4CP2A

Crystal structure of epithelial adhesin 9 a domain (epa9a) from candida glabrata in complex with galb1-4glcnac
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
249
structure length
219
Chain Sequence
HYPRPEGCSSPPNAVSVGLHMDLYNYPYLYVKGQCWNPEYQDPNFPRYGYKKYGSFGSSDHVNGKISWDHNEFKEGCKPIMARLPTAYNYPAKITFSNFTMVLSGYFKPKSTGLYKFEIHADDFILFNFGSKNAFECCNREESIDNFGPYVAYAMWPNEADQELEVYLFEDSYYPIRLFYNNRDYHSKFMVGFYPPNTEEITYDFDGYLYMLDDTGNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords EPITHELIAL ADHESIN 9
publication title The Structure and Function of the Epithelial Adhesins
rcsb
source organism Candida glabrata
total genus 59
structure length 219
sequence length 249
ec nomenclature
pdb deposition date 2014-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10528 GLEYA GLEYA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4cp2A00
5A3MA 2XJTA 4AF9A 2XJSA 5A3LA 4CP1A 2XJQA 4CP2A 4AHZA 4COVA 2XJRA 4CP0A 4A3XA 4AFCA 2XJUA 4LHKA 4AFBA 4AI1A 4AI0A 4COWA 4LHLA 4AI2A 4AHWA 4GQ7A 4LHNA 4COYA 4AI3A 2XJVA 4COZA 2XJPA 4AHYA 4AFAA 4D3WA 4ASLA 4COUA 4AHXA
chains in the Genus database with same CATH superfamily
5I91A 3O14A 4Y5TA 1K5MA 1W03A 4Y22B 3WEZA 5EPAA 1V6JA 5FZBA 1HQWA 4BQ3A 1QQP2 5FKCA 3C2UA 1QHDA 1HN0A 3K3NA 1HXS1 5LASA 4XF3A 4JC1A 4MH0E 1Q56A 1O3QA 2YC0A 3NV2A 2XL9A 3KV6A 3OSDA 4FPEA 3RZMA 3CBNA 3NNFA 2Z2SB 4JHZA 5FP7A 4DQAA 3I3MA 2J1TA 1ND2C 1VRH2 2VVEA 2ZGOA 4P9IA 3URFA 3A0NA 2P3YA 1H2KA 5JDBA 2D40A 2X09A 4XFCA 3AZWA 2LUWA 4B3NA 1F5FA 4AVVA 4XJ9A 4UF0A 1F9KA 1KGYA 5K4LA 2GNMA 4LBMA 4B7KA 2W1SA 2R042 2PHLA 4KMQA 1GWKA 4HFSA 3ZSKA 5FZEA 4CCJA 2H6CA 1D2QA 4W6YA 5HCBA 3LDKA 3T2PA 1AYN1 1WW7A 1W2AX 3LEGA 1F35A 4NWVA 3I2GA 1GNYA 2DUPA 2PN5A 3HNYM 4N43B 1ULOA 5LCWL 5FYBA 4NIAA 4GAZA 2CY6A 5CKMA 4WM7A 2UU8A 1NCRB 1VIWB 4K8RB 4CDWA 5IK4A 2X5IA 4FI9A 3VBSA 3LZZA 1AR71 4Y22A 1WCDJ 1W2OA 3N35A 4Q0QA 4BH9A 1F8VA 3OJBA 5JAXA 1O8PA 1S2BA 5CEHA 3FHAA 2E33A 3BCWA 2RM21 4XF4A 4UWDA 2RDQA 3OBAA 3IDCB 2CSGA 3ELNA 4FPYA 4M4PA 4TSVA 4DMIA 3DL3A 5CA6A 1RL3A 5J3UA 1SCSA 4MV2A 4IV3C 4W6WA 5FOJB 2WWUA 5FBZA 1W6MA 1DGWA 1W39A 1UOFA 4FPOB 4J6GA 3IN9A 3TNPB 1VBD1 5TSWA 1OA4A 4OZXA 4AI8A 1CWPA 3ZN4A 1J84A 2EICA 4ATFA 4KWJA 4K1ZA 2PELA 1F5JA 2BNOA 2QQIA 4URTA 2C5DA 4YGCA 3ZR6A 4FAGA 3MYXA 1JYCA 2PHDA 3OUJA 2VCMA 1SPPB 5FLIA 1UXXX 5ANQA 3D3AA 4LKSA 1M4WA 4NPRA 4TN7A 5FY8A 2J1VA 1RUD1 3RGBA 1LGNA 1D0HA 3VBFB 4AAPA 2WFF3 3GYDA 4N43A 2BQPA 4KU8A 4CXYA 1HQLA 4BQ4A 3LA7A 4ZHNA 3A23A 4CCCA 1UU5A 2A7AA 1NCRA 1AYM3 3FE5A 4A6SA 2Y6FA 4IE6A 4D7YA 2YY1A 1L7RA 1ZZBA 3HEIA 3M2MA 3PMEA 2XLAA 2WNVA 1NQDA 1QGLA 1UPIA 2NM1A 3AP4A 2JDAA 1D4M2 1VBA3 3N7MA 3NV1A 2BDRA 3BALA 4KG8A 3U14A 3KGLA 1V6IA 4H55A 1J58A 2JIJA 3IIIA 4QDQA 4NHYA 4BXSV 2WZR2 2VH9A 4AG4A 3I4IA 3W5NA 1VBC3 5GLUA 1DZQA 5KBFA 5BNNB 2GC1A 2V4VA 4DEVA 2QNKA 1LHUA 3BIWE 4LOTA 5GZEA 4E2QA 1C8M3 4Q1RA 3GALA 1NYWA 2SBAA 3Q8CA 4M0NA 2WLPA 1RXGA 4R9BA 1R092 4XABA 2ZZJA 3ACIA 1C1LA 3VKMA 5K7PA 2GC0A 2O8OA 5KHKA 1S0IA 1MVQA 2WT0A 1VBB2 3TBDA 1SPPA 4LNVA 5F5AA 1TMF2 1YEWA 4Y3OA 2VOVA 3U11A 3AP7A 4K7JA 2KR2A 1ZRFA 3VBFA 1Z7S2 1HJFA 3AMMA 3INAA 3OD4A 3ZYGA 2ETEA 1VAKA 5FYUA 3ZFGC 5IK7A 1VB2A 4X6QB 3NRUA 4BCUA 3PVOA 1ONAA 2XGXA 4OHXA 3TEWA 1FT9A 1WCKA 4XIKA 2B8MA 4CUCA 1WMFA 2FQPA 2GH2A 2HBUA 5JR7B 4COYA 3O1MA 2DBIA 4ONUA 1B35C 2HEWF 2UWBA 4BWOA 1WCQA 3O1TA 3RMYA 1BBT2 1LOFA 4HZFA 1O59A 4KH9A 4UYBA 5CFCC 2ZEYA 3ZYIB 1TME1 4URAA 1GSLA 2XBO2 3OEAA 1PMIA 1MS5A 4JDMA 2RS12 4FFGA 4QB2A 5JUVA 2JJ6A 4Q4Y3 3O1UA 4S2HA 2WQ8A 4D6RA 5A6XA 1HN1A 1X8EA 4QU1A 1QNYA 3H7YA 4AXOA 3AKPA 1UAIA 1HRI3 2ZEXA 1QXJA 5L9BA 3T09A 1GZTA 1YRZA 2XWJB 5C8CA 4GKXA 1UD1A 5DMYA 2HKXA 2ZAAA 3RG0A 1V9U3 2HWC3 3NJXA 1OA2A 3MLJA 4QX3A 1LU1A 2IWGB 4MUVA 4EQVA 2B9UA 5F6KA 1OVPA 3H50A 1ULPA 3ZXFA 4UFKA 1NAEA 1D0GA 1LOAA 2NZ9A 1AX1A 3A4UA 2YBSA 3ZMOA 4OZOA 2O1QA 3HAGA 2RVAA 4JQTA 2VQUA 1UY3A 3B94A 3DGTA 2G1MA 4CCLA 5A1FA 4V1PA 2NPIA 4FFHA 3VD4A 3RZJA 2HWD1 2VUDA 3S57A 4JDOA 5FZKA 4AFCA 1GQGA 1WCSA 3LPGA 1XNDA 3VBHB 3B00A 4QDSA 4ARYA 3THPA 4NJ4A 4NWWA 5EWSA 4W65A 2J1RA 3B7MA 1LHOA 5A3UA 1ULDA 1ZBA3 4V2VA 4UFMA 4HKOA 2XOMA 5LBCA 2JDPA 2WS92 1JS9A 1JZ7A 1VMFA 1YIPA 5FYCA 1H9WA 1NQJA 2Z69A 4PCRA 1NCQC 1UIJA 1H8TC 5FZGA 1VRBA 3T08A 3ZIXA 4DIQA 1DIWA 1GYKA 3CU7A 3E5XA 4LBNA 1ZRDA 3FFZA 2P3KA 4FPFA 5J98B 1FMD3 3H8UA 4PIYA 1RUH1 4MGIE 1GU3A 2PHFA 2QQOA 2I45A 3E97A 4FO9A 3T1MA 4R9AA 4M3CB 1WLCA 4QU2A 3WW3A 4KWUA 4LO7A 3WNPA 5LEJA 3DXUA 3C7GA 3PUHA 4ZXKA 1MZ5A 4UOJA 1BEV2 5FYZA 4CPBA 1RUJ2 1TQ5A 4R4ZA 3JU9A 2EIEA 1MR5A 3AKRA 1RUE3 2ZGPA 3UL2A 3VBHA 2GC3A 2JG8B 4LQRA 4N7IA 3CJXA 1GP6A 5L19A 2D93A 2GU9A 2KD7A 1EAH3 3AFKA 1GUIA 1SHWB 3PHMA 3LE0A 3GDBA 3ST7A 1SEFA 5HXMA 1V6MA 3RPQA 2W95A 3NJYA 4BM8A 5JWPA 3S5AA 2HWF3 4H2AA 3U75A 3R05A 1ZRRA 3MDPA 4MGKE 3ACGA 3MV01 1A8MA 3FMGA 2XL7A 5ACA2 2XVKA 5LZ6A 5T3NA 4HANA 4AEDC 5A6QA 1N1YA 4SLIA 5JMOA 4UAPA 2YPDA 4ZU5A 1CAWA 3ZSJA 4N53B 5LRSA 2VMCA 1MEC3 2XPJA 1MS1A 1DQ2A 4R9DA 4M3CA 3I3EA 4BJ0A 1MZFA 1DYPA 3O12A 4XDQA 5EIYB 4QX5A 4XXAA 3NAPB 1JHJA 2CU5A 1LHVA 2YROA 1S0GA 1YQ8A 4NPMA 4QGNA 