4A44A

Cpgh89cbm32-5, from clostridium perfringens, in complex with the tn antigen
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
140
structure length
140
Chain Sequence
ASALPQGNMKATATSEHPDVGNEGLAKFAIDGKENTIWHTKYNPVEELPQSITLELGGSYEINKFTYLPRSGAKNGNITKYELHVSEDGNNFRKISEGNWDDSGSLKTLKFNSTKATHVKLVALEGVGGFASAAELNVFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Carbohydrate Recognition by an Architecturally Complex Alpha-N-Acetylglucosaminidase from Clostridium Perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
molecule keywords ALPHA-N-ACETYLGLUCOSAMINIDASE FAMILY PROTEIN
total genus 30
structure length 140
sequence length 140
ec nomenclature ec 3.2.1.50: Alpha-N-acetylglucosaminidase.
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4a44A00
2DCJA 1JHJA 4D0QA 2Y6LA 4DXSA 2R7EB 3VD5A 1UYYA 4MGSA 4XURA 1K3IA 2CDOA 3T0DA 1US3A 1I5PA 1JYXA 4DXRA 3W5NA 2J7MA 3ABZA 3K4ZA 3IB3A 3WSOA 2WZ8A 4QAWA 3VDBA 3HJRA 4IUGA 2W91A 2L9LA 2VZRA 4KMQA 4CU6A 1UY0A 3MBWA 4ZY9A 4DEQA 3AC0A 3CMGA 1GOFA 2VZSA 4QX2A 4YPJA 3HEIA 4ZZ5A 3LEGA 1CIYA 4XUTA 4KWUA 4W8JA 2V72A 3VDAA 4L0PA 4QDRA 4JKMA 3CKHA 3LPGA 4A6OA 1JYVA 1XNTA 2Y6HA 2HYXA 2OKXA 1GNYA 2VMFA 2J1SA 3GDBA 2JDAA 3ZM8A 4OZOA 3UETA 1JYWA 3UNPA 3MUZ1 1SDDB 1JYNA 3WNMA 1LNSA 5IFPA 1UWWA 1R64A 3MUY1 1UMHA 2XONA 3I2FA 3VD9A 4CUCA 1J83A 2JD9A 1D7PM 4A4AA 2J1AA 2YFZA 4OYUA 1F4AA 4TTGA 3DECA 2VZTA 4QDSA 4E8DA 1JZ8A 2W94A 1YQ2A 1WCQA 3A22A 4FI9A 3J7HA 4HG6B 2VMCA 1XC6A 2W1QA 4ET7A 2ZEYA 4RN5A 2W87A 1W8NA 3I2GA 2VCAA 4PT6A 3WNLA 1O8SA 2WO2A 3I2HA 3OGSA 3ACIA 4M4RA 4PF1A 1O8PA 3CZJA 4BJ0A 1CZVA 1OD3A 3ACHA 2J22A 4A45A 3NJXA 4UAPA 5LA0A 3PUIA 3DYPA 3OGVA 4GZ9A 5CZKA 1JU3A 2YB7A 2BGOA 3OGRA 4QX3A 1DYOA 4JKLA 1UZ0A 1F4HA 5C7GA 3ETPA 2QQNA 3MV11 5B4XA 2BGPA 2W1UA 3C7HA 4P02B 3VD3A 2J1VA 5DN2A 3LQCA 5G04L 3A7QA 5J1XA 3GXUA 4LPLA 1ULOA 3WNOA 1W9SA 4CU9A 1K12A 2VQUA 3I97A 2WO1A 2VO5A 2ZEWA 4A3ZA 1IQDC 2W47A 1WKYA 2E33A 3I3DA 4LHSA 4QB1A 2B9VA 5C71A 1MPXA 2X05A 5LCWL 5JXHA 4DUWA 4OUEA 3C7EA 1PX4A 1XNAA 5C70A 3WF1A 3K46A 2RVAA 3NNGA 4W4ZA 2QBXA 1J84A 3I2IA 1W9WA 2Y6JA 4KI5M 2KD7A 4QB2A 3WNPA 1US2A 2W46A 2VCBA 4MADA 3IDAA 1RYYA 4QX1A 5DMYA 1JZ5A 1UYZA 3ACFA 4QX0A 1JZ6A 3SEEA 2QQLA 5I0DA 3I2KA 3FL7A 5G05L 2ID4A 3IIIA 2V4VA 4LQRA 5HPOA 4UOJA 2DDUA 3CQOA 2XOMA 3HN3A 1H6XA 4ARXA 2EIEA 1GOGA 2VL4A 1K45A 3PUHA 4P00B 1W9TA 2WN3A 4QDQA 3WNKA 1PMJX 2Z4FA 1UX7A 3C8XA 2B4KA 5JXJA 3C7OA 4TXWA 2E31A 4CVUA 1CZSA 1L7RA 1P8JA 3OB8A 5EJZB 2VJXA 2QQMA 3GGLA 2ZEZA 2WABA 1XPWA 2VM9A 2VZ3A 3WF4A 2WAOA 3K4DA 4XUOA 1DP0A 2J1EA 4PQQA 2EIBA 1GU3A 4BK5A 3FN9A 1NUKA 3MV01 3P1IA 2JE8A 3THCA 2VZ1A 3WQBA 5JUVA 2X10A 1UY1A 3E1F1 3ACGA 4XUQA 2C4XA 2VTFA 5CYYA 4BDVB 4DUVA 2V5DA 3T2QA 1OF3A 2VQTA 4MOAA 1EUTA 2ZXQA 5A1AA 2VZPA 2QQOA 4ZZ8A 5IYYA 1CZTA 1KGYA 5JXGA 2VC9A 2YFUA 3MO4A 2VMDA 2C26A 4P08A 3DYOA 3VD4A 2WYSA 4D8MA 2VZOA 2Y6KA 2Y8KA 2YC4A 3DYMA 3I3BA 1W99A 3A21A 4MO3M 4BXSV 1GUIA 3C7GA 1JZ7A 4A42A 4CU8A 1GOHA 1W8OA 3T0AA 3VDCA 2BBAA 5IJRA 2X09A 4QB6A 2WN2A 2ORZA 3LE0A 4XZUG 3LEKA 4ZXEA 3T08A 4JHZA 2VMEA 1TVGA 1JI6A 2W5FA 3FHQA 4CUAA 3CDZB 3T2OA 2DCKA 3K77A 4XVHA 1NKGA 1EUUA 2EICA 4DEVA 2LS6A 1SHWB 2C9KA 5LA2A 3NJVA 1GMMA 2YC2A 1UY4A 3EB7A 4AG4A 3SKVA 2W95A 3EYPA 2VZUA 3WNNA 2XHNA 1OF4A 3OBAA 1SG3A 3FHAA 3HNYM 3ECQA 3F2ZA 1TG7A 1PMHX 4DUXA 2W1SA 4XUPA 2W3JA 2VR4A 3WF3A 5JR2A 1W0NA 2E26A 4Z2AA 3T0BA 3BN6A 3W5MA 2PQSA 4P5YA 5JMOA 2VZVA 3C7FA 4W50A 1JZ2A 4CU7A 3WEZA 4AAXA 4LKSA 1HN1A 1OT5A 3K4AA 4GWJA 1UMIA 5EJ1B 3GM8A 2WQ8A 3SEPA 1JU4A 1JZ3A 3HPNA 2J1UA 3IAQA 3T09A 2W9XA 1KEXA 1K42A 2VOTA 4OMDA 2VZQA 2QQJA 3HNMA 2ORXA 2YG0A 1UXXX 3HOBA 1JZ4A 2Y6GA 3SKJE 2Y64A 5LA1A 3BGAA 5IHRA 1PX3A 1UY3A 2W92A 3UESA 1ULPA 3IAPA 4M4PA 1UYXA 2J1TA 3I3EA 2BZDA 5DQ0A 3OG2A 1DLCA 3OEBA 1GQPA 3NRUA 5F7UA 2LW8A 5HXMA 1O59A 1BHGA 4XUNA 1T2XA 1CX1A 3OEAA 4GWIA 4JKKA 3CIHA 1L7QA 3LEIA 2WZEA 3I2JA 3NQHA 4E8CA 2W1WA 3P6BA 2QQKA 5IFTA 2BERA 3WF2A 1H6YA 4RYDA 5FUIA 2ZEXA 1UXZA 3CZUA 4MGQA 4CUBA 2VCCA 3T2PA 5DPNA 4UI9L 2HLEA 3K75B 3A23A 4ARYA 2CDPA 2WAAA 2WO3A 4QPWA 3WF0A 4OMCA 2WDBA 4DXTA 1NX9A 1NAEA 2WBKA 4A44A 4JX0A 5B4NA 2EIDA 1UY2A 4BK4A 2J1RA 3VD7A 1OH4A 3HNBM 5EIYB 3THDA 2WUHA 3U37A 5JXIA 3JXSA 2RJ2A 2JKXA 2RV9A 3LPFA 2XQXA 2E32A 2QQIA 4A41A 3D3AA
chains in the Genus database with same CATH superfamily
3BB6A 2E9QA 2Y6LA 3B3QE 4DXSA 2HWF3 1QWRA 4DPNA 4GB33 3VD5A 1ZM1A 5GLZA 1UYYA 2A6VA 2XJPA 1NLQA 3SLIA 1JW6A 2CDOA 1RVF1 1AR62 1I1EA 4JAAA 3AYAA 2VOWA 4XJWA 1JYXA 2VY0A 1A3KA 1TME1 1YFUA 4D94A 2LALA 3UGGA 2PHWA 4KG0A 3UKTA 2QKDA 3ABZA 2E63A 4LXLA 1LR5A 2VXRA 1D4M2 1OLRA 3IB3A 4HL0A 4XF9A 4UBGA 2BNMA 5BY5A 5ACA3 2HWB2 4LO4B 5GZGA 3VDBA 3HJRA 3OD0A 3PMSA 1BYHA 2NQYA 3LFIA 2PFWA 4MGYE 5A3WA 5C8WA 1GNZA 3TN92 5JIUA 4XCBA 3P3PA 4WVMB 1TME2 4CDWB 2D3PA 1NQJA 4NO4A 3VBUC 3CHXA 4KWUA 2BWCA 3PU3A 3VDDB 4COUA 1XNDA 2A6ZA 3AMNA 3WQBA 3I2OA 4LLOA 1O5LA 1F31A 2G9GA 3TRSB 1W39A 3GZTB 3JBG1 4L0PA 1VAVA 2JECA 1A8MA 2QDRA 3NJZA 4I0BA 4JKMA 1K5MC 4UYBA 1XNTA 2WNVC 2IUWA 2WQ4A 1E5IA 2HYXA 4ZPIA 3V56A 2D5HA 1VBC1 2DTYA 2QUOA 3ACLA 3GDBA 4NAOA 5DDJ3 2ATFA 1H4GA 5FFOC 2XUMA 1UQXA 3THTA 1EV13 4C1WA 3JBG3 4OUSA 2B7YA 1BBT3 3MUZ1 3TEZA 2G4IA 1SDDB 4XFAA 1ULFA 3T4HB 1XYPA 5FMDA 1RUD2 1QOOA 2BUKA 2HEWF 3RQ0A 1D2SA 2BOJA 2D6PA 5FK8A 4IEQA 5BNNC 3MUY1 2FD8A 1LOBA 1MS8A 2XONA 2QNKA 2XKPA 3D5OA 5K4LA 3OBZA 1FPN2 1J83A 3HR9A 4J6GA 3UGHA 1UOJA 1BK1A 1C5HA 3I7DA 5ANQA 4A7KA 2RS11 2YFZA 3B69A 3O1PA 2Y38A 2TUNA 1ULEA 4TTGA 4Z8BA 3NNMA 4MSVA 3K2OA 1OKOA 5C6CA 3B00A 2W94A 4QU1A 1JUIA 1YQ2A 2ZACA 3A22A 4XJ8A 4KWJA 2Z2SB 4MVTA 4XBQA 5DAQA 5FY9A 1U5YA 2VMCA 1XC6A 2OA2A 4BMBA 1NG0A 4ET7A 4YVWC 2ZHLA 3Q8CA 2JIGA 3HBKA 1JOJA 1RL3A 4OHXA 1SLBA 1LULA 2ZZQA 4XF3A 1DGWX 1CJPA 5FXVA 1X50A 2IXCA 3WNLA 2DCZA 1PO21 2PAEA 3RRDA 3W20A 4ISQA 4C8DA 4KU8A 4PCRA 2CTVA 2LUWA 4YG0A 3WUCA 1C4RA 1N1YA 1UNBA 5F9TA 4E4ZA 3J9SA 2OQ6A 4GJYA 1OD3A 2DUPA 1PIV3 1DQ0A 3LKJA 4PBOA 4A7YA 1K5MB 1J3QA 1WGPA 5FJHA 3R6SA 3WHUA 5IVJA 4CCOA 5LA0A 3DYPA 2E51A 4V2VA 3SXWA 1JYTA 3OGVA 1W6OB 3AZXA 4XHXA 4Z07A 2DWRA 2WNUA 2VCMA 1JU3A 4XZPA 5EZWA 4A7ZA 5FZEA 5I91A 2A6WA 1DYOA 2PLV1 4JKLA 2JB8A 2R061 1RUC3 5A80A 5F37A 1OFSA 4Q0PA 5FQ0B 5J36A 5KBFA 2JG8A 1C5IA 2QQNA 3MV11 2G1MA 3ZSKA 5JOWA 2JICA 5IVFA 3GZUC 1OKQA 4I09A 3VD3A 4FVVA 4ZS3A 2DV9A 3FFZA 1PVXA 5G04L 2Q30A 2K46A 2I74A 4XIKA 3WQ1A 5F2SA 4Q4X1 5J1XA 1KFXL 5KHJA 1VJ2A 2GH2A 3WNOA 2C5DA 3TNPB 3VBFB 3VV1A 1GR3A 3VBSC 3ZDVA 4NN0A 4QPGA 2YDEA 2GALA 2K2SA 3I97A 2ZEWA 1UU5A 4CDUC 5JVVA 2W47A 2ADEA 1MR5A 3VBOC 5BYNA 1NCQA 3PTYA 2XVGA 4LBMA 3F95A 4AXOA 2B9VA 3CNAA 1OLMA 3WDTA 5FZHA 4HXCA 4LKDA 5CBLA 4XQWA 1DGRA 4P9JA 1DU3D 5BNQA 3NWKA 1CAVB 1B09A 5LCWL 4U2AA 2VNOA 2ZJCA 4DNYA 5JXHA 4QHBA 4HONA 2WRAA 4Q5OA 1XRUA 2C0ZA 1GLHA 3MIEA 3ZSLA 4OHVA 1RC6A 5HBAA 2YROA 1JXNA 3WDUA 3R05A 3I54A 4AW7A 3I2IA 1W9WA 4NWVA 2YBSA 1RGSA 1EYBA 2KD7A 2HBTA 4JDMA 4SLIA 4GMP0 5KHKA 1RUF1 4QT6A 3PVOA 5FRAA 5C4WA 2W46A 1AXYA 2VCBA 3FWEA 3KZ4C 2BV4A 2CNAA 3IDAA 3LDKA 4QKBA 4YW1A 3AFGA 1N3PA 3RZKA 2WO7A 1AR92 4YZ1A 4BIOA 4QX0A 3IT8A 2RS51 5LZ6A 5A3UA 5FY4A 4EZHA 1PHMA 1JZ6A 5FBJA 1MS4A 1AR63 1AYM1 3LDBA 4LUKA 4YW4A 4RQPC 3IDEA 4QPYA 2UURA 4Y22B 2GC3A 1VE0A 5G05L 1UZVA 2IXIA 4UOJA 2DDUA 5I8YA 4Q1RA 1ZBE2 2EXKA 2VULA 3U10A 1H2KA 3HN3A 3WP5A 1PO11 3ZPYA 1W0PA 2RS31 1MS5A 1QJU1 3KV5A 5FP7A 4BMEA 2EIEA 5C5UA 4F3JA 5M0TA 2XBO1 2VL4A 5FMCA 1CAXA 1OH3A 1OUXA 4P00B 4TLGA 4QM9A 3DKQA 1NA1B 1VB4A 1BMV1 1PMJX 3BODA 4K8RB 2Q8EA 4LBQD 1JYIA 1JH5A 3M3IA 4DFSA 1D4M1 3C8XA 5DDJ1 3AK0A 3MLKA 3KCCA 4LBQB 5HCAA 1RHI3 1W8HA 2PHLA 2RM23 4TSVA 2NM1A 3MIDA 4Q8LA 4CVUA 3ELNA 1CZSA 2X5IB 4YFWA 3TAYA 3D8CA 2QQUA 2XGXA 3M1HA 1YC61 3T2TA 3X29B 3RPQA 2Q1FA 3ZXAC 1KJRA 1LOGA 4CEWC 4FOWA 4MYEA 3LEMA 1DGRN 3OF1A 2X53S 5CAZA 3V64A 3GGLA 2VUJA 3BCWA 4R9DA 1S2KA 4M0NA 1RUG1 3N9NA 4FBFA 4QU2A 1LHOA 3POSA 1G9BA 5A32A 1EP0A 1WZXA 1GU3A 4Z1VA 2Z5WA 3FN9A 4QKFA 1NUKA 3P1IA 3UKNA 4K21A 5C8CA 2DTWA 4MH0E 2A6XA 4B7EA 1QJEA 1QJX1 5JUVA 2X10A 4N9IA 4HSJA 1Y9MA 2E53A 4U36A 5H9SA 4LITA 2HWE1 1UYPA 4XTMA 4XAAA 1QQP3 4BDVB 4F83A 3ZYPA 5ACA1 4LNVA 4H14A 2QDNA 4KWLA 4RR3C 4WM7A 1C3HA 2QQOA 2VZPA 5A1AA 3O1OA 3HWJA 5JLVA 1CZTA 1SACA 2WYFA 5JXGA 1V6NA 4FFIA 4NPLA 1COV3 4HN1A 2ZGUA 1Y9QA 4BWOA 5JI9A 3RZZA 4LA3A 5K0UB 1LOEA 4XBNA 3ORJA 1Y9GA 1RUOA 1W2AX 3ENRA 3Q8EA 3PL0A 2BP6A 3D4KA 3R4UA 4XF4A 4AHZA 3VD4A 2WZR2 2BGCA 2YC4A 4EE2A 3WQ7A 2X5IC 3KM5A 3J7NA 4PLOA 4YG6A 5H9PA 3BKZA 1GUIA 2RJKA 3C7GA 3FZ3A 4GKYA 1O6UA 4N43B 5F3EA 1QJU2 4QXCA 3T0AA 4Y4RA 3NV2A 3WW1A 1ZZCA 4D7YA 4CP9B 4KBZA 4GXLA 4HK9A 2D3SA 1R082 3VGIA 3I3MA 4XZUG 3LEKA 2Y0IA 3BOWA 4NIIA 4WBBA 4P9YA 4IV3B 1D0HA 1FOD2 1QF3A 4NROA 5DUXA 4JHZA 3VBFC 5D8AC 5FY8A 1IOAA 4ATEA 1JI6A 3FHQA 3VKOA 2RMU3 2R0FA 1ASJ1 4IEVA 1CX4A 2A73B 1V6LA 1AXZA 3GJBA 2DYCA 4XVHA 3T2OA 1EUUA 3DEMA 1OUSA 1LECA 4K1ZA 4ZS2A 1I3HA 1WW6A 4IE4A 2HWC1 1QDCA 4HN0A 5J3UA 3AM2A 5LA2A 2D5FA 4AGRA 3EB7A 1UY4A 3TB0A 3ZYFA 1O3QA 4RHV1 1BLZA 4AG4A 4DOUA 2EA7A 1RUI3 1REEA 3SKVA 1ENXA 4D7TA 2R1BA 2EXHA 1LRHA 2PQQA 2XHNA 5EYXA 3ZO0B 3U4XA 1VRH3 3FHAA 3OJBA 2ZGOA 3VBRB 2SLIA 5A6QA 4RS5A 1ONAA 4FTEA 1VBA2 5F5IA 5FUNA 4Y1YA 2E7AA 2GMPA 5FZ9A 1LHUA 1ZBA3 5JR2A 4Z2AA 3BN6A 3R4SA 3HBZA 2VZVA 2MEV3 1W6NB 2PA7A 1QJY1 4F7ZA 5CEHA 4KWKA 2ARCA 3H3UA 1VALA 2WA4A 3JUUA 1LHNA 4DXZA 4GWJA 5EJ1B 4OI4A 1TEIA 4XYXA 1JZ3A 4CEYA 3AKTA 4S2FA 1KEXA 3K51A 4JGZB 1YO8A 3ZFEB 2VTXJ 2HWC3 1Z7S3 3BIEA 1IG3A 1LOCA 3HNMA 4EN9B 5HCHA 1FOD3 5D8AB 3M3OA 3Q8AA 5FYSA 4W65A 4CUGA 4OHZA 1FMD2 1HB3A 1QQP1 1XBFA 1H9WA 1S0CA 4L2NA 5T5JA 3AL5A 2H6BA 4NE9A 4BXFA 3H9AA 4PLMA 5IHRA 3WW2A 1IPSA 5FY1A 1PX3A 5GALA 1AX2A 5L73A 3JD73 4MGIE 1UYXA 4PHZA 3RVHA 3NVCA 3RJ2X 2RS12 1BVVA 3KT4A 4YW2A 2OIIA 5F7UA 2UYAA 2AGSA 1W03A 1H4HA 4XJ9A 1YXWA 2JDZA 3RZJA 3AYEA 4MUVA 3ZSMA 4AFAA 3SCFA 3M2MA 1IS5A 1QQP2 1K5MA 1N1SA 1NLRA 2ZBJA 5FQ0A 1CR7A 3HQRA 4NOTA 2VPVA 5JZGC 4ZONA 3O0VA 4CCLA 5A3PA 1CX1A 4I3GA 5FMBA 3BTXA 4FCAA 1MS1A 4BISA 1PM7A 2MPFA 3FJSA 1FXZA 2AH2A 3I8TA 4FP2A 2O14A 1ND2B 1HRI3 3CIHA 3MW4A 4Y1VA 5AC92 3LEIA 3TYJA 2QQWA 4E8CA 1HJFA 4CDXB 3B9CA 1UIJA 1FI2A 3P6BA 1ZZ8A 1ZRFA 1ZVFA 1N1TA 2RHPA 1LGCA 1OA2A 4XDQA 1KQRA 4XDPA 4Q8KA 3NAPC 2QZ2A 1XNCA 1VAKA 1WW7A 2CY6A 4MGQA 4COYA 1E57A 4CUBA 3T2PA 2BQPA 2ZOEB 5DPNA 2VQAA 4RFT0 3SNMA 5SV8A 1DGWA 2QTWB 2FZ2A 2FBEA 1STMA 1VBA1 1CAUA 1G8WA 3A23A 4AYUA 4ARYA 2CDPA 2WO3A 2ZAHA 3POJA 3KD4A 3JQXA 5FP3A 5FZ7A 4DXTA 5KXDA 5CG9A 