4CP2A

Crystal structure of epithelial adhesin 9 a domain (epa9a) from candida glabrata in complex with galb1-4glcnac
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
249
structure length
219
Chain Sequence
b'HYPRPEGCSSPPNAVSVGLHMDLYNYPYLYVKGQCWNPEYQDPNFPRYGYKKYGSFGSSDHVNGKISWDHNEFKEGCKPIMARLPTAYNYPAKITFSNFTMVLSGYFKPKSTGLYKFEIHADDFILFNFGSKNAFECCNREESIDNFGPYVAYAMWPNEADQELEVYLFEDSYYPIRLFYNNRDYHSKFMVGFYPPNTEEITYDFDGYLYMLDDTGNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPITHELIAL ADHESIN 9
publication title The Structure and Function of the Epithelial Adhesins
rcsb
source organism Candida glabrata
molecule tags Cell adhesion
total genus 59
structure length 219
sequence length 249
ec nomenclature
pdb deposition date 2014-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10528 GLEYA GLEYA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4cp2A00
4COWA 4AI3A 4LHLA 4AFBA 4LHNA 4COVA 4CP1A 4AF9A 4ASLA 4AI1A 4AHYA 4LHKA 4COYA 4AHZA 4AI0A 4A3XA 4COZA 4AHWA 2XJSA 4AHXA 4COUA 2XJUA 4CP0A 4D3WA 5A3LA 2XJRA 4AFCA 4AFAA 2XJVA 2XJPA 5A3MA 2XJQA 4AI2A 2XJTA 4GQ7A 4CP2A
chains in the Genus database with same CATH superfamily
5LA1A 3WW4A 5BV6A 2PFWA 4BK5A 5F5AA 1JTZX 3ZN5A 2VVFA 1RUD1 3MF9A 1NT0A 4PCRA 4F83A 5FP3A 3WNKA 1VBC1 2WYFA 3CF6E 1W2TA 3T08A 4CE8A 5HXMA 4MG2A 3QH6A 1XJAA 4DS0A 5FXVA 4QPGC 1JYWA 1MPXA 1RUG2 2ZHKA 3BPZA 3UKTA 2WZR2 1CJDA 1ZBA1 4FP3A 4IEYA 1WZXA 5CFDC 3JZVA 5CIRA 2PHUA 4XVHA 1QJZA 3VDDA 2VMGA 4HKLA 3A4UA 5FZIA 4NOTA 4B4RA 1NLSA 1DQ2A 2DF7A 3MFCA 4QKNA 2PHLA 1G9FA 1LGCA 4R9AA 4KU7A 4W6XA 1OQEA 2W5FA 2FHRA 5FBZA 1W0NA 1LR5A 3U0ZA 1H6XA 2JJ6A 4QD2A 1LOAA 5FYSA 2OPWA 2ZEZA 4ZS2A 3P6BA 1OOPC 4ZU5A 5KHIA 2JB8A 5GM0A 2PMWB 5FZ4A 1OA4A 1HIXA 1W04A 2RM23 3UL2A 5C3OA 3T09A 4NROA 2I45A 4QQOA 5FKCA 1DZRA 3OB8A 4UF0A 3ZYBA 4CDUB 2WWUA 4DQAA 3AFGA 2GC2A 3KGZA 1RJ7A 1U0AA 3H42B 4XAAA 1GR3A 4I30A 1JI6A 2AUYA 3EB7A 1EAH2 1VBE1 3GNEA 5FAXA 5FZAA 3B3QE 5IWFA 2DUPA 2DUQA 3VUOA 1UZZA 1W99A 1PIV2 1GKBA 5E8AA 1UO9A 2VCMA 2BNMA 2WIIB 1C8NA 1RUC3 5KHJA 4YM1A 2XL7A 4IESA 2BWAA 3UJQA 1OQDA 3OUIA 1CPNA 2CAUA 5F5QA 1CN1A 1PX3A 3R0RA 4BDVB 3FBYA 3EBRA 2W95A 4XC9A 4LKSA 4CXYA 5DAQA 4XUPA 2WUHA 3TOJA 3MO4A 3KV5A 3I7DA 1O3SA 3J8F1 2XUEA 4ORFA 2NLRA 5J48A 2UYAA 2HWE1 2XVKA 2B39A 2D44A 1HQNA 4ZS3A 4DEVA 2JG9C 1H9WA 2F17A 3PMSA 4IV1B 3M2MA 4K1ZA 3ZYPA 2ARAA 2YU1A 4LBMA 5A33B 1K5MC 3P5BA 1CPMA 1CWPA 1GP5A 4XACA 1QJY1 1NLRA 1P8JA 1R093 2C0ZA 1NA1A 3T30A 2Q8OA 4IGOA 3ZXJA 3DCQA 4KG8A 3ZFFA 1AXKA 4N9HA 2B42B 2HH9A 1O3QA 1Q3EA 4Q0UA 1JMUB 5LWBA 1YIPA 4DY3A 3WHTA 2DVFA 3GGLA 4BYYA 4ATFA 4CCEA 2D3PA 2ARCA 4AI2A 2WJSA 2FDHA 1G6NA 2BTVC 3CEWA 4QU1A 2B9VA 5HCHA 3GHNA 3VKFC 5C6CA 4M01A 4HLTA 1DCSA 4TTGA 4CZSA 5BPXA 4RHV2 3N9OA 3WW2A 1JOBA 3KWVA 1ENXA 2WFPA 5H9RA 2DURA 4Q4V3 1SBDA 3H50A 1UWWA 1M4WA 4AHWA 3S0MA 3FFZA 3UJOA 2EIBA 4LO4B 1OD5A 3URFA 3VKLA 2SLIA 1S0FA 1W8ZA 1VMFA 5C9AC 4N7UA 3VDCA 3OGVA 4KI5M 1JN2P 4YFZA 3E5UA 4XF9A 2ZX0A 3W5NA 4AEDB 4LK6A 5ERLA 3GZEA 2HWF1 5C5TA 1S0BA 1ZYBA 5FXWA 5L9VA 1VAVA 2F6BA 2TUNA 4P14A 3VZLA 5K0UB 4JGZA 2PHTA 1ZNPA 3PVOA 4LOTA 4OCTA 3R6SA 3UKVA 1UOFA 2XHKA 3ZR5A 1OPOA 5FTTC 5L9BA 4BCUA 1XU2A 1D2QA 5FYMA 2VMIA 2DCJA 2OZJA 4XDQA 1VBC2 3NNGA 1J83A 1AYM2 1FMD2 1PO12 3O1SA 1V9U2 1WWYA 2DU0A 4BHPA 1QXJA 1GZ9A 3M70A 4UYBA 5I93A 2GZWA 4TWTA 1FOD2 2XKOA 2WAAA 2ZGMA 1PK6B 3AZXA 4FPFA 1QHDA 4CDUC 1G9AA 4LHSA 2HEWF 1S2KA 1CD3G 1SZBA 1QOTA 3IDEA 4DIQA 1W8NA 1X9PA 4HVOA 1MS1A 2WNUC 3VD7A 1POV0 4IEPA 4LBNA 1UF2C 2YY1A 4D69A 4E4DX 4MV2A 3WF2A 5E6HA 4MUVA 1X82A 4DFSA 3DGTA 3BCWA 1HV0A 5F5CA 3LDBA 5CFDA 4NRQA 2VOWA 5FMCA 1UD1A 2MEV2 2HWD2 2XLFA 4GKYA 1RIRA 4OQ9A 5C3RA 1GQHA 5FP4A 2D93A 4ET7A 3GCWA 3VD9A 2OKXA 2DYCA 4RD7A 3LFIA 1ZRFA 3A0NA 2CDPA 4OUEA 3ZDSA 1NAEA 4O61A 5LK5A 3WP6A 3ASIA 4QX7A 2BP6A 2BWCA 2Q1FA 2Z4FA 2QCSB 1ZRCA 2Z79A 2D6NA 5B2GB 1RUF1 3WG4A 4CEWA 2VCAA 1H1MA 1TQ5A 2NQYA 3H1YA 2D98A 1UOGA 4UXAA 5L73A 3THTA 4EZ4A 2GN3A 2IZWA 3IIIA 3OYWA 3MIEA 1XRUA 3HJRA 4TZDA 2VXJA 4K7JA 1HQLA 5F37A 1XB9A 3J9SA 2R063 4IV1C 5C71A 5L7OA 1UY0A 1PM4A 3MIFA 3KB5A 3NNJA 4LBJA 3TYJA 4R9DA 3CJIC 5FYCA 4FBFA 5HCBA 2YROA 1SFYA 1ZX5A 3L2HA 4Y4RA 3TB0A 4AQTA 4XF1A 3PIGA 3VBSC 3AB0A 4IEUA 1VBD1 2A71A 4AZZA 2VZPA 5FZHA 1SPPA 1UMZA 3JBG1 3VBRC 5CBLA 1RUJ3 3MDPA 4R4XA 1NKGA 1OH4A 1X36A 4A45A 4ZXEA 2V73A 1L7RA 4NE9A 4BQ5A 4GALA 5E1RA 4E4SA 5BNOC 2GNTA 3OPTA 5AVAA 3AVSA 3HOBA 3LQCA 5DAWA 3WW3A 2BBAA 2BFUS 2QQJA 1O5LA 4LO8A 2DVDA 3ZYJB 3E6CC 3FLTA 5JLVA 4Z2WA 4RS5A 2PAMA 1AR71 2OUJA 3ZN6A 5C3SA 2ATFA 3JD71 5FY0A 4MADA 5DUWA 3HNBM 3KVBA 4HKWA 4I3GA 4M3CA 2XJVA 1YFUA 1H6YA 2YDEA 4MXWB 3BTYA 3HQXA 1SLLA 1IPJA 1W8OA 2EXKA 3CKHA 4QKFA 5ANNA 4GJYA 3BI3A 1ND2B 3U14A 5B4NA 5IVEA 5LRSA 2ORZA 2WAOA 1NG0A 4CCDA 4B7EA 2WO1A 4QQLA 3PJQA 4N53A 1OKQA 2JXAA 4YZ4A 2RJ2A 2V5DA 4FPLA 3WCSA 5FP7A 1UY2A 5LB6A 4HK9A 1VRH2 1QQP1 2VTXA 4RN5A 5GLVA 1UMIA 3NWKA 5FBJA 1RMU3 3WG1A 4LO5B 4YVSC 3WDTA 5KC6A 2RMU2 1YIFA 3SISA 2OPKA 2VTFA 5FRAA 3ZFGA 4A41A 5CEHA 5FWJA 4MSVA 4NRMA 1JU4A 1NZCA 4X6RB 4Y1XA 3ABZA 1QU0A 2FZ1A 3R4DB 1PNFA 4XPVA 