4A44A

Cpgh89cbm32-5, from clostridium perfringens, in complex with the tn antigen
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
140
structure length
140
Chain Sequence
ASALPQGNMKATATSEHPDVGNEGLAKFAIDGKENTIWHTKYNPVEELPQSITLELGGSYEINKFTYLPRSGAKNGNITKYELHVSEDGNNFRKISEGNWDDSGSLKTLKFNSTKATHVKLVALEGVGGFASAAELNVFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Carbohydrate Recognition by an Architecturally Complex Alpha-N-Acetylglucosaminidase from Clostridium Perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
molecule keywords ALPHA-N-ACETYLGLUCOSAMINIDASE FAMILY PROTEIN
total genus 30
structure length 140
sequence length 140
ec nomenclature ec 3.2.1.50: Alpha-N-acetylglucosaminidase.
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4a44A00
1W8OA 2L9LA 4PQQA 4W50A 1PX4A 5A1AA 1W9TA 2WAAA 2ZEWA 3DECA 2JE8A 1CX1A 2VM9A 4ARXA 3T09A 3GM8A 2YC4A 2QQNA 3JXSA 3U37A 2VMFA 2ZEYA 4JKLA 4ZY9A 2VR4A 3C7HA 4CU9A 4P5YA 4P02B 4XVHA 4E8CA 2LW8A 1GNYA 4QDQA 1R64A 1JZ4A 4QX1A 2YFZA 3C7GA 3LE0A 2VZQA 4QB2A 2DCKA 4MOAA 4QAWA 1EUTA 3C7EA 5JMOA 3I2IA 2E31A 5LA1A 1YQ2A 1K45A 1JU3A 3UETA 3T08A 1F4HA 4XUOA 2W1QA 3MV01 2W87A 2RVAA 4TTGA 4LKSA 5EIYB 2BBAA 4QB1A 2HLEA 2VMDA 3T2OA 2X05A 3LEIA 3CZUA 1GMMA 1NUKA 4CUCA 3CKHA 5B4NA 5G04L 1K12A 3K77A 3SEPA 4YPJA 3ACHA 3A22A 3EB7A 3BGAA 3NQHA 3PUHA 3I3DA 3I2FA 3GDBA 3FN9A 5IHRA 5LCWL 3VDAA 3MUY1 4RN5A 4FI9A 5HXMA 2E26A 1EUUA 4QB6A 3ZM8A 1OH4A 5EJZB 2X10A 2VZVA 4BK5A 1F4AA 1L7QA 4XZUG 2W1WA 3HOBA 4XUQA 2J7MA 3K4ZA 4D8MA 2B9VA 4BXSV 1KGYA 3I3BA 3P1IA 3DYMA 1PMJX 4GWJA 1MPXA 2C4XA 5IJRA 5CYYA 1UY0A 3HN3A 3A7QA 2WO3A 1XNAA 2LS6A 4MO3M 1UMHA 1DLCA 2QQOA 4Z2AA 2QQIA 2R7EB 2VO5A 1ULPA 4OYUA 4PT6A 2ZXQA 2PQSA 5C7GA 4OMDA 3NNGA 1PX3A 2CDPA 3WNPA 2Y8KA 3OGSA 1JZ8A 3WF4A 2QQMA 3NJXA 2V5DA 4MADA 2BGPA 2WABA 3WNNA 3C7FA 2W1SA 3WF3A 1O8SA 4ET7A 3LPGA 2VZ1A 3T0BA 3WNOA 5C70A 3T0DA 2WN3A 3I2KA 2VCCA 2VZUA 1SHWB 3GGLA 4JKKA 4A45A 2EIEA 2J1TA 3DYOA 1H6XA 2VMEA 4DEQA 2VL4A 1JYWA 4OZOA 4DUXA 1CZSA 2W5FA 1GOGA 1JU4A 2YFUA 4QPWA 5IFTA 2JD9A 3T2QA 2RV9A 3DYPA 2WUHA 1GOHA 2BGOA 2W1UA 1OF4A 1I5PA 5HPOA 3VDBA 2VCBA 2OKXA 1UMIA 3P6BA 3CQOA 2JDAA 1XC6A 2WAOA 4MGQA 1HN1A 2W91A 1US3A 3OG2A 2Y6GA 3T2PA 5JUVA 2Z4FA 3SEEA 1O8PA 3VD3A 5LA2A 1JZ5A 1J83A 1US2A 4QX3A 4A44A 4QDRA 1JZ3A 2ZEXA 2VZPA 1DYOA 2VZTA 2WO1A 3ABZA 2J1SA 4UOJA 2BZDA 2WO2A 3THCA 3EYPA 4JKMA 5LA0A 4OUEA 1CZTA 2QBXA 4JHZA 2VC9A 3C8XA 2W3JA 3OGRA 5G05L 3AC0A 2B4KA 2C9KA 4A3ZA 1OD3A 1NKGA 3UESA 3VD7A 3I3EA 5EJ1B 1JI6A 2WBKA 3HNYM 3ACGA 4JX0A 3I2HA 2Y6JA 5DMYA 1XNTA 5B4XA 5IFPA 3MV11 1RYYA 4A42A 4L0PA 1UY3A 2KD7A 1W9SA 2Y6LA 2YB7A 4QX0A 4BDVB 1XPWA 2Y64A 2W47A 3OGVA 2Y6KA 1DP0A 4KMQA 2W9XA 3WF2A 4RYDA 4ZZ5A 3HNMA 2QQJA 2RJ2A 1IQDC 3I2GA 2J1RA 2J1AA 1GU3A 4ZXEA 4PF1A 5JXGA 3VDCA 4XUPA 5JXJA 3I2JA 3IAPA 3LEKA 4HG6B 2J1VA 4DUWA 4BK4A 4CU6A 2EICA 4CU7A 4AG4A 3GXUA 3MBWA 5I0DA 1H6YA 2EIBA 3MO4A 4UI9L 2J1EA 3SKJE 4LHSA 1UXZA 4KWUA 1JZ2A 2WDBA 3LQCA 1P8JA 1JZ6A 3I97A 3K4DA 2XOMA 4LQRA 2VCAA 2VJXA 1JYNA 3CDZB 1SG3A 5C71A 4MGSA 3VD5A 3UNPA 3IDAA 2QQLA 3LEGA 3HPNA 4AAXA 2ORXA 2WZEA 1T2XA 5CZKA 1GUIA 4DXRA 3IIIA 2EIDA 4TXWA 2ZEZA 3A23A 3MUZ1 2BERA 3K4AA 3HEIA 1OT5A 5JXIA 2QQKA 2XHNA 2E33A 4ARYA 3NRUA 4DXSA 1LNSA 3FHQA 3WSOA 2ORZA 5DPNA 1K3IA 4CUAA 4E8DA 1CIYA 1TVGA 2DDUA 3BN6A 3WNKA 4CUBA 5FUIA 3OEAA 2V4VA 2C26A 1UYXA 1NAEA 1UY1A 4A6OA 3CIHA 3ETPA 1BHGA 4LPLA 4XUNA 4GZ9A 3J7HA 4DXTA 2VZRA 1GOFA 5DQ0A 1UX7A 3C7OA 5J1XA 2J1UA 1JYVA 1UYZA 2YG0A 1D7PM 2W46A 5JXHA 4ZZ8A 3D3AA 1UYYA 4A4AA 1J84A 1W9WA 2VZOA 2WYSA 4QDSA 3W5NA 3K75B 4GWIA 2VMCA 2Y6HA 4W4ZA 1W99A 2WZ8A 3PUIA 3OB8A 2VOTA 1ULOA 4P08A 1UWWA 1PMHX 4DEVA 4QX2A 1SDDB 2WQ8A 2W92A 2X09A 2JKXA 3WNMA 4CU8A 2DCJA 2VZSA 2XQXA 3ECQA 3A21A 3VD9A 2VQUA 3T0AA 1JYXA 2CDOA 3IB3A 4W8JA 1UXXX 4CVUA 4XUTA 4BJ0A 1GQPA 1NX9A 1OF3A 3OBAA 2VZ3A 5DN2A 4DUVA 1KEXA 3W5MA 2VQTA 2V72A 2XONA 3WQBA 2ID4A 4XURA 2W94A 1JZ7A 2W95A 1L7RA 1UY2A 3ACIA 4D0QA 5F7UA 2VTFA 3SKVA 3HJRA 2E32A 4UAPA 4A41A 3FHAA 3E1F1 4KI5M 4OMCA 3LPFA 3F2ZA 3WNLA 2WN2A 3CMGA 1K42A 3WF0A 3HNBM 3OEBA 3WEZA 3VD4A 2YC2A 3WF1A 3THDA 1TG7A 3CZJA 2HYXA 3IAQA 5JR2A 1WCQA 1UY4A 3K46A 2J22A 3FL7A 4P00B 5IYYA 1UZ0A 3ACFA 3NJVA 4IUGA 4M4PA 1W8NA 1O59A 1WKYA 1CZVA 1JHJA 4M4RA 1W0NA
chains in the Genus database with same CATH superfamily
1ENQA 2DFBA 4R9BA 1PX4A 3OPTA 4H14A 4RR3B 3W20A 4YW4A 1BEV1 2Z69A 4N8MA 4NHLA 1VP6A 5DXDA 1FV3A 3OD4A 2ZGMA 3RG0A 3V65A 2VM9A 1YHFA 2TUNA 4K40A 5KBFA 3VBOB 2YC4A 2HKXA 3UGFA 1HRI3 3VBFA 1PGW2 3U37A 1VBE2 3W21A 3KWVA 3I59A 2X29A 3FFZA 4JKLA 1HRI2 4ATEA 2GNMA 4FPCA 4P02B 2VUCA 5CFDB 3LD8A 4E8CA 3B9IA 3QCWA 4QDQA 1AR73 4AHWA 4XBNA 5ACA3 2P6CA 4QX1A 3WOGA 1X8MA 3LE0A 2GP3A 1VRH3 5GM0A 2RMU1 1JUHA 4X8NA 4QAWA 1UKGA 3B7MA 5C3QA 3ZDVA 2DUOA 1W3VA 2ZA9A 1V6KA 4LORA 5A3LA 2VVEA 1JU3A 2R043 2Q8CA 1F4HA 1ZRCA 2TEPA 2PHUA 2OW4A 4IW3A 4XUOA 5AVAA 2W1QA 3I2DA 1HV0A 3TEWA 1DQ5A 4TTGA 4E27A 3O0VA 2OYZA 4COVA 4HZFA 1GP4A 1VMFA 4HL0A 4MLOA 4QB1A 5A7QA 1ZVFA 4EN9B 3LEIA 3AP5A 2ARXA 1MQTB 1WMEA 4FVVA 4OUSA 3CKHA 4LA2A 1AR93 4JGYB 4BQ4A 4K3UA 2PHFA 4TZDA 5G04L 2HBTA 3TWIA 1H8TB 4YPJA 5DDJ2 1L3JA 3KV6A 5GZDA 1RUF1 3QBQA 1C1FA 2ZZQA 4P9GA 1OVSA 4NWVA 3PUHA 1AR61 2ARAA 2DVGA 4HN0A 4BMBA 3PU3A 3I3DA 4CCKA 3I2FA 1QOOA 2QUOA 2XJRA 1OH3A 3M4FA 4GMP3 4CDXB 3VDAA 2ZHKA 4LKEA 1SPPA 1G9BA 3ES4A 2VAUA 1DFQA 2VPVA 1HRV3 2NQYA 1YQ6A 4FI9A 4DXZA 3S6PA 1EUUA 4NIIA 1WLDA 5CVRA 2PMWB 4YZ4A 1PNFA 4SBVA 2GN3A 2X10A 3AL6A 2VZVA 4Q27A 2XWJB 3UJQA 1W2UA 1AYM3 5BNNA 5FY9A 4AFMA 3OD0A 4Y5SA 2J7MA 2YV8A 5AC91 3VBOC 2X5IB 4IEPA 4OHVA 2B9VA 3QH6A 4N90A 3I3BA 2HWF1 4H7LA 4JDNA 3JQXA 2OIIA 5F3CA 4GWJA 3D82A 4WVMB 1W04A 1XE0A 1WD3A 4K21A 1CJPA 4RR3C 2C4XA 1W9YA 5BUVA 3M7AA 1UY0A 5F37A 3BB6A 1HRI1 3HN3A 2C5DA 1XYPA 2NM1A 2XG3A 3A7QA 4AFBA 1ND2A 1S0JA 3W58A 1QJU2 4C8DA 4IV3C 1XNAA 4FPKA 4FFFA 1DGRN 2XHKA 5GZGA 1N1VA 3DN7A 4I3GA 3GZUC 2QQIA 2R7EB 4Z2AA 3BTYA 3ZYGA 5BYNA 1XJAA 4DPNA 1RUD1 1SBDA 1YI9A 3K48A 5T5PA 5EP9A 3SLIA 3UKNA 2P3YA 4ZU5A 1JYCA 2AZ5A 1UF2C 3J4UH 3V0BA 3BPZA 1NY72 1VB4A 4ZU7A 5F3IA 5FQ0A 1DBNA 2JICA 3KF5A 1DIWA 1G9CA 1JOBA 2BWAA 2KA3A 3AB0A 4HVOA 4AE2A 4R9AA 1AHSA 4MADA 4XJ9A 2WNVB 3FLPA 2WABA 3CF6E 5FLHA 3LDRA 4B4RA 5A3TA 4BZ4A 4P5HA 3USSA 2XJSA 3QD6A 1R1ZA 4Q26A 4JGZB 2A6WA 2WNUC 3WNOA 4S2HA 1IPKA 2WWSA 2WN3A 3MIGA 5A32A 2VCCA 4FOQA 2GU9A 4XW3A 2ZMNA 1BXHA 1WMDA 1QOSA 1DGRA 1SHWB 3GGLA 3CJIC 4D69A 2D3PA 1PGL1 3ENRA 2J1TA 4C0HA 2UWAA 3VL9A 2XVLA 1S0EA 1N1TA 5FUPA 1GZWB 1RUE1 4NPLA 1PM7A 4IEZA 4DEQA 1JYWA 2R0HA 2JDMA 4FPYA 4X6RB 3LDBA 5FY0A 5ANQA 1CZSA 4XDOA 4GQ7A 4MGKE 4C0BA 5C4WC 1W0OA 5FBJA 3VBUB 2YFUA 2N7GA 3EJKA 1Y4WA 2CWSA 3VZLA 2JD9A 1LESA 2ES3A 4WZFA 3KV5A 5FXZA 4UW3A 2W39A 2RV9A 4XJWA 4YW3A 4W6YA 1EYBA 2YBSA 5DUWA 3P3PA 1E5HA 4WM8C 5HPOA 2RS32 3VDBA 3FC0A 1R1A2 2OKXA 5CA6A 1XYOA 1PZ8A 5IK4A 2HBUA 5F5AA 2JDAA 5FZ8A 2WAOA 3OG2A 4YYOA 2Y6GA 1HB2A 5BPXA 4YVSA 3SEEA 2W52A 4LBLA 1VPHA 2A7AA 1MR5A 3ZKYA 4QDRA 4J1WA 5KXCA 1BQPA 1Y43B 2PHWA 1JZ3A 5K8SA 4AGRA 2E9QA 4GJZA 4ES9A 3PTYA 3BODA 4V2VA 3AMMA 4NVPA 3ABZA 2A71A 4QPIB 4CXXA 4AGGA 2O14A 1FOD3 4UBGA 4ZS2A 5ERLA 1O3QA 2R041 4YW1A 3VL8A 4FAGA 3THCA 5BY5A 4Q2FA 2RDSA 2E51A 2WQ4A 3MHZA 5LA0A 1QIQA 3TBDA 2P2KA 2QBXA 3IKWA 2VU9A 1EV12 4ES8A 2BPA2 2E7TA 2NMOA 2W3JA 5G05L 3AC0A 2WLPA 4UFLA 4DIQA 2ZZJA 3H42B 3LB9A 4YGBA 2ZX2A 1UAIA 1VLNA 2GC1A 2R042 1N1SA 2XBO3 2Y6FA 3KVBA 3OUIA 4IDZA 4XF4A 1NKGA 3UESA 3VD7A 2YYOA 3I3EA 2Z79A 2PHTA 2ZHMA 4IEOA 4LIVA 1OPMA 5JIAA 4OHZA 4COZA 4Y33A 4QHOA 1DLLA 1ULEA 1YFYA 4JHTA 3PIGA 4Y20B 4XFCA 1W6OB 1QHDA 2MPFA 3K3NA 2QQUA 3NJYA 2ZTNA 3MV11 3ZXGA 2D3SA 1SLCA 5IVFA 3B9CA 5J09A 4AVBA 5EXOA 4DQAA 1W9SA 3DF0A 1XNCA 2JDYA 4NWWA 3EXUA 1HQLA 4GWMA 1TME2 1PVXA 4M3CA 1GKBA 4XCAA 3OGVA 3T1LA 1RUH2 4QKBA 3VBHC 2UY9A 3WQ7A 5L9VA 2P1BA 4GMP0 2QNKA 5LY1A 2W9XA 4XACA 4YGDA 3WF2A 4HKLA 1WCSA 5JZGC 1Q8VA 3KV9A 2VXJA 1GV9A 2QQJA 3A4UA 2HEWF 5JZGA 4MH0E 2J1RA 3MYXA 3AZVA 4ZXEA 5A1FA 1DZQA 3MDPA 5C9AA 5EPAA 2D43A 2D6NA 3VDCA 4CDWB 2DFCA 1SFYA 2FD8A 4BQWA 4IEYA 4WVWA 5FYZA 2G9ZA 1W2OA 2J1VA 1I6XA 2ZAHA 3AVSA 2HWE3 3OTFA 5FZ3A 3L2YA 1H4GA 3VDDB 2EICA 1CAXB 4CU6A 4YZ2A 3S5AA 2EXJA 2PHLA 1F5FA 4CU7A 2H0VA 4AOCA 1AXYA 1QGLA 4GH4C 1Z7S3 4OI2A 3N7LA 4O9GA 5FPXA 3UJOA 2FBEA 2QVSB 4YGEA 4NHKA 2ET1A 1SLLA 4PLMA 4OI1A 2YMZA 3ZMNA 1U5XA 1NCQB 2LALA 2BNNA 2VOWA 2JB4A 4FP2A 2ZCWA 3WHTA 5LEJA 2WT0A 3FE5A 2NMNA 3M3EA 4PJYA 1W6MB 2VUDA 4RFRB 4B8EA 3N9OA 5D8AA 5JWPA 3RZKA 4KWUA 2A6ZA 4IV1A 1TZOA 1VAKA 3F95A 4AGVA 4FPFA 1DQ6A 3ZPYA 4BYYA 2QJVA 5T54A 4CTEA 4LQRA 5IVEA 2WNUA 3AYDA 3QACA 3J8F2 4MVTA 1O4TA 2EAAA 1ZRIA 2JG9A 3N9NA 1OVPA 3QOPA 3CDZB 5L7OA 2D98A 3NO8A 3ZX7A 1LEDA 2ZGTA 2DVBA 5FYMA 1RTVA 4RS5B 3D0JA 3HPNA 1JW6A 2PLV3 2WZEA 3AZXA 4HPKB 5I8SA 4BQ1A 2QQWA 1T2XA 3RJRA 5CZKA 4INDA 3N4MA 1V00A 4RGKA 2C0ZA 2I2SA 5K0UB 4TXWA 3ZIXA 1KFUL 4C1XA 5GLZA 2P5BA 4CDXC 1AJOA 1HB3A 1J1TA 4H3WA 3MUZ1 2RJLA 5FZOB 3WDVA 5ISLA 4AI1A 1C5IA 3V0AB 4GWNA 3WX5A 3VZOA 1EP0A 4FXKB 2QQKA 4I2OA 3NRUA 1S55A 2R0FA 4A2UA 4IXLA 5JSOA 1H8TC 3WSOA 1GNHA 4LEJA 3VKOA 3ALQA 1HXS2 5L9RA 4E8DA 1VBD1 3BN6A 2VH9A 4YRDA 4FOYA 4NUBA 1YFXA 2PAKA 5FUIA 2DURA 3OEAA 3PVEA 2C26A 1OD5A 1UYXA 1NAEA 5EQUA 1UY1A 3B01A 1BEV2 1RUJ1 3BTAA 2OQ7A 3OCPA 1ONAA 1REEA 3AKQA 4LBKA 5FLIA 1BHGA 1AJKA 3VBSC 5AC93 2OA2A 1JH5A 4BA6A 5AC92 3ZR6A 4YZ5A 1UCXA 5F5QA 5BNNC 1X33A 4IEVA 2JB8A 3DUIA 1UYZA 3NAPC 1K5MA 3AVRA 4LNVA 3WDUA 3AKRA 3N3HA 1UYYA 4A4AA 3WDWA 2P37A 2CYFA 1HQNA 1RUJ3 3TEYA 5J36A 2IVIB 3NNJA 1RUJ2 1F15A 1W9WA 2VZOA 2K2SA 3JB4C 3KQRA 4QDSA 5FWEA 1AR62 3TN91 2D7FA 4GWIA 1RUD3 1FOD2 2G9GA 5CB7A 1XSQA 1RMU1 1RUD2 1H8VA 1WW7A 2WZ8A 3MIEA 1I3HA 1A78A 3WP6A 1A8DA 1HQWA 3Q8CA 1W06A 4E9KA 1S0FA 1EV13 1Q8QA 1U12A 3DPRB 2G19A 4P08A 3WG4A 1PMHX 3RYRA 3RZMA 2X09A 3FBYA 5FPZA 3ZDSA 5ABJB 1ENXA 3ZFFC 1ZYBA 2ARBA 3MF9A 4WM8B 1WA4A 4CCOA 3AMQA 4LBOA 4NN0A 2VZSA 5C8WA 2DCTA 3RRDA 1W28A 5FOJB 2QQPA 4D7TA 1UOFA 2LM3A 1ULCA 3GNEA 1FPN2 1POV3 3AP9A 1SFPA 2GMEA 4P9YA 4HKWA 1W6NA 1UYPA 2QZ3A 1S4CA 2QQVA 1MZEA 1F31A 1C3HA 4JTNA 5T5LA 3ZFEC 4XABA 2PAEA 1GR3A 2D6KA 2VECA 1NOVA 1GQPA 4BJ0A 3LCPA 5LY2A 2CGNA 4QPGA 2MEV3 3PTRB 4DUVA 1OLMA 3N9PA 1KEXA 4L99A 1WUVA 5F6KA 1V9U2 2XXZA 2O1QA 2W95A 4N9IA 4NRMA 5CISA 1W6PA 2WA3A 4XE9A 5FZ4A 4D0QA 3D8CA 2VTFA 3O1OA 1RUG3 5BNOB 3ZOIA 4UAPA 5FYHA 4DINB 1RUG2 4OMCA 5FYTA 2A6XA 3OY8B 1RUI3 5A33B 3N9LA 5A3WA 3CMGA 2F4PA 3PUSA 2XMLA 3ZIWA 4EN0A 3LOBA 