1VMHA 2H0VA 1IG0A 2CAVA 5DPNA 1XOYA 4WVVA 4XZUG 1H1AA 3J4UH 5FUNA 3WW4A 5J09A 4BLJA 3PVNA 1FOD1 3DECA 1RJ8A 3VHOA 3W58A 1UY4A 2YG0A 2YMZA 1RHI2 2VZUA 3AVSA 2R7EB 3JBG3 2JWPA 4IXLA 5IAXA 1PO21 5A6ZA 1DQ4A 1BMV2 4HOOA 2DF7A 4S2GA 5IT6A 4NRQA 3NWKA 1G7YA 1GICA 3GJAA 4CUAA 1WA6X 5FXWA 3VLBB 1XYOA 3USUB 1REEA 4O65A 5HV0A 1RMU3 3KF3A 4CVUA 4N53A 1LU2A 1AR91 4J1WA 5HCAA 3ES4A 1S0DA 1NZCA 1QJFA 3VGIA 4GWMA 1EY2A 2VUJA 5CYYA 5F1RA 1BQPA 2VULA 4QPGB 5CADA 2HBTA 2VY0A 2Y6JA 1UCXA 3NSTA 4ITCA 1F31A 5GKAC 3TN91 5JSRA 2GNTA 2VXJA 5GM0A 4EN9B 1X9PA 2P3IA 3KT4A 4OVEA 3ZYHA 2MEV1 4Q4X2 3LA2A 1VP6A 3NAPA 4FPCA 3ZFFC 5JR2A 1DF0A 5KC5A 2Q8DA 3LOBA 4BU2A 1JHNA 3JQWA 3WX5A 1FNYA 3AYCA 3UGGA 1ULCA 1QNWA 3EYPA 1NY72 2W39A 1WMXA 3NMBA 2Y6GA 3BTAA 5IW0A 1HW5A 5FPVA 4MX3A 3MV11 5AC93 3MW2A 2J42A 3FBMA 1UIKA 4META 5JXGA 4YZ3A 3RZLA 4IEVA 3HBKA 5KHJA 3N36A 1W2TA 2VZRA 1GKBA 1I5PA 2PXJA 2VD7A 4DXSA 3B01A 1ENXA 2ZHNA 3KQRA 3BU0A 1QDCA 5C5UA 3HOBA 3GCXA 1ENQA 4AEJA 4FPLA 3QOPA 3TRSB 4GWNA 4Y1XA 2ZZQA 4QX0A 4S2DA 3USUA 4X6RB 4BQ2A 2OS2A 3TEYA 3LKJA 4Q4W3 1KDKA 3WDXA 3CJIC 4ZZ8A 1V0AA 1AL23 2P37A 1K5MC 1H1IA 3K4ZA 1S0JA 2WAAA 1Z0HA 3PUQA 4YVSB 4XFBA 5FO9B 3H8XA 2LROA 5FWEA 2XUMA 3IAPA 1GWMA 1OKOA 1QF3A 2CAUA 4PLOA 2J22A 4AL9A 2D3RA 2IZWA 1QJU3 2QDNA 3UKTA 3GXUA 3MPBA 5JSPA 2B42B 1X7NA 2WNUB 4J25A 4YSFA 4AQ2A 4ATEA 2OXBA 1BHGA 2RS52 4HN1A 5FZLA 4LBQB 4N8MA 1QH6A 1K3IA 3ZSEA 3UGFA 3FFQA 4W4ZA 4A6OA 3VD7A 3BIEA 3LQCA 2MPFA 1SBDA 3POBA 4I09A 3JD73 3C7HA 2PLV2 3HMYA 5HXVA 5FWJA 2AR6A 2CGPA 1S0FA 2J1SA 1WLDA 4CRQA 2ZHLA 5KHHA 2RMU2 2AACA 4IEPA 1CZTA 1SLAA 2HWB2 3K48A 4B4PA 1G9BA 1BVVA 3MHZA 2VZ1A 4UW3A 4HETA 5C70A 5HBAA 2JG9B 1RUE1 3AMQA 2X5IC 4CDWC 3QD6A 2AGSA 2AC1A 3VBSC 1YXWA 3VD3A 5JZGB 1H6XA 4TLFA 3SH5A 1R64A 2BPA2 1QQP3 3H1YA 3Q8BA 1IS6A 5BPXA 5GALA 2E53A 4YVSA 1RUC1 3VD9A 4QPYA 1QJEA 2XHNA 4P00B 3O7OA 3Q9OA 5F32A 1Q8SA 2DTYA 2BGOA 3AVRA 3W9AA 4CU8A 3AZZA 3OGSA 4K6BA 4MGZE 3HR9A 4NE9A 1VBE1 3GZAA 2CYFA 3HNMA 2ARCA 1REDA 1F4AA 1URXA 2DYCA 2WNUA 2SLIA 5CFCA 2EAKA 3K4AA 1WGPA 2Z42A 3O1OA 4BOWA 4R8HA 1XNCA 5K0UB 1KEXA 1KRIA 1Q8OA 2R043 4GB31 1OT5A 3W21A 3U4SA 4EZ4A 1CVNA 3IAQA 2JEMA 3LSEA 4GMP1 1J3QA 2YFUA 4UW5A 3RZZA 3WG3A 1UYZA 3UGHA 1HQNA 1IS5A 4Q0PA 1CJDA 4Y33A 2VTFA 4BDVB 2AH2A 3G6JB 2E7AA 2ZS6B 3DF0A 1UXZA 5FO8B 1XNKA 4N43C 2QQUA 5F5QA 4QGLA 4B1MA 5JI7A 3TYJA 5FY1A 2FDGA 1NCRC 3ZO0B 5FREA 5JZGA 4QQPA 3HT1A 3EBRA 3SCGA 3ETQA 2WO1A 2WJSA 4NHMA 2ZKLA 2KA3A 2C1FA 2JB4A 2WINB 2IC1A 3WUCA 3UT0A 4CU7A 3JBG1 2VR4A 4RS5B 1QJY1 1UWWA 1JZ6A 4NVPA 1E5IA 3AP6A 1XYNA 2WSUA 4I2OA 3E6DA 2VCAA 3R4SA 2A71A 4HXCA 4IESA 1I1EA 4SBVA 1TEIA 2K2SA 3MW4A 2O8QA 5FJKA 4ES9A 4AHWA 4TYSA 3KVBA 5CU1A 5K0UA 1RMU1 4FT8A 2W1UA 5C4WB 1SFYA 5FXXA 4C91A 3I2DA 4O9EA 5A7QA 1PHMA 4MGSA 1DZRA 1TZOA 3GBGA 2OT7A 2ZPXA 4LBLA 4B4QA 3T0AA 1V6NA 3IPVB 1MVEA 1QJX2 5JMCA 1SBEA 2E9QA 2P5BA 4PI0A 4YG3A 1HV1A 3VBFC 4IGOA 3LD8A 3RZHA 3WHUA 2QFEA 1QY4A 1D7PM 1H8TA 1IQAA 4YFZA 1IKPA 1K42A 3J7MA 2ZCWA 4JGYB 5LBFA 4PBPA 1GOHA 4AK3A 2I2SA 4A45A 3S7EA 2RV9A 1D4M3 3B02A 1W0OA 2R062 1WZXA 2ORXA 3WNOA 2WZR3 4XCAA 2WT2A 4BE3A 4RQPB 2D7FA 4RS5A 1CONA 3E5QA 1FATA 2J1UA 4IEXA 2OUHA 4WZCA 1PVC1 2OPKA 3WP6A 4AGVA 4CEWB 1R093 2WO7A 3WP4A 1GOFA 2O14A 2F17A 4CP2A 1UF2C 5L9VA 4LKFA 3I2OA 4QX1A 5A3PA 1VBB3 4HK9A 5C4WA 2PQQA 1A3KA 4N9IA 3UYJA 1JZ5A 4C8DA 1SQ4A 1TMF3 1W6OA 3USSA 1PMJX 1UX7A 3IPVA 3I3DA 3MEPA 4B7EA 3U1XA 3GF6A 3W5MA 4AFBA 3OUIA 1Z7S3 2W5FA 1LTEA 1WWYA 3ALQA 4Q4V1 5FUPA 1XXNA 4L8QA 5ISLA 4XFAA 4XDPA 4YW5A 4CTEA 3V0BA 1EUUA 2VQAA 4JGYA 2XONA 2JDNA 4GH4B 2RJLA 4YW7A 4COUA 5ACA1 2G9GA 4WZFA 5FKBA 3B5LB 4IEQA 3U78A 1A8DA 2DCJA 5HCFA 3ZFEB 1QDOA 3AK0A 1W99A 1KD7A 5D8AB 4COVA 1BBT3 1MZ6A 3GHNA 3H1WA 5E16A 4IGQA 3WCSA 5E8AA 3JD71 5IK8A 2PHTA 4UFHA 2RR12 4YWAA 5FP4A 4BK4A 4YZ2A 1WBFA 1SZBA 1ZBE1 3UKNA 2XBO3 4JHTA 5L7OB 4I0WB 2GN3A 1DCSA 4LA2A 3GZEA 2QQMA 2RS13 4JV4A 1RVF1 4ZY9A 5FQ0A 1DBNA 3WR0A 4CEWA 1YWKA 4COZA 4G4FA 5F2WA 3WQ1A 2A73B 2RJKA 3DKQA 4Z82A 1G8WA 1COV2 4XFHA 3AXEA 1QQP1 5C6CA 3N7KA 1VR3A 2NN8A 4UBGA 4BMEA 2NQYA 1N1VA 2ZABA 4FQ4A 1QU0A 4QT6A 4D7TA 1S55A 5DN2A 4LIVA 5J37A 3NV3A 2Y38A 2I07B 1NXMA 1VRH1 2GSYA 4KQ7A 3ZR5A 1S0EA 2A70A 3M1HA 5LRRA 5C8WA 3UKVA 1HLCA 3VUOA 3RFRA 1LOBA 1G6NA 3CMGA 2IXIA 4GH4A 3JXSA 1C4RA 1WBLA 2FMDA 3NL1A 2Q4SA 2BGCA 2GC2A 5EZWA 3JZVA 1G9DA 1O91A 1YI9A 1E57A 1XC6A 5D21A 1JYXA 2OW4A 2R041 1ZM1A 1J1LA 4NMIA 3NO8A 4AI3A 5D8AA 3OG2A 3HNBM 3PU8A 5FR3A 3THTA 2VXRA 1AR83 4GJYA 4QPWA 4QQHA 4Y24A 2WZPP 3VBHC 5L7OA 4XOGA 1UQXA 4YG0A 3LFIA 4LKEA 3ACLA 1QH7A 1OH4A 5FZIA 4L9BA 3NKTA 1SCRA 1RYYA 1L3JA 5FXZA 3HD8B 1TG7A 2WS93 5L73A 5ABJB 5I0RA 3T2QA 5J36A 4HLTA 1UMHA 3MIEA 4JKLA 2VNGA 3RMXA 4Q8KA 4GXLA 2K9ZA 4GA9A 3M70A 4XXPA 4R4XA 5FYIA 1BYHA 5J1XA 1OMIA 5H9SA 3LDRA 1A78A 1XNTA 1STMA 4CDUB 4QAWA 3T2OA 1GZWB 2ET1A 5E88A 4YM2A 3ZXJA 4LUMA 2ZX2A 2LS6A 4X8NA 2JD4A 4PF1A 3HWJA 2BW8A 4U36A 5FP9A 3ES1A 2PHUA 4IEOA 3CJIA 2OZJA 2JB8A 4G9SB 3WXPA 1CZVA 1OD3A 3BI3A 3CF6E 4DB5A 1M06G 3C7OA 1BEV3 5AFBA 5I8YA 4CDQB 3RI9A 1DGRN 1RUJ3 4YRDA 2A6VA 4PQQA 3RJ2X 3WY6A 