  2WWJ A;  4RD7 A;  2XON A;  5CFC B;  1FOD 2;  4GB3 3;  2LS6 A;  4XXA A;  4YZ4 A;  4IV1 A;  4C90 A;  1S0C A;  4QB1 A;  4XFA A;  1ND2 B;  3LDB A;  4JV4 A;  1OQ1 A;  1PVX A;  2D6K A;  4U36 A;  3JBG 2;  2BUK A;  4FPF A;  4Q4X 1;  4M3C F;  1QH7 A;  2FCV A;  3ZDS A;  1HJF A;  2W1Q A;  4YW6 A;  3F2Z A;  2VUC A;  5FY1 A;  3VZO A;  1LCL A;  1CJP A;  2Y6K A;  4JX0 A;  2LRP A;  3A23 A;  3VGI A;  1WLC A;  5IVF A;  1QXP A;  4XF0 A;  3K2O A;  1NA1 C;  4LUK A;  5DZF A;  3U11 A;  1REF A;  5C9A A;  2HWF 1;  4DXT A;  1ULD A;  1GQH A;  5C3R A;  4K9S A;  4CU6 A;  1ZRD A;  3HOB A;  2ET7 A;  1JTZ X;  3URF A;  2DVF A;  3VBF A;  1XE7 A;  1M06 G;  2XJV A;  2RS1 3;  2BW8 A;  5HCF A;  4EJR A;  4MLO A;  4CVU A;  1E5S A;  2BU9 A;  1S0J A;  2OX0 A;  5CKN A;  4HT1 T;  2FDF A;  1FNZ A;  4JKK A;  3LOB A;  1X33 A;  3VKO A;  4AVS A;  3H8R A;  4YG0 A;  3ES1 A;  1UKR A;  4COY A;  3VDD A;  1GNH A;  4IE6 A;  1C8M 3;  1ZBA 2;  1DYO A;  2YFZ A;  2JDK A;  1XE8 A;  2WWU A;  3VBU A;  1W2N A;  3MYX A;  2NYY A;  1DZQ A;  4OHY A;  4IE0 A;  1RUO A;  1HRI 1;  4UBG A;  2RHP A;  3PUS A;  3SH4 A;  3I2K A;  1ZZ6 A;  3E5U A;  1FI2 A;  5FZ6 A;  3H3Z A;  2VUL A;  4ISR A;  4JQR A;  4DNY A;  1XND A;  1WMX A;  1IS3 A;  2ZAA A;  3LDK A;  3QOP A;  5DZG A;  1POV 3;  4JRA A;  2ZHK A;  3MIB A;  2F6B A;  4J1W A;  1Y3T A;  2V73 A;  1DLL A;  5LBF A;  1OT5 A;  5JAX A;  4H55 A;  4AAX A;  1E5R A;  2WYS A;  2GNB A;  1W06 A;  4QKD A;  2GMP A;  3VD9 A;  1UQX A;  1RGS A;  1VBD 2;  5HXV A;  4KBB A;  1DBN A;  3DKQ A;  1G86 A;  2Q1F A;  3IMM A;  3WSO A;  4QXC A;  4QPI C;  2FDK A;  4N53 C;  5FK7 A;  1F4A A;  1LES A;  4QGN A;  2P4E A;  1RUI 1;  5LCW L;  1UOB A;  3GZU C;  4K40 A;  4IV3 B;  2IFR A;  1PO1 1;  2VAU A;  2EA7 A;  3LE0 A;  3RGB A;  4MGT A;  1CAX A;  2P3K A;  5FP4 A;  1RUH 2;  4LIV A;  1NE4 A;  3H7Y A;  1W6O A;  2VQA A;  5IAT A;  4Z82 A;  5BPX A;  3KT4 A;  2B9V A;  4LMF A;  3KQ4 B;  1OD5 A;  2XWJ B;  1PO2 2;  5CNA A;  3ZMO A;  3ZPO A;  4D0Q A;  1ZRF A;  3DYP A;  2ILM A;  5L7O C;  1CAV A;  2DVA A;  1IHM A;  2FZ1 A;  4I09 A;  1HB1 A;  4E8D A;  4NMI A;  5GAL A;  2D93 A;  4H7L A;  3V65 A;  1MQT B;  4L97 A;  4EZ4 A;  1QHD A;  2VTF A;  1HX6 A;  3B3Q E;  5FZE A;  3MUZ 1;  5DUV A;  3J7H A;  4LR4 A;  5FYB A;  4CUB A;  1HV0 A;  4OVE A;  4QX5 A;  4DRV A;  1U12 A;  2TEP A;  3ACL A;  2EIG A;  5J09 A;  1JU3 A;  3SMH A;  2A6Y A;  4IL7 A;  1RC6 A;  3M3O A;  3SQO A;  5FPZ A;  1YQ6 A;  1GV9 A;  3ACH A;  4NID A;  2OII A;  1E5H A;  4EN6 B;  2XDV A;  3BVC A;  3AYA A;  4B3N A;  2VUA A;  2D6P A;  4H7M A;  3MW3 A;  3S57 A;  2VVE A;  5JXH A;  2PLV 1;  4K3U A;  1CAW B;  1J84 A;  3RS6 A;  2WA3 A;  1YNA A;  4GWN A;  3SCG A;  1KS4 A;  5E16 A;  5D8A B;  1F8V A;  5A33 A;  5FUI A;  5FAX A;  1HRV 1;  1F35 A;  2JDU A;  4JGY A;  4WZC A;  1G9A A;  2VZR A;  4HAN A;  3C2U A;  1MEC 1;  4W6X A;  4UW6 A;  3F95 A;  2PN5 A;  1C5H A;  1MAC A;  4EWE A;  1Y9Q A;  2OYZ A;  2VNV A;  1DZT A;  3ZYJ B;  5FMB A;  5IK7 A;  5F6L B;  1R08 3;  3LCP A;  1H6Y A;  5A7W A;  3SC7 X;  3OG2 A;  1JXN A;  1VR3 A;  5CYY A;  5FXW A;  3NJZ A;  1ZRI A;  2OPK A;  3J8F 1;  4YVW A;  1PZ9 A;  4XUP A;  2RJ2 A;  2B45 X;  3U37 A;  4N7U A;  4ZS3 A;  3I4I A;  4CP1 A;  1JU4 A;  1WZX A;  2P1B A;  2YGL A;  3VZN A;  2GND A;  5BXX A;  1CAW A;  1AR7 1;  1QWR A;  5FYY A;  5FXZ A;  5L9B A;  1FMD 2;  2VW0 A;  4B4R A;  1LAJ A;  3KV9 A;  4RS5 B;  3T1L A;  1IG0 A;  2JIG A;  1J3R A;  4UXA A;  5C6C A;  4R4X A;  3WP4 A;  1ZZC A;  3ACI A;  2EXH A;  1UY3 A;  4RA0 A;  1B09 A;  2HH9 A;  4GMP 0;  4KH9 A;  3AL6 A;  2ES3 A;  4FPG A;  2IWG B;  3ACG A;  3O0V A;  3S5Q A;  4D94 A;  3FBM A;  4NE9 A;  3TNQ A;  3W20 A;  3KT1 A;  2P17 A;  3O12 A;  2DFC A;  3DKW A;  2P3I A;  3KSC A;  5FZO A;  5BNO B;  2D3S A;  4Q29 A;  1XNC A;  4CUC A;  4RYD A;  1SLA A;  2IXL A;  2K46 A;  2VR4 A;  1QJX 3;  3FHI B;  1V70 A;  3VKN A;  4A7Y A;  1RXG A;  3BAL A;  4KNC A;  5FY9 A;  3WNL A;  1OXC A;  2WQZ C;  4FVV A;  3RRD A;  4DPN A;  2KD7 A;  2JG8 C;  4RSU A;  3THC A;  4NWW A;  3ZYG A;  1H9P A;  1VB2 A;  2Q4S A;  3WDU A;  3EXU A;  1NXD 1;  2AEY A;  4BE3 A;  2WT1 A;  3NVC A;  2NP0 A;  1VBA 2;  5IFP A;  1NCQ C;  4QXK A;  4P9L A;  4TTG A;  3OSD A;  4YNI A;  4DB5 A;  5A6X A;  1ZYB A;  4CEW C;  4CDW C;  2TNF A;  4MV2 A;  3D3A A;  2IVI B;  1Z0H A;  2C1F A;  3GXU A;  5FMO S;  3WVJ A;  2ZEY A;  1NX9 A;  2AR6 A;  3OY8 B;  2EIE A;  4CCC A;  1K3I A;  2PHW A;  4YW5 A;  4XAC A;  2XR4 A;  3B94 A;  2G19 A;  2R04 1;  4IGO A;  5FKC A;  5ERL A;  1VMH A;  5FRE A;  3JB8 A;  4B7K A;  4YZ5 A;  4RFT 0;  3AXE A;  3THD A;  2ZAB A;  5F5I A;  3WF3 A;  3SIT A;  1UPI A;  3AKS A;  3MDP A;  3O1P A;  4Q0S A;  4A2U A;  4O9E A;  4UWD A;  1YI7 A;  4XTP A;  1BKZ A;  2WN2 A;  3O1O A;  5JOY A;  5FZ1 A;  2Z69 A;  1UY0 A;  1W3V A;  