1GBGA

Bacillus licheniformis beta-glucanase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
QTGGSFYEPFNNYNTGLWQKADGYSNGNMFNCTWRANNVSMTSLGEMRLSLTSPSYNKFDCGENRSVQTYGYGLYEVNMKPAKNVGIVSSFFTYTGPTDGTPWDEIDIEFLGKDTTKVQFNYYTNGVGNHEKIVNLGFDAANSYHTYAFDWQPNSIKWYVDGQLKHTATTQIPQTPGKIMMNLWNGAGVDEWLGSYNGVTPLYAHYNWVRYTKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (glucanase)
molecule keywords (1,3-1,4)-BETA-D-GLUCAN 4 GLUCANOHYDROLASE
publication title Crystal structure of Bacillus licheniformis 1,3-1,4-beta-D-glucan 4-glucanohydrolase at 1.8 A resolution.
pubmed doi rcsb
source organism Bacillus licheniformis
total genus 49
structure length 214
sequence length 214
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 1995-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1gbgA00
1JYCA 3OYWA 1YO8A 1JW6A 1S0JA 1W6PA 1AVBA 2ZGTA 1B09A 1SBDA 2VW1A 5GLUA 2D6OX 4JC1A 4YGDA 4BMBA 5JLVA 1GYKA 4DRRA 5JDBA 2OUHA 2VW2A 2WQZC 5DZEA 1LOFA 1C57A 1DQ4A 1SLTA 3GALA 5GLVA 1N1YA 3B01A 4XJWA 3ZXFA 1G9CA 1C1FA 2ZHKA 3NV1A 1QGLA 3RS6A 3V0BA 1UZZA 1DYPA 3AXEA 1ENRA 2ZGRA 1WW6A 1Z78A 2R0HA 1CVNA 5T54A 4FPEA 1UZYA 5JMCA 1DYKA 1YI7A 1AX0A 3WVJA 2W68A 3M3CA 4YZ1A 2OUJA 4K1ZA 5T50A 1LU1A 2ZGQA 1HQWA 4LBKA 1PZ9A 2DV9A 3AFKA 4YGBA 1KQRA 5DG1A 2A70A 3D4KA 2D7FA 3VKFC 3AJZA 1KJLA 5FREA 4LBNA 1UAIA 1O4YA 2CWSA 4Y22A 4XYXA 2DUQA 2P34A 1BXHA 1DQ5A 3INAA 4M3CB 5DXDA 4AGRA 4YZ2A 4ATFA 1FATA 3OBTA 2DVGA 1AZDA 3MW4A 4XIKA 3WHUA 2ARXA 2ZZJA 3B3QE 1OKQA 1ULCA 1LECA 1ULEA 2DTYA 2Q5TA 4P9XA 3SH4A 2DVDA 2G4IA 2VU9A 3WDXA 1IS5A 3M1HA 4Y20B 2WLQA 3UJOA 4YZ4A 4LBMA 4XBQA 1I1EA 2P3KA 3WDWA 1MVQA 1IS6A 1S0FA 5IT6A 1SLAA 3QLQA 1MS5A 2PHXA 4P9YA 2XB6C 4Y24A 2DYCA 1FAYA 4XMIA 2UWBA 4GKYA 5JVVA 1ZA4A 2A3YA 5F9TA 4KBBA 3M3EA 1QDOA 1AF9A 2GMPA 3KQRA 5DG2A 4Q1RA 3ZXEA 4W65A 1JN2P 3D6EA 2ERFA 2D43A 4AVTA 4YW3A 4NOTA 5GLZA 2RHPA 4XIOA 3SISA 2GNDA 3ZSLA 2LALA 3R05A 3NWKA 3KM5A 1RITA 2YMZA 1G9BA 4YG3A 4YG6A 4DQAA 4RA0A 4Y1VA 3ILRA 1NLSA 3WZ1A 4XJ9A 2CWMA 3FLRA 3GNEA 4MYEA 2YY1A 4XXPA 2E6VA 1GSLA 3R4UA 4Q26A 1AJOA 2ZMLA 2D3RA 2GDFA 3WDUA 2CL2A 4NO4A 1S0GA 3B69A 4LBOA 5GJ6A 5GZDA 1GZ9A 1QU0A 4FPCA 1AX2A 4GXLA 3QCWA 3RSJA 3H0OA 2PELA 1QOOA 2ZMNA 3OYWB 1N3QA 4GALA 4ITCA 2EAKA 1W6PB 2AGSA 2W52A 4YM2A 4CTEA 2CY6A 4FPJA 2VXRA 1A3KA 1SLLA 1G7YA 1AXYA 1UPSA 3N7KA 4GWMA 3N3HA 1FNYA 3POSA 2ENRA 1GKBA 4XZPA 1V6MA 2ZGLA 2E7QA 1SLIA 5DZGA 3WHTA 4YFZA 1ENQA 2JKBA 3AYAA 3C2UA 3IMNA 3LSEA 1SBEA 3V0BB 1MS9A 3AZYA 3Q9OA 4YZ3A 3V0AA 1KRIA 3V65A 3WV6A 2A6WA 1WW7A 1SACA 1QDCA 4XXAA 5GM0A 2BQPA 2ZGPA 1NXD1 1MS8A 1Q56A 5T5PA 5E89A 1LENA 1RINA 4YM1A 5GLTA 4K1YA 1U0AA 2AH2A 3AZXA 3M2MA 4Q2FA 5DUWA 4JRAA 3UL2A 2ZMKA 4YLZA 4YW4A 3NV4A 5DUXA 2AREA 2ZA9A 4XJUA 5T5LA 1MZ5A 1UX6A 4PBOA 1VAVA 3AP9A 1W6QA 1DQ2A 1GANA 2TEPA 2VW0A 3ILNA 1LULA 2XG3A 2R1BA 2YZ4A 1SFYA 2JECA 5KXCA 1JXNA 1KITA 1UKGA 1OQ1A 2UWAA 1MS3A 1SLCA 4AVVA 1APNA 2EALA 3I4IA 3AX4A 1XQNA 2A6YA 2ZHMA 3APBA 2ARBA 2R49A 1YIFA 2ZGNA 3USUA 1LHUA 3MW2A 4RL7A 4AGVA 2OVUA 3AYDA 3O0WA 3ZXJA 2Z42A 1S1AA 4LBQD 1CN1A 2R0FA 3MEPA 2NM1A 2ZGMA 1YXWA 2AYHA 1BQPA 1H9WA 1LEMA 4UW5A 2GALA 3T2TA 2PHTA 4OZXA 3OY8A 3ZYRA 1GNHA 1MS1A 3AXDA 3ZSJA 4YM3A 3RMXA 1FX5A 1QOTA 2PHFA 4FP2A 1N3PA 4Q1PA 1V6JA 4R9BA 3HR9A 1LGNA 1WLWA 2JE9A 1BKZA 1G9FA 4SLIA 3IN9A 2R1DA 3LCPA 5JOZA 4YW5A 1N1VA 2NMOA 2GMEA 1DBNA 1V00A 3WG4A 4Q27A 1WW4A 5EYXA 2YROA 3T1LA 3W58A 4XDQA 2WNEA 4XTMA 1X50A 4ZXKA 1SBFA 2SLIA 3OPZA 1FYUA 2OW4A 1FNZA 3IKWA 5KXEA 1W0PA 3FLPA 1LTEA 1WD4A 1Q8SA 2A6VA 4XBLA 4PQ9A 4BLIA 2D6KA 3POYA 3FLTA 4M3CF 1DQ1A 4YM0A 5GZGA 4YGCA 2P3IA 3VKMA 3B00A 1W6NA 1H30A 4FOWA 1GZCA 4TZDA 2D3SA 1LHOA 2NP0A 1VALA 1EPWA 1LOBA 3O0VA 2SBAA 1C4RA 3V0AB 3RG0A 2GNTA 1BJQA 1N3OA 2P3JA 1LCLA 1CPNA 2W08A 4FPYA 4K20A 1LOEA 1DQ6A 4F83A 4DFSA 1W6OB 1LGCA 1D0HA 3M3QA 5H9SA 1GV9A 4M3CE 5T5JA 3ZPYA 4CRQA 2PHRA 1UL9A 2JJ6A 2ZAAA 2A6XA 2ZGKA 2DUPA 2WSVA 2VUAA 4FPFA 3SH3A 4XOGA 1LHVA 4BPZA 3O5SA 2EXHA 2ZBJA 2HYKA 1UMZA 3ZXKA 4FOVA 4GWNA 1HDKA 3WLUA 2JDZA 1S0DA 2V73A 2EF6A 1TEIA 1W6QB 3IM0A 1ULGA 3PVOA 4P9WA 4XTPA 5HCFA 3MW3A 3BTAA 3JU9A 2C5DA 2ZKNA 3AP4A 4D69A 1JOJA 3HN1A 4YZ5A 2GNBA 4ASMB 3AYCA 4FPLA 2NN8A 3FBYA 1S0IA 4BMEA 4U2AA 5T55A 1H9PA 3USUB 2A3XA 4JCKA 1WBLA 2WT0A 4XJAA 4Y1YA 1MR5A 2E51A 3OGGA 1WUVA 3M3OA 1YRZA 1V6IA 1WLDA 1BZWA 1O4ZA 1Q8OA 1WLCA 2A7AA 1JHNA 4PCRA 3WUDA 4AWDA 2WKKA 4DS0A 4XJZA 5HCBA 4FVVA 4FP3A 3RQ0A 1QOSA 2FHRA 3L2YA 1FV3A 2NZ9A 1QNWA 1Q8VA 4L8QA 3AZVA 4XJ8A 3BOPA 3OY8B 1FV2A 1OFSA 2H0BA 5H9RA 5IK8A 4BOWA 4R9DA 2W39A 1DLLA 2PHUA 4WVVA 2A71A 4Y22B 4Q8KA 1Q8QA 3FFZA 3LSDA 4IQPA 5CAZA 2C9AA 3OBRA 2P37A 3WCSA 2DVFA 1IOAA 3A0KA 3ATGA 3ZYPA 4FOYA 2LTNA 5EWSA 5H9PA 2ZACA 4YW1A 2A6ZA 3N7MA 1F9KA 3A4UA 3VV1A 5T5OA 1W6MA 2JE7A 3PMEA 2KM2A 4Y1ZA 3T1MA 5H9QA 5DUVA 1DIWA 2WT2A 1R1ZA 4YW2A 1HKDA 3TB0A 1V6KA 1HLCA 4YFWA 1LOFC 3WDVA 5DZFA 1BYHA 1LHWA 1DQ0A 1LU2A 3PJQA 4UW6A 5FRAA 5IK5A 1WBFA 4H55A 4BQ1A 1F31A 4FPHA 1W6NB 2A75A 3O0XA 1DZQA 1LEDA 4TYSA 2E53A 4Y26A 4AYUA 1C1LA 1QKQA 2VY0A 2D44A 2YV8A 4BLJA 4M01A 3ENRA 3N7LA 1CR7A 1Z0HA 1URXA 