1GBGA

Bacillus licheniformis beta-glucanase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
QTGGSFYEPFNNYNTGLWQKADGYSNGNMFNCTWRANNVSMTSLGEMRLSLTSPSYNKFDCGENRSVQTYGYGLYEVNMKPAKNVGIVSSFFTYTGPTDGTPWDEIDIEFLGKDTTKVQFNYYTNGVGNHEKIVNLGFDAANSYHTYAFDWQPNSIKWYVDGQLKHTATTQIPQTPGKIMMNLWNGAGVDEWLGSYNGVTPLYAHYNWVRYTKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (1,3-1,4)-BETA-D-GLUCAN 4 GLUCANOHYDROLASE
publication title Crystal structure of Bacillus licheniformis 1,3-1,4-beta-D-glucan 4-glucanohydrolase at 1.8 A resolution.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase (glucanase)
total genus 49
structure length 214
sequence length 214
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 1995-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1gbgA00
2WLQA 4R9CA 3LSEA 1DYKA 2GDFA 3WHTA 1DZQA 1HQLA 3B9CA 4KBBA 1W6PA 1AXZA 2P3JA 5IUQA 2FMDA 2GNTA 4FQ4A 5BYNA 1JYIA 2DVBA 4WVVA 4Y1VA 1UKGA 3N7JA 3LSDA 4AYUA 2ZZJA 1W6NA 1DLLA 1Q8SA 4YLZA 1CESA 4ISQA 4XILA 1LJ7A 3SH5A 2CYFA 1LHVA 5HCBA 3RQ0A 1LOEA 2EXIA 1JW6A 1FNZA 1QNWA 3BODA 1QNYA 1ULFA 2D6NA 2PHUA 1DFQA 5LK5A 1V6OA 2ZGLA 4YW1A 4TYSA 1XQNA 1CN1A 3OBRA 4Y1UA 4AVVA 2WT1A 3V0BB 3BTAA 1SCRA 3HN1A 3L2YA 1FAYA 3NV1A 2VUAA 4BQ1A 3ZSKA 3R4SA 5JDBA 3AFKA 3LCPA 2YZ4A 2G4IA 3UJOA 2AYHA 1V6KA 3POSA 4K20A 1CIWA 3VUOA 4LBJA 2JKBA 5JMCA 2ZGUA 4LBKA 4LBQA 1OQ1A 1WW5A 2BQPA 2DVDA 4M00A 1DHKB 1GYKA 3VV1A 4WVWA 1FATA 3MW4A 1AXKA 1W0PA 4GKXA 1V6MA 2D6MA 1VALA 2GMMA 4XOGA 5KXBA 4Q27A 3O5SA 1DQ0A 2OW4A 2D6KA 5T5LA 3ZSMA 1N1SA 2DWRA 1S0DA 1N1VA 5F5QA 5JOYA 2NZ9A 4PQ9A 1G9DA 1RITA 3AZXA 3MW3A 1KDMA 1DQ1A 1DQ4A 1V00A 4HL0A 3VKOA 1ULEA 1UZZA 4M3CF 4UW5A 1I1EA 3PVEA 2JECA 2YY1A 1MS0A 2AH2A 1G9BA 1W6OB 4JRAA 4XHXA 4OZXA 1MVEA 2YROA 3AK0A 2D3SA 2PHTA 4PBOA 2CWMA 2VW0A 3WDWA 3T2TA 1DGLA 4Y1ZA 4BMEA 4C1XA 2P2KA 1LULA 4M3CE 1W6OA 3O0WA 3OJBA 5DZEA 3H0OA 1WW4A 3N35A 4AGRA 1VAMA 2EAKA 1LHOA 1SBFA 1V6LA 5GZEA 2ARXA 1IKPA 4R9AA 2NMNA 4FPJA 3BOPA 3NV4A 2UWBA 3DUIA 2HYKA 1PZ8A 2R1BA 3MEPA 3DGTA 2W39A 2ZHMA 2SBAA 4K1YA 4DPNA 3FLTA 1FX5A 5JVVA 1ULDA 1WW6A 2DUPA 1KJRA 2H0BA 2VW1A 3B69A 2WKKA 1Q8QA 4Q2FA 4Q1PA 3WCSA 1D0HA 1SFYA 2E53A 3V0AA 2PHXA 1MR5A 2A3WA 4XXAA 4GA9A 4ATEA 1FNYA 2JE9A 3T1MA 4YGCA 2W52A 1ULGA 2ZGRA 5IK8A 2WNEA 4UW4A 2ZGTA 5GLVA 4CTEA 1CQ9A 3NV2A 3FUOA 1GLHA 3R05A 2R49A 4XJUA 5FRAA 5DUXA 3AZVA 5CAZA 1WD3A 3O0VA 1I3HA 1W6QB 2D7FA 4XBQA 4YG6A 1H30A 3SH4A 3M2MA 1DQ6A 3M3CA 4YM1A 1MS9A 2AGSA 3MW2A 1AF9A 1LENA 3AYEA 1MZ5A 1SLCA 1GBGA 2JD4A 4XJ9A 2XG3A 1W6QA 3WCRA 3WHUA 2EXKA 2WT0A 2EALA 2ZHLA 2ZMLA 1GICA 5FREA 2Z42A 1O4YA 4P9YA 4Y1YA 2JE7A 4FOWA 1R1ZA 3RMYA 3Q9OA 1WLCA 2DUOA 4GALA 4DFSA 1VLNA 3AJYA 3BIWE 4FOVA 1W6PB 5EWSA 1ENRA 1LOCA 1N3OA 2ZAAA 2E6VA 1UMZA 4H55A 3T1LA 5DG1A 5DUWA 1LU1A 3QLQA 3QCWA 2VY0A 1W6NB 2A5ZA 1SLIA 2WQZC 4NO4A 5F9TA 2D6OX 5GM0A 4Y24A 2ZKNA 5GJ6A 1ONAA 2A6YA 3FLPA 1SLLA 3ILNA 1GSLA 4JCKA 4UW6A 5E89A 2GN7A 2ZGSA 4FVVA 4YW2A 3KM5A 1JHNA 1MS8A 2ZGPA 3WDXA 1X50A 1H9WA 1JOJA 1LU2A 1VAVA 3SITA 5AVAA 5E88A 3ZXJA 4LBLA 2A70A 1LGCA 1A8DA 1G9AA 1LGBA 2JJ6A 3AJZA 3JU9A 4YFZA 3ZSJA 4YW4A 1RIRA 4XIOA 3WOGA 2A71A 1IS6A 1IOAA 2AUYA 2DUQA 4BMBA 1LEDA 3RS6A 4FPHA 3OYWA 3D6EA 1IS4A 3ATGA 3OBTA 2UURA 4FPYA 4LBQB 2C5DA 1HLCA 4Y22A 5EYXA 4YW5A 3V64A 4YZ3A 3WDTA 1CJPA 1C1FA 4MYEA 4XMIA 2WJSA 4JC1A 4M01A 4PF5A 4XYXA 1WLWA 5H9PA 1HDKA 1Q8PA 3MPPG 2D43A 1Z78A 5HCAA 1S1AA 2CTVA 2W08A 3WG1A 4CZSA 5GZDA 4I30A 5DUUA 5SV8A 1A3KA 2DVFA 1G8WA 1RINA 2DVGA 1N3PA 3ZSLA 4Q8LA 3W59A 3I8TA 1Q8OA 4FPOB 2ES3A 1F5FA 5CBLA 1QMJA 1WBFA 2WT2A 5GLUA 3SISA 4FPFA 5T50A 1CPNA 1W0OA 2I2SA 4WZFA 5GZCA 3ZXEA 3ILFA 3RMXA 2D6PA 3FLRA 1NLSA 2P37A 3INAA 4R9BA 2ZMNA 3WLUA 4YFWA 2D3PA 3WVJA 3ZXFA 1NXD1 4Y26A 2ERFA 3VKFC 2ZBJA 1S0JA 4FOYA 5H9QA 4Z8BA 1AVBA 1BJQA 2D44A 4P9WA 4W65A 4YZ5A 5IT6A 3AZZA 4IQPA 1Z0HA 4P9XA 3ZYPA 1GKBA 2ZHNA 1LESA 1UL9A 2R0HA 2V5YA 2YMZA 1KDKA 4XJZA 3AZYA 1AX1A 4AVTA 3V0AB 1J1TA 2ZGNA 1BZWA 1YO8A 4ITCA 3RSJA 4BLIA 3U4XA 1JN2P 4XXPA 2R1DA 1QDCA 3TB0A 4YZ1A 5JOXA 1IS3A 1ZM1A 1LOFC 2GNDA 1GZ9A 4BOWA 5CB7A 4D69A 3AX4A 1SBDA 4XTMA 3USUA 2NMOA 3W58A 1JUIA 3ZXLA 2CNAA 3CNAA 1QOTA 1QU0A 2UWCA 1KJLA 4BPZA 3AP7A 4GWMA 2DYCA 3IPVA 4YGDA 1SLBA 1TEIA 1DYPA 1URXA 3V65A 1F31A 2GMPA 4XBNA 3A0NA 3NV3A 2D6LX 4XMAA 4BLJA 2ARBA 4SLIA 4ZXKA 3JUUA 4XIKA 5L73A 2E7QA 5DXDA 5GALA 4LBQD 1S0CA 1N1TA 2KM2A 3OPZA 3A0KA 1IS5A 2OUHA 2ZACA 1ULCA 4Q1RA 3WDVA 5T54A 3AXDA 2R0FA 1SACA 2PELA 1UPSA 2NM1A 4L8QA 4Y20A 1QDOA 2ZGQA 1N3QA 1YRZA 3HR9A 3WUDA 2XB6C 3AP5A 5JOWA 4ASMB 3WG3A 4FOQA 2NP0A 3N7MA 4U36A 2PHFA 4ISRA 3WG4A 2A6ZA 1S0EA 3M3EA 3A4UA 4YGEA 4XJ8A 1AJOA 2TEPA 1C4RA 2UWAA 1FV2A 3NWKA 4FP3A 2NN8A 3N36A 3M3QA 1WBLA 4FPKA 4RA0A 1ENQA 1AXYA 5EXOA 1WCSA 4PCRA 5H9SA 2PHWA 1GZWB 3SLIA 5T5OA 4AVSA 1CVNA 4NOTA 2OUJA 4FP2A 1GNHA 1Y7BA 1LCLA 2WSVA 1W6MA 5EYYA 4XZPA 3WG2A 4XBLA 1GZWA 1VIWB 3B01A 4YW3A 1SLAA 2E51A 1C57A 2A6VA 1YIFA 3FUQA 1YI7A 3GNEA 1MZ6A 1V6NA 4FPLA 4M3CA 1HQWA 4FPGA 3ZPYA 1DIWA 3HMYA 1SBEA 1CR7A 4Q8KA 2DU1A 1YYNA 3OYWB 3ZVXA 4Y22B 3ZXKA 5KXDA 4YG3A 1S0BA 2JDZA 3KQRA 