4E4HA 2X29A 5C7GA 5KHGA 2QDRA 3A22A 2GP5A 1OF3A 1QOOA 2JG8C 4BIOA 4D7SA 3MICA 1MS9A 4LHKA 1CAUB 1ZZ9A 2C4XA 3U37A 1X33A 4BQWA 1VALA 4LBKA 1OOPB 1FV3A 2BZDA 2GMMA 3KB5A 3PNAA 4JDNA 3R6SA 3O0WA 4CCMA 2ZGRA 4UT5A 2RS32 4ASKA 4MZUA 2WBKA 3N9OA 4QPIB 5DABA 4XQDA 1C8NA 5ABJA 1JZ4A 1D4M1 1KS5A 1A6CA 2X8KA 1AX0A 3LCPA 3NJZA 5ACA3 2C26A 1K5JA 3UNPA 3VL9A 2NYYA 4PT6A 2WZR1 3POWA 1CQ9A 5T5PA 1YFWA 4F3JA 2RDNA 2RDRA 4JGZB 4QMAA 1LESA 4CDUA 2GDFA 4JCKA 5FPZA 1GZWA 2ZMNA 3JCIA 4N53C 4NO4A 2EXIA 3D0SA 5KC6A 4GZ9A 4M01A 1W8TA 5FFOC 1HB3A 1O4ZA 4O61A 4RFRB 3WP3A 1V6OA 2ZACA 2FBEA 3I3QA 3NAPC 4CDQA 1TMF1 1NG0A 4EE2A 5IVCA 1W0NA 3OTFA 5FXVA 2BWCA 3NNGA 3N9NA 4IEZA 3OPZA 4M4RA 2PHWA 1VAVA 4QD2A 1CAUA 1XYPA 3BB6A 4IE0A 4RSUA 4LITA 5A7OA 5C5TA 4NN0A 4YYOA 1RHI3 3WG4A 2PHXA 4FFFA 2PYTA 4QPIA 4NR1A 4CSWA 1W2NA 2P6HA 4NIIA 1DGRA 4CUGA 2J1EA 4DPNA 2W87A 2V73A 2VC9A 4XMIA 1C3HA 2F4PA 4B4RA 3JQXA 2XVLA 4JGZA 2XBO1 4RA0A 4LBOA 5BNPB 1PIV1 5IVJA 1JU4A 2UURA 5APAA 5AVPA 1OLMA 2VZTA 2RS11 3DPRB 4X8PA 1S4CA 3PU3A 4QXHA 3IM0A 1OKQA 1UMZA 3PTRB 5FOBB 3AJZA 4QPGC 1PK6B 1EV11 4B1LA 3N7LA 3K3OA 3GCWA 2VMIA 5IVBA 5JVVA 3UESA 4Q4X3 3D5OA 1DDLA 3HT2A 4DS0A 1APNA 1GQPA 1J1TA 2O0OA 2WO3A 1H9PA 3CLPA 4FTSA 4YM1A 1N1TA 1RUF2 4RHV1 1IOAA 2Y60A 1H4HA 1W6PB 1W90A 3WV6A 5IFPA 1DLCA 1XSRA 3AMHA 1S0CA 2YC2A 1ZVFA 3AYAA 4I3GA 3WNMA 1G9FA 2VBDA 3U07A 1W9WA 4AQ6A 3FZ3A 1WW4A 1OPMA 3HN3A 4GIQA 4TWTA 1ZX5A 1R082 1NE4A 2XQRA 5A3TA 2ZGKA 2GH8A 3QBQA 3LB9A 4AVAA 1AYN2 1XBFA 5BY5A 1Q8VA 2JDUA 4YM0A 2ZGQA 5BNOB 5F37A 3AP9A 2ARAA 3IT8A 1JYVA 1OQDA 1UZVA 4P9JA 4LXLA 4QXCA 5BNPA 1PGL1 4AOCA 2XJUA 3DPRA 1CX1A 2R071 3CZJA 3ZYJB 4YVSC 1PK6A 4QX2A 5GZDA 4PDWB 4EN8B 4NUBA 2CTVA 1ZZCA 2C0ZA 1Q3EA 2WO2A 1AVBA 3IIAA 1AR72 3K51A 1GWLA 3PUIA 3Q8FA 3FHQA 5KR7A 1SLTA 2H6BA 1BKZA 2VZOA 2WSVA 4DINB 2DCKA 3HN1A 2WNUC 3Q8AA 4OULA 5A7NA 1W6PA 2RS53 5FRAA 5BNNA 1AJOA 3IBMA 5B4XA 3MZHA 4W6XA 3WQ7A 1RUG3 1VBD2 1YNAA 2VZQA 1ST8A 4FPHA 5G05L 3BTZA 1LECA 3WNLA 1Q43A 1V00A 2PLV3 1ZZ8A 2WQ4A 4AAXA 2CWMA 5IVEA 2R1BA 4Q5OA 5CKQA 1JZ3A 3ZXDA 1SLCA 1HDKA 3HQRA 2BBVA 3FN9A 2RMU3 5LATA 1BZWA 2HWB3 1J83A 4NIGA 1PO13 4N90A 2LALA 1W6NB 5FK7A 2ZA9A 5BNOA 4CE8A 3KVAA 2E51A 5JZGC 4F8AA 1AR62 3NQHA 1WCUA 2IFWA 1IQDC 1SG3A 1W0PA 3OGRA 2L9LA 4YVWB 4YW4A 2BNMA 5GLVA 4C0HA 3WDUA 3PMSA 3VBOB 2JDKA 3SC7X 3OUHA 5KXEA 4MGTA 4TTGA 2CWSA 3WW2A 5KWRA 2ZAHA 5KXCA 3HQUA 3MGUA 5EV7A 3KWVA 1H2LA 3D8CA 3MUY1 3POGA 5EJZB 1PNGA 1VLNA 3MLKA 4LOSA 3B93A 4YPJA 2YPJA 4QKBA 4LEJA 3UJOA 3VZJA 2ERFA 5F6LB 4N7UA 2IXKA 2WR9A 5DUWA 3ZYBA 1OHFA 4QQ2A 4XUQA 1EPWA 1AR82 1ZZ6A 3AX4A 4BIFA 5K0UC 1C1FA 1S2KA 5LB6A 1NT0A 5I8SA 2XJPA 2EALA 1IS3A 3LWCA 4UW6A 1XRUA 4Z07A 1KS4A 1UO9A 4UI9L 3T2TA 1I6XA 4J1XA 2VL4A 4Q29A 4XHXA 3MFAA 1O6UA 5FPUA 2DU0A 5I0DA 4XYXA 1H8VA 3T3YA 3W59A 4CCEA 3VKLA 3FL7A 1HRV2 1ULEA 1IHMA 2B4KA 2WZEA 3P3NA 1W6NA 1WUVA 1YI7A 4DXZA 2RDSA 3MI8A 1BJQA 2FMYA 4DRRA 5T5OA 2GNBA 2IFRA 1I5ZA 3OBZA 1JH5A 3VDAA 1LB2A 1S0BA 4LO4B 3WNXA 5FAXA 4OMDA 3IWZA 1Q5OA 4RS5C 1N3PA 1BMV1 5JCTA 3DYPA 4ASMB 5FLHA 1PGW1 5FTTC 3I8TA 3Q8EA 4NIDA 4P9LA 2VNOA 3GJBA 4QKDA 1MS3A 4LE3A 4AQTA 2FDJA 3EXUA 1BK1A 4UFJA 5DZEA 2ZHKA 1TME2 1POV0 4H14A 4IERA 2ZEZA 1O3RA 1SMVA 2WFF1 2RHPA 5C4WC 3MUZ1 2VNRA 5JOXA 3O1RA 4XJ8A 3CO2A 3AKQA 4BQYA 4RGAA 4RN5A 3VDDB 4XURA 1AYM1 2BRTA 1QEXA 1QJX3 5F3GA 2UY8A 5FBJA 1Y7BA 1U5XA 1N47A 3LOIA 4Q4X1 2WAOA 2QQJA 1VBA1 2W92A 3FJSA 5L36A 2EAAA 5EP9A 1IPJA 5EYXA 1L7LA 2KM2A 4JGYC 3LFMA 1GNHA 1Y4WA 1VBC1 1O5LA 1W6QB 3WDYA 4AVSA 2DV9A 1C8M1 2R063 3J7LA 3KM5A 4XTPA 4Q0VA 4OI4A 1F2NA 1E5RA 4HK8A 4CP1A 1YIFA 2ET7A 4Z2AA 3EB7A 4JTNA 3OGJA 4PQ9A 5DZGA 5A1LA 1UZZA 1ASJ3 4AEMA 3ECQA 1Y3TA 3ZN6B 2ZKNA 3ASIA 1AXKA 2E32A 2HWD2 3I2HA 3ILFA 3AKSA 3AZXA 3NW4A 2JG8A 5F5IA 1E5HA 1XE0A 4CEWC 1DYKA 4E27A 1JUHA 4LHNA 3KT7A 3UJQA 3HPNA 3H3LA 1CD3G 2B9VA 1H4GA 2A1XA 2CNAA 2V5YA 2WUHA 3POYA 5JLVA 3J7NA 4QWNA 2VZSA 4INDA 2P4EA 1ENRA 2A3YA 1UZ0A 4OUEA 3SNMA 4AVBA 2WWJA 3LDBA 3ACHA 1NA1B 4P14A 1AHSA 4P9YA 4R52A 1U5IA 2JD9A 3FHIB 2Y26A 2A6WA 4FVVA 1FXZA 2WLQA 4P9WA 4CP9B 4GH4C 2RS51 1C5IA 3AFGA 5EHDA 2WFPA 1W6QA 4XF1A 1IPKA 2EXJA 3VZNA 4UFIA 1RUH2 4M00A 4PHZA 1XU1A 3ZFEC 3MIGA 1OXCA 5FZMA 5I8TA 2MHFA 4Q4Y1 4MXVA 5D8AC 3PUAA 2RR13 3H1MA 2FCTA 3RDIA 3RVHA 1CPNA 5DAXA 2K0GA 2GMPA 4BXFA 2NMOA 5L7OC 3ZN6A 4QHZA 2JENA 5FP8A 4KNCA 1HRI1 2RMU1 3D0JA 4Y26A 3GGLA 2BU9A 2QTWB 4MXWB 1Q8QA 1W8UA 2ZJCA 1SFPA 3TNQA 3RQ0A 4DRVA 1V9U1 3KV9A 2HWC1 1J59A 1COV3 1ND3B 2W68A 4DXRA 1CGPA 3ZKYA 3KQ4B 3K77A 5KXDA 5CISA 2LW8A 2HJIA 3WUDA 3RWNA 1DLLA 5DAPA 2XG3A 4NHXA 2VZVA 2HWE2 2B5HA 2VVDA 2VZ3A 1ZRCA 1QKQA 1IS4A 3OCPA 1TNRA 1R1ZA 2AEZA 4XIOA 4CP9A 5JXIA 3ZDSA 1HIXA 3WG2A 1JI6A 5A3MA 1CAVB 3A7QA 2JE9A 3MLLA 5SV8A 2D3SA 4Y1YA 4QGMA 5DDJ3 5LA9A 4QPGA 5IK5A 4WVWA 4XAEA 1ZBA1 3H3ZA 2PQSA 4XBLA 5FY0A 4CCKA 3AYEA 1JYTA 3IMMA 4C90A 3TEZA 3KF5A 2YU1A 2Z79A 2VE1A 2XLFA 5CG8A 1W9YA 3KHBA 3ZKUA 3MIHA 4EWEA 3R4DB 1LHWA 4YW6A 1H0BA 4UW4A 5H9QA 1WD3A 1MS0A 1YJLA 4CCDA 1OC1A 5ABJC 1ND3A 1FMD1 1FOD2 3VBSB 1H2MA 3KCXA 4JRLA 2D3PA 1RC6A 2RJ2A 1RUG2 3POFA 4ZS3A 4WM8B 