1HB1A 2D6KA 4QMAA 4AQTA 1L3JA 3GZAA 5BXXA 5J98B 1V9U2 1CAVA 1D4VB 2WBKA 3ON7A 4A44A 2UY9A 4BQWA 1VBE2 1CPMA 4LKEA 4RFRB 2ET7A 2J1RA 4I2OA 3WDWA 1U5IA 2JDMA 2ENRA 4AHYA 5A3LA 1IPKA 4P9GA 3WG1A 3OTFA 3THCA 4Q4W1 1UZWA 4RHV3 3L2YA 1JN2P 3FUOA 5FDBA 3WV6A 5EIYB 1HXS2 1UX6A 3AKRA 5CFDC 1LEDA 1RMU3 2RJ2A 4LK6A 2HWD3 4Y5Z0 3AL6A 2GMEA 4CXXA 4RL7A 2VVDA 1HX6A 4LUMA 1RXGA 2IVIB 3P5BA 5BUVA 1JHJA 4D0QA 2GU9A 3H50A 5GM0A 5JR7B 4AVAA 1SQ4A 4P9IA 3C2UA 3GCXA 4UFIA 4AQSA 4TN7A 2HYKA 3S30A 1K3IA 3U1XA 2PTMA 1RUF3 3T0DA 4HVQA 1H30A 1SPPB 2B8MA 1VBB2 3S7IA 4PI2A 3HIFA 4KBBA 3W5NA 1AYN3 2J7MA 2CAVA 4JGZC 1I6XA 3ZFEC 5BNPB 3VHRA 3MICA 3O5SA 4NHYA 4LKFA 4K8FA 3BTYA 2GNMA 1NXMA 2KR2A 2A75A 2VMGA 5FREA 4BLIA 1YFWA 3WSOA 2WZ8A 5A70A 4O9GA 5FO9B 1HKDA 4CDUA 5HV4A 1AR61 1AYM3 1RVF2 4IUGA 2L9LA 3EXUA 4KMQA 3VBOA 3LOBA 3MBWA 4ZY9A 1MQTC 1X9PA 2CV6A 2CGNA 1RUE1 2OW4A 3AC0A 4PQ9A 1QHDA 4CZSA 1NY72 4LHNA 3CMGA 3FLTA 2VZSA 4QX2A 5FPAA 4YPJA 1HQLA 5C5TA 5A33B 4E4DX 2DCYA 3TN93 4AI2A 1JUHA 3CJIB 2WQZC 3ZYBA 1RUJ2 3AB0A 3ZFGB 1ZA7A 3IKWA 4TYSA 1LKNA 5C3PA 2RDQA 4XETA 5FYHA 5IAVA 3FMGA 3MIHA 3JD71 1MS0A 5DABA 1MEC3 1U5ZA 4BQ5A 3J4UH 5CFDB 4AF9A 2OUJA 2XVKA 2ZX0A 3ROUA 1LOFC 3AKSA 3WINE 3MLLA 4G4FA 3LPGA 2RJLA 2W0XA 1CAWB 3MYXA 1FNYA 4KH9A 4A6OA 2Y6HA 4FFGA 1CJDA 3KV6A 2OKXA 5L9VA 4MGKE 4UFMA 1GZTA 4FP3A 2JDAA 4PDWA 4QXHA 1CD3G 1BK0A 3UETA 5J48A 1ENQA 2PHUA 4CCCA 4FTSA 3OUIA 4E4HA 3SISA 1PK6A 3AX4A 1XNKA 2XLGA 1WA4A 3USSA 1LU1A 2GC2A 2VBPA 5LK7B 1W6MA 1VBE1 4O9EA 3GF6A 1UOFA 3SC7X 2C9AA 4GMP1 5TSWA 1F5FA 1WA6X 3U0ZA 4W6XA 5IK5A 1CESA 3I2FA 4B1LA 2NP0A 3VD9A 1ST8A 4IW3A 4DRRA 5BNOA 3URFA 1Q8VA 4XFFA 1XSRA 1TMF1 1VB2A 4XDOA 2R49A 4CCDA 2D6OX 4OYUA 2OUHA 2VVEA 1C1LA 1FATA 1F4AA 3DCQA 1W6PB 4WM7B 3J7LA 2BDRA 4OZXA 5DAWA 4V1PA 5E1RA 1YQ5A 2H0BA 5ERLA 4FI9A 2A71A 5H9RA 1WLDA 2FMYA 1W06A 4NPRA 1AX1A 1O7FA 4RN5A 4YM0A 5FZBA 3VKFC 4DY5A 2W87A 1W8NA 4CP9A 3O1UA 4L9BA 4PT6A 1H2MA 1O8SA 3N7JA 4IEXA 3LA7A 2WIIB 3M3QA 4BM8A 4QPIA 3KT7A 3OPTA 4YWAA 4BJ0A 1W8FA 4X6RB 4A45A 1FPN3 1MZFA 3ZR5A 1PO23 4N53B 4EYUA 2XG3A 3OY8B 4L99A 5F8PA 2C24A 1AL0G 3VZOA 1GWLA 1W6QB 4UW6A 3GNEA 1RUD1 3OGRA 2DU0A 4QX3A 2VW0A 4AEMA 2DVBA 1N3QA 2RS53 4JHTA 2ZX4A 3H3ZA 3ETPA 5B4XA 2BGPA 2W1UA 4IEYA 1GWKA 4LE3A 3VBUA 1AJOA 4QPGB 1RJ7A 4Q0SA 2NPIA 4IE7A 4JC1A 4AL9A 1OSGA 3KHCA 4YVWB 1Q5OA 1NCRC 4R9AA 2ET1A 3VBRA 4BQ2A 3AP6A 3V0BB 4YW7A 3B94A 2WL1A 4XPVA 1IQDC 2VMHA 1AHSA 4A3ZA 2F6BA 3ZSEA 4RR3A 4QQOA 1E5HA 2BJSA 1OVSA 4LBOA 3HVDA 4HSLA 4LHSA 4QB1A 1RUG3 3GJAA 1F35A 1LENA 1KD7A 3TEYA 5C3OA 4BQ3A 1PMIA 2TEPA 3MIGA 1V9U3 4YVSB 3TN91 2XJRA 5LW9A 2Y26A 1ZRCA 2CAUA 4OUEA 3C7EA 2CL2A 2EVXA 1SCSA 4LK7A 3K46A 4PI0A 2RVAA 1ZZBA 5FUPA 3NNGA 4NRQA 4W4ZA 5BNOB 3NKGA 1V9U1 2Y6JA 4WM8C 2WLPA 1XE8A 3H1YA 4JZRA 4E4SA 2HWD2 1YRZA 3VUOA 1AL21 1OOPB 4E27A 5A7NA 1YHFA 1A34A 1RYYA 4QX1A 3WLUA 5AFEA 1AR83 4JCKA 4YRDA 1UYZA 4Z82A 1WD4A 2VGDA 1AUYA 1KS5A 1O91A 4IGPA 5C9AB 5IATA 1C1FA 3ETQA 4UW5A 3SEEA 2GDFA 5D8AA 2PAMA 5L36A 5LBFA 2ZKLA 2JDHA 5FXXA 3FL7A 1O4ZA 2V4VA 4FPEA 1GICA 2X8KA 4EN0A 2V5YA 4Q4V2 4Q27A 3LCPA 2NN8A 5LATA 1XYOA 2SBAA 5DUWA 3KVBA 1H6XA 1NA1A 3BPZA 3MGUA 4QPIB 5A3TA 1QJX3 2HH9A 1BJQA 2A7AA 4Z2WA 1GOGA 1XU2A 2GH8A 4I30A 4DS0A 5AC91 3MLJA 1K45A 1NOVA 1RUH2 1TMF3 2YBKA 3PUHA 1SLTA 2H0VA 4OQ9A 2R6QA 2WN3A 2Y0OA 4FPOB 4I0AA 2PLV2 1ND2A 2LTNA 4YZ4A 3WNKA 2R072 5JSOA 5CFCB 3ZLIA 1XQNA 4TZDA 1UX7A 3OYWB 1S4CA 1GSLA 3AMPA 1OLME 3ZXJA 1XSQA 2FDFA 5I8TA 2XXZA 4RGKA 4YW5A 1RB8G 3T1LA 1QJZA 5JXJA 1GBGA 1OXCA 2VXJA 1EPZA 4DZGA 4Q29A 5I93A 5JDBA 2OZ6A 3CJIC 3SQOA 2CWSA 4ZKTB 1DQ2A 4GAZA 2RG4A 3USUA 3JB8A 1OURA 3ZXFA 3OB8A 3E6DA 4HVOA 1ENRA 2VNRA 2WT1A 5DUVA 1Q8QA 2RM21 4FPLA 3UGFA 4CDQA 2VVFA 4Q2FA 5F5QA 4GH4C 3UV9A 2ARBA 1XPWA 2GC1A 2WABA 1RUH3 3OD4A 4K40A 2VM9A 4NRPA 2DCTA 1AR91 3ATGA 4QKDA 2P2KA 4YNIA 3WF4A 3O12A 4FXKB 2QQVA 1DP0A 3VBHA 2VBBA 1YIFA 3N3HA 2FHRA 4Q4W2 1BVP1 3MV01 3J26N 3MPPG 3H7YA 2A1XA 3ZFGA 3NV3A 4LJHA 4YYOA 3AMHA 5FZIA 1J3RA 4XUQA 1QDOA 1OOPA 2Z42A 5IVVA 1POV3 2VTFA 1QOTA 4Y3OA 2XKOA 5CYYA 3WW4A 1UPIA 4WZFA 2E6VA 4EZ4A 4X8NA 1AR72 1H9PA 1RIRA 4CTEA 1QY4A 4AWDA 4AAPA 1CQ9A 5FOBB 5IYYA 3RZMA 2NLRA 1URXA 1O4TA 1S2BA 1GFF2 2JE9A 1C57A 5LY1A 3HAGA 1TMF2 5KR7A 1BQPA 4UT5A 2MEV2 4CEYC 1SCRA 3INAA 4H3WA 4BA6A 5AFBA 4KL1A 4P08A 3ZXGA 2RDSA 3DYOA 2XL9A 4CEYB 1AJKA 3QLQA 1KRIA 4UFKA 2Y6KA 5GJ6A 5JCTA 3S6PA 1Q8PA 3VKNA 1VMJA 2XDVA 2ARAA 3ZOIA 4H7LA 1GWMA 4YARA 2YYOA 5FPZA 5F5AA 4HPKB 3MI8A 3VBOB 1AYN2 1NE4A 2NMNA 1SBDA 3OPWA 2WN2A 2R071 1X9TA 3JB4C 5K9YA 1N3OA 2IWGB 2XJSA 3LE0A 1POV1 2GN3A 3TWIA 4D6SA 2IC1A 5T5OA 2ARXA 1QJY3 4LOSA 2Y34A 1VBA3 1NCRB 4AI8A 2W5FA 4NHLA 4LIVA 1B35C 3CJXA 3O1TA 2XLAA 3K77A 1AYN1 4CDWA 2VUAA 3IPVA 5ABJA 2LS6A 2RS13 1SHWB 1ULCA 3LWCA 3WHTA 4DB5A 3NO8A 2C9KA 1OQEA 2A3WA 5CNAA 4FFFA 4OI1A 3AJYA 5CIRA 3ILRA 5FZCA 4AVSA 2OPWA 5EV7A 1XJAA 4N53C 3O1SA 3VZKA 2P6HA 2W95A 4CP0A 4ISRA 4MG2A 3WNNA 4LBLA 4LBJA 3POBA 3OBAA 2JDPA 1FYUA 4ORFA 3HNYM 4R52A 3ZDSA 1DFQA 4WM8B 2XJTA 1V6JA 1PMHX 4GIQA 1ACCA 4NPMA 2WFPA 1F8VA 1H0BA 3T0BA 3W5MA 2PQSA 2UWBA 5JMOA 5IK7A 3B7MA 4N7IA 4BH9A 3NW4A 3VBSB 3WEZA 4AEDB 5LWBA 4XFHA 1WLWA 2EAAA 4URTA 5FV3A 4JQTA 4D69A 1W28A 1QXRA 1FV2A 3GM8A 2GSYA 4NIAA 5KXEA 3BU0A 5K7PA 3HPNA 1REFA 2J1UA 5JPMB 2RDRA 5KHGA 4WM7C 2Q8OA 2UY8A 1K42A 1UW8A 3H42B 1MVQA 4LO5B 4R8HA 4UF0B 1WW5A 2IZWA 4YVSA 1VLNA 3MF6A 2QQJA 4CCJA 3NMBA 3MPBA 2CU5A 4C0HA 4O65A 5LK5A 4Q0QA 2ZS6B 1PZ8A 3HOBA 1JZ4A 3H8RA 1H2NA 1S55A 4X6QB 2PMWB 3LDRA 4AI0A 3WY6A 1HXS3 3PMEA 3SKJE 2FDGA 2Y64A 3BGAA 1EY2A 1F9KA 3MF9A 3RWKX 4AI3A 1L7LA 1APNA 2DVFA 3UESA 4V2WA 2W68A 3M70A 1ULPA 4M4PA 1UL9A 3GHMA 1HJGA 5C3RA 2J1TA 3BYWA 1WD3A 3RMXA 2BZDA 2JJ6A 1TME3 3OG2A 3A0NA 3OEBA 3KLSA 1GQPA 3KV4A 1CVNA 1LB2A 4P5HA 2LW8A 2YGLA 5HXMA 2BPA2 1OMIA 2BBVA 2VW1A 4CEWB 2WFF3 3SHRA 3RZLA 5FYVA 3VBHC 3E6CC 1V6MA 4XJUA 5DZFA 5L7OA 5FZDA 3AZZA 3VBUB 1ND3A 5IVYA 4B3NA 2K0GA 2HWC2 1YJLA 4AHWA 4FPJA 2WZEA 2YUEA 3POIA 5FPUA 3BALA 5LASA 3I2JA 4HOOA 1S0DA 4OHYA 5IFTA 1COV2 2ADDA 2BERA 5KXBA 1JBCA 1H6YA 3LF7A 2Q5TA 4RYDA 1G9AA 3E5UA 4O61A 3VLBB 3WT3A 1NCQB 1WUVA 1UF2C 3K3OA 3NNLA 2ZEXA 1Q56A 1UXZA 3FLPA 3ZFFC 2P4EA 1YEWA 1FPN1 1IKQA 1SFPA 1WW4A 1DZRA 1RUD3 4P9XA 1AYM2 1HB4A 1RVF3 3WXPA 1S2EA 1WMFA 2VCCA 4GWMA 5A7WB 3G7DA 1IG0A 2QJVA 4MXVA 4I01A 5C3SA 3LA2A 1R081 4COWA 4B4PA 1WMDA 2K9ZA 2R30A 4IEOA 1VMFA 2WAAA 1KS4A 3ZN6A 2XPJA 2O8QA 4OUMA 2WDBA 4RQPB 1NX9A 4JTNA 2AUYA 1PNGA 2JWPA 2EIDA 4MZUA 3PURA 3I3QA 3ZFFA 4LOTA 2XBO3 5FPXA 5EPAA 2F4PA 5HCFA 1PVC1 1H8VA 5DG2A 1EV12 4LMFA 1RTVA 4Q26A 3THDA 1VBD2 3U37A 3KWVA 1GZCA 3JXSA 2XB6C 3ZKUA 1JOBA 1A6CA 2JKXA 4FT8A 3LPFA 2XQXA 3ILFA 2E32A 2QQIA 1MEC1 4XMAA 2GC0A 3D3AA 5DUUA 1PVC3 3WW3A 2WNEA 1E5SA 1UU6A 4L11A 2WFF2 3GCWA 4LBKA 1NZIA 1PZ9A 2R7EB 2W2IA 3OYWA 4IERA 4AFMA 1O3RA 5T52A 5FYTA 4XURA 1CONA 4CCKA 2JG9B 1I5PA 3KF5A 1DG6A 4FTBA 4NHMA 5CKMA 3V0AB 4A6SA 3G6JB 1NQDA 4BLJA 1SBEA 4ASMB 2UWCA 2YHJA 4QPIC 4NIGA 1NXD1 5H9QA 3AZWA 3K4ZA 3WP3A 1HRV1 4CCNA 2V73A 3W9AA 4M01A 3LZZA 4FO9A 2W91A 2VZRA 3KB5A 4GMP3 4EWEA 1Z0HA 3OPZA 4UW3A 4DEQA 5DXDA 4RGAA 1AF9A 2P3JA 3ZIXA 2BW8A 1J1TA 3ZXKA 1KFUL 1GOFA 1HRV3 4XFIA 1MZ5A 3HEIA 2VW2A 3LEGA 4KGGA 4NVPA 2ZGMA 2NZ9A 2ZHMA 4R9BA 4PIZA 3CEWA 2HJIA 4QQHA 4GB32 5HV0A 2DU1A 4LHLA 5SV5A 3VDAA 2G9ZA 2JDUA 3ZN6B 2ILMA 4A3XA 2XR4A 3U07A 3RMYA 4CPBD 2WS93 2A70A 2HWF1 5C4WB 1RHI1 3AXEA 2VMFA 2J1SA 3CO2A 3POWA 3ZM8A 4EWAA 4CXYA 3PLQA 5EWSA 1IHMA 2Y60A 5FYIA 2R042 4NWWA 2D93A 3UT0A 1JYWA 1BKZA 4TLFA 3O1MA 4RA0A 2OXBA 3KT1A 1LESA 2OZJA 2YU2A 1G9FA 1Y7BA 4Q4Y1 1JYNA 4XC9A 3DKWA 5A7SA 1V6KA 3WNMA 1LNSA 4AEKA 3J8F3 5FAXA 3IDBB 2ES3A 1UMHA 1AR93 1PIV2 3B02A 2XVLA 4XHBA 1QU0A 1WCUA 4CUCA 3AP5A 3B5LB 2JD9A 1D7PM 5APAA 2ZZJA 4A4AA 3SH3A 4G3YC 5ISLA 2IXHA 5EFUA 1G9DA 3ZMNA 5J7MA 2VZTA 4WM8A 2EIGA 1UKGA 3IDCB 4E8DA 3LIGA 1RUE2 1JZ8A 4P9LA 5FO8B 1WCQA 5FZOB 1W8WA 5FPBA 2HWE2 1SLLA 3A4UA 5FZ0A 4EJRA 2W1QA 4CP2A 2ZAAA 4LULA 4IE5A 1UAIA 1WMXA 1HV1A 3W21A 2Y6FA 4FQ4A 3JBG2 4BIFA 1IS4A 2NYYA 1YNAA 3AYDA 3FBMA 4Z92B 3I2GA 2VCAA 3N36A 4RS5C 2JEMA 1SPPA 3K3NA 2AREA 2WO2A 4BU2A 3I2HA 1X8MA 4LHKA 4CXWA 4NIDA 3ACIA 4M4RA 4PF1A 4FPHA 3CZJA 3SCGA 3HMYA 1WBLA 5KC5A 3PIJA 2FCUA 2VU9A 4QGMA 1G7YA 1W9YA 3IMNA 4HK8A 1YQ6A 4QHOA 3UYJA 3VZMA 3RZGA 1MS3A 2WS92 4UAPA 4CDUB 1DLLA 1O5UA 2ZMKA 2GP3A 2OPKA 3WVJA 1KXGA 2ZKNA 1H1AA 1U5XA 4AVVA 1RUJ1 5CZKA 2A6YA 1PGW1 2YB7A 2BGOA 3KGLA 3ZYGA 3AZVA 3MFAA 4GULA 5F3GA 2B9UA 5D21A 2BVBA 3KSCA 2HWB3 1AL23 1VRBA 3C7HA 4GKXA 4JGYC 5BV6A 5J09A 2J1VA 2ZHKA 5I0SA 1VBB1 3A7QA 3T3YA 3GXUA 4LPLA 1ULOA 1HQNA 1QJFA 3PJYA 1K12A 2ZGTA 2VO5A 3N7MA 1Q8OA 2RM22 1X33A 2XL7A 3OBTA 1T6BX 1WKYA 2W39A 1OPMA 2P34A 3LFMA 4Y1XA 5L9RA 5KXCA 3KVAA 4L8QA 2AEYA 1ASJ2 3V65A 4GH4A 2W52A 1A8DA 5C71A 1RUE3 4URAA 4E9KA 1UOGA 4JV4A 4AE2A 4AK3A 1PO22 2YPDA 4K20A 5A3NA 5GLVA 1NY71 5A33A 4XTPA 1IS6A 3VZNA 4HFSA 1PIV1 3IZOA 1I9RA 3ZPOA 5E16A 3WOGA 5FIXA 5C70A 1LCLA 2B46X 2PHRA 5E6HA 5F3IA 5T54A 2AENA 1J84A 1VRH1 2P3IA 2Q1MA 2G9FA 4QKNA 2YU1A 1XYNA 4Y20B 5JPNB 1Q3EA 4MGTA 1VBC2 2ZX3A 5DMYA 5IVEA 1JZ5A 2CYFA 2BEOA 3AVRA 4UBHA 3ACFA 5D1IA 4AVBA 1EAH3 2GN7A 5LBEA 3RJRA 1AR73 5FYMA 2FZ1A 4Q0VA 1OC1A 1WCKA 2QQLA 4NHXA 5I0DA 3I2KA 4Q0UA 1YI9A 5C33A 2V09A 3DN7A 2ID4A 1PK6C 1WCSA 2YV8A 2ZGQA 3GBWA 2ZTNA 2FMDA 3IIIA 4LQRA 5DZEA 5EXOA 4IGQA 2XWBB 4AFBA 3FE5A 2XOMA 4ZHNA 4Y1ZA 4MV2A 3ZYJB 5F5CA 1XU1A 4AHXA 1JHNA 1TZOA 4XJZA 2R0HA 2DVGA 3H0OA 2NMOA 3VDDA 1J3PA 1ZX5A 2PHTA 4CSWA 5FCCA 4XCAA 4H55A 5FKBA 3I49A 4COVA 2Z4FA 1LHVA 2VG9A 3DV8A 4RSUA 1RUC1 3LA3A 1NYWA 1XXNA 2PLV3 1HRV2 3W58A 3TEWA 3N9QA 2WWJA 4CEWA 5KWRA 2Y33A 3A0KA 3B9IA 2Q4SA 2O8OA 5BNNB 1CWPA 1V6IA 1Q8SA 4Y26A 5FPLA 4TXWA 3T30A 3QOPA 1B35A 4MHRA 3ASIA 5A7OA 2F17A 3ZXLA 1SLAA 2JDKA 4CDWC 1W6NA 1L7RA 1P8JA 3WP6A 3U11A 2WNOA 1QJY2 1WLCA 4GH4B 4UWDA 5IT6A 1S0FA 3H8XA 5EJZB 4AR2A 1BZWA 2YBPA 4WVZA 5A6XA 2WWSA 1J58A 2QQMA 3S5AA 1PGL1 1PZ7A 2F4LA 3NV4A 1LTEA 4JGZA 3ZFEA 2VZ3A 1H1IA 4XUOA 3RYRA 1C8M2 1DQ4A 2J1EA 4N90A 4PQQA 2CWMA 4XEZA 4KU7A 4XMIA 1BXHA 2EIBA 2ZGSA 4IDZA 4LR4A 4BK5A 2BYVE 4XIOA 1X8EA 2EALA 2YMZA 3QH7A 1POQA 2ZGKA 1FMD1 1YJKA 1UY1A 3E1F1 4CPBA 5IAXA 3AMQA 4JGYA 2C4XA 3MHZA 3VKLA 1Y3TA 1FT9A 2VNGA 4EN6B 2RR11 2AZ5A 3LOIA 5C8CB 1IKPA 2BFUS 4B4QA 4DUVA 3QD6A 2V5DA 1OF3A 4B8EA 4CDXC 2VMIA 2FDIA 2VQTA 4MOAA 4YVWA 1XB9A 2ZXQA 4N43C 4R9CA 4XFGA 2BNNA 4BZ4A 5ABJC 1QMJA 4H7MA 4LO6B 1KGYA 2WSVA 3MEPA 4HVRA 4X8PA 3RZHA 1XNBA 