4ZU7A 2HWF2 2QQOA 2GP5A 4QPIB 5M0TA 4K8RB 5GKAC 5IK8A 1NUKA 5C70A 3OSDA 4QB2A 2OQ6A 4NHLA 2ET7A 1GP4A 2HWB1 3SKJE 2YC0A 2VVEA 4TLGA 1KFUL 1O4TA 2CWSA 2VW1A 3R4SA 4D7YA 2ZCWA 3WV6A 2RR11 4FT8A 1UYPA 3E5QA 5CZKA 1JH5A 3KSCA 2VR4A 2Y6JA 4ARYA 1PGL2 1W9TA 2Q5TA 3MLLA 4EWEA 1E5RA 3VZJA 3WLUA 3LOBA 1XYOA 1PO23 3AP4A 2JD4A 2RJKA 2WT0A 2XJPA 1H2MA 3OEAA 1ULEA 3LEMA 2X05A 3AKQA 1HV1A 3ENRA 5FZMA 1QJU1 1C5IA 2QJVA 1W2NA 3NAPC 1XOYA 1W6NA 3O1RA 3B02A 3KM5A 1C5HA 3EXUA 4XFIA 3LCPA 1GZWB 3LSDA 5EP9A 1LNSA 2IXKA 1SACA 4GJZA 3I2GA 4AHYA 4BPZA 4XTPA 2JDHA 4YM2A 3ZX7A 1V6KA 3HN1A 3MBWA 4AI8A 2PLV2 2WDBA 3J7LA 1A3KA 4JHZA 5FMDA 4BWOA 3SEEA 3SCFA 3FBMA 5DAVA 3OUJA 1KS5A 5HPOA 2ZZJA 2VULA 1D4M2 3B5LB 3AZVA 2W91A 5A70A 5F8PA 3GXUA 1AR91 4XQWA 1S0JA 1UY4A 4P9YA 5A1LA 1NLQA 1RHI3 5IVFA 3EMRA 4CP1A 5FJHA 1UPSA 5B4XA 4CEYB 2FDJA 3GZTB 4MGIE 3AVRA 5FY7A 1VBA3 3ZOIA 1JYXA 3T3YA 4RR3B 5EQUA 4E2GA 1EP0A 1A6CA 1KQRA 3NRUA 4Q8LA 2YMZA 1Q43A 2O14A 5CU1A 2CGNA 1IS5A 4BMBA 4CA9A 1W6OA 1NCRC 4CRQA 2WWJA 5C3QA 1SLBA 3HD8B 4Q26A 5LBEA 3UGFA 2HWC1 4AFAA 1ND3C 5FPVA 3KLSA 3GBWA 1HRV1 5CKNA 1W0OA 2AGSA 5FYBA 3DYPA 1Q8OA 4M3CF 3WR0A 4BXSV 3KF5A 4YG0A 1AYN1 1AUYA 1ND2C 4RQPA 3UETA 2ZGNA 1YFXA 1MS8A 2AREA 2BOJA 3MGUA 4QXCA 4LBLA 3PU3A 5KXDA 2FZ2A 3VDDB 5JSOA 3PMEA 3ZVXA 4P08A 1ULCA 2PAEA 4I0BA 2ZGKA 4QQPA 4QPWA 3FUOA 1GZCA 1MEC3 1VIWB 2VMHA 4Y4YA 5F32A 3T0AA 2RM22 2VXRA 4K6BA 4CP0A 4D3WA 1KRIA 2BV4A 3VBUA 5J36A 4FPYA 2GH2A 3VHOA 3I8TA 5A3PA 1Q8PA 4Y5Z0 2VMEA 3SMHA 5J3UA 4AE2A 4FFIA 1OLQA 1RVF2 2WABA 4IEQA 4ONUA 3H0OA 2E31A 4HN0A 4QPIC 2B7YA 2WFF3 3B93A 3PVBB 3PHMA 3I2KA 1TVGA 2W87A 4BISA 3UYJA 4Q27A 3GZUC 5FYZA 2XQXA 4LO7A 2EAKA 2D3SA 4LO6B 4LUKA 3E97A 2QFEA 4PQ9A 5FUIA 4LR4A 1RUC2 1ULDA 1W03A 1CESA 3VGIA 4Y33A 3ZXGA 3OF1A 5C5UA 1HXS3 1STMA 2YFZA 4AHXA 4GKXA 2DTYA 3NKGA 4XHBA 5FP8A 5FPLA 4W8JA 3VKMA 2ARXA 3OPZA 1QXPA 4Q4X3 3CQOA 4G9SB 3D82A 4IGQA 1ZVFA 1NE6A 2VBPA 4OLLA 1WMXA 4N9IA 5FMOL 5IUQA 1OI6A 3VL8A 2RS51 4CCOA 5FOJB 1MS4A 2DVAA 4GWMA 3P3NA 2WNVC 1DGWA 3I54A 4IDZA 1H8TA 1F4HA 4X8NA 1R092 4IXLA 5SV8A 5C8CC 3IBMA 1KXGA 2A7AA 2EIDA 1BBT1 5JXGA 4JV4A 4KWKA 5F2WA 3C7FA 2ZHMA 1UYXA 2YV8A 4PI2A 3U75A 3O0WA 1JZ4A 2GALA 2W52A 2F4LA 3EO6A 2WZ8A 5D2AA 4ISRA 2R043 2EA7A 3RMYA 1NA1B 1MS5A 2EVXA 2FCUA 4FPJA 4W65A 3KT7A 5EFUA 4K3UA 4O7XA 2Z69A 2XONA 3KQ4B 3AM2A 1LHVA 1KGYA 3PU8A 4IL7A 4W6WA 4YGDA 4NAMA 3FUQA 2DWRA 1UIKA 5I8SA 1MR5A 5I0SA 1FI2A 5FZEA 5FZFA 5FQ0A 1SG3A 1GYKA 3I2JA 4JRAA 4OHVA 5DMYA 2FDFA 4LBQD 5JIUA 1OURA 4QXKA 1G86A 3KV6A 2JEMA 4Q4V2 5LBBA 2WNEA 1V70A 1LHNA 4ZZ8A 4HPKB 3ZN4A 1BZWA 1HB4A 2NM1A 2BYVE 3NAPA 3R4UA 4RR3C 2FD8A 1RUG1 3OBRA 1C3HA 3I3BA 5HI0A 2EIEA 3H8OA 2WZR1 4EYUA 2QKDA 4IQPA 4IUGA 4N43B 3AP7A 1IPSA 1DFQA 5JWPA 1RJ8A 1ZA4A 3G7DA 1DZTA 1Z78A 5CKQA 1UQXA 4P9WA 3C8XA 3GHMA 2JD9A 2QTWB 5IVBA 5GZGA 4Q1PA 2CTVA 2RG4A 3K48A 2XQRA 3DPRA 2IWGB 4CDWA 4E8DA 5JOZA 4EN9B 5LK7B 4BA6A 4Z8BA 1PZ9A 2BGPA 3TN93 3W21A 1VMJA 2FMDA 5IAXA 3B9IA 2A75A 2Q8EA 3NV1A 2DCTA 4JGYA 4QB1A 3VBHA 4M0HA 3CNAA 5JDBA 3RPQA 4B7KA 3WUDA 2C24A 3I59A 3RZGA 1W9YA 2P3YA 5C4WC 1Q5OA 1V6LA 4E2SA 4GWNA 3AMHA 1PGW2 1EAH1 4RL7A 3SCHA 5A6XA 5KXEA 3O1VA 2QZ2A 5A7QA 4XFFA 2YFUA 4DRVA 3MHZA 4Y20A 3BOPA 1RUOA 1GQGA 3ROUA 2WT2A 4HBNA 1XU1A 1ULPA 3IDCB 1Y9QA 3ECQA 3KD4A 4HSJA 3UV9A 3C7GA 1HW5A 5JI9A 3G6JB 4FSJA 2C1FA 4W4ZA 2UY8A 3ETQA 4XZPA 1K42A 4XMAA 1ZRDA 1XNKA 2GC1A 5LATA 2P6HA 4AR2A 3FLRA 1IG0A 1WCSA 1JHNA 4LBQA 2P17A 1LGBA 1TME3 2B9UA 3T1MA 2YPDA 5JXHA 1A8DA 1O4ZA 1H4GA 1Q56A 2XHNA 3D4KA 3S6PA 4B1MA 3OY8A 2G9ZA 2TBVA 1FX5A 4B4PA 1UY1A 2BFUL 3WDXA 1UZVA 3ZFEC 2W1QA 2R062 4FQ4A 3I97A 4CCLA 4P9LA 2YZ4A 4BLJA 4YRDA 1LGNA 4NHMA 3BTXA 1W2AX 4ZPIA 3PUIA 4CEWB 5A6ZA 1W9FA 4QKBA 1ASJ3 4NVPA 1DQ0A 1DP0A 2CSGA 3VHRA 4JZRA 4PLOA 4K21A 3GCXA 3PUQA 5DG2A 2QQKA 5KR7A 1CIWA 5FCCA 3N9NA 2Z42A 1LRHA 4LKFA 2JIGA 4A7ZA 1IS4A 4BE3A 3HVDA 1ULOA 2CHHA 4CDXA 1RUJ2 2EF6A 3MFAA 4AYUA 2AYHA 1AX1A 4YPJA 3HT1A 1W6PA 4AGRA 3VBFA 2X09A 3POGA 1Q8VA 1WLDA 3Q8AA 4RHV1 1H8VA 3POEA 1SPPB 3LE0A 4LBOA 1UXZA 1UYZA 5H9PA 3WW1A 5J1XA 4LOSA 3DYOA 5FZ6A 4ZKTB 5BY5A 1JYNA 2VNGA 1N3PA 1F15A 2SBAA 3SITA 5IFPA 5LA9A 2VH9A 3D0SA 2ZMLA 5FZ3A 4LITA 5BNPA 3RZZA 4BJ0A 1XQNA 4Y22A 3GJAA 3AJZA 2QVSB 3KQRA 5CFCC 5JXIA 3LWCA 1SBEA 1AR83 4QAWA 5I91A 1ZZCA 1PX4A 3ACGA 4N43C 4FPCA 4RS5B 4XFCA 4XF4A 4GXLA 5IATA 4X8PA 2BDRA 4OYUA 3ZN6B 3IN9A 4BB3A 1X7NA 4FVVA 1SFNA 2ZBJA 4FFGA 1O3TA 1DGWX 5D8AA 4WM8C 3VN4A 4COVA 1HX6A 1IZ3A 2NZ9A 3K4AA 3I3QA 4ASLA 4IV3A 5LY2A 4COYA 2HKXA 2OIIA 3ZYRA 1AYM1 1FMD1 1PO11 3LIGA 1V9U1 1ZZ7A 4PBOA 1DIWA 3T2QA 1VB4A 2UYBA 3AP9A 3OBTA 4CPBD 2V72A 5JOXA 1W06A 4MLOA 1RMU2 5DG1A 1RUE3 2X5IA 4N53B 1FOD1 1HKDA 4Q0SA 1FATA 1ENRA 2C4XA 2GAUA 4MX3A 4JQRA 2QZ3A 2WQ4A 2A6XA 1SDWA 2DCZA 4WM7A 1WD4A 4FCAA 2A3YA 2XOMA 4OQ8A 4GMP0 2Y26A 1H9PA 1VJ2A 4AI3A 1E5SA 3ZFGB 1BYHA 5F2SA 2VGDA 3USUB 1JYCA 4K40A 2P3IA 1S0GA 5E89A 3S7EA 4CU9A 4ES8A 2MEV1 2HWD1 2W39A 3MICA 1B35C 2A5ZA 2K9ZA 4H3WA 5EYXA 2YUEA 3F95A 4Z07A 4BIFA 2R30A 3PUSA 4OI4A 1DQ6A 5JOYA 1URXA 1QKQA 1SMVA 2RHPA 2ZGLA 4H2AA 1D4VB 2Q1MA 1PO22 3OGGA 