1H4HA

Oligosaccharide-binding to family 11 xylanases: both covalent intermediate and mutant-product complexes display 2,5b conformations at the active-centre
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
207
structure length
207
Chain Sequence
EIVTDNSIGNHDGYDYEFWKDSGGSGTMILNHGGTFSAQWNNVNNILFRKGKKFNETQTHQQVGNMSINYGANFQPNGNAYLCVYGWTVDPLVAYYIVDSWGNWRPPGATPKGTITVDGGTYDIYETLRVNQPSIKGIATFKQYWSVRRSKRTSGTISVSNHFRAWENLGMNMGKMYEVALTVEGYQSSGSANVYSNTLRINGNPLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XYLANASE
publication title Catalysis and Specificity in Enzymatic Glycoside Hydrolysis: A 2,5B Conformation for the Glycosyl-Enzyme Intermediate Revealed by the Structure of the Bacillus Agaradhaerens Family 11 Xylanase.
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Glycoside hydrolase
total genus 59
structure length 207
sequence length 207
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h4hA00
1HV1A 4HKWA 3VGIA 3WQ0A 1H0BA 1KS5A 4IXLA 5K9YA 3LGRA 1XYOA 2NLRA 4S2HA 1OA3A 3O7OA 1YNAA 2BWAA 3B7MA 1H8VA 2NQYA 1OLQA 3VZNA 1C5HA 1REEA 2QZ3A 3VL9A 1QH6A 1XXNA 4XPVA 4XQDA 1XNCA 1BCXA 1XNDA 3WY6A 2JEMA 3AMPA 4XQWA 2VGDA 2DFBA 1BK1A 1HIXA 3VZMA 3EXUA 3WQ7A 1W2UA 3B5LB 3WP4A 1H1AA 2DCKA 1UU6A 1UU5A 3AKQA 4S2GA 1OA2A 1OLRA 3ZSEA 2B42B 2Z79A 1ENXA 2B45X 2QZ2A 3WP3A 1F5JA 3VZLA 1XYNA 1PVXA 3VHOA 1KS4A 3AKSA 4HKLA 3M4FA 2VUJA 2VG9A 3AMHA 3HD8B 1IGOA 1UU4A 4XQ4A 1XNBA 3VZJA 3WX5A 2BWCA 2BW8A 2B46X 3MFAA 3VZKA 2JICA 2JENA 3VL8A 3WQ1A 4S2FA 4HKOA 1H4HA 2VULA 4H7MA 3AMNA 3LB9A 1BVVA 2D98A 4HK8A 3AMMA 1T6GC 3VLBB 1REFA 2C1FA 3MF6A 3RI8A 3AMQA 1TE1B 5K7PA 3WP6A 2DCJA 3RI9A 2DCZA 1C5IA 1M4WA 2BVVA 3AKPA 1QH7A 3AKTA 1OA4A 4NPRA 5EJ3A 4HK9A 1REDA 1NLRA 2F6BA 3VHNA 1HV0A 3VHPA 3AKRA 3WR0A 2DCYA 2DFCA 5HXVA 1H4GA 1XNKA 4S2DA 3WT3A 3MFCA 3WXPA 3MF9A 3VZOA 1UKRA 1AXKA 1XYPA 3WP5A 2D97A
chains in the Genus database with same CATH superfamily
2QQJA 1EPZA 5A32B 1PIV3 3LGRA 2CAUA 2BNMA 3HNMA 3JD71 2ZHKA 2BGCA 2VCAA 1OA3A 5BY5A 5FO8B 1ULDA 2AEYA 1F5FA 4X6QB 3AJZA 4QHZA 2J7MA 4CDQC 4XPVA 2DU0A 4BQXA 3K75B 1BCXA 3TOJA 1QJX2 2WS91 4AI2A 1YYNA 1Q8VA 3N9PA 3I8TA 5C3RA 3ZYRA 3BPZA 5A3PA 3KV4A 4NROA 2MEV3 1OQ1A 2R1DA 1YQ6A 2XVGA 1XE7A 3B5LB 3I2GA 4I0WB 4AHZA 1TME3 3LZZA 3FBMA 3KCCA 1WZXA 4K8RB 2ZZJA 3ZXAC 2XJUA 2CSGA 1ULOA 5BV6A 2YXSA 2CYFA 2WS92 4D94A 2VW0A 2R063 3N35A 1B35A 5DAQA 3D4KA 4E4HA 3T1LA 4YZ5A 1W3VA 3GZUC 4IV1C 4Z92B 2GC1A 3VHOA 2ZKNA 3E1F1 3GZAA 3OEBA 4LNVA 2Q4SA 4YLZA 4RGAA 2XJPA 3VDDC 2QQOA 5JSPA 4PIZA 2R1BA 2VG9A 3QH6A 4QQHA 3AP7A 1H30A 4BCUA 4G3YC 3ILNA 3VBSC 3QLQA 1AR91 3WX5A 2V4VA 4R4XA 4V1PA 4BQ5A 5FP4A 1NY72 2B46X 3WNNA 3LEKA 2H0BA 4CPBA 1OFNA 3SCGA 2BUKA 3J7MA 1UOJA 3DYMA 3AC0A 2SBAA 1V6MA 1W6MA 2JICA 1CAVB 3E6CC 2WABA 3I2FA 1QWRA 4LHKA 1RUG2 1YC61 3SH3A 5JAXA 1DQ6A 4BQ3A 3NAPB 4HN1A 1RHI2 2J1EA 2VZ1A 5T5LA 1G9FA 3S6PA 5FYZA 1D2SA 3MIDA 5H9SA 2XLGA 1XJAA 3QH7A 4R9AA 2ATFA 3ZR5A 1A3KA 1ULCA 2R0HA 2FQPA 3VBOC 3KHCA 1EPWA 4GMP3 1IKPA 3SH5A 3MDPA 5BNNA 1ENSA 3AMNA 1S1AA 2GNBA 2CV6A 3BCWA 4CSWA 2CGPA 2JIGA 1E5IA 1S2KA 1HN0A 3K77A 5CG8A 3LA2A 1MPXA 4JGZC 3FFQA 2ZOEB 4Y22A 1RUJ1 3LA3A 2JE7A 2ZMKA 1CAUA 5LW9A 2HWC1 3AP4A 1DQ5A 2JXAA 4AHXA 1GOHA 3AKPA 5FPAA 1H1MA 1DZRA 4BDVB 3N9QA 1PVC2 3KMHA 2JDKA 5H9PA 5LA9A 1XSQA 2CL2A 2R49A 2R072 4NO4A 3IT8A 2YGLA 5JR7B 4P9WA 1RUJ2 2ZGKA 3ZYJB 5IVCA 2D40A 2HWC2 3A0NA 4YG3A 4QX2A 1V6OA 4M00A 2FDFA 4AFBA 1YRZA 4PIYA 5F8PA 4LHSA 4TN7A 1TG7A 2RMU3 4YGEA 5FXVA 3KD4A 5C6CA 3MF9A 1APNA 3K3OA 2XKOA 3F95A 3HOBA 1W0NA 2BGOA 1NXD1 3O1SA 3SCHA 4AQ6A 1HJGA 3MO4A 1IS4A 2GU9A 3LDKA 5LA0A 5L7OA 1YNAA 5K4LA 4M3CF 1AJKA 1K5JA 3M1HA 3I54A 1UN1A 4Z82A 1OF3A 1N1TA 3L2HA 5DAVA 1J1TA 4XQDA 4P5YA 3W58A 1AHSA 2KM2A 4ARYA 1LOFA 4COWA 4ET7A 1JU3A 4YW5A 5J1XA 1JYCA 4XTPA 4FOQA 2MPFA 4GIQA 4K40A 2W39A 1NCRC 4AQSA 3VUOA 1H1AA 3ACIA 2ZAHA 1UU5A 4KWKA 5BNOA 4O9GA 5KC5A 1RC6A 4Y20B 1QJU1 4Q4V3 4KU7A 4ZZ8A 4YNIA 4UFLA 4AYUA 5J7MA 3T2PA 4N53B 4LE3A 2PAMA 3C7EA 3LKJA 1RUH3 3VDCA 2XUMA 4BE3A 5LEJA 2QTWB 1OUSA 1I1EA 3CQOA 4UW5A 5FYIA 4XHBA 3DEMA 2BTVC 3ECQA 3A4UA 3M3QA 4YVWC 5CISA 3NQHA 2YC4A 2BFUS 2VUJA 3RG0A 4CDWB 4FTSA 3H8OA 3AMHA 3MW3A 3TEXA 2DVGA 1XNBA 2A6VA 2AH2A 4PT6A 1GP4A 1WMDA 1HRV3 3WG2A 1GQHA 3PIJA 4CEYB 1JZ5A 1S0BA 4DZGA 2FCVA 3MFAA 4JGYA 2AYHA 4RFRB 5HCBA 2HBTA 3JQXA 4RQPB 3OYWA 3WEZA 1QJY2 1J3RA 1ULEA 2ZGLA 2WKKA 4FPGA 5BNQA 5HV0A 1BVP1 3EJKA 4QB1A 4K7JA 4NIIA 3OTFA 2XPJA 1XRUA 4XW3A 4LXLA 4EN6B 1LULA 1IS5A 1MZFA 3BPSA 2PN5A 5D8AC 4I30A 2ZZQA 1UW8A 5JIAA 5DAXA 2VZSA 4MHRA 4KU8A 3TNQA 1NE6A 1AZDA 5HCHA 1T6BX 4A6OA 2P5BA 2PLV3 3WF1A 2VUCA 1BHGA 1J83A 3CZJA 3IKWA 3N9OA 5J36A 1LHNA 4OI2A 5FZGA 1WW5A 3VD4A 2X5IC 1ZRRA 1S0CA 5FLHA 5GLZA 2YG0A 5IJRA 1DQ1A 4BB3A 3BI3A 1J1LA 4HSLA 5A3WA 2YY1A 4ES8A 1US2A 4IETA 1H8TA 3PU8A 2VMHA 5EV7A 3ZSJA 1PNFA 1AL21 1PMHX 1SLTA 1KXGA 3H8XA 4Y5TA 2PA7A 3MLJA 4LK6A 4QX7A 2W0XA 2Y64A 4CCMA 1POV3 3BUCA 2VMCA 5T5OA 4AG4A 4OZXA 1R093 3M2MA 2K2SA 5FP9A 3LIHA 3UYJA 1UMIA 1UKRA 3THDA 2RV9A 4CEWA 3GBWA 2KR2A 3C7HA 2I74A 2XONA 3GNEA 1WCKA 2VZRA 4AXOA 4Q4Y1 