2Z4FA

Solution structure of the discoidin domain of ddr2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
161
structure length
161
Chain Sequence
NPAICRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Discoidin domain-containing receptor 2
publication title Structural basis of the collagen-binding mode of discoidin domain receptor 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 16
structure length 161
sequence length 161
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2z4fA00
3OEAA 1F4AA 4KI5M 5J1XA 5JXJA 3T09A 4MGQA 3HNMA 2XONA 1W99A 2VOTA 4W4ZA 1UMIA 3WNMA 3SEPA 3HN3A 5B4NA 3VDBA 1I5PA 4JHZA 4DUVA 3NQHA 4QDQA 4XZUG 4MO3M 2WYSA 3EYPA 1H6XA 2J1SA 2WBKA 2DDUA 4DEVA 1L7QA 1J84A 1XNAA 1JU3A 2X10A 2E31A 2YC4A 2VCCA 2Y6GA 2ZEYA 4XVHA 4P08A 2VMFA 4ZZ8A 3MO4A 3CZJA 2VZRA 3ACFA 3T0DA 3MUY1 1PMJX 1MPXA 5I0DA 1UZ0A 2WZEA 3LQCA 3I2JA 2W1SA 1W9WA 3ECQA 5C71A 3OG2A 4OMDA 2JD9A 2R7EB 1GOHA 4P02B 2V5DA 3A22A 1JZ8A 1JZ5A 3NJVA 3I2GA 3LE0A 1OF3A 2OKXA 4CUAA 3CZUA 4LKSA 5B4XA 1PMHX 2J1UA 3K4AA 2C4XA 4W8JA 3WNPA 4E8CA 3MV01 2J1TA 3VD7A 1UYZA 2Y6KA 2ZEZA 3NJXA 1HN1A 3LEKA 4E8DA 1OF4A 1IQDC 2J1RA 2CDPA 3LEIA 1O8SA 1PX3A 2W47A 3D3AA 3PUHA 1P8JA 4DUXA 3OBAA 1ULPA 5DN2A 1DLCA 2WDBA 4CU6A 4IUGA 2VM9A 2V72A 1DP0A 2VQTA 2WABA 2YB7A 3SKJE 2W5FA 4JKKA 4ET7A 3I3EA 2YFUA 4M4PA 2W87A 2WO2A 2VZQA 2VZVA 3VD4A 2EIEA 5JMOA 2VZ3A 1W8NA 3IDAA 2ORXA 2EIDA 2QBXA 2Y6LA 2Y6HA 3T2QA 1GUIA 2QQOA 4M4RA 2WUHA 1JYWA 3WNNA 1H6YA 1TVGA 2E26A 4PQQA 3BN6A 1XNTA 3AC0A 1KEXA 3C7GA 3GDBA 4L0PA 3THCA 1KGYA 1EUTA 4QX1A 3VD3A 3IIIA 1CZVA 4DXTA 4GWIA 3UETA 3IB3A 3WF2A 3THDA 3W5MA 1JI6A 4BJ0A 2W92A 3VDAA 1UYYA 1JZ6A 1OH4A 2JKXA 3WNLA 4HG6B 4CUCA 3A7QA 2QQLA 4LPLA 1W0NA 4MOAA 5HXMA 4CU8A 3I2IA 3C7HA 3CDZB 3J7HA 1US3A 1EUUA 2VZ1A 2J1VA 5A1AA 1RYYA 3T0AA 3I2HA 4RYDA 5C7GA 4JX0A 3MBWA 3T0BA 2WO1A 2YC2A 1NUKA 3OGRA 4ARXA 1GOGA 2QQIA 5F7UA 2DCKA 3DYMA 1UYXA 1JZ3A 1XPWA 4OUEA 3FN9A 4FI9A 4ZXEA 2VO5A 4KWUA 5LA0A 3MV11 4AAXA 3DYOA 2KD7A 2X05A 3VD5A 4ARYA 3HPNA 5EJZB 5LCWL 3WQBA 2WN2A 3K4DA 4QAWA 4UOJA 2W3JA 3CMGA 3OGSA 1JYXA 1CZTA 1WCQA 1UX7A 2J1AA 4QDSA 5DQ0A 3C8XA 4CVUA 5JUVA 2W46A 3WF1A 4P5YA 4QPWA 3WF3A 2XOMA 2PQSA 2LW8A 2RJ2A 2B4KA 2C9KA 4QX0A 1UY0A 2J1EA 2BZDA 1UXXX 4XUNA 4AG4A 3C7FA 4JKMA 4BK5A 2LS6A 2YG0A 1JZ7A 3T2OA 1O59A 2YFZA 4LQRA 2EIBA 1JU4A 1UWWA 1CIYA 3K77A 4XUTA 4KMQA 1SDDB 2RVAA 3K46A 3U37A 3I2KA 1DYOA 2WO3A 3HNYM 1LNSA 2VTFA 2WAOA 1UMHA 2Y8KA 2VCBA 3WSOA 1NX9A 1R64A 1SG3A 4CU9A 1JHJA 5G05L 2BERA 1O8PA 3E1F1 1JYVA 1K45A 5IYYA 3NRUA 2VR4A 1OT5A 1OD3A 2BGOA 5LA2A 2W95A 4CUBA 3ZM8A 2E33A 4PT6A 2QQJA 4A41A 1JZ2A 3HEIA 1UY4A 2VZTA 3DYPA 1UY3A 3SEEA 1NKGA 3UESA 2ZXQA 5JXGA 2VZUA 4ZY9A 3T08A 2VQUA 3FHAA 4A44A 2WQ8A 2W91A 3I2FA 5FUIA 3LPFA 4OYUA 3VDCA 4TTGA 2X09A 2VCAA 2L9LA 1JYNA 3W5NA 2ZEWA 5G04L 5C70A 3P6BA 2ID4A 3ACGA 2VL4A 2VZOA 2XQXA 4XURA 1J83A 1L7RA 4ZZ5A 3I3DA 3I97A 3VD9A 4BK4A 3A21A 4XUQA 1GOFA 2W9XA 3A23A 3DECA 4LHSA 5CYYA 5JXIA 5IHRA 2WZ8A 4DEQA 3ACHA 3HJRA 3ACIA 4XUPA 2VC9A 3WNKA 2JE8A 2W1WA 4PF1A 4A45A 1CZSA 2EICA 2VZSA 4OMCA 3LEGA 2CDOA 4UAPA 4TXWA 3K4ZA 5DMYA 1GMMA 1W9TA 4JKLA 2VJXA 4A6OA 4Z2AA 4QB6A 4D0QA 4BDVB 1PX4A 3P1IA 2C26A 5DPNA 3K75B 4P00B 1F4HA 3SKVA 3WF4A 5IJRA 4UI9L 2DCJA 2QQNA 2XHNA 4GZ9A 2VMCA 3OEBA 3FL7A 2RV9A 1XC6A 1K42A 1JZ4A 2J22A 4W50A 2W1UA 1K12A 4A42A 1ULOA 1TG7A 3CKHA 3CIHA 3FHQA 2BBAA 5IFPA 2HLEA 2ZEXA 2J7MA 2WN3A 5LA1A 4BXSV 1SHWB 2Y6JA 4QX3A 3T2PA 5CZKA 2WAAA 1T2XA 4DXSA 1NAEA 3WNOA 4QX2A 2ORZA 3IAPA 1YQ2A 5EIYB 2HYXA 3IAQA 1W9SA 3MUZ1 5IFTA 2W1QA 5JR2A 5JXHA 2B9VA 3F2ZA 4RN5A 4D8MA 3ETPA 5HPOA 2Y64A 4DUWA 2VMDA 1UXZA 3UNPA 1CX1A 3OB8A 1GU3A 3ABZA 2V4VA 2E32A 3PUIA 4CU7A 2VZPA 1WKYA 2BGPA 4MADA 5EJ1B 1GNYA 3HNBM 4OZOA 3OGVA 4QDRA 1K3IA 2W94A 3WEZA 1GQPA 3JXSA 4XUOA 2QQMA 4A4AA 4MGSA 1D7PM 4QB2A 3HOBA 4DXRA 3C7EA 3WF0A 1US2A 3GM8A 3EB7A 3C7OA 3LPGA 3NNGA 4QB1A 3BGAA 3I3BA 2Z4FA 2JDAA 4A3ZA 1BHGA 2VMEA 3CQOA 3GXUA 3GGLA 1UY1A 2QQKA 1UY2A 4YPJA 4GWJA 1W8OA
chains in the Genus database with same CATH superfamily
1XNKA 5JPNB 3ZSEA 1W8FA 3DPRA 1FI2A 4KWLA 5FIXA 2UU8A 2BBVA 2WSVA 3T09A 3HNMA 1BMV2 4AHZA 4Q4W1 1JBCA 3KHBA 1W99A 1COV3 3F95A 4CP9A 4E4ZA 1VMFA 1SLLA 4BWOA 2A73B 3NJZA 2ZBJA 2JDZA 2FZ2A 1DQ4A 3ON7A 1W6OB 2XVLA 4AI8A 1QOOA 2R071 5B4NA 1HRV2 1OMIA 1ZRIA 4XFHA 1CJDA 1JTZX 1COV2 3IDCB 1I5PA 5I0UA 1AR73 5FP4A 3NQHA 1LEMA 3FUOA 3ZSKA 1NCRB 4QDQA 5FP3A 5FZOB 2DVDA 4MO3M 1CGPA 5GLUA 3OCPA 1H6XA 1G8WA 2WBKA 1F5FA 4DEVA 2DCTA 3CEWA 1Q8VA 1L7QA 5FO7B 2X10A 1Y9QA 3THPA 2YZ4A 3GHMA 3ZXKA 3WR0A 1FXZA 4LR4A 2Y6GA 3RZGA 2ZEYA 3I49A 3N4MA 1AXKA 4Q4W3 1K5JA 1ASJ2 1KJLA 2VMFA 5FUPA 2D6MA 4OHVA 2VOWA 5JIUA 2A71A 1WW5A 4PLMA 1IPJA 3U78A 5C8WA 1IKPA 1LB2A 1GWKA 1U5YA 1PMJX 3OGJA 2QZ3A 1HQWA 1MPXA 2VNGA 3MFCA 2K9ZA 5BNOA 3FBYA 1W9WA 3B5LB 2NZ9A 1VBC3 2YPDA 4P02B 2V5DA 3A22A 4XTPA 1JZ5A 3NJVA 3KV4A 3UYJA 3I3MA 3PVOA 1VIWB 5LZ6A 1OQEA 4AEMA 4HSJA 2LROA 2Y26A 3LE0A 1PO22 4LHKA 4NRPA 4Q8LA 5FYVA 5FZDA 3CZUA 2VPVA 3LD8A 3ZFFA 2PMWB 4DRRA 3I3QA 2HBTA 3LEMA 4O7XA 5FMDA 3IPVB 4HXCA 4BQ1A 1IS4A 1NCRC 2GNMA 1EAH3 2VG9A 4XCBA 3AM2A 2D98A 4MGYE 2YC0A 4QKDA 3RJRA 1UYZA 1LOFA 3JUUA 3LA7A 1KXGA 2ZEZA 1DQ1A 2YY1A 1WBFA 2RR12 1E5IA 1IG3A 4MZUA 1X50A 1VB4A 1CAVA 4I0WB 1EAH2 1FPN1 1LU1A 4PLOA 4WM8A 5I0SA 3DEMA 5FXVA 1TME3 1BKZA 1DCSA 4FAHA 2VH9A 3VBHA 1R083 4AHXA 1P8JA 1ZZBA 1OSGA 2VVDA 3DV8A 1U5XA 5CFDA 2CV6A 1RUNA 1G9FA 1VBD2 1IHMA 5FO8B 1DLCA 1BZWA 3W20A 5E16A 3WUCA 1MZFA 4IV3B 1R082 5E1RA 3I59A 4ZU7A 5KHIA 4BXFA 2B45X 2R32A 5HCBA 4OQ9A 4COZA 2X8KA 1NA1A 4C90A 4JKKA 3VHRA 3RYPA 2HWC1 2WO2A 4AVBA 3OOXA 4GB31 5JAXA 1ENQA 2VZQA 4LBQB 2A6WA 4FPJA 2EIEA 5JMOA 2VZ3A 4KGQA 4PLNA 3IDAA 1NY71 2YDEA 3M8LA 5EHDA 4RFRB 2JE7A 1W3XA 3KF3A 3ZYRA 1BEV1 1FPN3 1VR3A 3TAYA 4XYXA 1OUXA 1DZRA 1NT0A 4HPKB 5KR7A 1VRH2 4QQ2A 1JW6A 3WVJA 4M4RA 2CGNA 4BOWA 4B7EA 5JIAA 2CYFA 2WS92 4Q8KA 1RUH1 1Y3TA 1ZZ9A 1AX0A 1BVP1 2GN7A 2E26A 1LEDA 4NPLA 4XQWA 2BDRA 4PQQA 2XGXA 5GLVA 4RGKA 3AC0A 3KQ4B 2W2IA 1KEXA 5AVAA 2DBIA 1DGRN 1EUTA 4QX7A 2HWC3 1BK0A 4GWIA 1QY4A 3UETA 1RUG2 5F3GA 2P3JA 3AKQA 5LWBA 3BI3A 1MQTB 5CIRA 4AZZA 2OW4A 1ZRCA 2WQZC 2C6SA 4BMBA 1BEV3 4CP1A 5DDJ2 1GP4A 2XBO2 3WNLA 2JG9A 3KT1A 5L9RA 5C3QA 1QKQA 3H1WA 2G4IA 1H1AA 1LESA 1LRHA 3A7QA 5IAVA 3AYDA 1FNZA 1W0NA 4LXLA 1LCLA 3ZDVA 5DABA 4FFIA 2XDVA 2P3YA 3I2IA 4ATEA 3JD72 1RUH3 4BMEA 3TOJA 1WMDA 1H8VA 1Q5OA 3GZEA 3PVNA 1EUUA 2RDRA 2VZ1A 1J3QA 1BLZA 1KS5A 1NZCA 3V0AB 1AX1A 2CTVA 3O14A 5EV7A 4RYDA 2GDFA 3A0NA 3NKGA 4IE4A 4GMP1 2OPKA 2BWAA 3OPTA 4J1XA 1QXPA 5GJ6A 5J96B 4QU2A 2D6NA 2VU9A 4COWA 1NUKA 1SPPB 3BOPA 3OGRA 1CR7A 5FZ1A 4A7YA 2RDNA 3NAPA 2Y33A 5F7UA 2PAEA 3M3EA 1QGLA 5J37A 1LHNA 2XHKA 2K0GA 2DWRA 2UURA 1MZEA 1OH3A 2CGOA 2JIGA 1WUVA 4QPIA 1XPWA 3JBG2 3VKFC 1CVNA 5DAWA 1TNFA 2YU2A 5ANNA 2RDSA 1UW8A 4YGDA 4OI0A 4XZPA 2V73A 1MQTC 3N9PA 3OJBA 4BH9A 4YFZA 1V00A 3VD5A 3MZHA 1O3QA 2XKOA 3MIGA 4V2VA 2X29A 1OUSA 4A3XA 4HANA 1QIQA 3CBNA 4CDXA 3KVAA 2WN2A 4QAWA 4JZRA 2W3JA 1H4GA 3CMGA 4IGPA 5C5TA 5CFCA 1C57A 1AJKA 4XHXA 4JCKA 3AKSA 4L97A 1G9DA 5F8PA 1E5SA 2EAKA 1YFYA 4P9XA 5FY8A 3O1TA 4GMP0 3RWKX 3EXUA 1CAUA 3S57A 4P5YA 1AXZA 3A0KA 1CJPA 4BQXA 2RJ2A 4FOQA 3EMRA 3U0ZA 2EALA 3WT3A 1UY0A 2B8MA 1RUC1 4WVMB 5A1LA 5F2WA 3NSTA 3GJBA 4ASMB 1WLCA 2Z2SB 5K7PA 3JZVA 4JKMA 3E5XA 1TMF2 4BK5A 4MV2A 1GLHA 5FXWA 3THTA 4E9KA 3J7MA 4CCNA 4FPCA 3T1MA 5ACA2 2MNGA 3FJSA 3LA2A 4IE5A 4B8EA 1FNYA 3D6EA 5F5CA 2ETEA 5EPAA 4BYYA 2D5HA 2BP6A 2MHFA 2ZGKA 4XUTA 3VBSB 4HMZA 1SBFA 3LA3A 1AUYA 3H1MA 1MS9A 5FLIA 4LITA 4BM8A 5C3OA 3HAGA 2IFRA 5FZHA 1V6MA 4AF9A 2OS2A 4DOUA 2WA3A 1V6KA 1ZZCA 5EQUA 1W06A 2HBUA 4QX8A 1V6LA 2R1DA 3WHUA 4AVSA 4D6RA 4LBKA 5HI0A 2BERA 4HKLA 4UFKA 4MH0E 1H2KA 3RZJA 1BBT2 1LECA 1I3HA 1RC6A 3NRUA 5IYYA 1OT5A 3SLIA 4YM2A 4Q4V2 3L2YA 1X9PA 3MLJA 3P5BA 5AVPA 4MXVA 5BNPB 3U07A 1SLAA 4YG3A 3U11A 1K5MA 3S7IA 1UNBA 4XBLA 4LHNA 4XFFA 2XQRA 3MIFA 4MHRA 4G3YC 3U10A 3DYPA 3CJIB 5C9AB 1UY3A 4K8FA 3VV1A 5F6LB 2ZXQA 2R063 2XJSA 4AGVA 1X33A 1HB4A 3DXUA 2EXJA 4I30A 5LBFA 4JC1A 4AI3A 2RS11 2NM1A 5FUNA 3LDKA 2BOIA 4AR2A 4FP3A 2VQUA 2R062 3I2FA 5FUIA 3VBSC 3AMQA 3WDXA 4OYUA 4OZXA 2W52A 1Q43A 1W8ZA 3C2UA 1YNAA 4B4QA 3BIWE 1JYNA 2QTWB 3WQ7A 3E5QA 2ZCWA 2ZEWA 3W5NA 1MS0A 4R9DA 3EO6A 4YW1A 4LO6B 1AR92 3IPVA 1S0CA 4QGLA 2VOXA 4OHYA 1CQ9A 2IWGB 1QDCA 3UGHA 3W58A 2P5BA 3OBZA 4BCUA 2GH2A 1RUJ3 5FQ0B 4XABA 3APBA 1KDKA 1REEA 1AL23 4Y1XA 3RJ2X 3UJOA 2ZPXA 4XF3A 1PGW1 4XJ9A 2YMZA 4YFWA 3VBRB 5BNPC 1RUJ2 3LWCA 3SQOA 5J09A 4GKYA 5JXIA 1M4WA 3FHIB 5M0TA 5J98B 1UPSA 1AL22 3ZFEB 4XUPA 4K3UA 3ZN6B 3WNKA 4NVPA 4IV3A 3VLBB 4YZ1A 1FATA 5ABJC 1X82A 1YC61 4HN1A 5C3PA 2CDOA 2EXIA 4MVTA 4EWEA 2I74A 1RVF1 3S6PA 1UL9A 5A3PA 4YZ5A 1KQRA 4TSVA 3AFGA 2BVVA 5DZGA 2VJXA 4NIGA 4XIKA 4Z2AA 4LA3A 1D4M2 4QHBA 5L9BA 1Z7S2 2I2SA 4AGRA 2C26A 5DPNA 4DINB 2D97A 1D4VB 1VRBA 1XE8A 4ISQA 4K8RB 2YBSA 1OA2A 4URTA 1QJU2 1SCSA 2XUMA 3H9AA 4KBBA 4UI9L 5F1RA 4OFGA 1VBE1 5LK5A 5F3CA 1OD5A 3H50A 5HXVA 3R4DB 3MIEA 4HPKA 2JD4A 5FY0A 4RS5B 1QJX1 1LULA 3RQ0A 2RV9A 4XJ8A 1CESA 4AQ6A 4L92A 2AYHA 1XC6A 1K42A 3LFMA 2JJ6A 1POQA 2J22A 4Y20B 4R9CA 5A7WB 2W1UA 1ULEA 4HKWA 2JDMA 5IK5A 5FKCA 4XBNA 5FZ6A 1K12A 2D3SA 1VP6A 4ONUA 1ZX5A 2CY6A 2DU1A 2PHTA 3M70A 3PHMA 3QLQA 5DUUA 5H9QA 3ZDSA 4LOSA 4X8NA 5CKMA 4CDUB 3BKZA 3CKHA 2WQ4A 4PIZA 3AX4A 1J1LA 4QKBA 2YBKA 3N7JA 5IFPA 1MS5A 5FOBB 1RJ7A 3ZFEC 2P17A 1D2QA 2WN3A 2WJSA 3MIDA 4Y22B 3VZKA 1QJEA 1WBLA 2FZ1A 2VY0A 1DFQA 1LHVA 2P3IA 5ERLA 1PM4A 1RXGA 4FSJA 1YQ5A 3IAPA 1YQ2A 3H3LA 2O8QA 1MZ5A 1FOD1 1RUI1 4NJ4A 5AC91 4MUVA 1QJX3 1YQ8A 2IXKA 4CCOA 1HB3A 4QX5A 5JR2A 2SBAA 4W6WA 1HJGA 5A70A 1Y43B 1MR5A 2PAKA 4LLOA 4XPVA 5BNQA 4D8MA 2D6OX 1ULFA 3V0AA 2E7AA 3NV1A 1FX5A 1UIKA 1HQLA 1STMA 2FDHA 4DUWA 1C1LA 1CX1A 4XTMA 3JCIA 4Y5TA 2MEV3 3PUIA 4RHV3 1MZ6A 5A32B 2BGPA 2GN3A 2H6CA 3ZN5A 4RS5C 2Y38A 4G9SB 1V70A 1IGOA 3VZMA 3TN91 2XG3A 5C8CC 4D6QA 2MEV2 2IXJA 3TEWA 4RHV2 5I0RA 3WP5A 4R52A 3DCQA 3O0VA 3JXSA 3Q9OA 3PU3A 3S5QA 3IWZA 3OY8B 2VULA 3POEA 2QQMA 5FV3A 1RHI1 3KV5A 4CDUC 2RM21 2UYAA 2ADEA 1QJY2 4XAAA 1TEIA 4E4HA 3GM8A 1UZZA 3EB7A 2XB6C 5IAXA 2YHJA 3NNGA 4QB1A 1NXMA 2GNTA 4Z82A 2IVIB 4XF0A 4AEDB 4A3ZA 1BHGA 3N7MA 3S30A 3VBUB 1F31A 1WLTA 3GGLA 1W8OA 5K0UB 3OEAA 4KI5M 4FPFA 5FZ3A 3ZO0B 1W8WA 5J1XA 1PIV2 1R092 3RS6A 5KC5A 1IOAA 3VZLA 2NMOA 1NE4A 4WM7C 5CVRA 5EYXA 3WD5A 1ZRRA 1X36A 5JSPA 2ZHLA 3WNMA 1JS9A 4BB3A 1ZBE2 5FY5A 4HBNA 