2Z4FA

Solution structure of the discoidin domain of ddr2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
161
structure length
161
Chain Sequence
NPAICRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Discoidin domain-containing receptor 2
publication title Structural basis of the collagen-binding mode of discoidin domain receptor 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 16
structure length 161
sequence length 161
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2z4fA00
2X05A 3DYPA 4AAXA 1GMMA 3MBWA 2WAOA 4XZUG 1EUUA 1R64A 4XUTA 3UETA 4DEQA 3I2IA 1GOFA 2E33A 2BGPA 3T0AA 1GUIA 3VDAA 2YFUA 4IUGA 3ABZA 1T2XA 1OD3A 1JHJA 4D8MA 2W94A 1W8OA 1MPXA 2WO3A 4M4RA 3K46A 5G05L 4QB6A 3T08A 4DUVA 2EIBA 4A3ZA 2XQXA 3A21A 2WYSA 3CMGA 3SKVA 2V4VA 3DYMA 3EB7A 1PX3A 5EIYB 2DDUA 2WUHA 3LQCA 4ZY9A 3T2QA 2W5FA 1O8PA 3WNMA 4D0QA 4TTGA 1JZ3A 2WZEA 2Y6JA 3HEIA 1UMHA 3T09A 4PT6A 1WCQA 3NJXA 5I0DA 2RV9A 3MO4A 4BDVB 4MGSA 2OKXA 3C7EA 2WABA 2VMEA 2W1QA 1UY3A 1WKYA 3F2ZA 4A44A 2QBXA 3MUZ1 1DYOA 5DN2A 2W1SA 3I2FA 4A4AA 1JZ5A 3D3AA 2W1WA 2W1UA 4A45A 3K4DA 5EJZB 2Y64A 4QX1A 4UAPA 4ZZ5A 3W5NA 5JXJA 2VZQA 4YPJA 5LA1A 3LE0A 4DXTA 2QQJA 5HXMA 1OT5A 2YC4A 3OG2A 3OGSA 5B4XA 2WZ8A 3FHAA 1SDDB 3OBAA 4CUBA 2WDBA 4QDSA 2E32A 2Y6LA 1GOGA 2RVAA 2VCAA 2JDAA 1UWWA 1LNSA 2VZOA 3P1IA 1UMIA 1UYZA 1SHWB 2LS6A 1UZ0A 4ZZ8A 3GXUA 1GOHA 3WF4A 2JKXA 2VQUA 2YFZA 3WF1A 1UY4A 1UYXA 4QX3A 3ETPA 4XUOA 1OF4A 2VMDA 2VZRA 3IB3A 4BXSV 3P6BA 1SG3A 3C7OA 2KD7A 1ULPA 2VCBA 1NAEA 2DCJA 2VQTA 1CZTA 1J83A 1O59A 3HPNA 4QDQA 4ARXA 3GGLA 3T2PA 3OEAA 1K42A 4LHSA 3AC0A 4DXSA 1JYXA 1TVGA 2W92A 1UYYA 4A42A 4LQRA 4W4ZA 4A6OA 5F7UA 2QQKA 2J1SA 3I2JA 1JI6A 2ID4A 3JXSA 5JR2A 5A1AA 2VZTA 4GWIA 3IIIA 1XPWA 4BK5A 2W3JA 4OMCA 3HNBM 3ACHA 5JXHA 1H6YA 4XVHA 2EICA 2VMCA 3MV11 1W99A 3NNGA 2QQMA 4CU6A 2V5DA 1JZ4A 2VOTA 2VZPA 3IAPA 1JU4A 2J22A 3NJVA 3OB8A 4DEVA 2VMFA 3CIHA 4DUXA 4OMDA 2EIEA 1I5PA 3CKHA 3A22A 3UNPA 3J7HA 2C9KA 4QAWA 1PX4A 2WQ8A 5IJRA 2BZDA 1UY1A 3LEIA 4LKSA 3WF0A 4ARYA 3OGVA 3WF3A 2JD9A 3LEKA 5CYYA 2HLEA 1IQDC 3I3DA 2WN3A 1OH4A 1W9SA 2R7EB 4QB1A 4QDRA 4RYDA 5C7GA 3VDCA 1XC6A 2J1AA 4ET7A 3LPFA 3WNPA 1J84A 1H6XA 1XNAA 5J1XA 3GDBA 2YC2A 2Y6GA 2BBAA 5DMYA 1XNTA 1YQ2A 2V72A 5IHRA 1JZ7A 1L7QA 4CUCA 3I3BA 2BERA 4KMQA 4P02B 4W50A 2EIDA 2J1EA 1KEXA 2W46A 3CZJA 5JXIA 1UY0A 2J1VA 3BGAA 3VDBA 2HYXA 3WEZA 4A41A 4JKMA 3T0DA 4CU8A 1JYWA 3IAQA 2YB7A 4CVUA 3HOBA 1HN1A 3ECQA 3OGRA 4PF1A 3FN9A 3THCA 1UY2A 4OUEA 1O8SA 3HNYM 2J1UA 5G04L 4MGQA 3PUIA 3WNLA 1K12A 3MV01 1NKGA 2W9XA 3I97A 4UI9L 5IYYA 2E31A 1W9TA 4MADA 1TG7A 2ZEYA 3DECA 2B4KA 3E1F1 3WNKA 1W9WA 3VD5A 5IFPA 2XHNA 3K77A 1DP0A 1K45A 1JZ8A 1JYNA 2C4XA 5JXGA 1EUTA 5HPOA 2VZSA 4ZXEA 1CX1A 4AG4A 2ZXQA 2VZVA 4MO3M 3A23A 2W91A 2L9LA 2ZEXA 3C8XA 3C7FA 1US3A 3EYPA 3HJRA 5LA2A 1L7RA 2WBKA 4OYUA 4E8DA 3U37A 1CZVA 4KI5M 3VD9A 4TXWA 1D7PM 4OZOA 4PQQA 4RN5A 2VZ1A 3I3EA 3ACIA 1DLCA 2W87A 2WAAA 2BGOA 2VCCA 2QQNA 1P8JA 3ZM8A 2VR4A 3MUY1 1US2A 4CU9A 4M4PA 4W8JA 3CZUA 3I2GA 2QQIA 4XURA 2VM9A 3WNOA 3HNMA 2WO2A 2Y6KA 1PMJX 1GU3A 1F4AA 1UXZA 1ULOA 3I2HA 4JKLA 3C7HA 5LA0A 1JU3A 2VC9A 1GQPA 2CDPA 5B4NA 4JKKA 2ZEWA 1W8NA 2ZEZA 3CDZB 4FI9A 3WSOA 1GNYA 1NX9A 3K4AA 3SEPA 2VZUA 5JMOA 2B9VA 1KGYA 2ORZA 1JZ6A 5LCWL 2W47A 5EJ1B 2ORXA 1UX7A 3K75B 4MOAA 1CZSA 4LPLA 2VJXA 4XUQA 3K4ZA 4JX0A 3LPGA 2VTFA 4BJ0A 3IDAA 3OEBA 4DUWA 4GZ9A 2J1RA 3W5MA 2XONA 2X09A 3WQBA 1F4HA 3WF2A 2W95A 3THDA 1JZ2A 2XOMA 3CQOA 4JHZA 5C71A 4L0PA 2LW8A 4CUAA 2QQOA 2QQLA 4KWUA 3I2KA 2J1TA 4QX0A 2VL4A 3A7QA 3WNNA 5DPNA 2YG0A 4Z2AA 2J7MA 3DYOA 1PMHX 1CIYA 2X10A 3ACFA 4BK4A 3SEEA 3T2OA 5FUIA 3VD3A 2DCKA 3T0BA 5IFTA 4P08A 1OF3A 4DXRA 2E26A 5JUVA 3BN6A 5DQ0A 2Y6HA 2JE8A 1NUKA 2C26A 1K3IA 3PUHA 4P5YA 4QB2A 2Z4FA 1UXXX 3NRUA 3HN3A 3UESA 1RYYA 4XUPA 3VD7A 3VD4A 4QX2A 2VZ3A 2WN2A 3NQHA 2PQSA 3GM8A 2CDOA 1BHGA 5C70A 1JYVA 5CZKA 1W0NA 4P00B 3ACGA 2RJ2A 4GWJA 4UOJA 4QPWA 2WO1A 3LEGA 4E8CA 3FL7A 4XUNA 3SKJE 4CU7A 3FHQA 4HG6B 2VO5A 2Y8KA 3C7GA
chains in the Genus database with same CATH superfamily
4NIAA 2BUKA 4AVAA 1JOJA 2HWE3 4QHBA 1WA4A 5I0RA 5I8YA 3D5OA 3PIGA 1YEWA 4LUMA 3I2IA 4XUTA 1GOFA 2XG3A 2BGPA 3T0AA 2ZABA 5C4WA 3G6JB 4FPKA 2ZMLA 2A70A 3VDAA 4AI9A 1Z7S2 4Q4W2 2XJPA 1ZNPA 4OZXA 1IS3A 1YXWA 1ZBE2 3PUSA 4IUGA 4BU2A 4DY5A 4WBBA 2D44A 1JBCA 1GWLA 2FD8A 1RHI1 1T2XA 1RUJ1 3FUQA 1JHJA 1LCLA 1I9RA 1O91A 2WRAA 3WCSA 2HWD2 2WO3A 4QX8A 2RS52 4NN0A 3K46A 2R6QA 1O6UA 2RDRA 2LM3A 4OUMA 1TQ5A 5C9AA 1K5JA 2BV4A 4INDA 3MYXA 1C57A 1ONAA 2ENRA 4HMZA 2Y26A 4QPGA 5FYCA 2WYSA 1O3SA 4EZHA 3WP4A 1X9TA 3ZN4A 3U10A 5I8TA 2VVDA 5FYSA 3QOPA 1ND3C 1QHDA 2WWJA 2DDUA 3ALQA 3ZDSA 1ST8A 3JUUA 5I8SA 2W5FA 1O8PA 3P5BA 4WZFA 3RJRA 4XFHA 1W9FA 2Y6JA 3HEIA 4XFAA 3IZOA 4O9GA 5APAA 4DRRA 1QXPA 4P9IA 2PAMA 4Z8BA 4D7SA 1DF0A 1SBDA 2Y6FA 1DGRA 5BNQA 5I0DA 5IVFA 3I54A 1W6QB 3I59B 1PO22 3MIBA 3MO4A 5LBFA 5J09A 5EP9A 4IEQA 2R061 4GKYA 3APBA 5F2SA 4RS5A 5KHGA 5FLHA 4BIFA 4DO0A 3C7EA 2WABA 3CJIC 2VMEA 1AVBA 4GAZA 3V0AB 3H1WA 5GLWA 4ZU4A 5E6HA 4E2SA 4AEJA 5IWFA 4EYUA 2QBXA 4HL0A 4LBNA 3DPRC 2XVLA 4QT6A 3ZFEA 3VBFA 4RFRB 1C1FA 4ISRA 1OVSA 1QJU2 1WA6X 3AZXA 4ITCA 4JGZA 4K1YA 3JCIA 4MXWB 1GQHA 1ZVFA 2W1WA 5JVVA 4A45A 4BZ4A 2WSUA 5IVJA 5EJZB 3B02A 4QX1A 1DLLA 5GZDA 2TEPA 2ZGLA 1F2NA 3W58A 4W65A 5HXMA 2DU1A 4CCOA 4B29A 4RD7A 1W2OA 2B7YA 2V73A 2OS2A 1RXGA 1DCSA 4R9BA 1CX4A 3ZXAC 1RVF2 3FHAA 2UWAA 1S0IA 4OHVA 1POV3 1UIJA 1VAKA 4AQ2A 2Y6LA 3UL2A 1WZXA 3CJIB 3RYRA 2XLFA 1AR82 2JICA 4YZ4A 3T1LA 4B4RA 4X8PA 1LNSA 2VZOA 5SV5A 2RMU3 3THTA 3C3VA 3WW4A 1SHWB 4ZZ8A 1FNYA 2AYHA 1VBB1 2B5HA 5GZFA 3WF4A 5LWBA 3HQRA 2VTXA 1CAXA 2MEV1 2D6NA 4I09A 1AXYA 5CVRA 3KMHA 4XUOA 1AR61 1OF4A 3IB3A 5T50A 2CSGA 3CLPA 2P37A 5D1IA 4X8NA 4N90A 3JBG1 5DZEA 1AL21 2VBDA 4IGOA 4OVEA 3H3UA 1TZOA 1MZEA 1ULPA 3AYCA 1F8VA 3RI8A 3NSTA 3WT3A 1J83A 3Q8EA 5FLJA 2DFCA 4PDWA 5FMCA 3ES4A 3GGLA 4Q2FA 5DDJ3 2RS13 2XBO2 4AGGA 2QKDA 4YFZA 5CIRA 2VY0A 1RMU1 3AC0A 1JYXA 3URFA 1LRHA 2W92A 1XBFA 2Z69A 5FTTC 3TBDA 4IGQA 1REEA 3POYA 4YW7A 3IPVB 2RJLA 4CCDA 1CR7A 1IGOA 4QGLA 4EWDA 4A6OA 1G9DA 2ADDA 2QQKA 3PDQA 3JB8A 4YM3A 1FMD1 3I2JA 2AENA 4XF0A 4AGVA 3AX4A 3OPZA 3RZHA 4MGZE 3GBFA 4GWIA 3TEXA 2BQPA 1XPWA 4IGPA 3OCPA 3HT1A 4FPCA 3S5AA 1VBA1 1AX0A 3H7YA 4OCTA 5FZCA 4XVHA 3I3QA 4IV3A 3LIGA 1W99A 4QHZA 4CU6A 4UW6A 4MG2A 5FZIA 1AX1A 3JZVA 1RUG2 2VOTA 2GNDA 1ENRA 1H4HA 5GZCA 1D2QA 1HQLA 5IW0A 3NJVA 5LBCA 1S0EA 4AFBA 2VMFA 3V0BB 4CDUC 4YG6A 3ZYGA 2EIEA 5CISA 3ZOIA 1YHFA 2LROA 1LODA 3RS6A 5C5TA 1PX4A 4BQYA 2ZGQA 1IS6A 3ST7A 1GV9A 3B69A 4MV2A 3B9IA 3VZJA 1D4M3 1GWMA 3WF3A 5J48A 2VTXJ 3D0SA 3LEKA 4XBNA 5CYYA 4HK8A 1KXGA 5K0UA 4C1WA 4YLZA 4JDMA 1SQ4A 4XQWA 1W06A 2OT7A 4YW2A 1K5MC 1W9SA 3VL9A 5CFCA 3VDCA 1XC6A 5E8AA 5FYVA 2J1AA 4MZUA 4QU1A 1YNAA 3ZSMA 4OUSA 1J3PA 1J84A 2B39A 2H0BA 4IV1C 5DZGA 3W59A 4LMFA 3ZSKA 5BNPC 3D82A 1YI9A 4BQWA 2YC2A 4SLIA 3VBOA 3LOBA 3PL0A 4GKXA 3TN92 3ZSJA 4CDUB 4WZCA 1QJY1 1TME1 2WS91 1ZBA2 3WCRA 1GR3A 3H3ZA 1PVC2 2VUJA 1T6GC 4CUCA 1VAMA 3RZJA 1FNZA 3J8F3 4QXCA 1VMHA 3BTAA 1RUE2 4XAAA 4XJUA 5E1RA 1RJ8A 2E6VA 1LAJA 2GDFA 5K4LA 4RGKA 4E4ZA 1W39A 4Q26A 4DZGA 2ILMA 4Q4Y2 2JEMA 4BQ3A 3SH4A 2YBSA 1ASJ3 3ZXFA 4WVZA 3VGIA 1ZYBA 1DGLA 2D5FA 2HYXA 5HXVA 3T0DA 3AP5A 4IV1B 4LOTA 1PHMA 2W08A 5FY9A 4MGYE 3L2HA 4IETA 1HKDA 3TNQA 2D7FA 5EJ3A 3NV3A 4AHYA 1E5HA 3AP9A 5DXDA 1BEV3 1FV3A 4MGQA 5KXEA 3MHZA 4CPBA 1DZTA 4G3YC 4RFT0 5IYYA 3ZYBA 1YQ5A 1W9TA 4QPGC 5FZOA 2GAUA 2ZPXA 3H7JA 4XF4A 4E9KA 2VQ0A 4LBQA 1WLTA 1OPOA 3GALA 1R081 5C5UA 2B4KA 3LA7A 5HV0A 2IC1A 3VD5A 2XHNA 1H2KA 5C4WB 1ODNA 1Q3EA 2LTNA 3AMNA 3ILRA 1DP0A 1V9U1 4Y22A 5IK4A 4A7ZA 3BVCA 1DGRN 2C4XA 3WP6A 3S6PA 1SEFA 5FBZA 4DIQA 1E5IA 2HWF2 1WLDA 4EQVA 3MLKA 5F3IA 3KD4A 4X6RB 5KBFA 2IXIA 1X33A 1OSGA 1UOBA 1M4WA 2W91A 2RM23 1QNWA 4LUKA 4RS5C 3TWIA 1PM4A 1J1TA 1CJPA 4AFCA 5C3RA 5C9AB 1XE7A 4NE9A 1QDOA 4XEZA 4PBPA 1OQ1A 4DMIA 5A7QA 2WC2A 2WYFA 4Q0VA 4QPGB 3WV6A 1ULEA 3ZFEC 3VBFC 4NRPA 1V6LA 1X50A 4RGGA 2IFRA 4MVTA 4JGZC 4KI5M 1RUH1 4GB31 2OYZA 1S4CA 3OY8A 3ZMOA 1TMF1 1RHI2 2DV9A 1I3HA 1Z78A 4TN7A 1OD5A 1AR93 1UKRA 1JW6A 3M70A 4PQQA 4Q8KA 5KHKA 1GFF2 4IQPA 2UY8A 1DLCA 4NVPA 4A6SA 2Q4SA 2WAAA 3FJSA 4N53C 4UFMA 5H9PA 5BYNA 3ZIWA 4PF5A 2KXLA 2OPWA 2JXAA 2VOVA 1G86A 1V00A 2BWCA 4NJ4A 5LEJA 4CU9A 2YXSA 5D8AA 3TOJA 2A73B 4DS0A 5J36A 1OOPA 3I2GA 1OXCA 2FDHA 1GP6A 3WDTA 2VM9A 4XFIA 3PTYA 3WUDA 2NPIA 3AP7A 4Q4V3 3O1TA 2BVVA 1Z7S1 1VRH2 1WCDJ 1IPSA 3A0NA 4Q4W1 4CCJA 3AXDA 1UXZA 3JQWA 1GICA 2GN3A 4JKLA 5FY7A 1RUC2 1ZBE1 4YRDA 3VBFB 3ZFEB 2WA3A 3N9LA 4JGZB 3ZXJA 4NO4A 1GQPA 3ZSEA 1V6KA 1W9YA 3RDIA 4AYUA 1X7NA 5FP8A 4LTAA 1VLNA 2QFEA 2VAUA 1X8EA 2HWD1 4KU7A 2R062 2ZEZA 3CDZB 1WBLA 5C3OA 5KXCA 2XJSA 2AUYA 2IXKA 3K4AA 3WOGA 4FQZA 3SEPA 4MH0E 4RQPA 4YGCA 1F35A 1KGYA 1REFA 1V6MA 4B1LA 1VBC3 4L8QA 5LCWL 1JHNA 2DF7A 1QF3A 5EJ1B 1H2LA 2P6HA 1XU1A 4PDWC 4E4HA 1I6XA 1QDCA 3ZX7A 4AAPA 2ZGSA 3JD72 5DAVA 3K2OA 4LPLA 2ZZQA 2B45X 3OYWA 5T54A 5ABJA 3O1MA 3SISA 1FPN3 1DFQA 2MNGA 2WNVA 3AXEA 3OOXA 3NAPA 3U4SA 5FJKA 4BJ0A 2LUWA 3S7IA 1NY72 2QNKA 5JOXA 2PAKA 1R1A1 3W5MA 4BE3A 1SBFA 3BCWA 3VDDB 4Z07A 1RUOA 1NE4A 3BPZA 1CAXB 4EE2A 1ZA7A 1HRV3 3Q8FA 3ZSLA 3SCFA 5A80A 1RUD3 5C71A 1OLME 1SMVA 4CUAA 4CSWA 3IWZA 4ONUA 4DXZA 2AEYA 1V70A 2EAAA 4D7TA 4QX0A 1VAVA 4P9YA 3WNNA 3ZPYA 1WMEA 2RR12 4J25A 3C2UA 3LSDA 3U75A 2D98A 5A3LA 3TEYA 1XSQA 2AGSA 4PDWB 1NCQA 4IV3C 1QJU1 1VBB2 2X10A 3DL3A 4K8RB 4R9DA 5CADA 2FDFA 1AF9A 4JQRA 4ZONA 1HV1A 1L3JA 3VD3A 4FPGA 2C9AA 5EYYA 3T0BA 4COZA 1BKZA 2ZHNA 4F83A 1DGWA 5A70A 1AR62 1EV12 1GANA 4O9EA 3S7EA 4RA0A 1OF3A 3M3QA 1S0FA 4K20A 1N1YA 4YGEA 5JUVA 4BQ1A 5DQ0A 1JYIA 2Y6HA 1W8UA 2GNMA 5FYUA 5ANNA 1FAYA 2YHJA 2AR6A 3PUHA 5K0UC 1W90A 2OZJA 2ZX4A 4QB2A 1AR81 5FXVA 1CGPA 2YY1A 1SCRA 3ETQA 3FBYA 3ZLIA 1YO8A 5FZHA 3HN3A 2R073 4CP0A 1O3TA 5CFCC 2Y38A 1DQ2A 4YW4A 2Q8EA 4IV3B 2BW8A 1OI6A 3UESA 2JDNA 3K51A 1MS0A 1RYYA 1DQ1A 1LENA 4EN9B 4NHYA 4AFMA 4BA6A 3PVNA 1OFSA 1J3QA 2VZ3A 2WN2A 4AQTA 4D3WA 1RC6A 3GM8A 2CDOA 3N9MA 3VBHB 2YBPA 3THPA 3VBOC 2WT1A 3RYPA 1W0NA 4JVAA 4YZ2A 3S0MA 3ACGA 1VBE3 2OA2A 5DAWA 3KV9A 4AI8A 2A1XA 3N9NA 4I3GA 3FL7A 5K7PA 3DPRA 1W2AX 3KS7A 2G1MA 4TLGA 3SKJE 1VBA2 2PAEA 5F32A 3WINE 5JPMB 2XKPA 2XBO1 3MZHA 3C7GA 5K0UB 3E5QA 4AAXA 2VVEA 1RUNA 3T4VA 3LOIA 2JG8A 1MVQA 3MBWA 4CTEA 3HN1A 4XZUG 4WVVA 1R64A 4DEQA 1NLQA 2CYFA 3UETA 4QM9A 2E33A 3VZKA 4COYA 2TBVA 2HWB3 5GZEA 3T4HB 3MF6A 1S0JA 2ARBA 