1H4HA

Oligosaccharide-binding to family 11 xylanases: both covalent intermediate and mutant-product complexes display 2,5b conformations at the active-centre
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
207
structure length
207
Chain Sequence
EIVTDNSIGNHDGYDYEFWKDSGGSGTMILNHGGTFSAQWNNVNNILFRKGKKFNETQTHQQVGNMSINYGANFQPNGNAYLCVYGWTVDPLVAYYIVDSWGNWRPPGATPKGTITVDGGTYDIYETLRVNQPSIKGIATFKQYWSVRRSKRTSGTISVSNHFRAWENLGMNMGKMYEVALTVEGYQSSGSANVYSNTLRINGNPLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XYLANASE
publication title Catalysis and Specificity in Enzymatic Glycoside Hydrolysis: A 2,5B Conformation for the Glycosyl-Enzyme Intermediate Revealed by the Structure of the Bacillus Agaradhaerens Family 11 Xylanase.
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Glycoside hydrolase
total genus 59
structure length 207
sequence length 207
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h4hA00
1XYOA 1YNAA 2DCZA 2VUJA 2QZ3A 2JICA 1HV0A 1OA4A 5K9YA 1W2UA 3VZNA 4HK8A 3VHOA 3WP5A 2B45X 1XNDA 1UU4A 3MF9A 3MF6A 1HIXA 2D97A 1H4GA 3VZLA 2JEMA 3VZMA 2BWCA 1XNCA 3WR0A 1QH7A 3AKRA 1IGOA 3WP3A 1REFA 1OLQA 3AKQA 4HKWA 3VZJA 2B42B 1H4HA 1XYPA 3MFCA 4HKOA 3WT3A 3AKPA 3VGIA 2BW8A 1H8VA 3WQ1A 4S2GA 3WX5A 2NLRA 1HV1A 1KS4A 1M4WA 3RI9A 2B46X 3WXPA 3MFAA 1PVXA 3WY6A 5HXVA 3VL8A 1REDA 4NPRA 3AMQA 1H1AA 1F5JA 2DCKA 2QZ2A 3B5LB 4HK9A 4XQWA 1QH6A 2JENA 4XQ4A 1NLRA 4H7MA 2DCJA 1KS5A 1C5HA 1XNKA 3VZKA 3RI8A 4S2HA 1TE1B 2BVVA 2DCYA 3WP4A 3WQ7A 1UKRA 3AMHA 3AMNA 4IXLA 3AMMA 3WP6A 3M4FA 1BVVA 3VHPA 3HD8B 1XYNA 1OA2A 5EJ3A 3EXUA 2VG9A 2DFCA 3LGRA 1ENXA 2Z79A 1AXKA 1OA3A 3VL9A 2DFBA 1H0BA 2NQYA 1XNBA 1OLRA 3B7MA 5K7PA 4XQDA 3VZOA 2D98A 4XPVA 3VHNA 3ZSEA 2BWAA 4S2FA 2C1FA 1UU6A 3VLBB 1UU5A 1BCXA 4HKLA 3AKSA 1BK1A 2F6BA 3WQ0A 3LB9A 3AMPA 1C5IA 1T6GC 1XXNA 3AKTA 2VGDA 3O7OA 1REEA 2VULA 4S2DA
chains in the Genus database with same CATH superfamily
2WNOA 2DCZA 1B35B 1CVNA 4ET7A 1A8DA 1XC6A 5JOZA 1VJ2A 1HRV2 2QQWA 2QTWB 2ARAA 2R49A 3LKJA 4ATFA 4AVTA 1ENQA 1UIKA 4JGZC 3MIGA 5JZGC 4EZHA 4Q27A 1WA6X 2RM22 1Z7S3 2O1QA 2PHUA 1IS5A 1RUF2 4IE6A 4Q29A 4CU7A 1JU4A 4UFHA 4FTEA 2BYVE 3M1HA 4GWMA 1A3KA 4QKDA 3MF6A 5D1IA 1V6LA 4OMDA 5GALA 4BOWA 5C4WC 3TN92 1CESA 4WV8A 2VZQA 1G9CA 4LUKA 1NY72 1UQXA 5CVRA 1ZRRA 1RXFA 4INDA 1NCQB 3A22A 1E5IA 1POV1 1W9YA 5FKBA 3AKQA 3WW4A 3WNMA 2GZWA 1N1YA 4XF9A 4K7JA 4LBQA 4QAWA 3M7AA 4GH4C 5J36A 4XZUG 1LJ7A 2XG3A 5DG1A 5FZ4A 1WZXA 3WQ1A 1GLHA 3POYA 3VBOA 2WWSA 1TZOA 1EV13 2RMU1 3FFQA 3U11A 1HV1A 5DDJ1 4CCMA 2XLFA 3RMXA 1C8M1 1V9U3 3HT2A 3POSA 5FP4A 3OD0A 4Q4Y2 3WW2A 1JZ6A 3ZYIB 3IM0A 1VIWB 2XLGA 2R073 4BQ5A 4AXOA 2BZDA 1HXS2 5IYYA 1IOAA 1W6MA 2BGPA 5FOJB 4JGYB 4NJ4A 1AR63 1W9WA 2BERA 2ZHMA 5AC93 4J6GA 1ZBA1 5I8SA 3LAGA 3I2IA 3GGLA 4MV2A 5IATA 1VBD3 3NNGA 5H9QA 3ABZA 5CFDB 5GLUA 3VDDC 1KS5A 1V6OA 5A3PA 1PO12 1WLWA 3AZWA 4AVCA 1XNKA 1QXJA 1YFYA 2MEV3 4C90A 1OUXA 1YCIA 4WZCA 5BNOC 2DDUA 4QB6A 1GQGA 5FXXA 1UY3A 2DU1A 1ND3B 1H6YA 1VPHA 3J4UH 4FOQA 4W6YA 1JUIA 2B39A 2XVGA 3NNMA 4HT1T 2MHFA 2XOMA 3ILRA 4JHZA 4KWJA 5G05L 5K0UC 2PXJA 3ZLIA 4EN6B 3LDRA 4IUGA 3LA3A 4QQHA 5FZ6A 3VKMA 3SNMA 2AZ5A 4QHOA 2ES3A 3TEYA 1YC61 4PF5A 4JQTA 5CZKA 3VBUA 5C9AA 4JRAA 4KMQA 5IVVA 1CWPA 1DYKA 2DYCA 1XE7A 4BQ1A 1O8PA 3O0XA 2F17A 4QGLA 2DBNA 5K7PA 1L7LA 1NG0A 4GB31 1SLCA 3UGFA 3GM8A 3I97A 4XTMA 4B4PA 2PN5A 2WNUB 3ZSEA 3ALQA 4TTGA 5DABA 4LR4A 2RDSA 5A6XA 2D6NA 3WQBA 5LASA 4AEJA 2MPFA 3EYPA 4O9GA 4BHPA 3AKSA 2VTFA 3OY8B 4XIKA 4GWIA 4JZRA 4OQ8A 3NAPC 1RUOA 2YDEA 2VZRA 4Q4X2 1ZYBA 5F3IA 3DPRB 3OTFA 4XBNA 4QX0A 3MI8A 2VZSA 3ATGA 2P5BA 3V0BB 3URFA 1GOFA 4YW2A 1UYPA 2QUOA 5ANNA 5BNNB 4NIGA 3D8CA 4AK3A 2ZX3A 5FZAA 1K12A 2HWB2 3LSDA 4CE8A 1I5ZA 1W3XA 4N43B 3Q8AA 1VE0A 1X9TA 3RZLA 5KHGA 1W2UA 5GZFA 5F5CA 5ABJA 2IUWA 3I59A 1H9PA 5IFPA 1J59A 3PL0A 3DYOA 1DQ4A 1HIXA 5IVEA 1TNFA 2V72A 1H4GA 3OGRA 3BALA 4LO6B 4CP2A 1AXZA 5D8AB 3WEZA 4COUA 5BPXA 3KCXA 3AKPA 3ZXJA 4DFSA 1PIV2 4IV3C 2BGOA 1QHDA 3FJSA 4IEYA 2PAMA 3H3LA 1LODA 2WFF3 2TBVA 3I7DA 3AZXA 3OYWB 4YGDA 1COV2 2X10A 4YVSB 2A1XA 4QQOA 2XBO1 4CDQB 4A41A 1RUE2 4XUPA 4BQYA 2H0VA 5KHHA 3VL8A 4Z8BA 5FPVA 2XJVA 5JXJA 2LS6A 2WAOA 3HMYA 4FCAA 5LEJA 4XMAA 4Y20A 2RVAA 4HK9A 2AR6A 3I3BA 2OT7A 4BU2A 3OJBA 1ZBE3 1OQEA 1UKGA 2ZCWA 1CN1A 1EYBA 2Y6GA 4JDNA 3I3QA 1PHMA 3J7LA 5IUQA 3MIEA 4PDWA 2Y6FA 4QDSA 5JSRA 4XAAA 2JG8B 4AHWA 3D6EA 3ZPYA 1RUD2 2GN7A 1AYN3 4X8NA 1CJDA 2HLEA 4CDWA 3WQ7A 4GIQA 3OF1A 3HN1A 1FPN1 2RR11 2R042 2QDRA 1RVF2 1BZWA 5DMYA 1W6OB 1ZNPA 4HVRA 3POWA 2BDRA 1NCRB 2G9ZA 2VUAA 3J8F1 4QDQA 4Y26A 2XQXA 4YFZA 3O1SA 4XCAA 3AX4A 3HVDA 1AJKA 5FY9A 5FY1A 1TME3 1EAH3 4J1XA 3KS7A 1G9DA 1OLRA 1FI2A 1MACA 2QKDA 3EHKA 4ZZ5A 5L36A 3WDWA 1O6UA 1PMJX 4B7EA 1OFNA 4I02A 3OD4A 5GLZA 3UKVA 2BNMA 2E63A 2QQOA 2MNGA 4XIOA 3JD72 4UWDA 5I8YA 4RS5A 1FATA 1FYUA 3QOPA 4LHSA 4RHV3 3WCSA 4BXFA 5D21A 2VOVA 4YW3A 1PZ7A 1WD4A 3BGAA 1LCLA 1K5JA 3JUUA 2D3PA 3I2GA 3NKTA 4IETA 1PGSA 3PTYA 1QJX3 4N90A 4E9KA 2VZ1A 4GULA 4UI9L 4YW1A 1RUJ2 3K75B 2FDFA 1MQTA 2ZX1A 2D44A 2W68A 3C7OA 2RS12 3CZJA 4NVPA 3UJOA 5HV4A 