2GC2A

The crystal structure of phosphoglucose isomerase from pyrococcus furiosus in complex with fructose 6-phosphate and zinc
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
188
structure length
188
Chain Sequence
MMYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Glucose-6-phosphate isomerase
publication title Evidence Supporting a cis-enediol-based Mechanism for Pyrococcus furiosus Phosphoglucose Isomerase
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 40
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature ec 5.3.1.9: Glucose-6-phosphate isomerase.
pdb deposition date 2006-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2gc2A00
3U0ZA 2XKOA 1XE7A 2XHKA 5FLHA 2XLFA 1X7NA 3HT2A 4D7SA 4HBNA 3UKNA 2Q30A 1ZRFA 1UD1A 3S7EA 4E2SA 4MGYE 2GC2A 4IEZA 4YYOA 2BEOA 2BYVE 4FT8A 4IEOA 4QMAA 4YNIA 5KHJA 2P17A 3RZZA 3BCWA 1O3TA 4UXAA 3NL1A 3U10A 4HN0A 4Q0PA 4KWJA 2Z69A 3FWEA 3TNQA 1CAUB 3SCGA 2B5HA 4QM9A 3E6BA 4QM8A 1PMIA 4NVPA 3H8UA 3PLQA 1TQ5A 4KWKA 2B9UA 4YRDA 1O5LA 4WZCA 4RD7A 1J3RA 1UW8A 1L3JA 2H6CA 4HVOA 4XF3A 4BH9A 4AXOA 2UY8A 4LUKA 3TNPB 4GULA 3ZDSA 1NZCA 2N7GA 2F4PA 5JAXA 2GAUA 4BHPA 3E6DA 4MGIE 1CAXA 4XFAA 4R8HA 4I02A 5J7MA 4YSFA 4O9GA 4JTOA 4EROA 5FPXA 1ZRDA 4PJYA 2QDRA 1HW5A 4ORFA 2D93A 3O14A 3PVBB 4IEVA 3IIAA 4AQ6A 2BNMA 4EV0A 2Z2SB 3EO6A 3NW4A 3SMHA 5FQ0A 3RYKA 4HN1A 4HSJA 3R6SA 4BYYA 2Q4SA 4FAGA 5KHGA 4QXKA 2GH2A 2FQPA 5KHHA 1EPZA 3OTFA 1QWRA 5I0RA 2PHDA 3DN7A 4F7ZA 1FT9A 2IXLA 4LA2A 5FCCA 2PAEA 5I8YA 4I0BA 5AVPA 1GQGA 2ET1A 5KHIA 4UBGA 4IEYA 2GC0A 5FDBA 5J3UA 1ZZ8A 1YUDA 2ZKLA 1SQ4A 5CU1A 4XF0A 2IXKA 5JSOA 4ONUA 2KXLA 2ATFA 3ETQA 1CAWB 3U11A 4KU8A 3D0JA 3ES4A 1SFNA 3C3VA 3H1YA 4LUMA 2OPKA 3OD0A 3RYRA 3LA3A 3IDCB 2HJIA 5I0SA 4X6RB 1CX4A 1YFYA 4XFHA 1IPKA 4FAHA 3I59A 1YFUA 2GC1A 5BY5A 2IXIA 1NYWA 3D82A 1UIJA 2WC2A 5EFUA 4META 1RUOA 2C0ZA 3H9AA 4EWEA 2D40A 1H1MA 3H50A 5FPZA 3CEWA 2CAVA 2PFWA 3H1MA 3BPZA 4OLLA 4QGMA 4WBBA 5JR7B 3NJZA 4MGZE 5LEKA 1YFWA 3OF1A 5HI0A 4Q0QA 2IXCA 1NXMA 4XF9A 1ZZ9A 4ZU7A 3I7DA 4HVRA 2Q0AA 1CAVA 3QOPA 1LR5A 2I45A 5LRRA 2PTMA 1JUHA 3I54A 4XFBA 3ES1A 2GU9A 4I01A 2EAAA 1LRHA 5LRSA 4HMZA 1Q5OA 5E1RA 3WW4A 3ACLA 5JCTA 5EZWA 2BNNA 3GBFA 5D1IA 5LEJA 3WW1A 4ZU5A 1YHFA 1UIKA 2MPFA 1ZNPA 1ZZCA 5BV6A 1RL3A 2UY9A 3H3ZA 3M70A 2BNOA 1ZRCA 3SCFA 2PYTA 1RTVA 2V09A 1CAXB 3NSTA 4MZUA 2CAUA 3CL1A 4IESA 4LLOA 4HVQA 3UKVA 4MV2A 1O4TA 4LULA 2OA2A 5FLIA 2UYBA 3FE5A 3ELNA 3E5UA 1OD5A 3E5XA 3EJKA 3JZVA 1O3QA 1RUNA 4E2GA 1Q43A 3SXWA 3MZHA 3NKTA 5FQ0B 4HZFA 1CGPA 3FJSA 3IWZA 4IEQA 3OCPA 3EHKA 1OFNA 4D7TA 1DGRA 4BIFA 1IPJA 1EP0A 5F1RA 1V70A 2FMYA 2BGCA 3L2HA 2OZJA 3MPBA 3NVCA 4AVBA 5FLJA 4CYDA 5CADA 2QVSB 3M3IA 4B29A 3KGLA 5I91A 1X8MA 4E2QA 1SEFA 4L2NA 5CVRA 1Y9QA 1ZVFA 4LTAA 4I2OA 1NE6A 3EQEA 2OYZA 2D5FA 3MYXA 4Z07A 3RDIA 3WW3A 4PIXA 5C8WA 1NE4A 2VQAA 1DGWA 1ZX5A 2IXHA 4HSLA 2XLGA 5I93A 3ST7A 3RNSA 4MH0E 2XKPA 4XFFA 1WA4A 3DL3A 3I59B 3FFQA 4QGLA 3SHRA 3FX3A 4KU7A 1XRUA 4EWDA 1X8EA 2VPVA 1DZRA 1EY2A 3H3UA 4I09A 4LA3A 4XETA 3B02A 3D0SA 3RYPA 5E16A 3DV8A 4Q0UA 3LWCA 2MHFA 3IDBB 2ETEA 3KCCA 4XFCA 4MX3A 1ZZBA 1YLLA 4WVZA 3RPQA 3N4MA 2XL9A 1O7FA 4MUVA 5K8SA 2VECA 3ROUA 3FHIB 4XF1A 5KBFA 4OFGA 1CAVB 3LA7A 3LA2A 2IC1A 1ZZ6A 2PAMA 3BU7A 4TLFA 1LB2A 1O3SA 3HIFA 4P9GA 2EA7A 4LEJA 3S7IA 4F8AA 5JSPA 3BALA 4R52A 1J3PA 3G7DA 3PNAA 3LAGA 1O3RA 1Q3EA 3E5QA 5KHKA 2Y0OA 4XFIA 1J58A 3KGZA 4XF4A 3E97A 1VR3A 1FXZA 4O9EA 3E6CC 3EBRA 1WGPA 4PIYA 1H1IA 3LOIA 2Q1ZB 4K8FA 3KMHA 1QXJA 4IEXA 3WW2A 3MDPA 4KWLA 2GZWA 2DCTA 3KSCA 4IEWA 1OI6A 2HKXA 4XFGA 4I0AA 3USSA 1CAUA 2QNKA 5I8TA 1WLTA 2PQQA 2WFPA 3H1WA 4Q0SA 1FI2A 1U12A 2H0VA 1X82A 2O8QA 2OZ6A 1UPIA 1EYBA 1LKNA 1VJ2A 4JTNA 1Y3TA 1RC6A 4QX5A 1RGSA 2GC3A 4IEPA 2QCSB 5I0TA 2ET7A 3CF6E 4XEZA 3UKTA 4X6QB 3BB6A 1ZZ7A 1YWKA 4FBFA 1XE8A 4UBHA 2PA7A 4AVCA 4HLTA 1I6XA 3H7YA 2K9ZA 4IEUA 2IXJA 5I0UA 3CLPA 4N9IA 3HT1A 3FZ3A 4KL1A 4ZU4A 5J48A 3CO2A 4Q29A 2QJVA 4QGNA 4JV4A 3VHRA 1G6NA 2E9QA 1QY4A 5BUVA 2UYAA 1OMIA 4AVAA 3DKWA 1GQHA 1VP6A 4AQ2A 4EWAA 4L11A 4Z82A 1ZRRA 2CGPA 3HQXA 3H7JA 4J1XA 4PIZA 4DINB 1CAWA 1DZTA 4MGKE 1ZREA 5BXXA 2H6BA 4YARA 2PAKA 2EVXA 2XL7A 5I8SA 3S0MA 2ZCWA 2XLAA 4IERA 5T3NA 3LZZA 2O1QA 2XGXA 1J59A 3IBMA 4J1WA 1J1LA 4N9HA 1UCXA 4H7LA 1J3QA 5JSRA 3GYDA 2D5HA 5C6CA 4JVAA 2PHLA 2CV6A 2MNGA 3SCHA 4Q0VA 1I5ZA 4I3PA 5BPXA 1QXRA 2K0GA 2B8MA 3CJXA 3OGJA 4A2UA 1YFXA 3QACA 4IETA 1O5UA 1PM7A
chains in the Genus database with same CATH superfamily
