2Z4FA

Solution structure of the discoidin domain of ddr2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
161
structure length
161
Chain Sequence
NPAICRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Discoidin domain-containing receptor 2
publication title Structural basis of the collagen-binding mode of discoidin domain receptor 2
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 161
sequence length 161
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2z4fA00
2W94A 1MPXA 1H6YA 2WO1A 4GWIA 3K75B 5DN2A 4E8DA 3VDAA 4QDSA 3C7GA 1PMJX 1UWWA 2RVAA 3I2KA 4KWUA 2X09A 1JZ5A 3OGSA 4ZXEA 3T2QA 2VC9A 2YFZA 5C70A 2BBAA 1EUUA 1NAEA 3I2HA 3WNOA 2RV9A 5G05L 3I2FA 3W5MA 2B9VA 2VCCA 2VMFA 3C7OA 2J1AA 1JZ4A 2E31A 2QQNA 1CX1A 4CU6A 1OT5A 2W95A 4PT6A 3HNBM 4PQQA 3OEAA 2Y6JA 4JKLA 1UMIA 2ZXQA 4TTGA 4XUTA 2QQMA 1JHJA 3CZJA 4FI9A 1DYOA 2VQTA 3IAQA 2W1SA 4QB1A 1UY1A 4MOAA 2QQLA 2Y6KA 4P02B 2J1VA 2W47A 5LA0A 5B4NA 1GUIA 2BERA 1DP0A 3E1F1 3K77A 3VDCA 3OBAA 3T0AA 2WN3A 4Z2AA 2PQSA 5HPOA 3THDA 4DUVA 1OF4A 4ET7A 2QBXA 4QB2A 1F4AA 4MADA 2ORXA 3HN3A 1W9SA 3ETPA 3WF0A 1GQPA 4DEVA 3VD7A 2WO3A 4JKKA 3DYOA 2QQOA 4BXSV 2VCBA 1UMHA 3C7FA 3DYPA 2VZ3A 2XONA 4JKMA 1UYXA 2VO5A 4XZUG 3SKJE 2XQXA 4GZ9A 2XOMA 4OZOA 2VZSA 4CUAA 1ULPA 3I3BA 3W5NA 1T2XA 2BGPA 2WQ8A 3WEZA 2W46A 4QPWA 1UY3A 2VZRA 4CUCA 3DYMA 2YC4A 3MV01 3PUHA 3P6BA 5C7GA 3C7EA 4A4AA 3CQOA 4OUEA 5CZKA 5JXGA 3UETA 2X05A 3P1IA 2J1UA 3A23A 4W50A 3MBWA 1K42A 4GWJA 3HOBA 1O8PA 1UY4A 1CZTA 2VTFA 2HYXA 4D8MA 2VJXA 3HNMA 3WNKA 3NJXA 3K4ZA 3LEGA 1UYYA 1CIYA 3MUY1 4UI9L 2YG0A 1HN1A 2VMDA 2W3JA 3DECA 3I3DA 2W1QA 2ID4A 3FL7A 3OB8A 2WUHA 5JXHA 2WABA 2J1TA 4ZZ5A 4XVHA 2CDPA 1TG7A 2EIDA 4OMCA 5IYYA 2WAOA 3LEKA 4A44A 1PX3A 3F2ZA 2KD7A 3ECQA 4A41A 4ARYA 1GOHA 4ZZ8A 4DUXA 2C9KA 3T2OA 3C7HA 1OD3A 4JX0A 3ACIA 3CIHA 1NX9A 4XUNA 2VOTA 3K4AA 1K3IA 1OF3A 1J83A 1XC6A 3I2JA 1XNTA 2VQUA 1UXZA 2OKXA 1UX7A 3NRUA 2C26A 3ACGA 2YC2A 4LKSA 3GXUA 5HXMA 2QQJA 2W9XA 3VD4A 1OH4A 4DXRA 5JR2A 3WSOA 2Z4FA 1BHGA 2VZQA 4HG6B 3T08A 1I5PA 5JMOA 3LEIA 4OMDA 2QQKA 3CZUA 3ACFA 3OGRA 4E8CA 3T0DA 4DEQA 5G04L 4M4PA 1K45A 4M4RA 5DPNA 2ZEZA 3ACHA 1US2A 2BZDA 2V4VA 4CVUA 1UY2A 5EJZB 4BK4A 3A21A 3HNYM 5EIYB 2VZPA 1JYNA 3NNGA 4L0PA 1D7PM 2QQIA 3U37A 4DUWA 1JZ3A 2BGOA 4P00B 5EJ1B 1JYVA 3OG2A 4CU8A 3K4DA 3FHAA 1IQDC 3ZM8A 1O59A 1GU3A 3WF2A 3A22A 5LA2A 3GM8A 4BJ0A 1JZ7A 2WN2A 1JZ2A 3SEEA 3GGLA 4XURA 3K46A 2JKXA 2VZTA 2W91A 3I3EA 4XUQA 1O8SA 4A42A 3EYPA 3OEBA 3BGAA 4A45A 1UZ0A 1W9WA 4XUOA 1JI6A 5IHRA 2VZUA 3WNLA 2Y8KA 5I0DA 1PX4A 1JYXA 2J1EA 2VL4A 3UNPA 4CU7A 5DMYA 2WO2A 4AAXA 2W5FA 3UESA 3PUIA 3LQCA 1DLCA 1PMHX 2EIEA 2Y6HA 1KEXA 4RYDA 4W8JA 4RN5A 2DCJA 3NJVA 2LS6A 1W8NA 4QX2A 3VD5A 1WCQA 4QX0A 1W8OA 5JXIA 1W9TA 3CKHA 3THCA 4QDRA 2RJ2A 3WNPA 4DXTA 3HEIA 4YPJA 3FHQA 2J7MA 4DXSA 2V5DA 4CUBA 2WDBA 3I2IA 3J7HA 4CU9A 3LPFA 5LCWL 1XNAA 1NUKA 2DDUA 2YFUA 3CDZB 2R7EB 1K12A 2VCAA 2ZEYA 2B4KA 3I97A 1H6XA 1CZSA 1JU3A 2E33A 2VM9A 3LPGA 3JXSA 1US3A 5IJRA 2E26A 1P8JA 5FUIA 2JD9A 2JDAA 5J1XA 4MO3M 3OGVA 2VMEA 1CZVA 3WNMA 4LQRA 3WF3A 1J84A 3IAPA 5DQ0A 1UXXX 5IFTA 3VDBA 1WKYA 2Y64A 1GOFA 2YB7A 2VR4A 2CDOA 4JHZA 5B4XA 3WF4A 4TXWA 2WZ8A 3MO4A 3VD9A 1ULOA 4P08A 2J22A 2ZEWA 1KGYA 3I2GA 2J1RA 1GMMA 4UAPA 2C4XA 2XHNA 2WZEA 2Y6GA 4QX1A 4ZY9A 5A1AA 2X10A 3FN9A 3WNNA 4P5YA 4LPLA 5F7UA 3ABZA 3T09A 3SKVA 1LNSA 3LE0A 1SHWB 4OYUA 5IFPA 2Y6LA 1JZ6A 1TVGA 2E32A 3C8XA 3WQBA 1GNYA 5LA1A 4QAWA 1W0NA 4QX3A 1JZ8A 5JUVA 3IIIA 5CYYA 1W99A 2V72A 3IB3A 3MUZ1 1SG3A 1XPWA 2L9LA 2W1WA 3GDBA 4QDQA 3HPNA 1UYZA 3D3AA 3CMGA 2ZEXA 2WAAA 4A3ZA 2W1UA 3NQHA 2WYSA 2W87A 4XUPA 4KMQA 1R64A 1NKGA 4IUGA 2HLEA 1L7RA 3AC0A 2ORZA 5C71A 4MGQA 2W92A 4W4ZA 2EICA 4LHSA 3A7QA 4ARXA 1YQ2A 4PF1A 3T0BA 2VZ1A 2JE8A 3IDAA 1EUTA 3EB7A 2EIBA 4A6OA 4QB6A 3VD3A 1L7QA 4KI5M 3T2PA 3MV11 1JYWA 4D0QA 2VZVA 3SEPA 4UOJA 2VMCA 1RYYA 4AG4A 1GOGA 1JU4A 2DCKA 1F4HA 3WF1A 2WBKA 3BN6A 1SDDB 4MGSA 4BK5A 5JXJA 1UY0A 2J1SA 2LW8A 2VZOA 4BDVB 3HJRA
chains in the Genus database with same CATH superfamily
1WMXA 4AEDC 3APBA 3VHRA 4ES8A 2D6OX 4FPJA 4IV1A 2YC0A 4LUMA 2VY0A 4I30A 3KGZA 5FFOC 1LODA 2W52A 3J7MA 3U0ZA 4HBNA 4KU7A 1YJKA 5CFCC 3C7GA 3WG1A 4OHXA 1UWWA 1IPJA 2EXIA 4LT5A 1RXFA 1UQXA 2UYBA 3R0RA 1SMVA 3MGUA 5APAA 4B1MA 1VMHA 3I2KA 5L7OA 1SPPB 4JRLA 4FOWA 2GC0A 4CPBD 1RUG2 4ZXEA 3T2QA 5A6YA 2YMZA 1IS6A 1AR83 4XC9A 5SV8A 1NAEA 3NNLA 1UZVA 4XQWA 1YJLA 3UJQA 4HVOA 3MEPA 1VBC3 1C3HA 2EA7A 1C8M3 4XTMA 2VG9A 3JQXA 4MVTA 4ISRA 1W8FA 1ZVFA 3AMMA 1CONA 2WT2A 4MH0E 5FYMA 1JZ4A 1VAMA 2E31A 2QQNA 1R091 2VNRA 4WVVA 5SV5A 2WYFA 1S0IA 4JV4A 4XXPA 3V56A 5FPLA 5GZDA 4IE0A 3UV9A 5A3PA 5JPNB 4AVSA 5EYYA 5CEHA 3T30A 3WW4A 4NRMA 1QQP1 4XCBA 2AYHA 3OEAA 4CDUA 4AI3A 3ZIWA 2O1QA 1MEC3 4K1ZA 3WLUA 1QJFA 4XUTA 2V4AA 1A34A 4CEYC 3NL1A 1LGNA 1COV1 4R8HA 5ERLA 2DV9A 3RWKX 1DYOA 4AHZA 1W6PB 1Y4WA 2CU5A 4ZS2A 2D7FA 1DGWX 5M0TA 4AQ6A 2QQLA 2YBKA 1ACCA 2J1VA 4EN6B 2W47A 3RI9A 4N90A 4HN1A 5B4NA 4BZ4A 4FPCA 4O61A 1CJPA 3O7OA 4H2AA 5HPOA 2GMMA 1GANA 4META 4XTPA 1G86A 1QXJA 3J4UH 2ZX0A 2RS33 1OF4A 4QB2A 1LULA 3N9LA 2VD7A 5BNQA 1AR92 1ZBE2 3MPBA 2GP3A 3WUDA 2G19A 1DQ6A 3HN3A 2Q5TA 1KFXL 2ET1A 3CHXA 2PHTA 4MXWA 1PO22 4DEVA 1PK6C 2R49A 5I0TA 4LBJA 5A7SA 1NCRC 5FLJA 3O1MA 1PO11 1PGL2 2DFBA 3DL3A 5GZCA 5LEKA 3U14A 1GKBA 3OSDA 1RUD3 5LBCA 4CDQA 5CKQA 4BXSV 4QHZA 1NA1A 5BPXA 1VMJA 3BIWE 2XJPA 5FXWA 1YFWA 5DUUA 1KDKA 4XFAA 4YGBA 1CESA 1F15A 3MLKA 4CSWA 1UYXA 4BQXA 3MI8A 3SKJE 5FP7A 3VBOC 3H7JA 2XQXA 1U5YA 5FKBA 1G9BA 3H8UA 3VBUA 1QJY1 4LKDA 1DGLA 1IQAA 2VUJA 4Q0UA 3NNJA 4FSJA 2BGPA 2WZR1 2WQ8A 2BVVA 3LZZA 4HK8A 4O9EA 3WEZA 1OH3A 1FOD2 1QJU2 2MHFA 3JBG3 4CUCA 4FTEA 3U07A 2YC4A 3VBFB 1R082 3BODA 1M06G 2RS11 3I59B 1LEDA 1HQNA 1VBA3 2BQPA 1MQTC 3P6BA 4IL7A 3CQOA 2OUJA 5CZKA 5FLIA 5JXGA 1S55A 4XJAA 3AZWA 4Q8KA 1RITA 3JD73 4AVVA 4QPGB 5AVPA 2LTNA 4UFKA 1GNHA 2GZWA 3POGA 4O9GA 1UW8A 1CWPA 4LBMA 1Z7S2 1OOPA 2I74A 3AXEA 4PLMA 5D8AA 3GBWA 1OSGA 4XIOA 4NIDA 4GB33 2JG9B 2YDEA 2OA2A 2P3IA 3O5SA 1LEMA 2VJXA 4HK9A 4K21A 4DZGA 4LXLA 3E6DA 2C9AA 4Q4V2 4LE4A 2WKKA 4LTAA 5JOXA 3ZX7A 4ATFA 4FOQA 4JGZC 1LOAA 2A3WA 2OZ6A 4UW6A 2P6HA 4Q4W3 5GLZA 1GICA 5IVFA 4LO6B 1I9RA 2BBVA 3M2MA 3OPTA 4UFJA 2RR11 1X7NA 3DECA 3I3DA 2Q4SA 1RHI2 2ID4A 4LO5B 4KG0A 2HBTA 2O8OA 1DZQA 2HWC2 3RWNA 4PF5A 1G9FA 3B00A 1OA3A 2C0ZA 2RE9A 3AP5A 3GALA 4MXVA 2WAOA 3RVHA 4RQPB 1VBE2 2BEOA 2MEV2 2WT0A 3F2ZA 3N9PA 4WV8A 3VHPA 2E63A 1VB2A 5FAXA 4A3XA 1JN2P 3ECQA 4ONUA 5JOWA 4A41A 3NV4A 1GOHA 4NRQA 3PTRB 1RUOA 2PXJA 3N3HA 4AQTA 4EN7B 2WNUC 4FQ4A 3KHCA 1RUG3 3R4DB 4XFIA 1GWKA 5GLTA 3BPSA 1CR7A 3CIHA 2Z2SB 3VZOA 5FO8B 1K3IA 3AM2A 3GZUC 5FR3A 1A8DA 1WLTA 2Y0IA 4YRDA 5CVRA 4DRRA 4INDA 3KLSA 3CO2A 4ISQA 3GBGA 3WW2A 1XC6A 3S7IA 4GWMA 1JUHA 4XDPA 5LY2A 1GWLA 1E5SA 4B4RA 3KHBA 1N3OA 1AR63 2VQUA 4QXBA 4JAAA 4CDWC 1URXA 4IEUA 5T50A 4CRQA 3OD4A 1LTEA 5ACA1 5A7WA 3MICA 4JC1A 4LNVA 5FYHA 1C57A 1MZ6A 1O4YA 2IVIB 2QQJA 2R1DA 1ONAA 1H2NA 2W9XA 4RR3C 1F8VA 1HN0A 1A78A 3N36A 1LOEA 1YQ8A 4YZ4A 3WSOA 2P3JA 2WQZC 4QKFA 1PNFA 4XDQA 2ARAA 4HG6B 5BNPA 2I45A 1WBFA 1JXNA 2XVGA 5JMOA 2R062 3E6BA 5LBFA 2JXAA 1DCSA 4LORA 3ACFA 1JYTA 1FPN2 2VXJA 4OUSA 4KH9A 2G1MA 1CPNA 1JTZX 1LU1A 3T0DA 5IVYA 2ZX2A 4HONA 4CEWB 1C1LA 1AL22 5DPNA 1KFUL 2ZEZA 3IBMA 4FPOB 2JWPA 3P3NA 1US2A 2WC2A 1Q3EA 3H42B 5A6QA 2V4VA 1BLZA 5EQUA 2QUOA 5EJZB 4DS0A 1AR93 1ZBE3 2KXLA 4HN0A 4JGYC 2IWGB 3HNYM 3IDBB 4CDXB 1T6BX 2VZPA 1JYNA 2PAKA 4QKBA 4Y33A 2QQIA 1XNBA 1PZ8A 4FQZA 4LMFA 5IT6A 3BTAA 1WCDJ 2BGOA 1O6UA 2DVGA 2VNGA 3ZFGC 5CFDC 4Y5Z0 3OG2A 5FLHA 4JHTA 1S0CA 4CU8A 1BZWA 1IQDC 3ZM8A 4DY5A 3ST7A 4RGKA 4XFHA 3A22A 3GM8A 5DDJ1 4CCEA 2WA4A 3N7KA 1JZ2A 4XAEA 3ZXLA 1DHKB 3GGLA 4PCRA 1OPMA 3K46A 2DVFA 3NNMA 4RS5C 5CB7A 4C91A 2VZTA 2OYZA 1G9CA 5GALA 2VNVA 1V6LA 3CJIB 4MUVA 4F7ZA 4A45A 4L99A 3VZNA 3VN4A 4QQLA 3RFRA 3KD4A 3DEMA 3VBRA 2QQWA 4QPIC 4FP3A 1FOD3 1QJU3 5I0DA 3BTYA 3D4KA 4B3NA 5BNOA 4CP1A 1R083 2W5FA 3DPRA 5D2AA 2HBUA 4C0HA 3PUIA 3H50A 5LASA 2GAUA 4CCLA 1PIV2 4BQ5A 4TLGA 2C6SA 4ATEA 3LQCA 3ZSKA 1Q8VA 2Y6HA 1HKDA 2UY8A 4NHMA 3VKMA 4Y5TA 1OLQA 1XE7A 1V6KA 4RN5A 2DCJA 2B7YA 3NJVA 2CSGA 4QX2A 1WCQA 4QX0A 1HV0A 4R9BA 5C4WA 3HQXA 3IZOA 3LKJA 2VMHA 5EXOA 5FZDA 5LATA 3THCA 4D7TA 4A7YA 4DXTA 4O7XA 1FMD1 1KJLA 3BB6A 3M3QA 4PLNA 1HXS2 4I3PA 3UGGA 2ZMNA 1ZZ9A 5K0UC 1K5MC 3AXDA 1Q8PA 3PVOA 4GKXA 4Q4V3 3AKTA 3F95A 5LK5A 1QWRA 3BPZA 2C24A 3I2IA 3S5AA 1ND3A 2JKBA 4LOTA 5FP3A 1NUKA 2VBPA 1DQ4A 2BJSA 2RJKA 1STMA 3J8F3 5J7MA 2ZAAA 2XJVA 4PBOA 4CXWA 2R072 1Y43B 3OPWA 4NN0A 4IE6A 2HYKA 1RHI3 5GJ6A 1XBFA 3VDDC 2HEYF 4BQ1A 1QGLA 2HWC3 3ACLA 2PHWA 2XGXA 3WQ7A 3OY8B 3ZYHA 4KGQA 1JW6A 4FOVA 1LOBA 3RMXA 5IJRA 5L36A 3NAPC 2DBIA 3AKQA 2G4IA 1UMZA 4N43A 4HVQA 5F3GA 1MS4A 5FOJB 2TUNA 4LJHA 2TEPA 2G9FA 4WM8C 5FY7A 1YQ5A 3LB9A 4FCAA 4Z82A 3OGVA 3JZVA 4LITA 2ARCA 3O14A 5HI0A 2VMEA 3WF3A 3KV6A 4Y20B 4BQ2A 4FOYA 4DPNA 5JZGC 3KF3A 5FZBA 4OVEA 1I1EA 1KQRA 3H0OA 3KT4A 5JSPA 2DVAA 2CDOA 2R6QA 4O65A 1UO9A 4XYXA 4EWDA 5JPMB 4FO9A 1YWKA 1PZ9A 2QZ2A 4TXWA 3WDUA 4LIUA 1W6OB 2VVFA 4ZU4A 4AWDA 2MNGA 3ZOIA 1EV11 2BV4A 4P08A 2D43A 5BNNC 4CP2A 2VNOA 3SCFA 4XFFA 5JLVA 1TMF2 5EPAA 4D6RA 3TEYA 1LAJA 2GNMA 2CGNA 5FZKA 1RMU2 1SQ4A 4NROA 2C4XA 1AZDA 2XHNA 1ZRIA 5DZFA 1PGW1 3EQEA 5IW0A 2B8MA 1GZCA 1GYKA 4QXHA 2RM21 3WCSA 2XL7A 2F4PA 2YU2A 3ME2A 3T09A 2R063 1L3JA 5FZ1A 2A6WA 4EQVA 3LE0A 4YW4A 1FPN3 4BWOA 4F3JA 2W0XA 3LSDA 4XMIA 5GZEA 2VVDA 2Y6LA 5L19A 1TVGA 5FYVA 1JZ6A 2RMU1 1AL23 1GNYA 3WDXA 5LA1A 3LF7A 2E7QA 3B93A 1LCLA 4QAWA 2X5IC 4YGEA 3LAGA 4N7IA 4QX3A 5ABJB 4IGOA 3JUUA 4N53B 1JZ8A 3IIIA 4GALA 5KHHA 5CYYA 3VB9A 5A3OA 4YVWC 4JVAA 3MUZ1 2OIIA 1QQP2 3AVRA 1WMEA 1RUH2 2Q1ZB 1N1VA 5F2WA 2ZX3A 4AEKA 2ZGSA 4BQ3A 2XJQA 3D3AA 3CMGA 1BQPA 3O1TA 2ZEXA 2WAAA 1POV0 1COV2 4K8FA 1UKRA 2Z5WA 2W1UA 3NQHA 1VMFA 4UXAA 4QD2A 4XE9A 1FT9A 1W8WA 2CWSA 2P3YA 2F17A 1ZRRA 5F6LB 3FWEA 2IXCA 1TME1 1OFSA 1POQA 4JQTA 2BP6A 5A7QA 3USUA 2YUEA 4FTBA 1GZ9A 1IG0A 5C8CC 2ZABA 4IETA 2EICA 2FDKA 1NQJA 4LHSA 3A7QA 4EZHA 3URFA 4ARXA 4B1LA 3T0BA 2VZ1A 3H1MA 3IM0A 3AJZA 3D0JA 3S7EA 1EUTA 3RS6A 3MPPG 5A3LA 2YGMA 3T2PA 3MV11 4K7JA 4EV0A 4D0QA 5C3PA 3VZLA 3T4VA 3O1SA 2WS93 1SCRA 2FBEA 1PIV3 5CFCA 5FYIA 1WW6A 4H3WA 1F4HA 1JUIA 2JDPA 2WBKA 2GNTA 4JCKA 3PL0A 4JZRA 4E4DX 5GLVA 5JXJA 2NLRA 2J1SA 3UGFA 2VZOA 4FPKA 5FZIA 2ZHMA 4NAOA 3LDRA 4UF0A 3WR0A 2D3RA 3HJRA 1EAH1 2KA3A 3ZYJB 3DXTA 5CA6A 1MPXA 3J9SA 1H6YA 2D93A 