1EUTA 4CUBA 4D69A 3ENRA 1W8FA 1OD5A 1JYNA 2XJTA 1LENA 2XJSA 4XBQA 5A3LA 3QACA 1PO22 1RIRA 1GFF2 5A33B 4CDUC 5BYNA 3NNJA 3T1LA 1RB8G 1DQ0A 1T6BX 2WWSA 1PO12 3N3HA 4I01A 3BU7A 3J8F2 4JX0A 1TNFA 3HBZA 1O4YA 2FHRA 2C9KA 5FY9A 2HYXA 1Y43B 1GR3A 1CAVA 1AR92 1EAH1 2Y33A 4AFDA 1OLME 4IETA 2VOTA 2CGNA 3POIA 4CDQC 1UPSA 5K9YA 5FK8A 5DG1A 2ADDA 3PDQA 2HWF1 1I9RA 2AREA 1LRHA 3WW1A 3I49A 2D44A 2MEV2 5FP3A 1V6LA 3ME2A 1WW6A 3KGZA 4H7LA 4LO5B 1GOGA 4Y4RA 5J48A 5FZDA 4BPZA 1HV0A 1NOVA 4UBHA 2JECA 2RS33 3F95A 1OA3A 3NKGA 1H30A 4LBQA 1F15A 4RYDA 5FZ0A 4UFLA 2BBAA 1KJLA 4QPIC 1MEC1 3VDBA 1LNSA 2R061 3ABZA 4NAMA 4WM8A 4IDZA 2EF6A 2Q8OA 3ATGA 1ZYBA 1CN1A 3GNEA 1U5YA 4A2UA 1UU4A 3SHRA 2CV6A 4XCBA 4JGZC 5A33A 4AE2A 1WMEA 3VHRA 3VKFC 2W2IA 4K21A 1KITA 5C33A 3UETA 1B09A 2IXHA 4LUKA 3AB0A 2YBKA 5C3QA 2JG9A 4P02B 4XETA 3AMPA 4AF9A 3WF3A 2EA7A 2V4AA 2Q1FA 2XHKA 3LIGA 2UYAA 3HIFA 1UX6A 2W94A 2GMEA 1OI6A 3F2ZA 3WP5A 5AFEA 5I0SA 5T5JA 5JXJA 2AYHA 2AZ5A 1OQEA 1XNAA 4HVQA 2CDPA 4EN0A 4BYYA 4Z8BA 5JIUA 5C3RA 4KG0A 1CIYA 4QX8A 4TXWA 3THDA 3V56A 5LW9A 4U2AA 5I0TA 3ZVXA 2V5DA 2OQ7A 4FPKA 3BTXA 4COWA 5JI9A 1OLRA 2V72A 1W2UA 3O0VA 4RGKA 3VZOA 4LO6B 4XW3A 2W1QA 3RYRA 1POV3 2EIGA 3CL1A 1GANA 3EO6A 4GJZA 4KU7A 5CKNA 4OHVA 1UYPA 2VCBA 1H6YA 2EIDA 2EXHA 2QBXA 2VCCA 4LPLA 1RUOA 4MLOA 4PLMA 1JW6A 4LE4A 5FZ9A 5BNPC 2VZPA 1YQ2A 3DPRC 1WA4A 4OQ9A 1NUKA 3K4DA 3KZ4C 3ZYRA 4WV8A 5DUVA 1PK6C 3SXWA 3NNMA 1E5SA 4AGGA 4F83A 1COV1 3IDBB 2OPWA 1HXS3 5AC91 2VECA 4ZS2A 2OYZA 3LEKA 1RUF3 1RUC2 3PLQA 2OKXA 2WC2A 1C57A 1ASJ2 2R0HA 5BNNC 4EWAA 5GZGA 1I3HA 1VBE2 2VTXA 5EXOA 1ULFA 2J1AA 2PAKA 2ZGNA 3AM2A 4GULA 3RSJA 3RWKX 3SQOA 1HJGA 1MACA 4R9CA 2VUCA 4Q4W1 4IE5A 5IATA 1AL21 5IJRA 4GB32 3I59B 2GAUA 1X50A 2RG4A 1R083 2DVBA 2VVFA 3C7EA 4IE7A 4PIZA 1AZDA 4QHOA 1Q8PA 2ILMA 5FYMA 3O1PA 1W8NA 1GNZA 1AYN3 2DCYA 3HJRA 3M4FA 4XFIA 2FCUA 2R16A 3SMHA 4W8JA 4IQPA 5BNOC 2XVGA 5CNAA 3OBTA 1UOJA 2HLEA 2WZ8A 1QJU1 1R1A2 2MNGA 4HG6B 5DAQA 1JZ2A 2ADEA 2P3JA 3DYMA 4PDWC 4CDXB 1AR73 4JZRA 3VHNA 3SCHA 2X10A 3P5BA 2D6NA 4FBFA 1RJ7A 2FD8A 1DZTA 3ACFA 3N9PA 4LMFA 2OA2A 3N4MA 4FCAA 4RQPA 4N9HA 4ZZ5A 1PM7A 1QJY2 5IFTA 2DBNA 4XJAA 2P17A 4FTEA 5C9AB 4QKNA 2C6SA 1S2EA 2ZGTA 1BLZA 1VBD3 2XXZA 4W50A 4Y20B 3OYWB 4AW7A 4BHPA 3K75B 5BNQA 1YFUA 3IMNA 4A42A 2W9XA 2ZX0A 3VKNA 3FLPA 3BTYA 3PIJA 1BXHA 2Y0OA 4GD4A 3U0ZA 5CZKA 3CEWA 4E2SA 5FZ3A 3I59A 5ERLA 5FPBA 1VE0A 2OIIA 3P6BA 5FZFA 1VMJA 3G7DA 1A34A 1RUD3 3LGRA 5T5LA 1T6GC 2YU2A 5A70A 1AR63 3RZKA 2XLGA 2Q5TA 2DUQA 2D6MA 2EXKA 1V6KA 4YW2A 1HB2A 1XU2A 1GBGA 4XF9A 3VV1A 1FX5A 1FPN2 2JKXA 5FYTA 2ZTNA 5B4NA 4YARA 4HBNA 2GALA 3VBOC 5KHIA 4IEUA 3POEA 4PI2A 4YFWA 4RFT0 4CU9A 5HI0A 4MGYE 4E4SA 3L2YA 3ZFEA 5DDJ2 4M3CE 3B9CA 1UOBA 4IE4A 1YC61 2YXSA 2Q8EA 2ZX3A 4FAHA 4KBZA 5C9AA 3PIGA 4Z2WA 5LY1A 3UV9A 5FPXA 2Q8CA 4YG6A 4LHSA 5EJ3A 5J7MA 1L7QA 3K46A 3OYWA 1BVP1 1QWRA 5FMOS 1UKRA 1PGSA 1QOSA 3AZVA 3T30A 5A3NA 2VNVA 2PHRA 3WF2A 4H7MA 1JOPA 3WF4A 1U5ZA 1UYYA 2JXAA 3C3VA 4K8FA 3I7DA 1RUI2 1OH3A 5F9TA 1HRV3 1MS4A 3VKOA 1FNZA 1U12A 2TBVA 5JSOA 3ZX7A 4BLIA 4JKMA 1LCLA 2D98A 3SH4A 4H3WA 3A21A 3O1SA 5FMCA 3FLTA 2Q1ZB 1NLSA 1D2SA 1PX3A 4QKFA 4NROA 1HX6A 5FYVA 4YGDA 5F3IA 3RI8A 1POV1 4DO0A 5HPOA 1SBFA 3ZXGA 2DFBA 4CZSA 3BN6A 5GLWA 3H8OA 1TME3 3I2IA 3ZXAC 1JZ8A 2DU1A 1RITA 4HONA 3DCQA 4LHLA 3BUCA 1LEDA 1N3OA 4LJHA 4XUTA 1KFXL 1YQ6A 1RVF2 2C24A 2E6VA 4LORA 1AUYA 4WM7B 4AZZA 1FAYA 2X53S 1X9TA 2D5HA 3M3QA 3VDDC 4DZGA 3BOWA 5FV3A 3FC0A 1CAXB 3GZUC 4QM9A 2FZ1A 5LWBA 3ILNA 5B2GB 2G4IA 3NNLA 3OY8B 3BOPA 2P1BA 4O9GA 1J3PA 5FYSA 2XJQA 4OUSA 5AVAA 1O5UA 1UW8A 2VTXJ 5HV4A 1RUF1 4LLOA 2VMDA 1O8SA 5FYYA 4BQXA 5EFUA 5CFDB 5JPNB 1S1AA 4QM8A 1W6MB 3CIHA 4ES8A 3DN7A 3C7FA 3N9QA 4MSVA 2BOIA 1LOGA 2H0BA 2VOXA 5BUVA 1R091 4DUXA 2BWAA 2W1WA 2E7TA 3M7AA 2VG9A 4GWJA 3ZYFA 1VBB1 1W9TA 3EMRA 1G9CA 2W3JA 1YYNA 4P5YA 1R081 2V09A 2HWD3 4XF0A 4D3WA 4A7YA 3BODA 4Q0UA 2DTWA 3PJQA 1Z7S1 5CIRA 3NV4A 1OVSA 3PVEA 4WVMB 3VD5A 5EJ1B 3AJYA 5I93A 1MQTB 2D6KA 2VBBA 5FMBA 3ZSLA 5IVFA 3VBUB 1OOPA 4GMP0 4E9KA 2EIBA 1HB4A 1RTVA 4C1XA 3W20A 1LHNA 2JIGA 2D6OX 3CKHA 3RNSA 4LLFA 3U10A 2VMEA 2PAEA 4JTOA 1CAXA 2VAUA 3AXDA 1OUSA 4FXGB 2WNVB 3FX3A 4OHZA 4PIXA 3JB8A 3MF9A 1EPZA 1H2NA 3OY8A 5LEKA 4ARXA 1NA1C 4LBJA 1XE7A 1BBT1 4L11A 2PTMA 1W05A 1W8WA 2FDIA 5FY7A 1GZCA 1H1MA 5CFDA 2LTNA 2VQTA 2ZBJA 2B7YA 5DUUA 3MO4A 1RUH3 5E6HA 2GZWA 1SDDB 5IYYA 4QB6A 2WDBA 4K9SA 3AYDA 5G04L 3P3PA 2QZ3A 3T0DA 2E31A 2JICA 4FSJA 1YQ5A 4QHBA 2XWBB 4XAAA 3S7IA 4KWKA 2QQVA 5C71A 2QZ2A 1HXS2 5FY4A 2W0XA 3R0RA 3WNNA 3P1IA 3UK9A 1YHFA 1XNBA 4ZPIA 4G3YC 3I2JA 3OPTA 4FPGA 5JOZA 4WVMA 3IDEA 2ZGSA 1AR61 1MQTA 1UKGA 3E5UA 5M0TA 3VBUA 1ND3C 3H3UA 5D2AA 3B9IA 4JRAA 2LM3A 5A1AA 2G9FA 2WN2A 1QOTA 1UY2A 5JXHA 3ZSMA 4ZKTB 2DDUA 5FZAA 2XKPA 1CZSA 2ATFA 3M8LA 4QB1A 5A7SA 4AWDA 3H0OA 1K45A 4S2FA 2YGMA 3MPPG 1UOGA 1CX4A 4M3CF 2HWE3 2IVJA 3WD5A 4Z92B 1ODNA 3VL8A 3ITQA 4JKKA 3IB3A 3S5QA 5F7UA 3OD0A 4EN7B 3O5SA 3WVJA 1AR81 2DUOA 4NIHA 1V70A 4HSJA 4I30A 5K8SA 3I3BA 4P9GA 2Z4FA 2XDVA 2P2KA 1N3QA 1VPHA 2PMWB 4FQZA 2BVVA 4GQ7A 2W47A 4IV1B 2XQXA 3QCWA 