2VH9A 3W59A 1MACA 3B9CA 5CNAA 1G8WA 4ATEA 3AYEA 4K21A 1KJRA 4Y1XA 1D2SA 1AX1A 3IPVA 2AR6A 2E7TA 2EXJA 5IK4A 2P2KA 1MZ6A 4GKXA 1MS0A 3VUOA 1V6LA 1MS4A 5E8AA 1IS3A 5GZCA 5KXBA 1KDKA 3RRDA 3SITA 1LOCA 5GLWA 2B7YA 4WZFA 4BM8A 2ZHNA 5BYNA 2GMMA 3HMYA 4U36A 1GZWA 2NMNA 4R9CA 1JBCA 2UURA 5JOYA 4FPGA 3U4XA 1WW5A 3V64A 2CNAA 5CBLA 1IKPA 4DPNA 5EYYA 3SH5A 1GBGA 2DVBA 3ILFA 5DUUA 1N47A 1VLNA 4LBQA 3UJQA 3CNAA 3WNXA 5L73A 4Y1UA 1JUIA 1CONA 3UK9A 4AVSA 1CESA 3SLIA 3R4SA 1LGBA 4ISQA 3WG3A 1GICA 2D6NA 2DTWA 3ASIA 5HCAA 1PZ7A 3RMYA 2JD4A 1G9AA 1LODA 4XILA 3BIWE 4PF5A 3TAYA 3ZSKA 3PVEA 1LOAA 1J1TA 1Q8PA 2DUOA 2EXKA 3N7JA 1VAMA 1AJKA 1LJ7A 2DURA 2A5ZA 2GN7A 3WUCA 4P14A 2I2SA 1LOGA 4FPOB 2ZHLA 1DHKB 5F5QA 5GALA 5GZEA 5JOXA 2PHWA 4XBNA 1CPMA 3SNMA 1ULFA 3WOGA 4LBLA 5IK7A 2NYYA 3AZZA 3WCRA 1CIWA 1F5FA 1G86A 2EXIA 1WD3A 4WV8A 1G9DA 3OJBA 4R9AA 1S0BA 3A0NA 1JYIA 5LK5A 1MVEA 3WDYA 1V6OA 4UW4A 1DGLA 2D6PA 1LHNA 4GA9A 2V5YA 1KDMA 2AENA 3ZXLA 3FUQA 3I8TA 1W0OA 2D6MA 4C1XA 5JOWA 5SV8A 3D5OA 3AJYA 3VKLA 2R16A 3AZWA 4ZKTB 1W6MB 3N36A 1VIWB 1A78A 1GNZA 5AVAA 5E88A 2ZGSA 4WVWA 1CJPA 4XE9A 1SCRA 3O12A 1IS4A 1WCSA 4M3CA 2YXSA 1ONAA 1LESA 3POWA 4FOQA 3VKOA 2ZGUA 1A8DA 3BODA 5CB7A 1IKQA 2D3PA 2DWRA 5T52A 1I3HA 1AXZA 3ZSMA 4C1WA 3PVNA 4Y20A 3AP7A 2CTVA 5IUQA 1V6NA 2WSUA 1HQLA 2EIGA 2WJSA 4M00A 2D6LX 1YYNA 2GN3A 3DUIA 5KXDA 5GZFA 4AGGA 2ES3A 4HL0A 2ZGOA 3VKNA 1SLBA 3ZVXA 3AP6A 1ULDA 3FUOA 2DVAA 1PZ8A 1S0EA 3N35A 3NV2A 4ISRA 2GNMA 1QNYA 3IPVB 1QF3A 1UN1A 4LBJA 4Q8LA 1S0CA 4UW3A 1ENSA 1Y7BA 4CZSA 5CA6A 2CYFA 2DU1A 5EXOA 2WT1A 2AUYA 3WG1A 4Z8BA 4FQZA 3AK0A 4XHXA 4YG0A 1SCSA 4PBPA 3AP5A 3NV3A 1AXKA 4FPKA 4XHBA 2UWCA 1QMJA 2ZABA 4DRVA 1W6OA 3JUUA 1GZWB 3WDTA 3MPPG 4FQ4A 3WG2A 1RIRA 4XMAA 1N1SA 1GLHA 4I30A 1CQ9A 2DU0A 1DFQA 2FMDA 4LBQB 4YGEA 2UU8A 3DGTA 1N1TA 4HANA 1ZM1A 2A3WA
chains in the Genus database with same CATH superfamily
2YGMA 2P4EA 1TME3 3PUIA 1S0JA 3WR0A 3GCXA 4LUMA 4BHPA 1SBDA 2VW1A 4ZU4A 2D6OX 4JC1A 4YGDA 3UETA 4L9BA 4Q4W3 3UNPA 2OUHA 5DZEA 1FOD1 1DQ4A 1SLTA 3GALA 4E2QA 5A1AA 1STMA 3B01A 1PGW2 2BVVA 1J1LA 2YU2A 4H2AA 4WM7A 4XJWA 3ZKYA 5LCWL 1G9CA 3GZTB 3NV1A 2K9ZA 1QEXA 2RS31 3RS6A 3QBQA 1AR92 1ENRA 1GFF2 3NJVA 3S30A 4BQ4A 5IVJA 2F6BA 4AOCA 3T08A 4PIYA 2PLV1 2QQJA 3WF3A 3WQBA 1QH6A 3J26N 1CVNA 1GNYA 2P6CA 5DDJ2 3U10A 5JMCA 1DYKA 2VL4A 1Y4WA 5FMBA 4GH4B 3IZOA 3OF1A 4K1ZA 4BIFA 5M0TA 1W2TA 3WNMA 1UWWA 4ES8A 4PIXA 5A7WA 5FPLA 4YGBA 5IVCA 2JXAA 2A70A 4EN7B 1X36A 1AR73 1QJU2 2D7FA 3AJZA 3WW1A 5IFTA 3J7LA 4M0HA 5FREA 1UAIA 2CWSA 4XYXA 3WZ1A 1AR81 3ZFFB 5C4WA 3INAA 4YW7A 5A3UA 3RZHA 3P3NA 4YVWB 1H0BA 4CE8A 5C3SA 3B3QE 2BOIA 1F5JA 1ULEA 4H7MA 1VRH1 4LKDA 1BK0A 4P9XA 2G4IA 2XUEA 2VU9A 4MGIE 1IS5A 4L99A 5I93A 5LA2A 4HXCA 4YZ4A 2WUHA 4NRMA 2P3KA 2QNKA 5EHDA 3TRSB 1UU5A 1BVP1 2PHXA 2KD7A 2DFBA 4K8FA 5L9RA 2WZR2 3OPTA 4WM8C 3WNNA 1PNFA 3K51A 3OUIA 1COV2 5JVVA 2DDUA 4CDQA 5JXGA 3DF0A 1X33A 1MZEA 3NJXA 4FFGA 1NYWA 2GMPA 4MHUA 5FYSA 1TNRA 3OGJA 2H6BA 3ZN6B 4W65A 1JN2P 1W3VA 2HBTA 2D43A 2ID4A 3SXWA 3U07A 2VUDA 4AQTA 1UY3A 5FPBA 1OFNA 4JQRA 3ZSLA 1PO21 4DEQA 3ETPA 1HN1A 3R05A 2GH8A 1IG0A 3ELNA 5EJZB 3DECA 3DN7A 3FFQA 1RITA 4Q0QA 1PVXA 4Q4V1 4AHYA 4DQAA 4Y1VA 4CEYA 2RS52 2QBXA 5FTTC 4BQ5A 2Y0OA 4E4ZA 3ZYJB 4ZZ5A 1HB4A 4IEUA 1GSLA 3R4UA 2W9XA 4W4ZA 1XYOA 2HH9A 4RS5A 2IZWA 2D3RA 4QGNA 2GDFA 4A2UA 4A44A 3BIEA 2XL9A 3WDUA 3EJKA 4NO4A 5I8TA 3B69A 3ZXAC 4XC9A 5CG8A 1K12A 1W39A 4NWWA 3KF3A 3QCWA 4R8HA 2W46A 5FZ3A 4BU2A 3GYDA 4GALA 4CYDA 4DB5A 4EJRA 2VNRA 4XF4A 3U14A 2CY6A 4FPJA 2OT7A 3OSDA 3VBOC 1QJX1 5FP9A 5IWFA 3HBKA 1W8WA 1AXYA 3T0AA 2XJRA 3N3HA 3TBDA 1NCRC 4L11A 4NUBA 1YC61 4P5HA 3AKTA 1XC6A 2PYTA 4WM7B 5DZGA 2WA4A 1ENQA 3C2UA 2IXIA 4CCMA 1MEC1 2VMDA 3ZMOA 1ALYA 1Z7S1 3RGBA 3AZYA 5F6LB 3UYJA 2V09A 5FYZA 3SCFA 3Q9OA 4YZ3A 4LE4A 2JDNA 1JZ5A 3CKHA 3WV6A 5FWJA 5FMOL 2Q1ZB 4PT6A 1PGL2 1IG3A 2RR12 2FZ2A 1QDCA 1RXFA 4CPBA 4BXFA 2BQPA 1JZ8A 1NXD1 1AYN1 1NCQC 1Q56A 5T5PA 3E5QA 4YM1A 4CCDA 5F37A 1U0AA 2AH2A 3U37A 1PK6C 3M2MA 1VBB1 5C4WB 4YW4A 2WNUC 4C91A 1C8M2 5F3CA 1WCQA 1WCDJ 4UXAA 4CEWC 3N9LA 4XUNA 1DQ2A 3D8CA 2AEZA 1RGSA 3E97A 1VBD3 4A7KA 2F4LA 2FCTA 2UWAA 4AVVA 2EALA 1BEV1 3NAPA 4IV1C 3UESA 1XQNA 5KHJA 1SG3A 5FZAA 4N9IA 1UYPA 2ARBA 2R49A 3J4UH 4CDQB 1LHUA 1EV12 3IIIA 5SV5A 2XDVA 4YRDA 4FXKB 1WZXA 1CAXA 2WS93 2YPJA 3L2HA 3ZXJA 3BB6A 2GC3A 2JG9A 2Z42A 2BU9A 4HPKA 1AR91 4LBQD 1ZZBA 1CN1A 1EAH2 3FHIB 4AQSA 1W8FA 2WYSA 1REEA 2R063 1RL3A 2GALA 2WABA 2VQUA 1GWKA 5HXMA 2I45A 5DDJ1 1K45A 3OY8A 3ZYRA 2EIEA 1MQTA 3AKRA 2HWF2 1ZX5A 3GJBA 1FX5A 3CHXA 4FP2A 4A45A 4CEYB 3POBA 5JZGB 2B45X 2RDQA 2G19A 1LGNA 2JE9A 2JDYA 4SLIA 5FUIA 2PXJA 4RS5B 5C5TA 3EQEA 1W99A 3WG4A 5EYXA 4N53C 3IMMA 2YROA 2NPIA 4NWVA 3ZPOA 4KGGA 4QAWA 1W8TA 4BWOA 4QQLA 5KXEA 2QQLA 3FLPA 4MZUA 1CAUA 5DQ0A 3WD5A 5A3MA 4BLIA 2D6KA 2VC9A 5FP8A 3FLTA 4S2FA 1S55A 5FZLA 4YGCA 2PQSA 3C7GA 4G4FA 3VKMA 3O1RA 4ZZ8A 1RB8G 3BOWA 1H6XA 3ALQA 1NXMA 2FDHA 4EV0A 5ABJA 1FOD3 3JB8A 2WZR1 3U1XA 1EPWA 3O0VA 5FXZA 2SBAA 1COV1 3RG0A 2RS33 1BJQA 1N3OA 2P3JA 1LCLA 2JICA 1OA4A 1XNBA 1DQ6A 2PLV3 