1G9AA 2P17A 1RINA 4LITA 4RA0A 4Y5TA 2FMDA 5DUVA 4ZU7A 1SACA 3CJIB 3WSOA 1JYXA 5L73A 4JKKA 2XB6C 1H8TB 3LA2A 4Y4YA 2X09A 4NIIA 1AHSA 3I3DA 3ZDVA 4A7YA 1PGL2 5IW0A 4CCKA 4XBQA 3QLQA 5FTTC 5BXXA 4D6SA 1H30A 1Q8OA 1QJU1 2B45X 2WFPA 4O65A 4Q0SA 1YUDA 2JE7A 3H1WA 4AVBA 2Q1MA 4AQ2A 2HBTA 1ZZBA 4LJHA 2L9LA 1QXRA 3CBNA 5F9TA 1O5UA 3T30A 5L7OC 1RUC1 5A3LA 2RMU3 3FLTA 4I0AA 3ZXAC 5DDJ3 4Y24A 2VZ3A 4QM9A 5A7NA 3T09A 2P3JA 3DYMA 1JOBA 1I6XA 5LCWL 1KFUL 2VZOA 4M3CB 2W94A 5J3UA 2YXSA 4MX3A 3LIHA 2H6CA 3IT8A 1CQ9A 3ZR5A 4EE2A 5CB7A 3GBFA 1W6PB 3WF0A 2ZOEB 3O1MA 1ZBA3 3R05A 2FZ1A 3ZX7A 1HN1A 1OOPC 4UOJA 1O4ZA 1BMV2 4Q8LA 1SBDA 3AMQA 4GXLA 4ASMB 5JCTA 3PVBB 2OX0A 2SLIA 4J1WA 4E27A 1WCQA 4FFGA 1S0EA 1US2A 4UW5A 4YM1A 2XMLA 2EICA 5C3OA 4JGZB 5JZGB 1R092 1XNAA 1OFSA 2WSVA 5JAXA 2G4IA 4H7MA 5IK5A 3WUCA 4EZ4A 1UY2A 5D2AA 4PF1A 1UD1A 2ATFA 4LA2A 5FZOB 4OI2A 4UFLA 3BTAA 3B69A 1A8MA 1S0JA 2GMEA 4XVHA 4IEUA 5CIRA 1HX6A 4PJYA 1QDCA 1VMJA 1CIYA 5HCFA 3MW4A 3VD9A 1N3QA 3AYCA 4OHVA 2VOTA 2JDUA 1U5IA 3ZFGC 2TEPA 1R081 4CA9A 1VRH2 1VR3A 4XHBA 1BEV1 1ONAA 1VMFA 2A6VA 2Y6JA 3CNAA 4XC9A 1FXZA 5BNPA 4XJ9A 4AI0A 4LULA 1DBNA 5C4WA 2DFCA 2WINB 2Z79A 4GB33 5JPMB 2WNVB 5EHDA 1YFUA 3BI3A 1WKYA 3Q9OA 2DTWA 4HONA 3TEWA 3I2OA 1GICA 1JU3A 1NQJA 1POQA 1GNHA 2R062 4DEVA 2OYZA 4YZ5A 2AREA 4XQDA 2JWPA 1H2LA 4AVAA 1J3QA 4LBLA 5JDBA 4LK7A 2BWAA 3ZYJB 2RDNA 3KT4A 3G7DA 3DV8A 5CKMA 1UU6A 4M3CF 5JOYA 1F15A 1XE8A 2RG4A 1SEFA 1B35C 1SPPB 1W6NB 1GV9A 2O8OA 3IPVB 4PIZA 5JLVA 3R4UA 1UY0A 2DBIA 1IS3A 4RFT0 1C5IA 1CGPA 5FZEA 2HH9A 4CP9B 4AGGA 4E4DX 5BNOB 3D82A 2VD7A 1RUH2 4LEJA 1WW5A 3KCYA 2ZAAA 1XNTA 3WINE 4P02B 4KG8A 1BJQA 1NYWA 3ES4A 5JOWA 2XQRA 2B7YA 1QMJA 4FPFA 3IWZA 1IKQA 4P08A 5FZDA 2VJXA 2WYSA 4PT6A 1ODMA 4CXYA 4PLMA 3HBKA 1CX4A 1AR81 4YG0A 1AXYA 3T2OA 4YVWA 3ZN6A 3FHIB 4YG3A 4IGPA 1WCDJ 4HPKB 3MF9A 3AVRA 4QT6A 3RZGA 3GCXA 4BQ3A 2D97A 2W3JA 1LOAA 1SQ4A 1NQDA 2W08A 4B29A 1GP5A 2ZGRA 4QPIA 5JMOA 1US3A 3NKGA 3VKOA 1SLAA 4BM8A 4B1MA 3N4MA 1VBE2 1BBT1 2VVFA 2JKXA 3CZUA 2B42B 4FO9A 2AENA 4IE7A 1YQ6A 1O59A 1URXA 3NV3A 2XJPA 3ES1A 3CF6E 3VBRB 2FDKA 3B94A 3H50A 4JGYC 2YU2A 2ZGQA 2XJQA 1KS4A 2ZXQA 4NMIA 1ZRDA 1LOGA 2A7AA 4EN9B 2VZPA 5CFDC 1WMFA 3N35A 3WXPA 3E6CC 3P3PA 4XACA 1PK6B 4KBBA 4B8EA 1W8ZA 4LKDA 1PM7A 2YROA 4LBOA 2IXKA 1E5SA 4MH0E 1H1AA 3ACHA 1ND3C 1T2XA 3BPZA 1CJPA 2DCKA 5GJ6A 2X5IB 4XFIA 4CSWA 2XL7A 1STMA 2JDYA 4F3JA 1GR3A 1YQCA 1UZYA 1CPMA 4L11A 2RJKA 2Q8OA 4AGRA 3T4HB 4D69A 1GZ9A 5GZCA 3HN3A 4HETA 4LLFA 2NZ9A 1GU3A 1Z7S2 4KNCA 3GHNA 2H6BA 1FPN3 1HLCA 4AYUA 3FHQA 2RR13 4BK5A 1S0IA 1DLLA 2YG0A 3USUA 3GZAA 4DPNA 3IZOA 3K51A 3R4DB 2P4EA 4O9EA 2QE3A 3J8F3 1UKRA 3AMNA 4ONUA 4P5YA 4F83A 5HCHA 1ZZ8A 3NNFA 3T1LA 4NRQA 2WWUA 3NO8A 2YPDA 1S2KA 3IKWA 4EN8B 2NMNA 4CVUA 3BODA 2WNUC 1NOVA 4BLIA 2WR9A 1KEXA 2KM2A 2EA7A 2WDBA 5LA2A 3SH4A 4NIDA 3NNJA 3H9AA 5ACA3 2E7TA 3HNBM 4WVMA 2JDAA 1UWWA 1EV12 4K1YA 3ORJA 3VBSB 3O1VA 2Y26A 4RSUA 5JUVA 1V9U2 3B7MA 4LO4B 5G04L 1CZTA 2G9FA 3AZZA 4QPGB 3VHNA 2CY6A 2R072 2R32A 2GNMA 3P5BA 4MYEA 1CAWA 4QWNA 4ZY9A 1ENSA 1FV3A 1UU5A 5BNNC 1AR62 5AC92 1WCSA 3VKLA 2JECA 1GYKA 1S0FA 4D94A 3O1UA 3VHRA 4N43C 5FP9A 2X05A 5LRRA 4QX3A 3LSEA 3AKTA 5FPBA 3RYRA 5A1AA 1SCRA 1WGPA 4D3WA 3C7GA 5F3CA 1WUVA 4A7ZA 1E57A 2MEV2 3IMMA 2E33A 3E5XA 1JHJA 1DYOA 2JE8A 4OMCA 1LHWA 3A0KA 3IDCB 2ZGSA 1BQPA 5JSOA 5A32B 3T0BA 3UK9A 1CD3G 4CEWA 1G9BA 1AR91 1PZ8A 5K9YA 5D8AC 3MLKA 4UXAA 4NHLA 2GMMA 4QKFA 1S4CA 5FJHA 5FYMA 2YC2A 1ND2B 2OIIA 2E7QA 1RUC3 4IQPA 4YM2A 3ZOIA 1LHUA 1OT5A 5CG8A 3E5QA 1CZSA 1W6QA 2BWCA 1LOFA 4CZSA 3M2MA 1FX5A 4ZONA 5CEHA 1VBB3 3WP3A 3JQWA 2BUKA 2CU5A 2YFZA 3K4ZA 5C5TA 3JBG2 4ES9A 1N1VA 4OHZA 4CDQC 1PGW1 1ZZ9A 3CHXA 5CBLA 1O3QA 2G1MA 2HEYF 4G9SB 5FZ8A 1OPMA 2VW2A 2LTNA 5E6HA 3S7IA 2BRTA 2UWAA 3LZZA 1J1LA 2VM9A 4MO3M 4Q4V1 3RI9A 4NRMA 1UX7A 4HG6B 3W20A 4BDVB 4GA9A 1GZTA 4COYA 2OS2A 3BVCA 3AJYA 3TYJA 4HVQA 4B7KA 5C71A 1QJY3 2JG8C 1YXWA 2EIEA 2WN2A 2A3XA 4M4RA 1BYHA 1KGYA 4I0BA 2QZ2A 4NE9A 5LB6A 2HWF3 1W2OA 3VN4A 1ZVFA 1IS4A 3S6PA 5IVJA 4MSVA 3C7EA 3OSDA 5FQ0B 2BBVA 1NCRC 5C5UA 4IV1B 4TXWA 3MW2A 1JOPA 1KJLA 4XHXA 2WO7A 4BIOA 5DAVA 2VNOA 2BVVA 1BEV3 5FYYA 3WDVA 1OLMA 1SBFA 2WWJA 3MUZ1 4AEMA 1JYNA 2WT1A 3VKNA 4XE9A 4AAPA 1VRBA 1MEC3 4YWAA 1XE0A 3WNPA 2ZTNA 2VE1A 3UKTA 4XBLA 3U1XA 1WWYA 3ZFEA 1OA2A 3AXDA 2I07B 5A3OA 1H2KA 4BLJA 4Q8KA 2VCCA 3UETA 5A80A 3ZDSA 2WYFA 5FV3A 5T5OA 5L19A 2WFF2 3OEBA 4V2WA 4CDXA 1JZ2A 4QPYA 4Q0UA 4IE5A 2WS91 1ULDA 2OKXA 3WG2A 4CPBD 1MZ6A 1WLDA 1A34A 2UY9A 1PVC1 4YARA 5IVFA 1V00A 2W0XA 4NROA 1QXPA 4NAOA 1EY2A 2PHTA 1YHFA 4LHNA 2K2SA 1JHNA 3DKWA 3PLQA 1UCXA 4D7SA 2PMWB 4JHTA 3FLPA 1BK1A 4C1XA 2F6BA 3AP6A 5FBJA 3SH5A 3POIA 1H8TC 5KHIA 2EALA 2VGDA 5H9SA 4AFDA 5DN2A 1D7PM 1AYM1 1NT0A 3FZ3A 3O14A 4MGTA 3ROUA 5A3MA 5FMOS 5C8WA 3DUIA 2ZGOA 5FYVA 1D0HA 1YNAA 2VUJA 3MICA 5DAPA 2YBPA 1AZDA 4BZ4A 4H2AA 3ZFGB 5FUPA 1UOFA 2AYHA 2ZS6B 3RQ0A 3ZMNA 3LA7A 3KWVA 5JI9A 3T2PA 2GC3A 4LT5A 4AR2A 1VAKA 2C5DA 2LW8A 2BP6A 1GP6A 1W05A 5CFCB 3JQXA 5F32A 4JKMA 1AX2A 1RMU1 3OGVA 3H1YA 3T0AA 5HI0A 1TME2 1EAH2 4HKWA 1LRHA 2CNAA 5FYSA 2G9GA 