2VC9A 3UK9A 2A5ZA 1FV3A 1H2LA 1LHWA 1SFYA 1G86A 3BI3A 3OUJA 4O7XA 1HIXA 5FXZA 3KQRA 5A3MA 2C26A 4FXGB 3HN1A 3TOJA 1Z7S1 2WYSA 3RWNA 3ZYIB 5I0RA 5C9AC 3POFA 1YUDA 2Y8KA 3DYMA 3I3BA 4YGEA 1W99A 4NJ4A 3A21A 1ODMA 1ZNPA 3E97A 3U75A 1ZZ9A 3I59A 4NAMA 2JG9A 1JZ7A 3ZXEA 1YQCA 4A42A 4IV1A 1GOHA 1W8OA 1QIQA 2ZCWA 3CL1A 3KHBA 2BBAA 4NR1A 4YM1A 2P17A 2JKBA 5IJRA 2X09A 2AC1A 3VN4A 2VUDA 1XE7A 1SLCA 3N9OA 2P6CA 4QB6A 1CIWA 5F3CA 1IS3A 2ORZA 3JCIA 3T08A 1X82A 3O1VA 3O0XA 3IWZA 4QXBA 3EHKA 4QQPA 3EQEA 5C9AA 4C90A 2VMEA 1TVGA 3IPVB 4CUAA 4META 3PDQA 3CDZB 1QNWA 1ND3C 4EQVA 3PUAA 5IW0A 4B7KA 4OULA 2DCKA 1NKGA 1G6NA 2EICA 4L97A 2WNUB 5FZAA 3E5QA 3CJIA 3AZYA 1LAJA 4YM3A 1REDA 2D40A 2LROA 1IPJA 3DXTA 4PIXA 3NJVA 1GMMA 5FWJA 2P37A 1SFNA 4INDA 1QEXA 1W2TA 2DVDA 1CAXB 2VQ0A 3EYPA 2VZUA 1RUH1 4N9HA 3WCRA 4Y33A 1RUNA 2B42B 1RJ8A 3T4VA 1OF4A 1SG3A 5FZ6A 4C0BA 1AX0A 1W6MB 4YM2A 3PJQA 2ZGLA 3GBGA 3VHNA 3EMRA 1KJLA 2Q8DA 3D82A 5A1LA 5LRSA 3ECQA 3F2ZA 1NE6A 2PYTA 1D0GA 1OFNA 4ITCA 4FOYA 4LORA 1R092 4DUXA 2VNVA 2W1SA 1XE0A 3VBSA 2ZX1A 5A7WA 1RMU2 3M3EA 3WF3A 4EV0A 1W0NA 1AR71 4KG8A 2QE3A 3DPRC 4M0HA 2XMLA 4QX5A 4QXKA 3B01A 1OPOA 4W50A 3S57A 1UOBA 3FX3A 4JDNA 4LKSA 5EJ3A 4OVEA 4YZ3A 3P3NA 2VH9A 4PDWC 2QZ3A 1QOSA 3K4AA 2DURA 2GZWA 1COV1 2WQ8A 1JU4A 2JX9A 2BOIA 2E7TA 1PK6B 2DVAA 3IAQA 3T09A 1O3SA 2WLQA 2W9XA 5FMOS 1PO12 3E5XA 3KGZA 4OCTA 4P9WA 3GHNA 5DAPA 2ZHNA 4HETA 4K3UA 4OLLA 1FMD3 2EXJA 4P14A 4E2SA 5FTTC 2WT0A 4ZXKA 5FZOA 1BMV2 2DUOA 2WWUA 3POEA 4B1MA 5IK8A 5DAVA 4NMIA 1IQAA 3E6BA 4ASKA 1R083 3NAPB 5KHIA 1HV0A 5LA1A 4HZFA 4UW4A 3BOPA 5A6YA 1S0BA 2WC2A 4XACA 4ARXA 1UY3A 2W92A 4I3PA 4M3CB 2WINB 5A1FA 2HBUA 2TNFA 2W08A 3N35A 3Q9OA 4EWDA 2WR9A 3BIWE 3I3EA 4IEWA 1OOPC 5GLTA 2D6MA 4PBPA 1DQ6A 1W8UA 1TQ5A 1OVPA 2I45A 1RINA 1VIWB 2OS2A 1CPNA 2JENA 3M7AA 1VMHA 2WZR3 4M00A 1SEFA 2AEZA 3ALQA 4UFJA 1YLLA 1PVC2 1O59A 1BHGA 4XUNA 4CCEA 1OLQA 4JVAA 1SZBA 2QCSB 3PTRB 3KS7A 5FZKA 1D2QA 5CKQA 2VOKA 3WDVA 1H8TB 1OD5A 5A7QA 1GYKA 1ZA4A 4GWIA 4JKKA 1V00A 2YPJA 2HWD1 1K5JA 4Q4X3 1CN1A 1RITA 3WCSA 4LIUA 3NQHA 3FHIB 5C3QA 2VTXA 2W1WA 4FSJA 2QQKA 4BHPA 2Q0AA 2VBDA 2WKKA 3VHPA 4RR3B 5FXWA 4LA2A 1ZRDA 3O0WA 4HPKA 1YYNA 1W8TA 2C6SA 5EHDA 3IIAA 5GLWA 2AR6A 2R16A 1SMVA 1YWKA 3V0BA 5DAXA 1S1AA 3M3CA 4PIYA 1OBNA 2HWB1 4Q4V1 1ZBA1 3KV9A 1TE1B 3IBMA 1QGLA 3PVEA 5LEJA 2JD4A 3OUHA 5LBBA 2IXKA 4BE3A 3CBNA 1FNZA 5E88A 3QBQA 4RGGA 5D2AA 2DBIA 5EYYA 3ZSJA 4IQPA 1CAUB 4OFGA 1JMUB 1V6OA 4RD7A 4ATFA 4JX0A 4BK4A 4YW6A 5AC93 3HT2A 4CE8A 2IVJA 1TNFA 1UD1A 1VR3A 4KQ7A 1N1VA 5JI7A 3I2DA 3N7KA 5I0TA 5JSRA 2VUCA 2WUHA 4N8MA 5JXIA 2CGPA 3VKMA 2DUQA 1JOPA 2D97A 2XJQA 4N43A 1VBD3 3WX5A 1GP5A 3WG3A 4A41A 5GZCA 3ILNA 3POYA 1AVBA 2JG8C 2DCJA 3UKVA 1NA1C 3VHOA 4DY3A 1E5RA 4AGVA 3EO6A 3HQUA 3IMMA 1DGLA 1LEMA 3GYDA 3J8F2 4MGSA 4QHZA 1EAH2 2CSGA 2JG8B 1UPSA 2XH6A 4WZCA 3DPRA 5FZLA 5K0UA 1SBFA 3PHMA 3NV1A 1US3A 1W8ZA 2BWAA 2TBVA 2ZGRA 5I8SA 1J1LA 1S0JA 4DXRA 5FZ8A 4J1WA 4YW3A 3M4FA 2B5HA 4M3CA 2I07B 3RDIA 1VPHA 3ZFGC 5EQUA 1H8TA 4H2AA 3MW2A 1C8M1 1GQGA 3S7EA 3MZHA 3AXDA 4XBLA 1UO9A 4AVTA 1R1ZA 5BNPA 4QAWA 4XFBA 5FY0A 2J42A 3OGJA 4FQZA 5CVRA 3J8F1 5GZFA 1UY0A 1EAH1 3SH5A 4CU6A 3H8UA 1ZREA 5CFCA 2GNTA 5EP9A 5F39A 3AVSA 4LO8A 5GZDA 5L7OB 4ZZ5A 1F2NA 3PU8A 2UYBA 1O3TA 1RUJ3 2BVVA 1LGBA 2BU9A 2YZ4A 2D6LX 3CLPA 1CIYA 1Q43A 1W2OA 2H6CA 2P1BA 2VOXA 3RI8A 3ZYHA 4XFCA 4XUTA 3N9MA 2N7GA 1B35B 2A3YA 4IXLA 4W8JA 5FLJA 1W90A 2R063 1HXS1 2V72A 4YGDA 1MQTA 4XW3A 3OCPA 4OHWA 5L19A 5IVCA 4QQ2A 4IE6A 1CAWA 3HT1A 4LT5A 1W05A 3VBFA 1JODA 5C4WC 4M3CE 2DF7A 3Q8FA 3VBHB 4QDRA 2IXJA 1W2UA 2WZR1 5JIAA 4MX3A 3CKHA 5T55A 4D6RA 3LSEA 1JYVA 3GALA 3L2HA 2BNOA 4QQLA 1YCIA 3AP7A 4LLFA 5FP8A 3WZ1A 1GNYA 1OA3A 1AL22 1DYKA 1DQ1A 1R1A1 1R093 2ETEA 2X5IA 3EBRA 1I5ZA 3NJYA 4OZOA 4AFCA 4D6QA 2DBNA 4YGBA 3UNPA 3H7JA 5T50A 1ZRIA 5CB7A 2R043 3T1MA 5JWPA 3PUQA 4GD4A 5A7PA 2HWF2 1DZTA 2P5BA 4EN7B 4Y22A 4TWTA 4CDQB 5IFPA 4FPCA 1UWWA 1R64A 3OOXA 2BFUL 1AR82 1FOD1 1ASJ3 1JYCA 2RS32 1BCXA 5GKAC 1RMU1 3U4SA 2PHXA 3AP9A 3RNSA 4Q4X2 2WT2A 2J1AA 4Q4Y2 1OA4A 4CRQA 2ZPXA 4YFZA 1D4M3 3KMHA 3DECA 4QDSA 4XJAA 5A3OA 2ZA9A 4Q4V3 1UCXA 3LSDA 4JRAA 5FK7A 3RS6A 5BNOC 5FZGA 3J7HA 5CU1A 5JAXA 5FY5A 1MS9A 2PXJA 4MXWA 4HG6B 1HB2A 3D0JA 1SDWA 3D0SA 2ZEYA 3QH6A 4RHV2 4WVWA 4LBNA 3LIHA 3MW3A 2QFEA 5J96B 3BTAA 1VBC3 2EXIA 4AQ6A 4MGZE 3ZXDA 1WWYA 5JZGA 4NUBA 4K7JA 2RDNA 3RSJA 3ZIWA 3OGSA 3THPA 3V0AA 3I59B 4AVCA 2RS33 4DQAA 1O8PA 4J1XA 1CZVA 4IV1B 3R4DB 1NT0A 3ACHA 2J22A 5LB6A 1VBD1 3NJXA 4BB3A 1IZ3A 2RMU1 4NRMA 2LRPA 5LBCA 3IM0A 4JRLA 2VAUA 3PUIA 5B2GB 5FKCA 1GV9A 2WZPP 1MEC2 1RUC2 4GZ9A 3OGGA 1FAYA 4XF0A 3NAPA 5FPVA 3ZKYA 2KXLA 1NCRA 1QJX2 4N53A 1UZ0A 1F4HA 2XUEA 5E89A 5C7GA 2Q8CA 1BBT2 5JMCA 5LY2A 2ZMNA 3WDXA 1S0IA 4YVSC 2HWE3 4B29A 5DDJ2 4P02B 1LU2A 1UKRA 1NZCA 1GZWA 3APBA 5DN2A 3LQCA 2D6NA 1HRI1 5ABJB 4D7SA 1W9SA 3BU7A 1OQDA 2VQUA 4IESA 4K1YA 5DZGA 2WO1A 5FO7B 4CDXA 2XLFA 1UZYA 2HEVF 2UWAA 4LTAA 2D7FA 3SH4A 3ZFFB 4YZ5A 5AVAA 2E33A 3I3DA 3WR0A 3CF6E 3B93A 3NKTA 1F5JA 4ZU5A 4EN8B 4B4RA 3FUQA 5FZ4A 3N9PA 1MPXA 2FQPA 4S2GA 1RUG2 3AP4A 2X05A 1HQWA 2R1DA 3R0RA 1HLCA 1S0EA 2VD7A 3N4MA 1WLTA 3UL2A 4AEDC 4DUWA 3DUIA 5I0UA 1G9CA 3Q8BA 4EROA 1PX4A 1XNAA 3GBFA 2ZGNA 4HKWA 1ZRRA 5HXVA 5K0UC 3BUCA 3ZX7A 4FOVA 4XQ4A 3WF1A 3O1RA 2IFWA 2QVSB 3EJKA 4Y1UA 4ES9A 2KA3A 2QBXA 4XXAA 2MNGA 3AYCA 2IFRA 2OQ7A 1BEV2 2ZX2A 4KI5M 4XQDA 1WCDJ 3D6EA 4QB2A 2XJUA 1IGOA 1US2A 3WNPA 1Y43B 1ODNA 3ES4A 1ZYBA 1C8M3 2PELA 2R062 4MADA 4F8AA 1DZQA 1RHI2 3RI9A 5GLUA 1PGW2 2XQRA 1MVEA 3N7LA 3BTZA 1PGL2 4JDOA 4AEDA 5CFCC 3L9JT 3ME2A 4IEZA 3OSDA 3JU9A 5T5PA 1ULGA 3BVCA 5DG1A 4XABA 4AEJA 1LJ7A 5T5LA 5CFDA 5LA9A 3HD8B 3ZYRA 3SITA 5FP9A 4DRVA 4ZU7A 4QM8A 5HPOA 1OHFA 2YGMA 2OX0A 3NSTA 4Y5TA 3CQOA 3WD5A 2FCTA 1UIKA 2JG9C 1JS9A 5ANNA 3JZVA 2BRTA 1KDMA 4UFLA 1EPWA 4I02A 5ACA2 4YZ2A 5F6LB 2R073 1XOYA 2RR12 4PJYA 1W9TA 4QDQA 5FR3A 4PLNA 4FAGA 4Q4W3 4R4ZA 4GWNA 4BQXA 1W3VA 1DF0A 3ITQA 2YXSA 1OI6A 2B4KA 1LOFA 1O4YA 3DPRB 4BCUA 3H1WA 4BQYA 5FYCA 5JOZA 4OI0A 3C3VA 4XILA 3USUB 1QNYA 3C7OA 3WQ0A 2MEV1 1A78A 2E31A 5IVBA 1AXKA 2PHDA 5F6KA 3ZR6A 2LM3A 5E8AA 4OQ8A 1UU4A 1R1A3 1CGPA 4DO0A 4HMZA 4GALA 5JOXA 3CU7A 1Z7S2 4C91A 3PNAA 1ENSA 4Q1PA 1ULDA 1UMZA 1C8NA 4AFDA 5KC6A 2WFF1 4YGCA 2VJXA 3QCWA 2ZEZA 3ZN5A 4W6WA 1LGNA 2RS52 4SBVA 3LAGA 2V4AA 3SCHA 4IV1C 3ZN4A 4RQPA 2WAOA 3K4DA 1PM4A 4HBNA 2ERFA 4WVMA 2WJSA 2PN5A 1GKBA 2E7QA 4QX8A 5IUQA 2O0OA 2D98A 2P3YA 4AQ2A 1GZ9A 1S0GA 3JQWA 3VB9A 1ZBE1 2JE8A 2CGOA 1LODA 2VZ1A 3H3LA 2EF6A 1QJU3 4K9SA 5F2WA 3TEXA 3LD8A 5A32B 4CDQC 3ACGA 3I4IA 4XF1A 2CHHA 1YI7A 4YG3A 4BQ4A 4IV3C 3NL1A 3T2QA 5FZ1A 2BTVC 3PVBB 4COZA 1GQHA 1EUTA 2RE9A 1YQ8A 3AMMA 3KF3A 1NCQC 1JTZX 3IN9A 4ZZ8A 4ZU4A 3RFRA 3DGTA 1KITA 4IEPA 3VZLA 4LE4A 5K8SA 1ALYA 3VZJA 2RR13 2OT7A 3FBYA 1W2NA 3W59A 3PUSA 4CP1A 2YFUA 4BQ1A 1F15A 3MO4A 2VMDA 2I2SA 2JDYA 2VE1A 2D43A 5BPXA 5FP4A 4GQ7A 4D8MA 2VZOA 5FLIA 1DHKB 3WNXA 4W6YA 2FCVA 4GA9A 2C1FA 4MO3M 2HEYF 2EAKA 1MZ6A 1QXJA 2A3XA 4BXSV 2Q1ZB 4S2DA 2WNVA 4FOQA 4CU8A 4MHUA 1PGSA 4N7UA 1UN1A 3VDCA 5J37A 2GNBA 3VL9A 1VRH2 2R32A 3KCYA 2B39A 3FFQA 4Y20A 4MLOA 3RGBA 2AACA 3AFKA 1LOAA 2FDKA 4WVVA 4S2HA 2VECA 4ZXEA 1W6OA 2UU8A 2WSUA 4J25A 1Z78A 3U78A 3WG4A 3TNQA 2ZGPA 3J7MA 4XXPA 3UJQA 2P3KA 1DYPA 1ZBE3 5AVPA 4QD2A 3HQXA 4CA9A 3OY8A 3WDYA 4JTOA 4BPZA 4DEVA 4FPGA 2KM2A 1RXFA 1MACA 4GJZA 4AZZA 3POGA 2D3RA 2JDNA 4UXAA 4CCMA 3DL3A 1J59A 1MQTB 1GP6A 5FYBA 3U14A 4DINB 4Y5SA 2YC2A 2GP5A 4FPKA 1YFXA 4DIQA 1QXPA 1SLIA 3S5QA 3UJOA 4IL7A 1TNRA 3WUDA 1RUF2 4R4XA 3TBDA 3VDDC 4QWNA 1ZZ6A 2WA3A 4AOCA 1PNFA 1TG7A 1ZBA2 2XJVA 4M3CF 1WBFA 4D3WA 2GNDA 2ZABA 5IK4A 5BNNA 3PIGA 3VBRC 4XUPA 2W3JA 2QQPA 4CYDA 2VR4A 2FDHA 4E2QA 3N9LA 4Y24A 5L9BA 4BOWA 2E26A 3H1MA 4BYYA 1GNHA 2OVUA 2AYHA 4P5YA 3C7FA 4XAEA 2WS91 1JZ2A 4CU7A 4LEJA 2MHFA 5FJKA 4AAXA 4C1XA 2GMMA 1HN1A 4KNCA 3VL8A 5JZGB 1OT5A 1U0AA 2JE7A 4JQRA 4HT1T 4ASLA 2YY1A 1R091 1UMIA 3ZMOA 3QACA 5HCBA 4UF0A 2JB4A 3SEPA 1X7NA 4FFHA 4ES8A 2R041 4K6BA 2WNUC 3AKQA 1N47A 4MXWB 5FZ3A 1R1A2 4Q4Y3 3RYKA 2VOTA 4IGOA 1QH6A 3AKPA 4NIHA 1BBT1 4OMDA 5FYZA 5FOJB 2VZQA 4HANA 1DIWA 2Z69A 4IEUA 4XOGA 1PO13 2B45X 2ORXA 2YG0A 5C8CC 1UXXX 4FAHA 1M4WA 1T6GC 4KGQA 2JIJA 4OI2A 3MIFA 3O14A 4E2GA 4FPYA 1YIPA 4LO7A 2Y6GA 5CKNA 4AI9A 2G19A 2PHFA 3WG2A 1AR81 2X29A 1GANA 2HKXA 4YLZA 4JGYB 5FYUA 1M06G 3BPSA 4IV3A 1W04A 3IAPA 5FZFA 4L92A 5FYYA 2WNVB 5DQ0A 1DDLA 5FBZA 1GZWB 1DLCA 3NNJA 3NRUA 3KQ4B 3RYPA 1U12A 3MDPA 2IXLA 4HLTA 5F32A 3PVNA 1EV11 1FX5A 1H8TC 2XWJB 1T2XA 4QX7A 5HI0A 1HN0A 1W0OA 1V0AA 2YC0A 4IETA 4PDWB 5FY7A 3ZVXA 1HRI2 4HKOA 4HKLA 3ST7A 1OQ1A 2DFBA 3OEAA 5FWEA 4DMIA 1C28A 5IWFA 2XHKA 3S0MA 2XBO2 1POV0 1L7QA 4IE0A 3RG0A 4WV8A 1MZEA 3K48A 1BEV1 4G9SB 5CADA 4AGGA 1ND2C 1ND3B 3WF2A 1ZZ7A 4LBQA 1H1MA 1GP4A 3ES1A 4A2UA 1HW5A 4QGLA 5FUIA 5T3NA 3FLRA 2DFCA 1DCSA 4Y4YA 5CG8A 5L7OC 4RS5B 1RUI1 4PF5A 3DXUA 3CZUA 4NHKA 2RMU2 4YSFA 1V70A 4XE9A 5LRRA 1AZDA 5A6ZA 3LGRA 1HDKA 3AJZA 3DF0A 4UI9L 4AI1A 1W3XA 2HLEA 3K75B 3LB9A 4CU9A 1YFYA 5FMOL 4QPWA 1QH7A 2VOVA 3WF0A 3M8LA 5BNPC 5CISA 1VBB3 1QKQA 4OMCA 1NLSA 5JOYA 1VBE3 2JXAA 3O7OA 1DQ5A 1NAEA 5GZEA 5CA6A 1RUI2 5F1RA 2ZMLA 4ONUA 5B4NA 1DBNA 1VAMA 1Y4WA 4QGNA 1UY2A 2FDJA 3H8OA 1X36A 5LEKA 2O1QA 2Z79A 5KHHA 2OYZA 5JSPA 3GZEA 5FZMA 3VD7A 1KDKA 1OH4A 1WMEA 4I0WB 3HNBM 2D44A 4QPGC 1UZZA 3JD72 3MIBA 3NNFA 3SMHA 4GB31 3WP4A 1W6PA 3KCXA 2GAUA 1BEV3 4FPFA 3MFCA 2RV9A 4UFHA 1VP6A 1W9FA 3FC0A 3OBRA 2PAKA 5FLHA 1W6QA
chains in the Genus database with same CATH topology