4IGPA 4M3CE 5T5JA 3BU0A 3VHRA 1OI6A 5FDBA 2ZAAA 2A6XA 3HQUA 2ZGKA 3MUY1 5FZ9A 5DAPA 4FPFA 5A7SA 4XOGA 1JU4A 2XGXA 4XFAA 5F3GA 1YQ2A 3O5SA 2ADEA 3CZJA 5A80A 3GF6A 2BNOA 3BPSA 3M4FA 3FHQA 2RS51 4J1WA 2VCCA 3URFA 3LOBA 2A73B 2YPDA 5GKAC 5A6QA 4MSVA 3WLUA 1PMHX 4OLLA 4AFBA 1PX4A 2RMU2 1AR83 2XKOA 2YGLA 2W2IA 3PVOA 3IM0A 2J1EA 3TEYA 4XTPA 3JXSA 1FPN2 2IXLA 2KR2A 2EIBA 3JU9A 3POJA 2TUNA 4OUMA 4JTOA 3ZFGC 5F3EA 1XNCA 1VRH3 2X09A 3MIHA 1R1A2 3KV4A 1X8MA 4FPLA 3NAPB 4I01A 4I3PA 4D7SA 5A3TA 2BFUS 4PJYA 3GHMA 4BMEA 1IPKA 2A3XA 4Y33A 4XJAA 2Q1FA 2WT0A 4FSJA 2XJSA 3MIEA 1MR5A 5JSPA 4RSUA 4JDNA 1CAXB 1O4ZA 2A7AA 1VPHA 1RYYA 2JG9B 2Q0AA 3BYWA 4HPKB 2WAOA 5ANQA 1VAKA 4AWDA 4KU7A 4XJZA 4FVVA 1QOSA 1FV3A 2NZ9A 3RYKA 5BNOA 1H8VA 4AAPA 3OY8B 1FV2A 1MQTB 4RR3A 2FDJA 1PGL1 4COYA 3E5XA 4BOWA 5IK8A 4R9DA 1PO23 1UY0A 2RR11 3LDKA 4CU9A 1DLLA 1VMJA 4WVVA 1F2NA 2A71A 5DABA 5C3RA 5CAZA 4Q4V3 3CIHA 2WINB 2KA3A 2ET7A 1BVVA 3H3LA 1OF4A 5EWSA 2ZACA 4NHKA 3PUSA 2Q8EA 3A4UA 3UGHA 5T5OA 3VV1A 2JE7A 3PMEA 5A3NA 1W3XA 4Y1ZA 1OLMA 2PA7A 1OOPC 1C8M1 4QDSA 3EO6A 2WAAA 1DZRA 4QXHA 3WNPA 4NIIA 1R1ZA 1HKDA 1KD7A 1CAUB 4F8AA 4DUWA 3NNLA 5CEHA 1K3IA 1VMHA 3O1PA 3NW4A 2OQ7A 5DZFA 1C3HA 1DQ0A 1LU2A 3PJQA 1WMEA 1WBFA 1UW8A 3MYXA 1F31A 4RD7A 3OOXA 1QJX3 4RQPA 4BQ2A 1H1IA 1VE0A 1LEDA 2BPA2 3CZUA 5ABJB 5D8AA 5CFCA 1W8ZA 5LA0A 3I2OA 1C1LA 5FY1A 4OHXA 5FJHA 3OG2A 2DCTA 4HONA 5A1FA 4COZA 2QTWB 2YV8A 4M01A 1EV11 1MEC3 2P6HA 4B4QA 3PJYA 3KGZA 1KS5A 1Z7S3 4ATEA 1EAH1 5IW0A 3W20A 2EXJA 2E7TA 2VR4A 1XNKA 4BQ3A 4GKXA 2Y6FA 1XRUA 4XDPA 1QWRA 2X10A 1V6LA 3VUOA 3N9MA 1MS4A 3FJSA 2HWF1 5E8AA 4A42A 2BERA 1AYN3 4CDWA 4Y5TA 3SITA 2Z2SB 1LOCA 2B7YA 4BQXA 4LR4A 5FZOA 1LNSA 5FZIA 4U36A 5A3LA 5JOYA 4BK5A 2UURA 2Y6JA 1VBB3 3P5BA 5FYBA 1WW5A 2CNAA 5CBLA 3ZXGA 2VZVA 4Z92B 1BBT2 3SH5A 3T4VA 1N47A 1R082 1YQCA 3C3VA 3A23A 2PHLA 4XQ4A 5C33A 1JZ7A 4HZFA 3UK9A 3WINE 4AVSA 3BPZA 4MHRA 2QZ3A 3LEGA 3ROUA 3FL7A 1GICA 3ASIA 5HCAA 5JCTA 4Q0VA 4EZ4A 2JD4A 5DAQA 2WYFA 1I9RA 3POFA 1BEV3 5CKQA 5FOBB 4K8RB 3T1MA 1LOAA 2XVLA 3I59A 2ZEYA 3WUCA 5GZEA 2I2SA 1LOGA 3JQWA 2ZHLA 1DHKB 5F5QA 5JOXA 3KCXA 1JMUB 2PHWA 3MF6A 3SNMA 4CCCA 5BNOB 4LBLA 3WXPA 4DOUA 1J59A 2K0GA 2XMLA 1AR93 3NO8A 4RR3B 3WCRA 2EXIA 3CU7A 3LWCA 4LK7A 2DBNA 3OJBA 4OCTA 2WLPA 3A0NA 4J6GA 3WW3A 3GM8A 3D0JA 1O3TA 1MVEA 3WDYA 5C8CA 4JGZC 5DDJ3 3O7OA 2ZKLA 4UW4A 1YUDA 1LHNA 2Z69A 4FXGB 1J83A 3T3YA 4C1XA 5JOWA 1ZREA 4LLFA 4LA3A 2R16A 2FDIA 1RC6A 2QJVA 2Q8OA 5GJ6A 3C8XA 4CCKA 2E31A 4WVWA 1H2LA 4XFHA 5K7PA 4ASKA 1XXNA 2RMU1 4AHXA 4EN9B 2WZ8A 4J1XA 4M3CA 4OULA 1Y9QA 3VKOA 1FPN1 5FZMA 1NQJA 1D4M2 3BODA 1ZNPA 2D3PA 2DWRA 3IAQA 3IB3A 2W95A 4MX3A 4RQPB 1UOBA 2J22A 1OBNA 1R1A1 1B35C 5D8AB 4DEVA 5CFCB 3J8F2 1JH5A 5F5CA 1OF3A 2WJSA 2WO2A 1YYNA 4E2GA 1YJLA 4BJ0A 2GSYA 2JDKA 4AGGA 5KXDA 2JDPA 1OQEA 4HBNA 2WZR3 3KT4A 1RJ7A 1SLBA 3OD0A 4NVPA 3AP6A 1ULDA 3FUOA 2DVAA 1PZ8A 3POEA 4CCJA 1TVGA 1I5PA 1COV3 4L92A 4YSFA 4W50A 3RWNA 5LB6A 4Q8LA 2JWPA 1JYVA 2JB4A 4LORA 5FZFA 3KGLA 1GP4A 4OUSA 3T4HB 5IFPA 1OH4A 5KC5A 1YEWA 4XHXA 4PBPA 4CDWB 2P1BA 5FZ8A 5EIYB 4FFIA 2YC4A 2ZABA 1NZCA 4CA9A 4NIGA 2WRAA 5FZOB 3PUAA 5A6ZA 3RZMA 4FQ4A 2LUWA 1EP0A 1RIRA 2RS53 5CU1A 2F4PA 4X6QB 1CQ9A 3ZYHA 5FY7A 2FMDA 3HNMA 4YGEA 5IVVA 3FX3A 3GZUC 4QPIA 4BIOA 2UU8A 3KV9A 3BI3A 3NSTA 5JZGC 4D7TA 1JUHA 2XQRA 4NMIA 1JYCA 2B46X 1US3A 1YO8A 3I3DA 1W6PA 2VUJA 4Y4YA 1REDA 4IE7A 4XFGA 5JLVA 1QHDA 3I59B 5JDBA 3R4DB 2L9LA 2D93A 2VTFA 2WQZC 2IXCA 1JU3A 4EWEA 1C57A 2V4VA 5GLVA 4CCLA 4XUOA 1QJY2 2QUOA 1C1FA 4V2WA 3DYOA 2ZHKA 5FZ0A 1QGLA 2XJUA 3H9AA 1UZZA 2EVXA 2FZ1A 3AXEA 3ST7A 1UMIA 2FD8A 1WW6A 1X7NA 3ACIA 4N43A 4UFLA 1W8HA 2VZTA 4QGMA 4K40A 3X29B 4E27A 5C8CB 1AYM1 5T54A 5J3UA 3ZXDA 1UZYA 2JB8A 4JGYA 1YI7A 4ZPIA 2W68A 1RUI2 2RR13 4LUKA 1HQNA 2BV4A 3VLBB 4YZ1A 3PIGA 5EJ3A 1J58A 1E5HA 3WQ1A 1PZ9A 2DV9A 1DGWA 2VJXA 3NNFA 1KQRA 2XLAA 3FZ3A 3D4KA 1OLQA 4UT5A 1V70A 3LB9A 5HCBA 4Y22A 4OUEA 1BXHA 1DQ5A 4M3CB 3T2PA 5IVEA 5CADA 3RFRA 1PVC2 1C8M3 4NE9A 3OBTA 5HV4A 2DVGA 3MW4A 1BBT1 3I2HA 1ZRCA 3IAPA 5FYMA 3WHUA 3FC0A 1R081 3CJIA 2ZAHA 2IUWA 2Q5TA 3ABZA 3NNMA 3SH4A 4LJHA 4B1MA 4CCNA 3OGSA 3M1HA 4QQHA 3RZGA 5BUVA 2RJKA 3GBGA 4XBQA 4XEZA 2WNVA 5KHHA 1IS6A 1UZVA 5A6YA 1SLAA 3QLQA 1MS5A 1F4AA 1HX6A 1L7RA 4Q5OA 5KWRA 2FCVA 3VBFA 1V9U2 4IEZA 5JUVA 3QD6A 2UWBA 4GKYA 4QPGC 5EZWA 2BWAA 1EV13 1ZA4A 2RS12 4BISA 2Z4FA 2A3YA 4Q4Y2 5F9TA 4KBBA 1QDOA 1AF9A 2GU9A 3VZNA 3WT3A 4A7ZA 1PM4A 4AVTA 2C1FA 4YW3A 4NOTA 1JODA 2WN2A 1XBFA 5GLZA 2PHDA 2RHPA 1EAH3 4XIOA 5EJ1B 3ZFEC 2XVGA 1Q5OA 2WN3A 4NIAA 3VD7A 3OB8A 1CGPA 1O7FA 3VHOA 4Y3OA 4YG3A 4YG6A 2HWF3 2FBEA 2XWBB 3I2IA 4RA0A 3ILRA 3ZSEA 2VMFA 2E32A 4NPRA 5FZ1A 4HVOA 4W6WA 2CWMA 3K3NA 2E6VA 4HLTA 4CXYA 1H4GA 4QPIB 3M3IA 4MGSA 4CU7A 4CSWA 4IV3A 5C9AA 4QB2A 5GZDA 5F39A 2B4KA 5BXXA 3RSJA 4D8MA 3H0OA 2ZMNA 2X29A 1Q43A 1W6PB 4E4SA 1D4M1 4ZU7A 2RDNA 3LKJA 5J1XA 3PNAA 4I0AA 1OLRA 1G7YA 5LK7B 3N7KA 4GWMA 4LKFA 1RUH2 2ENRA 2X53S 4KWJA 3J8F1 1V6MA 4XZPA 5F6KA 1SLIA 1JI6A 3MO4A 4PDWA 2YDEA 2OQ6A 1YIPA 3H1MA 4KH9A 4AEDC 2VBPA 4KG8A 3LSEA 5FAXA 1SBEA 5ACA2 3KV6A 1C5IA 4LEJA 5G04L 2DCYA 1BMV2 1JZ4A 4N43B 3HD8B 5F3IA 1QJEA 3V0AA 3IDCB 5B2GB 5HBAA 5F7UA 2XONA 1XE7A 4XDOA 4N8MA 3OPWA 4FAHA 4MLOA 4JGYB 4LXLA 5BY5A 4HK8A 5I0SA 4QX2A 1VJ2A 1GU3A 3GGLA 4JDOA 2YFZA 4UFHA 4GMP1 1OPMA 4XXAA 2YC2A 2A1XA 1K5MA 2ZGPA 1RXGA 2X05A 2ZX2A 1MS8A 5IHRA 3C7FA 4K1YA 2R042 3TYJA 3AZXA 2Y26A 3KCYA 2QQWA 5J7MA 3WF0A 1UMHA 2ZCWA 4JRAA 4LO8A 2P17A 4E2SA 2ZA9A 3K48A 2VTXA 4BH9A 4PBOA 3CJIB 1XE0A 1UY1A 2RMU3 3VBRA 4KI5M 3DPRA 3S57A 2TEPA 3O1OA 1FPN3 1DU3D 2VW0A 5IJRA 1LULA 2XG3A 3ON7A 3P6BA 4RGGA 2VZOA 4CUAA 1ZZ8A 4R4XA 1JXNA 5FPZA 2WNVB 2XJTA 1MS3A 1OURA 4XAEA 1JZ3A 1R1A3 3I4IA 3B02A 2Y34A 3AX4A 3VBUB 2XH6A 2ZHMA 1GWLA 4XFBA 3VBFB 3PDQA 3GDBA 4XW3A 3MW2A 3I2JA 4E4DX 2OVUA 1QJY1 3POIA 3SHRA 5C70A 4MGYE 2CDOA 2Y38A 3E6CC 4JRLA 1S1AA 4HSJA 2R0FA 4PI0A 5A1LA 1CZTA 2NM1A 5FPUA 1YXWA 1BQPA 3DKQA 3KLSA 1UYYA 2ZX1A 2VULA 4IEYA 5FBZA 2PHFA 1RUI1 3E5UA 4JV4A 3OGRA 3MLLA 3AFGA 4HG6B 5IYYA 1WLWA 4O9GA 1BKZA 4CDUA 2BRTA 3U78A 5C4WC 3KQ4B 3LCPA 3SKJE 3ZKUA 2GMEA 3MICA 4IV3B 5E1RA 1REFA 5C9AB 3O1SA 3LA3A 3I49A 3W58A 2JG8C 1SPPA 2WNEA 4XDQA 1X50A 5I91A 2VOVA 4AL9A 1PVC1 3LEIA 2VQ0A 5LASA 4AEJA 4HKLA 3IKWA 1VR3A 1W0PA 2JKXA 1WD4A 1Q8SA 3MLJA 1POV0 4PQ9A 2FMYA 4QX1A 4CXXA 3VL9A 5GZGA 1SMVA 4FCAA 3OCPA 3AMNA 4FOWA 2IVIB 5HCHA 3ACLA 3CL1A 2WC2A 4LLOA 1LHOA 3FBMA 1LOBA 1V9U1 1PX3A 3WP5A 3GBFA 1C4RA 3V0AB 4LIUA 2RS11 4FPYA 2W08A 3OBZA 3P1IA 4Q4Y1 3HN3A 3ITQA 4F83A 1D0GA 4DFSA 3MIBA 3VD9A 1W6OB 1D0HA 1F15A 4MXWA 1GZTA 1GV9A 1UXZA 5FKCA 4CRQA 1RJ8A 3ZYBA 1K5MB 1AYM3 2JJ6A 4DZGA 2C24A 4IEOA 2WSVA 1X9PA 3M70A 3SH3A 1QIQA 2VUCA 3TN92 1AUYA 2HYKA 2WWUA 3ZXKA 3I3QA 2VD7A 2XXZA 1HV1A 4GWNA 2VCBA 1YLLA 3JBG2 5D21A 2PAMA 1HDKA 5FYUA 4QHBA 3TEXA 1I5ZA 1PM7A 1ZZCA 2BP6A 1O8SA 3VBRB 1W0NA 3UKVA 3KMHA 4WVMA 3DPRB 1ULGA 3ETQA 5CVRA 1HN0A 2BUKA 3MW3A 1BHGA 4NN0A 2C5DA 1BBT3 2ZKNA 5F2SA 4P5YA 3H8XA 1R083 1JOJA 1US2A 4TN7A 4ASMB 4LOTA 4DINB 3CMGA 5FMDA 4LMFA 2JDAA 1NZIA 2H6CA 2YFUA 2NN8A 4NHXA 1S0IA 5C8WA 3LDRA 4F3JA 4U2AA 5T55A 1H9PA 5CYYA 2BGOA 1RUH1 2IVJA 4Y1YA 5EFUA 5APAA 5F2WA 3USSA 4JDMA 3MPBA 5FZGA 1RUJ2 3IIAA 3M3OA 1AL22 1WLDA 1BZWA 1OLME 1WLCA 2W47A 4MGZE 3ZO0B 1XNTA 3VBOA 4PCRA 5ACA1 5JMOA 1P8JA 3ACGA 2G9FA 4LULA 1M4WA 4FP3A 3RQ0A 2FHRA 1VBA2 3L2YA 1GP5A 1RUD2 5KHKA 3BALA 5A7WB 4XJ8A 2OXBA 3BOPA 5L7OA 3CLPA 1OFSA 3PIJA 2H0BA 1ENXA 1W2AX 2UY9A 2W1QA 3W5MA 1RMU2 1CZVA 4Q8KA 1Q8QA 1TNFA 3LSDA 4IEVA 1O3QA 2QFEA 2LROA 2P37A 3OBRA 4CDUB 2VZ3A 3WF4A 4I2OA 1T6GC 4V1PA 5AC92 3LPFA 5H9PA 2R041 3O14A 3N7MA 4O61A 1M06G 1F9KA 4OVEA 3TOJA 4ZY9A 1W6MA 1SPPB 5FR3A 1SFPA 5FO8B 1UKRA 1NCQA 4BK4A 3VBHC 3WSOA 5DUVA 4YW2A 5CIRA 4B3NA 4HN0A 4CXWA 5DPNA 1LOFC 3E6DA 1PK6A 4UW6A 1WCUA 5J36A 1D4M3 2WNUA 4P00B 4A3ZA 5FLIA 2J1RA 2A75A 2VNOA 1PGW1 4TYSA 4CEWA 2WWSA 3AKSA 4Y26A 1PNGA 3J8F3 4JHZA 2VY0A 3CEWA 4IESA 2D44A 3E1F1 1WCKA 3HNBM 5FY5A 3EHKA 3N7LA 1CR7A 1MACA 3B9CA 3WEZA 3LQCA 3WNOA 4AHZA 3DEMA 4W6XA 4IV1A 4QMAA 3TNQA 4K21A 1KJRA 4MXWB 3HOBA 2GP3A 5IK4A 2P2KA 4A6OA 1MZ6A 4L97A 1XB9A 1MS0A 5A33A 5A70A 1PHMA 4LITA 4CDXC 3PUHA 4GMP3 4BCUA 5KHIA 1W8UA 1QJU1 4CP1A 2RDSA 1L7LA 5KXBA 1VBC2 1H1AA 3RRDA 4EWAA 3FWEA 4IEQA 4CUCA 2VQAA 5ISLA 4TSVA 4M4PA 2GMMA 3HMYA 1GZWA 4HFSA 5J98B 4WVMB 3V64A 5A3PA 2RM22 1IKPA 3RZLA 4DPNA 2R30A 4OYUA 4Q0UA 5DUUA 2QDNA 4LBQA 3CNAA 3WF1A 5L73A 5C6CA 5BV6A 1CONA 1QH7A 2W5FA 2QKDA 2R32A 5FYYA 2ORXA 1CESA 1LGBA 3LFMA 1Y9MA 3WG3A 4BB3A 2DTWA 4B29A 1G9AA 2J1TA 4XILA 2VNVA 3SQOA 3ZSKA 3PVEA 4LIVA 1J1TA 1KEXA 2EXKA 3N7JA 1AJKA 2DURA 2GN7A 3VBOB 3Q8FA 2BNMA 4P14A 4QKNA 4FPOB 4XACA 5GALA 2VZQA 1QJY3 4I02A 1IZ3A 1UYXA 1GP6A 5IK7A 1UU6A 5L7OB 3NQHA 1W03A 3AZZA 3ZIXA 4ORFA 1HIXA 4QHOA 1S0BA 3OGVA 3RYRA 5LK5A 1OKOA 4P9IA 4XZUG 4QXBA 2VO5A 1CZSA 1GWMA 2PAKA 4Y4RA 1DGLA 4GA9A 2AENA 4XPVA 4IE6A 4CUGA 2WR9A 1VBE2 3KS7A 1RUI3 4XABA 2EA7A 3TN91 1UCXA 3D5OA 2VMIA 4XFIA 2BZDA 2R7EB 1YCIA 5LEKA 1W6MB 2VG9A 4XF3A 1VIWB 1RUOA 1GNZA 2QQUA 3M7AA 1NCQB 2ZGSA 3JBG1 5E88A 3WF2A 5DAVA 1POQA 3QACA 2ATFA 2VZUA 1H2NA 1SCRA 4YWAA 5FP7A 3VHPA 1WCSA 4KWLA 1PK6B 2VMHA 2YXSA 1UYZA 4NRQA 1LESA 3POWA 1S2EA 1PVC3 4JZRA 4PLMA 2ZGUA 4D6RA 2WNUB 5T52A 2RE9A 3BGAA 2B5HA 3J7NA 3FE5A 1RUG2 4CEWB 1H8TC 4MGKE 5J48A 4ZONA 4P9GA 3MV01 3ORJA 1V6NA 4CU8A 2LM3A 1HQLA 2D6LX 3OEAA 3VZJA 1RUJ1 4B7EA 1X82A 2ZGOA 4AQ6A 3VKNA 1AL21 2V5DA 5FPVA 1V9U3 4IV1B 2PQQA 1ZRRA 3N35A 2Y64A 4IE0A 1S0EA 1UIKA 3KSCA 2WO7A 2GNMA 4ZS3A 5EP9A 5FMOS 4CVUA 2RS13 5I8YA 1QF3A 1GQGA 3DYPA 2CU5A 3HPNA 1VBA1 4JKMA 3K3OA 4MOAA 1RUD1 4Q4Y3 5A33B 1OA3A 1Y7BA 4QXKA 5CA6A 2CYFA 1TZOA 3ES4A 4YYOA 2AUYA 2XUMA 1NT0A 2JE8A 1ZBA2 2AEYA 4WBBA 3AP5A 1AXKA 1CAWA 1RMU1 4XHBA 3KD4A 3Q8AA 2BWCA 1EPZA 4DRVA 2BOJA 1GZWB 1XOYA 3H7JA 5C71A 4A41A 1OD3A 4D7YA 1O5LA 3UKTA 5AC91 1SDWA 2DU0A 4RGKA 3A22A 3W9AA 3IDAA 5KBFA 4LBQB 4IEPA 1A6CA 3B94A 1NY72 3G6JB 2A3WA 4FTBA 3PHMA 1W90A 1J3RA 1JW6A 5HI0A 5C3OA 1EUTA 1AVBA 2ZGTA 1B09A 1OOPA 2WQ4A 3H7YA 4JHTA 3MIDA 4A6SA 1GYKA 2ZPXA 3OD4A 2VW2A 2H0VA 2R072 2ZEWA 1RUH3 5BNPC 3J7HA 4AR2A 5LWBA 1N1YA 4MO3M 4LO4B 1NAEA 2ORZA 4O7XA 3ZXFA 3EXUA 4UF0A 