1H4HA

Oligosaccharide-binding to family 11 xylanases: both covalent intermediate and mutant-product complexes display 2,5b conformations at the active-centre
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
207
structure length
207
Chain Sequence
EIVTDNSIGNHDGYDYEFWKDSGGSGTMILNHGGTFSAQWNNVNNILFRKGKKFNETQTHQQVGNMSINYGANFQPNGNAYLCVYGWTVDPLVAYYIVDSWGNWRPPGATPKGTITVDGGTYDIYETLRVNQPSIKGIATFKQYWSVRRSKRTSGTISVSNHFRAWENLGMNMGKMYEVALTVEGYQSSGSANVYSNTLRINGNPLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Glycoside hydrolase
molecule keywords XYLANASE
publication title Catalysis and Specificity in Enzymatic Glycoside Hydrolysis: A 2,5B Conformation for the Glycosyl-Enzyme Intermediate Revealed by the Structure of the Bacillus Agaradhaerens Family 11 Xylanase.
pubmed doi rcsb
source organism Bacillus agaradhaerens
total genus 59
structure length 207
sequence length 207
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h4hA00
1H4HA 1OA4A 2DCJA 3VZOA 5HXVA 1KS4A 1XNDA 1ENXA 3B7MA 1REDA 2BVVA 5K9YA 1BK1A 1BVVA 2VG9A 1H0BA 1UU4A 3VZLA 1OLQA 2BWCA 2VUJA 1UU6A 1C5HA 3AKTA 3WX5A 3WT3A 3MFCA 1H1AA 3LGRA 2VULA 5K7PA 1HIXA 1IGOA 3WXPA 1QH6A 1QH7A 1REEA 3HD8B 1XNCA 3AKQA 2Z79A 3AMPA 3LB9A 4S2DA 4XQ4A 1XYPA 3AKRA 1OA3A 1OLRA 1UKRA 1NLRA 3AKSA 1OA2A 2C1FA 1T6GC 1BCXA 4NPRA 1H4GA 2B46X 2DCZA 3WQ0A 1M4WA 3MFAA 3MF9A 3AMNA 2D97A 2F6BA 2QZ2A 1HV1A 3VZNA 1REFA 2BW8A 3VHNA 1XNBA 2B42B 3AKPA 2DFBA 3B5LB 2BWAA 2DCKA 4S2FA 2DCYA 3EXUA 4XQWA 2D98A 4HK8A 1HV0A 4HKLA 1XYOA 2DFCA 3WR0A 1UU5A 1AXKA 5EJ3A 4S2GA 4XQDA 1H8VA 2JEMA 1C5IA 3AMQA 3MF6A 3O7OA 2VGDA 4IXLA 3VLBB 1XNKA 3WQ7A 3VZJA 2QZ3A 3VHPA 2JICA 3VZKA 4HKWA 1F5JA 2B45X 4S2HA 3WP3A 1W2UA 3RI8A 3WY6A 3VHOA 3AMHA 4HK9A 3AMMA 1XYNA 3M4FA 3VL9A 4HKOA 3VGIA 1KS5A 3ZSEA 1YNAA 4XPVA 3VZMA 2JENA 3WP6A 1XXNA 3VL8A 3WP5A 3WQ1A 3WP4A 4H7MA 1PVXA 3RI9A 2NLRA 2NQYA 1TE1B
chains in the Genus database with same CATH superfamily
4YM0A 2VZOA 4RS5A 2BFUS 2IZWA 2Y8KA 4XJ8A 1BK0A 2RJ2A 2Y6HA 4HN0A 5DAPA 4PDWB 4A45A 2FQPA 4QHBA 5CVRA 5IFTA 2J1SA 1L3JA 5A6QA 5FZ4A 2R063 4LO5B 4U36A 4AEKA 2GSYA 5EJZB 1SPPA 1UMIA 1W6NA 2JG8B 4RYDA 1H2NA 5IVFA 2QQJA 3IKWA 5A32B 1GNZA 5E89A 1VBA2 5LWBA 5SV8A 1DIWA 3ZFGB 2VPVA 1ENRA 1R091 3DPRA 4YZ3A 4ATEA 4CDUC 1V6NA 3GBWA 4FFIA 1RXGA 5FZ0A 5FZOA 5C8CC 2WZR2 4PQ9A 3JCIA 1RB8G 4MGTA 2DF7A 3GYDA 3JB4C 2RHPA 1C8M2 1IGOA 3AYAA 4Y20B 4HVQA 5C33A 4IEYA 1UY2A 1G7YA 2XBO3 3D82A 3M70A 3P5BA 2V72A 4XUNA 3W58A 3WNLA 1JI6A 1MS8A 4PIZA 1CD3G 3INAA 4WVWA 3WUCA 3FLTA 1Q8PA 4CDUB 4L2NA 4NHKA 2JE8A 1JH5A 4B4QA 5C8CB 1RTVA 1JZ4A 5I0RA 4KH9A 2GDFA 4GWJA 5FK7A 3ZN4A 1D0HA 4RR3C 4CP1A 1DP0A 5F6LB 5FXVA 2J1UA 1PZ8A 5LK5A 3W59A 4YNIA 2R16A 5CFDC 1P8JA 4FXKB 2XOMA 2JG9A 2VZ3A 2K0GA 3MF9A 2ERFA 2FCVA 1RUC3 3OPWA 4YFWA 3ZX7A 2J1AA 1D4VB 2PLV1 5AVPA 1WW7A 4D6RA 3ACGA 3BU0A 4YGDA 4MGKE 4Y24A 1COV3 5AC92 4MGQA 3RYRA 2P6CA 3NVCA 3OTFA 1DGRA 2E7QA 4N53C 4PHZA 1HV0A 1QQP1 3POFA 2Q5TA 4RR3B 1KXGA 3I3EA 4BHPA 1OLME 4XFFA 3CKHA 5FYSA 3UESA 3VKOA 4CPBD 5CFDB 3GF6A 3WLUA 3ILNA 3ZSKA 1W8ZA 2ORXA 3BIWE 1X36A 5FMOL 3ZXAC 2ZGRA 2WJSA 2WRAA 1UYXA 4KWUA 3VLBB 2VNOA 3ZXKA 1JZ3A 2XPJA 2O1QA 4XIKA 4CEWA 1EP0A 1YJKA 4UFMA 1AR62 4QB1A 3VBOC 2VL4A 3VZKA 4LKSA 1HB1A 4HPKA 1LAJA 3E5UA 4COUA 3KGLA 1I1EA 1AYM2 4S2HA 3JD73 2PAMA 2XJQA 3EO6A 1A34A 4N53B 4XDPA 4BPZA 4OI0A 3MICA 3VL9A 4NHYA 3VD9A 5F2SA 3DUIA 2RS12 1RIRA 2YU2A 4O65A 4ZY9A 4O9GA 1SEFA 2DDUA 4XJZA 3KCXA 4AGVA 3K4AA 4NRQA 5CIRA 1W2OA 2Y6JA 3NO8A 3TN91 3WG2A 4OVEA 2YGLA 1IS6A 2JIJA 1POV3 4HETA 4XOGA 3VBOB 3RZJA 2ZGQA 3ZPOA 1W6MB 2ZMLA 1KJRA 5JUVA 1FPN1 5FPZA 1WMXA 3I3QA 4Y4RA 3U10A 1AL21 4AI8A 3I2KA 4BQ4A 4NIGA 2DCJA 1WCSA 3OBTA 4Y22A 1ENXA 2XKPA 3WW1A 4K9SA 4YSFA 1RUG3 3HN3A 1FX5A 3MEPA 2AZ5A 1POQA 4P9YA 4FFGA 2VOXA 5A3PA 1BVVA 3M3CA 2N7GA 3IAPA 3OEBA 4CU8A 2J1EA 3LDRA 3IMNA 3U75A 3OB8A 1BMV1 4BOWA 1SLTA 2WFF2 3T2TA 3FBYA 4PF1A 4XFHA 1GMMA 5DUVA 3PURA 2P17A 2LUWA 1CZVA 1H1AA 2VMEA 3K3NA 4BLIA 2SBAA 2VE1A 3R0RA 1I9RA 2ZACA 4BQ2A 1X8EA 1AR81 3WHUA 3LOIA 1YCIA 3I2JA 1VBD3 1WWYA 3HNMA 1PX3A 2AENA 5JMCA 3VBUC 2LM3A 3BI3A 4PBPA 1YEWA 1OQDA 2CGNA 4NHLA 3WHTA 4Y1UA 2HWD1 1JUIA 5B4XA 1ZRIA 4HSLA 2V5YA 1WCQA 2D6LX 3MUZ1 3C7GA 3LEMA 2J22A 3PUAA 3ZIWA 4QPIA 4CEYB 1W6OA 4GMP0 2OQ6A 4AHXA 1SLBA 1RUD1 4ZHNA 4LO6B 3WQ0A 4QKNA 2VUDA 4RL7A 1J84A 4UW4A 4A2UA 5GZCA 5CADA 2HEWF 1UOJA 3VBUB 2BERA 2VUCA 3V64A 1REFA 2PXJA 1VBC2 1ZBE2 2YG0A 3JBG3 4LIUA 5FPBA 3U37A 2D6PA 2DFBA 3PU8A 1HB3A 1N1VA 1D0GA 5IJRA 4D7SA 1HRV1 2I2SA 4GB33 4C1XA 5FOJB 3PMSA 4FOVA 2B9UA 1AXKA 4GZ9A 4OULA 5JR7B 4XFGA 2OPWA 4EN8B 2OZ6A 1RUE2 3MF6A 2Y6FA 1ZZ9A 3FC0A 5DG1A 1UZYA 1G9BA 4IEQA 3I2IA 4AHZA 1H2KA 1DGLA 4L0PA 4XUTA 1NE4A 5G04L 3ZO0B 5C3RA 1Y3TA 4CUAA 5C9AC 5J96B 4GKXA 4WZFA 4DXTA 3WDVA 4ARXA 3RS6A 1YWKA 1PVC2 4P9IA 5IVJA 1AXZA 3FHAA 4LOSA 4MXWB 3U1XA 1EUTA 4IV3C 1EYBA 1YFYA 4MLOA 1FNYA 2J1TA 2A3WA 4INDA 3O12A 2A7AA 4NAMA 2MNGA 4WZCA 5FWEA 3N7JA 4IGQA 1OUXA 1W3XA 4BJ0A 4XHBA 2X05A 5AFBA 2QQLA 1UZ0A 1UZZA 2WQ8A 1JOPA 3H8UA 3WP5A 4OHYA 2EA7A 2Z42A 1C8M1 3HBKA 1W9WA 5FWJA 3TB0A 1LU2A 