3MIEA 4QKNA 4GWIA 3VBSC 4AHWA 2R041 4NO4A 5L9VA 1HXS3 1RUC2 1SLCA 1LRHA 4YW3A 1AR62 4BISA 3K51A 3VDAA 3G6JB 5C5TA 1VBC2 2OS2A 4WBBA 1PMJX 2RVAA 5DAQA 2XBO1 3I3MA 2OUHA 1IG3A 1XOYA 4HSJA 1O91A 5FDBA 2YGLA 2BYVE 4GA9A 4KWUA 3IN9A 1U5XA 2AR6A 3WCRA 3TWIA 3KQ4B 3ZR5A 3I7DA 2JG8B 2B9UA 2YFZA 1WW5A 2BBAA 5FOBB 2IC1A 4QQ2A 3DXUA 3W58A 4OI2A 4Z1VA 3FX3A 3EHKA 2P5BA 5G05L 4CEYA 3I2FA 5C5UA 1HIXA 2AREA 2I2SA 3C7OA 3J26N 4WM7B 3WT3A 3ZFFC 2J1AA 4GQ7A 3D0SA 3NO8A 1TQ5A 1ZBA1 1G7YA 1PVC1 3HNBM 4Z2WA 4BB3A 5I93A 3PDQA 1YQ6A 4AI2A 4DFSA 3G7DA 3WP3A 1CIWA 3R05A 4NWWA 5EFUA 1QU0A 4JDMA 1H8TB 1HLCA 1UMIA 3LGRA 2HJIA 4ZONA 3SH5A 1Z0HA 2VULA 1GWMA 1YXWA 4FI9A 3LIGA 3IAQA 3WP6A 3NKGA 4P02B 3CJXA 4MOAA 2Y6KA 4Y22A 5FZGA 1S2KA 1NCRA 4AHYA 1BBT1 1YIFA 3NV3A 3U4SA 3VDCA 5AC92 3OBAA 3V0BA 2PN5A 5FYUA 3AVSA 3BYWA 2PQSA 3FBMA 5E6HA 3D5OA 1ULCA 1TMF3 3OYWA 2ARBA 4S2FA 1ALYA 1RMU3 1HRV1 2BNNA 1BEV1 1F4AA 2CYFA 3VKNA 2DF7A 3ES4A 1AUYA 2ARXA 2E53A 3ENRA 4MADA 1CAWB 1NCQB 2ORXA 2WINB 5ANQA 1GQPA 3LEMA 2YYOA 4IE5A 5KHKA 1AYN2 2EXJA 3VBOA 4Z8BA 2VCMA 2XJSA 2BOIA 2WNVA 3VD7A 4A7KA 5A3MA 5FO7B 5C6CA 3ZFEB 2QQOA 1OMIA 2P34A 1SBDA 2WR9A 2VCBA 2VMGA 1UMHA 4XILA 1WMFA 2N7GA 4WZFA 1QMJA 1QJEA 1SBFA 4LIVA 4IV3C 4QU1A 3ROUA 4QX8A 3VUOA 3DYPA 4LBNA 4WVZA 1GBGA 4EROA 1DF0A 1QOSA 2DFCA 4JKMA 5E88A 3ZMNA 2HWB1 4XF4A 4GH4B 2OPWA 3KVAA 1NLSA 1QQP3 1ODMA 3AKRA 3ES1A 4OZOA 4CUAA 2VTXA 1EPZA 4I0BA 2ETEA 4TSVA 4CCKA 1T2XA 1G9AA 4P9JA 4K8RB 5BV6A 4P9GA 1COV3 1QNWA 3Q8BA 5CU1A 4JDOA 4Q4X1 4N9IA 4QPWA 2X29A 2FDFA 2ZHNA 1YIPA 5FMDA 5L73A 1ZZCA 3PUHA 5AVAA 2FDGA 4GIQA 4XXAA 5E16A 2C5DA 4DB5A 2G9GA 5C7GA 2ZGOA 3PMEA 5FZLA 3RG0A 3MW4A 3PJYA 4KWLA 3USUB 4JGZA 1MS1A 2KM2A 1X50A 5A33A 3A23A 5FCCA 1ZA4A 4SBVA 2WT1A 4HKOA 4YNIA 4E27A 5FPVA 2D6KA 3MBWA 1H9PA 4Y1VA 1LR5A 5I0RA 1K42A 1W05A 2Y34A 4Q4W2 1J3RA 5FTTC 5FZ8A 1S0DA 5FY1A 4D94A 1QKQA 1UY4A 1V6JA 2VTFA 4QWNA 5DABA 3T1LA 5FK7A 4GD4A 5FIXA 1LHVA 1UPIA 1PZ7A 3NJXA 3OUIA 4OZXA 2QDRA 4DNYA 3LEGA 3KCXA 1CIYA 3MUY1 1W6MA 3ZXJA 4D69A 1DIWA 3NSTA 3QCWA 5FQ0B 1V9U1 1HRI2 1IS3A 5KHJA 3UKVA 3CBNA 2EXHA 2D3PA 1CAXA 2JIJA 2A7AA 2VXRA 3I2DA 5LB6A 1NG0A 2PLV1 2WNUA 3FL7A 3OB8A 2BNOA 3JCIA 5JXHA 1UU4A 3AMPA 2AACA 2WABA 3RYKA 2IFRA 3WP4A 1EY2A 4JTOA 4XVHA 4MLOA 2CDPA 4RHV1 1TG7A 2BFUL 4NJ4A 1G8WA 4XQ4A 2LM3A 1HJFA 1RUC3 3FMGA 3LEKA 4UFLA 5FY4A 2P4EA 2Q30A 4YVSB 1PX3A 1XSQA 3RYPA 4A44A 1ND2C 5LRRA 4PDWC 4OQ9A 1VBB1 2KD7A 1ZRDA 1W2OA 1ULGA 2WZR3 1LGBA 1WCSA 4CDWA 4DUXA 1ZZ8A 2ZAHA 3R4SA 2CY6A 3WY6A 2NQYA 3IPVB 5A32A 1K5JA 2JB4A 4M3CE 2ET7A 1O5LA 1UU5A 5F3IA 1RUE2 1OD3A 2P6CA 2VOTA 1OF3A 5T54A 1LHOA 1U0AA 3MW3A 3I8TA 4MGTA 3SH3A 2HEVF 3OD0A 5IAVA 5IVJA 4UT5A 1ULDA 4NOTA 3H3LA 2WWUA 4CCCA 4BLIA 3V0AA 5FYZA 4XQDA 1UXZA 1LOFA 2R0HA 2C26A 2DCYA 1QH6A 3E5UA 5IK5A 1LESA 3O1RA 3ACGA 4XCAA 1JMUB 3Q8FA 2VTXJ 2ZGMA 4IEZA 2YC2A 4LLOA 3ZSEA 2VE1A 3LFIA 1AXKA 3GCXA 2ZKNA 3OBZA 3VD4A 3WQ0A 4OQ8A 3S57A 4XHBA 4FP2A 5JI7A 1CAUA 5JR2A 3BI3A 1H4HA 2OXBA 3AL6A 4BQYA 3BOWA 5L9RA 1BHGA 4JGYA 2VZQA 3AYDA 4Y22B 3T08A 1IKPA 1Y7BA 3L9JT 1VBD2 2ENRA 1ZYBA 4IERA 2O8QA 1GZWA 3CZUA 3EJKA 4MSVA 5ISLA 1UOJA 2JECA 4E8CA 1QJX2 1AR72 2R32A 5AC93 5CFDA 3UT0A 3ZFGA 1C5IA 5J36A 3V0BB 4GMP1 4P14A 4K3UA 5G04L 1UF2C 2IXHA 4XBQA 1E5RA 4I0WB 4CXYA 4HPKB 3AP6A 1NZCA 3QD6A 5B2GB 4BK4A 4B4QA 2JJ6A 5F6KA 3TOJA 1ULEA 5EIYB 2VH9A 3CF6E 1W04A 1SLTA 2A73B 1LOCA 3JU9A 4RS5A 3HBKA 1AXYA 5FXZA 1D7PM 5KXEA 3U37A 1AYN3 4X8NA 1JZ3A 3QH7A 2WNVB 2PFWA 2W2IA 5FPZA 3H8RA 3GBFA 1IPSA 3LA3A 4FFFA 4P00B 5LW9A 1VIWB 2JIGA 2Y26A 1RUF1 2ZX1A 5FPBA 4KBBA 3BTZA 2ZX4A 4MG2A 2EIGA 4QPIA 1H0BA 1XNDA 2VOKA 3SITA 1O59A 1EPWA 1OBNA 2HWE2 4COVA 4Q1RA 5LA2A 3TEWA 4CUGA 2C1FA 4KL1A 3V65A 1EV12 4RFT0 1LU2A 3SEEA 4Y1UA 3AZVA 2D44A 3VKFC 4XETA 2JKXA 1DFQA 4H7MA 1C1FA 2W91A 4W65A 4BM8A 4LEJA 4AYUA 1KRIA 3EYPA 1ZRFA 1A6CA 2DTYA 1OQ1A 4BMBA 1RGSA 4XUOA 1C28A 2BFUS 2BWAA 2XXZA 2YBSA 2JEMA 3DKWA 2K9ZA 3U11A 5IHRA 3WNLA 3TN91 1AR81 4AVCA 2RM22 4Q5OA 1PX4A 4R9DA 2J1EA 4XIKA 3UNPA 1HDKA 4AAXA 5DZEA 5A3UA 5K0UA 1K5MA 1C8M1 1RVF1 4AXOA 1O3QA 5JOYA 3WG4A 1HJGA 1SLBA 3M3OA 1CAVA 4YM2A 3VBHB 3ZPOA 5A33B 2E9QA 1HW5A 5CAZA 1A8MA 1Q8SA 5DZGA 3M7AA 5FZOA 2RMU2 1FX5A 4CCMA 3WV6A 2VBBA 1W8HA 3B7MA 3VD5A 1VRBA 4X6QB 4FPLA 4CXXA 1XB9A 1W8OA 4H14A 3VBFC 3VDDA 3J8F2 3ZMOA 1MS9A 5FZ4A 4P9LA 2HKXA 4XOGA 5CNAA 4LBQA 3HEIA 4YGCA 4YPJA 1MEC1 3N4MA 3VZKA 3FHIB 1DQ5A 3BU7A 3MLJA 4NPRA 4YM0A 2D6NA 3L2HA 4EWEA 4IV1B 3CL1A 3N9QA 4RFRB 1YFYA 3LPFA 4HKWA 4YG6A 5KC5A 2ZJCA 3INAA 2DDUA 2QCSB 3FZ3A 5DAPA 4WM8A 1HRI3 4ZU5A 2VCAA 2JG9C 3DV8A 4B7KA 2B4KA 3ILFA 4YG0A 2ZGQA 3ZXDA 2GP5A 1O7FA 1H6XA 1CZSA 1JU3A 2E33A 2EAAA 5L7OB 1W2UA 1RL3A 1AYM2 4N8MA 3POJA 2RS31 4BLJA 4AL9A 1US3A 2B39A 2R1BA 3DF0A 1LHUA 3O0XA 3H1YA 2D5HA 5LBBA 3SQOA 1O3RA 4Q0VA 2WO7A 2HWD1 3U75A 4LO4B 1G6NA 3T3YA 2QVSB 2Q8DA 4AFAA 2PHLA 4AEMA 4MZUA 3GCWA 4EN0A 4LHNA 2IXLA 1OXCA 5J1XA 4MO3M 5BNNA 2ZZQA 1O4TA 1RUD1 2CL2A 5A32B 2X8KA 3WNMA 5FV3A 3J7LA 2NMNA 4GJZA 4LQRA 2PHRA 3K48A 4LOSA 4QM8A 3Q8EA 5A1FA 1RUE3 2A70A 1VE0A 5FKCA 4RQPC 2CTVA 1UXXX 2AH2A 4Y1ZA 3VDBA 5FPXA 1J59A 1XYNA 4CDUB 4CP9A 4YARA 1IHMA 4QGLA 3ZYPA 1DYKA 5B4XA 1GNZA 2AUYA 2WFF2 2WZ8A 2QDNA 3H3ZA 2RDRA 3VD9A 1ULOA 2ERFA 5J48A 1FMD3 1APNA 2XJRA 2J22A 4BU2A 5F39A 4XHXA 2AENA 2QQUA 1QNYA 3RPQA 2XB6C 3JBG1 2IXIA 2PHXA 3OGJA 1CAUB 2X5IA 1H9WA 2FCVA 5HV4A 2VAUA 3ZSMA 1VBA1 1WCUA 3SH4A 4C0BA 3RQ0A 1UAIA 5FWJA 1W06A 5A1AA 4YVWA 2X10A 2BPA2 3WNNA 2FQPA 4P5YA 4LPLA 2FD8A 1YFUA 4LK6A 4CTEA 3RZGA 1VBD3 2LROA 4GJYA 1DZRA 4C1WA 1QF3A 2GN7A 3MFCA 1LNSA 4MXWB 5LBEA 1QJX3 1AR73 4BYYA 4P9WA 4RSUA 1Q8OA 1F9KA 2RS52 4HVRA 4URAA 2Y60A 3C8XA 4GB31 3JQWA 4UBGA 1QDCA 3WQBA 1BMV2 3ILRA 2XUMA 4OI1A 3BUCA 1RUJ2 4BIFA 4CDQB 1KXGA 3ATGA 1NA1B 5JUVA 5CIRA 4RS5B 3P3PA 3U10A 3X29B 4F8AA 4M3CF 3ORJA 3GDBA 4PJYA 4OCTA 3WDTA 3O1VA 3LA2A 3HPNA 4CEWC 4Y1XA 3SISA 2B46X 3VL9A 4EE2A 2TBVA 1LOGA 1W6NA 5C8CA 4YZ2A 4ES9A 2PAMA 4A3ZA 4UFIA 3OGGA 3KCCA 3VBUB 4Y5SA 4CDXC 3N9NA 3VGIA 1CPMA 3AP7A 2DCZA 2D6MA 2VECA 2HWE3 3HN1A 5FZCA 4XUPA 1VP6A 4QQHA 1EV13 5IAXA 1XU2A 2ZS6B 3ILNA 4LLFA 5JAXA 4XBLA 3POEA 3PVEA 2D40A 2AEYA 2WS92 2UWCA 3A0KA 4BOWA 4IGQA 4NIHA 3LWCA 3B9IA 3PMSA 4XACA 2XWBB 2H0VA 5C3QA 4L11A 4OI0A 5CG8A 1RUG1 2CNAA 3AK0A 2OT7A 4AFMA 2JE8A 5LZ6A 2RM23 1OOPB 1MVEA 5D8AB 1YYNA 3VBSA 1DZTA 4A6OA 2LALA 2D6PA 1HQWA 2DUQA 3UK9A 5IK4A 3T4HB 5KHIA 1ZA7A 2YROA 4X6RB 3QACA 2XJTA 4UOJA 2VMCA 3NJZA 3CJIC 1S1AA 2DCKA 1TE1B 4X8PA 5FMCA 4LO8A 3BN6A 1AR61 1R1A2 4QXCA 2DU1A 1SDDB 2RMU3 3SNMA 3RZKA 1NLRA 2A3XA 4DY3A 5A6XA 1V6NA 4BDVB 3THPA 4BQ4A 1D2QA 3K3NA 2K46A 2W94A 2NM1A 4QU2A 3MW2A 1BXHA 2GC1A 5F3CA 2WO1A 2ILMA 1FYUA 5EV7A 4P9IA 4AI1A 3U78A 4NHXA 4BQWA 3K75B 3M1HA 5DN2A 5FYTA 1JOJA 4OFGA 2BRTA 1UOGA 2VUAA 3I54A 3M4FA 1HB2A 3WW3A 1ASJ2 3H1WA 5KR7A 1OPOA 1OA2A 1ZM1A 1VAVA 4Q4X2 3Q8CA 3QBQA 2ZGUA 5FY8A 5FY0A 2X09A 5JR7B 4Q4Y2 2ZHLA 2HWF2 1SLAA 4UBHA 2I07B 3TEZA 5C70A 1EUUA 3I2HA 4MHUA 3RJ2X 1AYM3 3OCPA 5FJKA 1O5UA 4HXCA 4YGDA 4ZHNA 5JCTA 1DQ1A 5TSWA 4XJ9A 3W5MA 2B9VA 2B5HA 1E57A 4IXLA 1AR91 1ZBE1 4E9KA 2VMFA 5C9AA 2Y38A 3OUHA 3OBTA 1NY72 1PO21 1B35C 2W95A 4PT6A 4TN7A 4PQQA 5GKAC 3RZHA 5FMBA 2FMDA 1PM4A 5KXBA 4M00A 1LGCA 3KV4A 3POWA 1PVXA 3WVJA 4BHPA 5H9QA 2Y6JA 4XAAA 3TAYA 2X53S 4JKLA 4AAPA 5F5IA 4NIGA 1NOVA 5A7WB 3AMHA 3WD5A 2QQMA 1JHJA 1D2SA 3CZJA 4QT6A 5CBLA 2Z42A 4FBFA 3KQRA 3EMRA 2VQTA 4I2OA 1PM7A 1XJAA 5DAXA 2XDVA 3KT1A 2VGDA 2BU9A 2KR2A 2PA7A 2WFF3 3B94A 4Q0SA 3RNSA 4FAGA 1N1YA 4IE7A 3WP5A 2BERA 1BYHA 1DP0A 2ZCWA 2DTWA 3E1F1 3TNPB 3TRSB 1CX1A 4G4FA 2R043 5FBZA 2WLPA 4W6WA 1VRH1 2ZMKA 3THDA 2JE9A 4KWJA 3WHTA 4BXFA 4ZS3A 1FOD1 1QJU1 4ET7A 3NVCA 4KG8A 4L92A 3MLLA 1LENA 1JODA 4R52A 1W3VA 1E5HA 1QY4A 4UWDA 2AGSA 2DBNA 3D8CA 1R092 4DINB 1YC61 5FXXA 2GNBA 1JH5A 5JI9A 4WVWA 3H8XA 3PIJA 5FPAA 1UCXA 1J1TA 3T2TA 1HB3A 4PHZA 3HIFA 2WO3A 4WVMA 3WINE 3WNXA 1Z7S1 3LDKA 4PIYA 4YLZA 2RS53 1JOBA 2W68A 4BPZA 2JDYA 3C7FA 1RUJ3 2DUOA 2PYTA 4XJ8A 4YW5A 1ZBA3 3ZKYA 5A3TA 3HAGA 2VZ3A 4Q4V1 2QQVA 4QGNA 3B9CA 1RJ7A 3GZEA 2XMLA 4AQSA 4EJRA 2XONA 3C3VA 1UOFA 3FJSA 3OBRA 2WNOA 2VVEA 5KHGA 2VO5A 4P9XA 4AW7A 1Z78A 3LOBA 4I3GA 3DN7A 1ULPA 4Y3OA 1TNFA 4KWKA 4QX7A 5BNPB 4FTSA 4COUA 1POV3 1FXZA 1M4WA 5FZHA 1RHI1 1UU6A 5ABJC 1D0GA 4N53C 2W46A 1W03A 2YXSA 4IEVA 1UY3A 1W2NA 3PVBB 2HWC1 3DYMA 1XNKA 3MIFA 3MV01 1W28A 4QQPA 4QHBA 1SLIA 3BALA 3VBRB 1OQEA 4A4AA 2PTMA 3HVDA 2W08A 4I02A 2GMEA 4OUEA 4AEDA 4YFZA 2BNMA 2X05A 1VBE1 2MEV1 2XLGA 3HBZA 2Y6FA 3B01A 4M3CA 5BNOB 1PO12 2R16A 1S0EA 2WFPA 3DPRB 3P1IA 2K2SA 5GZFA 2JD4A 4AHXA 4NE9A 4W50A 5K4LA 4HFSA 5FBJA 3B02A 3N9MA 3GHNA 4GWJA 4DRVA 5CADA 1O8PA 4YSFA 2ADEA 1CZTA 2XL9A 2HYXA 5J3UA 5J37A 4D8MA 1UPSA 2Y0OA 4IEWA 5C4WB 2MPFA 5D21A 5JSRA 4BH9A 4YM1A 5FZFA 1V70A 1MS3A 2ADDA 1LHNA 1ND2A 5DAWA 4BCUA 4PDWA 4UI9L 2WA3A 5A7PA 2Q1FA 2YG0A 1OUXA 1RUF2 1REFA 2R30A 2VMDA 5LA9A 1R1A3 1QJY2 2YBPA 1ND3B 1UIJA 2W1QA 2WZR2 4CCDA 4TZDA 1GQGA 3AL5A 4XF3A 1NZIA 1GQHA 2WUHA 1QJZA 4A7ZA 3LA7A 1BVVA 1X36A 2B42B 3WDVA 1PHMA 3M3CA 2RS12 1AL0G 3AYEA 4HMZA 4OMCA 1VLNA 1WLDA 3U1XA 2JDNA 4FXGB 3TBDA 2AC1A 5JOZA 3NKTA 2V09A 1ASJ3 2WSUA 3R6SA 5FZMA 3PU8A 4Q4X3 2R061 3MHZA 4N43B 5F32A 5FWEA 1H2MA 1FPN1 2Q8EA 4HT1T 2P3KA 4HETA 4Q4Y3 2HWF3 1GZTA 1XQNA 2ZA9A 4AVAA 4UYBA 5FZAA 2FMYA 4KBZA 1AL21 3ITQA 5I8TA 1IS4A 3ACIA 3TNQA 1NX9A 4XUNA 5I91A 4HSLA 4E2GA 1DU3D 4CCNA 3BKZA 2BW8A 3WXPA 3GYDA 4TYSA 4NVPA 4YZ5A 5C9AB 4Y1YA 5A3NA 4I09A 1J83A 4ZKTB 1W6QA 2PHUA 1I3HA 5FYSA 1GSLA 1BKZA 1JS9A 3M3IA 2RR12 4XF9A 1F5JA 2OKXA 3NRUA 3KS7A 2JG8C 1JOPA 1TZOA 4H7LA 1PK6A 4LKSA 4Q27A 3GXUA 1WLWA 1X8EA 3POYA 4N7UA 5HXMA 1W6PA 2ZMLA 1H4GA 1H2KA 1MS0A 1OH4A 3OTFA 4WM7C 5FY5A 2FZ1A 1WD4A 4KQ7A 3PUSA 2XHKA 2GC2A 1MZFA 4M0NA 3W20A 5HCHA 3AYAA 5CG9A 4CA9A 4BA6A 4OMDA 2O0OA 2QQKA 1RUI1 4QMAA 3FBYA 3OGRA 4CP0A 1OHFA 1H8TC 4AGGA 5FUPA 4DEQA 5BXXA 1OLME 1H1AA 5EWSA 1K45A 3POBA 4NAMA 1B09A 2A1XA 1QIQA 2BVBA 3ACHA 5T3NA 2JDZA 1OD5A 4U2AA 3ZYBA 4R4XA 2QFEA 5T5LA 3UGHA 3LDBA 1N47A 5CKMA 4UW3A 3SCGA 4EYUA 2H0BA 5AFEA 1IZ3A 1AJOA 1RINA 1F5FA 3BVCA 3M70A 5DAVA 1NXMA 4J1WA 3A21A 1CD3G 4XZPA 2NMOA 3AP9A 1X9PA 1CGPA 2WL1A 3GNEA 1PIV1 3KMHA 2XH6A 3KB5A 1R093 3NNGA 3PUQA 3MF6A 3Q8AA 4GULA 4L0PA 4RL7A 3ZYGA 1MQTA 3ALQA 3O1OA 3PLQA 3W59A 5ACA2 4WVMB 4HLTA 2IXJA 4Q1PA 2VOXA 2DU0A 2D6LX 3HT2A 1IGOA 1XSRA 1ENQA 1NCQC 1GU3A 2Q0AA 1DGWA 2RJLA 4KNCA 2WZPP 1HXS1 1YEWA 4BJ0A 1IKQA 3WG2A 