2Z4FA

Solution structure of the discoidin domain of ddr2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
161
structure length
161
Chain Sequence
NPAICRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the collagen-binding mode of discoidin domain receptor 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Discoidin domain-containing receptor 2
total genus 16
structure length 161
sequence length 161
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2z4fA00
4JKMA 3ACHA 4CU7A 1WKYA 4PQQA 5JXIA 3OBAA 3T09A 3VD9A 1K45A 3THDA 3ACIA 4D8MA 3NNGA 4DXSA 4E8CA 1RYYA 3T0DA 5CYYA 3DECA 2WO2A 4JHZA 2Y6KA 4A6OA 1CZVA 1PMHX 3BGAA 4MADA 4QDQA 3LEGA 2C26A 2XHNA 2EICA 4Z2AA 3IDAA 1GOFA 4TXWA 3OB8A 3FL7A 1KEXA 3I3DA 4QX0A 4CU9A 1EUTA 5IFTA 1NUKA 1JHJA 5DMYA 2VZOA 1UYZA 3I3EA 1K12A 1US3A 1UXXX 3VDCA 3HOBA 2W1SA 3PUHA 1YQ2A 4W50A 3J7HA 3HNYM 3OG2A 1GMMA 4TTGA 3C7GA 4KWUA 3T2QA 2VCCA 5EIYB 3CKHA 1GOHA 3SKJE 4RN5A 4MOAA 1I5PA 4XUNA 1L7RA 4ZXEA 3W5MA 2E26A 2VZQA 5LA1A 1H6XA 1O8PA 4IUGA 4DUXA 5FUIA 5IFPA 3I2JA 1J84A 2ZEZA 5A1AA 4LPLA 2VOTA 3T2OA 1SG3A 1W9SA 2LS6A 4W4ZA 3C7OA 3T0BA 3I2FA 3DYMA 3ACFA 3VDBA 3UETA 5JXGA 2WDBA 1JYVA 3A7QA 4ZZ5A 3FHQA 2ORXA 4L0PA 1UY1A 2C9KA 2VZ3A 2WBKA 2J1VA 2WZEA 2W91A 5EJZB 4QPWA 2E31A 2OKXA 4FI9A 3OGVA 1DYOA 3MBWA 2W1WA 1UMHA 2J1SA 1UY0A 1XC6A 2VZVA 3C8XA 3LPFA 3EB7A 1CZSA 2CDOA 2J1UA 2WABA 2XQXA 3GM8A 3I3BA 2Z4FA 1JYNA 1DLCA 3NJVA 2WN2A 1UWWA 4M4RA 3HJRA 4XUTA 2W1QA 4JKLA 3SKVA 2Y6JA 3WQBA 4ARYA 3I2GA 2RVAA 1JZ8A 5JUVA 2V5DA 4UOJA 5B4NA 1JI6A 2WQ8A 2BGOA 5JXHA 3WNPA 3FHAA 1WCQA 3U37A 3SEPA 1KGYA 3C7EA 4JX0A 3IAQA 2VL4A 3NJXA 2ORZA 2X05A 3WF0A 4QB2A 2QQOA 1JZ6A 4QX2A 3T0AA 4GWIA 4M4PA 2XONA 1DP0A 3I2HA 3CMGA 2WO1A 2C4XA 4W8JA 1GUIA 2VQUA 3WF3A 1L7QA 2EIDA 1O59A 4A45A 3MV01 3A22A 3MUZ1 2QQKA 3JXSA 3E1F1 4P08A 4PT6A 4BK4A 2VZSA 5B4XA 4LKSA 1SHWB 4UI9L 3LEIA 1O8SA 2BBAA 3WNNA 4OMCA 1UXZA 2EIBA 4XURA 3LQCA 4GWJA 3FN9A 3A21A 5IYYA 4QDSA 1NAEA 2JE8A 4ARXA 2HLEA 3T08A 1F4HA 1US2A 3VDAA 4QX1A 3WF2A 3WF4A 4XUOA 5DPNA 3WNLA 3WEZA 3K4AA 2WUHA 1XPWA 5J1XA 2ZEYA 4OUEA 4QAWA 2WAOA 2VMDA 3GGLA 3K75B 1OT5A 1P8JA 4CUCA 2E33A 4DEQA 3ETPA 3SEEA 2V4VA 1TVGA 4OMDA 3HEIA 1IQDC 2V72A 1XNTA 2VMEA 4BXSV 4DXRA 4UAPA 3K4DA 2W94A 3ECQA 1GU3A 5JMOA 2BGPA 1W8OA 1UYXA 2QQIA 1XNAA 1JYXA 5IJRA 2BZDA 3I2KA 2J1TA 4P00B 1JZ3A 4DUVA 3MV11 1UMIA 3I2IA 2YFUA 2W1UA 2VO5A 4DXTA 3OEBA 2Y6GA 2JDAA 3DYPA 3P1IA 3ACGA 2VCAA 4A42A 3HNBM 1UY2A 3A23A 2X10A 5LA0A 3WNKA 3C7FA 5CZKA 4BJ0A 2B4KA 1JZ5A 2Y6HA 2WO3A 1JZ7A 2ZXQA 1OF3A 2YG0A 4XUPA 2VM9A 3K4ZA 4XZUG 1UY4A 1W99A 2J1EA 1JU3A 2J22A 3CDZB 4YPJA 5HPOA 4QDRA 2R7EB 4PF1A 1ULOA 3C7HA 2JKXA 2VMCA 5I0DA 2PQSA 4QB6A 5HXMA 1PX4A 2VR4A 2W92A 1HN1A 2VZ1A 3EYPA 2DDUA 1NKGA 4ZY9A 2J7MA 5JXJA 1W0NA 2Y64A 1F4AA 2EIEA 3GDBA 3F2ZA 3AC0A 1W9TA 3VD5A 4A41A 4CUAA 2W5FA 5DQ0A 4CUBA 3VD4A 4BDVB 3LEKA 2W46A 3CZJA 1CIYA 3WNMA 2VC9A 2RV9A 3WF1A 1JU4A 5C71A 2VJXA 2WZ8A 4P02B 1EUUA 2BERA 2LW8A 1K3IA 2ZEWA 1PMJX 3IAPA 4XVHA 3IIIA 1PX3A 2WN3A 2WYSA 2W87A 3T2PA 5JR2A 3D3AA 2Y8KA 1JYWA 4KI5M 2VQTA 4AAXA 2QQJA 2JD9A 3DYOA 4D0QA 3UESA 1D7PM 1UX7A 3VD7A 4A3ZA 3WSOA 2CDPA 4CU8A 1T2XA 2VMFA 4E8DA 3NQHA 3W5NA 5G04L 3K77A 1W8NA 2B9VA 1JZ2A 2VZRA 3WNOA 4LHSA 2Y6LA 3CZUA 2RJ2A 2DCKA 3P6BA 4ZZ8A 2HYXA 4A44A 1UZ0A 3K46A 1ULPA 4P5YA 1OH4A 1R64A 4A4AA 3BN6A 1JZ4A 2QQMA 2VZTA 4OZOA 1K42A 2ID4A 2YC4A 2YFZA 2YC2A 1GQPA 4KMQA 1CZTA 2DCJA 4LQRA 2VZPA 2XOMA 1CX1A 4MGSA 5F7UA 2W3JA 4HG6B 4OYUA 3LPGA 3PUIA 4MGQA 3HN3A 5C70A 2J1AA 3CQOA 2X09A 3VD3A 5EJ1B 4QX3A 3UNPA 4AG4A 3OGSA 3CIHA 2VCBA 3MO4A 4CU6A 1BHGA 2W95A 4DUWA 3HPNA 4QB1A 3GXUA 1GOGA 1OD3A 4MO3M 4BK5A 1OF4A 2QQNA 3OGRA 4DEVA 5LCWL 2KD7A 2J1RA 4RYDA 2QQLA 1UY3A 2ZEXA 1J83A 2YB7A 2W9XA 1SDDB 3HNMA 2VZUA 1GNYA 1TG7A 2E32A 3MUY1 2WAAA 5G05L 5IHRA 1H6YA 4XUQA 4CVUA 3ZM8A 1W9WA 1LNSA 1MPXA 1UYYA 3IB3A 3NRUA 5DN2A 3LE0A 3ABZA 3OEAA 5LA2A 5C7GA 3I97A 1NX9A 2W47A 4ET7A 3THCA 4GZ9A 2L9LA 2QBXA 4JKKA 2VTFA
chains in the Genus database with same CATH superfamily
1GZWB 5K4LA 1ZRCA 3MYXA 5FZGA 1VJ2A 3ME2A 1C8M1 3E5XA 3OBAA 1UIJA 4AI9A 1TNFA 3C3VA 3E6BA 5I0TA 2HEYF 3VD9A 3G7DA 1AR63 2ZHMA 5J36A 2BOIA 1TME3 4YSFA 3NNGA 4M3CB 4Q4X1 4DXSA 4PDWB 5BNPB 4YGEA 3PIJA 4YZ1A 2YC0A 1YWKA 5C3SA 1J1TA 3AYDA 2ZAHA 4A6OA 3PTRB 1PK6A 2RR12 3BGAA 3M2MA 4FPEA 1QOSA 2RS53 4JV4A 1UOBA 3ZO0B 5KXBA 4FQ4A 2JICA 3T3YA 4Z2AA 1VBD1 1GOFA 4RS5C 1HXS2 5FJKA 1YQCA 1GFF2 4QX0A 4W6XA 4AHZA 4CU9A 4FPFA 2D3SA 5BNOC 3TB0A 2JKBA 5HCBA 1H1IA 3ST7A 1NUKA 1KFUL 1DU3D 3WQ1A 1MVEA 5GZGA 4DFSA 2JEMA 4SLIA 3UGGA 1W03A 1RUF3 4NJ4A 1US3A 1UXXX 2FZ2A 1K5MB 3MLLA 5IVBA 5FZBA 5CVRA 1YFXA 3ZKUA 4JTOA 4ZS2A 2RMU2 3J7HA 4HVQA 2Y34A 5F5QA 1KRIA 1VBC1 4EJRA 1Q3EA 3B01A 5BV6A 1GMMA 4QQOA 2VY0A 4TTGA 5CFCC 1EV13 1A78A 4LOSA 3DPRA 4OHWA 4M3CF 3ILNA 1Q8VA 1TZOA 4JQRA 2VAUA 1PM7A 5EIYB 2GDFA 1OOPB 1PVXA 4LO5B 3BOPA 1XU1A 4BYYA 4WM8C 1L7RA 2VQAA 3KCYA 2G4IA 4K21A 3UK9A 3OY8A 5DG1A 4BLIA 1AR93 4IUGA 3ASIA 1COV2 3DXUA 1ULGA 4GJYA 4CDWA 5A1AA 3LIHA 4HZFA 2Q1FA 1R082 2CL2A 4LT5A 5L36A 3POFA 5A7WB 3MIDA 3FLTA 2IVIB 4PBOA 1VBA2 5LATA 5FOBB 4QXKA 1YQ8A 3DYMA 1CX4A 4XIKA 3UETA 1RINA 1DF0A 2YYOA 4FOWA 5I8YA 4AHXA 2E7AA 3B7MA 3D0JA 3WNXA 1AYN1 2VULA 4KU8A 3WQ0A 5IWFA 4FTSA 1QH7A 2W91A 4QPWA 4CP0A 3HWJA 4HPKB 4FOVA 4BQ5A 1GNHA 5KXDA 2WT0A 5FPAA 1DYOA 3FZ3A 1B35C 1FOD2 3ZOIA 3O14A 5C5TA 4JZRA 1TNRA 1UY0A 4OI4A 2VZVA 2IXJA 5ABJB 3VZJA 4A7KA 3GCXA 3H1MA 4YW3A 4SBVA 1MQTB 1ZZ8A 2ADEA 3KCXA 4HT1T 5GKAC 4QM9A 3GM8A 2Z4FA 1Z7S2 2Z42A 3DF0A 3V0BA 5KHGA 5GZEA 4NN0A 2XBO3 4D7SA 2W1QA 2GP3A 4JVAA 2VXRA 1SBEA 2R30A 1PGW1 1OQ1A 3PDQA 3RWKX 2QQUA 1JZ8A 3USUB 1RHI2 5C3RA 2XHKA 5JUVA 4CDQC 3AX4A 1R093 1VRBA 3PU8A 1NY72 3VBRC 2ARBA 2WQ8A 3EO6A 3WNPA 1Q8SA 4BHPA 4RS5A 3SEPA 4BMBA 2NP0A 1AYN3 1NY71 1ZBA3 3A4UA 5FXWA 4YW5A 1BBT2 2HWE3 4UW3A 1QJY3 4MGTA 3NJXA 4MGZE 2ORZA 4HL0A 4AI2A 3PJQA 2PN5A 5A3NA 3AP5A 2WC2A 4XCAA 2WLPA 2QQOA 2BVVA 1NLRA 3T0AA 4GWIA 4ITCA 1DP0A 3NNLA 3I2HA 3CMGA 5AFBA 1D0HA 1UYPA 3RMXA 5C3PA 1GUIA 1VPHA 2JB4A 2XDVA 2E7QA 3UKTA 2WR9A 2VQUA 4AFDA 3I8TA 4AAPA 1O59A 2XJTA 2JB8A 4X8PA 2UU8A 3JXSA 1ULCA 3IDCB 1RMU3 1GR3A 4GB33 5KHHA 4XJAA 3SNMA 3ZSLA 3Q8FA 4UI9L 3LEIA 1W3XA 4N7UA 3MI8A 1LECA 4Q1RA 3WNNA 4CP9A 3IZOA 3OTFA 1UXZA 2ETEA 5A70A 2XPJA 1DYPA 3EBRA 4GWJA 1D4M3 3MIEA 3SC7X 3FN9A 4XTPA 5BNNB 1YI9A 4GH4C 1V9U2 5FUNA 1UOFA 4ARXA 3T08A 3Q8CA 1DGLA 4CCOA 1RUD2 1O4ZA 4CXWA 2Q1ZB 1W0PA 3HD8B 4MGIE 4XUOA 3WCRA 3BOWA 1ENRA 2D93A 4BQ3A 2WUHA 3H1WA 4GMP0 2QKDA 4LITA 4QT6A 1BZWA 1MZ5A 4OLLA 2D98A 4QAWA 5JWPA 1MQTC 2GNMA 2WAOA 4QGMA 1DIWA 1UOGA 3GGLA 4XF3A 3WXPA 3KV5A 3KF3A 1YRZA 2XL7A 1RUOA 4LO7A 3LKJA 3ZPYA 3TN92 4Q8LA 2ZGTA 4N8MA 2YUEA 1OPMA 3ETPA 1REDA 4UFLA 4W65A 2WWJA 1A6CA 2LALA 3I3QA 3CF6E 2V4VA 5C8CA 2RS12 4OMDA 2VTXJ 4XQWA 1PIV1 5GZFA 1XNTA 4QKBA 5FYBA 4YW4A 1LODA 2JWPA 4MGYE 4X8NA 1SLIA 2SBAA 4K1ZA 3K4DA 1EV12 2VOVA 3LDBA 3RFRA 4URAA 4PI0A 2VUJA 4IV1A 5EV7A 1X9TA 3ZR6A 3B3QE 2BGPA 5F3EA 3AP4A 3L2HA 4HKWA 1W8OA 1PVC1 1UYXA 1CIWA 1W6NA 4I3PA 1N1YA 1XNAA 1UN1A 4CDWB 1V9U3 2A6XA 1LKNA 4LBKA 4DO0A 3AKQA 1UL9A 1JZ3A 2J1TA 4QWNA 3JBG3 4FPJA 4NRQA 2WO7A 3KGZA 3MV11 4NHYA 4RGKA 1ST8A 2YFUA 5D8AB 2YXSA 1A34A 2VO5A 1Y9MA 4LBJA 4XPVA 2ZGLA 4XJZA 2TEPA 3VBHA 4FPLA 2JDAA 2DBNA 1MS1A 3FLRA 3P1IA 4FFIA 4LBLA 3WDVA 1M4WA 3RDIA 4OCTA 1R1A3 5E89A 1VB2A 1VAKA 3A23A 4FP2A 4QKNA 1RXGA 5FY0A 5LA0A 1FMD1 3I2DA 3I7DA 5H9RA 1FXZA 4QQLA 2B4KA 2Y6HA 3VN4A 4XUPA 3WP5A 2VM9A 2VVFA 4XZUG 4ZU7A 1X50A 1TMF3 4IGPA 1W6MB 4YPJA 3BCWA 3S30A 4RGGA 4C91A 2VOWA 5JPNB 4URTA 3JZVA 2NQYA 4NIIA 3ACLA 3ZXJA 5I8TA 3N3HA 1WD3A 1YJKA 4PF1A 2ZGOA 3WG3A 2RDRA 1GWMA 4UF0B 4ZXKA 4B1MA 4BZ4A 5I0DA 4RR3B 2ZMNA 4NPRA 4XILA 1RB8G 4Q5OA 3O0VA 1S0IA 4QB6A 3ZFGC 3POSA 1PX4A 2ILMA 2RM22 5DDJ3 5CFCA 5BNOB 1H2LA 2ZHNA 2YROA 3JQXA 1DFQA 1PM4A 4L8QA 4XF0A 4Y4YA 4FSJA 4GULA 1PHMA 3K48A 2P5BA 4JAAA 5JSRA 5EJ3A 4U2AA 3HQUA 2JD4A 2PYTA 2Y64A 2JDMA 2P6HA 4OI0A 1PGW2 3M3IA 1PMIA 2PHFA 3AC0A 3N7LA 1V6MA 4A41A 1WMXA 3BIWE 2RDQA 4OHYA 4AEDC 4BIFA 2DF7A 4Y5TA 4CUBA 4HKOA 4BDVB 1NQJA 3MIHA 1VBE2 2WWUA 2D97A 1CD3G 3CZJA 3HBZA 1LOEA 1AL23 4BIOA 5BNPC 5KWRA 3MF6A 2RV9A 1N1VA 3CL1A 1CAUB 5FLHA 5C71A 2VG9A 3MPBA 4WM7C 2C24A 2HWB1 3MPPG 3N9PA 5EYYA 4Q8KA 3VBUB 4H14A 4N53A 1ZRIA 5I0SA 1DGWA 1D2SA 5IUQA 3ZMOA 3OUIA 3B9IA 1K3IA 2D6OX 3POWA 3D8CA 3CLPA 3J8F1 1PX3A 2ARXA 5JR2A 3D3AA 2AUYA 2Y8KA 1U12A 4YG0A 3ZN5A 2QQWA 2DYCA 2VQTA 3ZKYA 1WBFA 4AAXA 1CJPA 2QQJA 1XQNA 5JZGC 3M8LA 4D0QA 3UESA 2HYKA 1R091 5FZ7A 5BY5A 3GHNA 1FPN2 2XUMA 5L19A 4L92A 5SV8A 3UV9A 1WZXA 4PLNA 3GZEA 3VKLA 4MSVA 2BYVE 4CU8A 1LEDA 3AFKA 3O1SA 1W6QB 2OUHA 2VMFA 3LB9A 3WG2A 3NV2A 5T5PA 1B35A 4FCAA 4CCEA 3W5NA 1HN0A 3D6EA 3U11A 1MZEA 4BQ1A 3VZLA 1FATA 5IK5A 3KV6A 2OZJA 1RUH2 3N36A 1DHKB 4AQ2A 5FYSA 2RJ2A 2DCKA 3GNEA 1KXGA 2HYXA 3CJXA 1PO11 1UX6A 3N7MA 1RUH3 2UYBA 3WOGA 4AR2A 4YW7A 2AYHA 1ULDA 2OA2A 1R64A 3UL2A 1GZ9A 3T4HB 4NIDA 5IATA 3LGRA 4FBFA 1ZVFA 4C1WA 1WMFA 2YFZA 4C0BA 1CAWA 2OUJA 3N9OA 1V6KA 1AR71 2WQZC 3DKWA 3J26N 4QPGC 1HV0A 2DCJA 4IEYA 2VZPA 2XOMA 1CX1A 4YFWA 2FMDA 5A6QA 1KDKA 1HB3A 1HLCA 1SPPA 3KSCA 4Q4Y1 4RSUA 4YVWA 2BV4A 5FJHA 5A7OA 1NZIA 4UFIA 4HG6B 1WWYA 1W6NB 1XE0A 3LPGA 3LFIA 4Q4Y2 1YQ5A 3FHIB 3ZYPA 3HN3A 2Q4SA 3CQOA 2D6PA 4RFT0 1SDWA 2WWSA 4AHYA 3BIEA 4L99A 3VD3A 1GWLA 1LJ7A 3FLPA 4QX3A 3VLBB 3CEWA 5FZOB 1PVC3 1YC61 1BK0A 3CIHA 4YVSA 5FK8A 2VCBA 2XL9A 1X7NA 3ZYRA 1ZREA 2FCVA 2PTMA 2CAUA 1O4YA 5CKNA 5IVEA 1WA6X 3HPNA 1OD3A 1ZZCA 2E7TA 2B45X 2K9ZA 3NWKA 4MO3M 4MXWB 2QUOA 3MW2A 5CKMA 2C6SA 2VNGA 4WVMB 4IEXA 2GC3A 4BWOA 3VBFB 4YW6A 1CGPA 4RYDA 2R073 4FFFA 5F6LB 3T2TA 2QQLA 3E6CC 2H0VA 1OH3A 2G9ZA 5EHDA 3RZJA 1CVNA 4HVRA 1J83A 5FAXA 4JQTA 1QOTA 3BB6A 3OPTA 3U1XA 1SBFA 1TG7A 2E32A 2YGLA 2V73A 1EAH1 1YEWA 3DL3A 2WAAA 4NHXA 1H6YA 1OQEA 4HLTA 5CIRA 1W04A 5A3PA 2W2IA 4M00A 1W6OB 2D44A 5FKBA 5IW0A 3ZM8A 4MGKE 4CVUA 1MPXA 1Y9GA 1NCRA 3VHOA 2VW0A 1JOJA 3NRUA 5CFDB 2CWMA 1F9KA 2WFF2 4KWKA 1O91A 1K5JA 4CDQA 4IW3A 2CY6A 2YGMA 2GMPA 4NIAA 5F5AA 2LUWA 3OEAA 3DGTA 3O1MA 4JGZA 5LBCA 4BQ4A 5C7GA 3N9NA 4IE4A 4PIYA 1QNWA 2X29A 1GYKA 5I93A 2P3KA 3CU7A 1UNBA 3THCA 1YUDA 1Z0HA 5CB7A 2VTXA 4UW4A 3MW3A 2HWF3 3FE5A 5DAQA 5GJ6A 1O3TA 4CU7A 3ZXKA 5C9AA 1WKYA 4D7TA 3T09A 4CXXA 3RZGA 1JYIA 1DLLA 1K45A 1RUE2 3VBRB 2WLQA 1OOPC 4LTAA 1RYYA 1O4TA 3GCWA 1FOD1 2QVSB 3ZFFB 5FY5A 5AVPA 4JHZA 3WW1A 1UKGA 3O1RA 1CZVA 2CHHA 1PMHX 1SQ4A 