2VQ0A 2YYOA 3VBRA 4LA3A 1HN1A 3M3QA 4CXXA 4PLNA 5LASA 1H8TA 4RFRB 1W8WA 3FFQA 2AREA 1IS3A 3UYJA 1WW6A 1OOPC 2JKXA 4AI9A 4HZFA 3DV8A 2GAUA 5FZLA 4LUKA 1YLLA 1GZTA 4OQ9A 1Q8QA 4Q0UA 3AL5A 4UF0B 2ZAHA 3AB0A 1NOVA 3JXSA 5DZEA 4R9CA 3BIEA 4AQTA 1LRHA 5ACA3 2A3XA 3MI8A 4M4PA 5FMCA 4IEOA 1HQNA 5GLTA 4NAOA 4E2QA 3OUIA 4QQPA 1HX6A 3V56A 1BEV3 3QCWA 5EYXA 3PUQA 1OOPB 3POEA 4MADA 2WSUA 3S7IA 1UY3A 5H9SA 3J9SA 1W6NB 2K2SA 3TNQA 4NN0A 4LLOA 3VBSC 2ET1A 5BXXA 2YC0A 1GANA 1ZX5A 5FBJA 2PTMA 1G9CA 3VDDA 2BTVC 3VKFC 4Q4X1 1UMZA 1BYHA 4XABA 2QQKA 3VKMA 2GMPA 1LHNA 3SCFA 3QACA 3RWNA 1IKQA 4TZDA 3MLKA 1LKNA 5KXCA 4AEDA 1OA3A 1MZ5A 3KQRA 1DQ1A 1TME1 1W8HA 5JR2A 4HN1A 1CAUB 4FTSA 3K3OA 3MV01 4XF9A 1LHWA 4TWTA 2OZJA 3ZN6A 4O61A 5CFCC 3MIDA 2WFPA 4DFSA 1AYM1 2GNMA 2RS32 3U07A 1S4CA 3IT8A 4NOTA 1ONAA 4Y3OA 1YQ2A 5LBEA 3MFAA 1UNBA 2WWUA 4JC1A 3KV5A 3AMNA 4FTEA 1ZRDA 3T3YA 3HMYA 3R4UA 4QWNA 5LB6A 3JUUA 4NE9A 3RZZA 4AYUA 4CDXC 2RS11 2VO5A 3GBGA 1TNFA 1OPOA 4YW7A 4D94A 1SZBA 4JGZA 1D2SA 2BGCA 1KGYA 2DCKA 2RJLA 5E1RA 5EWSA 2XLFA 4FPKA 5A3UA 2DCYA 4GH4A 1CJDA 3T1LA 3JU9A 4Y26A 2ZGLA 1ENQA 1W0OA 1OXCA 1ULGA 2DYCA 3B01A 2G9GA 4COYA 2YXSA 5CFCB 2DFCA 4J25A 3C7HA 3HAGA 1QXRA 4NPMA 3BODA 4CE8A 5DG2A 1RUJ3 2VBDA 1QJX1 3U78A 2D93A 3LCPA 4TLGA 4UFJA 1WLDA 3ZYBA 4CDXB 1RYYA 2ATFA 5I8TA 2YPDA 1EV13 2NM1A 2CWMA 3MW2A 5D8AA 2GC1A 2JICA 5L7OA 4HKWA 1AZDA 3IDEA 2WO7A 2ZGNA 5GM0A 3D3AA 4DEVA 2Y60A 1K5MC 1W9FA 4GKYA 4Q0PA 2R061 3OGJA 2GN3A 3SQOA 4B29A 1QGLA 2ZX1A 2GC0A 5J3UA 1PM4A 3KT7A 5E88A 2CL2A 4QPGC 3OGGA 4L97A 1W8TA 1OQ1A 1PM7A 2I45A 3GCWA 2WNVA 1FV3A 4NR1A 4XMAA 3WW4A 1EAH3 2YFZA 3BOPA 2E26A 3N9LA 4YVWC 1SBFA 4IERA 3CIHA 4B1MA 1J3RA 1QJFA 1G86A 1S2KA 2YC2A 1ZBA2 4JCKA 4BIOA 2GH2A 2D7FA 3OOXA 3HIFA 5FP4A 2R32A 3ZOIA 4DIQA 4CVUA 5FYZA 1FAYA 1VB2A 4LULA 4MX3A 3KV9A 5C71A 1K5MB 1UOGA 3X29B 2O14A 1VBE2 1QIQA 2XBO1 3OY8A 1XE0A 4LE4A 4NVPA 4RQPC 1DDLA 4EZ4A 1WMEA 1OLMA 1ZM1A 1X9TA 4IEPA 5JPMB 2P37A 4CU9A 4QPGB 5GZFA 3IZOA 2G9ZA 1I5ZA 1VRBA 5KXDA 2FDIA 3ZYRA 3KCCA 3ZIXA 2W3JA 3DKWA 5HI0A 1RVF3 1RUH2 1SCSA 2JKBA 3B7MA 1J3PA 4YVWB 5FY0A 3ZLIA 1LB2A 4DMIA 1LOGA 2XVKA 1H1MA 4FAHA 1W39A 2VG9A 3LWCA 2R0HA 3ZFFA 1HDKA 2RDQA 1GWKA 5FYBA 5FY7A 2VMCA 1OBNA 3V0BA 1EPWA 1FMD2 4RQPB 4OCTA 2PHTA 4RHV3 4YW5A 1PO22 1RUC1 1SACA 2GNTA 2ZOEB 3WEZA 3Q8CA 3MIFA 5A1FA 4AVSA 4JRAA 1WGPA 2Z2SB 5K7PA 2VOWA 2X29A 4IQPA 3OGRA 1TMF3 1COV1 1QJEA 4QHZA 3I97A 1JU3A 4QX5A 1GP6A 5DAQA 2OKXA 5IFPA 1ND3A 3BUCA 2VW2A 2VTFA 3SXWA 4LORA 1S0FA 2QE3A 4QGLA 1QJU3 2QQMA 3WVJA 2UY9A 3GGLA 4YW4A 1PNGA 3AKRA 2VCAA 1YIPA 5IT6A 2B8MA 4LPLA 2ZGMA 3SH4A 2WC2A 1T6GC 5F39A 4LTAA 2D6NA 3ZKUA 1MVQA 3HWJA 2ZJCA 2X5IC 2RS53 3ITQA 4LK6A 1R1ZA 4XYXA 1CAVA 1F4HA 3T08A 2WT1A 2CAVA 5FDBA 4LBQA 3JD71 3LOBA 1ULDA 2EF6A 3I59A 2EXKA 4Q2FA 3ES1A 5J37A 5JAXA 2RG4A 3AP7A 4K8FA 3OSDA 1J83A 1JZ8A 4RD7A 1UQXA 1ZZBA 5JMOA 1LGNA 5J1XA 3E6DA 1DZTA 1AL23 1Y9QA 2OUJA 3J8F3 3LA7A 3E5XA 4JKLA 4UFIA 5FKBA 4F83A 2X5IB 4QXHA 2HEYF 1POV1 4KU8A 5J48A 3LE0A 5B4NA 4UOJA 4HSJA 1ND2A 2O0OA 4XTMA 3BYWA 5G05L 4JDMA 4CUBA 4JQTA 4E8CA 4XQDA 2KM2A 4TLFA 5EPAA 5DDJ2 2VTXJ 3PIJA 1PK6C 4UFKA 4UBGA 2PELA 4LBNA 4OYUA 4N7UA 1PZ9A 2VMDA 4YZ1A 3H0OA 4QD2A 4WM7C 3UL2A 5T3NA 2BEOA 5A3TA 1O6UA 3OBRA 5H9PA 1CIWA 5LY1A 1NA1A 4HFSA 4YYOA 3APBA 1RUG1 1LOCA 4H55A 4HG6B 4NJ4A 2BVBA 4EN9B 3E1F1 1Q8VA 3LEKA 3WG3A 2GZWA 1UX7A 4NUBA 3ZN5A 3D8CA 2VXRA 2FCUA 1FATA 1ZA7A 2HWE2 4W6WA 3SMHA 1PK6B 4QDRA 4XZPA 5HPOA 3O1UA 1UY4A 3QOPA 4XAAA 4E4DX 3WCSA 4WM7B 5E6HA 1JN2P 2NPIA 4MGZE 4UW5A 5E16A 4OI2A 5JXHA 4OUMA 3OF1A 2RM22 2YUEA 5EIYB 1QJY2 2NQYA 1Y43B 3MO4A 4Q4V3 4DINB 4Q8LA 5LATA 3IIIA 1DQ0A 2QQIA 1PMIA 2XL9A 3M2MA 4FPFA 1MZ6A 4QGMA 4XETA 1KS4A 1FV2A 2WN3A 5A1LA 3LSEA 5I0UA 4M3CB 1Q8SA 1O5LA 1RC6A 1CAXA 2RV9A 3IWZA 4NRPA 4BMBA 2OYZA 5KXBA 1NCQC 1PGL2 4OLLA 2DTYA 2HKXA 2RS31 2VCBA 3ST7A 1OMIA 1R082 2BUKA 4FXGB 5FZ6A 2EIBA 2Y0OA 2VUJA 1RITA 1UD1A 4QXKA 4WVZA 1H6XA 1C5HA 3MDPA 1LTEA 2J1RA 2WS92 3AXDA 3IB3A 3IPVB 4LBQD 3RFRA 3JBG1 4QB6A 5FPLA 5ABJA 1FOD1 1AYN3 4Q27A 2Z69A 4LKEA 1RHI2 3ACIA 1LECA 3E97A 2XUMA 3HT1A 3OG2A 2E63A 4DY3A 1XPWA 2XHKA 4B4RA 2JDAA 3RZMA 4QKDA 2YV8A 3AZYA 2P5BA 4GB31 3SNMA 1O5UA 5BNPC 3ZDVA 1OKQA 3H1MA 3E6CC 5CZKA 3N4MA 5BYNA 3GM8A 4YLZA 3WF2A 4AAXA 1OFNA 3RG0A 1JYTA 3N36A 2HWC2 4L11A 4UXAA 5E8AA 3ILFA 1GNYA 4YARA 1U5XA 1MS4A 4IV1C 1VBA3 2P3KA 4XZUG 5FPUA 2WNUA 3T2OA 4W4ZA 5TSWA 1XU1A 3ZSMA 1UY0A 1Z78A 2X09A 1U5ZA 4FFFA 2WZR3 2EVXA 3CJIC 1K42A 5BNPB 4LOTA 1A8DA 2QZ2A 4AEDB 4CP2A 1C8M3 3R4SA 4QX1A 4QKBA 4AR2A 4QGNA 4B7KA 1CIYA 2H0BA 3NNLA 4Z8BA 2P2KA 4L99A 3DCQA 5T52A 3D5OA 4QAWA 1JYWA 1I6XA 1UOFA 2Y33A 4BQ3A 1AF9A 2R6QA 1HB4A 4LHKA 5FMDA 2Q8DA 4IV1B 3DXUA 3NWKA 3LZZA 3U11A 1OFSA 3ACFA 3PDQA 4XFAA 5JDBA 2JDHA 3A21A 1RUF2 5BV6A 2X10A 4CDWC 4D3WA 2PHFA 2XUEA 1OVSA 4A7YA 4LT5A 5CB7A 4Q5OA 1VE0A 1O3TA 4KI5M 1DQ5A 1TNRA 5DAXA 5FUIA 2W08A 2WWJA 1HW5A 1BBT2 3TYJA 1RUH1 4P9WA 2UYAA 2GH8A 2BJSA 4EN6B 2HJIA 5HCHA 4ASKA 4XF3A 1N3OA 3K48A 1WA6X 4HKOA 3OPTA 5AC93 4X8PA 5KHHA 4DRRA 2JIGA 4CDWB 5A7WA 4GMP1 2XLAA 1RGSA 1FMD1 4URAA 4Q0QA 