4AEJA 4DOUA 2UYAA 4RD7A 1MVQA 5FP8A 1UYPA 1S4CA 5AFBA 4C1XA 4XFGA 3ZFEC 3I3EA 3U4XA 4XUQA 1O8SA 5F3EA 5JIUA 1W8TA 2ATFA 3BGAA 3OEBA 1OLRA 2ZGKA 1AX1A 2K0GA 1UZ0A 4IEXA 4GMP0 1ENSA 1JI6A 2EXKA 3WDYA 2R071 3VBFA 1TNRA 1AF9A 2VZUA 3ON7A 3I59A 4UW4A 2Y8KA 3SMHA 2VL4A 5DXDA 4CU7A 5DMYA 1W2AX 2UWBA 2WO2A 4FPFA 4QPYA 3JB8A 4AEDB 4GH4C 5DUWA 3UESA 4IEOA 1SDWA 1LKNA 4K20A 3SCHA 1QEXA 1MACA 1UOBA 1PMHX 2D3SA 4RYDA 5KXCA 1PO13 2Z69A 4W8JA 2JG9A 2LS6A 5CFCB 1RUNA 4DQAA 1ZZBA 1REEA 2BWCA 1W9TA 3CKHA 4B7EA 2A71A 2RJ2A 4PIXA 1IS5A 1CN1A 4UF0B 1VB4A 3N9OA 4Y4YA 3FHQA 5DDJ2 5FYBA 2ZGRA 2XR4A 2VW1A 4DXSA 3FUQA 4CUBA 3O0VA 4XDOA 1F35A 5HXVA 3J7HA 5GM0A 2XKOA 1XNAA 2XLAA 1RUF3 2WSVA 2WJSA 2R7EB 1K12A 3WHUA 1QJY3 3I97A 4L97A 5F5CA 1O3SA 1D4M1 2GH8A 4HZFA 1XNCA 3ZDSA 3GZAA 3PURA 2VM9A 1TMF1 4LBOA 5IVCA 1CQ9A 1C5HA 1W2TA 5FZ3A 3D6EA 4RQPA 5IUQA 1RMU1 3W21A 2E26A 2RS13 4QQOA 1U5IA 3DCQA 1RXGA 3H7YA 5JSOA 1HB1A 1AJKA 4FFHA 4CEYB 1OFNA 2ZKLA 2ZPXA 3AFKA 3PVNA 4K6BA 4LBQD 3WQ1A 2Q8OA 3TN93 2EAKA 4YW6A 3UKTA 3N7JA 3KV9A 3MIGA 1OKOA 3FC0A 1EP0A 1CZVA 2E7AA 1RVF3 1ZZ6A 2NZ9A 4G9SB 2WWSA 1FMD2 4Q0QA 2VPVA 4YVSC 3IAPA 5DQ0A 3NWKA 3S30A 3LCPA 1WKYA 3DGTA 1EYBA 1GOFA 4ASLA 2CWMA 2ZBJA 4B4PA 4AGVA 4CU6A 1W6QB 1XU1A 4AVBA 4OHWA 1A3KA 1ULFA 3IKWA 1ZZ7A 1HX6A 2GN3A 5IVBA 4GKYA 3MFAA 3RDIA 1AXZA 1RUH1 4PLOA 3WX5A 4E2QA 5CISA 1UZZA 2RR13 5J96B 1FNZA 1PK6B 3FLRA 1KGYA 1NCRB 4LR4A 2DVBA 2OZJA 4GAZA 3O1UA 1WW7A 2GMPA 1S0JA 2J1RA 1BJQA 1E5IA 2D98A 3FFQA 5FJHA 4UAPA 1MR5A 3OYWB 1RC6A 1ENRA 2PQQA 2Y6GA 4QX1A 4E4ZA 4Z92B 2VOVA 1X8MA 3H3UA 3I3QA 4OLLA 3FN9A 4LUKA 4XABA 5IK7A 4IGPA 3TB0A 2YPJA 1UKGA 3ABZA 3GF6A 3FUOA 4CEWA 2H6CA 1D0HA 4ASKA 3AJYA 1SHWB 2JB8A 4MHRA 4OYUA 5I0UA 3VBOB 4AVTA 4B8EA 3MZHA 3ZDVA 1CVNA 3SC7X 4COYA 2HWD3 4CDXA 2PMWB 3VHOA 3HR9A 4E4SA 4R9CA 5JIAA 4COZA 2JDKA 5K8SA 4NPLA 1W99A 5FXVA 3IB3A 1SG3A 1XPWA 2XQRA 4TLFA 2L9LA 5BUVA 3ZXGA 2W1WA 1MQTB 3B69A 4XEZA 5JMCA 4ASMB 2ES3A 4MGYE 3CEWA 1DBNA 2DVDA 5ACA3 3RJRA 1WUVA 5LRSA 5JWPA 1V6OA 3AZXA 1YO8A 2DUPA 2JICA 1HB4A 1V0AA 3BOPA 2NP0A 2BTVC 3BTXA 4P9YA 1PGW2 4OUMA 1QOTA 4KMQA 4EZ4A 1R64A 1RUC1 3AZZA 4MX3A 3PUAA 2WNVC 3CJIA 1MZEA 1VRH2 2HLEA 2WWJA 1L7RA 1VBC1 2ORZA 5C71A 4COWA 1KS5A 4MGQA 4OI4A 4R4ZA 2FCUA 2QJVA 1O4ZA 2W92A 4JGZB 4W4ZA 4NWVA 2ZHKA 3W9AA 4D6QA 3VZJA 4FXKB 4XPVA 2EALA 3O12A 5A80A 1YQ2A 4PF1A 3POSA 4PBPA 3ZKUA 2DCTA 2OPKA 3IDAA 4GXLA 4MYEA 1LECA 3ZR6A 4CZSA 3EB7A 2EIBA 5F5QA 2VMIA 4YW2A 3VD3A 1L7QA 2HEWF 3A4UA 4RGAA 1VJ2A 2VZVA 1UD1A 2JX9A 4YYOA 5HCFA 3ZSJA 3PTYA 4YZ3A 5I8YA 3FFZA 3N35A 4CPBA 4YM3A 3WUCA 3WF1A 3NAPA 3KWVA 1W6MB 3ELNA 4QPGC 5FPUA 2A6YA 2WLQA 4FAHA 2TNFA 4MGSA 1XYPA 5D1IA 3USSA 4ZU7A 5EZWA 3GJAA 4XJWA 4LA3A 2YY1A 4NPMA 5FZ0A 1W0OA 1CAXB 1QXRA 2WNUB 1S2EA 3WDWA 1TME2 3IT8A 1J58A 3VBHC 2A5ZA 1PGSA 4IEYA 5DDJ3 1JHNA 1W3XA 5JZGA 1KS4A 5IWFA 4E8DA 4C8DA 1NT0A 4QDSA 3BIEA 4IEPA 4XFCA 2ZGLA 2VW2A 1MZ5A 1B35A 4JRAA 4LBLA 3WW1A 2A6VA 4OHVA 4W6XA 5LEJA 5AC91 1JZ5A 3OGSA 2YZ4A 4MGIE 1D4VB 3OY8A 4B29A 4CDWB 2VC9A 2RDSA 4FFIA 2GH2A 3WNOA 1F31A 4IV1C 3RYRA 3LSEA 2RV9A 5KBFA 2UURA 4EN9B 1G9DA 2JDMA 4IW3A 2JENA 1N1SA 1OVPA 3WZ1A 4D7YA 2A6ZA 2VCCA 2Q1MA 5FO9B 1SFPA 1YI9A 5DUVA 2W39A 1CX4A 1OT5A 3QLQA 5KC6A 4M0HA 1AYN1 2DWRA 5DUXA 3ZSLA 3ZXKA 5L7OC 1N3PA 2FDJA 4IDZA 4Y20A 2E51A 3C2UA 5T5PA 3UL2A 3AZYA 3V0AB 1AHSA 1EAH2 4J1XA 1DQ2A 3HWJA 3KT7A 4MGKE 1GP4A 2FDIA 2R042 3HQUA 2ZXQA 3HD8B 1REDA 4UW5A 4TTGA 4EWAA 3HT1A 4AI8A 1R1ZA 1UZWA 4MGZE 1C8NA 1W6OA 2YV8A 4FPEA 2A3YA 3FE5A 2GSYA 2W1SA 3EXUA 2JDHA 1UY1A 2XBO2 3KM5A 4QB1A 1SZBA 1YQCA 4JGYB 5J09A 3DUIA 3L2YA 4Q0PA 5LA0A 3RSJA 1ZRCA 5HV0A 1GUIA 3K77A 2GDFA 2GALA 1XE0A 4SLIA 3KCYA 5FMOL 3T0AA 1NYWA 2WN3A 4Y4RA 1Q5OA 3JD71 4Z2AA 1GZWB 4XJZA 4DUVA 1Q56A 4CDUC 4FPHA 4AFBA 3ZFGB 5CFDB 4TWTA 2QBXA 4A6SA 3MF9A 3RZMA 2BGCA 2XVLA 1IOAA 3A0NA 4YG3A 4DIQA 4LHKA 1S0BA 1LOFC 1YFXA 1W9SA 2PAEA 2IZWA 3ETPA 2DURA 1UIKA 4K40A 4XF1A 3TEXA 3WF0A 1ZBA2 4NMIA 1PVC2 4HANA 3VKLA 1ZREA 2PELA 4PQ9A 3THTA 2SLIA 2ZGNA 1KJRA 3K2OA 4LBKA 2IFWA 4NHKA 4QM9A 4JKKA 3DYOA 1DLLA 5ABJA 4Q4W1 4WZCA 4N53A 1BVP1 1DQ0A 5A3WA 4AZZA 1H8VA 1O3TA 2OX0A 3KV5A 1YHFA 2GC3A 2VBDA 1DGRA 1PO23 3ZO0B 4AF9A 4AFCA 1LHWA 4QPIB 1DDLA 1XYOA 2FHRA 3AFGA 1WA6X 2YHJA 4R9AA 4AQ2A 4UFMA 2GNDA 4XZUG 5A1LA 1BBT2 4LO7A 5GLWA 3ZPYA 4GZ9A 1HRI1 2XOMA 1GR3A 2VZSA 3TYJA 5C33A 3I3BA 3VLBB 4CCOA 5EYXA 3W5NA 5F9TA 1ST8A 3OJBA 1AX0A 5IVVA 4CDQC 1YUDA 4XMAA 4K9SA 2PHDA 1NA1C 2FCTA 1SACA 3HQRA 4CE8A 2BOJA 2R0FA 2VZRA 1HRV2 3GHMA 1X9TA 1BEV2 3SLIA 3AX4A 1WD3A 3CU7A 1RUI2 1H1IA 3C7EA 3ZN6A 5FP4A 1UNBA 2VW0A 3V64A 1Y9MA 4NHLA 4HOOA 3UETA 2UWAA 1GV9A 2QQPA 1OKQA 5K0UB 1K5MB 1VRH3 2J1UA 1H2LA 3PHMA 3ZN5A 2GU9A 4YWAA 2PHFA 4Q26A 1CAVB 1WW4A 2P17A 1RJ8A 3POIA 2V5YA 5T55A 1X82A 3VBUC 1Y3TA 5FZOB 3HOBA 4CCJA 2BUKA 2WIIB 5FP9A 5I8SA 1S0GA 3E97A 1RUE1 1FV3A 3PU3A 3HNMA 2CHHA 4FPYA 3VDDB 4JQRA 3WNKA 3ZYIB 3K4ZA 5C8WA 1ENXA 4NUBA 1UYYA 1ZX5A 4LBQB 3ZXEA 2HWB2 3UJOA 4AOCA 2H6BA 3POFA 1Z7S3 4S2HA 2UU8A 3NAPB 1HN1A 1S0FA 4JTNA 5BYNA 2W3JA 3EBRA 2IVJA 2Y33A 3ZFFA 4L9BA 3WG3A 1PMIA 1OOPC 1WGPA 2XWJB 5D8AC 4WM8B 3S5QA 1UL9A 1LB2A 4DO0A 4W6YA 1VR3A 1OI6A 1NE6A 2J1TA 3N7LA 2NYYA 5FZ9A 4ZZ5A 5E1RA 5IVEA 2EIDA 2OW4A 1TME3 1WCKA 1W8UA 3CLPA 5DG1A 5IYYA 5JZGB 1JYIA 3OPZA 3B3QE 5FMOS 3E5QA 1U5ZA 1NXD1 1SBEA 1OA4A 1OLMA 3VZMA 4BMEA 4K1YA 1B35B 1J3PA 4ARYA 3DKQA 1VBD1 3IMNA 4FPGA 4LHLA 1N1TA 2C9KA 2JE7A 2JG8A 1W8ZA 4ZZ8A 5FZ6A 1QJX1 1AR71 4ORFA 4QX5A 1KITA 1YNAA 3AB0A 3T2OA 3C7HA 4NHYA 4JX0A 1PGL1 2QKDA 5FY9A 5BNNB 1VBE3 1UZYA 2MEV3 4WM7A 3K4AA 1MS8A 1FI2A 1Q8QA 2F4LA 3MIBA 2QNKA 2EF6A 5FRAA 3RMYA 2A75A 1GP5A 1Y9QA 2P37A 4H55A 4F83A 3O1PA 2NN8A 1V9U2 2RHPA 4CP9B 1U12A 3I2JA 4LK7A 3ZLIA 1XNTA 4L8QA 5GZGA 2QZ3A 3LFMA 1Q43A 1UX7A 2XLFA 3I2OA 1H8TA 2PLV2 1SFYA 3AP4A 5F8PA 1EAH3 4BIOA 4GWNA 4BE3A 1LJ7A 4I0AA 3M3EA 2RDQA 4RHV2 1XRUA 2D5FA 2ZGPA 4DXRA 2Z4FA 3ZN4A 4D7SA 5F2SA 5GLUA 2HWE1 1FATA 5H9RA 2LRPA 5ANNA 3GZTB 1FNYA 2X5IB 1VPHA 2ZOEB 1D4M2 1VBB2 4Q29A 4RR3A 5K9YA 1I5PA 4IV3A 2XBO3 1DG6A 2ZGTA 1R081 3NW4A 3LEIA 5EP9A 3J7NA 4OULA 4YVWB 3VKOA 1L7LA 5A6ZA 1S2BA 2QTWB 4IEQA 3IMMA 2SBAA 2CAVA 2VUCA 4M4PA 5F37A 2OVUA 4YFWA 4M4RA 4L2NA 5K7PA 4D6SA 1FAYA 1CAWA 1NCQA 2BZDA 3MDPA 1UY2A 4FVVA 4CVUA 1DGRN 4Y26A 5FK8A 5T5JA 1V6MA 2WQ4A 4PI0A 5BNPC 2XJUA 2YPDA 2JDUA 3FLPA 3K3OA 4C90A 2J42A 3ZFEA 1PVC3 4DUWA 4DMIA 1WZXA 1VAKA 5EJ1B 1JYVA 4FFGA 5E89A 2ZZJA 3R4UA 4P5HA 5C8CB 1YRZA 1W6NB 2ZTNA 3J8F1 3FHAA 3K4DA 4Q8LA 3WF2A 1W39A 1UN1A 3AMQA 2B45X 3ETQA 4XW3A 4GH4A 5FZEA 1JZ7A 2WN2A 2IXKA 4UFHA 3VHNA 1GFF2 1WBLA 4XURA 3RZJA 3B5LB 3KSCA 2CGOA 2ZACA 4AI0A 5I0SA 1BBT3 4A42A 1ZNPA 2Q8CA 1SEFA 1W9WA 5FYCA 4AFDA 1BCXA 3Q9OA 1I6XA 1OQDA 1RIRA 3I49A 1W0PA 3ZIXA 1JYXA 3SXWA 1AYM1 1HRV3 2XKPA 1BEV3 2FDHA 1W90A 4XJUA 4LULA 5A7NA 3ZN6B 1WLCA 3H9AA 5HCAA 3E6CC 1RUI3 3VBSB 3NMBA 1NE4A 2G9ZA 1OUSA 3RZZA 5BY5A 2BDRA 1DLCA 2EIEA 3LOIA 1WMDA 1AVBA 1KEXA 2VQ0A 4N9HA 4V2WA 5LK7B 2VU9A 1JYCA 4E4HA 1QDOA 1W8NA 5H9PA 1RB8G 2CGPA 1FV2A 5F5AA 5HCBA 4G3YC 5JXIA 1KD7A 4QDRA 3WNPA 3VBRC 3O0WA 4AGRA 1SLLA 4LKFA 3IDEA 4RGGA 5BNOC 2O14A 1YCIA 2J7MA 3DPRC 5FQ0A 4HL0A 5EJ3A 5IK8A 2V5DA 2QE3A 4KU8A 3AYCA 4QXKA 2WDBA 3OOXA 2HWB3 3NJYA 4CU9A 2V73A 5LCWL 3RI8A 3D82A 1OVSA 2YFUA 2WFF1 3CDZB 3HMYA 3ZFFB 4RA0A 5JVVA 2ZEYA 3AMNA 1SPPA 2WRAA 5C4WC 1H30A 1BK0A 1AR82 3TN92 3PJQA 3LPGA 1WA4A 2XPJA 1UX6A 1N3QA 3JXSA 4LA2A 4YVSA 3WOGA 5C3RA 3VV1A 1C4RA 1C8M2 1RVF2 3AKPA 3ZYRA 5DG2A 4J6GA 2A6XA 4LE3A 2FZ2A 1OC1A 1P8JA 3RZLA 4PI2A 5FUIA 1CJDA 4AE2A 3IIAA 1ND3C 2VQAA 1SFNA 2R073 3BCWA 3IPVA 4IESA 2AZ5A 3ZVXA 1JBCA 3JB4C 2JD9A 2JDAA 5C3OA 5LY1A 1J3QA 4QGMA 3N7MA 1HV1A 4KGGA 4XFBA 2AEZA 3BU0A 2RS51 1J84A 1I5ZA 3IDCB 3IWZA 2WNEA 1MEC2 4AI9A 1BMV1 5IFTA 2UY9A 1RUJ1 2P1BA 2Y64A 1WWYA 3KGLA 4J25A 2YB7A 4ZPIA 2VR4A 4N43C 5KXDA 3KZ4C 4JHZA 3WF4A 2LUWA 3I4IA 1XXNA 2DYCA 1F2NA 1PNGA 1V9U3 1YLLA 1SCSA 2NPIA 1QHDA 3MO4A 4YW1A 5C3SA 1W9YA 3PNAA 4NRPA 2ZEWA 1AX2A 5HBAA 1POV1 2PLV3 2F6BA 2RG4A 3RRDA 1QH7A 2RS32 3I2GA 5FREA 5C9AC 2Z79A 1GMMA 1TEIA 5L9BA 1NQDA 4NIIA 4RHV3 5H9SA 4AR2A 2WZEA 4EN8B 4NR1A 4ZY9A 1QXPA 2HWD2 5T52A 2RDNA 4RR3B 1W9FA 4IV3B 1D4M3 1VBB3 1YI7A 4E2SA 5F7UA 3LD8A 4Z07A 1QOOA 4M01A 3FLTA 3SHRA 3SKVA 2WS91 3QH6A 1RUD2 4YW7A 1KDMA 3GJBA 3MIDA 2HH9A 4QHOA 4XBNA 3T1MA 5IFPA 4HPKA 4IE4A 3VL8A 4HKLA 2E32A 3H8OA 1RTVA 1V6IA 5F1RA 2P2KA 3OF1A 1W0NA 4DXZA 4PIZA 5JDBA 4LKEA 1VALA 4XF0A 2CV6A 3EO6A 3E5XA 2VOWA 2XG3A 4JDNA 4ITCA 1OURA 4NIAA 1X33A 2CAUA 2YU1A 2V72A 3UKNA 5CKNA 3NV1A 4URTA 3QOPA 4QDQA 5EHDA 3PIGA 3ZYFA 1R1A1 1UYZA 1XE8A 4V2VA 2IUWA 1GP6A 3M8LA 2WYSA 3JBG2 4Q2FA 2W87A 5A7OA 4OHZA 2OQ6A 4U36A 1VBA2 5KWRA 4V1PA 4D3WA 4CYDA 1RUH3 2E7TA 1DYPA 1ODNA 1HQLA 1NLQA 1MS5A 3OUJA 1NKGA 5J98B 3JD72 4IUGA 3ASIA 3KVBA 3AC0A 3AKSA 1ASJ1 3P5BA 2XUEA 4QPGA 3S0MA 4M3CB 5LWBA 4AK3A 1BK1A 2OQ7A 5E8AA 4GMP3 4Q4Y1 3ZXFA 2E6VA 1H1MA 2HWF1 3NV2A 4GB32 4Y24A 5T5OA 3RGBA 4A2UA 3LIHA 4IQPA 2D97A 3KF5A 4QB6A 4KI5M 5FUNA 5FYYA 3VBHA 5A70A 1JYWA 3MYXA 3SEPA 4MV2A 3UYJA 1RYYA 2XVKA 2EVXA 4S2GA 1GOGA 4AG4A 5IATA 4OHYA 4QKDA 1JU4A 4S2DA 2VUDA 4ZXKA 1NY71 3NNFA 4YZ1A 1ND2B 3S6PA 4BK5A 4PDWB 1Y9GA 3CNAA 1J1LA 1UY0A 4I01A 3ZXAC 2LW8A 1IPKA 5FZ7A 4FT8A 3MIHA 1V00A 1GLHA 1T6GC
chains in the Genus database with same CATH topology