2DCJA 1JHJA 4D0QA 2Y6LA 4DXSA 2R7EB 3VD5A 1UYYA 4MGSA 4XURA 1K3IA 2CDOA 3T0DA 1US3A 1I5PA 1JYXA 4DXRA 3W5NA 2J7MA 3ABZA 3K4ZA 3IB3A 3WSOA 2WZ8A 4QAWA 3VDBA 3HJRA 4IUGA 2W91A 2L9LA 2VZRA 4KMQA 4CU6A 1UY0A 3MBWA 4ZY9A 4DEQA 3AC0A 3CMGA 1GOFA 2VZSA 4QX2A 4YPJA 3HEIA 4ZZ5A 3LEGA 1CIYA 4XUTA 4KWUA 4W8JA 2V72A 3VDAA 4L0PA 4QDRA 4JKMA 3CKHA 3LPGA 4A6OA 1JYVA 1XNTA 2Y6HA 2HYXA 2OKXA 1GNYA 2VMFA 2J1SA 3GDBA 2JDAA 3ZM8A 4OZOA 3UETA 1JYWA 3UNPA 3MUZ1 1SDDB 1JYNA 3WNMA 1LNSA 5IFPA 1UWWA 1R64A 3MUY1 1UMHA 2XONA 3I2FA 3VD9A 4CUCA 1J83A 2JD9A 1D7PM 4A4AA 2J1AA 2YFZA 4OYUA 1F4AA 4TTGA 3DECA 2VZTA 4QDSA 4E8DA 1JZ8A 2W94A 1YQ2A 1WCQA 3A22A 4FI9A 3J7HA 4HG6B 2VMCA 1XC6A 2W1QA 4ET7A 2ZEYA 4RN5A 2W87A 1W8NA 3I2GA 2VCAA 4PT6A 3WNLA 1O8SA 2WO2A 3I2HA 3OGSA 3ACIA 4M4RA 4PF1A 1O8PA 3CZJA 4BJ0A 1CZVA 1OD3A 3ACHA 2J22A 4A45A 3NJXA 4UAPA 5LA0A 3PUIA 3DYPA 3OGVA 4GZ9A 5CZKA 1JU3A 2YB7A 2BGOA 3OGRA 4QX3A 1DYOA 4JKLA 1UZ0A 1F4HA 5C7GA 3ETPA 2QQNA 3MV11 5B4XA 2BGPA 2W1UA 3C7HA 4P02B 3VD3A 2J1VA 5DN2A 3LQCA 5G04L 3A7QA 5J1XA 3GXUA 4LPLA 1ULOA 3WNOA 1W9SA 4CU9A 1K12A 2VQUA 3I97A 2WO1A 2VO5A 2ZEWA 4A3ZA 1IQDC 2W47A 1WKYA 2E33A 3I3DA 4LHSA 4QB1A 2B9VA 5C71A 1MPXA 2X05A 5LCWL 5JXHA 4DUWA 4OUEA 3C7EA 1PX4A 1XNAA 5C70A 3WF1A 3K46A 2RVAA 3NNGA 4W4ZA 2QBXA 1J84A 3I2IA 1W9WA 2Y6JA 4KI5M 2KD7A 4QB2A 3WNPA 1US2A 2W46A 2VCBA 4MADA 3IDAA 1RYYA 4QX1A 5DMYA 1JZ5A 1UYZA 3ACFA 4QX0A 1JZ6A 3SEEA 2QQLA 5I0DA 3I2KA 3FL7A 5G05L 2ID4A 3IIIA 2V4VA 4LQRA 5HPOA 4UOJA 2DDUA 3CQOA 2XOMA 3HN3A 1H6XA 4ARXA 2EIEA 1GOGA 2VL4A 1K45A 3PUHA 4P00B 1W9TA 2WN3A 4QDQA 3WNKA 1PMJX 2Z4FA 1UX7A 3C8XA 2B4KA 5JXJA 3C7OA 4TXWA 2E31A 4CVUA 1CZSA 1L7RA 1P8JA 3OB8A 5EJZB 2VJXA 2QQMA 3GGLA 2ZEZA 2WABA 1XPWA 2VM9A 2VZ3A 3WF4A 2WAOA 3K4DA 4XUOA 1DP0A 2J1EA 4PQQA 2EIBA 1GU3A 4BK5A 3FN9A 1NUKA 3MV01 3P1IA 2JE8A 3THCA 2VZ1A 3WQBA 5JUVA 2X10A 1UY1A 3E1F1 3ACGA 4XUQA 2C4XA 2VTFA 5CYYA 4BDVB 4DUVA 2V5DA 3T2QA 1OF3A 2VQTA 4MOAA 1EUTA 2ZXQA 5A1AA 2VZPA 2QQOA 4ZZ8A 5IYYA 1CZTA 1KGYA 5JXGA 2VC9A 2YFUA 3MO4A 2VMDA 2C26A 4P08A 3DYOA 3VD4A 2WYSA 4D8MA 2VZOA 2Y6KA 2Y8KA 2YC4A 3DYMA 3I3BA 1W99A 3A21A 4MO3M 4BXSV 1GUIA 3C7GA 1JZ7A 4A42A 4CU8A 1GOHA 1W8OA 3T0AA 3VDCA 2BBAA 5IJRA 2X09A 4QB6A 2WN2A 2ORZA 3LE0A 4XZUG 3LEKA 4ZXEA 3T08A 4JHZA 2VMEA 1TVGA 1JI6A 2W5FA 3FHQA 4CUAA 3CDZB 3T2OA 2DCKA 3K77A 4XVHA 1NKGA 1EUUA 2EICA 4DEVA 2LS6A 1SHWB 2C9KA 5LA2A 3NJVA 1GMMA 2YC2A 1UY4A 3EB7A 4AG4A 3SKVA 2W95A 3EYPA 2VZUA 3WNNA 2XHNA 1OF4A 3OBAA 1SG3A 3FHAA 3HNYM 3ECQA 3F2ZA 1TG7A 1PMHX 4DUXA 2W1SA 4XUPA 2W3JA 2VR4A 3WF3A 5JR2A 1W0NA 2E26A 4Z2AA 3T0BA 3BN6A 3W5MA 2PQSA 4P5YA 5JMOA 2VZVA 3C7FA 4W50A 1JZ2A 4CU7A 3WEZA 4AAXA 4LKSA 1HN1A 1OT5A 3K4AA 4GWJA 1UMIA 5EJ1B 3GM8A 2WQ8A 3SEPA 1JU4A 1JZ3A 3HPNA 2J1UA 3IAQA 3T09A 2W9XA 1KEXA 1K42A 2VOTA 4OMDA 2VZQA 2QQJA 3HNMA 2ORXA 2YG0A 1UXXX 3HOBA 1JZ4A 2Y6GA 3SKJE 2Y64A 5LA1A 3BGAA 5IHRA 1PX3A 1UY3A 2W92A 3UESA 1ULPA 3IAPA 4M4PA 1UYXA 2J1TA 3I3EA 2BZDA 5DQ0A 3OG2A 1DLCA 3OEBA 1GQPA 3NRUA 5F7UA 2LW8A 5HXMA 1O59A 1BHGA 4XUNA 1T2XA 1CX1A 3OEAA 4GWIA 4JKKA 3CIHA 1L7QA 3LEIA 2WZEA 3I2JA 3NQHA 4E8CA 2W1WA 3P6BA 2QQKA 5IFTA 2BERA 3WF2A 1H6YA 4RYDA 5FUIA 2ZEXA 1UXZA 3CZUA 4MGQA 4CUBA 2VCCA 3T2PA 5DPNA 4UI9L 2HLEA 3K75B 3A23A 4ARYA 2CDPA 2WAAA 2WO3A 4QPWA 3WF0A 4OMCA 2WDBA 4DXTA 1NX9A 1NAEA 2WBKA 4A44A 4JX0A 5B4NA 2EIDA 1UY2A 4BK4A 2J1RA 3VD7A 1OH4A 3HNBM 5EIYB 3THDA 2WUHA 3U37A 5JXIA 3JXSA 2RJ2A 2JKXA 2RV9A 3LPFA 2XQXA 2E32A 2QQIA 4A41A 3D3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DCJ A;  1JHJ A;  4D0Q A;  2Y6L A;  4DXS A;  2R7E B;  3VD5 A;  1UYY A;  4MGS A;  4XUR A;  1K3I A;  2CDO A;  3T0D A;  1US3 A;  1I5P A;  1JYX A;  4DXR A;  3W5N A;  2J7M A;  3ABZ A;  3K4Z A;  3IB3 A;  3WSO A;  2WZ8 A;  4QAW A;  3VDB A;  3HJR A;  4IUG A;  2W91 A;  2L9L A;  2VZR A;  4KMQ A;  4CU6 A;  1UY0 A;  3MBW A;  4ZY9 A;  4DEQ A;  3AC0 A;  3CMG A;  1GOF A;  2VZS A;  4QX2 A;  4YPJ A;  3HEI A;  4ZZ5 A;  3LEG A;  1CIY A;  4XUT A;  4KWU A;  4W8J A;  2V72 A;  3VDA A;  4L0P A;  4QDR A;  4JKM A;  3CKH A;  3LPG A;  4A6O A;  1JYV A;  1XNT A;  2Y6H A;  2HYX A;  2OKX A;  1GNY A;  2VMF A;  2J1S A;  3GDB A;  2JDA A;  3ZM8 A;  4OZO A;  3UET A;  1JYW A;  3UNP A;  3MUZ 1;  1SDD B;  1JYN A;  3WNM A;  1LNS A;  5IFP A;  1UWW A;  1R64 A;  3MUY 1;  1UMH A;  2XON A;  3I2F A;  3VD9 A;  4CUC A;  1J83 A;  2JD9 A;  1D7P M;  4A4A A;  2J1A A;  2YFZ A;  4OYU A;  1F4A A;  4TTG A;  3DEC A;  2VZT A;  4QDS A;  4E8D A;  1JZ8 A;  2W94 A;  1YQ2 A;  1WCQ A;  3A22 A;  4FI9 A;  3J7H A;  4HG6 B;  2VMC A;  1XC6 A;  2W1Q A;  4ET7 A;  2ZEY A;  4RN5 A;  2W87 A;  1W8N A;  3I2G A;  2VCA A;  4PT6 A;  3WNL A;  1O8S A;  2WO2 A;  3I2H A;  3OGS A;  3ACI A;  4M4R A;  4PF1 A;  1O8P A;  3CZJ A;  4BJ0 A;  1CZV A;  1OD3 A;  3ACH A;  2J22 A;  4A45 A;  3NJX A;  4UAP A;  5LA0 A;  3PUI A;  3DYP A;  3OGV A;  4GZ9 A;  5CZK A;  1JU3 A;  2YB7 A;  2BGO A;  3OGR A;  4QX3 A;  1DYO A;  4JKL A;  1UZ0 A;  1F4H A;  5C7G A;  3ETP A;  2QQN A;  3MV1 1;  5B4X A;  2BGP A;  2W1U A;  3C7H A;  4P02 B;  3VD3 A;  2J1V A;  5DN2 A;  3LQC A;  5G04 L;  3A7Q A;  5J1X A;  3GXU A;  4LPL A;  1ULO A;  3WNO A;  1W9S A;  4CU9 A;  1K12 A;  2VQU A;  3I97 A;  2WO1 A;  2VO5 A;  2ZEW A;  4A3Z A;  1IQD C;  2W47 A;  1WKY A;  2E33 A;  3I3D A;  4LHS A;  4QB1 A;  2B9V A;  5C71 A;  1MPX A;  2X05 A;  5LCW L;  5JXH A;  4DUW A;  4OUE A;  3C7E A;  1PX4 A;  1XNA A;  5C70 A;  3WF1 A;  3K46 A;  2RVA A;  3NNG A;  4W4Z A;  2QBX A;  1J84 A;  3I2I A;  1W9W A;  2Y6J A;  4KI5 M;  2KD7 A;  4QB2 A;  3WNP A;  1US2 A;  2W46 A;  2VCB A;  4MAD A;  3IDA A;  1RYY A;  4QX1 A;  5DMY A;  1JZ5 A;  1UYZ A;  3ACF A;  4QX0 A;  1JZ6 A;  3SEE A;  2QQL A;  5I0D A;  3I2K A;  3FL7 A;  5G05 L;  2ID4 A;  3III A;  2V4V A;  4LQR A;  5HPO A;  4UOJ A;  2DDU A;  3CQO A;  2XOM A;  3HN3 A;  1H6X A;  4ARX A;  2EIE A;  1GOG A;  2VL4 A;  1K45 A;  3PUH A;  4P00 B;  1W9T A;  2WN3 A;  4QDQ A;  3WNK A;  1PMJ X;  2Z4F A;  1UX7 A;  3C8X A;  2B4K A;  5JXJ A;  3C7O A;  4TXW A;  2E31 A;  4CVU A;  1CZS A;  1L7R A;  1P8J A;  3OB8 A;  5EJZ B;  2VJX A;  2QQM A;  3GGL A;  2ZEZ A;  2WAB A;  1XPW A;  2VM9 A;  2VZ3 A;  3WF4 A;  2WAO A;  3K4D A;  4XUO A;  1DP0 A;  2J1E A;  4PQQ A;  2EIB A;  1GU3 A;  4BK5 A;  3FN9 A;  1NUK A;  3MV0 1;  3P1I A;  2JE8 A;  3THC A;  2VZ1 A;  3WQB A;  5JUV A;  2X10 A;  1UY1 A;  3E1F 1;  3ACG A;  4XUQ A;  2C4X A;  2VTF A;  5CYY A;  4BDV B;  4DUV A;  2V5D A;  3T2Q A;  1OF3 A;  2VQT A;  4MOA A;  1EUT A;  2ZXQ A;  5A1A A;  2VZP A;  2QQO A;  4ZZ8 A;  5IYY A;  1CZT A;  1KGY A;  5JXG A;  2VC9 A;  2YFU A;  3MO4 A;  2VMD A;  2C26 A;  4P08 A;  3DYO A;  3VD4 A;  2WYS A;  4D8M A;  2VZO A;  2Y6K A;  2Y8K A;  2YC4 A;  3DYM A;  3I3B A;  1W99 A;  3A21 A;  4MO3 M;  4BXS V;  1GUI A;  3C7G A;  1JZ7 A;  4A42 A;  4CU8 A;  1GOH A;  1W8O A;  3T0A A;  3VDC A;  2BBA A;  5IJR A;  2X09 A;  4QB6 A;  2WN2 A;  2ORZ A;  3LE0 A;  4XZU G;  3LEK A;  4ZXE A;  3T08 A;  4JHZ A;  2VME A;  1TVG A;  1JI6 A;  2W5F A;  3FHQ A;  4CUA A;  3CDZ B;  3T2O A;  2DCK A;  3K77 A;  4XVH A;  1NKG A;  1EUU A;  2EIC A;  4DEV A;  2LS6 A;  1SHW B;  2C9K A;  5LA2 A;  3NJV A;  1GMM A;  2YC2 A;  1UY4 A;  3EB7 A;  4AG4 A;  3SKV A;  2W95 A;  3EYP A;  2VZU A;  3WNN A;  2XHN A;  1OF4 A;  3OBA A;  1SG3 A;  3FHA A;  3HNY M;  3ECQ A;  3F2Z A;  1TG7 A;  1PMH X;  4DUX A;  2W1S A;  4XUP A;  2W3J A;  2VR4 A;  3WF3 A;  5JR2 A;  1W0N A;  2E26 A;  4Z2A A;  3T0B A;  3BN6 A;  3W5M A;  2PQS A;  4P5Y A;  5JMO A;  2VZV A;  3C7F A;  4W50 A;  1JZ2 A;  4CU7 A;  3WEZ A;  4AAX A;  4LKS A;  1HN1 A;  1OT5 A;  3K4A A;  4GWJ A;  1UMI A;  5EJ1 B;  3GM8 A;  2WQ8 A;  3SEP A;  1JU4 A;  1JZ3 A;  3HPN A;  2J1U A;  3IAQ A;  3T09 A;  2W9X A;  1KEX A;  1K42 A;  2VOT A;  4OMD A;  2VZQ A;  2QQJ A;  3HNM A;  2ORX A;  2YG0 A;  1UXX X;  3HOB A;  1JZ4 A;  2Y6G A;  3SKJ E;  2Y64 A;  5LA1 A;  3BGA A;  5IHR A;  1PX3 A;  1UY3 A;  2W92 A;  3UES A;  1ULP A;  3IAP A;  4M4P A;  1UYX A;  2J1T A;  3I3E A;  2BZD A;  5DQ0 A;  3OG2 A;  1DLC A;  3OEB A;  1GQP A;  3NRU A;  5F7U A;  2LW8 A;  5HXM A;  1O59 A;  1BHG A;  4XUN A;  1T2X A;  1CX1 A;  3OEA A;  4GWI A;  4JKK A;  3CIH A;  1L7Q A;  3LEI A;  2WZE A;  3I2J A;  3NQH A;  4E8C A;  2W1W A;  3P6B A;  2QQK A;  5IFT A;  2BER A;  3WF2 A;  1H6Y A;  4RYD A;  5FUI A;  2ZEX A;  1UXZ A;  3CZU A;  4MGQ A;  4CUB A;  2VCC A;  3T2P A;  5DPN A;  4UI9 L;  2HLE A;  3K75 B;  3A23 A;  4ARY A;  2CDP A;  2WAA A;  2WO3 A;  4QPW A;  3WF0 A;  4OMC A;  2WDB A;  4DXT A;  1NX9 A;  1NAE A;  2WBK A;  4A44 A;  4JX0 A;  5B4N A;  2EID A;  1UY2 A;  4BK4 A;  2J1R A;  3VD7 A;  1OH4 A;  3HNB M;  5EIY B;  3THD A;  2WUH A;  3U37 A;  5JXI A;  3JXS A;  2RJ2 A;  2JKX A;  2RV9 A;  3LPF A;  2XQX A;  2E32 A;  2QQI A;  4A41 A;  3D3A A; 
#chains in the Genus database with same CATH topology
 3BB6 A;  2E9Q A;  2Y6L A;  3B3Q E;  4DXS A;  2HWF 3;  1QWR A;  4DPN A;  4GB3 3;  3VD5 A;  1ZM1 A;  5GLZ A;  1UYY A;  2A6V A;  2XJP A;  1NLQ A;  3SLI A;  1JW6 A;  2CDO A;  1RVF 1;  1AR6 2;  1I1E A;  4JAA A;  3AYA A;  2VOW A;  4XJW A;  1JYX A;  2VY0 A;  1A3K A;  1TME 1;  1YFU A;  4D94 A;  2LAL A;  3UGG A;  2PHW A;  4KG0 A;  3UKT A;  2QKD A;  3ABZ A;  2E63 A;  4LXL A;  1LR5 A;  2VXR A;  1D4M 2;  1OLR A;  3IB3 A;  4HL0 A;  4XF9 A;  4UBG A;  2BNM A;  5BY5 A;  5ACA 3;  2HWB 2;  4LO4 B;  5GZG A;  3VDB A;  3HJR A;  3OD0 A;  3PMS A;  1BYH A;  2NQY A;  3LFI A;  2PFW A;  4MGY E;  5A3W A;  5C8W A;  1GNZ A;  3TN9 2;  5JIU A;  4XCB A;  3P3P A;  4WVM B;  1TME 2;  4CDW B;  2D3P A;  1NQJ A;  4NO4 A;  3VBU C;  3CHX A;  4KWU A;  2BWC A;  3PU3 A;  3VDD B;  4COU A;  1XND A;  2A6Z A;  3AMN A;  3WQB A;  3I2O A;  4LLO A;  1O5L A;  1F31 A;  2G9G A;  3TRS B;  1W39 A;  3GZT B;  3JBG 1;  4L0P A;  1VAV A;  2JEC A;  1A8M A;  2QDR A;  3NJZ A;  4I0B A;  4JKM A;  1K5M C;  4UYB A;  1XNT A;  2WNV C;  2IUW A;  2WQ4 A;  1E5I A;  2HYX A;  4ZPI A;  3V56 A;  2D5H A;  1VBC 1;  2DTY A;  2QUO A;  3ACL A;  3GDB A;  4NAO A;  5DDJ 3;  2ATF A;  1H4G A;  5FFO C;  2XUM A;  1UQX A;  3THT A;  1EV1 3;  4C1W A;  3JBG 3;  4OUS A;  2B7Y A;  1BBT 3;  3MUZ 1;  3TEZ A;  2G4I A;  1SDD B;  4XFA A;  1ULF A;  3T4H B;  1XYP A;  5FMD A;  1RUD 2;  1QOO A;  2BUK A;  2HEW F;  3RQ0 A;  1D2S A;  2BOJ A;  2D6P A;  5FK8 A;  4IEQ A;  5BNN C;  3MUY 1;  2FD8 A;  1LOB A;  1MS8 A;  2XON A;  2QNK A;  2XKP A;  3D5O A;  5K4L A;  3OBZ A;  1FPN 2;  1J83 A;  3HR9 A;  4J6G A;  3UGH A;  1UOJ A;  1BK1 A;  1C5H A;  3I7D A;  5ANQ A;  4A7K A;  2RS1 1;  2YFZ A;  3B69 A;  3O1P A;  2Y38 A;  2TUN A;  1ULE A;  4TTG A;  4Z8B A;  3NNM A;  4MSV A;  3K2O A;  1OKO A;  5C6C A;  3B00 A;  2W94 A;  4QU1 A;  1JUI A;  1YQ2 A;  2ZAC A;  3A22 A;  4XJ8 A;  4KWJ A;  2Z2S B;  4MVT A;  4XBQ A;  5DAQ A;  5FY9 A;  1U5Y A;  2VMC A;  1XC6 A;  2OA2 A;  4BMB A;  1NG0 A;  4ET7 A;  4YVW C;  2ZHL A;  3Q8C A;  2JIG A;  3HBK A;  1JOJ A;  1RL3 A;  4OHX A;  1SLB A;  1LUL A;  2ZZQ A;  4XF3 A;  1DGW X;  1CJP A;  5FXV A;  1X50 A;  2IXC A;  3WNL A;  2DCZ A;  1PO2 1;  2PAE A;  3RRD A;  3W20 A;  4ISQ A;  4C8D A;  4KU8 A;  4PCR A;  2CTV A;  2LUW A;  4YG0 A;  3WUC A;  1C4R A;  1N1Y A;  1UNB A;  5F9T A;  4E4Z A;  3J9S A;  2OQ6 A;  4GJY A;  1OD3 A;  2DUP A;  1PIV 3;  1DQ0 A;  3LKJ A;  4PBO A;  4A7Y A;  1K5M B;  1J3Q A;  1WGP A;  5FJH A;  3R6S A;  3WHU A;  5IVJ A;  4CCO A;  5LA0 A;  3DYP A;  2E51 A;  4V2V A;  3SXW A;  1JYT A;  