3MFCA 3LEGA 4Z2WA 1S0BA 3RMYA 2XHNA 4HSLA 3R4SA 3ZXLA 3NNJA 3CJIB 2VGDA 5EQUA 3LDKA 4YM1A 2XJQA 1F5JA 3FL7A 4YW2A 3I3DA 1HRI1 2K2SA 2QQPA 3S6PA 1H8VA 1SBDA 4AHWA 2EF6A 3ZFEB 1W6QA 1CPMA 1W05A 2QNKA 4CRQA 1WMEA 4F8AA 3WV6A 4OFGA 1GP5A 1LHUA 1YFYA 3QH6A 1K12A 5FP8A 4RS5B 2HH9A 4QU2A 1IHMA 1ZA7A 2IXLA 3RVHA 4MX3A 3H8RA 1C28A 4LULA 5FZHA 1YQ2A 5FY1A 5AVAA 4GAZA 4Q4V1 4YFZA 4NE9A 1BLZA 3VV1A 3PJYA 1IPSA 1LOCA 4YZ2A 2UWAA 3PL0A 4LHLA 3RGBA 5FV3A 3ZN4A 2BNOA 2MEV1 2F6BA 3K51A 4AVAA 4XFAA 4AI8A 1UCXA 2VCCA 4IEZA 1GLHA 1IPJA 1O7FA 1QJU2 1K5MC 3E5UA 3MLJA 4EROA 5C5UA 4GALA 1U5IA 1C8M2 4RN5A 4FFGA 1NA1C 2R041 2VZQA 3ZIXA 5ACA1 1RUF1 4NAOA 1H6XA 5C4WC 1O8PA 1WBLA 2ET1A 4DUXA 1H30A 2E51A 2WQ4A 1J84A 1NOVA 4AZZA 5IFPA 3AKSA 4LK6A 4PHZA 1HJFA 2JE7A 3ZDVA 1M06G 5KC6A 4G3YC 2TUNA 4KQ7A 1NCQC 3T2OA 1IG3A 4HK8A 3POEA 1W9SA 2LS6A 2JXAA 4XMAA 5LK5A 5BNNA 2B9UA 4CEYA 5GLWA 3H3UA 5BNPA 3I2FA 2VW1A 5ANQA 5L7OC 1BCXA 5I0UA 2CAVA 1VP6A 4UW5A 2A7AA 1GKBA 5FR3A 3VDBA 1MZFA 5GLVA 5AFEA 5L7OB 4Q0UA 1UO9A 4B8EA 5JXGA 2WDBA 1DCSA 2XVLA 3A7QA 3DUIA 3O7OA 4GKXA 3FHQA 1AXKA 2ORXA 4IDZA 4XQDA 1QJEA 4ZZ5A 2NLRA 2DCZA 4XBQA 1UY1A 2C9KA 4JDNA 3WW4A 2WZEA 2C5DA 5FQ0A 1RVF2 1VRH2 5FMOL 1UU6A 2Y0OA 2E31A 4NHMA 1G9BA 3KVAA 1UKRA 1S2BA 4CP1A 2GN7A 4FI9A 1QJY2 1YXWA 4D69A 4BMEA 3OGVA 1ENSA 1WMDA 4PDWA 2W1WA 1N1SA 3PUSA 4QQPA 1ZA4A 5FLJA 1OC1A 1EV11 3H3ZA 1H9WA 4H3WA 2OPKA 3AJZA 3PVNA 1W8TA 5HBAA 2XJUA 4LE3A 5D8AC 4FAHA 4GXLA 2BFUS 3CJIC 3BPSA 4YARA 5K0UB 4IESA 1DQ1A 4ISQA 4KGGA 5TSWA 3I3BA 5FCCA 3W20A 3NJVA 1HRV1 4Q1PA 2I2SA 3ZN6B 1DYKA 1FV2A 2CNAA 1W6OA 1ZNPA 4XUTA 4KH9A 3TNPB 4O9EA 5FYUA 1X82A 3WQBA 1NE6A 2RVAA 3I2GA 5F5IA 2AR6A 3KB5A 1V0AA 4XFGA 3ZFFC 5DAXA 2V5DA 3BPZA 2YU1A 2GZWA 3DEMA 5HV0A 3TBDA 3KZ4C 2A3XA 3AFGA 1O3RA 2ADDA 5JXHA 2CSGA 2VU9A 3AYCA 3FHAA 3J7LA 5F6KA 4B7KA 1JBCA 4OHVA 4Q4W2 3MIGA 4KBBA 2EXIA 2ZOEB 5FZLA 4M3CA 4PJYA 3AYEA 1JXNA 1URXA 1BEV2 2V09A 2BW8A 3MW4A 2A3YA 3WF0A 3FBMA 1QY4A 2R072 4D7YA 1NQDA 2XONA 4LK7A 5K9YA 4DRRA 4KNCA 1DZRA 2ZGKA 3CHXA 3SH5A 3AMQA 1MS8A 1VBD3 1YCIA 4CCJA 2ZJCA 3K3OA 1L7QA 2VBDA 3AMHA 1GZTA 3A22A 3MUZ1 1LENA 4R9AA 2QQKA 2QE3A 1OA2A 1V9U1 3FBYA 4P08A 4PT6A 4I09A 2Y26A 2VZSA 4KGQA 4XTMA 5IAVA 3TNQA 1ZYBA 3OY8B 1ND2A 4AI1A 3R05A 1O8SA 3OD4A 2MNGA 1RUG2 5JMCA 4Y20B 3RYPA 3LQCA 1POQA 1QH6A 5FZ3A 3NAPA 5KHKA 1LHNA 3U75A 2Y0IA 4Q2FA 5A7WA 2NMNA 3MFAA 4V1PA 1QJU3 5AC91 3WZ1A 2JENA 1RXFA 1REFA 2CGOA 2HLEA 1F4HA 3N9LA 4Z07A 3ZYHA 1GP6A 4DPNA 1VB4A 4E4DX 1SACA 3VDAA 3IMNA 1UPSA 3VHRA 5JSPA 3SITA 3ES4A 3HVDA 4YGDA 2ZPXA 1UMZA 5FO7B 4AFMA 2ZEYA 1X33A 2VMDA 2RMU3 3J9SA 4RR3A 4Y1YA 3SQOA 3MIBA 4WBBA 4Y3OA 3WW2A 4CUCA 2WS93 4TWTA 5CAZA 4LHKA 5FXZA 3POBA 5LRRA 2ARAA 5JR7B 3KGLA 2ZX1A 3AK0A 2WZR3 4BE3A 3BU7A 5GLZA 1BBT1 1OI6A 3QBQA 4IEQA 4LE4A 4HANA 4WZFA 3NJZA 3VBOC 2F4PA 4CYDA 1BKZA 4MG2A 2PHRA 4QM8A 1ODMA 5SV5A 1GANA 2BJSA 1HV1A 2GH2A 2QJVA 3MICA 1XB9A 4LO6B 4TLFA 1COV1 4CPBA 1JYXA 3U4XA 4BB3A 3LWCA 3PVEA 1Z7S3 5IJRA 5HCHA 4DB5A 4IEOA 1ZRRA 3I2KA 4P00B 2VOXA 1AF9A 4AE2A 2HWD1 5F37A 4ASLA 1UMIA 1JMUB 4XXAA 2QQVA 5FKCA 1KD7A 5ABJC 1RIRA 1U0AA 1WW7A 1S0GA 5DUVA 2Y6GA 2RM23 3LIGA 5DDJ2 2ARCA 2CYFA 3AXDA 1SLBA 2Z69A 4FVVA 1B35B 2VCAA 3JCIA 2V4AA 1CWPA 2VVDA 2Q30A 1AYN2 4XIOA 3OD0A 1Q56A 3V56A 2X10A 1G9CA 4QQHA 5CZKA 3M70A 1OURA 4QHBA 5JI7A 4YYOA 3LOIA 1E57A 3MLKA 2O8OA 2ZCWA 5FK7A 1VBE3 5A3LA 3I49A 3BUCA 2OT7A 4NWVA 2ZXQA 4S2HA 1OF3A 2P1BA 2ZGPA 3PUQA 4XCBA 3BYWA 1G6NA 1W99A 4LUMA 4BXFA 3K2OA 1UW8A 5T52A 1H4GA 1QXRA 2JX9A 4UW6A 5T50A 1FI2A 1WCKA 4XDOA 1I5ZA 1RUE3 3LEMA 5FDBA 1XRUA 4KU7A 5FWJA 1QJY1 2JG8C 2XJPA 4CCKA 4Y1UA 3KV4A 3OJBA 1C1FA 1KFXL 3VZNA 5F32A 1APNA 2VMCA 4DS0A 3VBFA 1GP4A 3O5SA 2ZX0A 5HXMA 1IS3A 1UQXA 3RI8A 5LZ6A 3TYJA 1N3PA 4A6SA 2W92A 1DBNA 2CWSA 1W8WA 2DDUA 3TN93 4AL9A 2VNOA 4IV3B 2I45A 4LXLA 1N1TA 4Q29A 4ZY9A 1VLNA 2XJRA 2FZ1A 5EPAA 1XYPA 4CEWC 4J1XA 3RS6A 3ZPOA 2WFPA 2ZZQA 4GKYA 4UYBA 5JCTA 3USSA 3O1TA 1LGBA 2R043 3WDYA 4YZ4A 3VD5A 2YBPA 2UY8A 4CUAA 5F8PA 4RHV2 3W58A 3UGFA 3P3PA 1V6OA 4RD7A 1E5RA 4P9JA 5CNAA 1SLLA 3UJOA 4WM8A 5JIAA 2Q8OA 1YYNA 4K8RB 1QGLA 1W2NA 2VUAA 5FP7A 1CIYA 4META 3O1VA 2P3JA 5FO9B 1W2TA 1JU4A 4FPHA 3H42B 4WVMA 2R0HA 2LTNA 4DOUA 2WZ8A 4P02B 1EUUA 2DTWA 2BERA 4NHLA 2AREA 1GNZA 4I0BA 5EXOA 1NCQA 3OPZA 4Q4Y3 5FXVA 5FPXA 2ZEWA 1I3HA 1F2NA 1PMJX 1WUVA 3AL6A 4YG6A 3IIIA 1H0BA 1S0DA 2RJKA 4XF1A 5A3TA 4LBQA 3DPRC 3IDBB 2YDEA 2W87A 3T2PA 2BWCA 2GSYA 1SCSA 1XSRA 1WW6A 4Y33A 2E6VA 4BM8A 4KI5M 1OPOA 1QQP3 3OSDA 2WNVA 4IETA 4ATEA 3H7JA 2QDRA 3BU0A 1GSLA 5E88A 4C90A 5A3UA 1PNFA 4Y1ZA 1VBA1 1FYUA 2DU1A 4CSWA 3VUOA 1ASJ3 2HBUA 3ORJA 2CDPA 3TEYA 4XAEA 4BCUA 1LR5A 3EMRA 5BYNA 1G86A 3IWZA 3CNAA 1RJ7A 2PMWB 1FV3A 1AYM2 2B8MA 2TBVA 3EXUA 3K77A 3KV9A 4PDWC 1AUYA 2B9VA 3SXWA 4AEMA 1QEXA 3GHMA 2OPWA 1GICA 2GMEA 4I30A 3IPVB 3KF5A 4LHSA 3WNOA 1RUI3 3V0AA 2ZHKA 5DUUA 3CJIA 3IDEA 1QNYA 1PZ8A 1AVBA 4P9YA 4PIZA 1W6PA 1AR62 1RUJ1 1Q8OA 1RUI2 3N4MA 1NA1B 4P5YA 5GM0A 4IE0A 4MHRA 1OH4A 3H1YA 1BVP1 3ZIWA 3AKPA 2XLFA 1O3QA 1BXHA 3ZFEA 1K42A 2VMIA 3KVBA 1POV1 1CONA 4QKFA 4CPBD 2PAKA 2GMMA 2YC2A 3ITQA 3RZKA 5EFUA 2AEYA 3E97A 3A0KA 3N7KA 3VBRA 1GQPA 1HRI2 4KMQA 5LBFA 3INAA 4EN8B 5JPMB 4LQRA 2RMU1 3GZTB 4XXPA 2ZGNA 2AEZA 4B7EA 1OLQA 1QQP2 3AMPA 4UFKA 2GNTA 4MGSA 3LA7A 4LOTA 5F7UA 5LBBA 2BNNA 4OYUA 2GNDA 5C4WA 4DNYA 3PUIA 1NXMA 2O1QA 5LBEA 4B4RA 2B42B 3ALQA 2H0BA 5CKQA 5C70A 1XE7A 2J1AA 3N35A 5A80A 3UKNA 3O0WA 2ZACA 4LR4A 4N53B 2X09A 4NRPA 4AGVA 4CXYA 4IEPA 3RZMA 1OVSA 5EJ1B 1S4CA 1ZZ7A 2MEV2 2PHLA 4AG4A 4NVPA 1VAMA 2CV6A 5E1RA 3ZXDA 3MO4A 2YBSA 3PNAA 3NJYA 2NN8A 4L97A 4UBGA 1FMD2 3VZOA 4XHBA 4P9IA 1OF4A 1CAUA 3JBG1 4FT8A 3OGRA 4HPKA 4UXAA 1RUF2 2SLIA 5LCWL 1U5ZA 4ES9A 2J1RA 3VBUA 3ZLIA 5CEHA 2RS51 1V6LA 1H4HA 3NAPC 4A3XA 1PGL2 3UKVA 1ZBE1 2A6ZA 4OUSA 2YB7A 2BU9A 1SDDB 1PO12 3HNMA 4CDXC 1CAVA 3KMHA 1GNYA 1W9FA 2VXJA 4LORA 2ERFA 4N43B 1S0FA 2WL1A 5FLIA 5LK7B 4Q4X3 4XZPA 5IHRA 2XWBB 3V0BB 2VW2A 3JQWA 5FQ0B 4QPIC 4OZXA 1YIPA 5FY7A 1SLAA 4BA6A 4P14A 4NPLA 4F7ZA 2R0FA 4LBOA 1X8EA 5DZFA 3R0RA 4LUKA 4NRMA 1OMIA 4CEYC 4LMFA 1VMFA 1KDMA 2PHWA 2KXLA 1A3KA 1HDKA 1RUD1 3IN9A 2DV9A 4XFBA 3HT1A 3FUQA 5DXDA 3ABZA 3M3QA 1CAWB 5LA2A 4XAAA 1UZWA 3LSDA 5FZ9A 5LASA 4C0HA 2WSVA 1NX9A 2A70A 5M0TA 3WP4A 4GH4A 1JH5A 4ET7A 1W06A 2AENA 1C5HA 2FDHA 1LESA 5IVYA 1SPPB 5J48A 4JKKA 3E5QA 1FT9A 1RUD3 4JKMA 1VMJA 4IV1C 3WDUA 5JXIA 5CBLA 1XBFA 2NZ9A 1E5HA 1CESA 1NLQA 1YO8A 3NV3A 4Z82A 1LULA 5FMCA 1BMV1 3THDA 1AXZA 1RVF1 1VRH1 2EALA 2JDUA 2WYFA 2OW4A 3ACIA 4D8MA 4AYUA 1OVPA 4EWAA 3WDTA 5FFOC 4E8CA 5J37A 3HAGA 3PLQA 3EHKA 1DGWX 2XBO1 5CYYA 2E63A 2C9AA 3CBNA 3BTXA 4XE9A 5C6CA 4XACA 4YGCA 2Y6KA 1ASJ2 1AL0G 1FAYA 1HW5A 4S2FA 3WDWA 5F5CA 1DZTA 2CTVA 4CP9B 4DIQA 1OSGA 4XEZA 5EYXA 4QDQA 2FMYA 4MADA 4GJZA 2C26A 5FY9A 4NWWA 5A3MA 4Q0VA 3B5LB 2G19A 5A6XA 1OFNA 1AZDA 1R1A2 2IXKA 3KHBA 1H2MA 1UD1A 2GNBA 4Q4V2 3IDAA 3POJA 4TXWA 3OB8A 3TRSB 2UURA 2YHJA 1KEXA 3U78A 4AQSA 2GP5A 4XDQA 4LO8A 3OGJA 2JDZA 2TNFA 2VBPA 1GQGA 1ND2B 3LSEA 1EUTA 5IK7A 1BEV1 5IFTA 4FOQA 5K8SA 3ON7A 3TOJA 2Q8CA 4P5HA 5E8AA 2FDGA 2QZ2A 4HN1A 1XNKA 4J25A 4MXWA 4XJ8A 4EN7B 3LOBA 3J8F3 1CJDA 2W1SA 3HOBA 1HQWA 2LROA 4K3UA 3WQ7A 3ELNA 3VL9A 4W50A 5D2AA 5D1IA 1AX1A 3HNYM 3OG2A 3ZR5A 2IVJA 4ONUA 1ZM1A 5FYIA 3D4KA 2GC0A 1VIWB 1IZ3A 4INDA 3W59A 4QX5A 2RDNA 2VBBA 2WFF1 4MUVA 5GLTA 1SCRA 2BQPA 2ZGSA 5A33B 2HEWF 4XFHA 3GBWA 3T1MA 1I9RA 1GOHA 1LGNA 2XVKA 1XU2A 1RUI1 4IERA 1LOFA 2XKOA 4MOAA 1I5PA 4QPIB 1C3HA 4XUNA 3WUDA 5JZGA 1NG0A 3HQRA 3W5MA 2ZGUA 2E26A 4CDXA 3UJQA 1G8WA 2GU9A 5CFDA 2ZEZA 1RUJ2 4RGAA 3VBSB 2ZX2A 2HJIA 4CUGA 4LPLA 4AEDA 5A1FA 3VHPA 3NAPB 2OVUA 1SG3A 4CE8A 3S7EA 2WNUC 4W4ZA 1VBC3 2F4LA 4IE6A 2XJVA 2RR13 4S2GA 3WHTA 3UT0A 3ZFGA 4IE5A 4E4HA 1ZRDA 3PMSA 3ACFA 4FPKA 1ND3C 4L9BA 3VBHB 2BNMA 5EZWA 5KHIA 2VMHA 1HQNA 4LBMA 2BEOA 2KA3A 3RYRA 4L0PA 4WVWA 4B29A 3DKQA 1ZBA1 5T54A 1PO22 4JRLA 3H7YA 5I91A 3C2UA 2VZ3A 2AZ5A 4B4QA 3I4IA 5KR7A 2VVEA 4AVCA 2DVAA 1ZBA2 2X5IB 4PQ9A 1RUG3 5L9VA 1NCRB 1LB2A 3MBWA 4YGBA 1GQHA 2OS2A 3WD5A 1UMHA 3WX5A 2J1SA 5DG2A 3AZZA 3LZZA 1MS0A 1WLDA 3K3NA 2Y38A 3T0DA 1XC6A 4XBNA 3KHCA 3LPFA 5F2SA 5IVVA 2I74A 2KR2A 4JGYA 5FYZA 1NE4A 2CDOA 4HMZA 2J1UA 1F5FA 4Y24A 4XDPA 3TEXA 3OPWA 1UPIA 5FZDA 3VKOA 2WABA 1W8FA 4WM7A 2JDPA 2XQXA 2O8QA 5FXXA 1JYNA 2D6MA 4HETA 2YV8A 2A6VA 3ZYGA 4Q0SA 1NLSA 2WN2A 5E6HA 2ZA9A 4AVTA 3HJRA 3PMEA 1PNGA 2B39A 2Y6JA 1LAJA 1WLCA 1UZZA 4PBPA 2MEV3 3AB0A 5B4NA 5C9AB 1X9PA 4FP3A 2XUEA 2ZKLA 3NW4A 1LCLA 1N3OA 3RJ2X 3TWIA 3IT8A 3AKRA 3LFMA 3U37A 1KGYA 5F3IA 3THTA 3I59B 3PU3A 3KQRA 5CU1A 1RGSA 2Z79A 4JX0A 3I3MA 3WR0A 2DFBA 3IAQA 2VL4A 3KS7A 2HBTA 3UGHA 1RUC2 3ZYBA 4A7YA 1OBNA 3ES1A 4LLFA 1NT0A 1PO23 2CGPA 4QPGA 2FBEA 1WLWA 1EAH3 1LOGA 1TE1B 4MYEA 5J98B 4WV8A 1PGSA 4M4PA 5FZOA 3VZMA 1TMF2 1Y43B 1MEC3 5I8SA 3B02A 2OQ7A 2WO1A 3FMGA 4GWMA 1IPKA 3JB8A 3NNFA 3HT2A 1E5SA 2XLAA 1D4VB 1MS3A 1DQ6A 2VUCA 2JG8A 2X8KA 3E1F1 4K1YA 4XF9A 5EWSA 5B4XA 4BK4A 1ENQA 4ASKA 1COV3 1RHI1 2D43A 1C4RA 2BBAA 4IGQA 5DAVA 4EYUA 4CEWB 3RZHA 1LOFC 3T1LA 4EWEA 4GIQA 3VKMA 2EIGA 2DURA 2WNOA 4IXLA 4LO4B 3O1UA 1RVF3 1VRH3 4S2DA 2RS33 2X5IC 1CN1A 4EN9B 1AYM3 4TLGA 1OKQA 1C8M3 4XW3A 2ZBJA 2JE8A 3QLQA 1MR5A 2ZAAA 1D4M1 2K46A 3WINE 2WNUA 1US2A 4QXBA 3WF4A 1FNYA 5DPNA 2P37A 5FZAA 1ENXA 1FX5A 1BMV2 5JAXA 1F15A 5DZGA 1RHI3 3RWNA 5J1XA 5D21A 3O1PA 4OUEA 2EXKA 5BUVA 3AXEA 4WVVA 3K75B 4R4ZA 2WFF3 4V2WA 1PIV3 3Q8EA 4K7JA 1NXD1 2WS91 5JI9A 1AR81 1POV0 1AR83 4AVVA 4MZUA 4CDUA 1LTEA 4DEQA 3M7AA 1NCRC 3ZFEC 1HXS3 4CA9A 1TVGA 2WS92 3GJAA 5FZ1A 2BDRA 4E2GA 4LKEA 2VMEA 1RUH1 3IPVA 2QTWB 1R1A1 1BBT3 2HWE2 4UAPA 3V0AB 3BODA 1OQDA 4O65A 1J58A 1V6NA 5FTTC 2WT1A 2W94A 1W6PB 2WT2A 1LHVA 1GU3A 3ECQA 3JB4C 2N7GA 5L73A 5JMOA 3NKTA 2D7FA 2ZGQA 4BQ2A 2BVBA 1ZBE3 3FC0A 4GA9A 4CDWC 3FFZA 1W28A 4EE2A 2QQIA 1ND3B 2PQQA 4IEWA 4QU1A 3S0MA 2BFUL 4LA3A 3RPQA 4COWA 5IT6A 2YY1A 3U10A 2BZDA 1I1EA 1Z78A 3POGA 1AYM1 1BJQA 2A75A 4Y1XA 1XNCA 2WNEA 3VKFC 1MZ6A 3OYWB 5FYHA 4DUVA 2HWC2 2A3WA 1PK6C 5DAWA 1LOBA 2W1UA 4WZCA 2GAUA 4OHXA 1EPZA 5FMOS 1O5UA 2BWAA 3OEBA 4IEUA 1W2UA 3DYPA 4IGOA 1W90A 1S0EA 3ACGA 3D82A 2DCTA 3HBKA 1A8MA 4QD2A 4A42A 4COUA 2Q8EA 4FOYA 2RS11 2AC1A 5FOJB 3WNKA 4X6RB 3IM0A 2WNVB 4AF9A 4DZGA 2P2KA 4FTBA 1HXS1 1L7LA 2XB6C 3OF1A 3WDXA 1JZ5A 1YQ6A 1KS4A 1AR73 2WO3A 2A6YA 4N9HA 3ZN6A 2YG0A 3LDRA 4P9XA 3K4ZA 1NA1A 5KBFA 1W2OA 2MPFA 5HCAA 1JOPA 1JYTA 1JYCA 2J22A 2ZMLA 5FZEA 