3BYWA 4OHWA 3JCIA 1F35A 3AP7A 3LEIA 4QKBA 5JOXA 1UZVA 4COWA 1KDKA 3DCQA 1B09A 2BBAA 4ASKA 4S2GA 4YM3A 3R0RA 3B93A 4RHV2 2CDPA 2YGMA 2BTVC 1GNZA 5E16A 4AVSA 2QQKA 1JYWA 5FYBA 4CCJA 3VBFA 1D4M2 2PHWA 3GJBA 4ASLA 1QJX2 4JRLA 4XDPA 4URTA 1Q3EA 5HXVA 5FFOC 4RGKA 1GZWA 2VQAA 2EVXA 1NX9A 2DU0A 2GU9A 2XJTA 2PELA 1NA1A 3H3ZA 4IE4A 1S0GA 1F5JA 5E89A 5CNAA 1LHNA 1IZ3A 5IFTA 1O4TA 3B5LB 1F31A 3WOGA 3OEAA 5LWBA 2VMGA 4QQLA 4XF4A 4HANA 5FKCA 5FO7B 3POGA 2D5FA 4LBQB 3RGBA 3TN91 3TNPB 4NWWA 4DMIA 4S2HA 4KGGA 4FT8A 2XKPA 3AJZA 1DQ5A 2WNVC 3VBOB 3CEWA 1K5MA 1J1TA 3RMYA 2ZGKA 4NIHA 5LRSA 3ETQA 4CEYB 1YEWA 4SLIA 1UYYA 3WUDA 5M0TA 1RUNA 1NCQA 4XFAA 3VBHA 3AL5A 4MXVA 2WZEA 4PCRA 5DDJ2 4ES8A 3BTZA 1FOD1 1G7YA 1OC1A 1PO22 3EXUA 4Q4Y1 1DLCA 2RHPA 2VMIA 3Q8EA 5A70A 4Y1UA 2DUQA 3AXEA 4QQPA 4UBHA 5CU1A 5FY5A 2JDNA 2XDVA 5FMCA 3M3OA 3RPQA 4CCDA 1H0BA 1HXS1 1HJFA 1FMD2 4MVTA 3RZKA 1XNBA 4Y1XA 4AEDC 4XF0A 3TBDA 2Z4FA 2ARCA 3M3IA 1TMF3 1W04A 2WZR1 4IEOA 1ZBA2 2XVLA 1V6NA 5BV6A 3D4KA 3KLSA 4MGKE 3DXUA 1DCSA 2P1BA 4H55A 1X9PA 3MUY1 2JD9A 4BQ2A 3Q8CA 4JGYA 2J1EA 3W21A 3IB3A 2EIGA 2A6WA 4MHUA 1XSQA 3WQ0A 5I8TA 3OGSA 2VCMA 1VBC3 2VZUA 4L9BA 4M01A 4ORFA 4YLZA 5IVYA 3RJRA 3RNSA 3HR9A 3VB9A 1HN0A 4FAHA 3NW4A 2J1VA 2HKXA 2Q4SA 3ECQA 4AE2A 3CL1A 2AUYA 2J1AA 3H7JA 5K4LA 3RSJA 2GC1A 3ZR6A 2NP0A 2UWCA 5KHJA 1GMMA 1WMXA 2RJLA 3KT1A 4DQAA 1W9SA 3NMBA 4ZKTB 4XFFA 4A6SA 1UOBA 3GHMA 1ZRCA 1LHOA 4LO7A 1JYVA 1LOBA 3VZNA 2DUPA 2D5HA 4HK8A 4URAA 4XETA 4AFBA 4ZU4A 2BFUL 1X33A 3VBRC 3DF0A 4P9YA 4FPYA 4UFIA 1C1FA 4W8JA 3WF3A 1QH7A 3AKRA 1F4HA 1JZ7A 1UW8A 3LOBA 3L9JT 1QEXA 3ZFFB 4A2UA 2YV8A 3TWIA 4BXSV 3T2QA 1PK6C 4Q4V3 1Q56A 1AR72 4M4PA 4RR3B 1EPZA 1HRI3 1LENA 2C4XA 2C0ZA 4MXWA 1OKOA 4QQ2A 1H9WA 4HN1A 4CXXA 4EWEA 1MS3A 2X5IC 4HLTA 1VALA 5HCAA 3V56A 1I9RA 1UZWA 3A4UA 5IK8A 3I49A 1C3HA 2EAKA 2DVFA 3APBA 3DPRA 5ABJB 2HWB1 5CISA 2RS51 1LEDA 5FUNA 4OQ9A 2D93A 5C3SA 5EQUA 5EJZB 2D3SA 4BMBA 1W2NA 1Y9GA 2X29A 1W8NA 1UMZA 4XQWA 5DUWA 5C8CA 1QH6A 2GSYA 5FXZA 3AK0A 1WA4A 1SFNA 3BPSA 5FDBA 5J98B 1GWMA 2N7GA 4YW6A 5JMCA 1OQ1A 1XSRA 3WNLA 2RV9A 1CIWA 4AI8A 3PVOA 2DF7A 2V5YA 5FP3A 2LUWA 4NHKA 4XJ8A 2ZGUA 1PX3A 3PUSA 2IFRA 1WCKA 3VBSC 4BCUA 2W92A 1SMVA 4KL1A 1DZRA 1R1A2 4P9XA 4FVVA 3K4AA 3V0AB 4DUVA 4BMEA 4Y22B 1MZ5A 3W9AA 3ZKYA 3RWKX 2VCAA 4QPGC 3ZMOA 3B9CA 1XYNA 2WS93 5FMDA 1COV1 3KT7A 4BIFA 3OPZA 1PVC3 4ISRA 5FP7A 4Z2AA 5L9VA 4UFKA 1ULPA 4FPHA 3AZYA 1HDKA 4Y20B 3N9PA 5T52A 1Y4WA 3OYWA 2WA3A 4YVSA 3I4IA 5DZFA 3WF4A 3KV4A 3ZN5A 3ZYGA 4QX5A 4EN7B 3C8XA 2W39A 5JR2A 4C8DA 1DYPA 2QQUA 4PDWB 2HEWF 4EWDA 1V6IA 1LULA 3LEKA 4Q26A 3AC0A 3ZM8A 2Y0OA 4I30A 3C7HA 1VAMA 4CDWB 1AYM3 5FYTA 3SEPA 2OVUA 3PVEA 1L3JA 4EROA 1W03A 2PTMA 4LK6A 3DECA 2WIIB 2XUMA 2X53S 4JAAA 4MZUA 1RUD1 1WBLA 1R1ZA 1O7FA 3DKQA 4WZFA 1HQWA 3NV1A 1ND2C 2I74A 4W4ZA 2WLPA 4Q4W1 3MPPG 1WW6A 5GLWA 4DZGA 1UY1A 3OUJA 5A7OA 1OBNA 1QY4A 4Z07A 1IQDC 2RR12 2QQNA 3N7MA 4BQ4A 1LU1A 5FPAA 5C3RA 3QCWA 1Q5OA 4QB2A 2J1UA 5K8SA 3J8F2 4KU8A 4W6XA 3WF2A 4N53A 4OI4A 4BH9A 2OQ6A 1Y43B 4LQRA 3T0DA 2R7EB 1WW4A 4SBVA 1RMU3 2GP3A 4C1WA 4AHYA 4CPBA 1W6OA 5JIUA 1JTZX 1AX1A 3OUHA 3T4VA 4RS5B 1QOSA 4A6OA 2G19A 2EXHA 3WCRA 5ACA2 1YJKA 1ST8A 3L2HA 5AFEA 3WG1A 3BTYA 5A7WB 1K3IA 1V6KA 4G4FA 2DTYA 4HKOA 5FZCA 2JG9A 5GZDA 1U0AA 2X8KA 4Y1ZA 5A7SA 5FRAA 2VO5A 1KD7A 2FBEA 3VDCA 3U0ZA 4P9WA 4XUTA 2TUNA 1DP0A 2OUJA 4BE3A 1UAIA 1VB2A 2QQLA 1JZ8A 3MYXA 2ARXA 3I2JA 2Q8EA 5DG2A 1HB4A 2VMHA 1UOJA 2VCBA 2ZBJA 4W50A 2WAAA 1D2SA 4Y5SA 2CDOA 2O8QA 2ZMKA 4UFJA 4R4XA 5FYUA 1POV3 1X82A 1W06A 2VQUA 3BB6A 5JIAA 3WNKA 3UNPA 3GDBA 4LHKA 5FAXA 2VAUA 4AVVA 2WT2A 2GH2A 2P3YA 4IV1C 5FYHA 1JZ3A 1QDOA 1RUG1 1T6BX 4FPLA 4FP3A 3TN93 4F7ZA 1PGL1 2CAUA 1DG6A 3B00A 3OBZA 1J84A 3CJIA 3N7KA 4RQPC 3ZSLA 2XHNA 2Q5TA 3D0JA 3RWNA 1V70A 5FY4A 1Y3TA 3MIFA 3ZXEA 4D7YA 5FMOL 1C8M3 4UW3A 2FD8A 3MBWA 3ZKUA 2VVDA 4IL7A 5LK5A 3USSA 3PIJA 1QJFA 3NNLA 1H6XA 1RUC2 1NZIA 3PU3A 1S2BA 3O12A 2QQPA 2DCYA 1FOD3 3J7MA 3LQCA 3PU8A 2WQ8A 3W5MA 4A42A 4OUSA 3RZMA 4X8PA 1QF3A 2IZWA 1OKQA 4K8RB 5B4XA 1VBB2 4ZXKA 2AEYA 1VLNA 3C7FA 4R9AA 2D3RA 4XW3A 2ZKLA 1HXS3 3KV9A 5IJRA 1HB1A 2RS32 4LO5B 4P5HA 3AYDA 1UYXA 2WZR3 3KZ4C 4LBMA 2A3WA 4M3CA 5EXOA 5I0DA 3P1IA 3PURA 5KXDA 1IKPA 1PM4A 3MV11 4WM7A 2C9AA 4XYXA 5FZMA 3KCCA 3RYKA 5C7GA 5HBAA 1BMV1 5LA9A 3E97A 1H1IA 1X8EA 5SV8A 4PQ9A 4MHRA 2JDKA 3VZOA 2ZACA 1SFPA 3LWCA 3VD3A 4BB3A 3HPNA 2PHFA 5C70A 4UT5A 2ZPXA 4CDUA 1R091 1Z78A 1QJY2 3CJXA 2JIGA 4Y1VA 3MPBA 2GC2A 1NXD1 2VMCA 4UAPA 4BQXA 4D6QA 2PHXA 4JGZA 3HQUA 2XWBB 5JZGA 2HWF2 2JE9A 4ARXA 2E9QA 2FDHA 5A7QA 1JODA 5FZ0A 5JWPA 2OW4A 5BNPB 4UF0A 5FZOA 1REEA 1WMDA 1CAUB 4S2DA 3CLPA 4I09A 3VV1A 2VMEA 2I45A 4YNIA 5B4NA 1VRH1 5CFCC 1BEV2 5EP9A 3KF5A 2JICA 4ZU5A 1HV0A 4L99A 3EBRA 3U75A 1XQNA 4PBOA 2VNRA 5CYYA 4XFGA 5L9RA 4CCOA 4QGNA 5J96B 3RZHA 1SHWB 1MEC2 3QBQA 4GH4A 5C3QA 4IEWA 5KXCA 5J09A 4A7KA 3GZUC 2J42A 3CKHA 4X6RB 3ZYHA 1DGLA 1POV0 2Z5WA 4BA6A 2B9UA 4JTOA 4D6RA 3VZLA 2WNVA 4GKYA 3MIHA 3K48A 4DINB 1JN2P 4AEDB 4CCLA 2DWRA 2ZGLA 3NJZA 3ACLA 3P6BA 4Y33A 3WW1A 2C6SA 3J9SA 3LEMA 1MR5A 3WT3A 1DQ6A 1H8VA 