1G9FA 4FPEA 2B7YA 1MS4A 2VU9A 3ILRA 1QGLA 4YM3A 1AZDA 2GALA 1S0FA 1LOBA 3ZYRA 1SLTA 3O12A 3WZ1A 1FYUA 5JOZA 1U0AA 4FPCA 3AYAA 2VXRA 1MS1A 1G86A 5HCFA 1G9CA 4YM0A 1QOOA 2EXHA 1GANA 5DG2A 1LHWA 1C1LA 1H9PA 5IK7A 1WUVA 1LHNA 2ZGMA 3WDUA 1APNA 1KQRA 2DTWA 3AXEA 4CRQA 1GV9A 2DTYA 3N7KA 2ENRA 2ZABA 3VKMA 2VW2A 2UU8A 4F83A 3PVOA 2Q5TA 3ASIA 3IMNA 2W68A 1S0GA 3V0BA 4C1WA 3TAYA 4YZ4A 1FV3A 2GNMA 1UZYA 5DZGA 3B00A 4YGBA 3WDYA 3SNMA 2P3IA 3N7LA 1LTEA 1Q8VA 2A3XA 2EIGA 2A3YA 1LGNA 1IKQA 4LBMA 4P14A 5GLWA 3D5OA 2GNBA 4RL7A 1V6IA 1LOAA 1F9KA 5IK5A 4PBPA 1YXWA 2GN3A 2DU0A 1S0IA 2CWSA 2AENA 5T5PA 1CONA 1N47A 3WV6A 2AR6A 1ZA4A 2LALA 4YG0A 2ZHKA 4XE9A 1UN1A 3APBA 1G7YA 3POWA 2ZGOA 2AREA 3AYDA 3M3OA 4ATFA 1BKZA 4LBOA 3RG0A 3UL2A 1CPMA 4XHBA 2RHPA 4FQZA 5H9RA 1LHUA 3USUB 4GWNA 4DRRA 5E8AA 3PJQA 2YXSA 2V73A 2A7AA 3PVNA 3IPVB 5GZGA 4ZKTB 3IKWA 5DZFA 5IK4A 5JLVA 3AP9A 4XJAA 4WV8A 1JBCA 1HKDA 4XJWA 1UAIA 2P34A 1LOGA 2CY6A 3WUCA 1WW7A 4UW3A 2NYYA 3FFZA 4AWDA 5CA6A 1DQ2A 3R4UA 2R16A 2SLIA 2DVAA 1GNZA 1GZCA 2OVUA 3AP4A 3AZWA 1ENSA 3C2UA 4YM2A 1AX0A 1JXNA 3OY8B 4LBNA 2D3RA 1WD4A 4Y1XA 1Q56A 1SCSA 2EXJA 3VKNA 4AGVA 3VKLA 2VH9A 3UK9A 2A6WA 5GLTA 1BYHA 5CNAA 1AX2A 2CL2A 4Y20B 4Q26A 2ZMKA 1LOFA 4GXLA 2EF6A 3OY8A 1EPWA 3M1HA 3PMEA 3ENRA 1PZ9A 1MS3A 1O4ZA 2DURA 1JYCA 1MS5A 2E7TA 1V6JA 3WNXA 4YZ2A 5KXCA 2C9AA 1BXHA 4XDQA 1N1YA 2A75A 1LECA 3GALA 1AJKA 2YV8A 4HANA 1A78A 3IM0A 5T5JA 4TZDA 1LODA 2ZA9A 1DBNA 3O0XA 1B09A 1PZ7A 1BQPA 3SH3A 1QKQA 1MVQA 4DRVA 3UJQA 4U2AA 1QOSA 3IN9A 3OGGA 1KITA 3D4KA 2LTNA 5T55A 2GMEA 2WSUA 5KXEA 4AGGA 1W6MB 2PHRA 2DV9A 4DQAA 4DS0A 4XTPA 3I4IA 5GZFA 4K1ZA 1QF3A 5T52A 3FBYA 1D2SA 1OFSA 5GLZA 4M3CB 2ZGKA 3POYA 4K21A 2P3KA 4BM8A 1WLDA 2FHRA 3AYCA 3N3HA 5DUVA 1UX6A 2A6XA 3AP6A 4GKYA 1OKQA 1DQ5A 4R9DA 3B3QE 3RRDA 1MACA 1LEMA 1KRIA
chains in the Genus database with same CATH superfamily
2WLQA 4XUTA 1LR5A 2VECA 4OULA 4QQPA 1H8TB 1SZBA 3AVSA 1DZQA 3T4VA 1HQLA 1TMF3 1KD7A 1Y9QA 1L3JA 1H6YA 1AXZA 2HH9A 3B9CA 3I3DA 4XUQA 4Z1VA 2GNTA 4FQ4A 5BYNA 1JYIA 1SFPA 5FZCA 2H0VA 4Y1VA 3PUSA 3LFIA 3O1RA 2ZJCA 1JHJA 3IDEA 1CESA 4CDUC 2JWPA 3SH5A 4HETA 4N53A 2FD8A 2C0ZA 3JB4C 1JW6A 2XJSA 4IV1C 3W5NA 1RUI3 4LIVA 3PIGA 4AFCA 4XQ4A 4QKNA 3OGSA 3NVCA 3I2DA 1FXZA 2ZGLA 4YW1A 2BW8A 4UFMA 3CLPA 3DL3A 3OBRA 4AVVA 2Z79A 2EA7A 3MUZ1 3O1SA 3IT8A 3BTAA 4AQSA 5JCTA 4P08A 2ETEA 4XF9A 3R4SA 4AI9A 2EICA 1WKYA 1X8MA 4PF1A 2Q8OA 4URAA 2JG9A 4EROA 2YZ4A 2EIDA 2IXIA 2WBKA 1IHMA 3KGLA 3TEWA 2WA3A 4LBJA 5JMCA 3VUOA 4CXYA 1ND2B 2RJ2A 2Q0AA 2ZGUA 1OQ1A 1WW5A 2BQPA 4LBKA 4LJHA 4AFAA 2ILMA 2MNGA 1H2KA 3HVDA 2UYBA 1AXKA 5FYUA 1AR82 4X8PA 3OPTA 1AR81 1NA1A 4JAAA 2XWBB 2X5IB 3UGHA 1DQ0A 4YYOA 2R063 2D6KA 4JKMA 5T5LA 4L9BA 1N1SA 1S0DA 2RM23 1GWMA 1KDMA 2BVBA 2P5BA 4HL0A 3TN92 1BVP1 1UZZA 4UW5A 3TN91 1ZRIA 3RPQA 5JPMB 4CCOA 2R042 3MUY1 3MF9A 2R041 1JZ4A 3BU0A 2VJXA 4XHXA 4XDOA 4OZXA 4BB3A 2ZEWA 4LKEA 3PHMA 2D3SA 3URFA 4PBOA 2CWMA 4BMEA 3T2TA 1E5SA 4QT6A 4WM8A 1FOD2 3KT7A 1FOD1 5DAQA 4TLGA 2KA3A 3AFGA 2QQIA 5FPLA 1WW4A 3HT2A 1V9U2 4KMQA 1VAMA 1V9U1 1HN0A 1SBFA 2R7EB 4LA2A 4DXTA 1PGL2 1PGL1 1IKPA 4C0BA 1RUNA 1J83A 1K5MC 2MPFA 2W87A 4FPJA 3NV4A 3J7HA 1PZ8A 4K8FA 2R1BA 4QGNA 1CX4A 2W39A 2ZHMA 3DGTA 2YU1A 2W1SA 4XFFA 1VBA3 3RGBA 3SCFA 3KF3A 4NPRA 3O1OA 2FDGA 3GZUC 1RHI2 1RHI1 4R8HA 5F39A 1CD3G 1PMJX 2ZGTA 5J09A 4NUBA 5GLVA 5A7WB 2IUWA 3R05A 4W50A 1AR93 5DUXA 3AZVA 4LUKA 1WD3A 4XABA 3WX5A 4C0HA 4NHLA 4AZZA 1R082 1W6QB 4XBQA 1R081 3TBDA 3ZX7A 3NNJA 1ZRCA 1PGSA 5I0SA 4YM1A 3MW2A 4IGOA 5F8PA 5IVYA 2BWCA 2BOJA 5F2WA 3AM2A 1GFF2 3KVAA 3WHUA 2WT0A 1CAXA 2ZHLA 3PVBB 4MX3A 1GICA 1JOPA 1Q5OA 4Y1YA 2JEMA 1XB9A 5C5UA 3GGLA 3RMYA 4META 3Q9OA 1WLCA 4YVWC 4A7YA 3ZYHA 4GALA 2XHNA 4DFSA 4BDVB 3ACGA 5DMYA 1X8EA 2RS13 2XUEA 1W6PB 4NHXA 4FI9A 1LOCA 1N3OA 1HB3A 3WW3A 4EJRA 5C8WA 2ZCWA 3T1LA 1ENXA 3TEZA 3WT3A 5B2GB 4DZGA 4HVOA 5DUWA 2I45A 3TNPB 1QXJA 5AFEA 3AVRA 3QCWA 4AEJA 3WQ0A 2ZX0A 2TUNA 3PL0A 3VZOA 4K7JA 4I0BA 1VBE3 5AC93 5GM0A 3N9OA 2ZKNA 1PHMA 2A6YA 1YQ6A 1SLLA 5F5CA 3K51A 3ZIWA 3WW1A 3GDBA 5KHHA 2J1UA 5G04L 3KM5A 2PFWA 2ZX4A 1H9WA 1JOJA 2LW8A 3LA2A 3RI9A 3SITA 2C24A 3ZXJA 1RVF2 3B94A 1RVF1 4INDA 3D0JA 1OVPA 1JYNA 1LGCA 4AFMA 5K9YA 2VCBA 4IV3B 1VR3A 5C33A 3UT0A 3ZSJA 4YW4A 1RIRA 2E32A 4PDWA 3WOGA 1U5ZA 4JZRA 2YC0A 2DUQA 1C5HA 4LITA 3K46A 3UK9A 1E57A 1IS4A 2BFUL 3B02A 5FMOS 1OQDA 5CG8A 1NT0A 5A3WA 1NE6A 1VMJA 3F2ZA 2K46A 1ZRRA 2G9FA 1W9WA 4YZ3A 4CE8A 2PHDA 1C1FA 4RD7A 3H9AA 2GAUA 4QGMA 4M01A 1H6XA 4RR3C 5FBJA 4E8CA 1QHDA 5IVFA 1JYVA 1ODNA 2W47A 4DEVA 3PNAA 1K3IA 2BRTA 1S1AA 3WG1A 1VJ2A 4AVSA 3MICA 4IGPA 2GZWA 2XHKA 5DUUA 2QUOA 4YW7A 4CZSA 4B7EA 1G8WA 4XW3A 3HNMA 3I3EA 4GWIA 4RS5A 5IAVA 3RFRA 3DPRB 2BEOA 4Q8LA 3LIGA 4XQWA 4IEWA 4FPOB 4QQHA 2WZPP 4EWAA 5CBLA 2VBBA 1REDA 2WT2A 3DF0A 3HJRA 4OFGA 4XFIA 5J98B 1MQTB 3BVCA 2QKDA 3ILFA 1H2MA 3KV6A 3QH7A 3RMXA 3ZXEA 2D6PA 1ND3B 3INAA 3OD0A 2ZMNA 5D8AA 4YFWA 3WW2A 1ZZ9A 2BNMA 2D3PA 2JG8C 3WVJA 4LO5B 1X7NA 2ERFA 2WWUA 5H9QA 1AL23 2WAAA 3KSCA 2VBDA 3VBHB 3RYKA 3LOIA 3WQ1A 1CAVB 3ZFFA 5F3CA 5FO9B 5IT6A 3POFA 