4CP2A

Crystal structure of epithelial adhesin 9 a domain (epa9a) from candida glabrata in complex with galb1-4glcnac
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
249
structure length
219
Chain Sequence
HYPRPEGCSSPPNAVSVGLHMDLYNYPYLYVKGQCWNPEYQDPNFPRYGYKKYGSFGSSDHVNGKISWDHNEFKEGCKPIMARLPTAYNYPAKITFSNFTMVLSGYFKPKSTGLYKFEIHADDFILFNFGSKNAFECCNREESIDNFGPYVAYAMWPNEADQELEVYLFEDSYYPIRLFYNNRDYHSKFMVGFYPPNTEEITYDFDGYLYMLDDTGNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPITHELIAL ADHESIN 9
publication title The Structure and Function of the Epithelial Adhesins
rcsb
source organism Candida glabrata
molecule tags Cell adhesion
total genus 59
structure length 219
sequence length 249
ec nomenclature
pdb deposition date 2014-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10528 GLEYA GLEYA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4cp2A00
4AF9A 4AHZA 2XJRA 4D3WA 4AI2A 4AFCA 4LHKA 4GQ7A 4COZA 4AI3A 4LHNA 4AHXA 4AI0A 2XJVA 2XJQA 4AHWA 4CP0A 4AFAA 4COUA 4AFBA 4COYA 2XJTA 4LHLA 4A3XA 4COWA 5A3LA 4COVA 4AHYA 2XJUA 2XJPA 5A3MA 4CP1A 4AI1A 2XJSA 4CP2A 4ASLA
chains in the Genus database with same CATH superfamily
4P00B 4M3CE 3K3OA 1POQA 2E7TA 2VZOA 2PFWA 3EBRA 4QXCA 2EAAA 3I2DA 1HRV3 1LGBA 1V6JA 4FPEA 2XQXA 2JDKA 4QQOA 5FZOA 2SBAA 3VLBB 1ULCA 2OS2A 2GU9A 3VD5A 3S57A 4A6OA 2XB6C 4ORFA 4UFJA 1OQEA 4CA9A 4CDQC 4GB33 4OULA 1PO21 2F17A 2UURA 4JVAA 1QKQA 4YVSB 1WLCA 2IC1A 4AAPA 4B4RA 5ACA3 2D3SA 4NIGA 1US2A 5SV5A 4B7KA 2QNKA 4DIQA 2WDBA 4RR3C 4FPCA 4YW2A 3L2YA 5J48A 1IS6A 1LESA 4NHMA 4QX1A 3PJQA 4YGEA 4PIZA 1RUG3 1SCSA 3S0MA 3LQCA 5TSWA 3ZDVA 2HWD3 5CZKA 4P9IA 1ZX5A 4QD2A 2LW8A 4X8NA 1OVPA 3FE5A 3WP4A 2C6SA 1VJ2A 5FTTC 4QDSA 1RUC1 2CV6A 1BEV3 1W6NA 4AXOA 1YI9A 2XJUA 2VCCA 4UW3A 2GNTA 1HV0A 2ZHMA 3UV9A 4U36A 3MUZ1 1UN1A 5KXEA 5HXVA 1GUIA 4FPKA 1NUKA 1U5ZA 2WLPA 5A7WB 3T2TA 5C9AB 5AC92 2VW1A 4J25A 2RS33 3POSA 2PHRA 3LD8A 2RM21 4V2VA 1AXYA 5LA1A 2W68A 5K8SA 3PURA 5C5UA 4AEMA 5GZGA 2D93A 2VTFA 1N1TA 5FMOL 5JLVA 4MGQA 1PVC2 1QJU3 4AVSA 2WYSA 2E53A 2X09A 1FOD3 5CADA 4YSFA 1MZ5A 4KBBA 4YW4A 4NUBA 4GKYA 4GWJA 4DUXA 1JYIA 2JXAA 3RJRA 2J1SA 4EN8B 1EV11 2QQMA 2TUNA 2A73B 2FDJA 2BV4A 2YDEA 4CCOA 1JXNA 1QJY2 1U5YA 2B39A 2PLV1 1OFSA 4XW3A 2XBO3 4K7JA 5A7QA 1NA1A 1PIV3 1RITA 1DZQA 1U5XA 2RR11 4AEDA 5C3RA 1N3OA 2ZEWA 1AYN1 4LOSA 1Y43B 3HQUA 3S6PA 3MV11 3PUIA 2VBDA 3WF2A 1OBNA 2DF7A 4LBMA 5LA9A 2BNNA 4D7YA 1ZZBA 3ZXAC 4X6RB 5L9BA 3MF9A 5HCAA 2FDKA 2RS12 5FZMA 3ZYJB 1M06G 1LEMA 4Q0VA 4D69A 1EYBA 1PVC1 2YYOA 4RN5A 5D8AA 4Q0UA 4YFWA 5GZEA 3WP6A 3R4DB 2WQ8A 4CU7A 4B4QA 1BLZA 1LJ7A 5A6YA 2UWCA 1BZWA 5E6HA 2WRAA 1J3PA 2DVGA 3OBAA 1AL0G 2WFPA 3I2OA 4CZSA 1C28A 3PVBB 4X8PA 4HETA 1KRIA 1ND2C 2Z4FA 5I8SA 1C4RA 3AVSA 2EXKA 1NLSA 1NCQA 2XG3A 3ZKUA 1RUJ2 3BB6A 3IDAA 3VBUA 3WG2A 4V2WA 1NG0A 5LASA 1A78A 2YGMA 3MIDA 4QX7A 4XJ8A 5FREA 4ASKA 3IWZA 2BQPA 2R6QA 3TEZA 1LHUA 4OYUA 1LGCA 3WR0A 5BNNC 1NX9A 1GP5A 1CWPA 2UWAA 1AL23 3O5SA 2O8QA 4FPYA 3TN91 1ZRCA 3VBRC 5FZIA 4PLOA 2R32A 2FDFA 4IEYA 1LHWA 2GN7A 2VVDA 4HKWA 2ZGOA 5F3CA 3LSEA 2R30A 1XNTA 3RQ0A 2VOXA 4LUMA 1RVF3 2CDOA 2VUAA 3LPGA 3QACA 4LKSA 3ZFGB 1R082 5CU1A 3ZSMA 3KV4A 1RUI1 4C91A 4W4ZA 2WWJA 3ZFFB 4IV3A 4QQPA 5IK5A 4AWDA 2W1WA 4WVZA 1VBA1 1YEWA 5LBCA 1QXJA 3MIGA 4IE4A 2VMHA 2PHLA 2CGOA 1XC6A 1JBCA 1ASJ3 4KWKA 1QY4A 3MI8A 4Y1YA 4QPIA 1CJDA 5LATA 4BQ2A 5HCFA 3K46A 4KG8A 2GP3A 2ZMKA 2WO3A 3RWKX 2XVGA 1AXKA 3URFA 3I3EA 4JRLA 1KGYA 4Q8LA 4A3ZA 1H1AA 4D0QA 5GLTA 1UCXA 2O1QA 1SHWB 2E7QA 3WHUA 3UGHA 4YFZA 3H7JA 1VRH1 4HSJA 5J09A 2JKXA 3O7OA 4ASLA 3FHQA 3SITA 3DL3A 2VL4A 4YGDA 2WZR3 4ZU5A 4QHBA 2WNUB 2FMDA 3ASIA 5LY2A 2X5IB 4K1ZA 2VZTA 3GF6A 4JTNA 1W2AX 3LIHA 4GAZA 3SLIA 1GNYA 1LULA 2RE9A 3QLQA 4LOTA 4ZS3A 2ARCA 4PT6A 1MPXA 1JUIA 1W3VA 3ENRA 5FY1A 1S4CA 3AP4A 3OBZA 3UT0A 1W2OA 3AFKA 4NN0A 5HBAA 1JH5A 3DPRB 4DS0A 1BK0A 1GR3A 1QJZA 5GKAC 1Q56A 4Q4W3 5FXVA 2ARBA 1F9KA 2R1BA 4OHXA 1KJRA 2OYZA 3SCGA 1F5FA 3CHXA 4KL1A 5FMBA 3UYJA 5A7NA 3O1TA 4FOVA 1UIKA 2ZGQA 3L9JT 4MXVA 4CU8A 1S0BA 1Z7S1 2RJKA 4KWJA 1B35A 2BVVA 1G8WA 1F2NA 2B42B 2VNOA 4XPVA 4OZOA 4W65A 1ACCA 2RMU3 3N36A 4A45A 1JYXA 5A1FA 4HANA 3VBOB 1RUE3 2BRTA 1OOPC 2W39A 3OD4A 1WCSA 3NNFA 1ULGA 5IVYA 1I1EA 1R1A2 1EAH1 3RNSA 4UFKA 3VL9A 3RZLA 4CCKA 5ANNA 2GMMA 1RMU1 4K8FA 3PJYA 4XIKA 2ZGKA 5FP7A 5FZHA 3WY6A 4CSWA 2PHFA 5F9TA 5JPNB 1K5MA 5G04L 4YG6A 1JYNA 3LDRA 1K3IA 1QGLA 4PDWC 5FWJA 2XONA 2FCTA 3RZHA 4AQSA 3UL2A 2MEV1 1UY2A 3MDPA 5E89A 3JD73 1QDCA 4M4PA 3WD5A 1UOFA 1NY72 3K4DA 1MS0A 2RVAA 2HKXA 2VCMA 4JGZB 4XUQA 4AG4A 3OB8A 2PHUA 4CPBA 1W9FA 1JYTA 5E8AA 1PNFA 2FDIA 3ZFEB 4UFIA 2UY9A 5A1AA 1SDWA 4LO7A 4BQXA 1RHI3 1A6CA 3JQXA 4EWDA 1H8TC 1UY0A 1J83A 3AYAA 4R9DA 4OI0A 3N7JA 4D6QA 3GDBA 1RL3A 1CAVB 4I02A 4LHLA 4N9IA 4JRAA 4C0BA 4EJRA 4DEQA 5C70A 3R0RA 2A6YA 4BCUA 2CYFA 1S0DA 2VCAA 1WW7A 2WZ8A 2JDNA 1Y9QA 3OOXA 1NE4A 1OUSA 1H0BA 1BKZA 1O5LA 4P9JA 4RGKA 2QQPA 3H0OA 4INDA 4MHRA 3ZXKA 5IVBA 1JZ3A 1KFXL 3VHPA 2NPIA 3USSA 1ZZ7A 1WBLA 4HBNA 3C2UA 1CQ9A 3W59A 1AYM1 4LBQB 4NHKA 1UU6A 1COV3 3FLPA 1OA3A 5CFDB 5FYZA 1SPPB 3RYRA 