5LA1A 1Q3EA 4KNCA 5FMCA 2QQKA 1DYPA 4XUQA 3S7IA 3G7DA 3THPA 4TWTA 3VHNA 5ACA3 2ZGRA 1RHI2 1ZRFA 4YVSC 3VB9A 3JQXA 4FTSA 2BJSA 3EB7A 3KZ4C 4HN1A 1R092 3MFCA 2J1AA 1AX0A 3MDPA 3EMRA 3FHAA 3K77A 3WVJA 3M3CA 2JD9A 2WO3A 1LU1A 4DNYA 5FXVA 1VBC1 3AFKA 4K3UA 4ZHNA 5EQUA 3ZYFA 3THTA 1GQPA 1PIV2 1KJLA 2R043 4IGQA 4FFFA 4LBNA 4O65A 4HETA 5FZHA 2P34A 5FZ7A 4AGRA 2OZJA 2P3YA 3W5NA 1O6UA 2RM21 4MV2A 2GP5A 1NQDA 4ATFA 1HW5A 1FATA 3H50A 4GWJA 2OX0A 3HJRA 4OMDA 3MFAA 3SEPA 2XWJB 1U5YA 3R6SA 1ACCA 3WW4A 4DY5A 4KU8A 4OHYA 5FQ0A 1K42A 3WDXA 4DUVA 3UJOA 4N7IA 2BVBA 5CFDC 2YHJA 1MVQA 4HVQA 1X9TA 3LEKA 1YI9A 2XB6C 4P9YA 4Y24A 2DYCA 4IEWA 4D6QA 1UZWA 1XJAA 1J84A 1J3PA 3NMBA 3Q8EA 1XNDA 3JD72 3VZMA 2PAEA 3T09A 3HWJA 2CAUA 3KQRA 5DG2A 4Q1RA 3D6EA 4P02B 2J42A 3ZR5A 1UU4A 5C8CC 4BXSV 2C26A 1VRBA 1UOGA 3SISA 2IWGB 5K0UC 2CSGA 2IFRA 2XLFA 4OI2A 5FP4A 3NWKA 2ZEZA 4IGOA 4CP9A 4BE3A 4B1LA 1NE4A 1OVSA 2NLRA 1QJU3 5FYCA 4JKLA 1VBE1 4RGAA 3TNPB 3GNEA 2WFF2 4MYEA 1OVPA 2YY1A 4V2VA 1F8VA 1VMFA 4JQTA 2I07B 4Q4X2 3Q8BA 4JGZA 1AJOA 5HXVA 3BKZA 1HB1A 1W9WA 1S0GA 2Q30A 4LBOA 2VVDA 4QPYA 4RFRB 1GZ9A 3B5LB 1ZBE2 1AX2A 4FPCA 4GXLA 4NPLA 1O3RA 2RDRA 2PELA 1QOOA 1N3QA 4AG4A 5JI7A 4CTEA 2W52A 2AGSA 1SEFA 4YM2A 1RUF2 3RVHA 1OOPB 1A3KA 1BK1A 1SLLA 1XYPA 2XQXA 1VBD2 4W6YA 5IAXA 1UPSA 1RUG1 5C3QA 4K6BA 1FNYA 3GJAA 3POSA 5JXIA 4KQ7A 2ZGLA 2E7QA 2XHKA 3WHTA 4YFZA 4AF9A 3IMNA 4UF0B 1UOJA 3MGUA 3BUCA 2VVEA 1CJDA 4H3WA 2JX9A 4Z82A 4E8DA 4BZ4A 1PMJX 1ND2C 1BLZA 2HWB2 3DV8A 4XAAA 4KMQA 4EROA 1AR62 1KRIA 3HQXA 4QDQA 5A3OA 4GIQA 3TWIA 1FI2A 3OUJA 2Q8DA 2N7GA 1H2MA 1DDLA 2R062 1G6NA 5GM0A 5FYIA 1ZBA1 4EWDA 4OZOA 5E6HA 3MBWA 1LENA 1RINA 4BQWA 4X8PA 4OHVA 2HWC2 5FUPA 5GLTA 1JTZX 5LBEA 3TN93 4COUA 3N4MA 2PFWA 1NA1C 1EY2A 5DUWA 2X5IC 5FOJB 2ZMKA 3R0RA 5DUXA 4QKBA 3ZDVA 1OUXA 2P5BA 5JIAA 3JBG3 5CISA 3DYMA 3ZN4A 1JYTA 1MZ5A 2Y6HA 1UX6A 4LTAA 3VZOA 2JIJA 5JAXA 3B7MA 4LO5B 4CCEA 1VAVA 2HJIA 3BN6A 4Z07A 1GANA 5KHGA 1QQP2 1NY71 5FQ0B 4UBGA 3KVAA 3ILNA 1GUIA 3LA7A 2R1BA 2RV9A 3TEZA 3ZYIB 2JECA 5KXCA 1KITA 3VDDC 1UKGA 1OQ1A 2WWJA 3QOPA 1UZ0A 2PMWB 1APNA 2FCUA 2HEWF 4KG0A 5FLJA 3APBA 5JZGA 2E7AA 4UFJA 1YIFA 1RUNA 5FXWA 2R071 5JSRA 2VZRA 2OKXA 4NRPA 2JENA 4AGVA 3MI8A 3VBSC 1RUJ3 3NL1A 4P9JA 3AYDA 4MH0E 1AL23 1XSRA 1OA2A 1D2QA 4QT6A 1RHI1 2ZGMA 2W94A 4JGYC 1VBA3 1RUE2 1RUD3 1HXS2 3T2TA 4ASLA 4OMCA 3UGGA 4CP9B 3S5AA 2PHTA 4OZXA 1ZZ9A 2GZWA 1NKGA 1MS1A 1R091 2QQMA 1W9YA 4KL1A 3RMXA 2HLEA 4TXWA 1N3PA 1CAVA 1RMU3 1V6JA 4AI2A 4MGTA 4R9BA 3IT8A 3SCHA 3HR9A 3LAGA 1KFUL 3L9JT 1G9FA 3GCWA 5A6XA 1O59A 2CAVA 2PTMA 3IN9A 4IEXA 5J96B 4YW5A 2OPKA 1PIV1 3NJZA 2NMOA 2XR4A 1DBNA 1V00A 2OS2A 3I97A 4Q27A 5K8SA 3BTYA 3T1LA 4XTMA 3IWZA 2XJQA 3OPZA 1AR82 1FNZA 1XSQA 2OW4A 4AFAA 1LTEA 1X8EA 2A6VA 1C28A 3POYA 2HEVF 2R6QA 1C5HA 1DQ1A 5BPXA 3VBUC 2BNNA 3B00A 1GOFA 1W6NA 1XE8A 4QX7A 1QJZA 1GZCA 4TZDA 2W3JA 2D3SA 2PN5A 4QB1A 1LR5A 4RFT0 3V56A 2NP0A 1ZZ6A 2B9VA 4IW3A 4OHWA 1XU2A 5CG9A 2W1UA 2GNTA 3JD71 4K20A 1CPNA 1WMDA 1LOEA 4GH4C 3VZLA 3H3UA 3IDEA 4B4RA 2XVKA 5H9SA 1LGCA 3N9NA 5BNNA 2PHRA 4QPGA 4LHSA 4META 2DUPA 1O91A 2LS6A 2BTVC 2O0OA 4JVAA 4UWDA 4QU2A 3ZFFC 1ND3A 1YNAA 3FMGA 1LHVA 1KGYA 4QHZA 4XVHA 4BDVB 1PO22 1QXPA 3AMHA 2EXHA 2ZBJA 4RYDA 5FYTA 4YVWC 4GZ9A 1VBC3 2ZX4A 4NPMA 3ZFEA 2WDBA 2K46A 2WFF1 1QJFA 4OHZA 2JDZA 3CF6E 4Q4X1 4K9SA 2V73A 2JDHA 3THCA 1TEIA 4P9WA 5HCFA 1DYOA 1YFWA 2RM23 3OUHA 2AZ5A 5FKBA 5A7QA 3BTAA 2ZS6B 5A32A 5EV7A 4HSLA 1ZBE1 5F5AA 3AP4A 5DAXA 4D69A 3LIGA 4X8NA 2RG4A 4YZ5A 4PLOA 1RUF1 4R4ZA 3AYCA 4AFMA 2VVFA 3I2FA 4LNVA 2GC0A 2UYAA 5FWEA 1JS9A 1CX4A 5FYVA 3ACHA 1SQ4A 1CD3G 2E51A 3OGGA 1WUVA 3KV5A 5HV0A 1Q8OA 2E63A 2JDUA 3GBWA 4GULA 1JHNA 2QQIA 4S2DA 4XUTA 2VMGA 1HRI2 2Y33A 3WUDA 4DS0A 2WKKA 5LY1A 4Y5SA 4A7YA 2HWB1 4AXOA 1RTVA 5TSWA 1AR61 1Q8VA 3AZVA 3B9IA 5A7NA 4AEDA 4F7ZA 1K5MC 4MGQA 2CGNA 4GAZA 1YHFA 4Z2AA 1CAVB 2W39A 1C8NA 2XHNA 4YW6A 2HKXA 2PHUA 4Y22B 4D6SA 3FFZA 1TG7A 4C8DA 4E9KA 2C9AA 2BBVA 3DKWA 3UV9A 5J37A 1IOAA 3A0KA 3U75A 3PTRB 1VBE3 4FOYA 2LTNA 4LA2A 2HWC1 4QD2A 2VOXA 2Z5WA 2A6ZA 2B8MA 3VBRC 4IETA 3AL6A 3HNYM 3QH7A 5H9QA 2WT2A 1IPSA 3TB0A 2OIIA 2WZPP 1V6KA 1HLCA 4YFWA 1TE1B 1BYHA 4LPLA 5FRAA 1QQP1 5IK5A 1FMD2 4WM7C 3IDBB 4H55A 2QQVA 2Q4SA 5CZKA 4DY3A 1R64A 1W6NB 1JYIA 2Y6GA 3LD8A 1U12A 1RUG3 3MV11 2E53A 4AYUA 1YFUA 1WA4A 2D40A 2XL7A 3WQ7A 1QKQA 1QY4A 2AACA 1BEV2 4BLJA 2ILMA 4XQWA 3ENRA 4D0QA 1UF2C 2ZZQA 1Z0HA 2VH9A 1URXA 3KT7A 4LQRA 3KB5A 2XOMA 4E8CA 3AYEA 1ULPA 5FPXA 4GWIA 5BNNB 2Y6LA 4KWKA 2AR6A 4QPGB 2IXJA 3JCIA 1RUE1 4GB32 1HXS1 2VCAA 1ND3B 3PTYA 4TLGA 2HYXA 4AVAA 1IS3A 3T2QA 1ZBA3 4CDUC 2J1VA 5KC6A 1GOGA 2WBKA 2GC1A 3ZFEB 3U4SA 2EIDA 3NRUA 3T2OA 5GLWA 2WL1A 4WZFA 4A4AA 2NMNA 4AFCA 4AQ2A 4C90A 1WA6X 3U4XA 4FPGA 5FXXA 4XF0A 2HWD2 2MEV2 4NHMA 2Y8KA 3AB0A 4TLFA 3SCGA 4IUGA 3J9SA 5EYYA 5A32B 4X6RB 4XCBA 2VOKA 2DVBA 2LW8A 3ILFA 3VN4A 1VLNA 4JTNA 1JUIA 2ZEXA 4I3GA 4PDWB 3B93A 2Q1MA 1VB2A 1IGOA 3D3AA 3PLQA 5CKNA 2VXJA 4CDQC 1WWYA 4XFFA 4QX0A 1PZ7A 2JG8A 4EQVA 1LODA 4XF1A 1HV0A 3TAYA 1SFNA 4AW7A 1XYNA 3WY6A 2ET1A 1Q8PA 1VAMA 1LJ7A 4OI4A 