2IXHA 4E8DA 1UXXX 2YY1A 3ZYPA 3NNMA 5JZGC 1BEV1 2E9QA 2EICA 2ARBA 3DN7A 1GZWB 5DAVA 1JZ2A 4YRDA 1S55A 3RNSA 3NQHA 4PF5A 1LODA 2VD7A 5HCAA 2A1XA 3WG1A 1AR63 4IE4A 1FYUA 2XG3A 3D0SA 1U5YA 5FZ8A 5LW9A 4O9EA 4XFBA 2VVEA 1S0GA 1AYM3 1W04A 2VAUA 5FO8B 1OPMA 2QQUA 1NCRC 2CNAA 3ZYIB 5GKAC 4KBZA 1LJ7A 4M3CE 3NKTA 4QX3A 2AH2A 2RS13 4QHOA 2WZ8A 3AP4A 3GALA 1OD5A 4K20A 4K21A 1QF3A 1MS5A 5FK8A 5IVEA 4ZS2A 1W8FA 1IOAA 1ULFA 2BWCA 5IK4A 3AC0A 4M3CF 1UWWA 4AOCA 4LR4A 3M7AA 2CY6A 2HH9A 3B3QE 1BZWA 3WT3A 3MFCA 2JG8C 3FMGA 1NCRB 4ZXKA 3MPPG 1W0NA 3F95A 5LBFA 3LGRA 5T50A 2ARXA 3ZSLA 3TEYA 2X53S 1T2XA 2W2IA 1PHMA 4GWIA 3ZFGC 4LEJA 2DVGA 1W28A 5FBZA 5JIUA 2R30A 2JDKA 2ADDA 1KFXL 1DU3D 2BNMA 3NAPC 3RPQA 1SLCA 4E4ZA 2H6BA 4QM9A 1VJ2A 2F4PA 4CCOA 1YI7A 1O8SA 1VAMA 1JBCA 5HBAA 4P9XA 3NNFA 5K0UA 5FZDA 3I2OA 2JJ6A 2ZAAA 5I91A 1U5IA 2F17A 2VJXA 1RUJ1 4IV3A 2R042 1EPZA 2Z5WA 4QX2A 1JUHA 5FJHA 2XJPA 2JXAA 2C1FA 3CQOA 1LULA 4BMEA 2XQXA 3AFKA 3AVRA 1EV11 3K2OA 5FP8A 4AEJA 4MSVA 2WFF3 4AGGA 4ASLA 1F2NA 1PGW1 4A7ZA 3OGVA 1F15A 2EXIA 1SDDB 2ZBJA 3VHRA 2QCSB 5A7SA 3NAPB 2WAAA 5FJKA 1DLLA 2PHXA 5JOYA 3WF1A 1K3IA 2WDBA 1WD4A 4GAZA 3USUB 3RWKX 3DYOA 4AXOA 2JD9A 2GNBA 3N7LA 4Z82A 1SDWA 2HWE1 1MZEA 3T30A 1CAVB 4QMAA 1EAH1 4DPNA 2D98A 5CKMA 4XBNA 4CXYA 2PAKA 4LBQB 3FHIB 3NKGA 4AF9A 4A41A 4BQYA 3S57A 2GC3A 2Y6KA 4IE7A 1MEC2 1QJY1 4I3GA 4FP3A 4P5YA 4JKMA 2Q8OA 3F2ZA 3URFA 5JOXA 5D1IA 1VPHA 2NZ9A 4IEXA 2V4VA 3NV2A 3FLPA 5A6XA 4W65A 2YDEA 2ZEXA 1VBC3 1ZBE3 4Y1ZA 1GZCA 1RVF1 3SKVA 4ISQA 2UU8A 3FX3A 2DUOA 4FO9A 1D4M2 2XWJB 2IUWA 2Q30A 4P9JA 4CP9B 1XYNA 1ZZ8A 3I3BA 3K4ZA 4ZU4A 5FZ9A 5A70A 1PGL1 2H0VA 4D8MA 3VD5A 1H9PA 1CAWA 2WA4A 3NJXA 3PU3A 2C26A 1YRZA 1E5HA 5A33A 1X7NA 2C4XA 2WS91 4RHV1 5GJ6A 4FPLA 1RUE3 3WDUA 5C4WA 3T09A 4OZXA 1PVXA 1XRUA 2Q8CA 4DQAA 1TMF1 2O8OA 3NSTA 5CG8A 1MQTC 1LEMA 2BRTA 2IFWA 2WINB 2ET7A 1H4HA 2AACA 2XR4A 1F31A 1QJU1 4J1WA 1PVC3 4N43A 1QHDA 1RL3A 2VZSA 2HWC1 5FY9A 5C3QA 1CX1A 3O1PA 1NYWA 4DO0A 1WZXA 1RUNA 2ORZA 4H3WA 4YFZA 4M01A 5F6KA 5KR7A 2VW1A 1HXS2 3HVDA 1E5RA 1JMUB 1VRH2 2BVVA 3DYPA 3HT2A 2VR4A 3ZR6A 1MR5A 1SLAA 1WMFA 2RS51 3JZVA 3PMEA 1ST8A 1AUYA 4CCNA 2HWB2 5IHRA 4XJWA 3VBHC 3CMGA 5IVBA 1MS9A 1MQTB 3IDCB 1X33A 4FOQA 2XJSA 3AKTA 1NY72 3CEWA 5DQ0A 2ZMNA 3A23A 2HWF2 5KC6A 1TEIA 1AVBA 4XCBA 1ZREA 4FI9A 1O4TA 1CAXB 3EQEA 5F8PA 1V9U2 2PMWB 2VULA 3DYMA 4H7LA 5A3OA 1GZ9A 3KVBA 2DVFA 3ROUA 3ECQA 4OFGA 4LHNA 3J8F1 4XJ9A 2HBTA 3FFZA 3ME2A 4NHXA 1RUF1 1IS4A 3EBRA 3CZUA 5F9TA 5ISLA 4XQ4A 3KT1A 3VBHB 2BOIA 3LD8A 4IDZA 3QBQA 3TNPB 2JDYA 1V0AA 3FZ3A 3WDYA 3G7DA 1L7QA 1WW4A 4JGYA 1OURA 4V2WA 3FLRA 3S0MA 2LALA 4WVMA 1XSQA 1RJ8A 3AJZA 2XVGA 3AP9A 3GZAA 5JSOA 3IN9A 2D97A 2RJKA 4DUVA 2Y34A 2A6XA 4COZA 2JDUA 2VZRA 4CEYC 4FCAA 5BNQA 3R6SA 1UAIA 1YHFA 1OI6A 3MPBA 3TEWA 2BWAA 1GSLA 1ULOA 4OI1A 3KCYA 1WMDA 4G3YC 2E32A 5FYIA 1XJAA 3C7EA 5GZDA 5LBBA 5LCWL 3T0DA 1OUSA 5FXWA 5JVVA 2VNVA 1AR92 3OUJA 5BNOA 2IFRA 1AJOA 1H2LA 5F5CA 2DVDA 3POSA 4AVTA 3ZYJB 2HYKA 2IWGB 2Y0IA 1IHMA 1UU5A 4LHLA 4UFHA 1B09A 1YQ5A 2WIIB 4PT6A 2YBPA 4HLTA 5FPVA 1PO12 2NYYA 3NV3A 4UT5A 2BQPA 2R072 2QQOA 1XNKA 2RS33 1LR5A 3VBFC 5J98B 1ASJ2 4Q4V1 4Q4W2 2W5FA 2BGOA 4CDQA 3A4UA 3UJQA 1BQPA 4QQOA 4O7XA 1SLIA 3K46A 3IDBB 3PVOA 4TYSA 1ZZCA 1NLSA 1YXWA 4XBLA 2QJVA 4Z2AA 3K75B 3O0XA 4EROA 5J7MA 2Y6LA 3VKNA 4JTNA 1FOD3 1N1SA 4MHRA 1GQPA 3PNAA 4FVVA 3MZHA 4F7ZA 3U0ZA 4IW3A 4K1ZA 4FOYA 4YVSC 3KV6A 4LKDA 4AL9A 5F37A 5CKNA 5LBCA 3HJRA 3O1SA 2QUOA 1QJZA 3VBFB 3WP6A 3ZDSA 3ZYGA 2Y38A 1W8OA 2XGXA 5BNNA 1S2BA 4BXSV 3VDBA 4Q1RA 4X6RB 4ORFA 4C1WA 4Q8KA 1VMJA 1AYN1 4JDOA 2R1DA 3LAGA 1YFWA 5APAA 2WSVA 4GJYA 4L8QA 3KLSA 3SC7X 2BP6A 1W9TA 2VMHA 2BZDA 4A3XA 4YVSB 5HV4A 4FTBA 1XU2A 5F5QA 4XF0A 1UOBA 1W06A 2ADEA 3A22A 2R041 2BDRA 2MHFA 1W8UA 4DUWA 4R9DA 3OEAA 1ULEA 2JD4A 2ZXQA 4HXCA 1CESA 1AR72 1VBA1 2RR12 2GMEA 4PIXA 4LA2A 2VH9A 5CISA 4NMIA 2QQVA 5FP3A 1ZBA3 2CGPA 1UZWA 1R1A2 2WZR1 3B00A 1OH4A 3S7EA 4AFBA 2WZEA 1F8VA 1DQ4A 5CNAA 4RS5C 4RN5A 5K8SA 1VBE3 4CRQA 1S0JA 1YUDA 1W6PA 3WXPA 3KM5A 1C1FA 5FREA 3IDAA 2VCCA 1WCUA 2CDPA 4E9KA 4MV2A 4BXFA 5C8WA 1RUH3 2XMLA 3POIA 2W46A 1B35A 3VD3A 4XXAA 5FQ0B 4BCUA 3DPRC 5FYTA 3ZFEA 4RS5B 4GMP3 3UT0A 2ZX4A 1FMD3 3ES4A 3ZVXA 4IE0A 4XF1A 3L2YA 3M1HA 1PO23 1QDCA 3C7FA 3ETPA 4NWWA 3S6PA 1ACCA 1VAKA 1A3KA 2I07B 3BPSA 1M4WA 3JQXA 1S0EA 1QOTA 2BYVE 3BVCA 1UYPA 4N7IA 4OMDA 3OPZA 1S0CA 4XF4A 3VZNA 2GNDA 2BW8A 1SPPB 2VBBA 1ULCA 1YFUA 2ZHKA 3VHNA 3WF4A 2QQPA 4IE6A 4KWKA 5AC91 5A3MA 4K1YA 1GV9A 2AEYA 3DPRB 2WNEA 1SFPA 5C7GA 1VR3A 5FYCA 4NIAA 1BHGA 2UY8A 3K4DA 5F3EA 5FZOB 1QOSA 4XIOA 1DG6A 3P6BA 4JHTA 5FLJA 2ZPXA 5IAVA 4EZHA 3LFMA 2HLEA 4MGYE 3AK0A 1AR61 4PI2A 3AMQA 3O7OA 3ACHA 5FTTC 4QKFA 3O1TA 1KRIA 1CVNA 2EALA 1W9YA 5JIAA 3E5QA 1N47A 1CPMA 2VZUA 1IQAA 2DTWA 3I8TA 2PFWA 2V4AA 3B02A 3AJYA 4JVAA 4YM3A 2CHHA 3J7LA 5EXOA 2WO2A 1V6JA 3PJYA 4N9IA 4CSWA 2JE7A 4PBOA 3M4FA 1LU1A 1N1TA 3Q9OA 1HJGA 4M00A 5FFOC 1N3PA 4D0QA 2JG9B 3LEGA 1V70A 3OYWA 4KBBA 4XILA 3H8XA 4BM8A 3HNBM 2WL1A 3PL0A 2QQNA 5FRAA 3W21A 3B9CA 1CN1A 5DZFA 3J26N 4OHZA 3WP4A 2YGMA 4CEWC 5DDJ3 2L9LA 2VW0A 