3C7EA 4AVVA 4D94A 5FXXA 1FV3A 4EQVA 2PQSA 3V0BB 1I5PA 4AI9A 5A80A 5IK4A 3ST7A 1ZBE3 2IXJA 2PA7A 1MZ5A 1NXD1 3HWJA 3OD4A 3A7QA 1RVF3 4NIHA 4KH9A 4E27A 5A32A 1REEA 4UBGA 2X29A 3RJ2X 3ZDVA 1OC1A 1SEFA 1NYWA 1W8TA 4LIVA 4XCBA 3A23A 4YW5A 3BTZA 2WS93 4RGGA 3T4HB 4ASKA 4CCJA 2JWPA 4I02A 2RJLA 1DYPA 1NCQB 1W6NB 3TBDA 3TNQA 4TLFA 4XURA 3OGSA 5FPZA 1NZIA 2KXLA 3BODA 5LRRA 1W05A 3WSOA 3LPFA 1D7PM 3MLJA 1OXCA 2XJRA 3DKWA 4YVWA 2WN3A 5J98B 3ZPYA 2HLEA 4BQWA 4P02B 3K46A 1VAKA 3RZKA 2BERA 2JG8A 4P9GA 4UFJA 5FZ8A 3SH3A 3I2OA 1DDLA 5C7GA 3B69A 2VZUA 4CPBA 1SBFA 5G05L 2L9LA 5IFTA 1RHI2 4XOGA 4Y24A 4GMP3 3RGBA 3BVCA 4LKEA 4ZY9A 3WG3A 4L9BA 4WVMB 1QIQA 1VBA2 4CXWA 3N7JA 1RYYA 2R32A 3M4FA 5I0TA 1IQDC 3LF7A 3NV4A 3U1XA 1DYKA 2ENRA 4HN1A 2CY6A 4ASMB 2IFRA 4ZHNA 3LSEA 3V65A 4EN0A 1FV2A 4Y1UA 4OZOA 3RDIA 2XLGA 1BK0A 4HETA 2DBIA 5BNNA 4LORA 5F1RA 2W3JA 3N7MA 4O65A 1JZ2A 1C8M3 1AL23 2J1VA 1CZVA 3J7HA 2XJTA 4DXTA 1YO8A 4F3JA 5EJ3A 3WHUA 3DL3A 3AXEA 2ZGOA 4B3NA 1W6OB 3AYAA 2VUJA 4GAZA 2NPIA 1UX6A 5LW9A 3MW2A 4YG6A 4NHKA 2HYKA 4L92A 2AENA 4QGNA 2V4AA 1VRH1 1T6GC 1YNAA 2C9KA 4XW3A 2O8OA 5GZEA 1MEC2 2C9AA 3H3LA 2GN7A 4CUCA 1IKPA 2JDNA 2FQPA 5I8YA 2VZTA 4XQDA 1EV13 2Q30A 2RMU1 1XNAA 1W6MA 4XFGA 5IK5A 5CA6A 2XLAA 4UI9L 3AMMA 3OG2A 4NJ4A 1UZ0A 1WMDA 1Z7S3 2XWBB 1PGSA 2LROA 2KA3A 2VQUA 3OEBA 2GNMA 4XFHA 1VR3A 3ZLIA 1O6UA 4QDSA 3AKTA 4BH9A 2V09A 2ZPXA 1KDMA 2R1DA 4GH4A 1A8MA 2WFF2 3H8XA 1PZ7A 3KHBA 4MH0E 3TNPB 4QQHA 1YXWA 2IUWA 4PDWB 1MQTA 4KGGA 3INAA 1DGLA 4URTA 4RFT0 5CADA 1TNRA 1UU5A 4XCAA 5FUPA 1PGL1 3T4VA 2XDVA 2Q0AA 4W50A 2IFWA 2BU9A 4U2AA 3MIGA 4Q0QA 1HXS2 4QMAA 3QD6A 2VZOA 4AEJA 2JE8A 3POSA 3LIHA 4Q4X2 1CAUA 3I2IA 4B4QA 3MV01 1VALA 1KDKA 4YGEA 5IVCA 2ZX3A 4AW7A 3WP3A 1E57A 3JUUA 3ZSEA 4D6RA 4Q4W3 2ZX1A 3TEYA 4O9EA 4QPGA 2ZACA 3HNYM 4KU8A 4NR1A 2LTNA 4IE0A 4YGCA 3U07A 4ES9A 4CP9A 2BEOA 3M1HA 3OOXA 4W6YA 5L19A 2RDRA 4AI1A 3PLQA 3WD5A 5GLTA 1JS9A 1W2UA 3I49A 2O8QA 2PLV1 4NPMA 1LB2A 1CGPA 3VHPA 4M3CE 3VKNA 1UIJA 1NCQC 1NQJA 1XBFA 4LQRA 3W58A 3ILNA 1E5HA 3RWNA 3WZ1A 2VY0A 1RINA 4FAGA 2R042 5APAA 4ZONA 1D4M1 2VZSA 3ES1A 4GD4A 4XBNA 2J1RA 4PIZA 4PHZA 3OJBA 1PHMA 3TEZA 3WNXA 2A70A 4PT6A 4KWUA 3PIJA 3M3CA 1OOPA 3IM0A 4RA0A 2ARBA 1VP6A 2W68A 3RVHA 1PM7A 2J1SA 2F4PA 3HR9A 4GWIA 1GANA 3FLPA 3H7JA 4JTOA 3CDZB 1R1A3 1BEV3 3AMNA 4LT5A 4GULA 4WVZA 4UW5A 4AK3A 5FYYA 4IETA 2I07B 4XDPA 3K3OA 3WQ0A 4YW6A 3KCYA 3O1PA 3KCCA 2VQTA 4YARA 1RL3A 4CXXA 4Y5SA 3K75B 1FNZA 4XBLA 4URAA 4L0PA 2PHDA 2Y6LA 2JIJA 1AHSA 1GOFA 2GP3A 3AMPA 1WUVA 2EXHA 1CZTA 1PVC3 4H7MA 4AVTA 3V0AA 5BXXA 1ENQA 1YQ8A 3ETPA 3WNMA 3OBAA 5ABJB 5HV4A 2D6OX 1XYPA 1POV3 2W1SA 3HBZA 4FTEA 4S2DA 3TN92 3BIWE 3AKRA 4HT1T 2PTMA 1QNYA 2RM21 3WNPA 2VOKA 3OBZA 4NUBA 3DPRB 4CDWB 1KITA 1NY72 1CIYA 3POJA 4GZ9A 5EZWA 1CAXA 3WG2A 1LEMA 2RS13 5FO8B 5FY4A 2JG9A 3CU7A 5K8SA 3H7YA 4YW7A 1PZ8A 5GLZA 1K5MA 1F35A 1JOJA 3ILRA 4JAAA 5A7WA 1RVF1 4DOUA 1BVP1 1FNYA 4AEDC 2QBXA 1V00A 3IZOA 3OGJA 4LKDA 2RS33 3HMYA 1YQ2A 3I59B 5K0UC 2FDKA 5A7NA 4EWAA 2J7MA 4CUBA 1MS9A 1JZ8A 1IGOA 4PDWC 5D1IA 1QWRA 3H8UA 1RUC1 1ZZ8A 5J96B 1TZOA 1COV3 2D6KA 4XJ9A 5ISLA 3CBNA 2Y34A 3BU0A 3GBFA 3N9QA 3ZYGA 5FZOA 2DU1A 3N3HA 1REFA 3VBOB 3FJSA 2UY9A 1HB3A 2PXJA 2X10A 4CCMA 4BIOA 3LGRA 1TME2 2D5HA 3FZ3A 3J4UH 2DVGA 3RYKA 3V56A 1V6NA 5IAVA 1PK6C 1LOFC 4E8CA 2P37A 2VMDA 5F3CA 1CX4A 1SDDB 3WINE 3ZKUA 5DZGA 4LE4A 2RVAA 3WNOA 2ZMKA 5LCWL 3PVNA 5I0UA 5C9AA 1LODA 3DKQA 4LBQB 1ZRIA 2WKKA 2XMLA 5DZFA 1GP6A 5FY9A 1IHMA 4QM8A 3I2DA 1R091 2ZEWA 4HANA 4FI9A 2ZKLA 4PBPA 1G7YA 2Q8CA 3H8RA 4UAPA 1ASJ2 3SLIA 2R49A 3OY8B 4QHOA 2LRPA 2QDRA 4OHXA 5C33A 4R52A 2G9FA 2JE9A 5JSRA 2XGXA 4JKLA 4KBZA 2OA2A 1EPWA 1YEWA 5FZ0A 2IC1A 3ORJA 1QOSA 4AVCA 1OT5A 2ZEXA 2D7FA 3IMNA 4AGVA 2VOXA 3BALA 4F7ZA 3I3EA 2QQUA 4UFMA 5AFEA 2VZVA 4UOJA 4JKKA 4Y1ZA 3SEPA 3O1TA 2VW0A 3E5XA 4G3YC 2J1TA 1VBB3 4YFWA 3W59A 3FC0A 5E16A 3AC0A 4LLFA 5A3NA 1FAYA 4CU6A 2Q8DA 3K51A 3PUHA 5IYYA 1W6QA 4Q4V1 1H1AA 4EROA 3VD4A 1TMF3 4CDUA 1OVPA 2Y0IA 4S2FA 3UT0A 1W6PB 2D6LX 4Q29A 3MW4A 5ACA3 3QACA 1EV11 1V6OA 1QJX3 3NV3A 4V1PA 5JZGB 3W5MA 1ONAA 1YQ5A 3VBFB 1RUI2 2WNUA 4CDQB 3VZKA 2E7AA 3LA2A 3LFMA 1EYBA 1BJQA 1LESA 3SXWA 1S0EA 3ZMNA 5KHGA 3POIA 1AR82 3NVCA 4PF5A 4Z82A 5CVRA 2BJSA 1ZRRA 4EE2A 4BQ2A 3EHKA 1I6XA 4R9BA 1W28A 5FPUA 1QJFA 2LW8A 5L36A 4OI1A 2NP0A 4Y22B 3CMGA 4B1LA 4DXSA 4BQYA 3VV1A 1JZ7A 3WEZA 3BYWA 3N9PA 5ABJC 4QB6A 1OHFA 1OPMA 4OMDA 2UWCA 2Q4SA 2JDMA 1ST8A 2P2KA 5JAXA 2ZS6B 4KQ7A 3KT1A 1YQCA 4OHWA 1O7FA 4YZ2A 1RUE2 1YRZA 3FE5A 3I3DA 5D8AB 4AQ2A 2OS2A 5ANQA 2VZQA 5EHDA 4YG3A 5LA0A 4AFCA 1X50A 4IV1A 1F5FA 3L9JT 1WKYA 4XIKA 1PGW1 4YNIA 4L2NA 4PF1A 5HXVA 1GWKA 2WNOA 1OSGA 1G8WA 1UCXA 3ACIA 1XNCA 3CJIA 2XB6C 4Q4Y3 3KV9A 1KEXA 1PMIA 1VRBA 2BQPA 3VBSA 1H2KA 4WM7B 5KBFA 1TG7A 5DQ0A 4IE4A 3VBRA 4YW4A 2QQVA 4RGKA 1MVEA 3DV8A 2KD7A 3S7IA 2D6PA 3UNPA 5AC93 3AZZA 2XPJA 5FJKA 2VQ0A 3VBOC 1LHUA 5BNOA 5DABA 2FMYA 2VOVA 4NIAA 2CGOA 4KG0A 1WCQA 2A3XA 2XBO3 2Y8KA 1RB8G 5A7SA 4Z2AA 1ZBE2 3T0BA 4CYDA 4NIDA 4Q2FA 1AZDA 5CKMA 1S0DA 5FR3A 2BUKA 2R061 1LOCA 2VTXJ 4JCKA 2YBSA 4JDMA 4UF0B 4WBBA 