1DF0A 3SEPA 3ZXAC 4N8MA 1VLNA 1YEWA 2GC3A 1ZYBA 3V0BB 1Y9GA 5H9PA 4YM3A 3RZLA 4Y5SA 1DHKB 2RM23 1LGNA 2ARCA 4N90A 3PUSA 4WVMA 3MGUA 2FHRA 2WWUA 1NZIA 2ZACA 4ZU4A 5BV6A 4XJAA 4ZS2A 1FMD1 2OA2A 4ZKTB 3USUA 5FYMA 4D69A 3EYPA 3J8F3 4NHYA 1XSQA 4H2AA 3N7LA 1CWPA 3N9QA 4IEYA 1OLQA 1RUD1 4PI2A 2WFF2 1XNAA 4TZDA 1JU3A 5I8YA 5EFUA 2RS52 3MEPA 1XU2A 2E31A 2YC4A 2VCCA 3T3YA 3B02A 2E51A 3J8F2 2RE9A 4FTSA 4ZZ8A 4JDOA 4GJZA 1KS4A 4YARA 3T0DA 1DYKA 3UJQA 3MUY1 3VBOB 4AEDC 3OPWA 3IZOA 3J7NA 3FMGA 1DGWA 1Q8SA 1UAIA 5FLHA 1RUF1 1AYN1 1UZ0A 3I2JA 3JB4C 4GA9A 5K0UC 1KDMA 4OMDA 4KH9A 2JD9A 2R7EB 5L7OA 4FTEA 2XKPA 1W6NB 2C0ZA 1H4HA 1CPNA 3LKJA 4PDWA 3ZYHA 1PO11 2DF7A 2NYYA 3GCXA 3M3QA 3M7AA 2WNVC 3GZUC 4CXWA 4CP2A 1J3PA 2WNUA 4META 4B1MA 2OKXA 5T55A 4Y1ZA 1RUD3 4YVWB 4AK3A 1HXS3 1EV11 3VB9A 1DBNA 1RL3A 1WW6A 1YI9A 4Q4X2 5B4XA 2UWBA 2AREA 2LRPA 3O0WA 2GZWA 1J59A 2C4XA 1V6NA 3AK0A 3KQRA 1PMIA 1QH6A 5FYCA 5L36A 1HXS2 4AI9A 3MV01 1AXYA 2A3XA 2J1TA 1ULGA 1W6MB 3CJIA 5C9AA 2D6LX 2Y6KA 1S55A 1AR63 3NJXA 4RQPA 5F3EA 4R4ZA 5E6HA 2B5HA 1AYN3 3EHKA 1UCXA 3WG1A 1POV0 5IVFA 1ND3C 3IMMA 2J1RA 3LEIA 2HWD3 1ZREA 1PX3A 2W47A 2ZX2A 3D3AA 1UOJA 3PUHA 1APNA 1SLCA 5FMOS 5HV4A 1AR62 2WO7A 5I93A 5CKNA 1PGL1 2ZGLA 1S2BA 2XH6A 2AENA 2Y0IA 4N53A 5GZEA 2HH9A 3ME2A 1AZDA 1XNBA 3VBOC 1H8TA 1DQ2A 1OA3A 5CBLA 4ZS3A 4CU6A 1EV13 2VM9A 3ZYPA 4Y1VA 3AVSA 4RR3A 3O5SA 1BMV1 3IIAA 3KGZA 1QNYA 2WABA 2YB7A 5F2SA 4AVCA 3O1SA 2YFUA 1ALYA 1X9TA 2Q4SA 2W87A 4M4PA 4CE8A 2ZZJA 1RXFA 4LK6A 2WNOA 2QVSB 1HRV1 3JU9A 5FQ0A 3VD4A 4LJHA 4XOGA 5IK4A 2ZHNA 2ZJCA 3SMHA 1W8NA 1COV1 2BFUS 1DDLA 2ORXA 4YVWC 1RMU2 2OZJA 1XNCA 2EIDA 2RJKA 3VBRC 1UZWA 2JICA 2Y6LA 1E5HA 2DVGA 1W8UA 1SACA 2SLIA 3K48A 4Q0VA 5JI7A 1PZ9A 4Q1RA 2QQOA 4NHXA 1MEC3 2OVUA 2WUHA 3P3PA 1C1FA 1AR71 4LBOA 5FYBA 4GH4A 3HR9A 2VW2A 1IKQA 1JHNA 2ZKLA 4GJYA 3ZIXA 3VKNA 5GKAC 2ET7A 1LHOA 3GDBA 1MEC2 4EN7B 4WVWA 4AQ2A 3PIGA 1KGYA 1ASJ1 1QQP2 3H7YA 5DAVA 2JKBA 2WKKA 3KGLA 1CZVA 1T6GC 1G86A 1DZTA 5I0TA 4BU2A 1HRV3 2FQPA 1U0AA 4QKFA 1EYBA 3IB3A 3THDA 3W5MA 3VBFA 3LDRA 2RG4A 4CP0A 1PNFA 2W92A 3VDAA 4S2DA 1UYYA 1JZ6A 1OH4A 2JKXA 3RNSA 4HG6B 1J3RA 3PVEA 1ACCA 3R05A 4XHBA 3RMXA 1QXRA 2BVBA 5GZFA 4ASKA 2F4LA 4C0BA 4UW5A 4I3PA 3O0XA 4R4XA 5E88A 3WW3A 1VBC1 3KZ4C 1WD4A 4CU8A 5C3SA 3HT1A 4PF5A 1C8M2 1RUE3 2J42A 5GALA 3SCFA 2I45A 2QE3A 4IL7A 4CDQB 3WW2A 4UBHA 4L99A 1ASJ3 5EZWA 5APAA 5B2GB 4BIOA 1Y9MA 4CDUA 3R6SA 3J26N 1RUE2 5C7GA 3ILFA 5SV8A 4YZ3A 5FOJB 4Y22A 1L3JA 2RR11 3B00A 4PBPA 3U1XA 4AOCA 4AVTA 1XB9A 1DGLA 2WO1A 4WZCA 1EAH1 4ARXA 2N7GA 4P14A 1GOGA 5DZFA 1SBDA 1S0EA 3HQXA 3MIBA 1YXWA 2XJRA 3RWNA 2DCKA 1DIWA 2QQWA 1VBD1 2PTMA 2ZMNA 3AYAA 3M3CA 1PO23 3D5OA 4OUEA 1TME1 3FN9A 3RFRA 2R0FA 1R081 1R1A2 4QKNA 3HD8B 1OOPB 4IEOA 4KWUA 3Q8CA 3DUIA 3MV11 4HOOA 4AAXA 3DYOA 2KD7A 4WVVA 3ZKUA 4CZSA 4ARYA 5ANQA 5EJZB 3WY6A 1QH7A 4TWTA 4QGMA 2XMLA 4FFFA 3IDEA 5FMBA 2WR9A 3K4DA 4HVOA 4CCKA 2RR13 1NLRA 1NOVA 1XYOA 3POBA 3OGSA 1ZRFA 1YCIA 2DFCA 1GQGA 2NP0A 1AX2A 2A6YA 1UZVA 5LBBA 4JHTA 1WCQA 2J1AA 4LBJA 4OI1A 1VB2A 4QDSA 4UT5A 1IS6A 5DQ0A 3C8XA 1VRH1 4XQ4A 4CDQC 4S2FA 4CVUA 1S1AA 2W46A 3GBGA 2D44A 2JG8B 2PXJA 5DAXA 3WF1A 1VBD3 3WF3A 5FAXA 3OUIA 2DTYA 2AUYA 3ZXLA 4L11A 2BZDA 1NCQA 3ZLIA 1V6JA 2WC2A 1UXXX 4AG4A 3C7FA 5JMCA 2ARBA 3NWKA 3VBUA 2PHFA 5I8TA 4Y4RA 1PZ8A 1YJLA 2LS6A 1B35A 4UFIA 1JZ7A 4D7TA 5K0UA 4EN6B 1S0DA 3SH4A 5C5UA 1O7FA 1VE0A 2BV4A 2VW0A 2IXCA 3B94A 5CKQA 2WZR3 1RUG1 5A1FA 2D7FA 3ZOIA 1HW5A 1VBB2 3K77A 5FY4A 4KMQA 3K46A 3TEXA 3I2KA 5DDJ1 1DYOA 1W39A 1OOPC 2WO3A 2XBO1 2ENRA 3HNYM 1BVVA 2WZR2 2VUJA 3ZN4A 1VRH3 2Y8KA 1C5IA 3V0BA 3WSOA 1OVPA 3HIFA 1OFNA 3GBWA 3FFZA 3JD71 2WS93 5T52A 3RYKA 2HWE2 4K7JA 5DG1A 3S5AA 1I9RA 5KC6A 3AFKA 4LLFA 4Q0SA 3E1F1 1JYVA 5CNAA 4AGGA 2K46A 5DUXA 1K45A 3WG2A 4SBVA 4BLJA 1W6PB 2VR4A 3IMNA 5JOWA 2CHHA 4FO9A 5LA2A 5A33B 2RDQA 2W95A 4LNVA 1F35A 2E33A 1RUG3 2G19A 2JG8C 4A41A 4DFSA 1SMVA 3ZFGA 3OYWA 2Q8DA 4AW7A 1XE0A 1YUDA 5HCFA 4UW6A 3D4KA 4BQYA 1UY4A 2TUNA 1U5IA 4EZ4A 1Z0HA 1W2UA 5DDJ3 3VBOA 2XBO3 2JDYA 3MHZA 3SEEA 2ZX4A 1G7YA 5GLWA 2LUWA 3HQRA 4JGYA 4UF0B 4FOVA 1JOBA 3JD73 3E6DA 3JBG1 1IPKA 1YIPA 1W6NA 1VBA3 4JDMA 3T08A 4XW3A 4EZHA 5ISLA 4LK7A 4A44A 2PLV3 4P9LA 3KCXA 2JWPA 4Q0UA 4FQ4A 1QMJA 3O12A 2O14A 2XWBB 3MFAA 3NVCA 4LIUA 4V1PA 5IVYA 3VDCA 3LOBA 2YGMA 2VBBA 3FUQA 4YZ2A 4FBFA 3I2DA 3GALA 1XQNA 2AEZA 3LFIA 4BHPA 1VBA2 1HRI3 1ZA7A 1GANA 4NUBA 1W2NA 4YZ4A 2PLV2 3ZSLA 1B09A 2EXKA 1H2NA 1PHMA 3FFQA 3KV9A 5F32A 5LEKA 2DYCA 5FPBA 3T2TA 3P6BA 1JUIA 2R1BA 2ID4A 4XJUA 3ACGA 1HRI2 3B3QE 3MIHA 4XURA 1ND2B 4QM8A 2P2KA 4NOTA 1FV3A 2Q5TA 1FAYA 4UXAA 5FZ9A 4BK4A 2A3YA 2RJLA 1CAWA 4DIQA 3GNEA 1IQAA 2BTVC 4FVVA 3OBRA 1GOFA 2W9XA 3A23A 3JBG3 4FQZA 4LHSA 4WVZA 5CYYA 1UF2C 2WZ8A 4EV0A 2HJIA 3ACHA 1OXCA 4Q27A 1S0GA 3ACIA 5I8SA 1TMF1 5LRRA 4FOWA 1C8NA 4LE3A 4XFBA 2VC9A 5A3OA 4NIAA 1XJAA 2VGDA 4HKOA 5DUWA 1NXD1 4C1XA 5ACA1 1N1TA 1CZSA 1UU6A 2EICA 2VZSA 1UO9A 4FT8A 4FCAA 3NMBA 4OMCA 5IVBA 1WMXA 1W9YA 3WOGA 1GMMA 5LBCA 3ZX7A 2A6VA 2R49A 4JKLA 1JODA 2BJSA 3ES4A 3GYDA 1AYM3 4A6OA 3DXTA 1W03A 2PHUA 1MS1A 4NIIA 4D0QA 1N3OA 4BDVB 2VTXA 4LA2A 3TEYA 2ZAAA 3IKWA 4QQHA 4P00B 5BY5A 1F4HA 3SKVA 3PVBB 3LOIA 2HWF3 2JB4A 3QBQA 1AYM2 2X5IB 5BPXA 2QQNA 5A3TA 4CXYA 4OVEA 1PVC3 4JDNA 1BBT1 1TMF3 3BUCA 2R043 2HWF2 1W04A 2EVXA 1LOCA 1SLIA 1GQHA 5T54A 1ND2C 4XQDA 5ACA3 1JZ4A 4E4SA 3R4UA 1PVC2 5FZFA 4K1ZA 2FDJA 4QPGB 3BODA 1F15A 2R042 2VXRA 4LORA 4A42A 3VL8A 5CG9A 2DU0A 4S2HA 4M0NA 3V65A 4MGZE 3CIHA 3G6JB 3HMYA 2BBAA 3N36A 2ZEXA 3WCSA 3WLUA 4BXSV 4MYEA 1O5UA 3B69A 3QACA 4ASLA 3D0SA 1MS4A 1GZWB 1T2XA 1ONAA 5FBJA 1NAEA 2QDNA 4R9BA 1W6OA 2BOJA 2VD7A 3KM5A 2R061 4AFDA 1LOAA 4Y3OA 1G9AA 1D0HA 1H2LA 1BBT3 3E6BA 2P6HA 4RA0A 1YJKA 2W1QA 3LAGA 2HEWF 4OI2A 5JXHA 1NCRA 4P9IA 2DUPA 4Q4V3 5FZOA 1OC1A 1W2AX 1SBEA 1GZCA 1WA4A 3AP6A 1ZRDA 2WRAA 1BYHA 2VUCA 2Y64A 2UY9A 2Q30A 4CDQA 1UOBA 1UN1A 5LK7B 4ZU5A 2X5IC 2E32A 1SEFA 4TYSA 4CU7A 1VMJA 1WKYA 3FX3A 4MHUA 3TNPB 3UKVA 5SV5A 3WINE 1F2NA 1F5JA 1REFA 4HT1T 2GP3A 4YNIA 3FE5A 1GNYA 4EJRA 4IETA 4LIVA 2DURA 4J1WA 5GLTA 4HK8A 2ZMKA 1W3VA 1YHFA 2DVAA 2RS33 1GQPA 1RUJ1 3EQEA 3OUJA 2OIIA 2OUHA 4QPGC 4XUOA 1HB2A 4Q4Y2 3Q8FA 2AEYA 3UKTA 5T50A 3W59A 5ABJB 5KXCA 3GZTB 1AL21 4MGSA 2UY8A 4QB2A 4DXRA 5EYYA 4E2SA 1WA6X 3RGBA 2RS32 3WF0A 4GIQA 1OOPA 2NLRA 3I3BA 5LW9A 2QDRA 5FP7A 2G9FA 2Z4FA 5KWRA 3WDWA 1AR93 1HKDA 3GXUA 5FK8A 3VDDB 2QQKA 5DUVA 4YPJA 2YGLA 1F4AA 4Y4YA 2D93A 5JZGB 1XYPA 5A80A 1ZZ7A 2JDUA 1NQJA 1D0GA 1I6XA 2QZ2A 1G6NA 3OF1A 2XONA 2O0OA 1QJU1 4F7ZA 4W4ZA 1UMIA 4OUSA 4EROA 5BNNC 5GLZA 4UFMA 3RI9A 4I0AA 4WBBA 1ENRA 2C5DA 4HONA 3WQ0A 1E57A 4CEWB 3AL5A 1N1SA 2B46X 4P9JA 3AKPA 5FPXA 3BU7A 4DUVA 4H3WA 5BXXA 3U14A 1PK6B 5DXDA 5IUQA 3SH5A 1HIXA 3J9SA 5F5AA 3TBDA 3URFA 1V6IA 3VN4A 4DQAA 3Q8AA 5IT6A 4HLTA 2YPJA 2CAUA 2PFWA 3M1HA 2DDUA 3D0JA 4KU8A 4YVSC 4HN0A 3O1OA 4YRDA 1IG0A 1J84A 2IXHA 1D4M3 1Z7S3 3WP4A 1UPIA 5FZLA 1T6BX 1MACA 2D6KA 3HWJA 4C1WA 4XFIA 4UW4A 3NKTA 1QJU3 4JGZB 2YV8A 4Q29A 1UKGA 3ACLA 3UGGA 2OX0A 3CNAA 3RZMA 3ACFA 4RL7A 4LBQA 1GZTA 4N43B 1BCXA 4LE4A 5KHHA 2O1QA 3PJQA 1CN1A 3MPBA 3VDDC 2WZEA 3LQCA 4OUMA 3AYCA 5FY1A 5H9RA 2ES3A 2WSUA 2XLFA 3G7DA 4YW3A 3OG2A 1TQ5A 2AACA 5A3NA 5C71A 3UK9A 1GOHA 5JZGC 4AVVA 3QOPA 1V9U2 4O9EA 2DVBA 3WNXA 4DS0A 4H7LA 4B4PA 1W6PA 2C9AA 3R0RA 4UFLA 5A3UA 5A33A 3I2GA 3WDUA 5C8CB 1OF3A 5BNOB 4Q0PA 4D94A 4YW5A 2B9UA 1M06G 1MS3A 3DPRB 2F4PA 1PNGA 4KBZA 4LKSA 4LO4B 4P5HA 4QM9A 4Y5Z0 5FRAA 4CEWC 5GZCA 4BLIA 4KG8A 4JTOA 1Q8OA 2J1UA 2MEV1 1OPOA 4RHV1 4AI2A 4COUA 4W8JA 1A6CA 4Y33A 1LOGA 1PK6C 4CP9B 4E8CA 3MW4A 3VD7A 5A7SA 1N1VA 2DFBA 2ZMLA 2ZHMA 5KXEA 3ZR6A 1HV1A 1MQTA 1A8MA 5D21A 5FJKA 4OI4A 5FZ4A 4E8DA 1QJY1 1CONA 3BOWA 1IQDC 2HKXA 2CDPA 1HLCA 3W9AA 1O8SA 4BZ4A 1O4YA 4D7SA 5K4LA 1X7NA 2XXZA 4LOTA 3POWA 1G9BA 2YBPA 1VAVA 1Q3EA 4JGZC 4DUXA 3OBAA 4WM7B 3FC0A 2QFEA 4ZXKA 3D8CA 4N43C 1YI7A 1ZVFA 2WDBA 3L9JT 4AFBA 5JDBA 4IUGA 5CA6A 2W68A 1R091 3KCYA 5FYTA 2V72A 3ZYGA 1TZOA 1DP0A 4GALA 1RVF2 3CL1A 3MICA 2VQTA 5GZGA 4B7KA 3TNQA 2W5FA 4ET7A 5FPLA 1ENXA 1ZBE1 3C3VA 3ES1A 4AFAA 3H0OA 2DV9A 4PQ9A 3AMMA 3H8UA 4Q0QA 1OVSA 2D6PA 5DZEA 2ZX0A 3POYA 2VZVA 1W8HA 3U75A 4UFHA 5FBZA 4AL9A 1SPPA 2PA7A 5BNOC 2E9QA 1J1TA 1QJY3 2ARAA 5BUVA 4KGGA 2QBXA 4XJWA 1QNWA 3AP5A 3DPRC 4IEXA 1O6UA 2Y6HA 3T2QA 4XXPA 3MLKA 1N3PA 2D43A 1YRZA 1GUIA 2OXBA 3ZVXA 3HBKA 5A6QA 1EP0A 4E4DX 2LTNA 1Q8PA 2R6QA 2BYVE 1JYWA 2WFF1 3WNNA 5FCCA 2BU9A 3X29B 3ZMOA 2UWAA 2RS51 3ITQA 2Y6FA 5IVCA 1DLLA 1PIV3 1R093 2WLPA 3J8F1 4AE2A 3GHNA 4L0PA 5IW0A 3R4SA 1SFPA 3WW4A 1TE1B 1ZBE3 3IIIA 3VD3A 5CADA 3GBFA 1ODNA 2XPJA 1WW4A 1HV0A 3K3OA 2XL9A 4M3CF 4XF9A 1LKNA 2WNVB 3AMPA 3RZKA 3GCWA 2HEVF 4M3CB 4QHZA 2X5IA 3PTRB 4FPYA 4UW3A 2XL7A 3PLQA 5LA9A 1PVXA 4WM8B 1LJ7A 4CEYB 3LZZA 3ROUA 1UQXA 4ISRA 1AR83 4A6SA 4LPLA 4DY3A 1RUI2 1SQ4A 2HWB3 4MOAA 4AHYA 5AC92 2B42B 5HXMA 5CFDB 1GV9A 3C7HA 3W21A 2ZKNA 4AQSA 3CDZB 2WFF3 4AHWA 2V4AA 2RS53 2Y0OA 5F39A 2ZGSA 3ZMNA 4Q4X1 2J1VA 4SLIA 1AR82 4QPGA 4LKFA 5FK7A 5A1AA 2HWB2 3B9IA 3OPZA 5F3IA 4MG2A 3T0AA 3I2HA 4MSVA 1ENSA 2GMPA 4DPNA 2XLGA 3OD0A 1NA1B 1GNZA 1HXS1 1ND3B 2JIJA 3RVHA 1GYKA 2A75A 4I01A 2EF6A 3RPQA 3T0BA 3VBSA 4K9SA 1IPSA 1QWRA 1GZWA 1RINA 2KXLA 2XUEA 5LASA 2X53S 5FZ7A 3MW3A 3ZFFC 4QXBA 1AR61 2CU5A 1OKQA 2FDGA 4BQ2A 4MX3A 3Q8BA 3DN7A 2IFWA 4CCLA 1JZ3A 3N9OA 2HWD1 1C4RA 4NRMA 5AFBA 4GWNA 4XETA 2BRTA 4FI9A 1LOFC 5CU1A 5LB6A 4Z1VA 4ZXEA 1LGCA 4Q4X3 5LA0A 4F8AA 2X05A 4LBNA 4OHWA 3RZZA 1XBFA 3N9NA 4YM0A 4HL0A 4WM8C 4CEYC 1S2EA 4BA6A 4D6SA 3CJXA 5JCTA 3WQBA 1R1ZA 5BNPA 4BISA 1RJ8A 2Z79A 4UOJA 5CFDC 3N9LA 2VECA 4RFT0 4PI0A 1RMU1 2DBNA 3K2OA 1CZTA 3ENRA 2RHPA 3HQUA 2ZGQA 4NHKA 1D2SA 3OSDA 4YGEA 5ABJA 4QXCA 1GZ9A 3ZYJB 2ZOEB 1S0BA 4QPWA 1NA1C 2CSGA 5FXXA 1GWMA 2PQSA 2LW8A 3NL1A 4NROA 2B4KA 3O1PA 4XFGA 1LODA 2DTWA 4CPBA 2GC2A 4LTAA 2ZGUA 4XUNA 2MPFA 1LENA 2G1MA 1YO8A 2WFPA 4WV8A 1MEC1 3SISA 4FAGA 5FMOL 4NIHA 4ZPIA 3T2OA 1O59A 3N35A 3KLSA 3H1YA 4LQRA 5IATA 5JZGA 1OQ1A 4DO0A 2BW8A 2YU1A 1OLRA 3HN1A 1W05A 2EIBA 1UOGA 1JU4A 4BPZA 1UWWA 4Y1YA 2B39A 3AZWA 2VXJA 1ZBA3 3POJA 3PURA 3FWEA 4K21A 3WX5A 2RVAA 1RMU3 2GMMA 3U37A 3USSA 3VKLA 1LNSA 2VTFA 4WZFA 3NAPB 1ULDA 2Q1ZB 1UMHA 2VOKA 5FKBA 2CWMA 2WT2A 3PDQA 1ZBA2 1RUF2 4QPIB 3VBRA 5CAZA 1VAMA 2C24A 4QMAA 1JHJA 1C8M1 1KITA 1N3QA 5G05L 1UU4A 2BFUL 2R30A 3T4VA 2EA7A 3QH7A 2EIGA 1PO12 3SH3A 4NRQA 3ZFEA 4I0BA 2PQQA 4M01A 5C33A 1QQP3 1WCUA 2CNAA 