2W94A 1MPXA 1H6YA 2WO1A 4GWIA 3K75B 5DN2A 4E8DA 3VDAA 4QDSA 3C7GA 1PMJX 1UWWA 2RVAA 3I2KA 4KWUA 2X09A 1JZ5A 3OGSA 4ZXEA 3T2QA 2VC9A 2YFZA 5C70A 2BBAA 1EUUA 1NAEA 3I2HA 3WNOA 2RV9A 5G05L 3I2FA 3W5MA 2B9VA 2VCCA 2VMFA 3C7OA 2J1AA 1JZ4A 2E31A 2QQNA 1CX1A 4CU6A 1OT5A 2W95A 4PT6A 3HNBM 4PQQA 3OEAA 2Y6JA 4JKLA 1UMIA 2ZXQA 4TTGA 4XUTA 2QQMA 1JHJA 3CZJA 4FI9A 1DYOA 2VQTA 3IAQA 2W1SA 4QB1A 1UY1A 4MOAA 2QQLA 2Y6KA 4P02B 2J1VA 2W47A 5LA0A 5B4NA 1GUIA 2BERA 1DP0A 3E1F1 3K77A 3VDCA 3OBAA 3T0AA 2WN3A 4Z2AA 2PQSA 5HPOA 3THDA 4DUVA 1OF4A 4ET7A 2QBXA 4QB2A 1F4AA 4MADA 2ORXA 3HN3A 1W9SA 3ETPA 3WF0A 1GQPA 4DEVA 3VD7A 2WO3A 4JKKA 3DYOA 2QQOA 4BXSV 2VCBA 1UMHA 3C7FA 3DYPA 2VZ3A 2XONA 4JKMA 1UYXA 2VO5A 4XZUG 3SKJE 2XQXA 4GZ9A 2XOMA 4OZOA 2VZSA 4CUAA 1ULPA 3I3BA 3W5NA 1T2XA 2BGPA 2WQ8A 3WEZA 2W46A 4QPWA 1UY3A 2VZRA 4CUCA 3DYMA 2YC4A 3MV01 3PUHA 3P6BA 5C7GA 3C7EA 4A4AA 3CQOA 4OUEA 5CZKA 5JXGA 3UETA 2X05A 3P1IA 2J1UA 3A23A 4W50A 3MBWA 1K42A 4GWJA 3HOBA 1O8PA 1UY4A 1CZTA 2VTFA 2HYXA 4D8MA 2VJXA 3HNMA 3WNKA 3NJXA 3K4ZA 3LEGA 1UYYA 1CIYA 3MUY1 4UI9L 2YG0A 1HN1A 2VMDA 2W3JA 3DECA 3I3DA 2W1QA 2ID4A 3FL7A 3OB8A 2WUHA 5JXHA 2WABA 2J1TA 4ZZ5A 4XVHA 2CDPA 1TG7A 2EIDA 4OMCA 5IYYA 2WAOA 3LEKA 4A44A 1PX3A 3F2ZA 2KD7A 3ECQA 4A41A 4ARYA 1GOHA 4ZZ8A 4DUXA 2C9KA 3T2OA 3C7HA 1OD3A 4JX0A 3ACIA 3CIHA 1NX9A 4XUNA 2VOTA 3K4AA 1K3IA 1OF3A 1J83A 1XC6A 3I2JA 1XNTA 2VQUA 1UXZA 2OKXA 1UX7A 3NRUA 2C26A 3ACGA 2YC2A 4LKSA 3GXUA 5HXMA 2QQJA 2W9XA 3VD4A 1OH4A 4DXRA 5JR2A 3WSOA 2Z4FA 1BHGA 2VZQA 4HG6B 3T08A 1I5PA 5JMOA 3LEIA 4OMDA 2QQKA 3CZUA 3ACFA 3OGRA 4E8CA 3T0DA 4DEQA 5G04L 4M4PA 1K45A 4M4RA 5DPNA 2ZEZA 3ACHA 1US2A 2BZDA 2V4VA 4CVUA 1UY2A 5EJZB 4BK4A 3A21A 3HNYM 5EIYB 2VZPA 1JYNA 3NNGA 4L0PA 1D7PM 2QQIA 3U37A 4DUWA 1JZ3A 2BGOA 4P00B 5EJ1B 1JYVA 3OG2A 4CU8A 3K4DA 3FHAA 1IQDC 3ZM8A 1O59A 1GU3A 3WF2A 3A22A 5LA2A 3GM8A 4BJ0A 1JZ7A 2WN2A 1JZ2A 3SEEA 3GGLA 4XURA 3K46A 2JKXA 2VZTA 2W91A 3I3EA 4XUQA 1O8SA 4A42A 3EYPA 3OEBA 3BGAA 4A45A 1UZ0A 1W9WA 4XUOA 1JI6A 5IHRA 2VZUA 3WNLA 2Y8KA 5I0DA 1PX4A 1JYXA 2J1EA 2VL4A 3UNPA 4CU7A 5DMYA 2WO2A 4AAXA 2W5FA 3UESA 3PUIA 3LQCA 1DLCA 1PMHX 2EIEA 2Y6HA 1KEXA 4RYDA 4W8JA 4RN5A 2DCJA 3NJVA 2LS6A 1W8NA 4QX2A 3VD5A 1WCQA 4QX0A 1W8OA 5JXIA 1W9TA 3CKHA 3THCA 4QDRA 2RJ2A 3WNPA 4DXTA 3HEIA 4YPJA 3FHQA 2J7MA 4DXSA 2V5DA 4CUBA 2WDBA 3I2IA 3J7HA 4CU9A 3LPFA 5LCWL 1XNAA 1NUKA 2DDUA 2YFUA 3CDZB 2R7EB 1K12A 2VCAA 2ZEYA 2B4KA 3I97A 1H6XA 1CZSA 1JU3A 2E33A 2VM9A 3LPGA 3JXSA 1US3A 5IJRA 2E26A 1P8JA 5FUIA 2JD9A 2JDAA 5J1XA 4MO3M 3OGVA 2VMEA 1CZVA 3WNMA 4LQRA 3WF3A 1J84A 3IAPA 5DQ0A 1UXXX 5IFTA 3VDBA 1WKYA 2Y64A 1GOFA 2YB7A 2VR4A 2CDOA 4JHZA 5B4XA 3WF4A 4TXWA 2WZ8A 3MO4A 3VD9A 1ULOA 4P08A 2J22A 2ZEWA 1KGYA 3I2GA 2J1RA 1GMMA 4UAPA 2C4XA 2XHNA 2WZEA 2Y6GA 4QX1A 4ZY9A 5A1AA 2X10A 3FN9A 3WNNA 4P5YA 4LPLA 5F7UA 3ABZA 3T09A 3SKVA 1LNSA 3LE0A 1SHWB 4OYUA 5IFPA 2Y6LA 1JZ6A 1TVGA 2E32A 3C8XA 3WQBA 1GNYA 5LA1A 4QAWA 1W0NA 4QX3A 1JZ8A 5JUVA 3IIIA 5CYYA 1W99A 2V72A 3IB3A 3MUZ1 1SG3A 1XPWA 2L9LA 2W1WA 3GDBA 4QDQA 3HPNA 1UYZA 3D3AA 3CMGA 2ZEXA 2WAAA 4A3ZA 2W1UA 3NQHA 2WYSA 2W87A 4XUPA 4KMQA 1R64A 1NKGA 4IUGA 2HLEA 1L7RA 3AC0A 2ORZA 5C71A 4MGQA 2W92A 4W4ZA 2EICA 4LHSA 3A7QA 4ARXA 1YQ2A 4PF1A 3T0BA 2VZ1A 2JE8A 3IDAA 1EUTA 3EB7A 2EIBA 4A6OA 4QB6A 3VD3A 1L7QA 4KI5M 3T2PA 3MV11 1JYWA 4D0QA 2VZVA 3SEPA 4UOJA 2VMCA 1RYYA 4AG4A 1GOGA 1JU4A 2DCKA 1F4HA 3WF1A 2WBKA 3BN6A 1SDDB 4MGSA 4BK5A 5JXJA 1UY0A 2J1SA 2LW8A 2VZOA 4BDVB 3HJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W94 A;  1MPX A;  1H6Y A;  2WO1 A;  4GWI A;  3K75 B;  5DN2 A;  4E8D A;  3VDA A;  4QDS A;  3C7G A;  1PMJ X;  1UWW A;  2RVA A;  3I2K A;  4KWU A;  2X09 A;  1JZ5 A;  3OGS A;  4ZXE A;  3T2Q A;  2VC9 A;  2YFZ A;  5C70 A;  2BBA A;  1EUU A;  1NAE A;  3I2H A;  3WNO A;  2RV9 A;  5G05 L;  3I2F A;  3W5M A;  2B9V A;  2VCC A;  2VMF A;  3C7O A;  2J1A A;  1JZ4 A;  2E31 A;  2QQN A;  1CX1 A;  4CU6 A;  1OT5 A;  2W95 A;  4PT6 A;  3HNB M;  4PQQ A;  3OEA A;  2Y6J A;  4JKL A;  1UMI A;  2ZXQ A;  4TTG A;  4XUT A;  2QQM A;  1JHJ A;  3CZJ A;  4FI9 A;  1DYO A;  2VQT A;  3IAQ A;  2W1S A;  4QB1 A;  1UY1 A;  4MOA A;  2QQL A;  2Y6K A;  4P02 B;  2J1V A;  2W47 A;  5LA0 A;  5B4N A;  1GUI A;  2BER A;  1DP0 A;  3E1F 1;  3K77 A;  3VDC A;  3OBA A;  3T0A A;  2WN3 A;  4Z2A A;  2PQS A;  5HPO A;  3THD A;  4DUV A;  1OF4 A;  4ET7 A;  2QBX A;  4QB2 A;  1F4A A;  4MAD A;  2ORX A;  3HN3 A;  1W9S A;  3ETP A;  3WF0 A;  1GQP A;  4DEV A;  3VD7 A;  2WO3 A;  4JKK A;  3DYO A;  2QQO A;  4BXS V;  2VCB A;  1UMH A;  3C7F A;  3DYP A;  2VZ3 A;  2XON A;  4JKM A;  1UYX A;  2VO5 A;  4XZU G;  3SKJ E;  2XQX A;  4GZ9 A;  2XOM A;  4OZO A;  2VZS A;  4CUA A;  1ULP A;  3I3B A;  3W5N A;  1T2X A;  2BGP A;  2WQ8 A;  3WEZ A;  2W46 A;  4QPW A;  1UY3 A;  2VZR A;  4CUC A;  3DYM A;  2YC4 A;  3MV0 1;  3PUH A;  3P6B A;  5C7G A;  3C7E A;  4A4A A;  3CQO A;  4OUE A;  5CZK A;  5JXG A;  3UET A;  2X05 A;  3P1I A;  2J1U A;  3A23 A;  4W50 A;  3MBW A;  1K42 A;  4GWJ A;  3HOB A;  1O8P A;  1UY4 A;  1CZT A;  2VTF A;  2HYX A;  4D8M A;  2VJX A;  3HNM A;  3WNK A;  3NJX A;  3K4Z A;  3LEG A;  1UYY A;  1CIY A;  3MUY 1;  4UI9 L;  2YG0 A;  1HN1 A;  2VMD A;  2W3J A;  3DEC A;  3I3D A;  2W1Q A;  2ID4 A;  3FL7 A;  3OB8 A;  2WUH A;  5JXH A;  2WAB A;  2J1T A;  4ZZ5 A;  4XVH A;  2CDP A;  1TG7 A;  2EID A;  4OMC A;  5IYY A;  2WAO A;  3LEK A;  4A44 A;  1PX3 A;  3F2Z A;  2KD7 A;  3ECQ A;  4A41 A;  4ARY A;  1GOH A;  4ZZ8 A;  4DUX A;  2C9K A;  3T2O A;  3C7H A;  1OD3 A;  4JX0 A;  3ACI A;  3CIH A;  1NX9 A;  4XUN A;  2VOT A;  3K4A A;  1K3I A;  1OF3 A;  1J83 A;  1XC6 A;  3I2J A;  1XNT A;  2VQU A;  1UXZ A;  2OKX A;  1UX7 A;  3NRU A;  2C26 A;  3ACG A;  2YC2 A;  4LKS A;  3GXU A;  5HXM A;  2QQJ A;  2W9X A;  3VD4 A;  1OH4 A;  4DXR A;  5JR2 A;  3WSO A;  2Z4F A;  1BHG A;  2VZQ A;  4HG6 B;  3T08 A;  1I5P A;  5JMO A;  3LEI A;  4OMD A;  2QQK A;  3CZU A;  3ACF A;  3OGR A;  4E8C A;  3T0D A;  4DEQ A;  5G04 L;  4M4P A;  1K45 A;  4M4R A;  5DPN A;  2ZEZ A;  3ACH A;  1US2 A;  2BZD A;  2V4V A;  4CVU A;  1UY2 A;  5EJZ B;  4BK4 A;  3A21 A;  3HNY M;  5EIY B;  2VZP A;  1JYN A;  3NNG A;  4L0P A;  1D7P M;  2QQI A;  3U37 A;  4DUW A;  1JZ3 A;  2BGO A;  4P00 B;  5EJ1 B;  1JYV A;  3OG2 A;  4CU8 A;  3K4D A;  3FHA A;  1IQD C;  3ZM8 A;  1O59 A;  1GU3 A;  3WF2 A;  3A22 A;  5LA2 A;  3GM8 A;  4BJ0 A;  1JZ7 A;  2WN2 A;  1JZ2 A;  3SEE A;  3GGL A;  4XUR A;  3K46 A;  2JKX A;  2VZT A;  2W91 A;  3I3E A;  4XUQ A;  1O8S A;  4A42 A;  3EYP A;  3OEB A;  3BGA A;  4A45 A;  1UZ0 A;  1W9W A;  4XUO A;  1JI6 A;  5IHR A;  2VZU A;  3WNL A;  2Y8K A;  5I0D A;  1PX4 A;  1JYX A;  2J1E A;  2VL4 A;  3UNP A;  4CU7 A;  5DMY A;  2WO2 A;  4AAX A;  2W5F A;  3UES A;  3PUI A;  3LQC A;  1DLC A;  1PMH X;  2EIE A;  2Y6H A;  1KEX A;  4RYD A;  4W8J A;  4RN5 A;  2DCJ A;  3NJV A;  2LS6 A;  1W8N A;  4QX2 A;  3VD5 A;  1WCQ A;  4QX0 A;  1W8O A;  5JXI A;  1W9T A;  3CKH A;  3THC A;  4QDR A;  2RJ2 A;  3WNP A;  4DXT A;  3HEI A;  4YPJ A;  3FHQ A;  2J7M A;  4DXS A;  2V5D A;  4CUB A;  2WDB A;  3I2I A;  3J7H A;  4CU9 A;  3LPF A;  5LCW L;  1XNA A;  1NUK A;  2DDU A;  2YFU A;  3CDZ B;  2R7E B;  1K12 A;  2VCA A;  2ZEY A;  2B4K A;  3I97 A;  1H6X A;  1CZS A;  1JU3 A;  2E33 A;  2VM9 A;  3LPG A;  3JXS A;  1US3 A;  5IJR A;  2E26 A;  1P8J A;  5FUI A;  2JD9 A;  2JDA A;  5J1X A;  4MO3 M;  3OGV A;  2VME A;  1CZV A;  3WNM A;  4LQR A;  3WF3 A;  1J84 A;  3IAP A;  5DQ0 A;  1UXX X;  5IFT A;  3VDB A;  1WKY A;  2Y64 A;  1GOF A;  2YB7 A;  2VR4 A;  2CDO A;  4JHZ A;  5B4X A;  3WF4 A;  4TXW A;  2WZ8 A;  3MO4 A;  3VD9 A;  1ULO A;  4P08 A;  2J22 A;  2ZEW A;  1KGY A;  3I2G A;  2J1R A;  1GMM A;  4UAP A;  2C4X A;  2XHN A;  2WZE A;  2Y6G A;  4QX1 A;  4ZY9 A;  5A1A A;  2X10 A;  3FN9 A;  3WNN A;  4P5Y A;  4LPL A;  5F7U A;  3ABZ A;  3T09 A;  3SKV A;  1LNS A;  3LE0 A;  1SHW B;  4OYU A;  5IFP A;  2Y6L A;  1JZ6 A;  1TVG A;  2E32 A;  3C8X A;  3WQB A;  1GNY A;  5LA1 A;  4QAW A;  1W0N A;  4QX3 A;  1JZ8 A;  5JUV A;  3III A;  5CYY A;  1W99 A;  2V72 A;  3IB3 A;  3MUZ 1;  1SG3 A;  1XPW A;  2L9L A;  2W1W A;  3GDB A;  4QDQ A;  3HPN A;  1UYZ A;  3D3A A;  3CMG A;  2ZEX A;  2WAA A;  4A3Z A;  2W1U A;  3NQH A;  2WYS A;  2W87 A;  4XUP A;  4KMQ A;  1R64 A;  1NKG A;  4IUG A;  2HLE A;  1L7R A;  3AC0 A;  2ORZ A;  5C71 A;  4MGQ A;  2W92 A;  4W4Z A;  2EIC A;  4LHS A;  3A7Q A;  4ARX A;  1YQ2 A;  4PF1 A;  3T0B A;  2VZ1 A;  2JE8 A;  3IDA A;  1EUT A;  3EB7 A;  2EIB A;  4A6O A;  4QB6 A;  3VD3 A;  1L7Q A;  4KI5 M;  3T2P A;  3MV1 1;  1JYW A;  4D0Q A;  2VZV A;  3SEP A;  4UOJ A;  2VMC A;  1RYY A;  4AG4 A;  1GOG A;  1JU4 A;  2DCK A;  1F4H A;  3WF1 A;  2WBK A;  3BN6 A;  1SDD B;  4MGS A;  4BK5 A;  5JXJ A;  1UY0 A;  2J1S A;  2LW8 A;  2VZO A;  4BDV B;  3HJR A; 
#chains in the Genus database with same CATH topology
 1WMX A;  4AED C;  3APB A;  3VHR A;  4ES8 A;  2D6O X;  4FPJ A;  4IV1 A;  2YC0 A;  4LUM A;  2VY0 A;  4I30 A;  3KGZ A;  5FFO C;  1LOD A;  2W52 A;  3J7M A;  3U0Z A;  4HBN A;  4KU7 A;  1YJK A;  5CFC C;  3C7G A;  3WG1 A;  4OHX A;  1UWW A;  1IPJ A;  2EXI A;  4LT5 A;  1RXF A;  1UQX A;  2UYB A;  3R0R A;  1SMV A;  3MGU A;  5APA A;  4B1M A;  1VMH A;  3I2K A;  5L7O A;  1SPP B;  4JRL A;  4FOW A;  2GC0 A;  4CPB D;  1RUG 2;  4ZXE A;  3T2Q A;  5A6Y A;  2YMZ A;  1IS6 A;  1AR8 3;  4XC9 A;  5SV8 A;  1NAE A;  3NNL A;  1UZV A;  4XQW A;  1YJL A;  3UJQ A;  4HVO A;  3MEP A;  1VBC 3;  1C3H A;  2EA7 A;  1C8M 3;  4XTM A;  2VG9 A;  3JQX A;  4MVT A;  4ISR A;  1W8F A;  1ZVF A;  3AMM A;  1CON A;  2WT2 A;  4MH0 E;  5FYM A;  1JZ4 A;  1VAM A;  2E31 A;  2QQN A;  1R09 1;  2VNR A;  4WVV A;  5SV5 A;  2WYF A;  1S0I A;  4JV4 A;  4XXP A;  3V56 A;  5FPL A;  5GZD A;  4IE0 A;  3UV9 A;  5A3P A;  5JPN B;  4AVS A;  5EYY A;  5CEH A;  3T30 A;  3WW4 A;  4NRM A;  1QQP 1;  4XCB A;  2AYH A;  3OEA A;  4CDU A;  4AI3 A;  3ZIW A;  2O1Q A;  1MEC 3;  4K1Z A;  3WLU A;  1QJF A;  4XUT A;  2V4A A;  1A34 A;  4CEY C;  3NL1 A;  1LGN A;  1COV 1;  4R8H A;  5ERL A;  2DV9 A;  3RWK X;  1DYO A;  4AHZ A;  1W6P B;  1Y4W A;  2CU5 A;  4ZS2 A;  2D7F A;  1DGW X;  5M0T A;  4AQ6 A;  2QQL A;  2YBK A;  1ACC A;  2J1V A;  4EN6 B;  2W47 A;  3RI9 A;  4N90 A;  4HN1 A;  5B4N A;  4BZ4 A;  4FPC A;  4O61 A;  1CJP A;  3O7O A;  4H2A A;  5HPO A;  2GMM A;  1GAN A;  4MET A;  4XTP A;  1G86 A;  1QXJ A;  3J4U H;  2ZX0 A;  2RS3 3;  1OF4 A;  4QB2 A;  1LUL A;  3N9L A;  2VD7 A;  5BNQ A;  1AR9 2;  1ZBE 2;  3MPB A;  2GP3 A;  3WUD A;  2G19 A;  1DQ6 A;  3HN3 A;  2Q5T A;  1KFX L;  2ET1 A;  3CHX A;  2PHT A;  4MXW A;  1PO2 2;  4DEV A;  1PK6 C;  2R49 A;  5I0T A;  4LBJ A;  5A7S A;  1NCR C;  5FLJ A;  3O1M A;  1PO1 1;  1PGL 2;  2DFB A;  3DL3 A;  5GZC A;  5LEK A;  3U14 A;  1GKB A;  3OSD A;  1RUD 3;  5LBC A;  4CDQ A;  5CKQ A;  4BXS V;  4QHZ A;  1NA1 A;  5BPX A;  1VMJ A;  3BIW E;  2XJP A;  5FXW A;  1YFW A;  5DUU A;  1KDK A;  4XFA A;  4YGB A;  1CES A;  1F15 A;  3MLK A;  4CSW A;  1UYX A;  4BQX A;  3MI8 A;  3SKJ E;  5FP7 A;  3VBO C;  3H7J A;  2XQX A;  1U5Y A;  5FKB A;  1G9B A;  3H8U A;  3VBU A;  1QJY 1;  4LKD A;  1DGL A;  1IQA A;  2VUJ A;  4Q0U A;  3NNJ A;  4FSJ A;  2BGP A;  2WZR 1;  2WQ8 A;  2BVV A;  3LZZ A;  4HK8 A;  4O9E A;  3WEZ A;  1OH3 A;  1FOD 2;  1QJU 2;  2MHF A;  3JBG 3;  4CUC A;  4FTE A;  3U07 A;  2YC4 A;  3VBF B;  1R08 2;  3BOD A;  1M06 G;  2RS1 1;  3I59 B;  1LED A;  1HQN A;  1VBA 3;  2BQP A;  1MQT C;  3P6B A;  4IL7 A;  3CQO A;  2OUJ A;  5CZK A;  5FLI A;  5JXG A;  1S55 A;  4XJA A;  3AZW A;  4Q8K A;  1RIT A;  3JD7 3;  4AVV A;  4QPG B;  5AVP A;  