3VD5A 3WF4A 1RUH3 2WS92 1HB1A 1DQ1A 1J58A 3DUIA 1DQ5A 1H0BA 1W0PA 2R073 5C8WA 1CX1A 1GWMA 1T2XA 3ALQA 3ZIXA 4HVQA 2AH2A 4YZ5A 4IE6A 5IK7A 2XUMA 2QQIA 2JDUA 1RUJ1 3HN3A 1TE1B 1UU4A 2TEPA 3BPSA 5L9RA 3WY6A 2WA4A 5F3EA 4XXAA 4SBVA 4A2UA 3EJKA 4OFGA 1WA6X 5FLIA 1KFXL 3HPNA 3GALA 5KWRA 2FCVA 2CV6A 5LA2A 2ZX2A 2BVVA 3H3ZA 4YVSA 4YVWB 3FL7A 3I3MA 5FZLA 4INDA 1NE4A 1RTVA 1GICA 4NHXA 1RUD3 3EYPA 1LHWA 4XBQA 2XH6A 4U36A 1N47A 1VAMA 4P9JA 5JZGC 4FP2A 1DU3D 4D8MA 1US2A 2PHXA 1JBCA 4CDQC 5CG9A 2VG9A 4JC1A 3PURA 4FOWA 4EZHA 4YWAA 1GLHA 4QT6A 4A7KA 5FFOC 1C8M2 1AL22 1QNWA 4EN7B 3O1OA 3ATGA 3B7MA 2WWSA 3LA3A 3PNAA 3KF3A 3QOPA 1ZBA3 3THPA 5I8TA 3P1IA 3ZYFA 3N7KA 1MS3A 2E53A 3WDVA 3ZFFB 1W8HA 5BNNB 1F4AA 1W9WA 4DINB 1KS4A 2VVDA 3LA7A 4OHZA 4JTNA 4C1XA 3VB9A 2K46A 1OLME 4IE7A 3UGHA 4D6QA 1EY2A 5FOBB 1GZTA 4UFHA 2E63A 3I4IA 4RYDA 5FZ7A 3ZYHA 4AEMA 4AI0A 1SCSA 1O91A 2JKBA 2VQAA 4CEYC 1RMU1 1I5ZA 4ZZ5A 2JDPA 2ZABA 1EV12 2V4VA 1DHKB 2WT1A 5A6QA 1QF3A 5F6KA 1LAJA 2KM2A 4KNCA 2W46A 4C8DA 4WZCA 3AYDA 2PHRA 1LEDA 2ZXQA 1Z7S2 2FBEA 3KVAA 5A6YA 1E5IA 3ZXEA 2B45X 3RI9A 2XJQA 2OQ7A 4LXLA 1O8PA 4C1WA 2IXIA 1LULA 5JI7A 4MVTA 1WW6A 4XE9A 1FYUA 4AG4A 2ERFA 1W6MB 2E33A 1AVBA 1OA2A 2WO2A 2EAAA 1GMMA 1VBE3 2OUHA 4AVBA 3D8CA 3IWZA 3NMBA 2TNFA 4GA9A 3EQEA 4CCKA 1AXYA 5FO7B 1BLZA 4BQXA 2GMEA 3KHCA 5IHRA 4GH4B 3VDDC 3O1UA 2W1WA 2WQ8A 4C90A 2YYOA 4JGZB 1PO21 4MXVA 5K9YA 1MQTB 1MVQA 5KHKA 3NSTA 4OVEA 1S0CA 1ACCA 4XFAA 4AAXA 5FKBA 1VBB1 1UZWA 1DLLA 2GMPA 4JKMA 3TAYA 3WF0A 2LUWA 1VMHA 5FY8A 4FPKA 2EXJA 2H0VA 4Q4W2 1J1LA 4R8HA 4AAPA 1R64A 3IPVA 3POBA 1Y7BA 2A6YA 1CAUB 2XR4A 1TMF1 3J8F3 5JIAA 3BUCA 1NCRA 2JE7A 3DF0A 5FIXA 4HZFA 2VUCA 3UESA 4BLIA 5LY1A 1QJX1 1X33A 2GDFA 5FZCA 1RGSA 3DN7A 2HWE3 1ND3A 3M8LA 3ELNA 2QQPA 5JPMB 3OCPA 5FY5A 3A0KA 1ENSA 1OQ1A 3ILFA 3TRSB 4AFMA 5AFBA 1OLMA 1QJY3 2RE9A 1OLRA 3S57A 1ND2A 2P6CA 3BIEA 2MPFA 5GALA 3ZMOA 2HJIA 5EYYA 4I0WB 4LMFA 5CFDB 4PQQA 1JYTA 2J1AA 2W9XA 2Y6FA 4OI0A 2XL9A 2HBTA 3ZXAC 2H0BA 3NJXA 1SFPA 2JECA 3MUY1 4FOQA 2VBBA 2OYZA 3ZXKA 1J1TA 1RHI1 1H4HA 4RSUA 3WNNA 5T3NA 3ZR6A 1UW8A 3PUAA 4HFSA 3IT8A 1FT9A 2ZMNA 1I1EA 1I9RA 5LASA 1VBA1 2Y33A 3NV2A 1R1A2 1BEV2 2ZAAA 3UGGA 1A34A 4QGLA 2DBNA 3JQXA 5FYIA 3MZHA 1J3PA 1W39A 4OZXA 3BKZA 4AFDA 4NHYA 3ZIWA 4QPIA 3OYWB 3ZM8A 4CCNA 1CR7A 3IAQA 3ZXLA 1TNFA 4XYXA 4CVUA 4V2WA 2GC3A 5L7OB 5F6LB 1AX0A 2QQWA 4PJYA 3V64A 4YW1A 1PVC2 4Q0PA 1NA1C 4GQ7A 1LKNA 5EPAA 1UN1A 2JKXA 4D6SA 2JDYA 1JODA 3ZFFC 4S2GA 4DMIA 1R083 1PNGA 2CU5A 3B9CA 1DZQA 4A44A 4LLOA 1IS6A 1VB2A 3GJBA 3CJXA 4MZUA 4FAHA 4FFHA 2ZJCA 5FYVA 3HQUA 3WDWA 3V0AB 1MEC1 1W3XA 3WOGA 3APBA 2MNGA 5J09A 1LJ7A 3RS6A 2CDOA 1QXRA 2B8MA 4L99A 2J1EA 5DAXA 1SLAA 1RUI3 4YW2A 4OUMA 2RS12 2GC0A 4C0BA 5EWSA 1U5ZA 1ZREA 2XXZA 2WNVA 4DNYA 3ES4A 3K77A 2E32A 4QKDA 1C1LA 1B09A 3WQBA 1Y9MA 5C8CA 1PVXA 2WFF1 1ZZBA 4FOYA 5EXOA 4AOCA 1CAXB 2CGPA 2V5YA 4M4RA 4IEZA 4L11A 4XJZA 1WMFA 2RS32 1RUH1 2JG9B 2R6QA 4XEZA 5CNAA 1S55A 5T55A 4M3CB 1K5MB 2C5DA 2R7EB 3HEIA 3RWKX 1HLCA 2VU9A 5CG8A 5A7WB 1COV2 1AR62 4V2VA 4Y26A 2ZA9A 3RQ0A 1HB2A 1HXS1 1JW6A 5FDBA 2BVBA 1WCKA 3FHQA 3AX4A 2YU2A 4L97A 4Q4X1 1LOBA 3N4MA 2BZDA 3LD8A 1S4CA 5IW0A 2OX0A 1V6MA 3VL9A 5FZ9A 2DCKA 2J1UA 3C7HA 4JX0A 4PI0A 3FN9A 5FZOB 4Q1RA 5KXBA 1RITA 1W8WA 3W20A 5JCTA 4RR3A 2VCBA 4PLMA 2J22A 1AXZA 1RUF3 3CZJA 1HQWA 4AFBA 2GMMA 4HVRA 2A6VA 2I2SA 2A73B 2ZZQA 3AL5A 4HG6B 1Y43B 3THDA 5FV3A 4K9SA 2ZEYA 1OFSA 2UWAA 4WVVA 1GUIA 4Q8KA 5C9AB 3DXUA 2YHJA 3LEKA 2ZHNA 1S0IA 4COUA 2ADDA 4AL9A 2R041 1IS3A 1D0GA 2R0HA 1SHWB 4XUNA 4OHYA 2A3WA 4LE3A 4ZU4A 1VBD3 5A3MA 4KL1A 1EUUA 3FHAA 4XUTA 1YI9A 3O7OA 5IT6A 4TXWA 5H9SA 1VBB2 1UNBA 2Y0OA 3JBG3 1ZZ6A 4QU2A 3AMQA 1RXFA 2C6SA 2OXBA 2JICA 3K2OA 4WZFA 1N1YA 3VD3A 5IVVA 3M7AA 3VHNA 1JUIA 1CJPA 5FZKA 2OVUA 3OD0A 5DUVA 1NXMA 5JMOA 1TMF2 4NN0A 5C4WA 4AVAA 5ACA2 3KT4A 3B00A 1QJX2 1ZZ9A 2DCYA 4EV0A 1OVSA 3GF6A 1NQDA 4JQTA 4CEWC 3THCA 4BM8A 1BXHA 4AQ6A 3D0JA 1BCXA 1BMV2 1W6QB 4DUWA 4NRPA 4QXBA 1AR73 1GV9A 3AYEA 4A6OA 3FFQA 4H7LA 3JD73 4FPGA 3ITQA 1JUHA 1N3QA 4XJWA 1L7QA 2WNUB 2WBKA 3ACLA 4XABA 5L7OC 3LB9A 3D6EA 4S2HA 1AL0G 1WLCA 3O0XA 2UU8A 4QX0A 5DN2A 3Q8CA 4D7TA 1CAWA 3F2ZA 4J1WA 4XFBA 3WP4A 4Z92B 1XNBA 3KV4A 3QH7A 3LOIA 3ON7A 3U78A 4BOWA 5GZCA 4UBHA 4NIIA 4AXOA 1WLTA 3ZYIB 1CQ9A 2WN2A 3E1F1 3TN91 3WQ1A 3WF1A 5GZFA 1K3IA 5BYNA 1RC6A 3WCRA 1U5IA 1NY71 3X29B 2ZHLA 2WINB 3RZLA 1QQP3 4WV8A 3Q8BA 4HONA 4D7SA 5FZDA 2ZGSA 3ZFEA 1N1VA 5GJ6A 3VZNA 2G9GA 2D6MA 1U12A 2DTWA 4Q4Y2 4RS5C 3AJYA 4YW3A 4LIUA 2ZX4A 3FX3A 3JU9A 1Y4WA 5JXJA 3VDBA 1PMHX 2PAKA 3VKOA 4DZGA 1JZ3A 4K8FA 1HJFA 3SHRA 1X8EA 3BB6A 4FPEA 4BQ1A 2HWB3 2FCTA 3NNMA 3CJIB 3HNMA 3OPWA 1WD3A 2RR13 1YWKA 5EJZB 3CL1A 2VMCA 3SQOA 4HMZA 3WVJA 4A42A 2BBVA 5AC92 4RQPB 1GBGA 3VBSB 1BHGA 3CIHA 3JB4C 4PIXA 4QHBA 1JYVA 1I3HA 3NL1A 2Z5WA 4UW6A 1LHOA 4IEVA 2BOIA 4FO9A 4UT5A 1UOJA 1TME1 4N53C 5A7OA 1UL9A 3VBRB 2XBO2 4DB5A 4GB32 4IERA 3LKJA 2HYXA 5A7PA 1O4YA 2VZRA 3LAGA 4O9GA 3Q8FA 4AGGA 3P3PA 1MS0A 5HV0A 1ODNA 2E7TA 3KZ4C 4R9CA 1VLNA 2WLPA 4HPKA 3RZHA 4YZ3A 1LECA 5BNOB 2DUOA 2VM9A 2D3RA 5I0RA 1GQPA 1QJU3 5DDJ3 