4JC1A 4FFIA 5A32A 2ADEA 1ZBA1 4YRDA 2WZR1 1PX3A 4EV0A 1DG6A 4LOTA 3OBZA 3T0AA 4GKYA 2RR13 1OLQA 3PJYA 4L8QA 2QZ3A 4RSUA 4DFSA 1RUC3 4X8PA 2V4AA 1XNCA 2A5ZA 4JVAA 4HL0A 1XNDA 4FOYA 4QT6A 5LRRA 2XL7A 4RS5C 1UZYA 3USSA 3MIBA 5JXJA 2F4PA 4QQ2A 4QKDA 1VIWB 1XE8A 1ZBA2 1G86A 3N9MA 2WZR2 5FZ6A 5FWJA 2XBO3 3LSEA 1QDCA 2XMLA 3KV6A 3JQWA 4LKEA 4XF0A 1FV3A 2DCKA 3AL6A 4LBQB 2QE3A 1WKYA 2Y8KA 2JDHA 4RHV2 5F6LB 2JG9C 1HXS3 1NAEA 3EB7A 5FZHA 5F3IA 1QQP2 1A34A 1CAXB 2R041 1FMD1 4JTOA 2CU5A 4XJAA 2B45X 4FFHA 4LO5B 5IUQA 5LB6A 3VBRC 5HI0A 1VBC3 1UZWA 1QJFA 1ENQA 1Y3TA 4PBPA 4EWEA 1RTVA 1AVBA 4QXCA 2HWE3 2BZDA 3Q8EA 3SNMA 1SCSA 2OW4A 2PHTA 4DO0A 1GANA 2GMMA 3N36A 4LR4A 2EVXA 3VZJA 1H9WA 2WQ4A 3RNSA 4AF9A 2D6LX 1PO21 3JUUA 3VDDA 5I0TA 2W68A 2OX0A 1VBA3 2BJSA 2OUHA 1NCQB 3I3MA 3U10A 1MS8A 4LBMA 1V6NA 4QB2A 3TEZA 1UYYA 1LHWA 2PFWA 2VNRA 1CAVA 1W9WA 2VZPA 1BBT1 3TBDA 1EV12 2NMOA 4XIKA 1LEDA 3NAPA 3HNYM 3N4MA 5FZ1A 5KHJA 2OQ7A 2WJSA 4P9JA 1NE4A 1GSLA 2PQQA 2VW2A 1NXMA 5LRSA 2D7FA 4R9BA 4Q4X3 4M3CE 4IW3A 5JXGA 4QPIC 3O1MA 3ZN6B 2WNUB 2WL1A 5DUXA 4QX3A 1MACA 1E5SA 1BBT2 2AZ5A 5TSWA 4EN8B 3HN3A 5K7PA 3MHZA 5E8AA 1X9TA 5T54A 2K46A 4WM7C 4NIGA 3ES4A 5LA1A 1OKQA 2RJKA 1V9U1 5J37A 3IDBB 1HN1A 4JDNA 1RMU2 4UW4A 2DUOA 5LBCA 4HVOA 3FHQA 1ZRDA 2RM21 1G9AA 3IIIA 3J8F1 3UGGA 2GZWA 1XB9A 4I09A 1W28A 4BMBA 4A2UA 5C8CB 5KHGA 1F2NA 4YZ3A 3BIWE 5FPLA 1W90A 1AR61 3ON7A 1C28A 4ZPIA 1HJFA 1N47A 4E4DX 1RIRA 4A44A 5C3PA 1VAKA 2D6NA 3DPRC 1KGYA 1IPSA 4QQOA 5L9RA 4ASKA 2RM22 5CFCB 3J8F2 3KCYA 3KSCA 4Y4RA 1KS5A 2IFWA 2WFF3 1Q8SA 3O5SA 1JUHA 3PUQA 4GB31 4C8DA 3H8RA 2UWBA 2VXRA 4GMP0 4UBHA 1UCXA 4DRRA 5IVEA 3UT0A 1AR62 1AR73 2WN2A 4XYXA 1U5IA 3HR9A 3KWVA 4NAOA 3K48A 3VL9A 5A3MA 5JSRA 3AFGA 1UD1A 1XXNA 3OG2A 4KL1A 4MXWB 5JMOA 1SCRA 3THCA 5K0UC 3TN91 2TEPA 4OHVA 3JBG1 2OA2A 2Q0AA 2XR4A 4IEZA 4C90A 1WLWA 1H6XA 4NIAA 2VECA 1U5XA 2WSUA 2YUEA 2DF7A 4MUVA 4OCTA 2X09A 1F31A 2QDRA 2Z42A 1H2KA 3ATGA 4NMIA 5ABJC 5FYCA 1GFF2 5BNPC 3POEA 3WDYA 3TN92 4BIOA 4YM1A 1N1YA 2JE8A 2J1AA 2Q8OA 3JBG2 1NCRA 3O1RA 3BN6A 1W8ZA 3K2OA 1CZTA 2ERFA 5FTTC 3LSDA 5DN2A 3AYDA 3ORJA 5IVJA 1G7YA 1IPJA 1FOD3 4IERA 4N53A 3SC7X 1YEWA 4AFDA 4A4AA 2GAUA 4COUA 3A0KA 4RGKA 3AP5A 5GLUA 2VOWA 2EXJA 3L2YA 1UPSA 1VBE1 2HWF1 5GM0A 2YU2A 1QY4A 1O91A 4GWNA 5L9BA 4M0NA 4CDWA 5F5QA 1AR83 1VBD3 3K46A 2PXJA 2BWCA 2GP3A 5E1RA 3ZN5A 3ME2A 4YVWA 4MHUA 1RUOA 2HEYF 4Q4W1 4TSVA 4YW2A 3BVCA 5CKNA 4CEYA 1O8PA 1YIPA 1ZZCA 5A70A 1FATA 2E6VA 1B35B 1YI7A 3H50A 2BNNA 1VBE2 3KF5A 2HWF2 5A3OA 2Q8EA 3O1OA 4NHMA 1OXCA 3PUHA 5AC91 5KXCA 1DP0A 4Q4W2 1D4M3 1AYN1 4P9IA 2PHDA 3MV01 3BU7A 4Y1VA 4JAAA 1V00A 1CIYA 1L7QA 4JCKA 5I0SA 4Y1YA 1T6GC 2PAKA 1ZZ9A 4NRQA 4CUGA 1BEV3 4O61A 1WCQA 4QXKA 3PLQA 1XQNA 1GICA 3ILRA 4IEQA 5FZDA 2EICA 1W6MB 3WOGA 4Q5OA 3UJQA 4R52A 2DVDA 3KB5A 1W8HA 1S0EA 2VZ3A 2FMDA 2QQUA 1PZ9A 1QF3A 3B9IA 1STMA 5CAZA 3PIGA 3AFKA 5DXDA 3RQ0A 3IMNA 1LOAA 2C9AA 3MLKA 4RA0A 1Q8OA 4I02A 4NIDA 1YFUA 1ASJ3 3B9CA 3NO8A 4SBVA 3KCXA 5JZGC 4NWWA 3HIFA 1OH3A 3MUY1 3C8XA 3MIEA 4EN7B 1H2MA 1K42A 3DF0A 1C4RA 4URAA 1PIV2 3HPNA 3RYRA 4CUAA 3RPQA 2MEV1 3QACA 2XHNA 3N3HA 1GNHA 3WNXA 5FPUA 4FOVA 3WD5A 1TVGA 4H55A 3LWCA 4URTA 1DIWA 2D3PA 4YM3A 3KT7A 1PM7A 1WLDA 4LO8A 3SHRA 1WMXA 5CYYA 4GH4C 4IL7A 4D6RA 5F5AA 1UYXA 4YM2A 4CZSA 5GZCA 4H7LA 4GWJA 2MEV2 1MQTC 5C70A 2HJIA 1VB2A 1BK1A 5GJ6A 3VZMA 1QOOA 2QQWA 3IB3A 4E2QA 2A3XA 2FDJA 4W50A 1FI2A 4AVBA 2P1BA 2RE9A 1RVF1 3OOXA 2XLFA 4K21A 3D8CA 4XMIA 3B01A 2XWBB 1ODMA 2R062 4RS5A 1CPNA 1OBNA 2ORXA 3PVNA 4RFT0 4CUCA 5L7OB 4S2GA 4LBQA 2HKXA 1JHNA 1LTEA 1G6NA 3KQRA 2B42B 2FZ1A 1QU0A 2SLIA 1W6NA 1G8WA 1POV0 2WO2A 5LY2A 5FUNA 3T08A 5EQUA 1LECA 2ZABA 1MEC1 3AM2A 4FFFA 3FFZA 1CAXA 3VV1A 5FDBA 3RYPA 3PJQA 1MS4A 4IDZA 1T2XA 1IOAA 3P5BA 3D0JA 2VW1A 4PQQA 5BYNA 2NYYA 2VOXA 1WW4A 3VBRA 4CDXC 5FY7A 4GKXA 4XF1A 4XIOA 4AEKA 3H7YA 4GMP1 4UFIA 2FD8A 2WR9A 1MEC2 5F32A 1HB4A 3ZYIB 5BNOB 2B39A 2YV8A 4IQPA 3KQ4B 4CCNA 4N8MA 3M3OA 2I45A 2YU1A 4TXWA 3WNKA 1VE0A 2Q8DA 4QDRA 4G9SB 1KDKA 1W99A 2IFRA 4QPYA 1GMMA 1NCQA 3HWJA 3ZFEC 2JENA 4C91A 1EP0A 4FPYA 4TYSA 1AUYA 1DBNA 5FMOS 3P1IA 3SQOA 3VL8A 3WQ1A 1ND2B 2AEZA 2Y0OA 3CLPA 4MSVA 2P37A 4S2FA 2A6YA 3SKVA 5B2GB 3UK9A 2VULA 3ACHA 1RUF3 1DCSA 5FRAA 2IXHA 4AFCA 1ULGA 1JYIA 5FP3A 2ADDA 3T2TA 4NIHA 5GKAC 2RS31 3TYJA 3VLBB 4DMIA 1COV3 4BK5A 2F17A 1AX1A 4JGYB 2Q1MA 3POWA 4M0HA 4LO7A 2YB7A 4XBNA 4A7YA 1S55A 1W8TA 1NLQA 4CP0A 2GNTA 3OGJA 2ZEXA 2XG3A 3CNAA 2ZX4A 5I93A 4YW7A 2RS32 1TMF1 2GNDA 3LPGA 2BERA 2AUYA 5M0TA 5LY1A 4RL7A 4KWLA 2DUQA 4X6RB 5IVBA 1CD3G 2EIDA 1O4YA 2DCYA 1QOTA 4P9LA 4WBBA 4AI3A 5CADA 1O5LA 4GWMA 2IVJA 4YVSB 1EAH1 5T52A 3U07A 4ZU4A 3W21A 3GM8A 1SLIA 4UW6A 4QDQA 4CDUC 4DUXA 4WVZA 5CVRA 1WMFA 1JMUB 2VAUA 3IAPA 3CKHA 1HW5A 4YGCA 3SH4A 5J3UA 2IUWA 2VR4A 4HKWA 2EALA 4IXLA 1X9PA 4R9DA 1S2BA 1YFWA 4RR3B 1UOGA 4W6YA 5LBBA 1EAH2 3ZX7A 3O7OA 1WMEA 3DPRA 1HRI1 1J58A 1QKQA 1SPPB 4M4RA 4Q4V1 3SITA 2WNVB 1C5HA 2DUPA 1ST8A 3T09A 2UY8A 3PURA 4ZS3A 4B4QA 3FN9A 5FMBA 1IZ3A 5FZ0A 4OQ8A 5HBAA 4MXWA 2WYFA 3U78A 1HIXA 4X8NA 4ZHNA 2LW8A 1LGNA 5E88A 1HRI2 1JZ6A 4CEWB 