4PHZA 4C1WA 5FY0A 4GULA 1S1AA 1WW4A 1X33A 2JG8C 3KCYA 3NL1A 4QB2A 2YG0A 1SBDA 2P3IA 2WQZC 5F32A 2HWC3 1TG7A 1S0IA 5IVCA 4ZU7A 3PLQA 3EB7A 3LPFA 2PYTA 3BU7A 1L3JA 2A6XA 3ETQA 4Q4V2 1J3QA 4UFLA 2JICA 2VY0A 2GNDA 4IERA 1RJ8A 2D6MA 3AMMA 1NQDA 3AZXA 4I09A 2W52A 2IZWA 5JWPA 1HN0A 4XF0A 3T08A 2BOJA 4BQ3A 4YVWB 4QQHA 3THTA 5FK8A 4UF0B 4AEKA 2ARAA 3USUA 4BDVB 2Q5TA 5BNPC 1QOTA 1WCDJ 4RQPA 2ENRA 3BTXA 2BWAA 4PBPA 5I8YA 1T6BX 5JOXA 4QU2A 4XBQA 1VBC1 2ZX3A 3ZKYA 2QDNA 4NOTA 1KXGA 4FXGB 4NHYA 5FPZA 1RVF2 1KEXA 5JR2A 1YO8A 5F8PA 1YXWA 2GMPA 4A2UA 3QD6A 1NCRC 3KMHA 4ES8A 1FI2A 1VMJA 5FV3A 4CXXA 1GNZA 4BU2A 3DYMA 1OFNA 4LJHA 4AI2A 4D3WA 1JYWA 4CCMA 3WNMA 3BKZA 2EIEA 1VP6A 2GC1A 2ZOEB 3HEIA 4Q4X1 3ZYGA 1TMF1 2HWE3 4B3NA 2Y6LA 2KM2A 3VBSB 1VBB3 2WS93 2MHFA 1QQP3 3NJVA 1YCIA 4UFHA 1J59A 2K2SA 2VAUA 1WMXA 3K48A 3VZLA 4LLFA 1S2BA 3O0XA 2ZXQA 4Y26A 5LBBA 1ULEA 3ELNA 4AI9A 2I07B 1VBE1 3OGGA 5F3EA 2AR6A 4QGMA 4ONUA 5F3IA 1AX1A 3J8F1 4HFSA 4Y1ZA 5FBZA 1C1LA 1GP4A 1CAXA 3NRUA 4JDNA 2QFEA 4QT6A 1HQLA 1OVSA 1JN2P 2UU8A 2W1UA 3B93A 2BEOA 5C7GA 4RGAA 1ZRFA 3SH4A 2YBSA 4XOGA 5CNAA 4CCJA 1BK1A 1O8PA 1UPIA 5SV8A 2HBUA 1ZBA1 2B8MA 3ZXLA 4DO0A 1V6LA 4WVVA 5FMDA 4FBFA 1CPNA 1DYPA 1YIFA 5KR7A 1MACA 4ZXKA 5T54A 2R042 1W99A 4FQ4A 2ZCWA 3GCXA 4JGYB 2ADEA 4WM7B 1RXFA 1UZYA 4WZCA 5A3MA 5GALA 3RYPA 2CTVA 2CAUA 4XILA 3AJYA 2VOWA 2DVBA 3F2ZA 1H1IA 2YPDA 3AKTA 1J3RA 1NXD1 3IDCB 2PQQA 1HB1A 2ILMA 4QX5A 2DURA 3PIJA 4RHV3 1FPN2 3MPBA 4MUVA 4Y22B 3ABZA 3AVRA 4JC1A 4XFBA 2PQSA 2QQUA 4HKLA 2ZMLA 2Q4SA 5C8CB 1RUD1 2G1MA 1ZBE2 4DXSA 2JD4A 1SFNA 3TEYA 5IK8A 3MHZA 4YARA 2ZGPA 3N35A 4LNVA 3WDYA 1S55A 3KV9A 2VXJA 2WR9A 5J37A 4BXSV 2JDYA 4JV4A 1HB3A 4Z1VA 1N1SA 5CISA 1VAVA 2EIBA 1H2KA 1IQDC 2GSYA 1W04A 1LRHA 3U07A 5FO9B 1YFXA 3WG4A 5FZGA 3B01A 4PI2A 4CDUB 3B9CA 3THPA 1KITA 1DGWX 2YXSA 2W2IA 2E32A 4AVTA 4MYEA 1L7QA 1N1VA 1G6NA 4GH4A 1CR7A 4P08A 2IWGB 2B9VA 4XEZA 1X7NA 2JDAA 3DUIA 4LULA 4LKEA 3SCHA 3T4VA 5L36A 1YNAA 3PMEA 4MG2A 4BH9A 2RDSA 4HXCA 3B02A 3QBQA 2ZACA 1KQRA 2GH2A 4QX2A 4N53B 5FY5A 3WVJA 4LK7A 1MQTA 1QJEA 1IPKA 3IPVA 5BNOB 5FXWA 3CZJA 1BMV1 1HB2A 3OEBA 3DPRA 1G7YA 2PAMA 4COVA 2VD7A 5I0UA 3VZMA 4JZRA 2DFBA 1YHFA 4UI9L 1PHMA 4AQ2A 2G19A 4PQQA 4AL9A 3LEKA 2JDUA 1VMHA 3IBMA 1V6OA 3M3QA 4IV1A 1R092 2JDPA 4RS5A 1JHJA 1RGSA 2NQYA 3KCCA 1NA1C 4XXPA 4BB3A 2AENA 1W0PA 3W58A 4AEDC 4YW1A 1D0GA 2Q8DA 4QQLA 5FP9A 1AR71 2WAOA 2VTXJ 1CGPA 2B46X 4IEZA 2I74A 1UZZA 1WUVA 2LRPA 2ZS6B 5IT6A 1NLRA 1MS9A 1PO23 3VBOA 3OJBA 3MIEA 4O7XA 5IYYA 5D8AC 2WNVA 2XL7A 2YPJA 3LEMA 1OA4A 3MLJA 3ZPOA 5H9QA 5C4WB 3L2HA 4FPJA 2JDMA 5LEJA 1DU3D 1XYPA 3VZJA 4CP9B 5JSRA 3BGAA 4AW7A 1OLMA 4Q4Y2 2Q8EA 1GP6A 1GV9A 1HXS1 2F6BA 2VH9A 3PU8A 5EXOA 5FP3A 4XFAA 3WQ0A 1V9U2 1NCQC 1OUXA 3LZZA 3ZN5A 3POBA 1BBT2 1PGSA 5FQ0A 1AR62 4JQRA 1CX1A 3PTRB 1RUC3 4QPGB 3BTZA 4CYDA 5DAWA 1W03A 1OLME 3W5NA 4HVOA 3NMBA 2XJQA 4FAGA 1IS3A 3NNMA 2TEPA 3HN1A 2RV9A 2ZGSA 1EPZA 4HOOA 4YRDA 2JIJA 2WN3A 4LT5A 3GHNA 4PLNA 1ZRDA 4GMP0 5CYYA 3UKVA 2ADDA 3ZYFA 5IFPA 2P6CA 5JZGC 3LB9A 2RM23 5IK4A 3U75A 2B7YA 2A75A 4N90A 4P5HA 2KA3A 2A6VA 3ROUA 3CL1A 3OPZA 4CEWB 2Z2SB 4GWIA 5EJ3A 1SLLA 4IV3C 2D6PA 5FZLA 3UGFA 1X9PA 1DQ6A 1QXRA 1HKDA 1UMHA 3ZOIA 3OG2A 3V0AA 5IWFA 3BOPA 3N7LA 1CONA 2CGNA 1E5IA 3J7HA 1JHNA 2NMNA 1EV13 2RJLA 4FFFA 4QPIC 1RUNA 1ENQA 1FNYA 2PMWB 4ZZ5A 1OURA 3LFIA 5F5AA 4Q5OA 5CFDA 5DG1A 2PLV3 1F5JA 1XSRA 5D1IA 1GFF2 2XUEA 2OQ7A 4LKDA 5FYCA 4XF1A 2X10A 3OPWA 2RR13 4FP3A 2YHJA 4XJZA 1LHVA 1RUH1 1AYN3 3C3VA 1ZREA 1O4YA 4Y20A 1W6PB 2WFF3 4C8DA 1LNSA 3LEGA 1C8M2 2XJSA 4XZUG 2WNEA 1L7LA 3NKGA 1PGW1 2QQLA 4F8AA 4FI9A 4RSUA 3FHIB 1IS5A 1DQ0A 5CKQA 5F1RA 2WZEA 3U1XA 1CJPA 4I0WB 2CWSA 2R061 3M3EA 4Q8KA 1UX7A 4H14A 3OUIA 3ZVXA 1HX6A 1TME3 3BIEA 1PO12 1UW8A 2PHTA 1X50A 1GZCA 2ZGNA 3NNLA 4FP2A 4WM8A 2Z42A 3WNLA 3IMMA 2XOMA 5JIAA 4B1MA 3ACGA 4XFGA 1K12A 4DB5A 3SH5A 3P3NA 5A6QA 2OZJA 2QE3A 4XYXA 4BJ0A 3V56A 4GZ9A 4N43B 3AFGA 4ZKTB 2WT0A 4EQVA 4DXZA 3A23A 4UAPA 4Z82A 4MGIE 5FUNA 5GZDA 4Q0QA 5IVJA 1LOFC 2QQIA 1KS4A 1SLTA 4XQ4A 1AX2A 1B35C 3C8XA 3TN93 4ZXEA 1RUF1 3MIBA 2W46A 4MHUA 2HWB2 1U12A 5JSOA 3CIHA 4TN7A 4XUPA 1OF3A 4PF5A 4DXRA 2V4AA 1OKOA 2BNMA 2EA7A 1A8MA 4K3UA 1TNFA 1LCLA 1GNHA 5A3WA 4TLFA 1RUI3 4UW4A 4AVAA 1GU3A 4LO6B 3RVHA 4XABA 4AHYA 4ATFA 1HN1A 1K5MC 5IVVA 1SFPA 1VBA3 3A0KA 1MVEA 5C3PA 3JBG3 1PX4A 3ZXDA 4EN7B 1OMIA 1URXA 2QQOA 1MR5A 5CFCA 4XDQA 1CAUB 4D7SA 1JZ2A 1MS4A 3VBFB 4MSVA 1PK6A 4L0PA 5F7UA 2HWF1 4JDOA 4OHYA 4OUEA 4YM1A 4ASMB 4CDWA 2YBPA 3INAA 1NCRA 2ZHKA 2D5HA 3POYA 4E27A 2X05A 1KFUL 5FWEA 1DG6A 2DUOA 5FZAA 1QJX1 1GQGA 4LBOA 3B9IA 1GMMA 4KMQA 1ZYBA 1VRH3 3ZM8A 4IQPA 1CIWA 1UO9A 3GZAA 3R05A 3ZMOA 4OI4A 2WABA 3KQRA 3WNPA 2EF6A 1HRI1 3RZMA 3KLSA 4CU6A 2H6CA 5ABJA 5T55A 1SBEA 4CP2A 5DDJ2 1YFYA 3ILFA 3V65A 2W92A 3H3ZA 4LK6A 2VQ0A 3ORJA 4YNIA 3RWNA 1FMD2 3ZIWA 1O3QA 2LALA 3VKFC 2IFWA 4Y22A 5HCHA 4YZ5A 1UOBA 2P3YA 3N9MA 1DCSA 3RGBA 4E4SA 2UYAA 4QKFA 3IZOA 3KVAA 4D94A 1UYZA 4IGQA 4U2AA 5J98B 5GLVA 2D6OX 4OHZA 4UOJA 2WO7A 2HBTA 5FMCA 2RS52 5LRRA 1UXZA 2A6ZA 3EQEA 4R8HA 3WF0A 4DPNA 1Z7S3 4FQZA 4K6BA 5JI9A 