1LAJA 2I45A 3WEZA 3VD4A 5CAZA 1APNA 1W8HA 2HEVF 3THDA 1TG7A 3CZJA 1AF9A 3KCXA 2Q30A 2JG8B 2RDRA 1UY4A 4BIOA 4JCKA 3RVHA 2YROA 2ZX3A 3FL7A 3ZFEB 2H6BA 4D6SA 4NJ4A 2VMIA 3M1HA 1EPZA 2XLGA 1X7NA 3WG3A 4K6BA 5C3RA 1ACCA 1W8UA 2XJVA 3ACFA 3NJVA 5T5JA 4B29A 1W8NA 5FO7B 2YC0A 2YBKA 3CJIA 3Q9OA 1O59A 2BTVC 4R8HA 3UKVA 1PO21 4CXYA 1TQ5A 3IWZA 4CDQA 4BQ5A 4E4ZA 3RZGA 4DO0A 1IS5A 1C4RA 1W0NA 4ZXKA 5IVVA 2L9LA 2QDRA 4W50A 5FRAA 3GBFA 3FX3A 2BDRA 5A1AA 2R063 1W9TA 1YWKA 3AFKA 4JGYC 4JDOA 3O1RA 4E4DX 1OHFA 3WZ1A 3DECA 2JE8A 1M06G 4S2DA 5FZFA 4NAMA 3T09A 3THPA 3O5SA 3PVBB 5APAA 1WW4A 4PLOA 3JD72 3VBHA 1B35A 1MS3A 5FV3A 1KRIA 3C7HA 4XTPA 4LBQD 4P5YA 4L92A 4XVHA 3DL3A 2AENA 1R64A 1AZDA 2BUKA 3POGA 3U07A 2VZQA 4EE2A 4QB2A 4IL7A 1EAH3 1ZZCA 2MHFA 4N43A 1VRH2 2JDHA 3RFRA 1BZWA 1EUTA 1Y7BA 3C7EA 5FXWA 4AHYA 2FMYA 2G1MA 2B42B 5C5UA 4Z8BA 3VBOA 1IPSA 1YFUA 2UY8A 4K7JA 2ZBJA 1SBFA 5DUXA 3U4SA 5T3NA 3ZXDA 5CFDC 2VGDA 4AVTA 3T08A 3U0ZA 5CFDA 2VUAA 4K9SA 1N47A 1PMIA 1ZBA2 4BM8A 1R1A1 1NA1C 4Y22B 1WLCA 2VMDA 5SV5A 4DOUA 1RUG1 2WJSA 3CZUA 2EA7A 5JMCA 4BMEA 1AR92 1LJ7A 1PHMA 1NUKA 4FP3A 4DRVA 1SCSA 1XU2A 5B4NA 3SEPA 1C5HA 3K77A 1ASJ3 1YQ8A 4EQVA 4G3YC 4J1XA 5DG1A 1JOPA 3OUJA 2D5FA 4RQPB 3EB7A 2OVUA 3NQHA 3LFMA 4B7KA 1V70A 4MHRA 1RHI2 3M8LA 4AVAA 1K5MC 5IHRA 2AR6A 2WWJA 3KT4A 5CFCA 4Q1RA 4IERA 1IS6A 1YEWA 1YFWA 1VR3A 2R1DA 4QB6A 1OH4A 2HWF3 3SNMA 2ZX0A 4NIHA 4ORFA 4YZ3A 5FZDA 1ZZ9A 2VE1A 4XPVA 1PO22 1FNYA 1F4AA 4ZPIA 2VTXJ 3SH3A 4E2QA 4XJAA 3GJAA 1KQRA 4XZUG 4FCAA 3WD5A 3HT1A 2NN8A 3K4ZA 3RPQA 4XDPA 2XGXA 4H55A 3WNXA 2Q4SA 3G6JB 1PO11 2BEOA 5C4WA 2JIJA 4QMAA 3AP7A 2GMPA 4PI0A 3DYMA 1PMJX 2DBIA 1SLTA 4OUMA 2VCMA 1EY2A 2VMHA 3PIJA 2DVDA 5J98B 5BNQA 5I0SA 1QJY1 1R081 1AR82 3K3OA 5FK7A 5FR3A 4YARA 2DCYA 2BP6A 1LOCA 5DZFA 2LS6A 2VG9A 2WZR1 4MO3M 1GANA 2WT1A 2XL9A 4PIXA 5D21A 3ZYRA 2XPJA 1BMV2 2VO5A 1ULPA 2D6MA 4I0AA 3RI8A 3NNLA 4PT6A 2ZXQA 4YVWB 4HXCA 1A3KA 3HMYA 4OMDA 2GC0A 2D5HA 3NNGA 4BE3A 4PQ9A 1SFNA 4WVMA 5IAXA 2CDPA 5FZGA 3WNPA 2Y8KA 1MZFA 1MQTC 5DUVA 4C1WA 2QQMA 4K8RB 1V6IA 2V5DA 3RMYA 4AEDA 4COYA 4KWLA 2C24A 2ZAAA 5LBFA 2BGPA 1S0CA 1W6QB 1NLRA 4IV1C 3HBKA 4CP9B 4EN8B 4CCNA 2BGCA 2HJIA 3J8F1 1VBA2 4CP0A 2CHHA 3V0BB 2TBVA 3T0DA 3EMRA 3T2TA 2EALA 2GAUA 1QJFA 5CU1A 2VZUA 1REDA 4XJZA 4IETA 4IGQA 2VOKA 4M0NA 5FY7A 4YLZA 3WCRA 3AZYA 5FY5A 4EYUA 5FPAA 3HWJA 1JYIA 5FK8A 3I4IA 2EIEA 2WZR2 4HBNA 4O9EA 1QQP2 2WNVA 3O0XA 5C3PA 5KXDA 3OF1A 4MSVA 5IW0A 3DYOA 3ZN4A 4HN1A 4QT6A 1OOPC 2BV4A 3W9AA 1HN0A 1PNGA 3A0KA 4I0WB 1IZ3A 2VL4A 3CHXA 4LKDA 3BVCA 4P14A 5FCCA 4OZOA 2DTYA 4O65A 2CTVA 2W5FA 4HKOA 3KF3A 3POJA 5ANNA 2P3KA 2CV6A 2VTXA 2VW2A 1NE4A 2OPKA 1MS9A 2Y0IA 3K2OA 2QDNA 3PURA 1RMU3 3RWNA 1SEFA 5CEHA 1LGNA 5I0UA 2BGOA 3PJYA 1H2MA 2W1UA 3CBNA 2VCBA 3S30A 5JVVA 1NCQC 3LDKA 1EV11 3P6BA 2RS33 4LHNA 1W05A 4XMAA 1XC6A 1HN1A 2W91A 5AFEA 4LO8A 3UK9A 5HV0A 1DDLA 4OLLA 2Z4FA 3H9AA 1Z0HA 1J1LA 2PA7A 2UWCA 4FPHA 4OHWA 4Z2WA 1ENSA 1JZ5A 3J7MA 3T30A 4QX3A 4I09A 4LE4A 2FHRA 2PFWA 4V2WA 1FXZA 2XH6A 2ZEXA 4N53A 2VZPA 3KCCA 1ZRRA 4IQPA 2FCVA 2VNVA 2VZTA 3WW4A 3WQ1A 1UOGA 2J1SA 2BZDA 3O14A 1RJ8A 1CESA 1OC1A 4LBQA 4CCLA 5IWFA 2RS31 4IEWA 4UWDA 3GBGA 2VY0A 1DG6A 1PK6B 2VXRA 5FO9B 4JHZA 1OMIA 1H1IA 5K0UC 4QKFA 2FCUA 3C8XA 2AEYA 4LE3A 4Y1UA 1OLME 3OGRA 1N3QA 3WP3A 5DABA 2B4KA 3M3QA 4Q4X3 4RGGA 1OD3A 4RL7A 4QPIA 5FMOS 1LRHA 1Q8PA 1MEC2 4E2SA 3KHCA 5H9SA 4Q1PA 3SH4A 4H7MA 5F39A 1JI6A 1LULA 2H0BA 3ACGA 3SITA 1KXGA 4IESA 1CPNA 3AJZA 3I2HA 3NW4A 4XCBA 3AYEA 4XHXA 3P5BA 2WS93 1CAVA 4R52A 4A42A 1W03A 4HSJA 1NA1B 3M3CA 3PU8A 3ROUA 3O1TA 3BPSA 2HWC1 2YB7A 4QX0A 2VNGA 2WINB 3NV3A 3UGGA 2FDKA 1YUDA 4BDVB 1HLCA 1XOYA 5IK5A 3N7KA 2YY1A 2Y6KA 4BISA 4IE0A 1AL0G 1DP0A 5BNPA 4CEYC 2VVFA 1CONA 2EVXA 1CN1A 3G7DA 3KM5A 3IMNA 4RYDA 3IM0A 2Q8OA 2OZ6A 3BTZA 3E5QA 1HRV2 3MFAA 1IQDC 3T3YA 1NG0A 4JC1A 3I2GA 4NIAA 1VIWB 1QKQA 5KC5A 4AI2A 1PO13 1QF3A 2B39A 1AXKA 1S1AA 4DS0A 5JXGA 4QGNA 4NIDA 3S57A 1YO8A 4BPZA 5CNAA 5JXJA 3NL1A 1QJY2 1R082 3V56A 1YIFA 1QJY3 1R083 1BK1A 1WCUA 1RC6A 1BK0A 3N7JA 4XFBA 3RZHA 3LKJA 1D4M2 1W2AX 1D4M3 2AYHA 4NPMA 4AG4A 4MGIE 3GXUA 1IQAA 3MBWA 1Z7S2 1E5RA 1FX5A 4P9IA 4XDQA 5SV8A 3PDQA 4LXLA 4Z92B 3MO4A 1LODA 3MI8A 3W59A 2Z2SB 4RQPC 2JE9A 1DU3D 3DKWA 1CR7A 4QX7A 5FZMA 2RM22 1NQJA 2HWD2 5A7NA 3H3LA 5LRRA 4R9DA 4LHSA 2PHXA 4NHYA 1ND3B 1UXZA 2YHJA 1W8FA 3OUHA 5DAQA 2FCTA 1QNWA 3VZKA 3JUUA 3K4DA 3SCGA 1BKZA 1XE8A 3AYAA 3VBRB 2WA4A 1S0DA 4Q0SA 4ASLA 4B1MA 5FO8B 5F2SA 1HB4A 4JQTA 2QTWB 2VJXA 1O3SA 1JYNA 4CDUA 3HQUA 3J8F3 5C71A 1NCQA 2ZPXA 1KDKA 1MVEA 4YG0A 4F7ZA 3IDAA 1G86A 2QQLA 4DY5A 3UNPA 1PGSA 3NKTA 4AAXA 5DAPA 3KV4A 1AR72 5ACA2 2PXJA 1W6MA 2PLV2 2WKKA 5D8AB 2LUWA 4XFGA 2DU1A 4YSFA 4DXRA 5A1LA 1ZRFA 1WBFA 4Q0PA 5EHDA 3GBWA 2DTWA 3NAPB 5EJ3A 4CCEA 3SHRA 4QU1A 2P3JA 2NYYA 3QH7A 3M70A 3NV1A 1IOAA 3K4AA 2HWC2 2JG9B 2XJQA 2WFPA 2R1BA 3EQEA 4RS5C 2I07B 4CA9A 2XHNA 2E33A 4L97A 4DXSA 3IZOA 3AMPA 5C5TA 1S0BA 3HQRA 2PYTA 1LENA 1SMVA 3LOIA 5FAXA 1V6LA 5DPNA 1WBLA 1DGWA 1K3IA 1NYWA 2JIGA 3WW1A 3WNKA 3O1SA 1WCKA 1XXNA 1UOJA 2VW1A 3N9QA 4RHV3 5LBCA 1BEV3 2PQQA 1CAWB 2ADDA 1J3RA 3CIHA 1X9PA 4HOOA 5AVPA 4MXWA 3ZPOA 2LRPA 2XDVA 3HR9A 1D0GA 4GZ9A 2PELA 1RMU2 4DXTA 2OUJA 1GOFA 1R093 5DQ0A 1UX7A 4FOVA 3VKFC 1YIPA 3MIFA 5K7PA 5F32A 1VBC2 1VAMA 3KGZA 3TNPB 3IIAA 5C8CA 2W46A 5JXHA 4ZZ8A 4A7YA 3R05A 3E97A 5JOYA 3PMSA 2BNOA 1PZ7A 1H4HA 1IG0A 1RIRA 3MIBA 5JI9A 5JOXA 5KR7A 1O5LA 1J84A 2Y34A 3D6EA 1YJLA 2RS12 4CCDA 5FP4A 4W65A 2X5IC 4BOWA 4ITCA 1PO23 1Y9MA 4CXWA 2WYSA 3VDDC 3ZXKA 4WVZA 2VMCA 3OOXA 3ORJA 1KS4A 4PDWA 2R061 4FFIA 4LUKA 5FMDA 2XVGA 1K5MB 1XNKA 3PUIA 4JZRA 4EV0A 5K9YA 1PIV1 4ATFA 4YM3A 4FTBA 5BNOC 2FDIA 1UWWA 3V64A 5L73A 2JD4A 4LHKA 4Y1YA 3N7MA 1RUF3 4NR1A 5I93A 3FUQA 1VMJA 2TNFA 4YW2A 4KU7A 1O3TA 2ZOEB 2Q1FA 3ECQA 3VD9A 2VQUA 3SCFA 5JLVA 2W08A 1QY4A 4L8QA 4RA0A 3SISA 3WUDA 4W8JA 5FWJA 1ZZBA 3DPRA 1PIV3 3GCXA 3NMBA 4XUTA 5A7WB 2Q8DA 5FFOC 1UNBA 1NX9A 4R9CA 3OBAA 2QZ2A 1B35C 3ZXFA 4XXPA 5E88A 2MEV2 3VKLA 2V72A 3ES1A 1H2KA 1FPN1 2ID4A 4XURA 1TME3 2HWD1 3H50A 3TN93 3OGJA 3J7NA 1L7RA 1OBNA 1TEIA 2RHPA 2YBPA 1LOBA 4QHZA 4KWJA 1W39A 1PZ9A 1A8MA 1MQTA 1NXD1 2PN5A 1DGLA 2VMGA 4P9JA 1J3PA 1RUC2 1B09A 1IGOA 1W6NB 2E32A 5F9TA 3MZHA 4COWA 2CWMA 4RGAA 3E1F1 5T52A 1DYPA 3GYDA 2VNRA 5FYBA 1XRUA 1C8M2 4PF5A 2YGMA 4Y4RA 4D3WA 5CKMA 5FZBA 2E63A 1ASJ1 1IKQA 2Q5TA 1L7LA 2WN2A 3Q8EA 1BVVA 1GP6A 3WF0A 1K42A 2IWGB 1JXNA 3HNBM 5T55A 2DVAA 3VZMA 3VV1A 3WF1A 4WV8A 1O3RA 1W6PB 4ZHNA 3IAQA 1WCQA 1LCLA 4QM8A 4NAOA 4IE4A 4QU2A 1POV1 3BUCA 1YNAA 3ZSKA 1UPSA 4Q4Y3 4WM7A 1HV1A 1T6GC 2WO7A 3IDEA 3OY8A 2P17A 2DV9A 1LHVA 1UU6A 1ND3C 3HN1A 1UKRA 3IDCB 3ON7A 4QX5A 1OUXA 1ZX5A 5A33A 1O4ZA 5BNNB 3ZSMA 4YFZA 4XZPA 3NJZA 3WT3A 2W68A 3I8TA 5BV6A 3ATGA 4KU8A 2CAUA 2X5IA 5FOBB 1AVBA 2RG4A 2JDKA 4Q4V2 1O4YA 1W8OA 1WMXA 2JG8A 2R062 3OJBA 4KWKA 5GZFA 3X29B 5CBLA 2YPJA 1OA2A 1XYNA 3WG1A 5FLJA 5GLUA 2WAAA 2ZEWA 5JI7A 4D7YA 4EZ4A 1JUIA 4XQ4A 4ARXA 3WDXA 3GM8A 3WXPA 4UFJA 3JD73 3JXSA 3ACLA 4META 4LK6A 2IUWA 4XIKA 1VB2A 1RL3A 3PVOA 3CJIB 2VR4A 4UFHA 4CU9A 3RWKX 1OKOA 4YG6A 4NHMA 4FBFA 2LW8A 3WVJA 3CNAA 1JZ4A 1RUE3 2YFZA 3C7GA 5GZCA 3ITQA 3POYA 4MYEA 2Y33A 4BB3A 1D2SA 3DCQA 5IVBA 2OQ6A 3MLJA 1AYN2 1N1YA 5FZAA 1NCRA 4MOAA 1A6CA 4UW5A 4Y26A 1VBE1 1XNBA 1DQ0A 5FQ0B 4LO5B 2X53S 3KVAA 3ST7A 1IKPA 4GB31 2RS11 5LA1A 1YC61 4LBNA 4L2NA 4URTA 4IV3A 1PVC1 4DNYA 4CE8A 3H8RA 1K45A 4JGZC 3GJBA 1YI7A 3NVCA 4XF1A 3SC7X 2GH2A 1JODA 1N3OA 1OQ1A 1DQ1A 2WL1A 3MV01 4JGZA 2W87A 1X82A 5D2AA 1HXS3 4OI4A 3ZYJB 1BBT3 2RVAA 1C57A 3APBA 5EIYB 1NZCA 1W2TA 2BBAA 2ZGLA 5EZWA 3POIA 5AFBA 2X05A 5L36A 5FXXA 4N43B 3WY6A 1BCXA 3ZN6B 2ZJCA 2ZKLA 4NRPA 4LT5A 4YWAA 4KQ7A 2A3WA 2F6BA 5DDJ3 4NHXA 5E89A 2CGPA 2DYCA 1OPOA 3NKGA 4DMIA 3ACHA 4AFAA 5KHJA 1PVC3 1GZWA 3BGAA 5A80A 4I01A 4CDUC 3D0SA 3EHKA 1QNYA 1DGWX 2D3RA 1F35A 3VBFC 2GNDA 3E6DA 5J37A 1W90A 4ONUA 4B3NA 3UV9A 5IVJA 3GDBA 3CJXA 5LEKA 5LCWL 1BBT1 5FY8A 3MUY1 3VBUA 5HCFA 1PK6C 3B02A 3WLUA 1JMUB 4RN5A 4YW7A 4BIFA 3H8UA 4CPBD 2YU1A 4BLIA 3JU9A 3ZM8A 1PO12 3FLTA 1NT0A 4CP2A 1RVF3 3VHNA 2RS53 1AX2A 1UIJA 2YZ4A 4AQTA 2MNGA 2W1WA 1W3XA 3HOBA 2Y0OA 4XUQA 4MG2A 3AL5A 1SLAA 2AACA 2VUJA 3WV6A 3ZFFA 4FPEA 5LZ6A 1D2QA 1KGYA 2CNAA 3RYPA 5CFCB 4YM2A 1LOGA 2D97A 3P1IA 4FSJA 3B93A 4RR3A 5GLWA 4UW6A 5EYXA 2GDFA 3L2HA 1NLQA 4KL1A 3JD71 4WBBA 4XFIA 2ZGKA 3ILFA 1XQNA 3POBA 2IVJA 1U5ZA 3HIFA 2IFWA 3RSJA 3WQ0A 1QDCA 1AR83 2WO3A 2VBPA 4LULA 2SBAA 5FKBA 3IBMA 2LTNA 5FTTC 2UYAA 1WA6X 3ZKUA 1LOEA 3NSTA 4XBLA 4XMIA 1TMF2 1CIWA 5CG9A 2PQSA 4Q0QA 5C7GA 3UYJA 4R4XA 5JPMB 4GB32 2WT2A 3WP5A 3OGSA 2Y60A 2HEYF 4GB33 4U36A 2A73B 3WF4A 1HJGA 2ARCA 1VBB1 3NJXA 3KQ4B 4TWTA 5L9BA 2Z5WA 4XETA 1O91A 2DUPA 1I9RA 4Q4V1 1FATA 1Y9QA 1WLWA 4I02A 3CLPA 3POSA 1UO9A 4NPRA 2D44A 2D6PA 2W1SA 2QKDA 2WFF2 2OS2A 4IE5A 1J58A 3WF3A 1O8SA 4ET7A 5JPNB 4YVWA 3ZXLA 5FZ9A 3T0BA 1CAUB 1UQXA 4AHZA 5C70A 4MX3A 5JCTA 1RUI2 2ZGQA 2HWC3 5DDJ1 3R4SA 2PTMA 4M3CB 4JGYA 4QHBA 4K8FA 1AX1A 5F2WA 2XLFA 4JKKA 3B5LB 5F5CA 1QQP3 5J48A 1GYKA 1VBB3 2B9UA 4Q0VA 4AEDB 1H8TA 4PLNA 4COUA 5C33A 1Q8SA 4UF0A 3IT8A 4ISRA 1VAVA 4E4HA 2VMEA 5HV4A 2PAMA 2E6VA 2Q1ZB 2SLIA 3PMEA 2AC1A 2AUYA 3KHBA 1NXMA 3GHMA 4Q4Y2 5C3OA 1PM4A 1YYNA 4CDXA 4CP9A 4DUXA 4EWEA 3VLBB 2RE9A 1GOGA 1UZYA 1LOFA 2IXHA 3I54A 1VBA1 3JB8A 4QQ2A 2ZABA 2ENRA 3T2QA 3DYPA 4CCJA 1E5SA 1LKNA 4I3PA 2IC1A 1R092 2QE3A 3VDDA 4NOTA 4GIQA 4N7IA 4JRLA 1WW6A 1I5PA 2WNEA 1LHUA 2ERFA 3FMGA 1LGCA 5DAVA 1H1MA 3QLQA 5HCBA 3CQOA 2W2IA 1ULFA 4WZCA 3R0RA 5FYIA 1US3A 2W0XA 5FP9A 3ZXEA 3UL2A 1O8PA 5C3SA 1QJX2 1UL9A 4MHUA 3LA7A 1BVP1 5FJKA 2J42A 4AEMA 1S2EA 2GNTA 1VBE3 5H9RA 5DG2A 4AR2A 4GKXA 1DYOA 1MS8A 2WO1A 4LK7A 4JQRA 4Y1ZA 1XE7A 4L11A 4OZXA 4UOJA 1QDOA 3MIDA 4Q4X1 2FDFA 3R6SA 2BJSA 3ZYHA 2WO2A 1COV3 1NE6A 3EYPA 5E16A 5D1IA 4JKMA 1XSRA 3J26N 1COV2 3VHPA 2VNOA 3MLKA 4OUEA 3RJ2X 3CO2A 4Y24A 1DZTA 2IFRA 1DCSA 5LW9A 2WQZC 4HT1T 4O61A 5LBEA 1FI2A 1SCRA 1OOPA 1OKQA 4AI0A 5I0TA 5A7PA 1YQCA 1OLRA 2WSUA 3JQWA 3WW3A 2C9KA 2R16A 2YGLA 4URAA 1G8WA 3MIHA 1YXWA 2BW8A 2XBO2 4FPLA 4LO4B 5EJ1B 1ZBA3 4Q4Y1 1SACA 3I3MA 1MEC3 4M3CE 5F3GA 4HSLA 2WBKA 1GLHA 1Z78A 3VBRC 2ZX4A 2G4IA 1W8WA 2GC3A 5A3PA 1IS3A 1UU4A 2Y6JA 4OHXA 5F6LB 4AI3A 1XNTA 5B4XA 1PK6A 5A3UA 5HBAA 3KD4A 1G9DA 1UOBA 1JYTA 3TAYA 3JBG1 1QXJA 3FUOA 4QQPA 4CCMA 2WS92 1UY3A 2KD7A 4HK9A 1H1AA 5A7OA 5A32B 5T5OA 4BHPA 1X36A 1I1EA 1XPWA 2Y64A 4LHLA 3H7JA 2W47A 4AEKA 4MV2A 3TN92 3I49A 3BTXA 3RDIA 1RVF1 3PUQA 