2ARCA 2E63A 4Q4V2 4XFFA 1OKOA 2QCSB 4QKFA 1GZTA 1IQDC 1U5ZA 3I3QA 4QU1A 1HRV1 1RUH2 2YHJA 2VVFA 1QJX1 4YWAA 3G6JB 3BTYA 3U75A 2A6XA 4PDWC 3VBHC 5LZ6A 1KD7A 2EAAA 2OKXA 4UFJA 3WP3A 4JZRA 5A7OA 1E5RA 1O7FA 3PL0A 5ABJA 5C4WC 3R4SA 5BNPA 2MHFA 3T4HB 2XVLA 3O1TA 1KS4A 5FY4A 2XH6A 3M4FA 2GMPA 3AP9A 3UESA 1HRV2 2C6SA 4FSJA 1IG3A 2ZX2A 4JTNA 4FPOB 1I5PA 4P02B 4XEZA 3U4SA 4YW6A 4A41A 1QJZA 4CDQB 1OQEA 2X05A 5A7PA 2HBUA 1V6JA 4OMDA 3VKLA 1VRBA 1XU1A 1I6XA 3NJVA 1ZA4A 1C8M3 3WW3A 2F4LA 1WA4A 4K1YA 5GLWA 1LB2A 1S0JA 3CDZB 3FWEA 3BTZA 5FMOL 2JB4A 1UIJA 1CAWA 3PVOA 3KLSA 4I0BA 3I2JA 4FPEA 2OZ6A 1SBDA 1WA6X 1C3HA 1CVNA 1NY71 2RS13 3FLRA 1JS9A 1JH5A 2X29A 1VMJA 3I2IA 2WZEA 3P3PA 4XFCA 1VBB1 4IV1B 3ZMNA 2ZTNA 4FBFA 4FPFA 2IZWA 2Z2SB 4OVEA 1LNSA 2PLV2 2WWSA 3C3VA 4NOTA 4RYDA 1RUG1 4CP9B 5IYYA 5C9AC 3BOPA 1RHI1 1W2AX 5FZEA 1W8UA 3VDDB 4AOCA 1NT0A 3ZDVA 1POV1 3AMQA 1R083 5LEKA 4WM8C 1RUI3 1UYPA 3WP6A 5FZ8A 2BP6A 1QEXA 5FFOC 3AL5A 4MO3M 3RRDA 3VBSB 5G04L 3J7HA 2GH8A 4DXTA 1VBB2 4BLJA 2CDOA 5LK5A 3ZYGA 1RUD3 2XOMA 1LOBA 1HB2A 2J1TA 5F3CA 2WT2A 1WD4A 2F6BA 4META 3MIGA 1RB8G 1NZIA 2YROA 3NV4A 1W03A 4NE9A 4WZCA 3I3EA 1X82A 3L9JT 2ZS6B 5IK8A 4FAGA 1R092 3H0OA 4YGBA 1OFSA 1W6OA 3WVJA 2VTXA 5IFPA 1YQCA 2ZX0A 4Q26A 5F39A 3VBOB 1OI6A 4BJ0A 3RZGA 2A6ZA 1PVC1 2FDKA 4UW3A 2D5HA 3E6BA 3WHUA 5JZGA 3OBTA 2R071 2Y26A 1AX2A 4AAPA 3C7FA 4E4ZA 3MLLA 2XBO1 2RS51 2YC0A 4FI9A 3CHXA 1RXGA 4JGZB 4HONA 4Y1UA 3U11A 2W46A 1CWPA 2AR6A 2HWD3 4AFAA 4DB5A 1HB1A 2A71A 1I9RA 1RJ8A 5J09A 1IQAA 4B3NA 4HVRA 3VZNA 3FE5A 4IEVA 2Z69A 2VBPA 3MW4A 1OMIA 1UAIA 3GXUA 1W6QB 2W87A 3HAGA 3ALQA 2VJXA 3TB0A 3WY6A 2XBO2 2RS52 3N7KA 2I07B 2A73B 1JZ2A 5DPNA 4GH4A 2HWE1 3ZKUA 1VALA 1W2UA 2WQ8A 5F1RA 4HSJA 1O3RA 1YIFA 4NRMA 4HFSA 4P9YA 4LOSA 4PLOA 3WNMA 1VBC2 1R1A3 4N43C 1DQ0A 2VQUA 5T3NA 2G1MA 2J42A 4A6SA 2HWE2 1GOFA 1PO13 3FJSA 3WLUA 4KG8A 2WRAA 4PJYA 5FYTA 1LESA 5HV4A 3AVSA 3O1UA 1GWLA 2CHHA 4J1XA 3VBUC 3RZHA 4CVUA 2A6WA 3DYOA 2FCTA 4P5HA 1U12A 3DN7A 4O7XA 1W8OA 3ZN4A 2BW8A 2FDHA 1NUKA 1O4TA 2UURA 3GJBA 4NPMA 4PI2A 1Q56A 2VZUA 4HMZA 4QAWA 1VPHA 5IHRA 1NCRB 4YGDA 2H6CA 3IBMA 1KJRA 5EIYB 5CA6A 2V5YA 2VMDA 3J7LA 4TLGA 4MVTA 3HBKA 5FKCA 3NNLA 4BPZA 4BQ4A 1OOPC 5DUWA 3U0ZA 3U4XA 2OXBA 4Q4X2 4LA2A 3O14A 4JV4A 4QKNA 1ND2A 1FPN3 4LPLA 5FLJA 4EQVA 3ZFEA 4YZ4A 4H7MA 2K9ZA 3VKNA 2TBVA 3NL1A 1QJY1 2AGSA 2VVEA 2D98A 2WWUA 1HX6A 1SQ4A 3ZXFA 2VBBA 2UWAA 2C1FA 3NJZA 1C1FA 1CPMA 4K1ZA 4YVWB 5F5CA 4OHZA 3EO6A 4EJRA 1TE1B 1ENRA 5FYUA 5IWFA 4IE4A 1UMZA 3UJOA 5BUVA 4LO4B 1DGWA 4BMEA 4PLNA 2VCMA 3ZIWA 5KWRA 4K3UA 1Q43A 1YUDA 5A33A 4JRLA 5JUVA 1AYM3 3WF0A 3WF4A 3ZFFC 4MYEA 1HDKA 1LR5A 5HCFA 3E97A 5KXDA 4N7IA 3VHNA 2VH9A 4R9CA 3JZVA 2VOVA 1YQ5A 4B7EA 3O1VA 2VL4A 4XE9A 1SG3A 3E5QA 3JU9A 4AI1A 1O8SA 1W6PB 1Y9QA 2VY0A 1H4GA 4WVMA 2WT0A 3F2ZA 4ONUA 1XNKA 2DBIA 3POBA 5KHIA 4YVSA 1A8MA 5D8AB 1NX9A 2HEWF 3JD73 4KH9A 4AVAA 5I8YA 3RGBA 2D93A 4Y33A 2W1QA 5DMYA 2ZGSA 1JOBA 1H0BA 2WZ8A 3WG3A 1AR72 1K5MC 2IWGB 1QNYA 2NLRA 4JX0A 4AHWA 1S0DA 2HWB1 3V65A 2VZVA 4UOJA 4XFHA 1UWWA 5D1IA 5T55A 3EBRA 2E7AA 4RR3A 4CDUA 2EXKA 2BYVE 2WS93 2DDUA 4JKMA 4NUBA 2DWRA 2X5IB 1REEA 1H9PA 2C24A 3NNFA 3N9LA 1S4CA 5I91A 3H3UA 1SPPA 3UETA 4Y4YA 2WNVA 2VQ0A 1W9TA 1NG0A 1OHFA 1SZBA 2QQNA 2ZGNA 3OPWA 4XTMA 2H6BA 2HWB2 4XQWA 3AZXA 3ETPA 1W9YA 2WIIB 3O0VA 4LBQD 4ZY9A 5L19A 1E57A 4LBNA 3CEWA 3WP4A 1GZCA 2JD9A 4JKKA 5A1FA 1OT5A 3DGTA 4N7UA 4I3GA 4ZXKA 2B8MA 3MUZ1 4QM8A 3POSA 3KT1A 5D21A 4NPLA 1K45A 5IVFA 2XB6C 3U14A 3FUOA 4B29A 5JIUA 2XDVA 1BXHA 4TTGA 1J3QA 2CGOA 2QZ2A 4DXRA 3D82A 3VBFC 4YZ2A 1F8VA 1W3XA 1YJKA 1ND3C 1I5ZA 4RGGA 2GC0A 3DKWA 3I4IA 3A22A 4QB6A 4COZA 1AR93 5FZFA 4RHV1 1AR82 2LRPA 4PDWA 5SV8A 2YBPA 3HQRA 2BVBA 1GU3A 4UF0A 5DZFA 3H7JA 4TLFA 1GP5A 1QQP1 1WW7A 4K6BA 1UU4A 5F3EA 3SLIA 4HPKA 4LK7A 3CJIC 4E4SA 5CFDC 2VQAA 4OUSA 3ZXEA 3ZXLA 2JG8C 4RS5B 4CDQA 2E7QA 2YC2A 2YBKA 3AZWA 3S0MA 1A78A 3N9NA 3I7DA 2W1SA 2WLQA 2HYKA 1DQ4A 1W6NB 2ARAA 1DGWX 1LOEA 3KVAA 4EE2A 1CZSA 4HG6B 5FZMA 4BIFA 1RINA 1D4M2 3RYKA 2JG9B 2W92A 1BMV1 1ZVFA 4JDOA 2TUNA 1H2NA 4OI1A 3T4VA 1AXZA 3VBRB 2YMZA 1SFYA 2Y33A 3ZVXA 4LMFA 1RUJ3 4IV1A 3WCSA 1X36A 3MGUA 4ISQA 1EV11 5I0UA 3UKTA 4CP9A 5LATA 3V0AB 1BKZA 4XMAA 2O14A 4LQRA 4E2GA 3ZOIA 1BMV2 1WBFA 5IAVA 1CIWA 3SEPA 2ZEYA 3Q8FA 3T3YA 2P3KA 4LHNA 3RZJA 3VBSA 4CCLA 3ELNA 1QH7A 1OURA 1JI6A 4EYUA 3D3AA 4IE5A 4WM8A 3BU0A 1REDA 4LBKA 4QX8A 4I0AA 3ZFGC 4CCKA 1HV0A 1N3OA 1KQRA 3ACFA 3OGGA 4LLFA 4OHWA 4XDPA 2E53A 5AVAA 3NMBA 2ZHMA 3RMXA 2NP0A 3THPA 1WGPA 4NVPA 4AQ2A 1HQWA 1SACA 2ID4A 3D0SA 3ENRA 1L3JA 4LUMA 3TEYA 1ZRFA 4QD2A 1SLCA 1RMU1 3FC0A 5FY0A 3R0RA 3JB4C 3R05A 4AVVA 3VBOA 4NR1A 4BHPA 1AXKA 1J84A 2BOIA 2D97A 1Y9GA 1QDOA 2GP5A 4QPIB 1BJQA 5DDJ1 3MEPA 4BA6A 5C5UA 1OVSA 1GR3A 4O9EA 2GN7A 3H1WA 5JLVA 4BLIA 4JGZA 2IVIB 1H8VA 3FUQA 4WM7B 3WINE 2PHFA 3KVBA 1MVEA 2C4XA 1MZEA 3NV3A 2IXCA 5EPAA 4D3WA 5CEHA 3LCPA 2QFEA 4CXXA 4ZU7A 5I0RA 3OUIA 5FK8A 1FAYA 1YJLA 1NA1C 5DDJ2 3FLTA 3CMGA 4MZUA 4H3WA 4IE6A 4UBGA 1W6QA 2A70A 1UY1A 3WW1A 2JD4A 4CXYA 3USUB 5HCAA 4L9BA 4OULA 1QJU3 4QQPA 3RWNA 1MVQA 2JJ6A 1DLCA 