4XACA 1K42A 1W8HA 5LWBA 3J7NA 1PM7A 4NWVA 1H9WA 2WYFA 4EN0A 1XE0A 3OYWA 4GXLA 4F7ZA 3ZSKA 3U37A 2JE8A 1C8NA 3N9QA 1LR5A 1ULOA 4HT1T 4LORA 4S2HA 4XQWA 4CE8A 3I2FA 3E1F1 4BQ1A 3CZUA 2J1VA 1EAH3 3FUQA 4W6XA 1IKPA 1UU4A 5DAQA 1GQHA 2SLIA 1PZ7A 4L2NA 4EZHA 1VPHA 3E5XA 4JKMA 1RMU3 4XURA 5EJ1B 3ZYHA 5A7SA 1QMJA 1UPSA 2D5FA 2Y6JA 3KD4A 5FPAA 4DMIA 1JYVA 3BUCA 4TWTA 2GP5A 2JECA 3BCWA 4D6SA 1LKNA 2P1BA 2YC4A 4L8QA 4Y1UA 1JZ7A 3VD9A 2OPWA 3RSJA 5FPLA 3VV1A 4RQPC 1WA6X 5JAXA 5C3SA 2MEV3 2NZ9A 1IS4A 2LS6A 4AR2A 1O3RA 1H1MA 4Z8BA 2XJPA 5FDBA 4JX0A 4OI2A 4EV0A 1CD3G 1BQPA 1NZIA 5DZGA 3M7AA 5FYSA 3AP5A 3I2KA 5C8WA 3WSOA 4R9CA 4Q0SA 1W8ZA 4NMIA 2Y0OA 3SISA 3AZWA 3IDEA 3WOGA 3K77A 5DAVA 3GBGA 1WW5A 5KHJA 4CEYB 4AFDA 4LHNA 1I9RA 1SZBA 2XKOA 3ZR6A 2D44A 4ITCA 1IG0A 1SQ4A 3CJIA 3PIGA 2JIGA 1J1TA 4CDQB 1RINA 2ZAAA 2VMEA 3HNMA 2LM3A 5KXCA 2XVLA 2XR4A 4EE2A 1YLLA 1DIWA 3E5UA 1S0JA 2VZPA 5DZEA 2ZHLA 5FLHA 3KQ4B 5KWRA 1UQXA 2N7GA 2VW2A 4RR3B 2JB4A 3JXSA 4HL0A 1E5RA 1MZ6A 2WFF2 4YM0A 1FT9A 4M01A 5H9SA 5FJHA 1FAYA 2W3JA 2RG4A 1AYM3 2J22A 4XF3A 1YQ8A 1Y3TA 2P3KA 4E4HA 2BPA2 3H50A 1UU5A 2ZHNA 5J7MA 2FCUA 3V0BA 3IDBB 3I2JA 1QEXA 2JG9A 2PELA 3I3QA 5AC91 2J42A 4G4FA 2VZRA 3AP6A 3PDQA 1D2QA 4JHZA 3K75B 4BHPA 1WLWA 2R0HA 2VW0A 3VL8A 4NRMA 3VKNA 3RS6A 2G9FA 3I59A 4KWLA 2IXLA 2Y33A 3FWEA 3HAGA 3LFMA 2YFZA 4AGRA 3ZIXA 5BV6A 3O1OA 5K7PA 5KHGA 4QM8A 1VBD2 5FOJB 1QJY1 1UY3A 1W9YA 4YW5A 3VBHA 2BZDA 1UF2C 4XDOA 5FZDA 4LUKA 3UKNA 2GC3A 4B4PA 3LF7A 3THDA 2XMLA 1QIQA 1H4GA 1GANA 1UY1A 3WDVA 5L7OA 1VBC3 2W94A 3N9LA 3P1IA 4MOAA 4AFAA 1WGPA 2AEYA 4CCLA 2CSGA 4NE9A 1CZVA 1UYYA 3RFRA 3E6DA 1MS8A 2RS11 2Z5WA 3K3NA 3EYPA 4O61A 3G6JB 2JDZA 3OBTA 1GQPA 2VR4A 5A33B 3C7EA 2R072 3MW2A 5JZGA 5F6KA 5J1XA 1D4M2 4PIYA 1CZTA 1DBNA 1AR93 2NN8A 3AZVA 1IG3A 3FBYA 4Q4X3 1HQWA 2OUJA 1TMF3 1EPWA 4K20A 1UKRA 3ES4A 2X53S 4CUAA 4GH4C 2ZABA 1RUOA 3N7KA 1XNDA 3WNKA 5EYXA 2WSVA 2P4EA 3WW3A 4ZHNA 2O8OA 4IUGA 1RUJ1 1AR83 3DKQA 4AI3A 4BZ4A 1VBE3 3ZN6A 3RJ2X 3D5OA 2IXHA 3S5QA 1MQTC 1DDLA 2VNRA 3J8F3 5A32A 1LTEA 3IKWA 3WF3A 1LOEA 1UOGA 3NAPB 5LA2A 2JKBA 2WWUA 3DPRC 3ZYRA 2GNMA 4E2SA 4XBNA 3VKOA 1MEC2 4QX8A 3P3PA 4Q27A 4F83A 1CPMA 1Q8VA 3VDDB 4IV1C 4LTAA 2DYCA 4RS5C 4CVUA 4DY5A 1W6OB 2QKDA 3TRSB 1V6NA 4QXHA 1ZBA3 4FVVA 3WNNA 5JIUA 5JXJA 3CF6E 2HJIA 5FFOC 1ENRA 2VUJA 4RFRB 2ARXA 2FHRA 1R081 1CESA 2VBPA 3BPZA 2AACA 1M4WA 4LBNA 2Y38A 2WN2A 3VBOC 5JDBA 2JEMA 2QZ2A 3OTFA 2X29A 5BNNB 1NYWA 2BYVE 5AVAA 1HRV2 2WNVC 3VBRB 4J1WA 4LA2A 4Y5TA 1SDDB 4R52A 4MZUA 5C71A 4BYYA 3GALA 2FDGA 1NQJA 4LHSA 4M0HA 1YRZA 3AP7A 4LBQD 1GZWA 3OUJA 2D6LX 2QJVA 4GB32 4EZ4A 1CVNA 1WBFA 3KGZA 3PUAA 3BVCA 3KM5A 5ACA2 4KU7A 3BIWE 3P6BA 1RUD3 1SLBA 3SKJE 4MLOA 5GLUA 3LDBA 1CAWB 1NAEA 1STMA 2VZ1A 2Y64A 4PJYA 5JXHA 1DLCA 1LOFA 1JZ4A 5JR7B 1OKQA 4MXWA 5K0UA 2ZGRA 1CZSA 2HYXA 5K4LA 1D2SA 3ACLA 4A7ZA 2IXIA 1RUG2 3D4KA 4FCAA 3WQ7A 4FFHA 1W8OA 2EXJA 2QQJA 3ACHA 3GJBA 4IGPA 2HWD2 1Y7BA 2DV9A 4ET7A 2GALA 2OIIA 4GWMA 5DMYA 1YFUA 2V5DA 1WMFA 3WW4A 2GH8A 4J6GA 5DAPA 3KF3A 5C3QA 4GJZA 2J7MA 3WX5A 3U4SA 2TNFA 1BEV2 5FZEA 1ZZ8A 2Q8CA 4WVMA 1VE0A 3VDCA 4PF1A 2D43A 1Y9MA 1G9DA 2JX9A 1RJ7A 4IESA 2VC9A 3AYCA 5C5TA 4OHVA 5LY1A 2FZ1A 4IXLA 3H1YA 1SBFA 4HKOA 4DY3A 3N9PA 2RS32 2DFCA 2IXCA 3LKJA 2QVSB 2AH2A 2VUDA 2XJVA 2H6BA 5BY5A 3VD4A 2WIIB 2ET7A 3AYEA 4CP0A 4CU9A 5CFDC 1QJU2 3BPSA 5I93A 2OKXA 1FOD2 5DUVA 3D3AA 3UESA 2ZX2A 5FYUA 1R1A1 3BOWA 1AR73 4YVSA 3BI3A 1JI6A 4M3CF 1G9AA 5JPMB 1PGL2 4IDZA 1UYXA 1JODA 3PHMA 4QMAA 4OUSA 2IXKA 4BK4A 3LDKA 5HV0A 1QNWA 1W6MB 3KT7A 4FT8A 4O9GA 4W50A 4WZFA 4ZONA 5EFUA 2XBO2 5IW0A 3U0ZA 1PIV2 5FR3A 1NLQA 4XDPA 5GZCA 1DQ5A 5FLJA 4BLIA 4HPKB 4NIDA 1OOPB 2ZGUA 2ZZQA 1LENA 1NY71 4N9HA 1OSGA 4EN9B 3Q8BA 1F35A 1JS9A 5H9RA 2HH9A 1HXS3 1GKBA 5AFEA 2XQRA 2XJTA 4MGYE 3H1WA 4WM8C 2YROA 1H9PA 5E1RA 3KCXA 4FPHA 4CTEA 4BE3A 1JOJA 4XAEA 4YM2A 2BBVA 2JJ6A 4IEUA 2Y6FA 5FZCA 1XNKA 1X82A 4AYUA 4PDWB 4L99A 5JSPA 5LCWL 4BISA 1HJGA 2Y6GA 2P6HA 2QDRA 3WNOA 4AEJA 4A7KA 2GC2A 2Y6KA 5A7WA 1REEA 1S2KA 4A4AA 5C9AA 1XU2A 1QDOA 5I0DA 1ZRRA 3HWJA 2VG9A 4G9SB 5FKCA 4CEYA 2XDVA 3U10A 3AM2A 1G9BA 4AQTA 1AVBA 4HMZA 1H8TB 3T3YA 1ZZ9A 3VHNA 5T3NA 4F3JA 3PUHA 3RI9A 1OH4A 4Y5Z0 2CU5A 1YQ5A 4MV2A 1AL22 4P02B 1PMIA 4RYDA 5EWSA 3WEZA 1K45A 3ZMNA 4IGOA 1B09A 2R16A 3D0JA 4AK3A 1LEDA 1SACA 5CFCC 2ERFA 4PIXA 4H2AA 2WQ4A 3JCIA 3GJAA 1PK6C 5DPNA 1PMHX 4CDWC 3MYXA 1OI6A 2VJXA 3AMNA 2XJRA 3PVEA 3K4AA 2BU9A 5A6ZA 5JCTA 3LGRA 5FXXA 4GA9A 3WLUA 3TEXA 3HT1A 4W6WA 3PVOA 1K5JA 4Q4V1 1WMEA 1XE8A 2DCKA 1RUH3 3GZTB 4IE7A 4BIFA 2VOVA 3D0SA 3AP9A 1ASJ2 4A41A 2O14A 4CDXB 1Y4WA 1N3QA 2GAUA 2XUMA 3R4SA 4Y1VA 5DQ0A 2WJSA 3FX3A 2XHKA 4E2QA 5A1LA 2OVUA 1HJFA 2HYKA 3RYKA 4KH9A 3D8CA 5ABJC 2VOKA 2R063 4JDMA 5F6LB 3TB0A 4FPFA 5T52A 1MVQA 1RVF1 4R9AA 3QCWA 1V6MA 3AKRA 3CBNA 5FY7A 2WT2A 4AFCA 2WZR2 4DRVA 4FOYA 1OD3A 3MUY1 3CLPA 5IHRA 3OGJA 1IHMA 1YC61 4WBBA 1MS3A 2VZ3A 1UNBA 3VDAA 4AVCA 3H8XA 5L9VA 4FPLA 4BA6A 3I3DA 4NAOA 4H7LA 2AREA 2DWRA 3ZXFA 1JOPA 5I8TA 2E26A 3QH6A 1RUF3 1S0FA 5LW9A 4OZXA 1A8DA 5KHIA 3ON7A 1O4ZA 2XPJA 3RZZA 4Q4W2 3OGSA 3ZFGA 2W1QA 