3BUC A;  4XDQ A;  3BTZ A;  4NUB A;  5FRA A;  5JUV A;  2FMD A;  2JE9 A;  3CBN A;  1AUY A;  5CFD C;  3JZV A;  1NCR B;  3ZFF A;  1DCS A;  1TME 1;  1RVF 1;  2ADD A;  2LTN A;  3IMN A;  4LOR A;  1TG7 A;  4IEZ A;  5JDB A;  2BQP A;  3H3L A;  4EV0 A;  5CFC C;  2C9A A;  3ELN A;  1YRZ A;  4V2W A;  1COV 3;  1QJF A;  1W6M A;  2E26 A;  2DF7 A;  1SG3 A;  2IXC A;  1ND2 C;  2R30 A;  2VXR A;  4S2H A;  4YG6 A;  3KB5 A;  5FYC A;  3LFI A;  1N3Q A;  3RDI A;  5JR2 A;  1EAH 1;  1F2N A;  2BRT A;  4QX8 A;  3P1I A;  3AP4 A;  5BV6 A;  3FHQ A;  4RHV 1;  1SLB A;  3D4K A;  4QHZ A;  5FYZ A;  5H9S A;  4OUS A;  3DL3 A;  4U2A A;  1C8N A;  1ND3 A;  1RHI 3;  2A6W A;  2P2K A;  1JN2 P;  1V6N A;  3LD8 A;  2AEN A;  2HWE 1;  2ZCW A;  2JB8 A;  5JZG A;  4I0W B;  3WLU A;  2WUH A;  2N7G A;  4AVC A;  1IZ3 A;  1Q8S A;  4QPW A;  3QBQ A;  2PQQ A;  1MVE A;  4IEY A;  4LT5 A;  2QQJ A;  3GF6 A;  4YVS A;  2R6Q A;  5F8P A;  4KG8 A;  5IAX A;  2PEL A;  4B7E A;  4F3J A;  4HK9 A;  4CSW A;  1U0A A;  5JIA A;  2ZGL A;  3POI A;  4GAL A;  3SCF A;  1PGW 1;  2PQS A;  4MOA A;  4FPK A;  3VL9 A;  2WO2 A;  5IFT A;  2OUH A;  3AMP A;  3IB3 A;  5BNP A;  2WNV B;  4JKM A;  1LOE A;  3AMM A;  5IAV A;  3E5Q A;  2HWB 1;  1MVQ A;  3U4S A;  1A78 A;  3GNE A;  4QU2 A;  2OQ7 A;  1HQL A;  5L36 A;  1A8M A;  2AH2 A;  3GZA A;  3QD6 A;  1QJU 1;  3IZO A;  4LBO A;  4N9I A;  4Y33 A;  3ROU A;  2RM2 3;  5T5L A;  4CP2 A;  2RS1 2;  3V0B B;  4NRQ A;  2J1U A;  1WW6 A;  4WM7 B;  3MO4 A;  2XUM A;  1N1S A;  4EN8 B;  2R06 3;  3AKR A;  1F31 A;  3WT3 A;  3PUI A;  2WO7 A;  3HQX A;  1D4M 1;  4RQP B;  5DZE A;  4IEO A;  2ORX A;  1QNW A;  2JG9 A;  5IWF A;  4OUM A;  1C8M 2;  1GZW B;  1PMJ X;  1PZ7 A;  1RUF 1;  1RUE 1;  1GWL A;  4LK7 A;  3VDB A;  1PVC 1;  1OQE A;  4J1X A;  4CDU A;  5IK4 A;  3I2I A;  2XWB B;  1PMI A;  3ZFE A;  5EP9 A;  4QDR A;  3BN6 A;  3NWK A;  2XKP A;  3OYW B;  1HB4 A;  4IV3 C;  1QXR A;  2QQU A;  1C57 A;  1MS9 A;  1W8T A;  2V5Y A;  2XUE A;  1D4V B;  4CDQ A;  2YG0 A;  4H3W A;  4XDP A;  1AL2 1;  2WNV A;  4D7S A;  3BYW A;  3GBF A;  5EXO A;  4DUW A;  2A5Z A;  4OI1 A;  5FK8 A;  2BZD A;  1MS0 A;  1Q3E A;  3FLT A;  5JSO A;  3I54 A;  1PNG A;  1UZV A;  2X05 A;  1W28 A;  4XQ4 A;  5C33 A;  3PMS A;  4B29 A;  4B4P A;  1AX0 A;  2XJQ A;  2WZR 3;  1MQT C;  4P9Y A;  2VMI A;  3R4D B;  5DAB A;  3MZH A;  2D97 A;  2G4I A;  2QQO A;  1N3P A;  4QQO A;  1XNT A;  2CTV A;  5D1I A;  1B35 B;  5CU1 A;  1UIK A;  5FPX A;  3IT8 A;  5LK7 B;  1UL9 A;  1VMF A;  2I45 A;  3KLS A;  1OOP A;  1UN1 A;  2DBI A;  3MGU A;  3NW4 A;  5DN2 A;  4TLG A;  4TZD A;  1UY4 A;  3HNB M;  2K2S A;  4Y4Y A;  5FJK A;  4IXL A;  4UW5 A;  3BTA A;  3U07 A;  4P08 A;  4CZS A;  1UZY A;  2RVA A;  1RYY A;  4IE4 A;  2X8K A;  1QIQ A;  4W65 A;  4QPG A;  1X8M A;  5D8A C;  3O5S A;  1H4G A;  1W0O A;  1WGP A;  4PLM A;  4WVM A;  1CQ9 A;  4XJU A;  1WLT A;  4MGQ A;  3WW3 A;  1CGP A;  2VMD A;  1WD3 A;  3LFM A;  5LBB A;  4BH9 A;  2RE9 A;  1RMU 3;  1GNY A;  1RIR A;  2Y6H A;  2R1B A;  1DF0 A;  3C7H A;  3HN1 A;  4FO9 A;  4XHX A;  4Z07 A;  3N9N A;  1PGL 1;  4ASM B;  2VBD A;  1L7Q A;  3M7A A;  4XQW A;  1PK6 B;  3OBT A;  4MYE A;  4XFF A;  2SLI A;  2WSV A;  4BXF A;  5AC9 3;  1JZ7 A;  3WR0 A;  4NJ4 A;  4FFF A;  4OI2 A;  1FXZ A;  2XJR A;  3H50 A;  4JDO A;  2DUR A;  4CYD A;  4XEZ A;  3I3M A;  2ZGK A;  1TMF 1;  1MZ5 A;  4IE7 A;  5FZ7 A;  3SKV A;  1SZB A;  4QD2 A;  1C1L A;  1YQC A;  1O8S A;  2Q5T A;  4UFK A;  3ZSL A;  3OD4 A;  4BQ2 A;  2DBN A;  1XRU A;  2XLF A;  3ITQ A;  4N9H A;  1BEV 1;  5IJR A;  4FTE A;  4HET A;  4YM0 A;  1ZRR A;  1V6I A;  3U1X A;  3VD5 A;  5L9V A;  4HMZ A;  3VZM A;  1Y9M A;  2DCT A;  2W3J A;  3P5B A;  1I9R A;  3N9P A;  5EYY A;  1KJR A;  3KM5 A;  4LLF A;  4QX1 A;  2RS3 3;  4AOC A;  4Y5Z 0;  5IW0 A;  1LU2 A;  1QH6 A;  5T5J A;  2PHX A;  3K4A A;  3WQ0 A;  4URA A;  4RS5 C;  1PIV 3;  2VE1 A;  1BXH A;  1YJK A;  2CDP A;  5DMY A;  1UXZ A;  1R08 2;  3WQB A;  2NZ9 A;  1OC1 A;  3CLP A;  3RSJ A;  4BWO A;  5CAD A;  3LAG A;  4IDZ A;  5LA9 A;  3SLI A;  2BP6 A;  1UZ0 A;  2BVV A;  4R52 A;  3OB8 A;  2VZ3 A;  1DIW A;  1H2M A;  4P5H A;  1OD3 A;  4NO4 A;  4UFL A;  5FZ8 A;  3CJI A;  1SHW B;  4OHW A;  1C28 A;  1LNS A;  4MGI E;  4AL9 A;  4NAO A;  3NNJ A;  5BNO C;  2H0V A;  3PL0 A;  3KHB A;  4CA9 A;  2R07 3;  4XTM A;  4PCR A;  1PX4 A;  1H30 A;  4K21 A;  5FZ3 A;  3RYR A;  3UGH A;  4TWT A;  5IVV A;  5SV5 A;  3M2M A;  1UOJ A;  1SBF A;  4Q8K A;  2QZ2 A;  2NQY A;  4EN7 B;  1UMH A;  2PMW B;  2BNM A;  3WUD A;  2MEV 3;  4OMC A;  3E6D A;  2CNA A;  3RJ2 X;  3LB9 A;  4KWU A;  5LBE A;  1I3H A;  4TLF A;  5A3O A;  1JOD A;  1T2X A;  2W1S A;  3O1T A;  1ASJ 3;  1JW6 A;  2GC0 A;  4XJA A;  4AQT A;  5I0R A;  3RZH A;  1ULO A;  2HJI A;  1ZZB A;  2WNO A;  4BYY A;  1MS8 A;  3TRS B;  1N3O A;  4OMD A;  1NY7 1;  4XFB