3N7JA 2YZ4A 5J48A 1HB3A 1GQGA 5CU1A 1F35A 2QUOA 1OPMA 2V73A 5JVVA 3AKQA 4TWTA 1URXA 1OLRA 1ZBE3 3DPRB 2LM3A 1WLCA 3NVCA 4LA3A 1RUE3 4EROA 5A1AA 2PHWA 3EQEA 5I0DA 2XQXA 2XJQA 3UGHA 2ILMA 1E5HA 1BZWA 1OLME 2WINB 5T5JA 4OHYA 1ZA7A 3OD0A 4NHLA 5DABA 4AZZA 1O3TA 4AEDC 4BQ2A 2W91A 4D69A 4XQ4A 2R7EB 4CCOA 3NNMA 2JDUA 1LU1A 4N9HA 5K0UB 4GWIA 1GWKA 2R6QA 1UPIA 1RXFA 1VMHA 3ZXDA 2VE1A 5FZKA 4QPGC 3H3LA 1UX7A 4FOWA 2Y60A 1QXPA 2EF6A 3LD8A 2QKDA 4LBOA 1QHDA 3PDQA 4OMCA 5ABJB 5BNPB 3OCPA 2D3RA 4EN9B 2B4KA 4BOWA 3GF6A 4FPHA 3RZZA 2J1UA 4LTAA 4COVA 4KI5M 4IE7A 4CP1A 1U5YA 4FPKA 4JHZA 4ZXEA 4AI8A 1TEIA 2VM9A 2Y38A 4GJZA 1V6IA 2PHLA 4ARXA 2XJSA 3RZKA 3VKOA 2ZMLA 2DCZA 3FZ3A 1ZRCA 4Q8LA 1JODA 3BTAA 1CAWB 3ASIA 4I3PA 4IUGA 3U1XA 1AL23 1UF2C 4QWNA 3E5XA 2RDSA 4QX0A 1MS3A 3URFA 3H1YA 2P3JA 1ONAA 4CU7A 3ES1A 3AXEA 1LHVA 4OYUA 3A21A 2CWMA 1NLSA 1YHFA 1A8DA 1PGW1 4LKDA 2VNVA 4XHXA 1LHOA 4A3XA 5ACA1 4XF4A 4JKLA 4U2AA 1ZX5A 3ZLIA 1W6PA 4IEYA 4PBOA 3BTXA 1DGRN 1PGL2 4Q4Y3 1LGBA 1ZBA3 3WG4A 5D8AA 5FO9B 1HV1A 4BQ1A 1PGW2 4UXAA 4IEUA 1N1SA 1FXZA 4PHZA 1JYTA 5ACA2 1OLMA 2HLEA 2A3YA 1LOCA 3EMRA 4QDSA 4XCBA 2ARBA 4CE8A 4AI9A 1POQA 1O3SA 5IAXA 1W2TA 1PIV1 4WV8A 2E7TA 1LENA 5LBEA 5FREA 1AXYA 1B09A 5FZCA 2QBXA 4Q1RA 2C9KA 2JB8A 2X5IA 1W6OB 2ZKLA 3W5MA 5FPZA 2DYCA 5FLIA 2JEMA 5DQ0A 1RYYA 4OQ9A 4D7TA 2DVBA 3BB6A 3DECA 1EYBA 4SLIA 2GDFA 4HETA 4DXZA 3B3QE 2W9XA 2Q30A 4J1WA 2D6OX 5JZGB 4QQLA 4MV2A 1F9KA 1XSRA 2R043 1FMD3 4W6XA 4ES9A 4CP2A 1Z7S3 4MH0E 1XU2A 2GSYA 4QHBA 2X8KA 4RD7A 3ZMOA 1R1ZA 5C3SA 4OI0A 1TNRA 2ZCWA 2FDIA 3DV8A 4YSFA 3PNAA 3RDIA 5BNNC 1JYWA 1TME1 5DG1A 2O8OA 2RJ2A 2RHPA 4PCRA 5C8WA 2WWJA 2R32A 5L9VA 1F5JA 1XYNA 4LE4A 4E9KA 2QQVA 2R061 4Y5SA 4NAMA 2X10A 1NQDA 2WAAA 2KXLA 1DYOA 1PO23 4D7YA 5CFCA 4JQRA 4GH4B 4LO6B 3UNPA 2P4EA 2JDYA 1S0GA 1ZRIA 1KFXL 1N3PA 1IGOA 2WO7A 2BDRA 1TME2 1C8M2 1Y7BA 4FPLA 4IV3C 4PF5A 5K8SA 2FHRA 3LIGA 1IG0A 4UFMA 4XUPA 1MQTB 4LIVA 2BNOA 3GZTB 5FP7A 5FV3A 3W5NA 1CZVA 2D44A 4BM8A 3VDBA 2VZQA 2BRTA 2PELA 1BBT3 4Q27A 4WVWA 2CTVA 2ZX1A 3GALA 5FY1A 3CJXA 4CCJA 3INAA 3ZIXA 4MGIE 1N3QA 3MICA 1JYVA 1JZ3A 3CJIA 3PTRB 2RJLA 2JE9A 3ZYHA 4QGLA 5FZIA 5GZEA 4DIQA 5C5TA 3HMYA 4FQZA 1W8FA 2BOJA 2VZTA 3B94A 5LASA 2JG9A 2EAKA 1EUTA 1S0IA 3GZEA 2J1SA 3ZPOA 4XZUG 5DAPA 2ARXA 3VN4A 3WF3A 1LAJA 3POFA 1RUI2 4D0QA 1Q3EA 1REFA 5I8TA 2QNKA 4HN0A 3ZYFA 4MGSA 3H3ZA 2YBSA 1V9U3 3WUCA 4PIXA 1RUD2 1JU4A 3PTYA 4CDXB 5FYBA 2DCJA 3KV9A 3ZR6A 3V0AA 2IXKA 2OUJA 2BVVA 1UZVA 3M70A 1YCIA 2RM23 1LOFC 1GUIA 1PM4A 3LFIA 5KC6A 1W2NA 4XBLA 5A3UA 1Y43B 3AYEA 1W0PA 2Y0IA 5KHKA 4E2SA 4HXCA 1XC6A 3ZFEB 4XUTA 2DVAA 4INDA 2ET7A 4FP2A 1UKGA 2VUAA 3BODA 2W52A 4P9XA 2LUWA 1SFNA 1JZ8A 5JCTA 1SHWB 3NWKA 2GN3A 5IATA 4GB33 2MNGA 2RDNA 2VU9A 2Y6LA 5JXHA 1ACCA 4FTBA 5LWBA 1GBGA 1YXWA 3WP5A 1P8JA 2J1RA 2ENRA 3GHNA 4AFMA 2W1UA 5A3TA 3MBWA 2VXJA 2RMU1 5JI7A 1EY2A 4DS0A 5A33B 2JDMA 2VCBA 4QPIA 2VO5A 2PHUA 2VOTA 3Q8AA 2ES3A 4LKFA 2BWAA 1ZZ8A 5I8SA 3UKVA 2ZA9A 2Q1ZB 3RJRA 5BPXA 4WM7A 4LT5A 4A7ZA 2DURA 1DYPA 3IZOA 4WVMB 1DFQA 4W8JA 3WQBA 4F8AA 5ANQA 2HH9A 1MS5A 2B7YA 2RMU2 4DQAA 3OEAA 1FT9A 3M3IA 1CESA 3KM5A 3NNGA 4LORA 4L92A 3RZMA 5A3NA 3J26N 4CRQA 4XXPA 3NKTA 3IN9A 5FYSA 2R0FA 1V6KA 1M06G 3USUA 2XL9A 1PK6C 3BYWA 2ZGQA 1UU6A 4XFGA 4AL9A 3AX4A 3V0BB 2VD7A 3IIAA 3VKFC 4CU6A 4UAPA 4HT1T 4CDUB 2VTXJ 4QGMA 3IDEA 4FCAA 4QMAA 2YYOA 3HVDA 3OY8A 4LIUA 1W8WA 5EJZB 3GGLA 3JXSA 3THTA 4Q1PA 1ENXA 5FQ0A 3CBNA 1YO8A 4K9SA 4YG6A 1VBE3 3ITQA 2HWF3 5T50A 3CIHA 3VZLA 5FAXA 2W94A 5FR3A 5J96B 1S2EA 3I3BA 4BQWA 3IWZA 1RUH1 3OD4A 4KMQA 4YW3A 4F7ZA 5FOBB 4GZ9A 1W0OA 4LBLA 1FPN1 1OQDA 2DVFA 4AVCA 1H8TC 1DGLA 4TZDA 3LOIA 3PMSA 2PMWB 3GJAA 5K0UA 3HT1A 4UFKA 5KR7A 4AEDA 5AC93 4MGZE 3HT2A 4MLOA 3BOWA 3MZHA 2YPDA 3POYA 1SDDB 4A45A 5IVYA 1FNZA 2ZPXA 4FXGB 1AYN3 1FPN2 4NHYA 3LA7A 5A7QA 3RS6A 2P2KA 2OPWA 5JOWA 4N90A 4PDWB 3OBRA 3VBHB 5GZDA 2VC9A 4XAAA 4UF0B 2O8QA 1X8EA 4XABA 3RVHA 1ZYBA 5IW0A 4Q8KA 3ZO0B 5C4WB 3LEGA 4XETA 4HPKB 2WLPA 1IKQA 2OS2A 3MW2A 4LULA 2VZOA 3VD7A 4AI0A 1CR7A 2NPIA 5H9QA 1HQNA 5B4XA 4XC9A 5GZGA 3EYPA 5AFEA 3WZ1A 4DINB 5DZEA 1AYM2 3W9AA 5L73A 1C5IA 2D6KA 5EFUA 4BU2A 1C1LA 1LEMA 3ST7A 3HEIA 5C7GA 1SDWA 1LOGA 2IXLA 2PLV1 3POGA 2ZAAA 4YG0A 4Z8BA 4HVQA 5EYYA 1LU2A 1XE0A 2I2SA 2NN8A 1NLRA 2W5FA 1AJOA 3SXWA 1JYNA 3VHPA 4V2VA 4DRVA 4EWDA 5FWEA 1GYKA 1BK0A 1O6UA 4PF1A 4XF9A 2DCTA 3CO2A 3JD72 3ZYPA 3OF1A 4QX5A 5AVPA 2VPVA 4FFGA 3OBAA 4Z1VA 5FZLA 1SMVA 1JN2P 3S57A 2GC3A 2WC2A 5JDBA 3S5QA 1JZ4A 4GAZA 4IGPA 5LCWL 2GMEA 2ZGTA 5C9AB 1QXJA 5JPMB 3HQUA 1XYOA 4KGGA 4DXSA 1BYHA 1R091 3IMMA 2EXHA 5T5PA 4C1WA 5FMDA 3WDWA 4WM8B 3OGVA 2HEVF 3EHKA 2UU8A 3I59B 2ZBJA 2QQLA 4IEXA 5FJHA 3O1PA 3AXDA 5FY5A 5CBLA 1GNZA 4J25A 1VR3A 5B4NA 5J98B 1DYKA 1RVF3 3POIA 2RR11 2XQRA 1SEFA 4BQYA 2DFBA 1RUC1 4R8HA 2EIEA 3WQ7A 4OZOA 3SMHA 1LRHA 1XBFA 3D5OA 2BBVA 1QIQA 1W05A 2H0VA 2W47A 3NAPC 5DZGA 4B4PA 1MEC3 3HJRA 4L99A 1LHUA 2C0ZA 3WCRA 5A6QA 5FIXA 2Q5TA 1O59A 1WUVA 1OA2A 4XF3A 2WZPP 5A6ZA 4ZKTB 4MXVA 2RR12 1WWYA 5SV5A 3IM0A 3X29B 3HN1A 1AR92 1RUC2 3O12A 1CJDA 1Z0HA 1HXS1 5A7WB 5A80A 5D2AA 5E89A 2ZGOA 