3U4XA 1QDCA 2VNVA 5FLJA 5FMOS 3VBUB 4E4HA 5A1FA 2OW4A 5CFCA 1DF0A 1UX7A 1OFNA 1RUH2 1C4RA 3FHIB 3WDYA 3ZFGC 1ASJ1 1O3RA 4N43A 1IPKA 1IG3A 1WW5A 2R072 4XTMA 2WRAA 3JB8A 3VZMA 2BNNA 4MGSA 1OF3A 4EWDA 4KMQA 4P9XA 2XJUA 4E2QA 4WM8A 1OBNA 1IKQA 1VE0A 3O0VA 5FK8A 1R081 4CP2A 4NWVA 4I09A 2XG3A 3JQWA 1XYNA 2XVLA 1IQAA 1ODMA 1QOOA 5FLHA 1AR93 1MACA 3MEPA 4YGBA 2VZ1A 3U37A 4IEWA 2WA3A 1RUD2 4LEJA 5GLWA 3S5QA 1JZ6A 5LEKA 4FOVA 1DG6A 2P3JA 1CONA 3N7LA 3RRDA 3T2PA 1RUI1 2LM3A 1NOVA 1V0AA 1O8SA 2VJXA 2YC2A 3GBGA 3KGLA 4M4PA 1APNA 3WXPA 3ZSLA 4IEOA 1M06G 1US3A 1UOBA 1HRI3 1UY3A 2W1UA 3IMMA 4LTAA 4YVSB 3WP5A 1BVVA 2QNKA 5FMBA 1AR81 3ZSJA 3SH4A 1YFYA 4P5HA 4OI2A 1H8TB 1YC61 4A3ZA 3TEWA 1B35A 1ZBA2 3O1MA 2HWC3 3BN6A 3M3IA 4YZ1A 4AQSA 4OULA 5HBAA 3GZAA 4DXRA 1HRV3 4MHRA 1JHJA 1JU3A 2PHFA 2H6CA 4LA3A 1AYN3 1YI7A 2YGMA 4Y1YA 2MHFA 1WW4A 3WT3A 1N1SA 4ZXKA 1GWLA 1RUE1 4NAOA 2A1XA 3OUHA 1AJOA 3DYMA 2P1BA 5FQ0B 3HIFA 1G9CA 2FDIA 4XDOA 4FXKB 4C91A 4XETA 1DBNA 1S1AA 1UMHA 4HSLA 1JZ5A 3NQHA 4J25A 4LJHA 4MOAA 3KMHA 5BNQA 1XXNA 1HN0A 1UAIA 3N9MA 3NAPB 2WYSA 2PELA 2YBPA 2ES3A 4XMIA 1C57A 1YFWA 4QX3A 2DFCA 5J37A 1ULGA 1OUSA 2GU9A 1LOEA 2OT7A 3WF3A 1W2OA 4Q0VA 4LHLA 1VBE2 4YSFA 1X9TA 5HCFA 3T0DA 4LBKA 3W9AA 3USSA 4K20A 2D40A 1SCRA 2VECA 5H9QA 2PQQA 3IDBB 1FPN3 2BGCA 4RQPC 4H14A 4QWNA 4XF3A 5K7PA 3QBQA 4XF0A 1F5JA 4MGTA 4JVAA 2J42A 2Y6KA 3MW3A 3NW4A 4DPNA 2O1QA 1ZBE1 4NMIA 5DUUA 2X53S 2E7QA 4KGQA 2R16A 5DPNA 2JX9A 4UWDA 1CAVA 3E6DA 1XNDA 4JGYB 3J8F2 3HQRA 3A22A 4GWJA 3VBHB 1BK1A 4BMEA 1UKRA 1K45A 1ULFA 2VO5A 4JRLA 1G9BA 3VBUC 3S5AA 2WS91 1YHFA 2HWE2 2RS53 2W92A 3AP5A 3MLKA 5TSWA 4Y3OA 5FPAA 4Z1VA 2AZ5A 2E6VA 4AHZA 3C7OA 1AR63 3IPVB 4COZA 4DUXA 1QJY2 5FWEA 2W47A 1NCRB 1W9SA 4LUMA 4Y20B 2WO3A 1BBT3 4MGYE 1ND3B 2P5BA 2ID4A 5D21A 3MIDA 1LU2A 4META 4PIYA 4HOOA 1H2LA 4BU2A 4GIQA 3AKSA 5FYHA 1IOAA 2NN8A 2ZTNA 4GMP1 1W8FA 3PDQA 4J6GA 1H30A 4NWWA 4UFKA 2VPVA 4LHNA 2VL4A 3MPBA 2BRTA 3POWA 2G4IA 3IKWA 2NYYA 3C2UA 5FO9B 1WBFA 3N9LA 1N3OA 4QX1A 2WR9A 4JDNA 3TWIA 2RV9A 1C8M1 1HDKA 1AL21 1XNTA 1RUG3 1Y3TA 3J26N 3AL6A 3USUA 4B29A 2WZR3 3N35A 1H8TC 5LBFA 1F31A 2WSVA 4LPLA 5DUXA 2RDNA 2ZGQA 5EJ1B 3WX5A 4IEXA 1XSRA 5FREA 1R082 5F9TA 3GYDA 3DEMA 3CHXA 4XJ8A 1UZYA 2P3KA 3JXSA 1R1ZA 2XVGA 3VZOA 4CDXB 1UXXX 3I2FA 2K0GA 4CUAA 2XWJB 2EXIA 2DFBA 4R4ZA 3MV11 3V0BA 2DV9A 4BK4A 1U5XA 4Y5TA 1TEIA 5T50A 2I74A 3CZUA 1F9KA 4M00A 5FYUA 2W94A 1WGPA 4A6SA 1Z7S1 5G04L 4QDRA 5A3LA 5T5JA 2YXSA 1YYNA 3TEXA 1UYYA 2WLQA 1RUNA 4FTSA 3NJYA 4ITCA 3PJYA 3T2OA 5DDJ1 4BZ4A 4FPHA 1ZM1A 3IAPA 1NCQA 1T6BX 3Q8EA 5BNPB 1J3RA 5CYYA 1EAH3 3AP6A 3IB3A 1CVNA 2LALA 2WNVB 5GLUA 3RJRA 3BOWA 1K12A 1QJEA 4ARXA 3M3OA 3LPGA 1V6JA 1PIV3 5C8CB 1UKGA 3SC7X 2Y38A 4I0AA 2HEVF 4P9IA 2BW8A 3A21A 4QGMA 2Q1ZB 2E26A 2VBDA 4XJUA 1YCIA 1YJLA 2LS6A 3ZPOA 2E51A 1GNZA 3R05A 1DGRN 2D97A 2ZOEB 4RFRB 2PYTA 4CDWC 3DPRC 5F3GA 3L2YA 1D2SA 4IV3B 2D5FA 4KWLA 3BTAA 2JB4A 1J3QA 4Q4W1 4WVMA 4ATEA 3NNLA 4CTEA 2WQZC 5A33A 2W08A 1S2EA 3NKTA 3O12A 4EN6B 2ZGPA 5FPXA 2X5IB 1HJGA 1RUF2 4CUGA 4JGYC 3VBHC 4IW3A 1S2BA 3MYXA 3OTFA 4XUQA 4YLZA 3O14A 1C1FA 3U4SA 1GU3A 2YGLA 3ZO0B 1HRI1 1LOGA 2VE1A 1DYOA 2ZGTA 2IVIB 3T2TA 3SH5A 1UPIA 5CISA 3KCXA 3B01A 3ZXFA 2R1BA 4XIOA 2W0XA 5FP9A 4F8AA 4FTBA 2JDZA 4LNVA 2JDAA 1VBD2 5T5OA 4BXFA 4DXZA 1K5JA 4GB33 2CAVA 3ZSMA 3JBG2 2QE3A 2HEYF 1W90A 2WSUA 2WL1A 4OUSA 4FFFA 5A3WA 2A6ZA 1O5UA 1XSQA 4E9KA 3MUZ1 1QDOA 5F3IA 5IVYA 1F8VA 4TN7A 5EV7A 1AX2A 1R1A1 1BEV1 1DQ4A 1DLCA 4RHV3 4FXGB 1L7LA 3K4ZA 3J7NA 2WC2A 5FUNA 2XJSA 3AZYA 3HT2A 3C3VA 5DAPA 2D43A 4AEDA 3MPPG 3U11A 2R0FA 3UKNA 3QCWA 2VUAA 4BQ3A 2BPA2 5A32B 5K0UA 4QX5A 1AR72 4L8QA 5C4WB 2B4KA 1LU1A 3JD72 4M0NA 2VC9A 4PDWA 4NO4A 4P5YA 4XXPA 5T54A 4EJRA 5JOWA 5JPNB 2ET1A 1PVC1 3H9AA 1YUDA 2AEZA 4LA2A 1AJKA 4XQ4A 5FPBA 1BKZA 2A6WA 2AR6A 2VAUA 2CNAA 3PTYA 3OGRA 5JVVA 2G19A 1MZ6A 1CZSA 1POV1 2OZ6A 2VCCA 3AZWA 1JXNA 3NNFA 4MHUA 2BGOA 3O5SA 4CDXC 4I01A 2IXCA 2NMNA 2JG8B 2ADEA 4HK8A 1FPN1 2YG0A 1PK6A 2X8KA 1LOFA 5GZDA 1SLIA 1QH7A 5LZ6A 1VBC3 1CAWB 1L3JA 1AYM3 2CYFA 1FMD3 1PO13 2EIGA 1QH6A 1QQP2 1V9U3 2AEYA 1RXGA 1Y9GA 2RS11 3ACFA 3MF6A 4QDQA 3VBFC 1SLTA 3HBKA 5C3PA 1XPWA 5A1AA 1J84A 3ACHA 1QGLA 3WNLA 1UU6A 5IVJA 1FOD3 2JENA 3POFA 4QHZA 5KXCA 3T1LA 4HKOA 5FZBA 3ME2A 5JR2A 1Z0HA 1D0HA 4XHXA 1WBLA 2GNBA 2RS31 4XILA 3SNMA 5A3OA 1GNHA 3NJVA 1H1IA 1OKOA 4IE5A 4QM9A 4RGAA 3NJZA 3WDUA 3ZFEB 5BNPC 4SLIA 1OF4A 3RI8A 3RSJA 4YM0A 5FK7A 4KBBA 4UW3A 1COV1 1AR61 2E9QA 2HWB2 2NMOA 3AK0A 4QPYA 3QLQA 4AF9A 4CU8A 1Q8SA 1SQ4A 4H55A 4LHKA 5DXDA 2RR12 4N90A 2MEV3 1GNYA 1U5YA 2HWD3 4N8MA 3D5OA 1SLCA 4AWDA 2ORXA 4MYEA 3H1WA 4EN8B 2VD7A 5D8AC 1GFF2 4Y1VA 5HCAA 3WUCA 4IV3C 4WVWA 3RFRA 1POQA 2VOTA 5CB7A 2RDQA 4TYSA 4CCCA 1WCUA 3RYRA 4MGZE 2BNOA 5LBCA 1QJU2 2QUOA 3AYCA 2X5IC 5DDJ2 5FYTA 5FXZA 1QEXA 5E88A 3I2HA 4A7YA 3LZZA 2G1MA 4YYOA 3JCIA 2UURA 4NPRA 4AVSA 3FMGA 4WM7C 2KR2A 2WZPP 3K3NA 4C0HA 3RZMA 3CO2A 4MGQA 1HN1A 5CFCB 4XUOA 2YB7A 1WCDJ 3MIBA 4FPOB 1OD3A 5ABJA 2ILMA 3DXTA 3SKVA 5J7MA 3PVEA 3RZJA 2EALA 2AACA 3B94A 2EICA 5F39A 5DZEA 3RG0A 1OUXA 5FY1A 1DGRA 1AR92 