2LTN A;  4UFK A;  1GNH A;  2GZW A;  3POG A;  4O9G A;  1UW8 A;  1CWP A;  4LBM A;  1Z7S 2;  1OOP A;  2I74 A;  3AXE A;  4PLM A;  5D8A A;  3GBW A;  1OSG A;  4XIO A;  4NID A;  4GB3 3;  2JG9 B;  2YDE A;  2OA2 A;  2P3I A;  3O5S A;  1LEM A;  2VJX A;  4HK9 A;  4K21 A;  4DZG A;  4LXL A;  3E6D A;  2C9A A;  4Q4V 2;  4LE4 A;  2WKK A;  4LTA A;  5JOX A;  3ZX7 A;  4ATF A;  4FOQ A;  4JGZ C;  1LOA A;  2A3W A;  2OZ6 A;  4UW6 A;  2P6H A;  4Q4W 3;  5GLZ A;  1GIC A;  5IVF A;  4LO6 B;  1I9R A;  2BBV A;  3M2M A;  3OPT A;  4UFJ A;  2RR1 1;  1X7N A;  3DEC A;  3I3D A;  2Q4S A;  1RHI 2;  2ID4 A;  4LO5 B;  4KG0 A;  2HBT A;  2O8O A;  1DZQ A;  2HWC 2;  3RWN A;  4PF5 A;  1G9F A;  3B00 A;  1OA3 A;  2C0Z A;  2RE9 A;  3AP5 A;  3GAL A;  4MXV A;  2WAO A;  3RVH A;  4RQP B;  1VBE 2;  2BEO A;  2MEV 2;  2WT0 A;  3F2Z A;  3N9P A;  4WV8 A;  3VHP A;  2E63 A;  1VB2 A;  5FAX A;  4A3X A;  1JN2 P;  3ECQ A;  4ONU A;  5JOW A;  4A41 A;  3NV4 A;  1GOH A;  4NRQ A;  3PTR B;  1RUO A;  2PXJ A;  3N3H A;  4AQT A;  4EN7 B;  2WNU C;  4FQ4 A;  3KHC A;  1RUG 3;  3R4D B;  4XFI A;  1GWK A;  5GLT A;  3BPS A;  1CR7 A;  3CIH A;  2Z2S B;  3VZO A;  5FO8 B;  1K3I A;  3AM2 A;  3GZU C;  5FR3 A;  1A8D A;  1WLT A;  2Y0I A;  4YRD A;  5CVR A;  4DRR A;  4IND A;  3KLS A;  3CO2 A;  4ISQ A;  3GBG A;  3WW2 A;  1XC6 A;  3S7I A;  4GWM A;  1JUH A;  4XDP A;  5LY2 A;  1GWL A;  1E5S A;  4B4R A;  3KHB A;  1N3O A;  1AR6 3;  2VQU A;  4QXB A;  4JAA A;  4CDW C;  1URX A;  4IEU A;  5T50 A;  4CRQ A;  3OD4 A;  1LTE A;  5ACA 1;  5A7W A;  3MIC A;  4JC1 A;  4LNV A;  5FYH A;  1C57 A;  1MZ6 A;  1O4Y A;  2IVI B;  2QQJ A;  2R1D A;  1ONA A;  1H2N A;  2W9X A;  4RR3 C;  1F8V A;  1HN0 A;  1A78 A;  3N36 A;  1LOE A;  1YQ8 A;  4YZ4 A;  3WSO A;  2P3J A;  2WQZ C;  4QKF A;  1PNF A;  4XDQ A;  2ARA A;  4HG6 B;  5BNP A;  2I45 A;  1WBF A;  1JXN A;  2XVG A;  5JMO A;  2R06 2;  3E6B A;  5LBF A;  2JXA A;  1DCS A;  4LOR A;  3ACF A;  1JYT A;  1FPN 2;  2VXJ A;  4OUS A;  4KH9 A;  2G1M A;  1CPN A;  1JTZ X;  1LU1 A;  3T0D A;  5IVY A;  2ZX2 A;  4HON A;  4CEW B;  1C1L A;  1AL2 2;  5DPN A;  1KFU L;  2ZEZ A;  3IBM A;  4FPO B;  2JWP A;  3P3N A;  1US2 A;  2WC2 A;  1Q3E A;  3H42 B;  5A6Q A;  2V4V A;  1BLZ A;  5EQU A;  2QUO A;  5EJZ B;  4DS0 A;  1AR9 3;  1ZBE 3;  2KXL A;  4HN0 A;  4JGY C;  2IWG B;  3HNY M;  3IDB B;  4CDX B;  1T6B X;  2VZP A;  1JYN A;  2PAK A;  4QKB A;  4Y33 A;  2QQI A;  1XNB A;  1PZ8 A;  4FQZ A;  4LMF A;  5IT6 A;  3BTA A;  1WCD J;  2BGO A;  1O6U A;  2DVG A;  2VNG A;  3ZFG C;  5CFD C;  4Y5Z 0;  3OG2 A;  5FLH A;  4JHT A;  1S0C A;  4CU8 A;  1BZW A;  1IQD C;  3ZM8 A;  4DY5 A;  3ST7 A;  4RGK A;  4XFH A;  3A22 A;  3GM8 A;  5DDJ 1;  4CCE A;  2WA4 A;  3N7K A;  1JZ2 A;  4XAE A;  3ZXL A;  1DHK B;  3GGL A;  4PCR A;  1OPM A;  3K46 A;  2DVF A;  3NNM A;  4RS5 C;  5CB7 A;  4C91 A;  2VZT A;  2OYZ A;  1G9C A;  5GAL A;  2VNV A;  1V6L A;  3CJI B;  4MUV A;  4F7Z A;  4A45 A;  4L99 A;  3VZN A;  3VN4 A;  4QQL A;  3RFR A;  3KD4 A;  3DEM A;  3VBR A;  2QQW A;  4QPI C;  4FP3 A;  1FOD 3;  1QJU 3;  5I0D A;  3BTY A;  3D4K A;  4B3N A;  5BNO A;  4CP1 A;  1R08 3;  2W5F A;  3DPR A;  5D2A A;  2HBU A;  4C0H A;  3PUI A;  3H50 A;  5LAS A;  2GAU A;  4CCL A;  1PIV 2;  4BQ5 A;  4TLG A;  2C6S A;  4ATE A;  3LQC A;  3ZSK A;  1Q8V A;  2Y6H A;  1HKD A;  2UY8 A;  4NHM A;  3VKM A;  4Y5T A;  1OLQ A;  1XE7 A;  1V6K A;  4RN5 A;  2DCJ A;  2B7Y A;  3NJV A;  2CSG A;  4QX2 A;  1WCQ A;  4QX0 A;  1HV0 A;  4R9B A;  5C4W A;  3HQX A;  3IZO A;  3LKJ A;  2VMH A;  5EXO A;  5FZD A;  5LAT A;  3THC A;  4D7T A;  4A7Y A;  4DXT A;  4O7X A;  1FMD 1;  1KJL A;  3BB6 A;  3M3Q A;  4PLN A;  1HXS 2;  4I3P A;  3UGG A;  2ZMN A;  1ZZ9 A;  5K0U C;  1K5M C;  3AXD A;  1Q8P A;  3PVO A;  4GKX A;  4Q4V 3;  3AKT A;  3F95 A;  5LK5 A;  1QWR A;  3BPZ A;  2C24 A;  3I2I A;  3S5A A;  1ND3 A;  2JKB A;  4LOT A;  5FP3 A;  1NUK A;  2VBP A;  1DQ4 A;  2BJS A;  2RJK A;  1STM A;  3J8F 3;  5J7M A;  2ZAA A;  2XJV A;  4PBO A;  4CXW A;  2R07 2;  1Y43 B;  3OPW A;  4NN0 A;  4IE6 A;  2HYK A;  1RHI 3;  5GJ6 A;  1XBF A;  3VDD C;  2HEY F;  4BQ1 A;  1QGL A;  2HWC 3;  3ACL A;  2PHW A;  2XGX A;  3WQ7 A;  3OY8 B;  3ZYH A;  4KGQ A;  1JW6 A;  4FOV A;  1LOB A;  3RMX A;  5IJR A;  5L36 A;  3NAP C;  2DBI A;  3AKQ A;  2G4I A;  1UMZ A;  4N43 A;  4HVQ A;  5F3G A;  1MS4 A;  5FOJ B;  2TUN A;  4LJH A;  2TEP A;  2G9F A;  4WM8 C;  5FY7 A;  1YQ5 A;  3LB9 A;  4FCA A;  4Z82 A;  3OGV A;  3JZV A;  4LIT A;  2ARC A;  3O14 A;  5HI0 A;  2VME A;  3WF3 A;  3KV6 A;  4Y20 B;  4BQ2 A;  4FOY A;  4DPN A;  5JZG C;  3KF3 A;  5FZB A;  4OVE A;  1I1E A;  1KQR A;  3H0O A;  3KT4 A;  5JSP A;  2DVA A;  2CDO A;  2R6Q A;  4O65 A;  1UO9 A;  4XYX A;  4EWD A;  5JPM B;  4FO9 A;  1YWK A;  1PZ9 A;  2QZ2 A;  4TXW A;  3WDU A;  4LIU A;  1W6O B;  2VVF A;  4ZU4 A;  4AWD A;  2MNG A;  3ZOI A;  1EV1 1;  2BV4 A;  4P08 A;  2D43 A;  5BNN C;  4CP2 A;  2VNO A;  3SCF A;  4XFF A;  5JLV A;  1TMF 2;  5EPA A;  4D6R A;  3TEY A;  1LAJ A;  2GNM A;  2CGN A;  5FZK A;  1RMU 2;  1SQ4 A;  4NRO A;  2C4X A;  1AZD A;  2XHN A;  1ZRI A;  5DZF A;  1PGW 1;  3EQE A;  5IW0 A;  2B8M A;  1GZC A;  1GYK A;  4QXH A;  2RM2 1;  3WCS A;  2XL7 A;  2F4P A;  2YU2 A;  3ME2 A;  3T09 A;  2R06 3;  1L3J A;  5FZ1 A;  2A6W A;  4EQV A;  3LE0 A;  4YW4 A;  1FPN 3;  4BWO A;  4F3J A;  2W0X A;  3LSD A;  4XMI A;  5GZE A;  2VVD A;  2Y6L A;  5L19 A;  1TVG A;  5FYV A;  1JZ6 A;  2RMU 1;  1AL2 3;  1GNY A;  3WDX A;  5LA1 A;  3LF7 A;  2E7Q A;  3B93 A;  1LCL A;  4QAW A;  2X5I C;  4YGE A;  3LAG A;  4N7I A;  4QX3 A;  5ABJ B;  4IGO A;  3JUU A;  4N53 B;  1JZ8 A;  3III A;  4GAL A;  5KHH A;  5CYY A;  3VB9 A;  5A3O A;  4YVW C;  4JVA A;  3MUZ 1;  2OII A;  1QQP 2;  3AVR A;  1WME A;  1RUH 2;  2Q1Z B;  1N1V A;  5F2W A;  2ZX3 A;  4AEK A;  2ZGS A;  4BQ3 A;  2XJQ A;  3D3A A;  3CMG A;  1BQP A;  3O1T A;  2ZEX A;  2WAA A;  1POV 0;  1COV 2;  4K8F A;  1UKR A;  2Z5W A;  2W1U A;  3NQH A;  1VMF A;  4UXA A;  4QD2 A;  4XE9 A;  1FT9 A;  1W8W A;  2CWS A;  2P3Y A;  2F17 A;  1ZRR A;  5F6L B;  3FWE A;  2IXC A;  1TME 1;  1OFS A;  1POQ A;  4JQT A;  2BP6 A;  5A7Q A;  3USU A;  2YUE A;  4FTB A;  1GZ9 A;  1IG0 A;  5C8C C;  2ZAB A;  4IET A;  2EIC A;  2FDK A;  1NQJ A;  4LHS A;  3A7Q A;  4EZH A;  3URF A;  4ARX A;  4B1L A;  3T0B A;  2VZ1 A;  3H1M A;  3IM0 A;  3AJZ A;  3D0J A;  3S7E A;  1EUT A;  3RS6 A;  3MPP G;  5A3L A;  2YGM A;  3T2P A;  3MV1 1;  4K7J A;  4EV0 A;  4D0Q A;  5C3P A;  3VZL A;  3T4V A;  3O1S A;  2WS9 3;  1SCR A;  2FBE A;  1PIV 3;  5CFC A;  5FYI A;  1WW6 A;  4H3W A;  1F4H A;  1JUI A;  2JDP A;  2WBK A;  2GNT A;  4JCK A;  3PL0 A;  4JZR A;  4E4D X;  5GLV A;  5JXJ A;  2NLR A;  2J1S A;  3UGF A;  2VZO A;  4FPK A;  5FZI A;  2ZHM A;  4NAO A;  3LDR A;  4UF0 A;  3WR0 A;  2D3R A;  3HJR A;  1EAH 1;  2KA3 A;  3ZYJ B;  3DXT A;  5CA6 A;  1MPX A;  3J9S A;  1H6Y A;  2D93 A;  3MIE A;  4QKN A;  4GWI A;  3VBS C;  4AHW A;  2R04 1;  4NO4 A;  5L9V A;  1HXS 3;  1RUC 2;  1SLC A;  1LRH A;  4YW3 A;  1AR6 2;  4BIS A;  3K51 A;  3VDA A;  3G6J B;  5C5T A;  1VBC 2;  2OS2 A;  4WBB A;  1PMJ X;  2RVA A;  5DAQ A;  2XBO 1;  3I3M A;  2OUH A;  1IG3 A;  1XOY A;  4HSJ A;  1O91 A;  5FDB A;  2YGL A;  2BYV E;  4GA9 A;  4KWU A;  3IN9 A;  1U5X A;  2AR6 A;  3WCR A;  3TWI A;  3KQ4 B;  3ZR5 A;  3I7D A;  2JG8 B;  2B9U A;  2YFZ A;  1WW5 A;  2BBA A;  5FOB B;  2IC1 A;  4QQ2 A;  3DXU A;  3W58 A;  4OI2 A;  4Z1V A;  3FX3 A;  3EHK A;  2P5B A;  5G05 L;  4CEY A;  3I2F A;  5C5U A;  1HIX A;  2ARE A;  2I2S A;  3C7O A;  3J26 N;  4WM7 B;  3WT3 A;  3ZFF C;  2J1A A;  4GQ7 A;  3D0S A;  3NO8 A;  1TQ5 A;  1ZBA 1;  1G7Y A;  1PVC 1;  3HNB M;  4Z2W A;  4BB3 A;  5I93 A;  3PDQ A;  1YQ6 A;  4AI2 A;  4DFS A;  3G7D A;  3WP3 A;  1CIW A;  3R05 A;  4NWW A;  5EFU A;  1QU0 A;  4JDM A;  1H8T B;  1HLC A;  1UMI A;  3LGR A;  2HJI A;  4ZON A;  3SH5 A;  1Z0H A;  2VUL A;  1GWM A;  1YXW A;  4FI9 A;  3LIG A;  3IAQ A;  3WP6 A;  3NKG A;  4P02 B;  3CJX A;  4MOA A;  2Y6K A;  4Y22 A;  5FZG A;  1S2K A;  1NCR A;  4AHY A;  1BBT 1;  1YIF A;  3NV3 A;  3U4S A;  3VDC A;  5AC9 2;  3OBA A;  3V0B A;  2PN5 A;  5FYU A;  3AVS A;  3BYW A;  2PQS A;  3FBM A;  5E6H A;  3D5O A;  1ULC A;  1TMF 3;  3OYW A;  2ARB A;  4S2F A;  1ALY A;  1RMU 3;  1HRV 1;  2BNN A;  1BEV 1;  1F4A A;  2CYF A;  3VKN A;  2DF7 A;  3ES4 A;  1AUY A;  2ARX A;  2E53 A;  3ENR A;  4MAD A;  1CAW B;  1NCQ B;  2ORX A;  2WIN B;  5ANQ A;  1GQP A;  3LEM A;  2YYO A;  4IE5 A;  5KHK A;  1AYN 2;  2EXJ A;  3VBO A;  4Z8B A;  2VCM A;  2XJS A;  2BOI A;  2WNV A;  3VD7 A;  4A7K A;  5A3M A;  5FO7 B;  5C6C A;  3ZFE B;  2QQO A;  1OMI A;  2P34 A;  1SBD A;  2WR9 A;  2VCB A;  2VMG A;  1UMH A;  4XIL A;  1WMF A;  2N7G A;  4WZF A;  1QMJ A;  1QJE A;  1SBF A;  4LIV A;  4IV3 C;  4QU1 A;  3ROU A;  4QX8 A;  3VUO A;  3DYP A;  4LBN A;  4WVZ A;  1GBG A;  4ERO A;  1DF0 A;  1QOS A;  2DFC A;  4JKM A;  5E88 A;  3ZMN A;  2HWB 1;  4XF4 A;  4GH4 B;  2OPW A;  3KVA A;  1NLS A;  1QQP 3;  1ODM A;  3AKR A;  3ES1 A;  4OZO A;  4CUA A;  2VTX A;  1EPZ A;  4I0B A;  2ETE A;  4TSV A;  4CCK A;  1T2X A;  1G9A A;  4P9J A;  4K8R B;  5BV6 A;  4P9G A;  1COV 3;  1QNW A;  3Q8B A;  5CU1 A;  4JDO A;  4Q4X 1;  4N9I A;  4QPW A;  2X29 A;  2FDF A;  2ZHN A;  1YIP A;  5FMD A;  5L73 A;  1ZZC A;  3PUH A;  5AVA A;  2FDG A;  4GIQ A;  4XXA A;  5E16 A;  2C5D A;  4DB5 A;  2G9G A;  5C7G A;  2ZGO A;  3PME A;  5FZL A;  3RG0 A;  3MW4 A;  3PJY A;  4KWL A;  3USU B;  4JGZ A;  1MS1 A;  2KM2 A;  1X50 A;  5A33 A;  3A23 A;  5FCC A;  1ZA4 A;  4SBV A;  2WT1 A;  4HKO A;  4YNI A;  4E27 A;  5FPV A;  2D6K A;  3MBW A;  1H9P A;  4Y1V A;  1LR5 A;  5I0R A;  1K42 A;  1W05 A;  2Y34 A;  4Q4W 2;  1J3R A;  5FTT C;  5FZ8 A;  1S0D A;  5FY1 A;  4D94 A;  1QKQ A;  1UY4 A;  1V6J A;  2VTF A;  4QWN A;  5DAB A;  3T1L A;  5FK7 A;  4GD4 A;  5FIX A;  1LHV A;  1UPI A;  1PZ7 A;  3NJX A;  3OUI A;  4OZX A;  2QDR A;  4DNY A;  3LEG A;  3KCX A;  1CIY A;  3MUY 1;  1W6M A;  3ZXJ A;  4D69 A;  1DIW A;  3NST A;  3QCW A;  5FQ0 B;  1V9U 1;  1HRI 2;  1IS3 A;  5KHJ A;  3UKV A;  3CBN A;  2EXH A;  2D3P A;  1CAX A;  2JIJ A;  2A7A A;  2VXR A;  3I2D A;  5LB6 A;  1NG0 A;  2PLV 1;  2WNU A;  3FL7 A;  3OB8 A;  2BNO A;  3JCI A;  5JXH A;  1UU4 A;  3AMP A;  2AAC A;  2WAB A;  3RYK A;  2IFR A;  3WP4 A;  1EY2 A;  4JTO A;  4XVH A;  4MLO A;  2CDP A;  4RHV 1;  1TG7 A;  2BFU L;  4NJ4 A;  1G8W A;  4XQ4 A;  2LM3 A;  1HJF A;  1RUC 3;  3FMG A;  3LEK A;  4UFL A;  5FY4 A;  2P4E A;  2Q30 A;  4YVS B;  1PX3 