1Q8QA 2W3JA 4Z2WA 2PAEA 3AKSA 3PU3A 4XXAA 3ZXJA 1QXRA 2UYAA 4FQ4A 5KXBA 2JDAA 1VBC1 1JUIA 2X53S 2ZHLA 5IK4A 1HKDA 5CKMA 3AZVA 1WCSA 5ERLA 1W9FA 1YFXA 2RVAA 4YYOA 2WUHA 1W8NA 2JKBA 1IHMA 4XJ9A 4GJYA 3LAGA 4FP3A 4BZ4A 1HXS2 4XFBA 3ZSKA 1MQTA 1OD3A 3O0XA 2NZ9A 4IV3A 2FZ2A 5A7SA 4KWJA 2JDNA 1W2OA 5F9TA 4LEJA 5CIRA 5E6HA 4KG0A 1VRH3 4KNCA 5LA2A 1VBA1 4BYYA 5A6XA 2YFUA 1AX0A 3I2KA 4N43B 2VUDA 4QX1A 4HKOA 4KBZA 2RS33 2RG4A 2LALA 1DZTA 2LTNA 3UGFA 4BXSV 4NWVA 1PNGA 2VVDA 5F5IA 1C8NA 3LB9A 4Y24A 4MADA 3B02A 2DU1A 4LLOA 1VBA2 2JX9A 3MF6A 4AWDA 3VBUB 4LKSA 3MIHA 4JHTA 4Q4X1 1ZZBA 4AR2A 1TMF3 2E9QA 1HLCA 1WD3A 3H9AA 4WZFA 3WG1A 3WDVA 4CDXA 3NW4A 2VQTA 3UV9A 3QBQA 5FYVA 5GLTA 2P17A 4D6SA 5FBZA 3ACLA 2E26A 3GDBA 2A1XA 4NPRA 1OSGA 2OQ6A 3DYPA 1EAH3 2XUEA 3D6EA 3E5UA 4UFHA 3W20A 4XJ8A 4E8CA 1NYWA 5EWSA 3MPPG 5A1LA 2G4IA 4FPJA 3WR0A 3PMEA 1O3QA 2R16A 2D6PA 1OOPB 4J6GA 4NRPA 2XJVA 4ZONA 4CU9A 2WYSA 4DEQA 2NMNA 4FO9A 2XLAA 2XWJB 4M01A 1OPOA 3WDXA 2V5DA 2ZEWA 1YQ8A 3JCIA 5KBFA 1PHMA 2BU9A 4COYA 1GZ9A 3K4ZA 3S7EA 4HOOA 2Y34A 4N53C 4Q0VA 1HRI3 1F4AA 3VGIA 1FYUA 1VAMA 2W1WA 4EN0A 5FZOA 4D6QA 4B1MA 2YPJA 4M3CB 4S2HA 4DUWA 1JZ7A 3DKQA 3K4AA 1GZWA 4XAEA 4MGQA 5G05L 5EJ1B 4FTEA 4AW7A 2NQYA 4CDWC 4CTEA 2WFF1 1ZBE1 4D8MA 5EYXA 4DPNA 1UO9A 3TAYA 1RUE1 3ZFFB 1MS0A 2V09A 4L97A 1QJU2 1AR71 1DU3D 2QQMA 2ZX3A 4CEYC 2W08A 1ODNA 4YARA 3AYAA 1UOFA 3AMPA 4M4PA 2VGDA 4AGGA 2WQZC 2AACA 3LOBA 1QNWA 2UWCA 4AVTA 1QJX3 2YDEA 4RQPC 4B1LA 2WFF2 1ZBE2 2PQSA 1S0FA 5E16A 3H1MA 5IT6A 1RUE2 1QGLA 2Y6HA 4GALA 2IC1A 4F3JA 3ZSEA 3V0BA 4QU2A 4JRAA 5FK7A 4XUNA 2B5HA 2Z79A 3M3CA 3QD6A 2ORZA 4JQTA 1PK6A 1KITA 3I2DA 4EZHA 1K5MB 4W65A 4Q29A 2OZJA 3WV6A 5A7NA 2XHKA 3E6DA 3ZSLA 1O4ZA 2JDPA 3KT4A 5A6YA 1Q5OA 4OUMA 1FOD1 1D0HA 1LODA 4OFGA 3NJYA 5EHDA 3B00A 3VD3A 2ZACA 3LEMA 3M8LA 1R64A 3NV1A 3AZYA 1TZOA 1H6YA 1UZ0A 4Z2AA 1AR81 1VBD1 2CNAA 2A75A 2D5FA 2EIBA 3ABZA 1D7PM 4XJUA 1U0AA 1FOD2 3TRSB 3S7IA 1RGSA 4B7KA 1FNYA 2DBNA 1VBB3 4YM0A 1TQ5A 1SLLA 3HNBM 3Q8BA 2E33A 1WLTA 3HBZA 1RUG3 1OVPA 4MG2A 1X33A 1VLNA 1ULFA 4ATEA 2WBKA 2O1QA 1RHI3 4MOAA 3JB8A 4WVVA 1X8MA 3WHTA 4FAHA 2D3SA 3WUDA 1VBD2 4AEJA 3VBFB 3VBHA 4IGOA 2XJRA 1ND3B 1BVVA 3IPVA 3AMMA 4HK8A 1A6CA 5FZ3A 1D4M1 5C4WA 5IK7A 2WNEA 1WCDJ 3WDUA 3T1MA 1AL22 4BXFA 4LBJA 4NHKA 3WSOA 1FV2A 3AVRA 3RI9A 3MPBA 4L0PA 4XVHA 3CJIB 3J9SA 1BEV1 5CFDB 4KBBA 3DL3A 2JG8B 3VDAA 1OUXA 4DEVA 4NHXA 4Y5Z0 4HK9A 3RJ2X 2ZEZA 3W59A 2E51A 4FVVA 4OI4A 4UWDA 3O0WA 3U37A 4Q0PA 3AKRA 2VNOA 1PVC3 5L36A 2GH2A 1GOGA 2G19A 3J4UH 5IK5A 4Q4Y2 5F3GA 1BEV2 5C3OA 1O5UA 2R073 3DXUA 3LE0A 1DQ2A 2WO1A 4AEMA 4MGYE 2RS53 3VBFA 2L9LA 3DCQA 1ASJ1 2E31A 4LJHA 4GD4A 3WXPA 2HWC3 5F7UA 2WSVA 4E8DA 1NKGA 2KD7A 1W06A 5DUVA 4P00B 3IAQA 4BWOA 2B9VA 2UYBA 5FOJB 5FPXA 3LQCA 3A7QA 5C9AA 1Z7S1 5APAA 3B7MA 3KS7A 4BISA 4Q0SA 1ASJ2 2BFUL 2ETEA 4OLLA 1SBFA 4XUOA 5F2SA 3I59A 5DAWA 3GYDA 4XURA 3KZ4C 4XCAA 4Q2FA 2K0GA 2Q1FA 2FBEA 1K12A 3OUJA 3J7NA 3GHMA 2VMFA 3NJXA 3ZFGB 1QOSA 3HQXA 4IEPA 2LROA 2R042 1FMD2 1FX5A 2AENA 1NCQC 4XZPA 1ZM1A 1Z7S2 2VMIA 3KV5A 2QDNA 3AB0A 5FXZA 3T0DA 5CZKA 4W4ZA 2BPA2 4LUKA 1CX1A 3OJBA 4ISRA 1PGSA 1VB4A 4Q0QA 1D2QA 5DG2A 1JYXA 3FLPA 3PUSA 3LDRA 3PVBB 5EP9A 5FUPA 3WNLA 1AF9A 4UYBA 1PMIA 3RSJA 1QMJA 4GXLA 4DY3A 1UXZA 5FZ4A 3TNPB 4AGVA 3S5AA 1GP6A 1UIKA 5HXMA 3Q9OA 2XVKA 3KF3A 3MYXA 3NV2A 1PO22 5FY8A 5KHHA 2FDGA 4XACA 4HZFA 1YI9A 1N1VA 2WNUC 4Y1XA 5A7WA 3NNJA 1D0GA 5IFTA 3HD8B 4C1XA 3PUIA 5HPOA 3I49A 2TNFA 1YQ2A 4P08A 3I2OA 1KFUL 1BLZA 2LS6A 3QCWA 3VB9A 4XJWA 2G9FA 1LJ7A 4OUEA 1NA1B 5FP8A 2G9GA 4P9GA 2XXZA 1NZCA 5CKQA 5F6KA 1UQXA 2WO3A 2YFZA 3ZPYA 1W9SA 2D43A 5JOZA 3OY8B 3OB8A 5FQ0B 4GA9A 2P34A 3OGRA 4I2OA 2C26A 4AAXA 2OIIA 1V70A 1MZ5A 5C8CC 1QJY3 4D7SA 2IXIA 4KQ7A 2W95A 1WCUA 2ZGMA 1G9CA 1MR5A 1VAVA 1CGPA 4AQTA 1TNFA 4H2AA 4YW4A 4N43A 1SLBA 3LF7A 3POJA 3C7GA 1V9U2 4QKBA 4QM9A 5CG9A 3IDCB 5CFCC 1KEXA 2PTMA 1EUUA 4XFIA 1JW6A 1RUF1 3H8UA 3DUIA 3AJYA 3WW4A 4CA9A 2FMYA 1UOBA 1ZNPA 1UNBA 2ZGRA 4LITA 4AEDB 1ZREA 2AREA 3TWIA 3VBUA 3K4DA 2Z5WA 1OC1A 1COV1 1PX4A 3R4UA 5FKBA 2Y6JA 1M4WA 3V64A 2GALA 1H2LA 1DZQA 3CU7A 3GBGA 2E32A 1LCLA 3V56A 4XDQA 2RDQA 4QPGB 4QPWA 1OA4A 4XILA 3ROUA 5EJ3A 4CUBA 1RUF2 1MS1A 1UMHA 5C33A 1NQJA 4B4RA 2WAOA 5F37A 5CB7A 1WW6A 5JI9A 4GQ7A 4IGQA 1Y4WA 4QHOA 4GB32 1COV2 5HXVA 2JIJA 3I3DA 5EZWA 4HBNA 1YWKA 1RITA 1US3A 2WNOA 1OH4A 1OOPA 2QJVA 3WT3A 1YFYA 4H14A 1GKBA 2HWB3 1RJ7A 2XKPA 3VZOA 1XYPA 4MGKE 2OPKA 4ASLA 4CCCA 4QGNA 5F2WA 2P6HA 1KJLA 1J3PA 5FZAA 3WQ0A 5FXWA 5FYMA 2N7GA 1NOVA 3P6BA 5JXIA 5GZFA 1CN1A 1Y9MA 4Y20A 5FZ9A 5AFBA 4V2WA 3G7DA 3RZLA 2P3IA 4M3CA 1KRIA 4AK3A 1PGL1 1XPWA 5FPBA 1GQPA 3RFRA 2PHRA 2DV9A 3P3NA 3LDBA 5FZBA 1QH6A 3UL2A 1CX4A 2PHXA 3PVEA 3WF2A 4QXBA 3S30A 4CPBD 3MI8A 3AZZA 3CZUA 3ZFFA 1J59A 5FY9A 3SCFA 1QJEA 3SISA 4O65A 5LK7B 1ZZ7A 2PYTA 4FXKB 1W04A 4K20A 1B35C 5JWPA 2W2IA 4ZU5A 4BH9A 3M3EA 1VP6A 2WZR3 1DHKB 4Q0UA 2BBAA 1I3HA 4MGTA 1GV9A 2DTYA 5LBFA 1UYZA 2FCUA 3BGAA 4IEOA 2RDRA 3K3NA 1IPKA 4RHV3 4RQPA 2WDBA 4KGQA 3OUHA 3OSDA 1PZ8A 4DUVA 1QQP3 2GNMA 2VOKA 3I2HA 2Y6GA 1XNAA 1X7NA 1RL3A 1K5MA 2J22A 