3U0ZA 4Q8KA 1SACA 2QQWA 4AEDA 5FLHA 4BXSV 2LALA 3M3EA 2ZHNA 1W05A 2CDOA 2ZMNA 4E4HA 4QPGB 1ZRFA 1CJPA 5DPNA 3IZOA 3DCQA 1JTZX 4Q4W2 1UYYA 4A3XA 2IFRA 4YYOA 3ZSEA 2BEOA 3JUUA 3VBUC 4FPHA 4DY3A 2BYVE 4FT8A 4IEOA 4X8NA 4YNIA 5FY5A 3LIGA 1WUVA 4Q5OA 3BCWA 5IJRA 1ZBE1 3CJIB 3RZZA 1G9CA 1O3TA 1H6XA 4GH4B 4XAEA 4NIDA 4P9JA 3V0BB 3ACIA 4Y20B 3BN6A 4JGYB 1V6OA 4HN0A 4Q0PA 1W2OA 4CCLA 4CDQC 4ZONA 2NQYA 1DCSA 1YQ6A 2RS13 3POJA 1CAUB 4QQ2A 5FZ0A 1XSRA 2B5HA 4QM9A 1VBA3 1GP6A 3DYMA 4QM8A 3SCGA 2C5DA 3H8UA 5BNNB 5JMOA 1G9AA 5AFBA 3WDVA 3V65A 3Q8AA 3IPVA 4AG4A 1VRH1 1TQ5A 4QB1A 1B35A 4KWKA 1ENXA 3BODA 4RD7A 2CY6A 2H6CA 1QDOA 4HVOA 4XF3A 1W6OA 1BK1A 2YDEA 3ZDSA 2WT2A 1FYUA 5JAXA 2GAUA 4WM7B 4MGIE 1MZEA 1R092 3AP7A 5CFDA 1UU5A 2DBNA 2OW4A 1IGOA 4N8MA 4R8HA 1X36A 2VMIA 2DBIA 2Y0IA 4CXWA 1ND3C 4RS5A 5DUWA 4L97A 1FPN1 5IVCA 4XYXA 1RJ7A 4JTOA 2ARAA 3NJVA 3MIHA 1RUH1 4YVWC 5GM0A 4EROA 5FPXA 1YJLA 3R4DB 4S2HA 4J6GA 3LPFA 1HW5A 2O0OA 5K7PA 3LB9A 1QJU2 3ILRA 2VD7A 3I2JA 5FWEA 4EQVA 2GN3A 4FI9A 1ENRA 1RB8G 5FY9A 3SMHA 5ERLA 4FTBA 2DDUA 4KG0A 4LO4B 1YYNA 3U1XA 1XU2A 4YW1A 2Q4SA 4R4ZA 1PIV2 4QXKA 2GH2A 2NP0A 2FQPA 4MG2A 1UMIA 2R063 3THTA 3KS7A 4NPRA 1S1AA 2DCJA 3ZYFA 2LTNA 2QQVA 3I97A 2J22A 2YU1A 2TNFA 4K3UA 1YI7A 3BIWE 3N35A 3QCWA 4FXGB 2P3KA 4I0BA 5I8YA 4G9SB 2R072 1NLSA 1LOBA 2ET1A 5KHIA 3DPRA 1HX6A 1W03A 1ZBA3 2ARXA 3ENRA 3ZYBA 1SQ4A 5CU1A 3RMYA 5JSOA 4CEYB 4MGSA 3MW2A 2KXLA 4DOUA 4Y1ZA 3FFZA 4RHV1 1HXS2 3KQRA 1SCSA 1W8WA 2QQKA 1V6IA 2L9LA 4ITCA 5FY1A 3ZFGB 2OQ7A 1CAWB 2RDSA 1LOFC 1UKGA 2VXRA 2Q8CA 4KU8A 1MACA 2FD8A 2R0HA 5JLVA 3O1OA 3HJRA 5K9YA 1SFNA 1VLNA 5HPOA 1QHDA 3LQCA 2P3IA 1W8HA 4FOQA 4FPLA 4OZXA 2YPDA 4HOOA 3R4SA 1HKDA 4Q1PA 1AYM3 5GLWA 3BVCA 3LA3A 3OUJA 3IDCB 3N9OA 4Y22B 2HJIA 2AYHA 3A22A 1AL23 2AREA 1W8OA 5F3GA 3PL0A 1CX4A 5JI7A 2WR9A 1UOJA 4IW3A 4NAMA 4XFHA 3GZEA 3I59A 5C70A 4W6WA 2P34A 2GC1A 5EJZB 5BY5A 1GQPA 1HQWA 4AEKA 1LHOA 3URFA 4TZDA 1VALA 1WLWA 5G04L 3H9AA 4B4RA 3FBMA 2R041 3LEGA 5J98B 3H50A 3ZSLA 2EXKA 2Q1MA 4EWAA 1IG3A 1OQEA 3J8F1 3OEBA 2X53S 3BPZA 4YM2A 1D2QA 3LFIA 2MEV3 3NJZA 5FZDA 1ZBE2 2YYOA 5HI0A 1R64A 2IXCA 3APBA 2VNVA 3TEZA 2OUJA 2DFCA 2VUCA 3LKJA 5DXDA 5FPVA 5JXJA 3QLQA 4HK8A 5FO9B 2GNTA 1YXWA 4HVRA 4LIVA 5F2WA 2Y6LA 1O91A 1R083 4RS5C 4XVHA 1UXXX 3AL6A 1GP5A 5HBAA 5F2SA 3AP4A 4Q26A 3WNMA 3ZXFA 4AGGA 5EWSA 5FPUA 4LBQA 1VRH2 3L9JT 4OVEA 2YPJA 4WZFA 2RS31 4LO7A 4H3WA 2C1FA 4QQPA 1T2XA 5FO8B 5LRSA 2WO3A 5AVAA 1Q5OA 3IAQA 3ZYJB 1SLBA 3IM0A 2W1WA 2WZEA 2BNNA 3GBFA 4S2GA 5E88A 3Q9OA 5HCAA 3BI3A 1F5JA 1TEIA 1TVGA 3SQOA 2OVUA 1FPN2 2VUJA 3ATGA 1ACCA 4YZ4A 4ZU5A 5C71A 2ORXA 2BQPA 4LBJA 1RUH2 1UIKA 4RR3B 3POFA 1ZNPA 3T0BA 2KA3A 3I2DA 2A6ZA 1DBNA 1WD4A 1OA3A 4GKXA 1KDKA 2AC1A 5F6KA 5EHDA 1OQDA 1PZ7A 1ZRCA 2DVDA 4ATFA 5FMCA 2GMPA 3ACFA 5IT6A 5J09A 4AI0A 1UY1A 4FPOB 2BV4A 1CAXB 4LHKA 4NHKA 2CAUA 4YM3A 4CUGA 5JOZA 1O4ZA 1V00A 1RVF1 3O1TA 5FYTA 3MPPG 5FO7B 5C5TA 2Y6KA 2WNEA 1Y43B 1PNFA 2UYBA 4QD2A 3FE5A 2ARBA 1W39A 3ZLIA 4UF0B 3JZVA 4PF5A 5K0UB 4FFIA 1O3QA 5ISLA 4E2GA 3SITA 1OLQA 5LB6A 3FN9A 2LS6A 4QDQA 3RQ0A 4Z2WA 1NT0A 4AEJA 5IVVA 3POBA 3Q8CA 4RHV2 2JKBA 5FQ0B 3ZFEA 4BK5A 3IWZA 1PGW1 1ULPA 1D0GA 3PIGA 3KV9A 1ASJ1 2XVGA 1RMU1 2YB7A 2XHNA 4CP1A 1MEC3 3SKVA 1H2MA 4XUTA 3VBSA 4CU7A 3I2GA 1GMMA 1HB2A 1V6NA 3L2HA 2OZJA 1H6YA 2V4VA 1YC61 1ZA4A 1UYXA 4QHOA 5C5UA 5JZGA 2V5YA 2XJTA 2WJSA 1JN2P 1H9WA 3M3IA 3P3PA 2BP6A 4N7IA 5SV8A 4RYDA 3VKLA 3F2ZA 3RFRA 3D5OA 3R4UA 5FP4A 4AI1A 1QOSA 2A5ZA 2YBSA 4HPKA 4L2NA 2WQ4A 3QH6A 5HCHA 4Q4Y1 3LEKA 4I2OA 1I3HA 2HYKA 2D3RA 5FK8A 2Q8EA 2R042 1Q8PA 1C5IA 2VU9A 2GMMA 3RDIA 3DKQA 3WW3A 1VMHA 1P8JA 4H2AA 1FNZA 4PIXA 4JQTA 1NE4A 2DVGA 2VQAA 3VDAA 1AVBA 4A7KA 1GZWB 1BYHA 3J8F2 3N7LA 3O1UA 4S2FA 4NJ4A 3VD4A 1F35A 3LSEA 4MH0E 1IS6A 2XKPA 4G3YC 5FYYA 3S5QA 3CZUA 3AK0A 4OI2A 5KC5A 3LCPA 5IUQA 3RZHA 4INDA 4E4ZA 1RUF3 3FL7A 3FX3A 5ABJA 1GICA 2CWSA 1XRUA 1X8EA 2YFZA 4MSVA 4XJ9A 4I09A 5FY4A 2BVBA 4QX3A 1APNA 3B02A 3TBDA 4W50A 3GHNA 2XJVA 2NLRA 1ULGA 1CJDA 3RYPA 3PMEA 1RITA 5E16A 1NCRC 3ASIA 4CDWB 3THCA 5DZGA 3LWCA 2BGOA 2RS32 3JCIA 4WVVA 3VBOC 2JB4A 3AP5A 2BOIA 3FLPA 2ZX4A 3KCCA 4Y4RA 5GLTA 1XNKA 1ULDA 4WVZA 4XIOA 2XL9A 1O7FA 2W92A 2ZGOA 1HRI3 2XR4A 2WT0A 4OZOA 4P08A 2UWCA 2XJQA 2WNVB 4Q4X3 2VNRA 4C90A 4LMFA 1CAVB 3LA2A 4XTPA 4IUGA 3ZXKA 2IC1A 4XJ8A 1NCQA 5FZEA 1PK6C 3P3NA 4P9GA 3S7IA 5BNOA 4NWWA 3BALA 1AJOA 4WM8B 3ZYGA 4R52A 4C8DA 3C7OA 4LE4A 2VXJA 4LBMA 1AYN1 1OFSA 3G7DA 4NIIA 4LT5A 2VE1A 3ZFEC 1SPPA 3WQBA 1N3PA 1W9TA 2Y0OA 4XFIA 3ZMNA 4LK7A 5AC93 1SPPB 4BK4A 3BOWA 3JU9A 1RVF2 4LORA 1VR3A 4O9EA 4ZXEA 1UKRA 5FZFA 3VBSC 3WXPA 3WZ1A 5BNPB 3QD6A 5LATA 1H1IA 2HWE3 4KNCA 4K8FA 4B3NA 4BQ1A 4CCJA 2UU8A 3MDPA 3AVSA 2GZWA 4NPLA 1IQDC 3VN4A 4IEWA 1OI6A 3WOGA 1K3IA 1PO11 3I8TA 2DUPA 4LJHA 5FZ4A 1KRIA 4GKYA 2Q8OA 3NQHA 1RUD3 4EN0A 1RUJ3 4XBQA 3RVHA 3H1WA 4Y26A 5HXVA 3T09A 1F2NA 1F5FA 1PGW2 2Z4FA 4GD4A 1QXPA 4QX7A 5GZFA 2PHTA 4XUQA 1ASJ2 1RMU2 2GNMA 1MZ6A 3POIA 3KVAA 3ZN5A 1FV3A 2DF7A 4GJZA 1N1VA 1REFA 4IDZA 3VGIA 2R32A 4JTNA 1DP0A 2RJKA 4HG6B 3ZIXA 2PHWA 4BWOA 4QX0A 3KLSA 2VUAA 1LTEA 5IVBA 1U5ZA 4Q1RA 3VD3A 3CF6E 2LUWA 4YGEA 3I4IA 1ZZ7A 3POWA 1JYWA 4FBFA 5ABJC 3QH7A 3TEYA 4Q4Y2 1CX1A 3WY6A 1XE8A 5T5LA 3IIIA 2JG9A 4HLTA 2VOKA 4CVUA 3VZMA 5FYSA 1COV1 1Q56A 4Y3OA 3I3EA 3HQRA 4IV1C 3SC7X 3OGSA 2K9ZA 5FZOA 4MADA 1VB2A 2WBKA 2PHXA 2XWJB 1ULFA 2XBO1 1W6PB 3FZ3A 4KL1A 4NUBA 5IFPA 2RR13 3WR0A 3ZXEA 4OUSA 1LEDA 4M01A 4JV4A 2E9QA 3KZ4C 3VZOA 5F7UA 1OLRA 2UYAA 1OMIA 2A6YA 1YQ8A 2ZX2A 4E27A 2R1DA 1S2BA 4IV3A 1GQHA 1VP6A 5SV5A 3K75B 3ZOIA 4MHRA 2QUOA 4COWA 1HDKA 4L11A 2JD4A 1O59A 2YBKA 1LOEA 1NCQC 4LHNA 2RE9A 3PDQA 5GZCA 3NAPC 4Z92B 