3FC0A 1W6OA 5E88A 5FYIA 4UFJA 2JIJA 3O1SA 4QPIA 1SLLA 3E5XA 4CCMA 4CPBD 3K48A 4F3JA 2YUEA 3ZVXA 5GM0A 4U2AA 4HKWA 2R0FA 1QH6A 1X82A 4LBQD 3KQ4B 1YFWA 1MPXA 3CHXA 5L7OB 4GMP1 3O7OA 2VU9A 2CNAA 5FFOC 1WUVA 2W39A 2G9ZA 5A32A 3T08A 2OIIA 4DUVA 3DUIA 4F8AA 1QY4A 2Z42A 4M3CF 2JB8A 2D6OX 4A3ZA 1RUG1 3CMGA 1CPNA 1QKQA 2WJSA 1WCSA 5A6YA 1O3RA 5BPXA 2PTMA 4FOWA 2WL1A 2V4VA 3DYMA 4UFHA 3WX5A 1W6MA 5FO9B 1S55A 4W6WA 2WUHA 4ZHNA 1UZWA 1LULA 1VPHA 3LDBA 1TME2 3VBRB 2WS92 1GP5A 2WZEA 4HOOA 5IVEA 3AMMA 3NMBA 4BMEA 3NJXA 5A3WA 2QCSB 4I0BA 4L92A 2KR2A 2RV9A 2Q5TA 3O1PA 1DQ6A 1EYBA 2X29A 4BDVB 1RUJ3 4QX5A 1SFNA 5FYTA 1JUIA 3OBTA 1O4TA 3VBSA 3ZYPA 2OKXA 3U11A 5FY4A 3ZYRA 5FZOB 2GZWA 3LGRA 5IVVA 1WKYA 3F2ZA 5C3SA 4FSJA 4LBQB 2SBAA 4JDOA 3K3OA 1OQEA 2BNNA 2WFF1 4XFGA 4Y4RA 2W1SA 4Y22B 2Q8OA 2BOJA 4OHXA 3KCCA 5ACA2 4KWJA 3D3AA 5LW9A 4AI3A 1RUF3 3TN91 4BH9A 1COV1 3M3CA 4X6QB 5FZ0A 4QMAA 5JXJA 3OPWA 2VZQA 2RJKA 3N4MA 5F8PA 1PVC1 3ILNA 4DXTA 5AVPA 1RUE1 1RUI1 2YC4A 5T5OA 2JE7A 2ZJCA 5FXZA 4YZ5A 5D8AC 2CGNA 3PTRB 3VN4A 1IPKA 3ZKUA 1R082 2DCYA 2WZ8A 1N3PA 1OOPC 3VL8A 4Q4Y1 4Z1VA 2VCMA 2ZHKA 4XHBA 4MGTA 5KHHA 1NT0A 4Q27A 1AYN2 1V9U2 4L9BA 4COUA 3AP6A 4FAGA 4YW5A 2FCVA 3MDPA 3AZZA 4HLTA 1UKGA 1QIQA 2IXLA 1POV0 3POSA 4P14A 3VHNA 4G9SB 2WLQA 4H2AA 2FQPA 1ALYA 3OY8B 2LS6A 3NV2A 1AYM2 1UZ0A 1YI7A 3GXUA 4NHXA 3KT4A 2E53A 4ASLA 1Z0HA 4JGYB 4AFDA 3W21A 3WG1A 1OFNA 2DVFA 4HKLA 1RL3A 1UY4A 1F31A 4HN1A 4P9WA 3TYJA 3WXPA 3ETPA 4L99A 2DU0A 5KR7A 4Q5OA 1PIV3 1CD3G 4ZS2A 4COWA 5KXDA 4BXSV 3MGUA 1AXKA 2G19A 4QKNA 1V6NA 3P6BA 3NKGA 1FI2A 3GJBA 3ZYJB 5FZMA 1W6PA 2ZAAA 1B35C 1UF2C 1LEDA 1QQP2 3AB0A 1NAEA 5D8AB 5KC5A 1RUH2 2VQTA 4HKOA 3WW3A 4EZ4A 2XWBB 1O59A 3HPNA 5FY1A 3OUIA 5JMCA 1WW5A 4QDQA 3RZZA 2V4AA 3HQUA 4TYSA 4ARXA 3RZLA 3T2PA 1K42A 2WNVC 1BXHA 2ES3A 2CWSA 1YJKA 3NAPC 4HANA 2IFWA 1FOD2 1UAIA 3AL5A 4DXSA 3PVEA 2VG9A 3UGFA 4FBFA 3M3EA 2BYVE 2JDZA 4ISQA 1HB3A 4BQXA 5A3MA 1CQ9A 4A42A 3TEWA 2RDNA 4LQRA 4M0HA 2MEV3 1CAVA 1PVXA 3BYWA 1UOJA 1S0CA 2RDSA 5GLTA 2J1SA 5FZFA 2D93A 1ULDA 5JZGC 1MVEA 3ES1A 4RQPB 1N1SA 2OQ6A 3JBG3 4IW3A 1JXNA 3RYKA 4AVTA 1AL23 1JYTA 4UW5A 2VZTA 1YWKA 4C0HA 1RXFA 4BK5A 2HWC1 1NCQC 2W3JA 2BDRA 3GZTB 2XUEA 3HNBM 1HX6A 5IVCA 4RGAA 4YM2A 3WP3A 4FCAA 4FOVA 4LOSA 3VB9A 5JXHA 5ABJB 3OYWB 4EN8B 3MV11 2WNVB 2QE3A 3QACA 4C0BA 1XQNA 2V5DA 3NAPB 4AHXA 1RMU3 3M2MA 5I0UA 4JC1A 4LJHA 1PGSA 3WG2A 4CP9A 1CVNA 4YW3A 1JU4A 4LE3A 4META 2JDKA 2D6KA 3AM2A 2XDVA 3OBZA 4H3WA 5FMOL 3UKTA 4DUXA 5I91A 5EV7A 4OMDA 2QQUA 2FBEA 3AVRA 1FMD3 1DQ5A 4NAMA 1I5PA 4LBOA 3A22A 5FMBA 5FZ6A 3J7HA 1WCUA 4QAWA 5IK5A 5IJRA 3MICA 2BZDA 4EN7B 1UU5A 1IG3A 3OGVA 4XMIA 1VRH1 1ULCA 2JD9A 2P17A 1DIWA 1S0BA 3M7AA 5JOZA 4Q0QA 1RUC1 2HLEA 4XFCA 1IQDC 4XYXA 1NCQB 1W8TA 4LR4A 4CCCA 4QXHA 5EQUA 4AEMA 1R1A2 5FZGA 2BPA2 3GHNA 2WWSA 3ZR6A 2R7EB 3J4UH 4QDRA 1W2NA 4RYDA 1FV2A 2VOWA 3SCGA 1UIKA 2VOKA 1KDMA 1VRBA 3ME2A 2YGMA 3ZYFA 1O5UA 2NMOA 1GNHA 4E27A 5BNOA 5DAPA 4RHV2 3BU0A 1G8WA 3EHKA 2DVAA 2JENA 3GDBA 3FFQA 2AREA 4XDPA 3AZWA 3T2TA 2BBAA 2PHFA 4KGGA 4QQHA 1LOBA 4I0AA 3ZFGC 2GC0A 2ZACA 1XNTA 1Q8SA 1OMIA 4Y1UA 1R093 3JD71 1ND3B 3VZOA 2JG9C 3WDUA 5C3QA 2FZ2A 1MEC2 1BBT2 2D3SA 1L7QA 1POQA 1Q56A 5CA6A 3I3BA 4Y4YA 3H1MA 2JG8C 1NY71 4P02B 1PM7A 1MR5A 1OH3A 4U36A 2G4IA 4XJAA 3FX3A 4COVA 3RZMA 2J1EA 3OGJA 2A7AA 4N53A 3T3YA 2W46A 3M3OA 5EHDA 5AC92 3TB0A 4XQDA 4XQ4A 2C0ZA 4PI0A 1IZ3A 3LIHA 1YUDA 4QPIC 4A41A 3WVJA 4W6XA 3EJKA 1U5ZA 1LU1A 5CKQA 2GMPA 4CU8A 1JYWA 1D0GA 1H9PA 1KS4A 2JX9A 2RR11 3B7MA 3RJ2X 4CVUA 3HOBA 3A0KA 5CBLA 1HN1A 2DTWA 3BODA 3DPRB 3L9JT 3OGRA 4XJWA 3ZFGB 4C1XA 1UY2A 1QJY3 4D7YA 1LU2A 5IK7A 1ZZBA 3HNYM 3M4FA 3WNLA 5T5PA 4CRQA 2ZGMA 4Z82A 1NKGA 5IAVA 2NLRA 2UWBA 2O8QA 2W9XA 1U5IA 2E31A 3I97A 4SBVA 1NXD1 2JG8B 1W05A 1EV11 4LKDA 1TG7A 4MADA 4UFIA 3DECA 4CA9A 4R9CA 1EAH1 3WNKA 3U78A 5DUWA 5IFPA 1QOSA 2D97A 3WQ1A 2X8KA 4UW3A 2VW1A 5GZGA 2GMMA 4K40A 3EBRA 4FFGA 5LBEA 1O4YA 1W6OB 5CAZA 1HQWA 1H2NA 1NQDA 4QPIB 2BEOA 4EJRA 4YARA 5HPOA 2CAUA 2VZSA 2VPVA 1H0BA 3N9OA 4JHTA 2ZXQA 3BALA 2PHDA 3FUOA 2VZVA 1ZA4A 3G7DA 4R4XA 5FKCA 4H14A 1QGLA 2JECA 1DZRA 2E63A 1PGW1 2CAVA 3POWA 3VBSC 4B1MA 3MF9A 1GBGA 2ZEXA 3KGZA 5A32B 3C7FA 4EWAA 5FQ0A 5A3OA 1W28A 2VBBA 2DVGA 3HJRA 2WBKA 2A6YA 3RG0A 5FXXA 4CEWA 3U37A 3O1RA 1U5YA 1CZVA 1W6MB 3NNFA 5GLZA 3UJOA 4AEDC 3BU7A 3VD9A 3A4UA 3GCXA 4FFIA 3KF5A 3LDRA 3MIEA 4IE4A 4UYBA 4CEYC 3I3MA 2VNRA 4P9JA 4RN5A 5FDBA 2VGDA 1LESA 5DG2A 5L73A 3I3EA 3ROUA 3VLBB 3ZXKA 3ACIA 1D0HA 1UMZA 2W87A 2BGOA 2VCCA 2QQNA 3R0RA 1QOTA 3SMHA 2VR4A 1BZWA 1O3QA 2BNMA 1CPMA 1US2A 4Q0UA 5FO8B 2O8OA 2BFUS 3VBSB 4M4PA 1WWYA 1LECA 1XYNA 4W8JA 1OHFA 3CNAA 5KHJA 1HXS3 2FMYA 3WNOA 2GNTA 1DG6A 3HAGA 5CFDA 2PLV2 4HFSA 1UOGA 2RG4A 3PIJA 3BUCA 3L2YA 4J1WA 5GALA 4LORA 1GU3A 1W8FA 1NA1A 1VP6A 3GZEA 3NNJA 3WG4A 5LA0A 1VBD3 4GB33 5JOWA 2VXJA 2VMGA 1ZM1A 5T5LA 3VKOA 4FAHA 4HONA 1C3HA 1TMF3 3D6EA 2VMHA 4KWLA 4XFBA 1LKNA 2Y60A 3DGTA 1AR72 4L97A 4LIVA 4S2DA 1XE8A 3KF3A 4IERA 4FI9A 3ON7A 3WSOA 1GYKA 5FYBA 1KITA 2ETEA 4P5HA 4XCAA 1U5XA 2H6CA 4FPJA 2VZUA 2I74A 1TNFA 4NIHA 1JZ6A 1KDKA 4PBOA 1EPZA 3QLQA 5IK8A 2WFF2 5JSPA 4LK6A 2ORXA 4BIOA 4N7UA 3DKQA 4KWKA 5FY0A 1CZSA 3OPTA 2EIGA 2JIGA 3LWCA 1UX6A 1COV2 3K4ZA 2YU1A 4XUQA 1Z7S3 3E6BA 3IIAA 1BQPA 4Q4W3 3MFAA 4Z2WA 2JDUA 2PHXA 2XJTA 3IDAA 3OEBA 1ZBE3 1LR5A 4FPFA 2P3JA 3JQXA 4HZFA 2JDMA 3OF1A 4UFLA 1RUI2 4Y20A 1LEMA 2X09A 3WQBA 3TEZA 1JZ2A 2ARAA 2XOMA 3AMPA 2WQZC 2HWD3 4KL1A 2RS53 3O0XA 1H4GA 2PQQA 3F95A 1H9WA 1K5MB 2QQOA 2Y33A 5TSWA 4CDWC 4D69A 2D6PA 2O1QA 1U12A 2QQLA 4KWUA 1PK6A 5H9RA 1Y7BA 3T30A 3A7QA 1W6PB 1Y43B 4XTMA 5EFUA 4YG0A 5DPNA 4UT5A 4XETA 1MS5A 4Z2AA 1OUSA 5BNPB 1IKQA 4LO8A 1CONA 1W3VA 4AHZA 3QCWA 4GWNA 3J7LA 3WQ7A 3ACFA 4LO4B 3OD0A 1N3OA 4BK4A 5ACA1 2ZKLA 3ZN6A 1BK1A 3HBKA 3CEWA 4P9XA 2GU9A 3WW2A 5KXBA 1YLLA 2DCKA 2VVFA 3GYDA 3RWNA 5LK5A 2AEZA 4Q8LA 5C8CA 3QD6A 2Y0IA 4OI1A 3H0OA 3AFGA 4JTOA 5ERLA 1JOPA 2WR9A 4K3UA 4TZDA 4R4ZA 2XHKA 1XXNA 2B46X 1PO23 2E26A 1CAVB 4P9GA 2RS11 5DUUA 3CBNA 4LO6B 5FP9A 1A34A 4IE6A 4AFAA 1AYN1 1NUKA 4IE5A 1LB2A 1XYOA 4ASMB 3CO2A 3R4DB 1GZCA 4AOCA 3U0ZA 1TEIA 1NQJA 1NLSA 4XPVA 2O14A 3KWVA 1XNDA 1UXXX 1ZZ7A 2YGLA 3KV5A 3NRUA 3PVOA 5EYXA 2DCTA 3I49A 1AYM1 2OPKA 2PN5A 1QJU3 3VHPA 1KQRA 1WW6A 2A3YA 5FK8A 1Y9GA 3VD4A 4LITA 2VD7A 1X9PA 5BNOC 4A2UA 4YVWA 4N9IA 1ENQA 1ZZ8A 4CP9B 2VNVA 1SPPA 1LGCA 2XR4A 5FY8A 1RINA 1XE0A 5F3GA 4S2GA 5C70A 1JYVA 3I4IA 2K2SA 4GULA 4XBQA 5FYHA 5HCHA 2LALA 5DUXA 3Q8CA 4JV4A 4UOJA 3ORJA 2WO1A 1QQP1 2HWC2 1RVF3 2VMIA 4PHZA 2VECA 1W04A 5L19A 2WO7A 4CZSA 3RNSA 2OVUA 1BYHA 3PURA 1C8M2 3FHQA 3MLLA 1PO12 2JDYA 1R1ZA 4UBHA 5FPUA 2AH2A 2X05A 1Y9MA 5L9BA 1AR83 1FOD1 1VALA 5FO7B 3ZIXA 1WW7A 1GMMA 3LEMA 4L2NA 5CB7A 4BMBA 2G9FA 2IXHA 1N1VA 4M00A 3W9AA 3GZAA 1OVPA 1XSRA 3WDXA 2KM2A 4IDZA 3B5LB 4RS5B 5LK7B 1RGSA 5BNOB 2ZHLA 3BI3A 4MUVA 2YFUA 4JRLA 4LHNA 3ZFFC 1IKPA 4QX7A 1WMDA 2VH9A 1UZZA 2VW2A 1DQ0A 4CCEA 2H6BA 1REDA 1YQ6A 1OD3A 4IESA 4XDQA 2W94A 4D8MA 3EXUA 1W8OA 5C3PA 2P1BA 1KD7A 3R6SA 1ND2A 4D94A 1A8DA 1OPMA 3IDBB 3BTXA 5LY1A 5FZ8A 2RS32 4WM7A 1WGPA 2XBO3 2ZGUA 5F3EA 1X36A 2DVDA 3N7KA 1QNYA 1HRI2 2JE9A 5J96B 3ACLA 1TNRA 1Y3TA 4NUBA 2YU2A 2D6MA 1N1TA 2XQXA 4N53B 4NHKA 1NCRA 3SKVA 4FOQA 1H8TA 1MZ5A 4QKBA 3MIFA 3SQOA 4OQ9A 4QGMA 4AI1A 3BTYA 3RZKA 1PX3A 2EA7A 3ZYHA 2WQ4A 4FT8A 4PLOA 2A71A 3SCHA 4AI0A 1B35A 4ZY9A 1H1MA 3NVCA 3T2QA 4TTGA 2ZGOA 3J8F1 1JZ3A 1OC1A 2XGXA 3MI8A 3O1VA 5F39A 1J1LA 1UMHA 2VULA 1W8HA 4PT6A 1MACA 5GLVA 1T6BX 4QHOA 3VHOA 4R8HA 1CAUA 3N7MA 5FZ9A 5HCAA 4QPYA 5A7SA 2A6WA 2XJVA 5EWSA 3KHCA 3ZN5A 4NPRA 3QH7A 1VB2A 2QZ2A 1PNGA 4QQPA 4Y24A 3RQ0A 2BU9A 4A7KA 5L36A 1WLCA 1UZVA 4CEWC 2ZBJA 1YYNA 4XXAA 2WT0A 4EWEA 2FCUA 3UYJA 1RUG3 4RHV1 1PZ9A 5JZGA 2RDQA 3MUZ1 2GNBA 4MSVA 5FUNA 5DN2A 5BV6A 3I2FA 4A4AA 1JZ5A 4AVVA 2ZGNA 3DN7A 4M3CA 4Q4X2 4XC9A 2YPJA 2Q8CA 2XVGA 2B42B 2F17A 4KBZA 4BWOA 5FWJA 3Q8BA 4UAPA 5IUQA 4NRQA 4ZZ5A 5FXWA 4FXKB 4GXLA 4UF0A 5LA9A 4YPJA 4UBGA 1MEC1 3HIFA 4S2HA 1BBT1 5FV3A 3O0VA 3POGA 3U14A 5A6ZA 4HVRA 1HQNA 1UCXA 2DBNA 1OT5A 1WMXA 2C6SA 2ZGPA 5B4XA 1EAH2 5FQ0B 1QJX2 1SDDB 2G9GA 3ZXLA 3OBAA 4BQ2A 5AC91 5CFDC 4UW4A 5A7NA 5LEKA 1F15A 1XJAA 1JTZX 2WDBA 1ACCA 1L7LA 3ILFA 3LCPA 5GJ6A 4OI2A 4BYYA 4D6QA 1W3XA 3NV1A 4UXAA 5GKAC 4NPMA 1GOGA 1NA1C 1SDWA 4CEWB 5JSOA 2RVAA 4MLOA 2VCAA 1UWWA 2W0XA 1XNCA 2HWE2 4JZRA 1NG0A 2K0GA 4QWNA 3P1IA 1W6QA 3EO6A 5FRAA 1UYZA 5FOJB 1EP0A 1WCKA 2Q0AA 4TSVA 1S0DA 4PIYA 5C8WA 3H8UA 3TN93 1PGW2 3WF1A 2WZR1 5T52A 1UYXA 4QX3A 5CG9A 3BB6A 3NKTA 1ZBA3 2VMDA 2VZRA 4WVMA 4BB3A 4QU2A 1PVC3 2VXRA 5JSRA 1RUE3 5JI7A 5F1RA 2D5HA 1RUI3 2XKOA 1G6NA 2KD7A 2Y0OA 3IN9A 4HBNA 4Y26A 3AKSA 4WM8A 3IT8A 1ZRIA 3I8TA 3KV6A 4XACA 5H9SA 2DCJA 4MXWA 4Q1RA 1CZTA 4FPOB 4Q4Y3 2Z5WA 1AHSA 1AR91 4J1XA 3O1UA 2WFPA 3USUA 5CFDB 1WBFA 4FO9A 3KZ4C 4XOGA 4PI2A 4D6SA 3OEAA 3SITA 2DTYA 1NA1B 2V09A 2XH6A 1TVGA 1CESA 2TUNA 3NWKA 2ZMNA 2JG9A 2QUOA 1N47A 3J7MA 1CAWA 4ZKTB 3CJXA 3LSEA 5FZ4A 4BPZA 2WNOA 1IS4A 4W4ZA 1W2UA 3SLIA 5B2GB 1YIPA 4LBJA 5CFCB 5F7UA 5I0SA 3BIEA 3ZMNA 4CXWA 3QBQA 4Q4V1 1PK6C 1JI6A 2R49A 5F37A 3N3HA 5JR2A 2F4LA 2X53S 3KLSA 3IIIA 4AZZA 4M0NA 2Y34A 3VBOB 1DBNA 4OHWA 2IXJA 3ACHA 2ZGRA 4AW7A 2EAKA 2B9UA 4V2WA 3ZYIB 1H6YA 2VBPA 1H8VA 2EICA 5C8CC 1LJ7A 5M0TA 4BISA 4URTA 2QQMA 4E4SA 1AXZA 3POJA 5ISLA 1AL0G 2V5YA 2HWF3 1JZ4A 4TLFA 3GNEA 4Y20B 2VZPA 4RR3C 2J22A 4LEJA 3V56A 2NQYA 3CIHA 4DEVA 5F6KA 1GZWA 2EXJA 2GSYA 3OUHA 1AUYA 1DYPA 2OUHA 2VOXA 2A75A 4PJYA 2CU5A 3CKHA 2GP5A 4AXOA 3UNPA 1DDLA 1PK6B 2ZMKA 4LO7A 1H30A 1HW5A 2PLV1 1SLAA 3LEIA 3PHMA 4LKSA 3WF0A 4ARYA 2E7TA 5FR3A 4IEVA 2HH9A 4O61A 4ORFA 3RWKX 5FPXA 4B7KA 1MS1A 1OBNA 2FCTA 3S30A 1HRV1 4BM8A 1AJOA 1VJ2A 4OULA 2XUMA 5FP4A 3I3DA 1RUD1 2WN3A 1OH4A 1RHI3 1YCIA 1NLRA 4QB1A 4MX3A 4XTPA 4Y33A 3MW4A 3LZZA 4XJZA 4YVWC 2F6BA 5C8CB 2ZGTA 1AR71 1STMA 3EMRA 4ET7A 1NXMA 2ZGKA 3WD5A 4FOYA 2HEWF 4IEYA 4XIKA 4P9LA 2IXCA 2FDGA 4KGQA 1FX5A 4DRVA 2GC3A 4LULA 1SACA 3IMMA 4K6BA 4LKFA 4HSLA 5IVBA 1C8NA 2HKXA 4AL9A 1NOVA 4XIOA 4L11A 3WHTA 3HWJA 4H7MA 1QJZA 3N7LA 4AEDA 4YSFA 2V72A 2WKKA 5FPVA 2PELA 3RI9A 1JZ7A 2HBTA 4ES8A 1VRH3 2VUCA 4CEYA 2BERA 1EPWA 5F5CA 1RUC3 4W50A 3UGGA 3FLRA 4LLOA 2C5DA 3EQEA 3VBUA 1KEXA 1UOFA 1A8MA 3PNAA 2OXBA 4KU8A 1MQTA 1SCSA 4AGRA 4C91A 3CZJA 2OUJA 5DDJ2 1UY0A 2J1VA 2R063 2RS12 4Y1ZA 3UKNA 5BNNA 5JXIA 1ZRFA 4JDNA 4Q29A 1SPPB 4FTSA 1LTEA 4JKMA 4I3PA 4YW1A 1D4VB 3SH3A 1OURA 2ZOEB 1Q8VA 