A;  5FLH A;  2JEC A;  1ZVF A;  2PA7 A;  2R0F A;  3MIG A;  3Q8C A;  5KHJ A;  4OZO A;  1QJX 2;  3FN9 A;  3WDX A;  2JD9 A;  3POE A;  1CR7 A;  3J7N A;  5B2G B;  3WZ1 A;  1GZT A;  4I0B A;  2VZV A;  2IXJ A;  2A3Y A;  1LTE A;  2ZML A;  4K7J A;  4Q5O A;  4Z2W A;  3RZM A;  1HN1 A;  4AI9 A;  1I5Z A;  5HCA A;  4UFH A;  1BJQ A;  1MZF A;  4BCU A;  3BIE A;  3GBG A;  2CWS A;  1XB9 A;  4UF0 A;  1DYK A;  4AED B;  4EN0 A;  2RS5 3;  1OKQ A;  1Q8Q A;  5DDJ 3;  4CDX A;  1GFF 2;  3EHK A;  3NJV A;  2ORZ A;  3DEM A;  4LA3 A;  2V09 A;  1GOH A;  5JOZ A;  4JAA A;  2W0X A;  4LKD A;  5BNN B;  2ZGM A;  4BIF A;  1X7N A;  2BFU L;  4UOJ A;  4IER A;  3NNM A;  2QDR A;  1NCR C;  2HWD 3;  3MFC A;  1UO9 A;  2E7A A;  3NJX A;  5IUQ A;  3VBO C;  2WNU A;  3K3O A;  3MHZ A;  3RMY A;  4FSJ A;  1UY2 A;  2DVB A;  3D8C A;  2GAL A;  3M4F A;  5F39 A;  1SFN A;  2FZ2 A;  5FZ0 A;  4DEV A;  3GJB A;  3VBS B;  3O0W A;  3OBZ A;  3ZXF A;  1LUL A;  4NR1 A;  1LOF A;  3LA3 A;  5LRR A;  2W2I A;  1LGB A;  1KIT A;  4MAD A;  1OUX A;  3BGA A;  5DQ0 A;  4Q1P A;  1GIC A;  3OOX A;  1SBE A;  2J1S A;  5CBL A;  1RUC 1;  1GYK A;  1LED A;  3VN4 A;  1W0N A;  3WF4 A;  1HXS 1;  3JD7 3;  4AGR A;  2OXB A;  4QU1 A;  1FPN 3;  4MXW B;  1L3J A;  4PHZ A;  3EO6 A;  5EHD A;  1NUK A;  1LHU A;  2VC9 A;  3VBR A;  5A80 A;  1BVV A;  1TEI A;  1OHF A;  2GAU A;  3POG A;  4RL7 A;  2X10 A;  4AWD A;  4W8J A;  4B4Q A;  4AGG A;  4GUL A;  1UYZ A;  1NXM A;  4CCM A;  4IE5 A;  3IPV B;  3M3E A;  4I01 A;  4IEU A;  4NII A;  1COV 2;  4D7T A;  3VBH B;  3POF A;  4XUR A;  2VTX A;  1CX1 A;  4HL0 A;  5GLV A;  5CG8 A;  4XJ9 A;  2ZX2 A;  1LOC A;  2ADE A;  3FFZ A;  2XLG A;  3IDE A;  2CL2 A;  2CY6 A;  2ZHM A;  3FJS A;  4MGY E;  2UWA A;  4HPK B;  2ZPX A;  3Q9O A;  4NHY A;  4P9X A;  4ZY9 A;  4Q4Y 1;  1LOA A;  2A7A A;  5DXD A;  5KC6 A;  2YFU A;  3O1U A;  2ZX4 A;  3TYJ A;  1MPX A;  2NM1 A;  2O1Q A;  4KWL A;  1RHI 2;  5JPN B;  2QQW A;  4NRM A;  4BQ4 A;  3O1V A;  5FDB A;  2WS9 1;  4P14 A;  2GH2 A;  4OHZ A;  1FNY A;  1T6B X;  2E31 A;  4NOT A;  5EZW A;  1MZ6 A;  3WD5 A;  4CPB A;  4AFM A;  1QDO A;  3T2T A;  1SDD B;  3DXT A;  2BOI A;  1CD3 G;  1U5I A;  2PTM A;  3GZT B;  2JDM A;  3NV2 A;  3WX5 A;  2BJS A;  1HQW A;  4IV1 B;  4RQP C;  1R64 A;  2EID A;  3WDV A;  4CRQ A;  3VBH A;  1WWY A;  1WMD A;  2YYO A;  4XF1 A;  1IPJ A;  4XAB A;  1A6C A;  2Q30 A;  3OD0 A;  4Q0Q A;  4C91 A;  4LBN A;  5EYX A;  2RMU 1;  1UD1 A;  2GMM A;  3IM0 A;  1PM4 A;  1S2K A;  4AEM A;  1JOP A;  2BOJ A;  3OPT A;  4Q4V 3;  3RMX A;  4HLT A;  4BA6 A;  5F3I A;  2QQK A;  3WUC A;  2ZZJ A;  1AXK A;  4YGD A;  5H9Q A;  4IES A;  2XL7 A;  4TN7 A;  2WO3 A;  4R9A A;  5C9A B;  2OVU A;  1LEM A;  1VBB 3;  1V9U 2;  1PNF A;  2Y8K A;  5ANN A;  5EFU A;  3U10 A;  2D6L X;  5BY5 A;  1AR8 1;  4OFG A;  1I5P A;  2RM2 2;  4GWM A;  4OYU A;  3I2G A;  1RUJ 1;  2X53 S;  1C4R A;  5JOW A;  1GLH A;  1W6N A;  1XXN A;  2KM2 A;  2R06 2;  2Y33 A;  3VBF B;  5CEH A;  1ENR A;  3VUO A;  1HW5 A;  2YY1 A;  3DGT A;  4BQ3 A;  1LOD A;  4IEW A;  2A1X A;  2C5D A;  4K6B A;  4A7Z A;  1W8Z A;  2A6X A;  2L9L A;  3EBR A;  2W1W A;  1BBT 1;  3K4D A;  4GA9 A;  4QX3 A;  3VDD B;  5TSW A;  5DAX A;  4D6S A;  3NMB A;  5FR3 A;  4CU8 A;  1TVG A;  1W9S A;  1UMI A;  3C7F A;  3VBU B;  1B35 C;  3QAC A;  2BWC A;  2HEY F;  2PAK A;  1JYN A;  4NHM A;  1XBF A;  2R7E B;  1LHN A;  1MS5 A;  1NOV A;  4Q4W 1;  4LO7 A;  1RIT A;  2WA4 A;  3RFR A;  1EV1 3;  4Y5S A;  4RGG A;  5JSP A;  1PHM A;  1WCK A;  4PF1 A;  3S7E A;  3BTY A;  4AHZ A;  2UYA A;  1Y7B A;  4RGK A;  2A6Z A;  3WNX A;  5ANQ A;  2ZX1 A;  2WLQ A;  4YM2 A;  1H2N A;  1QMJ A;  2KXL A;  5C3Q A;  4BB3 A;  1UPS A;  3WY6 A;  2BGP A;  1HB2 A;  3DPR A;  1XOY A;  1VBE 3;  4HK8 A;  4XUT A;  5FYI A;  5FYH A;  2VOW A;  2XOM A;  3LQC A;  3VHN A;  2JDP A;  2WZR 2;  2W46 A;  3FUQ A;  3LDR A;  4FXG B;  3B01 A;  4N90 A;  1AXZ A;  1WKY A;  3RZG A;  1OH4 A;  4PI0 A;  1US2 A;  1NG0 A;  5FY0 A;  3ZR5 A;  1CN1 A;  5F5C A;  4ZXK A;  4LBQ A;  1L7L A;  1PK6 C;  3AP6 A;  1AYM 1;  1UNB A;  4PT6 A;  2DTW A;  1XSQ A;  5BYN A;  2J1E A;  3H7J A;  3HPN A;  1Q8V A;  5A32 A;  5FQ0 A;  2VNR A;  3B9C A;  1CAX B;  1Z7S 1;  1DG6 A;  1H8T A;  3TNP B;  1W6O B;  2BBA A;  5FYM A;  2VEC A;  3B00 A;  1KJL A;  2QQV A;  3DF0 A;  5JXJ A;  1H1M A;  2C26 A;  1QDC A;  1WLW A;  2Y64 A;  4WM8 A;  3W5N A;  2YZ4 A;  1J3P A;  4DUV A;  3IDC B;  5CVR A;  4KBZ A;  1AYN 1;  4LO8 A;  1PZ8 A;  1CAV B;  2E6V A;  1JZ6 A;  3ORJ A;  1W2T A;  1YIF A;  5A7Q A;  3MIF A;  1S0G A;  1RMU 2;  3N36 A;  3W9A A;  1JZ8 A;  3JU9 A;  4UAP A;  5FY4 A;  2XBO 3;  1T6G C;  3GYD A;  3MFA A;  1WBL A;  4NHK A;  4PIY A;  4QXB A;  2FHR A;  3TN9 3;  2B4K A;  2BNN A;  1FOD 1;  2ZGN A;  3POY A;  5JVV A;  1LB2 A;  4HBN A;  4CCL A;  1H0B A;  4COV A;  5AC9 2;  4BM8 A;  