3OGV A;  1W6O B;  3AZX A;  4XHX A;  4Z07 A;  2DWR A;  2WNU A;  2VCM A;  1JU3 A;  4XZP A;  5EZW A;  4A7Z A;  5FZE A;  5I91 A;  2A6W A;  1DYO A;  2PLV 1;  4JKL A;  2JB8 A;  2R06 1;  1RUC 3;  5A80 A;  5F37 A;  1OFS A;  4Q0P A;  5FQ0 B;  5J36 A;  5KBF A;  2JG8 A;  1C5I A;  2QQN A;  3MV1 1;  2G1M A;  3ZSK A;  5JOW A;  2JIC A;  5IVF A;  3GZU C;  1OKQ A;  4I09 A;  3VD3 A;  4FVV A;  4ZS3 A;  2DV9 A;  3FFZ A;  1PVX A;  5G04 L;  2Q30 A;  2K46 A;  2I74 A;  4XIK A;  3WQ1 A;  5F2S A;  4Q4X 1;  5J1X A;  1KFX L;  5KHJ A;  1VJ2 A;  2GH2 A;  3WNO A;  2C5D A;  3TNP B;  3VBF B;  3VV1 A;  1GR3 A;  3VBS C;  3ZDV A;  4NN0 A;  4QPG A;  2YDE A;  2GAL A;  2K2S A;  3I97 A;  2ZEW A;  1UU5 A;  4CDU C;  5JVV A;  2W47 A;  2ADE A;  1MR5 A;  3VBO C;  5BYN A;  1NCQ A;  3PTY A;  2XVG A;  4LBM A;  3F95 A;  4AXO A;  2B9V A;  3CNA A;  1OLM A;  3WDT A;  5FZH A;  4HXC A;  4LKD A;  5CBL A;  4XQW A;  1DGR A;  4P9J A;  1DU3 D;  5BNQ A;  3NWK A;  1CAV B;  1B09 A;  5LCW L;  4U2A A;  2VNO A;  2ZJC A;  4DNY A;  5JXH A;  4QHB A;  4HON A;  2WRA A;  4Q5O A;  1XRU A;  2C0Z A;  1GLH A;  3MIE A;  3ZSL A;  4OHV A;  1RC6 A;  5HBA A;  2YRO A;  1JXN A;  3WDU A;  3R05 A;  3I54 A;  4AW7 A;  3I2I A;  1W9W A;  4NWV A;  2YBS A;  1RGS A;  1EYB A;  2KD7 A;  2HBT A;  4JDM A;  4SLI A;  4GMP 0;  5KHK A;  1RUF 1;  4QT6 A;  3PVO A;  5FRA A;  5C4W A;  2W46 A;  1AXY A;  2VCB A;  3FWE A;  3KZ4 C;  2BV4 A;  2CNA A;  3IDA A;  3LDK A;  4QKB A;  4YW1 A;  3AFG A;  1N3P A;  3RZK A;  2WO7 A;  1AR9 2;  4YZ1 A;  4BIO A;  4QX0 A;  3IT8 A;  2RS5 1;  5LZ6 A;  5A3U A;  5FY4 A;  4EZH A;  1PHM A;  1JZ6 A;  5FBJ A;  1MS4 A;  1AR6 3;  1AYM 1;  3LDB A;  4LUK A;  4YW4 A;  4RQP C;  3IDE A;  4QPY A;  2UUR A;  4Y22 B;  2GC3 A;  1VE0 A;  5G05 L;  1UZV A;  2IXI A;  4UOJ A;  2DDU A;  5I8Y A;  4Q1R A;  1ZBE 2;  2EXK A;  2VUL A;  3U10 A;  1H2K A;  3HN3 A;  3WP5 A;  1PO1 1;  3ZPY A;  1W0P A;  2RS3 1;  1MS5 A;  1QJU 1;  3KV5 A;  5FP7 A;  4BME A;  2EIE A;  5C5U A;  4F3J A;  5M0T A;  2XBO 1;  2VL4 A;  5FMC A;  1CAX A;  1OH3 A;  1OUX A;  4P00 B;  4TLG A;  4QM9 A;  3DKQ A;  1NA1 B;  1VB4 A;  1BMV 1;  1PMJ X;  3BOD A;  4K8R B;  2Q8E A;  4LBQ D;  1JYI A;  1JH5 A;  3M3I A;  4DFS A;  1D4M 1;  3C8X A;  5DDJ 1;  3AK0 A;  3MLK A;  3KCC A;  4LBQ B;  5HCA A;  1RHI 3;  1W8H A;  2PHL A;  2RM2 3;  4TSV A;  2NM1 A;  3MID A;  4Q8L A;  4CVU A;  3ELN A;  1CZS A;  2X5I B;  4YFW A;  3TAY A;  3D8C A;  2QQU A;  2XGX A;  3M1H A;  1YC6 1;  3T2T A;  3X29 B;  3RPQ A;  2Q1F A;  3ZXA C;  1KJR A;  1LOG A;  4CEW C;  4FOW A;  4MYE A;  3LEM A;  1DGR N;  3OF1 A;  2X53 S;  5CAZ A;  3V64 A;  3GGL A;  2VUJ A;  3BCW A;  4R9D A;  1S2K A;  4M0N A;  1RUG 1;  3N9N A;  4FBF A;  4QU2 A;  1LHO A;  3POS A;  1G9B A;  5A32 A;  1EP0 A;  1WZX A;  1GU3 A;  4Z1V A;  2Z5W A;  3FN9 A;  4QKF A;  1NUK A;  3P1I A;  3UKN A;  4K21 A;  5C8C A;  2DTW A;  4MH0 E;  2A6X A;  4B7E A;  1QJE A;  1QJX 1;  5JUV A;  2X10 A;  4N9I A;  4HSJ A;  1Y9M A;  2E53 A;  4U36 A;  5H9S A;  4LIT A;  2HWE 1;  1UYP A;  4XTM A;  4XAA A;  1QQP 3;  4BDV B;  4F83 A;  3ZYP A;  5ACA 1;  4LNV A;  4H14 A;  2QDN A;  4KWL A;  4RR3 C;  4WM7 A;  1C3H A;  2QQO A;  2VZP A;  5A1A A;  3O1O A;  3HWJ A;  5JLV A;  1CZT A;  1SAC A;  2WYF A;  5JXG A;  1V6N A;  4FFI A;  4NPL A;  1COV 3;  4HN1 A;  2ZGU A;  1Y9Q A;  4BWO A;  5JI9 A;  3RZZ A;  4LA3 A;  5K0U B;  1LOE A;  4XBN A;  3ORJ A;  1Y9G A;  1RUO A;  1W2A X;  3ENR A;  3Q8E A;  3PL0 A;  2BP6 A;  3D4K A;  3R4U A;  4XF4 A;  4AHZ A;  3VD4 A;  2WZR 2;  2BGC A;  2YC4 A;  4EE2 A;  3WQ7 A;  2X5I C;  3KM5 A;  3J7N A;  4PLO A;  4YG6 A;  5H9P A;  3BKZ A;  1GUI A;  2RJK A;  3C7G A;  3FZ3 A;  4GKY A;  1O6U A;  4N43 B;  5F3E A;  1QJU 2;  4QXC A;  3T0A A;  4Y4R A;  3NV2 A;  3WW1 A;  1ZZC A;  4D7Y A;  4CP9 B;  4KBZ A;  4GXL A;  4HK9 A;  2D3S A;  1R08 2;  3VGI A;  3I3M A;  4XZU G;  3LEK A;  2Y0I A;  3BOW A;  4NII A;  4WBB A;  4P9Y A;  4IV3 B;  1D0H A;  1FOD 2;  1QF3 A;  4NRO A;  5DUX A;  4JHZ A;  3VBF C;  5D8A C;  5FY8 A;  1IOA A;  4ATE A;  1JI6 A;  3FHQ A;  3VKO A;  2RMU 3;  2R0F A;  1ASJ 1;  4IEV A;  1CX4 A;  2A73 B;  1V6L A;  1AXZ A;  3GJB A;  2DYC A;  4XVH A;  3T2O A;  1EUU A;  3DEM A;  1OUS A;  1LEC A;  4K1Z A;  4ZS2 A;  1I3H A;  1WW6 A;  4IE4 A;  2HWC 1;  1QDC A;  4HN0 A;  5J3U A;  3AM2 A;  5LA2 A;  2D5F A;  4AGR A;  3EB7 A;  1UY4 A;  3TB0 A;  3ZYF A;  1O3Q A;  4RHV 1;  1BLZ A;  4AG4 A;  4DOU A;  2EA7 A;  1RUI 3;  1REE A;  3SKV A;  1ENX A;  4D7T A;  2R1B A;  2EXH A;  1LRH A;  2PQQ A;  2XHN A;  5EYX A;  3ZO0 B;  3U4X A;  1VRH 3;  3FHA A;  3OJB A;  2ZGO A;  3VBR B;  2SLI A;  5A6Q A;  4RS5 A;  1ONA A;  4FTE A;  1VBA 2;  5F5I A;  5FUN A;  4Y1Y A;  2E7A A;  2GMP A;  5FZ9 A;  1LHU A;  1ZBA 3;  5JR2 A;  4Z2A A;  3BN6 A;  3R4S A;  3HBZ A;  2VZV A;  2MEV 3;  1W6N B;  2PA7 A;  1QJY 1;  4F7Z A;  5CEH A;  4KWK A;  2ARC A;  3H3U A;  1VAL A;  2WA4 A;  3JUU A;  1LHN A;  4DXZ A;  4GWJ A;  5EJ1 B;  4OI4 A;  1TEI A;  4XYX A;  1JZ3 A;  4CEY A;  3AKT A;  4S2F A;  1KEX A;  3K51 A;  4JGZ B;  1YO8 A;  3ZFE B;  2VTX J;  2HWC 3;  1Z7S 3;  3BIE A;  1IG3 A;  1LOC A;  3HNM A;  4EN9 B;  5HCH A;  1FOD 3;  5D8A B;  3M3O A;  3Q8A A;  5FYS A;  4W65 A;  4CUG A;  4OHZ A;  1FMD 2;  1HB3 A;  1QQP 1;  1XBF A;  1H9W A;  1S0C A;  4L2N A;  5T5J A;  3AL5 A;  2H6B A;  4NE9 A;  4BXF A;  3H9A A;  4PLM A;  5IHR A;  3WW2 A;  1IPS A;  5FY1 A;  1PX3 A;  5GAL A;  1AX2 A;  5L73 A;  3JD7 3;  4MGI E;  1UYX A;  4PHZ A;  3RVH A;  3NVC A;  3RJ2 X;  2RS1 2;  1BVV A;  3KT4 A;  4YW2 A;  2OII A;  5F7U A;  2UYA A;  2AGS A;  1W03 A;  1H4H A;  4XJ9 A;  1YXW A;  2JDZ A;  3RZJ A;  3AYE A;  4MUV A;  3ZSM A;  4AFA A;  3SCF A;  3M2M A;  1IS5 A;  1QQP 2;  1K5M A;  1N1S A;  1NLR A;  2ZBJ A;  5FQ0 A;  1CR7 A;  3HQR A;  4NOT A;  2VPV A;  5JZG C;  4ZON A;  3O0V A;  4CCL A;  5A3P A;  1CX1 A;  4I3G A;  5FMB A;  3BTX A;  4FCA A;  1MS1 A;  4BIS A;  1PM7 A;  2MPF A;  3FJS A;  1FXZ A;  2AH2 A;  3I8T A;  4FP2 A;  2O14 A;  1ND2 B;  1HRI 3;  3CIH A;  3MW4 A;  4Y1V A;  5AC9 2;  3LEI A;  3TYJ A;  2QQW A;  4E8C A;  1HJF A;  4CDX B;  3B9C A;  1UIJ A;  1FI2 A;  3P6B A;  1ZZ8 A;  1ZRF A;  1ZVF A;  1N1T A;  2RHP A;  1LGC A;  1OA2 A;  4XDQ A;  1KQR A;  4XDP A;  4Q8K A;  3NAP C;  2QZ2 A;  1XNC A;  1VAK A;  1WW7 A;  2CY6 A;  4MGQ A;  4COY A;  1E57 A;  4CUB A;  3T2P A;  2BQP A;  2ZOE B;  5DPN A;  2VQA A;  4RFT 0;  3SNM A;  5SV8 A;  1DGW A;  2QTW B;  2FZ2 A;  2FBE A;  1STM A;  1VBA 1;  1CAU A;  1G8W A;  3A23 A;  4AYU A;  4ARY A;  2CDP A;  2WO3 A;  2ZAH A;  3POJ A;  3KD4 A;  3JQX A;  5FP3 A;  5FZ7 A;  4DXT A;  5KXD A;  5CG9 A;  1HB1 A;  2D6K A;  4QMA A;  4AQT A;  1L3J A;  3GZA A;  5BXX A;  5J98 B;  1V9U 2;  1CAV A;  1D4V B;  2WBK A;  3ON7 A;  4A44 A;  2UY9 A;  4BQW A;  1VBE 2;  1CPM A;  4LKE A;  4RFR B;  2ET7 A;  2J1R A;  4I2O A;  3WDW A;  1U5I A;  2JDM A;  2ENR A;  4AHY A;  5A3L A;  1IPK A;  4P9G A;  3WG1 A;  3OTF A;  3THC A;  4Q4W 1;  1UZW A;  4RHV 3;  3L2Y A;  1JN2 P;  3FUO A;  5FDB A;  3WV6 A;  5EIY B;  1HXS 2;  1UX6 A;  3AKR A;  5CFD C;  1LED A;  1RMU 3;  2RJ2 A;  4LK6 A;  2HWD 3;  4Y5Z 0;  3AL6 A;  2GME A;  4CXX A;  4RL7 A;  2VVD A;  1HX6 A;  4LUM A;  1RXG A;  2IVI B;  3P5B A;  5BUV A;  1JHJ A;  4D0Q A;  2GU9 A;  3H50 A;  5GM0 A;  5JR7 B;  4AVA A;  1SQ4 A;  4P9I A;  3C2U A;  3GCX A;  4UFI A;  4AQS A;  4TN7 A;  2HYK A;  3S30 A;  1K3I A;  3U1X A;  2PTM A;  1RUF 3;  3T0D A;  4HVQ A;  1H30 A;  1SPP B;  2B8M A;  1VBB 2;  3S7I A;  4PI2 A;  3HIF A;  4KBB A;  3W5N A;  1AYN 3;  2J7M A;  2CAV A;  4JGZ C;  1I6X A;  3ZFE C;  5BNP B;  3VHR A;  3MIC A;  3O5S A;  4NHY A;  4LKF A;  4K8F A;  3BTY A;  2GNM A;  1NXM A;  2KR2 A;  2A75 A;  2VMG A;  5FRE A;  4BLI A;  1YFW A;  3WSO A;  2WZ8 A;  5A70 A;  4O9G A;  5FO9 B;  1HKD A;  4CDU A;  5HV4 A;  1AR6 1;  1AYM 3;  1RVF 2;  4IUG A;  2L9L A;  3EXU A;  4KMQ A;  3VBO A;  3LOB A;  3MBW A;  4ZY9 A;  1MQT C;  1X9P A;  2CV6 A;  2CGN A;  1RUE 1;  2OW4 A;  3AC0 A;  4PQ9 A;  1QHD A;  4CZS A;  1NY7 2;  4LHN A;  3CMG A;  3FLT A;  2VZS A;  4QX2 A;  5FPA A;  4YPJ A;  1HQL A;  5C5T A;  5A33 B;  4E4D X;  2DCY A;  3TN9 3;  4AI2 A;  1JUH A;  3CJI B;  2WQZ C;  3ZYB A;  1RUJ 2;  3AB0 A;  3ZFG B;  1ZA7 A;  3IKW A;  4TYS A;  1LKN A;  5C3P A;  2RDQ A;  4XET A;  5FYH A;  5IAV A;  3FMG A;  3MIH A;  3JD7 1;  1MS0 A;  5DAB A;  1MEC 3;  1U5Z A;  4BQ5 A;  3J4U H;  5CFD B;  4AF9 A;  2OUJ A;  2XVK A;  2ZX0 A;  3ROU A;  1LOF C;  3AKS A;  3WIN E;  3MLL A;  4G4F A;  3LPG A;  2RJL A;  2W0X A;  1CAW B;  3MYX A;  1FNY A;  4KH9 A;  4A6O A;  2Y6H A;  4FFG A;  1CJD A;  3KV6 A;  2OKX A;  5L9V A;  4MGK E;  4UFM A;  1GZT A;  4FP3 A;  2JDA A;  4PDW A;  4QXH A;  1CD3 G;  1BK0 A;  3UET A;  5J48 A;  1ENQ A;  2PHU A;  4CCC A;  4FTS A;  3OUI A;  4E4H A;  3SIS A;  1PK6 A;  3AX4 A;  1XNK A;  2XLG A;  1WA4 A;  3USS A;  1LU1 A;  2GC2 A;  2VBP A;  5LK7 B;  1W6M A;  1VBE 1;  4O9E A;  3GF6 A;  1UOF A;  3SC7 X;  2C9A A;  4GMP 1;  5TSW A;  1F5F A;  1WA6 X;  3U0Z A;  4W6X A;  5IK5 A;  1CES A;  3I2F A;  4B1L A;  2NP0 A;  3VD9 A;  1ST8 A;  4IW3 A;  4DRR A;  5BNO A;  3URF A;  1Q8V A;  4XFF A;  1XSR A;  1TMF 1;  1VB2 A;  4XDO A;  2R49 A;  4CCD A;  2D6O X;  4OYU A;  2OUH A;  2VVE A;  1C1L A;  1FAT A;  1F4A A;  3DCQ A;  1W6P B;  4WM7 B;  3J7L A;  2BDR A;  4OZX A;  5DAW A;  4V1P A;  5E1R A;  1YQ5 A;  2H0B A;  5ERL A;  4FI9 A;  2A71 A;  5H9R A;  1WLD A;  2FMY A;  1W06 A;  4NPR A;  1AX1 A;  1O7F A;  4RN5 A;  4YM0 A;  5FZB A;  3VKF C;  4DY5 A;  2W87 A;  1W8N A;  4CP9 A;  3O1U A;  4L9B A;  4PT6 A;  1H2M A;  1O8S A;  3N7J A;  4IEX A;  3LA7 A;  2WII B;  3M3Q A;  4BM8 A;  4QPI A;  3KT7 A;  3OPT A;  4YWA A;  4BJ0 A;  1W8F A;  4X6R B;  4A45 A;  1FPN 3;  1MZF A;  3ZR5 A;  1PO2 3;  4N53 B;  4EYU A;  2XG3 A;  3OY8 B;  4L99 A;  5F8P A;  2C24 A;  1AL0 G;  3VZO A;  1GWL A;  1W6Q B;  4UW6 A;  3GNE A;  1RUD 1;  3OGR A;  2DU0 A;  4QX3 A;  2VW0 A;  4AEM A;  2DVB A;  1N3Q A;  2RS5 3;  4JHT A;  2ZX4 A;  3H3Z A;  3ETP A;  5B4X A;  2BGP A;  2W1U A;  4IEY A;  1GWK A;  4LE3 A;  3VBU A;  1AJO A;  4QPG B;  1RJ7 A;  4Q0S A;  2NPI A;  4IE7 A;  4JC1 A;  4AL9 A;  1OSG A;  3KHC A;  4YVW B;  1Q5O A;  1NCR C;  4R9A A;  2ET1 A;  3VBR A;  4BQ2 A;  3AP6 A;  3V0B B;  4YW7 A;  3B94 A;  2WL1 A;  4XPV A;  1IQD C;  2VMH A;  1AHS A;  4A3Z A;  2F6B A;  3ZSE A;  4RR3 A;  4QQO A;  1E5H A;  2BJS A;  1OVS A;  4LBO A;  3HVD A;  4HSL A;  4LHS A;  4QB1 A;  1RUG 3;  3GJA A;  1F35 A;  1LEN A;  1KD7 A;  3TEY A;  5C3O