4IQPA 2WZEA 4P9XA 1POV3 5L7OC 4QPGA 4L92A 4CDWA 4RGGA 3V0AB 1MEC3 4AVTA 1J1TA 4AFDA 1BZWA 2GU9A 3KS7A 3RSJA 1PNFA 5FQ0B 5GKAC 3ZMNA 4LE4A 3VBSA 4AE2A 2QNKA 1H4HA 5A7PA 2R1DA 3VZMA 4N43C 2RG4A 2WAOA 1IS3A 1ZM1A 5FZFA 1CWPA 5LA1A 4BOWA 2JDAA 4D69A 5CFCB 1E5IA 2O0OA 4XTMA 4AEDA 2Q1FA 1JUIA 5HXMA 2AZ5A 1QOTA 4DXRA 1KJLA 1UU4A 1UZVA 2VTFA 5BPXA 3IPVA 4AW7A 3UKTA 1SLBA 3CJIA 5FJKA 5IVCA 2ORXA 1SQ4A 1DYPA 1IQAA 1URXA 2DDUA 2JE8A 2P6HA 3LPFA 3Q8EA 4JGYA 3A0NA 3UGGA 3KCXA 1ZZBA 3OGRA 3MV11 4X6RB 5I8YA 3S6PA 4SLIA 5FY7A 3VZNA 1OLME 3I2OA 1HB2A 5BNOA 3G6JB 4BQ4A 5C3PA 2WFF2 4CU6A 5FXWA 2WFF1 5FYSA 2IVIB 2WZ8A 1S0CA 2W91A 2WRAA 4LO8A 3WDVA 4M4PA 2YFUA 3AXDA 3VZKA 1SACA 1PO22 4XZUG 1UPSA 1PO21 2NM1A 1QDOA 3HR9A 1QQP2 2OPWA 1ZBE2 1QQP1 1XYPA 1ZBE1 4FOQA 3VBOA 2HYXA 1XE8A 2QQKA 4U36A 3E97A 5BV6A 2I07B 1UPIA 1S0EA 2WNUC 5JXGA 2JKXA 3I2IA 2OKXA 2J7MA 4PIZA 4MGQA 4QPIA 3NWKA 3ZFEB 5FWJA 1O3TA 2WO3A 3I3QA 4FP3A 2NN8A 5K0UA 3KB5A 1ENQA 1XNCA 3BTZA 1AXYA 1ZZCA 2HWC2 5H9SA 2HWC1 4I3PA 1HV0A 1SDDB 4FFHA 2J22A 2RMU2 3PU3A 2RMU1 3AMHA 2XVLA 4FP2A 4P00B 1OF4A 1GNHA 4IEVA 2WSVA 1W6MA 4TWTA 5F3EA 3R0RA 5EYYA 5FY5A 3WG2A 4CPBA 1IZ3A 2HWB3 1GZWA 4HFSA 3E6BA 4XFCA 4Y4RA 1BHGA 1ZBA3 1V0AA 4IL7A 4JHZA 2GC2A 4KI5M 4OCTA 1C57A 4PIYA 4Q5OA 4AHXA 2OS2A 5A7OA 3FUQA 2RR12 1DGWX 1YQ8A 2RR11 1RUF2 4NE9A 1RUF1 4EZHA 1R093 3HPNA 3ZPYA 1QJY2 5F5IA 1QJY1 4DY3A 4Q8KA 4CU9A 1NQJA 2DCYA 3NAPA 1CZVA 1YYNA 3NQHA 4W6WA 2WWJA 1O3SA 3Q8AA 2Z2SB 4BJ0A 2WDBA 1S0BA 1WCQA 3IB3A 1RJ7A 3KQRA 2QE3A 4LO6B 1MS4A 2VU9A 2VMDA 2XVKA 5FZ7A 1E5HA 3SHRA 4IV1B 3TEYA 1H8TA 3OUJA 4GQ7A 3ZYRA 3O12A 3W5MA 1EPZA 4WVMA 3NJVA 3AYAA 4KWJA 2HBUA 3IZOA 1MS1A 3WNNA 4GMP0 1DZRA 5FYHA 3N9PA 4Y5Z0 3BTYA 5FWEA 1RUG2 1QJX3 1RUG1 5DG2A 5JAXA 1LHWA 4CXWA 1H9PA 5E1RA 1H1IA 4CP9B 3MBWA 5F7UA 2Y6HA 2UYAA 4L11A 1XU2A 2Q8CA 3GCWA 2ZABA 1W8NA 5CKNA 5FLJA 4F83A 2GH8A 5IFPA 3MLLA 2LROA 1O5UA 1H1MA 4KG8A 4S2DA 2W68A 3VDAA 3IWZA 3VDDC 1CZSA 1GR3A 3MO4A 3BALA 3WQBA 1RUH2 4C1WA 1XU1A 1RUH1 1K12A 3HD8B 3SNMA 1HXS2 1NXMA 2A3XA 1HXS1 3ZYGA 3RWNA 1ALYA 3BPSA 1V6IA 1W2UA 3ZFGB 5IK5A 3KT4A 4PBPA 1JH5A 4M0NA 5A3OA 2EAAA 5I8SA 2CU5A 2L9LA 5T5PA 1CONA 1VRBA 1N47A 5ISLA 4EN0A 1ZA4A 2LALA 4NVPA 4YG0A 4HPKB 5F6KA 5FP9A 1G7YA 3MLJA 3M3OA 1H1AA 4GB32 4GB31 2D40A 2FDKA 2X5IA 4LT5A 4LBOA 1TME2 2XJQA 1TME1 4JGZC 3VB9A 5DN2A 3AB0A 4DRRA 3PUIA 5E8AA 4UFHA 3PJQA 3KF5A 3WP5A 4EWEA 4DUXA 5E6HA 1WLTA 3IAPA 5DZFA 1K5MB 2Y6GA 4PI2A 4XJAA 4BXSV 5JLVA 3VN4A 1HKDA 4XJWA 2ZX3A 1F35A 4OHVA 4YPJA 3ZR6A 5F5AA 1WW7A 2NYYA 3FFZA 3RZGA 1J3QA 4AWDA 3R4UA 2BGPA 3K48A 2Y0IA 3MPBA 4EYUA 4DNYA 1ENSA 3C2UA 3I97A 1UY3A 1JXNA 3OY8B 3PUAA 1A34A 2D3RA 4Y1XA 1Q56A 4AGVA 3VKLA 2VH9A 4UWDA 2A6WA 2AEYA 4ES8A 1BYHA 5CNAA 3LKJA 1PMIA 1AX2A 2XQXA 1LOFA 3DXTA 2W1WA 2W1QA 3M1HA 3EBRA 2OPKA 3POEA 4CCEA 1BMV2 1PZ9A 4HK8A 4JRLA 1O4ZA 4QXBA 2E7TA 1T2XA 4IESA 4MGSA 2GC0A 1VBC3 1BXHA 2BTVC 1S2BA 2OXBA 3BN6A 4KWLA 3GALA 1AJKA 4HANA 5L36A 2V09A 5T5JA 4TZDA 2HWF2 4UYBA 4Q29A 2HWF1 2HWE2 2VD7A 2HWE1 4HVQA 5A70A 5KC5A 2VM9A 3A7QA 5A32B 1BBT2 3RVHA 4U2AA 1BBT1 3D4KA 3NNLA 5T55A 2O8QA 2VNGA 2XBO2 2CGOA 2PTMA 2XBO1 4LTAA 4M0HA 2H6BA 4AGGA 2VZTA 3H1WA 4RSUA 3POIA 4YVWB 1UWWA 1UZ0A 3D8CA 1XNAA 3I4IA 5GZFA 4K1ZA 1YFYA 1BEV2 1BEV1 3FBYA 1D2SA 3FHIB 2C6SA 1OFSA 4ZU4A 1NCQC 3POYA 2JICA 3THTA 4BM8A 2PXJA 1WLDA 1Z7S2 4PLNA 1Z7S1 2MEV2 3R4DB 2A6XA 2MEV1 1UY2A 2VZUA 4R9DA 1O91A 4NMIA 4YNIA 3RDIA 3T4HB 1LEMA 1UO9A 1DGRA 1MZEA 2Y38A 4Q0VA 5IWFA 5HPOA 1FPN3 4XF1A 1PO13 1REEA 2QQUA 1W6PA 1AR63 4Z82A 5FP3A 5HV4A 4CDXC 2JDKA 2CDOA 4DIQA 3KWVA 4Z2AA 1OA4A 4I02A 1O59A 1DLLA 1Q8SA 1RGSA 1HRV3 4ISQA 1LJ7A 3GJBA 3PUQA 3VZLA 3S7EA 1LHVA 3OEBA 3RQ0A 3VGIA 1J3RA 3SEEA 4AQTA 1D4M2 3BODA 1D4M1 1PMHX 1ULFA 2VZ1A 1DFQA 3JBG2 5FPUA 3JBG1 1V6OA 2D5FA 3DYMA 5LBFA 4ZS3A 4NIDA 3CBNA 2QQNA 3GHMA 5L9RA 4OUEA 1CN1A 3ZM8A 1ZREA 4RR3B 3W20A 4KU8A 4H2AA 4KGQA 4MXWA 4IV3A 3NV1A 4QPYA 4RGAA 2VUAA 5FCCA 4BQ1A 1T6BX 1VBD2 5K7PA 1VBD1 4P9LA 2K9ZA 2VCAA 1I9RA 5HV0A 4QHOA 3LD8A 2OX0A 5DAXA 2VZPA 1RUC3 3POSA 1H2NA 1PX3A 1S4CA 2DVDA 2XJVA 3U1XA 2J1TA 3VV1A 2GC3A 3KMHA 1FATA 2OQ7A 3MW4A 1FMD2 1NG0A 1Y9GA 1FMD1 1X9TA 4XOGA 5FOJB 1D7PM 5KXBA 1OC1A 4Q27A 4RGKA 4AEMA 2OW4A 3WP6A 4B3NA 3S5AA 2DWRA 5JOYA 1TNFA 1ZRFA 2I74A 4CPBD 5FDBA 3X29B 2RDNA 1DQ4A 2JG8B 3VKOA 1NKGA 1GUIA 1W2AX 4CYDA 4GULA 3PLQA 1W8HA 4LLFA 4MSVA 5A6XA 4JRAA 1D4VB 1MVEA 2YROA 2BBAA 3J7NA 3WDWA 2VCCA 4K40A 1DGLA 4C1XA 5L7OB 1O8SA 4M3CE 1MQTA 4AI3A 1W6OA 3GZEA 5IVEA 5DZEA 3H0OA 4AGRA 5C9AC 1JUHA 1ND3A 1V6LA 1W99A 4AVAA 5BNQA 2VVEA 2RS33 4N43B 2YBKA 3IMMA 1SPPB 3K4AA 1W2NA 3DUIA 2HYKA 3ABZA 2HEWF 3UKVA 2ORZA 2FQPA 3K4ZA 1QEXA 2ARAA 5JVVA 1UIJA 2D97A 4NIIA 3WCSA 3OTFA 3PIJA 3RWKX 3V0AA 5DAVA 3IIIA 5FY1A 2QTWB 4XC9A 5FQ0A 4ATEA 5C8CC 2HEYF 1X82A 2ZGRA 1RUJ2 2WNEA 3HBKA 1RUJ1 4UW4A 2B39A 4CTEA 1CQ9A 3NV2A 2WO1A 2IZWA 3FUOA 5FMBA 1P8JA 4IEXA 1VMFA 5CAZA 4BH9A 3T2OA 4JTNA 1W04A 4QD2A 3JD73 1H30A 1UY0A 2DCTA 1MS9A 1TMF1 3ACHA 4IGQA 1HW5A 1LENA 3MIBA 3U4SA 3VD5A 4AFBA 4MHRA 4EWDA 2JD4A 4XJ9A 2RV9A 4WM7C 4DOUA 2EALA 4RQPC 