1MS1 A;  3ZXK A;  5CG9 A;  5D2A A;  3ZDV A;  2DUP A;  5FZL A;  2B8M A;  4FAH A;  3JBG 1;  1YC6 1;  4ZPI A;  4IQP A;  5IVB A;  2Z2S B;  4YPJ A;  4D7Y A;  2QE3 A;  1IG3 A;  1L7R A;  3VV1 A;  4XAE A;  5FPL A;  1BYH A;  3SH5 A;  5JCT A;  4NIG A;  1ULC A;  3AVR A;  4ZHN A;  4HVO A;  4J6G A;  5K0U A;  2ZMK A;  3UV9 A;  1JUI A;  3A21 A;  1RUD 3;  3AX4 A;  5A33 B;  1O3T A;  4URT A;  5FIX A;  4JGY B;  3ZYR A;  4I02 A;  5FZD A;  2RS3 2;  3NNL A;  4GMP 1;  3RYK A;  3TEX A;  4LO6 B;  5JIU A;  5DPN A;  1BCX A;  4ITC A;  5FZI A;  4OHV A;  1PIV 2;  4W6Y A;  3CMG A;  2DCJ A;  5HCB A;  2ZGQ A;  4O65 A;  5K4L A;  1RUG 3;  1QU0 A;  5A7S A;  4Z1V A;  5I8Y A;  2AUY A;  1YQ2 A;  4MH0 E;  1BK1 A;  5A7W B;  3B9I A;  4KI5 M;  3S5A A;  5K9Y A;  1ZBA 1;  3S6P A;  4LIU A;  5IVC A;  1BVP 1;  2PFW A;  2DFB A;  2HEV F;  4YVW B;  3WG1 A;  1ZA4 A;  2JE8 A;  3ZSK A;  1JYV A;  2X5I A;  2WLP A;  2R07 2;  1X82 A;  1R09 3;  5I8T A;  2E7Q A;  3PLQ A;  2EF6 A;  5KXB A;  4AHW A;  2R49 A;  4ATF A;  3OJB A;  4XF3 A;  1DQ5 A;  3T0B A;  4C1W A;  4CUA A;  1AR6 3;  5A70 A;  4NRO A;  2VQT A;  4OUL A;  4UT5 A;  2CYF A;  3I3D A;  1LR5 A;  2MEV 2;  1ENX A;  3PVO A;  4AED C;  4ES9 A;  5A6Z A;  4DO0 A;  5FWJ A;  2ARA A;  1QOS A;  1ASJ 2;  4ZZ8 A;  1DGR N;  4AXO A;  1VAV A;  1VBD 1;  3LWC A;  4FP2 A;  2KR2 A;  5FMO L;  1OLR A;  3WF2 A;  2WYF A;  4NRP A;  4BDV B;  5BNN C;  4A7K A;  1KDM A;  2D5H A;  1ODN A;  1W8N A;  2HWC 3;  2XH6 A;  4S2D A;  3AXD A;  5FZO B;  4BLI A;  2YB7 A;  4NVP A;  3ASI A;  5A3M A;  3KVA A;  3OGJ A;  3NL1 A;  4HKL A;  3LEG A;  2QNK A;  5F6K A;  3WCR A;  1D2Q A;  1G6N A;  4M3C A;  2I2S A;  4XFI A;  3VBS C;  4MVT A;  4PDW B;  3UGG A;  1RUH 1;  1SPP A;  5ABJ A;  4JHZ A;  1LRH A;  3CDZ B;  3OGV A;  5T5P A;  3LSE A;  4XE9 A;  1R1A 3;  1JH5 A;  2MPF A;  2RS5 2;  3POS A;  2QQI A;  4XFG A;  5DDJ 2;  4AQS A;  4BK4 A;  3HT2 A;  4QQH A;  1PO2 1;  1TZO A;  1A8D A;  2P6C A;  5FO7 B;  5T55 A;  2LRO A;  3AYC A;  4JHT A;  5KHH A;  4D69 A;  4BQ1 A;  2V5D A;  4JDN A;  4N43 C;  1DGW A;  4BME A;  4DRR A;  4AFC A;  1C3H A;  2HWD 2;  1VRB A;  1O4Z A;  3JQX A;  1OI6 A;  1TQ5 A;  2VM9 A;  5EV7 A;  3NAP A;  5FYT A;  2AYH A;  1ZBE 3;  1RXF A;  4XQD A;  4MSV A;  1BMV 2;  1JOB A;  2IVJ A;  1DU3 D;  1A3K A;  5FV3 A;  1YO8 A;  2DU0 A;  2VG9 A;  1RTV A;  5CA6 A;  1QJY 3;  1Y9G A;  3HNY M;  4BLJ A;  3IWZ A;  4XBQ A;  3ZR6 A;  2C6S A;  3AZX A;  3H1W A;  5F1R A;  3W59 A;  4PDW A;  4KQ7 A;  2VUD A;  3JD7 2;  1HV1 A;  2WRA A;  1K5M C;  3V64 A;  1ALY A;  1FPN 2;  3R0R A;  4Y1Z A;  1ZA7 A;  1GKB A;  3C7E A;  1IGO A;  1JBC A;  3PUR A;  1JYT A;  1U5X A;  4YYO A;  4JRL A;  5GLT A;  1FV3 A;  2QJV A;  3M70 A;  3OTF A;  5KC5 A;  1CZS A;  1Y43 B;  1N1V A;  1SLC A;  1F5F A;  2O8Q A;  3IN9 A;  3ZFF B;  4GH4 A;  1NLQ A;  1KS5 A;  3I97 A;  3NV3 A;  4XPV A;  3DYM A;  4R8H A;  3T2O A;  2VD7 A;  5ACA 3;  1YHF A;  5F37 A;  3D6E A;  3BIW E;  3ES4 A;  1O7F A;  1S2E A;  4K1Z A;  4E4D X;  3UES A;  3E6C C;  1W6M B;  4IV1 C;  2Q8E A;  4GAZ A;  5FOJ B;  5A3T A;  1AR9 3;  3OF1 A;  1O3Q A;  2H6C A;  1YYN A;  4QHB A;  5FXX A;  5C71 A;  2AC1 A;  3AYD A;  3AL5 A;  4RGA A;  3FBY A;  3N4M A;  1K42 A;  5APA A;  2V72 A;  5GLU A;  5C8C A;  3SH3 A;  1QJE A;  2CAV A;  2R1D A;  3MPP G;  3HAG A;  4E2S A;  3WXP A;  2VJX A;  1VE0 A;  4CEY A;  4KMQ A;  3OUH A;  3KVB A;  3AP9 A;  4PIX A;  3T0D A;  1ND3 B;  2A3X A;  1FMD 1;  1GZ9 A;  1W2A X;  2WFF 2;  3AZY A;  1UYX A;  3E6B A;  3WQ1 A;  4CP9 A;  5JZG B;  1G7Y A;  1F4H A;  2VOK A;  2YU1 A;  1OFN A;  5LB6 A;  5ACA 2;  3VBF C;  3OEB A;  3H9A A;  3POW A;  1XU2 A;  3CZU A;  3ZFG A;  3GDB A;  4G3Y C;  2DYC A;  5FY7 A;  2OA2 A;  3RYP A;  2BWA A;  3RQ0 A;  3K4Z A;  4OHX A;  4YVS B;  4B1M A;  2FDG A;  1EPW A;  2BGC A;  3HBK A;  2CSG A;  3PVB B;  4DQA A;  4DXS A;  1AX2 A;  1VBC 3;  3VDD C;  4Q4V 2;  4WBB A;  5J48 A;  4PQQ A;  3LEM A;  2CGN A;  2HEW F;  3HBZ A;  3J7M A;  3KCC A;  4KGQ A;  4O61 A;  5T5O A;  4JTN A;  3VBU C;  4EZH A;  5BNP B;  3MLJ A;  2WL1 A;  4NHL A;  5J3U A;  3ON7 A;  3BU0 A;  3WHU A;  2NN8 A;  1VBB 2;  5B4N A;  1LHW A;  2B46 X;  1YJL A;  3C7G A;  2VZO A;  3LPF A;  2W5F A;  2PHR A;  3TBD A;  3R05 A;  1SLI A;  3RI9 A;  2RR1 3;  1ENS A;  1XQN A;  4E4S A;  4IEP A;  2P34 A;  1VBA 1;  2ZEW A;  3ILF A;  1WLD A;  1QEX A;  3HVD A;  3BOD A;  4XCB A;  4CCD A;  2GN3 A;  4AAP A;  2XML A;  5C4W A;  3VKF C;  3ACF A;  5KBF A;  1VRH 1;  2PHF A;  2YMZ A;  3LIG A;  3TWI A;  1H1I A;  2ENR A;  4GD4 A;  3TB0 A;  2JG9 B;  2QFE A;  4QGM A;  4Y26 A;  4CU9 A;  2X29 A;  1UCX A;  1W0P A;  3PDQ A;  2BVB A;  1UY1 A;  2QVS B;  3AFG A;  4QQ2 A;  5JR7 B;  5KHK A;  2GSY A;  1CAU A;  1DP0 A;  1MZE A;  4CDU B;  1MS3 A;  5FP9 A;  5FMC A;  3ZFE B;  2HKX A;  2R16 A;  4P9W A;  1UYP A;  