3ZN6A 2A6ZA 4BE3A 1YLLA 1LR5A 1RUE1 4IEPA 1KJRA 4LO7A 2H0BA 2QQJA 4CDXB 5FR3A 5FZMA 4QXHA 2O8OA 4JGZA 3PUQA 3HEIA 4HSLA 1UKRA 2WT1A 4M3CE 3KT4A 1OURA 4BQ5A 2GAUA 4GULA 2VZTA 3ZXFA 3T30A 1WGPA 2YYOA 2GMEA 3UESA 5JVVA 3UGFA 3CHXA 5FYYA 2VZUA 5JXGA 2WINB 2VNVA 2XVKA 3H7JA 1C8M3 1VAKA 1R1A1 1URXA 2QJVA 2OUJA 3FHAA 4RS5A 2WQ8A 5FFOC 2R0HA 1KRIA 3RDIA 3LPFA 4F3JA 5C8CA 1PO21 4TTGA 1W6QB 1BQPA 1JMUB 2X09A 3BYWA 4QGNA 3O1UA 4Y20A 3NAPC 3PJYA 4W6XA 5A7WA 2VQ0A 2RMU3 3AB0A 5G04L 5C70A 3H8RA 2KM2A 4H55A 2ATFA 2WA4A 4QPIC 4TLGA 5F5QA 3M3IA 4OCTA 5D8AB 2P1BA 3KSCA 2GC1A 2PHWA 1UOFA 2VL4A 2TNFA 2IXIA 4DMIA 1FT9A 1RGSA 2RMU2 1DYPA 1ZZ6A 1J83A 2VZOA 1HN0A 4FPLA 4ZZ5A 3I3DA 4J25A 2FCVA 4NN0A 3ZPOA 3RG0A 4Z07A 1YYNA 1IS5A 2PHDA 5FZKA 3SXWA 2A1XA 2IZWA 3KCCA 4CCCA 4UWDA 4IV1B 3DECA 2WL1A 3DKWA 4XE9A 4XMIA 4CDXC 1NG0A 1R1A3 2ZS6B 4DEQA 5JR7B 5FWJA 4KQ7A 5CFCC 3KV6A 3MI8A 4WM7A 1WWYA 4CDWB 4M00A 1JYCA 1SFYA 1AR72 3I4IA 5JSOA 3I8TA 3ZSMA 4A45A 5K8SA 2GC0A 5GZDA 3LEGA 4LBLA 3IBMA 4TXWA 1VBB1 5DMYA 3BTXA 1K5MB 3J4UH 3NNFA 2E6VA 5A32A 2FCTA 5JOZA 3NV4A 3VZNA 4PHZA 2A3WA 4QB6A 2WZR1 5FZCA 2OQ7A 1PX4A 3P1IA 5FP9A 2R073 1KD7A 3MW2A 1GFF2 2H6BA 2IUWA 2WNEA 4CCJA 4XFCA 4Q4W2 5KHGA 3WF4A 1WMFA 3BIEA 2HWE1 2JE9A 5JPMB 2DCJA 1OQDA 3OY8A 2EXHA 2R072 3M3OA 4XF1A 1AL0G 4AWDA 2E63A 2VMCA 3PU8A 5D8AC 1DQ6A 2DUOA 3FL7A 3H42B 2CGPA 3AZZA 2WS91 3WG3A 1VBC2 1HJFA 1Z78A 5LATA 2PHRA 2D3PA 4AEDA 4AYUA 4HVRA 2W0XA 1VBB3 1V0AA 2VTXJ 1ULOA 4IV1C 1W28A 3LIHA 1TG7A 1LGBA 3CO2A 2JEMA 3H3ZA 4MGIE 3KF5A 4OHZA 2OPWA 2Q8EA 2HLEA 1QXJA 4CDWC 5LA1A 3I7DA 1IZ3A 3LIGA 2ARXA 2WNVA 4QX3A 3SCHA 2VMGA 3VL9A 4M3CA 5CZKA 2WAAA 4DXSA 2HWE3 4IE0A 4QD2A 2XWJB 3WNOA 4CEYA 4BQ4A 5FZEA 1OPMA 2HYXA 1K5MC 1JOJA 3PNAA 1W9SA 3MUZ1 3K51A 5IFTA 1DG6A 1VBA1 1PGSA 1EPZA 2B9VA 3F2ZA 3BTZA 1TME2 4EWDA 1IS3A 2XLAA 2BGCA 2PLV1 4FFHA 1NLSA 1X8EA 1Q56A 5K9YA 1RUOA 5KHJA 1UXZA 2ZA9A 4DY5A 3UNPA 3ILNA 3ABZA 2V4VA 5FYSA 3L2HA 2GP5A 1DQ0A 1ND3A 1HRI1 4YGCA 1H1MA 4I09A 1PM7A 4NWWA 2ILMA 4QXKA 4XDOA 3VHOA 1RTVA 4QWNA 4JRAA 3HNBM 4W6YA 3ZXJA 4I3GA 4V2WA 1XOYA 2W94A 4L2NA 5AFEA 1WCKA 1LHUA 3CLPA 1H9PA 2VVFA 2G9GA 5FLJA 3BU0A 2WWSA 4FXKB 3AP9A 3PMEA 2WLQA 4A4AA 1D7PM 3PL0A 4N7IA 1JXNA 4GXLA 5IVEA 3QD6A 2A70A 1CAXB 4N9HA 4YLZA 2V09A 1FPN2 1US2A 4LULA 4FPKA 3LPGA 1EY2A 3BGAA 2UWCA 1U12A 2GH8A 2VMEA 3CQOA 3ETQA 1SZBA 1UY1A 2QQUA 1QDOA 1UY2A 2JDNA 4U36A 4YVWA 4S2GA 2XJPA 4LKEA 2DUQA 4GB33 3WXPA 3ZXEA 5JXJA 3UKNA 1S0JA 4MGQA 1J58A 2TBVA 2FDFA 5F37A 2VOTA 4Z2WA 1AYM1 3B93A 4IV3C 4KU7A 2Z69A 3BPZA 4ORFA 1W6MA 4XDPA 3HBZA 2HWC2 4YW7A 5A7OA 4GB32 2Q0AA 4MLOA 4LT5A 3HN3A 3WP3A 1WZXA 4EN8B 2E7QA 3VDBA 2Y34A 1VMHA 1ST8A 2HWF1 1NY72 3RYRA 1OKOA 3WHTA 4AI1A 5C4WB 1YIFA 4JHZA 3IM0A 4L8QA 1BEV2 1QJFA 2IXLA 1W2OA 2FCUA 3POIA 4XZUG 4Z8BA 3S0MA 1PVC1 4K1YA 3AYEA 4Q5OA 1WMEA 3KT7A 5LY1A 2WYSA 2IC1A 1QOSA 2R041 1DQ5A 1GR3A 1WLDA 1W0OA 2J1SA 4O65A 2VBPA 1O5LA 3AJYA 2QKDA 5FY9A 4IXLA 2ZX3A 3WW1A 3ZYFA 4CTEA 2VQAA 4D7YA 1RUH2 3AL6A 5BYNA 2H0VA 2F6BA 2XJQA 1W0PA 4Y26A 5FZBA 4IQPA 5A7NA 4GD4A 3WG4A 2WZPP 1OHFA 2AC1A 2AGSA 2BQPA 4NR1A 4XVHA 3BTYA 1WW7A 4P08A 4ITCA 1JH5A 1XXNA 2JDHA 2W08A 3CZJA 3JQXA 3MO4A 2VZRA 4G4FA 5FZ8A 5IWFA 1ZM1A 3OUHA 4JRLA 4JVAA 2CL2A 4IEQA 2IVJA 1W8TA 4ATFA 5HCHA 4JQRA 5I0DA 4XMAA 5J36A 1O3RA 2W1SA 3ECQA 5E8AA 3I54A 1O4ZA 4XBQA 3SCGA 1XSRA 2XVGA 5F9TA 1ZZ8A 1JZ8A 3V64A 4CXXA 4PCRA 5IK7A 5HV0A 2JDKA 1JN2P 4J6GA 3WUDA 2B7YA 1GNHA 1UZYA 2ZGRA 2W39A 1CX4A 2CAVA 3AZVA 3GZAA 4Q4V1 4QU1A 4CUAA 4GMP3 2Q1FA 4KNCA 1OFSA 4P9GA 3Q8EA 1QU0A 5F5IA 5T5LA 4CUCA 5KHKA 3MF9A 4QPYA 5C4WC 4CYDA 1CIWA 1PMHX 3K4AA 2PHXA 4C91A 3WNPA 2JDPA 4P9WA 1BXHA 3BVCA 5C3RA 3BALA 4Q4Y1 1HN1A 3LEKA 4RGGA 4AEJA 1S4CA 3POFA 3LSEA 5D1IA 5EXOA 5JLVA 2Q1MA 2RS31 4INDA 1OF4A 2ADDA 5KXBA 5F6KA 4YYOA 1VPHA 4JQTA 4AXOA 2AR6A 2GNBA 4HFSA 5JI9A 3H3UA 1ULPA 3USUB 1GICA 1W6QA 3UT0A 4EWAA 5FREA 5T5OA 2ZX1A 5DN2A 4BQWA 2JENA 5HBAA 2E7TA 2D5FA 5BNNB 1A78A 5E89A 5A7QA 2ZGOA 1AR91 1NE6A 3AP4A 1LOBA 3O1RA 5D8AA 1I5ZA 5FPUA 3N9MA 4YG0A 3SKJE 3B7MA 1OLME 3I3EA 1Q8QA 4NAOA 3AVRA 5C6CA 1Y7BA 2VMHA 4Q4Y3 3TB0A 1O91A 4CCDA 4N9IA 2ZGPA 2JECA 2YXSA 4IERA 4R8HA 2QQPA 3BTAA 3LB9A 4CRQA 3FZ3A 1RIRA 4YVSB 4IV1A 4IW3A 4AFMA 4CSWA 5L7OB 4FPOB 4IE6A 1RUC3 2NMNA 5FYUA 1PZ7A 1BJQA 4PDWB 4HK9A 4LO5B 3SHRA 5CG8A 4CDWA 3BB6A 2OQ6A 3D82A 3ZXGA 3NNLA 4B4RA 4XFAA 5LY2A 1GP5A 2WNUB 1H6YA 4L9BA 1TVGA 3UV9A 1G9CA 1C28A 1RUC2 1UX6A 4OQ8A 4LMFA 3BN6A 3N7KA 2PHLA 1XNTA 4UYBA 4H14A 5A3LA 3H8XA 4CCEA 1LU2A 3C7GA 3THCA 2QNKA 3TRSB 1LHWA 1A8DA 2R16A 4XC9A 1W9FA 4QX1A 1D4M1 4IEUA 1Z7S1 3M2MA 3QH6A 4DXTA 1LTEA 2ZAHA 4PBOA 4RQPB 1JYIA 3WF2A 1ZNPA 4LBQD 5CEHA 3O7OA 4H7MA 4XAEA 1JI6A 3WQ1A 4BJ0A 4B3NA 4COYA 3AMHA 1V9U1 1DZQA 4EYUA 2QQLA 2JG8A 2D40A 2P4EA 4NO4A 3KS7A 5L73A 4N53B 2VAUA 4IDZA 4AEKA 1H8TB 3AXDA 3J7HA 1QJZA 2DVFA 1US3A 4ZHNA 3VHNA 4COVA 1H9WA 1HQNA 1YQCA 2VW1A 1RYYA 1MVQA 4RR3B 3JQWA 4ES9A 3KWVA 2TEPA 5L7OC 3AXEA 3NW4A 3E97A 4LKDA 1QOTA 4PIYA 5IK8A 2ZTNA 3V56A 4JX0A 4PDWC 3PIJA 3O1MA 3MBWA 3AKTA 5EP9A 5FXZA 3RSJA 4PIXA 4NHLA 4Q26A 1LOEA 2YC2A 5A3MA 3OTFA 4AVAA 2WNUC 5T3NA 1UU5A 1H30A 3PMSA 4UBGA 4Y1UA 1GBGA 1ZA4A 3ZSJA 2QQIA 2RS13 4IGOA 3LCPA 4XCAA 1V9U3 5FYHA 2QCSB 4KWKA 4XEZA 1OI6A 3DYMA 1JUHA 4GWMA 5FZ0A 1N1YA 2GU9A 4O9GA 1N47A 3RI8A 3TYJA 1QHDA 1UYXA 4MXWB 4M0HA 3AZYA 5EWSA 1Y4WA 1I1EA 5A6ZA 2RS12 1AF9A 1V6OA 3CJIC 3MF6A 4GH4B 3TWIA 1CD3G 4KG0A 5C9AC 5FZAA 4RQPC 4PJYA 2VO5A 3JB8A 4YW2A 4EE2A 2XR4A 2FMDA 3DKQA 3NNMA 4NPMA 5FJHA 5T5PA 2OZ6A 3HPNA 2Q8OA 5LCWL 1EPWA 2BNMA 3FLTA 1XU1A 1GWLA 3KD4A 4XACA 2XJTA 2WT0A 3NV3A 4N53C 1OLMA 5FYIA 1H8TC 4XF4A 1JYXA 2VUAA 3VBFB 2FDIA 4XDQA 5FPZA 1UX7A 3IN9A 4NPRA 1KFUL 4RR3C 3LDBA 4YG6A 3WCRA 5JUVA 1FYUA 4UF0A 1W90A 3PUAA 4NWVA 5FP8A 4IEVA 3AZXA 4I2OA 1CAXA 1FV2A 2XOMA 2A6XA 2KR2A 4GKXA 4NE9A 3UL2A 4QX0A 1PGW2 1UIJA 2C9KA 3ZXDA 5FZIA 4AI0A 2J1EA 2BNNA 4QQOA 1SLBA 4E27A 2ERFA 3MDPA 2ZABA 3B01A 1U5ZA 1RVF3 4IEZA 4IGQA 1JYTA 3MLLA 2YG0A 3WZ1A 4O61A 4URAA 3ZKYA 2YFZA 3AMNA 3NNJA 4RGAA 3NJYA 1XRUA 1JOPA 1PIV1 4YSFA 1KFXL 2E53A 1CIYA 2EAAA 2GSYA 4FXGB 1SDDB 4GH4C 2Z42A 4D3WA 5GM0A 1TNRA 1VBE3 4K6BA 1GP6A 1ND2A 3POGA 1DU3D 2WAOA 3ILRA 4U2AA 5FWEA 5KBFA 3HT2A 2VCBA 1SFNA 4C0HA 1ULCA 1NX9A 5JOYA 2VMIA 1E5RA 1R64A 3ASIA 5C4WA 1SG3A 1F9KA 4CU9A 3LF7A 4FPHA 1VBE2 1WCDJ 4LO8A 2QQVA 2KA3A 4IEWA 5FO9B 3GF6A 2JB8A 1AR81 1O8PA 3KB5A 3MYXA 4HZFA 2GNDA 5KXDA 4DXZA 2HWB1 4LUKA 2XJUA 3POSA 3PTYA 1QJX2 1H1IA 4JV4A 2P37A 4GAZA 5H9SA 3VBFC 1X8MA 3OBTA 1HDKA 3U4SA 1OD3A 2BGOA 4Z92B 4A2UA 4DRVA 2JXAA 4CUBA 3ZM8A 2YUEA 4Q2FA 3KMHA 4PT6A 4JAAA 3ZFFB 3NO8A 2WWJA 1JZ2A 1AVBA 1YQ6A 1VALA 3P3NA 3TEZA 1C3HA 2BNOA 5LEJA 2K2SA 2YROA 4FOYA 3CF6E 4FPGA 4I02A 3VZJA 1QF3A 4RD7A 2CWSA 4DB5A 1UMZA 5FTTC 2NN8A 3QCWA 4A7KA 3KVBA 1NKGA 2V5YA 1S0IA 4CA9A 1FOD3 1MS8A 1RUI3 5AC93 3RZHA 3T1LA 4LHLA 4YW4A 1CAVB 4MGTA 4ZY9A 1YFXA 1S2KA 1XE7A 2PAMA 3E5UA 1SLTA 3ZYIB 4P9YA 1H0BA 1NCQB 2HEYF 2VNOA 2W91A 1YWKA 3VBHB 2BUKA 4LEJA 1FOD2 5FPVA 3S7EA 1XYNA 2NQYA 2P3KA 4RSUA 4FFGA 4CCMA 3WDYA 1B35B 2VCAA 5JWPA 2A5ZA 1O3TA 2L9LA 3SITA 2A7AA 4XXAA 4HVQA 1H2MA 4TLFA 2FD8A 4JTNA 3RMYA 4FTBA 4ES8A 2VCMA 3I59B 2Y60A 5LBEA 3U4XA 2HYKA 3TN93 3WV6A 5J7MA 3B9CA 5JOXA 5FMCA 2ZGMA 3FLPA 3O1VA 4BQ3A 4DZGA 3T4HB 2XQXA 1A34A 1OBNA 3E6CC 1L7RA 3WDVA 3I97A 3VD9A 2BWCA 4XIOA 2VBDA 2F17A 3TN92 1RHI3 2WIIB 3FLRA 3I2OA 5JSRA 2UYBA 3A21A 4X6RB 3EBRA 3AKRA 2LM3A 4XUQA 4YWAA 5FPAA 2AZ5A 2ZHKA 3HVDA 2DCZA 5D2AA 5A6XA 4FP2A 5IHRA 1NLQA 4AAPA 3HJRA 3KHCA 5DG2A 1RHI2 3INAA 2Q8CA 4CPBD 5A6YA 1RITA 2RM22 3J7LA 3AJZA 3RRDA 4E2GA 4ZONA 1XNDA 2JE8A 2OT7A 3ST7A 5BNNA 1SDWA 2W1WA 4IESA 4PF1A 3SNMA 1W2TA 4LUMA 2Z5WA 1POV1 3K3NA 3DGTA 4UAPA 3CU7A 4NMIA 1HX6A 3ATGA 3K4ZA 4IE7A 3VGIA 3N3HA 2OYZA 4AFCA 2G9ZA 1W9TA 3OYWB 3ZFGB 4YGBA 5A7PA 1AHSA 5J3UA 1NCQC 3VBHC 4NAMA 4NIDA 5I91A 2FMYA 1YFUA 3K75B 4QHOA 3VBUC 3EJKA 4EN0A 3ZPYA 4C8DA 1ZBA1 4CUGA 1B35C 3FBMA 4JGYB 4QQLA 4BIFA 4YVSA 2NPIA 4R9AA 4XILA 5IJRA 1BK1A 3WP6A 2XHNA 4MGKE 4KWJA 1O4TA 5IVJA 4A7ZA 3ZYBA 2JG9B 5CB7A 4GZ9A 1FMD3 3ZIWA 4F83A 3OEBA 3ORJA 3ELNA 1UYPA 5DAQA 4NHMA 2VVEA 2JX9A 1UD1A 4LBMA 3VKMA 5LRSA 5TSWA 1S0FA 5DAPA 2VNRA 2AH2A 1YFWA 1POV3 2FBEA 1C5HA 1FMD2 4OLLA 4UFJA 4W50A 5J48A 4FPEA 4GQ7A 4X6QB 1QQP1 2VUDA 3VDDA 4E2QA 2QUOA 3IDBB 2ZGNA 5L9VA 3AP7A 4B1LA 1RUD2 5A3WA 3FHQA 3DF0A 5T5JA 2PN5A 4KL1A 5FYZA 2I07B 2J7MA 2BPA2 4EQVA 3SC7X 5FDBA 1A3KA 1OA4A 1SHWB 1RUF3 2Y6JA 1AJOA 3VUOA 5FY7A 4K20A 3T2PA 3BCWA 1CAWB 5IVVA 3M4FA 4B29A 1WD3A 4QQPA 1L7LA 4QX2A 2ORZA 1GSLA 1NYWA 1REDA 4HETA 1HB1A 5EIYB 1PO13 5EJ3A 4CEWA 3ZFGC 3IAQA 4YM1A 2PYTA 1AYN2 4TN7A 4Y24A 3BPSA 3A4UA 3ZR5A 1WLWA 2HWD2 1PK6A 1VJ2A 4RN5A 3ALQA 3LGRA 3ETPA 3NV2A 4OHXA 2D3RA 4QT6A 5HPOA 1QEXA 4JGYC 5L19A 2VMDA 1RB8G 3OB8A 1GU3A 4X8PA 2DCYA 4DNYA 4N7UA 2VZPA 2WYFA 2RMU1 2JG9C 1WCSA 1EV12 4MADA 3MPPG 5EJ1B 3WDTA 2ZGTA 3OGGA 1GKBA 4OZOA 3OGVA 4QDRA 5CFCB 3IT8A 1K3IA 5CISA 3WEZA 4AQTA 3VKOA 4N43A 1NQDA 1O3SA 2C1FA 3OD4A 4YW6A 4EN9B 1DGRA 1SCRA 3LSDA 3VHPA 4MXWA 1CAUB 2XJVA 3HOBA 3C7EA 4XJZA 5HCAA 3H8OA 1CPMA 2LALA 2VE1A 2ZZQA 1DGWX 1ODMA 1MVEA 3C7OA 2P34A 2PELA 2VOVA 4K40A 4OULA 3GJAA 4Q1PA 1LAJA 2GALA 5FZGA 1PGL2 2JDAA 2BEOA 1F8VA 4W65A 2FDKA 2ET1A 2P6CA 4GWJA 3DL3A 3VZOA
chains in the Genus database with same CATH topology