2J1TA 2QJVA 2NYYA 1RC6A 1MZEA 2TNFA 3AP9A 3LDBA 3THDA 4AQSA 2AEZA 1G86A 1M4WA 1SZBA 2HWB3 4CRQA 2RS53 3IBMA 2B46X 1OH3A 2P37A 3UESA 4CP1A 1UF2C 1WCUA 3VDDA 4YZ2A 2IXHA 4OI1A 1BVP1 4DS0A 4FXGB 5FZBA 3SITA 5BNOA 1OF3A 2Y6LA 3FE5A 2PQSA 4HFSA 2ERFA 4YVWB 3ZN6B 5F7UA 3PIGA 2JDPA 2B9VA 4XJWA 1UIJA 4YZ4A 2BOIA 4FBFA 3VBOC 3JZVA 1UYZA 2BOJA 4CEYC 4XQ4A 4QPIB 5K0UA 1DZTA 1RUI2 2D6KA 1DGRN 2WJSA 4JDOA 2VXRA 2XBO3 4M0NA 4LBJA 1ZRIA 2FHRA 3SXWA 4IEZA 4FPEA 4HPKA 1IPKA 1VBE1 2VH9A 3WHTA 4DXRA 2O14A 5JXIA 4XILA 2WZPP 3FBMA 2WRAA 1ALYA 1XRUA 2GP5A 3HAGA 2W9XA 3ME2A 4LBQD 1GFF2 3SEEA 5BY5A 1IS6A 2UWBA 1BVVA 1DF0A 1UO9A 3TOJA 5IAXA 4OHYA 1O5LA 4FXKB 1CAXA 4META 4NHYA 3J7HA 3ILFA 3OBAA 4NRPA 1ASJ1 5JI7A 3LGRA 4XXAA 3JU9A 4YW7A 1NZCA 4FOWA 5A7PA 1GWLA 1MS0A 1QQP1 1G9FA 1A6CA 3NAPA 5EYXA 1W2TA 3CQOA 4OUMA 5A33A 2PAEA 4B3NA 4YZ1A 2ET1A 1DDLA 4ZS3A 4TSVA 3LE0A 5I0SA 3K46A 2J1RA 2A70A 1OURA 2ZMLA 1V6MA 3FLRA 2WLQA 2PHRA 1XB9A 2PA7A 3MGUA 2ZGNA 4TWTA 2C1FA 3SC7X 1RUD3 5EZWA 3WG4A 5ISLA 4MOAA 4JKLA 1OD3A 3ZSJA 1FT9A 5T3NA 3USUB 5A1FA 1TVGA 4Q4W3 1GSLA 1Z7S1 4P9LA 1XU2A 1MVQA 2JDZA 4XDOA 2JX9A 4LORA 4WM8B 1OD5A 2CV6A 3HOBA 4OHXA 4KU7A 3K3OA 4LNVA 3U07A 3HBZA 3OPWA 2GNTA 5F39A 1CZVA 5GLTA 2DUOA 4E4ZA 2AGSA 1W8UA 1CX1A 4H7LA 3BU7A 1U12A 5FOBB 1QGLA 3ZFFC 2HJIA 1EUTA 3M70A 5DZGA 3WLUA 3WP5A 4DEQA 5CKNA 3ZXFA 3R6SA 3MIDA 4IV3A 5HPOA 3NRUA 4OLLA 4XOGA 4MGIE 4RR3C 3SMHA 1CAWB 4KG0A 2ETEA 3OCPA 4MUVA 1JUHA 4YGEA 1XNCA 2XHKA 1LOEA 3FMGA 2R071 2IXIA 1VBD2 5JPNB 3VKFC 3VZJA 2WO1A 1MS4A 3MFCA 5ABJC 2C9KA 4XAEA 1AR61 4AZZA 3MIBA 1TMF2 2H0BA 3V65A 5AC91 1JZ4A 2ZA9A 3A23A 5LY1A 4MG2A 4V2VA 3KGZA 3LFIA 1QJU3 2NLRA 4LE3A 5LK7B 2ORXA 4PBPA 2B8MA 2BQPA 4KWUA 4CEWB 1RUG3 1VBC2 4AAXA 3CIHA 2QNKA 3MLJA 2HWE1 3ZXDA 2OPWA 2QQVA 2WSUA 2DURA 2UYAA 3P3NA 3SHRA 1HB2A 4P9GA 4YSFA 1W6QB 1HW5A 1H1MA 3PMSA 4IEPA 4XDQA 3DGTA 5FPZA 4IGOA 4YW4A 5FREA 5T5PA 5A32A 1GWKA 1JMUB 1NKGA 2DCJA 2PLV1 4QX1A 4LBKA 4XJUA 2VZTA 3NJVA 1O4YA 3RZJA 3HNMA 3IAQA 1ACCA 3THTA 1ND2A 4FOYA 2ZHKA 1X50A 1XOYA 1YLLA 5FZIA 3JBG1 3E5UA 1RITA 4KH9A 5F5QA 1OF4A 2W1SA 4GWJA 3T3YA 4L92A 3A0NA 5FZ7A 5FXVA 4TLGA 5F37A 1W2AX 2VNVA 3ZXGA 5JXHA 3ELNA 2BJSA 4KI5M 5A6QA 5ERLA 4PDWC 1K45A 4Q4V2 4CUCA 5FYCA 4PIYA 1W8HA 2XXZA 1HRI2 4IEQA 4NHXA 1OA3A 1W39A 3AP5A 1QWRA 4LKSA 1IHMA 1SFYA 3LPFA 4K3UA 2D6MA 2Y0IA 4CDWC 2VECA 1GQHA 1N1TA 3C2UA 2W95A 1AL0G 3LDKA 4Y1YA 1YIPA 3LOIA 5KHKA 2GH8A 3WD5A 5FO8B 2JB8A 3N3HA 1R083 1CAVA 1AF9A 3PNAA 3AM2A 2JKBA 1S1AA 4IERA 4NN0A 1Y7BA 2GNBA 3PMEA 4RQPB 1WBFA 3I2FA 1DGWX 4COVA 3WVJA 2PFWA 2YBSA 2VQ0A 3K3NA 2YUEA 5EIYB 1UOGA 4K1ZA 1LU2A 3M3CA 1Q8VA 1VRH3 1QJZA 4U36A 4ZS2A 3EB7A 3U37A 4K40A 4H3WA 2W52A 3RRDA 1UPSA 3PJYA 4RS5C 4ZHNA 3EMRA 1RHI1 5HXMA 2Q30A 4E8CA 1ZRFA 3ACGA 1V6JA 1YYNA 2ZGPA 2VMFA 2QFEA 3AL6A 4XUQA 4CDXB 5L7OA 3O1PA 1MPXA 4G3YC 5FK8A 5LA0A 2IWGB 2QQJA 2VTXJ 1W9TA 5FZ9A 2BGCA 1VBA1 2WFF1 3R4SA 2WS92 2A3YA 3GZTB 3MEPA 1DQ1A 4XCBA 2QVSB 3G6JB 3WR0A 4Z2WA 1DU3D 4TN7A 2XVKA 3TAYA 5H9PA 3SISA 1AL21 1ZBE2 2GDFA 4DB5A 2ZZQA 1W28A 3WNNA 2VC9A 2QQIA 1H4HA 3GCWA 1OOPA 2WQZC 4GZ9A 4OULA 3K2OA 3DN7A 2ZHLA 2BW8A 1VB4A 5I0TA 5AFBA 1AR83 1AYN2 5KWRA 1X36A 1JYCA 3ETPA 4FQZA 4GALA 2SBAA 4QMAA 4NOTA 5EV7A 4AQTA 1AYM2 3B02A 1QOTA 2O0OA 4LHLA 4NAMA 5FPLA 1C28A 2B5HA 4AFCA 5IT6A 3H1MA 3WY6A 4D7TA 2UY8A 2Z69A 3TEXA 3WNXA 1BBT3 4QU1A 1REDA 2A75A 1QKQA 1NUKA 4KWLA 3WV6A 1UMIA 4CDUC 5LBBA 2XJUA 1YQ2A 2YYOA 4Q0QA 4K9SA 3H8OA 4LBNA 1RTVA 2R6QA 4P14A 1S0BA 2JENA 3O0VA 1RJ7A 4JVAA 5DAQA 5FO9B 1RL3A 3ZFGA 4RN5A 4ZZ8A 5CADA 2WO2A 1OH4A 2FCUA 5EJ1B 5LEKA 3AYAA 3W5NA 3J7NA 1P8JA 1RMU2 1YIFA 2PYTA 2JDMA 2E6VA 1NAEA 1W8OA 1TME1 1EAH1 5LZ6A 2HWC1 3LD8A 2V4VA 1EUUA 5F6KA 1ASJ3 3IDBB 5CFCA 3AMHA 3I2DA 1D2QA 4IXLA 1EPWA 2HWD1 4RFRB 4YM0A 1YWKA 4O61A 3VBFB 3S5AA 4XMIA 1XJAA 5GLVA 4GMP1 2Y34A 4W65A 4NPMA 1HRV1 1QQP3 4YFWA 2IXJA 3IN9A 5TSWA 3UYJA 5FCCA 1BKZA 3TNQA 1D4M1 1UXXX 2XGXA 1UMHA 1B35A 1NA1B 2RM21 4HN0A 2GC0A 4MGYE 1RUF1 4YW5A 4PQQA 1NLQA 3VDBA 5JSPA 2NQYA 1SG3A 4LIVA 3O1OA 1N1SA 1J83A 5KXEA 1LHVA 1GOGA 3GJAA 1C1LA 5FZ3A 5LBFA 1GZCA 1KJRA 1NY71 1PNFA 3ZSMA 2A5ZA 2VNGA 1OLME 4OCTA 5JR7B 5FYIA 5BNPC 3ACIA 3VLBB 4HSJA 2EAAA 2FMYA 2WC2A 1FAYA 2VUCA 2Q1ZB 4XF3A 1K5MB 5LY2A 1OSGA 3F95A 2EXKA 1Z0HA 3UT0A 3ZPOA 2HBUA 1XXNA 2RMU2 4FPKA 3O5SA 4CCNA 2OUHA 3VBHB 5F1RA 1NXMA 1O8SA 1C8M2 3T2TA 4OUEA 1AVBA 3T1MA 5IK7A 1W6MB 1W9FA 3VD5A 4Q0VA 2QDNA 3O7OA 1WLCA 2DV9A 4GD4A 1QIQA 3H42B 3I54A 2R1DA 3N7JA 2BV4A 2QZ3A 1FOD2 2VXJA 1AX0A 3IDAA 4CEYA 3U78A 3V64A 3SCHA 1PO21 4CUAA 2PAKA 1QNYA 1ULFA 4LIUA 5KBFA 1JBCA 1H2NA 3LCPA 3D3AA 3WDXA 2A71A 2D43A 3EQEA 1YI9A 2E26A 1XNDA 1FMD1 5FK7A 2F4PA 1PO11 2BU9A 1JZ5A 4CU9A 4GKXA 4AF9A 1L7QA 1U5ZA 2WZR2 1W8TA 3ZXKA 2P3KA 1TG7A 5CFDA 2VU9A 1LR5A 3ZSKA 5FR3A 1S55A 1XYPA 1AR93 4XABA 1WD3A 3KV5A 3VGIA 1YRZA 4K20A 3LIGA 3FX3A 4YVWC 1ND3A 4FQ4A 5C9AB 2WN3A 3VBUB 2HWE3 2NM1A 1IG3A 4O7XA 2ZEZA 1UN1A 3H0OA 1KXGA 2K46A 3S5QA 2VOWA 3POBA 4QPIC 4NR1A 5FXWA 3THPA 1MS1A 2JB4A 3BIWE 1PVXA 1OVPA 4M0HA 2E32A 5A6YA 1Q8PA 2XL9A 4BJ0A 1Q43A 2W47A 4L8QA 2JDHA 2XPJA 1D4VB 