2UWAA 3UT0A 2ILMA 5C9AB 3RG0A 4J1XA 5IVYA 5FOJB 3IT8A 2WZPP 2XUMA 2BWAA 4DINB 4ARYA 4KG8A 3I2HA 4Q8LA 2JE7A 1W6MB 2D3SA 1MS8A 2X10A 1T6GC 4MGKE 5EQUA 3MIBA 1IKQA 2PLV1 2HEVF 1WCDJ 1E5SA 4NIHA 4MVTA 4HT1T 1UN1A 1GNHA 2CSGA 2XQRA 4FOWA 3S0MA 3RI8A 1HJGA 5L7OA 1UOGA 3FUQA 1LODA 1V6LA 1QU0A 3VKMA 3NNMA 4LBOA 3O7OA 5L7OB 1V6JA 2OUHA 1N1TA 1DLCA 4NOTA 3HNYM 1XQNA 3ZYRA 4CEWA 2DTWA 1A78A 1W0PA 4YVSA 1J1LA 4P9WA 1AYN2 4COYA 2BJSA 2VOWA 4BMBA 4AQTA 5A3UA 1QH7A 3RI9A 2OKXA 2Y34A 3GYDA 1AR63 1W8FA 3M2MA 5FMDA 4XPVA 4LKEA 1KS5A 1KXGA 1Z78A 1ONAA 4Y5SA 3WF1A 2JG8A 4HANA 4M3CA 1I5ZA 4N43B 2DVFA 3OG2A 5JXIA 2BOJA 3OGJA 3WDTA 4A2UA 2WFF3 1YFXA 4AGRA 1BQPA 3MUZ1 2FCTA 3OOXA 1KJLA 2HWD3 3HQUA 4IETA 1DYPA 2A7AA 3T3YA 4AW7A 2BZDA 1PM7A 5T52A 3EXUA 4CPBD 1PO12 1XE7A 2XHKA 3S6PA 4P9LA 5JXGA 2BGPA 4HBNA 1OOPB 3MHZA 5F3EA 3U37A 1G7YA 5A6XA 1G9BA 3AVRA 4RQPC 4E2SA 2RS11 2GC2A 2AENA 1Z7S3 1VBA1 2JEMA 4IEZA 4RA0A 5FZ7A 5CFCB 2YC2A 1XPWA 2E32A 4LNVA 4AYUA 5KHJA 5M0TA 2ZMLA 3AYCA 3W9AA 5FZBA 3CQOA 4RGGA 3I2OA 2VMEA 1C8M3 3NL1A 4HKWA 4XUNA 4Y24A 2YV8A 2O14A 1AX2A 2WQ8A 5A3WA 3NNJA 4OHYA 1G9DA 1OC1A 5FTTC 4XHXA 2BDRA 3ORJA 2YY1A 5C4WA 5AFEA 4KWUA 2VAUA 3E6BA 1LAJA 1AZDA 2YBPA 2VQTA 4JDOA 4LHLA 1H9PA 1GSLA 4S2DA 2ZGPA 3LFMA 2W68A 1COV2 2VZ1A 1O5LA 1OLME 1QKQA 1DQ4A 4BH9A 2UY8A 5GLVA 1W90A 4GULA 4FXKB 2XBO2 1DGWX 3E6DA 2RJ2A 2XMLA 3D3AA 4RGKA 4W6XA 5F3IA 4BQ4A 4K21A 3CHXA 3UJOA 3K51A 4PLOA 4R4XA 1VRBA 4UW4A 2P5BA 5J7MA 4M3CF 2V72A 3WG3A 3ZFFC 3K3NA 5C3OA 4L99A 3LSDA 1ST8A 5T5JA 4Z8BA 4FVVA 5FAXA 2GH8A 4PBOA 1ZRDA 2YMZA 4PJYA 5FYUA 5D2AA 4E4SA 3IAPA 1UX7A 3VBUA 5IK8A 2D93A 3HBKA 2VG9A 3M3CA 1S2KA 1ZRIA 3IIAA 1QJX3 3VBUB 5KXCA 1NA1B 3NNGA 5C3QA 2DCYA 2Z2SB 1HQLA 2WA4A 1ZBA1 2VL4A 2ZMKA 3HBZA 5KHGA 3KM5A 1XSQA 3H3LA 5KHHA 4CDQA 5DAWA 3O1VA 2B7YA 3VL8A 5A3LA 2WO1A 1QWRA 3KT1A 2PLV2 3IKWA 1AF9A 4PCRA 5C8CC 1MQTB 4F7ZA 4YLZA 1FT9A 2IXLA 2IVIB 2JDYA 4LA2A 2ZGMA 5FCCA 2JG8C 4EJRA 2BBAA 2TEPA 4XDPA 2G4IA 5AVPA 4AI2A 5T50A 1GQGA 2GDFA 5FRAA 4UBGA 2VTFA 2VZQA 4D3WA 2VCAA 3AZYA 4IE0A 5FDBA 5J3UA 2ARCA 2WNOA 2HWC3 2VVEA 3DYPA 3JBG3 1AYM1 2DUQA 1US2A 1AL21 3B9IA 2ES3A 1RHI1 2WS93 5EYYA 3ZKYA 2A73B 4YW2A 1Q8SA 3TOJA 3VKOA 5HV0A 5JOWA 2ZEZA 1KEXA 1POV3 4FPEA 4PDWC 1ND3B 5HV4A 2JICA 2ORZA 5A3OA 3D4KA 5FR3A 2HWB3 1OF4A 1DFQA 4DPNA 4YVWB 2QKDA 1KITA 2E31A 2OPKA 3RYRA 2GSYA 4A3ZA 3K3OA 1PVXA 4BLJA 2C9KA 3ZN6B 1VBD1 4AFAA 5LZ6A 1JYTA 4NAOA 5JPMB 4FAHA 1H0BA 3VHOA 5CNAA 4FPCA 3KF3A 3TN91 1XNTA 2Q1FA 3D82A 2XG3A 2WC2A 5EFUA 5K4LA 2WLPA 3OBZA 4META 2FBEA 4MXWB 2C0ZA 2W39A 4AZZA 1WBLA 4AL9A 5BNQA 3SEEA 4DUXA 5A32A 5L9VA 4BXFA 4Y4YA 3UYJA 4M4RA 1MZFA 5KC6A 2RS12 3H42B 2NMNA 4AHZA 4CSWA 4ES9A 1R1A3 4QXHA 3T1MA 1VBA2 1WMDA 2PFWA 2ZPXA 3VBFA 1F9KA 3H1MA 4OLLA 4YG0A 4WBBA 1W28A 2RMU3 1OLMA 1VAVA 1YFWA 4RL7A 1LECA 5DDJ3 2ZAHA 4Q0QA 3M7AA 1NXMA 3ZM8A 4XF9A 1C5HA 3RMXA 3B00A 2W2IA 5T5PA 5FMOL 1LOFA 1TG7A 1ULOA 1US3A 4DXTA 1W9FA 1AR93 4LBLA 2ZBJA 4AEDB 3ON7A 5F5CA 3QOPA 2AH2A 4L9BA 1WW6A 2I45A 3KV5A 3POYA 3I54A 3RZGA 3N3HA 2HEWF 3ES1A 3IMMA 2OS2A 4BDVB 3LDKA 4KI5M 4RFRB 5J96B 5FKBA 1DZQA 5A7NA 1LRHA 3P5BA 4D8MA 5KXBA 3OUHA 4JC1A 1VBB3 4HMZA 2Z79A 3M8LA 5H9RA 3VBRC 3PUHA 3WW4A 1AR73 3ACLA 5JCTA 2VOTA 3GZAA 3AYDA 3OUIA 1QQP3 3H8OA 4B1MA 5LEJA 4KH9A 3POEA 2AEZA 2WZR1 3RZMA 1PVC3 5FZHA 4P02B 4URAA 4OHXA 1S0GA 4FPKA 2WLQA 1TE1B 2UY9A 1AXZA 3IPVB 1WCUA 1B35B 3OPZA 3WUDA 2AEYA 1UMZA 5JPNB 2Y64A 2BNOA 1W6OB 1ZBA2 3T0AA 3OSDA 5T5OA 4GZ9A 1W6NA 1QNWA 1RTVA 2V09A 3MFCA 1O4YA 1WZXA 1BCXA 4CXYA 2Y6HA 3NSTA 5EPAA 3VDDC 5CFDB 4IESA 1S4CA 3A0KA 4AF9A 2F17A 2OPWA 4UOJA 2A1XA 5IK7A 4MV2A 4RS5B 1O4TA 4LULA 5LBEA 4FCAA 4N53C 4LBQD 1LGCA 3M3OA 1OH4A 1GKBA 4YW5A 2Y6FA 3E5UA 4QPWA 4QQHA 1EAH1 1OKQA 2QTWB 5CG9A 4IE5A 3WT3A 4GB31 1RUNA 2NMOA 1Q43A 3N7JA 1AYM2 1AUYA 4IGQA 4UI9L 4OQ8A 1UNBA 3WV6A 1AL22 2W87A 1UO9A 4HXCA 1RHI2 3FJSA 2Y6JA 1SBDA 1JODA 1BMV1 4LKFA 3EHKA 1H4HA 1PMHX 4M0NA 4FSJA 5F1RA 1EP0A 3O1SA 1V70A 1ND2C 4CDXA 2WSUA 3ACHA 3NVCA 1MVEA 4OYUA 3ZIWA 3VBFC 3N7KA 1H30A 1K5MC 1H2LA 2QVSB 4JGZA 3DPRB 1SFPA 5LY2A 5EIYB 4B29A 3ZO0B 2ZX3A 5EP9A 3S57A 4DB5A 1VBD2 2HBUA 4XIKA 4E2QA 2QQIA 2VW2A 1SEFA 3AP6A 1RUE1 3M1HA 3VBHC 2FCUA 4WVMA 3TN92 3VZKA 1HB1A 1XU1A 2PHRA 1XNBA 2A70A 1O8SA 3O0XA 3M4FA 4FOYA 1IOAA 5CB7A 4CP9A 4JKKA 1I5PA 5A1AA 3MIEA 4Z07A 1X33A 5J36A 5IK4A 1YRZA 2ZGTA 3N36A 1E5IA 1V9U1 3P1IA 1DGWA 1ZX5A 2IXHA 2XLGA 5FP3A 5A1LA 1A34A 3ST7A 2J1AA 3RNSA 1AXYA 3WSOA 2DUOA 3BGAA 4QU1A 4H14A 5KXEA 1CN1A 1UF2C 1WD3A 3M3QA 5FXWA 4QPGC 3DL3A 3I59B 4QGLA 4D6RA 2QBXA 2X5IA 4CXXA 3AJZA 2G9GA 4C91A 2ZXQA 1YJKA 1H2NA 4ZXKA 2ZGNA 4EWDA 3U75A 1IQAA 3C7GA 1HB3A 3NNLA 2X29A 1S0FA 4GJYA 4ZPIA 3CJIC 3AKQA 5LASA 3D0SA 2VJXA 3DV8A 3I2KA 4GH4C 1XXNA 3VD9A 1TMF1 1JU3A 1VIWB 3C8XA 3OPTA 1HQNA 2ETEA 3MV11 2WNUA 1HIXA 1BLZA 4XFCA 3LPGA 3AKRA 1ZZBA 1ENSA 3J7HA 3RPQA 4LIUA 5DAQA 3PUIA 4YW4A 2FDJA 2VECA 2WWUA 4QKBA 3FHIB 4Y1VA 2WO7A 3HOBA 5KR7A 4AR2A 4K9SA 2R30A 3K46A 4IGOA 2WZR2 5KBFA 4OFGA 4PI2A 1V6MA 3LA7A 2RDNA 4XOGA 1MS0A 1ZZ6A 2PAMA 4TWTA 3BU7A 4TLFA 4DZGA 