5JOXA 3R4DB 3S7IA 3KT7A 5HPOA 2D6LX 2PFWA 3JD71 2VOKA 4ORFA 3H8XA 4QDRA 2R7EB 5JLVA 5FWEA 3P3NA 1IKQA 1VR3A 3C7HA 4ZPIA 5LEKA 4AI3A 1EYBA 2PQSA 4H7LA 5BNNC 1MS4A 1YNAA 2WKKA 1POV3 4EQVA 1Q43A 2VR4A 4FO9A 4G4FA 5LY2A 2W52A 1UZVA 2XR4A 4CCCA 4C8DA 3B94A 1HN1A 2ZABA 3USUA 3EYPA 4I3GA 1Y9QA 2Y33A 2WJSA 2J7MA 2UYAA 5JIUA 1S2KA 2QZ3A 1W0NA 2ZKNA 3T4VA 4BOWA 1F4AA 3DXTA 4JGZC 4Q4W1 5J3UA 3F2ZA 3KCCA 5FUPA 1W9TA 1YFUA 4FPCA 1Y4WA 3M4FA 5A32B 2W5FA 4OQ9A 2W68A 3ZX7A 1OUXA 2VNRA 3L9JT 4C1XA 4IL7A 4XJ9A 3T30A 3GALA 5FP9A 4QPGB 2RJLA 4YG3A 4IQPA 3BVCA 3VD4A 4YNIA 3Q8BA 3I54A 3VBOB 2W46A 5ACA2 1GBGA 2G1MA 2VC9A 4QXHA 1VBA3 1GWKA 4Y5Z0 2BRTA 3JUUA 1VBB2 3MHZA 4HN0A 4RFRB 1F35A 4UFJA 4ES8A 1HX6A 5DUWA 2GN3A 3B93A 3IAPA 3PVBB 4XVHA 4ZKTB 1CAXA 2W0XA 1QJFA 4FPGA 2RS13 3D0SA 2WYSA 4HXCA 4A2UA 3U14A 5ISLA 4E9KA 1XXNA 2C0ZA 2OIIA 1XSQA 4QQ2A 5T3NA 3S5AA 1MS5A 2LM3A 2OQ6A 3WHUA 1MS9A 4ASMB 1YI7A 3IBMA 3WY6A 4GWNA 1OKOA 1D7PM 4KG0A 1UX7A 3VD7A 1C1LA 1JS9A 1S2EA 1ZZ9A 2AH2A 2VQ0A 4PLMA 3KM5A 3WSOA 1RUJ3 5HI0A 3GZAA 4E8DA 5FPUA 1XYOA 3NQHA 3U0ZA 1RUNA 2A71A 3AP7A 5DABA 1LU1A 1CAVB 4ZU5A 5A3OA 5C3OA 4L2NA 2EXJA 2EAAA 2MHFA 1H1AA 4M0HA 1JZ2A 3NMBA 3SLIA 2WRAA 2PA7A 2Y6LA 5T5JA 3RRDA 5LY1A 1AHSA 1DZQA 4DXZA 4F3JA 3CZUA 5JVVA 3NV4A 1HB2A 4FTEA 4ZZ8A 3NSTA 3HN1A 1HB4A 5DUXA 4XJWA 3K46A 1HRV2 3FX3A 3WW3A 1WLTA 3LCPA 4A4AA 3BN6A 1JZ4A 3ETQA 1H2NA 4OZOA 2Q8DA 1TQ5A 2ID4A 4X6QB 3AMNA 2YC4A 2IXCA 3UYJA 4CZSA 1GZCA 3A0NA 5IK4A 4M01A 4YLZA 3VHNA 1K5MA 1CZTA 5A7SA 3SH3A 4AEKA 1DDLA 2E9QA 2BOJA 2CGNA 2ATFA 2R32A 2J42A 2NM1A 3FWEA 5FP3A 1VALA 3RQ0A 1WW4A 3WVJA 5K7PA 2W39A 5K0UC 1T6BX 2IFWA 2W3JA 4L11A 1BEV3 4D6QA 4IV3A 2FHRA 1O6UA 4MGQA 2HWF2 4JDOA 4MVTA 4O61A 4XFFA 4PI2A 4QKDA 4CCLA 3ZXGA 3HMYA 4Q4X2 2JDNA 1XNBA 2VPVA 1LEMA 4HKLA 5L7OA 3UNPA 4RR3C 2OXBA 4HSJA 1NYWA 3OGSA 1G9AA 1ODNA 2CU5A 1AL22 2DUOA 4CU6A 2WINB 2HWC3 1BHGA 4I0AA 3FJSA 1HQLA 4AFCA 4QB1A 1X36A 1IQAA 1GOGA 3GXUA 4OI2A 4AEDB 2FD8A 4BK5A 3VGIA 2QQNA 4YZ3A 1YLLA 2RE9A 4DQAA 5LRSA 4B4PA 2DFCA 4ATFA 3J7MA 4Y22A 5F2WA 1UY3A 1YHFA 2VUDA 1PZ9A 1NCQB 3URFA 4E2SA 2R16A 2BTVC 3DV8A 1RITA 5AC92 2ZEXA 5FZ4A 4MHUA 3WP3A 1SFPA 2W9XA 1AR72 5CISA 2NPIA 3DPRB 4ISRA 5FO8B 3AP9A 1YJLA 2VZUA 3KLSA 1RUC3 3MUY1 1C57A 1QJX3 1J3PA 4EZHA 1RUE1 4HONA 4AEJA 4KWLA 5IVFA 4PCRA 2ZX4A 4QMAA 1W9WA 2GC1A 1LNSA 3AP6A 3TN91 3H0OA 3JD72 1DQ0A 5LW9A 4I02A 3IB3A 1OUSA 2ZMKA 3MZHA 4NR1A 4LKFA 3LE0A 2O14A 3ZXAC 4Q4V3 2DCYA 1VBE1 5HCFA 3RSJA 4RQPB 1RC6A 5A7QA 3FUOA 1EY2A 3GBFA 4AWDA 3NVCA 4YRDA 2JJ6A 1EPWA 3I97A 1I6XA 4E4ZA 4GMP1 2XH6A 4R9BA 1ULFA 4GZ9A 2YPDA 2EVXA 2QBXA 3AYAA 3WG4A 3J8F2 3NL1A 1HKDA 2YU2A 5C4WB 2WA4A 1XNDA 3ACHA 4PQQA 5FPZA 1J3RA 3VBOA 1ONAA 3VBSA 3O1OA 2RDSA 4Q0QA 4RA0A 2XJSA 3AMMA 3HIFA 5GLUA 2QCSB 2FCTA 2DUQA 2VH9A 2GALA 5LEJA 1D0GA 2IZWA 3DECA 2WO2A 3JBG2 5APAA 5FZKA 5J7MA 3D5OA 1JN2P 1R081 4YM3A 2JECA 1H8TB 5FZFA 5ABJA 4Z1VA 5LA9A 1PGL1 4BQWA 1F31A 4Y20A 2HWD3 1DQ2A 4LA2A 4YM0A 1JOBA 3ZMNA 2BUKA 5E16A 4LEJA 4TSVA 1R1ZA 3KWVA 2EICA 5FZ6A 2Z2SB 1SZBA 1ZZBA 4DRVA 4QGLA 4YZ5A 2X5IA 4LIVA 5LWBA 4EN0A 3POIA 5FREA 1V00A 4IV3C 3SHRA 2W08A 3THPA 3RZLA 3ENRA 3GF6A 5ERLA 2JG9A 3M3EA 1QMJA 1S55A 1VAVA 1JHJA 4JCKA 4Q0PA 3BALA 2D40A 2F17A 4N43A 2VZOA 1UYZA 3I3EA 5DMYA 1AR91 4BLJA 1T6GC 4D94A 1UU4A 3VDDB 1W8HA 3OGGA 3VDCA 4Y4RA 1JW6A 3NV1A 3R4UA 3PUHA 4QHOA 1KQRA 2DWRA 5BNQA 4KWJA 5T55A 4K40A 3WCSA 4Z92B 1VBD2 4R8HA 5F1RA 3J4UH 3VBHC 5I0RA 4QPYA 1LHWA 2XVGA 3MF9A 5H9QA 1RMU2 1NZCA 2Q0AA 4V2VA 3C7GA 2H6BA 4KWUA 3T2QA 5J09A 2WNUB 2FDJA 4K20A 4XF4A 1KJRA 5F3GA 4EWDA 1UF2C 1H1MA 1WCDJ 3CKHA 4FQZA 1HRV3 2YPJA 1MEC2 3SKJE 4COZA 3L2YA 3OUJA 4JDMA 2HWB2 2BGCA 4GH4B 1FNZA 4HVOA 2D3PA 2ZX3A 1D4M2 1HJGA 4ZXEA 5HXVA 5FZ0A 3V65A 1N47A 1IS5A 3ZXFA 5LA1A 1GZWA 5LB6A 1QJZA 4M0NA 2YZ4A 2P4EA 3I2JA 5FUIA 5FPBA 4UBHA 4LLOA 4CDUB 2QDNA 2BPA2 1VMHA 5AC93 1XOYA 2VOTA 1ASJ1 1PO13 2XMLA 1QIQA 1UOJA 3F95A 5FYVA 3E6DA 4DY5A 3VBFC 3C7OA 3T0BA 1FPN1 4JC1A 4PIXA 4H55A 3AZXA 3TEWA 2DU0A 5A6ZA 2I07B 2VMGA 1JYVA 1V6IA 1J3QA 1N3QA 3OUHA 5FP4A 3ZXEA 5FZCA 4TN7A 1DGRA 2ET7A 4N9IA 4UT5A 4XC9A 5GALA 4PLOA 4CEWA 3LAGA 1QXPA 2DVFA 2WBKA 4LJHA 1EAH2 2J1VA 4CDUC 1S0JA 5EJZB 1QJX2 4YW1A 4KBZA 2G9FA 4Q4W3 2OKXA 3WLUA 2DVDA 4P9GA 3OYWA 2HKXA 1TME1 2R061 5KC5A 1AL21 4K9SA 3MEPA 1Q8QA 2EXHA 4AVSA 4D3WA 2JDHA 2JE9A 4DY3A 1EP0A 5J96B 1HIXA 4I0WB 2Z5WA 2P34A 1ULEA 3C8XA 1PK6B 5ACA3 1VE0A 2KM2A 3EB7A 1CZSA 2V5YA 2XKPA 5FPVA 2EA7A 5FZ8A 3P5BA 1DLCA 2A1XA 2YMZA 1S0CA 5GZCA 1UWWA 4M4RA 4JKLA 5A7NA 1OLME 5H9PA 3SKVA 4COYA 3JD73 4ARYA 4NIGA 2NYYA 2Q1MA 2Y60A 4J1WA 2IUWA 1OHFA 2R063 3ZSKA 5A33A 4UOJA 1LOAA 3NNMA 1JI6A 1TMF1 3VDDC 4YVSC 1WA4A 5B2GB 2WNVC 2BGOA 4RQPA 4ZHNA 1WCQA 3GZUC 3RZZA 2D5FA 5L9RA 3BTZA 3C7EA 4BPZA 1MACA 3LD8A 5T5OA 3AZWA 4QX7A 1OLRA 4YM2A 5FZMA 2RS32 4YVWC 4CDXB 2X05A 1MVQA 3MIFA 4ZU4A 3VBUC 4R4XA 3S57A 3VZKA 1IOAA 4QB2A 4WM8B 2Q5TA 5KHJA 1JZ6A 4QX2A 3GJBA 5F39A 5BPXA 1J1LA 3POYA 1QDOA 1O3SA 4Q26A 2YBKA 4AFAA 1CR7A 1QDCA 2C4XA 4W8JA 3VKNA 5IK8A 4OULA 3WF3A 5IVJA 1OOPA 1VBC2 1DQ4A 2EIDA 2IXIA 1CPNA 1JTZX 3MV01 4A45A 1W2AX 1BQPA 1PVC2 4LKDA 2G9GA 4QPIA 5JZGB 4I01A 4RHV1 3X29B 3SCFA 5A32A 4OUMA 1YIFA 3MGUA 4OVEA 4LKSA 1SHWB 1JODA 4LBQB 2ZHLA 1AXYA 3H9AA 3N7JA 4XFCA 3AL5A 1H8TA 4OMCA 1IG0A 2EIBA 3AKTA 1DQ5A 1LRHA 2AACA 4XURA 4XYXA 3RG0A 4KL1A 1ZRFA 1KITA 2ZGRA 1ALYA 4GD4A 4AK3A 5CADA 3A21A 1QHDA 1PZ7A 4XMIA 4QDSA 5IYYA 1NAEA 3ZFGB 4K6BA 2OX0A 3PHMA 2VNVA 2BBVA 3U4SA 5FYMA 5BNOA 1WD4A 3JU9A 1W6MA 3VL8A 2FDKA 3WF2A 1Y3TA 4NUBA 4QX1A 1W0OA 5H9SA 3WNLA 3ZYIB 2H6CA 1ZBE2 2VE1A 1QXJA 3K4AA 3AZYA 4HOOA 3WEZA 1OLMA 1F8VA 3GYDA 1XPWA 3IMMA 4NHKA 2PHTA 1RTVA 3CO2A 2WZR1 2R042 4G9SB 1OT5A 1P8JA 4HBNA 4UWDA 3ZYFA 5DDJ1 2E33A 1JUIA 5F9TA 3I2OA 5F3CA 3IKWA 4IE7A 2LRPA 2WSUA 2XGXA 4AFBA 5C33A 2BP6A 3SEEA 4B1LA 3H50A 4E4SA 2IXHA 3HEIA 1IKPA 4MLOA 4XABA 1IQDC 2V72A 3OOXA 5CG9A 2O0OA 1OA3A 2PHXA 4JRAA 4WM7B 4BXSV 4DXRA 1S1AA 2FDIA 1QOOA 3B69A 3RYKA 1SLTA 4P9WA 4XQ4A 3ZVXA 4XJUA 2E53A 5C9AC 1YFWA 1Q8PA 4R9DA 2AGSA 2P17A 2JIGA 3AM2A 3H3LA 2X53S 2D6NA 4OQ8A 4NMIA 3WT3A 2P3YA 4NOTA 1O5LA 3DN7A 1RMU1 3U07A 1SFNA 3I59A 2A5ZA 2D6KA 4AGGA 2WA3A 4FAGA 3I2IA 2PLV2 4D6RA 1SLCA 1IS6A 1MEC1 2ENRA 1R083 2R1BA 4DXTA 5KXEA 1FOD3 1Y7BA 3ZSMA 1W3VA 4ZS3A 1WW5A 2K0GA 3HNBM 1DG6A 4JGYB 1UY2A 2GH8A 1PO21 4FXGB 4GB31 5BXXA 2JDYA 3C7FA 1G9DA 4BJ0A 4FPOB 1J59A 3KT1A 4GB32 2B5HA 1JZ7A 1FPN3 2B7YA 4E2QA 3ZDSA 2JG8B 2XBO2 1ZZ6A 1UY4A 2J1EA 1JU3A 5FYCA 3CDZB 4N7IA 4MH0E 3PIGA 4CCNA 2XQRA 1SEFA 3M3CA 1UU5A 1WCSA 5K0UA 1TME2 4XBLA 3BKZA 1LU2A 1V6JA 1ULOA 1AX2A 1AJOA 2JKXA 4Y1VA 5FY4A 2UWCA 4PF5A 3AZVA 5FIXA 5C8WA 1VBB3 3GBGA 3MDPA 4FFHA 5KXCA 2FQPA 4AVBA 4N90A 2ES3A 1G9FA 4YVWB 4OHZA 2R071 2VZ1A 1AX0A 2R062 3FFQA 1QJU1 3BTYA 1AR82 5HV4A 3QOPA 5CG8A 1NKGA 4R9CA 4CP2A 5JXJA 4NIHA 4DINB 3QCWA 2ZTNA 1LHOA 2NMOA 2EIEA 3GDBA 3B9CA 3WP6A 1VBB1 3W9AA 2RHPA 2XLGA 1G7YA 5GZDA 3ROUA 1BYHA 4EN6B 4JTNA 1B09A 4Y5SA 3Q9OA 3V64A 4FPYA 5DQ0A 1OXCA 3G6JB 2D5HA 3KT4A 4OI1A 3KD4A 5A3WA 3LEKA 2OZ6A 1CQ9A 3HQXA 2D3RA 1E5IA 2R49A 3HR9A 4EV0A 1RUG1 3WNMA 2HEVF 2RS31 3NO8A 3WF1A 4W6WA 4IEVA 4JGZB 3VBSC 2RR11 5EP9A 5L9BA 2VJXA 1WGPA 4BISA 2JDKA 2FDFA 4JHTA 1ZX5A 1U5XA 4LHNA 4Y22B 2PAEA 2HWC1 2LW8A 1RL3A 1ND2C 3OCPA 1AJKA 3LA3A 4KG8A 1PIV2 2WN3A 1H9PA 1W8UA 4YVSB 2B46X 4HFSA 4WVZA 1JHNA 1RJ8A 1ND3A 1JYWA 4I2OA 4CCDA 4NROA 5FPLA 2IFRA 2FCUA 2PELA 5FZIA 4XFIA 3AJYA 2HWB3 2JD9A 1UAIA 3DYOA 4W6YA 1HRI3 5A1LA 1A8DA 1REEA 3APBA 3SISA 1D2QA 4A3ZA 4AXOA 3PUAA 5D8AA 5JSOA 3B00A 1QQP1 4O9GA 4AGRA 2PXJA 4XOGA 5DAPA 4BH9A 4LNVA 5CFDC 1T2XA 2UWBA 3QD6A 1W39A 3S5QA 2OYZA 4CTEA 2WIIB 3DCQA 5ANNA 2JG9C 2R1DA 5G04L 5C8CB 1W8NA 5JOZA 3BI3A 3AVRA 4FXKB 1TEIA 5FYYA 1V70A 2VZRA 1JUHA 3O0XA 3KQ4B 1ACCA 3SMHA 3EQEA 4K8FA 3M3OA 5JDBA 4AOCA 3P6BA 5DZEA 4IV1B 4A44A 2EAKA 3WUCA 1UZ0A 1UZYA 1C8NA 1ULPA 3ZSJA 3NKGA 4TZDA 3O12A 2PAMA 4H7MA 4Z8BA 1H2KA 2JG9B 1BK1A 2QQMA 2RS52 2VZTA 4MXVA 4RL7A 4XETA 5C8CC 4CDQB 2WZPP 4AQTA 4COVA 5FBZA 3TEZA 1BVVA 2DVGA 3PURA 5IAXA 2HWF1 2ZGMA 1HB1A 3IIAA 1X8MA 4R52A 3VDDA 2DVBA 2VECA 3M1HA 1QU0A 1STMA 3RNSA 5FBJA 2DTYA 2VD7A 4DMIA 2ZS6B 4LBQD 4GMP3 3TAYA 4Q27A 3QACA 4BQYA 4QHZA 1AR92 1W8ZA 3LF7A 3SH4A 2A6WA 1RUC1 1DGRN 5CFCB 3PTYA 5A7PA 3OBTA 5JOYA 4HK9A 3J7NA 1QF3A 3OBZA 4O7XA 2QFEA 3N9QA 1WCUA 3Q8AA 1IS4A 4EZ4A 1SFYA 5CA6A 4M3CE 2XWJB 1U5YA 5FYTA 3ILFA 4N43C 1SMVA 1AR61 1KS5A 5FRAA 1IGOA 2VCMA 2WZR2 1Q5OA 1CAXB 4QX8A 3ZFFA 4NAMA 4UFMA 4YWAA 4CCMA 3SCHA 1W9YA 3ATGA 4AW7A 4F83A 3BTAA 2W95A 3VB9A 2RM21 4DUWA 3SCGA 2XG3A 3H8OA 1L3JA 4U36A 3ZYJB 1XYNA 4UF0A 1H8TC 3QH7A 4DEVA 4RHV3 3ILRA 5T5LA 4AQ6A 2KD7A 4H2AA 4CEYB 2A73B 3WG1A 5A6YA 3R6SA 1Z7S1 4XHXA 4AI0A 1OD5A 2DBIA 3AVSA 1XE8A 2PLV1 2DUPA 3H8UA 5FMDA 1QWRA 4D6SA 1GV9A 5C3QA 2P6CA 1MQTA 2PHUA 1C5IA 2XXZA 4N53C 4JGYC 5G05L 5IVCA 4J6GA 3RJRA 4ZONA 4XUQA 4NO4A 1R092 4B3NA 4QXCA 4BU2A 1QKQA 2IWGB 5FMBA 2P3IA 4Y26A 2JIJA 3OBRA 1UYYA 4LBNA 5DN2A 2PLV3 4E27A 3EJKA 3RI9A 1LGCA 2PHDA 5JOWA 1OFSA 2IC1A 1FMD3 5FY8A 4BQXA 4RQPC 4LIUA 2GC2A 3N9MA 2HWD2 2UY9A 2W47A 4MV2A 4P9LA 2Y6FA 4UFHA 2R6QA 4GQ7A 2RG4A 4QGNA 3W21A 1OA4A 3PVOA 1UIKA 2L9LA 4A7ZA 1KJLA 1QJX1 4NPMA 4TYSA 2ZZJA 2HWE1 3ZSEA 2VTFA 2C1FA 1XJAA 3LA2A
chains in the Genus database with same CATH topology