4WM8B 5JSPA 1O59A 4A4AA 4J1XA 5ACA1 2Z2SB 1GOHA 2ZGRA 3S30A 4HL0A 2ZAHA 2VNOA 4FQZA 4A3XA 1YLLA 3U10A 1V6IA 4MXWA 3VDAA 5A3UA 3LDKA 1HRI2 4QPGB 5F7UA 2QQMA 1OH3A 1BMV1 3M3QA 2WZEA 2AC1A 2FDGA 4CP9B 2QQLA 5EIYB 1WW7A 2Y60A 4MGKE 3HAGA 4DO0A 4D0QA 1F2NA 2K2SA 2W2IA 2HWC2 4NIGA 4CSWA 2JDKA 1JYIA 4MO3M 2QDNA 2ZGUA 2Y6GA 1HRV2 2IXLA 4TSVA 2DVBA 3NO8A 4YM3A 1PIV1 2VMFA 4P00B 1AYN2 3VBOA 2DDUA 1W3VA 1B35B 3BGAA 4YVWC 2VUDA 5BUVA 5AVPA 3ZSKA 1N1TA 1XE8A 2GH8A 5CAZA 1Q8QA 3D3AA 3E6BA 1LCLA 2JG8C 1VRH3 3PL0A 1OOPB 3GM8A 1GSLA 4I3PA 2PN5A 4B8EA 4AEKA 1OMIA 2YPJA 4QQ2A 2C26A 3UK9A 1YQ6A 3RMXA 5T52A 3H3UA 1A78A 2O0OA 1KJRA 2RMU3 1J59A 1ALYA 1ZA7A 2YC4A 3VLBB 4DUVA 3AXDA 5T5PA 1EPZA 1KD7A 2B5HA 2N7GA 4NPLA 4Q4Y1 2P34A 4CU7A 5JMCA 3LDRA 2HWF3 3LEIA 4JDOA 4KWJA 4ISQA 3ZXDA 1MZFA 2HBUA 1MZEA 1H2NA 4QX2A 2ZKNA 5BNNC 5T5LA 4Q5OA 4HXCA 2QQNA 2CL2A 5A3TA 2UWBA 1XE7A 3SCGA 2ETEA 2WO7A 4XAEA 3ZKYA 2P4EA 1G9DA 1KJLA 3FWEA 3J7MA 2Y6HA 1LENA 5AC91 1FPN2 5SV5A 4BQ4A 4IGPA 4LK7A 1QMJA 3AFKA 1XC6A 3RNSA 4DRRA 2RDSA 4QX8A 5LEJA 3PTRB 4UFLA 4DEQA 1VPHA 2CWMA 2XBO1 4GB31 3CLPA 5I0DA 2VW2A 1W8UA 4G4FA 1GZWA 2H6BA 1EUTA 5FZGA 3POYA 5K4LA 2IVJA 1LTEA 4E4ZA 1OA3A 5F5IA 5JZGA 3Q9OA 4OMCA 4COWA 3AKPA 5FZ1A 4CDQA 2VZ3A 3N36A 1REDA 1NX9A 1X8MA 3IIAA 2RS52 4QXHA 1XE0A 4XJAA 1WMEA 4LULA 2VNRA 4UW4A 5KHHA 1JOPA 1AF9A 5KC5A 2R071 3LEGA 2XKPA 1CAVB 2YBKA 1C28A 4XZUG 3DECA 1WA4A 3RYPA 4I2OA 2GNDA 2GSYA 3K4DA 4JHTA 3MI8A 5IJRA 1FXZA 4GH4C 4UFIA 5JR7B 3WQ7A 1BBT2 2PLV3 3GDBA 3H1MA 4K1YA 4PLNA 4DY5A 4JGZC 3MIHA 2PHWA 3IDAA 1MQTC 3KS7A 1GOGA 5JUVA 2B46X 3M3EA 2IXHA 1PMJX 4N7IA 1WLWA 3BU7A 1D4M3 1QY4A 4CEYA 2Y64A 1BQPA 4X6QB 1YJKA
chains in the Genus database with same CATH topology
3WW4A 5BV6A 2PFWA 1JTZX 3ZN5A 2VVFA 1RUD1 3MF9A 4PCRA 4F83A 1VBC1 3CF6E 3QH6A 4DS0A 4QPGC 1RUG2 2ZHKA 3BPZA 3UKTA 2WZR2 1CJDA 1ZBA1 4FP3A 4IEYA 5CFDC 3JZVA 5CIRA 2PHUA 1QJZA 3VDDA 2VMGA 4HKLA 3A4UA 4NOTA 4B4RA 1NLSA 1DQ2A 2DF7A 3MFCA 2PHLA 1G9FA 1LGCA 4R9AA 4KU7A 4W6XA 1OQEA 2FHRA 5FBZA 1LR5A 3U0ZA 2JJ6A 4QD2A 1LOAA 5KHIA 1OOPC 4ZU5A 5GM0A 1OA4A 1HIXA 3UL2A 2RM23 2I45A 4QQOA 1DZRA 4CDUB 4DQAA 3AFGA 2GC2A 3KGZA 1RJ7A 1U0AA 1GR3A 4I30A 2AUYA 1EAH2 1VBE1 3GNEA 5FAXA 3B3QE 2DUPA 2DUQA 3VUOA 1UZZA 1PIV2 1GKBA 5E8AA 2BNMA 2WIIB 1C8NA 1RUC3 5KHJA 4YM1A 2XL7A 4IESA 2BWAA 3UJQA 1OQDA 1CPNA 2CAUA 5F5QA 1CN1A 3R0RA 3FBYA 3EBRA 3TOJA 3I7DA 1O3SA 3J8F1 4ORFA 2NLRA 5J48A 2UYAA 2HWE1 2XVKA 2B39A 2D44A 1HQNA 2JG9C 1H9WA 3PMSA 4IV1B 4K1ZA 3M2MA 3ZYPA 5A33B 4LBMA 1K5MC 1CPMA 1QJY1 1NLRA 1R093 2C0ZA 1NA1A 2Q8OA 3ZXJA 4KG8A 3ZFFA 1AXKA 4N9HA 2B42B 1O3QA 1Q3EA 4Q0UA 1YIPA 4DY3A 3WHTA 2DVFA 4BYYA 4ATFA 2D3PA 4AI2A 2WJSA 1G6NA 2BTVC 3CEWA 3GHNA 3VKFC 5C6CA 4M01A 4HLTA 4CZSA 5BPXA 4RHV2 3WW2A 1ENXA 2WFPA 5H9RA 2DURA 4Q4V3 1SBDA 3H50A 1M4WA 4AHWA 3S0MA 3FFZA 3UJOA 4LO4B 1OD5A 3URFA 3VKLA 2SLIA 1S0FA 5C9AC 4N7UA 1JN2P 4YFZA 3E5UA 4XF9A 2ZX0A 4AEDB 2HWF1 1S0BA 1ZYBA 1VAVA 2F6BA 2TUNA 4P14A 3VZLA 5K0UB 4JGZA 2PHTA 1ZNPA 3PVOA 3R6SA 3UKVA 2XHKA 4BCUA 1OPOA 5FTTC 1XU2A 1D2QA 2VMIA 2DCJA 2OZJA 4XDQA 1VBC2 1AYM2 1FMD2 1PO12 1V9U2 2DU0A 4BHPA 1QXJA 1GZ9A 3M70A 5I93A 2GZWA 4TWTA 1FOD2 2XKOA 2ZGMA 1PK6B 3AZXA 4FPFA 1QHDA 4CDUC 1G9AA 2HEWF 1S2KA 1CD3G 1QOTA 3IDEA 4HVOA 1MS1A 2WNUC 1POV0 4IEPA 4LBNA 1UF2C 2YY1A 4D69A 4E4DX 4MV2A 4MUVA 1X82A 4DFSA 3DGTA 3BCWA 1HV0A 5CFDA 2VOWA 1UD1A 2MEV2 2HWD2 2XLFA 4GKYA 1RIRA 1GQHA 2D93A 1ZRFA 2DYCA 4RD7A 3A0NA 3ZDSA 5LK5A 3WP6A 3ASIA 2BWCA 2QCSB 1ZRCA 2Z79A 2D6NA 5B2GB 1RUF1 3WG4A 4CEWA 1H1MA 1TQ5A 2NQYA 3H1YA 2D98A 5L73A 4UXAA 3THTA 2GN3A 2IZWA 3OYWA 3MIEA 1XRUA 4TZDA 4K7JA 1HQLA 3J9SA 2R063 4IV1C 5L7OA 3MIFA 3KB5A 4LBJA 3TYJA 4R9DA 3CJIC 4FBFA 5HCBA 2YROA 1SFYA 1ZX5A 3L2HA 3TB0A 4AQTA 4XF1A 3VBSC 3AB0A 4IEUA 1VBD1 2A71A 1UMZA 3JBG1 3VBRC 5CBLA 1RUJ3 3MDPA 4R4XA 1X36A 2V73A 4GALA 5E1RA 4E4SA 5BNOC 2GNTA 5AVAA 3WW3A 2BFUS 1O5LA 4LO8A 2DVDA 3ZYJB 3E6CC 3FLTA 5JLVA 4Z2WA 4RS5A 2PAMA 1AR71 2OUJA 3ZN6A 2ATFA 3JD71 5DUWA 4I3GA 4HKWA 4M3CA 2XJVA 1YFUA 2YDEA 4MXWB 3HQXA 1SLLA 1IPJA 2EXKA 1ND2B 5LRSA 1NG0A 4B7EA 4QQLA 3PJQA 4N53A 1OKQA 2JXAA 4YZ4A 4FPLA 3WCSA 4HK9A 1VRH2 1QQP1 5GLVA 3NWKA 1RMU3 3WG1A 4LO5B 4YVSC 3WDTA 5KC6A 2RMU2 1YIFA 3SISA 2OPKA 5FRAA 3ZFGA 4MSVA 1NZCA 4X6RB 4Y1XA 3R4DB 1QU0A 2FZ1A 4ZU7A 1PNFA 4XPVA 2HWF2 4QPIB 5GKAC 5IK8A 4NHLA 2ET7A 2HWB1 2YC0A 2VVEA 1KFUL 2VW1A 1O4TA 2CWSA 3R4SA 4D7YA 2ZCWA 3WV6A 2RR11 4FT8A 3E5QA 1JH5A 3KSCA 1PGL2 2Q5TA 3MLLA 4EWEA 3VZJA 3LOBA 3WLUA 1XYOA 1PO23 3AP4A 2JD4A 2RJKA 2WT0A 2XJPA 1H2MA 1ULEA 3AKQA 1HV1A 3ENRA 1QJU1 1C5IA 2QJVA 3NAPC 1W6NA 3B02A 3KM5A 1C5HA 3EXUA 4XFIA 3LCPA 1GZWB 3LSDA 2IXKA 1SACA 4AHYA 4BPZA 4XTPA 4YM2A 3ZX7A 1V6KA 3HN1A 4AI8A 2PLV2 1A3KA 4BWOA 3SCFA 3FBMA 1KS5A 2ZZJA 2VULA 1D4M2 3B5LB 3AZVA 1AR91 4XQWA 1S0JA 4P9YA 1RHI3 4CP1A 1UPSA 4CEYB 3GZTB 4MGIE 1VBA3 4RR3B 4E2GA 1EP0A 1A6CA 1KQRA 4Q8LA 2YMZA 1Q43A 4BMBA 5CU1A 2CGNA 1IS5A 4CRQA 1W6OA 1NCRC 1SLBA 3HD8B 4Q26A 2HWC1 4AFAA 1ND3C 3KLSA 3GBWA 1HRV1 1W0OA 2AGSA 1Q8OA 4M3CF 3WR0A 4YG0A 1AYN1 1AUYA 1ND2C 4RQPA 2ZGNA 1YFXA 1MS8A 2AREA 3MGUA 4LBLA 