3O12A 1AX2A 2YB7A 3IAQA 1ND2C 2BOIA 3KM5A 1UN1A 4KBBA 1Q8PA 3FN9A 3LDKA 3THCA 4CCLA 3UKVA 2DCZA 1JS9A 2NMNA 1S2BA 2J1UA 2JB4A 3B93A 3IM0A 3JD73 3PUIA 4WM7C 4OHZA 1UW8A 1K12A 3H8RA 3AMQA 2XB6C 4N43A 1NCRC 1H8TC 1W03A 3MEPA 2I45A 1GWKA 3E1F1 4YFWA 3VZLA 2DFBA 1W9WA 3OUJA 4C8DA 3K77A 4NR1A 2ET1A 1K45A 2GP3A 4LIUA 4CDXC 1JZ8A 1OOPB 1JYNA 1MZ6A 5JXGA 4ZU5A 3M8LA 2GMEA 3PU8A 5FIXA 2C1FA 4ZXEA 4AG4A 3IMNA 4JAAA 4YVSA 4NAOA 2RR13 4MO3M 2ZS6B 5LZ6A 2GC1A 1W8ZA 1ND2B 2D3RA 3A23A 3BIWE 1VBB3 2L9LA 5LASA 1YFUA 2HWB1 4QKDA 4DB5A 1OLQA 4XF9A 1Q8QA 3EYPA 2A6ZA 3H1YA 5LA2A 1L7RA 3KQRA 5EXOA 1LHUA 1AR63 4WVWA 1LGNA 1OKOA 2DVBA 3KB5A 1NCRB 1EV13 1YFXA 1D4M2 1H8TB 1OA4A 4FPEA 4K21A 3WNXA 4CDWA 4E2GA 5HI0A 5DAXA 2XMLA 2I2SA 1VB4A 4OI4A 5FJHA 4V1PA 3AL6A 2PMWB 1B35B 1TE1B 1D7PM 3D4KA 3P3PA 3VZMA 3LAGA 3NNMA 4XDOA 2ET7A 2X5IA 2VZ1A 1C8M1 2E7QA 2UYBA 1PO11 2P6CA 3VKMA 4DINB 1CAUB 1LOAA 5HCFA 3O0WA 3SHRA 3ZM8A 3ASIA 1ODMA 2Q8DA 3IDEA 3IKWA 1VE0A 1YIFA 2QVSB 4I02A 5DG1A 5FPBA 2QQIA 3KT7A 3UT0A 4NIGA 1DYKA 2IVIB 3WY6A 1CWPA 3J8F2 1BJQA 3MLJA 3POBA 5JZGB 1F4AA 2ZHMA 4HVQA 3C7HA 2R1BA 1JU3A 4XXPA 2XJRA 4QXKA 5FUPA 2VC9A 2CDPA 5FZLA 1LHVA 4M3CB 5B4NA 2LRPA 1O4ZA 1ZRRA 4LA2A 4XJ8A 4AVCA 2A5ZA 4DOUA 2VUDA 3HT2A 2UWCA 1ASJ2 4UF0B 1VBA3 2FDJA 3LFIA 2A3WA 1ZRDA 2RS31 1HJFA 1XB9A 5KC6A 1HRI1 3QH6A 4OQ8A 4WM8C 4LBKA 3I2DA 2MPFA 5JMOA 1ZZ9A 5FPLA 2W47A 5BY5A 2CTVA 5FZ3A 1RUF1 5K8SA 1RJ7A 3M3IA 2P2KA 5FZ1A 1BEV2 1UX7A 1HB4A 4Y5Z0 4MOAA 1W2TA 3KCYA 3IBMA 2VJXA 3Q9OA 4IEZA 3SH5A 4CDQA 3KT1A 2XPJA 5L9RA 2BGCA 1JOBA 5FYZA 4DUWA 1LGBA 3E5UA 2GC2A 1PMIA 2J1RA 5CNAA 1ULFA 4BLJA 5HCBA 2XONA 2ZX2A 4HETA 1VR3A 1I5ZA 5CG8A 2IVJA 3THDA 5J7MA 3CQOA 1NYWA 3NW4A 4QKFA 4D6RA 1QJEA 1G9FA 4JHZA 4WVMB 1ENXA 2XJQA 1BVP1 4XFFA 5KHIA 3VKNA 5T55A 1ZZCA 4YM0A 3I2KA 1HV0A 2PA7A 4AVBA 2PYTA 2VL4A 4WM8B 3ZR5A 3CF6E 4MHUA 3I2OA 4NRMA 3OGGA 2YG0A 4KG8A 4BOWA 3ZFFA 2WNEA 5C33A 3USUB 3UK9A 1PMHX 2RM22 1CIYA 3FLPA 2ARXA 1RIRA 3SEEA 3VKFC 4K7JA 1C5HA 3T2OA 5FOBB 4I01A 3BOWA 2VNGA 1PIV1 4Q4X1 1S1AA 5FUIA 5A1FA 1F9KA 3H3LA 1TME3 5AFEA 1C28A 2EXKA 2WS93 2WZR2 4UWDA 5A3UA 3LD8A 2YBKA 4IEXA 3LFMA 5IFTA 2CHHA 1QWRA 2JG9B 3CL1A 2YC0A 4YZ1A 5JR7B 2E9QA 3LA2A 1CAWB 3KVAA 2OX0A 5I0TA 2J42A 4DXRA 2R041 4HPKA 2VE1A 2TNFA 4C90A 2XWJB 3NV4A 2FHRA 3BN6A 4HT1T 5JAXA 1QJX1 1AR92 5F2WA 4KNCA 1C5IA 2WNUA 2C26A 1PZ8A 1YJLA 4N9HA 4EN6B 3TNPB 2D40A 1Q8OA 1BVVA 3ZKYA 4P5YA 5LB6A 2UY9A 2HBUA 2Z4FA 3NO8A 1BLZA 4I0WB 2R0HA 2HWE1 3ZPOA 3D8CA 4LO5B 2JD4A 3VDDA 1BK0A 1SFYA 1F5FA 3OBRA 4OLLA 3HQXA 5ACA3 2R16A 3VD7A 3BTZA 3PLQA 5FCCA 3DV8A 3O14A 4QX2A 4AQSA 4Q4V2 5A7PA 3FHIB 4TWTA 1KJLA 4XCBA 1W8WA 4NROA 3WDWA 3ZXDA 4Y1YA 2N7GA 5CZKA 3OJBA 4P00B 1YFYA 4A7YA 4GWJA 1GZWB 2CGOA 4QPWA 4BQ4A 4XMAA 2PHWA 1R083 2FZ1A 3RVHA 1CJDA 2WA4A 5J37A 2YDEA 2PHTA 1LOEA 4FPYA 2A6VA 4CU7A 1AYN3 1V9U3 2QJVA 3FZ3A 4CP2A 1ZREA 1IG0A 3AK0A 1V6IA 4HSJA 5FPZA 2VO5A 5C6CA 2VW0A 2C24A 4LHLA 3DYPA 4DFSA 3VBUC 3TRSB 1VBC2 3H9AA 4E4DX 1AYM3 2IWGB 1MQTC 2BVBA 2WAOA 1PGL2 1EUUA 1A78A 2VQAA 3PU3A 3O1OA 5BNNC 4YYOA 2YYOA 3WDYA 1GUIA 5J3UA 5E89A 2HEVF 5J98B 3RMXA 1E5SA 2YPDA 4HN0A 2DBIA 2YROA 1FPN2 4PQ9A 1XYPA 4LBMA 4NPLA 1BMV1 3WR0A 5IATA 4H7LA 3R05A 1C1LA 3ABZA 4CCNA 1QQP3 1S0GA 4IEUA 3WHUA 4NMIA 1RUH3 1CIWA 1HRV2 1WLWA 2QQWA 1IPJA 1ZX5A 5DABA 4AEDB 1RITA 1RUD2 4M4RA 5G05L 3PMSA 5FREA 4QB6A 2ZX0A 4Y3OA 4N43C 4E2QA 4CEYB 3U4XA 3VBHA 3B3QE 1WD3A 2P3IA 5FZKA 4IEPA 1FOD3 2ARCA 5FZEA 5F5IA 5JDBA 2EIBA 5FP3A 5A7WA 1W0OA 3VBUB 3H8XA 1ZZ6A 3A21A 1OA3A 1KFUL 3HVDA 3KV4A 1LHWA 4B4QA 1MQTB 3AKTA 1YQ8A 4M3CE 3EB7A 3NJYA 1R091 5BNNB 1GKBA 5EIYB 4GIQA 4LE4A 3AKQA 3LQCA 3AMHA 3WNMA 4D0QA 1UPIA 4AR2A 1XOYA 4EV0A 4NHMA 4EROA 3T09A 2ZX3A 4YVSC 5CKNA 1WCQA 1AZDA 3ZXGA 1QU0A 1Y4WA 1UO9A 2R30A 1HDKA 2JDPA 1SLCA 1VMJA 2PHRA 1MS9A 3PVBB 3GBGA 3RSJA 4FVVA 1QOOA 5LATA 3RPQA 1APNA 1JYCA 1MS4A 3GJAA 5IT6A 4MGSA 4AEKA 1NZCA 1POV1 2P4EA 3N9QA 3MFCA 4FP3A 4N43B 5EZWA 4GMP0 2W1QA 3HR9A 1UY3A 3T1MA 1FYUA 4AWDA 2QZ3A 4A44A 2WINB 1LOGA 2R32A 4R52A 5FP7A 3VV1A 1DYOA 2RMU1 2FMDA 2R072 4ZU7A 3AJYA 5L7OA 3FFZA 5CU1A 4O7XA 2RE9A 2W1UA 2WSVA 2X5IC 4YGDA 2XVKA 3K4DA 4I30A 3IDCB 1H1AA 5I93A 2Y64A 5FZBA 3W5NA 3RGBA 5A3NA 5T3NA 5A3PA 2VUAA 4O65A 3LE0A 3U07A 2QQJA 4YVSB 4F7ZA 5LA1A 3J9SA 1HLCA 5A7OA 4Y1XA 3OG2A 5C4WC 3OGSA 1VBE2 4XAEA 3R4SA 4QGNA 2NN8A 1JMUB 2R1DA 4QQLA 1R1A3 2P3KA 3HMYA 3LB9A 4CYDA 4DQAA 1M06G 3SNMA 3DF0A 4CUBA 4RR3A 3POFA 4QDSA 5DDJ1 5DZFA 3VBRA 2E32A 4GH4A 4OFGA 4GA9A 4CDWB 1J3RA 4Y1VA 2BBVA 1JH5A 4QXBA 3HD8B 4W6YA 3GHMA 5FZAA 5FLIA 2JDAA 4RHV3 4AF9A 1C4RA 2Q1FA 4B3NA 2NP0A 1UMIA 1QXRA 5E16A 2F4PA 1GOHA 5C9AC 3MPPG 2JKXA 2X5IB 2VQUA 2YFZA 1URXA 3ELNA 2HWB2 3R4UA 2AC1A 1OA2A 5H9QA 2EVXA 1MEC3 2OW4A 1BBT3 2WLPA 1SLBA 3PJYA 4GJZA 1SG3A 2JJ6A 3C7OA 5A33A 3X29B 4CUGA 4MGKE 3GCWA 2VCBA 1YQCA 2QDRA 3D0JA 3FWEA 5AC93 4IEWA 3OD4A 4CDQC 3W20A 2QQVA 3Q8AA 1VMFA 5BXXA 2ZAHA 5F5QA 4LHSA 4M01A 3PMEA 4PIXA 1HIXA 4YM1A 1UYYA 1GSLA 1UU4A 1QH7A 4QQ2A 1YC61 4K9SA 5L9VA 2UYAA 2B8MA 1NZIA 2ZX1A 1HXS1 5F3CA 1LOFA 2WZR3 3SC7X 2ID4A 1UPSA 3JXSA 4KH9A 4G4FA 4AVSA 1W6NA 4LK7A 1VBD1 5A1AA 1D4M1 1OLRA 3M1HA 3KCXA 1N3QA 1G9BA 3I7DA 4MYEA 4OMCA 1RUJ2 3VKLA 2ERFA 4JGYA 1EY2A 2DUQA 3AP4A 4GJYA 4QQOA 1S2KA 4CDQB 1W0PA 2VMCA 1IS5A 3NNGA 2XLAA 1B09A 2HYKA 2W2IA 2YMZA 4GALA 4GQ7A 4XZPA 1WD4A 2E7AA 3JU9A 4PCRA 4BCUA 2EALA 4KQ7A 5JCTA 5FYYA 3V65A 1UNBA 1YRZA 2XL7A 3IAPA 2DURA 5HV4A 1GP4A 4BQ5A 5FY5A 2XL9A 3OB8A 3ZDVA 4ES9A 4YW6A 3RRDA 3WUCA 1RUF2 2WNUC 3H42B 1D2SA 2JKBA 3WZ1A 2C9KA 2WQ8A 4URAA 1UY1A 4Z92B 4CDXA 3VDDC 2BRTA 3UGHA 3ZFFB 1QEXA 3GBWA 4JCKA 4MGIE 4FFHA 4NWVA 1Q43A 4AE2A 4DPNA 4EN0A 5A6XA 2W52A 2D6LX 1Q5OA 2RS51 3S5QA 1OUXA 3MW2A 1OQDA 3O5SA 5C7GA 1KFXL 1ASJ1 4LBLA 4GMP3 1GLHA 3SXWA 1HB2A 1DZQA 2BNOA 2GH2A 3LPFA 4FP2A 3WNPA 2PHUA 4PLMA 3RZGA 4FTBA 4XHXA 4PLNA 1H6XA 5AVAA 1XNAA 5J1XA 4YGBA 2FDKA 4HPKB 2Y6GA 5DMYA 3MIHA 1GNZA 2CY6A 2HJIA 2CGPA 4GWMA 1BEV1 2WNUB 2VNOA 2ZCWA 5FPAA 1F5JA 1YQ2A 4LLFA 1PIV2 1UD1A 2PLV3 5IHRA 2IZWA 1H2MA 2P3YA 2XQRA 1UQXA 4KMQA 1PO21 4Q0PA 2EIDA 2D43A 2W68A 3MIGA 2WIIB 2FDIA 1V6JA 1MS8A 1BCXA 4OI0A 1O7FA 2QTWB 2R042 2DUOA 4YZ3A 5D21A 4FTEA 3N35A 3WLUA 2XJUA 1GZTA 1AR73 4YWAA 1IOAA 1O5LA 4B8EA 3BGAA 3VDBA 3AVSA 1UYPA 2CWMA 1LOCA 3WEZA 2BFUL 5A6QA 5LY2A 1QXJA 3B9CA 4ZPIA 3FLTA 4A3XA 4PIZA 1MZFA 2ADEA 5JOYA 1LHOA 2WFF3 2SLIA 4MHRA 3ECQA 4PF1A 3I59A 3E6DA 5F6LB 1PZ7A 2RM21 1E5RA 2MEV2 4OUEA 1O8SA 4QM8A 5FKBA 5G04L 1IHMA 2Z79A 3VBHC 4FXGB 3MV01 2K9ZA 5GLUA 1WW4A 1COV3 4UI9L 4XW3A 2PHLA 3AZYA 1H1IA 3JBG2 4JRAA 1UZYA 2BWAA 1AL22 5FMOS 3V0AA 2Q1MA 5LRRA 1SFPA 4CCKA 2GALA 2ZEYA 1RVF1 3FE5A 2GN7A 4JTNA 4Y5TA 4H55A 2XLGA 4HXCA 2AZ5A 5CKMA 1A6CA 3LKJA 1ND3A 1E57A 3KVBA 3AJZA 5FZ7A 1EUTA 1RMU2 3WW1A 1G9AA 1LHNA 4NIDA 3K3NA 2D3PA 3ENRA 1CX1A 4AI2A 4CP1A 5FYMA 3POIA 5FBJA 3DEMA 3FMGA 4AQ6A 4LNVA 4I2OA 5DAQA 5LBBA 2Q1ZB 4AK3A 3S57A 2DWRA 3C8XA 1FMD2 4JQTA 3OSDA 1US3A 1V0AA 1ULGA 5ANQA 1HB1A 3VHRA 3DXUA 4OYUA 5A7WB 5FK7A 3CJIA 4BHPA 5CEHA 1RTVA 4ATEA 4E8DA 1BMV2 3J7NA 3PUAA 1HN0A 3WG3A 5L7OC 4IXLA 3WQ0A 5SV8A 3KSCA 4TXWA 2JDHA 2NM1A 4OZOA 3AKRA 2KA3A 4HK9A 1S2EA 3E6CC 2E51A 3GF6A 3B00A 4Y5SA 1KS5A 4LA3A 5FMDA 5D2AA 3NJZA 2EXIA 3CU7A 1P8JA 1KRIA 4Q0SA 3PUQA 4K1ZA 1VBC1 1JN2P 3MUY1 3NNLA 1PGL1 4XABA 4B4PA 3VBRC 3CZUA 1SLTA 1R092 1Y9QA 2CL2A 2P34A 3BOPA 4GH4C 4XURA 3UV9A 5HBAA 2HEYF 3HNMA 2WO2A 2Y6KA 3KHBA 5F9TA 4N8MA 1FPN1 3FBMA 3E97A 1PMJX 1UL9A 2WT2A 3AYEA 2BJSA 5K9YA 1ULOA 3I2HA 2K46A 1GQGA 3U1XA 1G9CA 3B01A 2HWC3 4J6GA 1CN1A 2DYCA 3IPVA 3N7JA 3B94A 4JKKA 4NIIA 4KG0A 5JPNB 2P5BA 2IUWA 1W8NA 2ZEWA 3ZN6B 3ZO0B 3INAA 5LRSA 1RB8G 1C8M3 3USSA 1PO13 2ZKNA 1GNYA 4HVOA 1NX9A 5KWRA 2GH8A 3VUOA 2O0OA 2B9VA 2ORZA 1GZ9A 1FT9A 5EPAA 2RMU2 2QDNA 1ZRCA 4LHKA 4RR3B 5F5AA 3H8OA 1MS3A 1QJY2 2A6XA 4FPHA 4DNYA 3K75B 1SBEA 4GH4B 2DUPA 3RMYA 4R9AA 4LKEA 4JX0A 4MXVA 1U0AA 3LPGA 3MIDA 5AFBA 2PFWA 3AFKA 3ITQA 1VIWB 1OKQA 1DQ4A 4XJ9A 2VTFA 2MHFA 1X8MA 4GZ9A 2ZZJA 1V6OA 3JB4C 1PNFA 1LOFC 3AYDA 1F4HA 2NZ9A 3MPBA 4ASKA 3WF2A 2W95A 3ATGA 3DCQA 1A3KA 2UU8A 4NHLA 3GZUC 2NYYA 2LW8A 1JUHA 4L0PA 3V0BA 3LA3A 2I07B 1FATA 2RS33 4OHYA 1J58A 4YVWB 4V2VA 1HRI3 2AACA 4QD2A 2J1TA 5A33B 1FXZA 2OQ7A 1AJKA 3LF7A 4FQ4A 4IE7A 2YZ4A 1XU2A 4JGYC 2A3XA 2R071 4NWWA 4CXXA 2J7MA 3HBZA 3DYOA 4UFKA 4N7IA 5JIAA 4K8FA 1JODA 1ZBA1 5JI9A 4RL7A 3PJQA 2PXJA 2OZ6A 3WP5A 3OTFA 4LXLA 1UU6A 4S2FA 3WDVA 5JIUA 1WMFA 4LT5A 4P08A 2WWUA 2ZTNA 4DY3A 3AYAA 1G7YA 1XNKA 4RSUA 3RFRA 5IAXA 4IE0A 1VBE1 5JWPA 3DXTA 5BUVA 2RHPA 3UJQA 1IQAA 4IL7A 1SLIA 1XNBA 4XE9A 4ZXKA 1NE6A 3TAYA 1HJGA 5IVYA 4CDUA 3N9PA 1OLMA 2JE8A 2ZA9A 1W6NB 3ZXEA 2Z2SB 1I1EA 1K3IA 4BLIA 4GD4A 3N36A 5FAXA 3NL1A 4CXYA 2UURA 2BTVC 2WZPP 2YV8A 2H0VA 4IEOA 1DHKB 3BPSA 4XF3A 3VZNA 4XILA 2XXZA 1QMJA 1XRUA 3P3NA 5FZDA 5JLVA 1KJRA 4Q1PA 4XUPA 3AKPA 4Q4X3 3MW3A 1K5MA 1HXS2 4RQPC 3NQHA 2PQSA 4ATFA 4WM7B 5A3TA 5A1LA 4NOTA 3BKZA 3ZFGA 1BHGA 4CE8A 2BP6A 3AZVA 4WV8A 1VBD2 4GB32 3KGLA 4IV1A 4FFFA 3V64A 1DU3D 2EF6A 2R043 1DGWX 2EXHA 1SZBA 2RJ2A 3H50A 5BNPA 5ABJC 3DKWA 1TMF2 4YNIA 1J59A 1EAH3 3J26N 2CV6A 3LEGA 4ZS3A 2ATFA 1QJX3 4E8CA 4AHWA 1QJFA 5FWEA 4XBLA 4BXFA 5DUVA 2QQPA 1ENSA 2HWF1 4B7EA 3POEA 4CDXB 4HG6B 4YG3A 2JWPA 5T5JA 4XUNA 4FPLA 2Q30A 4XF1A 2Y8KA
chains in the Genus database with same CATH topology