4JKMA 3ACHA 4CU7A 1WKYA 4PQQA 5JXIA 3OBAA 3T09A 3VD9A 1K45A 3THDA 3ACIA 4D8MA 3NNGA 4DXSA 4E8CA 1RYYA 3T0DA 5CYYA 3DECA 2WO2A 4JHZA 2Y6KA 4A6OA 1CZVA 1PMHX 3BGAA 4MADA 4QDQA 3LEGA 2C26A 2XHNA 2EICA 4Z2AA 3IDAA 1GOFA 4TXWA 3OB8A 3FL7A 1KEXA 3I3DA 4QX0A 4CU9A 1EUTA 5IFTA 1NUKA 1JHJA 5DMYA 2VZOA 1UYZA 3I3EA 1K12A 1US3A 1UXXX 3VDCA 3HOBA 2W1SA 3PUHA 1YQ2A 4W50A 3J7HA 3HNYM 3OG2A 1GMMA 4TTGA 3C7GA 4KWUA 3T2QA 2VCCA 5EIYB 3CKHA 1GOHA 3SKJE 4RN5A 4MOAA 1I5PA 4XUNA 1L7RA 4ZXEA 3W5MA 2E26A 2VZQA 5LA1A 1H6XA 1O8PA 4IUGA 4DUXA 5FUIA 5IFPA 3I2JA 1J84A 2ZEZA 5A1AA 4LPLA 2VOTA 3T2OA 1SG3A 1W9SA 2LS6A 4W4ZA 3C7OA 3T0BA 3I2FA 3DYMA 3ACFA 3VDBA 3UETA 5JXGA 2WDBA 1JYVA 3A7QA 4ZZ5A 3FHQA 2ORXA 4L0PA 1UY1A 2C9KA 2VZ3A 2WBKA 2J1VA 2WZEA 2W91A 5EJZB 4QPWA 2E31A 2OKXA 4FI9A 3OGVA 1DYOA 3MBWA 2W1WA 1UMHA 2J1SA 1UY0A 1XC6A 2VZVA 3C8XA 3LPFA 3EB7A 1CZSA 2CDOA 2J1UA 2WABA 2XQXA 3GM8A 3I3BA 2Z4FA 1JYNA 1DLCA 3NJVA 2WN2A 1UWWA 4M4RA 3HJRA 4XUTA 2W1QA 4JKLA 3SKVA 2Y6JA 3WQBA 4ARYA 3I2GA 2RVAA 1JZ8A 5JUVA 2V5DA 4UOJA 5B4NA 1JI6A 2WQ8A 2BGOA 5JXHA 3WNPA 3FHAA 1WCQA 3U37A 3SEPA 1KGYA 3C7EA 4JX0A 3IAQA 2VL4A 3NJXA 2ORZA 2X05A 3WF0A 4QB2A 2QQOA 1JZ6A 4QX2A 3T0AA 4GWIA 4M4PA 2XONA 1DP0A 3I2HA 3CMGA 2WO1A 2C4XA 4W8JA 1GUIA 2VQUA 3WF3A 1L7QA 2EIDA 1O59A 4A45A 3MV01 3A22A 3MUZ1 2QQKA 3JXSA 3E1F1 4P08A 4PT6A 4BK4A 2VZSA 5B4XA 4LKSA 1SHWB 4UI9L 3LEIA 1O8SA 2BBAA 3WNNA 4OMCA 1UXZA 2EIBA 4XURA 3LQCA 4GWJA 3FN9A 3A21A 5IYYA 4QDSA 1NAEA 2JE8A 4ARXA 2HLEA 3T08A 1F4HA 1US2A 3VDAA 4QX1A 3WF2A 3WF4A 4XUOA 5DPNA 3WNLA 3WEZA 3K4AA 2WUHA 1XPWA 5J1XA 2ZEYA 4OUEA 4QAWA 2WAOA 2VMDA 3GGLA 3K75B 1OT5A 1P8JA 4CUCA 2E33A 4DEQA 3ETPA 3SEEA 2V4VA 1TVGA 4OMDA 3HEIA 1IQDC 2V72A 1XNTA 2VMEA 4BXSV 4DXRA 4UAPA 3K4DA 2W94A 3ECQA 1GU3A 5JMOA 2BGPA 1W8OA 1UYXA 2QQIA 1XNAA 1JYXA 5IJRA 2BZDA 3I2KA 2J1TA 4P00B 1JZ3A 4DUVA 3MV11 1UMIA 3I2IA 2YFUA 2W1UA 2VO5A 4DXTA 3OEBA 2Y6GA 2JDAA 3DYPA 3P1IA 3ACGA 2VCAA 4A42A 3HNBM 1UY2A 3A23A 2X10A 5LA0A 3WNKA 3C7FA 5CZKA 4BJ0A 2B4KA 1JZ5A 2Y6HA 2WO3A 1JZ7A 2ZXQA 1OF3A 2YG0A 4XUPA 2VM9A 3K4ZA 4XZUG 1UY4A 1W99A 2J1EA 1JU3A 2J22A 3CDZB 4YPJA 5HPOA 4QDRA 2R7EB 4PF1A 1ULOA 3C7HA 2JKXA 2VMCA 5I0DA 2PQSA 4QB6A 5HXMA 1PX4A 2VR4A 2W92A 1HN1A 2VZ1A 3EYPA 2DDUA 1NKGA 4ZY9A 2J7MA 5JXJA 1W0NA 2Y64A 1F4AA 2EIEA 3GDBA 3F2ZA 3AC0A 1W9TA 3VD5A 4A41A 4CUAA 2W5FA 5DQ0A 4CUBA 3VD4A 4BDVB 3LEKA 2W46A 3CZJA 1CIYA 3WNMA 2VC9A 2RV9A 3WF1A 1JU4A 5C71A 2VJXA 2WZ8A 4P02B 1EUUA 2BERA 2LW8A 1K3IA 2ZEWA 1PMJX 3IAPA 4XVHA 3IIIA 1PX3A 2WN3A 2WYSA 2W87A 3T2PA 5JR2A 3D3AA 2Y8KA 1JYWA 4KI5M 2VQTA 4AAXA 2QQJA 2JD9A 3DYOA 4D0QA 3UESA 1D7PM 1UX7A 3VD7A 4A3ZA 3WSOA 2CDPA 4CU8A 1T2XA 2VMFA 4E8DA 3NQHA 3W5NA 5G04L 3K77A 1W8NA 2B9VA 1JZ2A 2VZRA 3WNOA 4LHSA 2Y6LA 3CZUA 2RJ2A 2DCKA 3P6BA 4ZZ8A 2HYXA 4A44A 1UZ0A 3K46A 1ULPA 4P5YA 1OH4A 1R64A 4A4AA 3BN6A 1JZ4A 2QQMA 2VZTA 4OZOA 1K42A 2ID4A 2YC4A 2YFZA 2YC2A 1GQPA 4KMQA 1CZTA 2DCJA 4LQRA 2VZPA 2XOMA 1CX1A 4MGSA 5F7UA 2W3JA 4HG6B 4OYUA 3LPGA 3PUIA 4MGQA 3HN3A 5C70A 2J1AA 3CQOA 2X09A 3VD3A 5EJ1B 4QX3A 3UNPA 4AG4A 3OGSA 3CIHA 2VCBA 3MO4A 4CU6A 1BHGA 2W95A 4DUWA 3HPNA 4QB1A 3GXUA 1GOGA 1OD3A 4MO3M 4BK5A 1OF4A 2QQNA 3OGRA 4DEVA 5LCWL 2KD7A 2J1RA 4RYDA 2QQLA 1UY3A 2ZEXA 1J83A 2YB7A 2W9XA 1SDDB 3HNMA 2VZUA 1GNYA 1TG7A 2E32A 3MUY1 2WAAA 5G05L 5IHRA 1H6YA 4XUQA 4CVUA 3ZM8A 1W9WA 1LNSA 1MPXA 1UYYA 3IB3A 3NRUA 5DN2A 3LE0A 3ABZA 3OEAA 5LA2A 5C7GA 3I97A 1NX9A 2W47A 4ET7A 3THCA 4GZ9A 2L9LA 2QBXA 4JKKA 2VTFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKM A;  3ACH A;  4CU7 A;  1WKY A;  4PQQ A;  5JXI A;  3OBA A;  3T09 A;  3VD9 A;  1K45 A;  3THD A;  3ACI A;  4D8M A;  3NNG A;  4DXS A;  4E8C A;  1RYY A;  3T0D A;  5CYY A;  3DEC A;  2WO2 A;  4JHZ A;  2Y6K A;  4A6O A;  1CZV A;  1PMH X;  3BGA A;  4MAD A;  4QDQ A;  3LEG A;  2C26 A;  2XHN A;  2EIC A;  4Z2A A;  3IDA A;  1GOF A;  4TXW A;  3OB8 A;  3FL7 A;  1KEX A;  3I3D A;  4QX0 A;  4CU9 A;  1EUT A;  5IFT A;  1NUK A;  1JHJ A;  5DMY A;  2VZO A;  1UYZ A;  3I3E A;  1K12 A;  1US3 A;  1UXX X;  3VDC A;  3HOB A;  2W1S A;  3PUH A;  1YQ2 A;  4W50 A;  3J7H A;  3HNY M;  3OG2 A;  1GMM A;  4TTG A;  3C7G A;  4KWU A;  3T2Q A;  2VCC A;  5EIY B;  3CKH A;  1GOH A;  3SKJ E;  4RN5 A;  4MOA A;  1I5P A;  4XUN A;  1L7R A;  4ZXE A;  3W5M A;  2E26 A;  2VZQ A;  5LA1 A;  1H6X A;  1O8P A;  4IUG A;  4DUX A;  5FUI A;  5IFP A;  3I2J A;  1J84 A;  2ZEZ A;  5A1A A;  4LPL A;  2VOT A;  3T2O A;  1SG3 A;  1W9S A;  2LS6 A;  4W4Z A;  3C7O A;  3T0B A;  3I2F A;  3DYM A;  3ACF A;  3VDB A;  3UET A;  5JXG A;  2WDB A;  1JYV A;  3A7Q A;  4ZZ5 A;  3FHQ A;  2ORX A;  4L0P A;  1UY1 A;  2C9K A;  2VZ3 A;  2WBK A;  2J1V A;  2WZE A;  2W91 A;  5EJZ B;  4QPW A;  2E31 A;  2OKX A;  4FI9 A;  3OGV A;  1DYO A;  3MBW A;  2W1W A;  1UMH A;  2J1S A;  1UY0 A;  1XC6 A;  2VZV A;  3C8X A;  3LPF A;  3EB7 A;  1CZS A;  2CDO A;  2J1U A;  2WAB A;  2XQX A;  3GM8 A;  3I3B A;  2Z4F A;  1JYN A;  1DLC A;  3NJV A;  2WN2 A;  1UWW A;  4M4R A;  3HJR A;  4XUT A;  2W1Q A;  4JKL A;  3SKV A;  2Y6J A;  3WQB A;  4ARY A;  3I2G A;  2RVA A;  1JZ8 A;  5JUV A;  2V5D A;  4UOJ A;  5B4N A;  1JI6 A;  2WQ8 A;  2BGO A;  5JXH A;  3WNP A;  3FHA A;  1WCQ A;  3U37 A;  3SEP A;  1KGY A;  3C7E A;  4JX0 A;  3IAQ A;  2VL4 A;  3NJX A;  2ORZ A;  2X05 A;  3WF0 A;  4QB2 A;  2QQO A;  1JZ6 A;  4QX2 A;  3T0A A;  4GWI A;  4M4P A;  2XON A;  1DP0 A;  3I2H A;  3CMG A;  2WO1 A;  2C4X A;  4W8J A;  1GUI A;  2VQU A;  3WF3 A;  1L7Q A;  2EID A;  1O59 A;  4A45 A;  3MV0 1;  3A22 A;  3MUZ 1;  2QQK A;  3JXS A;  3E1F 1;  4P08 A;  4PT6 A;  4BK4 A;  2VZS A;  5B4X A;  4LKS A;  1SHW B;  4UI9 L;  3LEI A;  1O8S A;  2BBA A;  3WNN A;  4OMC A;  1UXZ A;  2EIB A;  4XUR A;  3LQC A;  4GWJ A;  3FN9 A;  3A21 A;  5IYY A;  4QDS A;  1NAE A;  2JE8 A;  4ARX A;  2HLE A;  3T08 A;  1F4H A;  1US2 A;  3VDA A;  4QX1 A;  3WF2 A;  3WF4 A;  4XUO A;  5DPN A;  3WNL A;  3WEZ A;  3K4A A;  2WUH A;  1XPW A;  5J1X A;  2ZEY A;  4OUE A;  4QAW A;  2WAO A;  2VMD A;  3GGL A;  3K75 B;  1OT5 A;  1P8J A;  4CUC A;  2E33 A;  4DEQ A;  3ETP A;  3SEE A;  2V4V A;  1TVG A;  4OMD A;  3HEI A;  1IQD C;  2V72 A;  1XNT A;  2VME A;  4BXS V;  4DXR A;  4UAP A;  3K4D A;  2W94 A;  3ECQ A;  1GU3 A;  5JMO A;  2BGP A;  1W8O A;  1UYX A;  2QQI A;  1XNA A;  1JYX A;  5IJR A;  2BZD A;  3I2K A;  2J1T A;  4P00 B;  1JZ3 A;  4DUV A;  3MV1 1;  1UMI A;  3I2I A;  2YFU A;  2W1U A;  2VO5 A;  4DXT A;  3OEB A;  2Y6G A;  2JDA A;  3DYP A;  3P1I A;  3ACG A;  2VCA A;  4A42 A;  3HNB M;  1UY2 A;  3A23 A;  2X10 A;  5LA0 A;  3WNK A;  3C7F A;  5CZK A;  4BJ0 A;  2B4K A;  1JZ5 A;  2Y6H A;  2WO3 A;  1JZ7 A;  2ZXQ A;  1OF3 A;  2YG0 A;  4XUP A;  2VM9 A;  3K4Z A;  4XZU G;  1UY4 A;  1W99 A;  2J1E A;  1JU3 A;  2J22 A;  3CDZ B;  4YPJ A;  5HPO A;  4QDR A;  2R7E B;  4PF1 A;  1ULO A;  3C7H A;  2JKX A;  2VMC A;  5I0D A;  2PQS A;  4QB6 A;  5HXM A;  1PX4 A;  2VR4 A;  2W92 A;  1HN1 A;  2VZ1 A;  3EYP A;  2DDU A;  1NKG A;  4ZY9 A;  2J7M A;  5JXJ A;  1W0N A;  2Y64 A;  1F4A A;  2EIE A;  3GDB A;  3F2Z A;  3AC0 A;  1W9T A;  3VD5 A;  4A41 A;  4CUA A;  2W5F A;  5DQ0 A;  4CUB A;  3VD4 A;  4BDV B;  3LEK A;  2W46 A;  3CZJ A;  1CIY A;  3WNM A;  2VC9 A;  2RV9 A;  3WF1 A;  1JU4 A;  5C71 A;  2VJX A;  2WZ8 A;  4P02 B;  1EUU A;  2BER A;  2LW8 A;  1K3I A;  2ZEW A;  1PMJ X;  3IAP A;  4XVH A;  3III A;  1PX3 A;  2WN3 A;  2WYS A;  2W87 A;  3T2P A;  5JR2 A;  3D3A A;  2Y8K A;  1JYW A;  4KI5 M;  2VQT A;  4AAX A;  2QQJ A;  2JD9 A;  3DYO A;  4D0Q A;  3UES A;  1D7P M;  1UX7 A;  3VD7 A;  4A3Z A;  3WSO A;  2CDP A;  4CU8 A;  1T2X A;  2VMF A;  4E8D A;  3NQH A;  3W5N A;  5G04 L;  3K77 A;  1W8N A;  2B9V A;  1JZ2 A;  2VZR A;  3WNO A;  4LHS A;  2Y6L A;  3CZU A;  2RJ2 A;  2DCK A;  3P6B A;  4ZZ8 A;  2HYX A;  4A44 A;  1UZ0 A;  3K46 A;  1ULP A;  4P5Y A;  1OH4 A;  1R64 A;  4A4A A;  3BN6 A;  1JZ4 A;  2QQM A;  2VZT A;  4OZO A;  1K42 A;  2ID4 A;  2YC4 A;  2YFZ A;  2YC2 A;  1GQP A;  4KMQ A;  1CZT A;  2DCJ A;  4LQR A;  2VZP A;  2XOM A;  1CX1 A;  4MGS A;  5F7U A;  2W3J A;  4HG6 B;  4OYU A;  3LPG A;  3PUI A;  4MGQ A;  3HN3 A;  5C70 A;  2J1A A;  3CQO A;  2X09 A;  3VD3 A;  5EJ1 B;  4QX3 A;  3UNP A;  4AG4 A;  3OGS A;  3CIH A;  2VCB A;  3MO4 A;  4CU6 A;  1BHG A;  2W95 A;  4DUW A;  3HPN A;  4QB1 A;  3GXU A;  1GOG A;  1OD3 A;  4MO3 M;  4BK5 A;  1OF4 A;  2QQN A;  3OGR A;  4DEV A;  5LCW L;  2KD7 A;  2J1R A;  4RYD A;  2QQL A;  1UY3 A;  2ZEX A;  1J83 A;  2YB7 A;  2W9X A;  1SDD B;  3HNM A;  2VZU A;  1GNY A;  1TG7 A;  2E32 A;  3MUY 1;  2WAA A;  5G05 L;  5IHR A;  1H6Y A;  4XUQ A;  4CVU A;  3ZM8 A;  1W9W A;  1LNS A;  1MPX A;  1UYY A;  3IB3 A;  3NRU A;  5DN2 A;  3LE0 A;  3ABZ A;  3OEA A;  5LA2 A;  5C7G A;  3I97 A;  1NX9 A;  2W47 A;  4ET7 A;  3THC A;  4GZ9 A;  2L9L A;  2QBX A;  4JKK A;  2VTF A; 
#chains in the Genus database with same CATH topology
 1GZW B;  5K4L A;  1ZRC A;  3MYX A;  5FZG A;  1VJ2 A;  3ME2 A;  1C8M 1;  3E5X A;  3OBA A;  1UIJ A;  4AI9 A;  1TNF A;  3C3V A;  3E6B A;  5I0T A;  2HEY F;  3VD9 A;  3G7D A;  1AR6 3;  2ZHM A;  5J36 A;  2BOI A;  1TME 3;  4YSF A;  3NNG A;  4M3C B;  4Q4X 1;  4DXS A;  4PDW B;  5BNP B;  4YGE A;  3PIJ A;  4YZ1 A;  2YC0 A;  1YWK A;  5C3S A;  1J1T A;  3AYD A;  2ZAH A;  4A6O A;  3PTR B;  1PK6 A;  2RR1 2;  3BGA A;  3M2M A;  4FPE A;  1QOS A;  2RS5 3;  4JV4 A;  1UOB A;  3ZO0 B;  5KXB A;  4FQ4 A;  2JIC A;  3T3Y A;  4Z2A A;  1VBD 1;  1GOF A;  4RS5 C;  1HXS 2;  5FJK A;  1YQC A;  1GFF 2;  4QX0 A;  4W6X A;  4AHZ A;  4CU9 A;  4FPF A;  2D3S A;  5BNO C;  3TB0 A;  2JKB A;  5HCB A;  1H1I A;  3ST7 A;  1NUK A;  1KFU L;  1DU3 D;  3WQ1 A;  1MVE A;  5GZG A;  4DFS A;  2JEM A;  4SLI A;  3UGG A;  1W03 A;  1RUF 3;  4NJ4 A;  1US3 A;  1UXX X;  2FZ2 A;  1K5M B;  3MLL A;  5IVB A;  5FZB A;  5CVR A;  1YFX A;  3ZKU A;  4JTO A;  4ZS2 A;  2RMU 2;  3J7H A;  4HVQ A;  2Y34 A;  5F5Q A;  1KRI A;  1VBC 1;  4EJR A;  1Q3E A;  3B01 A;  5BV6 A;  1GMM A;  4QQO A;  2VY0 A;  4TTG A;  5CFC C;  1EV1 3;  1A78 A;  4LOS A;  3DPR A;  4OHW A;  4M3C F;  3ILN A;  1Q8V A;  1TZO A;  4JQR A;  2VAU A;  1PM7 A;  5EIY B;  2GDF A;  1OOP B;  1PVX A;  4LO5 B;  3BOP A;  1XU1 A;  4BYY A;  4WM8 C;  1L7R A;  2VQA A;  3KCY A;  2G4I A;  4K21 A;  3UK9 A;  3OY8 A;  5DG1 A;  4BLI A;  1AR9 3;  4IUG A;  3ASI A;  1COV 2;  3DXU A;  1ULG A;  4GJY A;  4CDW A;  5A1A A;  3LIH A;  4HZF A;  2Q1F A;  1R08 2;  2CL2 A;  4LT5 A;  5L36 A;  3POF A;  5A7W B;  3MID A;  3FLT A;  2IVI B;  4PBO A;  1VBA 2;  5LAT A;  5FOB B;  4QXK A;  1YQ8 A;  3DYM A;  1CX4 A;  4XIK A;  3UET A;  1RIN A;  1DF0 A;  2YYO A;  4FOW A;  5I8Y A;  4AHX A;  2E7A A;  3B7M A;  3D0J A;  3WNX A;  1AYN 1;  2VUL A;  4KU8 A;  3WQ0 A;  5IWF A;  4FTS A;  1QH7 A;  2W91 A;  4QPW A;  4CP0 A;  3HWJ A;  4HPK B;  4FOV A;  4BQ5 A;  1GNH A;  5KXD A;  2WT0 A;  5FPA A;  1DYO A;  3FZ3 A;  1B35 C;  1FOD 2;  3ZOI A;  3O14 A;  5C5T A;  4JZR A;  1TNR A;  1UY0 A;  4OI4 A;  2VZV A;  2IXJ A;  5ABJ B;  3VZJ A;  4A7K A;  3GCX A;  3H1M A;  4YW3 A;  4SBV A;  1MQT B;  1ZZ8 A;  2ADE A;  3KCX A;  4HT1 T;  5GKA C;  4QM9 A;  3GM8 A;  2Z4F A;  1Z7S 2;  2Z42 A;  3DF0 A;  3V0B A;  5KHG A;  5GZE A;  4NN0 A;  2XBO 3;  4D7S A;  2W1Q A;  2GP3 A;  4JVA A;  2VXR A;  1SBE A;  2R30 A;  1PGW 1;  1OQ1 A;  3PDQ A;  3RWK X;  2QQU A;  1JZ8 A;  3USU B;  1RHI 2;  5C3R A;  2XHK A;  5JUV A;  4CDQ C;  3AX4 A;  1R09 3;  1VRB A;  3PU8 A;  1NY7 2;  3VBR C;  2ARB A;  2WQ8 A;  3EO6 A;  3WNP A;  1Q8S A;  4BHP A;  4RS5 A;  3SEP A;  4BMB A;  2NP0 A;  1AYN 3;  1NY7 1;  1ZBA 3;  3A4U A;  5FXW A;  4YW5 A;  1BBT 2;  2HWE 3;  4UW3 A;  1QJY 