A;  1XSQ A;  3RYP A;  4A44 A;  1ND2 C;  5LRR A;  4PDW C;  4OQ9 A;  1VBB 1;  2KD7 A;  1ZRD A;  1W2O A;  1ULG A;  2WZR 3;  1LGB A;  1WCS A;  4CDW A;  4DUX A;  1ZZ8 A;  2ZAH A;  3R4S A;  2CY6 A;  3WY6 A;  2NQY A;  3IPV B;  5A32 A;  1K5J A;  2JB4 A;  4M3C E;  2ET7 A;  1O5L A;  1UU5 A;  5F3I A;  1RUE 2;  1OD3 A;  2P6C A;  2VOT A;  1OF3 A;  5T54 A;  1LHO A;  1U0A A;  3MW3 A;  3I8T A;  4MGT A;  3SH3 A;  2HEV F;  3OD0 A;  5IAV A;  5IVJ A;  4UT5 A;  1ULD A;  4NOT A;  3H3L A;  2WWU A;  4CCC A;  4BLI A;  3V0A A;  5FYZ A;  4XQD A;  1UXZ A;  1LOF A;  2R0H A;  2C26 A;  2DCY A;  1QH6 A;  3E5U A;  5IK5 A;  1LES A;  3O1R A;  3ACG A;  4XCA A;  1JMU B;  3Q8F A;  2VTX J;  2ZGM A;  4IEZ A;  2YC2 A;  4LLO A;  3ZSE A;  2VE1 A;  3LFI A;  1AXK A;  3GCX A;  2ZKN A;  3OBZ A;  3VD4 A;  3WQ0 A;  4OQ8 A;  3S57 A;  4XHB A;  4FP2 A;  5JI7 A;  1CAU A;  5JR2 A;  3BI3 A;  1H4H A;  2OXB A;  3AL6 A;  4BQY A;  3BOW A;  5L9R A;  1BHG A;  4JGY A;  2VZQ A;  3AYD A;  4Y22 B;  3T08 A;  1IKP A;  1Y7B A;  3L9J T;  1VBD 2;  2ENR A;  1ZYB A;  4IER A;  2O8Q A;  1GZW A;  3CZU A;  3EJK A;  4MSV A;  5ISL A;  1UOJ A;  2JEC A;  4E8C A;  1QJX 2;  1AR7 2;  2R32 A;  5AC9 3;  5CFD A;  3UT0 A;  3ZFG A;  1C5I A;  5J36 A;  3V0B B;  4GMP 1;  4P14 A;  4K3U A;  5G04 L;  1UF2 C;  2IXH A;  4XBQ A;  1E5R A;  4I0W B;  4CXY A;  4HPK B;  3AP6 A;  1NZC A;  3QD6 A;  5B2G B;  4BK4 A;  4B4Q A;  2JJ6 A;  5F6K A;  3TOJ A;  1ULE A;  5EIY B;  2VH9 A;  3CF6 E;  1W04 A;  1SLT A;  2A73 B;  1LOC A;  3JU9 A;  4RS5 A;  3HBK A;  1AXY A;  5FXZ A;  1D7P M;  5KXE A;  3U37 A;  1AYN 3;  4X8N A;  1JZ3 A;  3QH7 A;  2WNV B;  2PFW A;  2W2I A;  5FPZ A;  3H8R A;  3GBF A;  1IPS A;  3LA3 A;  4FFF A;  4P00 B;  5LW9 A;  1VIW B;  2JIG A;  2Y26 A;  1RUF 1;  2ZX1 A;  5FPB A;  4KBB A;  3BTZ A;  2ZX4 A;  4MG2 A;  2EIG A;  4QPI A;  1H0B A;  1XND A;  2VOK A;  3SIT A;  1O59 A;  1EPW A;  1OBN A;  2HWE 2;  4COV A;  4Q1R A;  5LA2 A;  3TEW A;  4CUG A;  2C1F A;  4KL1 A;  3V65 A;  1EV1 2;  4RFT 0;  1LU2 A;  3SEE A;  4Y1U A;  3AZV A;  2D44 A;  3VKF C;  4XET A;  2JKX A;  1DFQ A;  4H7M A;  1C1F A;  2W91 A;  4W65 A;  4BM8 A;  4LEJ A;  4AYU A;  1KRI A;  3EYP A;  1ZRF A;  1A6C A;  2DTY A;  1OQ1 A;  4BMB A;  1RGS A;  4XUO A;  1C28 A;  2BFU S;  2BWA A;  2XXZ A;  2YBS A;  2JEM A;  3DKW A;  2K9Z A;  3U11 A;  5IHR A;  3WNL A;  3TN9 1;  1AR8 1;  4AVC A;  2RM2 2;  4Q5O A;  1PX4 A;  4R9D A;  2J1E A;  4XIK A;  3UNP A;  1HDK A;  4AAX A;  5DZE A;  5A3U A;  5K0U A;  1K5M A;  1C8M 1;  1RVF 1;  4AXO A;  1O3Q A;  5JOY A;  3WG4 A;  1HJG A;  1SLB A;  3M3O A;  1CAV A;  4YM2 A;  3VBH B;  3ZPO A;  5A33 B;  2E9Q A;  1HW5 A;  5CAZ A;  1A8M A;  1Q8S A;  5DZG A;  3M7A A;  5FZO A;  2RMU 2;  1FX5 A;  4CCM A;  3WV6 A;  2VBB A;  1W8H A;  3B7M A;  3VD5 A;  1VRB A;  4X6Q B;  4FPL A;  4CXX A;  1XB9 A;  1W8O A;  4H14 A;  3VBF C;  3VDD A;  3J8F 2;  3ZMO A;  1MS9 A;  5FZ4 A;  4P9L A;  2HKX A;  4XOG A;  5CNA A;  4LBQ A;  3HEI A;  4YGC A;  4YPJ A;  1MEC 1;  3N4M A;  3VZK A;  3FHI B;  1DQ5 A;  3BU7 A;  3MLJ A;  4NPR A;  4YM0 A;  2D6N A;  3L2H A;  4EWE A;  4IV1 B;  3CL1 A;  3N9Q A;  4RFR B;  1YFY A;  3LPF A;  4HKW A;  4YG6 A;  5KC5 A;  2ZJC A;  3INA A;  2DDU A;  2QCS B;  3FZ3 A;  5DAP A;  4WM8 A;  1HRI 3;  4ZU5 A;  2VCA A;  2JG9 C;  3DV8 A;  4B7K A;  2B4K A;  3ILF A;  4YG0 A;  2ZGQ A;  3ZXD A;  2GP5 A;  1O7F A;  1H6X A;  1CZS A;  1JU3 A;  2E33 A;  2EAA A;  5L7O B;  1W2U A;  1RL3 A;  1AYM 2;  4N8M A;  3POJ A;  2RS3 1;  4BLJ A;  4AL9 A;  1US3 A;  2B39 A;  2R1B A;  3DF0 A;  1LHU A;  3O0X A;  3H1Y A;  2D5H A;  5LBB A;  3SQO A;  1O3R A;  4Q0V A;  2WO7 A;  2HWD 1;  3U75 A;  4LO4 B;  1G6N A;  3T3Y A;  2QVS B;  2Q8D A;  4AFA A;  2PHL A;  4AEM A;  4MZU A;  3GCW A;  4EN0 A;  4LHN A;  2IXL A;  1OXC A;  5J1X A;  4MO3 M;  5BNN A;  2ZZQ A;  1O4T A;  1RUD 1;  2CL2 A;  5A32 B;  2X8K A;  3WNM A;  5FV3 A;  3J7L A;  2NMN A;  4GJZ A;  4LQR A;  2PHR A;  3K48 A;  4LOS A;  4QM8 A;  3Q8E A;  5A1F A;  1RUE 3;  2A70 A;  1VE0 A;  5FKC A;  4RQP C;  2CTV A;  1UXX X;  2AH2 A;  4Y1Z A;  3VDB A;  5FPX A;  1J59 A;  1XYN A;  4CDU B;  4CP9 A;  4YAR A;  1IHM A;  4QGL A;  3ZYP A;  1DYK A;  5B4X A;  1GNZ A;  2AUY A;  2WFF 2;  2WZ8 A;  2QDN A;  3H3Z A;  2RDR A;  3VD9 A;  1ULO A;  2ERF A;  5J48 A;  1FMD 3;  1APN A;  2XJR A;  2J22 A;  4BU2 A;  5F39 A;  4XHX A;  2AEN A;  2QQU A;  1QNY A;  3RPQ A;  2XB6 C;  3JBG 1;  2IXI A;  2PHX A;  3OGJ A;  1CAU B;  2X5I A;  1H9W A;  2FCV A;  5HV4 A;  2VAU A;  3ZSM A;  1VBA 1;  1WCU A;  3SH4 A;  4C0B A;  3RQ0 A;  1UAI A;  5FWJ A;  1W06 A;  5A1A A;  4YVW A;  2X10 A;  2BPA 2;  3WNN A;  2FQP A;  4P5Y A;  4LPL A;  2FD8 A;  1YFU A;  4LK6 A;  4CTE A;  3RZG A;  1VBD 3;  2LRO A;  4GJY A;  1DZR A;  4C1W A;  1QF3 A;  2GN7 A;  3MFC A;  1LNS A;  4MXW B;  5LBE A;  1QJX 3;  1AR7 3;  4BYY A;  4P9W A;  4RSU A;  1Q8O A;  1F9K A;  2RS5 2;  4HVR A;  4URA A;  2Y60 A;  3C8X A;  4GB3 1;  3JQW A;  4UBG A;  1QDC A;  3WQB A;  1BMV 2;  3ILR A;  2XUM A;  4OI1 A;  3BUC A;  1RUJ 2;  4BIF A;  4CDQ B;  1KXG A;  3ATG A;  1NA1 B;  5JUV A;  5CIR A;  4RS5 B;  3P3P A;  3U10 A;  3X29 B;  4F8A A;  4M3C F;  3ORJ A;  3GDB A;  4PJY A;  4OCT A;  3WDT A;  3O1V A;  3LA2 A;  3HPN A;  4CEW C;  4Y1X A;  3SIS A;  2B46 X;  3VL9 A;  4EE2 A;  2TBV A;  1LOG A;  1W6N A;  5C8C A;  4YZ2 A;  4ES9 A;  2PAM A;  4A3Z A;  4UFI A;  3OGG A;  3KCC A;  3VBU B;  4Y5S A;  4CDX C;  3N9N A;  3VGI A;  1CPM A;  3AP7 A;  2DCZ A;  2D6M A;  2VEC A;  2HWE 3;  3HN1 A;  5FZC A;  4XUP A;  1VP6 A;  4QQH A;  1EV1 3;  5IAX A;  1XU2 A;  2ZS6 B;  3ILN A;  4LLF A;  5JAX A;  4XBL A;  3POE A;  3PVE A;  2D40 A;  2AEY A;  2WS9 2;  2UWC A;  3A0K A;  4BOW A;  4IGQ A;  4NIH A;  3LWC A;  3B9I A;  3PMS A;  4XAC A;  2XWB B;  2H0V A;  5C3Q A;  4L11 A;  4OI0 A;  5CG8 A;  1RUG 1;  2CNA A;  3AK0 A;  2OT7 A;  4AFM A;  2JE8 A;  5LZ6 A;  2RM2 3;  1OOP B;  1MVE A;  5D8A B;  1YYN A;  3VBS A;  1DZT A;  4A6O A;  2LAL A;  2D6P A;  1HQW A;  2DUQ A;  3UK9 A;  5IK4 A;  3T4H B;  5KHI A;  1ZA7 A;  2YRO A;  4X6R B;  3QAC A;  2XJT A;  4UOJ A;  2VMC A;  3NJZ A;  3CJI C;  1S1A A;  2DCK A;  1TE1 B;  4X8P A;  5FMC A;  4LO8 A;  3BN6 A;  1AR6 1;  1R1A 2;  4QXC A;  2DU1 A;  1SDD B;  2RMU 3;  3SNM A;  3RZK A;  1NLR A;  2A3X A;  4DY3 A;  5A6X A;  1V6N A;  4BDV B;  3THP A;  4BQ4 A;  1D2Q A;  3K3N A;  2K46 A;  2W94 A;  2NM1 A;  4QU2 A;  3MW2 A;  1BXH A;  2GC1 A;  5F3C A;  2WO1 A;  2ILM A;  1FYU A;  5EV7 A;  4P9I A;  4AI1 A;  3U78 A;  4NHX A;  4BQW A;  3K75 B;  3M1H A;  5DN2 A;  5FYT A;  1JOJ A;  4OFG A;  2BRT A;  1UOG A;  2VUA A;  3I54 A;  3M4F A;  1HB2 A;  3WW3 A;  1ASJ 2;  3H1W A;  5KR7 A;  1OPO A;  1OA2 A;  1ZM1 A;  1VAV A;  4Q4X 2;  3Q8C A;  3QBQ A;  2ZGU A;  5FY8 A;  5FY0 A;  2X09 A;  5JR7 B;  4Q4Y 2;  2ZHL A;  2HWF 2;  1SLA A;  4UBH A;  2I07 B;  3TEZ A;  5C70 A;  1EUU A;  3I2H A;  4MHU A;  3RJ2 X;  1AYM 3;  3OCP A;  5FJK A;  1O5U A;  4HXC A;  4YGD A;  4ZHN A;  5JCT A;  1DQ1 A;  5TSW A;  4XJ9 A;  3W5M A;  2B9V A;  2B5H A;  1E57 A;  4IXL A;  1AR9 1;  1ZBE 1;  4E9K A;  2VMF A;  5C9A A;  2Y38 A;  3OUH A;  3OBT A;  1NY7 2;  1PO2 1;  1B35 C;  2W95 A;  4PT6 A;  4TN7 A;  4PQQ A;  5GKA C;  3RZH A;  5FMB A;  2FMD A;  1PM4 A;  5KXB A;  4M00 A;  1LGC A;  3KV4 A;  3POW A;  1PVX A;  3WVJ A;  4BHP A;  5H9Q A;  2Y6J A;  4XAA A;  3TAY A;  2X53 S;  4JKL A;  4AAP A;  5F5I A;  4NIG A;  1NOV A;  5A7W B;  3AMH A;  3WD5 A;  2QQM A;  1JHJ A;  1D2S A;  3CZJ A;  4QT6 A;  5CBL A;  2Z42 A;  4FBF A;  3KQR A;  3EMR A;  2VQT A;  4I2O A;  1PM7 A;  1XJA A;  5DAX A;  2XDV A;  3KT1 A;  2VGD A;  2BU9 A;  2KR2 A;  2PA7 A;  2WFF 3;  3B94 A;  4Q0S A;  3RNS A;  4FAG A;  1N1Y A;  4IE7 A;  3WP5 A;  2BER A;  1BYH A;  1DP0 A;  2ZCW A;  2DTW A;  3E1F 1;  3TNP B;  3TRS B;  1CX1 A;  4G4F A;  2R04 3;  5FBZ A;  2WLP A;  4W6W A;  1VRH 1;  2ZMK A;  3THD A;  2JE9 A;  4KWJ A;  3WHT A;  4BXF A;  4ZS3 A;  1FOD 1;  1QJU 1;  4ET7 A;  3NVC A;  4KG8 A;  4L92 A;  3MLL A;  1LEN A;  1JOD A;  4R52 A;  1W3V A;  1E5H A;  1QY4 A;  4UWD A;  2AGS A;  2DBN A;  3D8C A;  1R09 2;  4DIN B;  1YC6 1;  5FXX A;  2GNB A;  1JH5 A;  5JI9 A;  4WVW A;  3H8X A;  3PIJ A;  5FPA A;  1UCX A;  1J1T A;  3T2T A;  1HB3 A;  4PHZ A;  3HIF A;  2WO3 A;  4WVM A;  3WIN E;  3WNX A;  1Z7S 1;  3LDK A;  4PIY A;  4YLZ A;  2RS5 3;  1JOB A;  2W68 A;  4BPZ A;  2JDY A;  3C7F A;  1RUJ 3;  2DUO A;  2PYT A;  4XJ8 A;  4YW5 A;  1ZBA 3;  3ZKY A;  5A3T A;  3HAG A;  2VZ3 A;  4Q4V 1;  2QQV A;  4QGN A;  3B9C A;  1RJ7 A;  3GZE A;  2XML A;  4AQS A;  4EJR A;  2XON A;  3C3V A;  1UOF A;  3FJS A;  3OBR A;  2WNO A;  2VVE A;  5KHG A;  2VO5 A;  4P9X A;  4AW7 A;  1Z78 A;  3LOB A;  4I3G A;  3DN7 A;  1ULP A;  4Y3O A;  1TNF A;  4KWK A;  4QX7 A;  5BNP B;  4FTS A;  4COU A;  1POV 3;  1FXZ A;  1M4W A;  5FZH A;  1RHI 1;  1UU6 A;  5ABJ C;  1D0G A;  4N53 C;  2W46 A;  1W03 A;  2YXS A;  4IEV A;  1UY3 A;  1W2N A;  3PVB B;  2HWC 1;  3DYM A;  1XNK A;  3MIF A;  3MV0 1;  1W28 A;  4QQP A;  4QHB A;  1SLI A;  3BAL A;  3VBR B;  1OQE A;  4A4A A;  2PTM A;  3HVD A;  2W08 A;  4I02 A;  2GME A;  4OUE A;  4AED A;  4YFZ A;  2BNM A;  2X05 A;  1VBE 1;  2MEV 1;  2XLG A;  3HBZ A;  2Y6F A;  3B01 A;  4M3C A;  5BNO B;  1PO1 2;  2R16 A;  1S0E A;  2WFP A;  3DPR B;  3P1I A;  2K2S A;  5GZF A;  2JD4 A;  4AHX A;  4NE9 A;  4W50 A;  5K4L A;  4HFS A;  5FBJ A;  3B02 A;  3N9M A;  3GHN A;  4GWJ A;  4DRV A;  5CAD A;  1O8P A;  4YSF A;  2ADE A;  1CZT A;  2XL9 A;  2HYX A;  5J3U A;  5J37 A;  4D8M A;  1UPS A;  2Y0O A;  4IEW A;  5C4W B;  2MPF A;  5D21 A;  5JSR A;  4BH9 A;  4YM1 A;  5FZF A;  1V70 A;  1MS3 A;  2ADD A;  1LHN A;  1ND2 A;  5DAW A;  4BCU A;  4PDW A;  4UI9 L;  2WA3 A;  5A7P A;  2Q1F A;  2YG0 A;  1OUX A;  1RUF 2;  1REF A;  2R30 A;  2VMD A;  5LA9 A;  1R1A 3;  1QJY 2;  2YBP A;  1ND3 B;  1UIJ A;  2W1Q A;  2WZR 2;  4CCD A;  4TZD A;  1GQG A;  3AL5 A;  4XF3 A;  1NZI A;  1GQH A;  2WUH A;  1QJZ A;  4A7Z A;  3LA7 A;  1BVV A;  1X36 A;  2B42 B;  3WDV A;  1PHM A;  3M3C A;  2RS1 2;  1AL0 G;  3AYE A;  4HMZ A;  4OMC A;  1VLN A;  1WLD A;  3U1X A;  2JDN A;  4FXG B;  3TBD A;  2AC1 A;  5JOZ A;  3NKT A;  2V09 A;  1ASJ 3;  2WSU A;  3R6S A;  5FZM A;  3PU8 A;  4Q4X 3;  2R06 1;  3MHZ A;  4N43 B;  5F32 A;  5FWE A;  1H2M A;  1FPN 1;  2Q8E A;  4HT1 T;  2P3K A;  4HET A;  4Q4Y 3;  2HWF 3;  1GZT A;  1XQN A;  2ZA9 A;  4AVA A;  4UYB A;  5FZA A;  2FMY A;  4KBZ A;  1AL2 1;  3ITQ A;  5I8T A;  1IS4 A;  3ACI A;  3TNQ A;  