3OEAA 1F4AA 4KI5M 5J1XA 5JXJA 3T09A 4MGQA 3HNMA 2XONA 1W99A 2VOTA 4W4ZA 1UMIA 3WNMA 3SEPA 3HN3A 5B4NA 3VDBA 1I5PA 4JHZA 4DUVA 3NQHA 4QDQA 4XZUG 4MO3M 2WYSA 3EYPA 1H6XA 2J1SA 2WBKA 2DDUA 4DEVA 1L7QA 1J84A 1XNAA 1JU3A 2X10A 2E31A 2YC4A 2VCCA 2Y6GA 2ZEYA 4XVHA 4P08A 2VMFA 4ZZ8A 3MO4A 3CZJA 2VZRA 3ACFA 3T0DA 3MUY1 1PMJX 1MPXA 5I0DA 1UZ0A 2WZEA 3LQCA 3I2JA 2W1SA 1W9WA 3ECQA 5C71A 3OG2A 4OMDA 2JD9A 2R7EB 1GOHA 4P02B 2V5DA 3A22A 1JZ8A 1JZ5A 3NJVA 3I2GA 3LE0A 1OF3A 2OKXA 4CUAA 3CZUA 4LKSA 5B4XA 1PMHX 2J1UA 3K4AA 2C4XA 4W8JA 3WNPA 4E8CA 3MV01 2J1TA 3VD7A 1UYZA 2Y6KA 2ZEZA 3NJXA 1HN1A 3LEKA 4E8DA 1OF4A 1IQDC 2J1RA 2CDPA 3LEIA 1O8SA 1PX3A 2W47A 3D3AA 3PUHA 1P8JA 4DUXA 3OBAA 1ULPA 5DN2A 1DLCA 2WDBA 4CU6A 4IUGA 2VM9A 2V72A 1DP0A 2VQTA 2WABA 2YB7A 3SKJE 2W5FA 4JKKA 4ET7A 3I3EA 2YFUA 4M4PA 2W87A 2WO2A 2VZQA 2VZVA 3VD4A 2EIEA 5JMOA 2VZ3A 1W8NA 3IDAA 2ORXA 2EIDA 2QBXA 2Y6LA 2Y6HA 3T2QA 1GUIA 2QQOA 4M4RA 2WUHA 1JYWA 3WNNA 1H6YA 1TVGA 2E26A 4PQQA 3BN6A 1XNTA 3AC0A 1KEXA 3C7GA 3GDBA 4L0PA 3THCA 1KGYA 1EUTA 4QX1A 3VD3A 3IIIA 1CZVA 4DXTA 4GWIA 3UETA 3IB3A 3WF2A 3THDA 3W5MA 1JI6A 4BJ0A 2W92A 3VDAA 1UYYA 1JZ6A 1OH4A 2JKXA 3WNLA 4HG6B 4CUCA 3A7QA 2QQLA 4LPLA 1W0NA 4MOAA 5HXMA 4CU8A 3I2IA 3C7HA 3CDZB 3J7HA 1US3A 1EUUA 2VZ1A 2J1VA 5A1AA 1RYYA 3T0AA 3I2HA 4RYDA 5C7GA 4JX0A 3MBWA 3T0BA 2WO1A 2YC2A 1NUKA 3OGRA 4ARXA 1GOGA 2QQIA 5F7UA 2DCKA 3DYMA 1UYXA 1JZ3A 1XPWA 4OUEA 3FN9A 4FI9A 4ZXEA 2VO5A 4KWUA 5LA0A 3MV11 4AAXA 3DYOA 2KD7A 2X05A 3VD5A 4ARYA 3HPNA 5EJZB 5LCWL 3WQBA 2WN2A 3K4DA 4QAWA 4UOJA 2W3JA 3CMGA 3OGSA 1JYXA 1CZTA 1WCQA 1UX7A 2J1AA 4QDSA 5DQ0A 3C8XA 4CVUA 5JUVA 2W46A 3WF1A 4P5YA 4QPWA 3WF3A 2XOMA 2PQSA 2LW8A 2RJ2A 2B4KA 2C9KA 4QX0A 1UY0A 2J1EA 2BZDA 1UXXX 4XUNA 4AG4A 3C7FA 4JKMA 4BK5A 2LS6A 2YG0A 1JZ7A 3T2OA 1O59A 2YFZA 4LQRA 2EIBA 1JU4A 1UWWA 1CIYA 3K77A 4XUTA 4KMQA 1SDDB 2RVAA 3K46A 3U37A 3I2KA 1DYOA 2WO3A 3HNYM 1LNSA 2VTFA 2WAOA 1UMHA 2Y8KA 2VCBA 3WSOA 1NX9A 1R64A 1SG3A 4CU9A 1JHJA 5G05L 2BERA 1O8PA 3E1F1 1JYVA 1K45A 5IYYA 3NRUA 2VR4A 1OT5A 1OD3A 2BGOA 5LA2A 2W95A 4CUBA 3ZM8A 2E33A 4PT6A 2QQJA 4A41A 1JZ2A 3HEIA 1UY4A 2VZTA 3DYPA 1UY3A 3SEEA 1NKGA 3UESA 2ZXQA 5JXGA 2VZUA 4ZY9A 3T08A 2VQUA 3FHAA 4A44A 2WQ8A 2W91A 3I2FA 5FUIA 3LPFA 4OYUA 3VDCA 4TTGA 2X09A 2VCAA 2L9LA 1JYNA 3W5NA 2ZEWA 5G04L 5C70A 3P6BA 2ID4A 3ACGA 2VL4A 2VZOA 2XQXA 4XURA 1J83A 1L7RA 4ZZ5A 3I3DA 3I97A 3VD9A 4BK4A 3A21A 4XUQA 1GOFA 2W9XA 3A23A 3DECA 4LHSA 5CYYA 5JXIA 5IHRA 2WZ8A 4DEQA 3ACHA 3HJRA 3ACIA 4XUPA 2VC9A 3WNKA 2JE8A 2W1WA 4PF1A 4A45A 1CZSA 2EICA 2VZSA 4OMCA 3LEGA 2CDOA 4UAPA 4TXWA 3K4ZA 5DMYA 1GMMA 1W9TA 4JKLA 2VJXA 4A6OA 4Z2AA 4QB6A 4D0QA 4BDVB 1PX4A 3P1IA 2C26A 5DPNA 3K75B 4P00B 1F4HA 3SKVA 3WF4A 5IJRA 4UI9L 2DCJA 2QQNA 2XHNA 4GZ9A 2VMCA 3OEBA 3FL7A 2RV9A 1XC6A 1K42A 1JZ4A 2J22A 4W50A 2W1UA 1K12A 4A42A 1ULOA 1TG7A 3CKHA 3CIHA 3FHQA 2BBAA 5IFPA 2HLEA 2ZEXA 2J7MA 2WN3A 5LA1A 4BXSV 1SHWB 2Y6JA 4QX3A 3T2PA 5CZKA 2WAAA 1T2XA 4DXSA 1NAEA 3WNOA 4QX2A 2ORZA 3IAPA 1YQ2A 5EIYB 2HYXA 3IAQA 1W9SA 3MUZ1 5IFTA 2W1QA 5JR2A 5JXHA 2B9VA 3F2ZA 4RN5A 4D8MA 3ETPA 5HPOA 2Y64A 4DUWA 2VMDA 1UXZA 3UNPA 1CX1A 3OB8A 1GU3A 3ABZA 2V4VA 2E32A 3PUIA 4CU7A 2VZPA 1WKYA 2BGPA 4MADA 5EJ1B 1GNYA 3HNBM 4OZOA 3OGVA 4QDRA 1K3IA 2W94A 3WEZA 1GQPA 3JXSA 4XUOA 2QQMA 4A4AA 4MGSA 1D7PM 4QB2A 3HOBA 4DXRA 3C7EA 3WF0A 1US2A 3GM8A 3EB7A 3C7OA 3LPGA 3NNGA 4QB1A 3BGAA 3I3BA 2Z4FA 2JDAA 4A3ZA 1BHGA 2VMEA 3CQOA 3GXUA 3GGLA 1UY1A 2QQKA 1UY2A 4YPJA 4GWJA 1W8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OEA A;  1F4A A;  4KI5 M;  5J1X A;  5JXJ A;  3T09 A;  4MGQ A;  3HNM A;  2XON A;  1W99 A;  2VOT A;  4W4Z A;  1UMI A;  3WNM A;  3SEP A;  3HN3 A;  5B4N A;  3VDB A;  1I5P A;  4JHZ A;  4DUV A;  3NQH A;  4QDQ A;  4XZU G;  4MO3 M;  2WYS A;  3EYP A;  1H6X A;  2J1S A;  2WBK A;  2DDU A;  4DEV A;  1L7Q A;  1J84 A;  1XNA A;  1JU3 A;  2X10 A;  2E31 A;  2YC4 A;  2VCC A;  2Y6G A;  2ZEY A;  4XVH A;  4P08 A;  2VMF A;  4ZZ8 A;  3MO4 A;  3CZJ A;  2VZR A;  3ACF A;  3T0D A;  3MUY 1;  1PMJ X;  1MPX A;  5I0D A;  1UZ0 A;  2WZE A;  3LQC A;  3I2J A;  2W1S A;  1W9W A;  3ECQ A;  5C71 A;  3OG2 A;  4OMD A;  2JD9 A;  2R7E B;  1GOH A;  4P02 B;  2V5D A;  3A22 A;  1JZ8 A;  1JZ5 A;  3NJV A;  3I2G A;  3LE0 A;  1OF3 A;  2OKX A;  4CUA A;  3CZU A;  4LKS A;  5B4X A;  1PMH X;  2J1U A;  3K4A A;  2C4X A;  4W8J A;  3WNP A;  4E8C A;  3MV0 1;  2J1T A;  3VD7 A;  1UYZ A;  2Y6K A;  2ZEZ A;  3NJX A;  1HN1 A;  3LEK A;  4E8D A;  1OF4 A;  1IQD C;  2J1R A;  2CDP A;  3LEI A;  1O8S A;  1PX3 A;  2W47 A;  3D3A A;  3PUH A;  1P8J A;  4DUX A;  3OBA A;  1ULP A;  5DN2 A;  1DLC A;  2WDB A;  4CU6 A;  4IUG A;  2VM9 A;  2V72 A;  1DP0 A;  2VQT A;  2WAB A;  2YB7 A;  3SKJ E;  2W5F A;  4JKK A;  4ET7 A;  3I3E A;  2YFU A;  4M4P A;  2W87 A;  2WO2 A;  2VZQ A;  2VZV A;  3VD4 A;  2EIE A;  5JMO A;  2VZ3 A;  1W8N A;  3IDA A;  2ORX A;  2EID A;  2QBX A;  2Y6L A;  2Y6H A;  3T2Q A;  1GUI A;  2QQO A;  4M4R A;  2WUH A;  1JYW A;  3WNN A;  1H6Y A;  1TVG A;  2E26 A;  4PQQ A;  3BN6 A;  1XNT A;  3AC0 A;  1KEX A;  3C7G A;  3GDB A;  4L0P A;  3THC A;  1KGY A;  1EUT A;  4QX1 A;  3VD3 A;  3III A;  1CZV A;  4DXT A;  4GWI A;  3UET A;  3IB3 A;  3WF2 A;  3THD A;  3W5M A;  1JI6 A;  4BJ0 A;  2W92 A;  3VDA A;  1UYY A;  1JZ6 A;  1OH4 A;  2JKX A;  3WNL A;  4HG6 B;  4CUC A;  3A7Q A;  2QQL A;  4LPL A;  1W0N A;  4MOA A;  5HXM A;  4CU8 A;  3I2I A;  3C7H A;  3CDZ B;  3J7H A;  1US3 A;  1EUU A;  2VZ1 A;  2J1V A;  5A1A A;  1RYY A;  3T0A A;  3I2H A;  4RYD A;  5C7G A;  4JX0 A;  3MBW A;  3T0B A;  2WO1 A;  2YC2 A;  1NUK A;  3OGR A;  4ARX A;  1GOG A;  2QQI A;  5F7U A;  2DCK A;  3DYM A;  1UYX A;  1JZ3 A;  1XPW A;  4OUE A;  3FN9 A;  4FI9 A;  4ZXE A;  2VO5 A;  4KWU A;  5LA0 A;  3MV1 1;  4AAX A;  3DYO A;  2KD7 A;  2X05 A;  3VD5 A;  4ARY A;  3HPN A;  5EJZ B;  5LCW L;  3WQB A;  2WN2 A;  3K4D A;  4QAW A;  4UOJ A;  2W3J A;  3CMG A;  3OGS A;  1JYX A;  1CZT A;  1WCQ A;  1UX7 A;  2J1A A;  4QDS A;  5DQ0 A;  3C8X A;  4CVU A;  5JUV A;  2W46 A;  3WF1 A;  4P5Y A;  4QPW A;  3WF3 A;  2XOM A;  2PQS A;  2LW8 A;  2RJ2 A;  2B4K A;  2C9K A;  4QX0 A;  1UY0 A;  2J1E A;  2BZD A;  1UXX X;  4XUN A;  4AG4 A;  3C7F A;  4JKM A;  4BK5 A;  2LS6 A;  2YG0 A;  1JZ7 A;  3T2O A;  1O59 A;  2YFZ A;  4LQR A;  2EIB A;  1JU4 A;  1UWW A;  1CIY A;  3K77 A;  4XUT A;  4KMQ A;  1SDD B;  2RVA A;  3K46 A;  3U37 A;  3I2K A;  1DYO A;  2WO3 A;  3HNY M;  1LNS A;  2VTF A;  2WAO A;  1UMH A;  2Y8K A;  2VCB A;  3WSO A;  1NX9 A;  1R64 A;  1SG3 A;  4CU9 A;  1JHJ A;  5G05 L;  2BER A;  1O8P A;  3E1F 1;  1JYV A;  1K45 A;  5IYY A;  3NRU A;  2VR4 A;  1OT5 A;  1OD3 A;  2BGO A;  5LA2 A;  2W95 A;  4CUB A;  3ZM8 A;  2E33 A;  4PT6 A;  2QQJ A;  4A41 A;  1JZ2 A;  3HEI A;  1UY4 A;  2VZT A;  3DYP A;  1UY3 A;  3SEE A;  1NKG A;  3UES A;  2ZXQ A;  5JXG A;  2VZU A;  4ZY9 A;  3T08 A;  2VQU A;  3FHA A;  4A44 A;  2WQ8 A;  2W91 A;  3I2F A;  5FUI A;  3LPF A;  4OYU A;  3VDC A;  4TTG A;  2X09 A;  2VCA A;  2L9L A;  1JYN A;  3W5N A;  2ZEW A;  5G04 L;  5C70 A;  3P6B A;  2ID4 A;  3ACG A;  2VL4 A;  2VZO A;  2XQX A;  4XUR A;  1J83 A;  1L7R A;  4ZZ5 A;  3I3D A;  3I97 A;  3VD9 A;  4BK4 A;  3A21 A;  4XUQ A;  1GOF A;  2W9X A;  3A23 A;  3DEC A;  4LHS A;  5CYY A;  5JXI A;  5IHR A;  2WZ8 A;  4DEQ A;  3ACH A;  3HJR A;  3ACI A;  4XUP A;  2VC9 A;  3WNK A;  2JE8 A;  2W1W A;  4PF1 A;  4A45 A;  1CZS A;  2EIC A;  2VZS A;  4OMC A;  3LEG A;  2CDO A;  4UAP A;  4TXW A;  3K4Z A;  5DMY A;  1GMM A;  1W9T A;  4JKL A;  2VJX A;  4A6O A;  4Z2A A;  4QB6 A;  4D0Q A;  4BDV B;  1PX4 A;  3P1I A;  2C26 A;  5DPN A;  3K75 B;  4P00 B;  1F4H A;  3SKV A;  3WF4 A;  5IJR A;  4UI9 L;  2DCJ A;  2QQN A;  2XHN A;  4GZ9 A;  2VMC A;  3OEB A;  3FL7 A;  2RV9 A;  1XC6 A;  1K42 A;  1JZ4 A;  2J22 A;  4W50 A;  2W1U A;  1K12 A;  4A42 A;  1ULO A;  1TG7 A;  3CKH A;  3CIH A;  3FHQ A;  2BBA A;  5IFP A;  2HLE A;  2ZEX A;  2J7M A;  2WN3 A;  5LA1 A;  4BXS V;  1SHW B;  2Y6J A;  4QX3 A;  3T2P A;  5CZK A;  2WAA A;  1T2X A;  4DXS A;  1NAE A;  3WNO A;  4QX2 A;  2ORZ A;  3IAP A;  1YQ2 A;  5EIY B;  2HYX A;  3IAQ A;  1W9S A;  3MUZ 1;  5IFT A;  2W1Q A;  5JR2 A;  5JXH A;  2B9V A;  3F2Z A;  4RN5 A;  4D8M A;  3ETP A;  5HPO A;  2Y64 A;  4DUW A;  2VMD A;  1UXZ A;  3UNP A;  1CX1 A;  3OB8 A;  1GU3 A;  3ABZ A;  2V4V A;  2E32 A;  3PUI A;  4CU7 A;  2VZP A;  1WKY A;  2BGP A;  4MAD A;  5EJ1 B;  1GNY A;  3HNB M;  4OZO A;  3OGV A;  4QDR A;  1K3I A;  2W94 A;  3WEZ A;  1GQP A;  3JXS A;  4XUO A;  2QQM A;  4A4A A;  4MGS A;  1D7P M;  4QB2 A;  3HOB A;  4DXR A;  3C7E A;  3WF0 A;  1US2 A;  3GM8 A;  3EB7 A;  3C7O A;  3LPG A;  3NNG A;  4QB1 A;  3BGA A;  3I3B A;  2Z4F A;  2JDA A;  4A3Z A;  1BHG A;  2VME A;  3CQO A;  3GXU A;  3GGL A;  1UY1 A;  2QQK A;  1UY2 A;  4YPJ A;  4GWJ A;  1W8O A; 
#chains in the Genus database with same CATH topology
 1XNK A;  5JPN B;  3ZSE A;  1W8F A;  3DPR A;  1FI2 A;  4KWL A;  5FIX A;  2UU8 A;  2BBV A;  2WSV A;  3T09 A;  3HNM A;  1BMV 2;  4AHZ A;  4Q4W 1;  1JBC A;  3KHB A;  1W99 A;  1COV 3;  3F95 A;  4CP9 A;  4E4Z A;  1VMF A;  1SLL A;  4BWO A;  2A73 B;  3NJZ A;  2ZBJ A;  2JDZ A;  2FZ2 A;  1DQ4 A;  3ON7 A;  1W6O B;  2XVL A;  4AI8 A;  1QOO A;  2R07 1;  5B4N A;  1HRV 2;  1OMI A;  1ZRI A;  4XFH A;  1CJD A;  1JTZ X;  1COV 2;  3IDC B;  1I5P A;  5I0U A;  1AR7 3;  5FP4 A;  3NQH A;  1LEM A;  3FUO A;  3ZSK A;  1NCR B;  4QDQ A;  5FP3 A;  5FZO B;  2DVD A;  4MO3 M;  1CGP A;  5GLU A;  3OCP A;  1H6X A;  1G8W A;  2WBK A;  1F5F A;  4DEV A;  2DCT A;  3CEW A;  1Q8V A;  1L7Q A;  5FO7 B;  2X10 A;  1Y9Q A;  3THP A;  2YZ4 A;  3GHM A;  3ZXK A;  3WR0 A;  1FXZ A;  4LR4 A;  2Y6G A;  3RZG A;  2ZEY A;  3I49 A;  3N4M A;  1AXK A;  4Q4W 3;  1K5J A;  1ASJ 2;  1KJL A;  2VMF A;  5FUP A;  2D6M A;  4OHV A;  2VOW A;  5JIU A;  2A71 A;  1WW5 A;  4PLM A;  1IPJ A;  3U78 A;  5C8W A;  1IKP A;  1LB2 A;  1GWK A;  1U5Y A;  1PMJ X;  3OGJ A;  2QZ3 A;  1HQW A;  1MPX A;  2VNG A;  3MFC A;  2K9Z A;  5BNO A;  3FBY A;  1W9W A;  3B5L B;  2NZ9 A;  1VBC 3;  2YPD A;  4P02 B;  2V5D A;  3A22 A;  4XTP A;  1JZ5 A;  3NJV A;  3KV4 A;  3UYJ A;  3I3M A;  3PVO A;  1VIW B;  5LZ6 A;  1OQE A;  4AEM A;  4HSJ A;  2LRO A;  2Y26 A;  3LE0 A;  1PO2 2;  4LHK A;  4NRP A;  4Q8L A;  5FYV A;  5FZD A;  3CZU A;  2VPV A;  3LD8 A;  3ZFF A;  2PMW B;  4DRR A;  3I3Q A;  2HBT A;  3LEM A;  4O7X A;  5FMD A;  3IPV B;  4HXC A;  4BQ1 A;  1IS4 A;  1NCR C;  2GNM A;  1EAH 3;  2VG9 A;  4XCB A;  3AM2 A;  2D98 A;  4MGY E;  2YC0 A;  4QKD A;  3RJR A;  1UYZ A;  1LOF A;  3JUU A;  3LA7 A;  1KXG A;  2ZEZ A;  1DQ1 A;  2YY1 A;  1WBF A;  2RR1 2;  1E5I A;  1IG3 A;  4MZU A;  1X50 A;  1VB4 A;  1CAV A;  4I0W B;  1EAH 2;  1FPN 1;  1LU1 A;  4PLO A;  4WM8 A;  5I0S A;  3DEM A;  5FXV A;  1TME 3;  1BKZ A;  1DCS A;  4FAH A;  2VH9 A;  3VBH A;  1R08 3;  4AHX A;  1P8J A;  1ZZB A;  1OSG A;  2VVD A;  3DV8 A;  1U5X A;  5CFD A;  2CV6 A;  1RUN A;  1G9F A;  1VBD 2;  1IHM A;  5FO8 B;  1DLC A;  1BZW A;  3W20 A;  5E16 A;  3WUC A;  1MZF A;  4IV3 B;  1R08 2;  5E1R A;  3I59 A;  4ZU7 A;  5KHI A;  4BXF A;  2B45 X;  2R32 A;  5HCB A;  4OQ9 A;  4COZ A;  2X8K A;  1NA1 A;  4C90 A;  4JKK A;  3VHR A;  3RYP A;  2HWC 1;  2WO2 A;  4AVB A;  3OOX A;  4GB3 1;  5JAX A;  1ENQ A;  2VZQ A;  4LBQ B;  2A6W A;  4FPJ A;  2EIE A;  5JMO A;  2VZ3 A;  4KGQ A;  4PLN A;  3IDA A;  1NY7 1;  2YDE A;  3M8L A;  5EHD A;  4RFR B;  2JE7 A;  1W3X A;  3KF3 A;  3ZYR A;  1BEV 1;  1FPN 3;  1VR3 A;  3TAY A;  4XYX A;  1OUX A;  1DZR A;  1NT0 A;  4HPK B;  5KR7 A;  1VRH 2;  4QQ2 A;  1JW6 A;  3WVJ A;  4M4R A;  2CGN A;  