3;  4MGT A;  3NJX A;  4MGZ E;  2ORZ A;  4HL0 A;  4AI2 A;  3PJQ A;  2PN5 A;  5A3N A;  3AP5 A;  2WC2 A;  4XCA A;  2WLP A;  2QQO A;  2BVV A;  1NLR A;  3T0A A;  4GWI A;  4ITC A;  1DP0 A;  3NNL A;  3I2H A;  3CMG A;  5AFB A;  1D0H A;  1UYP A;  3RMX A;  5C3P A;  1GUI A;  1VPH A;  2JB4 A;  2XDV A;  2E7Q A;  3UKT A;  2WR9 A;  2VQU A;  4AFD A;  3I8T A;  4AAP A;  1O59 A;  2XJT A;  2JB8 A;  4X8P A;  2UU8 A;  3JXS A;  1ULC A;  3IDC B;  1RMU 3;  1GR3 A;  4GB3 3;  5KHH A;  4XJA A;  3SNM A;  3ZSL A;  3Q8F A;  4UI9 L;  3LEI A;  1W3X A;  4N7U A;  3MI8 A;  1LEC A;  4Q1R A;  3WNN A;  4CP9 A;  3IZO A;  3OTF A;  1UXZ A;  2ETE A;  5A70 A;  2XPJ A;  1DYP A;  3EBR A;  4GWJ A;  1D4M 3;  3MIE A;  3SC7 X;  3FN9 A;  4XTP A;  5BNN B;  1YI9 A;  4GH4 C;  1V9U 2;  5FUN A;  1UOF A;  4ARX A;  3T08 A;  3Q8C A;  1DGL A;  4CCO A;  1RUD 2;  1O4Z A;  4CXW A;  2Q1Z B;  1W0P A;  3HD8 B;  4MGI E;  4XUO A;  3WCR A;  3BOW A;  1ENR A;  2D93 A;  4BQ3 A;  2WUH A;  3H1W A;  4GMP 0;  2QKD A;  4LIT A;  4QT6 A;  1BZW A;  1MZ5 A;  4OLL A;  2D98 A;  4QAW A;  5JWP A;  1MQT C;  2GNM A;  2WAO A;  4QGM A;  1DIW A;  1UOG A;  3GGL A;  4XF3 A;  3WXP A;  3KV5 A;  3KF3 A;  1YRZ A;  2XL7 A;  1RUO A;  4LO7 A;  3LKJ A;  3ZPY A;  3TN9 2;  4Q8L A;  2ZGT A;  4N8M A;  2YUE A;  1OPM A;  3ETP A;  1RED A;  4UFL A;  4W65 A;  2WWJ A;  1A6C A;  2LAL A;  3I3Q A;  3CF6 E;  2V4V A;  5C8C A;  2RS1 2;  4OMD A;  2VTX J;  4XQW A;  1PIV 1;  5GZF A;  1XNT A;  4QKB A;  5FYB A;  4YW4 A;  1LOD A;  2JWP A;  4MGY E;  4X8N A;  1SLI A;  2SBA A;  4K1Z A;  3K4D A;  1EV1 2;  2VOV A;  3LDB A;  3RFR A;  4URA A;  4PI0 A;  2VUJ A;  4IV1 A;  5EV7 A;  1X9T A;  3ZR6 A;  3B3Q E;  2BGP A;  5F3E A;  3AP4 A;  3L2H A;  4HKW A;  1W8O A;  1PVC 1;  1UYX A;  1CIW A;  1W6N A;  4I3P A;  1N1Y A;  1XNA A;  1UN1 A;  4CDW B;  1V9U 3;  2A6X A;  1LKN A;  4LBK A;  4DO0 A;  3AKQ A;  1UL9 A;  1JZ3 A;  2J1T A;  4QWN A;  3JBG 3;  4FPJ A;  4NRQ A;  2WO7 A;  3KGZ A;  3MV1 1;  4NHY A;  4RGK A;  1ST8 A;  2YFU A;  5D8A B;  2YXS A;  1A34 A;  2VO5 A;  1Y9M A;  4LBJ A;  4XPV A;  2ZGL A;  4XJZ A;  2TEP A;  3VBH A;  4FPL A;  2JDA A;  2DBN A;  1MS1 A;  3FLR A;  3P1I A;  4FFI A;  4LBL A;  3WDV A;  1M4W A;  3RDI A;  4OCT A;  1R1A 3;  5E89 A;  1VB2 A;  1VAK A;  3A23 A;  4FP2 A;  4QKN A;  1RXG A;  5FY0 A;  5LA0 A;  1FMD 1;  3I2D A;  3I7D A;  5H9R A;  1FXZ A;  4QQL A;  2B4K A;  2Y6H A;  3VN4 A;  4XUP A;  3WP5 A;  2VM9 A;  2VVF A;  4XZU G;  4ZU7 A;  1X50 A;  1TMF 3;  4IGP A;  1W6M B;  4YPJ A;  3BCW A;  3S30 A;  4RGG A;  4C91 A;  2VOW A;  5JPN B;  4URT A;  3JZV A;  2NQY A;  4NII A;  3ACL A;  3ZXJ A;  5I8T A;  3N3H A;  1WD3 A;  1YJK A;  4PF1 A;  2ZGO A;  3WG3 A;  2RDR A;  1GWM A;  4UF0 B;  4ZXK A;  4B1M A;  4BZ4 A;  5I0D A;  4RR3 B;  2ZMN A;  4NPR A;  4XIL A;  1RB8 G;  4Q5O A;  3O0V A;  1S0I A;  4QB6 A;  3ZFG C;  3POS A;  1PX4 A;  2ILM A;  2RM2 2;  5DDJ 3;  5CFC A;  5BNO B;  1H2L A;  2ZHN A;  2YRO A;  3JQX A;  1DFQ A;  1PM4 A;  4L8Q A;  4XF0 A;  4Y4Y A;  4FSJ A;  4GUL A;  1PHM A;  3K48 A;  2P5B A;  4JAA A;  5JSR A;  5EJ3 A;  4U2A A;  3HQU A;  2JD4 A;  2PYT A;  2Y64 A;  2JDM A;  2P6H A;  4OI0 A;  1PGW 2;  3M3I A;  1PMI A;  2PHF A;  3AC0 A;  3N7L A;  1V6M A;  4A41 A;  1WMX A;  3BIW E;  2RDQ A;  4OHY A;  4AED C;  4BIF A;  2DF7 A;  4Y5T A;  4CUB A;  4HKO A;  4BDV B;  1NQJ A;  3MIH A;  1VBE 2;  2WWU A;  2D97 A;  1CD3 G;  3CZJ A;  3HBZ A;  1LOE A;  1AL2 3;  4BIO A;  5BNP C;  5KWR A;  3MF6 A;  2RV9 A;  1N1V A;  3CL1 A;  1CAU B;  5FLH A;  5C71 A;  2VG9 A;  3MPB A;  4WM7 C;  2C24 A;  2HWB 1;  3MPP G;  3N9P A;  5EYY A;  4Q8K A;  3VBU B;  4H14 A;  4N53 A;  1ZRI A;  5I0S A;  1DGW A;  1D2S A;  5IUQ A;  3ZMO A;  3OUI A;  3B9I A;  1K3I A;  2D6O X;  3POW A;  3D8C A;  3CLP A;  3J8F 1;  1PX3 A;  2ARX A;  5JR2 A;  3D3A A;  2AUY A;  2Y8K A;  1U12 A;  4YG0 A;  3ZN5 A;  2QQW A;  2DYC A;  2VQT A;  3ZKY A;  1WBF A;  4AAX A;  1CJP A;  2QQJ A;  1XQN A;  5JZG C;  3M8L A;  4D0Q A;  3UES A;  2HYK A;  1R09 1;  5FZ7 A;  5BY5 A;  3GHN A;  1FPN 2;  2XUM A;  5L19 A;  4L92 A;  5SV8 A;  3UV9 A;  1WZX A;  4PLN A;  3GZE A;  3VKL A;  4MSV A;  2BYV E;  4CU8 A;  1LED A;  3AFK A;  3O1S A;  1W6Q B;  2OUH A;  2VMF A;  3LB9 A;  3WG2 A;  3NV2 A;  5T5P A;  1B35 A;  4FCA A;  4CCE A;  3W5N A;  1HN0 A;  3D6E A;  3U11 A;  1MZE A;  4BQ1 A;  3VZL A;  1FAT A;  5IK5 A;  3KV6 A;  2OZJ A;  1RUH 2;  3N36 A;  1DHK B;  4AQ2 A;  5FYS A;  2RJ2 A;  2DCK A;  3GNE A;  1KXG A;  2HYX A;  3CJX A;  1PO1 1;  1UX6 A;  3N7M A;  1RUH 3;  2UYB A;  3WOG A;  4AR2 A;  4YW7 A;  2AYH A;  1ULD A;  2OA2 A;  1R64 A;  3UL2 A;  1GZ9 A;  3T4H B;  4NID A;  5IAT A;  3LGR A;  4FBF A;  1ZVF A;  4C1W A;  1WMF A;  2YFZ A;  4C0B A;  1CAW A;  2OUJ A;  3N9O A;  1V6K A;  1AR7 1;  2WQZ C;  3DKW A;  3J26 N;  4QPG C;  1HV0 A;  2DCJ A;  4IEY A;  2VZP A;  2XOM A;  1CX1 A;  4YFW A;  2FMD A;  5A6Q A;  1KDK A;  1HB3 A;  1HLC A;  1SPP A;  3KSC A;  4Q4Y 1;  4RSU A;  4YVW A;  2BV4 A;  5FJH A;  5A7O A;  1NZI A;  4UFI A;  4HG6 B;  1WWY A;  1W6N B;  1XE0 A;  3LPG A;  3LFI A;  4Q4Y 2;  1YQ5 A;  3FHI B;  3ZYP A;  3HN3 A;  2Q4S A;  3CQO A;  2D6P A;  4RFT 0;  1SDW A;  2WWS A;  4AHY A;  3BIE A;  4L99 A;  3VD3 A;  1GWL A;  1LJ7 A;  3FLP A;  4QX3 A;  3VLB B;  3CEW A;  5FZO B;  1PVC 3;  1YC6 1;  1BK0 A;  3CIH A;  4YVS A;  5FK8 A;  2VCB A;  2XL9 A;  1X7N A;  3ZYR A;  1ZRE A;  2FCV A;  2PTM A;  2CAU A;  1O4Y A;  5CKN A;  5IVE A;  1WA6 X;  3HPN A;  1OD3 A;  1ZZC A;  2E7T A;  2B45 X;  2K9Z A;  3NWK A;  4MO3 M;  4MXW B;  2QUO A;  3MW2 A;  5CKM A;  2C6S A;  2VNG A;  4WVM B;  4IEX A;  2GC3 A;  4BWO A;  3VBF B;  4YW6 A;  1CGP A;  4RYD A;  2R07 3;  4FFF A;  5F6L B;  3T2T A;  2QQL A;  3E6C C;  2H0V A;  1OH3 A;  2G9Z A;  5EHD A;  3RZJ A;  1CVN A;  4HVR A;  1J83 A;  5FAX A;  4JQT A;  1QOT A;  3BB6 A;  3OPT A;  3U1X A;  1SBF A;  1TG7 A;  2E32 A;  2YGL A;  2V73 A;  1EAH 1;  1YEW A;  3DL3 A;  2WAA A;  4NHX A;  1H6Y A;  1OQE A;  4HLT A;  5CIR A;  1W04 A;  5A3P A;  2W2I A;  4M00 A;  1W6O B;  2D44 A;  5FKB A;  5IW0 A;  3ZM8 A;  4MGK E;  4CVU A;  1MPX A;  1Y9G A;  1NCR A;  3VHO A;  2VW0 A;  1JOJ A;  3NRU A;  5CFD B;  2CWM A;  1F9K A;  2WFF 2;  4KWK A;  1O91 A;  1K5J A;  4CDQ A;  4IW3 A;  2CY6 A;  2YGM A;  2GMP A;  4NIA A;  5F5A A;  2LUW A;  3OEA A;  3DGT A;  3O1M A;  4JGZ A;  5LBC A;  4BQ4 A;  5C7G A;  3N9N A;  4IE4 A;  4PIY A;  1QNW A;  2X29 A;  1GYK A;  5I93 A;  2P3K A;  3CU7 A;  1UNB A;  3THC A;  1YUD A;  1Z0H A;  5CB7 A;  2VTX A;  4UW4 A;  3MW3 A;  2HWF 3;  3FE5 A;  5DAQ A;  5GJ6 A;  1O3T A;  4CU7 A;  3ZXK A;  5C9A A;  1WKY A;  4D7T A;  3T09 A;  4CXX A;  3RZG A;  1JYI A;  1DLL A;  1K45 A;  1RUE 2;  3VBR B;  2WLQ A;  1OOP C;  4LTA A;  1RYY A;  1O4T A;  3GCW A;  1FOD 1;  2QVS B;  3ZFF B;  5FY5 A;  5AVP A;  4JHZ A;  3WW1 A;  1UKG A;  3O1R A;  1CZV A;  2CHH A;  1PMH X;  1SQ4 A;  3MFC A;  3LEG A;  4Z2W A;  1S0B A;  3RMY A;  2XHN A;  4HSL A;  3R4S A;  3ZXL A;  3NNJ A;  3CJI B;  2VGD A;  5EQU A;  3LDK A;  4YM1 A;  2XJQ A;  1F5J A;  3FL7 A;  4YW2 A;  3I3D A;  1HRI 1;  2K2S A;  2QQP A;  3S6P A;  1H8V A;  1SBD A;  4AHW A;  2EF6 A;  3ZFE B;  1W6Q A;  1CPM A;  1W05 A;  2QNK A;  4CRQ A;  1WME A;  4F8A A;  3WV6 A;  4OFG A;  1GP5 A;  1LHU A;  1YFY A;  3QH6 A;  1K12 A;  5FP8 A;  4RS5 B;  2HH9 A;  4QU2 A;  1IHM A;  1ZA7 A;  2IXL A;  3RVH A;  4MX3 A;  3H8R A;  1C28 A;  4LUL A;  5FZH A;  1YQ2 A;  5FY1 A;  5AVA A;  4GAZ A;  4Q4V 1;  4YFZ A;  4NE9 A;  1BLZ A;  3VV1 A;  3PJY A;  1IPS A;  1LOC A;  4YZ2 A;  2UWA A;  3PL0 A;  4LHL A;  3RGB A;  5FV3 A;  3ZN4 A;  2BNO A;  2MEV 1;  2F6B A;  3K51 A;  4AVA A;  4XFA A;  4AI8 A;  1UCX A;  2VCC A;  4IEZ A;  1GLH A;  1IPJ A;  1O7F A;  1QJU 2;  1K5M C;  3E5U A;  3MLJ A;  4ERO A;  5C5U A;  4GAL A;  1U5I A;  1C8M 2;  4RN5 A;  4FFG A;  1NA1 C;  2R04 1;  2VZQ A;  3ZIX A;  5ACA 1;  1RUF 1;  4NAO A;  1H6X A;  5C4W C;  1O8P A;  1WBL A;  2ET1 A;  4DUX A;  1H30 A;  2E51 A;  2WQ4 A;  1J84 A;  1NOV A;  4AZZ A;  5IFP A;  3AKS A;  4LK6 A;  4PHZ A;  1HJF A;  2JE7 A;  3ZDV A;  1M06 G;  5KC6 A;  4G3Y C;  2TUN A;  4KQ7 A;  1NCQ C;  3T2O A;  1IG3 A;  4HK8 A;  3POE A;  1W9S A;  2LS6 A;  2JXA A;  4XMA A;  5LK5 A;  5BNN A;  2B9U A;  4CEY A;  5GLW A;  3H3U A;  5BNP A;  3I2F A;  2VW1 A;  5ANQ A;  5L7O C;  1BCX A;  5I0U A;  2CAV A;  1VP6 A;  4UW5 A;  2A7A A;  1GKB A;  5FR3 A;  3VDB A;  1MZF A;  5GLV A;  5AFE A;  5L7O B;  4Q0U A;  1UO9 A;  4B8E A;  5JXG A;  2WDB A;  1DCS A;  2XVL A;  3A7Q A;  3DUI A;  3O7O A;  4GKX A;  3FHQ A;  1AXK A;  2ORX A;  4IDZ A;  4XQD A;  1QJE A;  4ZZ5 A;  2NLR A;  2DCZ A;  4XBQ A;  1UY1 A;  2C9K A;  4JDN A;  3WW4 A;  2WZE A;  2C5D A;  5FQ0 A;  1RVF 2;  1VRH 2;  5FMO L;  1UU6 A;  2Y0O A;  2E31 A;  4NHM A;  1G9B A;  3KVA A;  1UKR A;  1S2B A;  4CP1 A;  2GN7 A;  4FI9 A;  1QJY 2;  1YXW A;  4D69 A;  4BME A;  3OGV A;  1ENS A;  1WMD A;  4PDW A;  2W1W A;  1N1S A;  3PUS A;  4QQP A;  1ZA4 A;  5FLJ A;  1OC1 A;  1EV1 1;  3H3Z A;  1H9W A;  4H3W A;  2OPK A;  3AJZ A;  3PVN A;  1W8T A;  5HBA A;  2XJU A;  4LE3 A;  5D8A C;  4FAH A;  4GXL A;  2BFU S;  3CJI C;  3BPS A;  4YAR A;  5K0U B;  4IES A;  1DQ1 A;  4ISQ A;  4KGG A;  5TSW A;  3I3B A;  5FCC A;  3W20 A;  3NJV A;  1HRV 1;  4Q1P A;  2I2S A;  3ZN6 B;  1DYK A;  1FV2 A;  2CNA A;  1W6O A;  1ZNP A;  4XUT A;  4KH9 A;  3TNP B;  4O9E A;  5FYU A;  1X82 A;  3WQB A;  1NE6 A;  2RVA A;  3I2G A;  5F5I A;  2AR6 A;  3KB5 A;  1V0A A;  4XFG A;  3ZFF C;  5DAX A;  2V5D A;  3BPZ A;  2YU1 A;  2GZW A;  3DEM A;  5HV0 A;  3TBD A;  3KZ4 C;  2A3X A;  3AFG A;  1O3R A;  2ADD A;  5JXH A;  2CSG A;  2VU9 A;  3AYC A;  3FHA A;  3J7L A;  5F6K A;  4B7K A;  1JBC A;  4OHV A;  4Q4W 2;  3MIG A;  4KBB A;  2EXI A;  2ZOE B;  5FZL A;  4M3C A;  4PJY A;  3AYE A;  1JXN A;  1URX A;  1BEV 2;  2V09 A;  2BW8 A;  3MW4 A;  2A3Y A;  3WF0 A;  3FBM A;  1QY4 A;  2R07 2;  4D7Y A;  1NQD A;  2XON A;  4LK7 A;  5K9Y A;  4DRR A;  4KNC A;  1DZR A;  2ZGK A;  3CHX A;  3SH5 A;  3AMQ A;  1MS8 A;  1VBD 3;  1YCI A;  4CCJ A;  2ZJC A;  3K3O A;  1L7Q A;  2VBD A;  3AMH A;  1GZT A;  3A22 A;  3MUZ 1;  1LEN A;  4R9A A;  2QQK A;  2QE3 A;  1OA2 A;  1V9U 1;  3FBY A;  4P08 A;  4PT6 A;  4I09 A;  2Y26 A;  2VZS A;  4KGQ A;  4XTM A;  5IAV A;  3TNQ A;  1ZYB A;  3OY8 B;  1ND2 A;  4AI1 A;  3R05 A;  1O8S A;  3OD4 A;  2MNG A;  1RUG 2;  5JMC A;  4Y20 B;  3RYP A;  3LQC A;  1POQ A;  1QH6 A;  5FZ3 A;  3NAP A;  5KHK A;  1LHN A;  3U75 A;  2Y0I A;  4Q2F A;  