3B93A 2F4LA 1FXZA 3I3DA 3BALA 2KXLA 2OIIA 5T5OA 2ILMA 3RMYA 1SFYA 3MLLA 5FY5A 1JYXA 3CJIA 4TSVA 5A33B 4OHWA 5A3LA 2PYTA 2ZS6B 5FPAA 4E2SA 2DWRA 3CNAA 4BU2A 1XNDA 1JYNA 3NL1A 3R4DB 3D4KA 3LIHA 1CZTA 4CEWB 5K9YA 2YFUA 2HWE3 2D3PA 2WFF1 1H0BA 2ZTNA 5FYHA 3T4VA 4AVBA 4HPKB 4X8NA 4NWVA 1RUOA 2FZ2A 1UMHA 1J1TA 4M0HA 1ZZ6A 1F9KA 3PUIA 3I54A 4HOOA 3N3HA 5I8YA 2Z4FA 2D40A 4IL7A 4NIDA 3NV4A 2RM23 3TOJA 2FDHA 3H50A 1QJY3 4IESA 1ZVFA 3NNJA 5KWRA 1HIXA 3ZR5A 4XC9A 4JTOA 5T54A 3KS7A 1O4ZA 5DUWA 3RYKA 2FHRA 1HQLA 4GQ7A 4B3NA 5IK8A 4XJAA 1E57A 1OF3A 4XBQA 4CCDA 2D6KA 3QD6A 1DYPA 2D6OX 2RDRA 3NW4A 3GDBA 1WD3A 1MS1A 4JX0A 1ASJ1 1R083 4Q4W1 4LMFA 4AWDA 5JZGA 3ZKYA 2WS93 2OW4A 4Y22B 3BTYA 3AFGA 1VBC1 1Q43A 1ZBE1 3MIHA 4ET7A 2PHUA 4JKKA 2A73B 1GKBA 2VTXA 4QT6A 4CCLA 5FZCA 1UKGA 2Q1MA 4K3UA 1NZIA 2G19A 1W03A 2YZ4A 2QDRA 2DBIA 4AQ6A 5EQUA 2RMU2 2BNOA 3JB8A 4OHXA 3VDAA 5C3SA 1GU3A 1NUKA 5F5IA 1KDMA 5AVAA 3TBDA 1RUI2 1IG3A 5HXMA 3HQRA 2FCTA 2WAOA 2HWC3 1OKOA 1XSRA 4PLMA 3POBA 1RUE1 2A5ZA 1OH3A 4YM2A 1L7LA 3B69A 4BE3A 4BIFA 5ACA2 5LEKA 3FHQA 1AX0A 1LNSA 2JX9A 4PDWA 4XEZA 1C5IA 2A6WA 2XL7A 4NPLA 2XWBB 5FZAA 3VV1A 4Q0SA 3VZJA 1IS5A 4A6OA 5BNOB 3PTRB 3CU7A 3ABZA 5FOBB 3PUSA 1GR3A 2JG8A 5FY8A 2E31A 1PVC1 4ONUA 5A32A 4FPGA 5FZFA 2IXKA 1W2UA 4N90A 3RMXA 5FZHA 5JOZA 4EWAA 3ZFGA 5CBLA 4K40A 4Q26A 4QPIB 2RR11 1VIWB 3ACLA 1W6OB 4G4FA 1TQ5A 2ZEYA 1U12A 4Q4Y2 1DCSA 1O3SA 1BJQA 1XNTA 1R1A1 2XB6C 3BTAA 4Y20A 2VM9A 1PZ7A 3WV6A 1RUF3 2CU5A 5DABA 3KT4A 4FPJA 4DB5A 1XE8A 1ALYA 3PJQA 4KL1A 4I02A 1CPNA 1O59A 2WT0A 3PTYA 2DUPA 2CGOA 3PVEA 2NLRA 4Y33A 1SBEA 3ZM8A 2QNKA 3EHKA 5DMYA 3O5SA 1BBT3 4XUPA 3SH5A 5L9VA 4X6QB 4CDUA 2VXJA 1YQCA 4YGEA 3N35A 5C8CA 2WLQA 5FY1A 1QXJA 4XFIA 5A7OA 1STMA 4LBMA 4RGKA 5F1RA 3UJOA 2ZX0A 1OHFA 3C7OA 3FJSA 3K51A 4J6GA 5FZMA 4YGCA 3MV11 1UYYA 3GHMA 4AW7A 4CP0A 2GU9A 2VOVA 2KR2A 2A6YA 5IATA 1KITA 2Y6GA 2BPA2 2W87A 1H8TC 1YC61 2B4KA 2J7MA 1CR7A 4CCMA 3NJZA 4QQHA 2IVJA 4RR3A 1R092 3IM0A 3SKJE 5KHGA 3ZXJA 3BKZA 5CFDA 4NROA 4QU2A 3ELNA 2C24A 5LRSA 3C2UA 3PVNA 2DV9A 4KG8A 3GZTB 3O14A 5KC5A 5CKQA 4ZONA 3AKQA 4CCEA 2Z79A 4XURA 1SMVA 3W20A 1W2AX 1UN1A 2ES3A 2DUQA 1PX4A 2LTNA 3OCPA 4FPCA 3VBRB 4KGGA 3POYA 4OUEA 1OLRA 1OSGA 4MO3M 1IG0A 2DU0A 1OA2A 1V6IA 3AKSA 1LESA 3LKJA 1H8TB 1NZCA 1QKQA 4N53A 1DHKB 1KQRA 3WCRA 3TEZA 1N1YA 4BWOA 1NT0A 5I93A 3Q8AA 4QPYA 4RGGA 5BPXA 2GC2A 5T5LA 2BGPA 2UWBA 3KGZA 4W50A 2EIEA 4LXLA 2F6BA 2VMFA 3GJAA 1XC6A 3BTXA 5LEJA 1YFXA 3VDDC 4FPYA 3RZLA 4MVTA 3VBOA 3WDXA 2RDNA 4QX0A 4D69A 1SG3A 1W6MA 2OXBA 1NQDA 3ENRA 2W0XA 2PLV2 4AEDC 1Q56A 1XQNA 4AI2A 2W39A 1G9DA 4JQRA 2VQUA 4AHWA 1SCRA 4HKLA 1RMU2 2ZHNA 2R043 1O91A 4CU6A 3DEMA 2C5DA 4KU7A 1IKPA 3N9QA 3POWA 1QQP2 1HJFA 1O7FA 3LDBA 4P9GA 2LS6A 3VDDB 1V6LA 1H30A 5LA0A 3A0NA 3ZXGA 2AYHA 2C9AA 4BB3A 4DZGA 1W0PA 3O0VA 1F5FA 4JGZC 4CUGA 4N8MA 4NIHA 4GH4C 4UI9L 3RI8A 1SHWB 3BCWA 3EMRA 3GNEA 3ZN6B 1NG0A 2PHLA 3LQCA 3LSDA 3VGIA 1O3QA 1DFQA 1PMHX 1CGPA 4BH9A 1EUUA 1GOGA 1ZBA1 3WNKA 4LO4B 4KMQA 3WNXA 4R52A 3RJ2X 1GWLA 3MW4A 4AFAA 4BK5A 1NLQA 3BOWA 1MEC3 3TN92 2BV4A 4JGZB 3USSA 4BYYA 2ZCWA 1VBE1 5L7OC 5FKCA 4GH4B 4C90A 2OPKA 1WBFA 3SCHA 3MIBA 4I30A 5L9RA 4IUGA 4WVVA 3UNPA 1F35A 1FPN2 4I0AA 5H9QA 1LOFC 1QXPA 2WBKA 5IW0A 4FAGA 2G1MA 1U0AA 4TTGA 5IWFA 1D4M3 2K9ZA 1VBB2 2OA2A 2XJRA 5HXVA 2WNVC 5ANNA 3MGUA 5AFEA 1V00A 1G9FA 3LA2A 1LENA 5D8AB 4ZKTB 2XVLA 2IXIA 1NX9A 2UWAA 3VBUA 2OS2A 3T2PA 4ZPIA 3WSOA 5L7OB 5B2GB 3LFIA 2IXLA 2VUAA 3GHNA 1PO21 2XJUA 4AFDA 1CONA 3IIAA 4R4XA 4F8AA 2TNFA 3M8LA 1HRI2 3H8RA 3OGSA 5F2WA 3TEXA 5DPNA 5IVVA 4YZ4A 1ODNA 3Q8FA 1BMV2 1G8WA 3BTZA 2E6VA 3RZKA 4DXZA 2WNVB 3I2HA 1NXD1 1BLZA 3PHMA 1CZSA 2ZHLA 5FZ3A 5HV0A 5LRRA 2ZZQA 1DYKA 5FUNA 2MEV2 3TWIA 2EXHA 1AR82 1VAVA 4FOWA 4IETA 2BBAA 2LRPA 3DF0A 1AX1A 3B9IA 3WNPA 3ZXDA 1JOBA 3ZFFC 2NP0A 1HXS3 1VRH3 5HCFA 3DXTA 5FLHA 3CHXA 3OY8B 2SLIA 4Q0VA 2E7AA 4YWAA 4DOUA 2DBNA 3LDKA 1BCXA 2HWB3 4IE5A 4NPRA 4XUQA 4AI0A 3NRUA 5FQ0A 5IVCA 1GOHA 2HWD2 1PIV2 4XDOA 3KWVA 1S0DA 5BNPA 4MXWA 4AVVA 2HWF3 2B46X 1HQWA 4RGAA 1G6NA 1DLCA 1V6OA 2FMDA 1WW5A 3CZJA 3H42B 1V9U3 1ZA4A 3UKTA 1CJPA 1MPXA 4XUOA 1RUD2 1ND3C 3MIEA 1VLNA 3THPA 2B42B 2JDZA 1OF4A 2WT2A 3AKPA 4Q4Y1 3ZFFB 1DBNA 4XXPA 4AK3A 4DNYA 2RE9A 5FZ7A 3GBFA 3V0BB 4BDVB 5C9AA 3CLPA 2A6ZA 4RA0A 3RQ0A 4JDNA 4EYUA 2QBXA 4R9AA 5EV7A 4A44A 2RDSA 2ZGKA 2OUHA 1HRV2 1MS0A 2DU1A 5DDJ1 5EJ3A 1KD7A 1L7RA 3S5AA 4C0HA 2J1VA 1ND3B 1YQ8A 2E7TA 3CJXA 4EN7B 5F7UA 5IK7A 4YW3A 4UF0A 2EIDA 3N7MA 4DRVA 5IVYA 3AZVA 4XW3A 1Z7S2 2OVUA 2XJTA 4K8RB 4COWA 2B9VA 2JB8A 4PLOA 4TN7A 4AZZA 1GBGA 4FPEA 4MZUA 2IC1A 3T4HB 1DGWA 1QOOA 4B8EA 1AR93 1OOPA 1ND2C 2W94A 3RSJA 3U4XA 3VZMA 1GLHA 3PIGA 1GQHA 2HYXA 2W9XA 3I59B 3AXEA 2VY0A 3N9NA 4KNCA 1PO13 5FZIA 4ZU7A 2RM21 3H1YA 2R073 1O8PA 2ENRA 4MGIE 1POV0 4JRLA 2E51A 1ASJ3 2Y64A 4Q4W3 4P5HA 3THTA 1HB2A 3AVSA 3KF5A 3DKQA 4ARYA 1NA1C 5DN2A 5T55A 1TE1B 1TG7A 2VQTA 4MHUA 2CYFA 3H3LA 1W99A 1CAUA 1ND2B 2BNNA 1UY1A 1LOBA 1WA4A 3BGAA 3ETQA 1V6MA 2QDNA 3LPFA 1YYNA 1UXZA 2VZTA 2YBKA 4P00B 5FCCA 3VBSA 1APNA 3LA3A 4XACA 1REDA 1SFNA 2AGSA 4D6QA 1UX6A 1R081 4PCRA 