1VB2A 4LLOA 1QXPA 4NIHA 1O4YA 3Q8FA 4BQ2A 3FHQA 1UQXA 4CUAA 3JQXA 1VLNA 4GZ9A 3AJYA 4XAAA 3BIWE 5C7GA 5EWSA 1RUI1 1TG7A 4AF9A 4NWVA 3H3LA 1UMZA 3OB8A 4F7ZA 3PU8A 1I5ZA 4EN6B 4M4RA 2FBEA 2WO2A 4P02B 5DG1A 1SDWA 5CISA 3ZFEA 1RXFA 1W6NB 2HWD3 2WQZC 1JMUB 3LEGA 4LHKA 2WO7A 3DV8A 2HLEA 3J9SA 3O7OA 4HKWA 4Y24A 4EQVA 2IXLA 1ONAA 2VNOA 5FXXA 3KV9A 5A80A 5J36A 2Y6LA 4JCKA 5E89A 2LS6A 4G9SB 4XQDA 3MHZA 1AR72 4FVVA 4YW2A 1AR71 4H14A 3OBZA 4KH9A 1MS8A 2VL4A 2ZGPA 4O9GA 4PIXA 1X50A 4BQWA 4N53C 1OUXA 1LU2A 1L7LA 1GNYA 3MGUA 4DMIA 1XYNA 5FP8A 4Z92B 1A8DA 1G9AA 1RTVA 2JJ6A 4Q0SA 3AJZA 4D3WA 3UESA 3H8OA 1VP6A 1NZCA 1OQEA 4XIOA 4NHMA 2R062 4LHNA 4DUWA 2R061 5TSWA 4YARA 4CVUA 1XNTA 2VMGA 3N9LA 3RS6A 2QCSB 2C4XA 5BNPC 3LIHA 2RM22 3FWEA 2RM21 2UURA 4FPYA 4LBQB 4CCKA 4EN7B 1VRH3 4QU2A 3WDTA 5FZOB 1HJFA 2CV6A 4IERA 2JG9C 3ETPA 4MYEA 4XMIA 1EY2A 1C3HA 4XYXA 4IV1A 1HDKA 1NCRA 4OLLA 4FTBA 1Y4WA 4N8MA 1UYYA 4CDQB 3H50A 5HCAA 1B35C 5FZIA 4QB1A 3K3NA 5A1FA 2WN3A 1RUOA 5GZDA 3GBGA 3LPGA 4QQOA 1HV1A 5APAA 3RI8A 3VDDB 2BGCA 3ZIXA 4COWA 1JI6A 2JDNA 1RINA 4ASLA 4D6QA 1G6NA 3WNMA 1N3PA 3AKTA 4CP9A 1JZ5A 5LY1A 3W59A 3I8TA 1Q8OA 2ES3A 3WP3A 1QMJA 3WXPA 3LB9A 4MOAA 2WZR3 4XUNA 3SISA 4GMP3 5T50A 2Y64A 2I2SA 1VBA1 2VC9A 2N7GA 3WNLA 3NO8A 2Y34A 5CFDC 3J7LA 2PQQA 3VD7A 5A1AA 4TLFA 2KXLA 2P37A 5KHGA 4R9BA 2C26A 1W9SA 2BOIA 2VR4A 4WM8C 1NE4A 1NY72 3VKFC 1NY71 1S0JA 2VMEA 2ARCA 2YPDA 5LEJA 4B4RA 4JGZB 1H0BA 1LRHA 5F3GA 3LE0A 3NJZA 3AZZA 1RMU3 1XE0A 1AR92 1AR91 3ZFGA 2ZHNA 3LDKA 4LK6A 1UL9A 2R0HA 1VPHA 3QD6A 1KDKA 2BVVA 2WYSA 1YO8A 2ZGNA 4AEKA 2WIIB 4DUVA 2VOKA 5A1LA 5FOBB 5LRSA 1W2OA 4HPKA 4CEYA 2VMIA 3CEWA 4A41A 4E4SA 1GZ9A 2RDSA 1CAUB 2ZEZA 2B42B 2IWGB 2LUWA 2VNVA 3CNAA 2UWCA 4BPZA 3DXUA 1CZTA 3HN3A 5JXHA 1K5MA 4HN1A 1TEIA 4E4DX 1F31A 1OKOA 2RS12 1U5IA 2RS11 3E5XA 5CKMA 5ANQA 2H6CA 3KLSA 3TN93 4AI8A 5A3PA 4ZXKA 3JUUA 4XIKA 4E4HA 3RJ2X 3S0MA 1OVSA 3FBMA 4Q4W3 5F6LB 1GU3A 5FXVA 4GD4A 2ADDA 3KD4A 4LNVA 4MV2A 5F3IA 3A0KA 2OUHA 1VBE2 1VBE1 2JX9A 1Y43B 1YLLA 4L8QA 3AKPA 5JOWA 1IGOA 1JS9A 3AP5A 2G1MA 4QX1A 4ASMB 3N7MA 3CU7A 3H8RA 5ABJA 2FDJA 3WG4A 2A6ZA 3TEXA 2Y6FA 3A4UA 3M3EA 4MGZE 5LA9A 2VOTA 4W6YA 5FUNA 3H7YA 3TWIA 5LRRA 1VAKA 1WMXA 3N36A 3VL8A 4L2NA 1W06A 1WCSA 1NCQB 2ATFA 4GIQA 3AL5A 2PHWA 1RL3A 5A32A 3SLIA 1J58A 3B7MA 1GOGA 4NOTA 1S55A 2OUJA 1ASJ3 4J25A 4IEUA 1RHI3 3EHKA 3TRSB 4YW3A 5JZGA 3M4FA 1I6XA 3HQUA 2FCVA 3O1VA 2A6VA 4DXSA 5JIUA 4LQRA 1YI7A 3PTYA 4V1PA 2GH2A 1TE1B 4CDXB 1YFWA 4QX3A 2VQUA 2WINB 3PTRB 1CIYA 1CR7A 1YCIA 4NRPA 3OYWB 3ZVXA 1KS5A 5KXDA 1R1A3 4HK9A 4OMDA 3POJA 5D21A 4K9SA 1G9FA 4PDWC 3DKQA 5EP9A 2WABA 3C7HA 2QBXA 1LOBA 5IHRA 2OQ6A 2VXRA 4COYA 5L9VA 1WCUA 4NAMA 5LW9A 5HCFA 1G9CA 3MLKA 2Q1MA 2EXHA 1GANA 1POQA 3PUHA 2DBIA 3ACFA 3H7JA 5IK7A 1WUVA 5L19A 2QQJA 3WDUA 3ZN6B 2JDHA 1AL22 4OHZA 4FAHA 1AL21 1APNA 1W8UA 4DY5A 2DTWA 5LZ6A 1GV9A 2DTYA 3N7KA 5CU1A 5FBZA 3VKMA 3H8UA 2JB8A 2QDRA 5C5TA 1POV1 4RS5C 4JV4A 2YPJA 5FK7A 1MEC2 2VZQA 3NW4A 1MEC1 2B9VA 2IXKA 5EV7A 2E26A 1NLQA 1S0GA 5FY4A 3TAYA 2VOXA 1AYN3 4QDRA 3T2QA 2R073 1PM4A 3SMHA 2EIEA 1WCKA 2NQYA 1F4AA 2ZX2A 3C7OA 1PIV3 4LBMA 1E5RA 4S2FA 3BB6A 4XURA 2GNBA 5GLWA 5FO8B 4XACA 4RL7A 1LOAA 2RE9A 1F9KA 1Q3EA 1YXWA 1OT5A 3VBUB 2DU0A 1S0IA 2JIJA 2X10A 4E2GA 4COZA 3PURA 4XFAA 4ZU5A 3KGZA 3ZFFC 4XE9A 4JKLA 4QXCA 2JDMA 2ZGOA 2AREA 3CIHA 1BKZA 2V72A 3UL2A 1ULOA 5LASA 4XHBA 2RHPA 5EJ1B 4QU1A 4BHPA 2XMLA 3ZXDA 5LA0A 3VBSC 5C9AB 4OMCA 2IC1A 2A7AA 3PVNA 1O8PA 2VXJA 3IKWA 2ADEA 5FUIA 4BWOA 4CEWA 2UY8A 2FMYA 4XAEA 1UY1A 3QH6A 1LOGA 2CY6A 5J1XA 4X8NA 3FX3A 5CYYA 3VBRC 1IQDC 5FYCA 2WC2A 1U12A 2SLIA 5L7OA 4JTOA 4Q4X3 5D2AA 3AZWA 3E5UA 1YUDA 2O14A 4LBNA 2FDFA 4FTEA 2EXJA 2O1QA 2PAMA 2DCKA 2XL9A 5C8CB 5GLTA 3JCIA 3RYRA 2AEZA 4LKSA 1RUE3 3GZAA 3LQCA 4JKKA 4MHUA 4BQYA 1L7RA 4GXLA 4D94A 2TBVA 4CXXA 1CX1A 4CU7A 1PX4A 5KXCA 1ZNPA 2OA2A 5FYYA 3RYPA 3MFAA 2EVXA 2VULA 3LZZA 2A75A 2HWB2 4Y5SA 2YV8A 2HWB1 2QZ3A 3BIEA 1ZBA2 3IM0A 4BQXA 1ZBA1 4A6OA 3O0XA 1H2LA 2PQSA 1PK6A 2VPVA 4HKOA 3SH3A 4LKFA 3VBFC 1WMEA 4DRVA 2OZ6A 2XDVA 3U75A 4QPIC 4UAPA 1R092 3OGGA 4WM7B 1C8NA 1R091 2E31A 2VAUA 3USSA 3KVBA 1UD1A 3ZMOA 3C7FA 2VOVA 1YFXA 5K0UC 2GMEA 1X33A 3IBMA 1GOFA 3KZ4C 2Y33A 4IE6A 3U07A 2DV9A 4AXOA 2JENA 4MGYE 4N9HA 4Y5TA 1NQDA 4BISA 4XTPA 2VTXJ 4ONUA 4DS0A 4Y33A 4ZU7A 4C90A 5FPZA 5T52A 3I3MA 3BKZA 4NIGA 4BZ4A 3PMSA 2XLGA 4M3CB 2ZGKA 2P3KA 3T30A 5JSPA 2X09A 3MFCA 4FT8A 3AYCA 1U5YA 2X8KA 3O14A 4XEZA 1XE7A 2FCUA 4OHYA 2CGNA 5FUPA 4EN9B 5FPVA 1QJX2 4W4ZA 1QJX1 4PT6A 3NL1A 2E63A 1DZTA 1KRIA 4AHZA 2VMFA 4AI1A 2GDFA 1R64A 3NNMA 4FFGA 2WFF3 3T2PA 5DDJ3 2QQPA 1JYXA 3NAPC 4AR2A 5HXVA 2P3JA 4CDUB 2FMDA 3M8LA 2DVBA 4QGLA 2BPA2 2K2SA 4WVVA 1O7FA 2Q30A 5C71A 3IAQA 3N7JA 4QB2A 3POBA 4AHYA 1QQP3 2PYTA 1ZBE3 1OMIA 4AYUA 1W6NA 1W3XA 2JXAA 3AMPA 3CL1A 4XF3A 4XILA 4YLZA 4MZUA 2WUHA 1UZWA 5FO7B 4LHSA 2BUKA 1CAWB 1K5JA 1STMA 2R32A 1FNZA 4YVSC 4YSFA 5FXZA 2B4KA 1XSQA 2RS53 1H4GA 2D6NA 2ZS6B 4ARXA 5BNPB 1EAH3 5LK5A 3DEMA 1AUYA 2BU9A 1QJU2 1QJU1 4JDOA 1YQCA 1OOPC 4ZZ8A 5IVVA 3E6CC 4XF0A 2ET7A 4PHZA 4R52A 4OI4A 