2A5ZA 2W87A 3ECQA 4N8MA 4NPRA 4KBZA 3O1PA 2RHPA 3FLTA 3ZFFA 4LBLA 1F4HA 3O1RA 1YFWA 3MLLA 1UL9A 5FZ1A 2XGXA 5JMCA 1U0AA 5FYYA 2WC2A 2RMU2 1YQCA 1R1ZA 3LOIA 2EVXA 3OBRA 4QX3A 1POV0 3NV4A 5F3GA 4BK5A 4Z07A 1DF0A 2JD9A 2FQPA 1RUE2 4A7YA 1IQAA 4M3CB 2RDRA 4YW7A 4ISQA 4L97A 3NAPA 4V1PA 2HWF3 3ILRA 1HB4A 1OLRA 1POV1 1EUTA 3OY8B 1OHFA 1XSQA 1H30A 2R041 3T1LA 1ZA7A 5FO7B 1GWLA 4CCNA 4GALA 1QJX3 2BWCA 3X29B 2DCYA 3H3LA 5FZ7A 2L9LA 4LO5B 2EIGA 1ZZCA 2Q0AA 2WNUA 4H7MA 5FAXA 2GN3A 1WA4A 2X5IA 2B4KA 3JD72 5G05L 2LROA 5FZOB 1TZOA 1FPN1 3CJIC 1W05A 1HRI3 2BOIA 3B69A 4Q0PA 2ZX1A 3A22A 3LE0A 1XNCA 1RHI2 1ZBE1 3WW2A 4ARYA 1C5IA 4MADA 2IVIB 3DXUA 4NPLA 4ATEA 3GBWA 3NV2A 1O7FA 3IM0A 1VB2A 2DVFA 3GBFA 4Q26A 3ZSEA 3A4UA 4AI1A 4WVWA 2ORXA 2NP0A 3NJZA 3DKWA 4XCAA 5KHKA 3EXUA 3POGA 1D7PM 3WG1A 3NV3A 1LGNA 5EPAA 4CXYA 3KV6A 4QPGC 3FC0A 3H1MA 4E9KA 5F5QA 2JG9C 3M70A 4IE0A 1OA2A 1WCUA 2Q1FA 1V0AA 4S2DA 3ZYPA 3KT1A 1Q5OA 2B45X 3E6CC 3AMQA 5T50A 5FZ8A 3IT8A 4LBKA 2J1RA 1W9TA 1COV2 5FPBA 3K51A 1Z78A 3AKPA 5DN2A 5B2GB 3O1UA 1F4AA 3CKHA 3POIA 1UMIA 4QGNA 1UD1A 1W90A 3FUOA 3RG0A 2FDHA 4Y3OA 4MO3M 2DTYA 2HWC2 1O5UA 5JUVA 1NXMA 2P17A 3VBHC 1R091 2ZGTA 4BXFA 3WHTA 1OD5A 1YJKA 4JGZA 3NQHA 5A3OA 2BBAA 1WD3A 3E97A 5FP8A 5L7OC 1UMZA 3ZFEA 5A6XA 4QU1A 2XL9A 1EP0A 1UIJA 3BTAA 2VUCA 4HN0A 4EWAA 3C7GA 3UKTA 1TQ5A 4LO4B 1GOFA 3SNMA 2P34A 2BERA 2PTMA 1NKGA 2H0BA 1CAVA 4R4ZA 1HV1A 2ZAHA 2D3RA 3DF0A 3ZXEA 4YM3A 1FYUA 1OH3A 2YB7A 2VXRA 4QQ2A 2GMEA 4QB1A 4Q1PA 2A1XA 4UBGA 4FXKB 4OVEA 1UZVA 4AEDB 3B94A 1NZCA 3SCFA 2DTWA 3OSDA 2IVJA 3N4MA 2EICA 3HJRA 4GMP1 4Q4Y1 4DFSA 4DUVA 3N9OA 4KGGA 1V9U1 3CQOA 4Z92B 1XXNA 3Q8CA 2Q8OA 3S5AA 1BBT1 2BFUL 1LOGA 2WO2A 4UYBA 1AR61 1ZVFA 5IVEA 4LBQA 3RMYA 2HWE2 3T4HB 3WUCA 1SPPA 2QTWB 1VBB2 2WS92 1QQP2 2NLRA 3PNAA 1AJOA 3KHCA 2E51A 4URAA 3A7QA 3AX4A 4B1LA 4N43C 1O3TA 1F31A 4P9LA 3FN9A 1EY2A 2ZTNA 2WNOA 1LU1A 3FJSA 5DABA 2A3WA 5AC93 1QH6A 4TZDA 1P8JA 3VBUB 1I5PA 3WCSA 5F5CA 4MGKE 5IATA 3HVDA 3J9SA 3M1HA 3VHRA 4H3WA 1PVC3 1C1FA 5DZFA 3KHBA 5CB7A 1S0CA 3VKLA 4ZZ8A 1VB4A 4XHBA 3OEAA 4OFGA 4AI0A 1VR3A 2WL1A 4YVWA 1S0GA 1H4HA 2B9UA 1PM4A 4UF0A 3UJQA 1ZNPA 1BXHA 1W2TA 1UX6A 3A21A 2ORZA 2J1EA 4ZY9A 3AC0A 1DGRA 3VZNA 3WF1A 4AVBA 2OUHA 3D82A 1AF9A 1ND3B 2D6NA 3OD0A 1QJY3 1TNRA 4XJWA 4BQWA 4BM8A 3I2GA 4IE6A 3AYDA 3WP3A 2QQVA 3MPPG 4OMDA 5AVPA 3VHOA 1ODMA 3I97A 4P9GA 4OQ9A 1UKGA 4IV3B 3AL6A 4DINB 3MFAA 3ZSLA 1LOAA 1C8M1 1NOVA 1XPWA 5K0UC 1W8WA 3N7MA 1MS5A 1ODNA 4RHV2 2OX0A 2RS13 3O1MA 2I2SA 2ZX4A 3IB3A 4BQYA 4CPBD 4QPIB 4CUBA 5LEKA 3POJA 4NIIA 3WP5A 1SG3A 3ZDSA 1BVP1 2PHWA 5FZ0A 3VBSA 5IJRA 4CDXA 2G9GA 2O0OA 1O91A 1C57A 2KD7A 3OF1A 4QHOA 1PO11 4TTGA 3NWKA 4XCBA 3EMRA 1GWKA 5FRAA 3MICA 1RUJ3 4JKLA 3O1SA 2W91A 1UYPA 2FCVA 3J7MA 4RD7A 1UZWA 4NRPA 4OCTA 3BYWA 2DVAA 1XBFA 2XXZA 2AUYA 2E31A 3F95A 1AZDA 4Y5SA 3GZEA 3T2QA 2Y34A 2CDPA 5FIXA 2HEVF 1FV2A 3HIFA 3KGLA 2HWB1 4W8JA 4KGQA 4UFMA 1QU0A 4PQ9A 2WSUA 3GYDA 1G86A 1BCXA 4P9WA 3I49A 3MW3A 1KS5A 5C33A 4QWNA 2WKKA 5LBEA 1GLHA 4YVSC 3W9AA 4EN6B 3CEWA 2IXJA 3EHKA 2BNOA 3HN3A 4JGYA 4G3YC 4WM7A 2OW4A 1R083 3UETA 2FMYA 3WDTA 2K46A 3CDZB 2Y26A 3SXWA 3WNXA 2VU9A 5DUWA 2CNAA 4BIOA 1B35B 1DGRN 2PHDA 4A44A 1YI7A 3OCPA 2VZVA 4AF9A 3IIAA 2VZSA 1ULPA 4LBJA 4MH0E 4JAAA 4XFHA 5C8CA 2VZUA 4HZFA 4BQ4A 3W21A 4AE2A 1PO22 3WXPA 3WZ1A 1I5ZA 3KV5A 4JKKA 3DYOA 2C9KA 2QUOA 2D98A 1VALA 1K5MB 5FZKA 1H2NA 1SCRA 4ARXA 1A34A 4XBLA 4CXWA 3DV8A 4Q1RA 4RGGA 3B7MA 3FL7A 4M0NA 4XAAA 1E5SA 4XC9A 3FFZA 4LMFA 3ZPYA 4CDUA 1IPSA 1FV3A 1YQ2A 4I3PA 5H9PA 3U11A 4RFT0 3H8RA 1SLCA 5C9AC 4AHZA 3I54A 1Z0HA 5FCCA 5DDJ1 4Q2FA 3S30A 4COZA 4FOWA 2EXIA 5FPXA 1E5HA 4CEYC 1FMD1 1ULFA 5DAXA 1RUC2 3PUSA 4YGCA 4FTBA 1RYYA 4TLGA 5D21A 1WLTA 4YPJA 4XVHA 3NNJA 2DBIA 4N53A 1YWKA 2R7EB 3BODA 5BNOA 3KB5A 3ZXGA 3JQWA 4I01A 3PMSA 4BQ5A 4L9BA 2V5YA 2C26A 2RS51 1UZ0A 2WT1A 5B4NA 3MF6A 2K9ZA 2RM22 3HNYM 1J84A 1JYCA 2BVBA 2VMCA 4OMCA 2XWJB 2ZGMA 5E88A 3SH3A 2VMFA 4XTPA 3GHMA 4NIHA 1LB2A 2DU0A 3AL5A 3B5LB 3JZVA 4S2FA 5FK7A 1ZZ6A 1ONAA 2ZKLA 1JTZX 2VQUA 4LHKA 4XUOA 1R1A3 3H8UA 5LK7B 3E6BA 3H42B 1SLIA 2IFRA 2P5BA 4P9XA 1V6KA 2HLEA 1JZ5A 2C9AA 4XIOA 3ALQA 5FYHA 2WZPP 1EV12 1UXXX 5L9RA 2DCZA 3SC7X 2ZX0A 2PLV2 3ZN4A 2V72A 2ZMNA 5C4WA 2Z79A 2VECA 3AMHA 4IEVA 3HMYA 3NO8A 3K2OA 3O14A 3WQ1A 2RR12 5D2AA 3VZOA 4CP9A 2WLQA 3ACIA 1AYN2 2ID4A 3SEPA 1HLCA 1DZRA 5JXGA 2UWBA 4M00A 3M3IA 4K9SA 3T0DA 3H7YA 1WCQA 4QPGA 5FYMA 1QXPA 5HI0A 3ATGA 1ULDA 3M2MA 4I3GA 3USUB 5LA0A 5BUVA 1TME2 3WDWA 4COYA 4RQPB 4YG3A 3T2PA 3W20A 2RDQA 2W08A 4N7IA 2AEZA 3WF4A 2VTXA 1REDA 2G9ZA 3CNAA 5IFTA 1UY4A 4NWWA 3POEA 4TYSA 1D0HA 3JU9A 2CAVA 3C7OA 1REFA 3M3OA 3MV01 4CEWA 1AUYA 2OZ6A 4FFIA 4GIQA 1XOYA 3HPNA 3ZFGC 1LHOA 2HEYF 1W06A 3RDIA 3QOPA 4K21A 2VO5A 1IOAA 4KI5M 4O65A 5EJZB 3ZFFC 2JWPA 2X8KA 4XUTA 2WFF1 2ZBJA 4PCRA 3NJXA 3I3BA 4ISRA 5JI7A 3SEEA 3TN92 4E8DA 1OPOA 1QH7A 4S2GA 5J96B 1I3HA 3FLRA 1CN1A 4PI0A 5BPXA 5J3UA 1W8FA 2F4PA 4UW5A 5FZ6A 2DUPA 5JOYA 1MS1A 3UNPA 4FPOB 2GC0A 2YFUA 4PLMA 4YZ1A 3NAPC 4ZU4A 2BGCA 3O0VA 4GD4A 1TME1 3CJXA 3M8LA 3RMXA 1DYOA 2EIDA 4KQ7A 5FZ9A 2DCTA 2A3YA 