2PLV3 3BOPA 4GB32 3S57A 4IEXA 2D6LX 3PDQA 1SLLA 4ITCA 1UXZA 1RGSA 4NUBA 4C91A 1TEIA 3JBG3 3WDUA 4K21A 1YJLA 1QNWA 4KBZA 2VOKA 3KVBA 5F6LB 2WNUA 2W1QA 4DOUA 1DGRA 5FZGA 4P00B 4YGBA 2DCTA 1SLBA 1H2MA 2YFUA 5C33A 1ZZ7A 1SBEA 4Q4X1 5CKQA 2A6YA 4MXWB 2WABA 3ENRA 3POJA 2R16A 3OY8A 4GWNA 2VTXA 2GMPA 4QDRA 1AR71 3J26N 4CTEA 2CTVA 3PTRB 4LOTA 1FNZA 4Y4RA 3ZFFA 2IFWA 3HD8B 3I59B 4QKNA 5A3NA 3V0BA 5F3GA 4A45A 1BLZA 5EJ3A 1MS9A 4EV0A 2IXLA 1A78A 2VW1A 4L0PA 4RR3A 5BNNA 2WKKA 2DFBA 5I93A 2AH2A 4N43A 3C3VA 3GF6A 3S7EA 1DGWA 3QACA 1YQ5A 3RZZA 4GQ7A 5C8CB 1JH5A 5IVCA 2RS52 5J7MA 2E7AA 2DVDA 3H8XA 4WM8C 2J7MA 5FY8A 3TB0A 2V09A 3M3EA 3UKNA 5A3WA 4PIXA 2Y33A 3EO6A 2VZVA 2VW0A 3N9OA 5FUIA 4CXWA 2FZ2A 3LFMA 4HKLA 4MGSA 2HEVF 3UGHA 1PIV1 3LB9A 3SH3A 5D8AA 3D5OA 1RHI3 4UYBA 1KITA 5GZEA 2EXJA 3U14A 3WDTA 2WNEA 4Z1VA 2OZ6A 2XBO2 4E2SA 1R1A1 1JYIA 5FIXA 4A44A 1RUE1 2FCVA 2K9ZA 1XYOA 1PNGA 1F2NA 4QB1A 2OXBA 1W8WA 1VBA3 3O1RA 1DHKB 5J48A 5FJKA 1QOOA 3MDPA 3NWKA 1F5FA 1OA4A 1VMHA 3KV6A 4XXPA 3MHZA 3PUIA 1W0NA 4GJZA 4AW7A 4CDQA 1JYTA 1KDMA 3V0AA 2KD7A 4DXZA 5DQ0A 1ZZ6A 4Y22A 3QH7A 4AFAA 3OPTA 3JB4C 4FP2A 2P3IA 1AL23 1JOJA 4R9CA 3SQOA 3MW3A 1U5XA 2FDJA 3EJKA 2VVEA 1AJOA 3FN9A 3KGLA 4CU8A 1JS9A 4AHZA 2OZJA 3OUIA 3N7LA 2XJSA 1J58A 4CEWC 2YHJA 3HJRA 2ZX4A 1UZZA 5L9BA 1M06G 2JG8A 1DZQA 3N9QA 4X6QB 1G8WA 3OGJA 1FPN2 4LLOA 2R041 1LOCA 2XLAA 1RVF1 3A7QA 5JXGA 1LOFC 4YYOA 2FQPA 5SV5A 4Q4W2 1XBFA 2OQ7A 4N53B 5IAVA 4IESA 2Y60A 1ZA7A 4JX0A 4N9IA 3OB8A 5KR7A 1NCRA 1UZ0A 4MADA 5E88A 3AFGA 3RDIA 4EYUA 2BPA2 4B1LA 2ZAHA 4M00A 3JD71 4HZFA 5FY7A 5I0UA 4HOOA 4LUMA 2ARBA 4NO4A 5F5AA 1MQTB 3LF7A 4A3ZA 1UX6A 2HWC3 3DXTA 4C0HA 4LOSA 5GZGA 3AYEA 5LBCA 1W99A 1LESA 1ENRA 1ZZCA 2HWD3 2A6ZA 2JG9B 2IC1A 3BCWA 4Q2FA 3CMGA 4XZPA 4E8DA 2C26A 1RUJ1 2JJ6A 5FYZA 1JW6A 4GMP3 4EJRA 2RS11 5IVBA 1HRV3 3LEGA 1SDDB 4HMZA 2ZGTA 4R52A 5T5JA 3RFRA 4AQ6A 1D4M3 1F9KA 5ANQA 2RM23 4FTSA 4PLOA 1RUF3 1IPSA 1I5PA 1LEMA 5A7WA 3WHUA 1MZFA 4UFMA 2J22A 4KGQA 5F2WA 1ENXA 1KRIA 3BUCA 1I3HA 1AXKA 5FY0A 2ZHNA 1XPWA 2WBKA 3WDYA 2HYKA 4RD7A 1QJU2 2W1WA 3WZ1A 5HCBA 2ILMA 4BK4A 1H8TA 2LALA 3L2YA 4AI1A 3HWJA 3GNEA 4BISA 3UV9A 3ZXLA 1ZREA 2YMZA 2XR4A 1RUG2 3IAPA 5GM0A 3TEZA 2Z42A 3ITQA 3U4SA 2WQ4A 3ZFEC 2D6OX 2W91A 1W3VA 5LATA 2LROA 5EWSA 3NQHA 4Q1PA 3HIFA 4NPLA 2ORZA 1OXCA 4LA3A 4Q4Y3 5T55A 4DRVA 1K42A 4FPGA 3LPGA 4GJYA 4R8HA 3SKVA 1WLTA 3AFKA 4IW3A 4CDXC 5CAZA 4IEVA 1DQ0A 3KM5A 3E6DA 2WZ8A 4JC1A 1IQAA 1N47A 3KB5A 4XJAA 1PO23 3NSTA 5A6ZA 4Q0PA 3BOWA 2E51A 1VBB1 1O3RA 5CA6A 3NV2A 4MLOA 3THCA 1FMD3 1W6PA 3MV01 4JDMA 3W59A 4WM7B 4DIQA 5ACA1 3BU0A 1PO13 3W58A 2RS31 3ACFA 3NJXA 3K77A 5T50A 3VHOA 2YB7A 1C4RA 3JB8A 2Q8CA 4CDUB 2BEOA 1ZX5A 3HEIA 2GAUA 5FBZA 3QH6A 5B2GB 1LECA 1UNBA 3B01A 5HV0A 2OPKA 2GN3A 1S0DA 1SDWA 3WNOA 1TQ5A 2QCSB 1LNSA 2P34A 1QJY1 3ZYFA 4OZXA 5DZEA 1NE6A 2PHDA 3VD7A 5DUXA 4DRRA 2W5FA 5C3PA 5C4WB 3AB0A 4HBNA 2WL1A 4DNYA 1R082 4XF1A 2HWF1 3K4DA 4QM8A 2ZEXA 1GP4A 4UF0B 5FZFA 3S30A 4E2QA 1I1EA 3FFZA 3H8UA 2A6XA 4GMP0 1CR7A 4CP0A 2VR4A 3OG2A 1WMEA 5FP8A 5F2SA 5EYYA 5H9RA 4ATEA 1XU1A 4OI0A 4JV4A 1D0GA 4GH4B 2CGNA 4XTPA 4HVOA 2V4AA 1R64A 1HKDA 2Y6HA 3U4XA 5T54A 2Y6KA 4NPRA 2UYBA 5IHRA 2R061 3O1TA 5DAXA 2D7FA 1CAUA 4N7IA 4DY3A 1MEC1 3BTXA 4BPZA 1O3SA 3B9IA 4Q4X3 3VBFC 4I01A 2ZGMA 4PI2A 1U5YA 2VOXA 2W1UA 3X29B 3GXUA 2CAVA 4IDZA 4RGGA 1AR73 3GALA 3PUAA 1MS8A 3FL7A 2IVJA 3AZVA 4XUOA 3SCGA 2XWJB 1E5RA 1OPOA 2P6CA 1ULCA 1NA1C 2KXLA 1SPPA 4L97A 4Z92B 1W6NA 1RUH1 1DIWA 3IPVA 2YGLA 4DO0A 5IWFA 3UGGA 3VDAA 4AEDA 3KQ4B 1C8NA 4QXHA 2YU1A 4N9HA 3M4FA 3N9NA 3VDDB 4CP9A 3IIAA 2J1SA 3Q8FA 2P6HA 2OA2A 4AFMA 1O91A 2ZEWA 5E8AA 4FI9A 5KC6A 2CL2A 4JQRA 1V0AA 3N36A 1AR82 1HJGA 1ULOA 2ID4A 4V1PA 2LM3A 4CUBA 1K5MC 1W8FA 1HQLA 4BQWA 4F8AA 2EIBA 3S0MA 3FWEA 1ODNA 3KHBA 4Q5OA 4BYYA 5K0UB 2GALA 1J3PA 1NCQC 3FUOA 1X7NA 3PUHA 4FFHA 3VBHC 3FHAA 4FPJA 1PIV3 2D98A 4LE4A 4XPVA 3VUOA 4K6BA 2B4KA 1NE4A 4S2FA 1BBT2 4I0WB 2EF6A 4Y3OA 1O3TA 2CGPA 1GOHA 1RUI1 5FMBA 1ZM1A 1FV2A 5FPUA 1COV3 3OBRA 3NVCA 4FTBA 5BNQA 2PQQA 1YFXA 1R1A3 1WW7A 1Y9MA 2V5DA 3QD6A 3AMPA 4FFIA 2E53A 4FFFA 1RUE3 4TYSA 3ZYRA 4ARYA 2Y64A 2BNNA 5C6CA 5CG9A 2RJ2A 5AVAA 4ZPIA 4N7UA 1CONA 5AVPA 1CAXB 1KFXL 2ZJCA 4XURA 1BHGA 3RVHA 3VBRA 1ULGA 4LTAA 4M3CE 3I2KA 4LKFA 3ZYBA 1QJEA 4CCCA 3ZO0B 4XFCA 3KHCA 1BK0A 1YFWA 4OVEA 4D0QA 2Q0AA 3Q8BA 4JTNA 2RE9A 3ST7A 4AI3A 4H14A 3ZVXA 3GZEA 1PZ9A 2LRPA 1ASJ2 2VPVA 3U10A 3NAPB 5BUVA 5KXBA 5A33B 1NLSA 4E4HA 3FBYA 1PK6A 1S2EA 3OOXA 3NL1A 4QXCA 1QQP2 1UU4A 4UW6A 5C9AC 4OYUA 3VBUC 3KMHA 1Y9QA 2JEMA 2X5IA 4QU2A 1RYYA 3TRSB 5FLHA 1IG0A 3CO2A 4DXTA 3O0WA 2Q8DA 4XUNA 2R043 1MS5A 1OLQA 4I3GA 1RVF3 2A73B 3POEA 4Y5Z0 3IMNA 3PJQA 1IPJA 2VUDA 4KWKA 5DAWA 3BIEA 4DUXA 5F3EA 4W6WA 3NJYA 1APNA 4QHZA 4EWAA 2VBPA 2JD4A 2VBBA 4WVMB 4QX7A 2KR2A 4COZA 5GKAC 4AG4A 1GANA 3H3UA 4YRDA 2NPIA 1LKNA 4K8FA 3WG3A 1Q8SA 4NWVA 2BFUS 1LAJA 1YI7A 1YO8A 2ENRA 2XUEA 1GQPA 1VAVA 2ET7A 3AVSA 3MFAA 2CHHA 4XFBA 1EV11 3SCFA 3RJ2X 3JD73 4WM8A 3UL2A 2R1BA 4NHMA 4IV3B 1V9U1 1LTEA 1N3OA 2RDQA 4N8MA 4EQVA 2QBXA 3MLLA 3VBSA 1LGNA 2VY0A 5LW9A 3IIIA 