3R4UA 4MYEA 2WS91 2GP3A 1NLRA 1TVGA 4KI5M 2VMFA 3ZDVA 2PA7A 4Y5SA 4A7KA 3AKTA 4OQ8A 4BISA 1HRV1 2RM22 3MBWA 4Q2FA 5C8CB 2OUJA 4CEYB 4XEZA 4NAOA 4MHRA 3BKZA 2QQWA 4IEYA 2B46X 1FOD3 2W08A 3ZPYA 1AJKA 2XUEA 1OURA 1PZ7A 1OBNA 2W91A 4WM8C 3ZPOA 5CBLA 5FDBA 2FDHA 4KBBA 3QH6A 5FMOL 5I0UA 2XMLA 2R30A 1PO23 1JMUB 3L2HA 4XJUA 5DAVA 4EZHA 4ISQA 4P08A 1IPSA 1LR5A 1AL0G 2QQLA 3OEBA 4I0BA 1EP0A 1BEV1 1RUJ1 3BPSA 1GMMA 1X36A 4QX7A 3J8F3 2RE9A 1SFNA 1RUD2 1JODA 2JG9C 3C8XA 3N9LA 4XQWA 2QQPA 2N7GA 3AMNA 1AR93 1XQNA 2WKKA 2VQ0A 1IGOA 2NMNA 3JB4C 1PIV2 1REFA 1TE1B 2QCSB 3H9AA 4K1YA 1GZ9A 3KMHA 4RL7A 4PLNA 4TZDA 4IV1A 3SH3A 4MHUA 4PDWA 1LOEA 1EV12 3TN93 3M3EA 4AEKA 2DVDA 2QE3A 3GHMA 5F39A 2MEV3 3PURA 1XSQA 4P5HA 5FJHA 5A3WA 1ALYA 4RR3B 5FZCA 4CEYA 4AVCA 4RHV2 4XQ4A 2FCVA 3RYKA 3ZYPA 5KXBA 3WF1A 1W8OA 2E63A 3JUUA 2A75A 4BK5A 4FP2A 3KS7A 4JVAA 4EROA 5GZCA 2VW2A 3MFCA 5T54A 4AQSA 4E4ZA 4XBNA 4WBBA 5EQUA 5LBBA 2C9AA 1ZZ7A 3GBWA 4KWLA 4LIUA 3VBRB 5C3OA 3GZTB 5LY2A 1ZREA 2R1DA 1PVXA 4YGBA 4LR4A 2A6ZA 3ZXLA 5GLTA 5FYHA 1JXNA 2A6XA 1DFQA 1OUXA 4FOYA 1KJRA 5F2SA 1QJZA 2DURA 2P6CA 3POJA 2ZEWA 4ZXEA 1SACA 5A32B 1X82A 3O0XA 4FXKB 3SEEA 3MW3A 5FZ1A 4Z1VA 1W28A 4JQRA 1PGL2 4Q0SA 4YVWA 1WLTA 2R072 1RHI1 5J96B 2W46A 4O7XA 3VBOA 1XJAA 2ZX4A 1JU3A 4QXKA 4XUOA 1O7FA 2UYBA 2ZGUA 2UY9A 5JIAA 4XTMA 2Y8KA 5DG2A 3D6EA 4FTBA 1FV2A 5BXXA 2JDHA 4MOAA 4FP3A 3WDVA 2BVBA 2HH9A 3LIHA 5FZ6A 4E2GA 2Q1MA 4KGQA 1UY0A 4XZPA 2X05A 3ZXEA 4RR3A 1UNBA 5F3CA 1OFSA 4QQLA 1UZYA 1HB1A 5FLJA 2FDKA 1NX9A 4ZU7A 3V65A 1CAWB 2BP6A 1DQ5A 3GBFA 4KGGA 2A3XA 1PNFA 2XJRA 1GQHA 4E8CA 3VB9A 1Y9GA 1DGLA 3VBRA 1JN2P 5H9RA 3QH7A 3WNKA 3U4XA 1DQ6A 2ZMKA 1BCXA 1US2A 3PUSA 3CZUA 4OMCA 4B29A 4YW3A 4AFAA 2XR4A 2IXCA 1NY71 2CL2A 4LO8A 5CB7A 4ASLA 5A32A 2P34A 1ND2B 1UY1A 4NOTA 2DCTA 2R32A 1NE6A 4M0HA 2OX0A 3ZIWA 3VHPA 2VPVA 2YHJA 3X29B 2WT1A 3FBYA 1RUC3 4NHLA 3V0AB 4RQPC 4P9XA 4C1WA 1LGCA 4FFIA 4A3XA 1HKDA 1RINA 4ISRA 5LA1A 1CPMA 1VBE3 2HWE1 2JDZA 1US3A 2QQKA 3T0BA 2F4LA 2QKDA 4L99A 4AR2A 1DQ1A 1W04A 4Y1ZA 4HKLA 4YW1A 2JKBA 3KCYA 3LPFA 4XFGA 1NZIA 4LA3A 4GB33 4CXWA 4DFSA 2DVAA 1FI2A 1UMIA 1ACCA 3BVCA 3ORJA 4GMP3 1PM4A 2LRPA 1SDWA 5FCCA 3VDDA 3WQBA 1KDMA 5JOWA 1CR7A 4XE9A 4DY5A 3BGAA 1J3RA 3DKWA 4HPKB 2BFUS 3MIDA 5GLZA 2YZ4A 1R1A3 3E6CC 3APBA 4XMAA 5GJ6A 4YM3A 3ZN5A 2KXLA 4IV3B 4Q1PA 1T2XA 1ND2A 2WNOA 3I97A 4OCTA 3TWIA 1AXYA 1WW5A 4CDXC 4AI2A 3BYWA 1GP5A 4XPVA 4CA9A 5GZFA 1RUG1 3L9JT 4Y1VA 4YNIA 3A0KA 4A41A 3IZOA 3M3OA 2DVGA 2PLV1 2OZ6A 3V0AA 1ENSA 1QJY3 2JDYA 2BJSA 1LULA 2FDFA 1AXZA 1QMJA 5C9AC 2ZGMA 1G86A 1PGW2 2HWB1 1PO11 2JE8A 2DFCA 1U0AA 2VU9A 3J8F1 4CXXA 2UWCA 1WMDA 4DOUA 4YLZA 5FZ4A 4Y5Z0 2K46A 4OFGA 2WFF2 5DUXA 2WABA 2WA4A 3ZM8A 1CESA 1YUDA 3MIFA 3WT3A 2TNFA 2YV8A 1AYM2 4UXAA 2WNEA 5HCHA 5A7WB 3LF7A 3E6BA 4NRPA 3SISA 1LEMA 3OBRA 4HPKA 5BV6A 2Z5WA 3TAYA 1NA1A 1VBA2 2EVXA 2ZMLA 5IAVA 4E4DX 3DXTA 1FPN3 4BA6A 4FOWA 4AHXA 1UU6A 4IV3A 3RZGA 3ETPA 1VBC2 4D94A 5ANNA 1DG6A 2VMHA 2Y6KA 4IEWA 2J7MA 1C8M2 3I2FA 4GKYA 3S30A 4I3PA 2A6YA 1MS8A 3WINE 1W9SA 2DCZA 3EJKA 5FZ8A 3I2KA 5T55A 4BMBA 3E1F1 1PVC3 3J7HA 4MXWA 2QJVA 3M3CA 4HKWA 4LK7A 2W52A 4AHYA 2IUWA 4XDOA 3HQXA 3WLUA 4XILA 1W9FA 2ZGLA 3DV8A 2D6PA 3I54A 3WDWA 5IHRA 1RUI3 3ZFGB 4C0BA 3KHCA 3H42B 4XJZA 2G19A 1DYOA 5IWFA 4CPBD 1ZA7A 3N7JA 4NRMA 1Y9MA 2WYFA 3KD4A 1UYXA 4QQOA 4D8MA 5A7WA 2CGOA 4NHKA 1SLIA 1VJ2A 3VZKA 4ZONA 1LKNA 4LT5A 4AGRA 1W06A 2NLRA 1B35B 4Q4V3 4AHZA 1X8MA 4HVRA 2WIIB 4CU6A 3KSCA 1RGSA 5DZFA 4MG2A 2YB7A 5CFCB 1IKQA 3FUQA 1KQRA 1UZWA 2B45X 2XJVA 4Q26A 2DWRA 3KLSA 4E8DA 2WL1A 4ORFA 4Q4Y2 5JPMB 1QJX1 2ID4A 5LBEA 3SCFA 3TN92 1LGBA 1AX2A 1VAMA 1ZBE3 2HYKA 1LAJA 4QDRA 5FZHA 3IKWA 5IVYA 3TEXA 3NVCA 4IGPA 1HRI2 1RVF3 4TLGA 2JDMA 2TUNA 2Y34A 1OOPC 2D6LX 4XUPA 5F5CA 4RGGA 4WM7C 4KL1A 2VW0A 4OLLA 1V9U2 2HWC2 1C5HA 4HVOA 1MPXA 3AL5A 3T4HB 1O3SA 3RS6A 5FY5A 3ZFGA 4AFMA 5CAZA 4XVHA 2R49A 3KCCA 1QIQA 1JOBA 2VM9A 5DQ0A 3WCRA 2TEPA 4Q27A 4CCNA 2WYSA 1B35A 1ULGA 1ASJ1 1GP4A 1VRH3 1WD4A 1XPWA 3AL6A 4OUMA 4CYDA 4EN6B 5CFDC 2NP0A 5T52A 3S6PA 4Y1UA 4L2NA 1CIWA 2BV4A 3AC0A 3RYPA 5A3OA 5C3PA 2BGPA 5T50A 1UN1A 3LEIA 1CJPA 1DU3D 3QLQA 1N1SA 3B69A 3VZMA 4L92A 1EYBA 1ZBA2 3PTYA 3OOXA 1D4VB 4OI0A 1YFYA 4AI1A 3FWEA 2ZOEB 3PL0A 4ZU4A 1OLQA 1MQTC 2ORZA 5A80A 1R1A1 1NCQB 3VBUC 1H8TB 3IDAA 3WQ0A 3O1VA 3KT1A 4D0QA 2IXLA 2WRAA 3GM8A 3J9SA 2UWAA 5LA2A 4LTAA 3LEMA 3OPWA 2WNVC 4HMZA 1FMD2 4JAAA 3VZLA 1OF4A 2ZX1A 4OYUA 4MO3M 3NJVA 2A3WA 4DY3A 2Y6HA 4I02A 2RR11 3OB8A 4LK6A 2ZHMA 5EYYA 2Q0AA 2CHHA 1XE8A 2BFUL 5L9RA 2Y0IA 4FOVA 2F6BA 4HN0A 2GN7A 2PAMA 2G9ZA 1POQA 2BUKA 4XC9A 5FZ7A 1RUE2 3ZOIA 4EYUA 3MIBA 2VMGA 2VO5A 3HVDA 3TOJA 1EAH2 4FOQA 2HEVF 3VDCA 3S0MA 3D4KA 2ARXA 4LULA 1W6OB 2VUAA 5FUIA 5FPLA 1QXRA 2XH6A 4ET7A 1YFXA 5CVRA 2HWF2 2D5FA 4CCOA 1YLLA 5FIXA 1JYWA 4HT1T 1LJ7A 4K40A 1NCQA 2A5ZA 3V0BB 2XB6C 4AEDB 4D6QA 3WSOA 1FPN1 2AUYA 1W8HA 3EQEA 4YZ4A 5D1IA 2DVFA 4A4AA 5IVVA 3POSA 1LODA 1MEC2 5DDJ1 5LK7B 2BOJA 1JUIA 2CDOA 3THCA 2IVIB 3RRDA 2XKOA 4YZ5A 1YO8A 1LOFC 5DAWA 1OSGA 2WN3A 3LA3A 3CHXA 4XHBA 1DGWX 1IZ3A 2BERA 3WG1A 1PZ9A 4AVTA 5FQ0B 