3HBKA 2W5FA 4XXAA 5F2WA 1RUI2 5FJKA 4KWUA 3VDDC 1W8TA 5BYNA 2C1FA 3IAPA 2D97A 1VBA2 1HQNA 1CAXB 1W6PA 1X9TA 3IN9A 2A71A 3LA7A 4Q4V3 1OQDA 3JBG2 1XRUA 4Y33A 5HCBA 3ZLIA 5A3TA 5JXIA 2RDNA 3HD8B 4NR1A 4LPLA 4QX0A 4DUWA 5FY8A 5CBLA 2D40A 2GNBA 2WNUC 3ZR5A 4NRQA 3V64A 2X5IC 1DQ2A 1XE7A 1VBD1 1XU1A 2EALA 1WLDA 2PHXA 4OQ8A 3TEWA 4HVQA 4UXAA 5CG8A 2BGPA 4E4DX 2P37A 4NO4A 1BYHA 1JU4A 2QCSB 5B4XA 2NMOA 2Y8KA 2ZGLA 5J36A 1VRH2 3N3HA 1ND3A 3MGUA 2C24A 1LOCA 1YUDA 4YYOA 5EV7A 2K0GA 4DQAA 4N43A 1LODA 1ND2B 3TYJA 1OPMA 1OT5A 4URTA 3TBDA 2R071 1DQ1A 2WA3A 4D7TA 4IEOA 1EUUA 5FUPA 1D4M1 3NKTA 4QDRA 5FYBA 3JBG1 4DXTA 2D3PA 1TEIA 3ZX7A 3DXTA 1T6GC 4QPYA 2YZ4A 3S7EA 5KHHA 3VD7A 3WCRA 3GM8A 2DDUA 5E16A 1DHKB 3I2IA 1MZEA 1XB9A 5FYTA 4LXLA 2ETEA 5FO8B 5APAA 4IETA 1W6QB 4UW6A 1WD4A 3G7DA 4HLTA 3POFA 1YYNA 4NAMA 5LBFA 1IKQA 3UJOA 3LOBA 1Z7S2 5F2SA 1KJLA 5FZ3A 4AFMA 4AGVA 4XF4A 4C0HA 2BTVC 3QH7A 4LE3A 2OT7A 2VQAA 4XUNA 1CAUA 1MEC1 3C7FA 3VBFA 3HQRA 3DECA 3I3MA 4GH4B 4EYUA 4O9EA 4XF9A 1O3SA 5EQUA 1C5HA 1N47A 3D6EA 5FPUA 2YBKA 4JGZC 1I6XA 1J1LA 3WT3A 1EAH2 4HK9A 4QXBA 4D8MA 3IAQA 1FATA 1POV3 3WUDA 3ZFEC 1OXCA 2BJSA 4HSLA 2R1DA 1RMU2 2R043 1MQTB 1N1YA 3IPVB 3MIHA 3R4UA 4P9YA 3UK9A 1YJLA 2WA4A 4QAWA 2D6KA 3J26N 4Y24A 1HRV1 1W8UA 2JB8A 2VBBA 1DGLA 1DQ4A 2MEV2 4IV1B 1OQ1A 2NYYA 4RS5B 3RZKA 3SMHA 3AJZA 1JZ6A 4GB31 1FPN3 2ZZJA 2BFUS 3O1VA 1C3HA 4GKXA 1VRBA 2PA7A 1PMJX 5ACA1 3FZ3A 5CVRA 3DCQA 2LTNA 5GJ6A 1ZM1A 4IEWA 1GZTA 1ZBE3 4K40A 3H8OA 2WUHA 1R64A 4BMBA 2Z69A 2WBKA 3ILNA 3NW4A 1XNBA 3SHRA 1H6YA 2WNVB 1US3A 4DOUA 2E9QA 1BJQA 1O59A 1WCKA 1RUG1 4QHZA 3HOBA 5IAVA 4JTOA 2HWD1 5FOBB 1G9FA 3FFQA 2VVEA 3GCWA 3CO2A 3B3QE 3TWIA 2WO1A 2YC0A 1QOSA 3NV1A 2FD8A 4X6QB 5EIYB 1BEV1 1U5IA 1V70A 2UYBA 1GICA 5FQ0B 1X8EA 1RXGA 4EROA 2VULA 4Z2WA 3HNBM 5FZ4A 2OQ6A 1AYM2 1DLLA 4XZPA 1FX5A 1RTVA 4AAXA 5LZ6A 5A7PA 1F15A 5CEHA 4CRQA 1H2LA 4YVWC 2CY6A 3VKMA 2J1UA 3ZSJA 4DRRA 1O4TA 4AHWA 2RS31 5BNQA 2DCJA 4IE5A 1ENSA 3ZYBA 3VB9A 3VD3A 4KNCA 4YW6A 3I8TA 3ZO0B 4I2OA 2ZJCA 1QJU1 1ZRIA 5I0TA 1R093 2R0FA 1AXZA 3FBMA 1FOD1 2OPKA 1KD7A 1O6UA 2C4XA 3EJKA 4NIAA 4JCKA 1UAIA 1X36A 4NHXA 5CG9A 5AFBA 1PGL1 3IMNA 5A3UA 3V0AB 4META 4HG6B 1RB8G 2ATFA 1VAKA 2XBO1 4AHXA 1PIV1 4CCCA 3VGIA 2CWMA 3WQBA 3PL0A 1XYOA 1XYNA 4OLLA 3VBSC 4CDXC 3J4UH 5EYYA 1VBC2 4CCDA 4XJAA 4AI8A 4CDQA 2CGPA 5ERLA 2V09A 2XHNA 2A6WA 4Q4Y3 4GMP3 3TAYA 3ZYIB 4P5YA 4Y20B 2AYHA 1V9U3 1QWRA 4R9BA 1DZTA 3ZXJA 1QHDA 2EAKA 2XKPA 1JUHA 1BBT3 1DGWA 5EP9A 4RR3A 5BXXA 5FP4A 4Z2AA 1AR63 1WZXA 3I2HA 5DXDA 4Q4X2 4UBHA 1AR92 4BMEA 1TMF2 5KC6A 2C0ZA 4I30A 1ST8A 4JQTA 3T30A 1DYKA 3TOJA 3WINE 5GZFA 3Q8AA 1AR82 2HEWF 4XMAA 4COUA 1VBE2 4D6RA 2GZWA 4WM8B 2R49A 4BOWA 4SBVA 4QKNA 1UOJA 2DVDA 2WINB 2JG8B 2V73A 1CIYA 5I0RA 4DEVA 3J8F2 2OA2A 2VQTA 4JGYC 4WM7C 4YZ2A 5I91A 5FZBA 2YU2A 4IEXA 2CL2A 4BWOA 1AL21 1GZ9A 1O8SA 4QGLA 4DZGA 4IEQA 4ZPIA 5DG2A 2VMDA 5C3OA 1H2MA 1FNZA 1TVGA 4KU8A 4NVPA 3AXDA 5IK7A 1FXZA 1Q8QA 3MEPA 4CUGA 1ZBA2 5FY9A 1Q8OA 1T2XA 4NROA 5F37A 3A0NA 1AR91 4MVTA 3U14A 4A42A 2E33A 5C8CC 2YUEA 3JB8A 3NJYA 5KXDA 4FPGA 4LEJA 4FO9A 3IIIA 4AFBA 1IGOA 1XQNA 1APNA 5BNPB 3MBWA 1KDMA 1AR81 4BLJA 2AZ5A 2VNGA 1ASJ1 3OGVA 3O0WA 1C8M3 2W95A 5CFCB 1CX4A 4AOCA 5A33A 1WW6A 2FBEA 2BUKA 1PK6B 4MGZE 5A3NA 1UWWA 5FYIA 3VZKA 4CDUC 2E6VA 2JDHA 4CDWB 4CUCA 1NCRB 1GBGA 1RUD2 4OI1A 1DFQA 3AZYA 1W39A 3J7LA 5L73A 5M0TA 3RI8A 2XLGA 1PO13 1Q43A 4ZS2A 5EHDA 3H9AA 2ZA9A 3KVBA 2WZR1 5I0SA 2YGLA 3HQXA 4N53C 4B29A 1D4VB 3GNEA 4J1XA 4COWA 5BNOC 3FHAA 1V00A 4LE4A 3R6SA 4FAHA 4LO8A 1QOOA 4EWEA 4QB6A 2E7AA 4YLZA 1VIWB 4E4ZA 2VZQA 3C7HA 2H0VA 2VOTA 3HR9A 4XETA 4E8CA 5ABJB 5HV4A 1A3KA 5F39A 1S2EA 3AXEA 3VDDA 2VMIA 1ND2A 3MLKA 1W6OA 3NNGA 1JZ8A 4W6YA 2HWB3 3KS7A 4Q4W1 5GLZA 3JUUA 5EZWA 3T0BA 3T09A 5T5OA 1W3XA 3SQOA 2ZEYA 1BMV2 5BNNA 4OHWA 5HPOA 4XTMA 3BTYA 2Y0IA 2LUWA 4LITA 3VBRA 1SLAA 2RMU1 3P5BA 2ZEZA 4A3XA 1W2NA 4AGGA 3Q8FA 1WKYA 4HK8A 1W6QA 1RUE1 2UY8A 3MW4A 5C4WC 1LECA 4K8RB 3OYWB 3ME2A 2VMGA 5FXZA 5GLWA 4YZ4A 1AR72 1BVVA 1TE1B 3AKSA 1AJKA 3BALA 4XQDA 2KXLA 5FMOS 3WV6A 2MNGA 2BW8A 4WV8A 1DP0A 1GOGA 1PX3A 2KR2A 3DEMA 4LLOA 4C1XA 2ZEXA 1CAWA 3HT2A 3N9NA 3ST7A 1JW6A 5A3PA 4AVVA 1AX0A 4AQ6A 1NT0A 5FLIA 5JOWA 3MO4A 5FYVA 3RZGA 2J1AA 2RJ2A 3I4IA 4HN1A 3WG3A 2PAEA 3POWA 2J1TA 3JD71 4P14A 1S0EA 1GOHA 1JOBA 1MZFA 2PXJA 2VNVA 4LR4A 4QDQA 4Y4RA 3T0AA 2XH6A 2AGSA 4K1YA 1W6NB 4FTEA 3I7DA 5IUQA 5A70A 5ISLA 1HXS2 2YC2A 2I45A 3AMPA 4NJ4A 2BDRA 5DDJ3 3RZJA 1RHI1 5KXBA 4ES9A 1W0NA 2D7FA 3BU0A 5LRSA 1FMD3 4CEWC 2YV8A 1Y9GA 4I0BA 3GZUC 3VUOA 2JE9A 4FFGA 4UT5A 4OUMA 3RRDA 4B7EA 1V6IA 2CHHA 1GSLA 3AKQA 4PBOA 1H6XA 2Q30A 4MGSA 5GM0A 4B8EA 5KC5A 1LAJA 3CJIB 4LIVA 5CKMA 2RS53 2IUWA 1PNGA 4YGBA 3AK0A 4GJYA 4Q29A 1E57A 4LQRA 1NE6A 1VAMA 5KBFA 5JMOA 4XFCA 1COV1 4MGTA 1RC6A 5CAZA 2Y6HA 3WDUA 4I0AA 1NA1B 3VBUC 3OUHA 2FZ2A 1IPJA 2VE1A 3Q8EA 4XJ9A 3MZHA 1W6MA 3V0BB 4SLIA 3HBZA 3LA2A 2F4LA 2HWC1 2VPVA 2XWBB 2JG9B 3KZ4C 2QBXA 2YMZA 3LSDA 4RL7A 4Y4YA 4HPKA 3U78A 2Q1ZB 1OOPA 3APBA 1OF4A 1W9WA 5FUIA 4HVRA 2DUQA 5D8AB 5A80A 1RUH2 2BGOA 4GWNA 3SKVA 1AHSA 4XHXA 3E5QA 