1W90A 1RUJ3 1LGBA 1NLRA 2XH6A 2RS13 4WVZA 3H8RA 1G6NA 2W2IA 1UY4A 4YZ3A 1CPNA 1GKBA 4QPGA 1F8VA 3VZKA 3PVNA 2GNDA 1RJ8A 2Y8KA 3DPRC 3PHMA 5DUUA 4AEKA 2WO3A 4A4AA 1VBD1 2C24A 2AC1A 2F4LA 1LGCA 4NIAA 1RIRA 2ADDA 2CYFA 2MEV1 4MGZE 1TMF1 4U2AA 5C8CC 3AMMA 3CDZB 3I2HA 3GBWA 3KVAA 3WP6A 3I3MA 2DVAA 2JIJA 4QXBA 3E1F1 1AUYA 3VHPA 5FWJA 3ASIA 3M3QA 5J37A 1AR92 4GAZA 1FNYA 2V73A 2VG9A 2YZ4A 3RG0A 1JXNA 3I3EA 2RDRA 3DYPA 1VBC1 4OFGA 3VD4A 2HWE2 4DXSA 3CU7A 3GYDA 4YGCA 3WF1A 3H7YA 4AI9A 4HXCA 1OMIA 2KA3A 4CYDA 1LB2A 1GNYA 4KQ7A 2FDIA 4ISQA 1RXGA 2WA4A 2ZZJA 4RL7A 1F4AA 2UU8A 3E6BA 3ZYPA 1PGW2 3B3QE 4XJZA 5FWEA 2PLV2 2XJRA 4P9JA 1ULEA 5A3TA 2VBDA 4B4QA 3DEMA 3MO4A 4QGMA 5APAA 3SLIA 1T6GC 4YVSC 5KC5A 3D0SA 4UW4A 4QX8A 4FPCA 1Q8QA 4LO8A 3KF3A 4QD2A 1PX4A 2PHLA 2D6PA 3ZIXA 1OUSA 2Q1FA 2RS33 4YPJA 2VULA 4PHZA 3I8TA 5F5IA 5F8PA 3HQRA 3PUQA 1DQ2A 1R093 4CU6A 4L2NA 2ZABA 4R9BA 5T5LA 2ZX2A 2Z2SB 2YBKA 2D40A 1TNRA 1S0CA 2BNOA 2HYXA 3UJQA 2E31A 1HRI1 5LBEA 1KQRA 2CSGA 5EPAA 2EIDA 3HT1A 4FAGA 4DY5A 3A21A 2IVIB 4B4RA 4TZDA 1CAVB 2FCTA 4OZOA 2IXCA 4C0BA 3VZMA 2ZMNA 4P9IA 4AOCA 1IGOA 5E1RA 2VQTA 2Y38A 1REFA 3RS6A 3IDEA 5I0RA 4E4SA 4AWDA 5JVVA 5FQ0A 4N53C 3MZHA 3ZFEB 2YY1A 5EFUA 4HSLA 1L7RA 1EP0A 3HNYM 4IV1A 2YC4A 1HB3A 3WX5A 5A3UA 2DVGA 3INAA 4CCEA 1PMHX 4QX2A 4RQPA 3N9LA 5L7OB 2R063 3BN6A 4WBBA 1N3PA 1OQDA 1MQTC 4LPLA 4E2GA 1RHI2 3POFA 3ZIWA 2YC0A 1OVSA 3KQRA 4QXKA 2YPJA 1JI6A 1PMIA 2JG9C 4RGAA 1E5HA 1OI6A 3SKJE 3BKZA 1PVC2 4BWOA 2BVBA 1MVEA 2DVBA 2R30A 3AP4A 1SLTA 3JXSA 4JCKA 1QU0A 5FLJA 4FPOB 2CWSA 1VBA2 4WVVA 5FPXA 5IK4A 4IE0A 3FC0A 2UURA 1RUH3 1W0OA 1C5HA 1C57A 4MGQA 4PLNA 4Z82A 5DPNA 5FZLA 1OOPB 3RI8A 4EN0A 3HQXA 4I2OA 1W0PA 1X8MA 2CWMA 2ADEA 2P2KA 1AL22 1TE1B 1ZBE1 1GBGA 1GUIA 3WW3A 4UBGA 3OGGA 2I2SA 1UL9A 4IGQA 3WP4A 4AHXA 2QQMA 2CGOA 4J25A 2NMOA 3CJIC 3FUQA 5FZ1A 3N9MA 1AYN1 4FOVA 2R0HA 2EXIA 2JXAA 2WT0A 4D8MA 2WUHA 4ZXEA 1RB8G 1ZA4A 3RYPA 2AACA 5I91A 4LKEA 4LMFA 3F2ZA 5DXDA 3ILNA 3VL9A 1HQNA 3M8LA 3NV4A 5FLIA 2ZEYA 5FZKA 2FDGA 1VBE3 5BYNA 3OBTA 1DFQA 1RUI3 4QHBA 4LXLA 1SLIA 2W46A 5LA1A 2NN8A 3ON7A 4Q1RA 4XEZA 4DUWA 3KD4A 5A1LA 1SCSA 2K0GA 1OHFA 4R9DA 1J3RA 2XKOA 2W87A 4R4ZA 3ZN4A 1BCXA 4I3PA 1BXHA 2ZKNA 1VP6A 4AGVA 4FSJA 3KSCA 2XONA 4TLFA 4YG6A 3DL3A 4WM7C 4AL9A 2ZX0A 4A3XA 4WVWA 3T08A 2VL4A 4RHV1 1GZWB 5J1XA 2VMDA 2HWC2 4CUGA 5FZHA 4XFHA 4AI2A 1QJX1 1YQ8A 1UPIA 2HWD2 2R0FA 3GBGA 4PI0A 4QPWA 4RYDA 4HL0A
chains in the Genus database with same CATH topology
2DCZA 1B35B 1CVNA 1A8DA 5JOZA 1VJ2A 1HRV2 3LKJA 2R49A 4ATFA 4AVTA 1ENQA 1UIKA 4JGZC 3MIGA 5JZGC 4Q27A 2RM22 1Z7S3 2O1QA 2PHUA 1IS5A 1RUF2 4Q29A 4FTEA 2BYVE 3M1HA 4GWMA 1A3KA 5D1IA 3MF6A 4BOWA 1V6LA 5GALA 5C4WC 3TN92 1CESA 4WV8A 1G9CA 4LUKA 1NY72 5CVRA 1ZRRA 4INDA 1NCQB 3WW4A 1POV1 3AKQA 2GZWA 1N1YA 4XF9A 4K7JA 4LBQA 3M7AA 4GH4C 5J36A 1LJ7A 2XG3A 5DG1A 3WQ1A 1GLHA 3POYA 3VBOA 2WWSA 1EV13 2RMU1 3FFQA 3U11A 1HV1A 5DDJ1 2XLFA 3RMXA 1C8M1 1V9U3 3HT2A 3POSA 3OD0A 4Q4Y2 3WW2A 3ZYIB 3IM0A 1VIWB 2XLGA 2R073 4AXOA 1HXS2 1IOAA 1W6MA 5FOJB 4JGYB 1AR63 2ZHMA 5AC93 4J6GA 1ZBA1 5I8SA 3LAGA 4MV2A 1VBD3 5CFDB 5H9QA 5GLUA 3VDDC 1KS5A 1V6OA 1PO12 1WLWA 3AZWA 4AVCA 1XNKA 1QXJA 1YFYA 2MEV3 4C90A 1YCIA 4WZCA 5BNOC 1GQGA 2DU1A 1ND3B 4FOQA 3J4UH 4W6YA 1JUIA 2B39A 2XVGA 4HT1T 2MHFA 3ILRA 4KWJA 5K0UC 4EN6B 4QQHA 3LA3A 3VKMA 3SNMA 2AZ5A 2ES3A 4PF5A 5C9AA 3VBUA 4JRAA 1DYKA 2DYCA 1XE7A 4BQ1A 3O0XA 4QGLA 5K7PA 1NG0A 4GB31 1SLCA 4XTMA 4B4PA 2PN5A 2WNUB 3ZSEA 3ALQA 4LR4A 2D6NA 4AEJA 2MPFA 4O9GA 4BHPA 3AKSA 3OY8B 4XIKA 3NAPC 1RUOA 2YDEA 4Q4X2 1ZYBA 3DPRB 3OTFA 4XBNA 3V0BB 3MI8A 3ATGA 3URFA 4YW2A 2QUOA 5BNNB 3D8CA 4AK3A 2ZX3A 2HWB2 3LSDA 1I5ZA 4N43B 5KHGA 1W2UA 5GZFA 5ABJA 3I59A 1H9PA 1J59A 1DQ4A 1HIXA 1TNFA 1H4GA 3BALA 4LO6B 4CP2A 1AXZA 5D8AB 4COUA 5BPXA 3KCXA 3AKPA 3ZXJA 4DFSA 1PIV2 4IV3C 1QHDA 3FJSA 4IEYA 2PAMA 1LODA 2WFF3 2TBVA 3I7DA 3AZXA 3OYWB 4YGDA 1COV2 4YVSB 4QQOA 2XBO1 4CDQB 1RUE2 2H0VA 5KHHA 3VL8A 4Z8BA 2XJVA 5LEJA 3HMYA 4FCAA 4XMAA 4Y20A 4HK9A 2AR6A 3OJBA 1ZBE3 1OQEA 1UKGA 2ZCWA 1CN1A 1EYBA 4JDNA 1PHMA 5IUQA 3MIEA 4PDWA 5JSRA 2JG8B 4AHWA 3D6EA 3ZPYA 1RUD2 2GN7A 1AYN3 4X8NA 1CJDA 4CDWA 3WQ7A 4GIQA 3OF1A 3HN1A 1FPN1 2RR11 2R042 2QDRA 1RVF2 1BZWA 1W6OB 1ZNPA 4HVRA 3POWA 4Y26A 1NCRB 2VUAA 3J8F1 4YFZA 3AX4A 1AJKA 1TME3 1EAH3 4J1XA 3KS7A 1OLRA 1FI2A 1MACA 2QKDA 3EHKA 5L36A 3WDWA 4B7EA 1OFNA 4I02A 3OD4A 5GLZA 3UKVA 2BNMA 2E63A 2MNGA 4XIOA 3JD72 5I8YA 4RS5A 1FATA 1FYUA 3QOPA 4RHV3 3WCSA 4YW3A 2VOVA 1PZ7A 1WD4A 3JUUA 1LCLA 4IETA 2D3PA 3NKTA 1PGSA 3PTYA 1QJX3 4N90A 4E9KA 4GULA 4YW1A 1RUJ2 1MQTA 2ZX1A 2D44A 2W68A 1G9AA 2RS12 4NVPA 3UJOA 2P17A 1RINA 4RA0A 2FMDA 5DUVA 4ZU7A 1SACA 3CJIB 5L73A 2XB6C 1H8TB 3LA2A 4Y4YA 1AHSA 4A7YA 1PGL2 4XBQA 3QLQA 5FTTC 5BXXA 1H30A 1Q8OA 1QJU1 2B45X 2WFPA 4Q0SA 1YUDA 2JE7A 3H1WA 4AVBA 2Q1MA 4AQ2A 1ZZBA 1QXRA 5F9TA 1O5UA 5L7OC 1RUC1 5A3LA 2RMU3 3FLTA 4I0AA 3ZXAC 5DDJ3 4Y24A 4QM9A 2P3JA 1I6XA 1KFUL 4M3CB 5J3UA 2YXSA 4MX3A 2H6CA 3IT8A 1CQ9A 5CB7A 3GBFA 1W6PB 2ZOEB 1ZBA3 3R05A 2FZ1A 3ZX7A 1OOPC 1O4ZA 1BMV2 4Q8LA 1SBDA 3AMQA 4GXLA 4ASMB 5JCTA 3PVBB 2SLIA 