3AVS A;  3M3I A;  5FZK A;  1OLM A;  3SCH A;  1JS9 A;  3RWN A;  1EV1 2;  4HON A;  4CDQ B;  4E4Z A;  3LA7 A;  5FZ9 A;  2E51 A;  1J58 A;  2HWF 3;  1TNR A;  1ULP A;  4E2G A;  3N3H A;  5EJ3 A;  2W39 A;  2WQ8 A;  4LBL A;  4Y3O A;  4E27 A;  1S0E A;  4AEK A;  1VBE 2;  1V9U 3;  1XYO A;  1ZNP A;  2QQN A;  3VBO A;  5F3C A;  5D21 A;  4IEQ A;  1OVP A;  4D6R A;  1NLS A;  4RR3 A;  5EQU A;  1DDL A;  4QXH A;  5CAZ A;  1NQJ A;  4W4Z A;  2VZ1 A;  5DG2 A;  4AVV A;  4MUV A;  2JXA A;  2ZTN A;  4NN0 A;  3WQ7 A;  1V00 A;  1UU6 A;  1HLC A;  3JCI A;  5A3W A;  1SAC A;  3WW1 A;  3VZL A;  1OOP B;  5AVA A;  1HRI 3;  3PUH A;  4BQ5 A;  1GP5 A;  2NPI A;  3MV0 1;  3W5M A;  1UX7 A;  3D5O A;  4CXW A;  2YV8 A;  4W50 A;  2P5B A;  2C0Z A;  3D0J A;  2A73 B;  1D2S A;  4GJY A;  1QF3 A;  2Y0O A;  4LUL A;  3SHR A;  1URX A;  4XUQ A;  3MIC A;  2PYT A;  1I1E A;  4GIQ A;  1C1F A;  2R0H A;  4QPG B;  2B5H A;  4LA2 A;  3FLR A;  4WVM B;  4XIK A;  3IAQ A;  3T0A A;  3ME2 A;  4JGY C;  2XBO 2;  3C8X A;  2IUW A;  2MNG A;  3TN9 2;  1PGL 2;  2ERF A;  2OPW A;  4BK5 A;  4GB3 1;  2JDZ A;  3ZKU A;  2A71 A;  1A34 A;  4LHS A;  2A6V A;  3VHR A;  3R4U A;  4XAA A;  1SLL A;  2X09 A;  3V56 A;  2W87 A;  1TE1 B;  1RUI 3;  5LA2 A;  1M4W A;  4ZU5 A;  1US3 A;  2UWC A;  2XVL A;  3FMG A;  4NPR A;  1LJ7 A;  3FL7 A;  1PO1 3;  3CJX A;  2EVX A;  1DZR A;  3I3B A;  5KHI A;  5CZK A;  3A0K A;  4DOU A;  4YVW C;  3ZSM A;  4FTS A;  2J1T A;  1ODM A;  3I59 A;  1KXG A;  1S55 A;  2JEN A;  1V6K A;  1NKG A;  2JX9 A;  1FAT A;  1RUD 2;  3M8L A;  3NST A;  4I3P A;  1JUH A;  5EJZ B;  4DY3 A;  5J7M A;  1JHJ A;  4Y1X A;  4FXK B;  4PBO A;  1IKQ A;  1S0F A;  4K8R B;  4FFI A;  4DEQ A;  1W8W A;  2VQ0 A;  2P6H A;  2FCT A;  1IS5 A;  3FUO A;  4K8F A;  4AGV A;  3OGG A;  1E5I A;  2H6B A;  2RS1 1;  2WBK A;  5CKQ A;  4XF4 A;  3WDY A;  4ZKT B;  1WD4 A;  4HG6 B;  3QLQ A;  5FY5 A;  5J98 B;  1W6Q A;  3KF3 A;  1RUG 2;  1WCU A;  3VB9 A;  3H1M A;  4H2A A;  3HQR A;  1PM7 A;  3AM2 A;  2DDU A;  3ZYH A;  3N9M A;  3VD7 A;  1C8M 1;  3SXW A;  1V6L A;  3AKQ A;  3PU8 A;  1LGN A;  3AC0 A;  1H9W A;  4FQZ A;  4I30 A;  4JGZ A;  3CJI B;  2F4L A;  5FPU A;  5FZC A;  1SQ4 A;  3BOW A;  3WNK A;  4AQ6 A;  3N7L A;  1R09 2;  2PLV 3;  1W90 A;  4UI9 L;  5ISL A;  4MO3 M;  1AR6 2;  2DVG A;  4I0A A;  1RL3 A;  4Q0V A;  1KEX A;  5FP7 A;  3UJO A;  1JI6 A;  1POV 1;  1XC6 A;  2MHF A;  2Y6J A;  5I0S A;  1HRV 3;  2WFP A;  1WCD J;  2J7M A;  1CIY A;  2XJT A;  3HIF A;  5FZB A;  2B39 A;  2TBV A;  5DUW A;  2BEO A;  4XW3 A;  5C5U A;  3DEC A;  2UY8 A;  2ZGS A;  1N47 A;  4XVH A;  1MEC 3;  2ZJC A;  4W6W A;  4L9B A;  4IGQ A;  1SDW A;  4IGP A;  3D82 A;  1AVB A;  1UZW A;  1FV2 A;  4IW3 A;  1PGS A;  3KGL A;  1G8W A;  2AGS A;  5A6Y A;  5FZH A;  2HWC 2;  1HIX A;  1H6X A;  3IDA A;  2Q1M A;  3KZ4 C;  4G4F A;  5DUU A;  4D6Q A;  4XXP A;  3NO8 A;  1O6U A;  2P3Y A;  4G9S B;  3J8F 3;  5SV8 A;  2LUW A;  2QQP A;  1BK0 A;  1NA1 A;  4JDM A;  2WZ8 A;  2VW2 A;  1GU3 A;  2XJU A;  1BZW A;  2ZKN A;  4K1Y A;  5IVJ A;  1HJG A;  4Y20 A;  1R1A 2;  3EJK A;  4XBN A;  5DAQ A;  1F9K A;  3USU A;  1JHN A;  1BHG A;  1W9T A;  1AR7 3;  4UF0 B;  3KCX A;  1JZ4 A;  1FX5 A;  1O5L A;  1YFW A;  2Z42 A;  2ZX3 A;  1OMI A;  4AFA A;  4CDX B;  4UFI A;  4HSJ A;  4ARY A;  3D0S A;  5BNQ A;  2EAL A;  4DIQ A;  4XIL A;  2HYX A;  3CU7 A;  1X9T A;  2HBU A;  4C8D A;  2E63 A;  2IXK A;  3AP5 A;  3MEP A;  2A3W A;  1GWM A;  2JB4 A;  3HR9 A;  1FYU A;  3ZFF C;  1ZBE 2;  2DUO A;  4A41 A;  1OQD A;  2XJP A;  2QQM A;  1WBF A;  2XHN A;  2WNU B;  4IND A;  4QDQ A;  5GZE A;  2Y0I A;  3RZZ A;  3T30 A;  4RFR B;  1D7P M;  3WNP A;  2UYB A;  2ID4 A;  1H1A A;  4EQV A;  2G1M A;  2W92 A;  3FE5 A;  3WEZ A;  1K5J A;  2FCU A;  4Q1R A;  3JB4 C;  3VKM A;  1QJY 2;  5JI7 A;  1RUC 2;  4PLN A;  1DGR A;  3LOI A;  1SCS A;  3JQW A;  3VDC A;  2RJL A;  4EWA A;  1ULG A;  1YCI A;  2GC3 A;  2ZKL A;  1REE A;  1GR3 A;  3WOG A;  4XJZ A;  1MR5 A;  3GAL A;  2B42 B;  1AJK A;  2D3P A;  3J26 N;  4ASL A;  3M3C A;  3VHO A;  1CPM A;  1ZZ9 A;  2J1V A;  4Y22 A;  3WDW A;  3MW2 A;  5F2S A;  4YW7 A;  4CP0 A;  4WV8 A;  2WZE A;  5FOB B;  3L9J T;  1ND3 C;  2FDJ A;  2Q1Z B;  3VBR B;  1YFU A;  2VMF A;  5T52 A;  1XE0 A;  1BLZ A;  4PQ9 A;  2Q8D A;  1V6J A;  1W9F A;  4QPI A;  2VVF A;  4N53 A;  5JZG C;  1POV 0;  1UOF A;  3MPB A;  2OZ6 A;  5L19 A;  1D0H A;  1PMH X;  1RIN A;  5FJH A;  5IT6 A;  4CXY A;  2D5F A;  3LA2 A;  2FBE A;  4DXZ A;  1R08 1;  2GDF A;  3OBA A;  3J4U H;  4YWA A;  4LJH A;  3THP A;  4LQR A;  4YVS C;  1DQ2 A;  3E5X A;  3ZXL A;  5I8S A;  1AR9 2;  2R04 3;  2VOX A;  4CCK A;  1GP4 A;  3UJQ A;  4BJ0 A;  2DV9 A;  4OQ9 A;  2I74 A;  4JCK A;  5LRS A;  2ARC A;  2VW1 A;  3I3E A;  3NNG A;  3OGR A;  3ALQ A;  4EE2 A;  4XFH A;  3SIS A;  2A70 A;  5BNP C;  1OA4 A;  3ILN A;  3POJ A;  3C7O A;  4QKB A;  5L7O A;  4LBJ A;  5LWB A;  2RJK A;  3MW4 A;  3PUQ A;  4ZXE A;  4TXW A;  3UET A;  4QB2 A;  2OS2 A;  2WZP P;  5FZA A;  1N1Y A;  4V2V A;  2G9Z A;  3I2J A;  3ETP A;  3T2Q A;  4TYS A;  1W6P A;  3AJY A;  1TME 3;  1RVF 3;  3RNS A;  4AE2 A;  3K75 B;  3PVN A;  5GKA C;  1Q56 A;  4HZF A;  4XBL A;  2J42 A;  1UU4 A;  4YFZ A;  4XFC A;  1VBC 2;  4GWI A;  3MV1 1;  5T3N A;  1RJ7 A;  2JG9 C;  5HI0 A;  1KGY A;  4AI8 A;  2EXJ A;  5FMD A;  2Q8O A;  3K46 A;  2BDR A;  3N35 A;  1QJX 1;  1WMF A;  3FC0 A;  4X8P A;  1EAH 3;  2IFW A;  3DUI A;  1UW8 A;  5G04 L;  4AQ2 A;  2W9X A;  1CZV A;  4AHY A;  4UFM A;  1LOB A;  3CNA A;  4RHV 3;  3B5L B;  4CUG A;  4F7Z A;  2YBK A;  3WCS A;  4IET A;  4CDQ C;  2QUO A;  2RR1 2;  4UYB A;  2WNV C;  5FO8 B;  5F2W A;  4Q0P A;  1XJA A;  3POB A;  1QQP 2;  1KDK A;  2HWE 3;  1W6N B;  3P3P A;  3NKG A;  2DWR A;  3NV1 A;  3VZJ A;  2WFF 3;  1YFY A;  2YBP A;  4M01 A;  4CCN A;  3U78 A;  1PX3 A;  1XYP A;  2ARE A;  3IDB B;  4WM7 C;  5EIY B;  1CES A;  1ONA A;  4Q4X 2;  1Q43 A;  3RJR A;  3T1M A;  4A44 A;  3WG2 A;  2WAA A;  2UU8 A;  5JXG A;  2IC1 A;  5FPV A;  4N8M A;  1UOG A;  1LHV A;  4ONU A;  5IK5 A;  4R4Z A;  2XL9 A;  4YG3 A;  5GZD A;  4YSF A;  2ZGP A;  3IBM A;  4OI4 A;  3TAY A;  1W99 A;  3L2Y A;  2HWF 2;  2D6N A;  2J1R A;  1RJ8 A;  3NNF A;  4N43 A;  4QQL A;  4UW4 A;  3ZN6 A;  3WHT A;  1GQG A;  4PJY A;  4FPY A;  2XPJ A;  2QBX A;  3WW2 A;  4ET7 A;  4PLO A;  1QJU 3;  4L99 A;  1AJO A;  2VXJ A;  3N7K A;  5C70 A;  5A7O A;  3ZLI A;  3DPR B;  1ULF A;  1LEC A;  1KQR A;  4YW1 A;  4MX3 A;  4XJ8 A;  2CGO A;  1D4M 3;  5J1X A;  3APB A;  2C9K A;  3I8T A;  4Z92 B;  2W91 A;  4DS0 A;  5JSR A;  3B69 A;  1COV 1;  1MS4 A;  1RUF 3;  4M4R A;  4FP3 A;  5E88 A;  4P9J A;  3H3U A;  4OLL A;  5I0U A;  4LBQ B;  2FDI A;  1PVC 3;  2DTY A;  1W8U A;  2VBP A;  4A45 A;  1QXJ A;  5A32 B;  1HRI 2;  5FQ0 B;  2ZZQ A;  1K5M A;  5I93 A;  5FXV A;  3CKH A;  3OBR A;  1H8T B;  3OUJ A;  4FOW A;  3RI8 A;  4A6O A;  2JG8 A;  4GWJ A;  4LKE A;  1WW5 A;  1UXX X;  3O1S A;  4WM8 B;  1BQP A;  1NCQ A;  2JDN A;  3AFK A;  3WV6 A;  5A1A A;  3M3Q A;  5C3P A;  4AVA A;  3KT7 A;  3H42 B;  1RHI 1;  5I0D A;  2A75 A;  3GCW A;  4Q26 A;  4XZU G;  2Z79 A;  3A4U A;  4CEW A;  4CDW A;  3WF1 A;  2RDQ A;  5FO9 B;  3LPG A;  2OQ6 A;  1J1L A;  4FCA A;  3HT1 A;  4JVA A;  4LOT A;  3ZXG A;  3VL8 A;  5LY1 A;  3H8O A;  2VO5 A;  5GZF A;  3I2D A;  5I0T A;  1CPN A;  2GC2 A;  2XG3 A;  2W52 A;  4AF9 A;  2PXJ A;  3KV5 A;  4L8Q A;  2FMY A;  1ZZ7 A;  1RUI 2;  4PI2 A;  3IKW A;  2JJ6 A;  3AJZ A;  2CDO A;  4ZZ5 A;  1F15 A;  2DCK A;  1PO1 2;  2WT2 A;  2F17 A;  4F83 A;  4AEJ A;  4L0P A;  1YI9 A;  1EYB A;  2PHU A;  3OGS A;  4FPL A;  3CJI C;  4LHL A;  5FZ4 A;  5T54 A;  4A3Z A;  2VH9 A;  3V0A A;  3PJQ A;  4HFS A;  2VBB A;  5GJ6 A;  3AZZ A;  3O1M A;  1HDK A;  2ZGU A;  3GHM A;  2YPD A;  4BU2 A;  1OA3 A;  4FPH A;  5K0U B;  3BPS A;  5FCC A;  4N7I A;  4P00 B;  4MGK E;  5FLJ A;  4NIA A;  3GGL A;  3FFQ A;  2JWP A;  2BNO A;  1V9U 1;  3K3N A;  5CFD A;  2VL4 A;  2Y26 A;  5EWS A;  3N9O A;  4YGC A;  5EJ1 B;  2RM2 1;  4QM9 A;  2UUR A;  3MF6 A;  5CIS A;  4BQW A;  4OQ8 A;  2D3R A;  1S4C A;  3KGZ A;  2R06 1;  3OUI A;  5FLI A;  3MLL A;  5CFC A;  4LO5 B;  4X6Q B;  2D6O X;  5BUV A;  5L73 A;  4DIN B;  1ZZ8 A;  1ND2 A;  2JIJ A;  5IVY A;  3HNM A;  3HQU A;  4MHU A;  2VZU A;  5GM0 A;  3ZPY A;  1XNB A;  1DGW X;  2XQR A;  3FLP A;  3FX3 A;  3KWV A;  1KRI A;  1JYC A;  3J9S A;  1TMF 3;  1YLL A;  1Z78 A;  1UWW A;  2Q8C A;  3UL2 A;  3SEE A;  3GHN A;  5F7U A;  2PLV 2;  2X5I B;  3WW4 A;  4YAR A;  1YXW A;  4QGL A;  4AYU A;  3ENR A;  3ZMN A;  2NMO A;  1DQ4 A;  2VMH A;  3RZJ A;  1BEV 3;  4FPC A;  3WP6 A;  1HRV 2;  4BHP A;  5FYU A;  2Y38 A;  1UIJ A;  5T50 A;  1IS4 A;  1S0D A;  1G9F A;  3WNM A;  4AI2 A;  3VHP A;  3WP5 A;  2CAU A;  2IXH A;  2ZEX A;  4HN0 A;  1MEC 2;  2FD8 A;  1VP6 A;  3CHX A;  1XU1 A;  3G6J B;  3KV4 A;  4P02 B;  2Y60 A;  3VKL A;  4LNV A;  4CDX C;  3TOJ A;  3UKV A;  4AG4 A;  3H8X A;  2ET1 A;  4BPZ A;  2WO1 A;  2WZR 1;  1OA2 A;  1SCR A;  3OEA A;  1YWK A;  3CEW A;  2BTV C;  1J3Q A;  1EPZ A;  2WNU C;  5LAS A;  3S7I A;  1G9C A;  3J8F 2;  2E9Q A;  1UYY A;  2FQP A;  4PBP A;  2JEM A;  3TEZ A;  4LKF A;  3N9Q A;  4IEX A;  1OKO A;  1GZC A;  4M3C B;  5FY8 A;  5ABJ B;  5CKM A;  1SPP B;  3DN7 A;  1LOF C;  1OFS A;  1QOT A;  4NPM A;  5DAW A;  1GBG A;  3AP7 A;  1AR7 2;  1YQ5 A;  3B93 A;  5JI9 A;  3U0Z A;  1CIW A;  2WQ4 A;  1OPO A;  2YC2 A;  4FOY A;  3W21 A;  4AVB A;  3ZM8 A;  1IQA A;  3MID A;  3P3N A;  4J25 A;  2WAB A;  5F3G A;  2YDE A;  3HJR A;  1WA6 X;  3AZV A;  3KV6 A;  4FI9 A;  1O91 A;  4MZU A;  3SKJ E;  1XPW A;  4I3G A;  1RMU 1;  3Q8B A;  5LY2 A;  4QHO A;  4YM1 A;  1QOO A;  1VPH A;  2VQU A;  2YU2 A;  3VBR C;  4E4H A;  