2WT1A 1BLZA 1YFUA 1OLMA 2WS93 3L2YA 1FAYA 2FZ1A 4XPVA 2BZDA 3ZSKA 4A7KA 1F15A 4IXLA 1B35B 3AFKA 1KFXL 3LCPA 4IW3A 1Y3TA 2G4IA 3UJOA 2AYHA 4OI1A 3VD4A 4A2UA 5A7SA 4K20A 2JKBA 5FPXA 4LBQA 3EJKA 4M00A 4A6SA 5FZGA 4XUOA 1DHKB 1JU4A 3ECQA 4OI0A 4RHV3 5FZOA 4WVWA 1A8MA 3K2OA 1V6MA 2D6MA 2GMMA 1ND2A 2WNOA 3O5SA 4B1MA 4XFBA 2VBPA 4CDQA 5CFDB 2G19A 1N1VA 3NMBA 5F5QA 5I91A 5FYIA 1UF2C 1G9DA 3MDPA 1GQPA 5CKQA 1DQ1A 1SEFA 2W92A 5FMOL 5LB6A 4WM8B 4M3CF 3THDA 4ARYA 1RC6A 4ZHNA 1NLRA 1DP0A 2JECA 2YY1A 1MS0A 2AH2A 1G9BA 5EZWA 1XNDA 4CCDA 4COVA 1PVC3 3A21A 4KBZA 4NR1A 2PHTA 2VVDA 2WWSA 2VW0A 5I93A 2YFZA 2HBTA 2BP6A 1VBC2 1BK0A 1OSGA 1UOJA 1VBC1 2XH6A 1J59A 5FR3A 1UOBA 3UNPA 1LAJA 3O0WA 4MUVA 4NN0A 2Q1ZB 3LEMA 3ETQA 1OI6A 3OF1A 3WEZA 5JR2A 3S30A 4Q4Y3 5AVPA 5GZEA 3FL7A 3ITQA 1SMVA 2GP5A 3K75B 5FJHA 2WYFA 3O1PA 4R9AA 2V4AA 4D7SA 2AACA 1GWKA 4F8AA 2UWBA 4JGZA 3MEPA 4JVAA 4LA3A 2CDPA 2ZEYA 4K1YA 4Q0PA 3HNBM 2E33A 4DPNA 1O4TA 2YC4A 2VW1A 2DUPA 1KJRA 3B69A 2LRPA 3ST7A 1Q8QA 3S7IA 3LDRA 4Q1PA 1D0HA 2E53A 4HXCA 4I3GA 4QX0A 2PHXA 4HSJA 3H3ZA 5JWPA 4R4XA 4GA9A 4CCNA 1FNYA 2JE9A 3SC7X 3THCA 4YGCA 2W52A 1ULGA 3BU7A 5LK7B 3A22A 3VHPA 4A3ZA 1HN1A 1CAUA 2Y6KA 1KS4A 4CP1A 1GLHA 5KC6A 4XJUA 5FRAA 2UY9A 4JQRA 2QQVA 1ODMA 4PJYA 2VZ3A 2HJIA 4FCAA 1OLRA 4YG6A 5A3UA 2Z69A 5A7WA 3WQ7A 4B4QA 1FPN2 1W9FA 1DQ6A 1FPN1 1PO12 1PO11 2P17A 3KV5A 3M3CA 4PQQA 1AF9A 1AR62 1AR61 1MZ5A 2VMCA 3V56A 4B29A 1GBGA 2Y8KA 1EV13 2XG3A 1W6QA 2W2IA 4Q4V3 4LOTA 4BU2A 5FREA 5DABA 2A1XA 2DF7A 4FOWA 3BUCA 2QQWA 1HRI3 5LY2A 1R1ZA 3UYJA 2R6QA 4AK3A 4D0QA 2YGLA 1RUD3 1ZZ7A 1QY4A 3J8F3 5J96B 1C8M3 4QXHA 5FYVA 3NKTA 2ZAAA 3FE5A 3ME2A 2QVSB 1ACCA 4X6QB 3QLQA 3WINE 2A5ZA 2VUJA 1SLIA 4NO4A 1GZTA 3WW4A 2AC1A 3MI8A 5F2SA 2CHHA 2XONA 4FXGB 3M3IA 5GJ6A 3WNKA 5C4WC 3W9AA 3PDQA 1NCQA 2XL7A 3GXUA 4KU7A 4QX7A 1GSLA 1QXRA 1HIXA 2GN7A 4HOOA 2XJTA 1RUC2 1K45A 1EYBA 1RUC1 5EIYB 5K8SA 5FY9A 1XNKA 1L7QA 3WDXA 4V2VA 1BBT3 1W9TA 3BYWA 2A70A 3CJXA 4W6XA 5FYZA 3M70A 2XBO3 4QDSA 5C3QA 1XNBA 4P9IA 3LOBA 4YFZA 3KHCA 3GM8A 2DFBA 4CDXA 2A71A 3LWCA 1IS6A 2HEVF 3E6DA 1IOAA 4KWUA 1YQ2A 4CCMA 5LCWL 1OA3A 1LEDA 3G7DA 3LEKA 4YWAA 3OYWA 2PMWB 3D6EA 3OBTA 5EYXA 2FZ2A 1HB1A 2C5DA 1HLCA 3RZZA 5EHDA 4YW5A 1GP4A 2BDRA 4MGTA 2YDEA 1CJPA 3MIEA 3AKRA 3K77A 1Z7S3 4YW6A 5LBBA 5DAPA 4PF5A 3U0ZA 1WLWA 5H9PA 1IPJA 1Q8PA 3NRUA 1UKRA 3MPPG 1KXGA 3VLBB 4RS5B 4COUA 5G05L 2CTVA 4IE0A 3BGAA 4LEJA 4OQ9A 2FCTA 5SV8A 4LKDA 1GQGA 1DLCA 2DVFA 2DCZA 4WZCA 3LDBA 4IEYA 2RS32 4BQ5A 2B45X 2RS31 3GCXA 3I7DA 4LO7A 3OUHA 3ZSLA 4S2GA 5FMCA 5DAWA 3AL6A 1J1LA 5E16A 4OZOA 1F5FA 2IXCA 4B8EA 1WBFA 2WNVC 3B5LB 2ZAHA 3J4UH 4FPFA 4LOSA 2V4VA 5GLUA 1W0OA 5EQUA 1US3A 2VUDA 1DGWA 4A44A 3DPRA 5FZBA 3WP4A 3FLRA 3FC0A 3WLUA 5IVJA 3RZMA 1JZ7A 1NXD1 1WCDJ 4Y26A 3DN7A 1MQTC 4XVHA 4Z8BA 1BK1A 1AVBA 1BJQA 1ND3C 4GH4C 4YZ5A 3VBSB 4FSJA 4AI2A 3ZYPA 1YHFA 1AHSA 2IFRA 2V5YA 1ST8A 1W8FA 2YMZA 4XJZA 3VBUA 5M0TA 4J1XA 5FMDA 2VUCA 1V70A 3JD72 3OGJA 3JD71 5L9BA 3VBHA 1CAVA 3VBRB 4BLIA 1JZ8A 3U4XA 4NIAA 1QDCA 2VZSA 5FZ8A 2G9GA 5FY8A 4RN5A 4J6GA 4BQ3A 2J1VA 1IG0A 3E5QA 4D6SA 1AYM3 4C91A 5BNNC 4UF0B 5J3UA 3TOJA 3W58A 2CNAA 4DO0A 1QU0A 3B9IA 3GZTB 3AP7A 4QAWA 1OBNA 2G9ZA 2DYCA 5LWBA 3Q8CA 1JYTA 3ZXAC 5CFCA 3EO6A 3V65A 1S2EA 3NV3A 2BGOA 2W46A 2WL1A 3SXWA 2ARBA 4BLJA 4C8DA 5L73A 1ULPA 4HLTA 4LHLA 5DXDA 1COV3 3RNSA 1PGW2 1TMF2 3PJYA 1PGW1 3NJYA 1D2QA 4LBQD 4HONA 4IDZA 1IS5A 2ZACA 1ULCA 2WNUB 4P9JA 5LEKA 3VBFB 3BI3A 4QPIB 2ZGQA 3WUDA 2XB6C 3WNPA 3WG3A 5I0RA 1XJAA 2PHFA 3GF6A 2B8MA 4ISRA 3T3YA 5ACA3 5I0TA 3VD9A 2YBSA 5B4NA 4O61A 2PLV3 5JOXA 1C4RA 1QJFA 1RUI2 3C7GA 3U78A 3M3QA 4RA0A 3VHRA 5C3RA 3BOWA 2ZEXA 2PHLA 5FZEA 1O3RA 1NAEA 2XKPA 3A23A 4FO9A 5EXOA 3T09A 4PCRA 2BBVA 2YHJA 1GZWB 1VBB3 3C3VA 4QHZA 5LBEA 1EUUA 1CVNA 5CVRA 5FK8A 3WR0A 3ZFEC 1TNRA 3K4DA 5JXJA 3ZR5A 2RJKA 1Y7BA 2BFUS 3IDAA 3T0DA 2WA4A 2DCJA 3S57A 1VRH2 2VCMA 1VIWB 1VRH1 4TN7A 2KR2A 4XBLA 3SQOA 3HNYM 1SLAA 3O1TA 2E51A 2KD7A 1JZ2A 4FPLA 1MZ6A 1NOVA 1V6NA 3HQXA 4OUSA 5JSOA 2YC2A 4M3CA 1A6CA 1FT9A 4L99A 3KHBA 1O6UA 3F95A 1HQWA 3ROUA 4FPGA 1DIWA 1SBEA 5FPAA 2Y0OA 3I2KA 4JDNA 4WVMB 1JOBA 4Y22B 4YG3A 4AVBA 2JDZA 4KL1A 2O8OA 3P1IA 2B7YA 4P5HA 3W21A 4QX2A 5BUVA 1AZDA 4YVSB 2GALA 4XFHA 1YNAA 4TXWA 4CCJA 1U0AA 2P1BA 4FPCA 2WZR2 2NPIA 1D0GA 2WZR1 2QFEA 3UKNA 4GMP1 4CDUA 3H1MA 2QJVA 3C8XA 1UMHA 1OOPB 3P3PA 1GP5A 2W3JA 2QQMA 4HKLA 1QOOA 1PM7A 1NCRC 1EUTA 4I09A 2JD9A 4TTGA 1OD3A 2XVGA 3EMRA 1QWRA 2P4EA 1LHNA 1DG6A 1VE0A 2F6BA 1CAWA 3H8XA 3LGRA 3ZKUA 3AXEA 1DF0A 2WN2A 1Y9MA 2ENRA 1NA1C 4WBBA 2VW2A 5FFOC 1GOHA 1OA2A 1RMU2 4IEZA 1RMU1 5BNPA 3PVOA 3ZYBA 2Q5TA 3NJXA 5CADA 3IMNA 3I2HA 4XETA 1YJKA 4I2OA 4CP2A 1AR73 1VBA2 1FV3A 2RVAA 4UT5A 1UZYA 5DZGA 4YGBA 3WDYA 3N7LA 4HMZA 2D5HA 2EIGA 1LGNA 1B35A 3D82A 3D5OA 4P5YA 4XF4A 2RJLA 4HSLA 1W8WA 5J7MA 1NUKA 3AKQA 5HBAA 4UOJA 4FFFA 4MLOA 3WV6A 3QOPA 1IPSA 3CZUA 1UN1A 3POWA 3QACA 1JYWA 3WF1A 3ZFGC 3AYDA 4NPMA 1H8VA 4P9GA 2ZTNA 2IVJA 1CPMA 3USUB 4FQZA 5H9RA 4URTA 1LHUA 4Q4W2 4GWNA 5CFDA 4Q4W1 5FV3A 2YXSA 2V73A 2V5DA 1JTZX 3ZO0B 4CEYC 4ZKTB 1OFNA 3AP9A 