1NX9 A;  4XUN A;  5I91 A;  4HSL A;  4E2G A;  1DU3 D;  4CCN A;  3BKZ A;  2BW8 A;  3WXP A;  3GYD A;  4TYS A;  4NVP A;  4YZ5 A;  5C9A B;  4Y1Y A;  5A3N A;  4I09 A;  1J83 A;  4ZKT B;  1W6Q A;  2PHU A;  1I3H A;  5FYS A;  1GSL A;  1BKZ A;  1JS9 A;  3M3I A;  2RR1 2;  4XF9 A;  1F5J A;  2OKX A;  3NRU A;  3KS7 A;  2JG8 C;  1JOP A;  1TZO A;  4H7L A;  1PK6 A;  4LKS A;  4Q27 A;  3GXU A;  1WLW A;  1X8E A;  3POY A;  4N7U A;  5HXM A;  1W6P A;  2ZML A;  1H4G A;  1H2K A;  1MS0 A;  1OH4 A;  3OTF A;  4WM7 C;  5FY5 A;  2FZ1 A;  1WD4 A;  4KQ7 A;  3PUS A;  2XHK A;  2GC2 A;  1MZF A;  4M0N A;  3W20 A;  5HCH A;  3AYA A;  5CG9 A;  4CA9 A;  4BA6 A;  4OMD A;  2O0O A;  2QQK A;  1RUI 1;  4QMA A;  3FBY A;  3OGR A;  4CP0 A;  1OHF A;  1H8T C;  4AGG A;  5FUP A;  4DEQ A;  5BXX A;  1OLM E;  1H1A A;  5EWS A;  1K45 A;  3POB A;  4NAM A;  1B09 A;  2A1X A;  1QIQ A;  2BVB A;  3ACH A;  5T3N A;  2JDZ A;  1OD5 A;  4U2A A;  3ZYB A;  4R4X A;  2QFE A;  5T5L A;  3UGH A;  3LDB A;  1N47 A;  5CKM A;  4UW3 A;  3SCG A;  4EYU A;  2H0B A;  5AFE A;  1IZ3 A;  1AJO A;  1RIN A;  1F5F A;  3BVC A;  3M70 A;  5DAV A;  1NXM A;  4J1W A;  3A21 A;  1CD3 G;  4XZP A;  2NMO A;  3AP9 A;  1X9P A;  1CGP A;  2WL1 A;  3GNE A;  1PIV 1;  3KMH A;  2XH6 A;  3KB5 A;  1R09 3;  3NNG A;  3PUQ A;  3MF6 A;  3Q8A A;  4GUL A;  4L0P A;  4RL7 A;  3ZYG A;  1MQT A;  3ALQ A;  3O1O A;  3PLQ A;  3W59 A;  5ACA 2;  4WVM B;  4HLT A;  2IXJ A;  4Q1P A;  2VOX A;  2DU0 A;  2D6L X;  3HT2 A;  1IGO A;  1XSR A;  1ENQ A;  1NCQ C;  1GU3 A;  2Q0A A;  1DGW A;  2RJL A;  4KNC A;  2WZP P;  1HXS 1;  1YEW A;  4BJ0 A;  1IKQ A;  3WG2 A;  4AEJ A;  4DOU A;  2UYA A;  4RD7 A;  1MVQ A;  5FP8 A;  1UYP A;  1S4C A;  5AFB A;  4C1X A;  4XFG A;  3ZFE C;  3I3E A;  3U4X A;  4XUQ A;  1O8S A;  5F3E A;  5JIU A;  1W8T A;  2ATF A;  3BGA A;  3OEB A;  1OLR A;  2ZGK A;  1AX1 A;  2K0G A;  1UZ0 A;  4IEX A;  4GMP 0;  1ENS A;  1JI6 A;  2EXK A;  3WDY A;  2R07 1;  3VBF A;  1TNR A;  1AF9 A;  2VZU A;  3ON7 A;  3I59 A;  4UW4 A;  2Y8K A;  3SMH A;  2VL4 A;  5DXD A;  4CU7 A;  5DMY A;  1W2A X;  2UWB A;  2WO2 A;  4FPF A;  4QPY A;  3JB8 A;  4AED B;  4GH4 C;  5DUW A;  3UES A;  4IEO A;  1SDW A;  1LKN A;  4K20 A;  3SCH A;  1QEX A;  1MAC A;  1UOB A;  1PMH X;  2D3S A;  4RYD A;  5KXC A;  1PO1 3;  2Z69 A;  4W8J A;  2JG9 A;  2LS6 A;  5CFC B;  1RUN A;  4DQA A;  1ZZB A;  1REE A;  2BWC A;  1W9T A;  3CKH A;  4B7E A;  2A71 A;  2RJ2 A;  4PIX A;  1IS5 A;  1CN1 A;  4UF0 B;  1VB4 A;  3N9O A;  4Y4Y A;  3FHQ A;  5DDJ 2;  5FYB A;  2ZGR A;  2XR4 A;  2VW1 A;  4DXS A;  3FUQ A;  4CUB A;  3O0V A;  4XDO A;  1F35 A;  5HXV A;  3J7H A;  5GM0 A;  2XKO A;  1XNA A;  2XLA A;  1RUF 3;  2WSV A;  2WJS A;  2R7E B;  1K12 A;  3WHU A;  1QJY 3;  3I97 A;  4L97 A;  5F5C A;  1O3S A;  1D4M 1;  2GH8 A;  4HZF A;  1XNC A;  3ZDS A;  3GZA A;  3PUR A;  2VM9 A;  1TMF 1;  4LBO A;  5IVC A;  1CQ9 A;  1C5H A;  1W2T A;  5FZ3 A;  3D6E A;  4RQP A;  5IUQ A;  1RMU 1;  3W21 A;  2E26 A;  2RS1 3;  4QQO A;  1U5I A;  3DCQ A;  1RXG A;  3H7Y A;  5JSO A;  1HB1 A;  1AJK A;  4FFH A;  4CEY B;  1OFN A;  2ZKL A;  2ZPX A;  3AFK A;  3PVN A;  4K6B A;  4LBQ D;  3WQ1 A;  2Q8O A;  3TN9 3;  2EAK A;  4YW6 A;  3UKT A;  3N7J A;  3KV9 A;  3MIG A;  1OKO A;  3FC0 A;  1EP0 A;  1CZV A;  2E7A A;  1RVF 3;  1ZZ6 A;  2NZ9 A;  4G9S B;  2WWS A;  1FMD 2;  4Q0Q A;  2VPV A;  4YVS C;  3IAP A;  5DQ0 A;  3NWK A;  3S30 A;  3LCP A;  1WKY A;  3DGT A;  1EYB A;  1GOF A;  4ASL A;  2CWM A;  2ZBJ A;  4B4P A;  4AGV A;  4CU6 A;  1W6Q B;  1XU1 A;  4AVB A;  4OHW A;  1A3K A;  1ULF A;  3IKW A;  1ZZ7 A;  1HX6 A;  2GN3 A;  5IVB A;  4GKY A;  3MFA A;  3RDI A;  1AXZ A;  1RUH 1;  4PLO A;  3WX5 A;  4E2Q A;  5CIS A;  1UZZ A;  2RR1 3;  5J96 B;  1FNZ A;  1PK6 B;  3FLR A;  1KGY A;  1NCR B;  4LR4 A;  2DVB A;  2OZJ A;  4GAZ A;  3O1U A;  1WW7 A;  2GMP A;  1S0J A;  2J1R A;  1BJQ A;  1E5I A;  2D98 A;  3FFQ A;  5FJH A;  4UAP A;  1MR5 A;  3OYW B;  1RC6 A;  1ENR A;  2PQQ A;  2Y6G A;  4QX1 A;  4E4Z A;  4Z92 B;  2VOV A;  1X8M A;  3H3U A;  3I3Q A;  4OLL A;  3FN9 A;  4LUK A;  4XAB A;  5IK7 A;  4IGP A;  3TB0 A;  2YPJ A;  1UKG A;  3ABZ A;  3GF6 A;  3FUO A;  4CEW A;  2H6C A;  1D0H A;  4ASK A;  3AJY A;  1SHW B;  2JB8 A;  4MHR A;  4OYU A;  5I0U A;  3VBO B;  4AVT A;  4B8E A;  3MZH A;  3ZDV A;  1CVN A;  3SC7 X;  4COY A;  2HWD 3;  4CDX A;  2PMW B;  3VHO A;  3HR9 A;  4E4S A;  4R9C A;  5JIA A;  4COZ A;  2JDK A;  5K8S A;  4NPL A;  1W99 A;  5FXV A;  3IB3 A;  1SG3 A;  1XPW A;  2XQR A;  4TLF A;  2L9L A;  5BUV A;  3ZXG A;  2W1W A;  1MQT B;  3B69 A;  4XEZ A;  5JMC A;  4ASM B;  2ES3 A;  4MGY E;  3CEW A;  1DBN A;  2DVD A;  5ACA 3;  3RJR A;  1WUV A;  5LRS A;  5JWP A;  1V6O A;  3AZX A;  1YO8 A;  2DUP A;  2JIC A;  1HB4 A;  1V0A A;  3BOP A;  2NP0 A;  2BTV C;  3BTX A;  4P9Y A;  1PGW 2;  4OUM A;  1QOT A;  4KMQ A;  4EZ4 A;  1R64 A;  1RUC 1;  3AZZ A;  4MX3 A;  3PUA A;  2WNV C;  3CJI A;  1MZE A;  1VRH 2;  2HLE A;  2WWJ A;  1L7R A;  1VBC 1;  2ORZ A;  5C71 A;  4COW A;  1KS5 A;  4MGQ A;  4OI4 A;  4R4Z A;  2FCU A;  2QJV A;  1O4Z A;  2W92 A;  4JGZ B;  4W4Z A;  4NWV A;  2ZHK A;  3W9A A;  4D6Q A;  3VZJ A;  4FXK B;  4XPV A;  2EAL A;  3O12 A;  5A80 A;  1YQ2 A;  4PF1 A;  3POS A;  4PBP A;  3ZKU A;  2DCT A;  2OPK A;  3IDA A;  4GXL A;  4MYE A;  1LEC A;  3ZR6 A;  4CZS A;  3EB7 A;  2EIB A;  5F5Q A;  2VMI A;  4YW2 A;  3VD3 A;  1L7Q A;  2HEW F;  3A4U A;  4RGA A;  1VJ2 A;  2VZV A;  1UD1 A;  2JX9 A;  4YYO A;  5HCF A;  3ZSJ A;  3PTY A;  4YZ3 A;  5I8Y A;  3FFZ A;  3N35 A;  4CPB A;  4YM3 A;  3WUC A;  3WF1 A;  3NAP A;  3KWV A;  1W6M B;  3ELN A;  4QPG C;  5FPU A;  2A6Y A;  2WLQ A;  4FAH A;  2TNF A;  4MGS A;  1XYP A;  5D1I A;  3USS A;  4ZU7 A;  5EZW A;  3GJA A;  4XJW A;  4LA3 A;  2YY1 A;  4NPM A;  5FZ0 A;  1W0O A;  1CAX B;  1QXR A;  2WNU B;  1S2E A;  3WDW A;  1TME 2;  3IT8 A;  1J58 A;  3VBH C;  2A5Z A;  1PGS A;  4IEY A;  5DDJ 3;  1JHN A;  1W3X A;  5JZG A;  1KS4 A;  5IWF A;  4E8D A;  4C8D A;  1NT0 A;  4QDS A;  3BIE A;  4IEP A;  4XFC A;  2ZGL A;  2VW2 A;  1MZ5 A;  1B35 A;  4JRA A;  4LBL A;  3WW1 A;  2A6V A;  4OHV A;  4W6X A;  5LEJ A;  5AC9 1;  1JZ5 A;  3OGS A;  2YZ4 A;  4MGI E;  1D4V B;  3OY8 A;  4B29 A;  4CDW B;  2VC9 A;  2RDS A;  4FFI A;  2GH2 A;  3WNO A;  1F31 A;  4IV1 C;  3RYR A;  3LSE A;  2RV9 A;  5KBF A;  2UUR A;  4EN9 B;  1G9D A;  2JDM A;  4IW3 A;  2JEN A;  1N1S A;  1OVP A;  3WZ1 A;  4D7Y A;  2A6Z A;  2VCC A;  2Q1M A;  5FO9 B;  1SFP A;  1YI9 A;  5DUV A;  2W39 A;  1CX4 A;  1OT5 A;  3QLQ A;  5KC6 A;  4M0H A;  1AYN 1;  2DWR A;  5DUX A;  3ZSL A;  3ZXK A;  5L7O C;  1N3P A;  2FDJ A;  4IDZ A;  4Y20 A;  2E51 A;  3C2U A;  5T5P A;  3UL2 A;  3AZY A;  3V0A B;  1AHS A;  1EAH 2;  4J1X A;  1DQ2 A;  3HWJ A;  3KT7 A;  4MGK E;  1GP4 A;  2FDI A;  2R04 2;  3HQU A;  2ZXQ A;  3HD8 B;  1RED A;  4UW5 A;  4TTG A;  4EWA A;  3HT1 A;  4AI8 A;  1R1Z A;  1UZW A;  4MGZ E;  1C8N A;  1W6O A;  2YV8 A;  4FPE A;  2A3Y A;  3FE5 A;  2GSY A;  2W1S A;  3EXU A;  2JDH A;  1UY1 A;  2XBO 2;  3KM5 A;  4QB1 A;  1SZB A;  1YQC A;  4JGY B;  5J09 A;  3DUI A;  3L2Y A;  4Q0P A;  5LA0 A;  3RSJ A;  1ZRC A;  5HV0 A;  1GUI A;  3K77 A;  2GDF A;  2GAL A;  1XE0 A;  4SLI A;  3KCY A;  5FMO L;  3T0A A;  1NYW A;  2WN3 A;  4Y4R A;  1Q5O A;  3JD7 1;  4Z2A A;  1GZW B;  4XJZ A;  4DUV A;  1Q56 A;  4CDU C;  4FPH A;  4AFB A;  3ZFG B;  5CFD B;  4TWT A;  2QBX A;  4A6S A;  3MF9 A;  3RZM A;  2BGC A;  2XVL A;  1IOA A;  3A0N A;  4YG3 A;  4DIQ A;  4LHK A;  1S0B A;  1LOF C;  1YFX A;  1W9S A;  2PAE A;  2IZW A;  3ETP A;  2DUR A;  1UIK A;  4K40 A;  4XF1 A;  3TEX A;  3WF0 A;  1ZBA 2;  4NMI A;  1PVC 2;  4HAN A;  3VKL A;  1ZRE A;  2PEL A;  4PQ9 A;  3THT A;  2SLI A;  2ZGN A;  1KJR A;  3K2O A;  4LBK A;  2IFW A;  4NHK A;  4QM9 A;  4JKK A;  3DYO A;  1DLL A;  5ABJ A;  4Q4W 1;  4WZC A;  4N53 A;  1BVP 1;  1DQ0 A;  5A3W A;  4AZZ A;  1H8V A;  1O3T A;  2OX0 A;  3KV5 A;  1YHF A;  2GC3 A;  2VBD A;  1DGR A;  1PO2 3;  3ZO0 B;  4AF9 A;  4AFC A;  1LHW A;  4QPI B;  1DDL A;  1XYO A;  2FHR A;  3AFG A;  1WA6 X;  2YHJ A;  4R9A A;  4AQ2 A;  4UFM A;  2GND A;  4XZU G;  5A1L A;  1BBT 2;  4LO7 A;  5GLW A;  3ZPY A;  4GZ9 A;  1HRI 1;  2XOM A;  1GR3 A;  2VZS A;  3TYJ A;  5C33 A;  3I3B A;  3VLB B;  4CCO A;  5EYX A;  3W5N A;  5F9T A;  1ST8 A;  3OJB A;  1AX0 A;  5IVV A;  4CDQ C;  1YUD A;  4XMA A;  4K9S A;  2PHD A;  1NA1 C;  2FCT A;  1SAC A;  3HQR A;  4CE8 A;  2BOJ A;  2R0F A;  2VZR A;  1HRV 2;  3GHM A;  1X9T A;  1BEV 2;  3SLI A;  3AX4 A;  1WD3 A;  3CU7 A;  1RUI 2;  1H1I A;  3C7E A;  3ZN6 A;  5FP4 A;  1UNB A;  2VW0 A;  3V64 A;  1Y9M A;  4NHL A;  4HOO A;  3UET A;  2UWA A;  1GV9 A;  2QQP A;  1OKQ A;  5K0U B;  1K5M B;  1VRH 3;  2J1U A;  1H2L A;  3PHM A;  3ZN5 A;  2GU9 A;  4YWA A;  2PHF A;  4Q26 A;  1CAV B;  1WW4 A;  2P17 A;  1RJ8 A;  3POI A;  2V5Y A;  5T55 A;  1X82 A;  3VBU C;  1Y3T A;  5FZO B;  3HOB A;  4CCJ A;  2BUK A;  2WII B;  5FP9 A;  5I8S A;  1S0G A;  3E97 A;  1RUE 1;  1FV3 A;  3PU3 A;  3HNM A;  2CHH A;  4FPY A;  3VDD B;  4JQR A;  3WNK A;  3ZYI B;  3K4Z A;  5C8W A;  1ENX A;  4NUB A;  1UYY A;  1ZX5 A;  4LBQ B;  3ZXE A;  2HWB 2;  3UJO A;  4AOC A;  2H6B A;  3POF A;  1Z7S 3;  4S2H A;  2UU8 A;  3NAP B;  1HN1 A;  1S0F A;  4JTN A;  5BYN A;  2W3J A;  3EBR A;  2IVJ A;  2Y33 A;  3ZFF A;  4L9B A;  3WG3 A;  1PMI A;  1OOP C;  1WGP A;  2XWJ B;  5D8A C;  4WM8 B;  3S5Q A;  1UL9 A;  1LB2 A;  4DO0 A;  4W6Y A;  1VR3 A;  1OI6 A;  1NE6 A;  2J1T A;  3N7L A;  2NYY A;  5FZ9 A;  4ZZ5 A;  5E1R A;  5IVE A;  2EID A;  2OW4 A;  1TME 3;  1WCK A;  1W8U A;  3CLP A;  5DG1 A;  5IYY A;  5JZG B;  1JYI A;  3OPZ A;  3B3Q E;  5FMO S;  3E5Q A;  1U5Z A;  1NXD 1;  1SBE A;  1OA4 A;  1OLM A;  3VZM A;  4BME A;  4K1Y A;  1B35 B;  1J3P A;  4ARY A;  3DKQ A;  1VBD 1;  3IMN A;  4FPG A;  4LHL A;  1N1T A;  2C9K A;  2JE7 A;  2JG8 A;  1W8Z A;  4ZZ8 A;  5FZ6 A;  1QJX 1;  1AR7 1;  4ORF A;  4QX5 A;  1KIT A;  1YNA A;  3AB0 A;  3T2O A;  3C7H A;  4NHY A;  4JX0 A;  1PGL 1;  2QKD A;  5FY9 A;  5BNN B;  1VBE 3;  1UZY A;  2MEV 3;  4WM7 A;  3K4A A;  1MS8 A;  1FI2 A;  1Q8Q A;  2F4L A;  3MIB A;  2QNK A;  2EF6 A;  5FRA A;  3RMY A;  2A75 A;  1GP5 A;  1Y9Q A;  2P37 A;  4H55 A;  4F83 A;  3O1P A;  2NN8 A;  1V9U 2;  2RHP A;  4CP9 B;  1U12 A;  3I2J A;  4LK7 A;  3ZLI A;  1XNT A;  4L8Q A;  5GZG A;  2QZ3 A;  3LFM A;  1Q43 A;  1UX7 A;  2XLF A;  3I2O A;  1H8T A;  2PLV 2;  1SFY A;  3AP4 A;  5F8P A;  1EAH 3;  4BIO A;  4GWN A;  4BE3 A;  1LJ7 A;  4I0A A;  3M3E A;  