4WM8A 5JSRA 1DQ2A 3A7QA 5EP9A 3SITA 1JHJA 1W05A 2X8KA 2ZX3A 3KQ4B 4CCJA 2XHNA 4LBOA 3VZLA 4ZZ8A 5CA6A 5FR3A 2VC9A 1NA1B 5T5JA 5A6ZA 1Q3EA 1UCXA 4EV0A 4P08A 4YW2A 1RHI1 4R8HA 2EIGA 2WR9A 4OMCA 5CFCA 4DY5A 1WKYA 4W6YA 4AAPA 5FYYA 5A6YA 3KF3A 1C4RA 1S2EA 2VNRA 4IEZA 1QH6A 1QH7A 1REEA 3H7JA 4MYEA 1RMU1 4CDXA 2Q1ZB 3S5QA 4ES8A 4W8JA 2NN8A 2JECA 2GALA 1W90A 4UAPA 3GZEA 4U2AA 1AR73 4E4HA 1XYPA 4Q4X2 2RR13 5DXDA 5LA1A 1XNAA 1UKRA 4MXVA 1JTZX 2VCMA 3WF0A 3UKNA 3SEPA 5C5TA 1GYKA 4H14A 1R1A3 1NQJA 3LF7A 5ABJC 1TME2 3MYXA 4Q1PA 2ZEZA 3SISA 4V2VA 2WWSA 2XXZA 2FD8A 5F32A 4HVOA 4YG0A 1GFF2 3P3NA 3OBAA 4Z2WA 3UV9A 4WBBA 2DURA 3RGBA 2ZX2A 4QX7A 3K77A 3EYPA 3AYCA 1UPIA 4LIVA 5L19A 3BU7A 2VVDA 4A6SA 3RVHA 1W2NA 1W6QA 3AX4A 1K5MA 5DZGA 1DQ6A 4BK4A 4YZ5A 3VUOA 2XQRA 1XYOA 3GCXA 3HPNA 3JQWA 5DAWA 4AE2A 5ABJB 2WNUC 1PNFA 2TBVA 4QPGA 4UYBA 5FP9A 1RINA 2IXCA 4PI0A 1H8VA 2VQAA 5FLIA 2YHJA 2WKKA 5FY4A 2Q4SA 3OBZA 2QTWB 2VGDA 4YVWA 3QH6A 1BBT1 1Y9MA 4I01A 4IEWA 3ZSJA 1QJX2 2D5FA 2QZ3A 3BPZA 2P3YA 2P3JA 1VBB1 3VD4A 3N9MA 3WQBA 1F5JA 2VZPA 3HOBA 3WW2A 2Y26A 2JDMA 3VHOA 2WO3A 5JXJA 4RQPA 1SLLA 1VMHA 2WNUB 3HNYM 2R062 4AG4A 4FT8A 1XBFA 3O1MA 3MUY1 1GP5A 4EJRA 3H9AA 1HRI1 5CEHA 3P1IA 3ASIA 3C8XA 1XXNA 3N7KA 3E6BA 4LKFA 4XAEA 3KZ4C 3H1WA 1RJ7A 1OVPA 4I0BA 4GULA 3WINE 5K4LA 1GNHA 5JCTA 4Y5TA 4XTPA 1X9PA 4F3JA 2MEV1 3AMPA 1URXA 3SCGA 4BQ5A 3KD4A 1AHSA 5T5PA 3Q8BA 5JLVA 1LHOA 4Y4YA 2XBO2 2W47A 4IEVA 2W95A 4QXBA 1QNWA 2WO1A 3S30A 1J1LA 1X8MA 1YO8A 1ZRCA 2G9FA 2YPJA 5EHDA 2PHRA 3HBZA 3ZMOA 3LIGA 1UO9A 2B7YA 1JS9A 3VD7A 4I09A 2PQQA 1PIV1 4AFMA 1JODA 4KWJA 2ZEWA 4META 1UU4A 2FDJA 5FYVA 1SQ4A 4LE3A 1OLQA 3KVAA 4KGQA 5JSPA 1OT5A 2YMZA 2A6VA 2FMYA 3WNOA 4LK7A 1LHVA 2PHDA 2P1BA 3AYDA 1OQEA 3I49A 1Y9GA 2UURA 5JWPA 3WW3A 1MZFA 3DECA 4HL0A 4Y1XA 2X5IA 5A1AA 5A7WB 4ES9A 1E5SA 2R1BA 1RUC2 2WQZC 5GALA 4DXRA 2YBSA 5L36A 4YM1A 2W92A 2ZABA 1I3HA 1X82A 2AEZA 1COV2 4QXCA 3N9OA 2P4EA 3ZYHA 1YQ6A 3LB9A 3QH7A 1JW6A 3R05A 1J3QA 4DUXA 2E33A 1NLRA 2RVAA 3IBMA 1KDKA 2OQ7A 2R0FA 3EJKA 5A7NA 4FSJA 4PQQA 4FQZA 2VECA 3ZXLA 5EFUA 2R7EB 1H4GA 1Z7S1 4QM8A 3AP6A 1AXYA 4XMIA 5GLVA 4BZ4A 4OQ8A 5KHJA 3CF6E 1PK6A 2QVSB 3FUQA 2VOTA 4LJHA 3ZXFA 3JD72 4Y5Z0 3T0BA 2EAAA 3KSCA 4WM7A 5K0UC 2B5HA 3RRDA 1MS3A 4SLIA 2OT7A 5C5UA 4LNVA 3EXUA 2ZMKA 2VZ1A 4YG6A 2KA3A 2DVBA 1VP6A 1MEC1 3KV4A 1WUVA 4AQSA 4S2GA 3WF3A 3W5MA 3UETA 1C28A 2PAEA 4DS0A 5C9AB 2IVIB 4M3CA 1NKGA 2D3RA 5ERLA 3WQ7A 3ALQA 2TEPA 3U4SA 1F4AA 3I3MA 3SHRA 3VHPA 5K0UB 4QB2A 1D4M1 1ZZ7A 3M3IA 4IV3B 1QMJA 2B45X 5EZWA 5A80A 5SV5A 3T0AA 3L9JT 3I7DA 2RMU3 3AMHA 1HN0A 1W3VA 1C8NA 1PGSA 2XDVA 3FBMA 3AMMA 3M3EA 4WV8A 1R64A 2TUNA 2ZKNA 2W68A 5I8SA 5KXEA 4A7KA 3IPVA 1LOAA 1RUI3 3AZWA 1RUG2 4HANA 1YNAA 4BA6A 4ISRA 4UBHA 4AI3A 3AM2A 5GLZA 4HVRA 4QU1A 2O8QA 1JXNA 3RZHA 4E2GA 5FV3A 5F3IA 4M0NA 1S0IA 4RSUA 1FI2A 1HKDA 3WQ1A 1NCQA 1NE6A 2JG9C 2GP3A 1VB4A 3Q8EA 4N9HA 2ZGTA 4FBFA 3PUHA 2V73A 3ZMNA 3IMMA 1PMJX 4CYDA 4AVCA 2WABA 5C3OA 1VBD2 3DGTA 4QQ2A 1HXS1 1VRH1 2J42A 4YW1A 4SBVA 4LBLA 4MGSA 1VMFA 4Q4Y3 5J09A 2YB7A 1KFUL 3VDCA 3G6JB 2HWB1 2I74A 2IXJA 2G4IA 3OJBA 4XDQA 3GZUC 3B94A 5FAXA 4NIIA 1BK1A 4XCAA 5KHKA 5C4WC 4PJYA 4GWNA 2VNGA 1NY71 1AL0G 2HWF1 2D3SA 4P02B 4HBNA 5F3GA 1IPSA 1V9U1 5JI7A 2CAUA 3P3PA 4JZRA 3VBSB 3VN4A 5JI9A 4IV1A 5JOWA 4BISA 5IYYA 3H3UA 4QX8A 3FWEA 5FO9B 1WCKA 3WZ1A 1IPJA 1CAWB 3J7HA 4N43C 1M06G 1H1IA 3ZPYA 3JBG2 3HR9A 4ZU5A 1C57A 1FOD2 3O0WA 1N3QA 3L2HA 5C6CA 4FFHA 2VZVA 1XNCA 1LHUA 3OD4A 4EQVA 5DUUA 5C4WB 3RYPA 5CG9A 5EJ1B 4MOAA 2E53A 1GP4A 2Q1FA 4S2DA 1I5PA 4GB32 3ZYFA 4B7EA 2BBVA 4AVAA 2LW8A 2R49A 5D2AA 2XJVA 4GALA 5CYYA 1LOEA 3MBWA 2W1WA 3KHBA 5CU1A 4ASMB 4N43B 1EY2A 1BXHA 3J7MA 4FP2A 2D6MA 5FZEA 2JDPA 4CDWA 3OUHA 1A8MA 3VB9A 4XHXA 1SBDA 1R093 1OC1A 2WYFA 1QDOA 1S0BA 5D21A 2WLPA 4TXWA 4C0BA 1IZ3A 2AR6A 1IQDC 3B5LB 1UIKA 3WG4A 4DXSA 1AR91 1XB9A 1GZWA 1D7PM 2QFEA 1LOFA 4LBKA 1D2QA 4S2FA 2VZQA 4Y1YA 2ID4A 4XQWA 4FQ4A 3AP5A 1PO11 2AUYA 2YC4A 4JGYC 2A75A 2WUHA 4NRMA 5J36A 1DZRA 1HLCA 2R071 1K5JA 3O1VA 3WDWA 3W5NA 2BFUL 3MW3A 2GMMA 4IXLA 1ZRFA 2FDKA 1W6QB 1Y7BA 3MIGA 4Z92B 2FDFA 1GICA 1Q8OA 2PQSA 4HT1T 1W8NA 2FBEA 3NJVA 3GXUA 5GLWA 3POGA 5FMOS 1CQ9A 1RHI3 5FO7B 1QY4A 4Q29A 1BKZA 1GQGA 5FUPA 4HK9A 4CU7A 5BNOC 4JGYB 2AC1A 2PLV3 3H3ZA 3NMBA 1NCRA 3TRSB 4WVMB 1E5IA 4LQRA 1H2MA 1LGCA 3FE5A 1RMU3 4XPVA 2JENA 3RJRA 1QU0A 4GWMA 4A42A 4QPIC 1QQP3 4CDQC 2CWSA 3VL8A 4GD4A 2VBPA 1RXFA 2WA3A 4ATFA 2ARAA 3RI9A 2PHWA 1BEV2 1V6KA 4KG0A 3J7NA 4RFT0 4Y1VA 3J4UH 4XFCA 2DCTA 4LLFA 3O1OA 5ANQA 1W9SA 4AI1A 5FPXA 4NO4A 4CCCA 1UYZA 1BVP1 2ZGPA 1AR71 2EAKA 3T2QA 2VU9A 2ZKLA 2P3IA 2P6HA 3NAPA 3WNNA 4CDQB 3POJA 3CDZB 4E4SA 2VMGA 4D7YA 4YGBA 3C3VA 5BNNC 1US2A 2ZA9A 3USUA 1YJLA 5LY2A 3CL1A 1ODMA 4LITA 1MACA 3KHCA 3I2FA 4OZOA 3O1RA 5C70A 2VMIA 5I0TA 3TN93 1WLTA 2KD7A 3THDA 4JHZA 4OUSA 5I0DA 3WX5A 3M3OA 3AYEA 2C0ZA 2OX0A 2W52A 3QLQA 4Z07A 4UWDA 3ZXEA 5L9BA 1O4YA 1FPN3 2VVFA 3HQXA 4B1LA 3SH3A 4L9BA 1NAEA 4KWLA 3VKLA 4AQ2A 1VBB3 3I2GA 4A4AA 5BNNB 3ATGA 3HD8B 4B4PA 1H9WA 5JXGA 3U14A 1JZ5A 2XLGA 3GJBA 2ETEA 3THCA 4JAAA 5FIXA 1UL9A 3NV1A 