5A7W A;  2NMN A;  3MFA A;  4V1P A;  1QJU 3;  5AC9 1;  3WZ1 A;  2JEN A;  1RXF A;  1REF A;  2CGO A;  2HLE A;  1F4H A;  3N9L A;  4Z07 A;  3ZYH A;  1GP6 A;  4DPN A;  1VB4 A;  4E4D X;  1SAC A;  3VDA A;  3IMN A;  1UPS A;  3VHR A;  5JSP A;  3SIT A;  3ES4 A;  3HVD A;  4YGD A;  2ZPX A;  1UMZ A;  5FO7 B;  4AFM A;  2ZEY A;  1X33 A;  2VMD A;  2RMU 3;  3J9S A;  4RR3 A;  4Y1Y A;  3SQO A;  3MIB A;  4WBB A;  4Y3O A;  3WW2 A;  4CUC A;  2WS9 3;  4TWT A;  5CAZ A;  4LHK A;  5FXZ A;  3POB A;  5LRR A;  2ARA A;  5JR7 B;  3KGL A;  2ZX1 A;  3AK0 A;  2WZR 3;  4BE3 A;  3BU7 A;  5GLZ A;  1BBT 1;  1OI6 A;  3QBQ A;  4IEQ A;  4LE4 A;  4HAN A;  4WZF A;  3NJZ A;  3VBO C;  2F4P A;  4CYD A;  1BKZ A;  4MG2 A;  2PHR A;  4QM8 A;  1ODM A;  5SV5 A;  1GAN A;  2BJS A;  1HV1 A;  2GH2 A;  2QJV A;  3MIC A;  1XB9 A;  4LO6 B;  4TLF A;  1COV 1;  4CPB A;  1JYX A;  3U4X A;  4BB3 A;  3LWC A;  3PVE A;  1Z7S 3;  5IJR A;  5HCH A;  4DB5 A;  4IEO A;  1ZRR A;  3I2K A;  4P00 B;  2VOX A;  1AF9 A;  4AE2 A;  2HWD 1;  5F37 A;  4ASL A;  1UMI A;  1JMU B;  4XXA A;  2QQV A;  5FKC A;  1KD7 A;  5ABJ C;  1RIR A;  1U0A A;  1WW7 A;  1S0G A;  5DUV A;  2Y6G A;  2RM2 3;  3LIG A;  5DDJ 2;  2ARC A;  2CYF A;  3AXD A;  1SLB A;  2Z69 A;  4FVV A;  1B35 B;  2VCA A;  3JCI A;  2V4A A;  1CWP A;  2VVD A;  2Q30 A;  1AYN 2;  4XIO A;  3OD0 A;  1Q56 A;  3V56 A;  2X10 A;  1G9C A;  4QQH A;  5CZK A;  3M70 A;  1OUR A;  4QHB A;  5JI7 A;  4YYO A;  3LOI A;  1E57 A;  3MLK A;  2O8O A;  2ZCW A;  5FK7 A;  1VBE 3;  5A3L A;  3I49 A;  3BUC A;  2OT7 A;  4NWV A;  2ZXQ A;  4S2H A;  1OF3 A;  2P1B A;  2ZGP A;  3PUQ A;  4XCB A;  3BYW A;  1G6N A;  1W99 A;  4LUM A;  4BXF A;  3K2O A;  1UW8 A;  5T52 A;  1H4G A;  1QXR A;  2JX9 A;  4UW6 A;  5T50 A;  1FI2 A;  1WCK A;  4XDO A;  1I5Z A;  1RUE 3;  3LEM A;  5FDB A;  1XRU A;  4KU7 A;  5FWJ A;  1QJY 1;  2JG8 C;  2XJP A;  4CCK A;  4Y1U A;  3KV4 A;  3OJB A;  1C1F A;  1KFX L;  3VZN A;  5F32 A;  1APN A;  2VMC A;  4DS0 A;  3VBF A;  1GP4 A;  3O5S A;  2ZX0 A;  5HXM A;  1IS3 A;  1UQX A;  3RI8 A;  5LZ6 A;  3TYJ A;  1N3P A;  4A6S A;  2W92 A;  1DBN A;  2CWS A;  1W8W A;  2DDU A;  3TN9 3;  4AL9 A;  2VNO A;  4IV3 B;  2I45 A;  4LXL A;  1N1T A;  4Q29 A;  4ZY9 A;  1VLN A;  2XJR A;  2FZ1 A;  5EPA A;  1XYP A;  4CEW C;  4J1X A;  3RS6 A;  3ZPO A;  2WFP A;  2ZZQ A;  4GKY A;  4UYB A;  5JCT A;  3USS A;  3O1T A;  1LGB A;  2R04 3;  3WDY A;  4YZ4 A;  3VD5 A;  2YBP A;  2UY8 A;  4CUA A;  5F8P A;  4RHV 2;  3W58 A;  3UGF A;  3P3P A;  1V6O A;  4RD7 A;  1E5R A;  4P9J A;  5CNA A;  1SLL A;  3UJO A;  4WM8 A;  5JIA A;  2Q8O A;  1YYN A;  4K8R B;  1QGL A;  1W2N A;  2VUA A;  5FP7 A;  1CIY A;  4MET A;  3O1V A;  2P3J A;  5FO9 B;  1W2T A;  1JU4 A;  4FPH A;  3H42 B;  4WVM A;  2R0H A;  2LTN A;  4DOU A;  2WZ8 A;  4P02 B;  1EUU A;  2DTW A;  2BER A;  4NHL A;  2ARE A;  1GNZ A;  4I0B A;  5EXO A;  1NCQ A;  3OPZ A;  4Q4Y 3;  5FXV A;  5FPX A;  2ZEW A;  1I3H A;  1F2N A;  1PMJ X;  1WUV A;  3AL6 A;  4YG6 A;  3III A;  1H0B A;  1S0D A;  2RJK A;  4XF1 A;  5A3T A;  4LBQ A;  3DPR C;  3IDB B;  2YDE A;  2W87 A;  3T2P A;  2BWC A;  2GSY A;  1SCS A;  1XSR A;  1WW6 A;  4Y33 A;  2E6V A;  4BM8 A;  4KI5 M;  1OPO A;  1QQP 3;  3OSD A;  2WNV A;  4IET A;  4ATE A;  3H7J A;  2QDR A;  3BU0 A;  1GSL A;  5E88 A;  4C90 A;  5A3U A;  1PNF A;  4Y1Z A;  1VBA 1;  1FYU A;  2DU1 A;  4CSW A;  3VUO A;  1ASJ 3;  2HBU A;  3ORJ A;  2CDP A;  3TEY A;  4XAE A;  4BCU A;  1LR5 A;  3EMR A;  5BYN A;  1G86 A;  3IWZ A;  3CNA A;  1RJ7 A;  2PMW B;  1FV3 A;  1AYM 2;  2B8M A;  2TBV A;  3EXU A;  3K77 A;  3KV9 A;  4PDW C;  1AUY A;  2B9V A;  3SXW A;  4AEM A;  1QEX A;  3GHM A;  2OPW A;  1GIC A;  2GME A;  4I30 A;  3IPV B;  3KF5 A;  4LHS A;  3WNO A;  1RUI 3;  3V0A A;  2ZHK A;  5DUU A;  3CJI A;  3IDE A;  1QNY A;  1PZ8 A;  1AVB A;  4P9Y A;  4PIZ A;  1W6P A;  1AR6 2;  1RUJ 1;  1Q8O A;  1RUI 2;  3N4M A;  1NA1 B;  4P5Y A;  5GM0 A;  4IE0 A;  4MHR A;  1OH4 A;  3H1Y A;  1BVP 1;  3ZIW A;  3AKP A;  2XLF A;  1O3Q A;  1BXH A;  3ZFE A;  1K42 A;  2VMI A;  3KVB A;  1POV 1;  1CON A;  4QKF A;  4CPB D;  2PAK A;  2GMM A;  2YC2 A;  3ITQ A;  3RZK A;  5EFU A;  2AEY A;  3E97 A;  3A0K A;  3N7K A;  3VBR A;  1GQP A;  1HRI 2;  4KMQ A;  5LBF A;  3INA A;  4EN8 B;  5JPM B;  4LQR A;  2RMU 1;  3GZT B;  4XXP A;  2ZGN A;  2AEZ A;  4B7E A;  1OLQ A;  1QQP 2;  3AMP A;  4UFK A;  2GNT A;  4MGS A;  3LA7 A;  4LOT A;  5F7U A;  5LBB A;  2BNN A;  4OYU A;  2GND A;  5C4W A;  4DNY A;  3PUI A;  1NXM A;  2O1Q A;  5LBE A;  4B4R A;  2B42 B;  3ALQ A;  2H0B A;  5CKQ A;  5C70 A;  1XE7 A;  2J1A A;  3N35 A;  5A80 A;  3UKN A;  3O0W A;  2ZAC A;  4LR4 A;  4N53 B;  2X09 A;  4NRP A;  4AGV A;  4CXY A;  4IEP A;  3RZM A;  1OVS A;  5EJ1 B;  1S4C A;  1ZZ7 A;  2MEV 2;  2PHL A;  4AG4 A;  4NVP A;  1VAM A;  2CV6 A;  5E1R A;  3ZXD A;  3MO4 A;  2YBS A;  3PNA A;  3NJY A;  2NN8 A;  4L97 A;  4UBG A;  1FMD 2;  3VZO A;  4XHB A;  4P9I A;  1OF4 A;  1CAU A;  3JBG 1;  4FT8 A;  3OGR A;  4HPK A;  4UXA A;  1RUF 2;  2SLI A;  5LCW L;  1U5Z A;  4ES9 A;  2J1R A;  3VBU A;  3ZLI A;  5CEH A;  2RS5 1;  1V6L A;  1H4H A;  3NAP C;  4A3X A;  1PGL 2;  3UKV A;  1ZBE 1;  2A6Z A;  4OUS A;  2YB7 A;  2BU9 A;  1SDD B;  1PO1 2;  3HNM A;  4CDX C;  1CAV A;  3KMH A;  1GNY A;  1W9F A;  2VXJ A;  4LOR A;  2ERF A;  4N43 B;  1S0F A;  2WL1 A;  5FLI A;  5LK7 B;  4Q4X 3;  4XZP A;  5IHR A;  2XWB B;  3V0B B;  2VW2 A;  3JQW A;  5FQ0 B;  4QPI C;  4OZX A;  1YIP A;  5FY7 A;  1SLA A;  4BA6 A;  4P14 A;  4NPL A;  4F7Z A;  2R0F A;  4LBO A;  1X8E A;  5DZF A;  3R0R A;  4LUK A;  4NRM A;  1OMI A;  4CEY C;  4LMF A;  1VMF A;  1KDM A;  2PHW A;  2KXL A;  1A3K A;  1HDK A;  1RUD 1;  3IN9 A;  2DV9 A;  4XFB A;  3HT1 A;  3FUQ A;  5DXD A;  3ABZ A;  3M3Q A;  1CAW B;  5LA2 A;  4XAA A;  1UZW A;  3LSD A;  5FZ9 A;  5LAS A;  4C0H A;  2WSV A;  1NX9 A;  2A70 A;  5M0T A;  3WP4 A;  4GH4 A;  1JH5 A;  4ET7 A;  1W06 A;  2AEN A;  1C5H A;  2FDH A;  1LES A;  5IVY A;  1SPP B;  5J48 A;  4JKK A;  3E5Q A;  1FT9 A;  1RUD 3;  4JKM A;  1VMJ A;  4IV1 C;  3WDU A;  5JXI A;  5CBL A;  1XBF A;  2NZ9 A;  1E5H A;  1CES A;  1NLQ A;  1YO8 A;  3NV3 A;  4Z82 A;  1LUL A;  5FMC A;  1BMV 1;  3THD A;  1AXZ A;  1RVF 1;  1VRH 1;  2EAL A;  2JDU A;  2WYF A;  2OW4 A;  3ACI A;  4D8M A;  4AYU A;  1OVP A;  4EWA A;  3WDT A;  5FFO C;  4E8C A;  5J37 A;  3HAG A;  3PLQ A;  3EHK A;  1DGW X;  2XBO 1;  5CYY A;  2E63 A;  2C9A A;  3CBN A;  3BTX A;  4XE9 A;  5C6C A;  4XAC A;  4YGC A;  2Y6K A;  1ASJ 2;  1AL0 G;  1FAY A;  1HW5 A;  4S2F A;  3WDW A;  5F5C A;  1DZT A;  2CTV A;  4CP9 B;  4DIQ A;  1OSG A;  4XEZ A;  5EYX A;  4QDQ A;  2FMY A;  4MAD A;  4GJZ A;  2C26 A;  5FY9 A;  4NWW A;  5A3M A;  4Q0V A;  3B5L B;  2G19 A;  5A6X A;  1OFN A;  1AZD A;  1R1A 2;  2IXK A;  3KHB A;  1H2M A;  1UD1 A;  2GNB A;  4Q4V 2;  3IDA A;  3POJ A;  4TXW A;  3OB8 A;  3TRS B;  2UUR A;  2YHJ A;  1KEX A;  3U78 A;  4AQS A;  2GP5 A;  4XDQ A;  4LO8 A;  3OGJ A;  2JDZ A;  2TNF A;  2VBP A;  1GQG A;  1ND2 B;  3LSE A;  1EUT A;  5IK7 A;  1BEV 1;  5IFT A;  4FOQ A;  5K8S A;  3ON7 A;  3TOJ A;  2Q8C A;  4P5H A;  5E8A A;  2FDG A;  2QZ2 A;  4HN1 A;  1XNK A;  4J25 A;  4MXW A;  4XJ8 A;  4EN7 B;  3LOB A;  3J8F 3;  1CJD A;  2W1S A;  3HOB A;  1HQW A;  2LRO A;  4K3U A;  3WQ7 A;  3ELN A;  3VL9 A;  4W50 A;  5D2A A;  5D1I A;  1AX1 A;  3HNY M;  3OG2 A;  3ZR5 A;  2IVJ A;  4ONU A;  1ZM1 A;  5FYI A;  3D4K A;  2GC0 A;  1VIW B;  1IZ3 A;  4IND A;  3W59 A;  4QX5 A;  2RDN A;  2VBB A;  2WFF 1;  4MUV A;  5GLT A;  1SCR A;  2BQP A;  2ZGS A;  5A33 B;  2HEW F;  4XFH A;  3GBW A;  3T1M A;  1I9R A;  1GOH A;  1LGN A;  2XVK A;  1XU2 A;  1RUI 1;  4IER A;  1LOF A;  2XKO A;  4MOA A;  1I5P A;  4QPI B;  1C3H A;  4XUN A;  3WUD A;  5JZG A;  1NG0 A;  3HQR A;  3W5M A;  2ZGU A;  2E26 A;  4CDX A;  3UJQ A;  1G8W A;  2GU9 A;  5CFD A;  2ZEZ A;  1RUJ 2;  4RGA A;  3VBS B;  2ZX2 A;  2HJI A;  4CUG A;  4LPL A;  4AED A;  5A1F A;  3VHP A;  3NAP B;  2OVU A;  1SG3 A;  4CE8 A;  3S7E A;  2WNU C;  4W4Z A;  1VBC 3;  2F4L A;  4IE6 A;  2XJV A;  2RR1 3;  4S2G A;  3WHT A;  3UT0 A;  3ZFG A;  4IE5 A;  4E4H A;  1ZRD A;  3PMS A;  3ACF A;  4FPK A;  1ND3 C;  4L9B A;  3VBH B;  2BNM A;  5EZW A;  5KHI A;  2VMH A;  1HQN A;  4LBM A;  2BEO A;  2KA3 A;  3RYR A;  4L0P A;  4WVW A;  4B29 A;  3DKQ A;  1ZBA 1;  5T54 A;  1PO2 2;  4JRL A;  3H7Y A;  5I91 A;  3C2U A;  2VZ3 A;  2AZ5 A;  4B4Q A;  3I4I A;  5KR7 A;  2VVE A;  4AVC A;  2DVA A;  1ZBA 2;  2X5I B;  4PQ9 A;  1RUG 3;  5L9V A;  1NCR B;  1LB2 A;  3MBW A;  4YGB A;  1GQH A;  2OS2 A;  3WD5 A;  1UMH A;  3WX5 A;  2J1S A;  5DG2 A;  3AZZ A;  3LZZ A;  1MS0 A;  1WLD A;  3K3N A;  2Y38 A;  3T0D A;  1XC6 A;  4XBN A;  3KHC A;  3LPF A;  5F2S A;  5IVV A;  2I74 A;  2KR2 A;  4JGY A;  5FYZ A;  1NE4 A;  2CDO A;  4HMZ A;  2J1U A;  1F5F A;  4Y24 A;  4XDP A;  3TEX A;  3OPW A;  1UPI A;  5FZD A;  3VKO A;  2WAB A;  1W8F A;  4WM7 A;  2JDP A;  2XQX A;  2O8Q A;  5FXX A;  1JYN A;  2D6M A;  4HET A;  2YV8 A;  2A6V A;  3ZYG A;  4Q0S A;  1NLS A;  2WN2 A;  5E6H A;  2ZA9 A;  4AVT A;  3HJR A;  3PME A;  1PNG A;  2B39 A;  2Y6J A;  1LAJ A;  1WLC A;  1UZZ A;  4PBP A;  2MEV 3;  3AB0 A;  5B4N A;  5C9A B;  1X9P A;  4FP3 A;  2XUE A;  2ZKL A;  3NW4 A;  1LCL A;  1N3O A;  3RJ2 X;  3TWI A;  3IT8 A;  3AKR A;  3LFM A;  3U37 A;  1KGY A;  5F3I A;  3THT A;  3I59 B;  3PU3 A;  3KQR A;  5CU1 A;  1RGS A;  2Z79 A;  4JX0 A;  3I3M A;  3WR0 A;  2DFB A;  3IAQ A;  2VL4 A;  3KS7 A;  2HBT A;  3UGH A;  1RUC 2;  3ZYB A;  4A7Y A;  1OBN A;  3ES1 A;  4LLF A;  1NT0 A;  1PO2 3;  2CGP A;  4QPG A;  2FBE A;  1WLW A;  1EAH 3;  1LOG A;  1TE1 B;  4MYE A;  5J98 B;  4WV8 A;  1PGS A;  4M4P A;  5FZO A;  3VZM A;  1TMF 2;  1Y43 B;  1MEC 3;  5I8S A;  3B02 A;  2OQ7 A;  2WO1 A;  3FMG A;  4GWM A;  1IPK A;  3JB8 A;  3NNF A;  3HT2 A;  1E5S A;  2XLA A;  1D4V B;  1MS3 A;  1DQ6 A;  2VUC A;  2JG8 A;  2X8K A;  3E1F 1;  4K1Y A;  4XF9 A;  5EWS A;  5B4X A;  4BK4 A;  1ENQ A;  4ASK A;  1COV 3;  1RHI 1;  2D43 A;  1C4R A;  2BBA A;  4IGQ A;  5DAV A;  4EYU A;  4CEW B;  3RZH A;  1LOF C;  3T1L A;  4EWE A;  4GIQ A;  3VKM A;  2EIG A;  2DUR A;  2WNO A;  4IXL A;  4LO4 B;  3O1U A;  1RVF 3;  1VRH 3;  4S2D A;  2RS3 3;  2X5I C;  1CN1 A;  4EN9 B;  1AYM 3;  4TLG A;  1OKQ A;  1C8M 3;  4XW3 A;  2ZBJ A;  2JE8 A;  3QLQ A;  1MR5 A;  2ZAA A;  1D4M 1;  2K46 A;  3WIN E;  2WNU A;  1US2 A;  4QXB A;  3WF4 A;  1FNY A;  5DPN A;  2P37 A;  5FZA A;  1ENX A;  1FX5 A;  1BMV 2;  5JAX A;  1F15 A;  5DZG A;  1RHI 3;  