4ARXA 1JYXA 4AOCA 2CDPA 4ZZ5A 1HXS3 2KD7A 4F8AA 4LBQB 2E7QA 1UX6A 3OYWA 2J7MA 4R9AA 4TTGA 2WAAA 5FZGA 3JB8A 1QF3A 3PNAA 2VMHA 3UK9A 4L92A 3AMQA 1K45A 3RSJA 1VBE1 3O5SA 3WNOA 3E5QA 3ZXGA 2VBBA 2VTXA 3U4XA 3TWIA 2VQ0A 4XF4A 1RUJ1 3ITQA 4GMP1 4NRMA 3RJRA 5A3MA 1X50A 3CBNA 1H1AA 5DN2A 1OKOA 1RINA 4A44A 2KM2A 4PI0A 1POV0 3EBRA 5F5QA 3PU3A 4PIYA 4UFLA 4CDXC 1DU3D 5FY0A 4HFSA 3AKTA 4FOVA 1NCRA 4PBPA 1GANA 1EAH2 1U5IA 4JGZC 4KWLA 4DFSA 3VBOA 1HLCA 2DCTA 3KSCA 4GB32 4LQRA 2BFUS 2GALA 2QNKA 1QNYA 1EUUA 1WLTA 2VW1A 4B8EA 4C1WA 1HV0A 4FFFA 1K5JA 1BMV2 1U12A 1ENQA 4JHTA 5A7SA 4BB3A 1OUSA 3S30A 1CESA 2EIBA 3UETA 5IAXA 1W6QA 3POSA 4MXVA 1PK6A 5IWFA 2ZHMA 4YW6A 3WNXA 1VJ2A 4BJ0A 4QB6A 2ERFA 5GZGA 1GV9A 5LK5A 4OHZA 4QX5A 1RGSA 1URXA 1W3VA 1UL9A 3ZFGC 2E7TA 4IEPA 5I0TA 4AVSA 1SDDB 4BOWA 5FP7A 2RR11 3UKTA 4X6QB 1XE0A 3WVJA 1RUE2 1IS3A 1VBC1 1YWKA 2X5IC 3ZFEB 1MS1A 3MLKA 4UBHA 3V0AA 1OVPA 1VRH3 4CCMA 2PA7A 1GYKA 2YC4A 4XABA 3T1LA 3RZLA 3R0RA 1LCLA 2P37A 3UNPA 2EAKA 3VBSB 2RG4A 5A7WA 2RM23 4AEMA 1NLRA 5I0UA 3QBQA 3ETPA 1V9U2 3PJQA 3FLRA 4BLIA 2D6NA 3HN3A 5JZGB 1C57A 1FMD1 4GWNA 1S0BA 1E57A 5T55A 4BE3A 3RZKA 2WNUC 3K4ZA 2RHPA 1HRV3 2E53A 4G4FA 1FPN3 3VHRA 4ATEA 2C24A 3F95A 4NIGA 1JU4A 3GDBA 3SH5A 5B4XA 3OBRA 4HPKB 5BUVA 3B3QE 5DUUA 4BQ5A 2WUHA 3T0DA 3DKWA 1BBT1 5FPAA 3MUY1 1EV13 4COVA 3UESA 3WCRA 4AQ2A 3B94A 1LENA 2B4KA 1UAIA 2ZGLA 2J1RA 5D8AA 1OVSA 4AE2A 1BEV3 4D7YA 5F37A 2D43A 1D4VB 2ZACA 3HQXA 2TUNA 4UFIA 2W46A 3ZR6A 1TMF2 3AXDA 4PIZA 4XQ4A 3ZYPA 4D6QA 1DZTA 1W2UA 2CHHA 2HWF1 2H6BA 4NR1A 2PAKA 2WN3A 5I0DA 2EVXA 1JYVA 3PUQA 1TME1 4UT5A 1BXHA 2XL7A 3O1PA 5I8SA 3JXSA 5ABJB 3B7MA 4DRVA 4A4AA 5DG1A 3CIHA 1VAMA 3NV4A 3DXTA 4BU2A 4IV1A 2ZCWA 1RUI3 3SKJE 1OBNA 4IERA 3VZJA 3WD5A 2XVKA 4RHV3 5FZLA 1LU1A 2VNGA 5EV7A 4B4QA 3ZX7A 2CNAA 2ZOEB 2JDAA 2WFF1 1IPSA 3IBMA 2VULA 4OUMA 4K8RB 2HWD1 2NZ9A 5FZKA 2ZJCA 4H7LA 1E5HA 5C33A 1B09A 1LOAA 2XUEA 3H8XA 1VBE2 3ZR5A 1SLCA 4JQRA 2EXIA 2B45X 2HLEA 2D5HA 3A23A 1JXNA 4RR3C 1NX9A 3OB8A 1RUJ2 4ZY9A 3OEAA 2MNGA 3GCXA 2RV9A 4Q0VA 2AZ5A 4I3PA 1QXRA 3I3BA 2B8MA 2W3JA 2G9FA 3BYWA 3NAPA 4RN5A 3N9LA 3O1MA 1NCQB 2QQJA 2ADDA 2XOMA 2XJRA 3AXEA 5BNOB 3WINE 4R9BA 4B1LA 3WNNA 3T2QA 2XLFA 1X7NA 4D7SA 5L19A 1YNAA 1AR83 2WINB 3ZSMA 1NXD1 1BK0A 5E89A 5DG2A 3S7EA 4MO3M 3J8F3 1OXCA 3TB0A 5FK7A 5K0UC 3VD7A 1KFXL 2W95A 1PGL1 1S0CA 4GWJA 3N7MA 4QMAA 1DG6A 2P17A 1YQ2A 1H8TA 5GZEA 3WHUA 5FP8A 5LBCA 2CGNA 2W52A 3A7QA 4UFMA 3SNMA 4QX1A 4CP0A 2EIEA 4V2WA 5A3PA 1OH3A 1X9PA 2W9XA 2YROA 3WDUA 2D7FA 2OX0A 1CIYA 2A3XA 4KWJA 3V56A 4RFT0 2RR12 2R16A 3AMPA 2IUWA 4JZRA 4XDOA 4C0BA 1ODNA 1VBC2 3GXUA 3KQ4B 1PMJX 3BPSA 4YW3A 1PMIA 3T4HB 5TSWA 4DXZA 1GBGA 2WL1A 1ALYA 3PLQA 2FDKA 1WMFA 5ANNA 5D8AC 3AMHA 1RUC1 1DQ2A 4DUVA 4K7JA 4YRDA 4YG3A 2BUKA 1J3RA 1UW8A 2CL2A 4A42A 5T54A 5IATA 3TNPB 3ACGA 4FFHA 4QDRA 4DEVA 4BHPA 4U36A 4CZSA 1FMD2 1OT5A 4CU8A 5FZ8A 1QJY3 5A7OA 4AHYA 2VR4A 4MOAA 4OCTA 3WF4A 4TXWA 3EB7A 4COZA 5CKNA 4YSFA 1RUG1 4XBLA 4O9GA 1UOFA 4BZ4A 1D4M1 4RQPA 4COUA 3NNFA 1FX5A 1KJRA 4NIAA 1CWPA 3FLTA 1BBT2 3J26N 4EZ4A 1DHKB 2X09A 3NWKA 2JG9B 4ORFA 4MHUA 3PVBB 3HAGA 3ILFA 3WNLA 4IEVA 2W91A 4O61A 3W21A 2WN2A 3EO6A 4LK6A 4PHZA 5FZOB 1JYCA 3AMNA 3RYKA 1M4WA 2HWC1 4HN1A 4EN6B 3AFKA 2QQUA 2DCZA 4CCDA 1S0DA 3FUOA 3N4MA 1RVF3 2P2KA 1BHGA 2JDZA 1JHNA 2HWF2 3OTFA 5LA1A 2P1BA 2WS91 2G1MA 1H8VA 1RYYA 2PHDA 2JDKA 3DN7A 1AX1A 3VDBA 1TME2 3WNKA 2F6BA 2PAEA 1I1EA 4XXAA 3LDBA 3C7FA 1NKGA 3I3DA 5FOBB 1GR3A 2OT7A 2QZ2A 2ZAAA 4IEYA 1W2TA 4IV3B 2GC0A 2HWB1 2CYFA 3HEIA 1BZWA 1YUDA 1UY0A 1Y9MA 2G19A 3ABZA 2QZ3A 3PIJA 4X8PA 3T08A 2IXKA 1LGBA 1M06G 1KFUL 1ZM1A 2WFF2 3K4DA 2A3WA 2HWD2 2RS53 4FTEA 5CG8A 2VZVA 1Y7BA 2WNVC 4QDSA 1JUIA 3U11A 3ZFFA 1K42A 1POQA 2K46A 2QQNA 5FXXA 2NM1A 4FFGA 4N7UA 2XJUA 3ES4A 1W06A 3VL9A 1HV1A 1XNDA 4Y1XA 2FDGA 1H4GA 4DIQA 2DU1A 3H1YA 3K48A 5JI9A 4R9CA 2B9VA 4Y33A 1J1TA 1R1A1 2ZA9A 1H8TC 1LNSA 2QQPA 1YFYA 1MPXA 5FY8A 3RGBA 1NY71 2W08A 3IN9A 5FKCA 2RMU1 4Q4Y3 3OY8A 2W1SA 2IXIA 4CEWB 1NYWA 1UY3A 4YVSB 1UIJA 1NLQA 5FZAA 4E8CA 5BNPC 5C8CA 3KVBA 4EWEA 2D40A 5FP9A 1AR91 2C4XA 1MS3A 1CIWA 4RGAA 5G05L 5FYBA 2CAVA 2RDRA 2WYSA 3VDCA 1OA2A 2JG8B 4M3CB 2Z5WA 2A6WA 1WKYA 2FHRA 5APAA 4A7ZA 1PGL2 3LOBA 4QGMA 5JR7B 3ME2A 4MGZE 3K4AA 2ZZJA 3K77A 5A3NA 3OF1A 4NO4A 1CZSA 2XWBB 2WAOA 2DFBA 2VZUA 5B4NA 4Q4V3 3ZPOA 3ZXLA 4ZU7A 3I7DA 2J1EA 1VBB1 5LCWL 5BYNA 4XC9A 2Q0AA 2EXJA 3JB4C 4JDMA 2XVLA 3VD5A 3W59A 3W5NA 5L73A 4PDWA 3WG4A 1LR5A 1XOYA 1QQP1 3NV2A 3E1F1 2PTMA 1JUHA 1O8PA 2WABA 4PT6A 4XUOA 4DXSA 3JD73 2R0FA 4XHBA 2CWMA 1PGSA 1RUC2 3SH3A 4B7EA 1REDA 1JI6A 3B69A 1LGNA 3EMRA 1PO23 1GNZA 1L7QA 2G9ZA 4W8JA 1GOFA 2W1UA 3IB3A 1OUXA 1QJX2 4NRQA 3UV9A 5E1RA 2WO2A 4YWAA 4BM8A 1MZ5A 1BKZA 1QGLA 2PQSA 2VVDA 3T4VA 1NAEA 5D1IA 1CZVA 3NO8A 1UWWA 3WDWA 1NOVA 1N1YA 1RUG2 2JXAA 1GP4A 1YHFA 1Z0HA 4LKSA 2DVAA 1D4M2 5C4WB 2VY0A 2J1TA 1JYNA 2MPFA 4CCNA 1WCSA 4JKLA 4KGQA 1ZZCA 1Y9GA 2ZHKA 3JQWA 1RL3A 1VMJA 2P3JA 3H3ZA 4UAPA 4DRRA 1AYN3 2P6HA 4YZ1A 3RJ2X 2FZ2A 4QHBA 3WP5A 2ZGUA 1WWYA 1MVQA 2HWC2 2PYTA 1OA4A 3FC0A 2DURA 2JE9A 