2QQNA 3D82A 3FLRA 4A3ZA 5H9PA 4IV1C 2Q30A 2VW1A 5E89A 2VOKA 2ZXQA 3H7JA 4BQ5A 4DUVA 4BB3A 2VOWA 3RJRA 1RUI1 2RM23 4FPJA 4QXBA 4V2WA 1JBCA 2I74A 3JBG2 5C8CC 1NLQA 2VGDA 2AENA 2YGLA 4CEYC 4IW3A 4EWDA 3ILRA 4HL0A 1C28A 1JTZX 1IG3A 5CG9A 1LOCA 1O4TA 3OF1A 4AEDA 3ZLIA 2Y64A 5JOYA 2OVUA 4MGQA 1GLHA 4PBOA 1KFUL 3K2OA 2WA3A 5F3EA 1RMU2 5FMDA 3WF0A 2ARBA 3DYOA 1NKGA 1MZEA 3WOGA 2Y6LA 2YFZA 4EJRA 4Y4YA 3DEMA 4PJYA 1SLBA 1DHKB 3LSDA 5E1RA 1ZA4A 4A44A 2YC4A 4IUGA 4IL7A 2GNDA 4A7ZA 1DP0A 4DEQA 1FYUA 2HEYF 1PX4A 2VJXA 4LKDA 4GWIA 3ZFFB 1K12A 1W3VA 1PZ8A 4DNYA 2BNNA 1ZRIA 1PIV3 4LBQD 3V64A 3FUOA 1XB9A 3MF6A 3OGVA 3KV4A 4YVWC 1EV13 2D97A 5F8PA 1G9AA 2RS31 2E26A 4L0PA 2JX9A 2YUEA 3CQOA 4Q8LA 3B3QE 4CDXA 2VBPA 3SKVA 1QXPA 4I0AA 2JE7A 5A7PA 4D6SA 1PMHX 3AP5A 4BQ1A 4MADA 5FZOB 3KV5A 5AC92 3ZMNA 4RHV3 4YZ1A 2ENRA 1YCIA 4RR3C 1WKYA 3EHKA 4NPLA 3PJYA 1KXGA 4Y20A 4DUWA 1F4HA 2R0FA 1RUNA 1PVC2 3WDTA 5IUQA 1OQ1A 3VBRC 3WHTA 1AF9A 3H8RA 2R6QA 3CJIB 3SITA 3ROUA 4K3UA 4MVTA 2QUOA 4Q4W2 1K5MB 3J26N 1YQCA 1Z78A 2ES3A 3OGGA 4XACA 1AL22 2IXJA 4AI0A 3T4VA 1W8ZA 3CDZB 2OQ6A 4HSLA 4OHYA 5A6YA 2BYVE 3SLIA 4XJWA 3WZ1A 3SKJE 2YYOA 5DXDA 4EV0A 2YBPA 3VN4A 3ZFFA 5FO7B 2YDEA 4Q4V2 3TB0A 2BEOA 3AZYA 1SLLA 1GV9A 4PF5A 1QJU2 2D43A 3CNAA 2R073 1NXD1 3M3IA 3SEPA 4OI1A 3BPZA 4F7ZA 5FPAA 2WQZC 2FZ2A 1WLWA 4AYUA 4B8EA 3N9MA 4AI9A 2AEYA 1YJKA 4UF0B 4DXTA 3PVBB 4XUNA 2QVSB 5SV5A 1VB4A 2E7QA 3LAGA 4CP0A 5FZOA 4WVZA 4GALA 3DUIA 3JD72 1BK0A 3ON7A 2PFWA 1ODMA 4K20A 2B39A 4L97A 4OHWA 4XFFA 4BZ4A 1P8JA 1ZBE2 5LK5A 1O3TA 1JYIA 1JOJA 1UL9A 4RD7A 4YGEA 1OPOA 1ZNPA 3ZXKA 1W3XA 5LA0A 4OI2A 1RXFA 5C3SA 4CDWB 1Y9QA 2X5IB 2BTVC 1OFNA
chains in the Genus database with same CATH topology
5I91A 3O14A 1K5MA 4Y22B 1V6JA 1HQWA 1QQP2 3C2UA 1QHDA 1HXS1 4XF3A 4JC1A 4MH0E 1Q56A 1O3QA 2YC0A 3NV2A 2XL9A 4FPEA 2Z2SB 4DQAA 1ND2C 1VRH2 2VVEA 2ZGOA 4P9IA 3URFA 3A0NA 1H2KA 5JDBA 2D40A 4XFCA 3AZWA 2LUWA 4B3NA 1F5FA 4AVVA 4XJ9A 1F9KA 2GNMA 4LBMA 4B7KA 2R042 2PHLA 4HFSA 3ZSKA 2H6CA 1D2QA 4W6YA 5HCBA 1AYN1 1WW7A 4NWVA 2DUPA 2PN5A 4N43B 2CY6A 4WM7A 2UU8A 1NCRB 1VIWB 4CDWA 5IK4A 2X5IA 3VBSA 3LZZA 1AR71 4Y22A 1WCDJ 3N35A 4BH9A 4Q0QA 1F8VA 3OJBA 5JAXA 1S2BA 4XF4A 3BCWA 2RM21 4DMIA 3IDCB 3ELNA 4FPYA 4TSVA 5J3UA 3DL3A 5CA6A 1RL3A 1SCSA 4MV2A 4IV3C 4W6WA 5FOJB 5FBZA 1W6MA 1DGWA 1W39A 4FPOB 4J6GA 3IN9A 3TNPB 1VBD1 5TSWA 1OA4A 4OZXA 4AI8A 3ZN4A 4ATFA 4KWJA 4K1ZA 2PELA 1F5JA 2BNOA 4YGCA 4URTA 2C5DA 4FAGA 3MYXA 1JYCA 2PHDA 5FLIA 1M4WA 4NPRA 1RUD1 1LGNA 1D0HA 3VBFB 2WFF3 3GYDA 4N43A 2BQPA 4KU8A 1HQLA 3LA7A 1UU5A 2A7AA 1NCRA 1AYM3 3FE5A 4D7YA 2YY1A 1ZZBA 3M2MA 3PMEA 2XLAA 2WNVA 1NQDA 1QGLA 1UPIA 2NM1A 3AP4A 3N7MA 1D4M2 1VBA3 3NV1A 4KG8A 3BALA 3KGLA 1V6IA 4H55A 1J58A 2WZR2 2VH9A 4AG4A 3I4IA 1VBC3 5GLUA 1DZQA 5KBFA 5BNNB 2GC1A 2QNKA 1LHUA 3BIWE 4E2QA 5GZEA 1C8M3 4Q1RA 3GALA 1NYWA 2SBAA 4M0NA 2WLPA 4R9BA 1R092 2ZZJA 3VKMA 1C1LA 5K7PA 5KHKA 2GC0A 2O8OA 1S0IA 1MVQA 2WT0A 1VBB2 3TBDA 4LNVA 1TMF2 2VOVA 3U11A 3AP7A 4K7JA 1ZRFA 3VBFA 1Z7S2 3AMMA 3INAA 3OD4A 3ZYGA 2ETEA 1VAKA 3ZFGC 5IK7A 1VB2A 4X6QB 4BCUA 3PVOA 1ONAA 2XGXA 4OHXA 1FT9A 1WCKA 4XIKA 2B8MA 1WMFA 2FQPA 2GH2A 5JR7B 4COYA 4ONUA 1B35C 2HEWF 2UWBA 4BWOA 3RMYA 1BBT2 1LOFA 4HZFA 4KH9A 5CFCC 3ZYIB 1TME1 1GSLA 2XBO2 1PMIA 1MS5A 4JDMA 2RS12 2JJ6A 4Q4Y3 4S2HA 1X8EA 1QNYA 3H7YA 4AXOA 3AKPA 1UAIA 1HRI3 1QXJA 1YRZA 2XWJB 5C8CA 4GKXA 1UD1A 2HKXA 2ZAAA 3RG0A 1V9U3 2HWC3 1OA2A 3MLJA 1LU1A 2IWGB 4MUVA 2B9UA 5F6KA 3H50A 3ZXFA 1D0GA 1LOAA 2NZ9A 1AX1A 3A4UA 3ZMOA 2O1QA 3HAGA 3B94A 3DGTA 4V1PA 2NPIA 2HWD1 4JDOA 4AFCA 1GQGA 1WCSA 1XNDA 3VBHB 3B00A 3THPA 4NWWA 5EWSA 4W65A 3B7MA 1LHOA 1ULDA 1ZBA3 4HKOA 2WS92 1YIPA 1H9WA 1NQJA 2Z69A 4PCRA 1NCQC 1UIJA 1H8TC 3ZIXA 1DIWA 1GYKA 3CU7A 3E5XA 4LBNA 1ZRDA 3FFZA 2P3KA 4FPFA 5J98B 1FMD3 3H8UA 4PIYA 1RUH1 4MGIE 2PHFA 2I45A 3E97A 4FO9A 3T1MA 4R9AA 4M3CB 1WLCA 4QU2A 3WW3A 4LO7A 5LEJA 4ZXKA 1MZ5A 1BEV2 1RUJ2 1TQ5A 4R4ZA 3JU9A 1MR5A 3AKRA 1RUE3 2ZGPA 3UL2A 3VBHA 2GC3A 2JG8B 4N7IA 3CJXA 5L19A 2D93A 2GU9A 1EAH3 3AFKA 3PHMA 3ST7A 1SEFA 1V6MA 3RPQA 4BM8A 2HWF3 3R05A 1ZRRA 3MDPA 4MGKE 1A8MA 3FMGA 2XL7A 5ACA2 2XVKA 5T3NA 4HANA 4AEDC 1N1YA 4SLIA 4ZU5A 1CAWA 3ZSJA 4N53B 5LRSA 1MEC3 2XPJA 1MS1A 1DQ2A 4R9DA 4M3CA 1MZFA 1DYPA 3O12A 4XDQA 4QX5A 4XXAA 3NAPB 1LHVA 2YROA 1S0GA 4QGNA 2H0VA 2CAVA 4WVVA 1H1AA 3J4UH 3WW4A 5J09A 4BLJA 3PVNA 1FOD1 1RJ8A 3VHOA 3W58A 2YMZA 1RHI2 3JBG3 4IXLA 1PO21 1DQ4A 1BMV2 2DF7A 4S2GA 3NWKA 1G7YA 1GICA 3VLBB 1XYOA 3USUB 1REEA 1RMU3 4N53A 1LU2A 1AR91 4J1WA 5HCAA 3ES4A 1S0DA 1NZCA 3VGIA 4GWMA 1EY2A 2VUJA 5F1RA 1BQPA 2VULA 4QPGB 5CADA 2VY0A 3NSTA 1UCXA 4ITCA 1F31A 5GKAC 3TN91 5JSRA 2GNTA 4EN9B 5GM0A 2P3IA 3KT4A 4OVEA 2MEV1 4Q4X2 3LA2A 1VP6A 3NAPA 4FPCA 3ZFFC 1DF0A 5KC5A 3LOBA 1JHNA 3JQWA 3WX5A 1FNYA 3AYCA 1ULCA 1QNWA 1NY72 2W39A 3BTAA 1HW5A 4MX3A 5AC93 3MW2A 3FBMA 1UIKA 4META 4YZ3A 4IEVA 5KHJA 3N36A 1GKBA 3B01A 1ENXA 2ZHNA 3KQRA 1QDCA 1ENQA 4AEJA 4FPLA 3QOPA 3TRSB 4GWNA 4Y1XA 2ZZQA 4S2DA 3USUA 4X6RB 3LKJA 4Q4W3 1KDKA 3WDXA 3CJIC 1AL23 2P37A 1K5MC 1H1IA 1S0JA 1Z0HA 4YVSB 4XFBA 5FO9B 2XUMA 2CAUA 1QF3A 