2WFPA 4HKLA 4K8FA 4JDMA 1BQPA 2B9UA 3ZSMA 2VMEA 4YFWA 4ITCA 4ASMB 2C5DA 1F15A 3WDTA 4AHYA 5AC92 5C3QA 4R4ZA 3GCWA 3FHIB 4N9IA 1SFPA 2GC2A 4HLTA 4EZ4A 3VZKA 3AYCA 4YPJA 1AYN2 4MX3A 1PMJX 2YGMA 5FMCA 2OYZA 4CYDA 2XJTA 1C57A 1JOPA 4XDOA 2XGXA 1C8M1 3OGSA 4HANA 1PZ7A 1VJ2A 4ZZ5A 1AL0G 4NN0A 4L11A 4LHLA 5BNNB 2QQIA 1H4HA 2QVSB 3ILFA 2VNGA 3DXTA 4QXHA 1EV13 5FPVA 2AC1A 3RMYA 3QOPA 2EA7A 4U36A 2RS11 4CXWA 2R30A 2ET1A 1ND3A 5JSOA 4E27A 4Y22B 3IDAA 2JDZA 1CAUB 5JPNB 3FL7A 2BGPA 4IV3B 1CJPA 3KHBA 2DTWA 5FBJA 1R081 2CY6A 2RS12 1RUI1 2WA3A 3AKTA 5CFDA 2QQKA 3T0BA 3AK0A 2JG8A 1G9BA 3MIFA 3B93A 2BV4A 1KDMA 1LGCA 1RUD1 4XOGA 4C0BA 3T2OA 1RMU3 2DFCA 4PLMA 1L7RA 4YFZA 2BQPA 5FJKA 1IS6A 5FYYA 4B8EA 1JHJA 3R4DB 1R082 1GNYA 2KA3A 4S2DA 5DDJ3 4DNYA 3MFCA 5L7OC 4UT5A 5DUUA 1SBEA 3C2UA 2BEOA 1W39A 2VTFA 3GCXA 2ZMNA 4G4FA 1DGRA 3FMGA 5FCCA 3FBYA 1HQLA 4AGRA 5K9YA 5IVVA 5ANNA 1UXXX 4XJZA 4ORFA 1DF0A 2Y6KA 2Z4FA 3J8F3 3LPFA 4PI0A 1UZZA 2J1VA 3FX3A 3OPZA 5JMCA 3MV11 1CQ9A 3SEEA 1RVF2 3GBFA 3Q8CA 1DLLA 5CNAA 2OT7A 1AR63 1VMFA 2HWD1 4NJ4A 1L7LA 1H1IA 5BNOC 2EIGA 5FUIA 3ZM8A 3FHAA 4ZS2A 2IXJA 3EXUA 3ZFGA 3ZXKA 5BXXA 1K3IA 5FXXA 4IESA 3K51A 4DOUA 1YLLA 5FYHA 3VD9A 5FZOB 5C71A 2D6MA 1JXNA 2G9ZA 4RN5A 1ND2C 2HWD2 1OF4A 1WBLA 3N7MA 4W6WA 1GZWB 1UX6A 5H9RA 1MS9A 3LFMA 5JR2A 2O0OA 5FZ7A 3NRUA 4Z07A 4BK4A 1V0AA 3TN93 1UL9A 3RWKX 3JBG3 1PVXA 1R1A1 2VMGA 4PQ9A 3LEIA 4KWUA 2JWPA 1VRH1 3ZXGA 4A3ZA 1V6LA 4P14A 2CGNA 4DY5A 1PO11 4IE0A 2Y6FA 4JGYC 3WNOA 4AE2A 3PUAA 2QQPA 3M7AA 3T2QA 2P6CA 2V72A 3PHMA 5ISLA 3N7LA 2VCCA 2ZXQA 1SLAA 1UY2A 2WNUA 3APBA 4I01A 4YW1A 4OHXA 2ZGUA 3VKMA 3ZDSA 3ZN6A 1GWMA 1F4HA 1GLHA 1R1A2 3OYWB 1NA1A 3ZYBA 1VRH2 4YZ1A 1UY0A 4A42A 3KGLA 3CF6E 1PO12 2WN3A 5KXEA 1DDLA 1PK6B 3I97A 4XBQA 3OPTA 2A7AA 2VBDA 3KGZA 3SKJE 4YVSC 5JOYA 3BIEA 1XOYA 4F83A 2ZGPA 5A3LA 1ALYA 1ULPA 1JTZX 3WNPA 4ATFA 1RUNA 1D4VB 1X50A 4A7KA 3C7OA 1MZ6A 2ZJCA 3CL1A 3ACGA 3H42B 3AP6A 4GULA 5JOXA 4XFAA 5C8CA 4Q4W3 3BALA 1OD5A 1UY4A 1TMF2 3B69A 4RR3C 1XNTA 3RI8A 2NM1A 3A23A 3ETQA 1JOJA 4C0HA 5EXOA 2UY9A 2WNVC 4UI9L 5FO7B 4L2NA 4Y26A 3UKNA 1H8TB 4Y1ZA 1JBCA 3VD5A 4CCEA 3VHRA 5GALA 3NKGA 1G9DA 3WW2A 5ACA3 2WA4A 2A3WA 2ZHNA 3TEWA 4Y3OA 1Z78A 4QPGA 5GLVA 3R6SA 4FPCA 4IEWA 2JECA 1AYM1 4CEWC 2CDPA 1ZZ6A 2HYXA 3IPVB 4AVSA 1CONA 2OVUA 1LKNA 2P3YA 3T30A 4FT8A 1IS3A 1Q8PA 4XUQA 2WT1A 4EWAA 4CU8A 3BKZA 2CAVA 2CWSA 2EXIA 2JKXA 3NSTA 1UY3A 2Q8CA 3ZKYA 4CCDA
chains in the Genus database with same CATH topology
1EPZA 5A32B 1PIV3 3LGRA 2CAUA 2BNMA 3JD71 2ZHKA 2BGCA 1OA3A 5BY5A 5FO8B 1ULDA 1F5FA 4X6QB 3AJZA 4CDQC 4XPVA 2DU0A 1BCXA 3TOJA 1QJX2 2WS91 4AI2A 1YYNA 1Q8VA 3I8TA 3ZYRA 3BPZA 2MEV3 1OQ1A 2R1DA 2XVGA 3B5LB 1XE7A 4I0WB 4AHZA 1TME3 3LZZA 3FBMA 3KCCA 2ZZJA 3ZXAC 2XJUA 5BV6A 2YXSA 2CYFA 2WS92 2VW0A 2R063 3N35A 1B35A 3D4KA 3T1LA 4YZ5A 3GZUC 4IV1C 4Z92B 2GC1A 3VHOA 2ZKNA 3GZAA 4LNVA 2Q4SA 4YLZA 4RGAA 2XJPA 3VDDC 5JSPA 4PIZA 2R1BA 2VG9A 3QH6A 4QQHA 3AP7A 1H30A 4BCUA 4G3YC 3ILNA 3VBSC 3QLQA 1AR91 3WX5A 4V1PA 4R4XA 1NY72 2B46X 2H0BA 1OFNA 3SCGA 2BUKA 2SBAA 1V6MA 1W6MA 2JICA 1CAVB 3E6CC 1QWRA 4LHKA 1RUG2 3SH3A 5JAXA 1DQ6A 3NAPB 4HN1A 1RHI2 3S6PA 4B8EA 5T5LA 1G9FA 5H9SA 1D2SA 3MIDA 2XLGA 3QH7A 4R9AA 2ATFA 1A3KA 1ULCA 2R0HA 2FQPA 3VBOC 1EPWA 4GMP3 1IKPA 3SH5A 3MDPA 5BNNA 1ENSA 3AMNA 1S1AA 2GNBA 2CV6A 3BCWA 2CGPA 1S2KA 5CG8A 3LA2A 4JGZC 3FFQA 2ZOEB 4Y22A 1RUJ1 3LA3A 2JE7A 2ZMKA 1CAUA 2HWC1 3AP4A 1DQ5A 2JXAA 4AHXA 3AKPA 1H1MA 1DZRA 1PVC2 3KMHA 5H9PA 2CL2A 2R49A 2R072 4NO4A 3IT8A 2YGLA 5JR7B 4P9WA 1RUJ2 2ZGKA 3ZYJB 2D40A 2HWC2 3A0NA 4YG3A 1V6OA 4M00A 4AFBA 1YRZA 4PIYA 2RMU3 3KD4A 5C6CA 3MF9A 1APNA 2XKOA 1NXD1 3SCHA 4AQ6A 1IS4A 2GU9A 5L7OA 1YNAA 4M3CF 1AJKA 3M1HA 3I54A 1UN1A 4Z82A 1N1TA 3L2HA 1J1TA 4XQDA 3W58A 1AHSA 2KM2A 4COWA 1LOFA 4YW5A 1JYCA 4XTPA 4FOQA 2MPFA 4GIQA 4K40A 2W39A 1NCRC 4AQSA 3VUOA 1H1AA 2ZAHA 1UU5A 4KWKA 5BNOA 4O9GA 5KC5A 1RC6A 4Y20B 1QJU1 4Q4V3 4KU7A 4YNIA 4AYUA 5J7MA 4N53B 4LE3A 2PAMA 3LKJA 1RUH3 2XUMA 4BE3A 5LEJA 1I1EA 4UW5A 4XHBA 2BTVC 3ECQA 3A4UA 3M3QA 4YVWC 3RG0A 2BFUS 2VUJA 4CDWB 4FTSA 3AMHA 3MW3A 2DVGA 1XNBA 2A6VA 2AH2A 1WMDA 1HRV3 3WG2A 1GQHA 4CEYB 1S0BA 4DZGA 3MFAA 4JGYA 2AYHA 5HCBA 3JQXA 4RQPB 3OYWA 1QJY2 1J3RA 1ULEA 2ZGLA 2WKKA 4FPGA 5BNQA 1BVP1 3EJKA 4K7JA 3OTFA 2XPJA 1XRUA 4XW3A 4EN6B 1LULA 1IS5A 1MZFA 2PN5A 5D8AC 4I30A 2ZZQA 1UW8A 5JIAA 3TNQA 4KU8A 1NE6A 1AZDA 2PLV3 3IKWA 5J36A 1LHNA 4OI2A 1WW5A 2X5IC 1ZRRA 1S0CA 5FLHA 5GLZA 1DQ1A 1J1LA 4HSLA 2YY1A 4ES8A 4IETA 1H8TA 2VMHA 5EV7A 3ZSJA 1PNFA 1AL21 1SLTA 1KXGA 2PA7A 3MLJA 2W0XA 1POV3 5T5OA 4AG4A 4OZXA 1R093 3M2MA 2K2SA 1UKRA 4CEWA 3GBWA 2I74A 3GNEA 1WCKA 4AXOA 4Q4Y1 4JC1A 5A32A 1ZBA1 4YRDA 2WZR1 4EV0A 1DG6A 4GKYA 2RR13 1OLQA 3PJYA 4L8QA 2QZ3A 4RSUA 4DFSA 1RUC3 4X8PA 1XNCA 2A5ZA 4JVAA 4HL0A 1XNDA 4FOYA 4QT6A 5LRRA 2XL7A 4RS5C 1UZYA 3USSA 3MIBA 2F4PA 4QQ2A 1VIWB 1XE8A 1ZBA2 1G86A 2WZR2 2XBO3 3LSEA 1QDCA 3JQWA 4XF0A 1FV3A 2DCKA 4LBQB 2QE3A 4RHV2 5F6LB 2JG9C 1HXS3 1QQP2 1CAXB 2R041 1FMD1 4JTOA 4XJAA 5IUQA 2B45X 4LO5B 3VBRC 5HI0A 1VBC3 1ENQA 1Y3TA 4PBPA 4EWEA 1RTVA 1AVBA 2HWE3 3SNMA 1SCSA 