2RDQ A;  4RHV 2;  1XRU A;  2D5F A;  2ZGP A;  4DXR A;  2Z4F A;  3ZN4 A;  4D7S A;  5F2S A;  5GLU A;  2HWE 1;  1FAT A;  5H9R A;  2LRP A;  5ANN A;  3GZT B;  1FNY A;  2X5I B;  1VPH A;  2ZOE B;  1D4M 2;  1VBB 2;  4Q29 A;  4RR3 A;  5K9Y A;  1I5P A;  4IV3 A;  2XBO 3;  1DG6 A;  2ZGT A;  1R08 1;  3NW4 A;  3LEI A;  5EP9 A;  3J7N A;  4OUL A;  4YVW B;  3VKO A;  1L7L A;  5A6Z A;  1S2B A;  2QTW B;  4IEQ A;  3IMM A;  2SBA A;  2CAV A;  2VUC A;  4M4P A;  5F37 A;  2OVU A;  4YFW A;  4M4R A;  4L2N A;  5K7P A;  4D6S A;  1FAY A;  1CAW A;  1NCQ A;  2BZD A;  3MDP A;  1UY2 A;  4FVV A;  4CVU A;  1DGR N;  4Y26 A;  5FK8 A;  5T5J A;  1V6M A;  2WQ4 A;  4PI0 A;  5BNP C;  2XJU A;  2YPD A;  2JDU A;  3FLP A;  3K3O A;  4C90 A;  2J42 A;  3ZFE A;  1PVC 3;  4DUW A;  4DMI A;  1WZX A;  1VAK A;  5EJ1 B;  1JYV A;  4FFG A;  5E89 A;  2ZZJ A;  3R4U A;  4P5H A;  5C8C B;  1YRZ A;  1W6N B;  2ZTN A;  3J8F 1;  3FHA A;  3K4D A;  4Q8L A;  3WF2 A;  1W39 A;  1UN1 A;  3AMQ A;  2B45 X;  3ETQ A;  4XW3 A;  4GH4 A;  5FZE A;  1JZ7 A;  2WN2 A;  2IXK A;  4UFH A;  3VHN A;  1GFF 2;  1WBL A;  4XUR A;  3RZJ A;  3B5L B;  3KSC A;  2CGO A;  2ZAC A;  4AI0 A;  5I0S A;  1BBT 3;  4A42 A;  1ZNP A;  2Q8C A;  1SEF A;  1W9W A;  5FYC A;  4AFD A;  1BCX A;  3Q9O A;  1I6X A;  1OQD A;  1RIR A;  3I49 A;  1W0P A;  3ZIX A;  1JYX A;  3SXW A;  1AYM 1;  1HRV 3;  2XKP A;  1BEV 3;  2FDH A;  1W90 A;  4XJU A;  4LUL A;  5A7N A;  3ZN6 B;  1WLC A;  3H9A A;  5HCA A;  3E6C C;  1RUI 3;  3VBS B;  3NMB A;  1NE4 A;  2G9Z A;  1OUS A;  3RZZ A;  5BY5 A;  2BDR A;  1DLC A;  2EIE A;  3LOI A;  1WMD A;  1AVB A;  1KEX A;  2VQ0 A;  4N9H A;  4V2W A;  5LK7 B;  2VU9 A;  1JYC A;  4E4H A;  1QDO A;  1W8N A;  5H9P A;  1RB8 G;  2CGP A;  1FV2 A;  5F5A A;  5HCB A;  4G3Y C;  5JXI A;  1KD7 A;  4QDR A;  3WNP A;  3VBR C;  3O0W A;  4AGR A;  1SLL A;  4LKF A;  3IDE A;  4RGG A;  5BNO C;  2O14 A;  1YCI A;  2J7M A;  3DPR C;  5FQ0 A;  4HL0 A;  5EJ3 A;  5IK8 A;  2V5D A;  2QE3 A;  4KU8 A;  3AYC A;  4QXK A;  2WDB A;  3OOX A;  2HWB 3;  3NJY A;  4CU9 A;  2V73 A;  5LCW L;  3RI8 A;  3D82 A;  1OVS A;  2YFU A;  2WFF 1;  3CDZ B;  3HMY A;  3ZFF B;  4RA0 A;  5JVV A;  2ZEY A;  3AMN A;  1SPP A;  2WRA A;  5C4W C;  1H30 A;  1BK0 A;  1AR8 2;  3TN9 2;  3PJQ A;  3LPG A;  1WA4 A;  2XPJ A;  1UX6 A;  1N3Q A;  3JXS A;  4LA2 A;  4YVS A;  3WOG A;  5C3R A;  3VV1 A;  1C4R A;  1C8M 2;  1RVF 2;  3AKP A;  3ZYR A;  5DG2 A;  4J6G A;  2A6X A;  4LE3 A;  2FZ2 A;  1OC1 A;  1P8J A;  3RZL A;  4PI2 A;  5FUI A;  1CJD A;  4AE2 A;  3IIA A;  1ND3 C;  2VQA A;  1SFN A;  2R07 3;  3BCW A;  3IPV A;  4IES A;  2AZ5 A;  3ZVX A;  1JBC A;  3JB4 C;  2JD9 A;  2JDA A;  5C3O A;  5LY1 A;  1J3Q A;  4QGM A;  3N7M A;  1HV1 A;  4KGG A;  4XFB A;  2AEZ A;  3BU0 A;  2RS5 1;  1J84 A;  1I5Z A;  3IDC B;  3IWZ A;  2WNE A;  1MEC 2;  4AI9 A;  1BMV 1;  5IFT A;  2UY9 A;  1RUJ 1;  2P1B A;  2Y64 A;  1WWY A;  3KGL A;  4J25 A;  2YB7 A;  4ZPI A;  2VR4 A;  4N43 C;  5KXD A;  3KZ4 C;  4JHZ A;  3WF4 A;  2LUW A;  3I4I A;  1XXN A;  2DYC A;  1F2N A;  1PNG A;  1V9U 3;  1YLL A;  1SCS A;  2NPI A;  1QHD A;  3MO4 A;  4YW1 A;  5C3S A;  1W9Y A;  3PNA A;  4NRP A;  2ZEW A;  1AX2 A;  5HBA A;  1POV 1;  2PLV 3;  2F6B A;  2RG4 A;  3RRD A;  1QH7 A;  2RS3 2;  3I2G A;  5FRE A;  5C9A C;  2Z79 A;  1GMM A;  1TEI A;  5L9B A;  1NQD A;  4NII A;  4RHV 3;  5H9S A;  4AR2 A;  2WZE A;  4EN8 B;  4NR1 A;  4ZY9 A;  1QXP A;  2HWD 2;  5T52 A;  2RDN A;  4RR3 B;  1W9F A;  4IV3 B;  1D4M 3;  1VBB 3;  1YI7 A;  4E2S A;  5F7U A;  3LD8 A;  4Z07 A;  1QOO A;  4M01 A;  3FLT A;  3SHR A;  3SKV A;  2WS9 1;  3QH6 A;  1RUD 2;  4YW7 A;  1KDM A;  3GJB A;  3MID A;  2HH9 A;  4QHO A;  4XBN A;  3T1M A;  5IFP A;  4HPK A;  4IE4 A;  3VL8 A;  4HKL A;  2E32 A;  3H8O A;  1RTV A;  1V6I A;  5F1R A;  2P2K A;  3OF1 A;  1W0N A;  4DXZ A;  4PIZ A;  5JDB A;  4LKE A;  1VAL A;  4XF0 A;  2CV6 A;  3EO6 A;  3E5X A;  2VOW A;  2XG3 A;  4JDN A;  4ITC A;  1OUR A;  4NIA A;  1X33 A;  2CAU A;  2YU1 A;  2V72 A;  3UKN A;  5CKN A;  3NV1 A;  4URT A;  3QOP A;  4QDQ A;  5EHD A;  3PIG A;  3ZYF A;  1R1A 1;  1UYZ A;  1XE8 A;  4V2V A;  2IUW A;  1GP6 A;  3M8L A;  2WYS A;  3JBG 2;  4Q2F A;  2W87 A;  5A7O A;  4OHZ A;  2OQ6 A;  4U36 A;  1VBA 2;  5KWR A;  4V1P A;  4D3W A;  4CYD A;  1RUH 3;  2E7T A;  1DYP A;  1ODN A;  1HQL A;  1NLQ A;  1MS5 A;  3OUJ A;  1NKG A;  5J98 B;  3JD7 2;  4IUG A;  3ASI A;  3KVB A;  3AC0 A;  3AKS A;  1ASJ 1;  3P5B A;  2XUE A;  4QPG A;  3S0M A;  4M3C B;  5LWB A;  4AK3 A;  1BK1 A;  2OQ7 A;  5E8A A;  4GMP 3;  4Q4Y 1;  3ZXF A;  2E6V A;  1H1M A;  2HWF 1;  3NV2 A;  4GB3 2;  4Y24 A;  5T5O A;  3RGB A;  4A2U A;  3LIH A;  4IQP A;  2D97 A;  3KF5 A;  4QB6 A;  4KI5 M;  5FUN A;  5FYY A;  3VBH A;  5A70 A;  1JYW A;  3MYX A;  3SEP A;  4MV2 A;  3UYJ A;  1RYY A;  2XVK A;  2EVX A;  4S2G A;  1GOG A;  4AG4 A;  5IAT A;  4OHY A;  4QKD A;  1JU4 A;  4S2D A;  2VUD A;  4ZXK A;  1NY7 1;  3NNF A;  4YZ1 A;  1ND2 B;  3S6P A;  4BK5 A;  4PDW B;  1Y9G A;  3CNA A;  1J1L A;  1UY0 A;  4I01 A;  3ZXA C;  2LW8 A;  1IPK A;  5FZ7 A;  4FT8 A;  3MIH A;  1V00 A;  1GLH A;  1T6G C; 
#chains in the Genus database with same CATH homology
 2W94 A;  1MPX A;  1H6Y A;  2WO1 A;  4GWI A;  3K75 B;  5DN2 A;  4E8D A;  3VDA A;  4QDS A;  3C7G A;  1PMJ X;  1UWW A;  2RVA A;  3I2K A;  4KWU A;  2X09 A;  1JZ5 A;  3OGS A;  4ZXE A;  3T2Q A;  2VC9 A;  2YFZ A;  5C70 A;  2BBA A;  1EUU A;  1NAE A;  3I2H A;  3WNO A;  2RV9 A;  5G05 L;  3I2F A;  3W5M A;  2B9V A;  2VCC A;  2VMF A;  3C7O A;  2J1A A;  1JZ4 A;  2E31 A;  2QQN A;  1CX1 A;  4CU6 A;  1OT5 A;  2W95 A;  4PT6 A;  3HNB M;  4PQQ A;  3OEA A;  2Y6J A;  4JKL A;  1UMI A;  2ZXQ A;  4TTG A;  4XUT A;  2QQM A;  1JHJ A;  3CZJ A;  4FI9 A;  1DYO A;  2VQT A;  3IAQ A;  2W1S A;  4QB1 A;  1UY1 A;  4MOA A;  2QQL A;  2Y6K A;  4P02 B;  2J1V A;  2W47 A;  5LA0 A;  5B4N A;  1GUI A;  2BER A;  1DP0 A;  3E1F 1;  3K77 A;  3VDC A;  3OBA A;  3T0A A;  2WN3 A;  4Z2A A;  2PQS A;  5HPO A;  3THD A;  4DUV A;  1OF4 A;  4ET7 A;  2QBX A;  4QB2 A;  1F4A A;  4MAD A;  2ORX A;  3HN3 A;  1W9S A;  3ETP A;  3WF0 A;  1GQP A;  4DEV A;  3VD7 A;  2WO3 A;  4JKK A;  3DYO A;  2QQO A;  4BXS V;  2VCB A;  1UMH A;  3C7F A;  3DYP A;  2VZ3 A;  2XON A;  4JKM A;  1UYX A;  2VO5 A;  4XZU G;  3SKJ E;  2XQX A;  4GZ9 A;  2XOM A;  4OZO A;  2VZS A;  4CUA A;  1ULP A;  3I3B A;  3W5N A;  1T2X A;  2BGP A;  2WQ8 A;  3WEZ A;  2W46 A;  4QPW A;  1UY3 A;  2VZR A;  4CUC A;  3DYM A;  2YC4 A;  3MV0 1;  3PUH A;  3P6B A;  5C7G A;  3C7E A;  4A4A A;  3CQO A;  4OUE A;  5CZK A;  5JXG A;  3UET A;  2X05 A;  3P1I A;  2J1U A;  3A23 A;  4W50 A;  3MBW A;  1K42 A;  4GWJ A;  3HOB A;  1O8P A;  1UY4 A;  1CZT A;  2VTF A;  2HYX A;  4D8M A;  2VJX A;  3HNM A;  3WNK A;  3NJX A;  3K4Z A;  3LEG A;  1UYY A;  1CIY A;  3MUY 1;  4UI9 L;  2YG0 A;  1HN1 A;  2VMD A;  2W3J A;  3DEC A;  3I3D A;  2W1Q A;  2ID4 A;  3FL7 A;  3OB8 A;  2WUH A;  5JXH A;  2WAB A;  2J1T A;  4ZZ5 A;  4XVH A;  2CDP A;  1TG7 A;  2EID A;  4OMC A;  5IYY A;  2WAO A;  3LEK A;  4A44 A;  1PX3 A;  3F2Z A;  2KD7 A;  3ECQ A;  4A41 A;  4ARY A;  1GOH A;  4ZZ8 A;  4DUX A;  2C9K A;  3T2O A;  3C7H A;  1OD3 A;  4JX0 A;  3ACI A;  3CIH A;  1NX9 A;  4XUN A;  2VOT A;  3K4A A;  1K3I A;  1OF3 A;  1J83 A;  1XC6 A;  3I2J A;  1XNT A;  2VQU A;  1UXZ A;  2OKX A;  1UX7 A;  3NRU A;  2C26 A;  3ACG A;  2YC2 A;  4LKS A;  3GXU A;  5HXM A;  2QQJ A;  2W9X A;  3VD4 A;  1OH4 A;  4DXR A;  5JR2 A;  3WSO A;  2Z4F A;  1BHG A;  2VZQ A;  4HG6 B;  3T08 A;  1I5P A;  5JMO A;  3LEI A;  4OMD A;  2QQK A;  3CZU A;  3ACF A;  3OGR A;  4E8C A;  3T0D A;  4DEQ A;  5G04 L;  4M4P A;  1K45 A;  4M4R A;  5DPN A;  2ZEZ A;  3ACH A;  1US2 A;  2BZD A;  2V4V A;  4CVU A;  1UY2 A;  5EJZ B;  4BK4 A;  3A21 A;  3HNY M;  5EIY B;  2VZP A;  1JYN A;  3NNG A;  4L0P A;  1D7P M;  2QQI A;  3U37 A;  4DUW A;  1JZ3 A;  2BGO A;  4P00 B;  5EJ1 B;  1JYV A;  3OG2 A;  4CU8 A;  3K4D A;  3FHA A;  1IQD C;  3ZM8 A;  1O59 A;  1GU3 A;  3WF2 A;  3A22 A;  5LA2 A;  3GM8 A;  4BJ0 A;  1JZ7 A;  2WN2 A;  1JZ2 A;  3SEE A;  3GGL A;  4XUR A;  3K46 A;  2JKX A;  2VZT A;  2W91 A;  3I3E A;  4XUQ A;  1O8S A;  4A42 A;  3EYP A;  3OEB A;  3BGA A;  4A45 A;  1UZ0 A;  1W9W A;  4XUO A;  1JI6 A;  5IHR A;  2VZU A;  3WNL A;  2Y8K A;  5I0D A;  1PX4 A;  1JYX A;  2J1E A;  2VL4 A;  3UNP A;  4CU7 A;  5DMY A;  2WO2 A;  4AAX A;  2W5F A;  3UES A;  3PUI A;  3LQC A;  1DLC A;  1PMH X;  2EIE A;  2Y6H A;  1KEX A;  4RYD A;  4W8J A;  4RN5 A;  2DCJ A;  3NJV A;  2LS6 A;  1W8N A;  4QX2 A;  3VD5 A;  1WCQ A;  4QX0 A;  1W8O A;  5JXI A;  1W9T A;  3CKH A;  3THC A;  4QDR A;  2RJ2 A;  3WNP A;  4DXT A;  3HEI A;  4YPJ A;  3FHQ A;  2J7M A;  4DXS A;  2V5D A;  4CUB A;  2WDB A;  3I2I A;  3J7H A;  4CU9 A;  3LPF A;  5LCW L;  1XNA A;  1NUK A;  2DDU A;  2YFU A;  3CDZ B;  2R7E B;  1K12 A;  2VCA A;  2ZEY A;  2B4K A;  3I97 A;  1H6X A;  1CZS A;  1JU3 A;  2E33 A;  2VM9 A;  3LPG A;  3JXS A;  1US3 A;  5IJR A;  2E26 A;  1P8J A;  5FUI A;  2JD9 A;  2JDA A;  5J1X A;  4MO3 M;  3OGV A;  2VME A;  1CZV A;  3WNM A;  4LQR A;  3WF3 A;  1J84 A;  3IAP A;  5DQ0 A;  1UXX X;  5IFT A;  3VDB A;  1WKY A;  2Y64 A;  1GOF A;  2YB7 A;  2VR4 A;  2CDO A;  4JHZ A;  5B4X A;  3WF4 A;  4TXW A;  2WZ8 A;  3MO4 A;  3VD9 A;  1ULO A;  4P08 A;  2J22 A;  2ZEW A;  1KGY A;  3I2G A;  2J1R A;  1GMM A;  4UAP A;  2C4X A;  2XHN A;  2WZE A;  2Y6G A;  4QX1 A;  4ZY9 A;  5A1A A;  2X10 A;  3FN9 A;  3WNN A;  4P5Y A;  4LPL A;  5F7U A;  3ABZ A;  3T09 A;  3SKV A;  1LNS A;  3LE0 A;  1SHW B;  4OYU A;  5IFP A;  2Y6L A;  1JZ6 A;  1TVG A;  2E32 A;  3C8X A;  3WQB A;  1GNY A;  5LA1 A;  4QAW A;  1W0N A;  4QX3 A;  1JZ8 A;  5JUV A;  3III A;  5CYY A;  1W99 A;  2V72 A;  3IB3 A;  3MUZ 1;  1SG3 A;  1XPW A;  2L9L A;  2W1W A;  3GDB A;  4QDQ A;  3HPN A;  1UYZ A;  3D3A A;  3CMG A;  2ZEX A;  2WAA A;  4A3Z A;  2W1U A;  3NQH A;  2WYS A;  2W87 A;  4XUP A;  4KMQ A;  1R64 A;  1NKG A;  4IUG A;  2HLE A;  1L7R A;  3AC0 A;  2ORZ A;  5C71 A;  4MGQ A;  2W92 A;  4W4Z A;  2EIC A;  4LHS A;  3A7Q A;  4ARX A;  1YQ2 A;  4PF1 A;  3T0B A;  2VZ1 A;  2JE8 A;  3IDA A;  1EUT A;  3EB7 A;  2EIB A;  4A6O A;  4QB6 A;  3VD3 A;  1L7Q A;  4KI5 M;  3T2P A;  3MV1 1;  1JYW A;  4D0Q A;  2VZV A;  3SEP A;  4UOJ A;  2VMC A;  1RYY A;  4AG4 A;  1GOG A;  1JU4 A;  2DCK A;  1F4H A;  3WF1 A;  2WBK A;  3BN6 A;  1SDD B;  4MGS A;  4BK5 A;  5JXJ A;  1UY0 A;  2J1S A;  2LW8 A;  2VZO A;  4BDV B;  3HJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...