4XMAA 4BQ3A 2JENA 3GBWA 4XE9A 3J9SA 2R061 2WS92 1GWMA 1UOBA 4PQ9A 4HVQA 5F32A 4A45A 4NHXA 5FLIA 3ELNA 4MGTA 3KHCA 5C9AC 1OD5A 2VZOA 4QX2A 1C1FA 1K12A 1MR5A 2HWB2 2WZ8A 1PO13 1TZOA 2I07B 1V0AA 1YCIA 2P4EA 1JH5A 2PELA 3AZWA 3SXWA 1NZIA 4ISQA 4LOTA 3VBRA 1JBCA 2B39A 2VMCA 3ZYIB 3MZHA 4HZFA 1CGPA 5H9QA 2HH9A 3J7NA 5J37A 2AACA 1DQ5A 4CDQB 2FDHA 4Y1YA 4D7TA 1BJQA 1DGRA 1R1ZA 4QKFA 1IPJA 4FP3A 2DYCA 1G86A 3W5MA 2FMYA 2A3YA 3MPBA 4AVBA 1YIPA 5FLJA 4CYDA 1EUTA 4QQOA 5CADA 3UL2A 2YZ4A 4KMQA 1LEMA 1R1A2 3KCXA 3KGLA 2VMFA 3T2TA 3MW3A 3VZNA 4CDUA 3BUCA 3OBTA 1Q8VA 1W9WA 1NY72 2WT1A 3MLJA 3WX5A 2ZX1A 4KGGA 4KQ7A 3UGHA 2RMU2 3FHAA 1EPWA 1W9SA 3VDDA 4AHXA 4LTAA 5A6ZA 1W99A 1COV3 1OPOA 3VDDB 1MS9A 2OYZA 2D5FA 1JOJA 4N53A 4GXLA 1AR92 2W5FA 2ZGSA 4BQWA 1SCRA 4AFCA 1YQCA 4D94A 1LJ7A 3LEIA 3HR9A 1PHMA 2LW8A 4YG6A 3KCYA 1D7PM 4HSLA 5FZMA 5I93A 2XPJA 3GNEA 3DGTA 3MEPA 3J7LA 5FY7A 2MEV1 2P6CA 2GMEA 1BVP1 3PURA 5FPBA 4CUAA 3WHTA 3T30A 1OOPC 3OJBA 4L0PA 3FFQA 3SHRA 5DAPA 1VBB2 5JMCA 2VPVA 1ND2A 1R081 4LR4A 2C26A 1QQP2 5A32B 3WUCA 1UQXA 5J1XA 2JDHA 2F4LA 1UZYA 1PVC2 1UZ0A 3NJYA 3USUA 1K5MA 1N47A 1O6UA 1W8NA 2QDNA 3U07A 4AFDA 2IZWA 4Q0UA 3VBFB 5F5IA 4XQDA 3MICA 2MHFA 3IDBB 1K5MB 2VO5A 3LIHA 2Y33A 2XDVA 5IVFA 4MX3A 4QAWA 3RS6A 3ZKUA 3VBHA 1C8NA 1PM4A 2JIJA 4OI4A 4P9IA 3LE0A 4MUVA 1FOD3 5A33A 3AYEA 4QXCA 3ROUA 3BOPA 1WCQA 4P5HA 4OMDA 1C28A 1NUKA 2VMGA 4QWNA 2BERA 2WWJA 4A6OA 2DV9A 1SLAA 2HBTA 2YXSA 3CKHA 1LB2A 2UURA 1IS5A 3HIFA 5ACA3 2EA7A 4LEJA 1S55A 2WKKA 3N9QA 4J25A 5F5AA 5JSPA 5KXDA 4AK3A 4JAAA 2XJPA 5JXHA 1J3PA 4NPMA 3MO4A 4K40A 1KGYA 3DECA 3LAGA 1JZ6A 1E5RA 1O3RA 4I30A 1Q3EA 4QPGA 5JOXA 3S5AA 2JKXA 2Y38A 3AYAA 5KHKA 1J58A 2R7EB 2RVAA 1XB9A 3KGZA 4XBNA 1RIRA 2R062 3E97A 1CONA 1FXZA 2JDNA 3GALA 4M4PA 4TLGA 4EN8B 2ENRA 4CU9A 4JHZA 1JS9A 3CJIA 1SDWA 3ZSJA 1NA1C 1SZBA 3LOIA 5CA6A 2Q1ZB 4GH4A 4AAPA 1QXJA 3V0BA 4Y20A 3IDEA 4JGYA 4XXPA 3WW2A 2D6MA 2YG0A 3X29B 2GNDA 4ZZ8A 4CDUC 2R6QA 2D6LX 1WW4A 3KB5A 2VUDA 5A7QA 4CP2A 2Y60A 4I0AA 1CAUA 4ISRA 2PQQA 1MQTC 3BTZA 2E51A 4RSUA 2WFPA 3LGRA 3DXUA 5BNNA 3C2UA 5F9TA 1W6NB 3ZPYA 4JKMA 4FQ4A 2A6XA 4P5YA 2ADEA 2YGMA 4KBZA 1OURA 3AZXA 5IAVA 4NHYA 4HL0A 2HEYF 1MEC1 1XYNA 2OZ6A 2DTYA 2BPA2 1UPIA 1LU2A 3PTRB 3POGA 1EYBA 4AFBA 1LKNA 4XAAA 1LOGA 2LM3A 4WM7A 5CEHA 2PHUA 3ZXDA 5IFTA 2RM21 1PNGA 4Q27A 4CCEA 5GKAC 2SBAA 2RJLA 3BTAA 2GC3A 3O0WA 4HK9A 4AI8A 2ET7A 5H9PA 4YW7A 4QPIC 3VZLA 2D97A 5L36A 2VVFA 4XQWA 3BB6A 1SMVA 4Q4W3 2Q5TA 1HRV1 1WLDA 3OGGA 4HKLA 5JIUA 4XACA 4FPGA 5FZ1A 3RWKX 3FHQA 3BIEA 1UYPA 1VB4A 4JX0A 3V64A 1WMEA 1V6KA 5DUVA 4OI1A 1ODMA 1EV11 4I0WB 4CDXB 2V4AA 5FXVA 2VCMA 1C1LA 3HVDA 3HPNA 1RJ8A 2VM9A 1BEV1 4XURA 3GCWA 4N9IA 3HT1A 4IXLA 4ZU4A 3CO2A 4LITA 4Q29A 1QJZA 4A6SA 4JGZB 2EALA 2MEV2 1G6NA 5FMBA 4IE7A 2PHFA 1CPNA 4NHMA 4QPYA 1I9RA 2JX9A 4WVMB 1GLHA 1FATA 1RUF1 5FZIA 3DYOA 3BKZA 1R082 1GUIA 4CP9B 4Z82A 1ZRRA 3KV4A 4P9XA 2QFEA 3MBWA 4CEYA 4D69A 2CGPA 1CZTA 1DF0A 1R093 3EYPA 5CYYA 1RUI1 3BTXA 2GNBA 5H9SA 5DAXA 4P9YA 5LBBA 3ZFGA 5A3TA 1CAWA 1DLLA 5EJ3A 3B01A 1F4HA 1JOPA 2VW0A 5IHRA 4IE6A 4I3GA 4AEDC 3FBYA 1ZREA 5BXXA 4YARA 3GM8A 3WEZA 1X9TA 1J84A 2IWGB 4A41A 1H2KA 2Y8KA 3MIDA 3AC0A 1QJU3 2X5IB 1HRI1 2B42B 3GHMA 1UZVA 5L9RA 1GNYA 4R9DA 2ZZQA 4Y22A 4Q4X1 4TN7A 3WCSA 3AX4A 4LO8A 4YFZA 2XLAA 3AZVA 3P6BA 1N1SA 3OGVA 3J4UH 4LE3A 1PIV3 2ZGRA 5T3NA 4JGYC 1RHI3 5FWJA 2O8OA 1SLIA 2O1QA 2XGXA 5FYIA 3W58A 2QQOA 4GWIA 4AAXA 3VHNA 1J59A 4YGBA 2FDFA 1F15A 1PX4A 5IW0A 1GZTA 3MF9A 1LHUA 5C3RA 4YGDA 3WP6A 5FZ3A 2WNUB 1W0NA 5DABA 4LOSA 1J3QA 5BNNC 4XTMA 4PLNA 1GWKA 2R073 4DS0A 5C6CA 1JMUB 5EYXA 3KT7A 2JIGA 5AC91 1AR81 4GQ7A 2JDMA 4A7YA 4BQ2A 5LBFA 3NKGA 4KBBA 5BPXA 1B35C 2K0GA 5GLZA 4XJWA 3CJXA 5F8PA 5HXMA 1GU3A 1VBD3 2ZEWA 2V5DA 4OMCA 3QACA 4WM7C 5FYVA 2HWE1 3WP3A 1IZ3A 2VZTA 2CTVA 3TN93 5FUNA 2E6VA 2Y26A 2FCVA 2XKOA 5CFDC 3OYWB 1SHWB 3I3MA 3HT2A 2BTVC 4IE4A 1RUD1 4NE9A 3UKNA 2Q30A 5FJKA 1UD1A 5I0SA 4MGYE 2BW8A 2WYFA 1MEC2 3AB0A 1YI9A 2WA3A 1VMFA 1OSGA 4K20A 5FJHA 4AFMA 1S0EA 4EE2A 5A1FA 4UXAA 3CZJA 5KWRA 1NCRB 1ULEA 2RM22 3C7EA 3U10A 4AWDA 3FMGA 4XUPA 5IYYA 2QQMA 5F6LB 3VBOB 2D98A 1AHSA 4CUCA 3D8CA 4DQAA 3O12A 2Z69A 3FWEA 3TNQA 3ZXAC 1JYIA 2VMDA 1QJY1 3LD8A 1HRV2 2JE8A 4RR3A 3OPWA 2WWSA 2A71A 4NVPA 1PZ8A 2V73A 4QX8A 2XJSA 4XW3A 3WQ0A 5GJ6A 3U14A 4UFKA 3I49A 4UFHA 1ZBE3 2VBDA 2B9UA 3DPRC 1GFF2 2J1VA 4WV8A 4WZCA 4CEYC 1EV12 1L3JA 5IVEA 1C4RA 1W6QB 4MLOA 4XILA 4AXOA 2LROA 4LUKA 4EN9B 2VZRA 1NZCA 1BEV2 1PK6B 2F4PA 2N7GA 2Y6GA 3ILNA 4FPJA 4NRPA 3ZMOA 4F83A 1KS4A 2D6OX 4GA9A 4CRQA 3GBGA 1CAXA 5A6YA 4XFAA 2J42A 2JB8A 3K2OA 3IDAA 2I74A 4I02A 4FQZA 2WZR3 5GZDA 1YEWA 4CCCA 4DO0A 5CBLA 4XJUA 5JIAA 1XJAA 4UFJA 3AM2A 1WMXA 1DQ1A 1RUF2 1UY2A 2QDRA 3PVEA 4UF0A 3HN1A 5K0UA 3V0AB 3GGLA 2D3PA 4NROA 3O14A 4IL7A 4LXLA 4AQ6A 2BNMA 4QB2A 5A7WB 4EV0A 3NW4A 2B46X 4E4DX 5FQ0A 1RUI2 4HSJA 2NYYA 3R6SA 4BYYA 4FAGA 3Q8EA 2JJ6A 4M0HA 1EPZA 1NG0A 2R49A 4OHWA 5FFOC 4SBVA 4YPJA 1LHWA 2JDPA 2P3YA 1RUH3 5I0RA 3SH4A 2RS51 4URTA 5E6HA 1JZ3A 1HJFA 2SLIA 1SBEA 5DAVA 2PN5A 3CDZB 3D6EA 1EAH3 1HRI2 