2A5ZA 2WO1A 3MLKA 2R073 2VTXJ 3NJYA 4QDRA 3ZMNA 4WM8A 4XBNA 1CPMA 1HB3A 5JWPA 4IL7A 2NYYA 4OI0A 2DCJA 4AEDB 4CEYC 3ZR6A 1CIWA 1F5FA 2BGCA 2VE1A 4WV8A 5DAWA 3LFIA 3ZYGA 1SHWB 4EN6B 1RHI3 3RZJA 4CP0A 2ZOEB 2C9KA 3HAGA 4RS5C 3AL5A 2D6PA 3H1WA 2E9QA 1R093 3KVBA 3NNGA 4XQDA 3ZXLA 3FUQA 4MADA 2XBO2 2XLGA 2D6MA 5JR2A 2YYOA 4XUPA 2VOWA 3AJYA 1YWKA 3AZWA 3H1YA 4ZKTB 5LEJA 2MHFA 1A78A 1XPWA 2BEOA 1IPJA 5AVAA 3OEBA 1PIV3 1E57A 3ZIWA 5I0DA 1RVF2 2BW8A 5IAVA 4KBZA 4JKKA 5FZDA 4EN0A 2DCZA 2O8QA 5D2AA 1UPIA 1A8DA 2BBAA 5CB7A 5LZ6A 1ZRDA 1D7PM 4QX8A 3N9OA 5FZEA 3ZSMA 4CPBD 4OQ8A 4Y20A 1A34A 3AP7A 2CTVA 4Z2WA 2WSUA 3VD5A 2W87A 2MPFA 4M00A 2BFUL 2GN3A 1NCRA 2D5FA 5GZFA 3SEEA 2ZX0A 3N9QA 4G9SB 3ZVXA 3NV2A 1ASJ2 4Q0SA 4ARYA 4YARA 5AC93 1HRI1 1QNYA 5L7OC 1FXZA 3JD73 4URAA 2WFPA 4LBJA 1S0CA 2TNFA 1ENSA 4N90A 4UW3A 4GJZA 4CZSA 1W9SA 3RZKA 5EXOA 4LKSA 3Q8CA 2WT1A 4OI1A 4Z8BA 5LW9A 1DCSA 4HMZA 3ECQA 4N7UA 4UI9L 2D97A 1W8OA 3GXUA 3NV3A 4D94A 3O1VA 4FPKA 5FZ6A 1EYBA 1UIJA 3AM2A 2VBBA 5C7GA 4MXVA 3WDTA 4HT1T 3RZZA 3KHCA 3TEWA 3WG2A 1OH3A 5BNQA 5FZKA 1N1SA 4QM9A 1GLHA 2WFF3 3VDBA 2BGPA 1DFQA 2QQNA 4Q4X3 3NAPC 4PQQA 4EN8B 5JI9A 3DGTA 1N1TA 4NROA 5FO9B 1ZYBA 3LF7A 3C7OA 3KWVA 3EBRA 1WKYA 5A7OA 3ZN5A 1RUC2 2VM9A 1ZBE3 2FDGA 3OYWA 2Z79A 4ZU5A 1DZTA 2TBVA 2BYVE 1FMD1 4XF9A 2JG8B 4LKEA 2HWE2 1RUF3 5GLUA 4BMBA 2JG9C 4QWNA 3VBHA 4WVZA 3DL3A 5K9YA 4DRRA 5IVBA 2RJLA 3HQRA 1LOFA 1NOVA 3ZLIA 2W91A 4IERA 4WM8B 5I0UA 3GZEA 1MQTC 3VD4A 3I2DA 3KCCA 1JYWA 3S0MA 2VQTA 5JXHA 3V0BA 1Z78A 4L2NA 1Y9GA 2CDPA 2HWB3 4SBVA 2MNGA 5KR7A 1AR63 1TMF2 2VZSA 1FT9A 1ST8A 2R0HA 4FPEA 5AFEA 4GB31 3ACFA 4C0HA 1PO12 3BCWA 1MPXA 1OPOA 3VL8A 1UX7A 3THDA 5JIUA 2OUJA 1DGRN 4HOOA 2ZGQA 4LBKA 1HQWA 1W2OA 2RJ2A 4LHNA 2W1WA 2YB7A 5T50A 4DUXA 1GMMA 5DG1A 1S2BA 1LRHA 1UO9A 3VKFC 3DXUA 2HWC3 1YQ6A 4CCOA 1IQAA 3O1TA 1O4YA 3WDVA 2DUQA 5DXDA 4CDXA 2HWD1 2MEV1 3ZDSA 4YZ2A 2YU1A 1A8MA 1AZDA 4XIKA 1Y3TA 3PL0A 1XNAA 2ARXA 2J1SA 4N53A 4QM8A 2ZZJA 5DN2A 1W2NA 4KWUA 5FUNA 4EYUA 1OKQA 1ULCA 1LECA 2DTYA 5ANNA 4Z1VA 5ABJC 5JXJA 2DVDA 1QQP3 3NKTA 1V0AA 3U0ZA 4Y20B 2WLQA 2YC0A 1AHSA 1UY2A 3BTZA 2E33A 3I7DA 4LBMA 1I1EA 3T30A 3WDWA 5IT6A 1S0FA 1NCRB 4MUVA 1ULOA 3H8OA 2W92A 1FAYA 2IFWA 4XMIA 2Q8CA 1L3JA 1U5XA 4YPJA 3CDZB 3VZKA 3M3EA 3ZXEA 4J25A 4RHV2 5I0TA 2ERFA 3KT1A 1O3SA 4L0PA 2GNDA 2XKPA 2LALA 1RUE3 1HXS3 5JPMB 3HT1A 3KM5A 5G05L 2YMZA 4CUBA 1G9BA 1NLSA 2DFCA 3AKQA 4H14A 2XBO1 3AVSA 4I0WB 4XJ9A 2W0XA 1HRV2 3FLRA 4XXPA 5T3NA 1VB4A 2V72A 4Q26A 2ZMLA 4XCAA 1CWPA 5FZBA 2C4XA 2CL2A 4GJYA 2D5HA 2HEYF 3CQOA 1U5ZA 1RVF1 1QU0A 1W05A 4ZS2A 1LKNA 1PMIA 2CGOA 3OYWB 4ITCA 1TME2 2EAKA 3RJRA 2QE3A 3ZX7A 2HBUA 3U11A 5FK7A 2OA2A 2VXRA 2X8KA 3VBHB 1W8NA 5C9AC 5LRSA 4Q4W2 3OBAA 3ZFGA 1UD1A 3H8UA 3DXTA 1GKBA 5J09A 3OTFA 5BNOC 3A7QA 3BU7A 3VGIA 4P08A 1NLQA 4DXRA 2JKBA 3AYAA 2QQOA 4RR3C 4RN5A 3NNJA 3V0BB 1H4HA 4NHLA 5CKMA 1MS9A 1ZA7A 5FJKA 3ZOIA 4UFIA 4E4HA 1H8TA 3WX5A 5IATA 4LE3A 3LOIA 1PGSA 1ASJ1 4AVBA 3LDBA 4EE2A 5FK8A 3VD3A 5F8PA 1NX9A 3V65A 3MZHA 2A6WA 2E26A 4INDA 4B7KA 1W2UA 1WW7A 1SACA 2ZX3A 3LZZA 1ODNA 2Y60A 4LT5A 5E89A 5HPOA 1AR72 1E5RA 4Q2FA 4XFCA 4CDXB 1YFXA 3UL2A 2V4AA 4YLZA 3NV4A 5LBCA 4URTA 2AREA 4XJUA 5T5LA 4RQPC 3ES1A 4N53B 3PUQA 3AP9A 2IXHA 5FYHA 3MIGA 1W6QA 5D8AC 5CFCC 1SZBA 3LE0A 5FPAA 1NG0A 3CJXA 4TTGA 1RUC1 2YZ4A 1SFYA 1VP6A 4ONUA 3I2KA 1D4VB 1SLCA 5F5IA 1HJFA 2HWE1 2UY8A 5LBBA 4AVCA 5FO7B 1YQ8A 2A6YA 1POV1 2ZGNA 2UYBA 3USUA 1AL0G 2GAUA 4RL7A 4PF1A 4COWA 4I0BA 3O0WA 3S6PA 4Q29A 4AK3A 4GMP0 4DO0A 4CDWC 4QB6A 1HRI3 5FFOC 3MEPA 3LGRA 1DGRA 3P3PA 3NKGA 2AYHA 2WZEA 5BNPA 2J7MA 1H9WA 1LEMA 2WQ8A 4UW5A 3S5QA 5IVFA 1YQ5A 1TMF1 2WIIB 3UGFA 1GNHA 3AXDA 3ZSJA 3K4DA 2VZPA 4YM3A 1PO11 3C7HA 1QOTA 4KGQA 4Q1PA 1AYM2 1TQ5A 3BTXA 5L19A 3HBZA 4YVSA 2YBSA 4QGLA 3MIFA 4DXZA 1H6YA 2DCKA 2R1DA 5JOZA 1DG6A 1UXXX 1N1VA 3H42B 4K7JA 1WW4A 4AI0A 2ZJCA 4NR1A 1IQDC 4ZXKA 1UY4A 2YG0A 3WP4A 1SBFA 2JIGA 2SLIA 5C3PA 5B4NA 4AEKA 1FYUA 3O1MA 1I6XA 4NIHA 4LK6A 3QH6A 1KS4A 2VAUA 4P9LA 4XBLA 1BMV1 2RVAA 4IE4A 3K4AA 3ZFGB 4IXLA 1FMD3 4M3CF 4NAOA 4YM0A 4S2HA 5JR7B 4AFDA 5IVYA 4AZZA 2P3IA 3K46A 1CX1A 2JDMA 3AC0A 3F2ZA 2XPJA 1H30A 5FIXA 2G1MA 1L7QA 2YBPA 1VALA 1H8TB 4GD4A 3PU8A 4JX0A 5FV3A 4JAAA 4XURA 4BQYA 2VMEA 5CFDA 1CAWB 4HK9A 4CP2A 3ZM8A 2GH2A 4QQ2A 4RHV1 4MVTA 3M3QA 3WP6A 1JHJA 3ZPYA 3M8LA 4D3WA 3WW2A 1UL9A 2QCSB 3GHNA 4GB33 2VUAA 3HIFA 5I8SA 4QQOA 4BYYA 2CV6A 2FDKA 1JZ6A 1EUUA 4BPZA 2ZTNA 2G9ZA 1UMZA 2QDRA 2YBKA 3H3ZA 4IDZA 1JYXA 4FOVA 2BDRA 1NUKA 5FY8A 1HJGA 1HRV1 1O5UA 3HT2A 1OXCA 4R52A 5K0UA 1DLCA 5E16A 4NIDA 3J7MA 4AAXA 3C7EA 1S0DA 3RNSA 2EF6A 3WNLA 3UT0A 1W6QB 2Y6KA 2FDFA 2HWD3 2MEV3 1W9TA 5AVPA 4QKFA 4LOSA 3MUZ1 1E5IA 3RI8A 4QPWA 1J3QA 4QX3A 3HN1A 1TME1 2VBDA 2GNBA 2DF7A 3F95A 3HEIA 1O4TA 4NAMA 2W1SA 5DMYA 3FBYA 5EPAA 3RWKX 4AI9A 4B8EA 1F35A 1SDDB 4Q4W1 2YUEA 3USUB 2EICA 4JCKA 1WBLA 1B35A 3RDIA 1W28A 3I3EA 4UOJA 5LRRA 1YRZA 2VZ1A 1UOFA 1V6IA 2WS92 4FBFA 5L36A 1ZVFA 5FP3A 3RYPA 2FQPA 4AI1A 3LA2A 1ZZ7A 1ODMA 5BNPB 3K75B 4LO6B 1DGWX 4ZXEA 2ARCA 3AVRA 1QNWA 4L8QA 4B4PA 1GR3A 1GOHA 3POGA 