A;  4BQ3 A;  1PMI A;  2TEP A;  3MIG A;  1V9U 3;  4YVS B;  3TN9 1;  2XJR A;  5LW9 A;  2Y26 A;  1ZRC A;  2CAU A;  4OUE A;  3C7E A;  2CL2 A;  2EVX A;  1SCS A;  4LK7 A;  3K46 A;  4PI0 A;  2RVA A;  1ZZB A;  5FUP A;  3NNG A;  4NRQ A;  4W4Z A;  5BNO B;  3NKG A;  1V9U 1;  2Y6J A;  4WM8 C;  2WLP A;  1XE8 A;  3H1Y A;  4JZR A;  4E4S A;  2HWD 2;  1YRZ A;  3VUO A;  1AL2 1;  1OOP B;  4E27 A;  5A7N A;  1YHF A;  1A34 A;  1RYY A;  4QX1 A;  3WLU A;  5AFE A;  1AR8 3;  4JCK A;  4YRD A;  1UYZ A;  4Z82 A;  1WD4 A;  2VGD A;  1AUY A;  1KS5 A;  1O91 A;  4IGP A;  5C9A B;  5IAT A;  1C1F A;  3ETQ A;  4UW5 A;  3SEE A;  2GDF A;  5D8A A;  2PAM A;  5L36 A;  5LBF A;  2ZKL A;  2JDH A;  5FXX A;  3FL7 A;  1O4Z A;  2V4V A;  4FPE A;  1GIC A;  2X8K A;  4EN0 A;  2V5Y A;  4Q4V 2;  4Q27 A;  3LCP A;  2NN8 A;  5LAT A;  1XYO A;  2SBA A;  5DUW A;  3KVB A;  1H6X A;  1NA1 A;  3BPZ A;  3MGU A;  4QPI B;  5A3T A;  1QJX 3;  2HH9 A;  1BJQ A;  2A7A A;  4Z2W A;  1GOG A;  1XU2 A;  2GH8 A;  4I30 A;  4DS0 A;  5AC9 1;  3MLJ A;  1K45 A;  1NOV A;  1RUH 2;  1TMF 3;  2YBK A;  3PUH A;  1SLT A;  2H0V A;  4OQ9 A;  2R6Q A;  2WN3 A;  2Y0O A;  4FPO B;  4I0A A;  2PLV 2;  1ND2 A;  2LTN A;  4YZ4 A;  3WNK A;  2R07 2;  5JSO A;  5CFC B;  3ZLI A;  1XQN A;  4TZD A;  1UX7 A;  3OYW B;  1S4C A;  1GSL A;  3AMP A;  1OLM E;  3ZXJ A;  1XSQ A;  2FDF A;  5I8T A;  2XXZ A;  4RGK A;  4YW5 A;  1RB8 G;  3T1L A;  1QJZ A;  5JXJ A;  1GBG A;  1OXC A;  2VXJ A;  1EPZ A;  4DZG A;  4Q29 A;  5I93 A;  5JDB A;  2OZ6 A;  3CJI C;  3SQO A;  2CWS A;  4ZKT B;  1DQ2 A;  4GAZ A;  2RG4 A;  3USU A;  3JB8 A;  1OUR A;  3ZXF A;  3OB8 A;  3E6D A;  4HVO A;  1ENR A;  2VNR A;  2WT1 A;  5DUV A;  1Q8Q A;  2RM2 1;  4FPL A;  3UGF A;  4CDQ A;  2VVF A;  4Q2F A;  5F5Q A;  4GH4 C;  3UV9 A;  2ARB A;  1XPW A;  2GC1 A;  2WAB A;  1RUH 3;  3OD4 A;  4K40 A;  2VM9 A;  4NRP A;  2DCT A;  1AR9 1;  3ATG A;  4QKD A;  2P2K A;  4YNI A;  3WF4 A;  3O12 A;  4FXK B;  2QQV A;  1DP0 A;  3VBH A;  2VBB A;  1YIF A;  3N3H A;  2FHR A;  4Q4W 2;  1BVP 1;  3MV0 1;  3J26 N;  3MPP G;  3H7Y A;  2A1X A;  3ZFG A;  3NV3 A;  4LJH A;  4YYO A;  3AMH A;  5FZI A;  1J3R A;  4XUQ A;  1QDO A;  1OOP A;  2Z42 A;  5IVV A;  1POV 3;  2VTF A;  1QOT A;  4Y3O A;  2XKO A;  5CYY A;  3WW4 A;  1UPI A;  4WZF A;  2E6V A;  4EZ4 A;  4X8N A;  1AR7 2;  1H9P A;  1RIR A;  4CTE A;  1QY4 A;  4AWD A;  4AAP A;  1CQ9 A;  5FOB B;  5IYY A;  3RZM A;  2NLR A;  1URX A;  1O4T A;  1S2B A;  1GFF 2;  2JE9 A;  1C57 A;  5LY1 A;  3HAG A;  1TMF 2;  5KR7 A;  1BQP A;  4UT5 A;  2MEV 2;  4CEY C;  1SCR A;  3INA A;  4H3W A;  4BA6 A;  5AFB A;  4KL1 A;  4P08 A;  3ZXG A;  2RDS A;  3DYO A;  2XL9 A;  4CEY B;  1AJK A;  3QLQ A;  1KRI A;  4UFK A;  2Y6K A;  5GJ6 A;  5JCT A;  3S6P A;  1Q8P A;  3VKN A;  1VMJ A;  2XDV A;  2ARA A;  3ZOI A;  4H7L A;  1GWM A;  4YAR A;  2YYO A;  5FPZ A;  5F5A A;  4HPK B;  3MI8 A;  3VBO B;  1AYN 2;  1NE4 A;  2NMN A;  1SBD A;  3OPW A;  2WN2 A;  2R07 1;  1X9T A;  3JB4 C;  5K9Y A;  1N3O A;  2IWG B;  2XJS A;  3LE0 A;  1POV 1;  2GN3 A;  3TWI A;  4D6S A;  2IC1 A;  5T5O A;  2ARX A;  1QJY 3;  4LOS A;  2Y34 A;  1VBA 3;  1NCR B;  4AI8 A;  2W5F A;  4NHL A;  4LIV A;  1B35 C;  3CJX A;  3O1T A;  2XLA A;  3K77 A;  1AYN 1;  4CDW A;  2VUA A;  3IPV A;  5ABJ A;  2LS6 A;  2RS1 3;  1SHW B;  1ULC A;  3LWC A;  3WHT A;  4DB5 A;  3NO8 A;  2C9K A;  1OQE A;  2A3W A;  5CNA A;  4FFF A;  4OI1 A;  3AJY A;  5CIR A;  3ILR A;  5FZC A;  4AVS A;  2OPW A;  5EV7 A;  1XJA A;  4N53 C;  3O1S A;  3VZK A;  2P6H A;  2W95 A;  4CP0 A;  4ISR A;  4MG2 A;  3WNN A;  4LBL A;  4LBJ A;  3POB A;  3OBA A;  2JDP A;  1FYU A;  4ORF A;  3HNY M;  4R52 A;  3ZDS A;  1DFQ A;  4WM8 B;  2XJT A;  1V6J A;  1PMH X;  4GIQ A;  1ACC A;  4NPM A;  2WFP A;  1F8V A;  1H0B A;  3T0B A;  3W5M A;  2PQS A;  2UWB A;  5JMO A;  5IK7 A;  3B7M A;  4N7I A;  4BH9 A;  3NW4 A;  3VBS B;  3WEZ A;  4AED B;  5LWB A;  4XFH A;  1WLW A;  2EAA A;  4URT A;  5FV3 A;  4JQT A;  4D69 A;  1W28 A;  1QXR A;  1FV2 A;  3GM8 A;  2GSY A;  4NIA A;  5KXE A;  3BU0 A;  5K7P A;  3HPN A;  1REF A;  2J1U A;  5JPM B;  2RDR A;  5KHG A;  4WM7 C;  2Q8O A;  2UY8 A;  1K42 A;  1UW8 A;  3H42 B;  1MVQ A;  4LO5 B;  4R8H A;  4UF0 B;  1WW5 A;  2IZW A;  4YVS A;  1VLN A;  3MF6 A;  2QQJ A;  4CCJ A;  3NMB A;  3MPB A;  2CU5 A;  4C0H A;  4O65 A;  5LK5 A;  4Q0Q A;  2ZS6 B;  1PZ8 A;  3HOB A;  1JZ4 A;  3H8R A;  1H2N A;  1S55 A;  4X6Q B;  2PMW B;  3LDR A;  4AI0 A;  3WY6 A;  1HXS 3;  3PME A;  3SKJ E;  2FDG A;  2Y64 A;  3BGA A;  1EY2 A;  1F9K A;  3MF9 A;  3RWK X;  4AI3 A;  1L7L A;  1APN A;  2DVF A;  3UES A;  4V2W A;  2W68 A;  3M70 A;  1ULP A;  4M4P A;  1UL9 A;  3GHM A;  1HJG A;  5C3R A;  2J1T A;  3BYW A;  1WD3 A;  3RMX A;  2BZD A;  2JJ6 A;  1TME 3;  3OG2 A;  3A0N A;  3OEB A;  3KLS A;  1GQP A;  3KV4 A;  1CVN A;  1LB2 A;  4P5H A;  2LW8 A;  2YGL A;  5HXM A;  2BPA 2;  1OMI A;  2BBV A;  2VW1 A;  4CEW B;  2WFF 3;  3SHR A;  3RZL A;  5FYV A;  3VBH C;  3E6C C;  1V6M A;  4XJU A;  5DZF A;  5L7O A;  5FZD A;  3AZZ A;  3VBU B;  1ND3 A;  5IVY A;  4B3N A;  2K0G A;  2HWC 2;  1YJL A;  4AHW A;  4FPJ A;  2WZE A;  2YUE A;  3POI A;  5FPU A;  3BAL A;  5LAS A;  3I2J A;  4HOO A;  1S0D A;  4OHY A;  5IFT A;  1COV 2;  2ADD A;  2BER A;  5KXB A;  1JBC A;  1H6Y A;  3LF7 A;  2Q5T A;  4RYD A;  1G9A A;  3E5U A;  4O61 A;  3VLB B;  3WT3 A;  1NCQ B;  1WUV A;  1UF2 C;  3K3O A;  3NNL A;  2ZEX A;  1Q56 A;  1UXZ A;  3FLP A;  3ZFF C;  2P4E A;  1YEW A;  1FPN 1;  1IKQ A;  1SFP A;  1WW4 A;  1DZR A;  1RUD 3;  4P9X A;  1AYM 2;  1HB4 A;  1RVF 3;  3WXP A;  1S2E A;  1WMF A;  2VCC A;  4GWM A;  5A7W B;  3G7D A;  1IG0 A;  2QJV A;  4MXV A;  4I01 A;  5C3S A;  3LA2 A;  1R08 1;  4COW A;  4B4P A;  1WMD A;  2K9Z A;  2R30 A;  4IEO A;  1VMF A;  2WAA A;  1KS4 A;  3ZN6 A;  2XPJ A;  2O8Q A;  4OUM A;  2WDB A;  4RQP B;  1NX9 A;  4JTN A;  2AUY A;  1PNG A;  2JWP A;  2EID A;  4MZU A;  3PUR A;  3I3Q A;  3ZFF A;  4LOT A;  2XBO 3;  5FPX A;  5EPA A;  2F4P A;  5HCF A;  1PVC 1;  1H8V A;  5DG2 A;  1EV1 2;  4LMF A;  1RTV A;  4Q26 A;  3THD A;  1VBD 2;  3U37 A;  3KWV A;  1GZC A;  3JXS A;  2XB6 C;  3ZKU A;  1JOB A;  1A6C A;  2JKX A;  4FT8 A;  3LPF A;  2XQX A;  3ILF A;  2E32 A;  2QQI A;  1MEC 1;  4XMA A;  2GC0 A;  3D3A A;  5DUU A;  1PVC 3;  3WW3 A;  2WNE A;  1E5S A;  1UU6 A;  4L11 A;  2WFF 2;  3GCW A;  4LBK A;  1NZI A;  1PZ9 A;  2R7E B;  2W2I A;  3OYW A;  4IER A;  4AFM A;  1O3R A;  5T52 A;  5FYT A;  4XUR A;  1CON A;  4CCK A;  2JG9 B;  1I5P A;  3KF5 A;  1DG6 A;  4FTB A;  4NHM A;  5CKM A;  3V0A B;  4A6S A;  3G6J B;  1NQD A;  4BLJ A;  1SBE A;  4ASM B;  2UWC A;  2YHJ A;  4QPI C;  4NIG A;  1NXD 1;  5H9Q A;  3AZW A;  3K4Z A;  3WP3 A;  1HRV 1;  4CCN A;  2V73 A;  3W9A A;  4M01 A;  3LZZ A;  4FO9 A;  2W91 A;  2VZR A;  3KB5 A;  4GMP 3;  4EWE A;  1Z0H A;  3OPZ A;  4UW3 A;  4DEQ A;  5DXD A;  4RGA A;  1AF9 A;  2P3J A;  3ZIX A;  2BW8 A;  1J1T A;  3ZXK A;  1KFU L;  1GOF A;  1HRV 3;  4XFI A;  1MZ5 A;  3HEI A;  2VW2 A;  3LEG A;  4KGG A;  4NVP A;  2ZGM A;  2NZ9 A;  2ZHM A;  4R9B A;  4PIZ A;  3CEW A;  2HJI A;  4QQH A;  4GB3 2;  5HV0 A;  2DU1 A;  4LHL A;  5SV5 A;  3VDA A;  2G9Z A;  2JDU A;  3ZN6 B;  2ILM A;  4A3X A;  2XR4 A;  3U07 A;  3RMY A;  4CPB D;  2WS9 3;  2A70 A;  2HWF 1;  5C4W B;  1RHI 1;  3AXE A;  2VMF A;  2J1S A;  3CO2 A;  3POW A;  3ZM8 A;  4EWA A;  4CXY A;  3PLQ A;  5EWS A;  1IHM A;  2Y60 A;  5FYI A;  2R04 2;  4NWW A;  2D93 A;  3UT0 A;  1JYW A;  1BKZ A;  4TLF A;  3O1M A;  4RA0 A;  2OXB A;  3KT1 A;  1LES A;  2OZJ A;  2YU2 A;  1G9F A;  1Y7B A;  4Q4Y 1;  1JYN A;  4XC9 A;  3DKW A;  5A7S A;  1V6K A;  3WNM A;  1LNS A;  4AEK A;  3J8F 3;  5FAX A;  3IDB B;  2ES3 A;  1UMH A;  1AR9 3;  1PIV 2;  3B02 A;  2XVL A;  4XHB A;  1QU0 A;  1WCU A;  4CUC A;  3AP5 A;  3B5L B;  2JD9 A;  1D7P M;  5APA A;  2ZZJ A;  4A4A A;  3SH3 A;  4G3Y C;  5ISL A;  2IXH A;  5EFU A;  1G9D A;  3ZMN A;  5J7M A;  2VZT A;  4WM8 A;  2EIG A;  1UKG A;  3IDC B;  4E8D A;  3LIG A;  1RUE 2;  1JZ8 A;  4P9L A;  5FO8 B;  1WCQ A;  5FZO B;  1W8W A;  5FPB A;  2HWE 2;  1SLL A;  3A4U A;  5FZ0 A;  4EJR A;  2W1Q A;  4CP2 A;  2ZAA A;  4LUL A;  4IE5 A;  1UAI A;  1WMX A;  1HV1 A;  3W21 A;  2Y6F A;  4FQ4 A;  3JBG 2;  4BIF A;  1IS4 A;  2NYY A;  1YNA A;  3AYD A;  3FBM A;  4Z92 B;  3I2G A;  2VCA A;  3N36 A;  4RS5 C;  2JEM A;  1SPP A;  3K3N A;  2ARE A;  2WO2 A;  4BU2 A;  3I2H A;  1X8M A;  4LHK A;  4CXW A;  4NID A;  3ACI A;  4M4R A;  4PF1 A;  4FPH A;  3CZJ A;  3SCG A;  3HMY A;  1WBL A;  5KC5 A;  3PIJ A;  2FCU A;  2VU9 A;  4QGM A;  1G7Y A;  1W9Y A;  3IMN A;  4HK8 A;  1YQ6 A;  4QHO A;  3UYJ A;  3VZM A;  3RZG A;  1MS3 A;  2WS9 2;  4UAP A;  4CDU B;  1DLL A;  1O5U A;  2ZMK A;  2GP3 A;  2OPK A;  3WVJ A;  1KXG A;  2ZKN A;  1H1A A;  1U5X A;  4AVV A;  1RUJ 1;  5CZK A;  2A6Y A;  1PGW 1;  2YB7 A;  2BGO A;  3KGL A;  3ZYG A;  3AZV A;  3MFA A;  4GUL A;  5F3G A;  2B9U A;  5D21 A;  2BVB A;  3KSC A;  2HWB 3;  1AL2 3;  1VRB A;  3C7H A;  4GKX A;  4JGY C;  5BV6 A;  5J09 A;  2J1V A;  2ZHK A;  5I0S A;  1VBB 1;  3A7Q A;  3T3Y A;  3GXU A;  4LPL A;  1ULO A;  1HQN A;  1QJF A;  3PJY A;  1K12 A;  2ZGT A;  2VO5 A;  3N7M A;  1Q8O A;  2RM2 2;  1X33 A;  2XL7 A;  3OBT A;  1T6B X;  1WKY A;  2W39 A;  1OPM A;  2P34 A;  3LFM A;  4Y1X A;  5L9R A;  5KXC A;  3KVA A;  4L8Q A;  2AEY A;  1ASJ 2;  3V65 A;  4GH4 A;  2W52 A;  1A8D A;  5C71 A;  1RUE 3;  4URA A;  4E9K A;  1UOG A;  4JV4 A;  4AE2 A;  4AK3 A;  1PO2 2;  2YPD A;  4K20 A;  5A3N A;  5GLV A;  1NY7 1;  5A33 A;  4XTP A;  1IS6 A;  3VZN A;  4HFS A;  1PIV 1;  3IZO A;  1I9R A;  3ZPO A;  5E16 A;  3WOG A;  5FIX A;  5C70 A;  1LCL A;  2B46 X;  2PHR A;  5E6H A;  5F3I A;  5T54 A;  2AEN A;  1J84 A;  1VRH 1;  2P3I A;  2Q1M A;  2G9F A;  4QKN A;  2YU1 A;  1XYN A;  4Y20 B;  5JPN B;  1Q3E A;  4MGT A;  1VBC 2;  2ZX3 A;  5DMY A;  5IVE A;  1JZ5 A;  2CYF A;  2BEO A;  3AVR A;  4UBH A;  3ACF A;  5D1I A;  4AVB A;  1EAH 3;  2GN7 A;  5LBE A;  3RJR A;  1AR7 3;  5FYM A;  2FZ1 A;  4Q0V A;  1OC1 A;  1WCK A;  2QQL A;  4NHX A;  5I0D A;  3I2K A;  4Q0U A;  1YI9 A;  5C33 A;  2V09 A;  3DN7 A;  2ID4 A;  1PK6 C;  1WCS A;  2YV8 A;  2ZGQ A;  3GBW A;  2ZTN A;  2FMD A;  3III A;  4LQR A;  5DZE A;  5EXO A;  4IGQ A;  2XWB B;  4AFB A;  3FE5 A;  2XOM A;  4ZHN A;  4Y1Z A;  4MV2 A;  3ZYJ B;  5F5C A;  1XU1 A;  4AHX A;  1JHN A;  1TZO A;  4XJZ A;  2R0H A;  2DVG A;  3H0O A;  2NMO A;  3VDD A;  1J3P A;  1ZX5 A;  2PHT A;  4CSW A;  5FCC A;  4XCA A;  4H55 A;  5FKB A;  3I49 A;  4COV A;  2Z4F A;  1LHV A;  2VG9 A;  