4KMQA 3MFCA 2VOVA 1S0GA 3AX4A 3RMXA 1V0AA 4X6QB 1MEC1 3VBSB 3HNMA 5LK7B 4OULA 4ZKTB 1AL23 4F3JA 1GU3A 2HWF2 4AYUA 2Q0AA 3U1XA 3HBZA 4D94A 5BNPC 4FO9A 3JBG3 1JTZX 2Y38A 4XUPA 3WHUA 5HI0A 2ZGUA 3JBG2 5I0RA 5A3NA 1WD4A 1QH6A 3IAPA 3Q8BA 3AK0A 5FKCA 3H0OA 4B1LA 3CEWA 4Y1VA 3PNAA 3O7OA 4GALA 5BNPB 2WIIB 1LTEA 1BMV1 4CEWA 5A6QA 4GH4A 3AXEA 1NCRC 2BNMA 1YQ5A 4A7ZA 3MPBA 3C2UA 5I0DA 1H6YA 1RUOA 2D6OX 4Y5Z0 1N3PA 1F2NA 3VGIA 1ZRDA 4IGOA 2PHDA 4GULA 3VZJA 5KXBA 1Q5OA 4UI9L 1H0BA 1SDWA 4AHXA 2WR9A 1O5UA 5GJ6A 1KD7A 1COV1 3AZWA 5C8CC 3BALA 2EIGA 1JZ2A 4J6GA 5E1RA 2WDBA 1G6NA 1W8ZA 1P8JA 4GJYA 5IUQA 3I97A 2XOMA 3PHMA 4QPYA 1W0PA 2CU5A 1XB9A 2RM21 1MS0A 2VCAA 3I2OA 1SG3A 5DAXA 1HXS1 4XF0A 3VD5A 3OYWB 4JAAA 3LEGA 3USUA 4LOTA 2ZX1A 5KHKA 2WLQA 2FDGA 1K5JA 2VD7A 1ND3A 2GSYA 2C1FA 3IPVA 4BQ2A 4XF3A 4ZU4A 2A75A 2EIDA 1IG3A 4QPGB 1NQDA 2P6HA 3A23A 4XIOA 3PJQA 3VBRA 1QJX1 2YUEA 4XTMA 2HWB1 4TSVA 4NRQA 4XQDA 2BERA 1OXCA 3EBRA 2NLRA 3HEIA 2P34A 5JXIA 1YJKA 4Q4W1 5FJHA 3PUAA 4JDMA 4ARYA 1LNSA 3FHQA 4XJ8A 1POQA 4QD2A 1JBCA 1CD3G 2ORZA 5F1RA 1FOD1 1R091 1BBT2 4BQXA 1CIYA 4CUBA 4DFSA 1XNDA 5EFUA 1SBEA 2XJPA 3POEA 2KM2A 5CG8A 2BU9A 3LWCA 1X8EA 1Y3TA 3VHRA 4A7KA 3AMNA 1G9FA 4XJUA 5GKAC 3ETPA 1RINA 3ZFGB 4LPLA 5FXVA 5JZGB 4XUNA 4OFGA 4AVVA 3J7HA 5FY1A 3DXUA 5KHHA 2JEMA 5C9AB 5FZCA 1IHMA 2XJUA 4CDWA 3C7OA 3MPPG 4N53C 1BJQA 2J1UA 1JYVA 1UX6A 5GLVA 3WINE 1EAH1 2LROA 3T4VA 4Q0UA 3S5QA 1KS5A 3BCWA 1LEMA 4IEUA 4IE7A 1CAXA 4NO4A 2VQAA 4RD7A 2O0OA 3HAGA 4IE6A 1AR81 3TEXA 2GP5A 1HIXA 2R6QA 4LITA 4CPBA 3ZYBA 4CDQB 1MVQA 1SZBA 1AYM2 3DKQA 5I8YA 2IZWA 3W5NA 5IK8A 1U5YA 3H1YA 3K75B 3M3IA 2UYBA 4L9BA 2V73A 1JOJA 4OQ8A 2DVFA 1W99A 3U78A 2VOTA 1YRZA 2FDJA 1ULOA 5DUUA 2PHRA 4IV1B 4HVQA 4M0HA 5CADA 1SDDB 1J3QA 1SLBA 1OSGA 2WQ8A 5FYCA 3UKTA 4Z07A 4PDWC 1QWRA 3DEMA 4UXAA 3NV2A 5FYVA 4XC9A 4CU8A 2DCJA 2V5YA 2RJKA 2XQXA 5L7OB 2RDQA 1FPN3 3A21A 3MW4A 4QKNA 4AEJA 4FTEA 3VZNA 3T0AA 4RS5A 1FNZA 1LU2A 2HWE1 4Q8LA 5FZ7A 3VN4A 1MS5A 4SLIA 4QM9A 1JYXA 4M01A 2EAKA 2NPIA 2NZ9A 3S0MA 4CVUA 5FMCA 1GICA 4HANA 4CEYA 4ASKA 1HDKA 5K0UA 3PL0A 1Z7S1 3BIWE 1DQ4A 1OF3A 4JTOA 3RZZA 5FZOA 1AL21 4FXGB 4Q4W3 3WQBA 1Q8OA 1WZXA 2BOIA 1FT9A 4XQWA 3SCHA 5E6HA 3POFA 1RUC3 1LHNA 3RZJA 1C8NA 3SKVA 4LBMA 1H9WA 5GALA 1GNZA 3B3QE 5EWSA 1QEXA 4KG0A 3OBTA 1S2KA 4A41A 3FHAA 4KI5M 3LPFA 1VBA3 2XUEA 3H1MA 1UZVA 4HK8A 5EYYA 1OI6A 3F2ZA 4Q29A 5FZLA 3WNLA 2JJ6A 3U10A 3OPWA 1RUNA 1W2NA 2I74A 1UD1A 3NV4A 3UGHA 4DZGA 3OEBA 2OZJA 2R072 3GF6A 2VBBA 2EF6A 3CU7A 4QQOA 1KJLA 1XBFA 2YC2A 4OVEA 3RS6A 2WZR3 3ZXAC 5CKNA 1CGPA 3U4XA 4LUMA 4R4ZA 1UMZA 4KBBA 4ISQA 5JDBA 1ODMA 5IVCA 3K46A 1CPMA 3ILRA 5IT6A 4P00B 4FAHA 1GBGA 1KDMA 4YVWC 2JE7A 1T6BX 1UZ0A 4XAEA 4YW6A 2RDNA 2JDUA 1LGBA 2ZGRA 4N9HA 4IUGA 1RB8G 1UIKA 4M4PA 1QH7A 3VBFB 3WG2A 5FPLA 3I59B 3KS7A 4XILA 3CL1A 3VKNA 2WYFA 5IK7A 1WKYA 4QGMA 1OLQA 2E7QA 3DV8A 1VBD2 2A3XA 4XFHA 4PQQA 4JRAA 2GN7A 3BYWA 3IDBB 5C4WB 4IEQA 4KG8A 3H7YA 1ZREA 1ZZ7A 4IGPA 1CQ9A 2VVDA 2K46A 5LWBA 3POWA 1AR91 1CX1A 5CKQA 2WWUA 3KLSA 5FDBA 2QQNA 1QXRA 2OT7A 2WZPP 2OX0A 1ZBA1 2VMFA 2ZEYA 3FJSA 4UT5A 1FV2A 4ZY9A 1AXZA 5HCAA 3AXDA 5JAXA 5ABJA 2JKBA 3P3NA 2JX9A 1GNYA 4XYXA 4WM8A 2AH2A 4YZ1A 2UWBA 4I0BA 5LBBA 3OBZA 3SMHA 2XQRA 1JN2P 1EAH2 1RUE2 2DCKA 1ZBE2 4AK3A 4A3XA 1TE1B 3ELNA 2WRAA 1Y9GA 5JMOA 5LK5A 3I2IA 2BBVA 5TSWA 2E31A 5LB6A 3ZSEA 1IS4A 1GZTA 1OA4A 1YQ2A 4AXOA 3H8OA 4Q4X2 3R4UA 3UETA 2JDPA 4QPIC 1ZM1A 5A70A 5A6ZA 5HCHA 3D4KA 3TYJA 3KCYA 2P4EA 3HD8B 4LKSA 5FP7A 1RUC1 1V6MA 3T2OA 2HLEA 2JXAA 4GXLA 4FOWA 1SPPB 3VHOA 4BQYA 2CSGA 5JOWA 5FP8A 4LIUA 3E5UA 1GMMA 3D5OA 4CUCA 5FZHA 3E6BA 2RMU2 2XVKA 1K12A 2XUMA 4IV3B 4YM1A 1QU0A 1ULGA 3GCWA 4D7SA 2ET7A 1C1LA 1QJZA 2A6YA 3A22A 4P9WA 4S2GA 4XOGA 3ZXJA 3GZAA 4CP1A 2E7AA 2EXIA 1PVC2 1RHI3 2HYKA 4C90A 5L7OC 3O0WA 3MW2A 3A0NA 3Q8FA 4UW4A 1GWLA 2UU8A 2CGOA 3ETQA 3FN9A 2OUHA 2Q1MA 4FFHA 4QPGC 4HONA 3ZN5A 2B45X 3FFQA 2GC2A 2CAVA 5HXMA 2E26A 2JG8C 2RS52 5EJZB 2RS13 4B4QA 2MEV1 4CSWA 3ZR5A 2VULA 1ND2B 1HJFA 4K1ZA 3OGGA 4Y1XA 3Q8AA 4BK5A 1RVF2 4EJRA 3FLRA 1L7QA 3N9MA 2GZWA 3I3QA 3MICA 4GMP1 4QQLA 5JSRA 3ZYPA 1QMJA 2H6CA 3GZEA 1DYKA 1LOFC 3JCIA 3MF6A 3N36A 4D8MA 4DB5A 4FQ4A 2OPWA 2A5ZA 3FWEA 5DZGA 4BXSV 5FZ6A 2XWBB 1SQ4A 1Q43A 2JECA 2B46X 4J25A 3WDTA 4GD4A 5FPUA 1DHKB 5B2GB 4PHZA 1MPXA 4EN7B 5M0TA 5IJRA 1RUI1 5CYYA 1PGW1 4Q8KA 5IAVA 3O1PA 4KGGA 4LBJA 2VQ0A 3U75A 1D4VB 3AJYA 3ILNA 3BOWA 1GWMA 3MEPA 2R30A 4LBQB 2WFF1 1YCIA 1B35B 1UMHA 4PBPA 3AKSA 1DLCA 1C28A 2QQOA 2ZS6B 1O6UA 4OYUA 4PI2A 3ZYFA 3LFIA 2HH9A 4WVVA 1GZ9A 1TMF3 3AZZA 1V6NA 2EXHA 3HQXA 5FBZA 5I91A 2AGSA 3RI9A 1PX3A 1NLSA 1JZ8A 1W9FA 4LOSA 4PIYA 1OQEA 4LR4A 4M3CF 1ZZ6A 4V1PA 1HW5A 4YGCA 1GWKA 3B69A 4YNIA 3M3OA 3KB5A 3NWKA 4OHYA 1KITA 3WNNA 1DQ2A 3WR0A 4TN7A 2WFF3 2IXKA 2ADEA 5HXVA 3V0AA 2ZHLA 3C7FA 1D4M1 2ZGNA 3LSEA 2YU2A 3LPGA 4WM7C 1NA1A 4HETA 2VZ1A 4Y22A 4XBQA 1V6OA 3LF7A 4QXCA 4UBHA 1TMF1 3I2KA 5FMBA 3H3ZA 5H9QA 1RGSA 2BQPA 4NMIA 2OXBA 5GLTA 2R073 4A45A 2WNVC 1UZZA 1FMD3 3S7EA 1DZRA 1WW5A 3URFA 5KHIA 1MS4A 1HKDA 1RHI1 4CDQC 1G7YA 1H6XA 3AP4A 4LA3A 4RQPA 1RUH1 2IXIA 3SXWA 4CYDA 1QOTA 3U14A 1QJEA 4RHV2 4AI9A 3GALA 4YVSB 4AW7A 4Z82A 1CAUA 3KZ4C 3H1WA 4PCRA 2F17A 1HRV1 1JU4A 3IMMA 4FPOB 5J96B 4QPWA 3C3VA 1OQDA 4M00A 5IFTA 1ODNA 1SLIA 4OI0A 2XJTA 4U2AA 1GFF2 5IVYA 3J9SA 2Q8EA 2WUHA 1GOHA 5A6YA 3GZTB 3LA2A 2R071 2A3YA 3DGTA 2A6VA 1OF4A 1E57A 1FMD1 2RR12 4AL9A 4Q4V3 1VBC3 4UF0B 5ABJC 1OFSA 1UMIA 2RR13 5E8AA 2ZMKA 1OA3A 1RXFA 4XEZA 5FMOL 5KWRA 1F8VA 5DZEA 1STMA 4MGQA 2A70A 4XHBA 4LMFA 3AYCA 4G4FA 3T2PA 5JUVA 4MGYE 4AWDA 3WCSA 2NP0A 1LHWA 3VD3A 5LA2A 1CWPA 1LECA 1J83A 2DCZA 2HWB2 1US2A 2ZHNA 4FQZA 2KR2A 4UFIA 4A44A 4A6SA 5KHGA 5A3OA 4CDWC 1ENRA 3NNMA 3LSDA 1QJU1 5H9PA 4AF9A 5F3EA 1QQP1 4B7EA 4GA9A 3JZVA 5FZKA 1CJDA 3TOJA 4PBOA 5L19A 3S7IA 1H30A 2XL7A 2O8QA 1JS9A 4AAPA 3ASIA 4Y20A 1ST8A 4RHV1 1ZBE3 1CZTA 1AYN3 1W6OA 1LOAA 1JHNA 1VJ2A 4HMZA 4KBZA 1U5IA 4QXHA 2VBDA 2VC9A 1AUYA 1OURA 2FZ1A 5D8AC 1VALA 3ME2A 5FY4A 2R49A 4A3ZA 1HX6A 4MXVA 3LA3A 4P9LA 4XFFA 4XF9A 1A34A 2WC2A 5JOZA 1F9KA 1TNFA 3HNYM 1ZA7A 4JX0A 5FREA 4BLJA 2K0GA 4QWNA 1W6QA 2ZKNA 5DMYA 1GQHA 1AYN1 5IFPA 2JDNA 1ULDA 2RMU3 1RYYA 4QXKA 4AQ2A 1OOPB 4KNCA 1Q3EA 3FZ3A 3T1MA 1TNRA 2XBO1 4L0PA 1YLLA 2Y6LA 1UW8A 4KGQA 1AX0A 1PGL2 3R4DB 1LHOA 4Y3OA 5FPVA 2QCSB 4FFGA 3KGLA 2CY6A 4LO7A 3IN9A 5C9AC 2JG9C 1F5JA 2JENA 2WNOA 1RUH3 1V6JA 4Y5TA 4DRRA 1VRBA 4LKFA 3VB9A 2FMDA 4CCCA 2P3IA 3WDYA 4AVCA 1H9PA 4CZSA 1LU1A 4ZZ5A 5A3MA 2RJ2A 4AFCA 5C6CA 3N35A 5FYUA 5FP3A 4BH9A 2J1AA 4EWDA 4PF1A 1AL22 2X8KA 5FZIA 1V9U1 4XAAA 3AM2A 3NNFA 5F5IA 2KXLA 3PVNA 3RGBA 3RNSA 5A6XA 3VUOA 3AKPA 3I2JA 1KFXL 3LEKA 4HG6B 5I8TA 5FYYA 3O1UA 4DUWA 3KMHA 1VBC1 4BK4A 2FDHA 4B4PA 1FYUA 2AREA 2HWE2 2ZACA 1UN1A 4ZS3A 1C8M1 3VBSA 2ZMLA 2YXSA 5T50A 5IATA 2WNUB 1UU5A 1BYHA 2CL2A 4AI8A 2EIBA 2EXKA 4NE9A 1WMFA 2F4LA 1NY71 3BOPA 2RM23 1QJU3 2YDEA 4PDWB 1TME1 2G9FA 2HWD3 4W6XA 4N7UA 4YM0A 2IXJA 3AKTA 4N53B 2J1EA 4HPKA 4EN6B 1VBD3 3SKJE 4Y4YA 3U11A 1MZ6A 4FPJA 2QFEA 4C91A 3WW2A 4E4SA 4CEWB 2JWPA 4LTAA 3LQCA 4GH4B 5GZEA 4N43C 5KXEA 3I7DA 3ZFGC 4F8AA 4X8PA 1H2LA 4BWOA 2IXCA 2JDZA 1JZ6A 2DBNA 5FUNA 2A1XA 3LGRA 1CVNA 3WUCA 1J59A 3BU7A 4D6RA 2YPDA 1I5ZA 1FAYA 4MGSA 4HLTA 2DUQA 2BVBA 4LJHA 3KT1A 1RJ7A 5FYSA 4NROA 3ZVXA 2ORXA 5BXXA 4OCTA 3BIEA 1POV0 3RYKA 3FHIB 1GUIA 3KSCA 4Q5OA 4QKDA 5A7WA 2Y26A 3IIIA 3ZMOA 5LRSA 2ZEZA 3DPRC 3MLLA 2ZGOA 4UFKA 1H2NA 4XXAA 4BQ3A 3FBMA 3E6CC 1NZIA 3ZYIB 2BFUS 1OT5A 4LLOA 1AR71 5ACA1 3O1VA 1CAVB 1IPJA 2BRTA 5K4LA 3SH5A 3WP4A 2XLAA 4W6WA 1WCDJ 4GAZA 1UPIA 1ZZ8A 2AEZA 1VBB2 2UURA 2DF7A 3OYWA 4P9XA 4CRQA 5JIUA 3USUB 4RSUA 3T4HB 3BI3A 4CUAA 1RITA 1TVGA 2DDUA 1VMHA 1ND2C 4PIZA 4EZHA 2WSVA 3IPVB 3RQ0A 4BXFA 2ZGPA 4BU2A 4EROA 2V4VA 4CEWC 2GALA 4MUVA 1ZA4A 1ZNPA 3INAA 2ETEA 4A6OA 1DF0A 4RFT0 4QGLA 1MACA 3MW3A 4I30A 4ASMB 2C9AA 5DAWA 4Z1VA 5FZ0A 3ZSJA 1REFA 4D6QA 1ASJ2 3RZLA 2C6SA 4KH9A 3B00A 4DY3A 3H3UA 2VZRA 1QXPA 1S2BA 2XR4A 2Z42A 3LIGA 4S2FA 5A7SA 3TB0A 2V09A 5J1XA 1CX4A 4WM7B 4YFWA 4YG3A 1BLZA 1OFNA 4H2AA 3VBUC 2YG0A 5FZEA 3TEZA 1D7PM 1E5IA 4K20A 4TYSA 3D3AA 4IEXA 1WGPA 4XFAA 3B94A 5LA9A 1EPWA 2DU0A 1QJX3 1LB2A 1MZ5A 2WS91 3O12A 2HWB3 5JSPA 3ZFGA 2XB6C 3TNQA 1AR63 2BWCA 4QX8A 1WWYA 4AQSA 3KT7A 4OQ9A 4AEDC 1G9AA 2IXLA 1M4WA 2Y6HA 2GNBA 3OPZA 4W4ZA 2FQPA 3HVDA 4AVSA 4GKYA 3AMHA 3OB8A 2D40A 4JVAA 1RXGA 3LZZA 4FTSA 3SQOA 3UT0A 3DXTA 4DEVA 1D0HA 4QX2A 2W92A 4HFSA 5KC6A 2JKXA 3WNMA 4FT8A 1RUF2 4CDUB 5J7MA 2R32A 5FPBA 2XKOA 2B7YA 2PLV1 1NCRB 1W8TA 4JV4A 2XKPA 5BNOA 1MS1A 3J7LA 4YVSC 2B8MA 2CDOA 3OSDA 3IB3A 1OUSA 5F8PA 1UXXX 1Q56A 3EO6A 4LO6B 4TLFA 3M2MA 4CUGA 3LEMA 4O7XA 1PIV2 3TRSB 4AQ6A 2VZ3A 4QQHA 5DN2A 3NAPA 4UYBA 2RS51 4Q4W2 2D93A 3W5MA 2D6LX 2VQTA 3K51A 5LASA 2XONA 2W94A 1URXA 1JZ7A 1V9U3 2VW0A 3ZO0B 5FIXA 1UY2A 3ACIA 2BYVE 3ZN6A 4E2GA 5F7UA 4ZONA 1GZCA 1GQGA 2B5HA 3HJRA 2ZGSA 5LATA 3ZFEA 5J3UA 3BU0A 1GP5A 1XU1A 3LIHA 2VOXA 3E5XA 3LAGA 4K1YA 2O8OA 3PLQA 4CEYB 2GH8A 2BVVA 4HVRA 2ATFA 1ALYA 5CFCC 3O1MA 5EV7A 4YW5A 1GSLA 1C8M3 1CAWA 3GHNA 3MGUA 3THTA 4F83A 4BCUA 1O7FA 1LR5A 4MXWB 2E53A 1FMD2 2BFUL 2RR11 4MZUA 3ZSLA 2HYXA 3HT2A 3L9JT 5JR2A 1VE0A 2V4AA 3H8XA 1X9TA 3ZLIA 4NIGA 5JR7B 2J22A 2BOJA 2K9ZA 2DWRA 2ILMA 1UZWA 5FZ1A 4LLFA 2GMMA 3AP6A 3VKMA 5IYYA 1X50A 4MGZE 1HB1A 4QXBA 4EWAA 4G9SB 3BKZA 5C8CB 1KJRA 3OBRA 4AFDA 3VBHB 3AFGA 1AYM1 2FZ2A 5CIRA 4TLGA 4FPGA 1U0AA 1WLTA 4MGTA 3ZFFB 1CZVA 1JHJA 1S0IA 4M4RA 1ZBE1 4AZZA 4UFMA 1VRH1 1R1A3
chains in the Genus database with same CATH topology