5H9RA 3CBNA 1K5JA 2ZXQA 1ND2A 4IQPA 4QPIC 2O14A 2K2SA 2F17A 3D82A 4YVSB 5A7PA 4GQ7A 2ETEA 3WCSA 2DVFA 3ATGA 4PLNA 1AR71 3ZYPA 5FCCA 2XBO3 4ES9A 4YW1A 3UKNA 5JPNB 1H2KA 5FY4A 2OZ6A 5JSOA 2NQYA 2KM2A 1Y43B 3FN9A 2G9GA 5FZCA 1DIWA 2B42B 4A3XA 4DMIA 1RVF3 4W8JA 1LHWA 1NA1A 2X5IA 4EZHA 1OHFA 3K2OA 4BQ1A 3GZAA 4FPHA 4QX5A 4IE5A 5LA9A 1T6BX 3O0XA 4UBHA 1DZQA 1DP0A 4ET7A 2ARAA 5A3WA 1FOD2 4N43C 3KHBA 2AC1A 4AHWA 3EYPA 2WA3A 2GC2A 1W04A 2RS32 4XETA 3VDDA 4DXTA 3W59A 4LHLA 1U5IA 5CFDB 4ARXA 4QQPA 5CNAA 1G8WA 1OC1A 1MZFA 5F32A 2VGDA 1ASJ3 2PLV2 2VPVA 4Y1XA 2CGPA 1D2SA 1AX1A 2XJPA 3IPVA 2IC1A 4UFMA 2C0ZA 4DIQA 3SC7X 1JOPA 4WZCA 5FY9A 3VBSA 2VECA 1LB2A 2O1QA 4JGZB 1OUSA 4HKWA 1OT5A 4HVRA 3RI9A 5GZCA 4FI9A 3WNKA 1KDKA 3JZVA 1QXJA 5K0UB 1BCXA 2EAAA 2VMCA 3CJIC 4UYBA 4BM8A 2ZHNA 5BYNA 1KFXL 2J1UA 3AKPA 4R9CA 5FBJA 1JBCA 3AMMA 4AI8A 1T2XA 3WQ0A 3A21A 2WNVC 4FAGA 1XU1A 1GBGA 2QZ2A 3WNXA 3UJQA 2B9UA 2DBIA 4Y1UA 2LRPA 5FY0A 1JZ2A 1VRH2 3VBFC 4BA6A 3SLIA 3R4SA 3SMHA 1DF0A 5AFBA 1RUC3 3LEMA 4ISQA 3AMPA 2D6NA 1YJKA 4UAPA 1W9FA 1KXGA 3RMYA 4FTEA 1B35B 2HWE3 3RJ2X 4FO9A 3N9PA 3BIWE 4PF5A 1JYNA 1ZRIA 2DUOA 4Q0PA 1POV3 3VDAA 4FFHA 3BVCA 3CO2A 4MG2A 3ME2A 3PU3A 3MF9A 4Y5Z0 1S4CA 3VBUA 1ULFA 3WOGA 4C0BA 1H1MA 3PMSA 5D1IA 5BNNC 2ADDA 4COVA 1G86A 1WD3A 1G9DA 4R9AA 5C5UA 4HKOA 1NLRA 1ND3C 2I74A 1ND2B 1TMF3 4FT8A 2C6SA 1V6OA 4Q4V2 3PVBB 4PHZA 1OSGA 1KDMA 2CHHA 1F4HA 2V5YA 1PO13 4IV3C 4M0NA 3I8TA 4OQ9A 1W0OA 4PI2A 1JOBA 1WLTA 4GH4A 3IBMA 4S2GA 5SV8A 4AEMA 3DCQA 3D0SA 1UNBA 3VKLA 3N36A 3I3BA 1CJPA 1YFYA 2VOTA 3ZFFA 4AE2A 4XE9A 1WMXA 2IXKA 3I2GA 3O12A 1IS4A 1WMFA 2XJVA 2QVSB 3WP3A 1ONAA 1NA1B 4FOQA 2X5IB 4PDWC 3I54A 4YVWA 1VBD1 1O8PA 3HVDA 5I0RA 1IHMA 1S2KA 4G3YC 5B4XA 1IKQA 3PURA 3W21A 1I3HA 1QJX2 1AXZA 1WGPA 3H8RA 3O1UA 4LHKA 4YNIA 5FZ4A 2KXLA 4C1WA 3PVNA 3AMQA 2O8OA 5IUQA 2D98A 4O9EA 2VCMA 2EIGA 2JEMA 5K4LA 3DUIA 1OD5A 1OMIA 1MEC2 3VDDB 2ES3A 3LIHA 4HL0A 5F1RA 4QKDA 2OPWA 1NE6A 4OFGA 1UQXA 2WS91 1Z7S2 4N9HA 5FLHA 1GQHA 4AI3A 3MHZA 4ISRA 3IPVB 5LY2A 5LBFA 4UFKA 3RPQA 1QXRA 1CIYA 1UN1A 2R061 2VNGA 2Y0IA 2QQPA 3VBSB 3ZN6A 4RHV3 2DU1A 5ERLA 3T0BA 4H7LA 4QXCA 3KF5A 4NJ4A 3S7EA 1W06A 3WG1A 1HB2A 4FQZA 3AK0A 1LAJA 4YG0A 1AYN2 1SCSA 5L9BA 3I3MA 2UWCA 4I09A 1QMJA 4PIZA 3K4ZA 4M4RA 4QU1A 3DPRC 1W6OA 3JUUA 3LPGA 3MPPG 3T0DA 1VBB2 4DXSA 4LO7A 4XMAA 5L9VA 1E5SA 1HRV3 4NHYA 4I30A 2B39A 2WNOA 5LATA 3E6BA 4CU6A 3VDCA 3SKVA 4HANA 1ZM1A 3NVCA 2OYZA 1OQDA 3JB4C
chains in the Genus database with same CATH topology
2YGMA 1TME3 1S0JA 3WR0A 4LUMA 4BHPA 1SBDA 2VW1A 4ZU4A 2D6OX 4JC1A 4YGDA 4L9BA 4Q4W3 2OUHA 5DZEA 1FOD1 1DQ4A 1SLTA 3GALA 4E2QA 3B01A 1PGW2 2BVVA 1J1LA 4WM7A 4XJWA 1G9CA 3GZTB 3NV1A 2K9ZA 2RS31 3RS6A 3QBQA 1AR92 1ENRA 1GFF2 3S30A 2F6BA 4PIYA 2PLV1 1QH6A 3J26N 1CVNA 5DDJ2 3U10A 5JMCA 1DYKA 4GH4B 4K1ZA 3OF1A 4BIFA 4ES8A 4PIXA 4YGBA 2JXAA 2A70A 4EN7B 1X36A 1AR73 1QJU2 2D7FA 3AJZA 3WW1A 4M0HA 5FREA 1UAIA 2CWSA 4XYXA 3WZ1A 1AR81 3ZFFB 5C4WA 3INAA 3P3NA 4YVWB 1H0BA 3B3QE 1F5JA 1ULEA 4H7MA 1VRH1 4P9XA 2G4IA 2VU9A 4MGIE 1IS5A 4L99A 5I93A 4YZ4A 2P3KA 2QNKA 3TRSB 1UU5A 1BVP1 2PHXA 4K8FA 2DFBA 2WZR2 4WM8C 1PNFA 3K51A 1COV2 5JVVA 4CDQA 3DF0A 1X33A 1MZEA 1NYWA 2GMPA 1TNRA 3OGJA 2H6BA 3ZN6B 4W65A 1JN2P 2D43A 3SXWA 3U07A 4AQTA 1OFNA 4JQRA 3ZSLA 1PO21 3R05A 2GH8A 3ELNA 3DN7A 3FFQA 1RITA 4Q0QA 1PVXA 4Q4V1 4AHYA 4DQAA 4Y1VA 4CEYA 2RS52 5FTTC 4E4ZA 2Y0OA 3ZYJB 4IEUA 1GSLA 3R4UA 1XYOA 4RS5A 4A2UA 2IZWA 2D3RA 4QGNA 2GDFA 2XL9A 3WDUA 3EJKA 4NO4A 5I8TA 3B69A 3ZXAC 5CG8A 1W39A 4NWWA 3QCWA 4R8HA 3GYDA 4GALA 4CYDA 4DB5A 4EJRA 2VNRA 4XF4A 2CY6A 4FPJA 3VBOC 1QJX1 1AXYA 2XJRA 3N3HA 3TBDA 1NCRC 4L11A 4P5HA 3AKTA 2PYTA 5DZGA 4WM7B 2WA4A 1ENQA 3C2UA 2IXIA 1MEC1 3ZMOA 1ALYA 1Z7S1 3AZYA 5F6LB 2V09A 3SCFA 3Q9OA 4YZ3A 4LE4A 3WV6A 5FMOL 2Q1ZB 1PGL2 2RR12 2FZ2A 1QDCA 2BQPA 1NXD1 1AYN1 1NCQC 1Q56A 5T5PA 3E5QA 4YM1A 1U0AA 2AH2A 1PK6C 3M2MA 1VBB1 5C4WB 4YW4A 2WNUC 4C91A 1C8M2 1WCDJ 4UXAA 4CEWC 1DQ2A 3D8CA 1RGSA 3E97A 1VBD3 4A7KA 2UWAA 4AVVA 2EALA 1BEV1 3NAPA 4IV1C 1XQNA 5KHJA 4N9IA 2ARBA 2R49A 3J4UH 4CDQB 1LHUA 1EV12 5SV5A 4YRDA 4FXKB 1CAXA 2WS93 2YPJA 3L2HA 3ZXJA 3BB6A 2GC3A 2JG9A 2Z42A 4HPKA 1AR91 4LBQD 1ZZBA 1CN1A 1EAH2 3FHIB 4AQSA 1REEA 2R063 1RL3A 2GALA 2I45A 5DDJ1 3ZYRA 3OY8A 1MQTA 3AKRA 2HWF2 1ZX5A 1FX5A 4CEYB 4FP2A 2B45X 1LGNA 2JE9A 4SLIA 4RS5B 3EQEA 3WG4A 5EYXA 4N53C 4NWVA 2YROA 2NPIA 4KGGA 4BWOA 4QQLA 5KXEA 4MZUA 3FLPA 3WD5A 1CAUA 5A3MA 4BLIA 2D6KA 3FLTA 4S2FA 1S55A 4YGCA 3VKMA 4G4FA 1RB8G 3BOWA 3ALQA 1NXMA 4EV0A 5ABJA 1FOD3 3JB8A 2WZR1 1EPWA 3O0VA 2SBAA 1COV1 3RG0A 2RS33 1BJQA 1N3OA 2P3JA 1LCLA 2JICA 1OA4A 1XNBA 1DQ6A 2PLV3 4M3CE 5T5JA 3VHRA 1OI6A 5FDBA 2ZAAA 2A6XA 2ZGKA 4FPFA 4XOGA 2XGXA 4XFAA 3O5SA 3GF6A 2BNOA 3M4FA 2RS51 4J1WA 3URFA 3LOBA 2A73B 5GKAC 4MSVA 3WLUA 4OLLA 4AFBA 2RMU2 2YGLA 1AR83 2XKOA 3PVOA 3IM0A 4XTPA 1FPN2 2IXLA 3JU9A 2TUNA 4OUMA 4JTOA 3ZFGC 1XNCA 1VRH3 3MIHA 4D7SA 1R1A2 1X8MA 4FPLA 3NAPB 4I01A 4I3PA 2BFUS 4PJYA 3GHMA 4BMEA 1IPKA 2A3XA 4XJAA 2WT0A 4FSJA 2XJSA 3MIEA 1MR5A 5JSPA 4RSUA 4JDNA 1CAXB 1O4ZA 2A7AA 2JG9B 2Q0AA 4HPKB 