3DV8 A;  4RSU A;  1RUC 1;  3LA3 A;  1NYW A;  1XXN A;  2PLV 3;  1HRV 2;  3W58 A;  3TEW A;  3N9Q A;  2WWJ A;  4CEW A;  5KWR A;  2Y33 A;  3A0K A;  3B9I A;  2Q4S A;  2O8O A;  5BNN B;  1CWP A;  1V6I A;  1Q8S A;  4Y26 A;  5FPL A;  4TXW A;  3T30 A;  3QOP A;  1B35 A;  4MHR A;  3ASI A;  5A7O A;  2F17 A;  3ZXL A;  1SLA A;  2JDK A;  4CDW C;  1W6N A;  1L7R A;  1P8J A;  3WP6 A;  3U11 A;  2WNO A;  1QJY 2;  1WLC A;  4GH4 B;  4UWD A;  5IT6 A;  1S0F A;  3H8X A;  5EJZ B;  4AR2 A;  1BZW A;  2YBP A;  4WVZ A;  5A6X A;  2WWS A;  1J58 A;  2QQM A;  3S5A A;  1PGL 1;  1PZ7 A;  2F4L A;  3NV4 A;  1LTE A;  4JGZ A;  3ZFE A;  2VZ3 A;  1H1I A;  4XUO A;  3RYR A;  1C8M 2;  1DQ4 A;  2J1E A;  4N90 A;  4PQQ A;  2CWM A;  4XEZ A;  4KU7 A;  4XMI A;  1BXH A;  2EIB A;  2ZGS A;  4IDZ A;  4LR4 A;  4BK5 A;  2BYV E;  4XIO A;  1X8E A;  2EAL A;  2YMZ A;  3QH7 A;  1POQ A;  2ZGK A;  1FMD 1;  1YJK A;  1UY1 A;  3E1F 1;  4CPB A;  5IAX A;  3AMQ A;  4JGY A;  2C4X A;  3MHZ A;  3VKL A;  1Y3T A;  1FT9 A;  2VNG A;  4EN6 B;  2RR1 1;  2AZ5 A;  3LOI A;  5C8C B;  1IKP A;  2BFU S;  4B4Q A;  4DUV A;  3QD6 A;  2V5D A;  1OF3 A;  4B8E A;  4CDX C;  2VMI A;  2FDI A;  2VQT A;  4MOA A;  4YVW A;  1XB9 A;  2ZXQ A;  4N43 C;  4R9C A;  4XFG A;  2BNN A;  4BZ4 A;  5ABJ C;  1QMJ A;  4H7M A;  4LO6 B;  1KGY A;  2WSV A;  3MEP A;  4HVR A;  4X8P A;  3RZH A;  1XNB A;  2VC9 A;  3UK9 A;  2A5Z A;  1FV3 A;  1H2L A;  1LHW A;  1SFY A;  1G86 A;  3BI3 A;  3OUJ A;  4O7X A;  1HIX A;  5FXZ A;  3KQR A;  5A3M A;  2C26 A;  4FXG B;  3HN1 A;  3TOJ A;  1Z7S 1;  2WYS A;  3RWN A;  3ZYI B;  5I0R A;  5C9A C;  3POF A;  1YUD A;  2Y8K A;  3DYM A;  3I3B A;  4YGE A;  1W99 A;  4NJ4 A;  3A21 A;  1ODM A;  1ZNP A;  3E97 A;  3U75 A;  1ZZ9 A;  3I59 A;  4NAM A;  2JG9 A;  1JZ7 A;  3ZXE A;  1YQC A;  4A42 A;  4IV1 A;  1GOH A;  1W8O A;  1QIQ A;  2ZCW A;  3CL1 A;  3KHB A;  2BBA A;  4NR1 A;  4YM1 A;  2P17 A;  2JKB A;  5IJR A;  2X09 A;  2AC1 A;  3VN4 A;  2VUD A;  1XE7 A;  1SLC A;  3N9O A;  2P6C A;  4QB6 A;  1CIW A;  5F3C A;  1IS3 A;  2ORZ A;  3JCI A;  3T08 A;  1X82 A;  3O1V A;  3O0X A;  3IWZ A;  4QXB A;  3EHK A;  4QQP A;  3EQE A;  5C9A A;  4C90 A;  2VME A;  1TVG A;  3IPV B;  4CUA A;  4MET A;  3PDQ A;  3CDZ B;  1QNW A;  1ND3 C;  4EQV A;  3PUA A;  5IW0 A;  4B7K A;  4OUL A;  2DCK A;  1NKG A;  1G6N A;  2EIC A;  4L97 A;  2WNU B;  5FZA A;  3E5Q A;  3CJI A;  3AZY A;  1LAJ A;  4YM3 A;  1RED A;  2D40 A;  2LRO A;  1IPJ A;  3DXT A;  4PIX A;  3NJV A;  1GMM A;  5FWJ A;  2P37 A;  1SFN A;  4IND A;  1QEX A;  1W2T A;  2DVD A;  1CAX B;  2VQ0 A;  3EYP A;  2VZU A;  1RUH 1;  4N9H A;  3WCR A;  4Y33 A;  1RUN A;  2B42 B;  1RJ8 A;  3T4V A;  1OF4 A;  1SG3 A;  5FZ6 A;  4C0B A;  1AX0 A;  1W6M B;  4YM2 A;  3PJQ A;  2ZGL A;  3GBG A;  3VHN A;  3EMR A;  1KJL A;  2Q8D A;  3D82 A;  5A1L A;  5LRS A;  3ECQ A;  3F2Z A;  1NE6 A;  2PYT A;  1D0G A;  1OFN A;  4ITC A;  4FOY A;  4LOR A;  1R09 2;  4DUX A;  2VNV A;  2W1S A;  1XE0 A;  3VBS A;  2ZX1 A;  5A7W A;  1RMU 2;  3M3E A;  3WF3 A;  4EV0 A;  1W0N A;  1AR7 1;  4KG8 A;  2QE3 A;  3DPR C;  4M0H A;  2XML A;  4QX5 A;  4QXK A;  3B01 A;  1OPO A;  4W50 A;  3S57 A;  1UOB A;  3FX3 A;  4JDN A;  4LKS A;  5EJ3 A;  4OVE A;  4YZ3 A;  3P3N A;  2VH9 A;  4PDW C;  2QZ3 A;  1QOS A;  3K4A A;  2DUR A;  2GZW A;  1COV 1;  2WQ8 A;  1JU4 A;  2JX9 A;  2BOI A;  2E7T A;  1PK6 B;  2DVA A;  3IAQ A;  3T09 A;  1O3S A;  2WLQ A;  2W9X A;  5FMO S;  1PO1 2;  3E5X A;  3KGZ A;  4OCT A;  4P9W A;  3GHN A;  5DAP A;  2ZHN A;  4HET A;  4K3U A;  4OLL A;  1FMD 3;  2EXJ A;  4P14 A;  4E2S A;  5FTT C;  2WT0 A;  4ZXK A;  5FZO A;  1BMV 2;  2DUO A;  2WWU A;  3POE A;  4B1M A;  5IK8 A;  5DAV A;  4NMI A;  1IQA A;  3E6B A;  4ASK A;  1R08 3;  3NAP B;  5KHI A;  1HV0 A;  5LA1 A;  4HZF A;  4UW4 A;  3BOP A;  5A6Y A;  1S0B A;  2WC2 A;  4XAC A;  4ARX A;  1UY3 A;  2W92 A;  4I3P A;  4M3C B;  2WIN B;  5A1F A;  2HBU A;  2TNF A;  2W08 A;  3N35 A;  3Q9O A;  4EWD A;  2WR9 A;  3BIW E;  3I3E A;  4IEW A;  1OOP C;  5GLT A;  2D6M A;  4PBP A;  1DQ6 A;  1W8U A;  1TQ5 A;  1OVP A;  2I45 A;  1RIN A;  1VIW B;  2OS2 A;  1CPN A;  2JEN A;  3M7A A;  1VMH A;  2WZR 3;  4M00 A;  1SEF A;  2AEZ A;  3ALQ A;  4UFJ A;  1YLL A;  1PVC 2;  1O59 A;  1BHG A;  4XUN A;  4CCE A;  1OLQ A;  4JVA A;  1SZB A;  2QCS B;  3PTR B;  3KS7 A;  5FZK A;  1D2Q A;  5CKQ A;  2VOK A;  3WDV A;  1H8T B;  1OD5 A;  5A7Q A;  1GYK A;  1ZA4 A;  4GWI A;  4JKK A;  1V00 A;  2YPJ A;  2HWD 1;  1K5J A;  4Q4X 3;  1CN1 A;  1RIT A;  3WCS A;  4LIU A;  3NQH A;  3FHI B;  5C3Q A;  2VTX A;  2W1W A;  4FSJ A;  2QQK A;  4BHP A;  2Q0A A;  2VBD A;  2WKK A;  3VHP A;  4RR3 B;  5FXW A;  4LA2 A;  1ZRD A;  3O0W A;  4HPK A;  1YYN A;  1W8T A;  2C6S A;  5EHD A;  3IIA A;  5GLW A;  2AR6 A;  2R16 A;  1SMV A;  1YWK A;  3V0B A;  5DAX A;  1S1A A;  3M3C A;  4PIY A;  1OBN A;  2HWB 1;  4Q4V 1;  1ZBA 1;  3KV9 A;  1TE1 B;  3IBM A;  1QGL A;  3PVE A;  5LEJ A;  2JD4 A;  3OUH A;  5LBB A;  2IXK A;  4BE3 A;  3CBN A;  1FNZ A;  5E88 A;  3QBQ A;  4RGG A;  5D2A A;  2DBI A;  5EYY A;  3ZSJ A;  4IQP A;  1CAU B;  4OFG A;  1JMU B;  1V6O A;  4RD7 A;  4ATF A;  4JX0 A;  4BK4 A;  4YW6 A;  5AC9 3;  3HT2 A;  4CE8 A;  2IVJ A;  1TNF A;  1UD1 A;  1VR3 A;  4KQ7 A;  1N1V A;  5JI7 A;  3I2D A;  3N7K A;  5I0T A;  5JSR A;  2VUC A;  2WUH A;  4N8M A;  5JXI A;  2CGP A;  3VKM A;  2DUQ A;  1JOP A;  2D97 A;  2XJQ A;  4N43 A;  1VBD 3;  3WX5 A;  1GP5 A;  3WG3 A;  4A41 A;  5GZC A;  3ILN A;  3POY A;  1AVB A;  2JG8 C;  2DCJ A;  3UKV A;  1NA1 C;  3VHO A;  4DY3 A;  1E5R A;  4AGV A;  3EO6 A;  3HQU A;  3IMM A;  1DGL A;  1LEM A;  3GYD A;  3J8F 2;  4MGS A;  4QHZ A;  1EAH 2;  2CSG A;  2JG8 B;  1UPS A;  2XH6 A;  4WZC A;  3DPR A;  5FZL A;  5K0U A;  1SBF A;  3PHM A;  3NV1 A;  1US3 A;  1W8Z A;  2BWA A;  2TBV A;  2ZGR A;  5I8S A;  1J1L A;  1S0J A;  4DXR A;  5FZ8 A;  4J1W A;  4YW3 A;  3M4F A;  2B5H A;  4M3C A;  2I07 B;  3RDI A;  1VPH A;  3ZFG C;  5EQU A;  1H8T A;  4H2A A;  3MW2 A;  1C8M 1;  1GQG A;  3S7E A;  3MZH A;  3AXD A;  4XBL A;  1UO9 A;  4AVT A;  1R1Z A;  5BNP A;  4QAW A;  4XFB A;  5FY0 A;  2J42 A;  3OGJ A;  4FQZ A;  5CVR A;  3J8F 1;  5GZF A;  1UY0 A;  1EAH 1;  3SH5 A;  4CU6 A;  3H8U A;  1ZRE A;  5CFC A;  2GNT A;  5EP9 A;  5F39 A;  3AVS A;  4LO8 A;  5GZD A;  5L7O B;  4ZZ5 A;  1F2N A;  3PU8 A;  2UYB A;  1O3T A;  1RUJ 3;  2BVV A;  1LGB A;  2BU9 A;  2YZ4 A;  2D6L X;  3CLP A;  1CIY A;  1Q43 A;  1W2O A;  2H6C A;  2P1B A;  2VOX A;  3RI8 A;  3ZYH A;  4XFC A;  4XUT A;  3N9M A;  2N7G A;  1B35 B;  2A3Y A;  4IXL A;  4W8J A;  5FLJ A;  1W90 A;  2R06 3;  1HXS 1;  2V72 A;  4YGD A;  1MQT A;  4XW3 A;  3OCP A;  4OHW A;  5L19 A;  5IVC A;  4QQ2 A;  4IE6 A;  1CAW A;  3HT1 A;  4LT5 A;  1W05 A;  3VBF A;  1JOD A;  5C4W C;  4M3C E;  2DF7 A;  3Q8F A;  3VBH B;  4QDR A;  2IXJ A;  1W2U A;  2WZR 1;  5JIA A;  4MX3 A;  3CKH A;  5T55 A;  4D6R A;  3LSE A;  1JYV A;  3GAL A;  3L2H A;  2BNO A;  4QQL A;  1YCI A;  3AP7 A;  4LLF A;  5FP8 A;  3WZ1 A;  1GNY A;  1OA3 A;  1AL2 2;  1DYK A;  1DQ1 A;  1R1A 1;  1R09 3;  2ETE A;  2X5I A;  3EBR A;  1I5Z A;  3NJY A;  4OZO A;  4AFC A;  4D6Q A;  2DBN A;  4YGB A;  3UNP A;  3H7J A;  5T50 A;  1ZRI A;  5CB7 A;  2R04 3;  3T1M A;  5JWP A;  3PUQ A;  4GD4 A;  5A7P A;  2HWF 2;  1DZT A;  2P5B A;  4EN7 B;  4Y22 A;  4TWT A;  4CDQ B;  5IFP A;  4FPC A;  1UWW A;  1R64 A;  3OOX A;  2BFU L;  1AR8 2;  1FOD 1;  1ASJ 3;  1JYC A;  2RS3 2;  1BCX A;  5GKA C;  1RMU 1;  3U4S A;  2PHX A;  3AP9 A;  3RNS A;  4Q4X 2;  2WT2 A;  2J1A A;  4Q4Y 2;  1OA4 A;  4CRQ A;  2ZPX A;  4YFZ A;  1D4M 3;  3KMH A;  3DEC A;  4QDS A;  4XJA A;  5A3O A;  2ZA9 A;  4Q4V 3;  1UCX A;  3LSD A;  4JRA A;  5FK7 A;  3RS6 A;  5BNO C;  5FZG A;  3J7H A;  5CU1 A;  5JAX A;  5FY5 A;  1MS9 A;  2PXJ A;  4MXW A;  4HG6 B;  1HB2 A;  3D0J A;  1SDW A;  3D0S A;  2ZEY A;  3QH6 A;  4RHV 2;  4WVW A;  4LBN A;  3LIH A;  3MW3 A;  2QFE A;  5J96 B;  3BTA A;  1VBC 3;  2EXI A;  4AQ6 A;  4MGZ E;  3ZXD A;  1WWY A;  5JZG A;  4NUB A;  4K7J A;  2RDN A;  3RSJ A;  3ZIW A;  3OGS A;  3THP A;  3V0A A;  3I59 B;  4AVC A;  2RS3 3;  4DQA A;  1O8P A;  4J1X A;  1CZV A;  4IV1 B;  3R4D B;  1NT0 A;  3ACH A;  2J22 A;  5LB6 A;  1VBD 1;  3NJX A;  4BB3 A;  1IZ3 A;  2RMU 1;  4NRM A;  2LRP A;  5LBC A;  3IM0 A;  4JRL A;  2VAU A;  3PUI A;  5B2G B;  5FKC A;  1GV9 A;  2WZP P;  1MEC 2;  1RUC 2;  4GZ9 A;  3OGG A;  1FAY A;  4XF0 A;  3NAP A;  5FPV A;  3ZKY A;  2KXL A;  1NCR A;  1QJX 2;  4N53 A;  1UZ0 A;  1F4H A;  2XUE A;  5E89 A;  5C7G A;  2Q8C A;  1BBT 2;  5JMC A;  5LY2 A;  2ZMN A;  3WDX A;  1S0I A;  4YVS C;  2HWE 3;  4B29 A;  5DDJ 2;  4P02 B;  1LU2 A;  1UKR A;  1NZC A;  1GZW A;  3APB A;  5DN2 A;  3LQC A;  2D6N A;  1HRI 1;  5ABJ B;  4D7S A;  1W9S A;  3BU7 A;  1OQD A;  2VQU A;  4IES A;  4K1Y A;  5DZG A;  2WO1 A;  5FO7 B;  4CDX A;  2XLF A;  1UZY A;  2HEV F;  2UWA A;  4LTA A;  2D7F A;  3SH4 A;  3ZFF B;  4YZ5 A;  5AVA A;  2E33 A;  3I3D A;  3WR0 A;  3CF6 E;  3B93 A;  3NKT A;  1F5J A;  4ZU5 A;  4EN8 B;  4B4R A;  3FUQ A;  5FZ4 A;  3N9P A;  1MPX A;  2FQP A;  4S2G A;  1RUG 2;  3AP4 A;  2X05 A;  1HQW A;  2R1D A;  3R0R A;  1HLC A;  1S0E A;  2VD7 A;  3N4M A;  1WLT A;  3UL2 A;  4AED C;  4DUW A;  3DUI A;  5I0U A;  1G9C A;  3Q8B A;  4ERO A;  1PX4 A;  1XNA A;  3GBF A;  2ZGN A;  4HKW A;  1ZRR A;  5HXV A;  5K0U C;  3BUC A;  3ZX7 A;  4FOV A;  4XQ4 A;  3WF1 A;  3O1R A;  2IFW A;  2QVS B;  3EJK A;  4Y1U A;  4ES9 A;  2KA3 A;  2QBX A;  4XXA A;  2MNG A;  3AYC A;  2IFR A;  2OQ7 A;  1BEV 2;  2ZX2 A;  4KI5 M;  4XQD A;  1WCD J;  3D6E A;  4QB2 A;  2XJU A;  1IGO A;  1US2 A;  3WNP A;  1Y43 B;  1ODN A;  3ES4 A;  1ZYB A;  1C8M 3;  2PEL A;  2R06 2;  4MAD A;  4F8A A;  1DZQ A;  1RHI 2;  3RI9 A;  5GLU A;  1PGW 2;  2XQR A;  1MVE A;  3N7L A;  3BTZ A;  1PGL 2;  4JDO A;  4AED A;  5CFC C;  3L9J T;  3ME2 A;  4IEZ A;  3OSD A;  3JU9 A;  5T5P A;  1ULG A;  3BVC A;  5DG1 A;  4XAB A;  4AEJ A;  1LJ7 A;  5T5L A;  5CFD A;  5LA9 A;  3HD8 B;  3ZYR A;  3SIT A;  5FP9 A;  4DRV A;  4ZU7 A;  4QM8 A;  5HPO A;  1OHF A;  2YGM A;  2OX0 A;  3NST A;  4Y5T A;  3CQO A;  3WD5 A;  2FCT A;  1UIK A;  2JG9 C;  1JS9 A;  5ANN A;  3JZV A;  2BRT A;  1KDM A;  4UFL A;  1EPW A;  4I02 A;  5ACA 2;  4YZ2 A;  5F6L B;  2R07 3;  1XOY A;  2RR1 2;  4PJY A;  1W9T A;  4QDQ A;  5FR3 A;  4PLN A;  4FAG A;  4Q4W 3;  4R4Z A;  4GWN A;  4BQX A;  1W3V A;  1DF0 A;  3ITQ A;  2YXS A;  1OI6 A;  2B4K A;  1LOF A;  1O4Y A;  3DPR B;  4BCU A;  3H1W A;  4BQY A;  5FYC A;  5JOZ A;  4OI0 A;  3C3V A;  4XIL A;  3USU B;  1QNY