4BOW A;  4B7E A;  5JIA A;  2CYF A;  2WS9 2;  4Q8K A;  1RUH 1;  1Y3T A;  1ZZ9 A;  1AX0 A;  1BVP 1;  2GN7 A;  2E26 A;  1LED A;  4NPL A;  4XQW A;  2BDR A;  4PQQ A;  2XGX A;  5GLV A;  4RGK A;  3AC0 A;  3KQ4 B;  2W2I A;  1KEX A;  5AVA A;  2DBI A;  1DGR N;  1EUT A;  4QX7 A;  2HWC 3;  1BK0 A;  4GWI A;  1QY4 A;  3UET A;  1RUG 2;  5F3G A;  2P3J A;  3AKQ A;  5LWB A;  3BI3 A;  1MQT B;  5CIR A;  4AZZ A;  2OW4 A;  1ZRC A;  2WQZ C;  2C6S A;  4BMB A;  1BEV 3;  4CP1 A;  5DDJ 2;  1GP4 A;  2XBO 2;  3WNL A;  2JG9 A;  3KT1 A;  5L9R A;  5C3Q A;  1QKQ A;  3H1W A;  2G4I A;  1H1A A;  1LES A;  1LRH A;  3A7Q A;  5IAV A;  3AYD A;  1FNZ A;  1W0N A;  4LXL A;  1LCL A;  3ZDV A;  5DAB A;  4FFI A;  2XDV A;  2P3Y A;  3I2I A;  4ATE A;  3JD7 2;  1RUH 3;  4BME A;  3TOJ A;  1WMD A;  1H8V A;  1Q5O A;  3GZE A;  3PVN A;  1EUU A;  2RDR A;  2VZ1 A;  1J3Q A;  1BLZ A;  1KS5 A;  1NZC A;  3V0A B;  1AX1 A;  2CTV A;  3O14 A;  5EV7 A;  4RYD A;  2GDF A;  3A0N A;  3NKG A;  4IE4 A;  4GMP 1;  2OPK A;  2BWA A;  3OPT A;  4J1X A;  1QXP A;  5GJ6 A;  5J96 B;  4QU2 A;  2D6N A;  2VU9 A;  4COW A;  1NUK A;  1SPP B;  3BOP A;  3OGR A;  1CR7 A;  5FZ1 A;  4A7Y A;  2RDN A;  3NAP A;  2Y33 A;  5F7U A;  2PAE A;  3M3E A;  1QGL A;  5J37 A;  1LHN A;  2XHK A;  2K0G A;  2DWR A;  2UUR A;  1MZE A;  1OH3 A;  2CGO A;  2JIG A;  1WUV A;  4QPI A;  1XPW A;  3JBG 2;  3VKF C;  1CVN A;  5DAW A;  1TNF A;  2YU2 A;  5ANN A;  2RDS A;  1UW8 A;  4YGD A;  4OI0 A;  4XZP A;  2V73 A;  1MQT C;  3N9P A;  3OJB A;  4BH9 A;  4YFZ A;  1V00 A;  3VD5 A;  3MZH A;  1O3Q A;  2XKO A;  3MIG A;  4V2V A;  2X29 A;  1OUS A;  4A3X A;  4HAN A;  1QIQ A;  3CBN A;  4CDX A;  3KVA A;  2WN2 A;  4QAW A;  4JZR A;  2W3J A;  1H4G A;  3CMG A;  4IGP A;  5C5T A;  5CFC A;  1C57 A;  1AJK A;  4XHX A;  4JCK A;  3AKS A;  4L97 A;  1G9D A;  5F8P A;  1E5S A;  2EAK A;  1YFY A;  4P9X A;  5FY8 A;  3O1T A;  4GMP 0;  3RWK X;  3EXU A;  1CAU A;  3S57 A;  4P5Y A;  1AXZ A;  3A0K A;  1CJP A;  4BQX A;  2RJ2 A;  4FOQ A;  3EMR A;  3U0Z A;  2EAL A;  3WT3 A;  1UY0 A;  2B8M A;  1RUC 1;  4WVM B;  5A1L A;  5F2W A;  3NST A;  3GJB A;  4ASM B;  1WLC A;  2Z2S B;  5K7P A;  3JZV A;  4JKM A;  3E5X A;  1TMF 2;  4BK5 A;  4MV2 A;  1GLH A;  5FXW A;  3THT A;  4E9K A;  3J7M A;  4CCN A;  4FPC A;  3T1M A;  5ACA 2;  2MNG A;  3FJS A;  3LA2 A;  4IE5 A;  4B8E A;  1FNY A;  3D6E A;  5F5C A;  2ETE A;  5EPA A;  4BYY A;  2D5H A;  2BP6 A;  2MHF A;  2ZGK A;  4XUT A;  3VBS B;  4HMZ A;  1SBF A;  3LA3 A;  1AUY A;  3H1M A;  1MS9 A;  5FLI A;  4LIT A;  4BM8 A;  5C3O A;  3HAG A;  2IFR A;  5FZH A;  1V6M A;  4AF9 A;  2OS2 A;  4DOU A;  2WA3 A;  1V6K A;  1ZZC A;  5EQU A;  1W06 A;  2HBU A;  4QX8 A;  1V6L A;  2R1D A;  3WHU A;  4AVS A;  4D6R A;  4LBK A;  5HI0 A;  2BER A;  4HKL A;  4UFK A;  4MH0 E;  1H2K A;  3RZJ A;  1BBT 2;  1LEC A;  1I3H A;  1RC6 A;  3NRU A;  5IYY A;  1OT5 A;  3SLI A;  4YM2 A;  4Q4V 2;  3L2Y A;  1X9P A;  3MLJ A;  3P5B A;  5AVP A;  4MXV A;  5BNP B;  3U07 A;  1SLA A;  4YG3 A;  3U11 A;  1K5M A;  3S7I A;  1UNB A;  4XBL A;  4LHN A;  4XFF A;  2XQR A;  3MIF A;  4MHR A;  4G3Y C;  3U10 A;  3DYP A;  3CJI B;  5C9A B;  1UY3 A;  4K8F A;  3VV1 A;  5F6L B;  2ZXQ A;  2R06 3;  2XJS A;  4AGV A;  1X33 A;  1HB4 A;  3DXU A;  2EXJ A;  4I30 A;  5LBF A;  4JC1 A;  4AI3 A;  2RS1 1;  2NM1 A;  5FUN A;  3LDK A;  2BOI A;  4AR2 A;  4FP3 A;  2VQU A;  2R06 2;  3I2F A;  5FUI A;  3VBS C;  3AMQ A;  3WDX A;  4OYU A;  4OZX A;  2W52 A;  1Q43 A;  1W8Z A;  3C2U A;  1YNA A;  4B4Q A;  3BIW E;  1JYN A;  2QTW B;  3WQ7 A;  3E5Q A;  2ZCW A;  2ZEW A;  3W5N A;  1MS0 A;  4R9D A;  3EO6 A;  4YW1 A;  4LO6 B;  1AR9 2;  3IPV A;  1S0C A;  4QGL A;  2VOX A;  4OHY A;  1CQ9 A;  2IWG B;  1QDC A;  3UGH A;  3W58 A;  2P5B A;  3OBZ A;  4BCU A;  2GH2 A;  1RUJ 3;  5FQ0 B;  4XAB A;  3APB A;  1KDK A;  1REE A;  1AL2 3;  4Y1X A;  3RJ2 X;  3UJO A;  2ZPX A;  4XF3 A;  1PGW 1;  4XJ9 A;  2YMZ A;  4YFW A;  3VBR B;  5BNP C;  1RUJ 2;  3LWC A;  3SQO A;  5J09 A;  4GKY A;  5JXI A;  1M4W A;  3FHI B;  5M0T A;  5J98 B;  1UPS A;  1AL2 2;  3ZFE B;  4XUP A;  4K3U A;  3ZN6 B;  3WNK A;  4NVP A;  4IV3 A;  3VLB B;  4YZ1 A;  1FAT A;  5ABJ C;  1X82 A;  1YC6 1;  4HN1 A;  5C3P A;  2CDO A;  2EXI A;  4MVT A;  4EWE A;  2I74 A;  1RVF 1;  3S6P A;  1UL9 A;  5A3P A;  4YZ5 A;  1KQR A;  4TSV A;  3AFG A;  2BVV A;  5DZG A;  2VJX A;  4NIG A;  4XIK A;  4Z2A A;  4LA3 A;  1D4M 2;  4QHB A;  5L9B A;  1Z7S 2;  2I2S A;  4AGR A;  2C26 A;  5DPN A;  4DIN B;  2D97 A;  1D4V B;  1VRB A;  1XE8 A;  4ISQ A;  4K8R B;  2YBS A;  1OA2 A;  4URT A;  1QJU 2;  1SCS A;  2XUM A;  3H9A A;  4KBB A;  4UI9 L;  5F1R A;  4OFG A;  1VBE 1;  5LK5 A;  5F3C A;  1OD5 A;  3H50 A;  5HXV A;  3R4D B;  3MIE A;  4HPK A;  2JD4 A;  5FY0 A;  4RS5 B;  1QJX 1;  1LUL A;  3RQ0 A;  2RV9 A;  4XJ8 A;  1CES A;  4AQ6 A;  4L92 A;  2AYH A;  1XC6 A;  1K42 A;  3LFM A;  2JJ6 A;  1POQ A;  2J22 A;  4Y20 B;  4R9C A;  5A7W B;  2W1U A;  1ULE A;  4HKW A;  2JDM A;  5IK5 A;  5FKC A;  4XBN A;  5FZ6 A;  1K12 A;  2D3S A;  1VP6 A;  4ONU A;  1ZX5 A;  2CY6 A;  2DU1 A;  2PHT A;  3M70 A;  3PHM A;  3QLQ A;  5DUU A;  5H9Q A;  3ZDS A;  4LOS A;  4X8N A;  5CKM A;  4CDU B;  3BKZ A;  3CKH A;  2WQ4 A;  4PIZ A;  3AX4 A;  1J1L A;  4QKB A;  2YBK A;  3N7J A;  5IFP A;  1MS5 A;  5FOB B;  1RJ7 A;  3ZFE C;  2P17 A;  1D2Q A;  2WN3 A;  2WJS A;  3MID A;  4Y22 B;  3VZK A;  1QJE A;  1WBL A;  2FZ1 A;  2VY0 A;  1DFQ A;  1LHV A;  2P3I A;  5ERL A;  1PM4 A;  1RXG A;  4FSJ A;  1YQ5 A;  3IAP A;  1YQ2 A;  3H3L A;  2O8Q A;  1MZ5 A;  1FOD 1;  1RUI 1;  4NJ4 A;  5AC9 1;  4MUV A;  1QJX 3;  1YQ8 A;  2IXK A;  4CCO A;  1HB3 A;  4QX5 A;  5JR2 A;  2SBA A;  4W6W A;  1HJG A;  5A70 A;  1Y43 B;  1MR5 A;  2PAK A;  4LLO A;  4XPV A;  5BNQ A;  4D8M A;  2D6O X;  1ULF A;  3V0A A;  2E7A A;  3NV1 A;  1FX5 A;  1UIK A;  1HQL A;  1STM A;  2FDH A;  4DUW A;  1C1L A;  1CX1 A;  4XTM A;  3JCI A;  4Y5T A;  2MEV 3;  3PUI A;  4RHV 3;  1MZ6 A;  5A32 B;  2BGP A;  2GN3 A;  2H6C A;  3ZN5 A;  4RS5 C;  2Y38 A;  4G9S B;  1V70 A;  1IGO A;  3VZM A;  3TN9 1;  2XG3 A;  5C8C C;  4D6Q A;  2MEV 2;  2IXJ A;  3TEW A;  4RHV 2;  5I0R A;  3WP5 A;  4R52 A;  3DCQ A;  3O0V A;  3JXS A;  3Q9O A;  3PU3 A;  3S5Q A;  3IWZ A;  3OY8 B;  2VUL A;  3POE A;  2QQM A;  5FV3 A;  1RHI 1;  3KV5 A;  4CDU C;  2RM2 1;  2UYA A;  2ADE A;  1QJY 2;  4XAA A;  1TEI A;  4E4H A;  3GM8 A;  1UZZ A;  3EB7 A;  2XB6 C;  5IAX A;  2YHJ A;  3NNG A;  4QB1 A;  1NXM A;  2GNT A;  4Z82 A;  2IVI B;  4XF0 A;  4AED B;  4A3Z A;  1BHG A;  3N7M A;  3S30 A;  3VBU B;  1F31 A;  1WLT A;  3GGL A;  1W8O A;  5K0U B;  3OEA A;  4KI5 M;  4FPF A;  5FZ3 A;  3ZO0 B;  1W8W A;  5J1X A;  1PIV 2;  1R09 2;  3RS6 A;  5KC5 A;  1IOA A;  3VZL A;  2NMO A;  1NE4 A;  4WM7 C;  5CVR A;  5EYX A;  3WD5 A;  1ZRR A;  1X36 A;  5JSP A;  2ZHL A;  3WNM A;  1JS9 A;  4BB3 A;  1ZBE 2;  5FY5 A;  4HBN A;  1DF0 A;  3SEP A;  3ZXA C;  4N8M A;  1VLN A;  1YEW A;  2GC3 A;  1ZYB A;  3V0B B;  1Y9G A;  5H9P A;  4YM3 A;  3RZL A;  4Y5S A;  1DHK B;  2RM2 3;  1LGN A;  2ARC A;  4N90 A;  3PUS A;  4WVM A;  3MGU A;  2FHR A;  2WWU A;  1NZI A;  2ZAC A;  4ZU4 A;  5BV6 A;  4XJA A;  4ZS2 A;  1FMD 1;  2OA2 A;  4ZKT B;  3USU A;  5FYM A;  4D69 A;  3EYP A;  3J8F 3;  4NHY A;  1XSQ A;  4H2A A;  3N7L A;  1CWP A;  3N9Q A;  4IEY A;  1OLQ A;  1RUD 1;  4PI2 A;  2WFF 2;  1XNA A;  4TZD A;  1JU3 A;  5I8Y A;  5EFU A;  2RS5 2;  3MEP A;  1XU2 A;  2E31 A;  2YC4 A;  2VCC A;  3T3Y A;  3B02 A;  2E51 A;  3J8F 2;  2RE9 A;  4FTS A;  4ZZ8 A;  4JDO A;  4GJZ A;  1KS4 A;  4YAR A;  3T0D A;  1DYK A;  3UJQ A;  3MUY 1;  3VBO B;  4AED C;  3OPW A;  3IZO A;  3J7N A;  3FMG A;  1DGW A;  1Q8S A;  1UAI A;  5FLH A;  1RUF 1;  1AYN 1;  1UZ0 A;  3I2J A;  3JB4 C;  4GA9 A;  5K0U C;  1KDM A;  4OMD A;  4KH9 A;  2JD9 A;  2R7E B;  5L7O A;  4FTE A;  2XKP A;  1W6N B;  2C0Z A;  1H4H A;  1CPN A;  3LKJ A;  4PDW A;  3ZYH A;  1PO1 1;  2DF7 A;  2NYY A;  3GCX A;  3M3Q A;  3M7A A;  2WNV C;  3GZU C;  4CXW A;  4CP2 A;  1J3P A;  2WNU A;  4MET A;  4B1M A;  2OKX A;  5T55 A;  4Y1Z A;  1RUD 3;  4YVW B;  4AK3 A;  1HXS 3;  1EV1 1;  3VB9 A;  1DBN A;  1RL3 A;  1WW6 A;  1YI9 A;  4Q4X 2;  5B4X A;  2UWB A;  2ARE A;  2LRP A;  3O0W A;  2GZW A;  1J59 A;  2C4X A;  1V6N A;  3AK0 A;  3KQR A;  1PMI A;  1QH6 A;  5FYC A;  5L36 A;  1HXS 2;  4AI9 A;  3MV0 1;  1AXY A;  2A3X A;  2J1T A;  1ULG A;  1W6M B;  3CJI A;  5C9A A;  2D6L X;  2Y6K A;  1S55 A;  1AR6 3;  3NJX A;  4RQP A;  5F3E A;  4R4Z A;  5E6H A;  2B5H A;  1AYN 3;  3EHK A;  1UCX A;  3WG1 A;  1POV 0;  5IVF A;  1ND3 C;  3IMM A;  2J1R A;  3LEI A;  2HWD 3;  1ZRE A;  1PX3 A;  2W47 A;  2ZX2 A;  3D3A A;  1UOJ A;  3PUH A;  1APN A;  1SLC A;  5FMO S;  5HV4 A;  1AR6 2;  2WO7 A;  5I93 A;  5CKN A;  1PGL 1;  2ZGL A;  1S2B A;  2XH6 A;  2AEN A;  2Y0I A;  4N53 A;  5GZE A;  2HH9 A;  3ME2 A;  1AZD A;  1XNB A;  3VBO C;  1H8T A;  1DQ2 A;  1OA3 A;  5CBL A;  4ZS3 A;  4CU6 A;  1EV1 3;  2VM9 A;  3ZYP A;  4Y1V A;  3AVS A;  4RR3 A;  3O5S A;  1BMV 1;  3IIA A;  3KGZ A;  1QNY A;  2WAB A;  2YB7 A;  5F2S A;  4AVC A;  3O1S A;  2YFU A;  1ALY A;  1X9T A;  2Q4S A;  2W87 A;  4M4P A;  4CE8 A;  2ZZJ A;  1RXF A;  4LK6 A;  2WNO A;  2QVS B;  1HRV 1;  3JU9 A;  5FQ0 A;  3VD4 A;  4LJH A;  4XOG A;  5IK4 A;  2ZHN A;  2ZJC A;  3SMH A;  1W8N A;  1COV 1;  2BFU S;  1DDL A;  2ORX A;  4YVW C;  1RMU 2;  2OZJ A;  1XNC A;  2EID A;  2RJK A;  3VBR C;  1UZW A;  2JIC A;  2Y6L A;  1E5H A;  2DVG A;  1W8U A;  1SAC A;  2SLI A;  3K48 A;  4Q0V A;  5JI7 A;  1PZ9 A;  4Q1R A;  2QQO A;  4NHX A;  1MEC 3;  2OVU A;  2WUH A;  3P3P A;  1C1F A;  1AR7 1;  4LBO A;  5FYB A;  4GH4 A;  3HR9 A;  2VW2 A;  1IKQ A;  1JHN A;  2ZKL A;  4GJY A;  3ZIX A;  3VKN A;  5GKA C;  2ET7 A;  1LHO A;  3GDB A;  1MEC 2;  4EN7 B;  4WVW A;  4AQ2 A;  3PIG A;  1KGY A;  1ASJ 1;  1QQP 2;  3H7Y A;  5DAV A;  2JKB A;  2WKK A;  3KGL A;  1CZV A;  1T6G C;  1G86 A;  1DZT A;  5I0T A;  4BU2 A;  1HRV 3;  2FQP A;  1U0A A;  4QKF A;  1EYB A;  3IB3 A;  3THD A;  3W5M A;  3VBF A;  3LDR A;  2RG4 A;  4CP0 A;  1PNF A;  2W92 A;  3VDA A;  4S2D A;  1UYY A;  1JZ6 A;  1OH4 A;  2JKX A;  3RNS A;  4HG6 B;  1J3R A;  3PVE A;  1ACC A;  3R05 A;  4XHB A;  3RMX A;  1QXR A;  2BVB A;  5GZF A;  4ASK A;  2F4L A;  4C0B A;  4UW5 A;  4I3P A;  3O0X A;  4R4X A;  5E88 A;  3WW3 A;  1VBC 1;  3KZ4 C;  1WD4 A;  4CU8 A;  5C3S A;  3HT1 A;  4PF5 A;  1C8M 2;  1RUE 3;  2J42 A;  5GAL A;  3SCF A;  2I45 A;  2QE3 A;  4IL7 A;  4CDQ B;  3WW2 A;  4UBH A;  4L99 A;  1ASJ 3;  5EZW