2X05A 3DYPA 4AAXA 1GMMA 3MBWA 2WAOA 4XZUG 1EUUA 1R64A 4XUTA 3UETA 4DEQA 3I2IA 1GOFA 2E33A 2BGPA 3T0AA 1GUIA 3VDAA 2YFUA 4IUGA 3ABZA 1T2XA 1OD3A 1JHJA 4D8MA 2W94A 1W8OA 1MPXA 2WO3A 4M4RA 3K46A 5G05L 4QB6A 3T08A 4DUVA 2EIBA 4A3ZA 2XQXA 3A21A 2WYSA 3CMGA 3SKVA 2V4VA 3DYMA 3EB7A 1PX3A 5EIYB 2DDUA 2WUHA 3LQCA 4ZY9A 3T2QA 2W5FA 1O8PA 3WNMA 4D0QA 4TTGA 1JZ3A 2WZEA 2Y6JA 3HEIA 1UMHA 3T09A 4PT6A 1WCQA 3NJXA 5I0DA 2RV9A 3MO4A 4BDVB 4MGSA 2OKXA 3C7EA 2WABA 2VMEA 2W1QA 1UY3A 1WKYA 3F2ZA 4A44A 2QBXA 3MUZ1 1DYOA 5DN2A 2W1SA 3I2FA 4A4AA 1JZ5A 3D3AA 2W1WA 2W1UA 4A45A 3K4DA 5EJZB 2Y64A 4QX1A 4UAPA 4ZZ5A 3W5NA 5JXJA 2VZQA 4YPJA 5LA1A 3LE0A 4DXTA 2QQJA 5HXMA 1OT5A 2YC4A 3OG2A 3OGSA 5B4XA 2WZ8A 3FHAA 1SDDB 3OBAA 4CUBA 2WDBA 4QDSA 2E32A 2Y6LA 1GOGA 2RVAA 2VCAA 2JDAA 1UWWA 1LNSA 2VZOA 3P1IA 1UMIA 1UYZA 1SHWB 2LS6A 1UZ0A 4ZZ8A 3GXUA 1GOHA 3WF4A 2JKXA 2VQUA 2YFZA 3WF1A 1UY4A 1UYXA 4QX3A 3ETPA 4XUOA 1OF4A 2VMDA 2VZRA 3IB3A 4BXSV 3P6BA 1SG3A 3C7OA 2KD7A 1ULPA 2VCBA 1NAEA 2DCJA 2VQTA 1CZTA 1J83A 1O59A 3HPNA 4QDQA 4ARXA 3GGLA 3T2PA 3OEAA 1K42A 4LHSA 3AC0A 4DXSA 1JYXA 1TVGA 2W92A 1UYYA 4A42A 4LQRA 4W4ZA 4A6OA 5F7UA 2QQKA 2J1SA 3I2JA 1JI6A 2ID4A 3JXSA 5JR2A 5A1AA 2VZTA 4GWIA 3IIIA 1XPWA 4BK5A 2W3JA 4OMCA 3HNBM 3ACHA 5JXHA 1H6YA 4XVHA 2EICA 2VMCA 3MV11 1W99A 3NNGA 2QQMA 4CU6A 2V5DA 1JZ4A 2VOTA 2VZPA 3IAPA 1JU4A 2J22A 3NJVA 3OB8A 4DEVA 2VMFA 3CIHA 4DUXA 4OMDA 2EIEA 1I5PA 3CKHA 3A22A 3UNPA 3J7HA 2C9KA 4QAWA 1PX4A 2WQ8A 5IJRA 2BZDA 1UY1A 3LEIA 4LKSA 3WF0A 4ARYA 3OGVA 3WF3A 2JD9A 3LEKA 5CYYA 2HLEA 1IQDC 3I3DA 2WN3A 1OH4A 1W9SA 2R7EB 4QB1A 4QDRA 4RYDA 5C7GA 3VDCA 1XC6A 2J1AA 4ET7A 3LPFA 3WNPA 1J84A 1H6XA 1XNAA 5J1XA 3GDBA 2YC2A 2Y6GA 2BBAA 5DMYA 1XNTA 1YQ2A 2V72A 5IHRA 1JZ7A 1L7QA 4CUCA 3I3BA 2BERA 4KMQA 4P02B 4W50A 2EIDA 2J1EA 1KEXA 2W46A 3CZJA 5JXIA 1UY0A 2J1VA 3BGAA 3VDBA 2HYXA 3WEZA 4A41A 4JKMA 3T0DA 4CU8A 1JYWA 3IAQA 2YB7A 4CVUA 3HOBA 1HN1A 3ECQA 3OGRA 4PF1A 3FN9A 3THCA 1UY2A 4OUEA 1O8SA 3HNYM 2J1UA 5G04L 4MGQA 3PUIA 3WNLA 1K12A 3MV01 1NKGA 2W9XA 3I97A 4UI9L 5IYYA 2E31A 1W9TA 4MADA 1TG7A 2ZEYA 3DECA 2B4KA 3E1F1 3WNKA 1W9WA 3VD5A 5IFPA 2XHNA 3K77A 1DP0A 1K45A 1JZ8A 1JYNA 2C4XA 5JXGA 1EUTA 5HPOA 2VZSA 4ZXEA 1CX1A 4AG4A 2ZXQA 2VZVA 4MO3M 3A23A 2W91A 2L9LA 2ZEXA 3C8XA 3C7FA 1US3A 3EYPA 3HJRA 5LA2A 1L7RA 2WBKA 4OYUA 4E8DA 3U37A 1CZVA 4KI5M 3VD9A 4TXWA 1D7PM 4OZOA 4PQQA 4RN5A 2VZ1A 3I3EA 3ACIA 1DLCA 2W87A 2WAAA 2BGOA 2VCCA 2QQNA 1P8JA 3ZM8A 2VR4A 3MUY1 1US2A 4CU9A 4M4PA 4W8JA 3CZUA 3I2GA 2QQIA 4XURA 2VM9A 3WNOA 3HNMA 2WO2A 2Y6KA 1PMJX 1GU3A 1F4AA 1UXZA 1ULOA 3I2HA 4JKLA 3C7HA 5LA0A 1JU3A 2VC9A 1GQPA 2CDPA 5B4NA 4JKKA 2ZEWA 1W8NA 2ZEZA 3CDZB 4FI9A 3WSOA 1GNYA 1NX9A 3K4AA 3SEPA 2VZUA 5JMOA 2B9VA 1KGYA 2ORZA 1JZ6A 5LCWL 2W47A 5EJ1B 2ORXA 1UX7A 3K75B 4MOAA 1CZSA 4LPLA 2VJXA 4XUQA 3K4ZA 4JX0A 3LPGA 2VTFA 4BJ0A 3IDAA 3OEBA 4DUWA 4GZ9A 2J1RA 3W5MA 2XONA 2X09A 3WQBA 1F4HA 3WF2A 2W95A 3THDA 1JZ2A 2XOMA 3CQOA 4JHZA 5C71A 4L0PA 2LW8A 4CUAA 2QQOA 2QQLA 4KWUA 3I2KA 2J1TA 4QX0A 2VL4A 3A7QA 3WNNA 5DPNA 2YG0A 4Z2AA 2J7MA 3DYOA 1PMHX 1CIYA 2X10A 3ACFA 4BK4A 3SEEA 3T2OA 5FUIA 3VD3A 2DCKA 3T0BA 5IFTA 4P08A 1OF3A 4DXRA 2E26A 5JUVA 3BN6A 5DQ0A 2Y6HA 2JE8A 1NUKA 2C26A 1K3IA 3PUHA 4P5YA 4QB2A 2Z4FA 1UXXX 3NRUA 3HN3A 3UESA 1RYYA 4XUPA 3VD7A 3VD4A 4QX2A 2VZ3A 2WN2A 3NQHA 2PQSA 3GM8A 2CDOA 1BHGA 5C70A 1JYVA 5CZKA 1W0NA 4P00B 3ACGA 2RJ2A 4GWJA 4UOJA 4QPWA 2WO1A 3LEGA 4E8CA 3FL7A 4XUNA 3SKJE 4CU7A 3FHQA 4HG6B 2VO5A 2Y8KA 3C7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X05 A;  3DYP A;  4AAX A;  1GMM A;  3MBW A;  2WAO A;  4XZU G;  1EUU A;  1R64 A;  4XUT A;  3UET A;  4DEQ A;  3I2I A;  1GOF A;  2E33 A;  2BGP A;  3T0A A;  1GUI A;  3VDA A;  2YFU A;  4IUG A;  3ABZ A;  1T2X A;  1OD3 A;  1JHJ A;  4D8M A;  2W94 A;  1W8O A;  1MPX A;  2WO3 A;  4M4R A;  3K46 A;  5G05 L;  4QB6 A;  3T08 A;  4DUV A;  2EIB A;  4A3Z A;  2XQX A;  3A21 A;  2WYS A;  3CMG A;  3SKV A;  2V4V A;  3DYM A;  3EB7 A;  1PX3 A;  5EIY B;  2DDU A;  2WUH A;  3LQC A;  4ZY9 A;  3T2Q A;  2W5F A;  1O8P A;  3WNM A;  4D0Q A;  4TTG A;  1JZ3 A;  2WZE A;  2Y6J A;  3HEI A;  1UMH A;  3T09 A;  4PT6 A;  1WCQ A;  3NJX A;  5I0D A;  2RV9 A;  3MO4 A;  4BDV B;  4MGS A;  2OKX A;  3C7E A;  2WAB A;  2VME A;  2W1Q A;  1UY3 A;  1WKY A;  3F2Z A;  4A44 A;  2QBX A;  3MUZ 1;  1DYO A;  5DN2 A;  2W1S A;  3I2F A;  4A4A A;  1JZ5 A;  3D3A A;  2W1W A;  2W1U A;  4A45 A;  3K4D A;  5EJZ B;  2Y64 A;  4QX1 A;  4UAP A;  4ZZ5 A;  3W5N A;  5JXJ A;  2VZQ A;  4YPJ A;  5LA1 A;  3LE0 A;  4DXT A;  2QQJ A;  5HXM A;  1OT5 A;  2YC4 A;  3OG2 A;  3OGS A;  5B4X A;  2WZ8 A;  3FHA A;  1SDD B;  3OBA A;  4CUB A;  2WDB A;  4QDS A;  2E32 A;  2Y6L A;  1GOG A;  2RVA A;  2VCA A;  2JDA A;  1UWW A;  1LNS A;  2VZO A;  3P1I A;  1UMI A;  1UYZ A;  1SHW B;  2LS6 A;  1UZ0 A;  4ZZ8 A;  3GXU A;  1GOH A;  3WF4 A;  2JKX A;  2VQU A;  2YFZ A;  3WF1 A;  1UY4 A;  1UYX A;  4QX3 A;  3ETP A;  4XUO A;  1OF4 A;  2VMD A;  2VZR A;  3IB3 A;  4BXS V;  3P6B A;  1SG3 A;  3C7O A;  2KD7 A;  1ULP A;  2VCB A;  1NAE A;  2DCJ A;  2VQT A;  1CZT A;  1J83 A;  1O59 A;  3HPN A;  4QDQ A;  4ARX A;  3GGL A;  3T2P A;  3OEA A;  1K42 A;  4LHS A;  3AC0 A;  4DXS A;  1JYX A;  1TVG A;  2W92 A;  1UYY A;  4A42 A;  4LQR A;  4W4Z A;  4A6O A;  5F7U A;  2QQK A;  2J1S A;  3I2J A;  1JI6 A;  2ID4 A;  3JXS A;  5JR2 A;  5A1A A;  2VZT A;  4GWI A;  3III A;  1XPW A;  4BK5 A;  2W3J A;  4OMC A;  3HNB M;  3ACH A;  5JXH A;  1H6Y A;  4XVH A;  2EIC A;  2VMC A;  3MV1 1;  1W99 A;  3NNG A;  2QQM A;  4CU6 A;  2V5D A;  1JZ4 A;  2VOT A;  2VZP A;  3IAP A;  1JU4 A;  2J22 A;  3NJV A;  3OB8 A;  4DEV A;  2VMF A;  3CIH A;  4DUX A;  4OMD A;  2EIE A;  1I5P A;  3CKH A;  3A22 A;  3UNP A;  3J7H A;  2C9K A;  4QAW A;  1PX4 A;  2WQ8 A;  5IJR A;  2BZD A;  1UY1 A;  3LEI A;  4LKS A;  3WF0 A;  4ARY A;  3OGV A;  3WF3 A;  2JD9 A;  3LEK A;  5CYY A;  2HLE A;  1IQD C;  3I3D A;  2WN3 A;  1OH4 A;  1W9S A;  2R7E B;  4QB1 A;  4QDR A;  4RYD A;  5C7G A;  3VDC A;  1XC6 A;  2J1A A;  4ET7 A;  3LPF A;  3WNP A;  1J84 A;  1H6X A;  1XNA A;  5J1X A;  3GDB A;  2YC2 A;  2Y6G A;  2BBA A;  5DMY A;  1XNT A;  1YQ2 A;  2V72 A;  5IHR A;  1JZ7 A;  1L7Q A;  4CUC A;  3I3B A;  2BER A;  4KMQ A;  4P02 B;  4W50 A;  2EID A;  2J1E A;  1KEX A;  2W46 A;  3CZJ A;  5JXI A;  1UY0 A;  2J1V A;  3BGA A;  3VDB A;  2HYX A;  3WEZ A;  4A41 A;  4JKM A;  3T0D A;  4CU8 A;  1JYW A;  3IAQ A;  2YB7 A;  4CVU A;  3HOB A;  1HN1 A;  3ECQ A;  3OGR A;  4PF1 A;  3FN9 A;  3THC A;  1UY2 A;  4OUE A;  1O8S A;  3HNY M;  2J1U A;  5G04 L;  4MGQ A;  3PUI A;  3WNL A;  1K12 A;  3MV0 1;  1NKG A;  2W9X A;  3I97 A;  4UI9 L;  5IYY A;  2E31 A;  1W9T A;  4MAD A;  1TG7 A;  2ZEY A;  3DEC A;  2B4K A;  3E1F 1;  3WNK A;  1W9W A;  3VD5 A;  5IFP A;  2XHN A;  3K77 A;  1DP0 A;  1K45 A;  1JZ8 A;  1JYN A;  2C4X A;  5JXG A;  1EUT A;  5HPO A;  2VZS A;  4ZXE A;  1CX1 A;  4AG4 A;  2ZXQ A;  2VZV A;  4MO3 M;  3A23 A;  2W91 A;  2L9L A;  2ZEX A;  3C8X A;  3C7F A;  1US3 A;  3EYP A;  3HJR A;  5LA2 A;  1L7R A;  2WBK A;  4OYU A;  4E8D A;  3U37 A;  1CZV A;  4KI5 M;  3VD9 A;  4TXW A;  1D7P M;  4OZO A;  4PQQ A;  4RN5 A;  2VZ1 A;  3I3E A;  3ACI A;  1DLC A;  2W87 A;  2WAA A;  2BGO A;  2VCC A;  2QQN A;  1P8J A;  3ZM8 A;  2VR4 A;  3MUY 1;  1US2 A;  4CU9 A;  4M4P A;  4W8J A;  3CZU A;  3I2G A;  2QQI A;  4XUR A;  2VM9 A;  3WNO A;  3HNM A;  2WO2 A;  2Y6K A;  1PMJ X;  1GU3 A;  1F4A A;  1UXZ A;  1ULO A;  3I2H A;  4JKL A;  3C7H A;  5LA0 A;  1JU3 A;  2VC9 A;  1GQP A;  2CDP A;  5B4N A;  4JKK A;  2ZEW A;  1W8N A;  2ZEZ A;  3CDZ B;  4FI9 A;  3WSO A;  1GNY A;  1NX9 A;  3K4A A;  3SEP A;  2VZU A;  5JMO A;  2B9V A;  1KGY A;  2ORZ A;  1JZ6 A;  5LCW L;  2W47 A;  5EJ1 B;  2ORX A;  1UX7 A;  3K75 B;  4MOA A;  1CZS A;  4LPL A;  2VJX A;  4XUQ A;  3K4Z A;  4JX0 A;  3LPG A;  2VTF A;  4BJ0 A;  3IDA A;  3OEB A;  4DUW A;  4GZ9 A;  2J1R A;  3W5M A;  2XON A;  2X09 A;  3WQB A;  1F4H A;  3WF2 A;  2W95 A;  3THD A;  1JZ2 A;  2XOM A;  3CQO A;  4JHZ A;  5C71 A;  4L0P A;  2LW8 A;  4CUA A;  2QQO A;  2QQL A;  4KWU A;  3I2K A;  2J1T A;  4QX0 A;  2VL4 A;  3A7Q A;  3WNN A;  5DPN A;  2YG0 A;  4Z2A A;  2J7M A;  3DYO A;  1PMH X;  1CIY A;  2X10 A;  3ACF A;  4BK4 A;  3SEE A;  3T2O A;  5FUI A;  3VD3 A;  2DCK A;  3T0B A;  5IFT A;  4P08 A;  1OF3 A;  4DXR A;  2E26 A;  5JUV A;  3BN6 A;  5DQ0 A;  2Y6H A;  2JE8 A;  1NUK A;  2C26 A;  1K3I A;  3PUH A;  4P5Y A;  4QB2 A;  2Z4F A;  1UXX X;  3NRU A;  3HN3 A;  3UES A;  1RYY A;  4XUP A;  3VD7 A;  3VD4 A;  4QX2 A;  2VZ3 A;  2WN2 A;  3NQH A;  2PQS A;  3GM8 A;  2CDO A;  1BHG A;  5C70 A;  1JYV A;  5CZK A;  1W0N A;  4P00 B;  3ACG A;  2RJ2 A;  4GWJ A;  4UOJ A;  4QPW A;  2WO1 A;  3LEG A;  4E8C A;  3FL7 A;  4XUN A;  3SKJ E;  4CU7 A;  3FHQ A;  4HG6 B;  2VO5 A;  2Y8K A;  3C7G A; 
#chains in the Genus database with same CATH topology
 4NIA A;  2BUK A;  4AVA A;  1JOJ A;  2HWE 3;  4QHB A;  1WA4 A;  5I0R A;  5I8Y A;  3D5O A;  3PIG A;  1YEW A;  4LUM A;  3I2I A;  4XUT A;  1GOF A;  2XG3 A;  2BGP A;  3T0A A;  2ZAB A;  5C4W A;  3G6J B;  4FPK A;  2ZML A;  2A70 A;  3VDA A;  4AI9 A;  1Z7S 2;  4Q4W 2;  2XJP A;  1ZNP A;  4OZX A;  1IS3 A;  1YXW A;  1ZBE 2;  3PUS A;  4IUG A;  4BU2 A;  4DY5 A;  4WBB A;  2D44 A;  1JBC A;  1GWL A;  2FD8 A;  1RHI 1;  1T2X A;  1RUJ 1;  3FUQ A;  1JHJ A;  1LCL A;  1I9R A;  1O91 A;  2WRA A;  3WCS A;  2HWD 2;  2WO3 A;  4QX8 A;  2RS5 2;  4NN0 A;  3K46 A;  2R6Q A;  1O6U A;  2RDR A;  2LM3 A;  4OUM A;  1TQ5 A;  5C9A A;  1K5J A;  2BV4 A;  4IND A;  3MYX A;  1C57 A;  1ONA A;  2ENR A;  4HMZ A;  2Y26 A;  4QPG A;  5FYC A;  2WYS A;  1O3S A;  4EZH A;  3WP4 A;  1X9T A;  3ZN4 A;  3U10 A;  5I8T A;  2VVD A;  5FYS A;  3QOP A;  1ND3 C;  1QHD A;  2WWJ A;  2DDU A;  3ALQ A;  3ZDS A;  1ST8 A;  3JUU A;  5I8S A;  2W5F A;  1O8P A;  3P5B A;  4WZF A;  3RJR A;  4XFH A;  1W9F A;  2Y6J A;  3HEI A;  4XFA A;  3IZO A;  4O9G A;  5APA A;  4DRR A;  1QXP A;  4P9I A;  2PAM A;  4Z8B A;  4D7S A;  1DF0 A;  1SBD A;  2Y6F A;  1DGR A;  5BNQ A;  5I0D A;  5IVF A;  3I54 A;  1W6Q B;  3I59 B;  1PO2 2;  3MIB A;  3MO4 A;  5LBF A;  5J09 A;  5EP9 A;  4IEQ A;  2R06 1;  4GKY A;  3APB A;  5F2S A;  4RS5 A;  5KHG A;  5FLH A;  4BIF A;  4DO0 A;  3C7E A;  2WAB A;  3CJI C;  2VME A;  1AVB A;  4GAZ A;  3V0A B;  3H1W A;  5GLW A;  4ZU4 A;  5E6H A;  4E2S A;  4AEJ A;  5IWF A;  4EYU A;  2QBX A;  4HL0 A;  4LBN A;  3DPR C;  2XVL A;  4QT6 A;  3ZFE A;  3VBF A;  4RFR B;  1C1F A;  4ISR A;  1OVS A;  1QJU 2;  1WA6 X;  3AZX A;  4ITC A;  4JGZ A;  4K1Y A;  3JCI A;  4MXW B;  1GQH A;  1ZVF A;  2W1W A;  5JVV A;  4A45 A;  4BZ4 A;  2WSU A;  5IVJ A;  5EJZ B;  3B02 A;  4QX1 A;  1DLL A;  5GZD A;  2TEP A;  2ZGL A;  1F2N A;  3W58 A;  4W65 A;  5HXM A;  2DU1 A;  4CCO A;  4B29 A;  4RD7 A;  1W2O A;  2B7Y A;  2V73 A;  2OS2 A;  1RXG A;  1DCS A;  4R9B A;  1CX4 A;  3ZXA C;  1RVF 2;  3FHA A;  2UWA A;  1S0I A;  4OHV A;  1POV 3;  1UIJ A;  1VAK A;  4AQ2 A;  2Y6L A;  3UL2 A;  1WZX A;  3CJI B;  3RYR A;  2XLF A;  1AR8 2;  2JIC A;  4YZ4 A;  3T1L A;  4B4R A;  4X8P A;  1LNS A;  2VZO A;  5SV5 A;  2RMU 3;  3THT A;  3C3V A;  3WW4 A;  1SHW B;  4ZZ8 A;  1FNY A;  2AYH A;  1VBB 1;  2B5H A;  5GZF A;  3WF4 A;  5LWB A;  3HQR A;  2VTX A;  1CAX A;  2MEV 1;  2D6N A;  4I09 A;  1AXY A;  5CVR A;  3KMH A;  4XUO A;  1AR6 1;  1OF4 A;  3IB3 A;  5T50 A;  2CSG A;  3CLP A;  2P37 A;  5D1I A;  4X8N A;  4N90 A;  3JBG 1;  5DZE A;  1AL2 1;  2VBD A;  4IGO A;  4OVE A;  3H3U A;  1TZO A;  1MZE A;  1ULP A;  3AYC A;  1F8V A;  3RI8 A;  3NST A;  3WT3 A;  1J83 A;  3Q8E A;  5FLJ A;  2DFC A;  