1UIJA 5A3WA 3NJYA 4NHMA 1ENSA 2A70A 5F5AA 2QQWA 2W1UA 3HQUA 3BB6A 3WOGA 5C3PA 3TAYA 4IGOA 5LZ6A 4CP9A 1RUJ2 2ARCA 2GN7A 2VOKA 1KJLA 4I3PA 1HRI3 5HCBA 3SLIA 4W6XA 5LK7B 3VBRC 3FL7A 1DGRN 1EV12 2DCZA 4Y5SA 3RZGA 1PGW2 1DZQA 5FYUA 2GP5A 1WCDJ 4LO7A 5EYYA 3H8OA 3AZZA 3CBNA 2W1QA 4BQXA 1K12A 1XOYA 1XNBA 1W2TA 2W1SA 3WNMA 1A6CA 4MH0E 4LUMA 1B35C 2MEV3 4LHSA 4QQLA 1JYVA 5M0TA 1AR83 5A7PA 3UKVA 2D43A 3FN9A 3ZFEC 4HK8A 3ILRA 3SEEA 1US3A 5A3NA 4UFLA 5F3CA 3V65A 1EAH2 2WYSA 1ZNPA 1YIFA 4EE2A 1LGBA 1W6PB 5FZGA 1QWRA 2HWD3 5KHIA 2YU1A 5FYMA 1DGWX 1PIV3 1X50A 1XE7A 4WM8C 1WLWA 5LA9A 1KEXA 3H7YA 3CO2A 5CAZA 2XONA 2CV6A 5H9RA 1B35B 1VBD1 1UW8A 2CSGA 1RUD3 3LEIA 4IEUA 2CTVA 3ZFEB 1QEXA 5A7QA 1MQTA 3WY6A 1LCLA 2Q0AA 3N9PA 2WNOA 4K7JA 2HEVF 2PN5A 3NNGA 1RVF2 4QDQA 4YW6A 1TVGA 3HEIA 4OI4A 3RDIA 5JXIA 1LEDA 1K45A 2NMOA 5FXXA 4V1PA 4WM8B 1JZ7A 1JYIA 4I2OA 4P14A 4QDSA 1HRV3 2A3YA 4GA9A 4XVHA 4EWEA 1J58A 3A0KA 4MUVA 4YG3A 4EWDA 1S1AA 4YPJA 4RHV2 3OD0A 1FT9A 4UW6A 3UK9A 4BQWA 3VBHA 5IUQA 1CX4A 4URTA 1Z7S3 2UYBA 3AZXA 2JE9A 1TMF2 3I2DA 3BN6A 5FP7A 2BU9A 3T1MA 4HMZA 4A3ZA 1OA4A 1ZYBA 3WDTA 1NCQB 2MPFA 2JB4A 4K6BA 3VZOA 4DEQA 5GZGA 1IPKA 3I4IA 4CXWA 1QJU2 4JV4A 3DL3A 1MVEA 4AHYA 1JOJA 2D5HA 2ZZJA 1UZVA 2V09A 4XE9A 4FPOB 1J59A 2V5DA 2ZGSA 3MHZA 3PLQA 3V0AA 1UU6A 5D8AC 4XJUA 1A78A 2RS52 3IAQA 2LROA 2CDOA 3HN1A 4J1XA 1UPSA 5IAXA 4FPHA 2NMNA 5I0SA 3UGFA 3OYWB 2C6SA 2C9KA 4C8DA 4YZ2A 4QPWA 5BUVA 2JWPA 2A71A 5FZKA 1GUIA 4CEYA 5BY5A 4AFCA 1NXMA 1ULPA 1AL22 3J8F2 4LBJA 4ZXEA 3UGGA 2XH6A 2B39A 5DUXA 1Q5OA 5FZ1A 5FZBA 1VALA 4GXLA 1WLCA 4CTEA 4R9BA 3PVBB 3CJIB 3WUDA 4ZZ5A 2WN2A 3FUOA 1OD3A 4GIQA 4GJZA 5GLUA 5IK5A 3KB5A 1O3RA 1C1LA 4BQ1A 1TZOA 2PA7A 2Q8EA 1AX2A 3V0AB 4I0WB 3W9AA 4C91A 1T6BX 2RMU1 4ZS3A 1HV1A 3VBFA 1ZRRA 4EN0A 1H6YA 4COVA 5GZEA 4CCKA 1CWPA 1DYOA 1RUI1 4D7TA 4BLJA 4P9LA 1JHNA 4CUCA 3KMHA 2P34A 5ACA1 2FZ1A 2W91A 4CZSA 2BOJA 4Q4X3 1YI9A 2FDGA 4HONA 3WR0A 5KBFA 4D6SA 4YVSA 1Y4WA 2HBUA 3AL6A 2JEMA 1FNZA 1TME3 2WQ4A 3MLJA 3EB7A 2K46A 2UWCA 4AEMA 4IGPA 2ZGUA 2QKDA 2WZPP 1Z0HA 4PIYA 1QNYA 2ZHMA 1JYCA 1AJKA 4R4ZA 5FXZA 3UGHA 1G9AA 2DVAA 1JU4A 5L73A 2EXJA 1C3HA 4H2AA 4Q4V2 4CA9A 1GOFA 3WP3A 5LA2A 4G9SB 1GWMA 4UW3A 5JPNB 3LPGA 1JZ6A 4MG2A 2H6CA 4Z1VA 1KS5A 4L92A 3ZSEA 4LO8A 5JZGB 3D0JA 1WBLA 2JDNA 4PDWC 3D6EA 1DF0A 2YROA 4AGRA 4CPBA 4ITCA 4KQ7A 5FMBA 4E27A 3ORJA 4H7MA 1UF2C 2XKOA 3ON7A 1QJX3 4OHVA 2D44A 2ZGOA 3WD5A 4M4RA 1AYN2
chains in the Genus database with same CATH topology
4YM0A 4RS5A 2BFUS 2IZWA 4XJ8A 4HN0A 4PDWB 2FQPA 4QHBA 5CVRA 1L3JA 2R063 4LO5B 4U36A 4AEKA 2GSYA 1W6NA 2JG8B 1H2NA 3IKWA 5A32B 1GNZA 5E89A 1VBA2 5SV8A 1DIWA 3ZFGB 2VPVA 1ENRA 1R091 3DPRA 4YZ3A 4ATEA 4CDUC 1V6NA 3GBWA 5C8CC 2WZR2 4PQ9A 3JCIA 1RB8G 2DF7A 3GYDA 3JB4C 2RHPA 1C8M2 1IGOA 3AYAA 4Y20B 4HVQA 5C33A 4IEYA 1G7YA 2XBO3 3D82A 3M70A 3W58A 1MS8A 4PIZA 1CD3G 3INAA 4WVWA 3WUCA 3FLTA 1Q8PA 4CDUB 4L2NA 4NHKA 1JH5A 4B4QA 5C8CB 1RTVA 4KH9A 2GDFA 3ZN4A 1D0HA 4RR3C 4CP1A 5F6LB 5CFDC 1PZ8A 5LK5A 3W59A 4YNIA 2R16A 4FXKB 2JG9A 2K0GA 3MF9A 2ERFA 4YFWA 1RUC3 3ZX7A 1D4VB 2PLV1 5AVPA 1WW7A 4YGDA 4MGKE 4Y24A 1COV3 5AC92 3RYRA 3NVCA 3OTFA 1DGRA 2E7QA 4N53C 1HV0A 1QQP1 2Q5TA 4RR3B 1KXGA 4BHPA 5CFDB 4XFFA 3VKOA 3GF6A 3WLUA 3ILNA 3ZSKA 3BIWE 1X36A 5FMOL 3ZXAC 2ZGRA 2WJSA 5IK5A 3VLBB 2XPJA 3ZXKA 2VNOA 2O1QA 4XIKA 4CEWA 1EP0A 1YJKA 1AR62 3VBOC 3VZKA 4HPKA 3E5UA 4COUA 3KGLA 1I1EA 1AYM2 4S2HA 3JD73 2PAMA 2XJQA 3EO6A 4N53B 4BPZA 4OI0A 3MICA 3VL9A 3DUIA 2RS12 1RIRA 4O9GA 1SEFA 4XJZA 3KCXA 4AGVA 5CIRA 3NO8A 3TN91 3WG2A 4OVEA 2YGLA 1IS6A 1POV3 4HETA 4XOGA 3VBOB 2ZGQA 1W6MB 2ZMLA 1KJRA 1FPN1 5FPZA 3U10A 1AL21 4AI8A 2DCJA 1WCSA 3OBTA 4Y22A 1ENXA 2XKPA 3WW1A 4K9SA 4YSFA 1RUG3 1FX5A 3MEPA 2AZ5A 4P9YA 2VOXA 1BVVA 3M3CA 2N7GA 3IMNA 1BMV1 4BOWA 1SLTA 2WFF2 3T2TA 3FBYA 4XFHA 5DUVA 2P17A 2LUWA 1H1AA 4BLIA 2SBAA 3R0RA 1I9RA 2ZACA 1X8EA 1AR81 3WHUA 3LOIA 1YCIA 1VBD3 2AENA 5JMCA 3VBUC 2LM3A 4PBPA 1OQDA 2CGNA 4NHLA 3WHTA 4Y1UA 2HWD1 1JUIA 4HSLA 2V5YA 2D6LX 3ZIWA 4QPIA 4CEYB 1W6OA 4GMP0 4AHXA 1SLBA 1RUD1 4LO6B 3WQ0A 4RL7A 4UW4A 4A2UA 5GZCA 5CADA 2HEWF 3VBUB 3V64A 1REFA 3JBG3 1VBC2 1ZBE2 2D6PA 2DFBA 1N1VA 1D0GA 4D7SA 1HRV1 2I2SA 4GB33 4C1XA 5FOJB 3PMSA 4FOVA 2B9UA 1AXKA 4OULA 5JR7B 4XFGA 4EN8B 2OZ6A 1RUE2 3MF6A 1ZZ9A 3FC0A 5DG1A 1UZYA 1G9BA 4IEQA 4AHZA 1H2KA 1DGLA 1NE4A 3ZO0B 1Y3TA 5C9AC 5J96B 4GKXA 4WZFA 3WDVA 3RS6A 1YWKA 1PVC2 4P9IA 1AXZA 4MXWB 4IV3C 1EYBA 1YFYA 4MLOA 1FNYA 4INDA 2A3WA 4AI3A 3O12A 2A7AA 2MNGA 4WZCA 3N7JA 4XHBA 5AFBA 1UZZA 3H8UA 3WP5A 4OHYA 2EA7A 2Z42A 1C8M1 3TB0A 1LU2A 2VQ0A 2YYOA 3VBRA 4LA3A 3M3QA 4PLNA 1H8TA 3FFQA 2AREA 1IS3A 1WW6A 1OOPC 4HZFA 3DV8A 2GAUA 4LUKA 1YLLA 1Q8QA 4Q0UA 2ZAHA 3AB0A 1NOVA 5DZEA 4R9CA 4AQTA 1LRHA 5ACA3 2A3XA 3MI8A 4IEOA 1HQNA 5GLTA 4E2QA 4QQPA 1HX6A 3V56A 1BEV3 3QCWA 5EYXA 1OOPB 2WSUA 3S7IA 5H9SA 3J9SA 1W6NB 2K2SA 3TNQA 4NN0A 4LLOA 3VBSC 2ET1A 5BXXA 2YC0A 1GANA 1ZX5A 2PTMA 1G9CA 3VDDA 2BTVC 3VKFC 4Q4X1 1UMZA 1BYHA 3VKMA 2GMPA 1LHNA 3SCFA 3QACA 3RWNA 1IKQA 4TZDA 3MLKA 1LKNA 5KXCA 4AEDA 1OA3A 1MZ5A 3KQRA 1DQ1A 1TME1 4HN1A 1CAUB 4FTSA 4XF9A 