4J1WA 4E27A 1S0EA 4UW5A 4YM1A 4JGZB 5JZGB 1R092 2WSVA 1OFSA 5JAXA 2G4IA 4H7MA 5IK5A 3WUCA 1UD1A 2ATFA 4LA2A 4OI2A 3BTAA 3B69A 1A8MA 1S0JA 2GMEA 5CIRA 4IEUA 1HX6A 4PJYA 1QDCA 5HCFA 3MW4A 1N3QA 3AYCA 4OHVA 1U5IA 3ZFGC 2TEPA 1R081 1VRH2 1VR3A 4XHBA 1BEV1 1ONAA 2A6VA 3CNAA 1FXZA 5BNPA 4XJ9A 4AI0A 4LULA 1DBNA 5C4WA 2DFCA 2WINB 2Z79A 4GB33 5JPMB 2WNVB 1YFUA 3Q9OA 2DTWA 1GICA 1NQJA 1GNHA 2R062 2OYZA 4YZ5A 2AREA 4XQDA 4AVAA 1H2LA 1J3QA 4LBLA 5JDBA 2BWAA 3ZYJB 3KT4A 3G7DA 3DV8A 1UU6A 4M3CF 5JOYA 1XE8A 1SEFA 1B35C 1W6NB 1GV9A 2O8OA 3IPVB 4PIZA 5JLVA 3R4UA 1IS3A 4RFT0 1C5IA 1CGPA 5BNOB 4AGGA 4E4DX 3D82A 1RUH2 4LEJA 1WW5A 3KCYA 2ZAAA 3WINE 4KG8A 1BJQA 1NYWA 3ES4A 5JOWA 2B7YA 1QMJA 4FPFA 3IWZA 1IKQA 4PLMA 1CX4A 1AR81 4YG0A 1AXYA 3ZN6A 4YVWA 3FHIB 4YG3A 1WCDJ 4HPKB 3MF9A 4QT6A 2D97A 1LOAA 1SQ4A 1NQDA 2W08A 4B29A 2ZGRA 4QPIA 3NKGA 3VKOA 1SLAA 4BM8A 3N4MA 1VBE2 1BBT1 2VVFA 2B42B 4FO9A 2AENA 1URXA 3NV3A 2XJPA 3ES1A 3CF6E 3VBRB 3B94A 3H50A 4JGYC 2ZGQA 2XJQA 1KS4A 1ZRDA 1LOGA 2A7AA 4EN9B 5CFDC 1WMFA 3N35A 3WXPA 3E6CC 3P3PA 1PK6B 4KBBA 4B8EA 1PM7A 2YROA 4LBOA 2IXKA 4MH0E 1H1AA 1ND3C 3BPZA 1CJPA 2DCKA 5GJ6A 2X5IB 4XFIA 2XL7A 4F3JA 1GR3A 4L11A 1UZYA 1CPMA 2Q8OA 2RJKA 4AGRA 4D69A 1GZ9A 5GZCA 4HETA 4LLFA 2NZ9A 1Z7S2 4KNCA 3GHNA 2H6BA 1FPN3 1HLCA 4AYUA 2RR13 1S0IA 1DLLA 3USUA 3GZAA 4DPNA 3R4DB 3K51A 4F83A 4ONUA 4O9EA 2QE3A 3J8F3 1UKRA 3AMNA 1ZZ8A 3T1LA 3NO8A 1S2KA 3IKWA 4EN8B 2NMNA 3BODA 2WNUC 1NOVA 4BLIA 2KM2A 2EA7A 3SH4A 3H9AA 5ACA3 2E7TA 4WVMA 1EV12 4K1YA 3VBSB 2Y26A 4RSUA 1V9U2 3B7MA 4LO4B 2G9FA 3AZZA 4QPGB 3VHNA 2CY6A 2R072 2R32A 2GNMA 4MYEA 1CAWA 1ENSA 1FV3A 1UU5A 5BNNC 1AR62 5AC92 1WCSA 3VKLA 2JECA 1GYKA 1S0FA 3VHRA 4N43C 5LRRA 3LSEA 3AKTA 3RYRA 1SCRA 1WGPA 4D3WA 1WUVA 4A7ZA 1E57A 2MEV2 3E5XA 1LHWA 3A0KA 3IDCB 2ZGSA 1BQPA 5JSOA 5A32B 3UK9A 1CD3G 4CEWA 1G9BA 1AR91 1PZ8A 5K9YA 5D8AC 3MLKA 4UXAA 4NHLA 2GMMA 1ND2B 2OIIA 2E7QA 1RUC3 4IQPA 4YM2A 1LHUA 5CG8A 3E5QA 1W6QA 2BWCA 1LOFA 4CZSA 3M2MA 1FX5A 1VBB3 3WP3A 3JQWA 2BUKA 3JBG2 4ES9A 1N1VA 4OHZA 4CDQC 1PGW1 1ZZ9A 5CBLA 1O3QA 2HEYF 4G9SB 1OPMA 2VW2A 2LTNA 3S7IA 2UWAA 3LZZA 1J1LA 3RI9A 4Q4V1 4GA9A 4COYA 3AJYA 3TYJA 4HVQA 4B7KA 1QJY3 2JG8C 1YXWA 2A3XA 1BYHA 4I0BA 2QZ2A 2HWF3 3VN4A 1ZVFA 1IS4A 3S6PA 4MSVA 5FQ0B 2BBVA 1NCRC 4IV1B 3MW2A 1KJLA 4XHXA 4BIOA 3WDVA 2VNOA 2BVVA 1BEV3 1SBFA 4AEMA 2WT1A 3VKNA 4XE9A 1MEC3 2ZTNA 3UKTA 4XBLA 3ZFEA 1OA2A 3AXDA 2I07B 1H2KA 4BLJA 4Q8KA 3ZDSA 5T5OA 5L19A 2WFF2 4CDXA 4QPYA 4Q0UA 2WS91 1ULDA 3WG2A 1MZ6A 1WLDA 2UY9A 1PVC1 4YARA 1V00A 2W0XA 1QXPA 1EY2A 2PHTA 1YHFA 4LHNA 2K2SA 1JHNA 3DKWA 3PLQA 1UCXA 4D7SA 4C1XA 3FLPA 1BK1A 2F6BA 3AP6A 3SH5A 1H8TC 5KHIA 2EALA 2VGDA 5H9SA 4AFDA 1AYM1 3FZ3A 3O14A 3ROUA 5A3MA 5FMOS 5C8WA 3DUIA 2ZGOA 1D0HA 1YNAA 2VUJA 3MICA 1AZDA 4BZ4A 3ZFGB 2AYHA 2ZS6B 3RQ0A 3ZMNA 3LA7A 5JI9A 2GC3A 4LT5A 1VAKA 2C5DA 5CFCB 3JQXA 1AX2A 1RMU1 3H1YA 5HI0A 1TME2 1EAH2 4HKWA 1LRHA 2CNAA 2G9GA 4OHWA 3JCIA 3AP7A 5JOXA 4COWA 1KDKA 1B09A 4S2GA 4YM3A 3R0RA 3B93A 4RHV2 2YGMA 2BTVC 1GNZA 5E16A 4AVSA 3VBFA 1D4M2 2PHWA 4ASLA 1QJX2 4JRLA 4URTA 1Q3EA 5HXVA 5FFOC 1GZWA 2VQAA 2EVXA 2DU0A 2GU9A 2XJTA 2PELA 1NA1A 3H3ZA 1S0GA 1F5JA 5E89A 5CNAA 1LHNA 1IZ3A 1O4TA 3B5LB 1F31A 3WOGA 2VMGA 4QQLA 4XF4A 4HANA 5FO7B 2D5FA 4LBQB 3TN91 3TNPB 4DMIA 4NWWA 4S2HA 4KGGA 4FT8A 2XKPA 3AJZA 1DQ5A 2WNVC 3VBOB 3CEWA 1K5MA 1J1TA 3RMYA 2ZGKA 5LRSA 3ETQA 4CEYB 4SLIA 3WUDA 1RUNA 1NCQA 4XFAA 3VBHA 4MXVA 4PCRA 5DDJ2 4ES8A 1FOD1 1G7YA 1PO22 3EXUA 4Q4Y1 2RHPA 2VMIA 4Y1UA 2DUQA 3AXEA 4QQPA 4UBHA 5CU1A 3M3OA 3RPQA 1H0BA 1HXS1 1FMD2 4MVTA 1XNBA 4Y1XA 4AEDC 4XF0A 3TBDA 3M3IA 4IEOA 1TMF3 2WZR1 5BV6A 1ZBA2 2XVLA 1V6NA 3D4KA 3KLSA 4MGKE 4H55A 4JGYA 2EIGA 2A6WA 3WQ0A 5I8TA 4L9BA 1VBC3 4M01A 4ORFA 3RNSA 4YLZA 3RJRA 3HR9A 4FAHA 3NW4A 4AE2A 2HKXA 2Q4SA 3ECQA 3CL1A 2AUYA 3H7JA 3RSJA 2GC1A 2NP0A 2UWCA 5KHJA 2RJLA 3KT1A 4DQAA 4ZKTB 4XFFA 3GHMA 1ZRCA 1LHOA 4LO7A 1LOBA 3VZNA 2DUPA 2D5HA 4HK8A 4XETA 4AFBA 4ZU4A 2BFUL 1X33A 3VBRC 3DF0A 4P9YA 4FPYA 1C1FA 1QH7A 3AKRA 1UW8A 3LOBA 3L9JT 3ZFFB 4A2UA 2YV8A 3TWIA 1PK6C 4Q4V3 1Q56A 1AR72 4RR3B 1EPZA 1HRI3 1LENA 2C0ZA 4MXWA 4QQ2A 1H9WA 4HN1A 4EWEA 1MS3A 2X5IC 4HLTA 1VALA 5HCAA 3V56A 1I9RA 3A4UA 5IK8A 1C3HA 2EAKA 2DVFA 3APBA 3DPRA 5ABJB 2HWB1 2RS51 1LEDA 2D93A 2D3SA 4BMBA 2X29A 1UMZA 4XQWA 5DUWA 5C8CA 1QH6A 2GSYA 3AK0A 1WA4A 1SFNA 5FDBA 5J98B 2N7GA 5JMCA 1OQ1A 4AI8A 1CIWA 3PVOA 2DF7A 2V5YA 2LUWA 4NHKA 4XJ8A 2ZGUA 2IFRA 1WCKA 3VBSC 4BCUA 1SMVA 4KL1A 1DZRA 1R1A2 4P9XA 4FVVA 3V0AB 4BMEA 4Y22B 1MZ5A 3W9AA 3ZMOA 4QPGC 3B9CA 1XYNA 2WS93 1COV1 3KT7A 4BIFA 3OPZA 1PVC3 4ISRA 4FPHA 3AZYA 1HDKA 4Y20B 5T52A 3OYWA 2WA3A 4YVSA 3I4IA 5DZFA 3ZN5A 3ZYGA 4QX5A 4EN7B 2W39A 1DYPA 4PDWB 2HEWF 4EWDA 1V6IA 1LULA 4Q26A 2Y0OA 4I30A 1VAMA 4CDWB 1AYM3 2OVUA 3PVEA 1L3JA 4EROA 2PTMA 2WIIB 2XUMA 2X53S 4JAAA 4MZUA 1RUD1 1WBLA 1R1ZA 1O7FA 4WZFA 1HQWA 3NV1A 1ND2C 2I74A 2WLPA 4Q4W1 3MPPG 1WW6A 5GLWA 4DZGA 1QY4A 4Z07A 2RR12 3N7MA 1LU1A 3QCWA 1Q5OA 5K8SA 3J8F2 4KU8A 4W6XA 4N53A 4OI4A 4BH9A 1Y43B 1WW4A 4SBVA 1RMU3 4C1WA 4AHYA 1W6OA 5JIUA 1JTZX 1AX1A 4RS5B 1QOSA 2EXHA 3WCRA 