1JZ5A 4N90A 4GB33 1G8WA 2VZ3A 4Q4X2 3PUSA 1WW7A 1ZZ8A 5D8AB 4AI9A 2ZKLA 4P00B 4XF0A 5FBZA 4ONUA 5DMYA 3ECQA 1DDLA 4CTEA 2ATFA 1QOTA 3ETQA 3RRDA 2QE3A 5F3CA 5LA0A 1JZ4A 2ZS6B 3WP4A 2I2SA 5FZ6A 2E7AA 1TNFA 3I2IA 4C0HA 3O0VA 4CU6A 4CE8A 4YZ2A 4E8DA 3D0JA 1DGRN 4OI0A 1AR61 4Z1VA 4ZKTB 5AC92 1AR82 3RWNA 3C3VA 1GZWA 1WCKA 2BWCA 1QJEA 2VOVA 4HKOA 4LUMA 4UYBA 3OD0A 5FREA 2WRAA 2ZEYA 5LWBA 2XQXA 4QU2A 4IV1B 3MGUA 1QEXA 4X6RB 2HWE2 1JZ7A 1RUE3 2Q8DA 1IPKA 1DIWA 3PU8A 4EZHA 2H0BA 2ZX0A 3KF5A 1YFUA 4CA9A 5EXOA 3CU7A 1RUOA 4Q4V1 3PHMA 3RZJA 2VZSA 1RUD2 4AGVA 1H1MA 2JECA 5FYCA 3WDXA 2C9AA 1V9U3 5FPZA 3CEWA 5JDBA 1ZYBA 4CDWA 1DGLA 4GIQA 3A21A 1Z7S1 4XJZA 4H7MA 2WDBA 5HCBA 4K1ZA 3JD71 1JZ2A 4NN0A 3H0OA 5LEKA 1UYZA 2CGOA 3NAPB 1WBFA 1UMHA 2IVJA 1ZZ9A 1C8M1 1PO21 2ZEXA 1AXKA 1W8UA 3AL5A 3ZN4A 1IS4A 1IHMA 2R043 1UU4A 1NQDA 1HN0A 2XH6A 4FO9A 5JWPA 2WNVA 3JQXA 1CAVA 3HWJA 5FPLA 1QJY2 5JR2A 1WLCA 5LRRA 1U0AA 3DUIA 4AI3A 4XFBA 3WG1A 1TMF3 4DXRA 4WM8A 3G6JB 2C6SA 2GU9A 4FP2A 1TNRA 1UU6A 4LLFA 5CZKA 4I01A 1S0JA 2CU5A 1AJKA 1XNCA 2EAAA 2W47A 2WIIB 3L2YA 1H8TB 3N9PA 4IGPA 3WQ1A 4V2VA 1VAKA 3KT4A 4LKDA 3MIGA 4W4ZA 5EZWA 5BNPA 2VGDA 3CNAA 3WW1A 1KQRA 1CQ9A 1QH6A 3MW4A 1QDCA 3AZZA 4ASKA 5EJ1B 2EIDA 2RS33 4WVWA 5BV6A 4AHWA 1L7RA 3SLIA 4TSVA 5JZGC 2YC0A 2D6PA 5HCFA 3M70A 3T2PA 1QIQA 1QJX1 1VBE3 1ZA7A 2NPIA 3AKSA 3VKNA 1MS5A 3SCFA 1NQJA 1OQ1A 3ZYHA 4GMP3 1W3XA 4MZUA 3CL1A 1F4AA 4M3CE 5CIRA 1UXZA 5IK5A 5DZFA 4LLOA 2RS52 3UKVA 2ZGQA 4QT6A 2OA2A 4RQPB 3HD8B 4LO5B 2NN8A 5FMOS 2VBPA 2VNOA 5FYZA 3B5LB 3GZTB 3GZUC 3E5XA 3ZSKA 4CCKA 3EJKA 2FMDA 1F8VA 2R1BA 4HETA 4SLIA 5D21A 1AL0G 5C7GA 3AKPA 3JBG1 5C3PA 3NKTA 3I3QA 2AR6A 2PMWB 4JRAA 2OIIA 5CISA 1VE0A 2YFUA 3O1RA 4IEQA 2DU0A 2DVBA 3OCPA 4E9KA 2GP5A 1OFNA 4FPFA 1G9FA 3LDRA 2YUEA 4K6BA 4LBNA 4BIFA 4BPZA 1W0OA 4L8QA 3HNBM 2BGCA 1W04A 3TYJA 3BU0A 1AR62 1POV1 3ZXJA 4CDWC 2X05A 1W6PA 1LULA 1QOOA 1DYOA 1UY4A 4CCOA 1SBFA 3Q8FA 3ZDVA 4LHSA 4IQPA 3VLBB 2VH9A 5LY1A 1PZ9A 5I91A 1X8MA 1N3QA 1VBC3 4XMIA 4YM0A 4BA6A 1ASJ3 5CVRA 1Y9QA 1RMU3 1LHNA 3WF0A 2JWPA 2YU2A 1LHVA 1ZVFA 3INAA 2OQ6A 5DQ0A 1NE6A 4JDNA 4Q4V2 2AUYA 4M00A 1REEA 3EQEA 3ZFFB 3WG2A 1S0IA 3MYXA 1UZZA 2VQUA 4O65A 4NMIA 5C9AA 5C8WA 2ID4A 4WM8C 1A8MA 4P14A 3VB9A 4ES8A 1FMD3 2W94A 1Z7S2 1J83A 5BNOC 3VUOA 5FYMA 1YIFA 2KR2A 3OD4A 2UWBA 1W6MA 1YQ5A 1VPHA 1FV2A 3JD72 4MGQA 2BRTA 4QHZA 2A6VA 4LPLA 4BISA 4XFFA 5DDJ1 1C8M2 1PO22 1GWLA 1WA4A 1XBFA 3NV1A 5FIXA 3VHPA 4D6SA 2E63A 1BBT3 1GZ9A 2J1UA 3OY8B 4KU7A 5DZEA 4QKDA 2E33A 2WQZC 1DZRA 1FOD1 1EY2A 3H3UA 1JOBA 4LA3A 1SLTA 1C3HA 5C8CB 3VV1A 2BFUL 3H8RA 4XETA 1QJFA 3HNMA 4BQYA 5IVJA 2QQLA 2K2SA 2EXHA 1FNYA 1LESA 4Y1UA 5JVVA 4NHLA 1SG3A 2JDUA 4W6YA 1CD3G 2HWF3 5ACA1 5ANQA 2ZGKA 4XDQA 3PMSA 3MFAA 2EIGA 2TBVA 1ULCA 1YLLA 4H55A 4QXBA 2VZPA 4DMIA 1TME3 1A8DA 3SISA 1RXGA 3SEPA 5K8SA 4JRLA 1AR71 4XF1A 3WQ7A 3KD4A 2VCCA 2VC9A 4ASMB 1CR7A 4YZ3A 4N43A 3THPA 4OULA 1UPSA 1A6CA 2ZTNA 1STMA 3DF0A 4PDWB 5L9BA 2W0XA 1A3KA 1PVC1 2GP3A 3DEMA 4DEQA 1XYPA 2BVVA 1O3SA 5FYHA 3MLLA 4XJAA 4CUBA 4ET7A 3AJYA 4PLMA 3T2OA 1DQ6A 4U2AA 1OOPA 2D6KA 3NJXA 2RDQA 4UW5A 3B93A 3THDA 3NRUA 1JHJA 5CFCA 3WF2A 4PF1A 4LBKA 3WNPA 4BMEA 4Z2AA 1GOGA 1W8ZA 2JG9C 4HONA 4GAZA 3E6CC 5CKMA 1WGPA 1IG0A 2XONA 4AVVA 4DY5A 5E8AA 2WSVA 3KMHA 2YGLA 4IEXA 3KHBA 4ZS2A 4UW6A 1WA6X 5CKQA 2LRPA 3LF7A 3TEWA 3B9CA 4DNYA 5LK7B 2HKXA 4XFGA 4Q2FA 4DUWA 4Y5Z0 3USSA 3JBG2 4AQSA 5JOYA 1SFYA 2XXZA 3C7HA 2AGSA 5FZ9A 5A7PA 5I8TA 1CVNA 3GF6A 4Q0SA 1FI2A 1KDMA 1AX0A 2JD9A 4QKNA 2H0VA 4B7KA 4Q4W1 1JZ8A 1QMJA 4ZHNA 3VKFC 4B4PA 4IV3C 5LA2A 1X82A 2O8QA 3AFGA 5FUPA 3MV01 4YZ5A 3UGGA 4FTSA 4O7XA 2ZKNA 1OF3A 2VOXA 1Y3TA 1RC6A 2YHJA 1IKPA 3U78A 1GZCA 2XB6C 1W2NA 2E26A 3OBAA 2QCSB 1OD3A 1OHFA 1U5XA 2ZABA 3PTYA 4GALA 4W65A 3HMYA 3A0NA 3GJBA 1BVVA 4XEZA 1Q8QA 2PXJA 3VBRB 4BCUA 1RXFA 3ALQA 4GWMA 5FUIA 1Y4WA 1RUC3 3AP9A 4AVCA 1WW5A 2D44A 1I6XA 5L7OC 1XYOA 1NA1A 3MF6A 4V1PA 1D2SA 3H7YA 4IEUA 2IXJA 4XZUG 3CMGA 3CLPA 1CPMA 5FZCA 3BTYA 3AMMA 5J48A 2VCBA 3KV6A 4YFWA 1R091 2W1QA 4CEWC 4YVSC 3R05A 1GOHA 4YM1A 2QJVA 1RUG3 4QGNA 4CDUB 2EF6A 3PJYA 3PUAA 4OUEA 1D4M3 1MQTA 4JCKA 5DDJ2 1UZWA 3PVNA 3WLUA 4ASLA 1FAYA 1QY4A 4UWDA 4XZPA 5JUVA 2J1SA 1W2AX 2Z42A 4UW3A 4XCBA 4AVAA 1U5YA 4FPYA 4N43C 5LA9A 3NMBA 2FDIA 2GN7A 1FOD2 4AVTA 3MIFA 1QJU1 5GALA 1XNAA 2X8KA 2XBO3 4N53B 2DCKA 1JW6A 3A4UA 3NV3A 2OXBA 3GJAA 2DWRA 3H7JA 5CAZA 4BIOA 2ZHLA 3TRSB 1PIV1 1HN1A 3MI8A 4MYEA 3IMNA 5ACA2 4QPIA 4OQ9A 1L7LA 1YO8A 1Q8OA 4CPBA 1KD7A 1DYKA 3I2FA 4QPIB 1ND3A 1PX3A 2BBVA 1D0HA 1F31A 4GMP0 1AR72 5CFCC 3ZVXA 5FV3A 4EN7B 4YVWA 2FZ1A 2R071 2HYXA 2A75A 4YGCA 5F39A 5GLUA 4K1YA 1ND2B 5A6QA 1OPMA 4EYUA 3N9NA 3UGFA 3ZN6A 3WF3A 1W8TA 1LOCA 3N9MA 4TYSA 3W20A 5B2GB 5LW9A 3LZZA 1SLLA 3USUB 3U4SA 1HXS1 4J1WA 2PLV3 3PVOA 4N9HA 1UCXA 1W9YA 4NWVA 4MXWA 2VTXJ 2EICA 3KWVA 3TEXA 3Q8BA 4PQQA 3J7MA 5JSRA 5FXZA 5C3SA 5C4WC 1N3OA 3VBHB 2BU9A 3WDYA 4F3JA 4JVAA 2IFWA 5A33B 1S2EA 4QQLA 5FBJA 2PHLA 2CV6A 4XCAA 3SCHA 5A80A 1XC6A 5A70A 1HB4A 4LO6B 3OGRA 4D0QA 4OHVA 1T6BX 3TAYA 5DUXA 3UJQA 4C1XA 4Y5TA 3LEMA 4ZS3A 4BQXA 1MS4A 1DQ0A 1O5UA