1W8OA 2L9LA 4PQQA 4W50A 1PX4A 5A1AA 1W9TA 2WAAA 2ZEWA 3DECA 2JE8A 1CX1A 2VM9A 4ARXA 3T09A 3GM8A 2YC4A 2QQNA 3JXSA 3U37A 2VMFA 2ZEYA 4JKLA 4ZY9A 2VR4A 3C7HA 4CU9A 4P5YA 4P02B 4XVHA 4E8CA 2LW8A 1GNYA 4QDQA 1R64A 1JZ4A 4QX1A 2YFZA 3C7GA 3LE0A 2VZQA 4QB2A 2DCKA 4MOAA 4QAWA 1EUTA 3C7EA 5JMOA 3I2IA 2E31A 5LA1A 1YQ2A 1K45A 1JU3A 3UETA 3T08A 1F4HA 4XUOA 2W1QA 3MV01 2W87A 2RVAA 4TTGA 4LKSA 5EIYB 2BBAA 4QB1A 2HLEA 2VMDA 3T2OA 2X05A 3LEIA 3CZUA 1GMMA 1NUKA 4CUCA 3CKHA 5B4NA 5G04L 1K12A 3K77A 3SEPA 4YPJA 3ACHA 3A22A 3EB7A 3BGAA 3NQHA 3PUHA 3I3DA 3I2FA 3GDBA 3FN9A 5IHRA 5LCWL 3VDAA 3MUY1 4RN5A 4FI9A 5HXMA 2E26A 1EUUA 4QB6A 3ZM8A 1OH4A 5EJZB 2X10A 2VZVA 4BK5A 1F4AA 1L7QA 4XZUG 2W1WA 3HOBA 4XUQA 2J7MA 3K4ZA 4D8MA 2B9VA 4BXSV 1KGYA 3I3BA 3P1IA 3DYMA 1PMJX 4GWJA 1MPXA 2C4XA 5IJRA 5CYYA 1UY0A 3HN3A 3A7QA 2WO3A 1XNAA 2LS6A 4MO3M 1UMHA 1DLCA 2QQOA 4Z2AA 2QQIA 2R7EB 2VO5A 1ULPA 4OYUA 4PT6A 2ZXQA 2PQSA 5C7GA 4OMDA 3NNGA 1PX3A 2CDPA 3WNPA 2Y8KA 3OGSA 1JZ8A 3WF4A 2QQMA 3NJXA 2V5DA 4MADA 2BGPA 2WABA 3WNNA 3C7FA 2W1SA 3WF3A 1O8SA 4ET7A 3LPGA 2VZ1A 3T0BA 3WNOA 5C70A 3T0DA 2WN3A 3I2KA 2VCCA 2VZUA 1SHWB 3GGLA 4JKKA 4A45A 2EIEA 2J1TA 3DYOA 1H6XA 2VMEA 4DEQA 2VL4A 1JYWA 4OZOA 4DUXA 1CZSA 2W5FA 1GOGA 1JU4A 2YFUA 4QPWA 5IFTA 2JD9A 3T2QA 2RV9A 3DYPA 2WUHA 1GOHA 2BGOA 2W1UA 1OF4A 1I5PA 5HPOA 3VDBA 2VCBA 2OKXA 1UMIA 3P6BA 3CQOA 2JDAA 1XC6A 2WAOA 4MGQA 1HN1A 2W91A 1US3A 3OG2A 2Y6GA 3T2PA 5JUVA 2Z4FA 3SEEA 1O8PA 3VD3A 5LA2A 1JZ5A 1J83A 1US2A 4QX3A 4A44A 4QDRA 1JZ3A 2ZEXA 2VZPA 1DYOA 2VZTA 2WO1A 3ABZA 2J1SA 4UOJA 2BZDA 2WO2A 3THCA 3EYPA 4JKMA 5LA0A 4OUEA 1CZTA 2QBXA 4JHZA 2VC9A 3C8XA 2W3JA 3OGRA 5G05L 3AC0A 2B4KA 2C9KA 4A3ZA 1OD3A 1NKGA 3UESA 3VD7A 3I3EA 5EJ1B 1JI6A 2WBKA 3HNYM 3ACGA 4JX0A 3I2HA 2Y6JA 5DMYA 1XNTA 5B4XA 5IFPA 3MV11 1RYYA 4A42A 4L0PA 1UY3A 2KD7A 1W9SA 2Y6LA 2YB7A 4QX0A 4BDVB 1XPWA 2Y64A 2W47A 3OGVA 2Y6KA 1DP0A 4KMQA 2W9XA 3WF2A 4RYDA 4ZZ5A 3HNMA 2QQJA 2RJ2A 1IQDC 3I2GA 2J1RA 2J1AA 1GU3A 4ZXEA 4PF1A 5JXGA 3VDCA 4XUPA 5JXJA 3I2JA 3IAPA 3LEKA 4HG6B 2J1VA 4DUWA 4BK4A 4CU6A 2EICA 4CU7A 4AG4A 3GXUA 3MBWA 5I0DA 1H6YA 2EIBA 3MO4A 4UI9L 2J1EA 3SKJE 4LHSA 1UXZA 4KWUA 1JZ2A 2WDBA 3LQCA 1P8JA 1JZ6A 3I97A 3K4DA 2XOMA 4LQRA 2VCAA 2VJXA 1JYNA 3CDZB 1SG3A 5C71A 4MGSA 3VD5A 3UNPA 3IDAA 2QQLA 3LEGA 3HPNA 4AAXA 2ORXA 2WZEA 1T2XA 5CZKA 1GUIA 4DXRA 3IIIA 2EIDA 4TXWA 2ZEZA 3A23A 3MUZ1 2BERA 3K4AA 3HEIA 1OT5A 5JXIA 2QQKA 2XHNA 2E33A 4ARYA 3NRUA 4DXSA 1LNSA 3FHQA 3WSOA 2ORZA 5DPNA 1K3IA 4CUAA 4E8DA 1CIYA 1TVGA 2DDUA 3BN6A 3WNKA 4CUBA 5FUIA 3OEAA 2V4VA 2C26A 1UYXA 1NAEA 1UY1A 4A6OA 3CIHA 3ETPA 1BHGA 4LPLA 4XUNA 4GZ9A 3J7HA 4DXTA 2VZRA 1GOFA 5DQ0A 1UX7A 3C7OA 5J1XA 2J1UA 1JYVA 1UYZA 2YG0A 1D7PM 2W46A 5JXHA 4ZZ8A 3D3AA 1UYYA 4A4AA 1J84A 1W9WA 2VZOA 2WYSA 4QDSA 3W5NA 3K75B 4GWIA 2VMCA 2Y6HA 4W4ZA 1W99A 2WZ8A 3PUIA 3OB8A 2VOTA 1ULOA 4P08A 1UWWA 1PMHX 4DEVA 4QX2A 1SDDB 2WQ8A 2W92A 2X09A 2JKXA 3WNMA 4CU8A 2DCJA 2VZSA 2XQXA 3ECQA 3A21A 3VD9A 2VQUA 3T0AA 1JYXA 2CDOA 3IB3A 4W8JA 1UXXX 4CVUA 4XUTA 4BJ0A 1GQPA 1NX9A 1OF3A 3OBAA 2VZ3A 5DN2A 4DUVA 1KEXA 3W5MA 2VQTA 2V72A 2XONA 3WQBA 2ID4A 4XURA 2W94A 1JZ7A 2W95A 1L7RA 1UY2A 3ACIA 4D0QA 5F7UA 2VTFA 3SKVA 3HJRA 2E32A 4UAPA 4A41A 3FHAA 3E1F1 4KI5M 4OMCA 3LPFA 3F2ZA 3WNLA 2WN2A 3CMGA 1K42A 3WF0A 3HNBM 3OEBA 3WEZA 3VD4A 2YC2A 3WF1A 3THDA 1TG7A 3CZJA 2HYXA 3IAQA 5JR2A 1WCQA 1UY4A 3K46A 2J22A 3FL7A 4P00B 5IYYA 1UZ0A 3ACFA 3NJVA 4IUGA 4M4PA 1W8NA 1O59A 1WKYA 1CZVA 1JHJA 4M4RA 1W0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W8O A;  2L9L A;  4PQQ A;  4W50 A;  1PX4 A;  5A1A A;  1W9T A;  2WAA A;  2ZEW A;  3DEC A;  2JE8 A;  1CX1 A;  2VM9 A;  4ARX A;  3T09 A;  3GM8 A;  2YC4 A;  2QQN A;  3JXS A;  3U37 A;  2VMF A;  2ZEY A;  4JKL A;  4ZY9 A;  2VR4 A;  3C7H A;  4CU9 A;  4P5Y A;  4P02 B;  4XVH A;  4E8C A;  2LW8 A;  1GNY A;  4QDQ A;  1R64 A;  1JZ4 A;  4QX1 A;  2YFZ A;  3C7G A;  3LE0 A;  2VZQ A;  4QB2 A;  2DCK A;  4MOA A;  4QAW A;  1EUT A;  3C7E A;  5JMO A;  3I2I A;  2E31 A;  5LA1 A;  1YQ2 A;  1K45 A;  1JU3 A;  3UET A;  3T08 A;  1F4H A;  4XUO A;  2W1Q A;  3MV0 1;  2W87 A;  2RVA A;  4TTG A;  4LKS A;  5EIY B;  2BBA A;  4QB1 A;  2HLE A;  2VMD A;  3T2O A;  2X05 A;  3LEI A;  3CZU A;  1GMM A;  1NUK A;  4CUC A;  3CKH A;  5B4N A;  5G04 L;  1K12 A;  3K77 A;  3SEP A;  4YPJ A;  3ACH A;  3A22 A;  3EB7 A;  3BGA A;  3NQH A;  3PUH A;  3I3D A;  3I2F A;  3GDB A;  3FN9 A;  5IHR A;  5LCW L;  3VDA A;  3MUY 1;  4RN5 A;  4FI9 A;  5HXM A;  2E26 A;  1EUU A;  4QB6 A;  3ZM8 A;  1OH4 A;  5EJZ B;  2X10 A;  2VZV A;  4BK5 A;  1F4A A;  1L7Q A;  4XZU G;  2W1W A;  3HOB A;  4XUQ A;  2J7M A;  3K4Z A;  4D8M A;  2B9V A;  4BXS V;  1KGY A;  3I3B A;  3P1I A;  3DYM A;  1PMJ X;  4GWJ A;  1MPX A;  2C4X A;  5IJR A;  5CYY A;  1UY0 A;  3HN3 A;  3A7Q A;  2WO3 A;  1XNA A;  2LS6 A;  4MO3 M;  1UMH A;  1DLC A;  2QQO A;  4Z2A A;  2QQI A;  2R7E B;  2VO5 A;  1ULP A;  4OYU A;  4PT6 A;  2ZXQ A;  2PQS A;  5C7G A;  4OMD A;  3NNG A;  1PX3 A;  2CDP A;  3WNP A;  2Y8K A;  3OGS A;  1JZ8 A;  3WF4 A;  2QQM A;  3NJX A;  2V5D A;  4MAD A;  2BGP A;  2WAB A;  3WNN A;  3C7F A;  2W1S A;  3WF3 A;  1O8S A;  4ET7 A;  3LPG A;  2VZ1 A;  3T0B A;  3WNO A;  5C70 A;  3T0D A;  2WN3 A;  3I2K A;  2VCC A;  2VZU A;  1SHW B;  3GGL A;  4JKK A;  4A45 A;  2EIE A;  2J1T A;  3DYO A;  1H6X A;  2VME A;  4DEQ A;  2VL4 A;  1JYW A;  4OZO A;  4DUX A;  1CZS A;  2W5F A;  1GOG A;  1JU4 A;  2YFU A;  4QPW A;  5IFT A;  2JD9 A;  3T2Q A;  2RV9 A;  3DYP A;  2WUH A;  1GOH A;  2BGO A;  2W1U A;  1OF4 A;  1I5P A;  5HPO A;  3VDB A;  2VCB A;  2OKX A;  1UMI A;  3P6B A;  3CQO A;  2JDA A;  1XC6 A;  2WAO A;  4MGQ A;  1HN1 A;  2W91 A;  1US3 A;  3OG2 A;  2Y6G A;  3T2P A;  5JUV A;  2Z4F A;  3SEE A;  1O8P A;  3VD3 A;  5LA2 A;  1JZ5 A;  1J83 A;  1US2 A;  4QX3 A;  4A44 A;  4QDR A;  1JZ3 A;  2ZEX A;  2VZP A;  1DYO A;  2VZT A;  2WO1 A;  3ABZ A;  2J1S A;  4UOJ A;  2BZD A;  2WO2 A;  3THC A;  3EYP A;  4JKM A;  5LA0 A;  4OUE A;  1CZT A;  2QBX A;  4JHZ A;  2VC9 A;  3C8X A;  2W3J A;  3OGR A;  5G05 L;  3AC0 A;  2B4K A;  2C9K A;  4A3Z A;  1OD3 A;  1NKG A;  3UES A;  3VD7 A;  3I3E A;  5EJ1 B;  1JI6 A;  2WBK A;  3HNY M;  3ACG A;  4JX0 A;  3I2H A;  2Y6J A;  5DMY A;  1XNT A;  5B4X A;  5IFP A;  3MV1 1;  1RYY A;  4A42 A;  4L0P A;  1UY3 A;  2KD7 A;  1W9S A;  2Y6L A;  2YB7 A;  4QX0 A;  4BDV B;  1XPW A;  2Y64 A;  2W47 A;  3OGV A;  2Y6K A;  1DP0 A;  4KMQ A;  2W9X A;  3WF2 A;  4RYD A;  4ZZ5 A;  3HNM A;  2QQJ A;  2RJ2 A;  1IQD C;  3I2G A;  2J1R A;  2J1A A;  1GU3 A;  4ZXE A;  4PF1 A;  5JXG A;  3VDC A;  4XUP A;  5JXJ A;  3I2J A;  3IAP A;  3LEK A;  4HG6 B;  2J1V A;  4DUW A;  4BK4 A;  4CU6 A;  2EIC A;  4CU7 A;  4AG4 A;  3GXU A;  3MBW A;  5I0D A;  1H6Y A;  2EIB A;  3MO4 A;  4UI9 L;  2J1E A;  3SKJ E;  4LHS A;  1UXZ A;  4KWU A;  1JZ2 A;  2WDB A;  3LQC A;  1P8J A;  1JZ6 A;  3I97 A;  3K4D A;  2XOM A;  4LQR A;  2VCA A;  2VJX A;  1JYN A;  3CDZ B;  1SG3 A;  5C71 A;  4MGS A;  3VD5 A;  3UNP A;  3IDA A;  2QQL A;  3LEG A;  3HPN A;  4AAX A;  2ORX A;  2WZE A;  1T2X A;  5CZK A;  1GUI A;  4DXR A;  3III A;  2EID A;  4TXW A;  2ZEZ A;  3A23 A;  3MUZ 1;  2BER A;  3K4A A;  3HEI A;  1OT5 A;  5JXI A;  2QQK A;  2XHN A;  2E33 A;  4ARY A;  3NRU A;  4DXS A;  1LNS A;  3FHQ A;  3WSO A;  2ORZ A;  5DPN A;  1K3I A;  4CUA A;  4E8D A;  1CIY A;  1TVG A;  2DDU A;  3BN6 A;  3WNK A;  4CUB A;  5FUI A;  3OEA A;  2V4V A;  2C26 A;  1UYX A;  1NAE A;  1UY1 A;  4A6O A;  3CIH A;  3ETP A;  1BHG A;  4LPL A;  4XUN A;  4GZ9 A;  3J7H A;  4DXT A;  2VZR A;  1GOF A;  5DQ0 A;  1UX7 A;  3C7O A;  5J1X A;  2J1U A;  1JYV A;  1UYZ A;  2YG0 A;  1D7P M;  2W46 A;  5JXH A;  4ZZ8 A;  3D3A A;  1UYY A;  4A4A A;  1J84 A;  1W9W A;  2VZO A;  2WYS A;  4QDS A;  3W5N A;  3K75 B;  4GWI A;  2VMC A;  2Y6H A;  4W4Z A;  1W99 A;  2WZ8 A;  3PUI A;  3OB8 A;  2VOT A;  1ULO A;  4P08 A;  1UWW A;  1PMH X;  4DEV A;  4QX2 A;  1SDD B;  2WQ8 A;  2W92 A;  2X09 A;  2JKX A;  3WNM A;  4CU8 A;  2DCJ A;  2VZS A;  2XQX A;  3ECQ A;  3A21 A;  3VD9 A;  2VQU A;  3T0A A;  1JYX A;  2CDO A;  3IB3 A;  4W8J A;  1UXX X;  4CVU A;  4XUT A;  4BJ0 A;  1GQP A;  1NX9 A;  1OF3 A;  3OBA A;  2VZ3 A;  5DN2 A;  4DUV A;  1KEX A;  3W5M A;  2VQT A;  2V72 A;  2XON A;  3WQB A;  2ID4 A;  4XUR A;  2W94 A;  1JZ7 A;  2W95 A;  1L7R A;  1UY2 A;  3ACI A;  4D0Q A;  5F7U A;  2VTF A;  3SKV A;  3HJR A;  2E32 A;  4UAP A;  4A41 A;  3FHA A;  3E1F 1;  4KI5 M;  4OMC A;  3LPF A;  3F2Z A;  3WNL A;  2WN2 A;  3CMG A;  1K42 A;  3WF0 A;  3HNB M;  3OEB A;  3WEZ A;  3VD4 A;  2YC2 A;  3WF1 A;  3THD A;  1TG7 A;  3CZJ A;  2HYX A;  3IAQ A;  5JR2 A;  1WCQ A;  1UY4 A;  3K46 A;  2J22 A;  3FL7 A;  4P00 B;  5IYY A;  1UZ0 A;  3ACF A;  3NJV A;  4IUG A;  4M4P A;  1W8N A;  1O59 A;  1WKY A;  1CZV A;  1JHJ A;  4M4R A;  1W0N A; 
#chains in the Genus database with same CATH topology
 1ENQ A;  2DFB A;  4R9B A;  1PX4 A;  3OPT A;  4H14 A;  4RR3 B;  3W20 A;  4YW4 A;  1BEV 1;  2Z69 A;  4N8M A;  4NHL A;  1VP6 A;  5DXD A;  1FV3 A;  3OD4 A;  2ZGM A;  3RG0 A;  3V65 A;  2VM9 A;  1YHF A;  2TUN A;  4K40 A;  5KBF A;  3VBO B;  2YC4 A;  2HKX A;  3UGF A;  1HRI 3;  3VBF A;  1PGW 2;  3U37 A;  1VBE 2;  3W21 A;  3KWV A;  3I59 A;  2X29 A;  3FFZ A;  4JKL A;  1HRI 2;  4ATE A;  2GNM A;  4FPC A;  4P02 B;  2VUC A;  5CFD B;  3LD8 A;  4E8C A;  3B9I A;  3QCW A;  4QDQ A;  1AR7 3;  4AHW A;  4XBN A;  5ACA 3;  2P6C A;  4QX1 A;  3WOG A;  1X8M A;  3LE0 A;  2GP3 A;  1VRH 3;  5GM0 A;  2RMU 1;  1JUH A;  4X8N A;  4QAW A;  1UKG A;  3B7M A;  5C3Q A;  3ZDV A;  2DUO A;  1W3V A;  2ZA9 A;  1V6K A;  4LOR A;  5A3L A;  2VVE A;  1JU3 A;  2R04 3;  2Q8C A;  1F4H A;  1ZRC A;  2TEP A;  2PHU A;  2OW4 A;  4IW3 A;  4XUO A;  5AVA A;  2W1Q A;  3I2D A;  1HV0 A;  3TEW A;  1DQ5 A;  4TTG A;  4E27 A;  3O0V A;  2OYZ A;  4COV A;  4HZF A;  1GP4 A;  1VMF A;  4HL0 A;  4MLO A;  4QB1 A;  5A7Q A;  1ZVF A;  4EN9 B;  3LEI A;  3AP5 A;  2ARX A;  1MQT B;  1WME A;  4FVV A;  4OUS A;  3CKH A;  4LA2 A;  1AR9 3;  4JGY B;  4BQ4 A;  4K3U A;  2PHF A;  4TZD A;  5G04 L;  2HBT A;  3TWI A;  1H8T B;  4YPJ A;  5DDJ 2;  1L3J A;  3KV6 A;  5GZD A;  1RUF 1;  3QBQ A;  1C1F A;  2ZZQ A;  4P9G A;  1OVS A;  4NWV A;  3PUH A;  1AR6 1;  2ARA A;  2DVG A;  4HN0 A;  4BMB A;  3PU3 A;  3I3D A;  4CCK A;  3I2F A;  1QOO A;  2QUO A;  2XJR A;  1OH3 A;  3M4F A;  4GMP 3;  4CDX B;  3VDA A;  2ZHK A;  4LKE A;  1SPP A;  1G9B A;  3ES4 A;  2VAU A;  1DFQ A;  2VPV A;  1HRV 3;  2NQY A;  1YQ6 A;  4FI9 A;  4DXZ A;  3S6P A;  1EUU A;  4NII A;  1WLD A;  5CVR A;  2PMW B;  4YZ4 A;  1PNF A;  4SBV A;  2GN3 A;  2X10 A;  3AL6 A;  2VZV A;  4Q27 A;  2XWJ B;  3UJQ A;  1W2U A;  1AYM 3;  5BNN A;  5FY9 A;  4AFM A;  3OD0 A;  4Y5S A;  2J7M A;  2YV8 A;  5AC9 1;  3VBO C;  2X5I B;  4IEP A;  4OHV A;  2B9V A;  3QH6 A;  4N90 A;  3I3B A;  2HWF 1;  4H7L A;  4JDN A;  3JQX A;  2OII A;  5F3C A;  4GWJ A;  3D82 A;  4WVM B;  1W04 A;  1XE0 A;  1WD3 A;  4K21 A;  1CJP A;  4RR3 C;  2C4X A;  1W9Y A;  5BUV A;  3M7A A;  1UY0 A;  5F37 A;  3BB6 A;  1HRI 1;  3HN3 A;  2C5D A;  1XYP A;  2NM1 A;  2XG3 A;  3A7Q A;  4AFB A;  1ND2 A;  1S0J A;  3W58 A;  1QJU 2;  4C8D A;  4IV3 C;  1XNA A;  4FPK A;  4FFF A;  1DGR N;  2XHK A;  5GZG A;  1N1V A;  3DN7 A;  4I3G A;  3GZU C;  2QQI A;  2R7E B;  4Z2A A;  3BTY A;  3ZYG A;  5BYN A;  1XJA A;  4DPN A;  1RUD 1;  1SBD A;  1YI9 A;  3K48 A;  5T5P A;  5EP9 A;  3SLI A;  3UKN A;  2P3Y A;  4ZU5 A;  1JYC A;  2AZ5 A;  