A;  3C7O A;  3WQ0 A;  2MEV 1;  1A78 A;  2E31 A;  5IVB A;  1AXK A;  2PHD A;  5F6K A;  3ZR6 A;  2LM3 A;  5E8A A;  4OQ8 A;  1UU4 A;  1R1A 3;  1CGP A;  4DO0 A;  4HMZ A;  4GAL A;  5JOX A;  3CU7 A;  1Z7S 2;  4C91 A;  3PNA A;  1ENS A;  4Q1P A;  1ULD A;  1UMZ A;  1C8N A;  4AFD A;  5KC6 A;  2WFF 1;  4YGC A;  2VJX A;  3QCW A;  2ZEZ A;  3ZN5 A;  4W6W A;  1LGN A;  2RS5 2;  4SBV A;  3LAG A;  2V4A A;  3SCH A;  4IV1 C;  3ZN4 A;  4RQP A;  2WAO A;  3K4D A;  1PM4 A;  4HBN A;  2ERF A;  4WVM A;  2WJS A;  2PN5 A;  1GKB A;  2E7Q A;  4QX8 A;  5IUQ A;  2O0O A;  2D98 A;  2P3Y A;  4AQ2 A;  1GZ9 A;  1S0G A;  3JQW A;  3VB9 A;  1ZBE 1;  2JE8 A;  2CGO A;  1LOD A;  2VZ1 A;  3H3L A;  2EF6 A;  1QJU 3;  4K9S A;  5F2W A;  3TEX A;  3LD8 A;  5A32 B;  4CDQ C;  3ACG A;  3I4I A;  4XF1 A;  2CHH A;  1YI7 A;  4YG3 A;  4BQ4 A;  4IV3 C;  3NL1 A;  3T2Q A;  5FZ1 A;  2BTV C;  3PVB B;  4COZ A;  1GQH A;  1EUT A;  2RE9 A;  1YQ8 A;  3AMM A;  3KF3 A;  1NCQ C;  1JTZ X;  3IN9 A;  4ZZ8 A;  4ZU4 A;  3RFR A;  3DGT A;  1KIT A;  4IEP A;  3VZL A;  4LE4 A;  5K8S A;  1ALY A;  3VZJ A;  2RR1 3;  2OT7 A;  3FBY A;  1W2N A;  3W59 A;  3PUS A;  4CP1 A;  2YFU A;  4BQ1 A;  1F15 A;  3MO4 A;  2VMD A;  2I2S A;  2JDY A;  2VE1 A;  2D43 A;  5BPX A;  5FP4 A;  4GQ7 A;  4D8M A;  2VZO A;  5FLI A;  1DHK B;  3WNX A;  4W6Y A;  2FCV A;  4GA9 A;  2C1F A;  4MO3 M;  2HEY F;  2EAK A;  1MZ6 A;  1QXJ A;  2A3X A;  4BXS V;  2Q1Z B;  4S2D A;  2WNV A;  4FOQ A;  4CU8 A;  4MHU A;  1PGS A;  4N7U A;  1UN1 A;  3VDC A;  5J37 A;  2GNB A;  3VL9 A;  1VRH 2;  2R32 A;  3KCY A;  2B39 A;  3FFQ A;  4Y20 A;  4MLO A;  3RGB A;  2AAC A;  3AFK A;  1LOA A;  2FDK A;  4WVV A;  4S2H A;  2VEC A;  4ZXE A;  1W6O A;  2UU8 A;  2WSU A;  4J25 A;  1Z78 A;  3U78 A;  3WG4 A;  3TNQ A;  2ZGP A;  3J7M A;  4XXP A;  3UJQ A;  2P3K A;  1DYP A;  1ZBE 3;  5AVP A;  4QD2 A;  3HQX A;  4CA9 A;  3OY8 A;  3WDY A;  4JTO A;  4BPZ A;  4DEV A;  4FPG A;  2KM2 A;  1RXF A;  1MAC A;  4GJZ A;  4AZZ A;  3POG A;  2D3R A;  2JDN A;  4UXA A;  4CCM A;  3DL3 A;  1J59 A;  1MQT B;  1GP6 A;  5FYB A;  3U14 A;  4DIN B;  4Y5S A;  2YC2 A;  2GP5 A;  4FPK A;  1YFX A;  4DIQ A;  1QXP A;  1SLI A;  3S5Q A;  3UJO A;  4IL7 A;  1TNR A;  3WUD A;  1RUF 2;  4R4X A;  3TBD A;  3VDD C;  4QWN A;  1ZZ6 A;  2WA3 A;  4AOC A;  1PNF A;  1TG7 A;  1ZBA 2;  2XJV A;  4M3C F;  1WBF A;  4D3W A;  2GND A;  2ZAB A;  5IK4 A;  5BNN A;  3PIG A;  3VBR C;  4XUP A;  2W3J A;  2QQP A;  4CYD A;  2VR4 A;  2FDH A;  4E2Q A;  3N9L A;  4Y24 A;  5L9B A;  4BOW A;  2E26 A;  3H1M A;  4BYY A;  1GNH A;  2OVU A;  2AYH A;  4P5Y A;  3C7F A;  4XAE A;  2WS9 1;  1JZ2 A;  4CU7 A;  4LEJ A;  2MHF A;  5FJK A;  4AAX A;  4C1X A;  2GMM A;  1HN1 A;  4KNC A;  3VL8 A;  5JZG B;  1OT5 A;  1U0A A;  2JE7 A;  4JQR A;  4HT1 T;  4ASL A;  2YY1 A;  1R09 1;  1UMI A;  3ZMO A;  3QAC A;  5HCB A;  4UF0 A;  2JB4 A;  3SEP A;  1X7N A;  4FFH A;  4ES8 A;  2R04 1;  4K6B A;  2WNU C;  3AKQ A;  1N47 A;  4MXW B;  5FZ3 A;  1R1A 2;  4Q4Y 3;  3RYK A;  2VOT A;  4IGO A;  1QH6 A;  3AKP A;  4NIH A;  1BBT 1;  4OMD A;  5FYZ A;  5FOJ B;  2VZQ A;  4HAN A;  1DIW A;  2Z69 A;  4IEU A;  4XOG A;  1PO1 3;  2B45 X;  2ORX A;  2YG0 A;  5C8C C;  1UXX X;  4FAH A;  1M4W A;  1T6G C;  4KGQ A;  2JIJ A;  4OI2 A;  3MIF A;  3O14 A;  4E2G A;  4FPY A;  1YIP A;  4LO7 A;  2Y6G A;  5CKN A;  4AI9 A;  2G19 A;  2PHF A;  3WG2 A;  1AR8 1;  2X29 A;  1GAN A;  2HKX A;  4YLZ A;  4JGY B;  5FYU A;  1M06 G;  3BPS A;  4IV3 A;  1W04 A;  3IAP A;  5FZF A;  4L92 A;  5FYY A;  2WNV B;  5DQ0 A;  1DDL A;  5FBZ A;  1GZW B;  1DLC A;  3NNJ A;  3NRU A;  3KQ4 B;  3RYP A;  1U12 A;  3MDP A;  2IXL A;  4HLT A;  5F32 A;  3PVN A;  1EV1 1;  1FX5 A;  1H8T C;  2XWJ B;  1T2X A;  4QX7 A;  5HI0 A;  1HN0 A;  1W0O A;  1V0A A;  2YC0 A;  4IET A;  4PDW B;  5FY7 A;  3ZVX A;  1HRI 2;  4HKO A;  4HKL A;  3ST7 A;  1OQ1 A;  2DFB A;  3OEA A;  5FWE A;  4DMI A;  1C28 A;  5IWF A;  2XHK A;  3S0M A;  2XBO 2;  1POV 0;  1L7Q A;  4IE0 A;  3RG0 A;  4WV8 A;  1MZE A;  3K48 A;  1BEV 1;  4G9S B;  5CAD A;  4AGG A;  1ND2 C;  1ND3 B;  3WF2 A;  1ZZ7 A;  4LBQ A;  1H1M A;  1GP4 A;  3ES1 A;  4A2U A;  1HW5 A;  4QGL A;  5FUI A;  5T3N A;  3FLR A;  2DFC A;  1DCS A;  4Y4Y A;  5CG8 A;  5L7O C;  4RS5 B;  1RUI 1;  4PF5 A;  3DXU A;  3CZU A;  4NHK A;  2RMU 2;  4YSF A;  1V70 A;  4XE9 A;  5LRR A;  1AZD A;  5A6Z A;  3LGR A;  1HDK A;  3AJZ A;  3DF0 A;  4UI9 L;  4AI1 A;  1W3X A;  2HLE A;  3K75 B;  3LB9 A;  4CU9 A;  1YFY A;  5FMO L;  4QPW A;  1QH7 A;  2VOV A;  3WF0 A;  3M8L A;  5BNP C;  5CIS A;  1VBB 3;  1QKQ A;  4OMC A;  1NLS A;  5JOY A;  1VBE 3;  2JXA A;  3O7O A;  1DQ5 A;  1NAE A;  5GZE A;  5CA6 A;  1RUI 2;  5F1R A;  2ZML A;  4ONU A;  5B4N A;  1DBN A;  1VAM A;  1Y4W A;  4QGN A;  1UY2 A;  2FDJ A;  3H8O A;  1X36 A;  5LEK A;  2O1Q A;  2Z79 A;  5KHH A;  2OYZ A;  5JSP A;  3GZE A;  5FZM A;  3VD7 A;  1KDK A;  1OH4 A;  1WME A;  4I0W B;  3HNB M;  2D44 A;  4QPG C;  1UZZ A;  3JD7 2;  3MIB A;  3NNF A;  3SMH A;  4GB3 1;  3WP4 A;  1W6P A;  3KCX A;  2GAU A;  1BEV 3;  4FPF A;  3MFC A;  2RV9 A;  4UFH A;  1VP6 A;  1W9F A;  3FC0 A;  3OBR A;  2PAK A;  5FLH A;  1W6Q A; 
#chains in the Genus database with same CATH homology
 2DCJ A;  1JHJ A;  4D0Q A;  2Y6L A;  4DXS A;  2R7E B;  3VD5 A;  1UYY A;  4MGS A;  4XUR A;  1K3I A;  2CDO A;  3T0D A;  1US3 A;  1I5P A;  1JYX A;  4DXR A;  3W5N A;  2J7M A;  3ABZ A;  3K4Z A;  3IB3 A;  3WSO A;  2WZ8 A;  4QAW A;  3VDB A;  3HJR A;  4IUG A;  2W91 A;  2L9L A;  2VZR A;  4KMQ A;  4CU6 A;  1UY0 A;  3MBW A;  4ZY9 A;  4DEQ A;  3AC0 A;  3CMG A;  1GOF A;  2VZS A;  4QX2 A;  4YPJ A;  3HEI A;  4ZZ5 A;  3LEG A;  1CIY A;  4XUT A;  4KWU A;  4W8J A;  2V72 A;  3VDA A;  4L0P A;  4QDR A;  4JKM A;  3CKH A;  3LPG A;  4A6O A;  1JYV A;  1XNT A;  2Y6H A;  2HYX A;  2OKX A;  1GNY A;  2VMF A;  2J1S A;  3GDB A;  2JDA A;  3ZM8 A;  4OZO A;  3UET A;  1JYW A;  3UNP A;  3MUZ 1;  1SDD B;  1JYN A;  3WNM A;  1LNS A;  5IFP A;  1UWW A;  1R64 A;  3MUY 1;  1UMH A;  2XON A;  3I2F A;  3VD9 A;  4CUC A;  1J83 A;  2JD9 A;  1D7P M;  4A4A A;  2J1A A;  2YFZ A;  4OYU A;  1F4A A;  4TTG A;  3DEC A;  2VZT A;  4QDS A;  4E8D A;  1JZ8 A;  2W94 A;  1YQ2 A;  1WCQ A;  3A22 A;  4FI9 A;  3J7H A;  4HG6 B;  2VMC A;  1XC6 A;  2W1Q A;  4ET7 A;  2ZEY A;  4RN5 A;  2W87 A;  1W8N A;  3I2G A;  2VCA A;  4PT6 A;  3WNL A;  1O8S A;  2WO2 A;  3I2H A;  3OGS A;  3ACI A;  4M4R A;  4PF1 A;  1O8P A;  3CZJ A;  4BJ0 A;  1CZV A;  1OD3 A;  3ACH A;  2J22 A;  4A45 A;  3NJX A;  4UAP A;  5LA0 A;  3PUI A;  3DYP A;  3OGV A;  4GZ9 A;  5CZK A;  1JU3 A;  2YB7 A;  2BGO A;  3OGR A;  4QX3 A;  1DYO A;  4JKL A;  1UZ0 A;  1F4H A;  5C7G A;  3ETP A;  2QQN A;  3MV1 1;  5B4X A;  2BGP A;  2W1U A;  3C7H A;  4P02 B;  3VD3 A;  2J1V A;  5DN2 A;  3LQC A;  5G04 L;  3A7Q A;  5J1X A;  3GXU A;  4LPL A;  1ULO A;  3WNO A;  1W9S A;  4CU9 A;  1K12 A;  2VQU A;  3I97 A;  2WO1 A;  2VO5 A;  2ZEW A;  4A3Z A;  1IQD C;  2W47 A;  1WKY A;  2E33 A;  3I3D A;  4LHS A;  4QB1 A;  2B9V A;  5C71 A;  1MPX A;  2X05 A;  5LCW L;  5JXH A;  4DUW A;  4OUE A;  3C7E A;  1PX4 A;  1XNA A;  5C70 A;  3WF1 A;  3K46 A;  2RVA A;  3NNG A;  4W4Z A;  2QBX A;  1J84 A;  3I2I A;  1W9W A;  2Y6J A;  4KI5 M;  2KD7 A;  4QB2 A;  3WNP A;  1US2 A;  2W46 A;  2VCB A;  4MAD A;  3IDA A;  1RYY A;  4QX1 A;  5DMY A;  1JZ5 A;  1UYZ A;  3ACF A;  4QX0 A;  1JZ6 A;  3SEE A;  2QQL A;  5I0D A;  3I2K A;  3FL7 A;  5G05 L;  2ID4 A;  3III A;  2V4V A;  4LQR A;  5HPO A;  4UOJ A;  2DDU A;  3CQO A;  2XOM A;  3HN3 A;  1H6X A;  4ARX A;  2EIE A;  1GOG A;  2VL4 A;  1K45 A;  3PUH A;  4P00 B;  1W9T A;  2WN3 A;  4QDQ A;  3WNK A;  1PMJ X;  2Z4F A;  1UX7 A;  3C8X A;  2B4K A;  5JXJ A;  3C7O A;  4TXW A;  2E31 A;  4CVU A;  1CZS A;  1L7R A;  1P8J A;  3OB8 A;  5EJZ B;  2VJX A;  2QQM A;  3GGL A;  2ZEZ A;  2WAB A;  1XPW A;  2VM9 A;  2VZ3 A;  3WF4 A;  2WAO A;  3K4D A;  4XUO A;  1DP0 A;  2J1E A;  4PQQ A;  2EIB A;  1GU3 A;  4BK5 A;  3FN9 A;  1NUK A;  3MV0 1;  3P1I A;  2JE8 A;  3THC A;  2VZ1 A;  3WQB A;  5JUV A;  2X10 A;  1UY1 A;  3E1F 1;  3ACG A;  4XUQ A;  2C4X A;  2VTF A;  5CYY A;  4BDV B;  4DUV A;  2V5D A;  3T2Q A;  1OF3 A;  2VQT A;  4MOA A;  1EUT A;  2ZXQ A;  5A1A A;  2VZP A;  2QQO A;  4ZZ8 A;  5IYY A;  1CZT A;  1KGY A;  5JXG A;  2VC9 A;  2YFU A;  3MO4 A;  2VMD A;  2C26 A;  4P08 A;  3DYO A;  3VD4 A;  2WYS A;  4D8M A;  2VZO A;  2Y6K A;  2Y8K A;  2YC4 A;  3DYM A;  3I3B A;  1W99 A;  3A21 A;  4MO3 M;  4BXS V;  1GUI A;  3C7G A;  1JZ7 A;  4A42 A;  4CU8 A;  1GOH A;  1W8O A;  3T0A A;  3VDC A;  2BBA A;  5IJR A;  2X09 A;  4QB6 A;  2WN2 A;  2ORZ A;  3LE0 A;  4XZU G;  3LEK A;  4ZXE A;  3T08 A;  4JHZ A;  2VME A;  1TVG A;  1JI6 A;  2W5F A;  3FHQ A;  4CUA A;  3CDZ B;  3T2O A;  2DCK A;  3K77 A;  4XVH A;  1NKG A;  1EUU A;  2EIC A;  4DEV A;  2LS6 A;  1SHW B;  2C9K A;  5LA2 A;  3NJV A;  1GMM A;  2YC2 A;  1UY4 A;  3EB7 A;  4AG4 A;  3SKV A;  2W95 A;  3EYP A;  2VZU A;  3WNN A;  2XHN A;  1OF4 A;  3OBA A;  1SG3 A;  3FHA A;  3HNY M;  3ECQ A;  3F2Z A;  1TG7 A;  1PMH X;  4DUX A;  2W1S A;  4XUP A;  2W3J A;  2VR4 A;  3WF3 A;  5JR2 A;  1W0N A;  2E26 A;  4Z2A A;  3T0B A;  3BN6 A;  3W5M A;  2PQS A;  4P5Y A;  5JMO A;  2VZV A;  3C7F A;  4W50 A;  1JZ2 A;  4CU7 A;  3WEZ A;  4AAX A;  4LKS A;  1HN1 A;  1OT5 A;  3K4A A;  4GWJ A;  1UMI A;  5EJ1 B;  3GM8 A;  2WQ8 A;  3SEP A;  1JU4 A;  1JZ3 A;  3HPN A;  2J1U A;  3IAQ A;  3T09 A;  2W9X A;  1KEX A;  1K42 A;  2VOT A;  4OMD A;  2VZQ A;  2QQJ A;  3HNM A;  2ORX A;  2YG0 A;  1UXX X;  3HOB A;  1JZ4 A;  2Y6G A;  3SKJ E;  2Y64 A;  5LA1 A;  3BGA A;  5IHR A;  1PX3 A;  1UY3 A;  2W92 A;  3UES A;  1ULP A;  3IAP A;  4M4P A;  1UYX A;  2J1T A;  3I3E A;  2BZD A;  5DQ0 A;  3OG2 A;  1DLC A;  3OEB A;  1GQP A;  3NRU A;  5F7U A;  2LW8 A;  5HXM A;  1O59 A;  1BHG A;  4XUN A;  1T2X A;  1CX1 A;  3OEA A;  4GWI A;  4JKK A;  3CIH A;  1L7Q A;  3LEI A;  2WZE A;  3I2J A;  3NQH A;  4E8C A;  2W1W A;  3P6B A;  2QQK A;  5IFT A;  2BER A;  3WF2 A;  1H6Y A;  4RYD A;  5FUI A;  2ZEX A;  1UXZ A;  3CZU A;  4MGQ A;  4CUB A;  2VCC A;  3T2P A;  5DPN A;  4UI9 L;  2HLE A;  3K75 B;  3A23 A;  4ARY A;  2CDP A;  2WAA A;  2WO3 A;  4QPW A;  3WF0 A;  4OMC A;  2WDB A;  4DXT A;  1NX9 A;  1NAE A;  2WBK A;  4A44 A;  4JX0 A;  5B4N A;  2EID A;  1UY2 A;  4BK4 A;  2J1R A;  3VD7 A;  1OH4 A;  3HNB M;  5EIY B;  3THD A;  2WUH A;  3U37 A;  5JXI A;  3JXS A;  2RJ2 A;  2JKX A;  2RV9 A;  3LPF A;  2XQX A;  2E32 A;  2QQI A;  4A41 A;  3D3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...