2OW4A 2PHTA 1GANA 2GMMA 3N36A 4LR4A 2EVXA 3VZJA 1H9WA 2WQ4A 3RNSA 4AF9A 2D6LX 1PO21 3JUUA 3VDDA 5I0TA 2W68A 1VBA3 2OUHA 1NCQB 3U10A 1MS8A 4LBMA 1V6NA 1LHWA 2VNRA 2PFWA 1CAVA 3TBDA 1BBT1 1EV12 2NMOA 4XIKA 1LEDA 3NAPA 3N4MA 5KHJA 2WJSA 4P9JA 1NE4A 1GSLA 2PQQA 2VW2A 1NXMA 5LRSA 2D7FA 4R9BA 4Q4X3 4M3CE 4QPIC 3ZN6B 2WNUB 2WL1A 5DUXA 1MACA 1BBT2 2AZ5A 5TSWA 4EN8B 5K7PA 5E8AA 5T54A 4WM7C 3ES4A 1OKQA 2RJKA 1V9U1 5J37A 3IDBB 4JDNA 1RMU2 4UW4A 2DUOA 4HVOA 1ZRDA 2RM21 1G9AA 3J8F1 2GZWA 4I09A 4BMBA 4A2UA 5C8CB 5KHGA 1F2NA 4YZ3A 3BIWE 1AR61 1C28A 4E4DX 1N47A 1RIRA 1VAKA 2D6NA 3DPRC 4QQOA 2RM22 5CFCB 3J8F2 3KCYA 3KSCA 1KS5A 2IFWA 2WFF3 1Q8SA 3O5SA 1JUHA 4GB31 2UWBA 2VXRA 4GMP0 4UBHA 1UCXA 4DRRA 1AR62 1AR73 4XYXA 1U5IA 3HR9A 3K48A 3VL9A 5A3MA 5JSRA 3AFGA 1UD1A 1XXNA 4KL1A 4MXWB 1SCRA 5K0UC 3TN91 2TEPA 4OHVA 3JBG1 2OA2A 2Q0AA 4IEZA 4C90A 1WLWA 2VECA 1U5XA 2WSUA 2YUEA 2DF7A 4MUVA 1F31A 2QDRA 2Z42A 1H2KA 3ATGA 5ABJC 1GFF2 5BNPC 3WDYA 3TN92 4BIOA 4YM1A 1N1YA 2Q8OA 3JBG2 1NCRA 2ERFA 5FTTC 3LSDA 3AYDA 1G7YA 1IPJA 1FOD3 4IERA 4N53A 4AFDA 2GAUA 4COUA 3A0KA 5GLUA 3AP5A 2VOWA 2EXJA 3L2YA 1UPSA 1VBE1 2HWF1 5GM0A 1QY4A 1O91A 4GWNA 4M0NA 4CDWA 5F5QA 1AR83 1VBD3 2BWCA 5E1RA 3ZN5A 3ME2A 4YVWA 1RUOA 2HEYF 4Q4W1 4TSVA 4YW2A 4CEYA 1YIPA 1ZZCA 1FATA 2E6VA 1B35B 1YI7A 3H50A 2BNNA 1VBE2 2HWF2 4NHMA 5AC91 5KXCA 4Q4W2 1D4M3 1AYN1 4P9IA 2PHDA 3BU7A 4Y1VA 4JAAA 1V00A 4JCKA 5I0SA 4Y1YA 1T6GC 2PAKA 1ZZ9A 1BEV3 4QXKA 3PLQA 1XQNA 1GICA 3ILRA 4IEQA 3WOGA 1W6MB 3UJQA 4R52A 2DVDA 3KB5A 1S0EA 2FMDA 1PZ9A 1QF3A 3B9IA 5CAZA 3AFKA 5DXDA 3RQ0A 3IMNA 1LOAA 2C9AA 3MLKA 4RA0A 1Q8OA 4I02A 1YFUA 1ASJ3 3B9CA 3NO8A 4SBVA 3KCXA 5JZGC 4NWWA 3HIFA 3MIEA 4EN7B 1H2MA 3DF0A 1C4RA 1PIV2 3RYRA 3RPQA 2MEV1 3QACA 3N3HA 1GNHA 3WNXA 4FOVA 3WD5A 4H55A 3LWCA 4URTA 1DIWA 2D3PA 4YM3A 3KT7A 1PM7A 1WLDA 4LO8A 3SHRA 4GH4C 4IL7A 4YM2A 4CZSA 4H7LA 2MEV2 1MQTC 2HJIA 1VB2A 1BK1A 5GJ6A 3VZMA 1QOOA 4E2QA 2A3XA 4AVBA 1FI2A 2RE9A 1RVF1 2XLFA 4K21A 3D8CA 4XMIA 3B01A 2XWBB 2R062 4RS5A 1CPNA 3PVNA 4RFT0 5L7OB 4S2GA 4LBQA 2HKXA 1JHNA 1LTEA 1G6NA 3KQRA 2B42B 2FZ1A 1QU0A 2SLIA 1W6NA 1G8WA 1POV0 1LECA 2ZABA 1MEC1 3AM2A 3FFZA 1CAXA 3VV1A 5FDBA 3RYPA 3PJQA 1MS4A 1IOAA 3D0JA 2VW1A 5BYNA 2NYYA 2VOXA 1WW4A 3VBRA 4CDXC 4GKXA 4XF1A 4XIOA 4AEKA 3H7YA 4GMP1 1MEC2 5BNOB 2B39A 2YV8A 4IQPA 3M3OA 2I45A 4G9SB 1KDKA 2IFRA 4QPYA 1NCQA 3ZFEC 3HWJA 2JENA 4C91A 1EP0A 4FPYA 4TYSA 1AUYA 1DBNA 5FMOS 3VL8A 3WQ1A 1ND2B 2Y0OA 3CLPA 4MSVA 2P37A 4S2FA 2A6YA 5B2GB 3UK9A 2VULA 1RUF3 5FRAA 2IXHA 4AFCA 1ULGA 1JYIA 3T2TA 5GKAC 2RS31 3TYJA 3VLBB 4DMIA 1COV3 1AX1A 4JGYB 2Q1MA 3POWA 4M0HA 4LO7A 4XBNA 4A7YA 1S55A 4CP0A 2GNTA 3OGJA 2XG3A 3CNAA 2ZX4A 5I93A 2RS32 1TMF1 2GNDA 2AUYA 4RL7A 4KWLA 2DUQA 4X6RB 1CD3G 1O4YA 2DCYA 1QOTA 4P9LA 4WBBA 4AI3A 5CADA 1O5LA 4GWMA 4YVSB 1EAH1 5T52A 3U07A 4ZU4A 1SLIA 4UW6A 4CDUC 4WVZA 5CVRA 1WMFA 3SH4A 4YGCA 1HW5A 5J3UA 4HKWA 2EALA 4IXLA 4R9DA 1S2BA 1YFWA 4RR3B 4W6YA 1EAH2 3ZX7A 3O7OA 1WMEA 3DPRA 1HRI1 1J58A 1QKQA 4Q4V1 3SITA 2WNVB 1C5HA 2DUPA 4B4QA 2UY8A 1IZ3A 5HBAA 4MXWA 1HIXA 4X8NA 1LGNA 5E88A 1HRI2 4CEWB 2E63A 4Q4V2 4XFFA 2QCSB 1U5ZA 1HRV1 1RUH2 2YHJA 2VVFA 1QJX1 3G6JB 2A6XA 4PDWC 3VBHC 1KD7A 2EAAA 3WP3A 1O7FA 5ABJA 5C4WC 3R4SA 5BNPA 2MHFA 2XVLA 1KS4A 2XH6A 3M4FA 2GMPA 3AP9A 1HRV2 4FSJA 2ZX2A 4JTNA 4FPOB 4CDQB 4XEZA 1QJZA 1OQEA 1V6JA 3VKLA 1XU1A 1I6XA 1ZA4A 1C8M3 3WW3A 1LB2A 1WA4A 4K1YA 5GLWA 1S0JA 3FWEA 5FMOL 1UIJA 1CAWA 3PVOA 3KLSA 4I0BA 4FPEA 2OZ6A 1SBDA 1C3HA 1CVNA 1NY71 2RS13 3FLRA 1JH5A 2X29A 3P3PA 4XFCA 1VBB1 4IV1B 3ZMNA 2ZTNA 4FBFA 4FPFA 2IZWA 2Z2SB 4OVEA 2WWSA 2PLV2 4NOTA 3C3VA 1RUG1 5C9AC 3BOPA 1RHI1 3VDDB 1POV1 3AMQA 1R083 5LEKA 4WM8C 1RUI3 3WP6A 5FFOC 3RRDA 3VBSB 2GH8A 1VBB2 4BLJA 5LK5A 3ZYGA 1RUD3 1LOBA 2WT2A 1WD4A 2F6BA 4META 3MIGA 1RB8G 2YROA 3NV4A 4WZCA 1X82A 3L9JT 2ZS6B 5IK8A 4FAGA 1R092 3H0OA 4YGBA 1OFSA 1W6OA 3WVJA 2ZX0A 4Q26A 3VBOB 1OI6A 2A6ZA 1PVC1 4UW3A 2D5HA 3E6BA 3WHUA 5JZGA 3OBTA 2R071 2Y26A 1AX2A 4E4ZA 3MLLA 2XBO1 2RS51 2YC0A 4JGZB 4Y1UA 3U11A 2AR6A 2HWD3 4AFAA 4DB5A 2A71A 1I9RA 1RJ8A 5J09A 1IQAA 4B3NA 4HVRA 3VZNA 3FE5A 4IEVA 2Z69A 3MW4A 1OMIA 1UAIA 1W6QB 3HAGA 3ALQA 3TB0A 3WY6A 2XBO2 2RS52 3N7KA 2I07B 2A73B 4GH4A 2HWE1 1VALA 1W2UA 5F1RA 4HSJA 1O3RA 1YIFA 4HFSA 4P9YA 4PLOA 1VBC2 1R1A3 4N43C 1DQ0A 5T3NA 2HWE2 1PO13 3FJSA 3WLUA 4KG8A 4PJYA 1LESA 3VBUC 4J1XA 2A6WA 4P5HA 1U12A 3DN7A 3ZN4A 2BW8A 1O4TA 2UURA 1Q56A 4HMZA 1NCRB 4YGDA 2H6CA 3IBMA 1KJRA 5CA6A 2V5YA 4MVTA 3U0ZA 4BPZA 3U4XA 1OOPC 5DUWA 4Q4X2 4LA2A 3O14A 4JV4A 5FLJA 1ND2A 1FPN3 3ZFEA 4YZ4A 4H7MA 2K9ZA 3VKNA 2TBVA 3NL1A 1QJY1 2AGSA 2VVEA 2D98A 1HX6A 1SQ4A 3ZXFA 2UWAA 2C1FA 3NJZA 1C1FA 1CPMA 4K1ZA 4YVWB 4OHZA 3EO6A 4EJRA 1TE1B 1ENRA 3UJOA 1UMZA 5BUVA 4LO4B 1DGWA 4BMEA 4PLNA 3ZIWA 5KWRA 4K3UA 1Q43A 1YUDA 5A33A 4JRLA 1AYM3 3ZFFC 4MYEA 1HDKA 1LR5A 5HCFA 3E97A 5KXDA 4N7IA 3VHNA 2VH9A 4R9CA 3JZVA 2VOVA 4B7EA 4XE9A 3E5QA 3JU9A 4AI1A 1W6PB 1Y9QA 2VY0A 1H4GA 4WVMA 2WT0A 4ONUA 1XNKA 5KHIA 4YVSA 1A8MA 5D8AB 2HEWF 3JD73 4KH9A 4AVAA 5I8YA 2D93A 2ZGSA 1H0BA 3WG3A 1AR72 1K5MC 2IWGB 1QNYA 2NLRA 4AHWA 1S0DA 