4PDW A;  5FMC A;  3ES4 A;  3GGL A;  4Q2F A;  5DDJ 3;  2RS1 3;  2XBO 2;  4AGG A;  2QKD A;  4YFZ A;  5CIR A;  2VY0 A;  1RMU 1;  3AC0 A;  1JYX A;  3URF A;  1LRH A;  2W92 A;  1XBF A;  2Z69 A;  5FTT C;  3TBD A;  4IGQ A;  1REE A;  3POY A;  4YW7 A;  3IPV B;  2RJL A;  4CCD A;  1CR7 A;  1IGO A;  4QGL A;  4EWD A;  4A6O A;  1G9D A;  2ADD A;  2QQK A;  3PDQ A;  3JB8 A;  4YM3 A;  1FMD 1;  3I2J A;  2AEN A;  4XF0 A;  4AGV A;  3AX4 A;  3OPZ A;  3RZH A;  4MGZ E;  3GBF A;  4GWI A;  3TEX A;  2BQP A;  1XPW A;  4IGP A;  3OCP A;  3HT1 A;  4FPC A;  3S5A A;  1VBA 1;  1AX0 A;  3H7Y A;  4OCT A;  5FZC A;  4XVH A;  3I3Q A;  4IV3 A;  3LIG A;  1W99 A;  4QHZ A;  4CU6 A;  4UW6 A;  4MG2 A;  5FZI A;  1AX1 A;  3JZV A;  1RUG 2;  2VOT A;  2GND A;  1ENR A;  1H4H A;  5GZC A;  1D2Q A;  1HQL A;  5IW0 A;  3NJV A;  5LBC A;  1S0E A;  4AFB A;  2VMF A;  3V0B B;  4CDU C;  4YG6 A;  3ZYG A;  2EIE A;  5CIS A;  3ZOI A;  1YHF A;  2LRO A;  1LOD A;  3RS6 A;  5C5T A;  1PX4 A;  4BQY A;  2ZGQ A;  1IS6 A;  3ST7 A;  1GV9 A;  3B69 A;  4MV2 A;  3B9I A;  3VZJ A;  1D4M 3;  1GWM A;  3WF3 A;  5J48 A;  2VTX J;  3D0S A;  3LEK A;  4XBN A;  5CYY A;  4HK8 A;  1KXG A;  5K0U A;  4C1W A;  4YLZ A;  4JDM A;  1SQ4 A;  4XQW A;  1W06 A;  2OT7 A;  4YW2 A;  1K5M C;  1W9S A;  3VL9 A;  5CFC A;  3VDC A;  1XC6 A;  5E8A A;  5FYV A;  2J1A A;  4MZU A;  4QU1 A;  1YNA A;  3ZSM A;  4OUS A;  1J3P A;  1J84 A;  2B39 A;  2H0B A;  4IV1 C;  5DZG A;  3W59 A;  4LMF A;  3ZSK A;  5BNP C;  3D82 A;  1YI9 A;  4BQW A;  2YC2 A;  4SLI A;  3VBO A;  3LOB A;  3PL0 A;  4GKX A;  3TN9 2;  3ZSJ A;  4CDU B;  4WZC A;  1QJY 1;  1TME 1;  2WS9 1;  1ZBA 2;  3WCR A;  1GR3 A;  3H3Z A;  1PVC 2;  2VUJ A;  1T6G C;  4CUC A;  1VAM A;  3RZJ A;  1FNZ A;  3J8F 3;  4QXC A;  1VMH A;  3BTA A;  1RUE 2;  4XAA A;  4XJU A;  5E1R A;  1RJ8 A;  2E6V A;  1LAJ A;  2GDF A;  5K4L A;  4RGK A;  4E4Z A;  1W39 A;  4Q26 A;  4DZG A;  2ILM A;  4Q4Y 2;  2JEM A;  4BQ3 A;  3SH4 A;  2YBS A;  1ASJ 3;  3ZXF A;  4WVZ A;  3VGI A;  1ZYB A;  1DGL A;  2D5F A;  2HYX A;  5HXV A;  3T0D A;  3AP5 A;  4IV1 B;  4LOT A;  1PHM A;  2W08 A;  5FY9 A;  4MGY E;  3L2H A;  4IET A;  1HKD A;  3TNQ A;  2D7F A;  5EJ3 A;  3NV3 A;  4AHY A;  1E5H A;  3AP9 A;  5DXD A;  1BEV 3;  1FV3 A;  4MGQ A;  5KXE A;  3MHZ A;  4CPB A;  1DZT A;  4G3Y C;  4RFT 0;  5IYY A;  3ZYB A;  1YQ5 A;  1W9T A;  4QPG C;  5FZO A;  2GAU A;  2ZPX A;  3H7J A;  4XF4 A;  4E9K A;  2VQ0 A;  4LBQ A;  1WLT A;  1OPO A;  3GAL A;  1R08 1;  5C5U A;  2B4K A;  3LA7 A;  5HV0 A;  2IC1 A;  3VD5 A;  2XHN A;  1H2K A;  5C4W B;  1ODN A;  1Q3E A;  2LTN A;  3AMN A;  3ILR A;  1DP0 A;  1V9U 1;  4Y22 A;  5IK4 A;  4A7Z A;  3BVC A;  1DGR N;  2C4X A;  3WP6 A;  3S6P A;  1SEF A;  5FBZ A;  4DIQ A;  1E5I A;  2HWF 2;  1WLD A;  4EQV A;  3MLK A;  5F3I A;  3KD4 A;  4X6R B;  5KBF A;  2IXI A;  1X33 A;  1OSG A;  1UOB A;  1M4W A;  2W91 A;  2RM2 3;  1QNW A;  4LUK A;  4RS5 C;  3TWI A;  1PM4 A;  1J1T A;  1CJP A;  4AFC A;  5C3R A;  5C9A B;  1XE7 A;  4NE9 A;  1QDO A;  4XEZ A;  4PBP A;  1OQ1 A;  4DMI A;  5A7Q A;  2WC2 A;  2WYF A;  4Q0V A;  4QPG B;  3WV6 A;  1ULE A;  3ZFE C;  3VBF C;  4NRP A;  1V6L A;  1X50 A;  4RGG A;  2IFR A;  4MVT A;  4JGZ C;  4KI5 M;  1RUH 1;  4GB3 1;  2OYZ A;  1S4C A;  3OY8 A;  3ZMO A;  1TMF 1;  1RHI 2;  2DV9 A;  1I3H A;  1Z78 A;  4TN7 A;  1OD5 A;  1AR9 3;  1UKR A;  1JW6 A;  3M70 A;  4PQQ A;  4Q8K A;  5KHK A;  1GFF 2;  4IQP A;  2UY8 A;  1DLC A;  4NVP A;  4A6S A;  2Q4S A;  2WAA A;  3FJS A;  4N53 C;  4UFM A;  5H9P A;  5BYN A;  3ZIW A;  4PF5 A;  2KXL A;  2OPW A;  2JXA A;  2VOV A;  1G86 A;  1V00 A;  2BWC A;  4NJ4 A;  5LEJ A;  4CU9 A;  2YXS A;  5D8A A;  3TOJ A;  2A73 B;  4DS0 A;  5J36 A;  1OOP A;  3I2G A;  1OXC A;  2FDH A;  1GP6 A;  3WDT A;  2VM9 A;  4XFI A;  3PTY A;  3WUD A;  2NPI A;  3AP7 A;  4Q4V 3;  3O1T A;  2BVV A;  1Z7S 1;  1VRH 2;  1WCD J;  1IPS A;  3A0N A;  4Q4W 1;  4CCJ A;  3AXD A;  1UXZ A;  3JQW A;  1GIC A;  2GN3 A;  4JKL A;  5FY7 A;  1RUC 2;  1ZBE 1;  4YRD A;  3VBF B;  3ZFE B;  2WA3 A;  3N9L A;  4JGZ B;  3ZXJ A;  4NO4 A;  1GQP A;  3ZSE A;  1V6K A;  1W9Y A;  3RDI A;  4AYU A;  1X7N A;  5FP8 A;  4LTA A;  1VLN A;  2QFE A;  2VAU A;  1X8E A;  2HWD 1;  4KU7 A;  2R06 2;  2ZEZ A;  3CDZ B;  1WBL A;  5C3O A;  5KXC A;  2XJS A;  2AUY A;  2IXK A;  3K4A A;  3WOG A;  4FQZ A;  3SEP A;  4MH0 E;  4RQP A;  4YGC A;  1F35 A;  1KGY A;  1REF A;  1V6M A;  4B1L A;  1VBC 3;  4L8Q A;  5LCW L;  1JHN A;  2DF7 A;  1QF3 A;  5EJ1 B;  1H2L A;  2P6H A;  1XU1 A;  4PDW C;  4E4H A;  1I6X A;  1QDC A;  3ZX7 A;  4AAP A;  2ZGS A;  3JD7 2;  5DAV A;  3K2O A;  4LPL A;  2ZZQ A;  2B45 X;  3OYW A;  5T54 A;  5ABJ A;  3O1M A;  3SIS A;  1FPN 3;  1DFQ A;  2MNG A;  2WNV A;  3AXE A;  3OOX A;  3NAP A;  3U4S A;  5FJK A;  4BJ0 A;  2LUW A;  3S7I A;  1NY7 2;  2QNK A;  5JOX A;  2PAK A;  1R1A 1;  3W5M A;  4BE3 A;  1SBF A;  3BCW A;  3VDD B;  4Z07 A;  1RUO A;  1NE4 A;  3BPZ A;  1CAX B;  4EE2 A;  1ZA7 A;  1HRV 3;  3Q8F A;  3ZSL A;  3SCF A;  5A80 A;  1RUD 3;  5C71 A;  1OLM E;  1SMV A;  4CUA A;  4CSW A;  3IWZ A;  4ONU A;  4DXZ A;  2AEY A;  1V70 A;  2EAA A;  4D7T A;  4QX0 A;  1VAV A;  4P9Y A;  3WNN A;  3ZPY A;  1WME A;  2RR1 2;  4J25 A;  3C2U A;  3LSD A;  3U75 A;  2D98 A;  5A3L A;  3TEY A;  1XSQ A;  2AGS A;  4PDW B;  1NCQ A;  4IV3 C;  1QJU 1;  1VBB 2;  2X10 A;  3DL3 A;  4K8R B;  4R9D A;  5CAD A;  2FDF A;  1AF9 A;  4JQR A;  4ZON A;  1HV1 A;  1L3J A;  3VD3 A;  4FPG A;  2C9A A;  5EYY A;  3T0B A;  4COZ A;  1BKZ A;  2ZHN A;  4F83 A;  1DGW A;  5A70 A;  1AR6 2;  1EV1 2;  1GAN A;  4O9E A;  3S7E A;  4RA0 A;  1OF3 A;  3M3Q A;  1S0F A;  4K20 A;  1N1Y A;  4YGE A;  5JUV A;  4BQ1 A;  5DQ0 A;  1JYI A;  2Y6H A;  1W8U A;  2GNM A;  5FYU A;  5ANN A;  1FAY A;  2YHJ A;  2AR6 A;  3PUH A;  5K0U C;  1W90 A;  2OZJ A;  2ZX4 A;  4QB2 A;  1AR8 1;  5FXV A;  1CGP A;  2YY1 A;  1SCR A;  3ETQ A;  3FBY A;  3ZLI A;  1YO8 A;  5FZH A;  3HN3 A;  2R07 3;  4CP0 A;  1O3T A;  5CFC C;  2Y38 A;  1DQ2 A;  4YW4 A;  2Q8E A;  4IV3 B;  2BW8 A;  1OI6 A;  3UES A;  2JDN A;  3K51 A;  1MS0 A;  1RYY A;  1DQ1 A;  1LEN A;  4EN9 B;  4NHY A;  4AFM A;  4BA6 A;  3PVN A;  1OFS A;  1J3Q A;  2VZ3 A;  2WN2 A;  4AQT A;  4D3W A;  1RC6 A;  3GM8 A;  2CDO A;  3N9M A;  3VBH B;  2YBP A;  3THP A;  3VBO C;  2WT1 A;  3RYP A;  1W0N A;  4JVA A;  4YZ2 A;  3S0M A;  3ACG A;  1VBE 3;  2OA2 A;  5DAW A;  3KV9 A;  4AI8 A;  2A1X A;  3N9N A;  4I3G A;  3FL7 A;  5K7P A;  3DPR A;  1W2A X;  3KS7 A;  2G1M A;  4TLG A;  3SKJ E;  1VBA 2;  2PAE A;  5F32 A;  3WIN E;  5JPM B;  2XKP A;  2XBO 1;  3MZH A;  3C7G A;  5K0U B;  3E5Q A;  4AAX A;  2VVE A;  1RUN A;  3T4V A;  3LOI A;  2JG8 A;  1MVQ A;  3MBW A;  4CTE A;  3HN1 A;  4XZU G;  4WVV A;  1R64 A;  4DEQ A;  1NLQ A;  2CYF A;  3UET A;  4QM9 A;  2E33 A;  3VZK A;  4COY A;  2TBV A;  2HWB 3;  5GZE A;  3T4H B;  3MF6 A;  1S0J A;  2ARB A;  3FC0 A;  1W6O A;  5E88 A;  5FYI A;  4UFJ A;  2JIJ A;  3O1S A;  4QPI A;  1SLL A;  3E5X A;  4CCM A;  4CPB D;  3K48 A;  4F3J A;  2YUE A;  3ZVX A;  5GM0 A;  4U2A A;  4HKW A;  2R0F A;  1QH6 A;  1X82 A;  4LBQ D;  3KQ4 B;  1YFW A;  1MPX A;  3CHX A;  5L7O B;  4GMP 1;  3O7O A;  2VU9 A;  2CNA A;  5FFO C;  1WUV A;  2W39 A;  2G9Z A;  5A32 A;  3T08 A;  2OII A;  4DUV A;  3DUI A;  4F8A A;  1QY4 A;  2Z42 A;  4M3C F;  2JB8 A;  2D6O X;  4A3Z A;  1RUG 1;  3CMG A;  1CPN A;  1QKQ A;  2WJS A;  1WCS A;  5A6Y A;  1O3R A;  5BPX A;  2PTM A;  4FOW A;  2WL1 A;  2V4V A;  3DYM A;  4UFH A;  3WX5 A;  1W6M A;  5FO9 B;  1S55 A;  4W6W A;  2WUH A;  4ZHN A;  1UZW A;  1LUL A;  1VPH A;  3LDB A;  1TME 2;  3VBR B;  2WS9 2;  1GP5 A;  2WZE A;  4HOO A;  5IVE A;  3AMM A;  3NMB A;  4BME A;  3NJX A;  5A3W A;  2QCS B;  4I0B A;  4L92 A;  2KR2 A;  2RV9 A;  2Q5T A;  3O1P A;  1DQ6 A;  1EYB A;  2X29 A;  4BDV B;  1RUJ 3;  4QX5 A;  1SFN A;  5FYT A;  1JUI A;  3OBT A;  1O4T A;  3VBS A;  3ZYP A;  2OKX A;  3U11 A;  5FY4 A;  3ZYR A;  5FZO B;  2GZW A;  3LGR A;  5IVV A;  1WKY A;  3F2Z A;  5C3S A;  4FSJ A;  4LBQ B;  2SBA A;  4JDO A;  3K3O A;  1OQE A;  2BNN A;  2WFF 1;  4XFG A;  4Y4R A;  2W1S A;  4Y22 B;  2Q8O A;  2BOJ A;  4OHX A;  3KCC A;  5ACA 2;  4KWJ A;  3D3A A;  5LW9 A;  4AI3 A;  1RUF 3;  3TN9 1;  4BH9 A;  1COV 1;  3M3C A;  4X6Q B;  5FZ0 A;  4QMA A;  5JXJ A;  3OPW A;  2VZQ A;  2RJK A;  3N4M A;  5F8P A;  1PVC 1;  3ILN A;  4DXT A;  5AVP A;  1RUE 1;  1RUI 1;  2YC4 A;  5T5O A;  2JE7 A;  2ZJC A;  5FXZ A;  4YZ5 A;  5D8A C;  2CGN A;  3PTR B;  3VN4 A;  1IPK A;  3ZKU A;  1R08 2;  2DCY A;  2WZ8 A;  1N3P A;  1OOP C;  3VL8 A;  4Q4Y 1;  4Z1V A;  2VCM A;  2ZHK A;  4XHB A;  4MGT A;  5KHH A;  1NT0 A;  4Q27 A;  1AYN 2;  1V9U 2;  4L9B A;  4COU A;  3AP6 A;  4FAG A;  4YW5 A;  2FCV A;  3MDP A;  3AZZ A;  4HLT A;  1UKG A;  1QIQ A;  2IXL A;  1POV 0;  3POS A;  4P14 A;  3VHN A;  4G9S B;  2WLQ A;  4H2A A;  2FQP A;  1ALY A;  3OY8 B;  2LS6 A;  3NV2 A;  1AYM 2;  1UZ0 A;  1YI7 A;  3GXU A;  4NHX A;  3KT4 A;  2E53 A;  4ASL A;  1Z0H A;  4JGY B;  4AFD A;  3W21 A;  3WG1 A;  1OFN A;  2DVF A;  4HKL A;  1RL3 A;  1UY4 A;  1F31 A;  4HN1 A;  4P9W A;  3TYJ A;  3WXP A;  3ETP A;  4L99 A;  2DU0 A;  5KR7 A;  4Q5O A;  1PIV 3;  1CD3 G;  4ZS2 A;  4COW A;  5KXD A;  4BXS V;  3MGU A;  1AXK A;  2G19 A;  4QKN A;  1V6N A;  3P6B A;  3NKG A;  1FI2 A;  3GJB A;  3ZYJ B;  5FZM A;  1W6P A;  2ZAA A;  1B35 C;  1UF2 C;  1LED A;  1QQP 2;  3AB0 A;  1NAE A;  5D8A B;  5KC5 A;  1RUH 2;  2VQT A;  4HKO A;  3WW3 A;  4EZ4 A;  2XWB B;  1O59 A;  3HPN A;  5FY1 A;  3OUI A;  5JMC A;  1WW5 A;  4QDQ A;  3RZZ A;  2V4A A;  3HQU A;  4TYS A;  4ARX A;  3RZL A;  3T2P A;  1K42 A;  2WNV C;  1BXH A;  2ES3 A;  2CWS A;  1YJK A;  3NAP C;  4HAN A;  2IFW A;  1FOD 2;  1UAI A;  3AL5 A;  4DXS A;  3PVE A;  2VG9 A;  3UGF A;  4FBF A;  3M3E A;  2BYV E;  2JDZ A;  4ISQ A;  1HB3 A;  4BQX A;  5A3M A;  1CQ9 A;  4A42 A;  3TEW A;  2RDN A;  4LQR A;  4M0H A;  2MEV 3;  1CAV A;  1PVX A;  3BYW A;  1UOJ A;  1S0C A;  2RDS A;  5GLT A;  2J1S A;  5FZF A;  2D93 A;  1ULD A;  5JZG C;  1MVE A;  3ES1 A;  4RQP B;  1N1S A;  2OQ6 A;  3JBG 3;  4IW3 A;  1JXN A;  3RYK A;  4AVT A;  1AL2 3;  1JYT A;  4UW5 A;  2VZT A;  1YWK A;  4C0H A;  1RXF A;  4BK5 A;  2HWC 1;  1NCQ C;  2W3J A;  2BDR A;  3GZT B;  2XUE A;  3HNB M;  1HX6 A;  5IVC A;  4RGA A;  4YM2 A;  3WP3 A;  4FCA A;  4FOV A;  4LOS A;  3VB9 A;  5JXH A;  5ABJ B;  3OYW B;  4EN8 B;  3MV1 1;  2WNV B;  2QE3 A;  3QAC A;  4C0B A;  1XQN A;  2V5D A;  3NAP B;  4AHX A;  1RMU 3;  3M2M A;  5I0U A;  4JC1 A;  4LJH