1ND3C 3I59B 3OGRA 4L11A 2C5DA 1Q3EA 4IEPA 4L92A 4M4RA 3B00A 1PGW2 4RA0A 5DUUA 1H8VA 3KSCA 3LCPA 3VN4A 4XJUA 3PU3A 1W2UA 4DNYA 4BPZA 1J58A 2VGDA 2GDFA 4NHLA 4PDWA 2P2KA 4QPWA 1NCQB 2R062 2VM9A 5LB6A 3LIGA 3LEIA 3Q9OA 4YZ3A 5FBJA 3VBHB 4AZZA 5IVFA 1L7RA 2NM1A 2WWSA 4GQ7A 4FOQA 5C6CA 1ALYA 2DU1A 1ZA4A 5L7OB 2VVFA 1QF3A 3WW1A 4KG0A 1WMDA 4CCEA 2QZ3A 1JU3A 1XNAA 1G9CA 1H8TA 5CA6A 2W9XA 1SFYA 5FY4A 1SEFA 5A3LA 3ETPA 4XE9A 2JENA 3WDXA 2W0XA 2HWE1 3ACFA 2E63A 5JZGB 2ZKNA 2G4IA 4CP1A 1VBB1 1N3PA 2ET1A 1QQP1 2WS91 3GXUA 1RUF2 5FZFA 5F5IA 1W28A 3VBFC 3VDBA 4XFFA 2Y60A 1HW5A 3T1MA 5ANQA 4XMIA 2XLFA 1W0OA 3DN7A 2A7AA 3EO6A 3AB0A 1RIRA 1Q8SA 1YIPA 1ENXA 2JE7A 3ZN6B 4QM9A 5DUXA 2QQWA 1OLQA 4IW3A 4LIUA 3LWCA 5IAXA 2VCBA 4Y1XA 3U4XA 3NVCA 5A32B 5LK5A 4YG0A 5JVVA 3MFCA 5HXMA 1HIXA 2QQNA 5FPVA 3PTYA 3PVNA 2JG8A 2XLAA 2OXBA 2ZPXA 4H55A 4LA3A 4MX3A 3RPQA 1LHNA 3KWVA 2ES3A 1JMUB 3O12A 2HWF2 3CU7A 4QKDA 3M4FA 4XFIA 3TNQA 1F8VA 4R4XA 1VBD3 2AC1A 3TNPB 3UGGA 1BHGA 3H3UA 1QJX2 1GWMA 4QXKA 1W9SA 3KT4A 1KDKA 2EXHA 2DBNA 5T5JA 3DYPA 3AZZA 3PUQA 5A7OA 3ES1A 4TSVA 3S7IA 4RHV1 1IZ3A 1SMVA 3JB4C 5T5LA 4UWDA 1HRI2 1PZ8A 5BNPA 1GZWB 1QJFA 1LOBA 2R073 5CIRA 3W5MA 2V4VA 1D4M3 3CMGA 2P3JA 1VLNA 4NPMA 5CKNA 4HONA 2YY1A 4N7UA 1VMFA 2A70A 2Q1MA 2PAKA 3NSTA 4LKFA 1PZ9A 4FTSA 3ITQA 5L19A 4IL7A 2A3XA 2QQKA 1QNYA 1XJAA 4MXWB 5K0UB 3OPTA 2W1SA 1Q8PA 3LAGA 2B5HA 2WAAA 3M3CA 4A6SA 4E2GA 2YU1A 2MPFA 5FKBA 4JHTA 4QKBA 2TBVA 3T2OA 1PVXA 3THCA 5K9YA 1X8MA 3FMGA 1OC1A 1HDKA 4TXWA 3LA3A 1GYKA 2W47A 2PN5A 1LU2A 4M3CA 5T5PA 1MEC3 4FSJA 3BN6A 1W8NA 1YQ6A 3DGTA 4WVMB 5JOZA 3GGLA 4YWAA 3OY8A 2XVKA 4YW3A 2BP6A 3MIFA 3K4ZA 3KF5A 1WWYA 4C90A
chains in the Genus database with same CATH topology
4M3CE 2E7TA 2PFWA 3EBRA 2EAAA 3I2DA 1HRV3 1LGBA 1V6JA 4FPEA 4QQOA 2SBAA 1ULCA 2GU9A 2XB6C 4ORFA 1OQEA 4CDQC 4GB33 4OULA 1PO21 2UURA 4JVAA 4YVSB 1QKQA 4B4RA 1WLCA 2IC1A 5ACA3 2D3SA 5SV5A 4B7KA 2QNKA 4RR3C 4FPCA 4YW2A 3L2YA 5J48A 1IS6A 1LESA 4NHMA 4YGEA 3PJQA 4PIZA 1RUG3 1SCSA 3S0MA 5TSWA 2HWD3 4P9IA 1ZX5A 4QD2A 4X8NA 3FE5A 3WP4A 1VJ2A 5FTTC 1RUC1 2CV6A 1BEV3 1W6NA 4AXOA 1YI9A 2XJUA 4UW3A 2GNTA 1HV0A 2ZHMA 3UV9A 4U36A 1UN1A 5KXEA 5HXVA 4FPKA 1U5ZA 2WLPA 3T2TA 5C9AB 5AC92 2VW1A 2RS33 3POSA 2PHRA 2RM21 1AXYA 2W68A 5K8SA 4AEMA 5GZGA 2D93A 5FMOL 1N1TA 5JLVA 1PVC2 1QJU3 4AVSA 2E53A 1FOD3 5CADA 4YSFA 1MZ5A 4KBBA 4YW4A 4GKYA 1JYIA 2JXAA 3RJRA 4EN8B 1EV11 2TUNA 2A73B 2YDEA 1JXNA 1QJY2 1U5YA 2B39A 2PLV1 1OFSA 4XW3A 2XBO3 4K7JA 1NA1A 1PIV3 1RITA 1DZQA 1U5XA 2RR11 4AEDA 1N3OA 3S6PA 1AYN1 2XPJA 1Y43B 4LBMA 2DF7A 2BNNA 4D7YA 1ZZBA 3ZXAC 4X6RB 3MF9A 5HCAA 2RS12 3ZYJB 1M06G 1LEMA 4Q0VA 4D69A 1EYBA 1PVC1 2YYOA 5D8AA 4Q0UA 4YFWA 5GZEA 3WP6A 3R4DB 4B4QA 1LJ7A 2UWCA 1BZWA 1J3PA 2DVGA 1AL0G 2WFPA 4CZSA 1C28A 3PVBB 4X8PA 4HETA 1KRIA 1ND2C 5I8SA 1C4RA 2EXKA 1NLSA 1NCQA 2XG3A 1RUJ2 3BB6A 3VBUA 3WG2A 1NG0A 1A78A 2YGMA 3MIDA 4XJ8A 5FREA 3IWZA 2BQPA 2R6QA 1LHUA 1LGCA 3WR0A 5BNNC 2UWAA 1AL23 3O5SA 2O8QA 4FPYA 3TN91 1ZRCA 3VBRC 4PLOA 2R32A 4IEYA 1LHWA 2GN7A 2VVDA 4HKWA 2ZGOA 3LSEA 2R30A 3RQ0A 2VOXA 4LUMA 1RVF3 2VUAA 3QACA 3ZFGB 1R082 5CU1A 3ZSMA 1RUI1 4C91A 5IK5A 3ZFFB 4IV3A 4QQPA 4AWDA 4WVZA 1VBA1 1QXJA 3MIGA 2VMHA 2PHLA 2CGOA 1JBCA 1ASJ3 4KWKA 1QY4A 3MI8A 4Y1YA 4QPIA 1CJDA 5HCFA 4KG8A 2ZMKA 2XVGA 1AXKA 3URFA 4JRLA 4Q8LA 1H1AA 5GLTA 1UCXA 2O1QA 2E7QA 3WHUA 4YFZA 3H7JA 1VRH1 4HSJA 5J09A 3O7OA 4ASLA 3SITA 3DL3A 4YGDA 2WZR3 4ZU5A 4QHBA 2WNUB 2FMDA 3ASIA 2X5IB 4K1ZA 3GF6A 4JTNA 3SLIA 1LULA 3QLQA 2RE9A 1JUIA 3ENRA 3AP4A 3AFKA 4NN0A 5HBAA 1JH5A 3DPRB 4DS0A 1GR3A 1QJZA 5GKAC 1Q56A 4Q4W3 2ARBA 1F9KA 2R1BA 4OHXA 1KJRA 2OYZA 3SCGA 1F5FA 4KL1A 4FOVA 1UIKA 2ZGQA 3L9JT 4MXVA 1S0BA 1Z7S1 2RJKA 4KWJA 1B35A 2BVVA 1G8WA 1F2NA 2B42B 2VNOA 4XPVA 4W65A 3N36A 2RMU3 4HANA 3VBOB 1RUE3 1OOPC 2W39A 3OD4A 1WCSA 1I1EA 1ULGA 1R1A2 1EAH1 3RNSA 3VL9A 3WY6A 2GMMA 1RMU1 4K8FA 3PJYA 4XIKA 2ZGKA 5F9TA 2PHFA 5JPNB 1K5MA 4YG6A 1QGLA 4PDWC 4AQSA 3UL2A 2MEV1 3MDPA 5E89A 3JD73 1QDCA 3WD5A 4AG4A 1NY72 1MS0A 4JGZB 2HKXA 2PHUA 5E8AA 1PNFA 3ZFEB 2UY9A 1SDWA 4LO7A 1RHI3 1A6CA 3JQXA 4EWDA 1H8TC 3AYAA 4R9DA 4OI0A 3N7JA 4EJRA 1RL3A 1CAVB 4I02A 4LHLA 4N9IA 4JRAA 4C0BA 3R0RA 2A6YA 4BCUA 2CYFA 1S0DA 1WW7A 1Y9QA 1NE4A 1H0BA 1BKZA 1O5LA 4P9JA 2QQPA 3H0OA 4INDA 3ZXKA 1KFXL 3VHPA 2NPIA 3USSA 1ZZ7A 1WBLA 4HBNA 3C2UA 1CQ9A 3W59A 1AYM1 4LBQB 4NHKA 1UU6A 1COV3 3FLPA 1OA3A 5CFDB 3RYRA 4C1WA 4GULA 1S1AA 1WW4A 1X33A 2JG8C 3KCYA 3NL1A 1SBDA 2P3IA 2WQZC 2HWC3 1S0IA 4ZU7A 3PLQA 2PYTA 3BU7A 1L3JA 2A6XA 3ETQA 4Q4V2 1J3QA 2JICA 2VY0A 2GNDA 4IERA 1RJ8A 2D6MA 3AMMA 1NQDA 3AZXA 4I09A 2W52A 2IZWA 5JWPA 4XF0A 4YVWB 4QQHA 3THTA 4AEKA 3USUA 2Q5TA 5BNPC 1QOTA 1WCDJ 4RQPA 2ENRA 2BWAA 4PBPA 5I8YA 5JOXA 4QU2A 4XBQA 1VBC1 2ZX3A 2QDNA 4NOTA 1KXGA 4FXGB 5FPZA 1RVF2 1YO8A 1YXWA 2GMPA 4A2UA 3QD6A 1NCRC 3KMHA 4ES8A 1FI2A 1GNZA 4D3WA 1OFNA 4AI2A 1VP6A 2GC1A 2ZOEB 4Q4X1 3ZYGA 1TMF1 2HWE3 4B3NA 2KM2A 3VBSB 1VBB3 2WS93 2MHFA 1QQP3 1YCIA 1J59A 2K2SA 3K48A 3VZLA 4LLFA 1S2BA 3O0XA 4Y26A 1ULEA 3ELNA 2I07B 1VBE1 3OGGA 2AR6A 4QGMA 4ONUA 1AX1A 3J8F1 4HFSA 4Y1ZA 5FBZA 1C1LA 