4WV8A 1TZOA 5FKBA 1UAIA 2P34A 4CU8A 1W05A 4E9KA 5LA2A 5KHJA 1AR83 3RZKA 1DQ2A 2R16A 3T0AA 2DVAA 3P6BA 4IEQA 1GNZA 2D98A 1GZCA 3IIAA 5SV5A 3ACIA 3VL9A 1SCSA 1DU3D 2DBNA 1W8OA 5KBFA 1WMDA 1RXGA 5JSRA 5CEHA 2CL2A 2R043 4Y20B 2ZMKA 2EF6A 3N9QA 3OY8A 1EPWA 3ES4A 3PMEA 3ENRA 3VDBA 1MS3A 3WNXA 5AC92 1JYCA 5AC91 1ASJ2 1V6JA 1ASJ1 1FOD3 1UCXA 5A3MA 1LECA 2WR9A 3ZSEA 1V9U3 1KFUL 1DBNA 1PZ7A 1BQPA 5ABJC 3FZ3A 5I0UA 3BPZA 1MVQA 4BK4A 4KNCA 2HKXA 1KITA 3HOBA 1OPMA 2LTNA 2A73B 4Z2WA 1DDLA 2WSUA 5KXEA 1US2A 4FFIA 4AOCA 1R1A2 4ZONA 1R1A1 3Q8BA 4DQAA 3CDZB 4IUGA 3OD4A 5J48A 1QF3A 1W03A 1YC61 2YB7A 1YI9A 3MIHA 2VQTA 5GLZA 4UI9L 3WF0A 3ZOIA 1UXZA 4K21A 3WF4A 4YVWA 2FHRA 3OPWA 2BJSA 2JIGA 5JZGC 4ZZ5A 1UX6A 3OCPA 1J3PA 4GKYA 1OKQA 1XBFA 1OURA 3RZHA 3ZLIA 2WFPA 1HQNA 5C4WB 4R9CA 3LSEA 1R083 1DYKA 4B4PA 3WHTA 4N9IA 4KBBA 5EFUA 1UYZA 3JXSA 5IUQA 4CP0A 3WY6A 4AQ6A 3BTXA 3OGVA 3ZKYA 2PAKA 1UKGA 3N9NA 5A6ZA 3LSDA 2RDRA 5CIRA 3MZHA 2YGMA 2ZZJA 5BY5A 2ET1A 3P5BA 1IPKA 3OOXA 2BNNA 1AYN2 3EB7A 4JX0A 1AYN1 4MG2A 2CYFA 2R072 2R071 5HCBA 1LOEA 1UMIA 3HBZA 2EXIA 1QNWA 3ZYFA 2VMHA 3J7MA 1PIV2 3U11A 1PIV1 1QNYA 5HCHA 4MVTA 2PHUA 4MXWB 3I2JA 4QM8A 1F8VA 3IDCB 4TYSA 1XQNA 5FZMA 2VG9A 5DPNA 3SKVA 3MV01 1CGPA 3LAGA 4DINB 5A33B 4Y1UA 3V0BB 2J1AA 2J1RA 2QQOA 4NPLA 3SCHA 3DECA 1SCRA 3HN1A 3POGA 3ALQA 4ZXEA 4EE2A 4UXAA 5JDBA 4LPLA 4CA9A 3NSTA 1KEXA 1YIPA 4RR3A 1V6KA 2XOMA 3THPA 1J84A 1CIWA 2VNRA 2Y60A 5JUVA 1JZ3A 4Z07A 4OHXA 1GYKA 3SEPA 1RVF3 1NYWA 2Y6JA 4NHKA 1W9YA 1W3VA 4PI0A 5D8AC 1W0PA 4GKXA 2B9UA 3DKWA 3FHAA 1VALA 3L9JT 2WNVB 4RYDA 2Z4FA 5DQ0A 5JIAA 2W94A 1VB4A 3ZSMA 4Q4X2 4Q4X1 1F2NA 1OH4A 5FZ6A 2NZ9A 4PQ9A 5IAXA 1XRUA 5A3NA 1RITA 3AZXA 3MW3A 4IE4A 3HQRA 1V00A 4GJZA 4QPGC 4CDWC 3I59B 1ULEA 1I1EA 4I01A 3P3NA 1RUE2 3PVEA 2ZKLA 1RUE1 2XQRA 4ES9A 3AMNA 5FYBA 1W6OB 4A3XA 4BA6A 3AK0A 5A6YA 3ACLA 1RYYA 1QH7A 4GH4B 2JG8A 4Y1ZA 1WGPA 3JZVA 2P2KA 1LULA 4CEWC 3IDBB 4AEDC 5FAXA 5IYYA 3OJBA 3N35A 1EP0A 2EAKA 1LHOA 1XPWA 2ARXA 2R30A 4NWWA 4UFLA 2NMNA 3CJIC 5C3SA 1BCXA 3BOPA 4QM9A 1UIKA 2ZXQA 3BCWA 2QZ2A 4JGYC 5BNNB 1W28A 3O1MA 2X29A 2SBAA 4LUMA 4KWKA 4XFGA 5JMOA 1CJDA 1FX5A 1S2KA 3FLTA 4N43A 5BNOC 2GP3A 1ULDA 1WW6A 2H0BA 4Q2FA 5FZ4A 2WKKA 1SPPA 1SFYA 3ES1A 1MPXA 3M7AA 1MR5A 2A3WA 4XXAA 3VBRA 3CHXA 1SG3A 3T1MA 5IK8A 3E1F1 1VMHA 4UF0A 1UOFA 3VBOC 4KG0A 5FP4A 2R49A 5JI9A 3AMMA 1PK6C 4QKFA 4AHWA 2CSGA 3O0VA 1QJEA 3AKSA 5FZDA 1BVVA 1I3HA 2D7FA 4RQPB 3U14A 4D6RA 2YBPA 3SH4A 3M2MA 2WLPA 5DDJ2 1JU3A 5DDJ1 2AGSA 4MH0E 2WQ8A 3AYEA 4HZFA 4RFT0 1SLCA 3AC0A 5FZ1A 3WCRA 2EXKA 2VVFA 2ZMLA 2Z42A 5IJRA 2OYZA 4P9YA 1OUSA 3VHOA 2JE7A 3WD5A 3DCQA 5EPAA 2Q4SA 2WNUA 5A6QA 3RZJA 2DUOA 2E7AA 3VBFA 4QKDA 5FZHA 2JDYA 4FOVA 5FZAA 2DFCA 1ENRA 4IE7A 2RS52 4TSVA 2RS51 2E6VA 2F4PA 4QX5A 3QBQA 1EAH2 1UU6A 4H55A 1EAH1 5HI0A 2D93A 4A45A 2GC1A 1OHFA 3RJRA 1LU1A 2W0XA 2VY0A 4DXZA 2VZRA 4L0PA 5F9TA 3JQWA 1HX6A 2D6OX 2B46X 2WS92 2WS91 4N53B 1PO23 3HWJA 3LA7A 1PNGA 3FLPA 3ILNA 1H8TC 4FXKB 1GWLA 1UX7A 4UW6A 5FLIA 4CSWA 1PVXA 3DYPA 3WSOA 2ZGSA 4LE3A 4JHTA 4XDPA 2PA7A 1JHNA 3VDCA 2CAUA 2OIIA 1ZVFA 1VAVA 3LA3A 3ZDVA 5AVAA 4D7YA 4D7TA 5E88A 5A3TA 2W9XA 4L97A 5JXIA 3ZXGA 4LBLA 4RHV2 4RHV1 2J1EA 2YU2A 3WF2A 4EN8B 3ZPOA 1LGBA 2P6CA 1OF3A 2WQ4A 2HWC3 3JU9A 3U10A 3VHNA 4QXKA 3MIFA 2JG9B 1M06G 2XR4A 2AUYA 3LFMA 4E2SA 3ZYJB 2RMU3 4BMBA 2ZZQA 4FPHA 3TYJA 1ZZ6A 1NCRB 3ATGA 4Y22A 5IFTA 2XLFA 3HIFA 3V64A 4B1LA 4EZ4A 4HVRA 1OH3A 2WJSA 1WWYA 1OXCA 3FFQA 4JC1A 1PVC2 4YVSA 5B4XA 1PVC1 5KWRA 4OHWA 1AL0G 1NA1B 1ZYBA 2RR13 3H1YA 5ERLA 3KQ4B 1RUF3 2VQAA 5AFBA 1UXXX 4CUGA 3ORJA 2D43A 1Z78A 2X53S 1QJY3 2W08A 5BXXA 4QMAA 1OOPA 1O3QA 4CCLA 1OD5A 4I30A 1A3KA 4NJ4A 4Q4Y2 3EQEA 5KHKA 4Q4Y1 1DYOA 4OYUA 1ND2C 4I0WB 2DVGA 2XJRA 4Q0UA 3ZN5A 4UFIA 1TQ5A 1FI2A 4MXVA 4CDQC 1ZA7A 4S2HA 2BNOA 2XPJA 4LR4A 3VDDA 3SKJE 1JODA 1CPNA 2X5IC 3MF6A 4WZFA 5GZCA 2W1UA 1NLSA 1RUG3 2K0GA 4MO3M 1NX9A 1GQHA 3TNQA 1YWKA 4W8JA 3ZXFA 5A3LA 5FZ9A 1YEWA 2W95A 4JDMA 1WMFA 2ZBJA 1QJU3 4FOYA 1I5PA 2XKOA 4IE5A 4CUBA 4R4ZA 5FZLA 4EV0A 2J1SA 4P9WA 2D44A 1SHWB 4W65A 3SCGA 4NRQA 1Z0HA 5F37A 1GKBA 1ZX5A 2J42A 1LESA 4CEYB 3N9MA 5C70A 4AG4A 3AMQA 4HBNA 5I8TA 2RDQA 1AX1A 3AZYA 3ELNA 4ITCA 2F4LA 1LKNA 1RUH3 1JN2P 5LATA 1UYXA 4XXPA 1F5JA 4YZ1A 2IXJA 3KCYA 3MIDA 5LBCA 3TB0A 3VD3A 4AVCA 2W5FA 1LOFC 1HXS3 2GNDA 4H7LA 1EV12 5CB7A 1EV11 1OLQA 3AX4A 4Q4V2 2VOWA 3H3UA 1SBDA 4Q4V1 4MGKE 3UGFA 2BYVE 1X9PA 3J26N 2NMOA 3USUA 4OQ8A 4GWJA 3ZXLA 3B93A 1REFA 2NLRA 4GWMA 1HRI2 4ZY9A 4XUPA 1HRI1 4OVEA 4YGDA 4BK5A 4CCCA 5JPNB 3CKHA 2PN5A 2XLAA 4I0AA 3I49A 1RUD2 3CQOA 1RUD1 2FDIA 3J8F2 4O7XA 3J8F1 2GMPA 4XBNA 2D6LX 1C8M2 4XMAA 5CG9A 1C8M1 4GB33 3UV9A 1U5XA 4DB5A 1TME3 1CAXB 2E7QA 1ZZ8A 1QH6A 5GALA 1DGRN 1XC6A 1N1TA 2QDNA 2KM2A 3OPZA 4NRMA 4WVZA 4Q1RA 5K4LA 4A42A 1BMV1 5ABJB 5D1IA 5T54A 2CAVA 3OUIA 2R0FA 2PELA 3C7EA 5IW0A 4OI2A 4Y20A 1JZ6A 4ORFA 4J1WA 1N3QA 1YRZA 3VZJA 1W8TA 4ZPIA 3CO2A 4BCUA 2NP0A 1RB8G 4RFRB 1HRV2 4PLOA 2XJPA 1HRV1 1YQ5A 4Y3OA 4A7ZA 2OT7A 5EJ3A 2QQLA 4YGEA 4XJ8A 4Q0QA 4G4FA 1AJOA 2FDHA 3KV4A 2TEPA 1W2TA 2UWAA 1FV2A 4NHYA 3WF3A 