A;  1PGS A;  3WG2 A;  4CP9 A;  1CVN A;  4YW3 A;  1JU4 A;  4LE3 A;  4MET A;  2JDK A;  2D6K A;  3AM2 A;  2XDV A;  3OBZ A;  4H3W A;  5FMO L;  3UKT A;  4DUX A;  5I91 A;  5EV7 A;  4OMD A;  2QQU A;  2FBE A;  3AVR A;  1FMD 3;  1DQ5 A;  4NAM A;  1I5P A;  4LBO A;  3A22 A;  5FMB A;  5FZ6 A;  3J7H A;  1WCU A;  4QAW A;  5IK5 A;  5IJR A;  3MIC A;  2BZD A;  4EN7 B;  1UU5 A;  1IG3 A;  3OGV A;  4XMI A;  1VRH 1;  1ULC A;  2JD9 A;  2P17 A;  1DIW A;  1S0B A;  3M7A A;  5JOZ A;  4Q0Q A;  1RUC 1;  2HLE A;  4XFC A;  1IQD C;  4XYX A;  1NCQ B;  1W8T A;  4LR4 A;  4CCC A;  4QXH A;  5EQU A;  4AEM A;  1R1A 2;  5FZG A;  2BPA 2;  3GHN A;  2WWS A;  3ZR6 A;  2R7E B;  3J4U H;  4QDR A;  1W2N A;  4RYD A;  1FV2 A;  2VOW A;  3SCG A;  1UIK A;  2VOK A;  1KDM A;  1VRB A;  3ME2 A;  2YGM A;  3ZYF A;  1O5U A;  2NMO A;  1GNH A;  4E27 A;  5BNO A;  5DAP A;  4RHV 2;  3BU0 A;  1G8W A;  3EHK A;  2DVA A;  2JEN A;  3GDB A;  3FFQ A;  2ARE A;  4XDP A;  3AZW A;  3T2T A;  2BBA A;  2PHF A;  4KGG A;  4QQH A;  1LOB A;  4I0A A;  3ZFG C;  2GC0 A;  2ZAC A;  1XNT A;  1Q8S A;  1OMI A;  4Y1U A;  1R09 3;  3JD7 1;  1ND3 B;  3VZO A;  2JG9 C;  3WDU A;  5C3Q A;  2FZ2 A;  1MEC 2;  1BBT 2;  2D3S A;  1L7Q A;  1POQ A;  1Q56 A;  5CA6 A;  3I3B A;  4Y4Y A;  3H1M A;  2JG8 C;  1NY7 1;  4P02 B;  1PM7 A;  1MR5 A;  1OH3 A;  4U36 A;  2G4I A;  4XJA A;  3FX3 A;  4COV A;  3RZM A;  2J1E A;  3OGJ A;  2A7A A;  4N53 A;  3T3Y A;  2W46 A;  3M3O A;  5EHD A;  5AC9 2;  3TB0 A;  4XQD A;  4XQ4 A;  2C0Z A;  4PI0 A;  1IZ3 A;  3LIH A;  1YUD A;  4QPI C;  4A41 A;  3WVJ A;  4W6X A;  3EJK A;  1U5Z A;  1LU1 A;  5CKQ A;  2GMP A;  4CU8 A;  1JYW A;  1D0G A;  1H9P A;  1KS4 A;  2JX9 A;  2RR1 1;  3B7M A;  3RJ2 X;  4CVU A;  3HOB A;  3A0K A;  5CBL A;  1HN1 A;  2DTW A;  3BOD A;  3DPR B;  3L9J T;  3OGR A;  4XJW A;  3ZFG B;  4C1X A;  1UY2 A;  1QJY 3;  4D7Y A;  1LU2 A;  5IK7 A;  1ZZB A;  3HNY M;  3M4F A;  3WNL A;  5T5P A;  4CRQ A;  2ZGM A;  4Z82 A;  1NKG A;  5IAV A;  2NLR A;  2UWB A;  2O8Q A;  2W9X A;  1U5I A;  2E31 A;  3I97 A;  4SBV A;  1NXD 1;  2JG8 B;  1W05 A;  1EV1 1;  4LKD A;  1TG7 A;  4MAD A;  4UFI A;  3DEC A;  4CA9 A;  4R9C A;  1EAH 1;  3WNK A;  3U78 A;  5DUW A;  5IFP A;  1QOS A;  2D97 A;  3WQ1 A;  2X8K A;  4UW3 A;  2VW1 A;  5GZG A;  2GMM A;  4K40 A;  3EBR A;  4FFG A;  5LBE A;  1O4Y A;  1W6O B;  5CAZ A;  1HQW A;  1H2N A;  1NQD A;  4QPI B;  2BEO A;  4EJR A;  4YAR A;  5HPO A;  2CAU A;  2VZS A;  2VPV A;  1H0B A;  3N9O A;  4JHT A;  2ZXQ A;  3BAL A;  2PHD A;  3FUO A;  2VZV A;  1ZA4 A;  3G7D A;  4R4X A;  5FKC A;  4H14 A;  1QGL A;  2JEC A;  1DZR A;  2E63 A;  1PGW 1;  2CAV A;  3POW A;  3VBS C;  4B1M A;  3MF9 A;  1GBG A;  2ZEX A;  3KGZ A;  5A32 B;  3C7F A;  4EWA A;  5FQ0 A;  5A3O A;  1W28 A;  2VBB A;  2DVG A;  3HJR A;  2WBK A;  2A6Y A;  3RG0 A;  5FXX A;  4CEW A;  3U37 A;  3O1R A;  1U5Y A;  1CZV A;  1W6M B;  3NNF A;  5GLZ A;  3UJO A;  4AED C;  3BU7 A;  3VD9 A;  3A4U A;  3GCX A;  4FFI A;  3KF5 A;  3LDR A;  3MIE A;  4IE4 A;  4UYB A;  4CEY C;  3I3M A;  2VNR A;  4P9J A;  4RN5 A;  5FDB A;  2VGD A;  1LES A;  5DG2 A;  5L73 A;  3I3E A;  3ROU A;  3VLB B;  3ZXK A;  3ACI A;  1D0H A;  1UMZ A;  2W87 A;  2BGO A;  2VCC A;  2QQN A;  3R0R A;  1QOT A;  3SMH A;  2VR4 A;  1BZW A;  1O3Q A;  2BNM A;  1CPM A;  1US2 A;  4Q0U A;  5FO8 B;  2O8O A;  2BFU S;  3VBS B;  4M4P A;  1WWY A;  1LEC A;  1XYN A;  4W8J A;  1OHF A;  3CNA A;  5KHJ A;  1HXS 3;  2FMY A;  3WNO A;  2GNT A;  1DG6 A;  3HAG A;  5CFD A;  2PLV 2;  4HFS A;  1UOG A;  2RG4 A;  3PIJ A;  3BUC A;  3L2Y A;  4J1W A;  5GAL A;  4LOR A;  1GU3 A;  1W8F A;  1NA1 A;  1VP6 A;  3GZE A;  3NNJ A;  3WG4 A;  5LA0 A;  1VBD 3;  4GB3 3;  5JOW A;  2VXJ A;  2VMG A;  1ZM1 A;  5T5L A;  3VKO A;  4FAH A;  4HON A;  1C3H A;  1TMF 3;  3D6E A;  2VMH A;  4KWL A;  4XFB A;  1LKN A;  2Y60 A;  3DGT A;  1AR7 2;  4L97 A;  4LIV A;  4S2D A;  1XE8 A;  3KF3 A;  4IER A;  4FI9 A;  3ON7 A;  3WSO A;  1GYK A;  5FYB A;  1KIT A;  2ETE A;  4P5H A;  4XCA A;  1U5X A;  2H6C A;  4FPJ A;  2VZU A;  2I74 A;  1TNF A;  4NIH A;  1JZ6 A;  1KDK A;  4PBO A;  1EPZ A;  3QLQ A;  5IK8 A;  2WFF 2;  5JSP A;  4LK6 A;  2ORX A;  4BIO A;  4N7U A;  3DKQ A;  4KWK A;  5FY0 A;  1CZS A;  3OPT A;  2EIG A;  2JIG A;  3LWC A;  1UX6 A;  1COV 2;  3K4Z A;  2YU1 A;  4XUQ A;  1Z7S 3;  3E6B A;  3IIA A;  1BQP A;  4Q4W 3;  3MFA A;  4Z2W A;  2JDU A;  2PHX A;  2XJT A;  3IDA A;  3OEB A;  1ZBE 3;  1LR5 A;  4FPF A;  2P3J A;  3JQX A;  4HZF A;  2JDM A;  3OF1 A;  4UFL A;  1RUI 2;  4Y20 A;  1LEM A;  2X09 A;  3WQB A;  3TEZ A;  1JZ2 A;  2ARA A;  2XOM A;  3AMP A;  2WQZ C;  2HWD 3;  4KL1 A;  2RS5 3;  3O0X A;  1H4G A;  2PQQ A;  3F95 A;  1H9W A;  1K5M B;  2QQO A;  2Y33 A;  5TSW A;  4CDW C;  4D69 A;  2D6P A;  2O1Q A;  1U12 A;  2QQL A;  4KWU A;  1PK6 A;  5H9R A;  1Y7B A;  3T30 A;  3A7Q A;  1W6P B;  1Y43 B;  4XTM A;  5EFU A;  4YG0 A;  5DPN A;  4UT5 A;  4XET A;  1MS5 A;  4Z2A A;  1OUS A;  5BNP B;  1IKQ A;  4LO8 A;  1CON A;  1W3V A;  4AHZ A;  3QCW A;  4GWN A;  3J7L A;  3WQ7 A;  3ACF A;  4LO4 B;  3OD0 A;  1N3O A;  4BK4 A;  5ACA 1;  2ZKL A;  3ZN6 A;  1BK1 A;  3HBK A;  3CEW A;  4P9X A;  2GU9 A;  3WW2 A;  5KXB A;  1YLL A;  2DCK A;  2VVF A;  3GYD A;  3RWN A;  5LK5 A;  2AEZ A;  4Q8L A;  5C8C A;  3QD6 A;  2Y0I A;  4OI1 A;  3H0O A;  3AFG A;  4JTO A;  5ERL A;  1JOP A;  2WR9 A;  4K3U A;  4TZD A;  4R4Z A;  2XHK A;  1XXN A;  2B46 X;  1PO2 3;  2E26 A;  1CAV B;  4P9G A;  2RS1 1;  5DUU A;  3CBN A;  4LO6 B;  5FP9 A;  1A34 A;  4IE6 A;  4AFA A;  1AYN 1;  1NUK A;  4IE5 A;  1LB2 A;  1XYO A;  4ASM B;  3CO2 A;  3R4D B;  1GZC A;  4AOC A;  3U0Z A;  1TEI A;  1NQJ A;  1NLS A;  4XPV A;  2O14 A;  3KWV A;  1XND A;  1UXX X;  1ZZ7 A;  2YGL A;  3KV5 A;  3NRU A;  3PVO A;  5EYX A;  2DCT A;  3I49 A;  1AYM 1;  2OPK A;  2PN5 A;  1QJU 3;  3VHP A;  1KQR A;  1WW6 A;  2A3Y A;  5FK8 A;  1Y9G A;  3VD4 A;  4LIT A;  2VD7 A;  1X9P A;  5BNO C;  4A2U A;  4YVW A;  4N9I A;  1ENQ A;  1ZZ8 A;  4CP9 B;  2VNV A;  1SPP A;  1LGC A;  2XR4 A;  5FY8 A;  1RIN A;  1XE0 A;  5F3G A;  4S2G A;  5C70 A;  1JYV A;  3I4I A;  2K2S A;  4GUL A;  4XBQ A;  5FYH A;  5HCH A;  2LAL A;  5DUX A;  3Q8C A;  4JV4 A;  4UOJ A;  3ORJ A;  2WO1 A;  1QQP 1;  2HWC 2;  1RVF 3;  2VMI A;  4PHZ A;  2VEC A;  1W04 A;  5L19 A;  2WO7 A;  4CZS A;  3RNS A;  2OVU A;  1BYH A;  3PUR A;  1C8M 2;  3FHQ A;  3MLL A;  1PO1 2;  2JDY A;  1R1Z A;  4UBH A;  5FPU A;  2AH2 A;  2X05 A;  1Y9M A;  5L9B A;  1AR8 3;  1FOD 1;  1VAL A;  5FO7 B;  3ZIX A;  1WW7 A;  1GMM A;  3LEM A;  4L2N A;  5CB7 A;  4BMB A;  2G9F A;  2IXH A;  1N1V A;  4M00 A;  3W9A A;  3GZA A;  1OVP A;  1XSR A;  3WDX A;  2KM2 A;  4IDZ A;  3B5L B;  4RS5 B;  5LK7 B;  1RGS A;  5BNO B;  2ZHL A;  3BI3 A;  4MUV A;  2YFU A;  4JRL A;  4LHN A;  3ZFF C;  1IKP A;  4QX7 A;  1WMD A;  2VH9 A;  1UZZ A;  2VW2 A;  1DQ0 A;  4CCE A;  2H6B A;  1RED A;  1YQ6 A;  1OD3 A;  4IES A;  4XDQ A;  2W94 A;  4D8M A;  3EXU A;  1W8O A;  5C3P A;  2P1B A;  1KD7 A;  3R6S A;  1ND2 A;  4D94 A;  1A8D A;  1OPM A;  3IDB B;  3BTX A;  5LY1 A;  5FZ8 A;  2RS3 2;  4WM7 A;  1WGP A;  2XBO 3;  2ZGU A;  5F3E A;  1X36 A;  2DVD A;  3N7K A;  1QNY A;  1HRI 2;  2JE9 A;  5J96 B;  3ACL A;  1TNR A;  1Y3T A;  4NUB A;  2YU2 A;  2D6M A;  1N1T A;  2XQX A;  4N53 B;  4NHK A;  1NCR A;  3SKV A;  4FOQ A;  1H8T A;  1MZ5 A;  4QKB A;  3MIF A;  3SQO A;  4OQ9 A;  4QGM A;  4AI1 A;  3BTY A;  3RZK A;  1PX3 A;  2EA7 A;  3ZYH A;  2WQ4 A;  4FT8 A;  4PLO A;  2A71 A;  3SCH A;  4AI0 A;  1B35 A;  4ZY9 A;  1H1M A;  3NVC A;  3T2Q A;  4TTG A;  2ZGO A;  3J8F 1;  1JZ3 A;  1OC1 A;  2XGX A;  3MI8 A;  3O1V A;  5F39 A;  1J1L A;  1UMH A;  2VUL A;  1W8H A;  4PT6 A;  1MAC A;  5GLV A;  1T6B X;  4QHO A;  3VHO A;  4R8H A;  1CAU A;  3N7M A;  5FZ9 A;  5HCA A;  4QPY A;  5A7S A;  2A6W A;  2XJV A;  5EWS A;  3KHC A;  3ZN5 A;  4NPR A;  3QH7 A;  1VB2 A;  2QZ2 A;  1PNG A;  4QQP A;  4Y24 A;  3RQ0 A;  2BU9 A;  4A7K A;  5L36 A;  1WLC A;  1UZV A;  4CEW C;  2ZBJ A;  1YYN A;  4XXA A;  2WT0 A;  4EWE A;  2FCU A;  3UYJ A;  1RUG 3;  4RHV 1;  1PZ9 A;  5JZG A;  2RDQ A;  3MUZ 1;  2GNB A;  4MSV A;  5FUN A;  5DN2 A;  5BV6 A;  3I2F A;  4A4A A;  1JZ5 A;  4AVV A;  2ZGN A;  3DN7 A;  4M3C A;  4Q4X 2;  4XC9 A;  2YPJ A;  2Q8C A;  2XVG A;  2B42 B;  2F17 A;  4KBZ A;  4BWO A;  5FWJ A;  3Q8B A;  4UAP A;  5IUQ A;  4NRQ A;  4ZZ5 A;  5FXW A;  4FXK B;  4GXL A;  4UF0 A;  5LA9 A;  4YPJ A;  4UBG A;  1MEC 1;  3HIF A;  4S2H A;  1BBT 1;  5FV3 A;  3O0V A;  3POG A;  3U14 A;  5A6Z A;  4HVR A;  1HQN A;  1UCX A;  2DBN A;  1OT5 A;  1WMX A;  2C6S A;  2ZGP A;  5B4X A;  1EAH 2;  5FQ0 B;  1QJX 2;  1SDD B;  2G9G A;  3ZXL A;  3OBA A;  4BQ2 A;  5AC9 1;  5CFD C;  4UW4 A;  5A7N A;  5LEK A;  1F15 A;  1XJA A;  1JTZ X;  2WDB A;  1ACC A;  1L7L A;  3ILF A;  3LCP A;  5GJ6 A;  4OI2 A;  4BYY A;  4D6Q A;  1W3X A;  3NV1 A;  4UXA A;  5GKA C;  4NPM A;  1GOG A;  1NA1 C;  1SDW A;  4CEW B;  5JSO A;  2RVA A;  4MLO A;  2VCA A;  1UWW A;  2W0X A;  1XNC A;  2HWE 2;  4JZR A;  1NG0 A;  2K0G A;  4QWN A;  3P1I A;  1W6Q A;  3EO6 A;  5FRA A;  1UYZ A;  5FOJ B;  1EP0 A;  1WCK A;  2Q0A A;  4TSV A;  1S0D A;  4PIY A;  5C8W A;  3H8U A;  3TN9 3;  1PGW 2;  3WF1 A;  2WZR 1;  5T52 A;  1UYX A;  4QX3 A;  5CG9 A;  3BB6 A;  3NKT A;  1ZBA 3;  2VMD A;  2VZR A;  4WVM A;  4BB3 A;  4QU2 A;  1PVC 3;  2VXR A;  5JSR A;  1RUE 3;  5JI7 A;  5F1R A;  2D5H A;  1RUI 3;  2XKO A;  1G6N A;  2KD7 A;  2Y0O A;  3IN9 A;  4HBN A;  4Y26 A;  3AKS A;  4WM8 A;  3IT8 A;  1ZRI A;  3I8T A;  3KV6 A;  4XAC A;  5H9S A;  2DCJ A;  4MXW A;  4Q1R A;  1CZT A;  4FPO B;  4Q4Y 3;  2Z5W A;  1AHS A;  1AR9 1;  4J1X A;  3O1U A;  2WFP A;  3USU A;  5CFD B;  1WBF A;  4FO9 A;  3KZ4 C;  4XOG A;  4PI2 A;  4D6S A;  3OEA A;  3SIT A;  2DTY A;  1NA1 B;  2V09 A;  2XH6 A;  1TVG A;  1CES A;  2TUN A;  3NWK A;  2ZMN A;  2JG9 A;  2QUO A;  1N47 A;  3J7M A;  1CAW A;  4ZKT B;  3CJX A;  3LSE A;  5FZ4 A;  4BPZ A;  2WNO A;  1IS4 A;  4W4Z A;  1W2U A;  3SLI A;  5B2G B;  1YIP A;  4LBJ A;  5CFC B;  5F7U A;  5I0S A;  3BIE A;  3ZMN A;  4CXW A;  3QBQ A;  4Q4V 1;  1PK6 C;  1JI6 A;  2R49 A;  5F37 A;  3N3H A;  5JR2 A;  2F4L A;  2X53 S;  3KLS A;  3III A;  4AZZ A;  4M0N A;  2Y34 A;  3VBO B;  1DBN A;  4OHW A;  2IXJ A;  3ACH A;  2ZGR A;  4AW7 A;  2EAK A;  2B9U A;  4V2W A;  3ZYI B;  1H6Y A;  2VBP A;  1H8V A;  2EIC A;  5C8C C;  1LJ7 A;  5M0T A;  4BIS A;  4URT A;  2QQM A;  4E4S A;  1AXZ A;  3POJ A;  5ISL A;  1AL0 G;  2V5Y A;  2HWF 3;  1JZ4 A;  4TLF A;  3GNE A;  4Y20 