1CAXA 4JDNA 2QFEA 4QT6A 1HQLA 1JN2P 2UU8A 3B93A 2BEOA 1ZRFA 4RGAA 3SH4A 4XOGA 5CNAA 1BK1A 5SV8A 1UPIA 1ZBA1 2B8MA 3ZXLA 1V6LA 4WVVA 4FBFA 1CPNA 1DYPA 1YIFA 1MACA 4ZXKA 5T54A 2R042 4FQ4A 2ZCWA 4JGYB 4WM7B 1UZYA 4WZCA 5A3MA 5GALA 3RYPA 2CTVA 2CAUA 4XILA 3AJYA 2VOWA 2DVBA 3MFCA 1H1IA 3AKTA 3IDCB 1J3RA 1NXD1 4QX5A 2PQQA 2ILMA 4RHV3 2DURA 1FPN2 3MPBA 4MUVA 4Y22B 4JC1A 4XFBA 4HKLA 2ZMLA 2Q4SA 5C8CB 1RUD1 1ZBE2 5IK8A 2JD4A 1SFNA 4YARA 2ZGPA 3N35A 4LNVA 3WDYA 1S55A 5J37A 4JV4A 4Z1VA 1N1SA 1VAVA 1H2KA 2GSYA 1LRHA 3U07A 5FO9B 1YFXA 3WG4A 3B01A 4CDUB 3B9CA 3THPA 1KITA 1DGWX 2YXSA 4AVTA 4MYEA 1N1VA 1G6NA 4GH4A 1CR7A 2IWGB 4XEZA 1X7NA 4LULA 3DUIA 3SCHA 5L36A 1YNAA 3PMEA 4BH9A 3B02A 3QBQA 2ZACA 1KQRA 2GH2A 4N53B 3WVJA 1MQTA 3IPVA 1IPKA 5BNOB 1BMV1 3DPRA 1G7YA 2PAMA 4COVA 5I0UA 3VZMA 2DFBA 1YHFA 1PHMA 4AQ2A 3IBMA 1O3TA 1V6OA 3M3QA 4IV1A 1R092 4RS5A 2NQYA 1RGSA 3KCCA 1NA1C 4XXPA 2AENA 1W0PA 3W58A 4AEDC 4YW1A 1D0GA 4QQLA 1AR71 1CGPA 2B46X 4IEZA 2I74A 1UZZA 1WUVA 2ZS6B 5IT6A 1NLRA 1MS9A 1PO23 3VBOA 3OJBA 3MIEA 5D8AC 2WNVA 2XL7A 2YPJA 1OA4A 3MLJA 5H9QA 5C4WB 3L2HA 4FPJA 5LEJA 1DU3D 1XYPA 3VZJA 5JSRA 4AW7A 4Q4Y2 1GV9A 1HXS1 2F6BA 2VH9A 5EXOA 4XFAA 3WQ0A 1V9U2 1NCQC 3LZZA 3ZN5A 1BBT2 1PGSA 5FQ0A 1AR62 4JQRA 4QPGB 1RUC3 4CYDA 4HVOA 2XJQA 4FAGA 1IS3A 2TEPA 3HN1A 2ZGSA 1EPZA 4YRDA 4LT5A 3GHNA 4PLNA 1ZRDA 4GMP0 3UKVA 5JZGC 3LB9A 2RM23 5IK4A 2B7YA 2A75A 4N90A 4P5HA 2KA3A 2A6VA 3ROUA 3CL1A 3OPZA 4CEWB 2Z2SB 5EJ3A 1SLLA 4IV3C 2D6PA 1DQ6A 1QXRA 1HKDA 3V0AA 3BOPA 3N7LA 1CONA 2CGNA 1JHNA 2NMNA 1EV13 2RJLA 4QPIC 1RUNA 1ENQA 1FNYA 5CFDA 5DG1A 2PLV3 1F5JA 5D1IA 1GFF2 4XF1A 4FP3A 4XJZA 2RR13 2YHJA 1LHVA 1RUH1 1AYN3 3C3VA 1ZREA 1O4YA 4Y20A 1W6PB 2WFF3 1C8M2 2XJSA 2WNEA 3NKGA 1PGW1 4F8AA 4RSUA 3FHIB 1IS5A 1DQ0A 5F1RA 1CJPA 4I0WB 2CWSA 2R061 3M3EA 4Q8KA 4H14A 3ZVXA 1HX6A 1TME3 1PO12 1UW8A 2PHTA 1X50A 1GZCA 2ZGNA 4FP2A 4WM8A 2Z42A 5JIAA 4XFGA 4DB5A 3SH5A 3P3NA 2OZJA 2QE3A 4XYXA 3V56A 4N43B 3AFGA 4ZKTB 2WT0A 4DXZA 4Z82A 4MGIE 5GZDA 4Q0QA 1LOFC 1KS4A 1SLTA 4XQ4A 1AX2A 1B35C 3TN93 1RUF1 3MIBA 2HWB2 1U12A 5JSOA 4PF5A 2BNMA 2EA7A 1A8MA 4K3UA 1TNFA 1LCLA 1GNHA 4TLFA 1RUI3 4UW4A 4AVAA 4LO6B 4AHYA 4ATFA 1K5MC 1VBA3 3A0KA 1MVEA 3JBG3 3ZXDA 4EN7B 5CFCA 1OMIA 1URXA 1MR5A 4XDQA 1CAUB 4D7SA 1MS4A 3VBFB 4MSVA 1PK6A 2HWF1 4JDOA 4OHYA 4YM1A 4CDWA 4ASMB 3INAA 1NCRA 2ZHKA 2D5HA 3POYA 4E27A 1KFUL 1DG6A 2DUOA 1QJX1 1GQGA 4LBOA 3B9IA 1ZYBA 1VRH3 4IQPA 1CIWA 3GZAA 3R05A 3ZMOA 4OI4A 3KQRA 2EF6A 1HRI1 3KLSA 2H6CA 5ABJA 5T55A 1SBEA 4CP2A 5DDJ2 1YFYA 3ILFA 3V65A 3H3ZA 4YNIA 2VQ0A 3RWNA 1O3QA 3ZIWA 1FMD2 2LALA 3VKFC 2IFWA 4Y22A 4YZ5A 4E4SA 4D94A 2UYAA 4U2AA 5J98B 5GLVA 2D6OX 4OHZA 2RS52 5LRRA 2A6ZA 3EQEA 4R8HA 4DPNA 1Z7S3 4FQZA 4K6BA 5JI9A 4NWVA 1PM7A 4EN0A 1H9WA 4F7ZA 3OYWA 4GXLA 3ZSKA 4HT1T 1C8NA 1LR5A 4XQWA 4S2HA 4BQ1A 1EAH3 3FUQA 4W6XA 1IKPA 1UU4A 1GQHA 2SLIA 1PZ7A 4L2NA 3E5XA 1RMU3 1QMJA 1UPSA 2D5FA 3KD4A 4DMIA 4TWTA 2JECA 3BCWA 1LKNA 4L8QA 4Y1UA 3RSJA 3VV1A 4RQPC 5JAXA 2MEV3 2NZ9A 1IS4A 1O3RA 1H1MA 4Z8BA 2XJPA 5FDBA 4EV0A 4OI2A 1CD3G 1BQPA 5DZGA 5C8WA 3M7AA 3AP5A 4R9CA 4Q0SA 2Y0OA 3SISA 3AZWA 3IDEA 3WOGA 3GBGA 1WW5A 5KHJA 4CEYB 4AFDA 4LHNA 1I9RA 2XKOA 2D44A 4ITCA 1SQ4A 3CJIA 1J1TA 4CDQB 1RINA 2ZAAA 2LM3A 5KXCA 2XVLA 1YLLA 1DIWA 3E5UA 1S0JA 5DZEA 2ZHLA 5FLHA 5KWRA 2N7GA 2VW2A 4RR3B 4YM0A 3VLBB 4HL0A 1MZ6A 2WFF2 5H9SA 4AE2A 1FT9A 4M01A 1FAYA 2BPA2 1AYM3 4XF3A 1Y3TA 2P3KA 3H50A 1UU5A 2ZHNA 5J7MA 3V0BA 3IDBB 5AC91 2JG9A 2PELA 4G4FA 3AP6A 1D2QA 4BHPA 1WLWA 2R0HA 2VW0A 3VL8A 3VKNA 3RS6A 2G9FA 3I59A 4KWLA 2IXLA 3FWEA 3HAGA 4AGRA 3ZIXA 5BV6A 5K7PA 5KHGA 4QM8A 1VBD2 5FOJB 1QJY1 4YW5A 3VBHA 1UF2C 3UKNA 4LUKA 2GC3A 4B4PA 1H4GA 1GANA 3WDVA 5L7OA 1VBC3 4AFAA 1WGPA 3E6DA 1MS8A 2RS11 3G6JB 2JDZA 3OBTA 5A33B 2R072 3MW2A 5JZGA 5F6KA 1D4M2 4PIYA 1DBNA 2NN8A 1AR93 3AZVA 4Q4X3 3FBYA 1HQWA 2OUJA 1TMF3 1EPWA 4K20A 1UKRA 3ES4A 2X53S 1RUOA 4GH4C 2ZABA 3N7KA 1XNDA 5EYXA 2WSVA 2O8OA 1RUJ1 1AR83 4AI3A 4BZ4A 1VBE3 3ZN6A 3RJ2X 3D5OA 2IXHA 1DDLA 1MQTC 2VNRA 3J8F3 5A32A 1LTEA 3IKWA 1LOEA 3NAPB 4E2SA 2JKBA 3DPRC 3ZYRA 2GNMA 4XBNA 3VKOA 1MEC2 3P3PA 4Q27A 4F83A 1CPMA 1Q8VA 3VDDB 4IV1C 4LTAA 2DYCA 4RS5C 4DY5A 1W6OB 2QKDA 3TRSB 1V6NA 1ZBA3 4FVVA 5JIUA 3CF6E 2HJIA 5FFOC 1ENRA 2VUJA 2ARXA 2FHRA 1R081 1CESA 3BPZA 4LBNA 1M4WA 2Y38A 3VBOC 5JDBA 2JEMA 2QZ2A 3OTFA 2X29A 5BNNB 1NYWA 2BYVE 5AVAA 1HRV2 2WNVC 3VBRB 4J1WA 4LA2A 4R52A 4MZUA 4BYYA 3GALA 1NQJA 4M0HA 1YRZA 3AP7A 4LBQD 1GZWA 2D6LX 2QJVA 4GB32 1CVNA 1WBFA 3KGZA 3KM5A 5ACA2 4KU7A 3BIWE 1RUD3 1SLBA 4MLOA 5GLUA 1CAWB 4PJYA 1LOFA 5JR7B 1OKQA 4MXWA 5K0UA 2ZGRA 1D2SA 3ACLA 4A7ZA 2IXIA 1RUG2 3D4KA 4FCAA 3WQ7A 2EXJA 2HWD2 1Y7BA 2DV9A 2GALA 2OIIA 4GWMA 1YFUA 1WMFA 3WW4A 2GH8A 4J6GA 3WX5A 2TNFA 1BEV2 1ZZ8A 4WVMA 2D43A 1G9DA 2JX9A 1RJ7A 4IESA 3AYCA 4OHVA 2FZ1A 4IXLA 3H1YA 1SBFA 4HKOA 4DY3A 2RS32 2DFCA 2IXCA 3LKJA 2QVSB 2AH2A 2XJVA 2H6BA 5BY5A 2WIIB 2ET7A 3AYEA 4CP0A 5CFDC 1QJU2 5I93A 1FOD2 5DUVA 2ZX2A 1R1A1 3BOWA 1AR73 4YVSA 4M3CF 1G9AA 5JPMB 1PGL2 3PHMA 4QMAA 4OUSA 2IXKA 1QNWA 1W6MB 3KT7A 4FT8A 4O9GA 4WZFA 5EFUA 3U0ZA 2XBO2 1PIV2 