4QDQA 4FPKA 4LORA 1WBLA 3DYOA 4OUMA 3KCCA 4IEPA 1UU5A 1WA6X 3I2FA 4QHBA 4N90A 1WZXA 4QX8A 2VZOA 4HN0A 5T5OA 4BYYA 4Y4YA 5JZGB 3O1UA 1UW8A 4BIOA 2IFWA 2YUEA 1LCLA 3EXUA 5C3OA 1GP6A 4LMFA 5KHIA 2ZOEB 4XZPA 3B01A 2VE1A 2VTXA 3MYXA 2HWF3 3OBAA 2F17A 2HWE3 4QB6A 1YIFA 2YYOA 3GJAA 3LF7A 3GNEA 3UETA 3U37A 4F3JA 3H42B 5FY0A 5F1RA 1Q43A 2B5HA 5FYMA 2XUMA 4PDWB 5A7QA 3MIGA 4E2QA 3GHNA 4SBVA 4KQ7A 2BWAA 3HMYA 1UY4A 4LO4B 1C5IA 2DU1A 3ZXKA 3OG2A 5FLHA 3T0BA 3OSDA 4E27A 3K3OA 5I0DA 4FPEA 4ASKA 2IXHA 4XCAA 5C4WA 1OPOA 3ILRA 1QGLA 2VZVA 4YM3A 5FIXA 1BEV3 5FZKA 1S0FA 3HEIA 1LB2A 1SLTA 5JOZA 3WZ1A 1FYUA 4IV3C 3R6SA 2C9KA 5FPBA 1G86A 5JR7B 1UOGA 2MEV3 2X05A 2P3YA 4YM0A 3CF6E 2VQ0A 4GJYA 4LIUA 1QIQA 1WA4A 3I54A 1C1LA 3HAGA 3OEAA 2ZGMA 4FAGA 1T6GC 1XOYA 3HT1A 4HT1T 1KQRA 5T3NA 4CRQA 1XXNA 3ON7A 2UU8A 2JB4A 4PLMA 2Z5WA 3ASIA 3NKGA 2JDPA 4GAZA 3T08A 3CMGA 2XJUA 1HB4A 1UNBA 5FYTA 1POV0 4G3YC 3ZN6A 3FMGA 5D8AB 5A33A 3V0BA 4YZ4A 2GNMA 2ZX1A 1X36A 2BERA 3B00A 4BXFA 4N7UA 2P3IA 5EJZB 1LTEA 1Q8VA 3DPRC 4NAOA 2A3YA 4K3UA 1AYM2 1IKQA 4P14A 1AYM1 2Y26A 1D4M3 1SFNA 4K8RB 3ZFFB 5IATA 4UFKA 3JBG3 4QPGB 4LXLA 4CDWB 2GN3A 1GMMA 4FBFA 1ZRDA 2CWSA 1NZIA 2AENA 5FP7A 5A7NA 3EYPA 5ANNA 2AR6A 2JDUA 4ET7A 2ZHKA 3WNOA 3APBA 2ZPXA 2WNVA 4ATFA 1UYPA 1VBD3 4ZS2A 3RG0A 3VBUC 4CEWB 4AEDB 4O9EA 3VBHC 1COV2 3ZN4A 1COV1 4D8MA 4MADA 4UBGA 3I2GA 2E9QA 2VO5A 3IPVB 2GSYA 1W0NA 4CUCA 5GZGA 4H3WA 5IK4A 3I59A 3JB8A 1LNSA 3CJIB 5IVBA 1JBCA 2OZJA 3CZJA 4QPWA 5CZKA 3GBFA 5KR7A 4JGYB 3WUCA 4LULA 4UW3A 1FMD3 4AL9A 5C9AA 3NNGA 4GH4A 5CA6A 1F4HA 5ACA2 5BNOB 5ACA1 4XCBA 2VGDA 2OVUA 5CFCC 4QKBA 3AP4A 2PLV2 4YM2A 3ZDSA 2PLV1 1AX0A 5FTTC 5C6CA 3VKNA 1WD4A 3ZYIB 2CGPA 3NNFA 1W39A 3GBWA 3FN9A 4NROA 2XXZA 4E4ZA 4Q26A 4LK7A 2ID4A 2Q8DA 1KGYA 3LEIA 1VBB2 1W8ZA 1XYOA 1VBB1 2HWD2 4QWNA 1YJLA 2HWD1 3VBOB 4AAXA 1M4WA 1W90A 5BNNA 2DURA 1MS5A 4QQ2A 5C8CA 1PK6B 4YZ2A 2C9AA 4KGGA 3RZLA 4O65A 4XDQA 2XWJB 1N1YA 2EIBA 2C1FA 2PAEA 4UFJA 1A78A 1LODA 2ZA9A 5K0UB 1B09A 4AI0A 1HJGA 3I3BA 4AQ2A 1K42A 1DCSA 3GYDA 1QKQA 4IEOA 4MGIE 3UJQA 3L2HA 4DEQA 1QOSA 5JI7A 3IN9A 4FTSA 4BIFA 2LM3A 2XGXA 4V2WA 3N4MA 3S5QA 1W6MB 2PHRA 4H7MA 5J37A 1XSRA 2BV4A 4IETA 2TNFA 3D3AA 2Q8EA 2MHFA 4WM7A 4RQPA 1MZFA 2YG0A 3D0SA 5FZ3A 1QJZA 1C28A 1TVGA 1IG3A 1O5LA 4UBHA 1RJ8A 1RUJ3 3N3HA 4QQLA 5FZ0A 4AAPA 5DUVA 4BE3A 4E8DA 4B7KA 5F32A 4A4AA 3NAPB 3FJSA 3AP6A 4YRDA 4HG6B 4K6BA 5FKCA 1DQ5A 4JQTA 3B3QE 3RRDA 1MACA 3KT1A 4N7IA
chains in the Genus database with same CATH topology
2WLQA 1LR5A 2VECA 4OULA 4QQPA 1H8TB 1DZQA 1HQLA 1TMF3 1KD7A 1Y9QA 1L3JA 3B9CA 1AXZA 4Z1VA 2GNTA 4FQ4A 5BYNA 1JYIA 2H0VA 4Y1VA 2ZJCA 3IDEA 1CESA 4CDUC 3SH5A 4HETA 4N53A 2C0ZA 3JB4C 1JW6A 2XJSA 4IV1C 1RUI3 4AFCA 4XQ4A 3NVCA 3I2DA 1FXZA 2ZGLA 4YW1A 2BW8A 3CLPA 3DL3A 3OBRA 4AVVA 2Z79A 2EA7A 3IT8A 3BTAA 4AQSA 5JCTA 2ETEA 4XF9A 3R4SA 1X8MA 2Q8OA 2JG9A 4EROA 2YZ4A 2IXIA 1IHMA 3KGLA 2WA3A 4LBJA 5JMCA 3VUOA 1ND2B 2ZGUA 2Q0AA 4LBKA 1OQ1A 1WW5A 2BQPA 4AFAA 2ILMA 2MNGA 1H2KA 2UYBA 1AXKA 1AR82 4X8PA 1AR81 1NA1A 4JAAA 2XWBB 2X5IB 1DQ0A 4YYOA 2R063 2D6KA 5T5LA 4L9BA 1N1SA 1S0DA 2RM23 1KDMA 3TN92 2BVBA 4HL0A 3TN91 5JPMB 1BVP1 1UZZA 4UW5A 3RPQA 2R042 3MF9A 2R041 4XHXA 4OZXA 3URFA 3PHMA 2D3SA 4BMEA 4PBOA 2CWMA 3T2TA 4QT6A 4WM8A 1FOD2 3KT7A 1FOD1 2KA3A 3AFGA 1WW4A 3HT2A 1V9U2 1VAMA 1V9U1 1SBFA 4LA2A 1PGL2 1PGL1 1IKPA 4C0BA 1RUNA 2MPFA 1K5MC 4FPJA 3NV4A 1PZ8A 4K8FA 2R1BA 4QGNA 1CX4A 2W39A 2ZHMA 3DGTA 4XFFA 1VBA3 3SCFA 4NPRA 3GZUC 1RHI2 1RHI1 4R8HA 1CD3G 2ZGTA 5J09A 5GLVA 3R05A 1AR93 5DUXA 3AZVA 4LUKA 1WD3A 3WX5A 4C0HA 4NHLA 1R082 1W6QB 4XBQA 1R081 3TBDA 1ZRCA 1PGSA 5I0SA 4YM1A 3MW2A 2BWCA 3AM2A 1GFF2 3WHUA 2WT0A 1CAXA 2ZHLA 3PVBB 4MX3A 1GICA 1Q5OA 4Y1YA 2JEMA 3RMYA 4META 3Q9OA 1WLCA 4YVWC 4A7YA 4GALA 4DFSA 1X8EA 2RS13 1W6PB 4EJRA 1LOCA 1N3OA 3WW3A 5C8WA 2ZCWA 3T1LA 1ENXA 3WT3A 5B2GB 4DZGA 4HVOA 5DUWA 2I45A 3TNPB 1QXJA 5AFEA 3QCWA 4AEJA 3WQ0A 2ZX0A 2TUNA 3VZOA 4K7JA 4I0BA 1VBE3 5AC93 5GM0A 2ZKNA 1PHMA 2A6YA 1SLLA 3ZIWA 3K51A 3WW1A 5KHHA 3KM5A 2PFWA 2ZX4A 1H9WA 1JOJA 3RI9A 3LA2A 3SITA 3ZXJA 1RVF2 3B94A 1RVF1 4INDA 3D0JA 1LGCA 4AFMA 5K9YA 4IV3B 1VR3A 5C33A 3ZSJA 4YW4A 1RIRA 4PDWA 3WOGA 1U5ZA 2YC0A 2DUQA 1C5HA 3UK9A 1E57A 1IS4A 2BFUL 3B02A 5FMOS 1OQDA 5CG8A 1NE6A 4YZ3A 1ZRRA 2G9FA 2PHDA 1C1FA 4RD7A 3H9AA 2GAUA 4QGMA 4M01A 4RR3C 1QHDA 3PNAA 1S1AA 3WG1A 1VJ2A 3MICA 2GZWA 2XHKA 5DUUA 2QUOA 4CZSA 4B7EA 1G8WA 4XW3A 4RS5A 3DPRB 2BEOA 4Q8LA 4XQWA 4IEWA 4FPOB 4QQHA 2WZPP 4EWAA 5CBLA 1REDA 2WT2A 3DF0A 4OFGA 4XFIA 5J98B 1MQTB 2QKDA 3ILFA 1H2MA 3RMXA 3QH7A 3ZXEA 2D6PA 1ND3B 3INAA 3OD0A 2ZMNA 5D8AA 4YFWA 3WW2A 1ZZ9A 2BNMA 2D3PA 2JG8C 3WVJA 4LO5B 1X7NA 2ERFA 5H9QA 1AL23 3KSCA 3VBHB 3RYKA 3LOIA 3WQ1A 1CAVB 3ZFFA 5IT6A 5FO9B 4IQPA 4P9XA 1POV3 5L7OC 4QPGA 4L92A 4CDWA 4RGGA 3V0AB 1MEC3 4AVTA 1J1TA 4AFDA 1BZWA 2GU9A 3KS7A 3RSJA 1PNFA 5FQ0B 5GKAC 3ZMNA 4LE4A 3VBSA 4AE2A 2QNKA 1H4HA 3VZMA 2R1DA 4N43C 1IS3A 1ZM1A 4BOWA 4D69A 5CFCB 2O0OA 4XTMA 4AEDA 1JUIA 2AZ5A 1QOTA 1KJLA 1UU4A 5BPXA 4AW7A 3IPVA 3UKTA 1SLBA 3CJIA 1SQ4A 1DYPA 1IQAA 1URXA 4JGYA 3A0NA 3KCXA 