4PLOA 2D3RA 2IZWA 1QJU3 2QDNA 3UKTA 3MPBA 5JSPA 2B42B 1X7NA 2WNUB 4YSFA 4AQ2A 4ATEA 2RS52 4HN1A 4LBQB 1QH6A 3ZSEA 3FFQA 2MPFA 1SBDA 4I09A 3JD73 2PLV2 3HMYA 5HXVA 2AR6A 2CGPA 1S0FA 1WLDA 4CRQA 2ZHLA 5KHHA 2RMU2 4IEPA 1SLAA 2HWB2 4B4PA 3K48A 1G9BA 1BVVA 4UW3A 4HETA 5HBAA 2JG9B 1RUE1 3AMQA 2X5IC 4CDWC 3QD6A 2AGSA 5JZGB 3VBSC 1YXWA 4TLFA 3SH5A 2BPA2 1QQP3 3H1YA 1IS6A 5BPXA 5GALA 2E53A 4YVSA 1RUC1 4QPYA 3O7OA 3Q9OA 1Q8SA 2DTYA 3W9AA 3AZZA 4K6BA 4MGZE 3HR9A 1VBE1 3GZAA 2CYFA 1REDA 1URXA 2DYCA 2WNUA 2SLIA 5CFCA 2EAKA 1WGPA 2Z42A 4BOWA 4R8HA 1XNCA 5K0UB 1KRIA 1Q8OA 2R043 4GB31 1CVNA 2JEMA 3LSEA 4GMP1 1J3QA 4UW5A 3RZZA 3WG3A 1HQNA 1IS5A 4Q0PA 1CJDA 2AH2A 3G6JB 2E7AA 2ZS6B 3DF0A 5FO8B 1XNKA 4N43C 5F5QA 4QGLA 5JI7A 3TYJA 1NCRC 3ZO0B 5FREA 5JZGA 4QQPA 3HT1A 3EBRA 3SCGA 3ETQA 2WJSA 4NHMA 2ZKLA 2KA3A 2C1FA 2WINB 2IC1A 3WUCA 3JBG1 4RS5B 1QJY1 4NVPA 4I2OA 3AP6A 1XYNA 2WSUA 3E6DA 3R4SA 2A71A 4IESA 1I1EA 4SBVA 1TEIA 2K2SA 3MW4A 2O8QA 4ES9A 4AHWA 4TYSA 5CU1A 5K0UA 1RMU1 4FT8A 5C4WB 1SFYA 4C91A 3I2DA 4O9EA 1PHMA 1DZRA 3GBGA 4LBLA 2ZPXA 4B4QA 1V6NA 3IPVB 1MVEA 1QJX2 5JMCA 1SBEA 2E9QA 4YG3A 1HV1A 3VBFC 3WHUA 2QFEA 1QY4A 1H8TA 1IQAA 4YFZA 1IKPA 4JGYB 2ZCWA 4PBPA 4AK3A 2I2SA 3S7EA 1D4M3 3B02A 1W0OA 2R062 2WZR3 4BE3A 2WT2A 4RQPB 2D7FA 4RS5A 1CONA 3E5QA 1FATA 4IEXA 2OUHA 4WZCA 1PVC1 2OPKA 3WP6A 4AGVA 4CEWB 1R093 3WP4A 4CP2A 1UF2C 1VBB3 4HK9A 5C4WA 2PQQA 1A3KA 4N9IA 1SQ4A 1TMF3 1W6OA 3USSA 3MEPA 3IPVA 4B7EA 3GF6A 4AFBA 1Z7S3 1LTEA 4Q4V1 3ALQA 1XXNA 4L8QA 4XFAA 4YW5A 4CTEA 3V0BA 2VQAA 4JGYA 4GH4B 4COUA 2RJLA 2G9GA 4WZFA 3B5LB 4IEQA 1A8DA 2DCJA 5HCFA 3ZFEB 1QDOA 3AK0A 1KD7A 5D8AB 4COVA 1BBT3 1MZ6A 3GHNA 3H1WA 5E16A 3WCSA 5E8AA 3JD71 5IK8A 2PHTA 2RR12 4YZ2A 1WBFA 1ZBE1 3UKNA 2XBO3 5L7OB 4I0WB 2GN3A 4LA2A 5FQ0A 2RS13 4JV4A 1RVF1 1DBNA 3WR0A 4CEWA 1YWKA 4COZA 4G4FA 3WQ1A 2A73B 2RJKA 4Z82A 1G8WA 1COV2 4XFHA 3AXEA 1QQP1 5C6CA 3N7KA 1VR3A 2NN8A 4UBGA 4BMEA 2NQYA 1N1VA 2ZABA 4FQ4A 1QU0A 4QT6A 4D7TA 1S55A 5J37A 3NV3A 2Y38A 2I07B 1NXMA 1VRH1 2GSYA 4KQ7A 1S0EA 2A70A 3M1HA 5LRRA 5C8WA 3UKVA 1HLCA 3VUOA 1LOBA 1G6NA 2IXIA 4GH4A 3NL1A 1C4RA 1WBLA 2FMDA 2Q4SA 2BGCA 2GC2A 5EZWA 3JZVA 1G9DA 1O91A 1YI9A 1E57A 2OW4A 2R041 1ZM1A 1J1LA 3NO8A 4AI3A 5D8AA 3THTA 2VXRA 1AR83 4QQHA 3VBHC 2WZPP 4Y24A 5L7OA 4XOGA 4YG0A 3ACLA 1QH7A 4L9BA 3NKTA 1SCRA 1L3JA 3HD8B 2WS93 5L73A 5ABJB 5I0RA 5J36A 4HLTA 3MIEA 2VNGA 3RMXA 4Q8KA 4GXLA 2K9ZA 4GA9A 3M70A 4XXPA 4R4XA 1BYHA 1OMIA 5H9SA 1A78A 4CDUB 3ZXJA 1GZWB 2ET1A 5E88A 4YM2A 4LUMA 2ZX2A 4X8NA 2JD4A 3HWJA 2BW8A 4U36A 3ES1A 2PHUA 4IEOA 3CJIA 2OZJA 4G9SB 3WXPA 3CF6E 4DB5A 1M06G 1BEV3 5AFBA 5I8YA 4CDQB 3RI9A 1DGRN 1RUJ3 4YRDA 2A6VA 3RJ2X 3WY6A 5KHGA 2X29A 2QDRA 1QOOA 2JG8C 4BIOA 4D7SA 3MICA 1MS9A 4LHKA 1CAUB 1ZZ9A 5JWPA 1X33A 1VALA 4LBKA 1OOPB 1FV3A 2GMMA 3KB5A 3PNAA 4JDNA 3R6SA 3O0WA 2ZGRA 2RS32 5ABJA 4MZUA 4QPIB 4XQDA 1C8NA 1D4M1 1KS5A 1A6CA 2X8KA 1AX0A 3LCPA 3NJZA 5ACA3 3VL9A 2NYYA 2WZR1 3POWA 1CQ9A 5T5PA 1YFWA 4F3JA 4JGZB 4QMAA 1LESA 4CDUA 2GDFA 4JCKA 5FPZA 1GZWA 2ZMNA 3JCIA 4N53C 4NO4A 2EXIA 3D0SA 5KC6A 4M01A 5FFOC 1O4ZA 3WP3A 1V6OA 2ZACA 2FBEA 3NAPC 4CDQA 1TMF1 1NG0A 3OTFA 2BWCA 4IEZA 3OPZA 4RSUA 2PHWA 1VAVA 4QD2A 1CAUA 1XYPA 3BB6A 5IT6A 4NN0A 4YYOA 1RHI3 3WG4A 2PHXA 2PYTA 4QPIA 4NR1A 1DGRA 4DPNA 2V73A 4XMIA 1C3HA 2F4PA 4B4RA 3JQXA 2XVLA 4JGZA 2XBO1 4RA0A 4LBOA 5BNPB 1PIV1 2UURA 5AVPA 3DPRB 2RS11 5FOBB 4X8PA 3IM0A 1OKQA 1UMZA 3AJZA 4QPGC 1PK6B 1EV11 3N7LA 2VMIA 5JVVA 4Q4X3 3D5OA 1DDLA 3HT2A 4DS0A 1APNA 1J1TA 2O0OA 1H9PA 3CLPA 4FTSA 4YM1A 1N1TA 1RUF2 4RHV1 1IOAA 1H4HA 1W6PB 3WV6A 3AMHA 1S0CA 1ZVFA 3AYAA 4I3GA 1G9FA 3U07A 4AQ6A 3FZ3A 1WW4A 1OPMA 4GIQA 4TWTA 1ZX5A 1R082 1NE4A 2ZGKA 2GH8A 3QBQA 3LB9A 4AVAA 1AYN2 5BY5A 1Q8VA 4YM0A 5BNOB 2ZGQA 3AP9A 3IT8A 1OQDA 4P9JA 5BNPA 1PGL1 2XJUA 3DPRA 2R071 3ZYJB 4YVSC 1PK6A 5GZDA 4EN8B 4PDWB 2CTVA 1ZZCA 2C0ZA 1Q3EA 1AVBA 3IIAA 1AR72 3K51A 1SLTA 2H6BA 1BKZA 2WSVA 4DINB 2DCKA 3HN1A 2WNUC 4OULA 1W6PA 2RS53 5FRAA 5BNNA 1AJOA 3IBMA 3MZHA 4W6XA 3WQ7A 1RUG3 1VBD2 1YNAA 4FPHA 1LECA 1Q43A 1V00A 2PLV3 1ZZ8A 2WQ4A 2CWMA 2R1BA 3ZXDA 1SLCA 1HDKA 2BBVA 2RMU3 1BZWA 2HWB3 1PO13 4N90A 2LALA 1W6NB 2ZA9A 5BNOA 2E51A 5JZGC 4F8AA 1AR62 2IFWA 1W0PA 4YVWB 4YW4A 2BNMA 5GLVA 4C0HA 3WDUA 3PMSA 3VBOB 5KXEA 2CWSA 3WW2A 5KWRA 2ZAHA 5KXCA 3MGUA 5EV7A 1H2LA 3D8CA 1PNGA 1VLNA 3MLKA 3VZJA 3B93A 3UJOA 2YPJA 5ACA1 4LEJA 2ERFA 5F6LB 4N7UA 2IXKA 5DUWA 1OHFA 4QQ2A 1EPWA 1AR82 1ZZ6A 3AX4A 4BIFA 5K0UC 1C1FA 1S2KA 5I8SA 2XJPA 2EALA 1IS3A 3LWCA 4UW6A 1XRUA 4Z07A 1KS4A 3T2TA 1I6XA 4J1XA 4XHXA 4Q29A 3MFAA 2DU0A 4XYXA 1H8VA 3W59A 3VKLA 1HRV2 1ULEA 1IHMA 3P3NA 1W6NA 1WUVA 1YI7A 4DXZA 3MI8A 1BJQA 2FMYA 4DRRA 5T5OA 2GNBA 2IFRA 1I5ZA 1JH5A 1LB2A 1S0BA 4LO4B 3WNXA 5FAXA 3IWZA 1Q5OA 4RS5C 1N3PA 1BMV1 5JCTA 4ASMB 5FLHA 1PGW1 5FTTC 3I8TA 4P9LA 2VNOA 1MS3A 4LE3A 4AQTA 3EXUA 1BK1A 5DZEA 2ZHKA 1TME2 1POV0 4H14A 4IERA 1O3RA 1SMVA 2WFF1 2RHPA 5C4WC 2VNRA 5JOXA 4XJ8A 3CO2A 3AKQA 4RGAA 3VDDB 1AYM1 1QJX3 2UY8A 1Y7BA 1U5XA 1N47A 3LOIA 4Q4X1 1VBA1 3FJSA 5L36A 2EAAA 1IPJA 5EYXA 2KM2A 4JGYC 1GNHA 1VBC1 1O5LA 1W6QB 3WDYA 