B;  2VZP A;  4RR3 C;  2J22 A;  4LEJ A;  3V56 A;  2NQY A;  3CIH A;  4DEV A;  5F6K A;  1GZW A;  2EXJ A;  2GSY A;  3OUH A;  1AUY A;  1DYP A;  2OUH A;  2VOX A;  2A75 A;  4PJY A;  2CU5 A;  3CKH A;  2GP5 A;  4AXO A;  3UNP A;  1DDL A;  1PK6 B;  2ZMK A;  4LO7 A;  1H30 A;  1HW5 A;  2PLV 1;  1SLA A;  3LEI A;  3PHM A;  4LKS A;  3WF0 A;  4ARY A;  2E7T A;  5FR3 A;  4IEV A;  2HH9 A;  4O61 A;  4ORF A;  3RWK X;  5FPX A;  4B7K A;  1MS1 A;  1OBN A;  2FCT A;  3S30 A;  1HRV 1;  4BM8 A;  1AJO A;  1VJ2 A;  4OUL A;  2XUM A;  5FP4 A;  3I3D A;  1RUD 1;  2WN3 A;  1OH4 A;  1RHI 3;  1YCI A;  1NLR A;  4QB1 A;  4MX3 A;  4XTP A;  4Y33 A;  3MW4 A;  3LZZ A;  4XJZ A;  4YVW C;  2F6B A;  5C8C B;  2ZGT A;  1AR7 1;  1STM A;  3EMR A;  4ET7 A;  1NXM A;  2ZGK A;  3WD5 A;  4FOY A;  2HEW F;  4IEY A;  4XIK A;  4P9L A;  2IXC A;  2FDG A;  4KGQ A;  1FX5 A;  4DRV A;  2GC3 A;  4LUL A;  1SAC A;  3IMM A;  4K6B A;  4LKF A;  4HSL A;  5IVB A;  1C8N A;  2HKX A;  4AL9 A;  1NOV A;  4XIO A;  4L11 A;  3WHT A;  3HWJ A;  4H7M A;  1QJZ A;  3N7L A;  4AED A;  4YSF A;  2V72 A;  2WKK A;  5FPV A;  2PEL A;  3RI9 A;  1JZ7 A;  2HBT A;  4ES8 A;  1VRH 3;  2VUC A;  4CEY A;  2BER A;  1EPW A;  5F5C A;  1RUC 3;  4W50 A;  3UGG A;  3FLR A;  4LLO A;  2C5D A;  3EQE A;  3VBU A;  1KEX A;  1UOF A;  1A8M A;  3PNA A;  2OXB A;  4KU8 A;  1MQT A;  1SCS A;  4AGR A;  4C91 A;  3CZJ A;  2OUJ A;  5DDJ 2;  1UY0 A;  2J1V A;  2R06 3;  2RS1 2;  4Y1Z A;  3UKN A;  5BNN A;  5JXI A;  1ZRF A;  4JDN A;  4Q29 A;  1SPP B;  4FTS A;  1LTE A;  4JKM A;  4I3P A;  4YW1 A;  1D4V B;  3SH3 A;  1OUR A;  2ZOE B;  1Q8V A;  3O12 A;  1AX2 A;  2YB7 A;  3IAQ A;  1ND2 C;  2BOI A;  3KM5 A;  1UN1 A;  4KBB A;  1Q8P A;  3FN9 A;  3LDK A;  3THC A;  4CCL A;  3UKV A;  2DCZ A;  1JS9 A;  2NMN A;  1S2B A;  2J1U A;  2JB4 A;  3B93 A;  3IM0 A;  3JD7 3;  3PUI A;  4WM7 C;  4OHZ A;  1UW8 A;  1K12 A;  3H8R A;  3AMQ A;  2XB6 C;  4N43 A;  1NCR C;  1H8T C;  1W03 A;  3MEP A;  2I45 A;  1GWK A;  3E1F 1;  4YFW A;  3VZL A;  2DFB A;  1W9W A;  3OUJ A;  4C8D A;  3K77 A;  4NR1 A;  2ET1 A;  1K45 A;  2GP3 A;  4LIU A;  4CDX C;  1JZ8 A;  1OOP B;  1JYN A;  1MZ6 A;  5JXG A;  4ZU5 A;  3M8L A;  2GME A;  3PU8 A;  5FIX A;  2C1F A;  4ZXE A;  4AG4 A;  3IMN A;  4JAA A;  4YVS A;  4NAO A;  2RR1 3;  4MO3 M;  2ZS6 B;  5LZ6 A;  2GC1 A;  1W8Z A;  1ND2 B;  2D3R A;  3A23 A;  3BIW E;  1VBB 3;  2L9L A;  5LAS A;  1YFU A;  2HWB 1;  4QKD A;  4DB5 A;  1OLQ A;  4XF9 A;  1Q8Q A;  3EYP A;  2A6Z A;  3H1Y A;  5LA2 A;  1L7R A;  3KQR A;  5EXO A;  1LHU A;  1AR6 3;  4WVW A;  1LGN A;  1OKO A;  2DVB A;  3KB5 A;  1NCR B;  1EV1 3;  1YFX A;  1D4M 2;  1H8T B;  1OA4 A;  4FPE A;  4K21 A;  3WNX A;  4CDW A;  4E2G A;  5HI0 A;  5DAX A;  2XML A;  2I2S A;  1VB4 A;  4OI4 A;  5FJH A;  4V1P A;  3AL6 A;  2PMW B;  1B35 B;  1TE1 B;  1D7P M;  3D4K A;  3P3P A;  3VZM A;  3LAG A;  3NNM A;  4XDO A;  2ET7 A;  2X5I A;  2VZ1 A;  1C8M 1;  2E7Q A;  2UYB A;  1PO1 1;  2P6C A;  3VKM A;  4DIN B;  1CAU B;  1LOA A;  5HCF A;  3O0W A;  3SHR A;  3ZM8 A;  3ASI A;  1ODM A;  2Q8D A;  3IDE A;  3IKW A;  1VE0 A;  1YIF A;  2QVS B;  4I02 A;  5DG1 A;  5FPB A;  2QQI A;  3KT7 A;  3UT0 A;  4NIG A;  1DYK A;  2IVI B;  3WY6 A;  1CWP A;  3J8F 2;  1BJQ A;  3MLJ A;  3POB A;  5JZG B;  1F4A A;  2ZHM A;  4HVQ A;  3C7H A;  2R1B A;  1JU3 A;  4XXP A;  2XJR A;  4QXK A;  5FUP A;  2VC9 A;  2CDP A;  5FZL A;  1LHV A;  4M3C B;  5B4N A;  2LRP A;  1O4Z A;  1ZRR A;  4LA2 A;  4XJ8 A;  4AVC A;  2A5Z A;  4DOU A;  2VUD A;  3HT2 A;  2UWC A;  1ASJ 2;  4UF0 B;  1VBA 3;  2FDJ A;  3LFI A;  2A3W A;  1ZRD A;  2RS3 1;  1HJF A;  1XB9 A;  5KC6 A;  1HRI 1;  3QH6 A;  4OQ8 A;  4WM8 C;  4LBK A;  3I2D A;  2MPF A;  5JMO A;  1ZZ9 A;  5FPL A;  2W47 A;  5BY5 A;  2CTV A;  5FZ3 A;  1RUF 1;  5K8S A;  1RJ7 A;  3M3I A;  2P2K A;  5FZ1 A;  1BEV 2;  1UX7 A;  1HB4 A;  4Y5Z 0;  4MOA A;  1W2T A;  3KCY A;  3IBM A;  2VJX A;  3Q9O A;  4IEZ A;  3SH5 A;  4CDQ A;  3KT1 A;  2XPJ A;  5L9R A;  2BGC A;  1JOB A;  5FYZ A;  4DUW A;  1LGB A;  3E5U A;  2GC2 A;  1PMI A;  2J1R A;  5CNA A;  1ULF A;  4BLJ A;  5HCB A;  2XON A;  2ZX2 A;  4HET A;  1VR3 A;  1I5Z A;  5CG8 A;  2IVJ A;  3THD A;  5J7M A;  3CQO A;  1NYW A;  3NW4 A;  4QKF A;  4D6R A;  1QJE A;  1G9F A;  4JHZ A;  4WVM B;  1ENX A;  2XJQ A;  1BVP 1;  4XFF A;  5KHI A;  3VKN A;  5T55 A;  1ZZC A;  4YM0 A;  3I2K A;  1HV0 A;  2PA7 A;  4AVB A;  2PYT A;  2VL4 A;  4WM8 B;  3ZR5 A;  3CF6 E;  4MHU A;  3I2O A;  4NRM A;  3OGG A;  2YG0 A;  4KG8 A;  4BOW A;  3ZFF A;  2WNE A;  5C33 A;  3USU B;  3UK9 A;  1PMH X;  2RM2 2;  1CIY A;  3FLP A;  2ARX A;  1RIR A;  3SEE A;  3VKF C;  4K7J A;  1C5H A;  3T2O A;  5FOB B;  4I01 A;  3BOW A;  2VNG A;  1PIV 1;  4Q4X 1;  1S1A A;  5FUI A;  5A1F A;  1F9K A;  3H3L A;  1TME 3;  5AFE A;  1C28 A;  2EXK A;  2WS9 3;  2WZR 2;  4UWD A;  5A3U A;  3LD8 A;  2YBK A;  4IEX A;  3LFM A;  5IFT A;  2CHH A;  1QWR A;  2JG9 B;  3CL1 A;  2YC0 A;  4YZ1 A;  5JR7 B;  2E9Q A;  3LA2 A;  1CAW B;  3KVA A;  2OX0 A;  5I0T A;  2J42 A;  4DXR A;  2R04 1;  4HPK A;  2VE1 A;  2TNF A;  4C90 A;  2XWJ B;  3NV4 A;  2FHR A;  3BN6 A;  4HT1 T;  5JAX A;  1QJX 1;  1AR9 2;  5F2W A;  4KNC A;  1C5I A;  2WNU A;  2C26 A;  1PZ8 A;  1YJL A;  4N9H A;  4EN6 B;  3TNP B;  2D40 A;  1Q8O A;  1BVV A;  3ZKY A;  4P5Y A;  5LB6 A;  2UY9 A;  2HBU A;  2Z4F A;  3NO8 A;  1BLZ A;  4I0W B;  2R0H A;  2HWE 1;  3ZPO A;  3D8C A;  4LO5 B;  2JD4 A;  3VDD A;  1BK0 A;  1SFY A;  1F5F A;  3OBR A;  4OLL A;  3HQX A;  5ACA 3;  2R16 A;  3VD7 A;  3BTZ A;  3PLQ A;  5FCC A;  3DV8 A;  3O14 A;  4QX2 A;  4AQS A;  4Q4V 2;  5A7P A;  3FHI B;  4TWT A;  1KJL A;  4XCB A;  1W8W A;  4NRO A;  3WDW A;  3ZXD A;  4Y1Y A;  2N7G A;  5CZK A;  3OJB A;  4P00 B;  1YFY A;  4A7Y A;  4GWJ A;  1GZW B;  2CGO A;  4QPW A;  4BQ4 A;  4XMA A;  2PHW A;  1R08 3;  2FZ1 A;  3RVH A;  1CJD A;  2WA4 A;  5J37 A;  2YDE A;  2PHT A;  1LOE A;  4FPY A;  2A6V A;  4CU7 A;  1AYN 3;  1V9U 3;  2QJV A;  3FZ3 A;  4CP2 A;  1ZRE A;  1IG0 A;  3AK0 A;  1V6I A;  4HSJ A;  5FPZ A;  2VO5 A;  5C6C A;  2VW0 A;  2C24 A;  4LHL A;  3DYP A;  4DFS A;  3VBU C;  3TRS B;  1VBC 2;  3H9A A;  4E4D X;  1AYM 3;  2IWG B;  1MQT C;  2BVB A;  2WAO A;  1PGL 2;  1EUU A;  1A78 A;  2VQA A;  3PU3 A;  3O1O A;  5BNN C;  4YYO A;  2YYO A;  3WDY A;  1GUI A;  5J3U A;  5E89 A;  2HEV F;  5J98 B;  3RMX A;  1E5S A;  2YPD A;  4HN0 A;  2DBI A;  2YRO A;  1FPN 2;  4PQ9 A;  1XYP A;  4LBM A;  4NPL A;  1BMV 1;  3WR0 A;  5IAT A;  4H7L A;  3R05 A;  1C1L A;  3ABZ A;  4CCN A;  1QQP 3;  1S0G A;  4IEU A;  3WHU A;  4NMI A;  1RUH 3;  1CIW A;  1HRV 2;  1WLW A;  2QQW A;  1IPJ A;  1ZX5 A;  5DAB A;  4AED B;  1RIT A;  1RUD 2;  4M4R A;  5G05 L;  3PMS A;  5FRE A;  4QB6 A;  2ZX0 A;  4Y3O A;  4N43 C;  4E2Q A;  4CEY B;  3U4X A;  3VBH A;  3B3Q E;  1WD3 A;  2P3I A;  5FZK A;  4IEP A;  1FOD 3;  2ARC A;  5FZE A;  5F5I A;  5JDB A;  2EIB A;  5FP3 A;  5A7W A;  1W0O A;  3VBU B;  3H8X A;  1ZZ6 A;  3A21 A;  1OA3 A;  1KFU L;  3HVD A;  3KV4 A;  1LHW A;  4B4Q A;  1MQT B;  3AKT A;  1YQ8 A;  4M3C E;  3EB7 A;  3NJY A;  1R09 1;  5BNN B;  1GKB A;  5EIY B;  4GIQ A;  4LE4 A;  3AKQ A;  3LQC A;  3AMH A;  3WNM A;  4D0Q A;  1UPI A;  4AR2 A;  1XOY A;  4EV0 A;  4NHM A;  4ERO A;  3T09 A;  2ZX3 A;  4YVS C;  5CKN A;  1WCQ A;  1AZD A;  3ZXG A;  1QU0 A;  1Y4W A;  1UO9 A;  2R30 A;  1HDK A;  2JDP A;  1SLC A;  1VMJ A;  2PHR A;  1MS9 A;  3PVB B;  3GBG A;  3RSJ A;  4FVV A;  1QOO A;  5LAT A;  3RPQ A;  1APN A;  1JYC A;  1MS4 A;  3GJA A;  5IT6 A;  4MGS A;  4AEK A;  1NZC A;  1POV 1;  2P4E A;  3N9Q A;  3MFC A;  4FP3 A;  4N43 B;  5EZW A;  4GMP 0;  2W1Q A;  3HR9 A;  1UY3 A;  3T1M A;  1FYU A;  4AWD A;  2QZ3 A;  4A44 A;  2WIN B;  1LOG A;  2R32 A;  4R52 A;  5FP7 A;  3VV1 A;  1DYO A;  2RMU 1;  2FMD A;  2R07 2;  4ZU7 A;  3AJY A;  5L7O A;  3FFZ A;  5CU1 A;  4O7X A;  2RE9 A;  2W1U A;  2WSV A;  2X5I C;  4YGD A;  2XVK A;  3K4D A;  4I30 A;  3IDC B;  1H1A A;  5I93 A;  2Y64 A;  5FZB A;  3W5N A;  3RGB A;  5A3N A;  5T3N A;  5A3P A;  2VUA A;  4O65 A;  3LE0 A;  3U07 A;  2QQJ A;  4YVS B;  4F7Z A;  5LA1 A;  3J9S A;  1HLC A;  5A7O A;  4Y1X A;  3OG2 A;  5C4W C;  3OGS A;  1VBE 2;  4XAE A;  3R4S A;  4QGN A;  2NN8 A;  1JMU B;  2R1D A;  4QQL A;  1R1A 3;  2P3K A;  3HMY A;  3LB9 A;  4CYD A;  4DQA A;  1M06 G;  3SNM A;  3DF0 A;  4CUB A;  4RR3 A;  3POF A;  4QDS A;  5DDJ 1;  5DZF A;  3VBR A;  2E32 A;  4GH4 A;  4OFG A;  4GA9 A;  4CDW B;  1J3R A;  4Y1V A;  2BBV A;  1JH5 A;  4QXB A;  3HD8 B;  4W6Y A;  3GHM A;  5FZA A;  5FLI A;  2JDA A;  4RHV 3;  4AF9 A;  1C4R A;  2Q1F A;  4B3N A;  2NP0 A;  1UMI A;  1QXR A;  5E16 A;  2F4P A;  1GOH A;  5C9A C;  3MPP G;  2JKX A;  2X5I B;  2VQU A;  2YFZ A;  1URX A;  3ELN A;  2HWB 2;  3R4U A;  2AC1 A;  1OA2 A;  5H9Q A;  2EVX A;  1MEC 3;  2OW4 A;  1BBT 3;  2WLP A;  1SLB A;  3PJY A;  4GJZ A;  1SG3 A;  2JJ6 A;  3C7O A;  5A33 A;  3X29 B;  4CUG A;  4MGK E;  3GCW A;  2VCB A;  1YQC A;  2QDR A;  3D0J A;  3FWE A;  5AC9 3;  4IEW A;  3OD4 A;  4CDQ C;  3W20 A;  2QQV A;  3Q8A A;  1VMF A;  5BXX A;  2ZAH A;  5F5Q A;  4LHS A;  4M01 A;  3PME A;  4PIX A;  1HIX A;  4YM1 A;  1UYY A;  1GSL A;  1UU4 A;  1QH7 A;  4QQ2 A;  1YC6 1;  4K9S A;  5L9V A;  2UYA A;  2B8M A;  1NZI A;  2ZX1 A;  1HXS 1;  5F3C A;  1LOF A;  2WZR 3;  3SC7 X;  2ID4 A;  1UPS A;  3JXS A;  4KH9 A;  4G4F A;  4AVS A;  1W6N A;  4LK7 A;  1VBD 1;  5A1A A;  1D4M 1;  1OLR A;  3M1H A;  3KCX A;  1N3Q A;  1G9B A;  3I7D A;  4MYE A;  4OMC A;  1RUJ 2;  3VKL A;  2ERF A;  4JGY A;  1EY2 A;  2DUQ A;  3AP4 A;  4GJY A;  4QQO A;  1S2K A;  4CDQ B;  1W0P A;  2VMC A;  1IS5 A;  3NNG A;  2XLA A;  1B09 A;  2HYK A;  2W2I A;  2YMZ A;  4GAL A;  4GQ7 A;  4XZP A;  1WD4 A;  2E7A A;  3JU9 A;  4PCR A;  4BCU A;  2EAL A;  4KQ7 A;  5JCT A;  5FYY A;  3V65 A;  1UNB A;  1YRZ A;  2XL7 A;  3IAP A;  2DUR A;  5HV4 A;  1GP4 A;  4BQ5 A;  5FY5 A;  2XL9 A;  3OB8 A;  3ZDV A;  4ES9 A;  4YW6 A;  3RRD A;  3WUC A;  1RUF 2;  2WNU C;  3H42 B;  1D2S A;  2JKB A;  3WZ1 A;  2C9K A;  2WQ8 A;  4URA A;  1UY1 A;  4Z92 B;  4CDX A;  3VDD C;  2BRT A;  3UGH A;  3ZFF B;  1QEX A;  3GBW A;  4JCK A;  4MGI E;  4FFH A;  4NWV A;  1Q43 A;  4AE2 A;  4DPN A;  4EN0 A;  5A6X A;  2W52 A;  2D6L X;  1Q5O A;  2RS5 1;  3S5Q A;  1OUX A;  3MW2 A;  1OQD A;  3O5S A;  5C7G A;  1KFX L;  1ASJ 1;  4LBL A;  4GMP 3;  1GLH A;  3SXW A;  1HB2 A;  1DZQ A;  2BNO A;  2GH2 A;  3LPF A;  4FP2 A;  3WNP A;  2PHU A;  4PLM A;  3RZG A;  4FTB A;  4XHX A;  4PLN A;  1H6X A;  5AVA A;  1XNA A;  