A;  5APA A;  5B2G B;  4BIO A;  1Y9M A;  4CDU A;  3R6S A;  3J26 N;  1RUE 2;  5C7G A;  3ILF A;  5SV8 A;  4YZ3 A;  5FOJ B;  4Y22 A;  1L3J A;  2RR1 1;  3B00 A;  4PBP A;  3U1X A;  4AOC A;  4AVT A;  1XB9 A;  1DGL A;  2WO1 A;  4WZC A;  1EAH 1;  4ARX A;  2N7G A;  4P14 A;  1GOG A;  5DZF A;  1SBD A;  1S0E A;  3HQX A;  3MIB A;  1YXW A;  2XJR A;  3RWN A;  2DCK A;  1DIW A;  2QQW A;  1VBD 1;  2PTM A;  2ZMN A;  3AYA A;  3M3C A;  1PO2 3;  3D5O A;  4OUE A;  1TME 1;  3FN9 A;  3RFR A;  2R0F A;  1R08 1;  1R1A 2;  4QKN A;  3HD8 B;  1OOP B;  4IEO A;  4KWU A;  3Q8C A;  3DUI A;  3MV1 1;  4HOO A;  4AAX A;  3DYO A;  2KD7 A;  4WVV A;  3ZKU A;  4CZS A;  4ARY A;  5ANQ A;  5EJZ B;  3WY6 A;  1QH7 A;  4TWT A;  4QGM A;  2XML A;  4FFF A;  3IDE A;  5FMB A;  2WR9 A;  3K4D A;  4HVO A;  4CCK A;  2RR1 3;  1NLR A;  1NOV A;  1XYO A;  3POB A;  3OGS A;  1ZRF A;  1YCI A;  2DFC A;  1GQG A;  2NP0 A;  1AX2 A;  2A6Y A;  1UZV A;  5LBB A;  4JHT A;  1WCQ A;  2J1A A;  4LBJ A;  4OI1 A;  1VB2 A;  4QDS A;  4UT5 A;  1IS6 A;  5DQ0 A;  3C8X A;  1VRH 1;  4XQ4 A;  4CDQ C;  4S2F A;  4CVU A;  1S1A A;  2W46 A;  3GBG A;  2D44 A;  2JG8 B;  2PXJ A;  5DAX A;  3WF1 A;  1VBD 3;  3WF3 A;  5FAX A;  3OUI A;  2DTY A;  2AUY A;  3ZXL A;  4L11 A;  2BZD A;  1NCQ A;  3ZLI A;  1V6J A;  2WC2 A;  1UXX X;  4AG4 A;  3C7F A;  5JMC A;  2ARB A;  3NWK A;  3VBU A;  2PHF A;  5I8T A;  4Y4R A;  1PZ8 A;  1YJL A;  2LS6 A;  1B35 A;  4UFI A;  1JZ7 A;  4D7T A;  5K0U A;  4EN6 B;  1S0D A;  3SH4 A;  5C5U A;  1O7F A;  1VE0 A;  2BV4 A;  2VW0 A;  2IXC A;  3B94 A;  5CKQ A;  2WZR 3;  1RUG 1;  5A1F A;  2D7F A;  3ZOI A;  1HW5 A;  1VBB 2;  3K77 A;  5FY4 A;  4KMQ A;  3K46 A;  3TEX A;  3I2K A;  5DDJ 1;  1DYO A;  1W39 A;  1OOP C;  2WO3 A;  2XBO 1;  2ENR A;  3HNY M;  1BVV A;  2WZR 2;  2VUJ A;  3ZN4 A;  1VRH 3;  2Y8K A;  1C5I A;  3V0B A;  3WSO A;  1OVP A;  3HIF A;  1OFN A;  3GBW A;  3FFZ A;  3JD7 1;  2WS9 3;  5T52 A;  3RYK A;  2HWE 2;  4K7J A;  5DG1 A;  3S5A A;  1I9R A;  5KC6 A;  3AFK A;  4LLF A;  4Q0S A;  3E1F 1;  1JYV A;  5CNA A;  4AGG A;  2K46 A;  5DUX A;  1K45 A;  3WG2 A;  4SBV A;  4BLJ A;  1W6P B;  2VR4 A;  3IMN A;  5JOW A;  2CHH A;  4FO9 A;  5LA2 A;  5A33 B;  2RDQ A;  2W95 A;  4LNV A;  1F35 A;  2E33 A;  1RUG 3;  2G19 A;  2JG8 C;  4A41 A;  4DFS A;  1SMV A;  3ZFG A;  3OYW A;  2Q8D A;  4AW7 A;  1XE0 A;  1YUD A;  5HCF A;  4UW6 A;  3D4K A;  4BQY A;  1UY4 A;  2TUN A;  1U5I A;  4EZ4 A;  1Z0H A;  1W2U A;  5DDJ 3;  3VBO A;  2XBO 3;  2JDY A;  3MHZ A;  3SEE A;  2ZX4 A;  1G7Y A;  5GLW A;  2LUW A;  3HQR A;  4JGY A;  4UF0 B;  4FOV A;  1JOB A;  3JD7 3;  3E6D A;  3JBG 1;  1IPK A;  1YIP A;  1W6N A;  1VBA 3;  4JDM A;  3T08 A;  4XW3 A;  4EZH A;  5ISL A;  4LK7 A;  4A44 A;  2PLV 3;  4P9L A;  3KCX A;  2JWP A;  4Q0U A;  4FQ4 A;  1QMJ A;  3O12 A;  2O14 A;  2XWB B;  3MFA A;  3NVC A;  4LIU A;  4V1P A;  5IVY A;  3VDC A;  3LOB A;  2YGM A;  2VBB A;  3FUQ A;  4YZ2 A;  4FBF A;  3I2D A;  3GAL A;  1XQN A;  2AEZ A;  3LFI A;  4BHP A;  1VBA 2;  1HRI 3;  1ZA7 A;  1GAN A;  4NUB A;  1W2N A;  4YZ4 A;  2PLV 2;  3ZSL A;  1B09 A;  2EXK A;  1H2N A;  1PHM A;  3FFQ A;  3KV9 A;  5F32 A;  5LEK A;  2DYC A;  5FPB A;  3T2T A;  3P6B A;  1JUI A;  2R1B A;  2ID4 A;  4XJU A;  3ACG A;  1HRI 2;  3B3Q E;  3MIH A;  4XUR A;  1ND2 B;  4QM8 A;  2P2K A;  4NOT A;  1FV3 A;  2Q5T A;  1FAY A;  4UXA A;  5FZ9 A;  4BK4 A;  2A3Y A;  2RJL A;  1CAW A;  4DIQ A;  3GNE A;  1IQA A;  2BTV C;  4FVV A;  3OBR A;  1GOF A;  2W9X A;  3A23 A;  3JBG 3;  4FQZ A;  4LHS A;  4WVZ A;  5CYY A;  1UF2 C;  2WZ8 A;  4EV0 A;  2HJI A;  3ACH A;  1OXC A;  4Q27 A;  1S0G A;  3ACI A;  5I8S A;  1TMF 1;  5LRR A;  4FOW A;  1C8N A;  4LE3 A;  4XFB A;  2VC9 A;  5A3O A;  4NIA A;  1XJA A;  2VGD A;  4HKO A;  5DUW A;  1NXD 1;  4C1X A;  5ACA 1;  1N1T A;  1CZS A;  1UU6 A;  2EIC A;  2VZS A;  1UO9 A;  4FT8 A;  4FCA A;  3NMB A;  4OMC A;  5IVB A;  1WMX A;  1W9Y A;  3WOG A;  1GMM A;  5LBC A;  3ZX7 A;  2A6V A;  2R49 A;  4JKL A;  1JOD A;  2BJS A;  3ES4 A;  3GYD A;  1AYM 3;  4A6O A;  3DXT A;  1W03 A;  2PHU A;  1MS1 A;  4NII A;  4D0Q A;  1N3O A;  4BDV B;  2VTX A;  4LA2 A;  3TEY A;  2ZAA A;  3IKW A;  4QQH A;  4P00 B;  5BY5 A;  1F4H A;  3SKV A;  3PVB B;  3LOI A;  2HWF 3;  2JB4 A;  3QBQ A;  1AYM 2;  2X5I B;  5BPX A;  2QQN A;  5A3T A;  4CXY A;  4OVE A;  1PVC 3;  4JDN A;  1BBT 1;  1TMF 3;  3BUC A;  2R04 3;  2HWF 2;  1W04 A;  2EVX A;  1LOC A;  1SLI A;  1GQH A;  5T54 A;  1ND2 C;  4XQD A;  5ACA 3;  1JZ4 A;  4E4S A;  3R4U A;  1PVC 2;  5FZF A;  4K1Z A;  2FDJ A;  4QPG B;  3BOD A;  1F15 A;  2R04 2;  2VXR A;  4LOR A;  4A42 A;  3VL8 A;  5CG9 A;  2DU0 A;  4S2H A;  4M0N A;  3V65 A;  4MGZ E;  3CIH A;  3G6J B;  3HMY A;  2BBA A;  3N36 A;  2ZEX A;  3WCS A;  3WLU A;  4BXS V;  4MYE A;  1O5U A;  3B69 A;  3QAC A;  4ASL A;  3D0S A;  1MS4 A;  1GZW B;  1T2X A;  1ONA A;  5FBJ A;  1NAE A;  2QDN A;  4R9B A;  1W6O A;  2BOJ A;  2VD7 A;  3KM5 A;  2R06 1;  4AFD A;  1LOA A;  4Y3O A;  1G9A A;  1D0H A;  1H2L A;  1BBT 3;  3E6B A;  2P6H A;  4RA0 A;  1YJK A;  2W1Q A;  3LAG A;  2HEW F;  4OI2 A;  5JXH A;  1NCR A;  4P9I A;  2DUP A;  4Q4V 3;  5FZO A;  1OC1 A;  1W2A X;  1SBE A;  1GZC A;  1WA4 A;  3AP6 A;  1ZRD A;  2WRA A;  1BYH A;  2VUC A;  2Y64 A;  2UY9 A;  2Q30 A;  4CDQ A;  1UOB A;  1UN1 A;  5LK7 B;  4ZU5 A;  2X5I C;  2E32 A;  1SEF A;  4TYS A;  4CU7 A;  1VMJ A;  1WKY A;  3FX3 A;  4MHU A;  3TNP B;  3UKV A;  5SV5 A;  3WIN E;  1F2N A;  1F5J A;  1REF A;  4HT1 T;  2GP3 A;  4YNI A;  3FE5 A;  1GNY A;  4EJR A;  4IET A;  4LIV A;  2DUR A;  4J1W A;  5GLT A;  4HK8 A;  2ZMK A;  1W3V A;  1YHF A;  2DVA A;  2RS3 3;  1GQP A;  1RUJ 1;  3EQE A;  3OUJ A;  2OII A;  2OUH A;  4QPG C;  4XUO A;  1HB2 A;  4Q4Y 2;  3Q8F A;  2AEY A;  3UKT A;  5T50 A;  3W59 A;  5ABJ B;  5KXC A;  3GZT B;  1AL2 1;  4MGS A;  2UY8 A;  4QB2 A;  4DXR A;  5EYY A;  4E2S A;  1WA6 X;  3RGB A;  2RS3 2;  3WF0 A;  4GIQ A;  1OOP A;  2NLR A;  3I3B A;  5LW9 A;  2QDR A;  5FP7 A;  2G9F A;  2Z4F A;  5KWR A;  3WDW A;  1AR9 3;  1HKD A;  3GXU A;  5FK8 A;  3VDD B;  2QQK A;  5DUV A;  4YPJ A;  2YGL A;  1F4A A;  4Y4Y A;  2D93 A;  5JZG B;  1XYP A;  5A80 A;  1ZZ7 A;  2JDU A;  1NQJ A;  1D0G A;  1I6X A;  2QZ2 A;  1G6N A;  3OF1 A;  2XON A;  2O0O A;  1QJU 1;  4F7Z A;  4W4Z A;  1UMI A;  4OUS A;  4ERO A;  5BNN C;  5GLZ A;  4UFM A;  3RI9 A;  4I0A A;  4WBB A;  1ENR A;  2C5D A;  4HON A;  3WQ0 A;  1E57 A;  4CEW B;  3AL5 A;  1N1S A;  2B46 X;  4P9J A;  3AKP A;  5FPX A;  3BU7 A;  4DUV A;  4H3W A;  5BXX A;  3U14 A;  1PK6 B;  5DXD A;  5IUQ A;  3SH5 A;  1HIX A;  3J9S A;  5F5A A;  3TBD A;  3URF A;  1V6I A;  3VN4 A;  4DQA A;  3Q8A A;  5IT6 A;  4HLT A;  2YPJ A;  2CAU A;  2PFW A;  3M1H A;  2DDU A;  3D0J A;  4KU8 A;  4YVS C;  4HN0 A;  3O1O A;  4YRD A;  1IG0 A;  1J84 A;  2IXH A;  1D4M 3;  1Z7S 3;  3WP4 A;  1UPI A;  5FZL A;  1T6B X;  1MAC A;  2D6K A;  3HWJ A;  4C1W A;  4XFI A;  4UW4 A;  3NKT A;  1QJU 3;  4JGZ B;  2YV8 A;  4Q29 A;  1UKG A;  3ACL A;  3UGG A;  2OX0 A;  3CNA A;  3RZM A;  3ACF A;  4RL7 A;  4LBQ A;  1GZT A;  4N43 B;  1BCX A;  4LE4 A;  5KHH A;  2O1Q A;  3PJQ A;  1CN1 A;  3MPB A;  3VDD C;  2WZE A;  3LQC A;  4OUM A;  3AYC A;  5FY1 A;  5H9R A;  2ES3 A;  2WSU A;  2XLF A;  3G7D A;  4YW3 A;  3OG2 A;  1TQ5 A;  2AAC A;  5A3N A;  5C71 A;  3UK9 A;  1GOH A;  5JZG C;  4AVV A;  3QOP A;  1V9U 2;  4O9E A;  2DVB A;  3WNX A;  4DS0 A;  4H7L A;  4B4P A;  1W6P A;  2C9A A;  3R0R A;  4UFL A;  5A3U A;  5A33 A;  3I2G A;  3WDU A;  5C8C B;  1OF3 A;  5BNO B;  4Q0P A;  4D94 A;  4YW5 A;  2B9U A;  1M06 G;  1MS3 A;  3DPR B;  2F4P A;  1PNG A;  4KBZ A;  4LKS A;  4LO4 B;  4P5H A;  4QM9 A;  4Y5Z 0;  5FRA A;  4CEW C;  5GZC A;  4BLI A;  4KG8 A;  4JTO A;  1Q8O A;  2J1U A;  2MEV 1;  1OPO A;  4RHV 1;  4AI2 A;  4COU A;  4W8J A;  1A6C A;  4Y33 A;  1LOG A;  1PK6 C;  4CP9 B;  4E8C A;  3MW4 A;  3VD7 A;  5A7S A;  1N1V A;  2DFB A;  2ZML A;  2ZHM A;  5KXE A;  3ZR6 A;  1HV1 A;  1MQT A;  1A8M A;  5D21 A;  5FJK A;  4OI4 A;  5FZ4 A;  4E8D A;  1QJY 1;  1CON A;  3BOW A;  1IQD C;  2HKX A;  2CDP A;  1HLC A;  3W9A A;  1O8S A;  4BZ4 A;  1O4Y A;  4D7S A;  5K4L A;  1X7N A;  2XXZ A;  4LOT A;  3POW A;  1G9B A;  2YBP A;  1VAV A;  1Q3E A;  4JGZ C;  4DUX A;  3OBA A;  4WM7 B;  3FC0 A;  2QFE A;  4ZXK A;  3D8C A;  4N43 C;  1YI7 A;  1ZVF A;  2WDB A;  3L9J T;  4AFB A;  5JDB A;  4IUG A;  5CA6 A;  2W68 A;  1R09 1;  3KCY A;  5FYT A;  2V72 A;  3ZYG A;  1TZO A;  1DP0 A;  4GAL A;  1RVF 2;  3CL1 A;  3MIC A;  2VQT A;  5GZG A;  4B7K A;  3TNQ A;  2W5F A;  4ET7 A;  5FPL A;  1ENX A;  1ZBE 1;  3C3V A;  3ES1 A;  4AFA A;  3H0O A;  2DV9 A;  4PQ9 A;  3AMM A;  3H8U A;  4Q0Q A;  1OVS A;  2D6P A;  5DZE A;  2ZX0 A;  3POY A;  2VZV A;  1W8H A;  3U75 A;  4UFH A;  5FBZ A;  4AL9 A;  1SPP A;  2PA7 A;  5BNO C;  2E9Q A;  1J1T A;  1QJY 3;  2ARA A;  5BUV A;  4KGG A;  2QBX A;  4XJW A;  1QNW A;  3AP5 A;  3DPR C;  4IEX A;  1O6U A;  2Y6H A;  3T2Q A;  4XXP A;  3MLK A;  1N3P A;  2D43 A;  1YRZ A;  1GUI A;  2OXB A;  3ZVX A;  3HBK A;  5A6Q A;  1EP0 A;  4E4D X;  2LTN A;  1Q8P A;  2R6Q A;  2BYV E;  1JYW A;  2WFF 1;  3WNN A;  5FCC A;  2BU9 A;  3X29 B;  3ZMO A;  2UWA A;  2RS5 1;  3ITQ A;  2Y6F A;  5IVC A;  1DLL A;  1PIV 3;  1R09 3;  2WLP A;  3J8F 1;  4AE2 A;  3GHN A;  4L0P A;  5IW0 A;  3R4S A;  1SFP A;  3WW4 A;  1TE1 B;  1ZBE 3;  3III A;  3VD3 A;  5CAD A;  3GBF A;  1ODN A;  2XPJ A;  1WW4 A;  1HV0 A;  3K3O A;  2XL9 A;  4M3C F;  4XF9 A;  1LKN A;  2WNV B;  3AMP A;  3RZK A;  3GCW A;  2HEV F;  4M3C B;  4QHZ A;  2X5I A;  3PTR B;  4FPY A;  4UW3 A;  2XL7 A;  3PLQ A;  5LA9 A;  1PVX A;  4WM8 B;  1LJ7 A;  4CEY B;  3LZZ A;  3ROU A;  1UQX A;  4ISR A;  1AR8 3;  4A6S A;  4LPL A;  4DY3 A;  1RUI 2;  1SQ4 A;  2HWB 3;  4MOA A;  4AHY A;  5AC9 2;  2B42 B;  5HXM A;  5CFD B;  1GV9 A;  3C7H A;  3W21 A;  2ZKN A;  4AQS A;  3CDZ B;  2WFF 3;  4AHW A;  2V4A A;  2RS5 3;  2Y0O A;  5F39 A;  2ZGS A;  3ZMN A;  4Q4X 1;  2J1V A;  4SLI A;  1AR8 2;  4QPG A;  4LKF A;  5FK7 A;  5A1A A;  2HWB 2;  3B9I A;  3OPZ A;  5F3I A;  4MG2 A;  3T0A A;  3I2H A;  4MSV A;  1ENS A;  2GMP A;  4DPN A;  2XLG A;  3OD0 A;  1NA1 B;  1GNZ A;  1HXS 1;  1ND3 B;  2JIJ A;  3RVH A;  1GYK A;  2A75 A;  4I01 A;  2EF6 A;  3RPQ A;  3T0B A;  3VBS A;  4K9S A;  1IPS A;  1QWR A;  1GZW A;  1RIN A;  2KXL A;  2XUE A;  5LAS A;  2X53 S;  5FZ7 A;  3MW3 A;  3ZFF C;  4QXB A;  1AR6 1;  2CU5 A;  1OKQ A;  2FDG A;  4BQ2 A;  4MX3 A;  3Q8B A;  3DN7 A;  2IFW A;  4CCL A;  1JZ3 A;  3N9O A;  2HWD 1;  1C4R