5ACA2 1YJKA 3L2HA 5AFEA 3WG1A 1V6KA 4G4FA 2DTYA 4HKOA 2JG9A 5GZDA 1U0AA 2X8KA 4Y1ZA 5FRAA 1KD7A 2FBEA 3U0ZA 4P9WA 2TUNA 2OUJA 4BE3A 1UAIA 1VB2A 3MYXA 2ARXA 5DG2A 2VMHA 2ZBJA 1D2SA 2O8QA 2ZMKA 4R4XA 1POV3 1X82A 5JIAA 3BB6A 5FAXA 4LHKA 4AVVA 2WT2A 2GH2A 4IV1C 1QDOA 1RUG1 4FPLA 4F7ZA 4FP3A 3TN93 1PGL1 2CAUA 1DG6A 3B00A 3CJIA 3N7KA 3ZSLA 4RQPC 2Q5TA 3D0JA 3RWNA 1V70A 1Y3TA 3MIFA 3ZXEA 4D7YA 5FMOL 1C8M3 4UW3A 2VVDA 4IL7A 5LK5A 3USSA 1RUC2 1S2BA 3O12A 2QQPA 2DCYA 1FOD3 4OUSA 4X8PA 1QF3A 2IZWA 1OKQA 1VBB2 4ZXKA 1VLNA 4R9AA 2D3RA 4XW3A 2ZKLA 1HXS3 2RS32 4LO5B 4P5HA 3AYDA 3KZ4C 2WZR3 4LBMA 5EXOA 2A3WA 4M3CA 5KXDA 1IKPA 4WM7A 2C9AA 4XYXA 3KCCA 3RYKA 5HBAA 1BMV1 3E97A 1H1IA 1X8EA 5SV8A 4PQ9A 3VZOA 2ZACA 3LWCA 2PHFA 2ZPXA 4CDUA 1R091 1Z78A 1QJY2 3CJXA 4Y1VA 3MPBA 2GC2A 1NXD1 2PHXA 4JGZA 2XWBB 5JZGA 2HWF2 2JE9A 2E9QA 5JWPA 2OW4A 5BNPB 1REEA 1WMDA 1CAUB 4S2DA 3CLPA 4I09A 3VV1A 4YNIA 2I45A 1VRH1 5CFCC 1BEV2 4ZU5A 2JICA 1HV0A 4L99A 3EBRA 1XQNA 4PBOA 2VNRA 4XFGA 4QGNA 5J96B 3QBQA 1MEC2 4GH4A 4IEWA 5KXCA 5J09A 4A7KA 3GZUC 4X6RB 1DGLA 1POV0 2Z5WA 4BA6A 2B9UA 4JTOA 3VZLA 2WNVA 4GKYA 3MIHA 3K48A 4DINB 1JN2P 4AEDB 2DWRA 2ZGLA 3NJZA 3ACLA 3WW1A 3J9SA 1MR5A 3WT3A 1DQ6A 1H8VA 2QJVA 3AP9A 2NYYA 1RC6A 1MZEA 2TNFA 4AQSA 1G86A 1M4WA 2HWB3 4CRQA 2RS53 3IBMA 2B46X 2P37A 4CP1A 1UF2C 3VDDA 4YZ2A 2IXHA 4OI1A 1BVP1 4DS0A 4FXGB 3SITA 5BNOA 3FE5A 4HFSA 2ERFA 4YVWB 3ZN6B 4FBFA 4XJWA 4YZ4A 1UIJA 3VBOC 3JZVA 4CEYC 4XQ4A 4QPIB 5K0UA 1DZTA 1RUI2 2D6KA 1DGRN 2WJSA 4JDOA 2VXRA 2XBO3 4M0NA 4LBJA 3SXWA 2FHRA 4IEZA 4FPEA 4HPKA 1IPKA 1VBE1 2VH9A 3WHTA 4XILA 2WZPP 3FBMA 1ALYA 1XRUA 3HAGA 3ME2A 5BY5A 4LBQD 1GFF2 1IS6A 2UWBA 1BVVA 1DF0A 3TOJA 4OHYA 1O5LA 4FXKB 1CAXA 4META 3ILFA 1ASJ1 5JI7A 3LGRA 4XXAA 3JU9A 1NZCA 4FOWA 1MS0A 1QQP1 1G9FA 1A6CA 3NAPA 5EYXA 4OUMA 5A33A 2PAEA 4B3NA 4YZ1A 2ET1A 1DDLA 4TSVA 5I0SA 2A70A 2ZMLA 1V6MA 3FLRA 2WLQA 2PHRA 3MGUA 2PA7A 4D94A 2ZGNA 4TWTA 2C1FA 1RUD3 5EZWA 3WG4A 3ZSJA 1FT9A 5T3NA 3USUB 4Q4W3 1GSLA 1Z7S1 4P9LA 1XU2A 1MVQA 2JDZA 2JX9A 4WM8B 1OD5A 2CV6A 4OHXA 4KU7A 4LNVA 3U07A 3HBZA 2GNTA 5GLTA 2DUOA 4E4ZA 2AGSA 4H7LA 3BU7A 1U12A 5FOBB 1QGLA 3ZFFC 2HJIA 3M70A 5DZGA 3WLUA 3WP5A 3ZXFA 3R6SA 3MIDA 4IV3A 4OLLA 4XOGA 4MGIE 4RR3C 3SMHA 1CAWB 4KG0A 2ETEA 3OCPA 4MUVA 1JUHA 4YGEA 1XNCA 2XHKA 1LOEA 3FMGA 2R071 2IXIA 1VBD2 5JPNB 3VKFC 3VZJA 1MS4A 3MFCA 5ABJC 1AR61 5AC91 3MIBA 1TMF2 2H0BA 3V65A 2ZA9A 3KGZA 1QJU3 2NLRA 4LE3A 5LK7B 4PBPA 2B8MA 2BQPA 4CEWB 1RUG3 1VBC2 2QNKA 3MLJA 2HWE1 3ZXDA 2WSUA 2DURA 2UYAA 3P3NA 3SHRA 4P9GA 4YSFA 1W6QB 1HW5A 1H1MA 3PMSA 4IEPA 4XDQA 3DGTA 5FPZA 4YW4A 5FREA 5T5PA 5A32A 2DCJA 2PLV1 4LBKA 4XJUA 1O4YA 3THTA 1ND2A 4FOYA 2ZHKA 1X50A 1YLLA 3JBG1 3E5UA 1RITA 4KH9A 5F5QA 4L92A 3A0NA 3ZXGA 3ELNA 4PDWC 4Q4V2 4PIYA 4IEQA 1HRI2 1OA3A 1W39A 3AP5A 1QWRA 1IHMA 1SFYA 4K3UA 4CDWC 2D6MA 2Y0IA 2VECA 1GQHA 1N1TA 3C2UA 4Y1YA 1AL0G 1YIPA 3LOIA 5KHKA 2GH8A 3WD5A 5FO8B 3N3HA 1R083 1CAVA 1AF9A 3PNAA 3AM2A 2JKBA 1S1AA 4IERA 4NN0A 1Y7BA 2GNBA 3PMEA 4RQPB 1WBFA 1DGWX 4COVA 3WVJA 2PFWA 2VQ0A 2YUEA 4K1ZA 1LU2A 3M3CA 1Q8VA 1VRH3 1QJZA 4U36A 4K40A 4H3WA 2W52A 3RRDA 1UPSA 3PJYA 4RS5C 1RHI1 2Q30A 1ZRFA 1V6JA 1YYNA 2ZGPA 5L7OA 2QFEA 4CDXB 4G3YC 2IWGB 2BGCA 1VBA1 2WFF1 3R4SA 2WS92 2A3YA 3GZTB 3MEPA 1DQ1A 2QVSB 3G6JB 3WR0A 4Z2WA 1DU3D 2XVKA 3TAYA 5H9PA 3SISA 1AL21 1ZBE2 2GDFA 4DB5A 2ZZQA 1H4HA 1OOPA 2WQZC 4OULA 3DN7A 2ZHLA 2BW8A 1VB4A 5I0TA 5AFBA 1AR83 1AYN2 5KWRA 1X36A 1JYCA 4FQZA 4GALA 4QMAA 2SBAA 4NOTA 5EV7A 4AQTA 1AYM2 3B02A 2O0OA 1QOTA 4LHLA 4AFCA 1C28A 2B5HA 5IT6A 3H1MA 3WY6A 4D7TA 2UY8A 2Z69A 3WNXA 1BBT3 1REDA 2A75A 1QKQA 4KWLA 3WV6A 4CDUC 2XJUA 2YYOA 4Q0QA 4K9SA 4LBNA 1RTVA 2R6QA 4P14A 1S0BA 2JENA 3O0VA 1RJ7A 4JVAA 5FO9B 1RL3A 3ZFGA 5CADA 5LEKA 3AYAA 1RMU2 1YIFA 2PYTA 2E6VA 1TME1 1EAH1 2HWC1 5F6KA 1ASJ3 3IDBB 5CFCA 3AMHA 3I2DA 1D2QA 4IXLA 1EPWA 2HWD1 4YM0A 1YWKA 3VBFB 4XMIA 5GLVA 4GMP1 4W65A 1HRV1 1QQP3 4YFWA 2IXJA 3IN9A 5TSWA 5FCCA 1BKZA 3TNQA 2XGXA 1D4M1 1B35A 1NA1B 2RM21 4HN0A 2GC0A 4MGYE 1RUF1 4YW5A 5JSPA 2NQYA 1N1SA 5KXEA 1LHVA 1C1LA 1GZCA 1KJRA 1NY71 1PNFA 3ZSMA 2A5ZA 2VNGA 5JR7B 5BNPC 3VLBB 4HSJA 2WC2A 2EAAA 2FMYA 1FAYA 2Q1ZB 4XF3A 1K5MB 1OSGA 2EXKA 1Z0HA 4FPKA 1XXNA 2RMU2 3O5SA 2OUHA 3VBHB 5F1RA 1NXMA 1C8M2 3T2TA 5IK7A 1AVBA 3T1MA 1W6MB 4Q0VA 2QDNA 3O7OA 1WLCA 2DV9A 3I54A 2R1DA 3N7JA 2QZ3A 1FOD2 1AX0A 4CEYA 3V64A 3SCHA 1PO21 2PAKA 1QNYA 1ULFA 5KBFA 1JBCA 1H2NA 3LCPA 3WDXA 2A71A 2D43A 3EQEA 1YI9A 1XNDA 1FMD1 2F4PA 1PO11 4GKXA 4AF9A 1U5ZA 2WZR2 3ZXKA 2P3KA 5CFDA 2VU9A 1LR5A 3ZSKA 1S55A 1XYPA 1AR93 1WD3A 3VGIA 1YRZA 4K20A 3FX3A 4YVWC 1ND3A 4FQ4A 5C9AB 3VBUB 2HWE3 2NM1A 1UN1A 3H0OA 1KXGA 2VOWA 4QPIC 4NR1A 3THPA 1MS1A 3BIWE 1PVXA 4M0HA 1Q8PA 2XL9A 1Q43A 4L8QA 2XPJA 1D4VB 2PLV3 3BOPA 4GB32 4IEXA 2D6LX 1SLLA 4ITCA 1RGSA 4C91A 1TEIA 3JBG3 3WDUA 4K21A 1YJLA 1QNWA 2VOKA 5F6LB 4DOUA 2WNUA 1DGRA 4YGBA 2DCTA 1SLBA 1H2MA 5C33A 1ZZ7A 1SBEA 4Q4X1 2A6YA 4MXWB 3ENRA 2R16A 3OY8A 4GWNA 2GMPA 1AR71 3J26N 4CTEA 2CTVA 3ZFFA 1FNZA 2IFWA 3HD8B 3I59B 3V0BA 5EJ3A 1MS9A 4EV0A 2IXLA 1A78A 2VW1A 4RR3A 5BNNA 2WKKA 2DFBA 5I93A 2AH2A