1LHWA 4TWTA 2OZJA 3ZN6A 5CFCC 3MIDA 2WFPA 4DFSA 1AYM1 2RS32 2GNMA 3U07A 4NOTA 3IT8A 1ONAA 1ZRDA 4FTEA 3MFAA 4JC1A 3AMNA 3HMYA 3R4UA 4CDXC 4AYUA 3JUUA 3RZZA 2RS11 3GBGA 1TNFA 1OPOA 4D94A 4JGZA 1D2SA 2BGCA 2DCKA 2RJLA 5E1RA 5EWSA 2XLFA 4FPKA 2DCYA 4GH4A 1CJDA 3T1LA 3JU9A 4Y26A 2ZGLA 1ENQA 1W0OA 2DYCA 1ULGA 4COYA 3B01A 2G9GA 2YXSA 5CFCB 2DFCA 3HAGA 1QXRA 3BODA 5DG2A 1RUJ3 1QJX1 2D93A 3LCPA 1WLDA 4CDXB 2ATFA 5I8TA 3MW2A 1EV13 2NM1A 2CWMA 5D8AA 2GC1A 2JICA 5L7OA 4HKWA 1AZDA 3IDEA 2ZGNA 5GM0A 1K5MC 4Q0PA 4GKYA 2R061 3OGJA 2GN3A 4B29A 5J3UA 1QGLA 2ZX1A 2GC0A 3KT7A 5E88A 2CL2A 4QPGC 3OGGA 4L97A 1OQ1A 1PM7A 2I45A 4XMAA 2WNVA 1FV3A 4NR1A 3WW4A 1EAH3 3BOPA 4YVWC 1SBFA 4IERA 1J3RA 1S2KA 1G86A 1ZBA2 4JCKA 4BIOA 2GH2A 2D7FA 3HIFA 2R32A 1FAYA 1VB2A 4LULA 4MX3A 1K5MB 3X29B 2XBO1 1VBE2 3OY8A 4LE4A 4NVPA 4RQPC 1DDLA 1WMEA 1ZM1A 4IEPA 5JPMB 2P37A 4QPGB 5GZFA 1I5ZA 5KXDA 3ZYRA 3KCCA 3ZIXA 3DKWA 5HI0A 1RVF3 1RUH2 1SCSA 2JKBA 3B7MA 1J3PA 4YVWB 1LB2A 4DMIA 1LOGA 2XVKA 1H1MA 4FAHA 1W39A 2VG9A 3LWCA 2R0HA 3ZFFA 1HDKA 3V0BA 1EPWA 1FMD2 4RQPB 4RHV3 2PHTA 4YW5A 1PO22 1RUC1 1SACA 2GNTA 2ZOEB 3MIFA 4AVSA 4JRAA 1WGPA 2Z2SB 5K7PA 2VOWA 2X29A 4IQPA 1TMF3 1COV1 4QX5A 1ND3A 2VW2A 3SXWA 1S0FA 2QE3A 4QGLA 1QJU3 3WVJA 2UY9A 4YW4A 1PNGA 3AKRA 1YIPA 5IT6A 2B8MA 2ZGMA 3SH4A 2WC2A 1T6GC 4LTAA 2D6NA 1MVQA 3HWJA 2ZJCA 2X5IC 2RS53 1R1ZA 4XYXA 1CAVA 2WT1A 2CAVA 5FDBA 4LBQA 3JD71 3LOBA 1ULDA 2EF6A 3I59A 2EXKA 4Q2FA 3ES1A 5J37A 5JAXA 3AP7A 4K8FA 4RD7A 1ZZBA 1LGNA 3E6DA 1DZTA 1AL23 1Y9QA 2OUJA 3J8F3 3LA7A 3E5XA 4F83A 2X5IB 2HEYF 1POV1 4KU8A 5J48A 4HSJA 1ND2A 2O0OA 4XTMA 5BY5A 4JDMA 4XQDA 2KM2A 4TLFA 5DDJ2 1PK6C 4UBGA 2PELA 4LBNA 4N7UA 1PZ9A 4YZ1A 3H0OA 4QD2A 4WM7C 3UL2A 5T3NA 2BEOA 5H9PA 3OBRA 1CIWA 1NA1A 4HFSA 4YYOA 3APBA 1RUG1 1LOCA 4H55A 4EN9B 2BVBA 1Q8VA 3WG3A 2GZWA 3ZN5A 3D8CA 2VXRA 1FATA 2HWE2 4W6WA 3SMHA 1PK6B 4XZPA 3QOPA 4E4DX 3WCSA 4WM7B 1JN2P 2NPIA 4MGZE 4UW5A 5E16A 4OI2A 4OUMA 3OF1A 2RM22 2YUEA 2NQYA 1QJY2 1Y43B 4Q4V3 4DINB 4Q8LA 1DQ0A 1PMIA 2XL9A 3M2MA 4FPFA 1MZ6A 4QGMA 4XETA 1KS4A 1FV2A 3LSEA 5I0UA 4M3CB 1Q8SA 1O5LA 1RC6A 1CAXA 3IWZA 4BMBA 2OYZA 5KXBA 1NCQC 1PGL2 4OLLA 2DTYA 2HKXA 2RS31 3ST7A 1OMIA 1R082 2BUKA 4FXGB 2Y0OA 2VUJA 1RITA 1UD1A 4QXKA 4WVZA 1C5HA 3MDPA 1LTEA 2WS92 3AXDA 3IPVB 4LBQD 3JBG1 5ABJA 1FOD1 1AYN3 4Q27A 2Z69A 1RHI2 3HT1A 1LECA 3E97A 2XUMA 2E63A 4DY3A 2XHKA 4B4RA 2YV8A 3AZYA 4GB31 5BNPC 3SNMA 1O5UA 1OKQA 3H1MA 3E6CC 3N4MA 5BYNA 4YLZA 1OFNA 3RG0A 3N36A 2HWC2 4L11A 4UXAA 5E8AA 3ILFA 4YARA 1U5XA 1MS4A 4IV1C 1VBA3 2P3KA 2WNUA 5TSWA 1XU1A 3ZSMA 1Z78A 1U5ZA 2WZR3 2EVXA 3CJIC 5BNPB 4CP2A 2QZ2A 1A8DA 4AEDB 1C8M3 3R4SA 4QGNA 4B7KA 2H0BA 4Z8BA 2P2KA 4L99A 5T52A 3D5OA 1I6XA 1AF9A 2R6QA 4LHKA 4IV1B 3NWKA 3LZZA 3U11A 1OFSA 4XFAA 5JDBA 1RUF2 5BV6A 4CDWC 4D3WA 2PHFA 4A7YA 4LT5A 5CB7A 1O3TA 1DQ5A 1TNRA 2W08A 1HW5A 1BBT2 3TYJA 1RUH1 4P9WA 2UYAA 2GH8A 4EN6B 2HJIA 4XF3A 1N3OA 3K48A 4HKOA 5AC93 4X8PA 5KHHA 4DRRA 4CDWB 4GMP1 2XLAA 1RGSA 1FMD1 4Q0QA 2IXHA 2YY1A 3ZYPA 5JZGC 1BEV1 2E9QA 2ARBA 3DN7A 1GZWB 4YRDA 1S55A 3RNSA 4PF5A 1LODA 5HCAA 3WG1A 1AR63 1FYUA 2XG3A 3D0SA 1U5YA 4O9EA 4XFBA 2VVEA 1S0GA 1AYM3 5FO8B 1OPMA 1NCRC 2CNAA 3ZYIB 5GKAC 1LJ7A 4M3CE 3NKTA 2AH2A 2RS13 3AP4A 3GALA 1OD5A 4K20A 4K21A 1QF3A 1MS5A 1IOAA 1ULFA 2BWCA 5IK4A 4M3CF 4LR4A 3M7AA 2CY6A 3B3QE 1BZWA 3WT3A 3MFCA 2JG8C 3FMGA 1NCRB 4ZXKA 3MPPG 3LGRA 5T50A 2ARXA 3ZSLA 2X53S 1PHMA 3ZFGC 4LEJA 2DVGA 5FBZA 5JIUA 2R30A 4E4ZA 1KFXL 1DU3D 2BNMA 3NAPC 3RPQA 1SLCA 2H6BA 4QM9A 1VJ2A 2F4PA 1YI7A 5HBAA 1VAMA 1JBCA 4P9XA 5K0UA 2JJ6A 2ZAAA 5I91A 1U5IA 1RUJ1 4IV3A 2R042 1EPZA 2Z5WA 1JUHA 2XJPA 2JXAA 2C1FA 4BMEA 1LULA 3AFKA 1EV11 4AEJA 4ASLA 4MSVA 2WFF3 4AGGA 1F2NA 1PGW1 4A7ZA 2EXIA 2ZBJA 3VHRA 2QCSB 3NAPB 1DLLA 2PHXA 5JOYA 1WD4A 3USUB 4AXOA 2GNBA 3N7LA 4Z82A 1SDWA 2HWE1 1MZEA 1CAVB 4QMAA 1EAH1 4DPNA 2D98A 4XBNA 2PAKA 4LBQB 3FHIB 3NKGA 4AF9A 2GC3A 1MEC2 1QJY1 4I3GA 4FP3A 2Q8OA 3URFA 5JOXA 5D1IA 2NZ9A 4IEXA 3NV2A 3FLPA 4W65A 2YDEA 1VBC3 1ZBE3 4Y1ZA 1GZCA 1RVF1 4ISQA 2UU8A 3FX3A 2DUOA 4FO9A 1D4M2 2XWJB 2Q30A 4P9JA 1XYNA 1ZZ8A 1PGL1 4ZU4A 2H0VA 1H9PA 1CAWA 2WA4A 1YRZA 5A33A 1X7NA 2WS91 4RHV1 5GJ6A 4FPLA 1RUE3 3WDUA 5C4WA 4OZXA 1PVXA 1XRUA 4DQAA 1TMF1 2O8OA 3NSTA 5CG8A 1MQTC 1LEMA 2IFWA 2WINB 2ET7A 1H4HA 1F31A 1QJU1 4J1WA 1PVC3 4N43A 1QHDA 1RL3A 2HWC1 1NYWA 1RUNA 4H3WA 4YFZA 4M01A 5F6KA 2VW1A 1HXS2 1VRH2 2BVVA 3HT2A 1MR5A 1SLAA 1WMFA 2RS51 3JZVA 3PMEA 1AUYA 2HWB2 4XJWA 3VBHC 1MS9A 1MQTB 3IDCB 1X33A 4FOQA 2XJSA 3AKTA 1NY72 3CEWA 2ZMNA 2HWF2 5KC6A 1TEIA 1AVBA 1ZREA 1O4TA 1CAXB 3EQEA 1V9U2 2VULA 4H7LA 1GZ9A 3ROUA 2DVFA 3ECQA 4OFGA 4LHNA 3J8F1 4XJ9A 3FFZA 3ME2A 1RUF1 1IS4A 3EBRA 5F9TA 4XQ4A 3KT1A 3VBHB 3QBQA 3TNPB 3FZ3A 3WDYA 3G7DA 1WW4A 4JGYA 3FLRA 3S0MA 2LALA 4WVMA 1RJ8A 3AJZA 2XVGA 3AP9A 3GZAA 5JSOA 3IN9A 2D97A 2RJKA 2A6XA 4COZA 4CEYC 4FCAA 5BNQA 3R6SA 1UAIA 1YHFA 1OI6A 3MPBA 2BWAA 1GSLA 4OI1A 3V0AB 3KCYA 1WMDA 4G3YC 5GZDA 5JVVA 1AR92 5BNOA 2IFRA 1AJOA 1H2LA 2DVDA 3POSA 4AVTA 3ZYJB 2Y0IA 2HYKA 2IWGB 1IHMA 1UU5A 4LHLA 1B09A 2WIIB 4HLTA 1PO12 2NYYA 3NV3A 2BQPA 2R072 1XNKA 2RS33 