2HWB1 3V65A 4XFHA 5D1IA 5T55A 4CDUA 3EBRA 2E7AA 4RR3A 2EXKA 2BYVE 2WS93 2DWRA 2X5IB 1REEA 1H9PA 5I91A 3H3UA 4Y4YA 2WNVA 2VQ0A 2ZGNA 1NG0A 1OHFA 4XTMA 2H6BA 2HWB2 4XQWA 3AZXA 2WIIB 3O0VA 4LBQD 5L19A 1E57A 4LBNA 3CEWA 3WP4A 1GZCA 4ZXKA 3DGTA 4N7UA 4I3GA 2B8MA 4QM8A 3POSA 3KT1A 2XB6C 3FUOA 4B29A 5JIUA 1BXHA 1J3QA 2CGOA 2QZ2A 4YZ2A 3D82A 3VBFC 1F8VA 1YJKA 1ND3C 1I5ZA 4RGGA 2GC0A 3DKWA 3I4IA 4COZA 1AR93 4RHV1 1AR82 4PDWA 5SV8A 2BVBA 5DZFA 3H7JA 4TLFA 1QQP1 1WW7A 4K6BA 1UU4A 3SLIA 4HPKA 5CFDC 3CJIC 4E4SA 2VQAA 4OUSA 3ZXEA 3ZXLA 2JG8C 4RS5B 4CDQA 2E7QA 3AZWA 3S0MA 1A78A 3I7DA 2WLQA 2HYKA 1DQ4A 1W6NB 1DGWX 1LOEA 4BIFA 1RINA 1D4M2 3RYKA 2JG9B 1BMV1 1ZVFA 4JDOA 2TUNA 1H2NA 4OI1A 1AXZA 3VBRB 2YMZA 1SFYA 3ZVXA 3WCSA 1RUJ3 4IV1A 1X36A 3MGUA 4ISQA 1EV11 5I0UA 3UKTA 3V0AB 1BKZA 4XMAA 4E2GA 1BMV2 1WBFA 1CIWA 2P3KA 4LHNA 3VBSA 3ELNA 1QH7A 4WM8A 1REDA 4LBKA 3ZFGC 4I0AA 1HV0A 1N3OA 1KQRA 3OGGA 4LLFA 4OHWA 2E53A 5AVAA 3RMXA 2ZHMA 2NP0A 3THPA 1WGPA 4NVPA 4AQ2A 1HQWA 1SACA 3D0SA 3ENRA 1L3JA 4LUMA 1ZRFA 4QD2A 1SLCA 1RMU1 3FC0A 3R0RA 3JB4C 3R05A 4AVVA 3VBOA 4NR1A 4BHPA 1AXKA 2D97A 1QDOA 4QPIB 1BJQA 5DDJ1 3MEPA 4BA6A 1GR3A 4O9EA 2GN7A 3H1WA 5JLVA 4BLIA 4JGZA 3FUQA 1H8VA 4WM7B 3WINE 2PHFA 3NV3A 1MVEA 4D3WA 1MZEA 2IXCA 3LCPA 2QFEA 4ZU7A 5I0RA 1FAYA 1YJLA 1NA1C 5DDJ2 3FLTA 3ZYIB 4MZUA 4H3WA 4UBGA 1W6QA 2A70A 3WW1A 2JD4A 3USUB 5HCAA 4L9BA 4OULA 1QJU3 4QQPA 3RWNA 1MVQA 2JJ6A 3N7JA 2YZ4A 5J48A 1GQGA 5CU1A 2QUOA 1OPMA 2V73A 5JVVA 3AKQA 4TWTA 1URXA 1OLRA 1ZBE3 3DPRB 2LM3A 1WLCA 3NVCA 4LA3A 1RUE3 4EROA 2PHWA 3EQEA 2XJQA 2ILMA 1BZWA 5T5JA 2WINB 4OHYA 3OD0A 4NHLA 1O3TA 4AEDC 4D69A 4XQ4A 1LU1A 4N9HA 5K0UB 2R6QA 1UPIA 3ZXDA 4QPGC 4FOWA 1QXPA 2EF6A 4LBOA 2QKDA 1QHDA 5ABJB 5BNPB 3OCPA 2D3RA 4EN9B 4BOWA 3GF6A 4FPHA 3RZZA 4COVA 4LTAA 4CP1A 1U5YA 4FPKA 4AI8A 1TEIA 2Y38A 1V6IA 2PHLA 2XJSA 3VKOA 2ZMLA 2DCZA 3FZ3A 1ZRCA 4Q8LA 3BTAA 1CAWB 3ASIA 4I3PA 1AL23 1UF2C 3E5XA 3URFA 1MS3A 3H1YA 2P3JA 1ONAA 3ES1A 3AXEA 1LHVA 2CWMA 1NLSA 1YHFA 1A8DA 1PGW1 4XHXA 1LHOA 4A3XA 5ACA1 4XF4A 4U2AA 1ZX5A 1W6PA 4IEYA 4PBOA 1DGRN 1PGL2 4Q4Y3 1LGBA 1ZBA3 3WG4A 5D8AA 5FO9B 1HV1A 4BQ1A 1PGW2 4UXAA 4IEUA 1N1SA 1FXZA 5ACA2 2A3YA 1LOCA 2ARBA 1O3SA 1PIV1 4WV8A 2E7TA 1LENA 5FREA 1AXYA 1B09A 4Q1RA 2X5IA 1W6OB 2ZKLA 5FPZA 2DYCA 5FLIA 2JEMA 4D7TA 2DVBA 3BB6A 1EYBA 4SLIA 2GDFA 4HETA 4DXZA 3B3QE 4J1WA 2Q30A 2D6OX 5JZGB 4QQLA 4MV2A 1F9KA 2R043 4W6XA 1FMD3 4ES9A 4CP2A 1Z7S3 4MH0E 1XU2A 2GSYA 4QHBA 2X8KA 4RD7A 3ZMOA 1R1ZA 4OI0A 1TNRA 2ZCWA 3DV8A 4YSFA 3PNAA 3RDIA 5BNNC 1TME1 5DG1A 2O8OA 2RHPA 4PCRA 5C8WA 2R32A 1F5JA 1XYNA 4LE4A 4E9KA 2R061 1NQDA 5CFCA 2KXLA 1PO23 4D7YA 4JQRA 4GH4B 4LO6B 1S0GA 1KFXL 1N3PA 1IGOA 4FPLA 1TME2 1C8M2 1Y7BA 4IV3C 4PF5A 4YGEA 5K8SA 2FHRA 1MQTB 2BNOA 3GZTB 2D44A 4BM8A 2PELA 4Q27A 1BBT3 4WVWA 2CTVA 2ZX1A 3GALA 3CJXA 3INAA 3ZIXA 4MGIE 1N3QA 3MICA 3CJIA 2RJLA 2JE9A 4QGLA 5GZEA 3HMYA 4FQZA 3B94A 2JG9A 2EAKA 1S0IA 2ARXA 3VN4A 1RUI2 5I8TA 1Q3EA 1REFA 2QNKA 4HN0A 3H3ZA 1V9U3 3WUCA 4PIXA 1RUD2 3PTYA 4CDXB 2DCJA 3V0AA 2IXKA 2OUJA 2BVVA 3M70A 1YCIA 2RM23 1LOFC 5KC6A 4XBLA 1Y43B 3AYEA 1W0PA 2Y0IA 5KHKA 4E2SA 3ZFEB 2DVAA 4INDA 2ET7A 4FP2A 1UKGA 2VUAA 3BODA 2W52A 4P9XA 2LUWA 1SFNA 5JCTA 3NWKA 2GN3A 4GB33 2MNGA 2VU9A 4FTBA 1GBGA 1YXWA 3WP5A 4AFMA 2ENRA 3GHNA 2RMU1 5JI7A 1EY2A 4DS0A 5A33B 4QPIA 2PHUA 2ES3A 2BWAA 1ZZ8A 5I8SA 3UKVA 2ZA9A 2Q1ZB 3RJRA 5BPXA 4WM7A 4LT5A 4A7ZA 2DURA 1DYPA 4WVMB 1DFQA 4F8AA 1MS5A 2B7YA 2RMU2 4DQAA 1FT9A 3M3IA 1CESA 3KM5A 4L92A 3J26N 4CRQA 4XXPA 3NKTA 3IN9A 2R0FA 1V6KA 1M06G 3USUA 2XL9A 1PK6C 4XFGA 2ZGQA 1UU6A 3AX4A 3V0BB 3IIAA 3VKFC 4HT1T 4CDUB 4QGMA 3IDEA 4FCAA 4QMAA 2YYOA 3OY8A 4D94A 5FQ0A 3THTA 4Q1PA 1ENXA 1YO8A 4K9SA 4YG6A 1VBE3 2HWF3 5T50A 3VZLA 5FAXA 5J96B 3IWZA 1RUH1 3OD4A 4YW3A 4F7ZA 5FOBB 1W0OA 4LBLA 1FPN1 1OQDA 2DVFA 4AVCA 1H8TC 1DGLA 4TZDA 3LOIA 3PMSA 5K0UA 3HT1A 4AEDA 5AC93 4MGZE 3HT2A 4MLOA 3BOWA 3MZHA 3POYA 1FNZA 2ZPXA 4FXGB 1AYN3 1FPN2 3LA7A 3RS6A 2P2KA 4N90A 4PDWB 3OBRA 3VBHB 5GZDA 2O8QA 1X8EA 1ZYBA 4Q8KA 3ZO0B 5C4WB 4XETA 4HPKB 2WLPA 1IKQA 3MW2A 4LULA 4AI0A 1CR7A 2NPIA 5H9QA 1HQNA 5GZGA 5AFEA 3WZ1A 4DINB 5DZEA 1AYM2 3W9AA 5L73A 1C5IA 2D6KA 5EFUA 1C1LA 1LEMA 3ST7A 1SDWA 1LOGA 2IXLA 2PLV1 2ZAAA 4YG0A 4Z8BA 4HVQA 5EYYA 1LU2A 2I2SA 2NN8A 1NLRA 3SXWA 1AJOA 3VHPA 4DRVA 4EWDA 1GYKA 4XF9A 2DCTA 3CO2A 3JD72 3ZYPA 3OF1A 4QX5A 5AVPA 2VPVA 4Z1VA 1SMVA 1JN2P 2GC3A 2WC2A 5JDBA 2GMEA 2ZGTA 5C9AB 1QXJA 5JPMB 1XYOA 4KGGA 1BYHA 1R091 2EXHA 5T5PA 4C1WA 3WDWA 4WM8B 2HEVF 3EHKA 2UU8A 3I59B 2ZBJA 4IEXA 3AXDA 5CBLA 1GNZA 1VR3A 5J98B 1DYKA 1RVF3 2RR11 1SEFA 2DFBA 1RUC1 4R8HA 3WQ7A 3SMHA 1LRHA 2BBVA 3D5OA 2H0VA 5DZGA 3NAPC 4B4PA 5GZCA 1MEC3 5JOWA 4L99A 1LHUA 2C0ZA 3WCRA 2Q5TA 4XF3A 1WUVA 1OA2A 2WZPP 4ZKTB 4MXVA 2RR12 5SV5A 3IM0A 3X29B 3HN1A 1AR92 1RUC2 3O12A 1CJDA 1Z0HA 1HXS1 5E89A 2ZGOA 1Q8QA 4Z2WA 2PAEA 3AKSA 4XXAA 3ZXJA 1QXRA 2UYAA 4FQ4A 5KXBA 1VBC1 1JUIA 2X53S 2ZHLA 5IK4A 1HKDA 3AZVA 1WCSA 1YFXA 4YYOA 2JKBA 1IHMA 4XJ9A 3LAGA 4FP3A 4BZ4A 1HXS2 4XFBA 3ZSKA 1MQTA 3O0XA 2NZ9A 4IV3A 2FZ2A 4KWJA 5F9TA 4LEJA 5CIRA 4KG0A 1VRH3 4KNCA 4BYYA