4AVSA 2DV9A 1C8M1 2R063 3KM5A 4XTPA 4Q0VA 4OI4A 1F2NA 4CP1A 4HK8A 1YIFA 2ET7A 4JTNA 3OGJA 4PQ9A 5DZGA 1UZZA 1ASJ3 4AEMA 3ECQA 1Y3TA 3ZN6B 2ZKNA 3ASIA 1AXKA 2HWD2 3ILFA 3AKSA 3AZXA 3NW4A 2JG8A 4CEWC 1DYKA 4E27A 1JUHA 4LHNA 3KT7A 3UJQA 1CD3G 2CNAA 1H4GA 2V5YA 3POYA 5JLVA 4INDA 1ENRA 2A3YA 3SNMA 4AVBA 1NA1B 4P14A 1AHSA 4P9YA 4R52A 1U5IA 3FHIB 2Y26A 2A6WA 4FVVA 1FXZA 2WLQA 4P9WA 4GH4C 2RS51 1C5IA 3AFGA 2WFPA 1W6QA 4XF1A 1IPKA 2EXJA 3VZNA 1RUH2 4M00A 1XU1A 3ZFEC 3MIGA 5I8TA 2MHFA 4Q4Y1 4MXVA 5D8AC 2RR13 3H1MA 3RDIA 1CPNA 2K0GA 2GMPA 2NMOA 5L7OC 3ZN6A 2JENA 4KNCA 2RMU1 1HRI1 3D0JA 4Y26A 4MXWB 1Q8QA 2ZJCA 3TNQA 3RQ0A 4DRVA 1V9U1 2HWC1 1J59A 1COV3 1ND3B 2W68A 1CGPA 5KXDA 2HJIA 3WUDA 3RWNA 1DLLA 2XG3A 2HWE2 2B5HA 2VVDA 1ZRCA 1QKQA 1IS4A 3OCPA 1TNRA 1R1ZA 4XIOA 3ZDSA 1HIXA 3WG2A 5A3MA 1CAVB 2JE9A 3MLLA 5SV8A 2D3SA 4Y1YA 4QGMA 5DDJ3 4QPGA 5IK5A 4WVWA 1ZBA1 3H3ZA 4XBLA 3AYEA 4C90A 2Z79A 2XLFA 5CG8A 3MIHA 4EWEA 3R4DB 1LHWA 1H0BA 4UW4A 5H9QA 1WD3A 1MS0A 1YJLA 5ABJC 1ND3A 1FMD1 1FOD2 3VBSB 1H2MA 3KCXA 4JRLA 2D3PA 1RC6A 1RUG2 4WM8B 4D69A 3ENRA 1OD5A 2XJTA 1LENA 2XJSA 4XBQA 5A3LA 3QACA 1PO22 1RIRA 1GFF2 5A33B 4CDUC 5BYNA 3T1LA 1RB8G 1DQ0A 2WWSA 1PO12 3N3HA 4I01A 3BU7A 3J8F2 1TNFA 3HBZA 1O4YA 2FHRA 1Y43B 1GR3A 1CAVA 1AR92 1EAH1 4AFDA 4IETA 2CGNA 4CDQC 1UPSA 5K9YA 5DG1A 2HWF1 1I9RA 2AREA 1LRHA 3WW1A 2D44A 2MEV2 1V6LA 3ME2A 1WW6A 3KGZA 4H7LA 4LO5B 5J48A 4BPZA 1HV0A 1NOVA 4UBHA 2JECA 2RS33 1OA3A 3NKGA 1H30A 4LBQA 1KJLA 4QPIC 1MEC1 2R061 4WM8A 2EF6A 2Q8OA 3ATGA 1ZYBA 1CN1A 3GNEA 1U5YA 4A2UA 1UU4A 3SHRA 2CV6A 5A33A 4JGZC 4AE2A 1WMEA 3VHRA 3VKFC 4K21A 1KITA 5C33A 1B09A 2IXHA 4LUKA 3AB0A 2JG9A 4XETA 3AMPA 4AF9A 2EA7A 2XHKA 2UYAA 3HIFA 1UX6A 2GMEA 1OI6A 5I0SA 3WP5A 5AFEA 5T5JA 2AYHA 2AZ5A 1OQEA 4HVQA 5JIUA 4EN0A 4BYYA 4Z8BA 4KG0A 3V56A 4U2AA 5I0TA 3ZVXA 4FPKA 4COWA 5JI9A 1OLRA 1W2UA 3O0VA 3VZOA 4LO6B 4XW3A 3RYRA 1POV3 2EIGA 3CL1A 1GANA 3EO6A 4KU7A 4OHVA 2EXHA 1RUOA 4MLOA 4PLMA 1JW6A 4LE4A 5BNPC 3DPRC 1WA4A 3KZ4C 3ZYRA 4WV8A 5DUVA 1PK6C 3SXWA 4AGGA 4F83A 1COV1 3IDBB 1HXS3 5AC91 2VECA 2OYZA 1RUF3 1RUC2 3PLQA 2WC2A 1C57A 1ASJ2 2R0HA 5BNNC 4EWAA 5GZGA 1I3HA 1VBE2 5EXOA 1ULFA 2ZGNA 2PAKA 3AM2A 4GULA 3RSJA 1MACA 4R9CA 4Q4W1 1AL21 4GB32 3I59B 2GAUA 1X50A 2VVFA 1R083 2DVBA 4PIZA 1AZDA 1Q8PA 2ILMA 1GNZA 1AYN3 2DCYA 4XFIA 3M4FA 2R16A 3SMHA 5BNOC 4IQPA 2XVGA 5CNAA 3OBTA 1QJU1 1R1A2 2MNGA 2P3JA 4PDWC 4CDXB 1AR73 3VHNA 3SCHA 2D6NA 4FBFA 1RJ7A 1DZTA 2OA2A 3N4MA 4FCAA 4RQPA 4N9HA 1PM7A 1QJY2 4XJAA 4FTEA 2P17A 5C9AB 2ZGTA 4AW7A 1VBD3 4Y20B 4BHPA 5BNQA 3OYWB 1YFUA 3IMNA 2ZX0A 3VKNA 3FLPA 1BXHA 2Y0OA 3U0ZA 3CEWA 4E2SA 3I59A 2OIIA 3G7DA 1RUD3 3LGRA 5T5LA 1T6GC 1AR63 2XLGA 2Q5TA 2DUQA 2D6MA 2EXKA 1V6KA 4YW2A 1XU2A 4XF9A 1GBGA 3VV1A 1FX5A 1FPN2 2ZTNA 4YARA 4HBNA 2GALA 3VBOC 5KHIA 4IEUA 4YFWA 4RFT0 5HI0A 4MGYE 4E4SA 3L2YA 3ZFEA 5DDJ2 4M3CE 3B9CA 2YXSA 2ZX3A 4FAHA 5C9AA 4Z2WA 3UV9A 5FPXA 4YG6A 5EJ3A 5J7MA 3OYWA 1BVP1 1QWRA 5FMOS 1UKRA 1PGSA 1QOSA 3AZVA 2PHRA 4H7MA 1U5ZA 2JXAA 3C3VA 4K8FA 3I7DA 1RUI2 5F9TA 1HRV3 1MS4A 3VKOA 1FNZA 1U12A 2TBVA 5JSOA 3ZX7A 4BLIA 1LCLA 2D98A 3SH4A 4H3WA 3FLTA 2Q1ZB 1NLSA 1D2SA 1HX6A 4YGDA 3RI8A 1POV1 1SBFA 3ZXGA 2DFBA 4CZSA 5GLWA 1TME3 3ZXAC 2DU1A 1RITA 4LHLA 1LEDA 1N3OA 1KFXL 1RVF2 2E6VA 4WM7B 1AUYA 1FAYA 2X53S 2D5HA 3M3QA 3VDDC 4DZGA 3BOWA 3FC0A 1CAXB 3GZUC 4QM9A 2FZ1A 3ILNA 5B2GB 2G4IA 3OY8B 3BOPA 4O9GA 1J3PA 2XJQA 4OUSA 5AVAA 1O5UA 1UW8A 1RUF1 4LLOA 5CFDB 5JPNB 5EFUA 1S1AA 4QM8A 1W6MB 4ES8A 3DN7A 4MSVA 1LOGA 2H0BA 2VOXA 5BUVA 1R091 2BWAA 2E7TA 3M7AA 2VG9A 1G9CA 1VBB1 1YYNA 1R081 2V09A 2HWD3 4XF0A 4D3WA 4A7YA 3BODA 4Q0UA 2DTWA 3PJQA 1Z7S1 5CIRA 3NV4A 3PVEA 4WVMB 5I93A 3AJYA 1MQTB 2D6KA 3ZSLA 3VBUB 1OOPA 4GMP0 4E9KA 1RTVA 4C1XA 1LHNA 3RNSA 2D6OX 3U10A 4LLFA 2PAEA 4JTOA 1CAXA 3AXDA 4FXGB 2WNVB 3FX3A 4OHZA 4PIXA 3JB8A 3MF9A 1EPZA 1H2NA 3OY8A 5LEKA 1NA1C 4LBJA 1XE7A 1BBT1 4L11A 2PTMA 1GZCA 1H1MA 5CFDA 2LTNA 2ZBJA 5DUUA 2B7YA 1RUH3 2GZWA 4K9SA 3AYDA 3P3PA 2QZ3A 2JICA 4FSJA 4QHBA 2XWBB 3S7IA 4KWKA 2QZ2A 1HXS2 2W0XA 3R0RA 3UK9A 1YHFA 1XNBA 4G3YC 5JOZA 4FPGA 4WVMA 3IDEA 2ZGSA 1AR61 1MQTA 1UKGA 3E5UA 3VBUA 1ND3C 3H3UA 3B9IA 4JRAA 2LM3A 2G9FA 1QOTA 3ZSMA 4ZKTB 2XKPA 4AWDA 2ATFA 3M8LA 3H0OA 4S2FA 2YGMA 3MPPG 4M3CF 1CX4A 4Z92B 2HWE3 3WD5A 3VL8A 3OD0A 4EN7B 3O5SA 3WVJA 1AR81 2DUOA 1V70A 4HSJA 4I30A 5K8SA 4P9GA 2P2KA 1N3QA 4FQZA 2BVVA 4GQ7A 4IV1B 3QCWA 3R4UA 4MYEA 2WS91 1NLRA 2PA7A 4A7KA 3AKTA 1HRV1 2RM22 4Q2FA 5C8CB 2OUJA 4CEYB 4XEZA 4IEYA 2B46X 1FOD3 2W08A 3ZPYA 1AJKA 1PZ7A 4WM8C 5CBLA 5FDBA 4KBBA 3QH6A 5FMOL 5I0UA 2R30A 1PO23 3L2HA 4XJUA 4ISQA 1LR5A 1AL0G 4I0BA 1EP0A 1BEV1 1RUJ1 1X36A 3J8F3 2RE9A 1SFNA 1RUD2 2JG9C 2QQPA 4XQWA 2N7GA 3AMNA 1AR93 1XQNA 2WKKA 2VQ0A 1IGOA 2NMNA 3JB4C 1PIV2 1REFA 1TE1B 2QCSB 3H9AA 4K1YA 1GZ9A 3KMHA 4RL7A 4PLNA 4TZDA 4IV1A 3SH3A 4PDWA 1LOEA 1EV12 3TN93 3M3EA 4AEKA 2DVDA 2QE3A 3GHMA 2MEV3 4P5HA 1ALYA 4RR3B 4CEYA 4AVCA 4RHV2 4XQ4A 3RYKA 3ZYPA 5KXBA 3JUUA 2E63A 2A75A 4FP2A 3KS7A 4JVAA 4EROA 5GZCA 2VW2A 3MFCA 5T54A 4AQSA 4E4ZA 4XBNA 4WBBA 2C9AA 1ZZ7A 3GBWA 4KWLA 3VBRB 3GZTB 1ZRE