5J1X A;  4YGB A;  2FDK A;  4HPK B;  2Y6G A;  5DMY A;  3MIH A;  1GNZ A;  2CY6 A;  2HJI A;  2CGP A;  4GWM A;  1BEV 1;  2WNU B;  2VNO A;  2ZCW A;  5FPA A;  1F5J A;  1YQ2 A;  4LLF A;  1PIV 2;  1UD1 A;  2PLV 3;  5IHR A;  2IZW A;  1H2M A;  2P3Y A;  2XQR A;  1UQX A;  4KMQ A;  1PO2 1;  4Q0P A;  2EID A;  2D43 A;  2W68 A;  3MIG A;  2WII B;  2FDI A;  1V6J A;  1MS8 A;  1BCX A;  4OI0 A;  1O7F A;  2QTW B;  2R04 2;  2DUO A;  4YZ3 A;  5D21 A;  4FTE A;  3N35 A;  3WLU A;  2XJU A;  1GZT A;  1AR7 3;  4YWA A;  1IOA A;  1O5L A;  4B8E A;  3BGA A;  3VDB A;  3AVS A;  1UYP A;  2CWM A;  1LOC A;  3WEZ A;  2BFU L;  5A6Q A;  5LY2 A;  1QXJ A;  3B9C A;  4ZPI A;  3FLT A;  4A3X A;  4PIZ A;  1MZF A;  2ADE A;  5JOY A;  1LHO A;  2WFF 3;  2SLI A;  4MHR A;  3ECQ A;  4PF1 A;  3I59 A;  3E6D A;  5F6L B;  1PZ7 A;  2RM2 1;  1E5R A;  2MEV 2;  4OUE A;  1O8S A;  4QM8 A;  5FKB A;  5G04 L;  1IHM A;  2Z79 A;  3VBH C;  4FXG B;  3MV0 1;  2K9Z A;  5GLU A;  1WW4 A;  1COV 3;  4UI9 L;  4XW3 A;  2PHL A;  3AZY A;  1H1I A;  3JBG 2;  4JRA A;  1UZY A;  2BWA A;  1AL2 2;  5FMO S;  3V0A A;  2Q1M A;  5LRR A;  1SFP A;  4CCK A;  2GAL A;  2ZEY A;  1RVF 1;  3FE5 A;  2GN7 A;  4JTN A;  4Y5T A;  4H55 A;  2XLG A;  4HXC A;  2AZ5 A;  5CKM A;  1A6C A;  3LKJ A;  1ND3 A;  1E57 A;  3KVB A;  3AJZ A;  5FZ7 A;  1EUT A;  1RMU 2;  3WW1 A;  1G9A A;  1LHN A;  4NID A;  3K3N A;  2D3P A;  3ENR A;  1CX1 A;  4AI2 A;  4CP1 A;  5FYM A;  3POI A;  5FBJ A;  3DEM A;  3FMG A;  4AQ6 A;  4LNV A;  4I2O A;  5DAQ A;  5LBB A;  2Q1Z B;  4AK3 A;  3S57 A;  2DWR A;  3C8X A;  1FMD 2;  4JQT A;  3OSD A;  1US3 A;  1V0A A;  1ULG A;  5ANQ A;  1HB1 A;  3VHR A;  3DXU A;  4OYU A;  5A7W B;  5FK7 A;  3CJI A;  4BHP A;  5CEH A;  1RTV A;  4ATE A;  4E8D A;  1BMV 2;  3J7N A;  3PUA A;  1HN0 A;  3WG3 A;  5L7O C;  4IXL A;  3WQ0 A;  5SV8 A;  3KSC A;  4TXW A;  2JDH A;  2NM1 A;  4OZO A;  3AKR A;  2KA3 A;  4HK9 A;  1S2E A;  3E6C C;  2E51 A;  3GF6 A;  3B00 A;  4Y5S A;  1KS5 A;  4LA3 A;  5FMD A;  5D2A A;  3NJZ A;  2EXI A;  3CU7 A;  1P8J A;  1KRI A;  4Q0S A;  3PUQ A;  4K1Z A;  1VBC 1;  1JN2 P;  3MUY 1;  3NNL A;  1PGL 1;  4XAB A;  4B4P A;  3VBR C;  3CZU A;  1SLT A;  1R09 2;  1Y9Q A;  2CL2 A;  2P34 A;  3BOP A;  4GH4 C;  4XUR A;  3UV9 A;  5HBA A;  2HEY F;  3HNM A;  2WO2 A;  2Y6K A;  3KHB A;  5F9T A;  4N8M A;  1FPN 1;  3FBM A;  3E97 A;  1PMJ X;  1UL9 A;  2WT2 A;  3AYE A;  2BJS A;  5K9Y A;  1ULO A;  3I2H A;  2K46 A;  1GQG A;  3U1X A;  1G9C A;  3B01 A;  2HWC 3;  4J6G A;  1CN1 A;  2DYC A;  3IPV A;  3N7J A;  3B94 A;  4JKK A;  4NII A;  4KG0 A;  5JPN B;  2P5B A;  2IUW A;  1W8N A;  2ZEW A;  3ZN6 B;  3ZO0 B;  3INA A;  5LRS A;  1RB8 G;  1C8M 3;  3USS A;  1PO1 3;  2ZKN A;  1GNY A;  4HVO A;  1NX9 A;  5KWR A;  2GH8 A;  3VUO A;  2O0O A;  2B9V A;  2ORZ A;  1GZ9 A;  1FT9 A;  5EPA A;  2RMU 2;  2QDN A;  1ZRC A;  4LHK A;  4RR3 B;  5F5A A;  3H8O A;  1MS3 A;  1QJY 2;  2A6X A;  4FPH A;  4DNY A;  3K75 B;  1SBE A;  4GH4 B;  2DUP A;  3RMY A;  4R9A A;  4LKE A;  4JX0 A;  4MXV A;  1U0A A;  3LPG A;  3MID A;  5AFB A;  2PFW A;  3AFK A;  3ITQ A;  1VIW B;  1OKQ A;  1DQ4 A;  4XJ9 A;  2VTF A;  2MHF A;  1X8M A;  4GZ9 A;  2ZZJ A;  1V6O A;  3JB4 C;  1PNF A;  1LOF C;  3AYD A;  1F4H A;  2NZ9 A;  3MPB A;  4ASK A;  3WF2 A;  2W95 A;  3ATG A;  3DCQ A;  1A3K A;  2UU8 A;  4NHL A;  3GZU C;  2NYY A;  2LW8 A;  1JUH A;  4L0P A;  3V0B A;  3LA3 A;  2I07 B;  1FAT A;  2RS3 3;  4OHY A;  1J58 A;  4YVW B;  4V2V A;  1HRI 3;  2AAC A;  4QD2 A;  2J1T A;  5A33 B;  1FXZ A;  2OQ7 A;  1AJK A;  3LF7 A;  4FQ4 A;  4IE7 A;  2YZ4 A;  1XU2 A;  4JGY C;  2A3X A;  2R07 1;  4NWW A;  4CXX A;  2J7M A;  3HBZ A;  3DYO A;  4UFK A;  4N7I A;  5JIA A;  4K8F A;  1JOD A;  1ZBA 1;  5JI9 A;  4RL7 A;  3PJQ A;  2PXJ A;  2OZ6 A;  3WP5 A;  3OTF A;  4LXL A;  1UU6 A;  4S2F A;  3WDV A;  5JIU A;  1WMF A;  4LT5 A;  4P08 A;  2WWU A;  2ZTN A;  4DY3 A;  3AYA A;  1G7Y A;  1XNK A;  4RSU A;  3RFR A;  5IAX A;  4IE0 A;  1VBE 1;  5JWP A;  3DXT A;  5BUV A;  2RHP A;  3UJQ A;  1IQA A;  4IL7 A;  1SLI A;  1XNB A;  4XE9 A;  4ZXK A;  1NE6 A;  3TAY A;  1HJG A;  5IVY A;  4CDU A;  3N9P A;  1OLM A;  2JE8 A;  2ZA9 A;  1W6N B;  3ZXE A;  2Z2S B;  1I1E A;  1K3I A;  4BLI A;  4GD4 A;  3N36 A;  5FAX A;  3NL1 A;  4CXY A;  2UUR A;  2BTV C;  2WZP P;  2YV8 A;  2H0V A;  4IEO A;  1DHK B;  3BPS A;  4XF3 A;  3VZN A;  4XIL A;  2XXZ A;  1QMJ A;  1XRU A;  3P3N A;  5FZD A;  5JLV A;  1KJR A;  4Q1P A;  4XUP A;  3AKP A;  4Q4X 3;  3MW3 A;  1K5M A;  1HXS 2;  4RQP C;  3NQH A;  2PQS A;  4ATF A;  4WM7 B;  5A3T A;  5A1L A;  4NOT A;  3BKZ A;  3ZFG A;  1BHG A;  4CE8 A;  2BP6 A;  3AZV A;  4WV8 A;  1VBD 2;  4GB3 2;  3KGL A;  4IV1 A;  4FFF A;  3V64 A;  1DU3 D;  2EF6 A;  2R04 3;  1DGW X;  2EXH A;  1SZB A;  2RJ2 A;  3H50 A;  5BNP A;  5ABJ C;  3DKW A;  1TMF 2;  4YNI A;  1J59 A;  1EAH 3;  3J26 N;  2CV6 A;  3LEG A;  4ZS3 A;  2ATF A;  1QJX 3;  4E8C A;  4AHW A;  1QJF A;  5FWE A;  4XBL A;  4BXF A;  5DUV A;  2QQP A;  1ENS A;  2HWF 1;  4B7E A;  3POE A;  4CDX B;  4HG6 B;  4YG3 A;  2JWP A;  5T5J A;  4XUN A;  4FPL A;  2Q30 A;  4XF1 A;  2Y8K A; 
#chains in the Genus database with same CATH homology
 2X05 A;  3DYP A;  4AAX A;  1GMM A;  3MBW A;  2WAO A;  4XZU G;  1EUU A;  1R64 A;  4XUT A;  3UET A;  4DEQ A;  3I2I A;  1GOF A;  2E33 A;  2BGP A;  3T0A A;  1GUI A;  3VDA A;  2YFU A;  4IUG A;  3ABZ A;  1T2X A;  1OD3 A;  1JHJ A;  4D8M A;  2W94 A;  1W8O A;  1MPX A;  2WO3 A;  4M4R A;  3K46 A;  5G05 L;  4QB6 A;  3T08 A;  4DUV A;  2EIB A;  4A3Z A;  2XQX A;  3A21 A;  2WYS A;  3CMG A;  3SKV A;  2V4V A;  3DYM A;  3EB7 A;  1PX3 A;  5EIY B;  2DDU A;  2WUH A;  3LQC A;  4ZY9 A;  3T2Q A;  2W5F A;  1O8P A;  3WNM A;  4D0Q A;  4TTG A;  1JZ3 A;  2WZE A;  2Y6J A;  3HEI A;  1UMH A;  3T09 A;  4PT6 A;  1WCQ A;  3NJX A;  5I0D A;  2RV9 A;  3MO4 A;  4BDV B;  4MGS A;  2OKX A;  3C7E A;  2WAB A;  2VME A;  2W1Q A;  1UY3 A;  1WKY A;  3F2Z A;  4A44 A;  2QBX A;  3MUZ 1;  1DYO A;  5DN2 A;  2W1S A;  3I2F A;  4A4A A;  1JZ5 A;  3D3A A;  2W1W A;  2W1U A;  4A45 A;  3K4D A;  5EJZ B;  2Y64 A;  4QX1 A;  4UAP A;  4ZZ5 A;  3W5N A;  5JXJ A;  2VZQ A;  4YPJ A;  5LA1 A;  3LE0 A;  4DXT A;  2QQJ A;  5HXM A;  1OT5 A;  2YC4 A;  3OG2 A;  3OGS A;  5B4X A;  2WZ8 A;  3FHA A;  1SDD B;  3OBA A;  4CUB A;  2WDB A;  4QDS A;  2E32 A;  2Y6L A;  1GOG A;  2RVA A;  2VCA A;  2JDA A;  1UWW A;  1LNS A;  2VZO A;  3P1I A;  1UMI A;  1UYZ A;  1SHW B;  2LS6 A;  1UZ0 A;  4ZZ8 A;  3GXU A;  1GOH A;  3WF4 A;  2JKX A;  2VQU A;  2YFZ A;  3WF1 A;  1UY4 A;  1UYX A;  4QX3 A;  3ETP A;  4XUO A;  1OF4 A;  2VMD A;  2VZR A;  3IB3 A;  4BXS V;  3P6B A;  1SG3 A;  3C7O A;  2KD7 A;  1ULP A;  2VCB A;  1NAE A;  2DCJ A;  2VQT A;  1CZT A;  1J83 A;  1O59 A;  3HPN A;  4QDQ A;  4ARX A;  3GGL A;  3T2P A;  3OEA A;  1K42 A;  4LHS A;  3AC0 A;  4DXS A;  1JYX A;  1TVG A;  2W92 A;  1UYY A;  4A42 A;  4LQR A;  4W4Z A;  4A6O A;  5F7U A;  2QQK A;  2J1S A;  3I2J A;  1JI6 A;  2ID4 A;  3JXS A;  5JR2 A;  5A1A A;  2VZT A;  4GWI A;  3III A;  1XPW A;  4BK5 A;  2W3J A;  4OMC A;  3HNB M;  3ACH A;  5JXH A;  1H6Y A;  4XVH A;  2EIC A;  2VMC A;  3MV1 1;  1W99 A;  3NNG A;  2QQM A;  4CU6 A;  2V5D A;  1JZ4 A;  2VOT A;  2VZP A;  3IAP A;  1JU4 A;  2J22 A;  3NJV A;  3OB8 A;  4DEV A;  2VMF A;  3CIH A;  4DUX A;  4OMD A;  2EIE A;  1I5P A;  3CKH A;  3A22 A;  3UNP A;  3J7H A;  2C9K A;  4QAW A;  1PX4 A;  2WQ8 A;  5IJR A;  2BZD A;  1UY1 A;  3LEI A;  4LKS A;  3WF0 A;  4ARY A;  3OGV A;  3WF3 A;  2JD9 A;  3LEK A;  5CYY A;  2HLE A;  1IQD C;  3I3D A;  2WN3 A;  1OH4 A;  1W9S A;  2R7E B;  4QB1 A;  4QDR A;  4RYD A;  5C7G A;  3VDC A;  1XC6 A;  2J1A A;  4ET7 A;  3LPF A;  3WNP A;  1J84 A;  1H6X A;  1XNA A;  5J1X A;  3GDB A;  2YC2 A;  2Y6G A;  2BBA A;  5DMY A;  1XNT A;  1YQ2 A;  2V72 A;  5IHR A;  1JZ7 A;  1L7Q A;  4CUC A;  3I3B A;  2BER A;  4KMQ A;  4P02 B;  4W50 A;  2EID A;  2J1E A;  1KEX A;  2W46 A;  3CZJ A;  5JXI A;  1UY0 A;  2J1V A;  3BGA A;  3VDB A;  2HYX A;  3WEZ A;  4A41 A;  4JKM A;  3T0D A;  4CU8 A;  1JYW A;  3IAQ A;  2YB7 A;  4CVU A;  3HOB A;  1HN1 A;  3ECQ A;  3OGR A;  4PF1 A;  3FN9 A;  3THC A;  1UY2 A;  4OUE A;  1O8S A;  3HNY M;  2J1U A;  5G04 L;  4MGQ A;  3PUI A;  3WNL A;  1K12 A;  3MV0 1;  1NKG A;  2W9X A;  3I97 A;  4UI9 L;  5IYY A;  2E31 A;  1W9T A;  4MAD A;  1TG7 A;  2ZEY A;  3DEC A;  2B4K A;  3E1F 1;  3WNK A;  1W9W A;  3VD5 A;  5IFP A;  2XHN A;  3K77 A;  1DP0 A;  1K45 A;  1JZ8 A;  1JYN A;  2C4X A;  5JXG A;  1EUT A;  5HPO A;  2VZS A;  4ZXE A;  1CX1 A;  4AG4 A;  2ZXQ A;  2VZV A;  4MO3 M;  3A23 A;  2W91 A;  2L9L A;  2ZEX A;  3C8X A;  3C7F A;  1US3 A;  3EYP A;  3HJR A;  5LA2 A;  1L7R A;  2WBK A;  4OYU A;  4E8D A;  3U37 A;  1CZV A;  4KI5 M;  3VD9 A;  4TXW A;  1D7P M;  4OZO A;  4PQQ A;  4RN5 A;  2VZ1 A;  3I3E A;  3ACI A;  1DLC A;  2W87 A;  2WAA A;  2BGO A;  2VCC A;  2QQN A;  1P8J A;  3ZM8 A;  2VR4 A;  3MUY 1;  1US2 A;  4CU9 A;  4M4P A;  4W8J A;  3CZU A;  3I2G A;  2QQI A;  4XUR A;  2VM9 A;  3WNO A;  3HNM A;  2WO2 A;  2Y6K A;  1PMJ X;  1GU3 A;  1F4A A;  1UXZ A;  1ULO A;  3I2H A;  4JKL A;  3C7H A;  5LA0 A;  1JU3 A;  2VC9 A;  1GQP A;  2CDP A;  5B4N A;  4JKK A;  2ZEW A;  1W8N A;  2ZEZ A;  3CDZ B;  4FI9 A;  3WSO A;  1GNY A;  1NX9 A;  3K4A A;  3SEP A;  2VZU A;  5JMO A;  2B9V A;  1KGY A;  2ORZ A;  1JZ6 A;  5LCW L;  2W47 A;  5EJ1 B;  2ORX A;  1UX7 A;  3K75 B;  4MOA A;  1CZS A;  4LPL A;  2VJX A;  4XUQ A;  3K4Z A;  4JX0 A;  3LPG A;  2VTF A;  4BJ0 A;  3IDA A;  3OEB A;  4DUW A;  4GZ9 A;  2J1R A;  3W5M A;  2XON A;  2X09 A;  3WQB A;  1F4H A;  3WF2 A;  2W95 A;  3THD A;  1JZ2 A;  2XOM A;  3CQO A;  4JHZ A;  5C71 A;  4L0P A;  2LW8 A;  4CUA A;  2QQO A;  2QQL A;  4KWU A;  3I2K A;  2J1T A;  4QX0 A;  2VL4 A;  3A7Q A;  3WNN A;  5DPN A;  2YG0 A;  4Z2A A;  2J7M A;  3DYO A;  1PMH X;  1CIY A;  2X10 A;  3ACF A;  4BK4 A;  3SEE A;  3T2O A;  5FUI A;  3VD3 A;  2DCK A;  3T0B A;  5IFT A;  4P08 A;  1OF3 A;  4DXR A;  2E26 A;  5JUV A;  3BN6 A;  5DQ0 A;  2Y6H A;  2JE8 A;  1NUK A;  2C26 A;  1K3I A;  3PUH A;  4P5Y A;  4QB2 A;  2Z4F A;  1UXX X;  3NRU A;  3HN3 A;  3UES A;  1RYY A;  4XUP A;  3VD7 A;  3VD4 A;  4QX2 A;  2VZ3 A;  2WN2 A;  3NQH A;  2PQS A;  3GM8 A;  2CDO A;  1BHG A;  5C70 A;  1JYV A;  5CZK A;  1W0N A;  4P00 B;  3ACG A;  2RJ2 A;  4GWJ A;  4UOJ A;  4QPW A;  2WO1 A;  3LEG A;  4E8C A;  3FL7 A;  4XUN A;  3SKJ E;  4CU7 A;  3FHQ A;  4HG6 B;  2VO5 A;  2Y8K A;  3C7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...