1UF2 C;  3J4U H;  3V0B A;  3BPZ A;  1NY7 2;  1VB4 A;  4ZU7 A;  5F3I A;  5FQ0 A;  1DBN A;  2JIC A;  3KF5 A;  1DIW A;  1G9C A;  1JOB A;  2BWA A;  2KA3 A;  3AB0 A;  4HVO A;  4AE2 A;  4R9A A;  1AHS A;  4MAD A;  4XJ9 A;  2WNV B;  3FLP A;  2WAB A;  3CF6 E;  5FLH A;  3LDR A;  4B4R A;  5A3T A;  4BZ4 A;  4P5H A;  3USS A;  2XJS A;  3QD6 A;  1R1Z A;  4Q26 A;  4JGZ B;  2A6W A;  2WNU C;  3WNO A;  4S2H A;  1IPK A;  2WWS A;  2WN3 A;  3MIG A;  5A32 A;  2VCC A;  4FOQ A;  2GU9 A;  4XW3 A;  2ZMN A;  1BXH A;  1WMD A;  1QOS A;  1DGR A;  1SHW B;  3GGL A;  3CJI C;  4D69 A;  2D3P A;  1PGL 1;  3ENR A;  2J1T A;  4C0H A;  2UWA A;  3VL9 A;  2XVL A;  1S0E A;  1N1T A;  5FUP A;  1GZW B;  1RUE 1;  4NPL A;  1PM7 A;  4IEZ A;  4DEQ A;  1JYW A;  2R0H A;  2JDM A;  4FPY A;  4X6R B;  3LDB A;  5FY0 A;  5ANQ A;  1CZS A;  4XDO A;  4GQ7 A;  4MGK E;  4C0B A;  5C4W C;  1W0O A;  5FBJ A;  3VBU B;  2YFU A;  2N7G A;  3EJK A;  1Y4W A;  2CWS A;  3VZL A;  2JD9 A;  1LES A;  2ES3 A;  4WZF A;  3KV5 A;  5FXZ A;  4UW3 A;  2W39 A;  2RV9 A;  4XJW A;  4YW3 A;  4W6Y A;  1EYB A;  2YBS A;  5DUW A;  3P3P A;  1E5H A;  4WM8 C;  5HPO A;  2RS3 2;  3VDB A;  3FC0 A;  1R1A 2;  2OKX A;  5CA6 A;  1XYO A;  1PZ8 A;  5IK4 A;  2HBU A;  5F5A A;  2JDA A;  5FZ8 A;  2WAO A;  3OG2 A;  4YYO A;  2Y6G A;  1HB2 A;  5BPX A;  4YVS A;  3SEE A;  2W52 A;  4LBL A;  1VPH A;  2A7A A;  1MR5 A;  3ZKY A;  4QDR A;  4J1W A;  5KXC A;  1BQP A;  1Y43 B;  2PHW A;  1JZ3 A;  5K8S A;  4AGR A;  2E9Q A;  4GJZ A;  4ES9 A;  3PTY A;  3BOD A;  4V2V A;  3AMM A;  4NVP A;  3ABZ A;  2A71 A;  4QPI B;  4CXX A;  4AGG A;  2O14 A;  1FOD 3;  4UBG A;  4ZS2 A;  5ERL A;  1O3Q A;  2R04 1;  4YW1 A;  3VL8 A;  4FAG A;  3THC A;  5BY5 A;  4Q2F A;  2RDS A;  2E51 A;  2WQ4 A;  3MHZ A;  5LA0 A;  1QIQ A;  3TBD A;  2P2K A;  2QBX A;  3IKW A;  2VU9 A;  1EV1 2;  4ES8 A;  2BPA 2;  2E7T A;  2NMO A;  2W3J A;  5G05 L;  3AC0 A;  2WLP A;  4UFL A;  4DIQ A;  2ZZJ A;  3H42 B;  3LB9 A;  4YGB A;  2ZX2 A;  1UAI A;  1VLN A;  2GC1 A;  2R04 2;  1N1S A;  2XBO 3;  2Y6F A;  3KVB A;  3OUI A;  4IDZ A;  4XF4 A;  1NKG A;  3UES A;  3VD7 A;  2YYO A;  3I3E A;  2Z79 A;  2PHT A;  2ZHM A;  4IEO A;  4LIV A;  1OPM A;  5JIA A;  4OHZ A;  4COZ A;  4Y33 A;  4QHO A;  1DLL A;  1ULE A;  1YFY A;  4JHT A;  3PIG A;  4Y20 B;  4XFC A;  1W6O B;  1QHD A;  2MPF A;  3K3N A;  2QQU A;  3NJY A;  2ZTN A;  3MV1 1;  3ZXG A;  2D3S A;  1SLC A;  5IVF A;  3B9C A;  5J09 A;  4AVB A;  5EXO A;  4DQA A;  1W9S A;  3DF0 A;  1XNC A;  2JDY A;  4NWW A;  3EXU A;  1HQL A;  4GWM A;  1TME 2;  1PVX A;  4M3C A;  1GKB A;  4XCA A;  3OGV A;  3T1L A;  1RUH 2;  4QKB A;  3VBH C;  2UY9 A;  3WQ7 A;  5L9V A;  2P1B A;  4GMP 0;  2QNK A;  5LY1 A;  2W9X A;  4XAC A;  4YGD A;  3WF2 A;  4HKL A;  1WCS A;  5JZG C;  1Q8V A;  3KV9 A;  2VXJ A;  1GV9 A;  2QQJ A;  3A4U A;  2HEW F;  5JZG A;  4MH0 E;  2J1R A;  3MYX A;  3AZV A;  4ZXE A;  5A1F A;  1DZQ A;  3MDP A;  5C9A A;  5EPA A;  2D43 A;  2D6N A;  3VDC A;  4CDW B;  2DFC A;  1SFY A;  2FD8 A;  4BQW A;  4IEY A;  4WVW A;  5FYZ A;  2G9Z A;  1W2O A;  2J1V A;  1I6X A;  2ZAH A;  3AVS A;  2HWE 3;  3OTF A;  5FZ3 A;  3L2Y A;  1H4G A;  3VDD B;  2EIC A;  1CAX B;  4CU6 A;  4YZ2 A;  3S5A A;  2EXJ A;  2PHL A;  1F5F A;  4CU7 A;  2H0V A;  4AOC A;  1AXY A;  1QGL A;  4GH4 C;  1Z7S 3;  4OI2 A;  3N7L A;  4O9G A;  5FPX A;  3UJO A;  2FBE A;  2QVS B;  4YGE A;  4NHK A;  2ET1 A;  1SLL A;  4PLM A;  4OI1 A;  2YMZ A;  3ZMN A;  1U5X A;  1NCQ B;  2LAL A;  2BNN A;  2VOW A;  2JB4 A;  4FP2 A;  2ZCW A;  3WHT A;  5LEJ A;  2WT0 A;  3FE5 A;  2NMN A;  3M3E A;  4PJY A;  1W6M B;  2VUD A;  4RFR B;  4B8E A;  3N9O A;  5D8A A;  5JWP A;  3RZK A;  4KWU A;  2A6Z A;  4IV1 A;  1TZO A;  1VAK A;  3F95 A;  4AGV A;  4FPF A;  1DQ6 A;  3ZPY A;  4BYY A;  2QJV A;  5T54 A;  4CTE A;  4LQR A;  5IVE A;  2WNU A;  3AYD A;  3QAC A;  3J8F 2;  4MVT A;  1O4T A;  2EAA A;  1ZRI A;  2JG9 A;  3N9N A;  1OVP A;  3QOP A;  3CDZ B;  5L7O A;  2D98 A;  3NO8 A;  3ZX7 A;  1LED A;  2ZGT A;  2DVB A;  5FYM A;  1RTV A;  4RS5 B;  3D0J A;  3HPN A;  1JW6 A;  2PLV 3;  2WZE A;  3AZX A;  4HPK B;  5I8S A;  4BQ1 A;  2QQW A;  1T2X A;  3RJR A;  5CZK A;  4IND A;  3N4M A;  1V00 A;  4RGK A;  2C0Z A;  2I2S A;  5K0U B;  4TXW A;  3ZIX A;  1KFU L;  4C1X A;  5GLZ A;  2P5B A;  4CDX C;  1AJO A;  1HB3 A;  1J1T A;  4H3W A;  3MUZ 1;  2RJL A;  5FZO B;  3WDV A;  5ISL A;  4AI1 A;  1C5I A;  3V0A B;  4GWN A;  3WX5 A;  3VZO A;  1EP0 A;  4FXK B;  2QQK A;  4I2O A;  3NRU A;  1S55 A;  2R0F A;  4A2U A;  4IXL A;  5JSO A;  1H8T C;  3WSO A;  1GNH A;  4LEJ A;  3VKO A;  3ALQ A;  1HXS 2;  5L9R A;  4E8D A;  1VBD 1;  3BN6 A;  2VH9 A;  4YRD A;  4FOY A;  4NUB A;  1YFX A;  2PAK A;  5FUI A;  2DUR A;  3OEA A;  3PVE A;  2C26 A;  1OD5 A;  1UYX A;  1NAE A;  5EQU A;  1UY1 A;  3B01 A;  1BEV 2;  1RUJ 1;  3BTA A;  2OQ7 A;  3OCP A;  1ONA A;  1REE A;  3AKQ A;  4LBK A;  5FLI A;  1BHG A;  1AJK A;  3VBS C;  5AC9 3;  2OA2 A;  1JH5 A;  4BA6 A;  5AC9 2;  3ZR6 A;  4YZ5 A;  1UCX A;  5F5Q A;  5BNN C;  1X33 A;  4IEV A;  2JB8 A;  3DUI A;  1UYZ A;  3NAP C;  1K5M A;  3AVR A;  4LNV A;  3WDU A;  3AKR A;  3N3H A;  1UYY A;  4A4A A;  3WDW A;  2P37 A;  2CYF A;  1HQN A;  1RUJ 3;  3TEY A;  5J36 A;  2IVI B;  3NNJ A;  1RUJ 2;  1F15 A;  1W9W A;  2VZO A;  2K2S A;  3JB4 C;  3KQR A;  4QDS A;  5FWE A;  1AR6 2;  3TN9 1;  2D7F A;  4GWI A;  1RUD 3;  1FOD 2;  2G9G A;  5CB7 A;  1XSQ A;  1RMU 1;  1RUD 2;  1H8V A;  1WW7 A;  2WZ8 A;  3MIE A;  1I3H A;  1A78 A;  3WP6 A;  1A8D A;  1HQW A;  3Q8C A;  1W06 A;  4E9K A;  1S0F A;  1EV1 3;  1Q8Q A;  1U12 A;  3DPR B;  2G19 A;  4P08 A;  3WG4 A;  1PMH X;  3RYR A;  3RZM A;  2X09 A;  3FBY A;  5FPZ A;  3ZDS A;  5ABJ B;  1ENX A;  3ZFF C;  1ZYB A;  2ARB A;  3MF9 A;  4WM8 B;  1WA4 A;  4CCO A;  3AMQ A;  4LBO A;  4NN0 A;  2VZS A;  5C8W A;  2DCT A;  3RRD A;  1W28 A;  5FOJ B;  2QQP A;  4D7T A;  1UOF A;  2LM3 A;  1ULC A;  3GNE A;  1FPN 2;  1POV 3;  3AP9 A;  1SFP A;  2GME A;  4P9Y A;  4HKW A;  1W6N A;  1UYP A;  2QZ3 A;  1S4C A;  2QQV A;  1MZE A;  1F31 A;  1C3H A;  4JTN A;  5T5L A;  3ZFE C;  4XAB A;  2PAE A;  1GR3 A;  2D6K A;  2VEC A;  1NOV A;  1GQP A;  4BJ0 A;  3LCP A;  5LY2 A;  2CGN A;  4QPG A;  2MEV 3;  3PTR B;  4DUV A;  1OLM A;  3N9P A;  1KEX A;  4L99 A;  1WUV A;  5F6K A;  1V9U 2;  2XXZ A;  2O1Q A;  2W95 A;  4N9I A;  4NRM A;  5CIS A;  1W6P A;  2WA3 A;  4XE9 A;  5FZ4 A;  4D0Q A;  3D8C A;  2VTF A;  3O1O A;  1RUG 3;  5BNO B;  3ZOI A;  4UAP A;  5FYH A;  4DIN B;  1RUG 2;  4OMC A;  5FYT A;  2A6X A;  3OY8 B;  1RUI 3;  5A33 B;  3N9L A;  5A3W A;  3CMG A;  2F4P A;  3PUS A;  2XML A;  3ZIW A;  4EN0 A;  3LOB A;  1LAJ A;  2I45 A;  3WEZ A;  3VD4 A;  5CAZ A;  1APN A;  1W8H A;  2HEV F;  3THD A;  1TG7 A;  3CZJ A;  1AF9 A;  3KCX A;  2Q30 A;  2JG8 B;  2RDR A;  1UY4 A;  4BIO A;  4JCK A;  3RVH A;  2YRO A;  2ZX3 A;  3FL7 A;  3ZFE B;  2H6B A;  4D6S A;  4NJ4 A;  2VMI A;  3M1H A;  1EPZ A;  2XLG A;  1X7N A;  3WG3 A;  4K6B A;  5C3R A;  1ACC A;  1W8U A;  2XJV A;  3ACF A;  3NJV A;  5T5J A;  4B29 A;  1W8N A;  5FO7 B;  2YC0 A;  2YBK A;  3CJI A;  3Q9O A;  1O59 A;  2BTV C;  4R8H A;  3UKV A;  1PO2 1;  4CXY A;  1TQ5 A;  3IWZ A;  4CDQ A;  4BQ5 A;  4E4Z A;  3RZG A;  4DO0 A;  1IS5 A;  1C4R A;  1W0N A;  4ZXK A;  5IVV A;  2L9L A;  2QDR A;  4W50 A;  5FRA A;  3GBF A;  3FX3 A;  2BDR A;  5A1A A;  2R06 3;  1W9T A;  1YWK A;  3AFK A;  4JGY C;  4JDO A;  3O1R A;  4E4D X;  1OHF A;  3WZ1 A;  3DEC A;  2JE8 A;  1M06 G;  4S2D A;  5FZF A;  4NAM A;  3T09 A;  3THP A;  3O5S A;  3PVB B;  5APA A;  1WW4 A;  4PLO A;  3JD7 2;  3VBH A;  1B35 A;  1MS3 A;  5FV3 A;  1KRI A;  3C7H A;  4XTP A;  4LBQ D;  4P5Y A;  4L92 A;  4XVH A;  3DL3 A;  2AEN A;  1R64 A;  1AZD A;  2BUK A;  3POG A;  3U07 A;  2VZQ A;  4EE2 A;  4QB2 A;  4IL7 A;  1EAH 3;  1ZZC A;  2MHF A;  4N43 A;  1VRH 2;  2JDH A;  3RFR A;  1BZW A;  1EUT A;  1Y7B A;  3C7E A;  5FXW A;  4AHY A;  2FMY A;  2G1M A;  2B42 B;  5C5U A;  4Z8B A;  3VBO A;  1IPS A;  1YFU A;  2UY8 A;  4K7J A;  2ZBJ A;  1SBF A;  5DUX A;  3U4S A;  5T3N A;  3ZXD A;  5CFD C;  2VGD A;  4AVT A;  3T08 A;  3U0Z A;  5CFD A;  2VUA A;  4K9S A;  1N47 A;  1PMI A;  1ZBA 2;  4BM8 A;  1R1A 1;  1NA1 C;  4Y22 B;  1WLC A;  2VMD A;  5SV5 A;  4DOU A;  1RUG 1;  2WJS A;  3CZU A;  2EA7 A;  5JMC A;  4BME A;  1AR9 2;  1LJ7 A;  1PHM A;  1NUK A;  4FP3 A;  4DRV A;  1SCS A;  1XU2 A;  5B4N A;  3SEP A;  1C5H A;  3K77 A;  1ASJ 3;  1YQ8 A;  4EQV A;  4G3Y C;  4J1X A;  5DG1 A;  1JOP A;  3OUJ A;  2D5F A;  4RQP B;  3EB7 A;  2OVU A;  3NQH A;  3LFM A;  4B7K A;  1V70 A;  4MHR A;  1RHI 2;  3M8L A;  4AVA A;  1K5M C;  5IHR A;  2AR6 A;  2WWJ A;  3KT4 A;  5CFC A;  4Q1R A;  4IER A;  1IS6 A;  1YEW A;  1YFW A;  1VR3 A;  2R1D A;  4QB6 A;  1OH4 A;  2HWF 3;  3SNM A;  2ZX0 A;  4NIH A;  4ORF A;  4YZ3 A;  5FZD A;  1ZZ9 A;  2VE1 A;  4XPV A;  1PO2 2;  1FNY A;  1F4A A;  4ZPI A;  2VTX J;  3SH3 A;  4E2Q A;  4XJA A;  3GJA A;  1KQR A;  4XZU G;  4FCA A;  3WD5 A;  3HT1 A;  2NN8 A;  3K4Z A;  3RPQ A;  4XDP A;  2XGX A;  4H55 A;  3WNX A;  2Q4S A;  3G6J B;  1PO1 1;  2BEO A;  5C4W A;  2JIJ A;  4QMA A;  3AP7 A;  2GMP A;  4PI0 A;  3DYM A;  1PMJ X;  2DBI A;  1SLT A;  4OUM A;  2VCM A;  1EY2 A;  2VMH A;  3PIJ A;  2DVD A;  5J98 B;  5BNQ A;  5I0S A;  1QJY 1;  1R08 1;  1AR8 2;  3K3O A;  5FK7 A;  5FR3 A;  4YAR A;  2DCY A;  2BP6 A;  1LOC A;  5DZF A;  2LS6 A;  2VG9 A;  2WZR 1;  4MO3 M;  1GAN A;  2WT1 A;  2XL9 A;  4PIX A;  5D21 A;  3ZYR A;  2XPJ A;  1BMV 2;  2VO5 A;  1ULP A;  2D6M A;  4I0A A;  3RI8 A;  3NNL A;  4PT6 A;  2ZXQ A;  4YVW B;  4HXC A;  1A3K A;  3HMY A;  4OMD A;  2GC0 A;  2D5H A;  3NNG A;  4BE3 A;  4PQ9 A;  1SFN A;  4WVM A;  5IAX A;  2CDP A;  5FZG A;  3WNP A;  2Y8K A;  1MZF A;  1MQT C;  5DUV A;  4C1W A;  2QQM A;  4K8R B;  1V6I A;  2V5D A;  3RMY A;  4AED A;  4COY A;  4KWL A;  2C24 A;  2ZAA A;  5LBF A;  2BGP A;  1S0C A;  1W6Q B;  1NLR A;  4IV1 C;  3HBK A;  4CP9 B;  4EN8 B;  4CCN A;  2BGC A;  2HJI A;  3J8F 1;  1VBA 2;  4CP0 A;  2CHH A;  3V0B B;  2TBV A;  3T0D A;  3EMR A;  3T2T A;  2EAL A;  2GAU A;  1QJF A;  5CU1 A;  2VZU A;  1RED A;  4XJZ A;  4IET A;  4IGQ A;  2VOK A;  4M0N A;  5FY7 A;  4YLZ A;  3WCR A;  3AZY A;  5FY5 A;  4EYU A;  5FPA A;  3HWJ A;  1JYI A;  5FK8 A;  3I4I A;  2EIE A;  2WZR 2;  4HBN A;  4O9E A;  1QQP 2;  2WNV A;  3O0X A;  5C3P A;  5KXD A;  3OF1 A;  4MSV A;  5IW0 A;  3DYO A;  3ZN4 A;  4HN1 A;  4QT6 A;  1OOP C;  2BV4 A;  3W9A A;  1HN0 A;  1PNG A;  3A0K A;  4I0W B;  1IZ3 A;  2VL4 A;  3CHX A;  4LKD A;  3BVC A;  4P14 