1X36 A;  3NAP B;  4MGZ E;  3RPQ A;  1WCS A;  2QQL A;  4P9I A;  4KG0 A;  1FAY A;  3B02 A;  4GJZ A;  1CZT A;  4ATE A;  3NQH A;  3KQR A;  1IKP A;  4DXR A;  5AC9 1;  4FTB A;  1J59 A;  4IV3 A;  4D8M A;  3LZZ A;  3BPZ A;  3JXS A;  2ZAH A;  1AX1 A;  3FHA A;  4A4A A;  4AI3 A;  4LKS A;  5FWE A;  1GOF A;  2ZA9 A;  1JZ5 A;  3MF9 A;  3MI8 A;  1O59 A;  1OF4 A;  1JYW A;  2BPA 2;  2VZP A;  4YGE A;  2YC0 A;  2WAO A;  3KMH A;  5LBC A;  1CON A;  1IS6 A;  5AVP A;  4MGS A;  1NQD A;  3H8U A;  2WR9 A;  4FFH A;  1WW4 A;  4QKF A;  3WP3 A;  5FTT C;  2IXI A;  4Q2F A;  2VZS A;  2XKO A;  2TUN A;  2WWS A;  2ZS6 B;  2RS3 1;  2W47 A;  1NZI A;  3HEI A;  2ETE A;  2OW4 A;  4LHN A;  5KWR A;  1MQT A;  2O14 A;  4GH4 B;  1PIV 1;  4AR2 A;  1G9D A;  3R6S A;  4C0H A;  2HYK A;  2LM3 A;  3KD4 A;  3IIA A;  3PUA A;  4E2Q A;  2XB6 C;  3SNM A;  2DUQ A;  2VOV A;  1N1T A;  3UK9 A;  4OCT A;  1YEW A;  4KGG A;  2R04 2;  4LPL A;  3T4H B;  3VD4 A;  2VNG A;  5CIR A;  4YZ2 A;  4XF9 A;  1LKN A;  3I3Q A;  1QGL A;  4YGB A;  3VBH C;  3TEY A;  1X8E A;  4I2O A;  5IYY A;  4C0B A;  1W39 A;  3OPZ A;  4YZ3 A;  5HPO A;  3NRU A;  2R07 1;  5HXM A;  1RUC 3;  5C8C B;  4S2G A;  4M00 A;  3Q8E A;  1IQD C;  4XUN A;  4KU7 A;  5E89 A;  5D8A A;  5J36 A;  2VMG A;  1HXS 3;  1ST8 A;  1NE6 A;  2WC2 A;  4CEY B;  5LEK A;  2W95 A;  4OUE A;  4LOS A;  3A7Q A;  4ASK A;  2XVG A;  2MEV 1;  4Q0U A;  4CP9 B;  2AAC A;  3ZYB A;  2E32 A;  2ZHL A;  2GNT A;  1TME 2;  1RVF 2;  1UKG A;  5A7N A;  3WNO A;  3THT A;  3EQE A;  5J96 B;  1ASJ 1;  1H8V A;  1W3X A;  2CV6 A;  3ZFG B;  3RZL A;  4DY5 A;  3I49 A;  1P8J A;  3HD8 B;  2BGO A;  4JZR A;  4KU8 A;  4EN9 B;  2AZ5 A;  3EMR A;  1ACC A;  4YZ1 A;  3NKT A;  4YFW A;  2C24 A;  2WT0 A;  1O8P A;  3WG3 A;  1EUU A;  2D6M A;  4S2F A;  5FKB A;  3WG4 A;  1U5Y A;  1DHK B;  4AI0 A;  1EAH 2;  2GZW A;  2VOT A;  3OPW A;  1ENQ A;  4LK6 A;  2D98 A;  2Y6G A;  4MXV A;  3FZ3 A;  1H2K A;  4Q4Y 3;  3KCY A;  4RHV 2;  5FZM A;  4XJW A;  1QJZ A;  4ARX A;  3MIE A;  3BB6 A;  1VAM A;  4CCO A;  2RS5 1;  1RUN A;  5DDJ 1;  1W2U A;  2CHH A;  2P37 A;  3ZYP A;  3BKZ A;  2JDH A;  2WS9 3;  2HWE 2;  4TSV A;  3X29 B;  1SBD A;  5C9A C;  1O3S A;  4RS5 A;  1VRH 2;  3O14 A;  4AW7 A;  3DYO A;  3DPR C;  4HVR A;  2HWD 1;  3CF6 E;  2OUJ A;  5C4W B;  4R9C A;  2XJS A;  2ZEZ A;  4AK3 A;  3CO2 A;  1ZRE A;  2WN3 A;  1CVN A;  5A1F A;  4B8E A;  4R9D A;  1HQN A;  2QDN A;  4ISQ A;  3ZVX A;  3NJY A;  1BMV 1;  4XDO A;  1PGW 2;  1CAU B;  4Z8B A;  5A3N A;  5BNO A;  1OBN A;  3T4V A;  5KR7 A;  2RMU 3;  1JMU B;  2OT7 A;  3PME A;  3RWK X;  1AL0 G;  1IOA A;  5EPA A;  3USS A;  4H14 A;  1SEF A;  1S2B A;  4FFG A;  4LLO A;  2VCA A;  4C1X A;  2EXI A;  2GH8 A;  3EYP A;  2HWB 2;  4BZ4 A;  2JKX A;  3RG0 A;  4MG2 A;  1H8T C;  2GP3 A;  5FBJ A;  1W03 A;  3UGF A;  1VLN A;  3JD7 1;  1QJU 2;  1FPN 1;  1AR8 3;  1YIP A;  1C5I A;  3N7M A;  4WM8 C;  1RUJ 3;  1SLT A;  2XQX A;  3LEK A;  3VBO B;  3U4X A;  5LK5 A;  2FDH A;  1WUV A;  3T2P A;  2W08 A;  3HMY A;  1CJD A;  1CX4 A;  1D4M 2;  2GN7 A;  2VUJ A;  4RR3 B;  1QQP 3;  3ZN5 A;  1VAL A;  1GSL A;  1W2O A;  3G7D A;  3I2H A;  4PIZ A;  3T08 A;  2J22 A;  1RUF 2;  3LIH A;  4KWJ A;  1RUE 2;  3OY8 A;  3VDA A;  4F8A A;  4M0N A;  5FUP A;  3GJA A;  1BBT 3;  1PVC 2;  2EAK A;  3CIH A;  3T09 A;  3KF5 A;  3VD3 A;  2KA3 A;  4IUG A;  2LAL A;  4HKW A;  4R9B A;  1J83 A;  2I07 B;  4Q4X 3;  4WZF A;  1STM A;  4AFB A;  1WA4 A;  1LGC A;  2EIC A;  2W1U A;  2BER A;  4Q4W 3;  1AL2 2;  4Q27 A;  4HVQ A;  4QX2 A;  5K8S A;  4XC9 A;  4NHX A;  5IHR A;  5KXC A;  1Y4W A;  5F5Q A;  4GZ9 A;  4KWK A;  3WDT A;  1AF9 A;  4XHB A;  5K0U C;  3BOP A;  2JD4 A;  2VME A;  1GAN A;  3ATG A;  1GUI A;  1I6X A;  5KXE A;  4GB3 2;  2WFF 1;  4JKL A;  3CL1 A;  1NCR A;  2JDY A;  4P9G A;  4Z2A A;  1GWK A;  2VNO A;  1EY2 A;  1LOG A;  3IAP A;  2VU9 A;  5ACA 1;  3S30 A;  4XCA A;  1DQ0 A;  4QX7 A;  3ZXJ A;  3MUY 1;  1DFQ A;  1NT0 A;  3ZX7 A;  3ZN4 A;  4JTO A;  2JDA A;  2ARB A;  2EIB A;  1AYM 3;  3N7J A;  4WVV A;  2H0B A;  4M3C E;  4ZU4 A;  2OKX A;  3BCW A;  2B7Y A;  3ZXD A;  4GKX A;  2Z4F A;  4Q4V 1;  4LHK A;  1Z7S 3;  4HXC A;  1UAI A;  1O3R A;  2Y6L A;  5FBZ A;  4HOO A;  2JE7 A;  3PNA A;  3I59 B;  2X5I C;  5FZG A;  4EWD A;  1VBB 1;  4ZU7 A;  1NYW A; 
#chains in the Genus database with same CATH homology