chains in the Genus database with same CATH topology
3U0ZA 4Q8KA 1SACA 4AEDA 5FLHA 2LALA 3M3EA 2ZHNA 2ZMNA 4QPGB 1ZRFA 1CJPA 1JTZX 4Q4W2 4A3XA 2IFRA 4YYOA 3ZSEA 2BEOA 3JUUA 3VBUC 4FPHA 4DY3A 2BYVE 4FT8A 4IEOA 4X8NA 4YNIA 1WUVA 3RZZA 3BCWA 1G9CA 1ZBE1 3CJIB 1O3TA 4GH4B 4P9JA 3V0BB 4Y20B 4JGYB 1V6OA 4HN0A 4Q0PA 4CDQC 2NQYA 2RS13 1CAUB 4QQ2A 3SCGA 2B5HA 4QM9A 1VBA3 4QM8A 5BNNB 2C5DA 3H8UA 1G9AA 5AFBA 3WDVA 3V65A 3IPVA 4AG4A 1VRH1 1TQ5A 1B35A 4KWKA 1ENXA 3BODA 4RD7A 2CY6A 2H6CA 1QDOA 4HVOA 4XF3A 1W6OA 1BK1A 2YDEA 3ZDSA 2WT2A 1FYUA 5JAXA 2GAUA 4WM7B 4MGIE 1MZEA 1R092 3AP7A 5CFDA 1UU5A 2OW4A 4R8HA 1IGOA 1X36A 2VMIA 2Y0IA 1ND3C 4RS5A 5DUWA 4L97A 1FPN1 4XYXA 1RJ7A 4JTOA 3MIHA 1RUH1 4YVWC 5GM0A 4EROA 5FPXA 1YJLA 3R4DB 4S2HA 4J6GA 1HW5A 2O0OA 5K7PA 3LB9A 1QJU2 3ILRA 2GN3A 1RB8G 1ENRA 3SMHA 4FTBA 4KG0A 4LO4B 1YYNA 1XU2A 4YW1A 2Q4SA 4R4ZA 1PIV2 4QXKA 2GH2A 2NP0A 2FQPA 2R063 3THTA 3KS7A 4NPRA 1S1AA 2DCJA 2LTNA 4K3UA 2TNFA 1YI7A 3BIWE 3N35A 3QCWA 4FXGB 2P3KA 4I0BA 5I8YA 4G9SB 2R072 1NLSA 1LOBA 2ET1A 5KHIA 3DPRA 1HX6A 1ZBA3 2ARXA 3ENRA 1SQ4A 5CU1A 3RMYA 5JSOA 4CEYB 3MW2A 2KXLA 4DOUA 4Y1ZA 3FFZA 4RHV1 1HXS2 3KQRA 1SCSA 1V6IA 4ITCA 3ZFGB 1CAWB 1LOFC 1UKGA 2VXRA 4KU8A 1MACA 2R0HA 5JLVA 5K9YA 1SFNA 1VLNA 1QHDA 4FOQA 2P3IA 4OZXA 4FPLA 5GLWA 3R4SA 1HKDA 4Q1PA 1AYM3 3LA3A 3IDCB 4Y22B 3T2TA 2HJIA 2AYHA 4E4DX 1AL23 2AREA 5I0SA 5JI7A 1CX4A 4XFHA 3I59A 4W6WA 2P34A 2GC1A 5BY5A 1HQWA 4AEKA 1LHOA 3URFA 4TZDA 1VALA 1WLWA 3H9AA 4B4RA 3FBMA 2R041 5J98B 3H50A 3ZSLA 2EXKA 2Q1MA 1OQEA 3J8F1 2X53S 3BPZA 4YM2A 1D2QA 2MEV3 3NJZA 1ZBE2 2YYOA 5HI0A 3APBA 2IXCA 2OUJA 2DFCA 3LKJA 5DXDA 3QLQA 4HK8A 5FO9B 2GNTA 1YXWA 4HVRA 1O91A 1R083 4RS5C 5HBAA 3AP4A 4Q26A 4AGGA 3ZXFA 5EWSA 4LBQA 1VRH2 3L9JT 4OVEA 2YPJA 4WZFA 2RS31 4LO7A 4H3WA 2C1FA 4QQPA 5FO8B 5LRSA 5AVAA 1Q5OA 3ZYJB 1SLBA 3IM0A 4S2GA 5E88A 2BNNA 3GBFA 5HCAA 3Q9OA 1F5JA 1TEIA 2OVUA 1FPN2 2VUJA 3ATGA 4YZ4A 4ZU5A 2BQPA 4LBJA 1RUH2 1UIKA 4RR3B 1ZNPA 2KA3A 3I2DA 2A6ZA 1DBNA 1WD4A 1OA3A 4GKXA 1KDKA 5F6KA 1OQDA 1PZ7A 1ZRCA 2DVDA 4ATFA 2GMPA 5IT6A 5J09A 4AI0A 4FPOB 4LHKA 1CAXB 4NHKA 2CAUA 4YM3A 5JOZA 1O4ZA 1V00A 1RVF1 3MPPG 5FO7B 2WNEA 1Y43B 1PNFA 2UYBA 4QD2A 3FE5A 2ARBA 1W39A 3JZVA 4PF5A 5K0UB 1O3QA 4E2GA 3SITA 1OLQA 3RQ0A 4Z2WA 4AEJA 4RHV2 2JKBA 5FQ0B 3ZFEA 3IWZA 1PGW1 1D0GA 1ASJ1 2XVGA 1RMU1 4CP1A 1MEC3 3VBSA 1H2MA 1V6NA 3L2HA 2OZJA 1ZA4A 5JZGA 2V5YA 2XJTA 2WJSA 1JN2P 1H9WA 3M3IA 3P3PA 4N7IA 5SV8A 3VKLA 3D5OA 3R4UA 4AI1A 1QOSA 2A5ZA 4HPKA 4L2NA 2WQ4A 3QH6A 4Q4Y1 4I2OA 1I3HA 2HYKA 2D3RA 2R042 1Q8PA 1C5IA 2VU9A 2GMMA 3RDIA 3WW3A 1FNZA 4PIXA 1NE4A 2DVGA 2VQAA 1AVBA 4A7KA 1GZWB 1BYHA 3J8F2 3N7LA 4S2FA 3LSEA 4MH0E 1IS6A 2XKPA 4G3YC 3AK0A 4OI2A 5KC5A 3LCPA 5IUQA 4INDA 4E4ZA 1RUF3 3FX3A 5ABJA 1GICA 2CWSA 1XRUA 1X8EA 4MSVA 4XJ9A 4I09A 2BVBA 1APNA 3B02A 3TBDA 3GHNA 2XJVA 2NLRA 1ULGA 1CJDA 3RYPA 3PMEA 1RITA 5E16A 1NCRC 3ASIA 4CDWB 5DZGA 3LWCA 2RS32 3JCIA 4WVVA 3VBOC 3AP5A 3FLPA 2ZX4A 3KCCA 5GLTA 1XNKA 1ULDA 4WVZA 4XIOA 2XL9A 1O7FA 2ZGOA 1HRI3 2WT0A 2UWCA 2XJQA 2WNVB 4Q4X3 2VNRA 4C90A 1CAVB 3LA2A 4XTPA 3ZXKA 2IC1A 4XJ8A 1NCQA 1PK6C 3P3NA 4P9GA 3S7IA 5BNOA 4NWWA 3BALA 1AJOA 4WM8B 3ZYGA 4R52A 4LE4A 4LBMA 1AYN1 1OFSA 3G7DA 4LT5A 3ZFEC 1N3PA 2Y0OA 4XFIA 3ZMNA 5AC93 3BOWA 3JU9A 1RVF2 4O9EA 1VR3A 3VBSC 5BNPB 1UKRA 3WXPA 3WZ1A 1G9DA 3QD6A 1H1IA 2HWE3 4KNCA 4K8FA 4B3NA 4BQ1A 2UU8A 3MDPA 2GZWA 3VN4A 4IEWA 1OI6A 3WOGA 3I8TA 1PO11 1KRIA 2DUPA 4GKYA 2Q8OA 4EN0A 1RUD3 1RUJ3 4XBQA 3H1WA 4Y26A 5HXVA 1F2NA 1F5FA 1PGW2 1QXPA 5GZFA 2PHTA 1ASJ2 1RMU2 2GNMA 1MZ6A 3ZN5A 1FV3A 2DF7A 1N1VA 1REFA 3VGIA 2R32A 4JTNA 2RJKA 3ZIXA 2PHWA 4BWOA 3KLSA 2VUAA 1LTEA 1U5ZA 4Q1RA 3CF6E 2LUWA 4YGEA 3I4IA 1ZZ7A 3POWA 4FBFA 5ABJC 3QH7A 4Q4Y2 3WY6A 1XE8A 5T5LA 2JG9A 4HLTA 2VOKA 3VZMA 1COV1 1Q56A 4IV1C 2K9ZA 1VB2A 2PHXA 2XWJB 1ULFA 2XBO1 1W6PB 3FZ3A 4KL1A 2RR13 3WR0A 3ZXEA 4OUSA 1LEDA 4M01A 4JV4A 2E9QA 3KZ4C 3VZOA 1OLRA 2UYAA 1OMIA 2A6YA 2ZX2A 4E27A 2R1DA 1S2BA 4IV3A 1GQHA 1VP6A 5SV5A 4COWA 2QUOA 1HDKA 4L11A 2JD4A 1LOEA 1NCQC 4LHNA 2RE9A 5GZCA 4Z92B 3NAPC 2UWAA 2ILMA 5C9AB 3RG0A 4J1XA 5FOJB 3IT8A 2WZPP 2XUMA 2BWAA 4DINB 4KG8A 4Q8LA 2JE7A 1W6MB 2D3SA 1MS8A 4MGKE 1T6GC 3MIBA 1IKQA 2PLV1 2HEVF 1WCDJ 4MVTA 4HT1T 1UN1A 1GNHA 4FOWA 3S0MA 3RI8A 5L7OA 3FUQA 1LODA 1V6LA 1QU0A 3VKMA 4LBOA 3O7OA 5L7OB 1V6JA 2OUHA 1N1TA 4NOTA 1XQNA 3ZYRA 4CEWA 2DTWA 1A78A 1W0PA 4YVSA 1J1LA 4P9WA 1AYN2 4COYA 2VOWA 4BMBA 4AQTA 1QH7A 3RI9A 3GYDA 1AR63 3M2MA 4XPVA 1KS5A 1KXGA 1Z78A 1ONAA 2JG8A 4HANA 4M3CA 1I5ZA 4N43B 2DVFA 3OGJA 3WDTA 4A2UA 2WFF3 1YFXA 4AGRA 1BQPA 4IETA 1KJLA 2HWD3 1DYPA 2A7AA 4AW7A 1PM7A 5T52A 3EXUA 1PO12 1XE7A 2XHKA 3S6PA 4P9LA 4HBNA 1OOPB 1G7YA 1G9BA 4RQPC 4E2SA 2RS11 2GC2A 2AENA 1Z7S3 1VBA1 2JEMA 4IEZA 4RA0A 5CFCB 4AYUA 4LNVA 5KHJA 2ZMLA 3AYCA 3W9AA 4RGGA 1C8M3 3NL1A 4HKWA 4Y24A 2YV8A 1AX2A 5FTTC 4XHXA 5C4WA 2YY1A 5AFEA 3E6BA 1AZDA 4JDOA 4LHLA 1H9PA 1GSLA 4S2DA 2ZGPA 2W68A 1COV2 1O5LA 1QKQA 1DQ4A 4BH9A 2UY8A 5GLVA 4GULA 4FXKB 2XBO2 1DGWX 3E6DA 4W6XA 4K21A 3UJOA 3K51A 4PLOA 4R4XA 