A;  5FCC A;  4OZO A;  2DTY A;  4O65 A;  2CTV A;  2W5F A;  4HKO A;  3KF3 A;  3POJ A;  5ANN A;  2P3K A;  2CV6 A;  2VTX A;  2VW2 A;  1NE4 A;  2OPK A;  1MS9 A;  2Y0I A;  3K2O A;  2QDN A;  3PUR A;  1RMU 3;  3RWN A;  1SEF A;  5CEH A;  1LGN A;  5I0U A;  2BGO A;  3PJY A;  1H2M A;  2W1U A;  3CBN A;  2VCB A;  3S30 A;  5JVV A;  1NCQ C;  3LDK A;  1EV1 1;  3P6B A;  2RS3 3;  4LHN A;  1W05 A;  4XMA A;  1XC6 A;  1HN1 A;  2W91 A;  5AFE A;  4LO8 A;  3UK9 A;  5HV0 A;  1DDL A;  4OLL A;  2Z4F A;  3H9A A;  1Z0H A;  1J1L A;  2PA7 A;  2UWC A;  4FPH A;  4OHW A;  4Z2W A;  1ENS A;  1JZ5 A;  3J7M A;  3T30 A;  4QX3 A;  4I09 A;  4LE4 A;  2FHR A;  2PFW A;  4V2W A;  1FXZ A;  2XH6 A;  2ZEX A;  4N53 A;  2VZP A;  3KCC A;  1ZRR A;  4IQP A;  2FCV A;  2VNV A;  2VZT A;  3WW4 A;  3WQ1 A;  1UOG A;  2J1S A;  2BZD A;  3O14 A;  1RJ8 A;  1CES A;  1OC1 A;  4LBQ A;  4CCL A;  5IWF A;  2RS3 1;  4IEW A;  4UWD A;  3GBG A;  2VY0 A;  1DG6 A;  1PK6 B;  2VXR A;  5FO9 B;  4JHZ A;  1OMI A;  1H1I A;  5K0U C;  4QKF A;  2FCU A;  3C8X A;  2AEY A;  4LE3 A;  4Y1U A;  1OLM E;  3OGR A;  1N3Q A;  3WP3 A;  5DAB A;  2B4K A;  3M3Q A;  4Q4X 3;  4RGG A;  1OD3 A;  4RL7 A;  4QPI A;  5FMO S;  1LRH A;  1Q8P A;  1MEC 2;  4E2S A;  3KHC A;  5H9S A;  4Q1P A;  3SH4 A;  4H7M A;  5F39 A;  1JI6 A;  1LUL A;  2H0B A;  3ACG A;  3SIT A;  1KXG A;  4IES A;  1CPN A;  3AJZ A;  3I2H A;  3NW4 A;  4XCB A;  3AYE A;  4XHX A;  3P5B A;  2WS9 3;  1CAV A;  4R52 A;  4A42 A;  1W03 A;  4HSJ A;  1NA1 B;  3M3C A;  3PU8 A;  3ROU A;  3O1T A;  3BPS A;  2HWC 1;  2YB7 A;  4QX0 A;  2VNG A;  2WIN B;  3NV3 A;  3UGG A;  2FDK A;  1YUD A;  4BDV B;  1HLC A;  1XOY A;  5IK5 A;  3N7K A;  2YY1 A;  2Y6K A;  4BIS A;  4IE0 A;  1AL0 G;  1DP0 A;  5BNP A;  4CEY C;  2VVF A;  1CON A;  2EVX A;  1CN1 A;  3G7D A;  3KM5 A;  3IMN A;  4RYD A;  3IM0 A;  2Q8O A;  2OZ6 A;  3BTZ A;  3E5Q A;  1HRV 2;  3MFA A;  1IQD C;  3T3Y A;  1NG0 A;  4JC1 A;  3I2G A;  4NIA A;  1VIW B;  1QKQ A;  5KC5 A;  4AI2 A;  1PO1 3;  1QF3 A;  2B39 A;  1AXK A;  1S1A A;  4DS0 A;  5JXG A;  4QGN A;  4NID A;  3S57 A;  1YO8 A;  4BPZ A;  5CNA A;  5JXJ A;  3NL1 A;  1QJY 2;  1R08 2;  3V56 A;  1YIF A;  1QJY 3;  1R08 3;  1BK1 A;  1WCU A;  1RC6 A;  1BK0 A;  3N7J A;  4XFB A;  3RZH A;  3LKJ A;  1D4M 2;  1W2A X;  1D4M 3;  2AYH A;  4NPM A;  4AG4 A;  4MGI E;  3GXU A;  1IQA A;  3MBW A;  1Z7S 2;  1E5R A;  1FX5 A;  4P9I A;  4XDQ A;  5SV8 A;  3PDQ A;  4LXL A;  4Z92 B;  3MO4 A;  1LOD A;  3MI8 A;  3W59 A;  2Z2S B;  4RQP C;  2JE9 A;  1DU3 D;  3DKW A;  1CR7 A;  4QX7 A;  5FZM A;  2RM2 2;  1NQJ A;  2HWD 2;  5A7N A;  3H3L A;  5LRR A;  4R9D A;  4LHS A;  2PHX A;  4NHY A;  1ND3 B;  1UXZ A;  2YHJ A;  1W8F A;  3OUH A;  5DAQ A;  2FCT A;  1QNW A;  3VZK A;  3JUU A;  3K4D A;  3SCG A;  1BKZ A;  1XE8 A;  3AYA A;  3VBR B;  2WA4 A;  1S0D A;  4Q0S A;  4ASL A;  4B1M A;  5FO8 B;  5F2S A;  1HB4 A;  4JQT A;  2QTW B;  2VJX A;  1O3S A;  1JYN A;  4CDU A;  3HQU A;  3J8F 3;  5C71 A;  1NCQ A;  2ZPX A;  1KDK A;  1MVE A;  4YG0 A;  4F7Z A;  3IDA A;  1G86 A;  2QQL A;  4DY5 A;  3UNP A;  1PGS A;  3NKT A;  4AAX A;  5DAP A;  3KV4 A;  1AR7 2;  5ACA 2;  2PXJ A;  1W6M A;  2PLV 2;  2WKK A;  5D8A B;  2LUW A;  4XFG A;  2DU1 A;  4YSF A;  4DXR A;  5A1L A;  1ZRF A;  1WBF A;  4Q0P A;  5EHD A;  3GBW A;  2DTW A;  3NAP B;  5EJ3 A;  4CCE A;  3SHR A;  4QU1 A;  2P3J A;  2NYY A;  3QH7 A;  3M70 A;  3NV1 A;  1IOA A;  3K4A A;  2HWC 2;  2JG9 B;  2XJQ A;  2WFP A;  2R1B A;  3EQE A;  4RS5 C;  2I07 B;  4CA9 A;  2XHN A;  2E33 A;  4L97 A;  4DXS A;  3IZO A;  3AMP A;  5C5T A;  1S0B A;  3HQR A;  2PYT A;  1LEN A;  1SMV A;  3LOI A;  5FAX A;  1V6L A;  5DPN A;  1WBL A;  1DGW A;  1K3I A;  1NYW A;  2JIG A;  3WW1 A;  3WNK A;  3O1S A;  1WCK A;  1XXN A;  1UOJ A;  2VW1 A;  3N9Q A;  4RHV 3;  5LBC A;  1BEV 3;  2PQQ A;  1CAW B;  2ADD A;  1J3R A;  3CIH A;  1X9P A;  4HOO A;  5AVP A;  4MXW A;  3ZPO A;  2LRP A;  2XDV A;  3HR9 A;  1D0G A;  4GZ9 A;  2PEL A;  1RMU 2;  4DXT A;  2OUJ A;  1GOF A;  1R09 3;  5DQ0 A;  1UX7 A;  4FOV A;  3VKF C;  1YIP A;  3MIF A;  5K7P A;  5F32 A;  1VBC 2;  1VAM A;  3KGZ A;  3TNP B;  3IIA A;  5C8C A;  2W46 A;  5JXH A;  4ZZ8 A;  4A7Y A;  3R05 A;  3E97 A;  5JOY A;  3PMS A;  2BNO A;  1PZ7 A;  1H4H A;  1IG0 A;  1RIR A;  3MIB A;  5JI9 A;  5JOX A;  5KR7 A;  1O5L A;  1J84 A;  2Y34 A;  3D6E A;  1YJL A;  2RS1 2;  4CCD A;  5FP4 A;  4W65 A;  2X5I C;  4BOW A;  4ITC A;  1PO2 3;  1Y9M A;  4CXW A;  2WYS A;  3VDD C;  3ZXK A;  4WVZ A;  2VMC A;  3OOX A;  3ORJ A;  1KS4 A;  4PDW A;  2R06 1;  4FFI A;  4LUK A;  5FMD A;  2XVG A;  1K5M B;  1XNK A;  3PUI A;  4JZR A;  4EV0 A;  5K9Y A;  1PIV 1;  4ATF A;  4YM3 A;  4FTB A;  5BNO C;  2FDI A;  1UWW A;  3V64 A;  5L73 A;  2JD4 A;  4LHK A;  4Y1Y A;  3N7M A;  1RUF 3;  4NR1 A;  5I93 A;  3FUQ A;  1VMJ A;  2TNF A;  4YW2 A;  4KU7 A;  1O3T A;  2ZOE B;  2Q1F A;  3ECQ A;  3VD9 A;  2VQU A;  3SCF A;  5JLV A;  2W08 A;  1QY4 A;  4L8Q A;  4RA0 A;  3SIS A;  3WUD A;  4W8J A;  5FWJ A;  1ZZB A;  3DPR A;  1PIV 3;  3GCX A;  3NMB A;  4XUT A;  5A7W B;  2Q8D A;  5FFO C;  1UNB A;  1NX9 A;  4R9C A;  3OBA A;  2QZ2 A;  1B35 C;  3ZXF A;  4XXP A;  5E88 A;  2MEV 2;  3VKL A;  2V72 A;  3ES1 A;  1H2K A;  1FPN 1;  2ID4 A;  4XUR A;  1TME 3;  2HWD 1;  3H50 A;  3TN9 3;  3OGJ A;  3J7N A;  1L7R A;  1OBN A;  1TEI A;  2RHP A;  2YBP A;  1LOB A;  4QHZ A;  4KWJ A;  1W39 A;  1PZ9 A;  1A8M A;  1MQT A;  1NXD 1;  2PN5 A;  1DGL A;  2VMG A;  4P9J A;  1J3P A;  1RUC 2;  1B09 A;  1IGO A;  1W6N B;  2E32 A;  5F9T A;  3MZH A;  4COW A;  2CWM A;  4RGA A;  3E1F 1;  5T52 A;  1DYP A;  3GYD A;  2VNR A;  5FYB A;  1XRU A;  1C8M 2;  4PF5 A;  2YGM A;  4Y4R A;  4D3W A;  5CKM A;  5FZB A;  2E63 A;  1ASJ 1;  1IKQ A;  2Q5T A;  1L7L A;  2WN2 A;  3Q8E A;  1BVV A;  1GP6 A;  3WF0 A;  1K42 A;  2IWG B;  1JXN A;  3HNB M;  5T55 A;  2DVA A;  3VZM A;  3VV1 A;  3WF1 A;  4WV8 A;  1O3R A;  1W6P B;  4ZHN A;  3IAQ A;  1WCQ A;  1LCL A;  4QM8 A;  4NAO A;  4IE4 A;  4QU2 A;  1POV 1;  3BUC A;  1YNA A;  3ZSK A;  1UPS A;  4Q4Y 3;  4WM7 A;  1HV1 A;  1T6G C;  2WO7 A;  3IDE A;  3OY8 A;  2P17 A;  2DV9 A;  1LHV A;  1UU6 A;  1ND3 C;  3HN1 A;  1UKR A;  3IDC B;  3ON7 A;  4QX5 A;  1OUX A;  1ZX5 A;  5A33 A;  1O4Z A;  5BNN B;  3ZSM A;  4YFZ A;  4XZP A;  3NJZ A;  3WT3 A;  2W68 A;  3I8T A;  5BV6 A;  3ATG A;  4KU8 A;  2CAU A;  2X5I A;  5FOB B;  1AVB A;  2RG4 A;  2JDK A;  4Q4V 2;  1O4Y A;  1W8O A;  1WMX A;  2JG8 A;  2R06 2;  3OJB A;  4KWK A;  5GZF A;  3X29 B;  5CBL A;  2YPJ A;  1OA2 A;  1XYN A;  3WG1 A;  5FLJ A;  5GLU A;  2WAA A;  2ZEW A;  5JI7 A;  4D7Y A;  4EZ4 A;  1JUI A;  4XQ4 A;  4ARX A;  3WDX A;  3GM8 A;  3WXP A;  4UFJ A;  3JD7 3;  3JXS A;  3ACL A;  4MET A;  4LK6 A;  2IUW A;  4XIK A;  1VB2 A;  1RL3 A;  3PVO A;  3CJI B;  2VR4 A;  4UFH A;  4CU9 A;  3RWK X;  1OKO A;  4YG6 A;  4NHM A;  4FBF A;  2LW8 A;  3WVJ A;  3CNA A;  1JZ4 A;  1RUE 3;  2YFZ A;  3C7G A;  5GZC A;  3ITQ A;  3POY A;  4MYE A;  2Y33 A;  4BB3 A;  1D2S A;  3DCQ A;  5IVB A;  2OQ6 A;  3MLJ A;  1AYN 2;  1N1Y A;  5FZA A;  1NCR A;  4MOA A;  1A6C A;  4UW5 A;  4Y26 A;  1VBE 1;  1XNB A;  1DQ0 A;  5FQ0 B;  4LO5 B;  2X53 S;  3KVA A;  3ST7 A;  1IKP A;  4GB3 1;  2RS1 1;  5LA1 A;  1YC6 1;  4LBN A;  4L2N A;  4URT A;  4IV3 A;  1PVC 1;  4DNY A;  4CE8 A;  3H8R A;  1K45 A;  4JGZ C;  3GJB A;  1YI7 A;  3NVC A;  4XF1 A;  3SC7 X;  2GH2 A;  1JOD A;  1N3O A;  1OQ1 A;  1DQ1 A;  2WL1 A;  3MV0 1;  4JGZ A;  2W87 A;  1X82 A;  5D2A A;  1HXS 3;  4OI4 A;  3ZYJ B;  1BBT 3;  2RVA A;  1C57 A;  3APB A;  5EIY B;  1NZC A;  1W2T A;  2BBA A;  2ZGL A;  5EZW A;  3POI A;  5AFB A;  2X05 A;  5L36 A;  5FXX A;  4N43 B;  3WY6 A;  1BCX A;  3ZN6 B;  2ZJC A;  2ZKL A;  4NRP A;  4LT5 A;  4YWA A;  4KQ7 A;  2A3W A;  2F6B A;  5DDJ 3;  4NHX A;  5E89 A;  2CGP A;  2DYC A;  1OPO A;  3NKG A;  4DMI A;  3ACH A;  4AFA A;  5KHJ A;  1PVC 3;  1GZW A;  3BGA A;  5A80 A;  4I01 A;  4CDU C;  3D0S A;  3EHK A;  1QNY A;  1DGW X;  2D3R A;  1F35 A;  3VBF C;  2GND A;  3E6D A;  5J37 A;  1W90 A;  4ONU A;  4B3N A;  3UV9 A;  5IVJ A;  3GDB A;  3CJX A;  5LEK A;  5LCW L;  1BBT 1;  5FY8 A;  3MUY 1;  3VBU A;  5HCF A;  1PK6 C;  3B02 A;  3WLU A;  1JMU B;  4RN5 A;  4YW7 A;  4BIF A;  3H8U A;  4CPB D;  2YU1 A;  4BLI A;  3JU9 A;  3ZM8 A;  1PO1 2;  3FLT A;  1NT0 A;  4CP2 A;  1RVF 3;  3VHN A;  2RS5 3;  1AX2 A;  1UIJ A;  2YZ4 A;  4AQT A;  2MNG A;  2W1W A;  1W3X A;  3HOB A;  2Y0O A;  4XUQ A;  4MG2 A;  3AL5 A;  1SLA A;  2AAC A;  2VUJ A;  3WV6 A;  3ZFF A;  4FPE A;  5LZ6 A;  1D2Q A;  1KGY A;  2CNA A;  3RYP A;  5CFC B;  4YM2 A;  1LOG A;  2D97 A;  3P1I A;  4FSJ A;  3B93 A;  4RR3 A;  5GLW A;  4UW6 A;  5EYX A;  2GDF A;  3L2H A;  1NLQ A;  4KL1 A;  3JD7 1;  4WBB A;  4XFI A;  2ZGK A;  3ILF A;  1XQN A;  3POB A;  2IVJ A;  1U5Z A;  3HIF A;  2IFW A;  3RSJ A;  3WQ0 A;  1QDC A;  1AR8 3;  2WO3 A;  2VBP A;  4LUL A;  2SBA A;  5FKB A;  3IBM A;  2LTN A;  5FTT C;  2UYA A;  1WA6 X;  3ZKU A;  1LOE A;  3NST A;  4XBL A;  4XMI A;  1TMF 2;  1CIW A;  5CG9 A;  2PQS A;  4Q0Q A;  5C7G A;  3UYJ A;  4R4X A;  5JPM B;  4GB3 2;  2WT2 A;  3WP5 A;  3OGS A;  2Y60 A;  2HEY F;  4GB3 3;  4U36 A;  2A73 B;  3WF4 A;  1HJG A;  2ARC A;  1VBB 1;  3NJX A;  3KQ4 B;  4TWT A;  5L9B A;  2Z5W A;  4XET A;  1O91 A;  2DUP A;  1I9R A;  4Q4V 1;  1FAT A;  1Y9Q A;  1WLW A;  4I02 A;  3CLP A;  3POS A;  1UO9 A;  4NPR A;  2D44 A;  2D6P A;  2W1S A;  2QKD A;  2WFF 2;  2OS2 A;  4IE5 A;  1J58 A;  3WF3 A;  1O8S A;  4ET7 A;  5JPN B;  4YVW A;  3ZXL A;  5FZ9 A;  3T0B A;  1CAU B;  1UQX A;  4AHZ A;  5C70 A;  4MX3 A;  5JCT A;  1RUI 2;  2ZGQ A;  2HWC 3;  5DDJ 1;  3R4S A;  2PTM A;  4M3C B;  4JGY A;  4QHB A;  4K8F A;  1AX1 A;  5F2W A;  2XLF A;  4JKK A;  3B5L B;  5F5C A;  1QQP 3;  5J48 A;  1GYK A;  1VBB 3;  2B9U A;  4Q0V A;  4AED B;  1H8T A;  4PLN A;  4COU A;  5C33 A;  1Q8S A;  4UF0 A;  3IT8 A;  4ISR A;  1VAV A;  4E4H A;  2VME A;  5HV4 A;  2PAM A;  2E6V A;  2Q1Z B;  2SLI A;  3PME A;  2AC1 A;  2AUY A;  3KHB A;  1NXM A;  3GHM A;  4Q4Y 2;  5C3O A;  1PM4 A;  1YYN A;  4CDX A;  4CP9 A;  4DUX A;  4EWE A;  3VLB B;  2RE9 A;  1GOG A;  1UZY A;  1LOF A;  2IXH A;  3I54 A;  1VBA 1;  3JB8 A;  4QQ2 A;  2ZAB A;  2ENR A;  3T2Q A;  3DYP A;  4CCJ A;  1E5S A;  1LKN A;  4I3P A;  2IC1 A;  1R09 2;  2QE3 A;  3VDD A;  4NOT A;  4GIQ A;  4N7I A;  4JRL A;  1WW6 A;  1I5P A;  2WNE A;  1LHU A;  2ERF A;  3FMG A;  1LGC A;  5DAV A;  1H1M A;  3QLQ A;  5HCB A;  3CQO A;  2W2I A;  1ULF A;  4WZC A;  3R0R A;  5FYI A;  1US3 A;  2W0X A;  5FP9 A;  3ZXE A;  3UL2 A;  