1VAKA 4AWDA 4KU7A 4XJZA 4FVVA 1QOSA 1FV3A 2NZ9A 3RYKA 5BNOA 1H8VA 3OY8B 1FV2A 1MQTB 4RR3A 1PGL1 4COYA 3E5XA 4BOWA 5IK8A 4R9DA 1PO23 2RR11 1DLLA 4WVVA 1F2NA 2A71A 5CAZA 4Q4V3 2WINB 2KA3A 2ET7A 1BVVA 5EWSA 2ZACA 4NHKA 3A4UA 3VV1A 5T5OA 2JE7A 3PMEA 4Y1ZA 2PA7A 1OOPC 1C8M1 3EO6A 1DZRA 1R1ZA 1HKDA 1KD7A 1CAUB 4F8AA 3NW4A 5DZFA 1C3HA 1DQ0A 1LU2A 3PJQA 1WMEA 1WBFA 1UW8A 3MYXA 1F31A 4RD7A 1QJX3 4RQPA 1H1IA 1LEDA 2BPA2 5ABJB 5D8AA 5CFCA 1C1LA 4OHXA 2DCTA 4COZA 2YV8A 4M01A 1EV11 1MEC3 4B4QA 3PJYA 3KGZA 1KS5A 1Z7S3 4ATEA 1EAH1 2EXJA 2E7TA 1XNKA 4GKXA 1XRUA 1QWRA 3VUOA 1V6LA 1MS4A 3FJSA 2HWF1 5E8AA 1AYN3 4CDWA 3SITA 2Z2SB 1LOCA 2B7YA 4LR4A 5A3LA 4U36A 5JOYA 2UURA 1VBB3 1WW5A 2CNAA 5CBLA 3ZXGA 4Z92B 1BBT2 3SH5A 1N47A 1R082 3C3VA 2PHLA 4XQ4A 5C33A 4HZFA 3UK9A 3WINE 4AVSA 3BPZA 2QZ3A 3ROUA 1GICA 3ASIA 5HCAA 5JCTA 4Q0VA 2JD4A 5FOBB 1I9RA 1BEV3 3T1MA 1LOAA 2XVLA 3I59A 3WUCA 5GZEA 2I2SA 1LOGA 3JQWA 2ZHLA 1DHKB 5F5QA 5JOXA 3KCXA 2PHWA 3MF6A 3SNMA 5BNOB 1J59A 4LBLA 3WXPA 4DOUA 2K0GA 1AR93 3NO8A 4RR3B 3WCRA 2EXIA 3CU7A 3LWCA 3OJBA 3WW3A 2WLPA 3A0NA 4J6GA 1O3TA 1JYIA 3D0JA 1MVEA 3WDYA 5C8CA 4JGZC 5DDJ3 3O7OA 2ZKLA 4UW4A 1YUDA 1LHNA 2Z69A 4FXGB 4C1XA 5JOWA 1ZREA 4LLFA 4LA3A 2R16A 1RC6A 2QJVA 2Q8OA 4WVWA 1H2LA 4XFHA 5K7PA 1XXNA 2RMU1 4AHXA 4EN9B 4J1XA 4M3CA 4OULA 1Y9QA 3VKOA 1FPN1 1NQJA 1D4M2 3BODA 1ZNPA 2D3PA 2DWRA 4MX3A 4RQPB 1R1A1 1B35C 5D8AB 5CFCB 3J8F2 1JH5A 2WJSA 1YYNA 4E2GA 1YJLA 5KXDA 2GSYA 4AGGA 1OQEA 4HBNA 2WZR3 3KT4A 1RJ7A 1SLBA 3OD0A 4NVPA 3AP6A 1ULDA 3FUOA 2DVAA 1PZ8A 1COV3 4L92A 4YSFA 3RWNA 4Q8LA 3KGLA 4OUSA 5KC5A 4XHXA 4PBPA 4CDWB 2ZABA 1NZCA 4FQ4A 2LUWA 1EP0A 1RIRA 2RS53 5CU1A 2F4PA 4X6QB 1CQ9A 2FMDA 4YGEA 3FX3A 3GZUC 4QPIA 4BIOA 2UU8A 3NSTA 5JZGC 4D7TA 1JUHA 1JYCA 2B46X 1YO8A 1W6PA 2VUJA 4Y4YA 1REDA 4XFGA 5JLVA 1QHDA 3I59B 5JDBA 3R4DB 2D93A 2WQZC 2IXCA 4EWEA 1C57A 5GLVA 1QJY2 2QUOA 1C1FA 2ZHKA 1QGLA 2XJUA 3H9AA 1UZZA 2EVXA 2FZ1A 3AXEA 3ST7A 1WW6A 1X7NA 4N43A 4E27A 4QGMA 4K40A 3X29B 5C8CB 1AYM1 5T54A 5J3UA 3ZXDA 1UZYA 4JGYA 1YI7A 2W68A 1RUI2 2RR13 4LUKA 1HQNA 3VLBB 4YZ1A 5EJ3A 1J58A 3WQ1A 1PZ9A 2DV9A 1DGWA 1KQRA 2XLAA 3FZ3A 3D4KA 1OLQA 1V70A 3LB9A 5HCBA 4Y22A 1BXHA 1DQ5A 4M3CB 5CADA 1PVC2 1C8M3 3OBTA 2DVGA 3MW4A 1BBT1 1ZRCA 3WHUA 3FC0A 1R081 3CJIA 2ZAHA 2Q5TA 3SH4A 3M1HA 4QQHA 5BUVA 2RJKA 3GBGA 4XBQA 4XEZA 2WNVA 5KHHA 1IS6A 1SLAA 3QLQA 1MS5A 1HX6A 5KWRA 3VBFA 1V9U2 4IEZA 3QD6A 2UWBA 4GKYA 4QPGC 5EZWA 2BWAA 1EV13 1ZA4A 2RS12 4Q4Y2 2A3YA 5F9TA 4KBBA 1QDOA 1AF9A 2GU9A 3VZNA 3WT3A 4A7ZA 4AVTA 2C1FA 4YW3A 4NOTA 5GLZA 3ZFEC 2PHDA 2RHPA 1EAH3 4XIOA 2XVGA 1Q5OA 1CGPA 1O7FA 3VHOA 4YG3A 4YG6A 2HWF3 2FBEA 2XWBB 4RA0A 3ILRA 3ZSEA 4NPRA 4HVOA 4W6WA 2CWMA 2E6VA 4HLTA 1H4GA 4QPIB 3M3IA 4IV3A 5C9AA 5GZDA 5BXXA 3RSJA 3H0OA 2ZMNA 2X29A 1Q43A 1W6PB 4E4SA 1D4M1 4ZU7A 3LKJA 3PNAA 4I0AA 1OLRA 1G7YA 5LK7B 3N7KA 4GWMA 1RUH2 2ENRA 2X53S 4KWJA 3J8F1 1V6MA 4XZPA 5F6KA 1SLIA 4PDWA 2YDEA 4AEDC 1YIPA 3H1MA 4KH9A 4KG8A 3LSEA 5FAXA 1SBEA 5ACA2 1C5IA 4LEJA 2DCYA 4N43B 3HD8B 3V0AA 3IDCB 5B2GB 5HBAA 1XE7A 4FAHA 4MLOA 4JGYB 5BY5A 4HK8A 5I0SA 1VJ2A 4JDOA 4GMP1 1OPMA 4XXAA 2ZGPA 1K5MA 2ZX2A 1MS8A 4K1YA 2R042 3TYJA 3AZXA 2Y26A 3KCYA 5J7MA 2ZCWA 4JRAA 4LO8A 2P17A 4E2SA 2ZA9A 3K48A 4BH9A 4PBOA 3CJIB 3VBRA 2RMU3 3DPRA 2TEPA 1FPN3 1DU3D 2VW0A 1LULA 2XG3A 4RGGA 1ZZ8A 4R4XA 1JXNA 5FPZA 2WNVB 2XJTA 1MS3A 1R1A3 3I4IA 3B02A 3VBUB 3AX4A 2XH6A 2ZHMA 3VBFB 4XFBA 4XW3A 3MW2A 2OVUA 1QJY1 3SHRA 4MGYE 2Y38A 3E6CC 4JRLA 1S1AA 4HSJA 2R0FA 2NM1A 1YXWA 1BQPA 3KLSA 2ZX1A 2VULA 4IEYA 5FBZA 2PHFA 1RUI1 3E5UA 4JV4A 3MLLA 3AFGA 1WLWA 4O9GA 1BKZA 4CDUA 5C4WC 3LCPA 2GMEA 3MICA 4IV3B 5E1RA 1REFA 5C9AB 3LA3A 3W58A 2JG8C 4XDQA 2WNEA 5I91A 1X50A 2VOVA 1PVC1 2VQ0A 4AEJA 4HKLA 3IKWA 1VR3A 1W0PA 1WD4A 1Q8SA 3MLJA 1POV0 4PQ9A 2FMYA 3VL9A 5GZGA 1SMVA 4FCAA 3OCPA 3AMNA 4FOWA 3ACLA 3CL1A 2WC2A 4LLOA 1LHOA 3FBMA 1LOBA 1V9U1 3WP5A 3GBFA 1C4RA 3V0AB 2RS11 4FPYA 2W08A 4Q4Y1 4F83A 1D0GA 4DFSA 3MIBA 1W6OB 1D0HA 4MXWA 4CRQA 1GV9A 1RJ8A 1K5MB 1AYM3 2JJ6A 4DZGA 4IEOA 2WSVA 3M70A 3SH3A 3TN92 1AUYA 2HYKA 3ZXKA 1HV1A 4GWNA 1YLLA 3JBG2 2PAMA 1HDKA 4QHBA 1I5ZA 1PM7A 1ZZCA 3VBRB 3UKVA 3KMHA 4WVMA 3DPRB 1ULGA 3ETQA 5CVRA 2BUKA 3MW3A 4NN0A 2C5DA 1BBT3 2ZKNA 1R083 1JOJA 4ASMB 4DINB 2H6CA 2NN8A 1S0IA 5C8WA 4F3JA 4U2AA 5T55A 1H9PA 1RUH1 5EFUA 4Y1YA 3USSA 4JDMA 3MPBA 1RUJ2 3IIAA 3M3OA 1AL22 1WLDA 1BZWA 4MGZE 1WLCA 3ZO0B 3VBOA 4PCRA 5ACA1 2G9FA 4LULA 1M4WA 4FP3A 3RQ0A 2FHRA 1VBA2 3L2YA 1RUD2 5KHKA 3BALA 4XJ8A 3BOPA 5L7OA 3CLPA 1OFSA 2H0BA 1ENXA 2UY9A 1RMU2 4Q8KA 1Q8QA 1TNFA 3LSDA 4IEVA 1O3QA 2QFEA 3OBRA 2P37A 4CDUB 4I2OA 1T6GC 4V1PA 5AC92 5H9PA 2R041 3O14A 3N7MA 1M06G 1F9KA 4OVEA 3TOJA 1W6MA 5FO8B 1UKRA 1NCQA 3VBHC 5DUVA 4YW2A 5CIRA 4B3NA 4HN0A 1LOFC 3E6DA 1PK6A 4UW6A 5J36A 1D4M3 2WNUA 5FLIA 2A75A 2VNOA 1PGW1 4TYSA 4CEWA 2WWSA 3AKSA 4Y26A 1PNGA 3J8F3 2VY0A 3CEWA 4IESA 2D44A 1WCKA 3EHKA 3N7LA 1CR7A 1MACA 3B9CA 4AHZA 4W6XA 4IV1A 4QMAA 3TNQA 4K21A 1KJRA 4MXWB 5IK4A 2P2KA 1MZ6A 4L97A 1MS0A 5A33A 1PHMA 4CDXC 5KHIA 4GMP3 4BCUA 1QJU1 4CP1A 5KXBA 1VBC2 1H1AA 3RRDA 4EWAA 3FWEA