5KXDA 2FZ2A 3VDDB 5JSOA 3PMEA 3ZVXA 1ULCA 2PAEA 4I0BA 2ZGKA 4QQPA 3FUOA 1GZCA 1MEC3 1VIWB 2VMHA 4Y4YA 2RM22 2VXRA 4K6BA 4CP0A 4D3WA 1KRIA 3VBUA 4FPYA 2GH2A 3VHOA 3I8TA 1Q8PA 4Y5Z0 3SMHA 5J3UA 4AE2A 1OLQA 1RVF2 4ONUA 4IEQA 3H0OA 4HN0A 4QPIC 2B7YA 2WFF3 3B93A 3PVBB 3PHMA 4Q27A 3GZUC 4LO7A 2EAKA 2D3SA 4LO6B 4LUKA 3E97A 2QFEA 4PQ9A 4LR4A 1RUC2 1ULDA 3VGIA 1CESA 3ZXGA 3OF1A 1HXS3 4AHXA 4GKXA 2DTYA 3NKGA 4XHBA 3VKMA 2ARXA 3OPZA 1QXPA 4Q4X3 4G9SB 3D82A 1ZVFA 1NE6A 4OLLA 4N9IA 5FMOL 5IUQA 1OI6A 3VL8A 2RS51 5FOJB 1MS4A 2DVAA 4GWMA 3P3NA 2WNVC 1DGWA 3I54A 1H8TA 4X8NA 1R092 4IXLA 5SV8A 5C8CC 3IBMA 1KXGA 2A7AA 1BBT1 4JV4A 4KWKA 2ZHMA 2YV8A 3O0WA 2GALA 2W52A 3EO6A 4ISRA 2R043 2EA7A 3RMYA 1NA1B 1MS5A 2EVXA 4FPJA 5EFUA 4W65A 3KT7A 4K3UA 2Z69A 3AM2A 1LHVA 4IL7A 4W6WA 4YGDA 3FUQA 2DWRA 1UIKA 5I8SA 1MR5A 5I0SA 1FI2A 5FQ0A 1GYKA 4OHVA 4JRAA 4LBQD 5JIUA 4QXKA 1G86A 2JEMA 4Q4V2 2WNEA 1V70A 1LHNA 4HPKB 3ZN4A 1BZWA 2NM1A 2BYVE 3NAPA 3R4UA 4RR3C 1RUG1 3OBRA 1C3HA 5HI0A 2WZR1 2QKDA 4IQPA 4N43B 3AP7A 1DFQA 5JWPA 1RJ8A 1ZA4A 3G7DA 1DZTA 1Z78A 4P9WA 3GHMA 5GZGA 4Q1PA 2CTVA 3K48A 4CDWA 3DPRA 2IWGB 5JOZA 5LK7B 4EN9B 4BA6A 4Z8BA 1PZ9A 3TN93 2FMDA 3B9IA 2A75A 3NV1A 2DCTA 4JGYA 3VBHA 4M0HA 3CNAA 5JDBA 3RPQA 4B7KA 3WUDA 3I59A 5C4WC 1Q5OA 1V6LA 4E2SA 4GWNA 3AMHA 1PGW2 1EAH1 4RL7A 3SCHA 5KXEA 2QZ2A 4XFFA 4DRVA 4Y20A 3BOPA 1RUOA 1GQGA 3ROUA 2WT2A 4HBNA 1XU1A 3IDCB 1Y9QA 3ECQA 3KD4A 4HSJA 3UV9A 1HW5A 5JI9A 3G6JB 4FSJA 2C1FA 2UY8A 3ETQA 4XZPA 4XMAA 1ZRDA 1XNKA 2GC1A 3FLRA 1WCSA 1JHNA 4LBQA 2P17A 1LGBA 1TME3 2B9UA 3T1MA 1A8DA 1O4ZA 1H4GA 1Q56A 3D4KA 3S6PA 3OY8A 2TBVA 1FX5A 4B4PA 2BFUL 3WDXA 3ZFEC 2R062 4FQ4A 4P9LA 2YZ4A 4BLJA 4YRDA 1LGNA 4NHMA 4CEWB 1ASJ3 4NVPA 1DQ0A 3VHRA 4PLOA 4K21A 5DG2A 1CIWA 5FCCA 2Z42A 1LRHA 4BE3A 4A7ZA 1IS4A 4CDXA 1RUJ2 2EF6A 3MFAA 4AYUA 2AYHA 1AX1A 3HT1A 1W6PA 4AGRA 3VBFA 1Q8VA 1WLDA 4RHV1 1H8VA 4LBOA 3WW1A 5H9PA 4ZKTB 5BY5A 2VNGA 1N3PA 2SBAA 3SITA 2VH9A 3D0SA 2ZMLA 5BNPA 3RZZA 1XQNA 4Y22A 3AJZA 2QVSB 3KQRA 5CFCC 3LWCA 1SBEA 1AR83 5I91A 1ZZCA 4N43C 4FPCA 4RS5B 4XFCA 4XF4A 4GXLA 4X8PA 3ZN6B 3IN9A 1X7NA 4FVVA 1SFNA 2ZBJA 1O3TA 1DGWX 5D8AA 4WM8C 3VN4A 4COVA 1HX6A 1IZ3A 2NZ9A 4ASLA 4IV3A 4COYA 2HKXA 2OIIA 3ZYRA 1AYM1 1FMD1 1PO11 1V9U1 1ZZ7A 4PBOA 1DIWA 1VB4A 2UYBA 3AP9A 3OBTA 5JOXA 4MLOA 1RMU2 5DG1A 1RUE3 2X5IA 4N53B 1FOD1 1HKDA 4Q0SA 1FATA 1ENRA 2GAUA 4MX3A 4JQRA 2QZ3A 2WQ4A 2A6XA 1SDWA 2DCZA 4WM7A 1WD4A 4FCAA 2A3YA 4GMP0 2Y26A 1H9PA 1VJ2A 4AI3A 3ZFGB 1BYHA 2VGDA 3USUB 1JYCA 4K40A 2P3IA 1S0GA 5E89A 3S7EA 4ES8A 2MEV1 2HWD1 2W39A 3MICA 1B35C 2A5ZA 2K9ZA 4H3WA 5EYXA 2YUEA 4Z07A 4BIFA 2R30A 4OI4A 1DQ6A 5JOYA 1URXA 1QKQA 1SMVA 2RHPA 2ZGLA 1D4VB 2Q1MA 1PO22 3OGGA 4AVVA 4D94A 1FV3A 3V0BB 5IK4A 3ST7A 1ZBE3 2IXJA 2PA7A 1MZ5A 1NXD1 3HWJA 3OD4A 1RVF3 4KH9A 4E27A 5A32A 1REEA 4UBGA 2X29A 3RJ2X 1SEFA 1NYWA 4YW5A 2WS93 4RGGA 4I02A 2RJLA 1DYPA 1NCQB 1W6NB 3TBDA 3TNQA 4TLFA 5FPZA 2KXLA 3BODA 5LRRA 3MLJA 2XJRA 3DKWA 4YVWA 5J98B 3ZPYA 1VAKA 2JG8A 4P9GA 3SH3A 1DDLA 3B69A 1SBFA 1RHI2 4XOGA 4Y24A 4GMP3 3WG3A 4L9BA 4WVMB 1VBA2 3N7JA 2R32A 3M4FA 5I0TA 3NV4A 1DYKA 2ENRA 4HN1A 2CY6A 4ASMB 2IFRA 3LSEA 3V65A 4EN0A 1FV2A 4Y1UA 3RDIA 2XLGA 4HETA 5BNNA 5F1RA 3N7MA 1C8M3 1AL23 2XJTA 1YO8A 4F3JA 5EJ3A 3WHUA 3DL3A 3AXEA 2ZGOA 4B3NA 1W6OB 3AYAA 2VUJA 2NPIA 1UX6A 3MW2A 4YG6A 4NHKA 2HYKA 4L92A 2AENA 4QGNA 1VRH1 1T6GC 1YNAA 4XW3A 2O8OA 5GZEA 1MEC2 2C9AA 2GN7A 5I8YA 1IKPA 2FQPA 4XQDA 1EV13 2Q30A 2RMU1 1W6MA 4XFGA 5IK5A 5CA6A 2XLAA 3AMMA 1WMDA 1Z7S3 2XWBB 1PGSA 5K8SA 2KA3A 4XFHA 2GNMA 1VR3A 3AKTA 4BH9A 2V09A 2ZPXA 1KDMA 2R1DA 4GH4A 1A8MA 2WFF2 1PZ7A 4MH0E 3TNPB 4QQHA 1YXWA 4PDWB 5J36A 1MQTA 4KGGA 3INAA 1DGLA 4URTA 4RFT0 5CADA 1TNRA 1UU5A 1PGL1 2Q0AA 2IFWA 4U2AA 3MIGA 4Q0QA 1HXS2 4QMAA 3QD6A 4AEJA 3POSA 4Q4X2 1CAUA 4B4QA 1VALA 1KDKA 4YGEA 2ZX3A 4AW7A 3WP3A 1E57A 3JUUA 3ZSEA 4Q4W3 2ZX1A 4O9EA 4QPGA 2ZACA 4KU8A 4NR1A 2LTNA 3U07A 4YGCA 4ES9A 2BEOA 3M1HA 4W6YA 5L19A 4AI1A 3PLQA 3WD5A 5GLTA 1W2UA 2O8QA 2PLV1 1LB2A 1CGPA 3VHPA 4M3CE 3VKNA 1UIJA 1NCQC 1NQJA 3W58A 3ILNA 3RWNA 3WZ1A 2VY0A 1RINA 4FAGA 2R042 1D4M1 3ES1A 4XBNA 4PIZA 3OJBA 1PHMA 3WNXA 2A70A 3M3CA 1OOPA 3IM0A 4RA0A 2ARBA 1VP6A 2W68A 1PM7A 2F4PA 3HR9A 1GANA 3FLPA 3H7JA 4JTOA 1R1A3 1BEV3 3AMNA 4LT5A 4GULA 4WVZA 4UW5A 4AK3A 4IETA 2I07B 3WQ0A 3KCYA 3KCCA 4YARA 1RL3A 1FNZA 4XBLA 2PHDA 1AHSA 3AMPA 1WUVA 2EXHA 1PVC3 4H7MA 3V0AA 4AVTA 5BXXA 1ENQA 5ABJB 2D6OX 1XYPA 1POV3 3HBZA 4FTEA 4S2DA 3TN92 3BIWE 3AKRA 4HT1T 2PTMA 1QNYA 2RM21 2VOKA 4CDWB 3DPRB 1KITA 1NY72 5EZWA 1CAXA 3WG2A 1LEMA 2RS13 5FO8B 2JG9A 3CU7A 3H7YA 1PZ8A 5GLZA 1K5MA 1JOJA 3ILRA 4JAAA 4DOUA 1RVF1 1BVP1 1FNYA 4AEDC 1V00A 3OGJA 5K0UC 2RS33 3HMYA 3I59B 4EWAA 1MS9A 1IGOA 4PDWC 5D1IA 1QWRA 3H8UA 1RUC1 1ZZ8A 5J96B 1COV3 2D6KA 4XJ9A 3GBFA 3ZYGA 2DU1A 3N3HA 1REFA 3VBOB 3FJSA 2UY9A 4BIOA 3LGRA 1TME2 2D5HA 3FZ3A 3J4UH 2DVGA 3RYKA 3V56A 1V6NA 1PK6C 1LOFC 2P37A 1CX4A 3WINE 5DZGA 4LE4A 2ZMKA 3PVNA 5I0UA 5C9AA 1LODA 4LBQB 2WKKA 5DZFA 1IHMA 4QM8A 3I2DA 1R091 4HANA 2ZKLA 4PBPA 1G7YA 1ASJ2 3SLIA 2R49A 3OY8B 2QDRA 4OHXA 5C33A 4R52A 2G9FA 2JE9A 