1O8P A;  5C3S A;  1QJX 2;  1UL9 A;  4MHU A;  3LA7 A;  1BVP 1;  5FJK A;  2J42 A;  4AEM A;  1S2E A;  2GNT A;  1VBE 3;  5H9R A;  5DG2 A;  4AR2 A;  4GKX A;  1DYO A;  1MS8 A;  2WO1 A;  4LK7 A;  4JQR A;  4Y1Z A;  1XE7 A;  4L11 A;  4OZX A;  4UOJ A;  1QDO A;  3MID A;  4Q4X 1;  2FDF A;  3R6S A;  2BJS A;  3ZYH A;  2WO2 A;  1COV 3;  1NE6 A;  3EYP A;  5E16 A;  5D1I A;  4JKM A;  1XSR A;  3J26 N;  1COV 2;  3VHP A;  2VNO A;  3MLK A;  4OUE A;  3RJ2 X;  3CO2 A;  4Y24 A;  1DZT A;  2IFR A;  1DCS A;  5LW9 A;  2WQZ C;  4HT1 T;  4O61 A;  5LBE A;  1FI2 A;  1SCR A;  1OOP A;  1OKQ A;  4AI0 A;  5I0T A;  5A7P A;  1YQC A;  1OLR A;  2WSU A;  3JQW A;  3WW3 A;  2C9K A;  2R16 A;  2YGL A;  4URA A;  1G8W A;  3MIH A;  1YXW A;  2BW8 A;  2XBO 2;  4FPL A;  4LO4 B;  5EJ1 B;  1ZBA 3;  4Q4Y 1;  1SAC A;  3I3M A;  1MEC 3;  4M3C E;  5F3G A;  4HSL A;  2WBK A;  1GLH A;  1Z78 A;  3VBR C;  2ZX4 A;  2G4I A;  1W8W A;  2GC3 A;  5A3P A;  1IS3 A;  1UU4 A;  2Y6J A;  4OHX A;  5F6L B;  4AI3 A;  1XNT A;  5B4X A;  1PK6 A;  5A3U A;  5HBA A;  3KD4 A;  1G9D A;  1UOB A;  1JYT A;  3TAY A;  3JBG 1;  1QXJ A;  3FUO A;  4QQP A;  4CCM A;  2WS9 2;  1UY3 A;  2KD7 A;  4HK9 A;  1H1A A;  5A7O A;  5A32 B;  5T5O A;  4BHP A;  1X36 A;  1I1E A;  1XPW A;  2Y64 A;  4LHL A;  3H7J A;  2W47 A;  4AEK A;  4MV2 A;  3TN9 2;  3I49 A;  3BTX A;  3RDI A;  1RVF 1;  3PUQ A;  4KMQ A;  3MFC A;  2VOV A;  1S0G A;  3AX4 A;  3RMX A;  1V0A A;  4X6Q B;  1MEC 1;  3VBS B;  3HNM A;  5LK7 B;  4OUL A;  4ZKT B;  1AL2 3;  4F3J A;  1GU3 A;  2HWF 2;  4AYU A;  2Q0A A;  3U1X A;  3HBZ A;  4D94 A;  5BNP C;  4FO9 A;  3JBG 3;  1JTZ X;  2Y38 A;  4XUP A;  3WHU A;  5HI0 A;  2ZGU A;  3JBG 2;  5I0R A;  5A3N A;  1WD4 A;  1QH6 A;  3IAP A;  3Q8B A;  3AK0 A;  5FKC A;  3H0O A;  4B1L A;  3CEW A;  4Y1V A;  3PNA A;  3O7O A;  4GAL A;  5BNP B;  2WII B;  1LTE A;  1BMV 1;  4CEW A;  5A6Q A;  4GH4 A;  3AXE A;  1NCR C;  2BNM A;  1YQ5 A;  4A7Z A;  3MPB A;  3C2U A;  5I0D A;  1H6Y A;  1RUO A;  2D6O X;  4Y5Z 0;  1N3P A;  1F2N A;  3VGI A;  1ZRD A;  4IGO A;  2PHD A;  4GUL A;  3VZJ A;  5KXB A;  1Q5O A;  4UI9 L;  1H0B A;  1SDW A;  4AHX A;  2WR9 A;  1O5U A;  5GJ6 A;  1KD7 A;  1COV 1;  3AZW A;  5C8C C;  3BAL A;  2EIG A;  1JZ2 A;  4J6G A;  5E1R A;  2WDB A;  1G6N A;  1W8Z A;  1P8J A;  4GJY A;  5IUQ A;  3I97 A;  2XOM A;  3PHM A;  4QPY A;  1W0P A;  2CU5 A;  1XB9 A;  2RM2 1;  1MS0 A;  2VCA A;  3I2O A;  1SG3 A;  5DAX A;  1HXS 1;  4XF0 A;  3VD5 A;  3OYW B;  4JAA A;  3LEG A;  3USU A;  4LOT A;  2ZX1 A;  5KHK A;  2WLQ A;  2FDG A;  1K5J A;  2VD7 A;  1ND3 A;  2GSY A;  2C1F A;  3IPV A;  4BQ2 A;  4XF3 A;  4ZU4 A;  2A75 A;  2EID A;  1IG3 A;  4QPG B;  1NQD A;  2P6H A;  3A23 A;  4XIO A;  3PJQ A;  3VBR A;  1QJX 1;  2YUE A;  4XTM A;  2HWB 1;  4TSV A;  4NRQ A;  4XQD A;  2BER A;  1OXC A;  3EBR A;  2NLR A;  3HEI A;  2P34 A;  5JXI A;  1YJK A;  4Q4W 1;  5FJH A;  3PUA A;  4JDM A;  4ARY A;  1LNS A;  3FHQ A;  4XJ8 A;  1POQ A;  4QD2 A;  1JBC A;  1CD3 G;  2ORZ A;  5F1R A;  1FOD 1;  1R09 1;  1BBT 2;  4BQX A;  1CIY A;  4CUB A;  4DFS A;  1XND A;  5EFU A;  1SBE A;  2XJP A;  3POE A;  2KM2 A;  5CG8 A;  2BU9 A;  3LWC A;  1X8E A;  1Y3T A;  3VHR A;  4A7K A;  3AMN A;  1G9F A;  4XJU A;  5GKA C;  3ETP A;  1RIN A;  3ZFG B;  4LPL A;  5FXV A;  5JZG B;  4XUN A;  4OFG A;  4AVV A;  3J7H A;  5FY1 A;  3DXU A;  5KHH A;  2JEM A;  5C9A B;  5FZC A;  1IHM A;  2XJU A;  4CDW A;  3C7O A;  3MPP G;  4N53 C;  1BJQ A;  2J1U A;  1JYV A;  1UX6 A;  5GLV A;  3WIN E;  1EAH 1;  2LRO A;  3T4V A;  4Q0U A;  3S5Q A;  1KS5 A;  3BCW A;  1LEM A;  4IEU A;  4IE7 A;  1CAX A;  4NO4 A;  2VQA A;  4RD7 A;  2O0O A;  3HAG A;  4IE6 A;  1AR8 1;  3TEX A;  2GP5 A;  1HIX A;  2R6Q A;  4LIT A;  4CPB A;  3ZYB A;  4CDQ B;  1MVQ A;  1SZB A;  1AYM 2;  3DKQ A;  5I8Y A;  2IZW A;  3W5N A;  5IK8 A;  1U5Y A;  3H1Y A;  3K75 B;  3M3I A;  2UYB A;  4L9B A;  2V73 A;  1JOJ A;  4OQ8 A;  2DVF A;  1W99 A;  3U78 A;  2VOT A;  1YRZ A;  2FDJ A;  1ULO A;  5DUU A;  2PHR A;  4IV1 B;  4HVQ A;  4M0H A;  5CAD A;  1SDD B;  1J3Q A;  1SLB A;  1OSG A;  2WQ8 A;  5FYC A;  3UKT A;  4Z07 A;  4PDW C;  1QWR A;  3DEM A;  4UXA A;  3NV2 A;  5FYV A;  4XC9 A;  4CU8 A;  2DCJ A;  2V5Y A;  2RJK A;  2XQX A;  5L7O B;  2RDQ A;  1FPN 3;  3A21 A;  3MW4 A;  4QKN A;  4AEJ A;  4FTE A;  3VZN A;  3T0A A;  4RS5 A;  1FNZ A;  1LU2 A;  2HWE 1;  4Q8L A;  5FZ7 A;  3VN4 A;  1MS5 A;  4SLI A;  4QM9 A;  1JYX A;  4M01 A;  2EAK A;  2NPI A;  2NZ9 A;  3S0M A;  4CVU A;  5FMC A;  1GIC A;  4HAN A;  4CEY A;  4ASK A;  1HDK A;  5K0U A;  3PL0 A;  1Z7S 1;  3BIW E;  1DQ4 A;  1OF3 A;  4JTO A;  3RZZ A;  5FZO A;  1AL2 1;  4FXG B;  4Q4W 3;  3WQB A;  1Q8O A;  1WZX A;  2BOI A;  1FT9 A;  4XQW A;  3SCH A;  5E6H A;  3POF A;  1RUC 3;  1LHN A;  3RZJ A;  1C8N A;  3SKV A;  4LBM A;  1H9W A;  5GAL A;  1GNZ A;  3B3Q E;  5EWS A;  1QEX A;  4KG0 A;  3OBT A;  1S2K A;  4A41 A;  3FHA A;  4KI5 M;  3LPF A;  1VBA 3;  2XUE A;  3H1M A;  1UZV A;  4HK8 A;  5EYY A;  1OI6 A;  3F2Z A;  4Q29 A;  5FZL A;  3WNL A;  2JJ6 A;  3U10 A;  3OPW A;  1RUN A;  1W2N A;  2I74 A;  1UD1 A;  3NV4 A;  3UGH A;  4DZG A;  3OEB A;  2OZJ A;  2R07 2;  3GF6 A;  2VBB A;  2EF6 A;  3CU7 A;  4QQO A;  1KJL A;  1XBF A;  2YC2 A;  4OVE A;  3RS6 A;  2WZR 3;  3ZXA C;  5CKN A;  1CGP A;  3U4X A;  4LUM A;  4R4Z A;  1UMZ A;  4KBB A;  4ISQ A;  5JDB A;  1ODM A;  5IVC A;  3K46 A;  1CPM A;  3ILR A;  5IT6 A;  4P00 B;  4FAH A;  1GBG A;  1KDM A;  4YVW C;  2JE7 A;  1T6B X;  1UZ0 A;  4XAE A;  4YW6 A;  2RDN A;  2JDU A;  1LGB A;  2ZGR A;  4N9H A;  4IUG A;  1RB8 G;  1UIK A;  4M4P A;  1QH7 A;  3VBF B;  3WG2 A;  5FPL A;  3I59 B;  3KS7 A;  4XIL A;  3CL1 A;  3VKN A;  2WYF A;  5IK7 A;  1WKY A;  4QGM A;  1OLQ A;  2E7Q A;  3DV8 A;  1VBD 2;  2A3X A;  4XFH A;  4PQQ A;  4JRA A;  2GN7 A;  3BYW A;  3IDB B;  5C4W B;  4IEQ A;  4KG8 A;  3H7Y A;  1ZRE A;  1ZZ7 A;  4IGP A;  1CQ9 A;  2VVD A;  2K46 A;  5LWB A;  3POW A;  1AR9 1;  1CX1 A;  5CKQ A;  2WWU A;  3KLS A;  5FDB A;  2QQN A;  1QXR A;  2OT7 A;  2WZP P;  2OX0 A;  1ZBA 1;  2VMF A;  2ZEY A;  3FJS A;  4UT5 A;  1FV2 A;  4ZY9 A;  1AXZ A;  5HCA A;  3AXD A;  5JAX A;  5ABJ A;  2JKB A;  3P3N A;  2JX9 A;  1GNY A;  4XYX A;  4WM8 A;  2AH2 A;  4YZ1 A;  2UWB A;  4I0B A;  5LBB A;  3OBZ A;  3SMH A;  2XQR A;  1JN2 P;  1EAH 2;  1RUE 2;  2DCK A;  1ZBE 2;  4AK3 A;  4A3X A;  1TE1 B;  3ELN A;  2WRA A;  1Y9G A;  5JMO A;  5LK5 A;  3I2I A;  2BBV A;  5TSW A;  2E31 A;  5LB6 A;  3ZSE A;  1IS4 A;  1GZT A;  1OA4 A;  1YQ2 A;  4AXO A;  3H8O A;  4Q4X 2;  3R4U A;  3UET A;  2JDP A;  4QPI C;  1ZM1 A;  5A70 A;  5A6Z A;  5HCH A;  3D4K A;  3TYJ A;  3KCY A;  2P4E A;  3HD8 B;  4LKS A;  5FP7 A;  1RUC 1;  1V6M A;  3T2O A;  2HLE A;  2JXA A;  4GXL A;  4FOW A;  1SPP B;  3VHO A;  4BQY A;  2CSG A;  5JOW A;  5FP8 A;  4LIU A;  3E5U A;  1GMM A;  3D5O A;  4CUC A;  5FZH A;  3E6B A;  2RMU 2;  2XVK A;  1K12 A;  2XUM A;  4IV3 B;  4YM1 A;  1QU0 A;  1ULG A;  3GCW A;  4D7S A;  2ET7 A;  1C1L A;  1QJZ A;  2A6Y A;  3A22 A;  4P9W A;  4S2G A;  4XOG A;  3ZXJ A;  3GZA A;  4CP1 A;  2E7A A;  2EXI A;  1PVC 2;  1RHI 3;  2HYK A;  4C90 A;  5L7O C;  3O0W A;  3MW2 A;  3A0N A;  3Q8F A;  4UW4 A;  1GWL A;  2UU8 A;  2CGO A;  3ETQ A;  3FN9 A;  2OUH A;  2Q1M A;  4FFH A;  4QPG C;  4HON A;  3ZN5 A;  2B45 X;  3FFQ A;  2GC2 A;  2CAV A;  5HXM A;  2E26 A;  2JG8 C;  2RS5 2;  5EJZ B;  2RS1 3;  4B4Q A;  2MEV 1;  4CSW A;  3ZR5 A;  2VUL A;  1ND2 B;  1HJF A;  4K1Z A;  3OGG A;  4Y1X A;  3Q8A A;  4BK5 A;  1RVF 2;  4EJR A;  3FLR A;  1L7Q A;  3N9M A;  2GZW A;  3I3Q A;  3MIC A;  4GMP 1;  4QQL A;  5JSR A;  3ZYP A;  1QMJ A;  2H6C A;  3GZE A;  1DYK A;  1LOF C;  3JCI A;  3MF6 A;  3N36 A;  4D8M A;  4DB5 A;  4FQ4 A;  2OPW A;  2A5Z A;  3FWE A;  5DZG A;  4BXS V;  5FZ6 A;  2XWB B;  1SQ4 A;  1Q43 A;  2JEC A;  2B46 X;  4J25 A;  3WDT A;  4GD4 A;  5FPU A;  1DHK B;  5B2G B;  4PHZ A;  1MPX A;  4EN7 B;  5M0T A;  5IJR A;  1RUI 1;  5CYY A;  1PGW 1;  4Q8K A;  5IAV A;  3O1P A;  4KGG A;  4LBJ A;  2VQ0 A;  3U75 A;  1D4V B;  3AJY A;  3ILN A;  3BOW A;  1GWM A;  3MEP A;  2R30 A;  4LBQ B;  2WFF 1;  1YCI A;  1B35 B;  1UMH A;  4PBP A;  3AKS A;  1DLC A;  1C28 A;  2QQO A;  2ZS6 B;  1O6U A;  4OYU A;  4PI2 A;  3ZYF A;  3LFI A;  2HH9 A;  4WVV A;  1GZ9 A;  1TMF 3;  3AZZ A;  1V6N A;  2EXH A;  3HQX A;  5FBZ A;  5I91 A;  2AGS A;  3RI9 A;  1PX3 A;  1NLS A;  1JZ8 A;  1W9F A;  4LOS A;  4PIY A;  1OQE A;  4LR4 A;  4M3C F;  1ZZ6 A;  4V1P A;  1HW5 A;  4YGC A;  1GWK A;  3B69 A;  4YNI A;  3M3O A;  3KB5 A;  3NWK A;  4OHY A;  1KIT A;  3WNN A;  1DQ2 A;  3WR0 A;  4TN7 A;  2WFF 3;  2IXK A;  2ADE A;  5HXV A;  3V0A A;  2ZHL A;  3C7F A;  1D4M 1;  2ZGN A;  3LSE A;  2YU2 A;  3LPG A;  4WM7 C;  1NA1 A;  4HET A;  2VZ1 A;  4Y22 A;  4XBQ A;  1V6O A;  3LF7 A;  4QXC A;  4UBH A;  1TMF 1;  3I2K A;  5FMB A;  3H3Z A;  5H9Q A;  1RGS A;  2BQP A;  4NMI A;  2OXB A;  5GLT A;  2R07 3;  4A45 A;  2WNV C;  1UZZ A;  1FMD 3;  3S7E A;  1DZR A;  1WW5 A;  3URF A;  5KHI A;  1MS4 A;  1HKD A;  1RHI 1;  4CDQ C;  1G7Y A;  1H6X A;  3AP4 A;  4LA3 A;  4RQP A;  1RUH 1;  2IXI A;  3SXW A;  4CYD A;  1QOT A;  3U14 A;  1QJE A;  4RHV 2;  4AI9 A;  3GAL A;  4YVS B;  4AW7 A;  4Z82 A;  1CAU A;  3KZ4 C;  3H1W A;  4PCR A;  2F17 A;  1HRV 1;  1JU4 A;  3IMM A;  4FPO B;  5J96 B;  4QPW A;  3C3V A;  1OQD A;  4M00 A;  5IFT A;  1ODN A;  1SLI A;  4OI0 A;  2XJT A;  4U2A A;  1GFF 2;  5IVY A;  3J9S A;  2Q8E A;  2WUH A;  1GOH A;  5A6Y A;  3GZT B;  3LA2 A;  2R07 1;  2A3Y A;  3DGT A;  2A6V A;  1OF4 A;  1E57 A;  1FMD 1;  2RR1 2;  4AL9 A;  4Q4V 3;  1VBC 3;  4UF0 B;  5ABJ C;  1OFS A;  1UMI A;  2RR1 3;  5E8A A;  2ZMK A;  1OA3 A;  1RXF A;  4XEZ A;  5FMO L;  5KWR A;  1F8V A;  5DZE A;  1STM A;  4MGQ A;  2A70 A;  4XHB A;  4LMF A;  3AYC A;  4G4F A;  3T2P A;  5JUV A;  4MGY E;  4AWD A;  3WCS A;  2NP0 A;  1LHW A;  3VD3 A;  5LA2 A;  1CWP A;  1LEC A;  1J83 A;  2DCZ A;  2HWB 2;  1US2 A;  2ZHN A;  4FQZ A;  2KR2 A;  4UFI A;  4A44 A;  4A6S A;  5KHG A;  5A3O A;  4CDW C;  1ENR A;  3NNM A;  3LSD A;  1QJU 1;  5H9P A;  4AF9 A;  5F3E A;  1QQP 1;  4B7E A;  4GA9 A;  3JZV A;  5FZK A;  1CJD A;  3TOJ A;  4PBO A;  5L19 A;  3S7I A;  1H30 A;  2XL7 A;  2O8Q A;  1JS9 A;  4AAP A;  3ASI A;  4Y20 A;  1ST8 A;  4RHV 1;  1ZBE 3;  1CZT A;  1AYN 3;  1W6O A;  1LOA A;  1JHN A;  1VJ2 A;  4HMZ A;  4KBZ A;  1U5I A;  4QXH A;  2VBD A;  2VC9 A;  1AUY A;  1OUR A;  2FZ1 A;  5D8A C;  1VAL A;  3ME2 A;  5FY4 A;  2R49 A;  4A3Z A;  1HX6 A;  4MXV A;  3LA3 A;  4P9L A;  4XFF A;  4XF9 A;  1A34 A;  2WC2 