1ZZBA 4X6RB 5I8YA 3S6PA 4SLIA 3VZNA 5BNOA 3G6JB 2WFF2 2WFF1 1S0CA 4LO8A 3WDVA 3AXDA 3VZKA 1SACA 1PO22 1UPSA 1PO21 2NM1A 1QDOA 3HR9A 1QQP2 1ZBE2 1QQP1 1XYPA 1ZBE1 4FOQA 3VBOA 4U36A 1XE8A 3E97A 5BV6A 2I07B 1UPIA 1S0EA 2WNUC 4PIZA 4QPIA 3ZFEB 3NWKA 1O3TA 4FP3A 2NN8A 5K0UA 3KB5A 1ENQA 1XNCA 1AXYA 1ZZCA 2HWC2 5H9SA 2HWC1 4I3PA 1HV0A 2RMU2 2RMU1 3AMHA 2XVLA 4FP2A 1GNHA 4IEVA 2WSVA 1W6MA 4TWTA 3R0RA 5EYYA 3WG2A 1IZ3A 2HWB3 1GZWA 4HFSA 3E6BA 4XFCA 1ZBA3 4IL7A 4BE3A 4AHXA 2GC2A 1C57A 4PIYA 3FUQA 2RR12 1DGWX 2RR11 1RUF2 1RUF1 1R093 3ZPYA 1QJY2 1QJY1 4DY3A 4Q8KA 1NQJA 2DCYA 3NAPA 1YYNA 4W6WA 1O3SA 2Z2SB 1S0BA 1RJ7A 3KQRA 2QE3A 4LO6B 1MS4A 2VU9A 2XVKA 3SHRA 4IV1B 1H8TA 4GQ7A 3ZYRA 3O12A 1EPZA 4WVMA 3AYAA 4KWJA 1MS1A 4GMP0 1DZRA 4Y5Z0 1RUG2 1QJX3 1RUG1 5DG2A 5JAXA 1LHWA 1H9PA 5E1RA 1H1IA 2UYAA 4L11A 1XU2A 2ZABA 5FLJA 4F83A 2GH8A 3MLLA 1O5UA 1H1MA 4KG8A 4S2DA 2W68A 3IWZA 3VDDC 1GR3A 3BALA 1RUH2 4C1WA 1XU1A 1RUH1 3HD8B 3SNMA 1HXS2 1NXMA 2A3XA 1HXS1 3ZYGA 3RWNA 1ALYA 1V6IA 1W2UA 3ZFGB 5IK5A 3KT4A 4PBPA 1JH5A 4M0NA 2EAAA 5I8SA 5T5PA 1CONA 1N47A 4EN0A 1ZA4A 2LALA 4NVPA 4YG0A 4HPKB 5F6KA 1G7YA 3MLJA 3M3OA 1H1AA 4GB32 4GB31 2D40A 4LT5A 2X5IA 4LBOA 1TME2 2XJQA 1TME1 4JGZC 3AB0A 4DRRA 5E8AA 3PJQA 3WP5A 4EWEA 1WLTA 5DZFA 1K5MB 5JLVA 4XJAA 3VN4A 1HKDA 4XJWA 2ZX3A 4OHVA 1WW7A 2NYYA 3FFZA 1J3QA 4AWDA 3R4UA 3K48A 2Y0IA 3MPBA 4DNYA 1ENSA 3C2UA 3OY8B 1JXNA 2D3RA 4Y1XA 1Q56A 4AGVA 3VKLA 2VH9A 2A6WA 4ES8A 1BYHA 5CNAA 3LKJA 1PMIA 1AX2A 1LOFA 3M1HA 3EBRA 2OPKA 1BMV2 1PZ9A 4HK8A 4JRLA 1O4ZA 2E7TA 4IESA 1VBC3 2BTVC 1BXHA 2GC0A 1S2BA 4KWLA 3GALA 1AJKA 4HANA 5L36A 2V09A 5T5JA 4TZDA 2HWF2 4Q29A 2HWF1 2HWE2 4HVQA 2HWE1 5KC5A 5A32B 1BBT2 4U2AA 1BBT1 3D4KA 5T55A 2O8QA 2VNGA 2XBO2 2CGOA 2PTMA 2XBO1 4LTAA 4M0HA 2H6BA 4AGGA 3H1WA 4RSUA 4YVWB 3D8CA 3I4IA 5GZFA 4K1ZA 1YFYA 1BEV2 1BEV1 3FBYA 1D2SA 3FHIB 4ZU4A 1OFSA 1NCQC 3POYA 2JICA 3THTA 4BM8A 1WLDA 1Z7S2 4PLNA 1Z7S1 2MEV2 3R4DB 2A6XA 2MEV1 4R9DA 1O91A 4YNIA 3RDIA 1LEMA 1DGRA 1MZEA 2Y38A 4Q0VA 1FPN3 4XF1A 1PO13 1REEA 1W6PA 1AR63 4Z82A 4CDXC 1OA4A 4I02A 1DLLA 1Q8SA 1RGSA 1HRV3 4ISQA 1LJ7A 3VZLA 3S7EA 1LHVA 3RQ0A 3VGIA 1J3RA 4AQTA 1D4M2 3BODA 1D4M1 1ULFA 1DFQA 3JBG2 3JBG1 1V6OA 2D5FA 3GHMA 1CN1A 1ZREA 4RR3B 4KU8A 4KGQA 4MXWA 4IV3A 3NV1A 4QPYA 4RGAA 2VUAA 5FCCA 4BQ1A 5K7PA 1VBD2 1VBD1 4P9LA 2K9ZA 1I9RA 1RUC3 3POSA 1H2NA 2DVDA 2XJVA 3VV1A 2GC3A 3KMHA 1FATA 3MW4A 1FMD2 1NG0A 1FMD1 4XOGA 5FOJB 5KXBA 4Q27A 4AEMA 2OW4A 3WP6A 4B3NA 2DWRA 5JOYA 1TNFA 1ZRFA 2I74A 5FDBA 3X29B 1DQ4A 2JG8B 3VKOA 4GULA 3PLQA 4LLFA 4MSVA 4JRAA 1D4VB 1MVEA 2YROA 3WDWA 4K40A 1DGLA 4C1XA 5L7OB 4M3CE 1MQTA 4AI3A 1W6OA 5DZEA 3H0OA 4AGRA 5C9AC 1JUHA 1ND3A 1V6LA 4AVAA 5BNQA 2VVEA 2RS33 4N43B 3DUIA 2HYKA 2HEWF 3UKVA 2FQPA 5JVVA 1UIJA 2D97A 3WCSA 3OTFA 3V0AA 5FQ0A 4ATEA 5C8CC 2HEYF 1X82A 2ZGRA 1RUJ2 2WNEA 4UW4A 1RUJ1 2B39A 4CTEA 1CQ9A 3NV2A 3FUOA 2IZWA 4IEXA 5CAZA 4BH9A 4JTNA 4QD2A 3JD73 1H30A 2DCTA 1MS9A 1TMF1 1HW5A 1LENA 3MIBA 4AFBA 4EWDA 2JD4A 4XJ9A 4WM7C 4DOUA 2EALA 4RQPC 1VB2A 4LLOA 1QXPA 1O4YA 3JQXA 1VLNA 3AJYA 3BIWE 5EWSA 1RUI1 4AF9A 4NWVA 1UMZA 4F7ZA 1I5ZA 4EN6B 2FBEA 5DG1A 1SDWA 3ZFEA 1W6NB 2HWD3 2WQZC 4LHKA 3DV8A 3J9SA 4HKWA 3O7OA 4Y24A 2IXLA 1ONAA 2VNOA 5J36A 4JCKA 5E89A 4G9SB 4XQDA 1AR72 4FVVA 4YW2A 1AR71 4H14A 4KH9A 1MS8A 4O9GA 2ZGPA 4PIXA 1X50A 4N53C 1LU2A 3MGUA 4DMIA 1XYNA 4Z92B 1A8DA 1G9AA 1RTVA 2JJ6A 4Q0SA 3AJZA 4D3WA 1VP6A 1NZCA 1OQEA 4XIOA 4NHMA 2R062 4LHNA 2R061 5TSWA 4YARA 2VMGA 3RS6A 2QCSB 5BNPC 2RM22 3FWEA 2RM21 2UURA 4FPYA 4LBQB 1VRH3 4QU2A 3WDTA 2CV6A 4IERA 2JG9C 4XMIA 4MYEA 1EY2A 1C3HA 4XYXA 4IV1A 1HDKA 1NCRA 4OLLA 4FTBA 4CDQB 3H50A 5HCAA 1B35C 1RUOA 5GZDA 3GBGA 4QQOA 3RI8A 1HV1A 3VDDB 3ZIXA 4COWA 2BGCA 1RINA 4ASLA 1G6NA 1N3PA 3AKTA 3W59A 3I8TA 1Q8OA 2ES3A 3WP3A 1QMJA 3WXPA 3LB9A 2WZR3 3SISA 4GMP3 5T50A 2I2SA 1VBA1 2N7GA 3NO8A 5CFDC 2PQQA 4TLFA 2KXLA 2P37A 5KHGA 4R9BA 4WM8C 1NE4A 1NY72 3VKFC 1NY71 1S0JA 5LEJA 4B4RA 4JGZB 1H0BA 1LRHA 3NJZA 3AZZA 1RMU3 1AR92 1AR91 3ZFGA 2ZHNA 1UL9A 2R0HA 3QD6A 1KDKA 2BVVA 2ZGNA 1YO8A 4AEKA 2WIIB 2VOKA 5FOBB 5LRSA 4HPKA 4CEYA 2VMIA 3CEWA 4E4SA 1GZ9A 1CAUB 2B42B 2IWGB 2LUWA 3CNAA 2UWCA 4BPZA 1K5MA 4HN1A 1TEIA 4E4DX 1F31A 2RS12 3E5XA 1U5IA 2RS11 2H6CA 3KLSA 3TN93 4AI8A 4ZXKA 3JUUA 4XIKA 3RJ2X 3S0MA 3FBMA 4Q4W3 5F6LB 3KD4A 4LNVA 4MV2A 3A0KA 2OUHA 1VBE2 1VBE1 2JX9A 1Y43B 1YLLA 4L8QA 3AKPA 5JOWA 1IGOA 3AP5A 4ASMB 3N7MA 3CU7A 5ABJA 3WG4A 2A6ZA 3M3EA 3A4UA 4MGZE 3TWIA 4W6YA 3H7YA 5LRRA 1VAKA 3N36A 3VL8A 4L2NA 1WCSA 1NCQB 2ATFA 4GIQA 2PHWA 1RL3A 5A32A 3SLIA 1J58A 3B7MA 4NOTA 1S55A 2OUJA 1ASJ3 4IEUA 1RHI3 3EHKA 3TRSB 4YW3A 5JZGA 3M4FA 1I6XA 2A6VA 5JIUA 1YI7A 3PTYA 4V1PA 2GH2A 1TE1B 4CDXB 1YFWA 2WINB 1CR7A 1YCIA 3OYWB 3ZVXA 1KS5A 5KXDA 1R1A3 4HK9A 4K9SA 1G9FA 4PDWC 1LOBA 2VXRA 4COYA 5HCFA 1G9CA 3MLKA 2Q1MA 2EXHA 1GANA 5IK7A 3H7JA 1WUVA 5L19A 3WDUA 3ZN6B 4OHZA 1AL22 4FAHA 1AL21 1APNA 4DY5A 2DTWA 1GV9A 2DTYA 3N7KA 5CU1A 5FBZA 3VKMA 3H8UA 2QDRA 1POV1 4RS5C 4JV4A 2YPJA 1MEC2 3NW4A 5EV7A 1MEC1 2IXKA 1S0GA 3TAYA 2VOXA 1AYN3 2R073 3SMHA 1WCKA 2NQYA 2ZX2A 4LBMA