5GZCA 1DQ5A 5FLJA 4BLIA 4HPKB 1OOPB 2ZGUA 2ZZQA 1LENA 1NY71 4N9HA 1OSGA 4EN9B 5H9RA 1HXS3 1GKBA 5AFEA 2XJTA 4MGYE 3H1WA 4WM8C 2YROA 1H9PA 5E1RA 3KCXA 4FPHA 4CTEA 4BE3A 1JOJA 4YM2A 2BBVA 2JJ6A 4IEUA 1XNKA 1X82A 4AYUA 4PDWB 4L99A 5JSPA 2QDRA 4A7KA 4AEJA 2GC2A 1REEA 1S2KA 5C9AA 1XU2A 1QDOA 1ZRRA 3HWJA 2VG9A 4G9SB 4CEYA 3U10A 3AM2A 1G9BA 4AQTA 1AVBA 4HMZA 1H8TB 1ZZ9A 3VHNA 5T3NA 4F3JA 3RI9A 4Y5Z0 4MV2A 1AL22 1PMIA 5EWSA 3ZMNA 1B09A 2R16A 3D0JA 4AK3A 1LEDA 1SACA 5CFCC 2ERFA 4PIXA 2WQ4A 3JCIA 1PK6C 4CDWC 3MYXA 1OI6A 3AMNA 3PVEA 2XJRA 5JCTA 3LGRA 4GA9A 3WLUA 3HT1A 4W6WA 3PVOA 4Q4V1 1WMEA 1XE8A 2DCKA 1RUH3 3GZTB 4BIFA 2VOVA 3D0SA 3AP9A 1ASJ2 4CDXB 2XUMA 1N3QA 2GAUA 3R4SA 4Y1VA 4E2QA 2WJSA 3FX3A 2XHKA 2OVUA 2HYKA 3RYKA 4KH9A 3D8CA 5ABJC 2VOKA 2R063 4JDMA 5F6LB 3TB0A 4FPFA 5T52A 1MVQA 1RVF1 4R9AA 3QCWA 1V6MA 3AKRA 4AFCA 2WT2A 4DRVA 2WZR2 4FOYA 3CLPA 3OGJA 1IHMA 4WBBA 1MS3A 4AVCA 4FPLA 4BA6A 4H7LA 2AREA 2DWRA 3ZXFA 5I8TA 3QH6A 1RUF3 1S0FA 4OZXA 1A8DA 5KHIA 1O4ZA 3RZZA 4Q4W2 3ZFGA 2A5ZA 3ECQA 4NPRA 2RHPA 3FLTA 3ZFFA 4LBLA 1YFWA 3MLLA 1UL9A 2XGXA 5JMCA 1U0AA 2WC2A 2RMU2 1R1ZA 3LOIA 2EVXA 3OBRA 1POV0 3NV4A 4Z07A 1DF0A 2FQPA 1RUE2 4A7YA 1IQAA 4M3CB 4ISQA 4L97A 3NAPA 4V1PA 2HWF3 3ILRA 1OLRA 1POV1 3OY8B 1OHFA 1H30A 2R041 3T1LA 5FO7B 4GALA 1QJX3 2BWCA 3X29B 2DCYA 4LO5B 2EIGA 1ZZCA 2WNUA 2Q0AA 4H7MA 5FAXA 2GN3A 1WA4A 2X5IA 3JD72 1FPN1 3CJIC 1HRI3 3B69A 4Q0PA 2ZX1A 1XNCA 1RHI2 1ZBE1 3WW2A 1C5IA 4ATEA 3GBWA 3NV2A 1O7FA 3IM0A 1VB2A 2DVFA 3GBFA 4Q26A 3ZSEA 3A4UA 4AI1A 4WVWA 2NP0A 3NJZA 3DKWA 5KHKA 3EXUA 3WG1A 3NV3A 1LGNA 4QPGC 3FC0A 3H1MA 4E9KA 5F5QA 2JG9C 3M70A 1OA2A 4S2DA 3ZYPA 3KT1A 1Q5OA 2B45X 3E6CC 3AMQA 5T50A 3IT8A 4LBKA 1COV2 3K51A 1Z78A 3AKPA 5B2GB 4QGNA 1UD1A 3FUOA 3RG0A 2DTYA 2HWC2 1O5UA 1NXMA 2P17A 3VBHC 1R091 2ZGTA 3WHTA 1OD5A 1YJKA 4JGZA 3E97A 1WD3A 5L7OC 1UMZA 3ZFEA 2XL9A 1EP0A 1UIJA 3BTAA 4HN0A 4EWAA 3UKTA 1TQ5A 4LO4B 3SNMA 2P34A 2PTMA 2H0BA 1CAVA 4R4ZA 1HV1A 2ZAHA 2D3RA 3DF0A 3ZXEA 4YM3A 1FYUA 2VXRA 4QQ2A 2GMEA 4Q1PA 4UBGA 4FXKB 4OVEA 4AEDB 3N4MA 3B94A 1NZCA 3SCFA 2DTWA 4Q4Y1 4GMP1 4DFSA 4KGGA 1V9U1 4Z92B 1XXNA 2Q8OA 1BBT1 2BFUL 1LOGA 1AR61 1ZVFA 4LBQA 3RMYA 2HWE2 3WUCA 2WS92 1VBB2 1QQP2 2NLRA 3PNAA 1AJOA 2E51A 3AX4A 4N43C 1F31A 4P9LA 1EY2A 2ZTNA 3FJSA 1LU1A 5AC93 2A3WA 1QH6A 4TZDA 3VBUB 3WCSA 4MGKE 3J9SA 3M1HA 3VHRA 4H3WA 1PVC3 1C1FA 5DZFA 5CB7A 1S0CA 3VKLA 1VB4A 4XHBA 4OFGA 4AI0A 1VR3A 2WL1A 4YVWA 1S0GA 1H4HA 2B9UA 3UJQA 1ZNPA 1BXHA 1UX6A 3VZNA 1DGRA 4AVBA 2OUHA 3D82A 1AF9A 1ND3B 2D6NA 3OD0A 1QJY3 1TNRA 4XJWA 4BM8A 3WP3A 3AYDA 3MPPG 3VHOA 5AVPA 4P9GA 1UKGA 4IV3B 4DINB 3MFAA 3ZSLA 1LOAA 1C8M1 1NOVA 5K0UC 3N7MA 1MS5A 4RHV2 2RS13 2I2SA 2ZX4A 5LEKA 4QPIB 3WP5A 3ZDSA 1BVP1 2PHWA 3VBSA 4CDXA 2G9GA 2O0OA 1O91A 1C57A 3OF1A 1PO11 3NWKA 5FRAA 3MICA 1RUJ3 4RD7A 2DVAA 2AUYA 1AZDA 2HEVF 1FV2A 3HIFA 3KGLA 2HWB1 4KGQA 1QU0A 4PQ9A 2WSUA 3GYDA 1G86A 1BCXA 4P9WA 3MW3A 1KS5A 5C33A 4EN6B 2WKKA 3W9AA 1GLHA 4YVSC 3CEWA 2IXJA 3EHKA 2BNOA 4JGYA 4WM7A 4G3YC 2OW4A 1R083 2FMYA 3WDTA 2Y26A 3SXWA 3WNXA 2VU9A 5DUWA 2CNAA 4BIOA 1B35B 1DGRN 2PHDA 1YI7A 3OCPA 4AF9A 3IIAA 4LBJA 4MH0E 4JAAA 4XFHA 5C8CA 4HZFA 1PO22 3WXPA 3WZ1A 1I5ZA 2QUOA 2D98A 1VALA 1K5MB 1H2NA 1SCRA 4XBLA 3DV8A 4Q1RA 4RGGA 3B7MA 4M0NA 3FFZA 3ZPYA 4CDUA 1FV3A 4I3PA 5H9PA 3U11A 4RFT0 1SLCA 5C9AC 4AHZA 3I54A 1Z0HA 5FCCA 5DDJ1 4Q2FA 3S30A 4COZA 4FOWA 2EXIA 5FPXA 4CEYC 1FMD1 1ULFA 1RUC2 4YGCA 4FTBA 1WLTA 4N53A 1YWKA 3BODA 5BNOA 3KB5A 3ZXGA 3JQWA 4I01A 3PMSA 4L9BA 2V5YA 2RS51 2WT1A 3MF6A 2K9ZA 2RM22 1JYCA 2BVBA 2XWJB 2ZGMA 5E88A 3SH3A 4XTPA 3GHMA 1LB2A 2DU0A 3B5LB 3JZVA 4S2FA 1ZZ6A 1ONAA 2ZKLA 1JTZX 4LHKA 1R1A3 3H8UA 5LK7B 3E6BA 1SLIA 2IFRA 4P9XA 1V6KA 2C9AA 4XIOA 3ALQA 2WZPP 1EV12 2DCZA 2ZX0A 2PLV2 3ZN4A 2ZMNA 5C4WA 2Z79A 2VECA 3AMHA 4IEVA 3HMYA 3NO8A 3O14A 3WQ1A 2RR12 3VZOA 2WLQA 1AYN2 1HLCA 1DZRA 2UWBA 4M00A 3M3IA 4K9SA 3H7YA 4QPGA 5HI0A 1QXPA 3ATGA 1ULDA 3M2MA 4I3GA 3USUB 5BUVA 1TME2 3WDWA 4COYA 4RQPB 4YG3A 2W08A 4N7IA 1REDA 3CNAA 4NWWA 4TYSA 1D0HA 3JU9A 2CAVA 1REFA 3M3OA 4CEWA 1AUYA 2OZ6A 4GIQA 3ZFGC 1LHOA 2HEYF 3RDIA 3QOPA 4K21A 1IOAA 3ZFFC 2X8KA 2WFF1 2ZBJA 4PCRA 5JI7A 4ISRA 3TN92 1OPOA 1QH7A 4S2GA 5J96B 1I3HA 3FLRA 1CN1A 5BPXA 5J3UA 2F4PA 4UW5A 5JOYA 2DUPA 1MS1A 4FPOB 2GC0A 4YZ1A 4PLMA 3NAPC 4ZU4A 2BGCA 3O0VA 1TME1 3CJXA 3M8LA 3RMXA 4KQ7A 2DCTA 2A3YA 4XXAA 1RUI2 3VDDC 5BYNA 2C1FA 2D97A 1VBA2 1HQNA 1CAXB 1W6PA 3IN9A 2A71A 3LA7A 4Q4V3 1OQDA 3JBG2 1XRUA 5HCBA 3HD8B 4NR1A 5CBLA 2D40A 2GNBA 2WNUC 3V64A 2X5IC 1DQ2A 1XE7A 1VBD1 1XU1A 2EALA 1WLDA 2PHXA 4HVQA 4UXAA 5CG8A 4E4DX 2P37A 4NO4A 1BYHA 2QCSB 2NMOA 2ZGLA 5J36A 1VRH2 3N3HA 1ND3A 3MGUA 1LOCA 1YUDA 4YYOA 5EV7A 2K0GA 4DQAA 4N43A 1LODA 1ND2B 3TYJA 1OPMA 4URTA 3TBDA 2R071 1DQ1A 2WA3A 4D7TA 4IEOA 1D4M1 3NKTA 3JBG1 2D3PA 1TEIA 3ZX7A 4QPYA 1T6GC 2YZ4A 3S7EA 5KHHA 3WCRA 5E16A 1DHKB 1MZEA 2ETEA 5FO8B 4IETA 1W6QB 4UW6A 1WD4A 3G7DA 4HLTA 1YYNA 1IKQA 3UJOA 3LOBA 1Z7S2 4AFMA 1KJLA 4AGVA 4C0HA 4XF4A 2BTVC 3QH7A 4LE3A 2VQAA 1CAUA 1MEC1 3VBFA 4GH4B 4O9EA 4XF9A 1O3SA 1C5HA 1N47A 3D6EA 4JGZC 3WT3A 1I6XA 1J1LA 1EAH2 4HK9A