A;  4NRM A;  5AFB A;  4GWN A;  4XET A;  2BRT A;  4FI9 A;  1LOF C;  5CU1 A;  5LB6 A;  4Z1V A;  4ZXE A;  1LGC A;  4Q4X 3;  5LA0 A;  4F8A A;  2X05 A;  4LBN A;  4OHW A;  3RZZ A;  1XBF A;  3N9N A;  4YM0 A;  4HL0 A;  4WM8 C;  4CEY C;  1S2E A;  4BA6 A;  4D6S A;  3CJX A;  5JCT A;  3WQB A;  1R1Z A;  5BNP A;  4BIS A;  1RJ8 A;  2Z79 A;  4UOJ A;  5CFD C;  3N9L A;  2VEC A;  4RFT 0;  4PI0 A;  1RMU 1;  2DBN A;  3K2O A;  1CZT A;  3ENR A;  2RHP A;  3HQU A;  2ZGQ A;  4NHK A;  1D2S A;  3OSD A;  4YGE A;  5ABJ A;  4QXC A;  1GZ9 A;  3ZYJ B;  2ZOE B;  1S0B A;  4QPW A;  1NA1 C;  2CSG A;  5FXX A;  1GWM A;  2PQS A;  2LW8 A;  3NL1 A;  4NRO A;  2B4K A;  3O1P A;  4XFG A;  1LOD A;  2DTW A;  4CPB A;  2GC2 A;  4LTA A;  2ZGU A;  4XUN A;  2MPF A;  1LEN A;  2G1M A;  1YO8 A;  2WFP A;  4WV8 A;  1MEC 1;  3SIS A;  4FAG A;  5FMO L;  4NIH A;  4ZPI A;  3T2O A;  1O59 A;  3N35 A;  3KLS A;  3H1Y A;  4LQR A;  5IAT A;  5JZG A;  1OQ1 A;  4DO0 A;  2BW8 A;  2YU1 A;  1OLR A;  3HN1 A;  1W05 A;  2EIB A;  1UOG A;  1JU4 A;  4BPZ A;  1UWW A;  4Y1Y A;  2B39 A;  3AZW A;  2VXJ A;  1ZBA 3;  3POJ A;  3PUR A;  3FWE A;  4K21 A;  3WX5 A;  2RVA A;  1RMU 3;  2GMM A;  3U37 A;  3USS A;  3VKL A;  1LNS A;  2VTF A;  4WZF A;  3NAP B;  1ULD A;  2Q1Z B;  1UMH A;  2VOK A;  5FKB A;  2CWM A;  2WT2 A;  3PDQ A;  1ZBA 2;  1RUF 2;  4QPI B;  3VBR A;  5CAZ A;  1VAM A;  2C24 A;  4QMA A;  1JHJ A;  1C8M 1;  1KIT A;  1N3Q A;  5G05 L;  1UU4 A;  2BFU L;  2R30 A;  3T4V A;  2EA7 A;  3QH7 A;  2EIG A;  1PO1 2;  3SH3 A;  4NRQ A;  3ZFE A;  4I0B A;  2PQQ A;  4M01 A;  5C33 A;  1QQP 3;  1WCU A;  2CNA A;  3ZN6 A;  2A6Z A;  4BE3 A;  1YLL A;  1LR5 A;  1RUE 1;  4IEP A;  1KJR A;  4LO7 A;  2H0B A;  2QQJ A;  4CDX B;  5FR3 A;  5FZM A;  4QXH A;  2O8O A;  4JGZ A;  3PUQ A;  3HEI A;  4HSL A;  1UKR A;  2WT1 A;  4M3C E;  3KT4 A;  1OUR A;  4BQ5 A;  2GAU A;  4GUL A;  2VZT A;  3ZXF A;  3T30 A;  1WGP A;  2YYO A;  2GME A;  3UES A;  5JVV A;  3UGF A;  3CHX A;  5FYY A;  2VZU A;  5JXG A;  2WIN B;  2VNV A;  2XVK A;  3H7J A;  1C8M 3;  1VAK A;  1R1A 1;  1URX A;  2QJV A;  2OUJ A;  3FHA A;  4RS5 A;  2WQ8 A;  5FFO C;  2R0H A;  1KRI A;  3RDI A;  3LPF A;  4F3J A;  5C8C A;  1PO2 1;  4TTG A;  1W6Q B;  1BQP A;  1JMU B;  2X09 A;  3BYW A;  4QGN A;  3O1U A;  4Y20 A;  3NAP C;  3PJY A;  4W6X A;  5A7W A;  2VQ0 A;  2RMU 3;  3AB0 A;  5G04 L;  5C70 A;  3H8R A;  2KM2 A;  4H55 A;  2ATF A;  2WA4 A;  4QPI C;  4TLG A;  5F5Q A;  3M3I A;  4OCT A;  5D8A B;  2P1B A;  3KSC A;  2GC1 A;  2PHW A;  1UOF A;  2VL4 A;  2TNF A;  2IXI A;  4DMI A;  1FT9 A;  1RGS A;  2RMU 2;  1DYP A;  1ZZ6 A;  1J83 A;  2VZO A;  1HN0 A;  4FPL A;  4ZZ5 A;  3I3D A;  4J25 A;  2FCV A;  4NN0 A;  3ZPO A;  3RG0 A;  4Z07 A;  1YYN A;  1IS5 A;  2PHD A;  5FZK A;  3SXW A;  2A1X A;  2IZW A;  3KCC A;  4CCC A;  4UWD A;  4IV1 B;  3DEC A;  2WL1 A;  3DKW A;  4XE9 A;  4XMI A;  4CDX C;  1NG0 A;  1R1A 3;  2ZS6 B;  4DEQ A;  5JR7 B;  5FWJ A;  4KQ7 A;  5CFC C;  3KV6 A;  3MI8 A;  4WM7 A;  1WWY A;  4CDW B;  4M00 A;  1JYC A;  1SFY A;  1AR7 2;  3I4I A;  5JSO A;  3I8T A;  3ZSM A;  4A45 A;  5K8S A;  2GC0 A;  5GZD A;  3LEG A;  4LBL A;  3IBM A;  4TXW A;  1VBB 1;  5DMY A;  3BTX A;  1K5M B;  3J4U H;  3NNF A;  2E6V A;  5A32 A;  2FCT A;  5JOZ A;  3NV4 A;  3VZN A;  4PHZ A;  2A3W A;  4QB6 A;  2WZR 1;  5FZC A;  2OQ7 A;  1PX4 A;  3P1I A;  5FP9 A;  2R07 3;  1KD7 A;  3MW2 A;  1GFF 2;  2H6B A;  2IUW A;  2WNE A;  4CCJ A;  4XFC A;  4Q4W 2;  5KHG A;  3WF4 A;  1WMF A;  3BIE A;  2HWE 1;  2JE9 A;  5JPM B;  2DCJ A;  1OQD A;  3OY8 A;  2EXH A;  2R07 2;  3M3O A;  4XF1 A;  1AL0 G;  4AWD A;  2E63 A;  2VMC A;  3PU8 A;  5D8A C;  1DQ6 A;  2DUO A;  3FL7 A;  3H42 B;  2CGP A;  3AZZ A;  2WS9 1;  3WG3 A;  1VBC 2;  1HJF A;  1Z78 A;  5LAT A;  2PHR A;  2D3P A;  4AED A;  4AYU A;  4HVR A;  2W0X A;  1VBB 3;  1V0A A;  2VTX J;  1ULO A;  4IV1 C;  1W28 A;  3LIH A;  1TG7 A;  1LGB A;  3CO2 A;  2JEM A;  3H3Z A;  4MGI E;  3KF5 A;  4OHZ A;  2OPW A;  2Q8E A;  2HLE A;  1QXJ A;  4CDW C;  5LA1 A;  3I7D A;  1IZ3 A;  3LIG A;  2ARX A;  2WNV A;  4QX3 A;  3SCH A;  2VMG A;  3VL9 A;  4M3C A;  5CZK A;  2WAA A;  4DXS A;  2HWE 3;  4IE0 A;  4QD2 A;  2XWJ B;  3WNO A;  4CEY A;  4BQ4 A;  5FZE A;  1OPM A;  2HYX A;  1K5M C;  1JOJ A;  3PNA A;  1W9S A;  3MUZ 1;  3K51 A;  5IFT A;  1DG6 A;  1VBA 1;  1PGS A;  1EPZ A;  2B9V A;  3F2Z A;  3BTZ A;  1TME 2;  4EWD A;  1IS3 A;  2XLA A;  2BGC A;  2PLV 1;  4FFH A;  1NLS A;  1X8E A;  1Q56 A;  5K9Y A;  1RUO A;  5KHJ A;  1UXZ A;  2ZA9 A;  4DY5 A;  3UNP A;  3ILN A;  3ABZ A;  2V4V A;  5FYS A;  3L2H A;  2GP5 A;  1DQ0 A;  1ND3 A;  1HRI 1;  4YGC A;  1H1M A;  4I09 A;  1PM7 A;  4NWW A;  2ILM A;  4QXK A;  4XDO A;  3VHO A;  1RTV A;  4QWN A;  4JRA A;  3HNB M;  4W6Y A;  3ZXJ A;  4I3G A;  4V2W A;  1XOY A;  2W94 A;  4L2N A;  5AFE A;  1WCK A;  1LHU A;  3CLP A;  1H9P A;  2VVF A;  2G9G A;  5FLJ A;  3BU0 A;  2WWS A;  4FXK B;  3AP9 A;  3PME A;  2WLQ A;  4A4A A;  1D7P M;  3PL0 A;  4N7I A;  1JXN A;  4GXL A;  5IVE A;  3QD6 A;  2A70 A;  1CAX B;  4N9H A;  4YLZ A;  2V09 A;  1FPN 2;  1US2 A;  4LUL A;  4FPK A;  3LPG A;  1EY2 A;  3BGA A;  2UWC A;  1U12 A;  2GH8 A;  2VME A;  3CQO A;  3ETQ A;  1SZB A;  1UY1 A;  2QQU A;  1QDO A;  1UY2 A;  2JDN A;  4U36 A;  4YVW A;  4S2G A;  2XJP A;  4LKE A;  2DUQ A;  4GB3 3;  3WXP A;  3ZXE A;  5JXJ A;  3UKN A;  1S0J A;  4MGQ A;  1J58 A;  2TBV A;  2FDF A;  5F37 A;  2VOT A;  4Z2W A;  1AYM 1;  3B93 A;  4IV3 C;  4KU7 A;  2Z69 A;  3BPZ A;  4ORF A;  1W6M A;  4XDP A;  3HBZ A;  2HWC 2;  4YW7 A;  5A7O A;  4GB3 2;  2Q0A A;  4MLO A;  4LT5 A;  3HN3 A;  3WP3 A;  1WZX A;  4EN8 B;  2E7Q A;  3VDB A;  2Y34 A;  1VMH A;  1ST8 A;  2HWF 1;  1NY7 2;  3RYR A;  1OKO A;  3WHT A;  4AI1 A;  5C4W B;  1YIF A;  4JHZ A;  3IM0 A;  4L8Q A;  1BEV 2;  1QJF A;  2IXL A;  1W2O A;  2FCU A;  3POI A;  4XZU G;  4Z8B A;  3S0M A;  1PVC 1;  4K1Y A;  3AYE A;  4Q5O A;  1WME A;  3KT7 A;  5LY1 A;  2WYS A;  2IC1 A;  1QOS A;  2R04 1;  1DQ5 A;  1GR3 A;  1WLD A;  1W0O A;  2J1S A;  4O65 A;  2VBP A;  1O5L A;  3AJY A;  2QKD A;  5FY9 A;  4IXL A;  2ZX3 A;  3WW1 A;  3ZYF A;  4CTE A;  2VQA A;  4D7Y A;  1RUH 2;  3AL6 A;  5BYN A;  2H0V A;  2F6B A;  2XJQ A;  1W0P A;  4Y26 A;  5FZB A;  4IQP A;  5A7N A;  4GD4 A;  3WG4 A;  2WZP P;  1OHF A;  2AC1 A;  2AGS A;  2BQP A;  4NR1 A;  4XVH A;  3BTY A;  1WW7 A;  4P08 A;  4ITC A;  1JH5 A;  1XXN A;  2JDH A;  2W08 A;  3CZJ A;  3JQX A;  3MO4 A;  2VZR A;  4G4F A;  5FZ8 A;  5IWF A;  1ZM1 A;  3OUH A;  4JRL A;  4JVA A;  2CL2 A;  4IEQ A;  2IVJ A;  1W8T A;  4ATF A;  5HCH A;  4JQR A;  5I0D A;  4XMA A;  5J36 A;  1O3R A;  2W1S A;  3ECQ A;  5E8A A;  3I54 A;  1O4Z A;  4XBQ A;  3SCG A;  1XSR A;  2XVG A;  5F9T A;  1ZZ8 A;  1JZ8 A;  3V64 A;  4CXX A;  4PCR A;  5IK7 A;  5HV0 A;  2JDK A;  1JN2 P;  4J6G A;  3WUD A;  2B7Y A;  1GNH A;  1UZY A;  2ZGR A;  2W39 A;  1CX4 A;  2CAV A;  3AZV A;  3GZA A;  4Q4V 1;  4QU1 A;  4CUA A;  4GMP 3;  2Q1F A;  4KNC A;  1OFS A;  4P9G A;  3Q8E A;  1QU0 A;  5F5I A;  5T5L A;  4CUC A;  5KHK A;  3MF9 A;  4QPY A;  5C4W C;  4CYD A;  1CIW A;  1PMH X;  3K4A A;  2PHX A;  4C91 A;  3WNP A;  2JDP A;  4P9W A;  1BXH A;  3BVC A;  5C3R A;  3BAL A;  4Q4Y 1;  1HN1 A;  3LEK A;  4RGG A;  4AEJ A;  1S4C A;  3POF A;  3LSE A;  5D1I A;  5EXO A;  5JLV A;  2Q1M A;  2RS3 1;  4IND A;  1OF4 A;  2ADD A;  5KXB A;  5F6K A;  4YYO A;  1VPH A;  4JQT A;  4AXO A;  2AR6 A;  2GNB A;  4HFS A;  5JI9 A;  3H3U A;  1ULP A;  3USU B;  1GIC A;  1W6Q A;  3UT0 A;  4EWA A;  5FRE A;  5T5O A;  2ZX1 A;  5DN2 A;  4BQW A;  2JEN A;  5HBA A;  2E7T A;  2D5F A;  5BNN B;  1A78 A;  5E89 A;  5A7Q A;  2ZGO A;  1AR9 1;  1NE6 A;  3AP4 A;  1LOB A;  3O1R A;  5D8A A;  1I5Z A;  5FPU A;  3N9M A;  4YG0 A;  3SKJ E;  3B7M A;  1OLM E;  3I3E A;  1Q8Q A;  4NAO A;  3AVR A;  5C6C A;  1Y7B A;  2VMH A;  4Q4Y 3;  3TB0 A;  1O91 A;  4CCD A;  4N9I A;  2ZGP A;  2JEC A;  2YXS A;  4IER A;  4R8H A;  2QQP A;  3BTA A;  3LB9 A;  4CRQ A;  3FZ3 A;  1RIR A;  4YVS B;  4IV1 A;  4IW3 A;  4AFM A;  4CSW A;  5L7O B;  4FPO B;  4IE6 A;  1RUC 3;  2NMN A;  5FYU A;  1PZ7 A;  1BJQ A;  4PDW B;  4HK9 A;  4LO5 B;  3SHR A;  5CG8 A;  4CDW A;  3BB6 A;  2OQ6 A;  3D82 A;  3ZXG A;  3NNL A;  4B4R A;  4XFA A;  5LY2 A;  1GP5 A;  2WNU B;  1H6Y A;  4L9B A;  1TVG A;  3UV9 A;  1G9C A;  1C28 A;  1RUC 2;  1UX6 A;  4OQ8 A;  4LMF A;  3BN6 A;  3N7K A;  2PHL A;  1XNT A;  4UYB A;  4H14 A;  5A3L A;  3H8X A;  4CCE A;  1LU2 A;  3C7G A;  3THC A;  2QNK A;  3TRS B;  1LHW A;  1A8D A;  2R16 A;  4XC9 A;  1W9F A;  4QX1 A;  1D4M 1;  4IEU A;  1Z7S 1;  3M2M A;  3QH6 A;  4DXT A;  1LTE A;  2ZAH A;  4PBO A;  4RQP B;  1JYI A;  3WF2 A;  1ZNP A;  4LBQ D;  5CEH A;  3O7O A;  4H7M A;  4XAE A;  1JI6 A;  3WQ1 A;  4BJ0 A;  4B3N A;  4COY A;  3AMH A;  1V9U 1;  1DZQ A;  4EYU A;  2QQL A;  2JG8 A;  2D40 A;  2P4E A;  4NO4 A;  3KS7 A;  5L73 A;  4N53 B;  2VAU A;  4IDZ A;  4AEK A;  1H8T B;  3AXD A;  3J7H A;  1QJZ A;  2DVF A;  1US3 A;  4ZHN A;  3VHN A;  4COV A;  1H9W A;  1HQN A;  1YQC A;  2VW1 A;  1RYY A;  1MVQ A;  4RR3 B;  3JQW A;  4ES9 A;  3KWV A;  2TEP A;  5L7O C;  3AXE A;  3NW4 A;  3E97 A;  4LKD A;  1QOT A;  4PIY A;  5IK8 A;  2ZTN A;  3V56 A;  4JX0 A;  4PDW C;  3PIJ A;  3O1M A;  3MBW A;  3AKT A;  5EP9 A;  5FXZ A;  3RSJ A;  4PIX A;  4NHL A;  4Q26 A;  1LOE A;  2YC2 A;  5A3M A;  3OTF A;  4AVA A;  2WNU C;  5T3N A;  1UU5 A;  1H30 A;  3PMS A;  4UBG A;  4Y1U A;  1GBG A;  1ZA4 A;  3ZSJ A;  2QQI A;  2RS1 3;  4IGO A;  3LCP A;  4XCA A;  1V9U 3;  5FYH A;  2QCS B;  4KWK A;  4XEZ A;  1OI6 A;  3DYM A;  1JUH A;  4GWM A;  5FZ0 A;  1N1Y A;  2GU9 A;  4O9G A;  1N47 A;  3RI8 A;  3TYJ A;  1QHD A;  1UYX A;  4MXW B;  4M0H A;  3AZY A;  5EWS A;  1Y4W A;  1I1E A;  5A6Z A;  2RS1 2;  1AF9 A;  1V6O A;  3CJI C;  3MF6 A;  4GH4 B;  3TWI A;  1CD3 G;  4KG0 A;  5C9A C;  5FZA A;  4RQP C;  4PJY A;  2VO5 A;  3JB8 A;  4YW2 A;  4EE2 A;  2XR4 A;  2FMD A;  3DKQ A;  3NNM A;  4NPM A;  5FJH A;  5T5P A;  2OZ6 A;  3HPN A;  2Q8O A;  5LCW L;  1EPW A;  2BNM A;  3FLT A;  1XU1 A;  1GWL A;  3KD4 A;  4XAC A;  2XJT A;  2WT0 A;  3NV3 A;  4N53 C;  1OLM A;  5FYI A;  1H8T C;  4XF4 A;  1JYX A;  2VUA A;  3VBF B;  2FDI A;  4XDQ A;  5FPZ A;  1UX7 A;  3IN9 A;  4NPR A;  1KFU L;  4RR3 C;  3LDB A;  4YG6 A;  3WCR A;  5JUV A;  1FYU A;  4UF0 A;  1W90 A;  3PUA A;  4NWV A;  5FP8 A;  4IEV A;  3AZX A;  4I2O A;  1CAX A;  1FV2 A;  2XOM A;  2A6X A;  2KR2 A;  4GKX A;  4NE9 A;  3UL2 A;  4QX0 A;  1PGW 2;  1UIJ A;  2C9K A;  3ZXD A;  