4UW4A 5J7MA 4M3CF 3WG3A 3ZFFC 4L99A 3LSDA 5T5JA 4Z8BA 4FVVA 5FAXA 2GH8A 4PBOA 1ZRDA 2YMZA 4PJYA 4E4SA 3VBUA 5IK8A 2D93A 2VG9A 3M3CA 1S2KA 3IIAA 5KXCA 1QJX3 3VBUB 1NA1B 2DCYA 2Z2SB 1HQLA 2WA4A 1ZBA1 2ZMKA 3HBZA 5KHGA 3KM5A 5KHHA 4CDQA 2B7YA 3VL8A 5A3LA 1QWRA 3KT1A 2PLV2 3IKWA 1AF9A 4PCRA 5C8CC 1MQTB 4F7ZA 4YLZA 1FT9A 2IXLA 4LA2A 5FCCA 2ZGMA 5A3MA 2JG8C 4EJRA 2TEPA 2G4IA 5AVPA 4AI2A 5T50A 1GQGA 2GDFA 5FRAA 4UBGA 4D3WA 3AZYA 5FDBA 5J3UA 2HWC3 2VVEA 3JBG3 1AYM1 2DUQA 1AL21 3B9IA 2ES3A 1RHI1 2WS93 5EYYA 2A73B 4YW2A 1Q8SA 3TOJA 3VKOA 5JOWA 1POV3 4PDWC 4FPEA 1ND3B 2JICA 3D4KA 2HWB3 1DFQA 4DPNA 4YVWB 2QKDA 1KITA 2OPKA 3RYRA 2GSYA 1PVXA 4BLJA 3ZN6B 1VBD1 4AFAA 5JPMB 4FAHA 1H0BA 3VHOA 5CNAA 4FPCA 3TN91 3D82A 2XG3A 2WC2A 5EFUA 2WLPA 4META 2FBEA 4MXWB 2C0ZA 2W39A 1WBLA 5BNQA 5A32A 4Y4YA 1MZFA 5KC6A 2RS12 4AHZA 2NMNA 4ES9A 1R1A3 3T1MA 1VBA2 1WMDA 2PFWA 2ZPXA 3VBFA 1F9KA 3H1MA 4OLLA 4YG0A 4WBBA 2RMU3 4RL7A 1VAVA 1YFWA 5DDJ3 1LECA 2ZAHA 4Q0QA 3M7AA 1NXMA 4XF9A 1C5HA 3RMXA 3B00A 5T5PA 5FMOL 1LOFA 1AR93 4LBLA 2ZBJA 4AEDB 3QOPA 2AH2A 4L9BA 1WW6A 2I45A 3POYA 3I54A 3N3HA 2HEWF 3ES1A 5J96B 1DZQA 1LRHA 5KXBA 4JC1A 1VBB3 4HMZA 2Z79A 3M8LA 5H9RA 3VBRC 3WW4A 1AR73 3ACLA 5JCTA 3GZAA 3AYDA 1QQP3 5LEJA 4KH9A 2WZR1 1PVC3 4OHXA 1S0GA 4FPKA 2WLQA 1TE1B 2UY9A 1AXZA 3IPVB 1B35B 3OPZA 3WUDA 1UMZA 5JPNB 2BNOA 1W6OB 1ZBA2 5T5OA 1W6NA 1QNWA 1RTVA 2V09A 3MFCA 1O4YA 1BCXA 3NSTA 3VDDC 5CFDB 4IESA 3A0KA 4AF9A 5IK7A 4MV2A 4RS5B 1O4TA 4LULA 4FCAA 4N53C 4LBQD 1LGCA 3M3OA 1GKBA 4YW5A 3E5UA 4QQHA 1EAH1 1OKQA 5CG9A 3WT3A 4GB31 1RUNA 2NMOA 1Q43A 3N7JA 1AYM2 1AUYA 3WV6A 1AL22 1RHI2 3FJSA 1SBDA 1BMV1 3EHKA 1H4HA 4M0NA 4FSJA 5F1RA 1EP0A 1V70A 1ND2C 4CDXA 2WSUA 3NVCA 1MVEA 3ZIWA 3VBFC 3N7KA 1H30A 1K5MC 1H2LA 2QVSB 4JGZA 3DPRB 4B29A 3ZO0B 2ZX3A 4DB5A 1VBD2 4XIKA 4E2QA 2VW2A 1SEFA 3AP6A 1RUE1 3M1HA 3VBHC 4WVMA 3TN92 3VZKA 1XU1A 2PHRA 1XNBA 2A70A 3O0XA 3M4FA 4FOYA 1IOAA 5CB7A 3MIEA 4Z07A 1X33A 5J36A 5IK4A 1YRZA 2ZGTA 3N36A 1V9U1 1DGWA 1ZX5A 2IXHA 2XLGA 3ST7A 3RNSA 1AXYA 2DUOA 4H14A 5KXEA 1CN1A 1UF2C 1WD3A 3M3QA 4QPGC 3DL3A 3I59B 4QGLA 2X5IA 3AJZA 2G9GA 4C91A 1YJKA 1H2NA 4ZXKA 2ZGNA 4EWDA 1IQAA 2X29A 1S0FA 3CJIC 3AKQA 3D0SA 3DV8A 4GH4C 1XXNA 1TMF1 1VIWB 1HQNA 2ETEA 2WNUA 1HIXA 4XFCA 3AKRA 1ZZBA 1ENSA 3RPQA 4YW4A 2VECA 3FHIB 4Y1VA 4K9SA 2R30A 5KBFA 2WZR2 4OFGA 1V6MA 3LA7A 4XOGA 1MS0A 1ZZ6A 2PAMA 4TWTA 3BU7A 4TLFA 4DZGA 1HXS3 4F8AA 4LBQB 2E7QA 1UX6A 3OYWA 4R9AA 3JB8A 1QF3A 3PNAA 2VMHA 3UK9A 4L92A 3AMQA 3RSJA 1VBE1 3O5SA 3ZXGA 3E5QA 3U4XA 3TWIA 2VQ0A 4XF4A 1RUJ1 4GMP1 3RJRA 1X50A 1H1AA 1RINA 2KM2A 4CDXC 1POV0 3EBRA 5F5QA 4PIYA 1DU3D 4HFSA 3AKTA 4FOVA 1NCRA 4PBPA 1GANA 1EAH2 1U5IA 4JGZC 4KWLA 4DFSA 3VBOA 1HLCA 2DCTA 3KSCA 4GB32 2BFUS 2GALA 2QNKA 1QNYA 1WLTA 2VW1A 4B8EA 4C1WA 1HV0A 1BMV2 1U12A 1ENQA 3S30A 1CESA 1W6QA 3POSA 4MXVA 1PK6A 3WNXA 2ZHMA 1VJ2A 2ERFA 5GZGA 1GV9A 5LK5A 4OHZA 4QX5A 1RGSA 1URXA 1UL9A 3ZFGC 2E7TA 4IEPA 5I0TA 4AVSA 4BOWA 2RR11 3UKTA 4X6QB 3WVJA 1RUE2 1IS3A 1VBC1 1YWKA 2X5IC 3ZFEB 1MS1A 3MLKA 4UBHA 3V0AA 1VRH3 2PA7A 1GYKA 3T1LA 3R0RA 1LCLA 2P37A 2EAKA 3VBSB 2RM23 4AEMA 1NLRA 5I0UA 3QBQA 1V9U2 3PJQA 3FLRA 4BLIA 2D6NA 5JZGB 1C57A 1FMD1 4GWNA 1S0BA 1E57A 5T55A 4BE3A 2WNUC 2RHPA 1HRV3 2E53A 4G4FA 1FPN3 3VHRA 4ATEA 3SH5A 3OBRA 4HPKB 5BUVA 3B3QE 5DUUA 3DKWA 1BBT1 1EV13 4COVA 3WCRA 4AQ2A 3B94A 1LENA 4AE2A 1UAIA 2ZGLA 5D8AA 4EWAA 1BEV3 4D7YA 2D43A 1D4VB 2ZACA 3HQXA 2TUNA 1TMF2 3AXDA 4PIZA 4XQ4A 3ZYPA 1DZTA 1W2UA 2HWF1 2H6BA 4NR1A 2PAKA 2EVXA 1TME1 1BXHA 2XL7A 5I8SA 5ABJB 3B7MA 4DRVA 5DG1A 1VAMA 3NV4A 4IV1A 2ZCWA 1RUI3 4IERA 3VZJA 3WD5A 2XVKA 4RHV3 1LU1A 2VNGA 5EV7A 4B4QA 3ZX7A 2CNAA 2ZOEB 2WFF1 3IBMA 4OUMA 2VULA 2HWD1 2NZ9A 2ZJCA 4H7LA 5C33A 1B09A 1LOAA 1VBE2 1SLCA 4JQRA 2EXIA 2B45X 2D5HA 1JXNA 4RR3C 1RUJ2 2MNGA 4Q0VA 2AZ5A 4I3PA 1QXRA 2B8MA 2G9FA 3NAPA 1NCQB 2XJRA 3AXEA 5BNOB 3WINE 4R9BA 2XLFA 1X7NA 4D7SA 5L19A 1YNAA 1AR83 2WINB 3ZSMA 1NXD1 5E89A 5DG2A 3S7EA 3J8F3 3TB0A 5K0UC 1KFXL 1PGL1 1S0CA 3N7MA 4QMAA 1DG6A 2P17A 1H8TA 5GZEA 3WHUA 2CGNA 2W52A 3SNMA 4CP0A 2YROA 3WDUA 2D7FA 2A3XA 4KWJA 3V56A 4RFT0 2RR12 2R16A 3AMPA 4C0BA 1VBC2 4YW3A 1PMIA 4DXZA 5TSWA 1GBGA 2WL1A 1ALYA 3PLQA 1WMFA 5D8AC 3AMHA 1RUC1 1DQ2A 4K7JA 4YRDA 4YG3A 2BUKA 1J3RA 1UW8A 2CL2A 5T54A 3TNPB 4BHPA 4U36A 4CZSA 1FMD2 1QJY3 4AHYA 4COZA 4YSFA 1RUG1 4XBLA 4O9GA 4BZ4A 4COUA 1D4M1 4RQPA 1FX5A 1KJRA 3FLTA 1BBT2 3J26N 1DHKB 3NWKA 2JG9B 4ORFA 3PVBB 3HAGA 3ILFA 4IEVA 3EO6A 1JYCA 3AMNA 3RYKA 1M4WA 2HWC1 4HN1A 4EN6B 3AFKA 2DCZA 1S0DA 3FUOA 1RVF3 2P2KA 2JDZA 1JHNA 2HWF2 3OTFA 2WS91 1H8VA 2PHDA 3DN7A 1AX1A 1TME2 2F6BA 2PAEA 1I1EA 4XXAA 5FOBB 1GR3A 2QZ2A 2ZAAA 4IEYA 4IV3B 2GC0A 2HWB1 2CYFA 1BZWA 1YUDA 4X8PA 2QZ3A 2IXKA 1LGBA 1M06G 1KFUL 1ZM1A 2WFF2 2A3WA 2HWD2 2RS53 4FTEA 5CG8A 1Y7BA 2WNVC 3U11A 1JUIA 3ZFFA 2NM1A 4N7UA 2XJUA 3ES4A 3VL9A 1HV1A 1XNDA 4Y1XA 1H4GA 2DU1A 3H1YA 3K48A 5JI9A 4R9CA 1J1TA 1R1A1 2ZA9A 1H8TC 2QQPA 1YFYA 1NY71 2W08A 3IN9A 2RMU1 4Q4Y3 3OY8A 2IXIA 4CEWB 1NYWA 4YVSB 1UIJA 5BNPC 5C8CA 4EWEA 2D40A 1AR91 1MS3A 1CIWA 4RGAA 2CAVA 1OA2A