3RWN A;  5J1X A;  5D21 A;  3O1P A;  4OUE A;  2EXK A;  5BUV A;  3AXE A;  4WVV A;  3K75 B;  4R4Z A;  2WFF 3;  4V2W A;  1PIV 3;  3Q8E A;  4K7J A;  1NXD 1;  2WS9 1;  5JI9 A;  1AR8 1;  1POV 0;  1AR8 3;  4AVV A;  4MZU A;  4CDU A;  1LTE A;  4DEQ A;  3M7A A;  1NCR C;  3ZFE C;  1HXS 3;  4CA9 A;  1TVG A;  2WS9 2;  3GJA A;  5FZ1 A;  2BDR A;  4E2G A;  4LKE A;  2VME A;  1RUH 1;  3IPV A;  2QTW B;  1R1A 1;  1BBT 3;  2HWE 2;  4UAP A;  3V0A B;  3BOD A;  1OQD A;  4O65 A;  1J58 A;  1V6N A;  5FTT C;  2WT1 A;  2W94 A;  1W6P B;  2WT2 A;  1LHV A;  1GU3 A;  3ECQ A;  3JB4 C;  2N7G A;  5L73 A;  5JMO A;  3NKT A;  2D7F A;  2ZGQ A;  4BQ2 A;  2BVB A;  1ZBE 3;  3FC0 A;  4GA9 A;  4CDW C;  3FFZ A;  1W28 A;  4EE2 A;  2QQI A;  1ND3 B;  2PQQ A;  4IEW A;  4QU1 A;  3S0M A;  2BFU L;  4LA3 A;  3RPQ A;  4COW A;  5IT6 A;  2YY1 A;  3U10 A;  2BZD A;  1I1E A;  1Z78 A;  3POG A;  1AYM 1;  1BJQ A;  2A75 A;  4Y1X A;  1XNC A;  2WNE A;  3VKF C;  1MZ6 A;  3OYW B;  5FYH A;  4DUV A;  2HWC 2;  2A3W A;  1PK6 C;  5DAW A;  1LOB A;  2W1U A;  4WZC A;  2GAU A;  4OHX A;  1EPZ A;  5FMO S;  1O5U A;  2BWA A;  3OEB A;  4IEU A;  1W2U A;  3DYP A;  4IGO A;  1W90 A;  1S0E A;  3ACG A;  3D82 A;  2DCT A;  3HBK A;  1A8M A;  4QD2 A;  4A42 A;  4COU A;  2Q8E A;  4FOY A;  2RS1 1;  2AC1 A;  5FOJ B;  3WNK A;  4X6R B;  3IM0 A;  2WNV B;  4AF9 A;  4DZG A;  2P2K A;  4FTB A;  1HXS 1;  1L7L A;  2XB6 C;  3OF1 A;  3WDX A;  1JZ5 A;  1YQ6 A;  1KS4 A;  1AR7 3;  2WO3 A;  2A6Y A;  4N9H A;  3ZN6 A;  2YG0 A;  3LDR A;  4P9X A;  3K4Z A;  1NA1 A;  5KBF A;  1W2O A;  2MPF A;  5HCA A;  1JOP A;  1JYT A;  1JYC A;  2J22 A;  2ZML A;  5FZE A;  5JOX A;  3R4D B;  3S7I A;  3KT7 A;  5HPO A;  2D6L X;  2PFW A;  3JD7 1;  2VOK A;  4ORF A;  3H8X A;  4QDR A;  2R7E B;  5JLV A;  5FWE A;  3P3N A;  1IKQ A;  1VR3 A;  3C7H A;  4ZPI A;  5LEK A;  4AI3 A;  1EYB A;  2PQS A;  4H7L A;  5BNN C;  1MS4 A;  1YNA A;  2WKK A;  1POV 3;  4EQV A;  1Q43 A;  2VR4 A;  4FO9 A;  4G4F A;  5LY2 A;  2W52 A;  1UZV A;  2XR4 A;  4CCC A;  4C8D A;  3B94 A;  1HN1 A;  2ZAB A;  3USU A;  3EYP A;  4I3G A;  1Y9Q A;  2Y33 A;  2WJS A;  2J7M A;  2UYA A;  5JIU A;  1S2K A;  2QZ3 A;  1W0N A;  2ZKN A;  3T4V A;  4BOW A;  1F4A A;  3DXT A;  4JGZ C;  4Q4W 1;  5J3U A;  3F2Z A;  3KCC A;  5FUP A;  1W9T A;  1YFU A;  4FPC A;  1Y4W A;  3M4F A;  5A32 B;  2W5F A;  4OQ9 A;  2W68 A;  3ZX7 A;  1OUX A;  2VNR A;  3L9J T;  4C1X A;  4IL7 A;  4XJ9 A;  3T30 A;  3GAL A;  5FP9 A;  4QPG B;  2RJL A;  4YG3 A;  4IQP A;  3BVC A;  3VD4 A;  4YNI A;  3Q8B A;  3I54 A;  3VBO B;  2W46 A;  5ACA 2;  1GBG A;  2G1M A;  2VC9 A;  4QXH A;  1VBA 3;  1GWK A;  4Y5Z 0;  2BRT A;  3JUU A;  1VBB 2;  3MHZ A;  4HN0 A;  4RFR B;  1F35 A;  4UFJ A;  4ES8 A;  1HX6 A;  5DUW A;  2GN3 A;  3B93 A;  3IAP A;  3PVB B;  4XVH A;  4ZKT B;  1CAX A;  2W0X A;  1QJF A;  4FPG A;  2RS1 3;  3D0S A;  2WYS A;  4HXC A;  4A2U A;  3U14 A;  5ISL A;  4E9K A;  1XXN A;  2C0Z A;  2OII A;  1XSQ A;  4QQ2 A;  5T3N A;  3S5A A;  1MS5 A;  2LM3 A;  2OQ6 A;  3WHU A;  1MS9 A;  4ASM B;  1YI7 A;  3IBM A;  3WY6 A;  4GWN A;  1OKO A;  1D7P M;  4KG0 A;  1UX7 A;  3VD7 A;  1C1L A;  1JS9 A;  1S2E A;  1ZZ9 A;  2AH2 A;  2VQ0 A;  4PLM A;  3KM5 A;  3WSO A;  1RUJ 3;  5HI0 A;  3GZA A;  4E8D A;  5FPU A;  1XYO A;  3NQH A;  3U0Z A;  1RUN A;  2A71 A;  3AP7 A;  5DAB A;  1LU1 A;  1CAV B;  4ZU5 A;  5A3O A;  5C3O A;  4L2N A;  2EXJ A;  2EAA A;  2MHF A;  1H1A A;  4M0H A;  1JZ2 A;  3NMB A;  3SLI A;  2WRA A;  2PA7 A;  2Y6L A;  5T5J A;  3RRD A;  5LY1 A;  1AHS A;  1DZQ A;  4DXZ A;  4F3J A;  3CZU A;  5JVV A;  3NV4 A;  1HB2 A;  4FTE A;  4ZZ8 A;  3NST A;  3HN1 A;  1HB4 A;  5DUX A;  4XJW A;  3K46 A;  1HRV 2;  3FX3 A;  3WW3 A;  1WLT A;  3LCP A;  4A4A A;  3BN6 A;  1JZ4 A;  3ETQ A;  1H2N A;  4OZO A;  2Q8D A;  1TQ5 A;  2ID4 A;  4X6Q B;  3AMN A;  2YC4 A;  2IXC A;  3UYJ A;  4CZS A;  1GZC A;  3A0N A;  5IK4 A;  4M01 A;  4YLZ A;  3VHN A;  1K5M A;  1CZT A;  5A7S A;  3SH3 A;  4AEK A;  1DDL A;  2E9Q A;  2BOJ A;  2CGN A;  2ATF A;  2R32 A;  2J42 A;  2NM1 A;  3FWE A;  5FP3 A;  1VAL A;  3RQ0 A;  1WW4 A;  3WVJ A;  5K7P A;  2W39 A;  5K0U C;  1T6B X;  2IFW A;  2W3J A;  4L11 A;  1BEV 3;  4D6Q A;  4IV3 A;  2FHR A;  1O6U A;  4MGQ A;  2HWF 2;  4JDO A;  4MVT A;  4O61 A;  4XFF A;  4PI2 A;  4QKD A;  4CCL A;  3ZXG A;  3HMY A;  4Q4X 2;  2JDN A;  1XNB A;  2VPV A;  1LEM A;  4HKL A;  5L7O A;  3UNP A;  4RR3 C;  2OXB A;  4HSJ A;  1NYW A;  3OGS A;  1G9A A;  1ODN A;  2CU5 A;  1AL2 2;  2DUO A;  4CU6 A;  2WIN B;  2HWC 3;  1BHG A;  4I0A A;  3FJS A;  1HQL A;  4AFC A;  4QB1 A;  1X36 A;  1IQA A;  1GOG A;  3GXU A;  4OI2 A;  4AED B;  2FD8 A;  4BK5 A;  3VGI A;  2QQN A;  4YZ3 A;  1YLL A;  2RE9 A;  4DQA A;  5LRS A;  4B4P A;  2DFC A;  4ATF A;  3J7M A;  4Y22 A;  5F2W A;  1UY3 A;  1YHF A;  2VUD A;  1PZ9 A;  1NCQ B;  3URF A;  4E2S A;  2R16 A;  2BTV C;  3DV8 A;  1RIT A;  5AC9 2;  2ZEX A;  5FZ4 A;  4MHU A;  3WP3 A;  1SFP A;  2W9X A;  1AR7 2;  5CIS A;  2NPI A;  3DPR B;  4ISR A;  5FO8 B;  3AP9 A;  1YJL A;  2VZU A;  3KLS A;  1RUC 3;  3MUY 1;  1C57 A;  1QJX 3;  1J3P A;  4EZH A;  1RUE 1;  4HON A;  4AEJ A;  4KWL A;  5IVF A;  4PCR A;  2ZX4 A;  4QMA A;  1W9W A;  2GC1 A;  1LNS A;  3AP6 A;  3TN9 1;  3H0O A;  3JD7 2;  1DQ0 A;  5LW9 A;  4I02 A;  3IB3 A;  1OUS A;  2ZMK A;  3MZH A;  4NR1 A;  4LKF A;  3LE0 A;  2O14 A;  3ZXA C;  4Q4V 3;  2DCY A;  1VBE 1;  5HCF A;  3RSJ A;  4RQP B;  1RC6 A;  5A7Q A;  3FUO A;  1EY2 A;  3GBF A;  4AWD A;  3NVC A;  4YRD A;  2JJ6 A;  1EPW A;  3I97 A;  1I6X A;  4E4Z A;  4GMP 1;  2XH6 A;  4R9B A;  1ULF A;  4GZ9 A;  2YPD A;  2EVX A;  2QBX A;  3AYA A;  3WG4 A;  3J8F 2;  3NL1 A;  1HKD A;  2YU2 A;  5C4W B;  2WA4 A;  1XND A;  3ACH A;  4PQQ A;  5FPZ A;  1J3R A;  3VBO A;  1ONA A;  3VBS A;  3O1O A;  2RDS A;  4Q0Q A;  4RA0 A;  2XJS A;  3AMM A;  3HIF A;  5GLU A;  2QCS B;  2FCT A;  2DUQ A;  2VH9 A;  2GAL A;  5LEJ A;  1D0G A;  2IZW A;  3DEC A;  2WO2 A;  3JBG 2;  5APA A;  5FZK A;  5J7M A;  3D5O A;  1JN2 P;  1R08 1;  4YM3 A;  2JEC A;  1H8T B;  5FZF A;  5ABJ A;  4Z1V A;  5LA9 A;  1PGL 1;  4BQW A;  1F31 A;  4Y20 A;  2HWD 3;  1DQ2 A;  4LA2 A;  4YM0 A;  1JOB A;  3ZMN A;  2BUK A;  5E16 A;  4LEJ A;  4TSV A;  1R1Z A;  3KWV A;  2EIC A;  5FZ6 A;  2Z2S B;  1SZB A;  1ZZB A;  4DRV A;  4QGL A;  4YZ5 A;  2X5I A;  4LIV A;  5LWB A;  4EN0 A;  3POI A;  5FRE A;  1V00 A;  4IV3 C;  3SHR A;  2W08 A;  3THP A;  3RZL A;  3ENR A;  3GF6 A;  5ERL A;  2JG9 A;  3M3E A;  1QMJ A;  1S55 A;  1VAV A;  1JHJ A;  4JCK A;  4Q0P A;  3BAL A;  2D40 A;  2F17 A;  4N43 A;  2VZO A;  1UYZ A;  3I3E A;  5DMY A;  1AR9 1;  4BLJ A;  1T6G C;  4D94 A;  1UU4 A;  3VDD B;  1W8H A;  3OGG A;  3VDC A;  4Y4R A;  1JW6 A;  3NV1 A;  3R4U A;  3PUH A;  4QHO A;  1KQR A;  2DWR A;  5BNQ A;  4KWJ A;  5T55 A;  4K40 A;  3WCS A;  4Z92 B;  1VBD 2;  4R8H A;  5F1R A;  3J4U H;  3VBH C;  5I0R A;  4QPY A;  1LHW A;  2XVG A;  3MF9 A;  5H9Q A;  1RMU 2;  1NZC A;  2Q0A A;  4V2V A;  3C7G A;  2H6B A;  4KWU A;  3T2Q A;  5J09 A;  2WNU B;  2FDJ A;  4K20 A;  4XF4 A;  1KJR A;  5F3G A;  4EWD A;  1UF2 C;  1H1M A;  1WCD J;  3CKH A;  4FQZ A;  1HRV 3;  2YPJ A;  1MEC 2;  3SKJ E;  4COZ A;  3L2Y A;  3OUJ A;  4JDM A;  2HWB 2;  2BGC A;  4GH4 B;  1FNZ A;  4HVO A;  2D3P A;  2ZX3 A;  1D4M 2;  1HJG A;  4ZXE A;  5HXV A;  5FZ0 A;  3V65 A;  1N47 A;  1IS5 A;  3ZXF A;  5LA1 A;  1GZW A;  5LB6 A;  1QJZ A;  4M0N A;  2YZ4 A;  2P4E A;  3I2J A;  5FUI A;  5FPB A;  4UBH A;  4LLO A;  4CDU B;  2QDN A;  2BPA 2;  1VMH A;  5AC9 3;  1XOY A;  2VOT A;  1ASJ 1;  1PO1 3;  2XML A;  1QIQ A;  1UOJ A;  3F95 A;  5FYV A;  3E6D A;  4DY5 A;  3VBF C;  3C7O A;  3T0B A;  1FPN 1;  4JC1 A;  4PIX A;  4H55 A;  3AZX A;  3TEW A;  2DU0 A;  5A6Z A;  2I07 B;  2VMG A;  1JYV A;  1V6I A;  1J3Q A;  1N3Q A;  3OUH A;  5FP4 A;  3ZXE A;  5FZC A;  4TN7 A;  1DGR A;  2ET7 A;  4N9I A;  4UT5 A;  4XC9 A;  5GAL A;  4PLO A;  4CEW A;  3LAG A;  1QXP A;  2DVF A;  2WBK A;  4LJH A;  1EAH 2;  2J1V A;  4CDU C;  1S0J A;  5EJZ B;  1QJX 2;  4YW1 A;  4KBZ A;  2G9F A;  4Q4W 3;  2OKX A;  3WLU A;  2DVD A;  4P9G A;  3OYW A;  2HKX A;  1TME 1;  2R06 1;  5KC5 A;  1AL2 1;  4K9S A;  3MEP A;  1Q8Q A;  2EXH A;  4AVS A;  4D3W A;  2JDH A;  2JE9 A;  4DY3 A;  1EP0 A;  5J96 B;  1HIX A;  4I0W B;  2Z5W A;  2P34 A;  1ULE A;  3C8X A;  1PK6 B;  5ACA 3;  1VE0 A;  2KM2 A;  3EB7 A;  1CZS A;  2V5Y A;  2XKP A;  5FPV A;  2EA7 A;  5FZ8 A;  3P5B A;  1DLC A;  2A1X A;  2YMZ A;  1S0C A;  5GZC A;  1UWW A;  4M4R A;  4JKL A;  5A7N A;  1OLM E;  5H9P A;  3SKV A;  4COY A;  3JD7 3;  4ARY A;  4NIG A;  2NYY A;  2Q1M A;  2Y60 A;  4J1W A;  2IUW A;  1OHF A;  2R06 3;  3ZSK A;  5A33 A;  4UOJ A;  1LOA A;  3NNM A;  1JI6 A;  1TMF 1;  3VDD C;  4YVS C;  1WA4 A;  5B2G B;  2WNV C;  2BGO A;  4RQP A;  4ZHN A;  1WCQ A;  3GZU C;  3RZZ A;  2D5F A;  5L9R A;  3BTZ A;  3C7E A;  4BPZ A;  1MAC A;  3LD8 A;  5T5O A;  3AZW A;  4QX7 A;  1OLR A;  4YM2 A;  5FZM A;  2RS3 2;  4YVW C;  4CDX B;  2X05 A;  1MVQ A;  3MIF A;  4ZU4 A;  3VBU C;  4R4X A;  3S57 A;  3VZK A;  1IOA A;  4QB2 A;  4WM8 B;  2Q5T A;  5KHJ A;  1JZ6 A;  4QX2 A;  3GJB A;  5F39 A;  5BPX A;  1J1L A;  3POY A;  1QDO A;  1O3S A;  4Q26 A;  2YBK A;  4AFA A;  1CR7 A;  1QDC A;  2C4X A;  4W8J A;  3VKN A;  5IK8 A;  4OUL A;  3WF3 A;  5IVJ A;  1OOP A;  1VBC 2;  1DQ4 A;  2EID A;  2IXI A;  1CPN A;  1JTZ X;  3MV0 1;  4A45 A;  1W2A X;  1BQP A;  1PVC 2;  4LKD A;  2G9G A;  4QPI A;  5JZG B;  4I01 A;  4RHV 1;  3X29 B;  3SCF A;  5A32 A;  4OUM A;  1YIF A;  3MGU A;  4OVE A;  4LKS A;  1SHW B;  1JOD A;  4LBQ B;  2ZHL A;  1AXY A;  3H9A A;  3N7J A;  4XFC A;  3AL5 A;  1H8T A;  4OMC A;  1IG0 A;  2EIB A;  3AKT A;  1DQ5 A;  1LRH A;  2AAC A;  4XUR A;  4XYX A;  3RG0 A;  4KL1 A;  1ZRF A;  1KIT A;  2ZGR A;  1ALY A;  4GD4 A;  4AK3 A;  5CAD A;  3A21 A;  1QHD A;  1PZ7 A;  4XMI A;  4QDS A;  5IYY A;  1NAE A;  3ZFG B;  4K6B A;  2OX0 A;  3PHM A;  2VNV A;  2BBV A;  3U4S A;  5FYM A;  5BNO A;  1WD4 A;  3JU9 A;  1W6M A;  3VL8 A;  2FDK A;  3WF2 A;  1Y3T A;  4NUB A;  4QX1 A;  1W0O A;  5H9S A;  3WNL A;  3ZYI B;  2H6C A;  1ZBE 2;  2VE1 A;  1QXJ A;  3K4A A;  3AZY A;  4HOO A;  3WEZ A;  1OLM A;  1F8V A;  3GYD A;  1XPW A;  3IMM A;  4NHK A;  2PHT A;  1RTV A;  3CO2 A;  2WZR 1;  2R04 2;  4G9S B;  1OT5 A;  1P8J A;  4HBN A;  4UWD A;  3ZYF A;  5DDJ 1;  2E33 A;  1JUI A;  5F9T A;  3I2O A;  5F3C A;  3IKW A;  4IE7 A;  2LRP A;  2WSU A;  2XGX A;  4AFB A;  5C33 A;  2BP6 A;  3SEE A;  4B1L A;  3H50 A;  4E4S A;  2IXH A;  3HEI