1LR5A 3VBFC 5J98B 1ASJ2 4Q4V1 4Q4W2 4CDQA 3A4UA 3UJQA 1BQPA 4QQOA 1SLIA 3IDBB 3PVOA 4TYSA 1ZZCA 1NLSA 1YXWA 4XBLA 2QJVA 4EROA 3O0XA 5J7MA 3VKNA 4JTNA 1FOD3 1N1SA 3MZHA 3PNAA 4FVVA 4F7ZA 3U0ZA 4K1ZA 4FOYA 4YVSC 2QUOA 1QJZA 3VBFB 3WP6A 3ZDSA 3ZYGA 2Y38A 2XGXA 5BNNA 1S2BA 4Q1RA 4X6RB 4ORFA 4C1WA 4Q8KA 1AYN1 4JDOA 2R1DA 3LAGA 1YFWA 2WSVA 4L8QA 3KLSA 2VMHA 4A3XA 4YVSB 4FTBA 1XU2A 5F5QA 4XF0A 2R041 2MHFA 4R9DA 1ULEA 2JD4A 1CESA 1AR72 1VBA1 2RR12 2GMEA 4PIXA 4LA2A 2VH9A 1ZBA3 2CGPA 1R1A2 2WZR1 3B00A 3S7EA 4AFBA 1F8VA 1DQ4A 5CNAA 4RS5C 5K8SA 1VBE3 4CRQA 1S0JA 1YUDA 1W6PA 3WXPA 3KM5A 1C1FA 5FREA 4E9KA 4MV2A 5C8WA 1RUH3 1B35A 4XXAA 5FQ0B 4BCUA 3DPRC 3ZFEA 4RS5B 4GMP3 2ZX4A 1FMD3 3ES4A 3ZVXA 4XF1A 3L2YA 3M1HA 1PO23 1QDCA 4NWWA 3S6PA 1VAKA 1A3KA 2I07B 3JQXA 1M4WA 4WM8A 1S0EA 1QOTA 2BYVE 4N7IA 3OPZA 1S0CA 4XF4A 3VZNA 2GNDA 2BW8A 3VHNA 2QQPA 1ULCA 1YFUA 2ZHKA 4KWKA 5AC91 5A3MA 4K1YA 1GV9A 3DPRB 2WNEA 1VR3A 2UY8A 1QOSA 4XIOA 1DG6A 5FLJA 2ZPXA 4MGYE 3AK0A 1AR61 5FTTC 3AMQA 3O7OA 1KRIA 1CVNA 2EALA 5JIAA 3E5QA 1N47A 1CPMA 1IQAA 2DTWA 3I8TA 2PFWA 3B02A 3AJYA 4JVAA 4YM3A 5EXOA 1V6JA 3PJYA 4N9IA 2JE7A 4PBOA 3M4FA 1LU1A 1N1TA 3Q9OA 4M00A 5FFOC 1N3PA 2JG9B 3OYWA 1V70A 4KBBA 4XILA 4BM8A 2WL1A 5FRAA 3B9CA 1CN1A 5DZFA 3J26N 4OHZA 3WP4A 2YGMA 4CEWC 5DDJ3 2VW0A 3B93A 1FXZA 3BALA 2KXLA 2OIIA 5T5OA 2ILMA 3RMYA 1SFYA 3MLLA 3CJIA 4TSVA 5A33B 4OHWA 5A3LA 2PYTA 2ZS6B 4E2SA 2DWRA 3CNAA 1XNDA 3NL1A 3R4DB 3D4KA 4CEWB 5K9YA 2HWE3 2D3PA 2WFF1 1H0BA 2ZTNA 4AVBA 4HPKB 4X8NA 4NWVA 1RUOA 2FZ2A 4M0HA 1J1TA 1ZZ6A 1F9KA 3I54A 3N3HA 5I8YA 2D40A 4IL7A 3NV4A 2RM23 3TOJA 3H50A 1QJY3 4IESA 1ZVFA 5KWRA 1HIXA 4JTOA 5T54A 3KS7A 1O4ZA 5DUWA 3RYKA 2FHRA 1HQLA 4GQ7A 4B3NA 5IK8A 4XJAA 1E57A 4XBQA 2D6KA 3QD6A 1DYPA 2D6OX 3NW4A 1WD3A 1MS1A 1ASJ1 1R083 4Q4W1 4AWDA 5JZGA 2WS93 2OW4A 4Y22B 3AFGA 1VBC1 1Q43A 1ZBE1 3MIHA 2PHUA 2A73B 1GKBA 4QT6A 1UKGA 2Q1MA 4K3UA 2YZ4A 2QDRA 4AQ6A 2RMU2 2BNOA 3JB8A 4OHXA 1KDMA 5AVAA 3TBDA 1RUI2 2HWC3 4PLMA 1RUE1 2A5ZA 4YM2A 4BE3A 5ACA2 3B69A 4BIFA 5LEKA 1AX0A 2JX9A 4PDWA 4XEZA 1C5IA 2A6WA 2XL7A 2XWBB 3VV1A 4Q0SA 3VZJA 1IS5A 5BNOB 3CU7A 5FOBB 1GR3A 2JG8A 1PVC1 4ONUA 5A32A 4FPGA 2IXKA 1W2UA 4N90A 3RMXA 5JOZA 4EWAA 3ZFGA 5CBLA 4K40A 4Q26A 4QPIB 2RR11 1VIWB 3ACLA 1W6OB 4G4FA 1TQ5A 1U12A 4Q4Y2 1O3SA 1BJQA 1R1A1 2XB6C 3BTAA 4Y20A 3WV6A 1PZ7A 1RUF3 3KT4A 4FPJA 4DB5A 1XE8A 1ALYA 3PJQA 4KL1A 4I02A 1CPNA 2WT0A 3PTYA 2DUPA 2CGOA 3PVEA 2NLRA 1SBEA 2QNKA 3EHKA 3O5SA 1BBT3 3SH5A 4X6QB 4CDUA 4YGEA 3N35A 5C8CA 2WLQA 1QXJA 4XFIA 5F1RA 4LBMA 3UJOA 2ZX0A 1OHFA 3FJSA 3K51A 4J6GA 4YGCA 3GHMA 4AW7A 4CP0A 2GU9A 2VOVA 2A6YA 1KITA 2BPA2 1H8TC 1CR7A 3NJZA 4QQHA 4RR3A 1R092 3IM0A 5KHGA 3ZXJA 5CFDA 4QU2A 3ELNA 5LRSA 3C2UA 3PVNA 2DV9A 4KG8A 3GZTB 3O14A 5KC5A 3AKQA 2Z79A 1SMVA 1UN1A 2ES3A 2DUQA 2LTNA 3OCPA 4FPCA 3VBRB 4KGGA 3POYA 1OLRA 1OSGA 3AKSA 2DU0A 1OA2A 1V6IA 1LESA 3LKJA 1H8TB 1NZCA 1QKQA 4N53A 1DHKB 1KQRA 3WCRA 1N1YA 4BWOA 5I93A 4QPYA 5BPXA 4RGGA 2GC2A 5T5LA 2UWBA 3KGZA 2F6BA 5LEJA 1YFXA 3VDDC 4FPYA 4MVTA 3VBOA 3WDXA 4D69A 1W6MA 3ENRA 1NQDA 2W0XA 2PLV2 4AEDC 1Q56A 1XQNA 4AI2A 2W39A 1G9DA 4JQRA 4AHWA 1SCRA 4HKLA 1RMU2 2ZHNA 2R043 1O91A 2C5DA 4KU7A 1IKPA 3POWA 1QQP2 1O7FA 4P9GA 3VDDB 1V6LA 1H30A 3A0NA 3ZXGA 2AYHA 2C9AA 4DZGA 1W0PA 3O0VA 1F5FA 4JGZC 4GH4C 3RI8A 3BCWA 3GNEA 3ZN6B 1NG0A 2PHLA 3LSDA 3VGIA 1O3QA 1DFQA 1CGPA 4BH9A 1ZBA1 4LO4B 3WNXA 4R52A 3RJ2X 4AFAA 3MW4A 3BOWA 1MEC3 3TN92 4JGZB 3USSA 4BYYA 2ZCWA 1VBE1 5L7OC 4GH4B 4C90A 2OPKA 1WBFA 3SCHA 3MIBA 4I30A 4WVVA 1FPN2 4I0AA 5H9QA 1LOFC 1QXPA 4FAGA 1U0AA 1D4M3 2K9ZA 1VBB2 2OA2A 2XJRA 5HXVA 2WNVC 3MGUA 5AFEA 1V00A 1G9FA 3LA2A 1LENA 5D8AB 4ZKTB 2XVLA 2IXIA 2UWAA 3VBUA 5L7OB 5B2GB 2IXLA 2VUAA 3GHNA 1PO21 2XJUA 4AFDA 1CONA 3IIAA 4R4XA 4F8AA 2TNFA 3M8LA 1HRI2 1BMV2 4YZ4A 1G8WA 2E6VA 4DXZA 2WNVB 3PHMA 1NXD1 2ZHLA 5LRRA 2ZZQA 1DYKA 2MEV2 3TWIA 2EXHA 1AR82 1VAVA 4FOWA 4IETA 3ZXDA 3DF0A 2NP0A 1AX1A 3B9IA 3ZFFC 1HXS3 1VRH3 5HCFA 5FLHA 3OY8B 2SLIA 4Q0VA 2E7AA 4DOUA 4NPRA 1BCXA 2HWB3 4AI0A 5FQ0A 2HWD2 1PIV2 1S0DA 5BNPA 4MXWA 4AVVA 2HWF3 2B46X 1HQWA 4RGAA 1G6NA 1V6OA 1WW5A 2FMDA 3UKTA 1V9U3 1ZA4A 1CJPA 1RUD2 1ND3C 3MIEA 1VLNA 3THPA 2B42B 2JDZA 2WT2A 3AKPA 4Q4Y1 3ZFFB 1DBNA 4XXPA 4AK3A 4DNYA 2RE9A 3GBFA 3V0BB 5C9AA 3CLPA 2A6ZA 4RA0A 3RQ0A 4JDNA 4R9AA 5EV7A 2ZGKA 2OUHA 1HRV2 1MS0A 2DU1A 5DDJ1 5EJ3A 1KD7A 4C0HA 1ND3B 2E7TA 3CJXA 4EN7B 5IK7A 4YW3A 3N7MA 4DRVA 3AZVA 4XW3A 1Z7S2 2OVUA 2XJTA 4COWA 4PLOA 1GBGA 4FPEA 4MZUA 2IC1A 1DGWA 1QOOA 4B8EA 1AR93 1OOPA 1ND2C 3RSJA 3U4XA 3VZMA 1GLHA 1GQHA 3I59B 3AXEA 2VY0A 4KNCA 1PO13 4ZU7A 2RM21 3H1YA 2R073 2ENRA 4MGIE 1POV0 4JRLA 2E51A 1ASJ3 4Q4W3 4P5HA 3THTA 1NA1C 5T55A 1TE1B 2CYFA 1CAUA 1ND2B 2BNNA 1LOBA 1WA4A 3ETQA 1V6MA 2QDNA 1YYNA 5FCCA 3VBSA 1APNA 3LA3A 1REDA 1SFNA 2AGSA 1UX6A 1R081 4PCRA 5JSRA 1DQ2A 3SITA 2X8KA 2ZX3A 3VZLA 4LBOA 5CA6A 5T5JA 1NA1B 1Q3EA 1UCXA 4EV0A 4YW2A 1RHI1 4R8HA 2EIGA 5CFCA 4DY5A 4W6YA 1C4RA 2VNRA 4IEZA 1QH6A 1QH7A 1REEA 3H7JA 4MYEA 1RMU1 4CDXA 2Q1ZB 4ES8A 2NN8A 2JECA 2GALA 4U2AA 1AR73 1XYPA 4Q4X2 2RR13 5DXDA 1UKRA 4MXVA 1JTZX 3UKNA 1GYKA