5FZI A;  4AI0 A;  2J1E A;  2BNN A;  4QQO A;  1SLB A;  4E27 A;  2ERF A;  3MDP A;  2ZAB A;  3B01 A;  1U5Z A;  1RVF 3;  4IEZ A;  4IGQ A;  1JYT A;  3MLL A;  2YG0 A;  3WZ1 A;  4O61 A;  4URA A;  3ZKY A;  2YFZ A;  3AMN A;  3NNJ A;  4RGA A;  3NJY A;  1XRU A;  1JOP A;  1PIV 1;  4YSF A;  1KFX L;  2E53 A;  1CIY A;  2EAA A;  2GSY A;  4FXG B;  1SDD B;  4GH4 C;  2Z42 A;  4D3W A;  5GM0 A;  1TNR A;  1VBE 3;  4K6B A;  1GP6 A;  1ND2 A;  3POG A;  1DU3 D;  2WAO A;  3ILR A;  4U2A A;  5FWE A;  5KBF A;  3HT2 A;  2VCB A;  1SFN A;  4C0H A;  1ULC A;  1NX9 A;  5JOY A;  2VMI A;  1E5R A;  1R64 A;  3ASI A;  5C4W A;  1SG3 A;  1F9K A;  4CU9 A;  3LF7 A;  4FPH A;  1VBE 2;  1WCD J;  4LO8 A;  2QQV A;  2KA3 A;  4IEW A;  5FO9 B;  3GF6 A;  2JB8 A;  1AR8 1;  1O8P A;  3KB5 A;  3MYX A;  4HZF A;  2GND A;  5KXD A;  4DXZ A;  2HWB 1;  4LUK A;  2XJU A;  3POS A;  3PTY A;  1QJX 2;  1H1I A;  4JV4 A;  2P37 A;  4GAZ A;  5H9S A;  3VBF C;  1X8M A;  3OBT A;  1HDK A;  3U4S A;  1OD3 A;  2BGO A;  4Z92 B;  4A2U A;  4DRV A;  2JXA A;  4CUB A;  3ZM8 A;  2YUE A;  4Q2F A;  3KMH A;  4PT6 A;  4JAA A;  3ZFF B;  3NO8 A;  2WWJ A;  1JZ2 A;  1AVB A;  1YQ6 A;  1VAL A;  3P3N A;  3TEZ A;  1C3H A;  2BNO A;  5LEJ A;  2K2S A;  2YRO A;  4FOY A;  3CF6 E;  4FPG A;  4I02 A;  3VZJ A;  1QF3 A;  4RD7 A;  2CWS A;  4DB5 A;  1UMZ A;  5FTT C;  2NN8 A;  3QCW A;  4A7K A;  3KVB A;  1NKG A;  2V5Y A;  1S0I A;  4CA9 A;  1FOD 3;  1MS8 A;  1RUI 3;  5AC9 3;  3RZH A;  3T1L A;  4LHL A;  4YW4 A;  1CAV B;  4MGT A;  4ZY9 A;  1YFX A;  1S2K A;  1XE7 A;  2PAM A;  3E5U A;  1SLT A;  3ZYI B;  4P9Y A;  1H0B A;  1NCQ B;  2HEY F;  2VNO A;  2W91 A;  1YWK A;  3VBH B;  2BUK A;  4LEJ A;  1FOD 2;  5FPV A;  3S7E A;  1XYN A;  2NQY A;  2P3K A;  4RSU A;  4FFG A;  4CCM A;  3WDY A;  1B35 B;  2VCA A;  5JWP A;  2A5Z A;  1O3T A;  2L9L A;  3SIT A;  2A7A A;  4XXA A;  4HVQ A;  1H2M A;  4TLF A;  2FD8 A;  4JTN A;  3RMY A;  4FTB A;  4ES8 A;  2VCM A;  3I59 B;  2Y60 A;  5LBE A;  3U4X A;  2HYK A;  3TN9 3;  3WV6 A;  5J7M A;  3B9C A;  5JOX A;  5FMC A;  2ZGM A;  3FLP A;  3O1V A;  4BQ3 A;  4DZG A;  3T4H B;  2XQX A;  1A34 A;  1OBN A;  3E6C C;  1L7R A;  3WDV A;  3I97 A;  3VD9 A;  2BWC A;  4XIO A;  2VBD A;  2F17 A;  3TN9 2;  1RHI 3;  2WII B;  3FLR A;  3I2O A;  5JSR A;  2UYB A;  3A21 A;  4X6R B;  3EBR A;  3AKR A;  2LM3 A;  4XUQ A;  4YWA A;  5FPA A;  2AZ5 A;  2ZHK A;  3HVD A;  2DCZ A;  5D2A A;  5A6X A;  4FP2 A;  5IHR A;  1NLQ A;  4AAP A;  3HJR A;  3KHC A;  5DG2 A;  1RHI 2;  3INA A;  2Q8C A;  4CPB D;  5A6Y A;  1RIT A;  2RM2 2;  3J7L A;  3AJZ A;  3RRD A;  4E2G A;  4ZON A;  1XND A;  2JE8 A;  2OT7 A;  3ST7 A;  5BNN A;  1SDW A;  2W1W A;  4IES A;  4PF1 A;  3SNM A;  1W2T A;  4LUM A;  2Z5W A;  1POV 1;  3K3N A;  3DGT A;  4UAP A;  3CU7 A;  4NMI A;  1HX6 A;  3ATG A;  3K4Z A;  4IE7 A;  3VGI A;  3N3H A;  2OYZ A;  4AFC A;  2G9Z A;  1W9T A;  3OYW B;  3ZFG B;  4YGB A;  5A7P A;  1AHS A;  5J3U A;  1NCQ C;  3VBH C;  4NAM A;  4NID A;  5I91 A;  2FMY A;  1YFU A;  3K75 B;  4QHO A;  3VBU C;  3EJK A;  4EN0 A;  3ZPY A;  4C8D A;  1ZBA 1;  4CUG A;  1B35 C;  3FBM A;  4JGY B;  4QQL A;  4BIF A;  4YVS A;  2NPI A;  4R9A A;  4XIL A;  5IJR A;  1BK1 A;  3WP6 A;  2XHN A;  4MGK E;  4KWJ A;  1O4T A;  5IVJ A;  4A7Z A;  3ZYB A;  2JG9 B;  5CB7 A;  4GZ9 A;  1FMD 3;  3ZIW A;  4F83 A;  3OEB A;  3ORJ A;  3ELN A;  1UYP A;  5DAQ A;  4NHM A;  2VVE A;  2JX9 A;  1UD1 A;  4LBM A;  3VKM A;  5LRS A;  5TSW A;  1S0F A;  5DAP A;  2VNR A;  2AH2 A;  1YFW A;  1POV 3;  2FBE A;  1C5H A;  1FMD 2;  4OLL A;  4UFJ A;  4W50 A;  5J48 A;  4FPE A;  4GQ7 A;  4X6Q B;  1QQP 1;  2VUD A;  3VDD A;  4E2Q A;  2QUO A;  3IDB B;  2ZGN A;  5L9V A;  3AP7 A;  4B1L A;  1RUD 2;  5A3W A;  3FHQ A;  3DF0 A;  5T5J A;  2PN5 A;  4KL1 A;  5FYZ A;  2I07 B;  2J7M A;  2BPA 2;  4EQV A;  3SC7 X;  5FDB A;  1A3K A;  1OA4 A;  1SHW B;  1RUF 3;  2Y6J A;  1AJO A;  3VUO A;  5FY7 A;  4K20 A;  3T2P A;  3BCW A;  1CAW B;  5IVV A;  3M4F A;  4B29 A;  1WD3 A;  4QQP A;  1L7L A;  4QX2 A;  2ORZ A;  1GSL A;  1NYW A;  1RED A;  4HET A;  1HB1 A;  5EIY B;  1PO1 3;  5EJ3 A;  4CEW A;  3ZFG C;  3IAQ A;  4YM1 A;  2PYT A;  1AYN 2;  4TN7 A;  4Y24 A;  3BPS A;  3A4U A;  3ZR5 A;  1WLW A;  2HWD 2;  1PK6 A;  1VJ2 A;  4RN5 A;  3ALQ A;  3LGR A;  3ETP A;  3NV2 A;  4OHX A;  2D3R A;  4QT6 A;  5HPO A;  1QEX A;  4JGY C;  5L19 A;  2VMD A;  1RB8 G;  3OB8 A;  1GU3 A;  4X8P A;  2DCY A;  4DNY A;  4N7U A;  2VZP A;  2WYF A;  2RMU 1;  2JG9 C;  1WCS A;  1EV1 2;  4MAD A;  3MPP G;  5EJ1 B;  3WDT A;  2ZGT A;  3OGG A;  1GKB A;  4OZO A;  3OGV A;  4QDR A;  5CFC B;  3IT8 A;  1K3I A;  5CIS A;  3WEZ A;  4AQT A;  3VKO A;  4N43 A;  1NQD A;  1O3S A;  2C1F A;  3OD4 A;  4YW6 A;  4EN9 B;  1DGR A;  1SCR A;  3LSD A;  3VHP A;  4MXW A;  1CAU B;  2XJV A;  3HOB A;  3C7E A;  4XJZ A;  5HCA A;  3H8O A;  1CPM A;  2LAL A;  2VE1 A;  2ZZQ A;  1DGW X;  1ODM A;  1MVE A;  3C7O A;  2P34 A;  2PEL A;  2VOV A;  4K40 A;  4OUL A;  3GJA A;  4Q1P A;  1LAJ A;  2GAL A;  5FZG A;  1PGL 2;  2JDA A;  2BEO A;  1F8V A;  4W65 A;  2FDK A;  2ET1 A;  2P6C A;  4GWJ A;  3DL3 A;  3VZO A; 
#chains in the Genus database with same CATH homology
 3OEA A;  1F4A A;  4KI5 M;  5J1X A;  5JXJ A;  3T09 A;  4MGQ A;  3HNM A;  2XON A;  1W99 A;  2VOT A;  4W4Z A;  1UMI A;  3WNM A;  3SEP A;  3HN3 A;  5B4N A;  3VDB A;  1I5P A;  4JHZ A;  4DUV A;  3NQH A;  4QDQ A;  4XZU G;  4MO3 M;  2WYS A;  3EYP A;  1H6X A;  2J1S A;  2WBK A;  2DDU A;  4DEV A;  1L7Q A;  1J84 A;  1XNA A;  1JU3 A;  2X10 A;  2E31 A;  2YC4 A;  2VCC A;  2Y6G A;  2ZEY A;  4XVH A;  4P08 A;  2VMF A;  4ZZ8 A;  3MO4 A;  3CZJ A;  2VZR A;  3ACF A;  3T0D A;  3MUY 1;  1PMJ X;  1MPX A;  5I0D A;  1UZ0 A;  2WZE A;  3LQC A;  3I2J A;  2W1S A;  1W9W A;  3ECQ A;  5C71 A;  3OG2 A;  4OMD A;  2JD9 A;  2R7E B;  1GOH A;  4P02 B;  2V5D A;  3A22 A;  1JZ8 A;  1JZ5 A;  3NJV A;  3I2G A;  3LE0 A;  1OF3 A;  2OKX A;  4CUA A;  3CZU A;  4LKS A;  5B4X A;  1PMH X;  2J1U A;  3K4A A;  2C4X A;  4W8J A;  3WNP A;  4E8C A;  3MV0 1;  2J1T A;  3VD7 A;  1UYZ A;  2Y6K A;  2ZEZ A;  3NJX A;  1HN1 A;  3LEK A;  4E8D A;  1OF4 A;  1IQD C;  2J1R A;  2CDP A;  3LEI A;  1O8S A;  1PX3 A;  2W47 A;  3D3A A;  3PUH A;  1P8J A;  4DUX A;  3OBA A;  1ULP A;  5DN2 A;  1DLC A;  2WDB A;  4CU6 A;  4IUG A;  2VM9 A;  2V72 A;  1DP0 A;  2VQT A;  2WAB A;  2YB7 A;  3SKJ E;  2W5F A;  4JKK A;  4ET7 A;  3I3E A;  2YFU A;  4M4P A;  2W87 A;  2WO2 A;  2VZQ A;  2VZV A;  3VD4 A;  2EIE A;  5JMO A;  2VZ3 A;  1W8N A;  3IDA A;  2ORX A;  2EID A;  2QBX A;  2Y6L A;  2Y6H A;  3T2Q A;  1GUI A;  2QQO A;  4M4R A;  2WUH A;  1JYW A;  3WNN A;  1H6Y A;  1TVG A;  2E26 A;  4PQQ A;  3BN6 A;  1XNT A;  3AC0 A;  1KEX A;  3C7G A;  3GDB A;  4L0P A;  3THC A;  1KGY A;  1EUT A;  4QX1 A;  3VD3 A;  3III A;  1CZV A;  4DXT A;  4GWI A;  3UET A;  3IB3 A;  3WF2 A;  3THD A;  3W5M A;  1JI6 A;  4BJ0 A;  2W92 A;  3VDA A;  1UYY A;  1JZ6 A;  1OH4 A;  2JKX A;  3WNL A;  4HG6 B;  4CUC A;  3A7Q A;  2QQL A;  4LPL A;  1W0N A;  4MOA A;  5HXM A;  4CU8 A;  3I2I A;  3C7H A;  3CDZ B;  3J7H A;  1US3 A;  1EUU A;  2VZ1 A;  2J1V A;  5A1A A;  1RYY A;  3T0A A;  3I2H A;  4RYD A;  5C7G A;  4JX0 A;  3MBW A;  3T0B A;  2WO1 A;  2YC2 A;  1NUK A;  3OGR A;  4ARX A;  1GOG A;  2QQI A;  5F7U A;  2DCK A;  3DYM A;  1UYX A;  1JZ3 A;  1XPW A;  4OUE A;  3FN9 A;  4FI9 A;  4ZXE A;  2VO5 A;  4KWU A;  5LA0 A;  3MV1 1;  4AAX A;  3DYO A;  2KD7 A;  2X05 A;  3VD5 A;  4ARY A;  3HPN A;  5EJZ B;  5LCW L;  3WQB A;  2WN2 A;  3K4D A;  4QAW A;  4UOJ A;  2W3J A;  3CMG A;  3OGS A;  1JYX A;  1CZT A;  1WCQ A;  1UX7 A;  2J1A A;  4QDS A;  5DQ0 A;  3C8X A;  4CVU A;  5JUV A;  2W46 A;  3WF1 A;  4P5Y A;  4QPW A;  3WF3 A;  2XOM A;  2PQS A;  2LW8 A;  2RJ2 A;  2B4K A;  2C9K A;  4QX0 A;  1UY0 A;  2J1E A;  2BZD A;  1UXX X;  4XUN A;  4AG4 A;  3C7F A;  4JKM A;  4BK5 A;  2LS6 A;  2YG0 A;  1JZ7 A;  3T2O A;  1O59 A;  2YFZ A;  4LQR A;  2EIB A;  1JU4 A;  1UWW A;  1CIY A;  3K77 A;  4XUT A;  4KMQ A;  1SDD B;  2RVA A;  3K46 A;  3U37 A;  3I2K A;  1DYO A;  2WO3 A;  3HNY M;  1LNS A;  2VTF A;  2WAO A;  1UMH A;  2Y8K A;  2VCB A;  3WSO A;  1NX9 A;  1R64 A;  1SG3 A;  4CU9 A;  1JHJ A;  5G05 L;  2BER A;  1O8P A;  3E1F 1;  1JYV A;  1K45 A;  5IYY A;  3NRU A;  2VR4 A;  1OT5 A;  1OD3 A;  2BGO A;  5LA2 A;  2W95 A;  4CUB A;  3ZM8 A;  2E33 A;  4PT6 A;  2QQJ A;  4A41 A;  1JZ2 A;  3HEI A;  1UY4 A;  2VZT A;  3DYP A;  1UY3 A;  3SEE A;  1NKG A;  3UES A;  2ZXQ A;  5JXG A;  2VZU A;  4ZY9 A;  3T08 A;  2VQU A;  3FHA A;  4A44 A;  2WQ8 A;  2W91 A;  3I2F A;  5FUI A;  3LPF A;  4OYU A;  3VDC A;  4TTG A;  2X09 A;  2VCA A;  2L9L A;  1JYN A;  3W5N A;  2ZEW A;  5G04 L;  5C70 A;  3P6B A;  2ID4 A;  3ACG A;  2VL4 A;  2VZO A;  2XQX A;  4XUR A;  1J83 A;  1L7R A;  4ZZ5 A;  3I3D A;  3I97 A;  3VD9 A;  4BK4 A;  3A21 A;  4XUQ A;  1GOF A;  2W9X A;  3A23 A;  3DEC A;  4LHS A;  5CYY A;  5JXI A;  5IHR A;  2WZ8 A;  4DEQ A;  3ACH A;  3HJR A;  3ACI A;  4XUP A;  2VC9 A;  3WNK A;  2JE8 A;  2W1W A;  4PF1 A;  4A45 A;  1CZS A;  2EIC A;  2VZS A;  4OMC A;  3LEG A;  2CDO A;  4UAP A;  4TXW A;  3K4Z A;  5DMY A;  1GMM A;  1W9T A;  4JKL A;  2VJX A;  4A6O A;  4Z2A A;  4QB6 A;  4D0Q A;  4BDV B;  1PX4 A;  3P1I A;  2C26 A;  5DPN A;  3K75 B;  4P00 B;  1F4H A;  3SKV A;  3WF4 A;  5IJR A;  4UI9 L;  2DCJ A;  2QQN A;  2XHN A;  4GZ9 A;  2VMC A;  3OEB A;  3FL7 A;  2RV9 A;  1XC6 A;  1K42 A;  1JZ4 A;  2J22 A;  4W50 A;  2W1U A;  1K12 A;  4A42 A;  1ULO A;  1TG7 A;  3CKH A;  3CIH A;  3FHQ A;  2BBA A;  5IFP A;  2HLE A;  2ZEX A;  2J7M A;  2WN3 A;  5LA1 A;  4BXS V;  1SHW B;  2Y6J A;  4QX3 A;  3T2P A;  5CZK A;  2WAA A;  1T2X A;  4DXS A;  1NAE A;  3WNO A;  4QX2 A;  2ORZ A;  3IAP A;  1YQ2 A;  5EIY B;  2HYX A;  3IAQ A;  1W9S A;  3MUZ 1;  5IFT A;  2W1Q A;  5JR2 A;  5JXH A;  2B9V A;  3F2Z A;  4RN5 A;  4D8M A;  3ETP A;  5HPO A;  2Y64 A;  4DUW A;  2VMD A;  1UXZ A;  3UNP A;  1CX1 A;  3OB8 A;  1GU3 A;  3ABZ A;  2V4V A;  2E32 A;  3PUI A;  4CU7 A;  2VZP A;  1WKY A;  2BGP A;  4MAD A;  5EJ1 B;  1GNY A;  3HNB M;  4OZO A;  3OGV A;  4QDR A;  1K3I A;  2W94 A;  3WEZ A;  1GQP A;  3JXS A;  4XUO A;  2QQM A;  4A4A A;  4MGS A;  1D7P M;  4QB2 A;  3HOB A;  4DXR A;  3C7E A;  3WF0 A;  1US2 A;  3GM8 A;  3EB7 A;  3C7O A;  3LPG A;  3NNG A;  4QB1 A;  3BGA A;  3I3B A;  2Z4F A;  2JDA A;  4A3Z A;  1BHG A;  2VME A;  3CQO A;  3GXU A;  3GGL A;  1UY1 A;  2QQK A;  1UY2 A;  4YPJ A;  4GWJ A;  1W8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...