A;  1IKP A;  4MLO A;  4XAB A;  1IQD C;  2V72 A;  3OOX A;  5CG9 A;  2O0O A;  1OA3 A;  2PHX A;  4JRA A;  4WM7 B;  4BXS V;  4DXR A;  1S1A A;  2FDI A;  1QOO A;  3B69 A;  3RYK A;  1SLT A;  4P9W A;  4XQ4 A;  3ZVX A;  4XJU A;  2E53 A;  5C9A C;  1YFW A;  1Q8P A;  4R9D A;  2AGS A;  2P17 A;  2JIG A;  3AM2 A;  3H3L A;  2X53 S;  2D6N A;  4OQ8 A;  4NMI A;  3WT3 A;  2P3Y A;  4NOT A;  1O5L A;  3DN7 A;  1RMU 1;  3U07 A;  1SFN A;  3I59 A;  2A5Z A;  2D6K A;  4AGG A;  2WA3 A;  4FAG A;  3I2I A;  2PLV 2;  4D6R A;  1SLC A;  1IS6 A;  1MEC 1;  2ENR A;  1R08 3;  2R1B A;  4DXT A;  5KXE A;  1FOD 3;  1Y7B A;  3ZSM A;  1W3V A;  4ZS3 A;  1WW5 A;  2K0G A;  3HNB M;  1DG6 A;  4JGY B;  1UY2 A;  2GH8 A;  1PO2 1;  4FXG B;  4GB3 1;  5BXX A;  2JDY A;  3C7F A;  1G9D A;  4BJ0 A;  4FPO B;  1J59 A;  3KT1 A;  4GB3 2;  2B5H A;  1JZ7 A;  1FPN 3;  2B7Y A;  4E2Q A;  3ZDS A;  2JG8 B;  2XBO 2;  1ZZ6 A;  1UY4 A;  2J1E A;  1JU3 A;  5FYC A;  3CDZ B;  4N7I A;  4MH0 E;  3PIG A;  4CCN A;  2XQR A;  1SEF A;  3M3C A;  1UU5 A;  1WCS A;  5K0U A;  1TME 2;  4XBL A;  3BKZ A;  1LU2 A;  1V6J A;  1ULO A;  1AX2 A;  1AJO A;  2JKX A;  4Y1V A;  5FY4 A;  2UWC A;  4PF5 A;  3AZV A;  5FIX A;  5C8W A;  1VBB 3;  3GBG A;  3MDP A;  4FFH A;  5KXC A;  2FQP A;  4AVB A;  4N90 A;  2ES3 A;  1G9F A;  4YVW B;  4OHZ A;  2R07 1;  2VZ1 A;  1AX0 A;  2R06 2;  3FFQ A;  1QJU 1;  3BTY A;  1AR8 2;  5HV4 A;  3QOP A;  5CG8 A;  1NKG A;  4R9C A;  4CP2 A;  5JXJ A;  4NIH A;  4DIN B;  3QCW A;  2ZTN A;  1LHO A;  2NMO A;  2EIE A;  3GDB A;  3B9C A;  3WP6 A;  1VBB 1;  3W9A A;  2RHP A;  2XLG A;  1G7Y A;  5GZD A;  3ROU A;  1BYH A;  4EN6 B;  4JTN A;  1B09 A;  4Y5S A;  3Q9O A;  3V64 A;  4FPY A;  5DQ0 A;  1OXC A;  3G6J B;  2D5H A;  3KT4 A;  4OI1 A;  3KD4 A;  5A3W A;  3LEK A;  2OZ6 A;  1CQ9 A;  3HQX A;  2D3R A;  1E5I A;  2R49 A;  3HR9 A;  4EV0 A;  1RUG 1;  3WNM A;  2HEV F;  2RS3 1;  3NO8 A;  3WF1 A;  4W6W A;  4IEV A;  4JGZ B;  3VBS C;  2RR1 1;  5EP9 A;  5L9B A;  2VJX A;  1WGP A;  4BIS A;  2JDK A;  2FDF A;  4JHT A;  1ZX5 A;  1U5X A;  4LHN A;  4Y22 B;  2PAE A;  2HWC 1;  2LW8 A;  1RL3 A;  1ND2 C;  3OCP A;  1AJK A;  3LA3 A;  4KG8 A;  1PIV 2;  2WN3 A;  1H9P A;  1W8U A;  4YVS B;  2B46 X;  4HFS A;  4WVZ A;  1JHN A;  1RJ8 A;  1ND3 A;  1JYW A;  4I2O A;  4CCD A;  4NRO A;  5FPL A;  2IFR A;  2FCU A;  2PEL A;  5FZI A;  4XFI A;  3AJY A;  2HWB 3;  2JD9 A;  1UAI A;  3DYO A;  4W6Y A;  1HRI 3;  5A1L A;  1A8D A;  1REE A;  3APB A;  3SIS A;  1D2Q A;  4A3Z A;  4AXO A;  3PUA A;  5D8A A;  5JSO A;  3B00 A;  1QQP 1;  4O9G A;  4AGR A;  2PXJ A;  4XOG A;  5DAP A;  4BH9 A;  4LNV A;  5CFD C;  1T2X A;  2UWB A;  3QD6 A;  1W39 A;  3S5Q A;  2OYZ A;  4CTE A;  2WII B;  3DCQ A;  5ANN A;  2JG9 C;  2R1D A;  5G04 L;  5C8C B;  1W8N A;  5JOZ A;  3BI3 A;  3AVR A;  4FXK B;  1TEI A;  5FYY A;  1V70 A;  2VZR A;  1JUH A;  3O0X A;  3KQ4 B;  1ACC A;  3SMH A;  3EQE A;  4K8F A;  3M3O A;  5JDB A;  4AOC A;  3P6B A;  5DZE A;  4IV1 B;  4A44 A;  2EAK A;  3WUC A;  1UZ0 A;  1UZY A;  1C8N A;  1ULP A;  3ZSJ A;  3NKG A;  4TZD A;  3O12 A;  2PAM A;  4H7M A;  4Z8B A;  1H2K A;  2JG9 B;  1BK1 A;  2QQM A;  2RS5 2;  2VZT A;  4MXV A;  4RL7 A;  4XET A;  5C8C C;  4CDQ B;  2WZP P;  4AQT A;  4COV A;  5FBZ A;  3TEZ A;  1BVV A;  2DVG A;  3PUR A;  5IAX A;  2HWF 1;  2ZGM A;  1HB1 A;  3IIA A;  1X8M A;  4R52 A;  3VDD A;  2DVB A;  2VEC A;  3M1H A;  1QU0 A;  1STM A;  3RNS A;  5FBJ A;  2DTY A;  2VD7 A;  4DMI A;  2ZS6 B;  4LBQ D;  4GMP 3;  3TAY A;  4Q27 A;  3QAC A;  4BQY A;  4QHZ A;  1AR9 2;  1W8Z A;  3LF7 A;  3SH4 A;  2A6W A;  1RUC 1;  1DGR N;  5CFC B;  3PTY A;  5A7P A;  3OBT A;  5JOY A;  4HK9 A;  3J7N A;  1QF3 A;  3OBZ A;  4O7X A;  2QFE A;  3N9Q A;  1WCU A;  3Q8A A;  1IS4 A;  4EZ4 A;  1SFY A;  5CA6 A;  4M3C E;  2XWJ B;  1U5Y A;  5FYT A;  3ILF A;  4N43 C;  1SMV A;  1AR6 1;  1KS5 A;  5FRA A;  1IGO A;  2VCM A;  2WZR 2;  1Q5O A;  1CAX B;  4QX8 A;  3ZFF A;  4NAM A;  4UFM A;  4YWA A;  4CCM A;  3SCH A;  1W9Y A;  3ATG A;  4AW7 A;  4F83 A;  3BTA A;  2W95 A;  3VB9 A;  2RM2 1;  4DUW A;  3SCG A;  2XG3 A;  3H8O A;  1L3J A;  4U36 A;  3ZYJ B;  1XYN A;  4UF0 A;  1H8T C;  3QH7 A;  4DEV A;  4RHV 3;  3ILR A;  5T5L A;  4AQ6 A;  2KD7 A;  4H2A A;  4CEY B;  2A73 B;  3WG1 A;  5A6Y A;  3R6S A;  1Z7S 1;  4XHX A;  4AI0 A;  1OD5 A;  2DBI A;  3AVS A;  1XE8 A;  2PLV 1;  2DUP A;  3H8U A;  5FMD A;  1QWR A;  4D6S A;  1GV9 A;  5C3Q A;  2P6C A;  1MQT A;  2PHU A;  1C5I A;  2XXZ A;  4N53 C;  4JGY C;  5G05 L;  5IVC A;  4J6G A;  3RJR A;  4ZON A;  4XUQ A;  4NO4 A;  1R09 2;  4B3N A;  4QXC A;  4BU2 A;  1QKQ A;  2IWG B;  5FMB A;  2P3I A;  4Y26 A;  2JIJ A;  3OBR A;  1UYY A;  4LBN A;  5DN2 A;  2PLV 3;  4E27 A;  3EJK A;  3RI9 A;  1LGC A;  2PHD A;  5JOW A;  1OFS A;  2IC1 A;  1FMD 3;  5FY8 A;  4BQX A;  4RQP C;  4LIU A;  2GC2 A;  3N9M A;  2HWD 2;  2UY9 A;  2W47 A;  4MV2 A;  4P9L A;  2Y6F A;  4UFH A;  2R6Q A;  4GQ7 A;  2RG4 A;  4QGN A;  3W21 A;  1OA4 A;  3PVO A;  1UIK A;  2L9L A;  4A7Z A;  1KJL A;  1QJX 1;  4NPM A;  4TYS A;  2ZZJ A;  2HWE 1;  3ZSE A;  2VTF A;  2C1F A;  1XJA A;  3LA2 A; 
#chains in the Genus database with same CATH homology
 4JKM A;  3ACH A;  4CU7 A;  1WKY A;  4PQQ A;  5JXI A;  3OBA A;  3T09 A;  3VD9 A;  1K45 A;  3THD A;  3ACI A;  4D8M A;  3NNG A;  4DXS A;  4E8C A;  1RYY A;  3T0D A;  5CYY A;  3DEC A;  2WO2 A;  4JHZ A;  2Y6K A;  4A6O A;  1CZV A;  1PMH X;  3BGA A;  4MAD A;  4QDQ A;  3LEG A;  2C26 A;  2XHN A;  2EIC A;  4Z2A A;  3IDA A;  1GOF A;  4TXW A;  3OB8 A;  3FL7 A;  1KEX A;  3I3D A;  4QX0 A;  4CU9 A;  1EUT A;  5IFT A;  1NUK A;  1JHJ A;  5DMY A;  2VZO A;  1UYZ A;  3I3E A;  1K12 A;  1US3 A;  1UXX X;  3VDC A;  3HOB A;  2W1S A;  3PUH A;  1YQ2 A;  4W50 A;  3J7H A;  3HNY M;  3OG2 A;  1GMM A;  4TTG A;  3C7G A;  4KWU A;  3T2Q A;  2VCC A;  5EIY B;  3CKH A;  1GOH A;  3SKJ E;  4RN5 A;  4MOA A;  1I5P A;  4XUN A;  1L7R A;  4ZXE A;  3W5M A;  2E26 A;  2VZQ A;  5LA1 A;  1H6X A;  1O8P A;  4IUG A;  4DUX A;  5FUI A;  5IFP A;  3I2J A;  1J84 A;  2ZEZ A;  5A1A A;  4LPL A;  2VOT A;  3T2O A;  1SG3 A;  1W9S A;  2LS6 A;  4W4Z A;  3C7O A;  3T0B A;  3I2F A;  3DYM A;  3ACF A;  3VDB A;  3UET A;  5JXG A;  2WDB A;  1JYV A;  3A7Q A;  4ZZ5 A;  3FHQ A;  2ORX A;  4L0P A;  1UY1 A;  2C9K A;  2VZ3 A;  2WBK A;  2J1V A;  2WZE A;  2W91 A;  5EJZ B;  4QPW A;  2E31 A;  2OKX A;  4FI9 A;  3OGV A;  1DYO A;  3MBW A;  2W1W A;  1UMH A;  2J1S A;  1UY0 A;  1XC6 A;  2VZV A;  3C8X A;  3LPF A;  3EB7 A;  1CZS A;  2CDO A;  2J1U A;  2WAB A;  2XQX A;  3GM8 A;  3I3B A;  2Z4F A;  1JYN A;  1DLC A;  3NJV A;  2WN2 A;  1UWW A;  4M4R A;  3HJR A;  4XUT A;  2W1Q A;  4JKL A;  3SKV A;  2Y6J A;  3WQB A;  4ARY A;  3I2G A;  2RVA A;  1JZ8 A;  5JUV A;  2V5D A;  4UOJ A;  5B4N A;  1JI6 A;  2WQ8 A;  2BGO A;  5JXH A;  3WNP A;  3FHA A;  1WCQ A;  3U37 A;  3SEP A;  1KGY A;  3C7E A;  4JX0 A;  3IAQ A;  2VL4 A;  3NJX A;  2ORZ A;  2X05 A;  3WF0 A;  4QB2 A;  2QQO A;  1JZ6 A;  4QX2 A;  3T0A A;  4GWI A;  4M4P A;  2XON A;  1DP0 A;  3I2H A;  3CMG A;  2WO1 A;  2C4X A;  4W8J A;  1GUI A;  2VQU A;  3WF3 A;  1L7Q A;  2EID A;  1O59 A;  4A45 A;  3MV0 1;  3A22 A;  3MUZ 1;  2QQK A;  3JXS A;  3E1F 1;  4P08 A;  4PT6 A;  4BK4 A;  2VZS A;  5B4X A;  4LKS A;  1SHW B;  4UI9 L;  3LEI A;  1O8S A;  2BBA A;  3WNN A;  4OMC A;  1UXZ A;  2EIB A;  4XUR A;  3LQC A;  4GWJ A;  3FN9 A;  3A21 A;  5IYY A;  4QDS A;  1NAE A;  2JE8 A;  4ARX A;  2HLE A;  3T08 A;  1F4H A;  1US2 A;  3VDA A;  4QX1 A;  3WF2 A;  3WF4 A;  4XUO A;  5DPN A;  3WNL A;  3WEZ A;  3K4A A;  2WUH A;  1XPW A;  5J1X A;  2ZEY A;  4OUE A;  4QAW A;  2WAO A;  2VMD A;  3GGL A;  3K75 B;  1OT5 A;  1P8J A;  4CUC A;  2E33 A;  4DEQ A;  3ETP A;  3SEE A;  2V4V A;  1TVG A;  4OMD A;  3HEI A;  1IQD C;  2V72 A;  1XNT A;  2VME A;  4BXS V;  4DXR A;  4UAP A;  3K4D A;  2W94 A;  3ECQ A;  1GU3 A;  5JMO A;  2BGP A;  1W8O A;  1UYX A;  2QQI A;  1XNA A;  1JYX A;  5IJR A;  2BZD A;  3I2K A;  2J1T A;  4P00 B;  1JZ3 A;  4DUV A;  3MV1 1;  1UMI A;  3I2I A;  2YFU A;  2W1U A;  2VO5 A;  4DXT A;  3OEB A;  2Y6G A;  2JDA A;  3DYP A;  3P1I A;  3ACG A;  2VCA A;  4A42 A;  3HNB M;  1UY2 A;  3A23 A;  2X10 A;  5LA0 A;  3WNK A;  3C7F A;  5CZK A;  4BJ0 A;  2B4K A;  1JZ5 A;  2Y6H A;  2WO3 A;  1JZ7 A;  2ZXQ A;  1OF3 A;  2YG0 A;  4XUP A;  2VM9 A;  3K4Z A;  4XZU G;  1UY4 A;  1W99 A;  2J1E A;  1JU3 A;  2J22 A;  3CDZ B;  4YPJ A;  5HPO A;  4QDR A;  2R7E B;  4PF1 A;  1ULO A;  3C7H A;  2JKX A;  2VMC A;  5I0D A;  2PQS A;  4QB6 A;  5HXM A;  1PX4 A;  2VR4 A;  2W92 A;  1HN1 A;  2VZ1 A;  3EYP A;  2DDU A;  1NKG A;  4ZY9 A;  2J7M A;  5JXJ A;  1W0N A;  2Y64 A;  1F4A A;  2EIE A;  3GDB A;  3F2Z A;  3AC0 A;  1W9T A;  3VD5 A;  4A41 A;  4CUA A;  2W5F A;  5DQ0 A;  4CUB A;  3VD4 A;  4BDV B;  3LEK A;  2W46 A;  3CZJ A;  1CIY A;  3WNM A;  2VC9 A;  2RV9 A;  3WF1 A;  1JU4 A;  5C71 A;  2VJX A;  2WZ8 A;  4P02 B;  1EUU A;  2BER A;  2LW8 A;  1K3I A;  2ZEW A;  1PMJ X;  3IAP A;  4XVH A;  3III A;  1PX3 A;  2WN3 A;  2WYS A;  2W87 A;  3T2P A;  5JR2 A;  3D3A A;  2Y8K A;  1JYW A;  4KI5 M;  2VQT A;  4AAX A;  2QQJ A;  2JD9 A;  3DYO A;  4D0Q A;  3UES A;  1D7P M;  1UX7 A;  3VD7 A;  4A3Z A;  3WSO A;  2CDP A;  4CU8 A;  1T2X A;  2VMF A;  4E8D A;  3NQH A;  3W5N A;  5G04 L;  3K77 A;  1W8N A;  2B9V A;  1JZ2 A;  2VZR A;  3WNO A;  4LHS A;  2Y6L A;  3CZU A;  2RJ2 A;  2DCK A;  3P6B A;  4ZZ8 A;  2HYX A;  4A44 A;  1UZ0 A;  3K46 A;  1ULP A;  4P5Y A;  1OH4 A;  1R64 A;  4A4A A;  3BN6 A;  1JZ4 A;  2QQM A;  2VZT A;  4OZO A;  1K42 A;  2ID4 A;  2YC4 A;  2YFZ A;  2YC2 A;  1GQP A;  4KMQ A;  1CZT A;  2DCJ A;  4LQR A;  2VZP A;  2XOM A;  1CX1 A;  4MGS A;  5F7U A;  2W3J A;  4HG6 B;  4OYU A;  3LPG A;  3PUI A;  4MGQ A;  3HN3 A;  5C70 A;  2J1A A;  3CQO A;  2X09 A;  3VD3 A;  5EJ1 B;  4QX3 A;  3UNP A;  4AG4 A;  3OGS A;  3CIH A;  2VCB A;  3MO4 A;  4CU6 A;  1BHG A;  2W95 A;  4DUW A;  3HPN A;  4QB1 A;  3GXU A;  1GOG A;  1OD3 A;  4MO3 M;  4BK5 A;  1OF4 A;  2QQN A;  3OGR A;  4DEV A;  5LCW L;  2KD7 A;  2J1R A;  4RYD A;  2QQL A;  1UY3 A;  2ZEX A;  1J83 A;  2YB7 A;  2W9X A;  1SDD B;  3HNM A;  2VZU A;  1GNY A;  1TG7 A;  2E32 A;  3MUY 1;  2WAA A;  5G05 L;  5IHR A;  1H6Y A;  4XUQ A;  4CVU A;  3ZM8 A;  1W9W A;  1LNS A;  1MPX A;  1UYY A;  3IB3 A;  3NRU A;  5DN2 A;  3LE0 A;  3ABZ A;  3OEA A;  5LA2 A;  5C7G A;  3I97 A;  1NX9 A;  2W47 A;  4ET7 A;  3THC A;  4GZ9 A;  2L9L A;  2QBX A;  4JKK A;  2VTF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...