 2J1V A;  2BGP A;  2WZE A;  3A22 A;  4XUT A;  2VMF A;  2XOM A;  3LQC A;  3ACI A;  2W46 A;  1UY3 A;  1PMH X;  2VCB A;  1WKY A;  1OH4 A;  2VZT A;  3ACG A;  1US2 A;  3OBA A;  3E1F 1;  5LA1 A;  4LQR A;  4PT6 A;  2VMC A;  2J1E A;  4CUC A;  3HPN A;  4RYD A;  4BJ0 A;  2VR4 A;  3I3E A;  2BBA A;  3WNL A;  3NNG A;  3OGR A;  4CU7 A;  5JXJ A;  1GMM A;  2KD7 A;  3C7O A;  2C26 A;  3THC A;  2Y64 A;  3W5N A;  4QDS A;  4DUV A;  4ZXE A;  4TXW A;  3UET A;  4QB2 A;  5IFP A;  1XNA A;  1JZ6 A;  3I2J A;  3ETP A;  3T2Q A;  1JZ8 A;  4TTG A;  4UAP A;  3D3A A;  3LEI A;  3K75 B;  2B4K A;  5C7G A;  3GXU A;  2ZEY A;  1NX9 A;  3WF0 A;  2EIE A;  1K3I A;  4BXS V;  1W8O A;  4GWI A;  3MV1 1;  1KGY A;  3K46 A;  4YPJ A;  4QB6 A;  3THD A;  3WF3 A;  5G04 L;  1L7R A;  2W9X A;  1CZV A;  3P6B A;  2J1A A;  1W9W A;  2LW8 A;  2WN2 A;  3A21 A;  1UY0 A;  2W94 A;  3WNN A;  5JUV A;  5DPN A;  1DLC A;  3ABZ A;  3GM8 A;  3CMG A;  1TG7 A;  2DCJ A;  1PX3 A;  5EIY B;  1JZ3 A;  2YC4 A;  1YQ2 A;  4P5Y A;  4XUO A;  3MBW A;  2E26 A;  4KI5 M;  4A44 A;  1SG3 A;  2WAA A;  5JXG A;  5JR2 A;  2JE8 A;  1JYV A;  3P1I A;  5JMO A;  3FHQ A;  1W99 A;  3T0B A;  2J1R A;  1OF3 A;  4CUA A;  5JXI A;  2VQT A;  4QX0 A;  2QBX A;  3I3D A;  4ET7 A;  5C70 A;  4M4P A;  2WUH A;  4ZZ8 A;  3WF2 A;  4BDV B;  4QPW A;  5J1X A;  2C9K A;  2QQJ A;  2W91 A;  1W8N A;  4M4R A;  4A45 A;  2YB7 A;  2PQS A;  2V4V A;  1NAE A;  4MOA A;  3LEG A;  2WO2 A;  5IFT A;  3CKH A;  3IB3 A;  4A6O A;  1GOG A;  4JHZ A;  4JKM A;  4GWJ A;  3CDZ B;  1UXX X;  3OGV A;  4QAW A;  2QQI A;  4BK4 A;  5A1A A;  5I0D A;  4XZU G;  3WF1 A;  2V5D A;  2J1U A;  3MO4 A;  3LPG A;  4DUX A;  2VZQ A;  3PUI A;  2VO5 A;  2VM9 A;  2ORX A;  5B4X A;  1K45 A;  1PMJ X;  2CDO A;  4ZZ5 A;  5G05 L;  3VDB A;  2DCK A;  3I2I A;  3EB7 A;  4L0P A;  1K12 A;  4QDR A;  3BN6 A;  3OGS A;  3HNY M;  4A3Z A;  2YG0 A;  3I2F A;  4P00 B;  3GGL A;  4DUW A;  3C7E A;  2VL4 A;  5EJ1 B;  2BZD A;  1CZS A;  2X05 A;  3I97 A;  2VCC A;  3DYM A;  3T2O A;  2QQO A;  3HNM A;  3UES A;  1XNT A;  2VZU A;  1JZ2 A;  5DN2 A;  2HLE A;  1UWW A;  5C71 A;  3SEE A;  5F7U A;  1UY4 A;  3CQO A;  3HNB M;  1K42 A;  1JYX A;  3HN3 A;  5LA0 A;  2V72 A;  1EUT A;  4P08 A;  2RVA A;  1RYY A;  2VJX A;  4KMQ A;  3WNM A;  3T0D A;  2ZEX A;  4A42 A;  1UYX A;  4P02 B;  4MGQ A;  1F4H A;  2VMD A;  2C4X A;  1GNY A;  4AG4 A;  3C7H A;  2Y6H A;  3OEB A;  2WDB A;  3CZU A;  2WO1 A;  3GDB A;  1L7Q A;  2ZXQ A;  3OEA A;  3K4Z A;  3III A;  1JZ7 A;  4DXS A;  1UYY A;  4PQQ A;  4RN5 A;  3SKV A;  4E8C A;  3CZJ A;  1O8S A;  5IJR A;  5B4N A;  3VD5 A;  2YC2 A;  3C7G A;  2VZO A;  3LPF A;  2W5F A;  2W3J A;  3ZM8 A;  2WAB A;  1WCQ A;  3HJR A;  2ZEW A;  4QX1 A;  4FI9 A;  3SKJ E;  1XPW A;  2E33 A;  3K4A A;  2VQU A;  5DMY A;  2CDP A;  3ACF A;  1UXZ A;  3WQB A;  2QQL A;  4CU9 A;  1UZ0 A;  1UY1 A;  3OB8 A;  1CZT A;  2VZ3 A;  3NQH A;  1OD3 A;  4DXR A;  1DP0 A;  3SEP A;  1SHW B;  4D8M A;  3K77 A;  3JXS A;  1LNS A;  3FHA A;  3ECQ A;  4A4A A;  4LKS A;  1JZ5 A;  1GOF A;  1O59 A;  1OF4 A;  1PX4 A;  1JYW A;  2VZP A;  2WAO A;  4MGS A;  1ULP A;  2RV9 A;  3UNP A;  2WQ8 A;  2VZS A;  1UMH A;  2QQN A;  2W47 A;  3HEI A;  4OMC A;  1GQP A;  4KWU A;  2XON A;  1T2X A;  2W1S A;  2LS6 A;  4W4Z A;  2VZ1 A;  1ULO A;  4QB1 A;  4OMD A;  4LPL A;  3VD4 A;  2W1Q A;  4OZO A;  3F2Z A;  3FN9 A;  2JD9 A;  3PUH A;  2Y6K A;  4JX0 A;  5IYY A;  3MV0 1;  3A23 A;  3W5M A;  1UX7 A;  2VZV A;  3NRU A;  5HPO A;  5HXM A;  1HN1 A;  4W50 A;  4XUN A;  1IQD C;  4DXT A;  4XUQ A;  4CU6 A;  2W95 A;  3HOB A;  4OUE A;  3A7Q A;  3NJV A;  2ORZ A;  3T0A A;  3IAQ A;  1GOH A;  2E32 A;  3C8X A;  4BK5 A;  4CVU A;  4UOJ A;  3WNO A;  4JKK A;  3NJX A;  4LHS A;  1P8J A;  2BGO A;  2X09 A;  1UY2 A;  2W87 A;  5LA2 A;  1O8P A;  1DYO A;  1EUU A;  2YFZ A;  1US3 A;  4DEV A;  3FL7 A;  2VOT A;  3I3B A;  2Y6G A;  5CZK A;  3BGA A;  3I2K A;  5DQ0 A;  2J1T A;  2J1S A;  4MAD A;  1NKG A;  1W0N A;  5EJZ B;  4ARX A;  3WF4 A;  1JHJ A;  1OT5 A;  4DEQ A;  1NUK A;  4AAX A;  2VC9 A;  2WYS A;  2WBK A;  3DYO A;  3VD9 A;  4HG6 B;  2X10 A;  4W8J A;  1UYZ A;  3WSO A;  2ZEZ A;  1CX1 A;  2WN3 A;  4XUR A;  1F4A A;  2DDU A;  3VD7 A;  5LCW L;  3AC0 A;  3LE0 A;  3WNK A;  4ZY9 A;  2VCA A;  3EYP A;  4UI9 L;  2YFU A;  4MO3 M;  2JKX A;  2B9V A;  1KEX A;  1MPX A;  1JI6 A;  1XC6 A;  2Y6J A;  4D0Q A;  3DYP A;  2J7M A;  1CIY A;  3DEC A;  2XQX A;  3LEK A;  4XVH A;  2E31 A;  4E8D A;  3T2P A;  2VTF A;  1SDD B;  3MUZ 1;  3I2H A;  3J7H A;  3T08 A;  2J22 A;  4CUB A;  3VDA A;  1H6X A;  1R64 A;  2EID A;  3IDA A;  1JU3 A;  3CIH A;  3T09 A;  3VD3 A;  4IUG A;  1J83 A;  3ACH A;  2EIC A;  2W1U A;  2QQK A;  2BER A;  2WZ8 A;  5JXH A;  1GU3 A;  1J84 A;  2WO3 A;  4QX2 A;  5IHR A;  1BHG A;  1W9T A;  4GZ9 A;  5FUI A;  2Y8K A;  1JZ4 A;  1I5P A;  4OYU A;  2VME A;  4ARY A;  1GUI A;  2VZR A;  3I2G A;  4JKL A;  2HYX A;  4Z2A A;  3IAP A;  4A41 A;  2QQM A;  2XHN A;  4QDQ A;  2L9L A;  3MUY 1;  4QX3 A;  1D7P M;  2W1W A;  3K4D A;  1H6Y A;  2ID4 A;  3WNP A;  3OG2 A;  2W92 A;  3WEZ A;  5CYY A;  2JDA A;  2EIB A;  4CU8 A;  1TVG A;  1W9S A;  2OKX A;  1UMI A;  3C7F A;  2Z4F A;  4XUP A;  2RJ2 A;  1JYN A;  2R7E B;  3U37 A;  1JU4 A;  2Y6L A;  3VDC A;  4PF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...