A;  5JOZ A;  1F9K A;  1TNF A;  3HNY M;  1ZA7 A;  4JX0 A;  5FRE A;  4BLJ A;  2K0G A;  4QWN A;  1W6Q A;  2ZKN A;  5DMY A;  1GQH A;  1AYN 1;  5IFP A;  2JDN A;  1ULD A;  2RMU 3;  1RYY A;  4QXK A;  4AQ2 A;  1OOP B;  4KNC A;  1Q3E A;  3FZ3 A;  3T1M A;  1TNR A;  2XBO 1;  4L0P A;  1YLL A;  2Y6L A;  1UW8 A;  4KGQ A;  1AX0 A;  1PGL 2;  3R4D B;  1LHO A;  4Y3O A;  5FPV A;  2QCS B;  4FFG A;  3KGL A;  2CY6 A;  4LO7 A;  3IN9 A;  5C9A C;  2JG9 C;  1F5J A;  2JEN A;  2WNO A;  1RUH 3;  1V6J A;  4Y5T A;  4DRR A;  1VRB A;  4LKF A;  3VB9 A;  2FMD A;  4CCC A;  2P3I A;  3WDY A;  4AVC A;  1H9P A;  4CZS A;  1LU1 A;  4ZZ5 A;  5A3M A;  2RJ2 A;  4AFC A;  5C6C A;  3N35 A;  5FYU A;  5FP3 A;  4BH9 A;  2J1A A;  4EWD A;  4PF1 A;  1AL2 2;  2X8K A;  5FZI A;  1V9U 1;  4XAA A;  3AM2 A;  3NNF A;  5F5I A;  2KXL A;  3PVN A;  3RGB A;  3RNS A;  5A6X A;  3VUO A;  3AKP A;  3I2J A;  1KFX L;  3LEK A;  4HG6 B;  5I8T A;  5FYY A;  3O1U A;  4DUW A;  3KMH A;  1VBC 1;  4BK4 A;  2FDH A;  4B4P A;  1FYU A;  2ARE A;  2HWE 2;  2ZAC A;  1UN1 A;  4ZS3 A;  1C8M 1;  3VBS A;  2ZML A;  2YXS A;  5T50 A;  5IAT A;  2WNU B;  1UU5 A;  1BYH A;  2CL2 A;  4AI8 A;  2EIB A;  2EXK A;  4NE9 A;  1WMF A;  2F4L A;  1NY7 1;  3BOP A;  2RM2 3;  1QJU 3;  2YDE A;  4PDW B;  1TME 1;  2G9F A;  2HWD 3;  4W6X A;  4N7U A;  4YM0 A;  2IXJ A;  3AKT A;  4N53 B;  2J1E A;  4HPK A;  4EN6 B;  1VBD 3;  3SKJ E;  4Y4Y A;  3U11 A;  1MZ6 A;  4FPJ A;  2QFE A;  4C91 A;  3WW2 A;  4E4S A;  4CEW B;  2JWP A;  4LTA A;  3LQC A;  4GH4 B;  5GZE A;  4N43 C;  5KXE A;  3I7D A;  3ZFG C;  4F8A A;  4X8P A;  1H2L A;  4BWO A;  2IXC A;  2JDZ A;  1JZ6 A;  2DBN A;  5FUN A;  2A1X A;  3LGR A;  1CVN A;  3WUC A;  1J59 A;  3BU7 A;  4D6R A;  2YPD A;  1I5Z A;  1FAY A;  4MGS A;  4HLT A;  2DUQ A;  2BVB A;  4LJH A;  3KT1 A;  1RJ7 A;  5FYS A;  4NRO A;  3ZVX A;  2ORX A;  5BXX A;  4OCT A;  3BIE A;  1POV 0;  3RYK A;  3FHI B;  1GUI A;  3KSC A;  4Q5O A;  4QKD A;  5A7W A;  2Y26 A;  3III A;  3ZMO A;  5LRS A;  2ZEZ A;  3DPR C;  3MLL A;  2ZGO A;  4UFK A;  1H2N A;  4XXA A;  4BQ3 A;  3FBM A;  3E6C C;  1NZI A;  3ZYI B;  2BFU S;  1OT5 A;  4LLO A;  1AR7 1;  5ACA 1;  3O1V A;  1CAV B;  1IPJ A;  2BRT A;  5K4L A;  3SH5 A;  3WP4 A;  2XLA A;  4W6W A;  1WCD J;  4GAZ A;  1UPI A;  1ZZ8 A;  2AEZ A;  1VBB 2;  2UUR A;  2DF7 A;  3OYW A;  4P9X A;  4CRQ A;  5JIU A;  3USU B;  4RSU A;  3T4H B;  3BI3 A;  4CUA A;  1RIT A;  1TVG A;  2DDU A;  1VMH A;  1ND2 C;  4PIZ A;  4EZH A;  2WSV A;  3IPV B;  3RQ0 A;  4BXF A;  2ZGP A;  4BU2 A;  4ERO A;  2V4V A;  4CEW C;  2GAL A;  4MUV A;  1ZA4 A;  1ZNP A;  3INA A;  2ETE A;  4A6O A;  1DF0 A;  4RFT 0;  4QGL A;  1MAC A;  3MW3 A;  4I30 A;  4ASM B;  2C9A A;  5DAW A;  4Z1V A;  5FZ0 A;  3ZSJ A;  1REF A;  4D6Q A;  1ASJ 2;  3RZL A;  2C6S A;  4KH9 A;  3B00 A;  4DY3 A;  3H3U A;  2VZR A;  1QXP A;  1S2B A;  2XR4 A;  2Z42 A;  3LIG A;  4S2F A;  5A7S A;  3TB0 A;  2V09 A;  5J1X A;  1CX4 A;  4WM7 B;  4YFW A;  4YG3 A;  1BLZ A;  1OFN A;  4H2A A;  3VBU C;  2YG0 A;  5FZE A;  3TEZ A;  1D7P M;  1E5I A;  4K20 A;  4TYS A;  3D3A A;  4IEX A;  1WGP A;  4XFA A;  3B94 A;  5LA9 A;  1EPW A;  2DU0 A;  1QJX 3;  1LB2 A;  1MZ5 A;  2WS9 1;  3O12 A;  2HWB 3;  5JSP A;  3ZFG A;  2XB6 C;  3TNQ A;  1AR6 3;  2BWC A;  4QX8 A;  1WWY A;  4AQS A;  3KT7 A;  4OQ9 A;  4AED C;  1G9A A;  2IXL A;  1M4W A;  2Y6H A;  2GNB A;  3OPZ A;  4W4Z A;  2FQP A;  3HVD A;  4AVS A;  4GKY A;  3AMH A;  3OB8 A;  2D40 A;  4JVA A;  1RXG A;  3LZZ A;  4FTS A;  3SQO A;  3UT0 A;  3DXT A;  4DEV A;  1D0H A;  4QX2 A;  2W92 A;  4HFS A;  5KC6 A;  2JKX A;  3WNM A;  4FT8 A;  1RUF 2;  4CDU B;  5J7M A;  2R32 A;  5FPB A;  2XKO A;  2B7Y A;  2PLV 1;  1NCR B;  1W8T A;  4JV4 A;  2XKP A;  5BNO A;  1MS1 A;  3J7L A;  4YVS C;  2B8M A;  2CDO A;  3OSD A;  3IB3 A;  1OUS A;  5F8P A;  1UXX X;  1Q56 A;  3EO6 A;  4LO6 B;  4TLF A;  3M2M A;  4CUG A;  3LEM A;  4O7X A;  1PIV 2;  3TRS B;  4AQ6 A;  2VZ3 A;  4QQH A;  5DN2 A;  3NAP A;  4UYB A;  2RS5 1;  4Q4W 2;  2D93 A;  3W5M A;  2D6L X;  2VQT A;  3K51 A;  5LAS A;  2XON A;  2W94 A;  1URX A;  1JZ7 A;  1V9U 3;  2VW0 A;  3ZO0 B;  5FIX A;  1UY2 A;  3ACI A;  2BYV E;  3ZN6 A;  4E2G A;  5F7U A;  4ZON A;  1GZC A;  1GQG A;  2B5H A;  3HJR A;  2ZGS A;  5LAT A;  3ZFE A;  5J3U A;  3BU0 A;  1GP5 A;  1XU1 A;  3LIH A;  2VOX A;  3E5X A;  3LAG A;  4K1Y A;  2O8O A;  3PLQ A;  4CEY B;  2GH8 A;  2BVV A;  4HVR A;  2ATF A;  1ALY A;  5CFC C;  3O1M A;  5EV7 A;  4YW5 A;  1GSL A;  1C8M 3;  1CAW A;  3GHN A;  3MGU A;  3THT A;  4F83 A;  4BCU A;  1O7F A;  1LR5 A;  4MXW B;  2E53 A;  1FMD 2;  2BFU L;  2RR1 1;  4MZU A;  3ZSL A;  2HYX A;  3HT2 A;  3L9J T;  5JR2 A;  1VE0 A;  2V4A A;  3H8X A;  1X9T A;  3ZLI A;  4NIG A;  5JR7 B;  2J22 A;  2BOJ A;  2K9Z A;  2DWR A;  2ILM A;  1UZW A;  5FZ1 A;  4LLF A;  2GMM A;  3AP6 A;  3VKM A;  5IYY A;  1X50 A;  4MGZ E;  1HB1 A;  4QXB A;  4EWA A;  4G9S B;  3BKZ A;  5C8C B;  1KJR A;  3OBR A;  4AFD A;  3VBH B;  3AFG A;  1AYM 1;  2FZ2 A;  5CIR A;  4TLG A;  4FPG A;  1U0A A;  1WLT A;  4MGT A;  3ZFF B;  1CZV A;  1JHJ A;  1S0I A;  4M4R A;  1ZBE 1;  4AZZ A;  4UFM A;  1VRH 1;  1R1A 3; 
#chains in the Genus database with same CATH homology
 1W8O A;  2L9L A;  4PQQ A;  4W50 A;  1PX4 A;  5A1A A;  1W9T A;  2WAA A;  2ZEW A;  3DEC A;  2JE8 A;  1CX1 A;  2VM9 A;  4ARX A;  3T09 A;  3GM8 A;  2YC4 A;  2QQN A;  3JXS A;  3U37 A;  2VMF A;  2ZEY A;  4JKL A;  4ZY9 A;  2VR4 A;  3C7H A;  4CU9 A;  4P5Y A;  4P02 B;  4XVH A;  4E8C A;  2LW8 A;  1GNY A;  4QDQ A;  1R64 A;  1JZ4 A;  4QX1 A;  2YFZ A;  3C7G A;  3LE0 A;  2VZQ A;  4QB2 A;  2DCK A;  4MOA A;  4QAW A;  1EUT A;  3C7E A;  5JMO A;  3I2I A;  2E31 A;  5LA1 A;  1YQ2 A;  1K45 A;  1JU3 A;  3UET A;  3T08 A;  1F4H A;  4XUO A;  2W1Q A;  3MV0 1;  2W87 A;  2RVA A;  4TTG A;  4LKS A;  5EIY B;  2BBA A;  4QB1 A;  2HLE A;  2VMD A;  3T2O A;  2X05 A;  3LEI A;  3CZU A;  1GMM A;  1NUK A;  4CUC A;  3CKH A;  5B4N A;  5G04 L;  1K12 A;  3K77 A;  3SEP A;  4YPJ A;  3ACH A;  3A22 A;  3EB7 A;  3BGA A;  3NQH A;  3PUH A;  3I3D A;  3I2F A;  3GDB A;  3FN9 A;  5IHR A;  5LCW L;  3VDA A;  3MUY 1;  4RN5 A;  4FI9 A;  5HXM A;  2E26 A;  1EUU A;  4QB6 A;  3ZM8 A;  1OH4 A;  5EJZ B;  2X10 A;  2VZV A;  4BK5 A;  1F4A A;  1L7Q A;  4XZU G;  2W1W A;  3HOB A;  4XUQ A;  2J7M A;  3K4Z A;  4D8M A;  2B9V A;  4BXS V;  1KGY A;  3I3B A;  3P1I A;  3DYM A;  1PMJ X;  4GWJ A;  1MPX A;  2C4X A;  5IJR A;  5CYY A;  1UY0 A;  3HN3 A;  3A7Q A;  2WO3 A;  1XNA A;  2LS6 A;  4MO3 M;  1UMH A;  1DLC A;  2QQO A;  4Z2A A;  2QQI A;  2R7E B;  2VO5 A;  1ULP A;  4OYU A;  4PT6 A;  2ZXQ A;  2PQS A;  5C7G A;  4OMD A;  3NNG A;  1PX3 A;  2CDP A;  3WNP A;  2Y8K A;  3OGS A;  1JZ8 A;  3WF4 A;  2QQM A;  3NJX A;  2V5D A;  4MAD A;  2BGP A;  2WAB A;  3WNN A;  3C7F A;  2W1S A;  3WF3 A;  1O8S A;  4ET7 A;  3LPG A;  2VZ1 A;  3T0B A;  3WNO A;  5C70 A;  3T0D A;  2WN3 A;  3I2K A;  2VCC A;  2VZU A;  1SHW B;  3GGL A;  4JKK A;  4A45 A;  2EIE A;  2J1T A;  3DYO A;  1H6X A;  2VME A;  4DEQ A;  2VL4 A;  1JYW A;  4OZO A;  4DUX A;  1CZS A;  2W5F A;  1GOG A;  1JU4 A;  2YFU A;  4QPW A;  5IFT A;  2JD9 A;  3T2Q A;  2RV9 A;  3DYP A;  2WUH A;  1GOH A;  2BGO A;  2W1U A;  1OF4 A;  1I5P A;  5HPO A;  3VDB A;  2VCB A;  2OKX A;  1UMI A;  3P6B A;  3CQO A;  2JDA A;  1XC6 A;  2WAO A;  4MGQ A;  1HN1 A;  2W91 A;  1US3 A;  3OG2 A;  2Y6G A;  3T2P A;  5JUV A;  2Z4F A;  3SEE A;  1O8P A;  3VD3 A;  5LA2 A;  1JZ5 A;  1J83 A;  1US2 A;  4QX3 A;  4A44 A;  4QDR A;  1JZ3 A;  2ZEX A;  2VZP A;  1DYO A;  2VZT A;  2WO1 A;  3ABZ A;  2J1S A;  4UOJ A;  2BZD A;  2WO2 A;  3THC A;  3EYP A;  4JKM A;  5LA0 A;  4OUE A;  1CZT A;  2QBX A;  4JHZ A;  2VC9 A;  3C8X A;  2W3J A;  3OGR A;  5G05 L;  3AC0 A;  2B4K A;  2C9K A;  4A3Z A;  1OD3 A;  1NKG A;  3UES A;  3VD7 A;  3I3E A;  5EJ1 B;  1JI6 A;  2WBK A;  3HNY M;  3ACG A;  4JX0 A;  3I2H A;  2Y6J A;  5DMY A;  1XNT A;  5B4X A;  5IFP A;  3MV1 1;  1RYY A;  4A42 A;  4L0P A;  1UY3 A;  2KD7 A;  1W9S A;  2Y6L A;  2YB7 A;  4QX0 A;  4BDV B;  1XPW A;  2Y64 A;  2W47 A;  3OGV A;  2Y6K A;  1DP0 A;  4KMQ A;  2W9X A;  3WF2 A;  4RYD A;  4ZZ5 A;  3HNM A;  2QQJ A;  2RJ2 A;  1IQD C;  3I2G A;  2J1R A;  2J1A A;  1GU3 A;  4ZXE A;  4PF1 A;  5JXG A;  3VDC A;  4XUP A;  5JXJ A;  3I2J A;  3IAP A;  3LEK A;  4HG6 B;  2J1V A;  4DUW A;  4BK4 A;  4CU6 A;  2EIC A;  4CU7 A;  4AG4 A;  3GXU A;  3MBW A;  5I0D A;  1H6Y A;  2EIB A;  3MO4 A;  4UI9 L;  2J1E A;  3SKJ E;  4LHS A;  1UXZ A;  4KWU A;  1JZ2 A;  2WDB A;  3LQC A;  1P8J A;  1JZ6 A;  3I97 A;  3K4D A;  2XOM A;  4LQR A;  2VCA A;  2VJX A;  1JYN A;  3CDZ B;  1SG3 A;  5C71 A;  4MGS A;  3VD5 A;  3UNP A;  3IDA A;  2QQL A;  3LEG A;  3HPN A;  4AAX A;  2ORX A;  2WZE A;  1T2X A;  5CZK A;  1GUI A;  4DXR A;  3III A;  2EID A;  4TXW A;  2ZEZ A;  3A23 A;  3MUZ 1;  2BER A;  3K4A A;  3HEI A;  1OT5 A;  5JXI A;  2QQK A;  2XHN A;  2E33 A;  4ARY A;  3NRU A;  4DXS A;  1LNS A;  3FHQ A;  3WSO A;  2ORZ A;  5DPN A;  1K3I A;  4CUA A;  4E8D A;  1CIY A;  1TVG A;  2DDU A;  3BN6 A;  3WNK A;  4CUB A;  5FUI A;  3OEA A;  2V4V A;  2C26 A;  1UYX A;  1NAE A;  1UY1 A;  4A6O A;  3CIH A;  3ETP A;  1BHG A;  4LPL A;  4XUN A;  4GZ9 A;  3J7H A;  4DXT A;  2VZR A;  1GOF A;  5DQ0 A;  1UX7 A;  3C7O A;  5J1X A;  2J1U A;  1JYV A;  1UYZ A;  2YG0 A;  1D7P M;  2W46 A;  5JXH A;  4ZZ8 A;  3D3A A;  1UYY A;  4A4A A;  1J84 A;  1W9W A;  2VZO A;  2WYS A;  4QDS A;  3W5N A;  3K75 B;  4GWI A;  2VMC A;  2Y6H A;  4W4Z A;  1W99 A;  2WZ8 A;  3PUI A;  3OB8 A;  2VOT A;  1ULO A;  4P08 A;  1UWW A;  1PMH X;  4DEV A;  4QX2 A;  1SDD B;  2WQ8 A;  2W92 A;  2X09 A;  2JKX A;  3WNM A;  4CU8 A;  2DCJ A;  2VZS A;  2XQX A;  3ECQ A;  3A21 A;  3VD9 A;  2VQU A;  3T0A A;  1JYX A;  2CDO A;  3IB3 A;  4W8J A;  1UXX X;  4CVU A;  4XUT A;  4BJ0 A;  1GQP A;  1NX9 A;  1OF3 A;  3OBA A;  2VZ3 A;  5DN2 A;  4DUV A;  1KEX A;  3W5M A;  2VQT A;  2V72 A;  2XON A;  3WQB A;  2ID4 A;  4XUR A;  2W94 A;  1JZ7 A;  2W95 A;  1L7R A;  1UY2 A;  3ACI A;  4D0Q A;  5F7U A;  2VTF A;  3SKV A;  3HJR A;  2E32 A;  4UAP A;  4A41 A;  3FHA A;  3E1F 1;  4KI5 M;  4OMC A;  3LPF A;  3F2Z A;  3WNL A;  2WN2 A;  3CMG A;  1K42 A;  3WF0 A;  3HNB M;  3OEB A;  3WEZ A;  3VD4 A;  2YC2 A;  3WF1 A;  3THD A;  1TG7 A;  3CZJ A;  2HYX A;  3IAQ A;  5JR2 A;  1WCQ A;  1UY4 A;  3K46 A;  2J22 A;  3FL7 A;  4P00 B;  5IYY A;  1UZ0 A;  3ACF A;  3NJV A;  4IUG A;  4M4P A;  1W8N A;  1O59 A;  1WKY A;  1CZV A;  1JHJ A;  4M4R A;  1W0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...