5JSRA 2XGXA 2OA2A 1EPWA 2IC1A 1QOSA 4AVCA 2D7FA 3IMNA 4AGVA 2VOXA 3BALA 4F7ZA 5AFEA 4Y1ZA 2VW0A 3E5XA 4G3YC 1VBB3 4YFWA 3W59A 3FC0A 5E16A 4LLFA 1FAYA 3K51A 1W6QA 4Q4V1 1H1AA 4EROA 1TMF3 4CDUA 4S2FA 2Y0IA 1W6PB 2D6LX 4Q29A 3MW4A 5ACA3 3QACA 1EV11 1V6OA 1QJX3 3NV3A 4V1PA 5JZGB 1ONAA 3VBFB 1RUI2 2WNUA 4CDQB 3VZKA 2E7AA 3LA2A 1EYBA 1BJQA 1LESA 3SXWA 1S0EA 3ZMNA 5KHGA 1AR82 3NVCA 4PF5A 4Z82A 5CVRA 1ZRRA 3EHKA 1I6XA 4R9BA 4OI1A 2NP0A 4Y22B 3VV1A 5ABJC 1OHFA 1OPMA 5JAXA 2UWCA 2Q4SA 2P2KA 2ZS6B 4KQ7A 3KT1A 4OHWA 4YZ2A 1O7FA 1RUE2 1YRZA 3FE5A 5D8AB 4AQ2A 4YG3A 4AFCA 1X50A 4IV1A 1F5FA 3L9JT 4XIKA 4YNIA 1PGW1 4L2NA 5HXVA 1OSGA 1G8WA 1UCXA 1XNCA 3CJIA 2XB6C 4Q4Y3 1PMIA 2BQPA 3VBSA 1H2KA 4WM7B 5KBFA 3VBRA 4YW4A 1MVEA 3DV8A 3S7IA 2D6PA 5AC93 3AZZA 2XPJA 2VQ0A 3VBOC 1LHUA 5BNOA 2FMYA 2VOVA 2CGOA 4KG0A 2A3XA 2XBO3 1RB8G 1ZBE2 4CYDA 4Q2FA 1AZDA 1S0DA 2BUKA 2R061 1LOCA 4JCKA 4JDMA 4WBBA 1RUH3 2WS92 1DQ1A 3DUIA 1J58A 1DQ5A 1H0BA 1W0PA 2R073 5C8WA 3ALQA 3ZIXA 4HVQA 2AH2A 4YZ5A 5IK7A 2XUMA 1RUJ1 1TE1B 1UU4A 2TEPA 3WY6A 2WA4A 4XXAA 4SBVA 4A2UA 3EJKA 4OFGA 5FLIA 1KFXL 3GALA 5KWRA 2CV6A 2ZX2A 2BVVA 3H3ZA 4YVSA 4YVWB 4INDA 1NE4A 1RTVA 1GICA 1RUD3 1LHWA 4XBQA 2XH6A 4U36A 1N47A 1VAMA 4P9JA 5JZGC 4FP2A 1DU3D 2PHXA 1JBCA 4CDQC 5CG9A 2VG9A 4JC1A 4FOWA 1GLHA 4QT6A 4A7KA 5FFOC 1C8M2 1AL22 1QNWA 4EN7B 3ATGA 3B7MA 2WWSA 3LA3A 3PNAA 3QOPA 1ZBA3 3THPA 5I8TA 3N7KA 1MS3A 2E53A 3WDVA 3ZFFB 5BNNB 4DINB 1KS4A 2VVDA 3LA7A 4OHZA 4JTNA 4C1XA 1EY2A 5FOBB 4AEMA 2E63A 3I4IA 4AI0A 1SCSA 1O91A 2JKBA 2VQAA 4CEYC 1RMU1 1I5ZA 2ZABA 1EV12 1DHKB 2WT1A 1QF3A 5F6KA 2KM2A 4KNCA 4WZCA 3AYDA 2PHRA 1LEDA 1Z7S2 2FBEA 3ZXEA 2B45X 3RI9A 2XJQA 4C1WA 2IXIA 1LULA 5JI7A 4MVTA 1WW6A 4XE9A 1FYUA 4AG4A 2ERFA 1W6MB 1AVBA 1OA2A 2EAAA 1VBE3 2OUHA 4AVBA 3D8CA 3IWZA 2TNFA 4GA9A 3EQEA 1AXYA 5FO7B 2GMEA 4GH4B 3VDDC 4C90A 2YYOA 4JGZB 1PO21 4MXVA 5K9YA 1MQTB 1MVQA 5KHKA 3NSTA 4OVEA 1S0CA 4XFAA 1VBB1 3TAYA 1DLLA 2GMPA 2LUWA 4FPKA 2EXJA 2H0VA 4Q4W2 1J1LA 4R8HA 3IPVA 1Y7BA 2A6YA 1CAUB 3J8F3 1TMF1 5JIAA 1NCRA 2JE7A 3DF0A 4HZFA 4BLIA 1QJX1 1X33A 2GDFA 1RGSA 3DN7A 2HWE3 1ND3A 3M8LA 3ELNA 2QQPA 5JPMB 3OCPA 3A0KA 1ENSA 1OQ1A 3ILFA 3TRSB 4AFMA 5AFBA 1QJY3 2RE9A 1OLRA 1ND2A 2MPFA 5GALA 3ZMOA 2HJIA 5EYYA 4I0WB 5CFDB 4OI0A 2XL9A 3ZXAC 2H0BA 2JECA 4FOQA 3ZXKA 2OYZA 1J1TA 1RHI1 1H4HA 4RSUA 5T3NA 1UW8A 4HFSA 3IT8A 1FT9A 2ZMNA 1I9RA 1VBA1 3NV2A 1R1A2 1BEV2 2ZAAA 4QGLA 3JQXA 3MZHA 1J3PA 1W39A 4OZXA 4AFDA 3ZIWA 4QPIA 3OYWB 1CR7A 3ZXLA 1TNFA 4XYXA 2GC3A 5L7OB 5F6LB 1AX0A 4PJYA 3V64A 4YW1A 1PVC2 4Q0PA 1NA1C 4GQ7A 1LKNA 1UN1A 3ZFFC 4S2GA 4DMIA 1R083 1PNGA 3B9CA 1DZQA 4LLOA 1IS6A 1VB2A 3CJXA 4MZUA 4FAHA 2ZJCA 3WDWA 3V0AB 1MEC1 3WOGA 3APBA 2MNGA 5J09A 1LJ7A 3RS6A 1QXRA 2B8MA 4L99A 4C0BA 5F9TA 1SLAA 1RUI3 4YW2A 4OUMA 2RS12 2GC0A 5L36A 5EWSA 1U5ZA 1ZREA 2WNVA 4DNYA 3ES4A 1C1LA 1B09A 5C8CA 2WFF1 1PVXA 1ZZBA 4FOYA 5EXOA 2CGPA 1CAXB 2V5YA 4IEZA 4L11A 4XJZA 1WMFA 2RS32 1RUH1 2JG9B 2R6QA 4XEZA 5CNAA 1S55A 5T55A 4M3CB 1K5MB 2C5DA 1HLCA 2VU9A 5CG8A 1COV2 1AR62 3RQ0A 4Y26A 2ZA9A 1HXS1 1JW6A 5FDBA 2BVBA 1WCKA 3AX4A 4L97A 4Q4X1 1LOBA 3N4MA 1V6MA 3VL9A 2DCKA 5KXBA 4Q1RA 1RITA 5JCTA 4RR3A 4PLMA 1AXZA 1RUF3 1HQWA 4AFBA 2GMMA 4HVRA 2A6VA 2I2SA 2A73B 2ZZQA 1Y43B 4K9SA 1OFSA 2UWAA 4WVVA 4Q8KA 5C9AB 2YHJA 2ZHNA 1S0IA 4COUA 2R041 1IS3A 1D0GA 2R0HA 4OHYA 2A3WA 4LE3A 4ZU4A 1VBD3 5A3MA 4KL1A 1YI9A 3O7OA 5IT6A 5H9SA 1VBB2 2Y0OA 3JBG3 1ZZ6A 4QU2A 3AMQA 4WZFA 2JICA 1N1YA 3M7AA 3VHNA 1JUIA 1CJPA 2OVUA 3OD0A 5DUVA 1NXMA 1TMF2 4NN0A 5C4WA 4AVAA 5ACA2 3KT4A 3B00A 1QJX2 1ZZ9A 2DCYA 4EV0A 3GF6A 1NQDA 4CEWC 4BM8A 1BXHA 4AQ6A 3D0JA 1BCXA 1BMV2 1W6QB 1AR73 1GV9A 3AYEA 3FFQA 4H7LA 3JD73 4FPGA 1JUHA 1N3QA 4XJWA 5L7OC 2WNUB 3ACLA 3LB9A 3D6EA 4S2HA 1AL0G 1WLCA 3O0XA 2UU8A 4D7TA 1CAWA 4J1WA 4XFBA 3WP4A 4Z92B 1XNBA 4BOWA 3QH7A 3LOIA 5GZCA 4UBHA 4AXOA 1WLTA 3ZYIB 1CQ9A 3TN91 3WQ1A 5GZFA 5BYNA 1RC6A 3WCRA 1U5IA 1NY71 3X29B 2ZHLA 2WINB 1QQP3 4WV8A 4D7SA 2ZGSA 3ZFEA 1N1VA 5GJ6A 3VZNA 2G9GA 2D6MA 1U12A 2DTWA 4Q4Y2 4RS5C 3AJYA 4YW3A 2ZX4A 3FX3A 3JU9A 3VKOA 2PAKA 4DZGA 4K8FA 3SHRA 1X8EA 3BB6A 4FPEA 4BQ1A 2HWB3 3CJIB 1WD3A 2RR13 1YWKA 3WVJA 3CL1A 2BBVA 4HMZA 5AC92 4RQPB 1GBGA 3VBSB 3JB4C 4QHBA 4PIXA 1I3HA 3NL1A 2Z5WA 4UW6A 1LHOA 4IEVA 4FO9A 1TME1 4N53C 4DB5A 1UL9A 3VBRB 2XBO2 4GB32 4IERA 3LKJA 1O4YA 3LAGA 4O9GA 4AGGA 3P3PA 1MS0A 3KZ4C 2E7TA 4R9CA 1VLNA 2WLPA 4HPKA 4YZ3A 1LECA 5BNOB 2DUOA 5I0RA 2D3RA 3U4XA 1QJU3 5DDJ3 1QDCA 5FLJA 5FMOS 3VBUB 2OW4A 5CFCA 1DF0A 3ZFGC 1OFNA 1RUH2 1C4RA 3FHIB 3WDYA 1ASJ1 1O3RA 4N43A 1IPKA 1WW5A 2R072 4XTMA 3JB8A 3VZMA 2BNNA 4EWDA 4P9XA 2XJUA 4E2QA 4WM8A 1IKQA 3O0VA 1R081 4CP2A 4NWVA 4I09A 2XG3A 3JQWA 1XYNA 2XVLA 1IQAA 1QOOA 5FLHA 1AR93 1MACA 3MEPA 4YGBA 4IEWA 2WA3A 1RUD2 4LEJA 5GLWA 5LEKA 4FOVA 1DG6A 2P3JA 1CONA 3N7LA 3RRDA 1RUI1 2LM3A 1NOVA 3KGLA 3ZSLA 3GBGA 1APNA 3WXPA 1M06G 4IEOA 4YVSB 1HRI3 4LTAA 3WP5A 1BVVA 2QNKA 3ZSJA 1AR81 3SH4A 1YFYA 4P5HA 4OI2A 1H8TB 1B35A 1ZBA2 2HWC3 3M3IA 4YZ1A 4AQSA 4OULA 5HBAA 3GZAA 1HRV3 2PHFA 2H6CA 4LA3A 1AYN3 1YI7A 2YGMA 4Y1YA 2MHFA 1WW4A 3WT3A 1N1SA 4ZXKA 1RUE1 1AJOA